data_1IXB
# 
_entry.id   1IXB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IXB         
RCSB  RCSB005370   
WWPDB D_1000005370 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1VEW '1VEW contains THE NATIVE STRUCTURE of the same protein FROM E. COLI'                           unspecified 
PDB 1I0H '1I0H contains crystal structure of the same protein Y174F MUTANT AT 1.35 ANGSTROMS RESOLUTION' unspecified 
PDB 1EN4 '1EN4 contains crystal structure of the same protein Q146H MUTANT'                              unspecified 
PDB 1EN6 '1EN6 contains crystal structure of the same protein Q146L MUTANT'                              unspecified 
PDB 1I08 '1I08 contains crystal structure of the same protein H30A MUTANT'                               unspecified 
PDB 1MMM '1MMM contains crystal structure of the same protein FE-SUBSTITUTED'                            unspecified 
PDB 1IX9 '1IX9 contains crystal structure of the same protein with MANGANASE(III)'                       unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IXB 
_pdbx_database_status.recvd_initial_deposition_date   2002-06-18 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Anderson, B.F.'  1 
'Edwards, R.A.'   2 
'Whittaker, M.M.' 3 
'Whittaker, J.W.' 4 
'Baker, E.N.'     5 
'Jameson, G.B.'   6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Structures at 0.90 A resolution of the oxidised and reduced forms of the Y174F mutant of the manganese superoxide dismutase from Escherichia coli
;
'To be Published' ?  ?    ?    ?    ?      ?  ?         0353 ? ? ?                 
1       
'Removing a Hydrogen Bond in the Dimer Interface of Escherichia Coli Manganese Superoxide Dismutase Alters Structure and Reactivity' 
Biochemistry      40 4622 4632 2001 BICHAW US 0006-2960 0033 ? ? 10.1021/bi002403h 
2       'Outer Sphere Mutations Perturb Metal Reactivity in Manganese Superoxide Dismutase' Biochemistry      40 15   27   2001 
BICHAW US 0006-2960 0033 ? ? 10.1021/bi0018943 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Anderson, B.F.'  1  
primary 'Edwards, R.A.'   2  
primary 'Whittaker, M.M.' 3  
primary 'Whittaker, J.W.' 4  
primary 'Baker, E.N.'     5  
primary 'Jameson, G.B.'   6  
1       'Edwards, R.A.'   7  
1       'Whittaker, M.M.' 8  
1       'Whittaker, J.W.' 9  
1       'Baker, E.N.'     10 
1       'Jameson, G.B.'   11 
2       'Edwards, R.A.'   12 
2       'Whittaker, M.M.' 13 
2       'Whittaker, J.W.' 14 
2       'Baker, E.N.'     15 
2       'Jameson, G.B.'   16 
# 
_cell.entry_id           1IXB 
_cell.length_a           46.815 
_cell.length_b           45.832 
_cell.length_c           96.187 
_cell.angle_alpha        90.00 
_cell.angle_beta         98.20 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1IXB 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SUPEROXIDE DISMUTASE'                  22980.877 2   1.15.1.1 Y174F ? ? 
2 non-polymer syn 'MANGANESE ION, 1 HYDROXYL COORDINATED' 71.945    2   ?        ?     ? ? 
3 water       nat water                                   18.015    925 ?        ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        MnSOD 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHAN
HSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASG
FPIMGLDVWEHAYFLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHAN
HSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASG
FPIMGLDVWEHAYFLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   TYR n 
1 3   THR n 
1 4   LEU n 
1 5   PRO n 
1 6   SER n 
1 7   LEU n 
1 8   PRO n 
1 9   TYR n 
1 10  ALA n 
1 11  TYR n 
1 12  ASP n 
1 13  ALA n 
1 14  LEU n 
1 15  GLU n 
1 16  PRO n 
1 17  HIS n 
1 18  PHE n 
1 19  ASP n 
1 20  LYS n 
1 21  GLN n 
1 22  THR n 
1 23  MET n 
1 24  GLU n 
1 25  ILE n 
1 26  HIS n 
1 27  HIS n 
1 28  THR n 
1 29  LYS n 
1 30  HIS n 
1 31  HIS n 
1 32  GLN n 
1 33  THR n 
1 34  TYR n 
1 35  VAL n 
1 36  ASN n 
1 37  ASN n 
1 38  ALA n 
1 39  ASN n 
1 40  ALA n 
1 41  ALA n 
1 42  LEU n 
1 43  GLU n 
1 44  SER n 
1 45  LEU n 
1 46  PRO n 
1 47  GLU n 
1 48  PHE n 
1 49  ALA n 
1 50  ASN n 
1 51  LEU n 
1 52  PRO n 
1 53  VAL n 
1 54  GLU n 
1 55  GLU n 
1 56  LEU n 
1 57  ILE n 
1 58  THR n 
1 59  LYS n 
1 60  LEU n 
1 61  ASP n 
1 62  GLN n 
1 63  LEU n 
1 64  PRO n 
1 65  ALA n 
1 66  ASP n 
1 67  LYS n 
1 68  LYS n 
1 69  THR n 
1 70  VAL n 
1 71  LEU n 
1 72  ARG n 
1 73  ASN n 
1 74  ASN n 
1 75  ALA n 
1 76  GLY n 
1 77  GLY n 
1 78  HIS n 
1 79  ALA n 
1 80  ASN n 
1 81  HIS n 
1 82  SER n 
1 83  LEU n 
1 84  PHE n 
1 85  TRP n 
1 86  LYS n 
1 87  GLY n 
1 88  LEU n 
1 89  LYS n 
1 90  LYS n 
1 91  GLY n 
1 92  THR n 
1 93  THR n 
1 94  LEU n 
1 95  GLN n 
1 96  GLY n 
1 97  ASP n 
1 98  LEU n 
1 99  LYS n 
1 100 ALA n 
1 101 ALA n 
1 102 ILE n 
1 103 GLU n 
1 104 ARG n 
1 105 ASP n 
1 106 PHE n 
1 107 GLY n 
1 108 SER n 
1 109 VAL n 
1 110 ASP n 
1 111 ASN n 
1 112 PHE n 
1 113 LYS n 
1 114 ALA n 
1 115 GLU n 
1 116 PHE n 
1 117 GLU n 
1 118 LYS n 
1 119 ALA n 
1 120 ALA n 
1 121 ALA n 
1 122 SER n 
1 123 ARG n 
1 124 PHE n 
1 125 GLY n 
1 126 SER n 
1 127 GLY n 
1 128 TRP n 
1 129 ALA n 
1 130 TRP n 
1 131 LEU n 
1 132 VAL n 
1 133 LEU n 
1 134 LYS n 
1 135 GLY n 
1 136 ASP n 
1 137 LYS n 
1 138 LEU n 
1 139 ALA n 
1 140 VAL n 
1 141 VAL n 
1 142 SER n 
1 143 THR n 
1 144 ALA n 
1 145 ASN n 
1 146 GLN n 
1 147 ASP n 
1 148 SER n 
1 149 PRO n 
1 150 LEU n 
1 151 MET n 
1 152 GLY n 
1 153 GLU n 
1 154 ALA n 
1 155 ILE n 
1 156 SER n 
1 157 GLY n 
1 158 ALA n 
1 159 SER n 
1 160 GLY n 
1 161 PHE n 
1 162 PRO n 
1 163 ILE n 
1 164 MET n 
1 165 GLY n 
1 166 LEU n 
1 167 ASP n 
1 168 VAL n 
1 169 TRP n 
1 170 GLU n 
1 171 HIS n 
1 172 ALA n 
1 173 TYR n 
1 174 PHE n 
1 175 LEU n 
1 176 LYS n 
1 177 PHE n 
1 178 GLN n 
1 179 ASN n 
1 180 ARG n 
1 181 ARG n 
1 182 PRO n 
1 183 ASP n 
1 184 TYR n 
1 185 ILE n 
1 186 LYS n 
1 187 GLU n 
1 188 PHE n 
1 189 TRP n 
1 190 ASN n 
1 191 VAL n 
1 192 VAL n 
1 193 ASN n 
1 194 TRP n 
1 195 ASP n 
1 196 GLU n 
1 197 ALA n 
1 198 ALA n 
1 199 ALA n 
1 200 ARG n 
1 201 PHE n 
1 202 ALA n 
1 203 ALA n 
1 204 LYS n 
1 205 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               QC781 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PDT1-5 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SODM_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHAN
HSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASG
FPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P00448 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1IXB A 1 ? 205 ? P00448 1 ? 205 ? 1 205 
2 1 1IXB B 1 ? 205 ? P00448 1 ? 205 ? 1 205 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1IXB PHE A 174 ? UNP P00448 TYR 174 ENGINEERED 174 1 
2 1IXB PHE B 174 ? UNP P00448 TYR 174 ENGINEERED 174 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                 ?           'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                ?           'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                              ?           'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                         ?           'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE                               ?           'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                         ?           'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                 ?           'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                               ?           'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                   ?           'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                              ?           'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                 ?           'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                  ?           'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                              ?           'C5 H11 N O2 S'  149.211 
MH2 non-polymer         . 'MANGANESE ION, 1 HYDROXYL COORDINATED' '[MN(OH)]+' 'H Mn O 2'       71.945  
PHE 'L-peptide linking' y PHENYLALANINE                           ?           'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                 ?           'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                  ?           'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                               ?           'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                              ?           'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                ?           'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                  ?           'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1IXB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.22 
_exptl_crystal.density_percent_sol   44.63 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
;16-20% PEG6000, 0.1M BICINE. CRYSTALS WERE REDUCED JUST PRIOR TO FREEZING BY ADDITION OF 10% H2O2 (1 PART to 40 PARTS MOTHER LIQUOR), pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1998-11-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'BENT GERMANIUM SINGLE CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.91 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE X11' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, Hamburg' 
_diffrn_source.pdbx_synchrotron_beamline   X11 
_diffrn_source.pdbx_wavelength             0.91 
_diffrn_source.pdbx_wavelength_list        0.91 
# 
_reflns.entry_id                     1IXB 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            0.90 
_reflns.number_obs                   274173 
_reflns.number_all                   274173 
_reflns.percent_possible_obs         92.1 
_reflns.pdbx_Rmerge_I_obs            0.03 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        56.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.d_res_high             0.90 
_reflns_shell.d_res_low              0.91 
_reflns_shell.percent_possible_all   81.7 
_reflns_shell.Rmerge_I_obs           0.395 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.entry_id                                 1IXB 
_refine.ls_number_reflns_obs                     274039 
_refine.ls_number_reflns_all                     274173 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            0.90 
_refine.ls_percent_reflns_obs                    90.9 
_refine.ls_R_factor_obs                          0.1109 
_refine.ls_R_factor_all                          0.1109 
_refine.ls_R_factor_R_work                       0.1107 
_refine.ls_R_factor_R_free                       0.1264 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.204 
_refine.ls_number_reflns_R_free                  3300 
_refine.ls_number_parameters                     39423 
_refine.ls_number_restraints                     47096 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    
;P.C.MOEWS & R.H.KRETSINGER,
J.MOL.BIOL.91(1975)201-228
;
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS
No electron density is observed for a second hydrogen atom 
on the coordinated solvent species in either chain. Thus, 
the coordinated solvent species is assigned as a hydroxide 
ion. However, a soft vibrational mode involving a putative 
second hydrogen atom could  render this atom undetectable 
in difference Fourier maps.
THE CLOSE CONTACTS AND POOR GEOMETRY LISTED IN REMARK 500 
ARE CAUSED BY PARTIAL OCCUPANCIES AND DISORDER.
;
_refine.pdbx_starting_model                      'MN-SOD FROM 1IOH' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'RANDOM SHELL' 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1IXB 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      39 
_refine_analyze.occupancy_sum_hydrogen          2927.00 
_refine_analyze.occupancy_sum_non_hydrogen      3990.33 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3254 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             925 
_refine_hist.number_atoms_total               4183 
_refine_hist.d_res_high                       0.90 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.015  ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.029  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.0298 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.091  ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.107  ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.006  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.036  ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      0.067  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1IXB 
_pdbx_refine.R_factor_all_no_cutoff                      0.1109 
_pdbx_refine.R_factor_obs_no_cutoff                      0.1107 
_pdbx_refine.free_R_factor_no_cutoff                     0.1264 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     1.204 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            3300 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.104 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.1038 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.1192 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   1.207 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          2876 
_pdbx_refine.number_reflns_obs_4sig_cutoff               238354 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1IXB 
_struct.title                     
'CRYSTAL STRUCTURE OF THE E. COLI MANGANESE(II) SUPEROXIDE DISMUTASE MUTANT Y174F AT 0.90 ANGSTROMS RESOLUTION.' 
_struct.pdbx_descriptor           'SUPEROXIDE DISMUTASE (E.C.1.15.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IXB 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
'MANGANESE(II) SUPEROXIDE DISMUTASE, Y174F MUTANT, HYDROGEN BOND REACTIVITY, ULTRAHIGH RESOLUTION, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 19  ? LYS A 29  ? ASP A 19  LYS A 29  1 ? 11 
HELX_P HELX_P2  2  LYS A 29  ? GLU A 43  ? LYS A 29  GLU A 43  1 ? 15 
HELX_P HELX_P3  3  LEU A 45  ? ASN A 50  ? LEU A 45  ASN A 50  1 ? 6  
HELX_P HELX_P4  4  PRO A 52  ? ILE A 57  ? PRO A 52  ILE A 57  1 ? 6  
HELX_P HELX_P5  5  THR A 58  ? LEU A 63  ? THR A 58  LEU A 63  5 ? 6  
HELX_P HELX_P6  6  PRO A 64  ? ASP A 66  ? PRO A 64  ASP A 66  5 ? 3  
HELX_P HELX_P7  7  LYS A 67  ? GLY A 87  ? LYS A 67  GLY A 87  1 ? 21 
HELX_P HELX_P8  8  GLN A 95  ? GLY A 107 ? GLN A 95  GLY A 107 1 ? 13 
HELX_P HELX_P9  9  SER A 108 ? ARG A 123 ? SER A 108 ARG A 123 1 ? 16 
HELX_P HELX_P10 10 SER A 148 ? MET A 151 ? SER A 148 MET A 151 5 ? 4  
HELX_P HELX_P11 11 GLY A 152 ? GLY A 157 ? GLY A 152 GLY A 157 1 ? 6  
HELX_P HELX_P12 12 TRP A 169 ? ALA A 172 ? TRP A 169 ALA A 172 5 ? 4  
HELX_P HELX_P13 13 TYR A 173 ? GLN A 178 ? TYR A 173 GLN A 178 1 ? 6  
HELX_P HELX_P14 14 ARG A 180 ? VAL A 192 ? ARG A 180 VAL A 192 1 ? 13 
HELX_P HELX_P15 15 ASN A 193 ? LYS A 205 ? ASN A 193 LYS A 205 1 ? 13 
HELX_P HELX_P16 16 ASP B 19  ? LYS B 29  ? ASP B 19  LYS B 29  1 ? 11 
HELX_P HELX_P17 17 LYS B 29  ? GLU B 43  ? LYS B 29  GLU B 43  1 ? 15 
HELX_P HELX_P18 18 LEU B 45  ? ASN B 50  ? LEU B 45  ASN B 50  1 ? 6  
HELX_P HELX_P19 19 PRO B 52  ? ILE B 57  ? PRO B 52  ILE B 57  1 ? 6  
HELX_P HELX_P20 20 THR B 58  ? LEU B 63  ? THR B 58  LEU B 63  5 ? 6  
HELX_P HELX_P21 21 PRO B 64  ? ASP B 66  ? PRO B 64  ASP B 66  5 ? 3  
HELX_P HELX_P22 22 LYS B 67  ? GLY B 87  ? LYS B 67  GLY B 87  1 ? 21 
HELX_P HELX_P23 23 GLN B 95  ? GLY B 107 ? GLN B 95  GLY B 107 1 ? 13 
HELX_P HELX_P24 24 SER B 108 ? ARG B 123 ? SER B 108 ARG B 123 1 ? 16 
HELX_P HELX_P25 25 SER B 148 ? MET B 151 ? SER B 148 MET B 151 5 ? 4  
HELX_P HELX_P26 26 GLY B 152 ? GLY B 157 ? GLY B 152 GLY B 157 1 ? 6  
HELX_P HELX_P27 27 TRP B 169 ? ALA B 172 ? TRP B 169 ALA B 172 5 ? 4  
HELX_P HELX_P28 28 TYR B 173 ? GLN B 178 ? TYR B 173 GLN B 178 1 ? 6  
HELX_P HELX_P29 29 ARG B 180 ? TRP B 189 ? ARG B 180 TRP B 189 1 ? 10 
HELX_P HELX_P30 30 ASN B 193 ? LYS B 205 ? ASN B 193 LYS B 205 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? C MH2 . MN ? ? ? 1_555 A HIS 26  NE2 ? ? A MH2 206 A HIS 26  1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc2 metalc ? ? C MH2 . MN ? ? ? 1_555 A HIS 81  NE2 ? ? A MH2 206 A HIS 81  1_555 ? ? ? ? ? ? ? 2.133 ? 
metalc3 metalc ? ? C MH2 . MN ? ? ? 1_555 A ASP 167 OD2 ? ? A MH2 206 A ASP 167 1_555 ? ? ? ? ? ? ? 2.052 ? 
metalc4 metalc ? ? C MH2 . MN ? ? ? 1_555 A HIS 171 NE2 ? ? A MH2 206 A HIS 171 1_555 ? ? ? ? ? ? ? 2.143 ? 
metalc5 metalc ? ? D MH2 . MN ? ? ? 1_555 B HIS 26  NE2 ? ? B MH2 206 B HIS 26  1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc6 metalc ? ? D MH2 . MN ? ? ? 1_555 B HIS 81  NE2 ? ? B MH2 206 B HIS 81  1_555 ? ? ? ? ? ? ? 2.149 ? 
metalc7 metalc ? ? D MH2 . MN ? ? ? 1_555 B ASP 167 OD2 ? ? B MH2 206 B ASP 167 1_555 ? ? ? ? ? ? ? 2.038 ? 
metalc8 metalc ? ? D MH2 . MN ? ? ? 1_555 B HIS 171 NE2 ? ? B MH2 206 B HIS 171 1_555 ? ? ? ? ? ? ? 2.126 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 15 A . ? GLU 15 A PRO 16 A ? PRO 16 A 1 5.32 
2 GLU 15 B . ? GLU 15 B PRO 16 B ? PRO 16 B 1 5.08 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 137 ? ALA A 144 ? LYS A 137 ALA A 144 
A 2 GLY A 127 ? LYS A 134 ? GLY A 127 LYS A 134 
A 3 PHE A 161 ? ASP A 167 ? PHE A 161 ASP A 167 
B 1 LYS B 137 ? ALA B 144 ? LYS B 137 ALA B 144 
B 2 GLY B 127 ? LYS B 134 ? GLY B 127 LYS B 134 
B 3 PHE B 161 ? ASP B 167 ? PHE B 161 ASP B 167 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 141 ? O VAL A 141 N TRP A 130 ? N TRP A 130 
A 2 3 N ALA A 129 ? N ALA A 129 O LEU A 166 ? O LEU A 166 
B 1 2 O VAL B 141 ? O VAL B 141 N TRP B 130 ? N TRP B 130 
B 2 3 N LEU B 131 ? N LEU B 131 O ILE B 163 ? O ILE B 163 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MH2 A 206' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MH2 B 206' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 HIS A 26  ? HIS A 26  . ? 1_555 ? 
2  AC1 6 HIS A 81  ? HIS A 81  . ? 1_555 ? 
3  AC1 6 GLN A 146 ? GLN A 146 . ? 1_555 ? 
4  AC1 6 ASP A 167 ? ASP A 167 . ? 1_555 ? 
5  AC1 6 TRP A 169 ? TRP A 169 . ? 1_555 ? 
6  AC1 6 HIS A 171 ? HIS A 171 . ? 1_555 ? 
7  AC2 6 HIS B 26  ? HIS B 26  . ? 1_555 ? 
8  AC2 6 HIS B 81  ? HIS B 81  . ? 1_555 ? 
9  AC2 6 GLN B 146 ? GLN B 146 . ? 1_555 ? 
10 AC2 6 ASP B 167 ? ASP B 167 . ? 1_555 ? 
11 AC2 6 TRP B 169 ? TRP B 169 . ? 1_555 ? 
12 AC2 6 HIS B 171 ? HIS B 171 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1IXB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    1IXB 
_atom_sites.fract_transf_matrix[1][1]   0.021361 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003078 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021819 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010504 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   A SER A 1 1   ? -14.541 36.139 10.960  0.71 29.90 ? 1   SER A N   1 
ATOM   2    N  N   B SER A 1 1   ? -14.513 36.449 11.466  0.29 30.19 ? 1   SER A N   1 
ATOM   3    C  CA  A SER A 1 1   ? -13.716 35.422 11.941  0.71 23.72 ? 1   SER A CA  1 
ATOM   4    C  CA  B SER A 1 1   ? -13.647 35.585 12.279  0.29 23.83 ? 1   SER A CA  1 
ATOM   5    C  C   A SER A 1 1   ? -12.678 34.588 11.221  0.71 16.21 ? 1   SER A C   1 
ATOM   6    C  C   B SER A 1 1   ? -12.403 35.178 11.512  0.29 18.78 ? 1   SER A C   1 
ATOM   7    O  O   A SER A 1 1   ? -12.808 34.338 10.035  0.71 18.01 ? 1   SER A O   1 
ATOM   8    O  O   B SER A 1 1   ? -12.129 35.736 10.447  0.29 16.79 ? 1   SER A O   1 
ATOM   9    C  CB  A SER A 1 1   ? -14.612 34.571 12.847  0.71 28.86 ? 1   SER A CB  1 
ATOM   10   C  CB  B SER A 1 1   ? -14.458 34.350 12.696  0.29 25.83 ? 1   SER A CB  1 
ATOM   11   O  OG  A SER A 1 1   ? -15.981 34.796 12.625  0.71 44.26 ? 1   SER A OG  1 
ATOM   12   O  OG  B SER A 1 1   ? -15.128 33.818 11.565  0.29 34.24 ? 1   SER A OG  1 
ATOM   13   N  N   . TYR A 1 2   ? -11.638 34.231 11.991  1.00 11.15 ? 2   TYR A N   1 
ATOM   14   C  CA  . TYR A 1 2   ? -10.560 33.474 11.341  1.00 9.82  ? 2   TYR A CA  1 
ATOM   15   C  C   . TYR A 1 2   ? -11.057 32.064 11.037  1.00 9.36  ? 2   TYR A C   1 
ATOM   16   O  O   . TYR A 1 2   ? -11.916 31.504 11.735  1.00 10.39 ? 2   TYR A O   1 
ATOM   17   C  CB  . TYR A 1 2   ? -9.364  33.361 12.296  1.00 9.58  ? 2   TYR A CB  1 
ATOM   18   C  CG  . TYR A 1 2   ? -8.712  34.687 12.652  1.00 9.37  ? 2   TYR A CG  1 
ATOM   19   C  CD1 . TYR A 1 2   ? -8.756  35.816 11.830  1.00 9.73  ? 2   TYR A CD1 1 
ATOM   20   C  CD2 . TYR A 1 2   ? -7.970  34.753 13.809  1.00 10.05 ? 2   TYR A CD2 1 
ATOM   21   C  CE1 . TYR A 1 2   ? -8.096  37.007 12.224  1.00 9.78  ? 2   TYR A CE1 1 
ATOM   22   C  CE2 . TYR A 1 2   ? -7.293  35.907 14.198  1.00 10.17 ? 2   TYR A CE2 1 
ATOM   23   C  CZ  . TYR A 1 2   ? -7.381  37.027 13.383  1.00 9.25  ? 2   TYR A CZ  1 
ATOM   24   O  OH  . TYR A 1 2   ? -6.724  38.158 13.816  1.00 9.70  ? 2   TYR A OH  1 
ATOM   25   N  N   . THR A 1 3   ? -10.451 31.433 10.024  1.00 9.50  ? 3   THR A N   1 
ATOM   26   C  CA  . THR A 1 3   ? -10.668 30.062 9.722   1.00 9.47  ? 3   THR A CA  1 
ATOM   27   C  C   . THR A 1 3   ? -9.312  29.379 9.534   1.00 8.25  ? 3   THR A C   1 
ATOM   28   O  O   . THR A 1 3   ? -8.303  29.980 9.180   1.00 8.59  ? 3   THR A O   1 
ATOM   29   C  CB  . THR A 1 3   ? -11.506 29.897 8.423   1.00 12.02 ? 3   THR A CB  1 
ATOM   30   O  OG1 . THR A 1 3   ? -10.712 30.442 7.324   1.00 13.65 ? 3   THR A OG1 1 
ATOM   31   C  CG2 . THR A 1 3   ? -12.818 30.596 8.534   1.00 15.93 ? 3   THR A CG2 1 
ATOM   32   N  N   . LEU A 1 4   ? -9.326  28.064 9.734   1.00 7.97  ? 4   LEU A N   1 
ATOM   33   C  CA  . LEU A 1 4   ? -8.169  27.213 9.421   1.00 7.27  ? 4   LEU A CA  1 
ATOM   34   C  C   . LEU A 1 4   ? -8.029  27.167 7.896   1.00 7.12  ? 4   LEU A C   1 
ATOM   35   O  O   . LEU A 1 4   ? -8.963  26.693 7.230   1.00 7.98  ? 4   LEU A O   1 
ATOM   36   C  CB  . LEU A 1 4   ? -8.352  25.814 9.978   1.00 7.71  ? 4   LEU A CB  1 
ATOM   37   C  CG  . LEU A 1 4   ? -7.114  24.933 9.816   1.00 7.40  ? 4   LEU A CG  1 
ATOM   38   C  CD1 . LEU A 1 4   ? -5.982  25.391 10.713  1.00 7.77  ? 4   LEU A CD1 1 
ATOM   39   C  CD2 . LEU A 1 4   ? -7.430  23.486 10.065  1.00 8.46  ? 4   LEU A CD2 1 
ATOM   40   N  N   . PRO A 1 5   ? -6.945  27.640 7.297   1.00 6.91  ? 5   PRO A N   1 
ATOM   41   C  CA  . PRO A 1 5   ? -6.871  27.715 5.841   1.00 6.60  ? 5   PRO A CA  1 
ATOM   42   C  C   . PRO A 1 5   ? -6.689  26.348 5.230   1.00 6.61  ? 5   PRO A C   1 
ATOM   43   O  O   . PRO A 1 5   ? -6.014  25.459 5.788   1.00 7.92  ? 5   PRO A O   1 
ATOM   44   C  CB  . PRO A 1 5   ? -5.616  28.574 5.588   1.00 7.27  ? 5   PRO A CB  1 
ATOM   45   C  CG  . PRO A 1 5   ? -4.750  28.276 6.800   1.00 7.60  ? 5   PRO A CG  1 
ATOM   46   C  CD  . PRO A 1 5   ? -5.727  28.151 7.943   1.00 7.24  ? 5   PRO A CD  1 
ATOM   47   N  N   . SER A 1 6   ? -7.219  26.191 4.014   1.00 6.62  ? 6   SER A N   1 
ATOM   48   C  CA  . SER A 1 6   ? -6.862  25.078 3.187   1.00 7.45  ? 6   SER A CA  1 
ATOM   49   C  C   . SER A 1 6   ? -5.405  25.204 2.760   1.00 7.02  ? 6   SER A C   1 
ATOM   50   O  O   . SER A 1 6   ? -4.849  26.299 2.627   1.00 7.79  ? 6   SER A O   1 
ATOM   51   C  CB  A SER A 1 6   ? -7.760  24.818 2.026   0.69 9.54  ? 6   SER A CB  1 
ATOM   52   C  CB  B SER A 1 6   ? -7.686  25.195 1.907   0.31 10.44 ? 6   SER A CB  1 
ATOM   53   O  OG  A SER A 1 6   ? -7.829  25.984 1.290   0.69 9.56  ? 6   SER A OG  1 
ATOM   54   O  OG  B SER A 1 6   ? -7.331  24.558 0.692   0.31 8.73  ? 6   SER A OG  1 
ATOM   55   N  N   . LEU A 1 7   ? -4.760  24.055 2.575   1.00 7.31  ? 7   LEU A N   1 
ATOM   56   C  CA  . LEU A 1 7   ? -3.342  23.990 2.309   1.00 7.25  ? 7   LEU A CA  1 
ATOM   57   C  C   . LEU A 1 7   ? -3.065  24.021 0.818   1.00 6.87  ? 7   LEU A C   1 
ATOM   58   O  O   . LEU A 1 7   ? -3.931  23.670 -0.007  1.00 7.59  ? 7   LEU A O   1 
ATOM   59   C  CB  . LEU A 1 7   ? -2.739  22.723 2.894   1.00 6.95  ? 7   LEU A CB  1 
ATOM   60   C  CG  . LEU A 1 7   ? -2.827  22.595 4.402   1.00 8.23  ? 7   LEU A CG  1 
ATOM   61   C  CD1 . LEU A 1 7   ? -2.095  21.367 4.882   1.00 11.45 ? 7   LEU A CD1 1 
ATOM   62   C  CD2 . LEU A 1 7   ? -2.303  23.827 5.118   1.00 11.22 ? 7   LEU A CD2 1 
ATOM   63   N  N   . PRO A 1 8   ? -1.827  24.295 0.416   1.00 6.97  ? 8   PRO A N   1 
ATOM   64   C  CA  . PRO A 1 8   ? -1.404  24.218 -0.976  1.00 7.21  ? 8   PRO A CA  1 
ATOM   65   C  C   . PRO A 1 8   ? -1.148  22.821 -1.476  1.00 7.35  ? 8   PRO A C   1 
ATOM   66   O  O   . PRO A 1 8   ? -0.662  22.662 -2.611  1.00 9.89  ? 8   PRO A O   1 
ATOM   67   C  CB  . PRO A 1 8   ? -0.145  25.102 -1.055  1.00 8.64  ? 8   PRO A CB  1 
ATOM   68   C  CG  . PRO A 1 8   ? 0.021   25.726 0.285   1.00 8.79  ? 8   PRO A CG  1 
ATOM   69   C  CD  . PRO A 1 8   ? -0.692  24.808 1.234   1.00 7.44  ? 8   PRO A CD  1 
ATOM   70   N  N   . TYR A 1 9   ? -1.389  21.800 -0.672  1.00 6.80  ? 9   TYR A N   1 
ATOM   71   C  CA  . TYR A 1 9   ? -0.958  20.441 -0.947  1.00 6.55  ? 9   TYR A CA  1 
ATOM   72   C  C   . TYR A 1 9   ? -1.688  19.524 0.032   1.00 6.43  ? 9   TYR A C   1 
ATOM   73   O  O   . TYR A 1 9   ? -2.216  19.945 1.053   1.00 7.31  ? 9   TYR A O   1 
ATOM   74   C  CB  . TYR A 1 9   ? 0.581   20.278 -0.807  1.00 7.26  ? 9   TYR A CB  1 
ATOM   75   C  CG  . TYR A 1 9   ? 1.139   21.029 0.375   1.00 6.81  ? 9   TYR A CG  1 
ATOM   76   C  CD1 . TYR A 1 9   ? 0.889   20.678 1.670   1.00 7.51  ? 9   TYR A CD1 1 
ATOM   77   C  CD2 . TYR A 1 9   ? 1.930   22.179 0.157   1.00 7.19  ? 9   TYR A CD2 1 
ATOM   78   C  CE1 . TYR A 1 9   ? 1.393   21.410 2.732   1.00 7.30  ? 9   TYR A CE1 1 
ATOM   79   C  CE2 . TYR A 1 9   ? 2.414   22.922 1.203   1.00 6.57  ? 9   TYR A CE2 1 
ATOM   80   C  CZ  . TYR A 1 9   ? 2.146   22.550 2.495   1.00 6.44  ? 9   TYR A CZ  1 
ATOM   81   O  OH  . TYR A 1 9   ? 2.571   23.305 3.578   1.00 6.87  ? 9   TYR A OH  1 
ATOM   82   N  N   . ALA A 1 10  ? -1.657  18.219 -0.307  1.00 6.47  ? 10  ALA A N   1 
ATOM   83   C  CA  . ALA A 1 10  ? -2.016  17.178 0.616   1.00 6.65  ? 10  ALA A CA  1 
ATOM   84   C  C   . ALA A 1 10  ? -0.938  17.047 1.710   1.00 6.20  ? 10  ALA A C   1 
ATOM   85   O  O   . ALA A 1 10  ? 0.224   17.414 1.520   1.00 6.63  ? 10  ALA A O   1 
ATOM   86   C  CB  . ALA A 1 10  ? -2.173  15.865 -0.138  1.00 7.61  ? 10  ALA A CB  1 
ATOM   87   N  N   . TYR A 1 11  ? -1.300  16.435 2.853   1.00 6.29  ? 11  TYR A N   1 
ATOM   88   C  CA  . TYR A 1 11  ? -0.411  16.321 3.964   1.00 6.31  ? 11  TYR A CA  1 
ATOM   89   C  C   . TYR A 1 11  ? 0.852   15.531 3.699   1.00 6.45  ? 11  TYR A C   1 
ATOM   90   O  O   . TYR A 1 11  ? 1.845   15.698 4.425   1.00 6.89  ? 11  TYR A O   1 
ATOM   91   C  CB  . TYR A 1 11  ? -1.111  15.671 5.170   1.00 6.50  ? 11  TYR A CB  1 
ATOM   92   C  CG  . TYR A 1 11  ? -2.271  16.468 5.742   1.00 6.48  ? 11  TYR A CG  1 
ATOM   93   C  CD1 . TYR A 1 11  ? -2.125  17.810 6.090   1.00 6.58  ? 11  TYR A CD1 1 
ATOM   94   C  CD2 . TYR A 1 11  ? -3.485  15.868 5.969   1.00 6.49  ? 11  TYR A CD2 1 
ATOM   95   C  CE1 . TYR A 1 11  ? -3.172  18.531 6.618   1.00 6.62  ? 11  TYR A CE1 1 
ATOM   96   C  CE2 . TYR A 1 11  ? -4.558  16.581 6.513   1.00 6.92  ? 11  TYR A CE2 1 
ATOM   97   C  CZ  . TYR A 1 11  ? -4.412  17.905 6.838   1.00 6.39  ? 11  TYR A CZ  1 
ATOM   98   O  OH  . TYR A 1 11  ? -5.471  18.577 7.352   1.00 7.08  ? 11  TYR A OH  1 
ATOM   99   N  N   . ASP A 1 12  ? 0.816   14.648 2.701   1.00 6.42  ? 12  ASP A N   1 
ATOM   100  C  CA  . ASP A 1 12  ? 1.936   13.793 2.350   1.00 6.70  ? 12  ASP A CA  1 
ATOM   101  C  C   . ASP A 1 12  ? 2.839   14.414 1.289   1.00 6.80  ? 12  ASP A C   1 
ATOM   102  O  O   . ASP A 1 12  ? 3.804   13.750 0.858   1.00 7.34  ? 12  ASP A O   1 
ATOM   103  C  CB  . ASP A 1 12  ? 1.430   12.441 1.864   1.00 8.37  ? 12  ASP A CB  1 
ATOM   104  C  CG  . ASP A 1 12  ? 0.624   12.572 0.501   1.00 8.82  ? 12  ASP A CG  1 
ATOM   105  O  OD1 . ASP A 1 12  ? 0.401   13.675 0.043   1.00 10.65 ? 12  ASP A OD1 1 
ATOM   106  O  OD2 . ASP A 1 12  ? 0.310   11.485 -0.067  1.00 11.18 ? 12  ASP A OD2 1 
ATOM   107  N  N   . ALA A 1 13  ? 2.608   15.669 0.893   1.00 6.31  ? 13  ALA A N   1 
ATOM   108  C  CA  . ALA A 1 13  ? 3.336   16.219 -0.238  1.00 6.80  ? 13  ALA A CA  1 
ATOM   109  C  C   . ALA A 1 13  ? 4.780   16.556 0.086   1.00 6.83  ? 13  ALA A C   1 
ATOM   110  O  O   . ALA A 1 13  ? 5.559   16.751 -0.863  1.00 8.67  ? 13  ALA A O   1 
ATOM   111  C  CB  . ALA A 1 13  ? 2.638   17.488 -0.739  1.00 7.46  ? 13  ALA A CB  1 
ATOM   112  N  N   . LEU A 1 14  ? 5.130   16.646 1.347   1.00 6.19  ? 14  LEU A N   1 
ATOM   113  C  CA  . LEU A 1 14  ? 6.488   17.016 1.746   1.00 6.43  ? 14  LEU A CA  1 
ATOM   114  C  C   . LEU A 1 14  ? 7.330   15.793 2.143   1.00 6.53  ? 14  LEU A C   1 
ATOM   115  O  O   . LEU A 1 14  ? 8.505   15.957 2.497   1.00 6.74  ? 14  LEU A O   1 
ATOM   116  C  CB  . LEU A 1 14  ? 6.456   18.045 2.866   1.00 6.22  ? 14  LEU A CB  1 
ATOM   117  C  CG  . LEU A 1 14  ? 5.641   19.317 2.527   1.00 6.92  ? 14  LEU A CG  1 
ATOM   118  C  CD1 . LEU A 1 14  ? 5.730   20.271 3.692   1.00 7.81  ? 14  LEU A CD1 1 
ATOM   119  C  CD2 . LEU A 1 14  ? 6.100   19.980 1.232   1.00 7.63  ? 14  LEU A CD2 1 
ATOM   120  N  N   . GLU A 1 15  ? 6.775   14.598 1.984   1.00 6.74  ? 15  GLU A N   1 
ATOM   121  C  CA  . GLU A 1 15  ? 7.565   13.374 2.154   1.00 6.72  ? 15  GLU A CA  1 
ATOM   122  C  C   . GLU A 1 15  ? 8.622   13.325 1.079   1.00 6.80  ? 15  GLU A C   1 
ATOM   123  O  O   . GLU A 1 15  ? 8.353   13.778 -0.043  1.00 7.45  ? 15  GLU A O   1 
ATOM   124  C  CB  . GLU A 1 15  ? 6.652   12.165 2.051   1.00 7.22  ? 15  GLU A CB  1 
ATOM   125  C  CG  . GLU A 1 15  ? 5.702   11.987 3.212   1.00 7.63  ? 15  GLU A CG  1 
ATOM   126  C  CD  . GLU A 1 15  ? 6.343   11.500 4.484   1.00 7.22  ? 15  GLU A CD  1 
ATOM   127  O  OE1 . GLU A 1 15  ? 7.562   11.212 4.493   1.00 8.05  ? 15  GLU A OE1 1 
ATOM   128  O  OE2 . GLU A 1 15  ? 5.588   11.352 5.483   1.00 8.22  ? 15  GLU A OE2 1 
ATOM   129  N  N   . PRO A 1 16  ? 9.819   12.804 1.357   1.00 7.16  ? 16  PRO A N   1 
ATOM   130  C  CA  . PRO A 1 16  ? 10.252  12.142 2.596   1.00 7.44  ? 16  PRO A CA  1 
ATOM   131  C  C   . PRO A 1 16  ? 10.913  13.051 3.573   1.00 7.03  ? 16  PRO A C   1 
ATOM   132  O  O   . PRO A 1 16  ? 11.703  12.594 4.428   1.00 9.14  ? 16  PRO A O   1 
ATOM   133  C  CB  . PRO A 1 16  ? 11.257  11.105 2.044   1.00 8.30  ? 16  PRO A CB  1 
ATOM   134  C  CG  . PRO A 1 16  ? 11.942  11.871 0.933   1.00 8.57  ? 16  PRO A CG  1 
ATOM   135  C  CD  . PRO A 1 16  ? 10.814  12.659 0.273   1.00 7.94  ? 16  PRO A CD  1 
ATOM   136  N  N   . HIS A 1 17  ? 10.657  14.355 3.490   1.00 6.75  ? 17  HIS A N   1 
ATOM   137  C  CA  . HIS A 1 17  ? 11.380  15.332 4.299   1.00 6.73  ? 17  HIS A CA  1 
ATOM   138  C  C   . HIS A 1 17  ? 10.669  15.656 5.610   1.00 6.53  ? 17  HIS A C   1 
ATOM   139  O  O   . HIS A 1 17  ? 11.242  15.484 6.680   1.00 7.31  ? 17  HIS A O   1 
ATOM   140  C  CB  . HIS A 1 17  ? 11.599  16.612 3.452   1.00 6.65  ? 17  HIS A CB  1 
ATOM   141  C  CG  . HIS A 1 17  ? 12.199  16.314 2.119   1.00 7.01  ? 17  HIS A CG  1 
ATOM   142  N  ND1 . HIS A 1 17  ? 13.438  15.728 1.987   1.00 7.43  ? 17  HIS A ND1 1 
ATOM   143  C  CD2 . HIS A 1 17  ? 11.724  16.449 0.864   1.00 7.65  ? 17  HIS A CD2 1 
ATOM   144  C  CE1 . HIS A 1 17  ? 13.674  15.558 0.666   1.00 8.36  ? 17  HIS A CE1 1 
ATOM   145  N  NE2 . HIS A 1 17  ? 12.647  15.983 -0.060  1.00 8.31  ? 17  HIS A NE2 1 
ATOM   146  N  N   . PHE A 1 18  ? 9.416   16.135 5.495   1.00 6.70  ? 18  PHE A N   1 
ATOM   147  C  CA  . PHE A 1 18  ? 8.567   16.397 6.672   1.00 6.53  ? 18  PHE A CA  1 
ATOM   148  C  C   . PHE A 1 18  ? 7.473   15.322 6.665   1.00 6.88  ? 18  PHE A C   1 
ATOM   149  O  O   . PHE A 1 18  ? 6.853   15.042 5.617   1.00 7.64  ? 18  PHE A O   1 
ATOM   150  C  CB  . PHE A 1 18  ? 7.914   17.792 6.615   1.00 6.83  ? 18  PHE A CB  1 
ATOM   151  C  CG  . PHE A 1 18  ? 8.834   18.960 6.946   1.00 6.71  ? 18  PHE A CG  1 
ATOM   152  C  CD1 . PHE A 1 18  ? 10.162  18.850 7.180   1.00 7.20  ? 18  PHE A CD1 1 
ATOM   153  C  CD2 . PHE A 1 18  ? 8.243   20.223 6.980   1.00 7.22  ? 18  PHE A CD2 1 
ATOM   154  C  CE1 . PHE A 1 18  ? 10.930  19.967 7.517   1.00 7.31  ? 18  PHE A CE1 1 
ATOM   155  C  CE2 . PHE A 1 18  ? 8.986   21.343 7.318   1.00 7.61  ? 18  PHE A CE2 1 
ATOM   156  C  CZ  . PHE A 1 18  ? 10.328  21.214 7.576   1.00 7.78  ? 18  PHE A CZ  1 
ATOM   157  N  N   . ASP A 1 19  ? 7.253   14.696 7.819   1.00 6.88  ? 19  ASP A N   1 
ATOM   158  C  CA  . ASP A 1 19  ? 6.362   13.552 7.916   1.00 6.91  ? 19  ASP A CA  1 
ATOM   159  C  C   . ASP A 1 19  ? 4.897   13.957 7.843   1.00 6.68  ? 19  ASP A C   1 
ATOM   160  O  O   . ASP A 1 19  ? 4.445   14.920 8.490   1.00 7.02  ? 19  ASP A O   1 
ATOM   161  C  CB  . ASP A 1 19  ? 6.637   12.751 9.177   1.00 7.23  ? 19  ASP A CB  1 
ATOM   162  C  CG  . ASP A 1 19  ? 6.457   13.535 10.472  1.00 7.31  ? 19  ASP A CG  1 
ATOM   163  O  OD1 . ASP A 1 19  ? 7.218   14.519 10.680  1.00 7.75  ? 19  ASP A OD1 1 
ATOM   164  O  OD2 . ASP A 1 19  ? 5.549   13.160 11.268  1.00 7.85  ? 19  ASP A OD2 1 
ATOM   165  N  N   . LYS A 1 20  ? 4.131   13.138 7.119   1.00 6.97  ? 20  LYS A N   1 
ATOM   166  C  CA  . LYS A 1 20  ? 2.729   13.427 6.868   1.00 7.27  ? 20  LYS A CA  1 
ATOM   167  C  C   . LYS A 1 20  ? 1.883   13.348 8.137   1.00 7.13  ? 20  LYS A C   1 
ATOM   168  O  O   . LYS A 1 20  ? 0.852   14.073 8.212   1.00 7.59  ? 20  LYS A O   1 
ATOM   169  C  CB  . LYS A 1 20  ? 2.191   12.492 5.795   1.00 7.70  ? 20  LYS A CB  1 
ATOM   170  C  CG  . LYS A 1 20  ? 2.144   11.034 6.134   1.00 8.69  ? 20  LYS A CG  1 
ATOM   171  C  CD  . LYS A 1 20  ? 1.831   10.241 4.879   1.00 10.36 ? 20  LYS A CD  1 
ATOM   172  C  CE  . LYS A 1 20  ? 1.682   8.762  5.131   1.00 14.10 ? 20  LYS A CE  1 
ATOM   173  N  NZ  . LYS A 1 20  ? 1.224   8.099  3.839   1.00 14.76 ? 20  LYS A NZ  1 
ATOM   174  N  N   . GLN A 1 21  ? 2.211   12.508 9.101   1.00 7.31  ? 21  GLN A N   1 
ATOM   175  C  CA  . GLN A 1 21  ? 1.409   12.467 10.327  1.00 7.90  ? 21  GLN A CA  1 
ATOM   176  C  C   . GLN A 1 21  ? 1.516   13.806 11.063  1.00 7.32  ? 21  GLN A C   1 
ATOM   177  O  O   . GLN A 1 21  ? 0.505   14.351 11.499  1.00 8.02  ? 21  GLN A O   1 
ATOM   178  C  CB  A GLN A 1 21  ? 1.786   11.289 11.221  0.48 9.45  ? 21  GLN A CB  1 
ATOM   179  C  CB  B GLN A 1 21  ? 1.882   11.333 11.241  0.52 9.18  ? 21  GLN A CB  1 
ATOM   180  C  CG  A GLN A 1 21  ? 0.859   11.156 12.403  0.48 9.98  ? 21  GLN A CG  1 
ATOM   181  C  CG  B GLN A 1 21  ? 1.153   11.362 12.583  0.52 11.96 ? 21  GLN A CG  1 
ATOM   182  C  CD  A GLN A 1 21  ? -0.631  10.929 12.212  0.48 10.95 ? 21  GLN A CD  1 
ATOM   183  C  CD  B GLN A 1 21  ? -0.329  11.016 12.461  0.52 18.45 ? 21  GLN A CD  1 
ATOM   184  O  OE1 A GLN A 1 21  ? -1.384  11.087 13.217  0.48 15.58 ? 21  GLN A OE1 1 
ATOM   185  O  OE1 B GLN A 1 21  ? -1.153  11.935 12.359  0.52 19.34 ? 21  GLN A OE1 1 
ATOM   186  N  NE2 A GLN A 1 21  ? -1.154  10.640 11.038  0.48 11.96 ? 21  GLN A NE2 1 
ATOM   187  N  NE2 B GLN A 1 21  ? -0.584  9.709  12.446  0.52 23.84 ? 21  GLN A NE2 1 
ATOM   188  N  N   . THR A 1 22  ? 2.728   14.336 11.189  1.00 7.10  ? 22  THR A N   1 
ATOM   189  C  CA  . THR A 1 22  ? 2.896   15.634 11.802  1.00 7.14  ? 22  THR A CA  1 
ATOM   190  C  C   . THR A 1 22  ? 2.173   16.721 11.010  1.00 6.75  ? 22  THR A C   1 
ATOM   191  O  O   . THR A 1 22  ? 1.512   17.572 11.563  1.00 7.09  ? 22  THR A O   1 
ATOM   192  C  CB  . THR A 1 22  ? 4.385   16.001 11.989  1.00 7.29  ? 22  THR A CB  1 
ATOM   193  O  OG1 . THR A 1 22  ? 4.915   15.095 12.957  1.00 8.35  ? 22  THR A OG1 1 
ATOM   194  C  CG2 . THR A 1 22  ? 4.555   17.412 12.498  1.00 7.91  ? 22  THR A CG2 1 
ATOM   195  N  N   . MET A 1 23  ? 2.310   16.703 9.661   1.00 6.76  ? 23  MET A N   1 
ATOM   196  C  CA  . MET A 1 23  ? 1.621   17.743 8.874   1.00 6.66  ? 23  MET A CA  1 
ATOM   197  C  C   . MET A 1 23  ? 0.135   17.793 9.254   1.00 6.81  ? 23  MET A C   1 
ATOM   198  O  O   . MET A 1 23  ? -0.441  18.875 9.470   1.00 7.09  ? 23  MET A O   1 
ATOM   199  C  CB  . MET A 1 23  ? 1.803   17.524 7.393   1.00 6.99  ? 23  MET A CB  1 
ATOM   200  C  CG  . MET A 1 23  ? 3.196   17.707 6.873   1.00 6.80  ? 23  MET A CG  1 
ATOM   201  S  SD  . MET A 1 23  ? 3.897   19.363 7.016   1.00 7.02  ? 23  MET A SD  1 
ATOM   202  C  CE  . MET A 1 23  ? 2.817   20.249 5.908   1.00 8.87  ? 23  MET A CE  1 
ATOM   203  N  N   . GLU A 1 24  ? -0.501  16.625 9.328   1.00 7.11  ? 24  GLU A N   1 
ATOM   204  C  CA  . GLU A 1 24  ? -1.927  16.587 9.598   1.00 7.27  ? 24  GLU A CA  1 
ATOM   205  C  C   . GLU A 1 24  ? -2.250  17.042 11.009  1.00 7.09  ? 24  GLU A C   1 
ATOM   206  O  O   . GLU A 1 24  ? -3.205  17.824 11.213  1.00 7.88  ? 24  GLU A O   1 
ATOM   207  C  CB  . GLU A 1 24  ? -2.462  15.163 9.354   1.00 7.35  ? 24  GLU A CB  1 
ATOM   208  C  CG  . GLU A 1 24  ? -3.930  15.040 9.677   1.00 7.96  ? 24  GLU A CG  1 
ATOM   209  C  CD  . GLU A 1 24  ? -4.593  13.764 9.192   1.00 10.34 ? 24  GLU A CD  1 
ATOM   210  O  OE1 . GLU A 1 24  ? -3.943  12.919 8.559   1.00 11.57 ? 24  GLU A OE1 1 
ATOM   211  O  OE2 . GLU A 1 24  ? -5.795  13.606 9.468   1.00 15.38 ? 24  GLU A OE2 1 
ATOM   212  N  N   . ILE A 1 25  ? -1.549  16.569 12.019  1.00 7.00  ? 25  ILE A N   1 
ATOM   213  C  CA  . ILE A 1 25  ? -1.773  17.007 13.407  1.00 7.41  ? 25  ILE A CA  1 
ATOM   214  C  C   . ILE A 1 25  ? -1.537  18.491 13.538  1.00 6.47  ? 25  ILE A C   1 
ATOM   215  O  O   . ILE A 1 25  ? -2.299  19.252 14.162  1.00 6.79  ? 25  ILE A O   1 
ATOM   216  C  CB  A ILE A 1 25  ? -0.850  16.222 14.377  0.83 9.14  ? 25  ILE A CB  1 
ATOM   217  C  CB  B ILE A 1 25  ? -0.936  16.170 14.393  0.17 7.04  ? 25  ILE A CB  1 
ATOM   218  C  CG1 A ILE A 1 25  ? -1.156  14.736 14.416  0.83 10.02 ? 25  ILE A CG1 1 
ATOM   219  C  CG1 B ILE A 1 25  ? -1.516  14.774 14.593  0.17 11.64 ? 25  ILE A CG1 1 
ATOM   220  C  CG2 A ILE A 1 25  ? -0.947  16.814 15.781  0.83 10.40 ? 25  ILE A CG2 1 
ATOM   221  C  CG2 B ILE A 1 25  ? -0.783  16.879 15.735  0.17 8.04  ? 25  ILE A CG2 1 
ATOM   222  C  CD1 A ILE A 1 25  ? -0.036  13.952 15.160  0.83 11.23 ? 25  ILE A CD1 1 
ATOM   223  C  CD1 B ILE A 1 25  ? -2.954  14.505 14.252  0.17 12.75 ? 25  ILE A CD1 1 
ATOM   224  N  N   . HIS A 1 26  ? -0.415  18.937 12.976  1.00 6.31  ? 26  HIS A N   1 
ATOM   225  C  CA  . HIS A 1 26  ? 0.021   20.321 13.094  1.00 5.98  ? 26  HIS A CA  1 
ATOM   226  C  C   . HIS A 1 26  ? -1.030  21.292 12.548  1.00 5.83  ? 26  HIS A C   1 
ATOM   227  O  O   . HIS A 1 26  ? -1.288  22.341 13.110  1.00 6.51  ? 26  HIS A O   1 
ATOM   228  C  CB  . HIS A 1 26  ? 1.370   20.406 12.372  1.00 6.24  ? 26  HIS A CB  1 
ATOM   229  C  CG  . HIS A 1 26  ? 2.175   21.624 12.668  1.00 5.81  ? 26  HIS A CG  1 
ATOM   230  N  ND1 . HIS A 1 26  ? 3.396   21.820 12.057  1.00 6.33  ? 26  HIS A ND1 1 
ATOM   231  C  CD2 . HIS A 1 26  ? 2.006   22.672 13.495  1.00 5.82  ? 26  HIS A CD2 1 
ATOM   232  C  CE1 . HIS A 1 26  ? 3.912   22.947 12.529  1.00 6.25  ? 26  HIS A CE1 1 
ATOM   233  N  NE2 . HIS A 1 26  ? 3.115   23.510 13.423  1.00 5.87  ? 26  HIS A NE2 1 
ATOM   234  N  N   . HIS A 1 27  ? -1.635  20.922 11.413  1.00 5.92  ? 27  HIS A N   1 
ATOM   235  C  CA  . HIS A 1 27  ? -2.707  21.714 10.786  1.00 5.96  ? 27  HIS A CA  1 
ATOM   236  C  C   . HIS A 1 27  ? -3.997  21.610 11.600  1.00 6.10  ? 27  HIS A C   1 
ATOM   237  O  O   . HIS A 1 27  ? -4.568  22.605 12.038  1.00 6.85  ? 27  HIS A O   1 
ATOM   238  C  CB  . HIS A 1 27  ? -2.870  21.219 9.358   1.00 6.28  ? 27  HIS A CB  1 
ATOM   239  C  CG  . HIS A 1 27  ? -3.906  21.925 8.542   1.00 5.95  ? 27  HIS A CG  1 
ATOM   240  N  ND1 . HIS A 1 27  ? -4.889  21.219 7.859   1.00 6.71  ? 27  HIS A ND1 1 
ATOM   241  C  CD2 . HIS A 1 27  ? -4.016  23.240 8.219   1.00 6.60  ? 27  HIS A CD2 1 
ATOM   242  C  CE1 . HIS A 1 27  ? -5.564  22.103 7.172   1.00 6.92  ? 27  HIS A CE1 1 
ATOM   243  N  NE2 . HIS A 1 27  ? -5.082  23.347 7.361   1.00 6.88  ? 27  HIS A NE2 1 
ATOM   244  N  N   . THR A 1 28  ? -4.478  20.366 11.774  1.00 6.50  ? 28  THR A N   1 
ATOM   245  C  CA  . THR A 1 28  ? -5.827  20.151 12.263  1.00 7.01  ? 28  THR A CA  1 
ATOM   246  C  C   . THR A 1 28  ? -5.990  20.317 13.779  1.00 6.98  ? 28  THR A C   1 
ATOM   247  O  O   . THR A 1 28  ? -7.133  20.507 14.235  1.00 7.89  ? 28  THR A O   1 
ATOM   248  C  CB  . THR A 1 28  ? -6.377  18.780 11.851  1.00 7.79  ? 28  THR A CB  1 
ATOM   249  O  OG1 . THR A 1 28  ? -5.643  17.763 12.536  1.00 8.63  ? 28  THR A OG1 1 
ATOM   250  C  CG2 . THR A 1 28  ? -6.370  18.581 10.385  1.00 8.22  ? 28  THR A CG2 1 
ATOM   251  N  N   . LYS A 1 29  ? -4.902  20.257 14.519  1.00 7.06  ? 29  LYS A N   1 
ATOM   252  C  CA  . LYS A 1 29  ? -4.906  20.391 15.973  1.00 7.29  ? 29  LYS A CA  1 
ATOM   253  C  C   . LYS A 1 29  ? -4.223  21.668 16.370  1.00 7.22  ? 29  LYS A C   1 
ATOM   254  O  O   . LYS A 1 29  ? -4.882  22.602 16.855  1.00 8.44  ? 29  LYS A O   1 
ATOM   255  C  CB  A LYS A 1 29  ? -4.299  19.136 16.629  0.54 9.88  ? 29  LYS A CB  1 
ATOM   256  C  CB  B LYS A 1 29  ? -4.337  19.160 16.678  0.46 7.14  ? 29  LYS A CB  1 
ATOM   257  C  CG  A LYS A 1 29  ? -5.296  17.975 16.383  0.54 9.46  ? 29  LYS A CG  1 
ATOM   258  C  CG  B LYS A 1 29  ? -4.868  17.785 16.256  0.46 9.26  ? 29  LYS A CG  1 
ATOM   259  C  CD  A LYS A 1 29  ? -4.811  16.689 16.947  0.54 13.27 ? 29  LYS A CD  1 
ATOM   260  C  CD  B LYS A 1 29  ? -6.328  17.676 16.689  0.46 13.37 ? 29  LYS A CD  1 
ATOM   261  C  CE  A LYS A 1 29  ? -5.854  15.576 17.004  0.54 18.85 ? 29  LYS A CE  1 
ATOM   262  C  CE  B LYS A 1 29  ? -6.848  16.273 16.440  0.46 19.79 ? 29  LYS A CE  1 
ATOM   263  N  NZ  A LYS A 1 29  ? -7.010  16.057 17.855  0.54 35.48 ? 29  LYS A NZ  1 
ATOM   264  N  NZ  B LYS A 1 29  ? -6.359  15.205 17.359  0.46 37.35 ? 29  LYS A NZ  1 
ATOM   265  N  N   . HIS A 1 30  ? -2.905  21.797 16.156  1.00 7.03  ? 30  HIS A N   1 
ATOM   266  C  CA  . HIS A 1 30  ? -2.202  22.960 16.712  1.00 6.94  ? 30  HIS A CA  1 
ATOM   267  C  C   . HIS A 1 30  ? -2.685  24.259 16.048  1.00 6.65  ? 30  HIS A C   1 
ATOM   268  O  O   . HIS A 1 30  ? -3.004  25.231 16.736  1.00 7.06  ? 30  HIS A O   1 
ATOM   269  C  CB  . HIS A 1 30  ? -0.689  22.784 16.555  1.00 7.61  ? 30  HIS A CB  1 
ATOM   270  C  CG  . HIS A 1 30  ? -0.184  21.645 17.348  1.00 7.54  ? 30  HIS A CG  1 
ATOM   271  N  ND1 . HIS A 1 30  ? -0.293  20.343 16.910  1.00 9.79  ? 30  HIS A ND1 1 
ATOM   272  C  CD2 . HIS A 1 30  ? 0.347   21.619 18.599  1.00 7.81  ? 30  HIS A CD2 1 
ATOM   273  C  CE1 . HIS A 1 30  ? 0.192   19.579 17.894  1.00 9.30  ? 30  HIS A CE1 1 
ATOM   274  N  NE2 . HIS A 1 30  ? 0.581   20.305 18.931  1.00 8.11  ? 30  HIS A NE2 1 
ATOM   275  N  N   . HIS A 1 31  ? -2.681  24.325 14.704  1.00 6.39  ? 31  HIS A N   1 
ATOM   276  C  CA  . HIS A 1 31  ? -3.096  25.540 14.061  1.00 6.09  ? 31  HIS A CA  1 
ATOM   277  C  C   . HIS A 1 31  ? -4.564  25.839 14.372  1.00 6.29  ? 31  HIS A C   1 
ATOM   278  O  O   . HIS A 1 31  ? -4.940  26.969 14.699  1.00 6.71  ? 31  HIS A O   1 
ATOM   279  C  CB  . HIS A 1 31  ? -2.779  25.475 12.551  1.00 6.09  ? 31  HIS A CB  1 
ATOM   280  C  CG  . HIS A 1 31  ? -2.990  26.763 11.846  1.00 5.95  ? 31  HIS A CG  1 
ATOM   281  N  ND1 . HIS A 1 31  ? -2.729  26.859 10.474  1.00 5.90  ? 31  HIS A ND1 1 
ATOM   282  C  CD2 . HIS A 1 31  ? -3.443  27.975 12.269  1.00 6.14  ? 31  HIS A CD2 1 
ATOM   283  C  CE1 . HIS A 1 31  ? -3.010  28.112 10.135  1.00 5.89  ? 31  HIS A CE1 1 
ATOM   284  N  NE2 . HIS A 1 31  ? -3.434  28.822 11.190  1.00 6.27  ? 31  HIS A NE2 1 
ATOM   285  N  N   . GLN A 1 32  ? -5.418  24.798 14.307  1.00 6.54  ? 32  GLN A N   1 
ATOM   286  C  CA  . GLN A 1 32  ? -6.822  24.982 14.624  1.00 6.78  ? 32  GLN A CA  1 
ATOM   287  C  C   . GLN A 1 32  ? -7.012  25.620 16.002  1.00 6.83  ? 32  GLN A C   1 
ATOM   288  O  O   . GLN A 1 32  ? -7.900  26.480 16.177  1.00 7.27  ? 32  GLN A O   1 
ATOM   289  C  CB  . GLN A 1 32  ? -7.559  23.626 14.564  1.00 7.45  ? 32  GLN A CB  1 
ATOM   290  C  CG  . GLN A 1 32  ? -9.035  23.764 14.830  1.00 8.55  ? 32  GLN A CG  1 
ATOM   291  C  CD  . GLN A 1 32  ? -9.778  24.365 13.647  1.00 8.31  ? 32  GLN A CD  1 
ATOM   292  O  OE1 . GLN A 1 32  ? -9.800  23.750 12.583  1.00 8.98  ? 32  GLN A OE1 1 
ATOM   293  N  NE2 . GLN A 1 32  ? -10.336 25.546 13.801  1.00 10.09 ? 32  GLN A NE2 1 
ATOM   294  N  N   . THR A 1 33  ? -6.238  25.192 16.994  1.00 6.95  ? 33  THR A N   1 
ATOM   295  C  CA  . THR A 1 33  ? -6.392  25.741 18.343  1.00 7.35  ? 33  THR A CA  1 
ATOM   296  C  C   . THR A 1 33  ? -6.072  27.217 18.379  1.00 6.89  ? 33  THR A C   1 
ATOM   297  O  O   . THR A 1 33  ? -6.754  27.993 19.068  1.00 7.61  ? 33  THR A O   1 
ATOM   298  C  CB  . THR A 1 33  ? -5.572  24.904 19.333  1.00 8.18  ? 33  THR A CB  1 
ATOM   299  O  OG1 . THR A 1 33  ? -6.148  23.596 19.390  1.00 10.17 ? 33  THR A OG1 1 
ATOM   300  C  CG2 . THR A 1 33  ? -5.526  25.534 20.704  1.00 9.01  ? 33  THR A CG2 1 
ATOM   301  N  N   . TYR A 1 34  ? -5.020  27.667 17.666  1.00 6.70  ? 34  TYR A N   1 
ATOM   302  C  CA  . TYR A 1 34  ? -4.757  29.099 17.599  1.00 6.67  ? 34  TYR A CA  1 
ATOM   303  C  C   . TYR A 1 34  ? -5.905  29.867 16.965  1.00 6.95  ? 34  TYR A C   1 
ATOM   304  O  O   . TYR A 1 34  ? -6.276  30.946 17.446  1.00 7.72  ? 34  TYR A O   1 
ATOM   305  C  CB  . TYR A 1 34  ? -3.442  29.401 16.839  1.00 6.96  ? 34  TYR A CB  1 
ATOM   306  C  CG  . TYR A 1 34  ? -2.206  28.855 17.512  1.00 6.64  ? 34  TYR A CG  1 
ATOM   307  C  CD1 . TYR A 1 34  ? -1.931  29.151 18.849  1.00 7.74  ? 34  TYR A CD1 1 
ATOM   308  C  CD2 . TYR A 1 34  ? -1.326  28.027 16.837  1.00 6.96  ? 34  TYR A CD2 1 
ATOM   309  C  CE1 . TYR A 1 34  ? -0.821  28.647 19.446  1.00 8.77  ? 34  TYR A CE1 1 
ATOM   310  C  CE2 . TYR A 1 34  ? -0.210  27.504 17.467  1.00 7.56  ? 34  TYR A CE2 1 
ATOM   311  C  CZ  . TYR A 1 34  ? 0.061   27.815 18.786  1.00 8.66  ? 34  TYR A CZ  1 
ATOM   312  O  OH  . TYR A 1 34  ? 1.196   27.298 19.372  1.00 10.48 ? 34  TYR A OH  1 
ATOM   313  N  N   . VAL A 1 35  ? -6.466  29.335 15.867  1.00 7.00  ? 35  VAL A N   1 
ATOM   314  C  CA  . VAL A 1 35  ? -7.626  29.949 15.247  1.00 7.25  ? 35  VAL A CA  1 
ATOM   315  C  C   . VAL A 1 35  ? -8.758  30.071 16.265  1.00 8.02  ? 35  VAL A C   1 
ATOM   316  O  O   . VAL A 1 35  ? -9.377  31.140 16.426  1.00 8.72  ? 35  VAL A O   1 
ATOM   317  C  CB  . VAL A 1 35  ? -8.067  29.126 14.031  1.00 7.32  ? 35  VAL A CB  1 
ATOM   318  C  CG1 . VAL A 1 35  ? -9.455  29.549 13.527  1.00 8.60  ? 35  VAL A CG1 1 
ATOM   319  C  CG2 . VAL A 1 35  ? -7.050  29.267 12.908  1.00 8.98  ? 35  VAL A CG2 1 
ATOM   320  N  N   . ASN A 1 36  ? -9.044  28.981 16.969  1.00 8.03  ? 36  ASN A N   1 
ATOM   321  C  CA  . ASN A 1 36  ? -10.181 28.969 17.892  1.00 8.73  ? 36  ASN A CA  1 
ATOM   322  C  C   . ASN A 1 36  ? -9.959  29.953 19.034  1.00 8.50  ? 36  ASN A C   1 
ATOM   323  O  O   . ASN A 1 36  ? -10.892 30.684 19.434  1.00 9.40  ? 36  ASN A O   1 
ATOM   324  C  CB  . ASN A 1 36  ? -10.386 27.575 18.452  1.00 9.65  ? 36  ASN A CB  1 
ATOM   325  C  CG  . ASN A 1 36  ? -10.833 26.569 17.447  1.00 10.26 ? 36  ASN A CG  1 
ATOM   326  O  OD1 . ASN A 1 36  ? -11.197 26.926 16.296  1.00 11.15 ? 36  ASN A OD1 1 
ATOM   327  N  ND2 . ASN A 1 36  ? -10.816 25.280 17.821  1.00 11.60 ? 36  ASN A ND2 1 
ATOM   328  N  N   . ASN A 1 37  ? -8.768  29.979 19.596  1.00 8.23  ? 37  ASN A N   1 
ATOM   329  C  CA  . ASN A 1 37  ? -8.506  30.812 20.765  1.00 8.82  ? 37  ASN A CA  1 
ATOM   330  C  C   . ASN A 1 37  ? -8.417  32.272 20.369  1.00 8.70  ? 37  ASN A C   1 
ATOM   331  O  O   . ASN A 1 37  ? -8.821  33.160 21.136  1.00 10.27 ? 37  ASN A O   1 
ATOM   332  C  CB  . ASN A 1 37  ? -7.297  30.295 21.559  1.00 9.56  ? 37  ASN A CB  1 
ATOM   333  C  CG  . ASN A 1 37  ? -7.655  28.966 22.274  1.00 10.70 ? 37  ASN A CG  1 
ATOM   334  O  OD1 . ASN A 1 37  ? -8.804  28.718 22.587  1.00 13.28 ? 37  ASN A OD1 1 
ATOM   335  N  ND2 . ASN A 1 37  ? -6.604  28.210 22.631  1.00 12.91 ? 37  ASN A ND2 1 
ATOM   336  N  N   . ALA A 1 38  ? -7.915  32.571 19.174  1.00 8.53  ? 38  ALA A N   1 
ATOM   337  C  CA  . ALA A 1 38  ? -7.955  33.943 18.691  1.00 9.02  ? 38  ALA A CA  1 
ATOM   338  C  C   . ALA A 1 38  ? -9.406  34.392 18.444  1.00 9.58  ? 38  ALA A C   1 
ATOM   339  O  O   . ALA A 1 38  ? -9.792  35.505 18.830  1.00 10.04 ? 38  ALA A O   1 
ATOM   340  C  CB  . ALA A 1 38  ? -7.160  34.090 17.396  1.00 8.68  ? 38  ALA A CB  1 
ATOM   341  N  N   . ASN A 1 39  ? -10.185 33.512 17.838  1.00 10.02 ? 39  ASN A N   1 
ATOM   342  C  CA  . ASN A 1 39  ? -11.591 33.877 17.605  1.00 10.35 ? 39  ASN A CA  1 
ATOM   343  C  C   . ASN A 1 39  ? -12.296 34.145 18.923  1.00 10.69 ? 39  ASN A C   1 
ATOM   344  O  O   . ASN A 1 39  ? -13.130 35.105 18.976  1.00 13.37 ? 39  ASN A O   1 
ATOM   345  C  CB  . ASN A 1 39  ? -12.315 32.777 16.791  1.00 10.79 ? 39  ASN A CB  1 
ATOM   346  C  CG  . ASN A 1 39  ? -12.036 32.809 15.329  1.00 10.91 ? 39  ASN A CG  1 
ATOM   347  O  OD1 . ASN A 1 39  ? -11.698 33.870 14.795  1.00 12.52 ? 39  ASN A OD1 1 
ATOM   348  N  ND2 . ASN A 1 39  ? -12.225 31.711 14.613  1.00 11.00 ? 39  ASN A ND2 1 
ATOM   349  N  N   . ALA A 1 40  ? -12.039 33.353 19.943  1.00 11.28 ? 40  ALA A N   1 
ATOM   350  C  CA  . ALA A 1 40  ? -12.741 33.554 21.208  1.00 12.23 ? 40  ALA A CA  1 
ATOM   351  C  C   . ALA A 1 40  ? -12.391 34.973 21.726  1.00 12.01 ? 40  ALA A C   1 
ATOM   352  O  O   . ALA A 1 40  ? -13.272 35.690 22.273  1.00 14.55 ? 40  ALA A O   1 
ATOM   353  C  CB  . ALA A 1 40  ? -12.317 32.499 22.198  1.00 13.53 ? 40  ALA A CB  1 
ATOM   354  N  N   . ALA A 1 41  ? -11.149 35.392 21.617  1.00 11.78 ? 41  ALA A N   1 
ATOM   355  C  CA  . ALA A 1 41  ? -10.700 36.713 22.101  1.00 12.35 ? 41  ALA A CA  1 
ATOM   356  C  C   . ALA A 1 41  ? -11.264 37.840 21.243  1.00 12.38 ? 41  ALA A C   1 
ATOM   357  O  O   . ALA A 1 41  ? -11.425 38.989 21.729  1.00 15.93 ? 41  ALA A O   1 
ATOM   358  C  CB  . ALA A 1 41  ? -9.203  36.759 22.194  1.00 13.82 ? 41  ALA A CB  1 
ATOM   359  N  N   . LEU A 1 42  ? -11.518 37.580 19.983  1.00 12.20 ? 42  LEU A N   1 
ATOM   360  C  CA  . LEU A 1 42  ? -11.999 38.610 19.099  1.00 12.62 ? 42  LEU A CA  1 
ATOM   361  C  C   . LEU A 1 42  ? -13.504 38.781 19.149  1.00 13.43 ? 42  LEU A C   1 
ATOM   362  O  O   . LEU A 1 42  ? -14.025 39.777 18.578  1.00 14.53 ? 42  LEU A O   1 
ATOM   363  C  CB  . LEU A 1 42  ? -11.533 38.327 17.662  1.00 13.04 ? 42  LEU A CB  1 
ATOM   364  C  CG  . LEU A 1 42  ? -10.042 38.654 17.443  1.00 13.13 ? 42  LEU A CG  1 
ATOM   365  C  CD1 . LEU A 1 42  ? -9.517  37.960 16.171  1.00 15.67 ? 42  LEU A CD1 1 
ATOM   366  C  CD2 . LEU A 1 42  ? -9.758  40.149 17.420  1.00 14.19 ? 42  LEU A CD2 1 
ATOM   367  N  N   . GLU A 1 43  ? -14.233 37.877 19.792  1.00 14.01 ? 43  GLU A N   1 
ATOM   368  C  CA  . GLU A 1 43  ? -15.707 38.005 19.818  1.00 16.78 ? 43  GLU A CA  1 
ATOM   369  C  C   . GLU A 1 43  ? -16.188 39.351 20.297  1.00 17.40 ? 43  GLU A C   1 
ATOM   370  O  O   . GLU A 1 43  ? -17.133 39.919 19.792  1.00 20.41 ? 43  GLU A O   1 
ATOM   371  C  CB  . GLU A 1 43  ? -16.273 36.883 20.694  1.00 21.65 ? 43  GLU A CB  1 
ATOM   372  C  CG  . GLU A 1 43  ? -16.375 35.549 19.995  1.00 25.64 ? 43  GLU A CG  1 
ATOM   373  C  CD  . GLU A 1 43  ? -17.744 35.546 19.299  1.00 36.86 ? 43  GLU A CD  1 
ATOM   374  O  OE1 . GLU A 1 43  ? -18.731 34.969 19.795  1.00 55.27 ? 43  GLU A OE1 1 
ATOM   375  O  OE2 . GLU A 1 43  ? -17.878 36.157 18.203  1.00 47.45 ? 43  GLU A OE2 1 
ATOM   376  N  N   . SER A 1 44  ? -15.518 39.898 21.314  1.00 15.34 ? 44  SER A N   1 
ATOM   377  C  CA  . SER A 1 44  ? -15.935 41.177 21.889  1.00 17.14 ? 44  SER A CA  1 
ATOM   378  C  C   . SER A 1 44  ? -15.321 42.391 21.206  1.00 17.13 ? 44  SER A C   1 
ATOM   379  O  O   . SER A 1 44  ? -15.519 43.521 21.672  1.00 19.12 ? 44  SER A O   1 
ATOM   380  C  CB  . SER A 1 44  ? -15.604 41.240 23.386  1.00 18.35 ? 44  SER A CB  1 
ATOM   381  O  OG  . SER A 1 44  ? -14.179 41.315 23.592  1.00 18.76 ? 44  SER A OG  1 
ATOM   382  N  N   . LEU A 1 45  ? -14.564 42.199 20.100  1.00 14.78 ? 45  LEU A N   1 
ATOM   383  C  CA  . LEU A 1 45  ? -13.796 43.219 19.424  1.00 15.48 ? 45  LEU A CA  1 
ATOM   384  C  C   . LEU A 1 45  ? -14.182 43.248 17.960  1.00 15.63 ? 45  LEU A C   1 
ATOM   385  O  O   . LEU A 1 45  ? -13.349 42.984 17.077  1.00 15.03 ? 45  LEU A O   1 
ATOM   386  C  CB  . LEU A 1 45  ? -12.280 42.949 19.549  1.00 14.69 ? 45  LEU A CB  1 
ATOM   387  C  CG  . LEU A 1 45  ? -11.690 42.943 20.964  1.00 17.35 ? 45  LEU A CG  1 
ATOM   388  C  CD1 . LEU A 1 45  ? -10.207 42.555 20.898  1.00 16.96 ? 45  LEU A CD1 1 
ATOM   389  C  CD2 . LEU A 1 45  ? -11.844 44.291 21.628  1.00 18.21 ? 45  LEU A CD2 1 
ATOM   390  N  N   . PRO A 1 46  ? -15.423 43.618 17.655  1.00 19.43 ? 46  PRO A N   1 
ATOM   391  C  CA  . PRO A 1 46  ? -15.834 43.661 16.227  1.00 21.13 ? 46  PRO A CA  1 
ATOM   392  C  C   . PRO A 1 46  ? -14.989 44.577 15.351  1.00 20.38 ? 46  PRO A C   1 
ATOM   393  O  O   . PRO A 1 46  ? -14.866 44.382 14.167  1.00 28.21 ? 46  PRO A O   1 
ATOM   394  C  CB  . PRO A 1 46  ? -17.263 44.154 16.301  1.00 27.55 ? 46  PRO A CB  1 
ATOM   395  C  CG  . PRO A 1 46  ? -17.336 44.907 17.605  1.00 27.91 ? 46  PRO A CG  1 
ATOM   396  C  CD  . PRO A 1 46  ? -16.537 43.986 18.525  1.00 23.18 ? 46  PRO A CD  1 
ATOM   397  N  N   . GLU A 1 47  ? -14.391 45.610 15.956  1.00 20.39 ? 47  GLU A N   1 
ATOM   398  C  CA  . GLU A 1 47  ? -13.561 46.491 15.112  1.00 22.12 ? 47  GLU A CA  1 
ATOM   399  C  C   . GLU A 1 47  ? -12.226 45.857 14.777  1.00 19.18 ? 47  GLU A C   1 
ATOM   400  O  O   . GLU A 1 47  ? -11.451 46.343 13.954  1.00 27.41 ? 47  GLU A O   1 
ATOM   401  C  CB  . GLU A 1 47  ? -13.356 47.829 15.818  1.00 26.71 ? 47  GLU A CB  1 
ATOM   402  C  CG  . GLU A 1 47  ? -12.642 47.814 17.143  1.00 30.24 ? 47  GLU A CG  1 
ATOM   403  C  CD  . GLU A 1 47  ? -13.183 47.285 18.456  1.00 34.26 ? 47  GLU A CD  1 
ATOM   404  O  OE1 . GLU A 1 47  ? -14.153 46.496 18.572  1.00 28.27 ? 47  GLU A OE1 1 
ATOM   405  O  OE2 . GLU A 1 47  ? -12.573 47.653 19.538  1.00 35.79 ? 47  GLU A OE2 1 
ATOM   406  N  N   . PHE A 1 48  ? -11.833 44.794 15.425  1.00 13.93 ? 48  PHE A N   1 
ATOM   407  C  CA  . PHE A 1 48  ? -10.553 44.131 15.156  1.00 13.13 ? 48  PHE A CA  1 
ATOM   408  C  C   . PHE A 1 48  ? -10.802 42.820 14.449  1.00 12.31 ? 48  PHE A C   1 
ATOM   409  O  O   . PHE A 1 48  ? -9.911  42.314 13.776  1.00 12.55 ? 48  PHE A O   1 
ATOM   410  C  CB  . PHE A 1 48  ? -9.740  43.918 16.423  1.00 14.56 ? 48  PHE A CB  1 
ATOM   411  C  CG  . PHE A 1 48  ? -9.155  45.197 16.940  1.00 15.72 ? 48  PHE A CG  1 
ATOM   412  C  CD1 . PHE A 1 48  ? -8.086  45.828 16.352  1.00 20.86 ? 48  PHE A CD1 1 
ATOM   413  C  CD2 . PHE A 1 48  ? -9.687  45.817 18.070  1.00 16.42 ? 48  PHE A CD2 1 
ATOM   414  C  CE1 . PHE A 1 48  ? -7.620  47.025 16.790  1.00 21.11 ? 48  PHE A CE1 1 
ATOM   415  C  CE2 . PHE A 1 48  ? -9.194  47.003 18.564  1.00 18.18 ? 48  PHE A CE2 1 
ATOM   416  C  CZ  . PHE A 1 48  ? -8.124  47.559 17.942  1.00 19.52 ? 48  PHE A CZ  1 
ATOM   417  N  N   . ALA A 1 49  ? -11.977 42.206 14.642  1.00 14.21 ? 49  ALA A N   1 
ATOM   418  C  CA  . ALA A 1 49  ? -12.202 40.866 14.131  1.00 13.42 ? 49  ALA A CA  1 
ATOM   419  C  C   . ALA A 1 49  ? -12.151 40.777 12.604  1.00 12.26 ? 49  ALA A C   1 
ATOM   420  O  O   . ALA A 1 49  ? -11.855 39.694 12.134  1.00 15.45 ? 49  ALA A O   1 
ATOM   421  C  CB  . ALA A 1 49  ? -13.561 40.413 14.668  1.00 16.08 ? 49  ALA A CB  1 
ATOM   422  N  N   . ASN A 1 50  ? -12.402 41.872 11.870  1.00 14.22 ? 50  ASN A N   1 
ATOM   423  C  CA  . ASN A 1 50  ? -12.423 41.807 10.425  1.00 16.02 ? 50  ASN A CA  1 
ATOM   424  C  C   . ASN A 1 50  ? -11.070 41.903 9.798   1.00 12.38 ? 50  ASN A C   1 
ATOM   425  O  O   . ASN A 1 50  ? -10.931 41.614 8.606   1.00 12.90 ? 50  ASN A O   1 
ATOM   426  C  CB  . ASN A 1 50  ? -13.322 42.969 9.911   1.00 25.72 ? 50  ASN A CB  1 
ATOM   427  C  CG  . ASN A 1 50  ? -14.765 42.869 10.319  1.00 33.37 ? 50  ASN A CG  1 
ATOM   428  O  OD1 . ASN A 1 50  ? -15.132 41.719 10.610  1.00 39.00 ? 50  ASN A OD1 1 
ATOM   429  N  ND2 . ASN A 1 50  ? -15.451 44.001 10.339  1.00 47.42 ? 50  ASN A ND2 1 
ATOM   430  N  N   . LEU A 1 51  ? -10.102 42.375 10.562  1.00 10.87 ? 51  LEU A N   1 
ATOM   431  C  CA  . LEU A 1 51  ? -8.808  42.561 9.969   1.00 9.43  ? 51  LEU A CA  1 
ATOM   432  C  C   . LEU A 1 51  ? -8.189  41.217 9.554   1.00 8.34  ? 51  LEU A C   1 
ATOM   433  O  O   . LEU A 1 51  ? -8.297  40.209 10.280  1.00 8.90  ? 51  LEU A O   1 
ATOM   434  C  CB  . LEU A 1 51  ? -7.820  43.216 10.916  1.00 9.56  ? 51  LEU A CB  1 
ATOM   435  C  CG  . LEU A 1 51  ? -7.780  44.747 10.929  1.00 11.69 ? 51  LEU A CG  1 
ATOM   436  C  CD1 . LEU A 1 51  ? -9.161  45.382 11.107  1.00 14.03 ? 51  LEU A CD1 1 
ATOM   437  C  CD2 . LEU A 1 51  ? -6.802  45.223 12.018  1.00 15.08 ? 51  LEU A CD2 1 
ATOM   438  N  N   . PRO A 1 52  ? -7.480  41.191 8.452   1.00 8.27  ? 52  PRO A N   1 
ATOM   439  C  CA  . PRO A 1 52  ? -6.615  40.020 8.209   1.00 7.84  ? 52  PRO A CA  1 
ATOM   440  C  C   . PRO A 1 52  ? -5.672  39.797 9.347   1.00 7.14  ? 52  PRO A C   1 
ATOM   441  O  O   . PRO A 1 52  ? -5.165  40.762 9.929   1.00 7.95  ? 52  PRO A O   1 
ATOM   442  C  CB  . PRO A 1 52  ? -5.856  40.449 6.935   1.00 8.60  ? 52  PRO A CB  1 
ATOM   443  C  CG  . PRO A 1 52  ? -6.804  41.411 6.241   1.00 9.43  ? 52  PRO A CG  1 
ATOM   444  C  CD  . PRO A 1 52  ? -7.394  42.167 7.366   1.00 9.16  ? 52  PRO A CD  1 
ATOM   445  N  N   . VAL A 1 53  ? -5.398  38.527 9.682   1.00 7.09  ? 53  VAL A N   1 
ATOM   446  C  CA  . VAL A 1 53  ? -4.543  38.243 10.860  1.00 7.17  ? 53  VAL A CA  1 
ATOM   447  C  C   . VAL A 1 53  ? -3.174  38.902 10.698  1.00 7.43  ? 53  VAL A C   1 
ATOM   448  O  O   . VAL A 1 53  ? -2.612  39.350 11.675  1.00 8.12  ? 53  VAL A O   1 
ATOM   449  C  CB  . VAL A 1 53  ? -4.476  36.738 11.075  1.00 7.20  ? 53  VAL A CB  1 
ATOM   450  C  CG1 . VAL A 1 53  ? -3.740  35.978 9.980   1.00 8.00  ? 53  VAL A CG1 1 
ATOM   451  C  CG2 . VAL A 1 53  ? -3.885  36.455 12.442  1.00 7.72  ? 53  VAL A CG2 1 
ATOM   452  N  N   . GLU A 1 54  ? -2.618  38.925 9.465   1.00 8.08  ? 54  GLU A N   1 
ATOM   453  C  CA  . GLU A 1 54  ? -1.281  39.469 9.249   1.00 8.80  ? 54  GLU A CA  1 
ATOM   454  C  C   . GLU A 1 54  ? -1.272  40.969 9.472   1.00 9.27  ? 54  GLU A C   1 
ATOM   455  O  O   . GLU A 1 54  ? -0.196  41.528 9.732   1.00 11.07 ? 54  GLU A O   1 
ATOM   456  C  CB  . GLU A 1 54  ? -0.712  39.039 7.877   1.00 11.19 ? 54  GLU A CB  1 
ATOM   457  C  CG  . GLU A 1 54  ? -1.321  39.558 6.618   1.00 10.39 ? 54  GLU A CG  1 
ATOM   458  C  CD  . GLU A 1 54  ? -2.616  38.961 6.109   1.00 9.86  ? 54  GLU A CD  1 
ATOM   459  O  OE1 . GLU A 1 54  ? -3.082  37.984 6.835   1.00 8.47  ? 54  GLU A OE1 1 
ATOM   460  O  OE2 . GLU A 1 54  ? -3.051  39.495 5.020   1.00 8.97  ? 54  GLU A OE2 1 
ATOM   461  N  N   . GLU A 1 55  ? -2.418  41.634 9.388   1.00 8.97  ? 55  GLU A N   1 
ATOM   462  C  CA  . GLU A 1 55  ? -2.555  43.047 9.678   1.00 9.11  ? 55  GLU A CA  1 
ATOM   463  C  C   . GLU A 1 55  ? -2.785  43.216 11.155  1.00 9.02  ? 55  GLU A C   1 
ATOM   464  O  O   . GLU A 1 55  ? -2.196  44.101 11.818  1.00 10.02 ? 55  GLU A O   1 
ATOM   465  C  CB  . GLU A 1 55  ? -3.669  43.696 8.891   1.00 10.34 ? 55  GLU A CB  1 
ATOM   466  C  CG  . GLU A 1 55  ? -3.767  45.182 9.130   1.00 11.04 ? 55  GLU A CG  1 
ATOM   467  C  CD  . GLU A 1 55  ? -4.836  45.900 8.351   1.00 10.41 ? 55  GLU A CD  1 
ATOM   468  O  OE1 . GLU A 1 55  ? -5.548  45.254 7.593   1.00 13.10 ? 55  GLU A OE1 1 
ATOM   469  O  OE2 . GLU A 1 55  ? -4.894  47.165 8.463   1.00 12.00 ? 55  GLU A OE2 1 
ATOM   470  N  N   . LEU A 1 56  ? -3.624  42.412 11.817  1.00 8.64  ? 56  LEU A N   1 
ATOM   471  C  CA  . LEU A 1 56  ? -3.894  42.562 13.216  1.00 8.79  ? 56  LEU A CA  1 
ATOM   472  C  C   . LEU A 1 56  ? -2.577  42.503 14.004  1.00 8.54  ? 56  LEU A C   1 
ATOM   473  O  O   . LEU A 1 56  ? -2.392  43.265 14.952  1.00 9.73  ? 56  LEU A O   1 
ATOM   474  C  CB  . LEU A 1 56  ? -4.860  41.484 13.727  1.00 9.01  ? 56  LEU A CB  1 
ATOM   475  C  CG  . LEU A 1 56  ? -5.154  41.580 15.209  1.00 12.15 ? 56  LEU A CG  1 
ATOM   476  C  CD1 . LEU A 1 56  ? -5.826  42.922 15.531  1.00 15.72 ? 56  LEU A CD1 1 
ATOM   477  C  CD2 . LEU A 1 56  ? -5.961  40.474 15.757  1.00 14.90 ? 56  LEU A CD2 1 
ATOM   478  N  N   . ILE A 1 57  ? -1.675  41.587 13.645  1.00 8.16  ? 57  ILE A N   1 
ATOM   479  C  CA  . ILE A 1 57  ? -0.464  41.443 14.472  1.00 8.57  ? 57  ILE A CA  1 
ATOM   480  C  C   . ILE A 1 57  ? 0.493   42.617 14.292  1.00 9.26  ? 57  ILE A C   1 
ATOM   481  O  O   . ILE A 1 57  ? 1.464   42.699 15.092  1.00 10.46 ? 57  ILE A O   1 
ATOM   482  C  CB  . ILE A 1 57  ? 0.243   40.089 14.205  1.00 8.55  ? 57  ILE A CB  1 
ATOM   483  C  CG1 . ILE A 1 57  ? 0.718   39.914 12.761  1.00 8.95  ? 57  ILE A CG1 1 
ATOM   484  C  CG2 . ILE A 1 57  ? -0.680  38.960 14.694  1.00 9.32  ? 57  ILE A CG2 1 
ATOM   485  C  CD1 . ILE A 1 57  ? 1.655   38.754 12.584  1.00 10.46 ? 57  ILE A CD1 1 
ATOM   486  N  N   . THR A 1 58  ? 0.250   43.532 13.352  1.00 9.53  ? 58  THR A N   1 
ATOM   487  C  CA  . THR A 1 58  ? 1.010   44.764 13.230  1.00 9.93  ? 58  THR A CA  1 
ATOM   488  C  C   . THR A 1 58  ? 0.413   45.869 14.090  1.00 11.29 ? 58  THR A C   1 
ATOM   489  O  O   . THR A 1 58  ? 0.990   46.980 14.162  1.00 12.99 ? 58  THR A O   1 
ATOM   490  C  CB  . THR A 1 58  ? 1.143   45.241 11.774  1.00 10.13 ? 58  THR A CB  1 
ATOM   491  O  OG1 . THR A 1 58  ? -0.124  45.785 11.317  1.00 10.90 ? 58  THR A OG1 1 
ATOM   492  C  CG2 . THR A 1 58  ? 1.707   44.208 10.839  1.00 10.33 ? 58  THR A CG2 1 
ATOM   493  N  N   . LYS A 1 59  ? -0.716  45.642 14.745  1.00 11.17 ? 59  LYS A N   1 
ATOM   494  C  CA  . LYS A 1 59  ? -1.559  46.632 15.395  1.00 12.25 ? 59  LYS A CA  1 
ATOM   495  C  C   . LYS A 1 59  ? -1.865  46.197 16.826  1.00 11.42 ? 59  LYS A C   1 
ATOM   496  O  O   . LYS A 1 59  ? -2.869  46.648 17.406  1.00 13.73 ? 59  LYS A O   1 
ATOM   497  C  CB  . LYS A 1 59  ? -2.826  46.905 14.565  1.00 13.58 ? 59  LYS A CB  1 
ATOM   498  C  CG  . LYS A 1 59  ? -2.505  47.608 13.230  1.00 14.54 ? 59  LYS A CG  1 
ATOM   499  C  CD  . LYS A 1 59  ? -3.711  47.940 12.392  1.00 17.75 ? 59  LYS A CD  1 
ATOM   500  C  CE  . LYS A 1 59  ? -3.286  48.739 11.162  1.00 20.43 ? 59  LYS A CE  1 
ATOM   501  N  NZ  . LYS A 1 59  ? -4.369  49.047 10.217  1.00 26.52 ? 59  LYS A NZ  1 
ATOM   502  N  N   . LEU A 1 60  ? -1.046  45.317 17.418  1.00 10.87 ? 60  LEU A N   1 
ATOM   503  C  CA  . LEU A 1 60  ? -1.360  44.824 18.737  1.00 10.49 ? 60  LEU A CA  1 
ATOM   504  C  C   . LEU A 1 60  ? -1.350  45.924 19.763  1.00 12.39 ? 60  LEU A C   1 
ATOM   505  O  O   . LEU A 1 60  ? -2.009  45.795 20.826  1.00 12.49 ? 60  LEU A O   1 
ATOM   506  C  CB  . LEU A 1 60  ? -0.342  43.711 19.170  1.00 11.30 ? 60  LEU A CB  1 
ATOM   507  C  CG  . LEU A 1 60  ? -0.394  42.439 18.326  1.00 10.67 ? 60  LEU A CG  1 
ATOM   508  C  CD1 . LEU A 1 60  ? 0.840   41.599 18.692  1.00 11.98 ? 60  LEU A CD1 1 
ATOM   509  C  CD2 . LEU A 1 60  ? -1.674  41.670 18.519  1.00 13.78 ? 60  LEU A CD2 1 
ATOM   510  N  N   . ASP A 1 61  ? -0.604  46.986 19.524  1.00 13.26 ? 61  ASP A N   1 
ATOM   511  C  CA  . ASP A 1 61  ? -0.560  48.125 20.409  1.00 14.97 ? 61  ASP A CA  1 
ATOM   512  C  C   . ASP A 1 61  ? -1.925  48.822 20.477  1.00 15.75 ? 61  ASP A C   1 
ATOM   513  O  O   . ASP A 1 61  ? -2.083  49.607 21.435  1.00 18.03 ? 61  ASP A O   1 
ATOM   514  C  CB  A ASP A 1 61  ? 0.458   49.147 19.898  0.58 17.24 ? 61  ASP A CB  1 
ATOM   515  C  CB  B ASP A 1 61  ? 0.529   49.110 19.973  0.42 15.91 ? 61  ASP A CB  1 
ATOM   516  C  CG  A ASP A 1 61  ? 0.211   49.572 18.458  0.58 18.12 ? 61  ASP A CG  1 
ATOM   517  C  CG  B ASP A 1 61  ? 0.479   49.592 18.547  0.42 18.45 ? 61  ASP A CG  1 
ATOM   518  O  OD1 A ASP A 1 61  ? 0.381   48.672 17.617  0.58 18.10 ? 61  ASP A OD1 1 
ATOM   519  O  OD1 B ASP A 1 61  ? -0.190  48.937 17.723  0.42 26.37 ? 61  ASP A OD1 1 
ATOM   520  O  OD2 A ASP A 1 61  ? -0.130  50.768 18.213  0.58 24.04 ? 61  ASP A OD2 1 
ATOM   521  O  OD2 B ASP A 1 61  ? 1.099   50.639 18.226  0.42 19.81 ? 61  ASP A OD2 1 
ATOM   522  N  N   . GLN A 1 62  ? -2.795  48.606 19.511  1.00 14.69 ? 62  GLN A N   1 
ATOM   523  C  CA  . GLN A 1 62  ? -4.115  49.282 19.532  1.00 17.03 ? 62  GLN A CA  1 
ATOM   524  C  C   . GLN A 1 62  ? -5.144  48.540 20.375  1.00 14.76 ? 62  GLN A C   1 
ATOM   525  O  O   . GLN A 1 62  ? -6.208  49.044 20.646  1.00 18.25 ? 62  GLN A O   1 
ATOM   526  C  CB  . GLN A 1 62  ? -4.582  49.408 18.089  1.00 20.18 ? 62  GLN A CB  1 
ATOM   527  C  CG  . GLN A 1 62  ? -3.805  50.319 17.167  1.00 24.28 ? 62  GLN A CG  1 
ATOM   528  C  CD  . GLN A 1 62  ? -4.393  50.421 15.767  1.00 24.09 ? 62  GLN A CD  1 
ATOM   529  O  OE1 . GLN A 1 62  ? -3.707  50.683 14.780  1.00 30.03 ? 62  GLN A OE1 1 
ATOM   530  N  NE2 . GLN A 1 62  ? -5.679  50.193 15.558  1.00 27.23 ? 62  GLN A NE2 1 
ATOM   531  N  N   . LEU A 1 63  ? -4.883  47.296 20.734  1.00 14.23 ? 63  LEU A N   1 
ATOM   532  C  CA  . LEU A 1 63  ? -5.827  46.497 21.457  1.00 14.21 ? 63  LEU A CA  1 
ATOM   533  C  C   . LEU A 1 63  ? -5.995  46.954 22.885  1.00 14.93 ? 63  LEU A C   1 
ATOM   534  O  O   . LEU A 1 63  ? -5.057  47.553 23.438  1.00 17.15 ? 63  LEU A O   1 
ATOM   535  C  CB  . LEU A 1 63  ? -5.355  45.031 21.521  1.00 13.59 ? 63  LEU A CB  1 
ATOM   536  C  CG  . LEU A 1 63  ? -5.344  44.283 20.177  1.00 12.77 ? 63  LEU A CG  1 
ATOM   537  C  CD1 . LEU A 1 63  ? -4.596  42.966 20.363  1.00 12.58 ? 63  LEU A CD1 1 
ATOM   538  C  CD2 . LEU A 1 63  ? -6.762  44.045 19.685  1.00 14.39 ? 63  LEU A CD2 1 
ATOM   539  N  N   . PRO A 1 64  ? -7.145  46.650 23.499  1.00 16.69 ? 64  PRO A N   1 
ATOM   540  C  CA  . PRO A 1 64  ? -7.300  46.842 24.930  1.00 16.31 ? 64  PRO A CA  1 
ATOM   541  C  C   . PRO A 1 64  ? -6.187  46.060 25.644  1.00 16.69 ? 64  PRO A C   1 
ATOM   542  O  O   . PRO A 1 64  ? -5.842  44.958 25.224  1.00 16.54 ? 64  PRO A O   1 
ATOM   543  C  CB  . PRO A 1 64  ? -8.654  46.281 25.278  1.00 18.40 ? 64  PRO A CB  1 
ATOM   544  C  CG  . PRO A 1 64  ? -9.453  46.353 23.977  1.00 21.31 ? 64  PRO A CG  1 
ATOM   545  C  CD  . PRO A 1 64  ? -8.401  46.075 22.930  1.00 16.89 ? 64  PRO A CD  1 
ATOM   546  N  N   . ALA A 1 65  ? -5.738  46.560 26.771  1.00 18.26 ? 65  ALA A N   1 
ATOM   547  C  CA  . ALA A 1 65  ? -4.673  45.905 27.522  1.00 20.10 ? 65  ALA A CA  1 
ATOM   548  C  C   . ALA A 1 65  ? -4.933  44.457 27.847  1.00 17.56 ? 65  ALA A C   1 
ATOM   549  O  O   . ALA A 1 65  ? -4.035  43.607 27.774  1.00 16.77 ? 65  ALA A O   1 
ATOM   550  C  CB  . ALA A 1 65  ? -4.463  46.676 28.822  1.00 27.21 ? 65  ALA A CB  1 
ATOM   551  N  N   . ASP A 1 66  ? -6.166  44.112 28.216  1.00 18.74 ? 66  ASP A N   1 
ATOM   552  C  CA  . ASP A 1 66  ? -6.499  42.758 28.637  1.00 19.25 ? 66  ASP A CA  1 
ATOM   553  C  C   . ASP A 1 66  ? -6.644  41.769 27.460  1.00 15.15 ? 66  ASP A C   1 
ATOM   554  O  O   . ASP A 1 66  ? -6.906  40.579 27.724  1.00 17.05 ? 66  ASP A O   1 
ATOM   555  C  CB  . ASP A 1 66  ? -7.770  42.749 29.489  1.00 23.28 ? 66  ASP A CB  1 
ATOM   556  C  CG  . ASP A 1 66  ? -9.007  43.233 28.759  1.00 28.62 ? 66  ASP A CG  1 
ATOM   557  O  OD1 . ASP A 1 66  ? -9.055  43.553 27.571  1.00 25.86 ? 66  ASP A OD1 1 
ATOM   558  O  OD2 . ASP A 1 66  ? -10.029 43.343 29.560  1.00 46.15 ? 66  ASP A OD2 1 
ATOM   559  N  N   . LYS A 1 67  ? -6.468  42.276 26.241  1.00 14.21 ? 67  LYS A N   1 
ATOM   560  C  CA  . LYS A 1 67  ? -6.531  41.443 25.046  1.00 12.65 ? 67  LYS A CA  1 
ATOM   561  C  C   . LYS A 1 67  ? -5.163  41.260 24.396  1.00 10.78 ? 67  LYS A C   1 
ATOM   562  O  O   . LYS A 1 67  ? -5.025  40.446 23.477  1.00 11.45 ? 67  LYS A O   1 
ATOM   563  C  CB  . LYS A 1 67  ? -7.486  42.055 24.041  1.00 14.23 ? 67  LYS A CB  1 
ATOM   564  C  CG  . LYS A 1 67  ? -8.939  42.174 24.505  1.00 15.46 ? 67  LYS A CG  1 
ATOM   565  C  CD  . LYS A 1 67  ? -9.605  40.832 24.384  1.00 16.53 ? 67  LYS A CD  1 
ATOM   566  C  CE  . LYS A 1 67  ? -11.077 41.082 24.608  1.00 16.31 ? 67  LYS A CE  1 
ATOM   567  N  NZ  . LYS A 1 67  ? -11.815 39.833 24.342  1.00 18.07 ? 67  LYS A NZ  1 
ATOM   568  N  N   . LYS A 1 68  ? -4.150  42.044 24.808  1.00 11.77 ? 68  LYS A N   1 
ATOM   569  C  CA  . LYS A 1 68  ? -2.906  42.085 24.075  1.00 11.00 ? 68  LYS A CA  1 
ATOM   570  C  C   . LYS A 1 68  ? -2.199  40.728 24.078  1.00 9.82  ? 68  LYS A C   1 
ATOM   571  O  O   . LYS A 1 68  ? -1.769  40.265 23.016  1.00 10.74 ? 68  LYS A O   1 
ATOM   572  C  CB  A LYS A 1 68  ? -2.004  43.199 24.616  0.61 12.11 ? 68  LYS A CB  1 
ATOM   573  C  CB  B LYS A 1 68  ? -1.951  43.105 24.726  0.39 13.13 ? 68  LYS A CB  1 
ATOM   574  C  CG  A LYS A 1 68  ? -0.715  43.293 23.846  0.61 12.32 ? 68  LYS A CG  1 
ATOM   575  C  CG  B LYS A 1 68  ? -2.412  44.530 24.541  0.39 15.59 ? 68  LYS A CG  1 
ATOM   576  C  CD  A LYS A 1 68  ? 0.223   44.368 24.358  0.61 11.65 ? 68  LYS A CD  1 
ATOM   577  C  CD  B LYS A 1 68  ? -1.617  45.545 25.378  0.39 18.94 ? 68  LYS A CD  1 
ATOM   578  C  CE  A LYS A 1 68  ? 1.647   44.253 23.878  0.61 14.49 ? 68  LYS A CE  1 
ATOM   579  C  CE  B LYS A 1 68  ? -1.866  46.896 24.691  0.39 18.61 ? 68  LYS A CE  1 
ATOM   580  N  NZ  A LYS A 1 68  ? 2.454   45.437 24.346  0.22 17.34 ? 68  LYS A NZ  1 
ATOM   581  N  NZ  B LYS A 1 68  ? -2.642  46.597 23.427  0.39 10.42 ? 68  LYS A NZ  1 
ATOM   582  N  NZ  C LYS A 1 68  ? -1.072  47.973 25.380  0.39 13.52 ? 68  LYS A NZ  1 
ATOM   583  N  N   . THR A 1 69  ? -2.067  40.094 25.223  1.00 10.12 ? 69  THR A N   1 
ATOM   584  C  CA  . THR A 1 69  ? -1.325  38.825 25.302  1.00 9.84  ? 69  THR A CA  1 
ATOM   585  C  C   . THR A 1 69  ? -2.012  37.713 24.546  1.00 8.81  ? 69  THR A C   1 
ATOM   586  O  O   . THR A 1 69  ? -1.380  36.974 23.803  1.00 8.11  ? 69  THR A O   1 
ATOM   587  C  CB  . THR A 1 69  ? -1.089  38.417 26.767  1.00 11.33 ? 69  THR A CB  1 
ATOM   588  O  OG1 . THR A 1 69  ? -0.265  39.423 27.386  1.00 14.29 ? 69  THR A OG1 1 
ATOM   589  C  CG2 . THR A 1 69  ? -0.384  37.043 26.882  1.00 13.48 ? 69  THR A CG2 1 
ATOM   590  N  N   . VAL A 1 70  ? -3.318  37.515 24.815  1.00 9.09  ? 70  VAL A N   1 
ATOM   591  C  CA  . VAL A 1 70  ? -3.997  36.396 24.197  1.00 8.91  ? 70  VAL A CA  1 
ATOM   592  C  C   . VAL A 1 70  ? -3.973  36.516 22.674  1.00 8.08  ? 70  VAL A C   1 
ATOM   593  O  O   . VAL A 1 70  ? -3.860  35.496 21.981  1.00 7.88  ? 70  VAL A O   1 
ATOM   594  C  CB  . VAL A 1 70  ? -5.418  36.243 24.771  1.00 10.59 ? 70  VAL A CB  1 
ATOM   595  C  CG1 . VAL A 1 70  ? -6.332  37.398 24.400  1.00 12.02 ? 70  VAL A CG1 1 
ATOM   596  C  CG2 . VAL A 1 70  ? -6.037  34.908 24.339  1.00 12.15 ? 70  VAL A CG2 1 
ATOM   597  N  N   . LEU A 1 71  ? -4.081  37.727 22.154  1.00 8.42  ? 71  LEU A N   1 
ATOM   598  C  CA  . LEU A 1 71  ? -4.046  37.904 20.696  1.00 8.07  ? 71  LEU A CA  1 
ATOM   599  C  C   . LEU A 1 71  ? -2.639  37.874 20.135  1.00 7.75  ? 71  LEU A C   1 
ATOM   600  O  O   . LEU A 1 71  ? -2.413  37.317 19.074  1.00 7.69  ? 71  LEU A O   1 
ATOM   601  C  CB  . LEU A 1 71  ? -4.900  39.107 20.232  1.00 9.18  ? 71  LEU A CB  1 
ATOM   602  C  CG  . LEU A 1 71  ? -6.356  38.800 20.239  1.00 10.55 ? 71  LEU A CG  1 
ATOM   603  C  CD1 . LEU A 1 71  ? -7.207  40.079 20.141  1.00 12.63 ? 71  LEU A CD1 1 
ATOM   604  C  CD2 . LEU A 1 71  ? -6.724  37.852 19.096  1.00 11.59 ? 71  LEU A CD2 1 
ATOM   605  N  N   . ARG A 1 72  ? -1.648  38.428 20.846  1.00 7.93  ? 72  ARG A N   1 
ATOM   606  C  CA  . ARG A 1 72  ? -0.259  38.228 20.452  1.00 7.45  ? 72  ARG A CA  1 
ATOM   607  C  C   . ARG A 1 72  ? -0.010  36.729 20.223  1.00 7.23  ? 72  ARG A C   1 
ATOM   608  O  O   . ARG A 1 72  ? 0.525   36.301 19.207  1.00 7.03  ? 72  ARG A O   1 
ATOM   609  C  CB  . ARG A 1 72  ? 0.637   38.802 21.523  1.00 7.89  ? 72  ARG A CB  1 
ATOM   610  C  CG  . ARG A 1 72  ? 2.113   38.517 21.384  1.00 7.88  ? 72  ARG A CG  1 
ATOM   611  C  CD  . ARG A 1 72  ? 2.861   39.144 22.549  1.00 8.63  ? 72  ARG A CD  1 
ATOM   612  N  NE  . ARG A 1 72  ? 4.259   38.842 22.549  1.00 8.28  ? 72  ARG A NE  1 
ATOM   613  C  CZ  . ARG A 1 72  ? 5.118   39.368 23.416  1.00 8.75  ? 72  ARG A CZ  1 
ATOM   614  N  NH1 . ARG A 1 72  ? 4.705   40.262 24.304  1.00 10.65 ? 72  ARG A NH1 1 
ATOM   615  N  NH2 . ARG A 1 72  ? 6.402   39.017 23.405  1.00 9.70  ? 72  ARG A NH2 1 
ATOM   616  N  N   . ASN A 1 73  ? -0.388  35.918 21.220  1.00 6.61  ? 73  ASN A N   1 
ATOM   617  C  CA  . ASN A 1 73  ? -0.059  34.508 21.191  1.00 6.51  ? 73  ASN A CA  1 
ATOM   618  C  C   . ASN A 1 73  ? -0.848  33.777 20.102  1.00 6.48  ? 73  ASN A C   1 
ATOM   619  O  O   . ASN A 1 73  ? -0.302  32.960 19.355  1.00 6.55  ? 73  ASN A O   1 
ATOM   620  C  CB  . ASN A 1 73  ? -0.304  33.881 22.571  1.00 6.79  ? 73  ASN A CB  1 
ATOM   621  C  CG  . ASN A 1 73  ? 0.705   34.347 23.611  1.00 6.91  ? 73  ASN A CG  1 
ATOM   622  O  OD1 . ASN A 1 73  ? 1.786   34.849 23.271  1.00 7.72  ? 73  ASN A OD1 1 
ATOM   623  N  ND2 . ASN A 1 73  ? 0.341   34.156 24.873  1.00 7.70  ? 73  ASN A ND2 1 
ATOM   624  N  N   . ASN A 1 74  ? -2.171  34.027 20.021  1.00 6.42  ? 74  ASN A N   1 
ATOM   625  C  CA  . ASN A 1 74  ? -3.014  33.232 19.159  1.00 6.59  ? 74  ASN A CA  1 
ATOM   626  C  C   . ASN A 1 74  ? -3.159  33.800 17.747  1.00 6.37  ? 74  ASN A C   1 
ATOM   627  O  O   . ASN A 1 74  ? -3.161  33.035 16.779  1.00 6.59  ? 74  ASN A O   1 
ATOM   628  C  CB  . ASN A 1 74  ? -4.390  32.993 19.795  1.00 7.11  ? 74  ASN A CB  1 
ATOM   629  C  CG  . ASN A 1 74  ? -4.242  32.088 20.987  1.00 7.37  ? 74  ASN A CG  1 
ATOM   630  O  OD1 . ASN A 1 74  ? -4.068  30.863 20.786  1.00 7.85  ? 74  ASN A OD1 1 
ATOM   631  N  ND2 . ASN A 1 74  ? -4.303  32.627 22.198  1.00 8.06  ? 74  ASN A ND2 1 
ATOM   632  N  N   . ALA A 1 75  ? -3.296  35.128 17.606  1.00 6.73  ? 75  ALA A N   1 
ATOM   633  C  CA  . ALA A 1 75  ? -3.211  35.702 16.258  1.00 6.58  ? 75  ALA A CA  1 
ATOM   634  C  C   . ALA A 1 75  ? -1.794  35.539 15.710  1.00 6.42  ? 75  ALA A C   1 
ATOM   635  O  O   . ALA A 1 75  ? -1.629  35.244 14.530  1.00 6.30  ? 75  ALA A O   1 
ATOM   636  C  CB  . ALA A 1 75  ? -3.652  37.171 16.221  1.00 7.48  ? 75  ALA A CB  1 
ATOM   637  N  N   . GLY A 1 76  ? -0.767  35.684 16.562  1.00 6.35  ? 76  GLY A N   1 
ATOM   638  C  CA  . GLY A 1 76  ? 0.588   35.330 16.097  1.00 6.23  ? 76  GLY A CA  1 
ATOM   639  C  C   . GLY A 1 76  ? 0.632   33.905 15.615  1.00 5.94  ? 76  GLY A C   1 
ATOM   640  O  O   . GLY A 1 76  ? 1.145   33.604 14.537  1.00 6.18  ? 76  GLY A O   1 
ATOM   641  N  N   . GLY A 1 77  ? 0.063   32.964 16.386  1.00 5.97  ? 77  GLY A N   1 
ATOM   642  C  CA  . GLY A 1 77  ? 0.082   31.586 15.943  1.00 5.98  ? 77  GLY A CA  1 
ATOM   643  C  C   . GLY A 1 77  ? -0.615  31.378 14.631  1.00 5.77  ? 77  GLY A C   1 
ATOM   644  O  O   . GLY A 1 77  ? -0.150  30.659 13.745  1.00 6.14  ? 77  GLY A O   1 
ATOM   645  N  N   . HIS A 1 78  ? -1.794  32.002 14.447  1.00 5.84  ? 78  HIS A N   1 
ATOM   646  C  CA  . HIS A 1 78  ? -2.512  31.841 13.193  1.00 5.77  ? 78  HIS A CA  1 
ATOM   647  C  C   . HIS A 1 78  ? -1.732  32.455 12.018  1.00 5.97  ? 78  HIS A C   1 
ATOM   648  O  O   . HIS A 1 78  ? -1.597  31.818 10.965  1.00 5.99  ? 78  HIS A O   1 
ATOM   649  C  CB  . HIS A 1 78  ? -3.913  32.466 13.361  1.00 5.91  ? 78  HIS A CB  1 
ATOM   650  C  CG  . HIS A 1 78  ? -4.743  32.418 12.115  1.00 6.17  ? 78  HIS A CG  1 
ATOM   651  N  ND1 . HIS A 1 78  ? -4.739  31.333 11.265  1.00 6.55  ? 78  HIS A ND1 1 
ATOM   652  C  CD2 . HIS A 1 78  ? -5.657  33.337 11.668  1.00 7.06  ? 78  HIS A CD2 1 
ATOM   653  C  CE1 . HIS A 1 78  ? -5.637  31.610 10.340  1.00 6.85  ? 78  HIS A CE1 1 
ATOM   654  N  NE2 . HIS A 1 78  ? -6.210  32.806 10.527  1.00 7.17  ? 78  HIS A NE2 1 
ATOM   655  N  N   . ALA A 1 79  ? -1.211  33.665 12.197  1.00 5.80  ? 79  ALA A N   1 
ATOM   656  C  CA  . ALA A 1 79  ? -0.438  34.269 11.114  1.00 5.92  ? 79  ALA A CA  1 
ATOM   657  C  C   . ALA A 1 79  ? 0.774   33.412 10.769  1.00 5.72  ? 79  ALA A C   1 
ATOM   658  O  O   . ALA A 1 79  ? 1.085   33.175 9.585   1.00 6.00  ? 79  ALA A O   1 
ATOM   659  C  CB  . ALA A 1 79  ? 0.036   35.667 11.518  1.00 6.52  ? 79  ALA A CB  1 
ATOM   660  N  N   . ASN A 1 80  ? 1.504   32.976 11.795  1.00 5.70  ? 80  ASN A N   1 
ATOM   661  C  CA  . ASN A 1 80  ? 2.767   32.265 11.514  1.00 5.59  ? 80  ASN A CA  1 
ATOM   662  C  C   . ASN A 1 80  ? 2.513   30.949 10.815  1.00 5.66  ? 80  ASN A C   1 
ATOM   663  O  O   . ASN A 1 80  ? 3.247   30.594 9.874   1.00 5.85  ? 80  ASN A O   1 
ATOM   664  C  CB  . ASN A 1 80  ? 3.536   32.039 12.820  1.00 5.61  ? 80  ASN A CB  1 
ATOM   665  C  CG  . ASN A 1 80  ? 4.023   33.327 13.464  1.00 5.96  ? 80  ASN A CG  1 
ATOM   666  O  OD1 . ASN A 1 80  ? 4.091   34.366 12.840  1.00 6.57  ? 80  ASN A OD1 1 
ATOM   667  N  ND2 . ASN A 1 80  ? 4.383   33.178 14.743  1.00 7.26  ? 80  ASN A ND2 1 
ATOM   668  N  N   . HIS A 1 81  ? 1.521   30.165 11.277  1.00 5.53  ? 81  HIS A N   1 
ATOM   669  C  CA  . HIS A 1 81  ? 1.252   28.912 10.625  1.00 5.31  ? 81  HIS A CA  1 
ATOM   670  C  C   . HIS A 1 81  ? 0.736   29.096 9.203   1.00 5.55  ? 81  HIS A C   1 
ATOM   671  O  O   . HIS A 1 81  ? 1.067   28.334 8.309   1.00 5.60  ? 81  HIS A O   1 
ATOM   672  C  CB  . HIS A 1 81  ? 0.279   28.026 11.443  1.00 5.85  ? 81  HIS A CB  1 
ATOM   673  C  CG  . HIS A 1 81  ? 0.931   27.522 12.662  1.00 5.69  ? 81  HIS A CG  1 
ATOM   674  N  ND1 . HIS A 1 81  ? 1.084   28.257 13.805  1.00 6.00  ? 81  HIS A ND1 1 
ATOM   675  C  CD2 . HIS A 1 81  ? 1.607   26.353 12.903  1.00 6.05  ? 81  HIS A CD2 1 
ATOM   676  C  CE1 . HIS A 1 81  ? 1.810   27.551 14.663  1.00 6.25  ? 81  HIS A CE1 1 
ATOM   677  N  NE2 . HIS A 1 81  ? 2.152   26.386 14.167  1.00 6.21  ? 81  HIS A NE2 1 
ATOM   678  N  N   . SER A 1 82  ? -0.101  30.130 8.992   1.00 5.47  ? 82  SER A N   1 
ATOM   679  C  CA  . SER A 1 82  ? -0.607  30.397 7.657   1.00 5.64  ? 82  SER A CA  1 
ATOM   680  C  C   . SER A 1 82  ? 0.547   30.639 6.672   1.00 5.56  ? 82  SER A C   1 
ATOM   681  O  O   . SER A 1 82  ? 0.530   30.161 5.530   1.00 6.05  ? 82  SER A O   1 
ATOM   682  C  CB  . SER A 1 82  ? -1.591  31.577 7.702   1.00 5.98  ? 82  SER A CB  1 
ATOM   683  O  OG  . SER A 1 82  ? -2.741  31.241 8.464   1.00 6.43  ? 82  SER A OG  1 
ATOM   684  N  N   . LEU A 1 83  ? 1.550   31.416 7.133   1.00 5.53  ? 83  LEU A N   1 
ATOM   685  C  CA  . LEU A 1 83  ? 2.735   31.669 6.333   1.00 5.70  ? 83  LEU A CA  1 
ATOM   686  C  C   . LEU A 1 83  ? 3.526   30.371 6.146   1.00 5.61  ? 83  LEU A C   1 
ATOM   687  O  O   . LEU A 1 83  ? 3.994   30.072 5.023   1.00 5.85  ? 83  LEU A O   1 
ATOM   688  C  CB  . LEU A 1 83  ? 3.576   32.756 7.040   1.00 6.14  ? 83  LEU A CB  1 
ATOM   689  C  CG  . LEU A 1 83  ? 4.861   33.177 6.330   1.00 7.00  ? 83  LEU A CG  1 
ATOM   690  C  CD1 . LEU A 1 83  ? 5.285   34.550 6.816   1.00 7.92  ? 83  LEU A CD1 1 
ATOM   691  C  CD2 . LEU A 1 83  ? 6.044   32.233 6.573   1.00 8.68  ? 83  LEU A CD2 1 
ATOM   692  N  N   . PHE A 1 84  ? 3.681   29.600 7.194   1.00 5.72  ? 84  PHE A N   1 
ATOM   693  C  CA  . PHE A 1 84  ? 4.484   28.372 7.117   1.00 5.70  ? 84  PHE A CA  1 
ATOM   694  C  C   . PHE A 1 84  ? 3.948   27.451 6.055   1.00 5.66  ? 84  PHE A C   1 
ATOM   695  O  O   . PHE A 1 84  ? 4.711   26.925 5.226   1.00 5.89  ? 84  PHE A O   1 
ATOM   696  C  CB  . PHE A 1 84  ? 4.502   27.720 8.506   1.00 5.98  ? 84  PHE A CB  1 
ATOM   697  C  CG  . PHE A 1 84  ? 5.473   26.561 8.675   1.00 6.21  ? 84  PHE A CG  1 
ATOM   698  C  CD1 . PHE A 1 84  ? 6.827   26.732 8.386   1.00 6.66  ? 84  PHE A CD1 1 
ATOM   699  C  CD2 . PHE A 1 84  ? 5.051   25.335 9.149   1.00 6.90  ? 84  PHE A CD2 1 
ATOM   700  C  CE1 . PHE A 1 84  ? 7.722   25.685 8.606   1.00 7.22  ? 84  PHE A CE1 1 
ATOM   701  C  CE2 . PHE A 1 84  ? 5.944   24.299 9.377   1.00 7.85  ? 84  PHE A CE2 1 
ATOM   702  C  CZ  . PHE A 1 84  ? 7.285   24.484 9.106   1.00 7.64  ? 84  PHE A CZ  1 
ATOM   703  N  N   . TRP A 1 85  ? 2.615   27.220 6.001   1.00 5.40  ? 85  TRP A N   1 
ATOM   704  C  CA  . TRP A 1 85  ? 2.134   26.261 5.035   1.00 5.53  ? 85  TRP A CA  1 
ATOM   705  C  C   . TRP A 1 85  ? 2.442   26.714 3.605   1.00 5.46  ? 85  TRP A C   1 
ATOM   706  O  O   . TRP A 1 85  ? 2.829   25.903 2.746   1.00 6.00  ? 85  TRP A O   1 
ATOM   707  C  CB  . TRP A 1 85  ? 0.621   26.018 5.128   1.00 5.68  ? 85  TRP A CB  1 
ATOM   708  C  CG  . TRP A 1 85  ? 0.152   25.679 6.518   1.00 5.62  ? 85  TRP A CG  1 
ATOM   709  C  CD1 . TRP A 1 85  ? -0.875  26.263 7.172   1.00 6.04  ? 85  TRP A CD1 1 
ATOM   710  C  CD2 . TRP A 1 85  ? 0.662   24.691 7.410   1.00 5.99  ? 85  TRP A CD2 1 
ATOM   711  N  NE1 . TRP A 1 85  ? -1.053  25.732 8.408   1.00 6.35  ? 85  TRP A NE1 1 
ATOM   712  C  CE2 . TRP A 1 85  ? -0.097  24.761 8.602   1.00 6.41  ? 85  TRP A CE2 1 
ATOM   713  C  CE3 . TRP A 1 85  ? 1.709   23.734 7.345   1.00 7.44  ? 85  TRP A CE3 1 
ATOM   714  C  CZ2 . TRP A 1 85  ? 0.128   23.952 9.702   1.00 7.95  ? 85  TRP A CZ2 1 
ATOM   715  C  CZ3 . TRP A 1 85  ? 1.948   22.933 8.444   1.00 8.94  ? 85  TRP A CZ3 1 
ATOM   716  C  CH2 . TRP A 1 85  ? 1.157   23.048 9.612   1.00 8.82  ? 85  TRP A CH2 1 
ATOM   717  N  N   . LYS A 1 86  ? 2.219   27.993 3.334   1.00 5.72  ? 86  LYS A N   1 
ATOM   718  C  CA  . LYS A 1 86  ? 2.473   28.561 2.006   1.00 5.78  ? 86  LYS A CA  1 
ATOM   719  C  C   . LYS A 1 86  ? 3.957   28.522 1.677   1.00 5.83  ? 86  LYS A C   1 
ATOM   720  O  O   . LYS A 1 86  ? 4.337   28.544 0.483   1.00 6.46  ? 86  LYS A O   1 
ATOM   721  C  CB  . LYS A 1 86  ? 1.925   29.994 1.951   1.00 6.36  ? 86  LYS A CB  1 
ATOM   722  C  CG  . LYS A 1 86  ? 0.396   30.054 1.937   1.00 7.52  ? 86  LYS A CG  1 
ATOM   723  C  CD  . LYS A 1 86  ? -0.082  31.505 2.002   1.00 8.98  ? 86  LYS A CD  1 
ATOM   724  C  CE  . LYS A 1 86  ? -1.563  31.679 1.715   1.00 11.00 ? 86  LYS A CE  1 
ATOM   725  N  NZ  . LYS A 1 86  ? -1.979  33.112 1.814   1.00 13.40 ? 86  LYS A NZ  1 
ATOM   726  N  N   . GLY A 1 87  ? 4.789   28.497 2.697   1.00 5.92  ? 87  GLY A N   1 
ATOM   727  C  CA  . GLY A 1 87  ? 6.203   28.597 2.567   1.00 6.22  ? 87  GLY A CA  1 
ATOM   728  C  C   . GLY A 1 87  ? 6.941   27.262 2.448   1.00 6.22  ? 87  GLY A C   1 
ATOM   729  O  O   . GLY A 1 87  ? 8.176   27.284 2.530   1.00 6.76  ? 87  GLY A O   1 
ATOM   730  N  N   . LEU A 1 88  ? 6.210   26.171 2.172   1.00 6.01  ? 88  LEU A N   1 
ATOM   731  C  CA  . LEU A 1 88  ? 6.754   24.833 1.998   1.00 6.25  ? 88  LEU A CA  1 
ATOM   732  C  C   . LEU A 1 88  ? 6.328   24.303 0.652   1.00 6.06  ? 88  LEU A C   1 
ATOM   733  O  O   . LEU A 1 88  ? 5.161   24.479 0.260   1.00 6.86  ? 88  LEU A O   1 
ATOM   734  C  CB  . LEU A 1 88  ? 6.280   23.893 3.106   1.00 6.22  ? 88  LEU A CB  1 
ATOM   735  C  CG  . LEU A 1 88  ? 6.664   24.320 4.532   1.00 6.43  ? 88  LEU A CG  1 
ATOM   736  C  CD1 . LEU A 1 88  ? 5.867   23.525 5.557   1.00 7.60  ? 88  LEU A CD1 1 
ATOM   737  C  CD2 . LEU A 1 88  ? 8.150   24.227 4.761   1.00 7.58  ? 88  LEU A CD2 1 
ATOM   738  N  N   . LYS A 1 89  ? 7.255   23.633 -0.068  1.00 6.03  ? 89  LYS A N   1 
ATOM   739  C  CA  . LYS A 1 89  ? 6.994   22.991 -1.338  1.00 6.19  ? 89  LYS A CA  1 
ATOM   740  C  C   . LYS A 1 89  ? 8.287   22.256 -1.727  1.00 6.34  ? 89  LYS A C   1 
ATOM   741  O  O   . LYS A 1 89  ? 9.363   22.823 -1.517  1.00 7.27  ? 89  LYS A O   1 
ATOM   742  C  CB  . LYS A 1 89  ? 6.632   23.980 -2.453  1.00 6.34  ? 89  LYS A CB  1 
ATOM   743  C  CG  . LYS A 1 89  ? 5.964   23.336 -3.643  1.00 7.06  ? 89  LYS A CG  1 
ATOM   744  C  CD  . LYS A 1 89  ? 5.382   24.333 -4.646  1.00 7.14  ? 89  LYS A CD  1 
ATOM   745  C  CE  . LYS A 1 89  ? 6.469   25.129 -5.351  1.00 7.05  ? 89  LYS A CE  1 
ATOM   746  N  NZ  . LYS A 1 89  ? 5.912   25.965 -6.440  1.00 7.90  ? 89  LYS A NZ  1 
ATOM   747  N  N   . LYS A 1 90  ? 8.176   21.087 -2.348  1.00 6.39  ? 90  LYS A N   1 
ATOM   748  C  CA  . LYS A 1 90  ? 9.337   20.418 -2.924  1.00 6.52  ? 90  LYS A CA  1 
ATOM   749  C  C   . LYS A 1 90  ? 9.632   20.923 -4.331  1.00 6.70  ? 90  LYS A C   1 
ATOM   750  O  O   . LYS A 1 90  ? 8.753   21.401 -5.040  1.00 7.52  ? 90  LYS A O   1 
ATOM   751  C  CB  . LYS A 1 90  ? 9.093   18.908 -2.997  1.00 6.93  ? 90  LYS A CB  1 
ATOM   752  C  CG  . LYS A 1 90  ? 9.084   18.225 -1.627  1.00 7.02  ? 90  LYS A CG  1 
ATOM   753  C  CD  . LYS A 1 90  ? 8.711   16.756 -1.718  1.00 6.84  ? 90  LYS A CD  1 
ATOM   754  C  CE  . LYS A 1 90  ? 9.715   15.914 -2.473  1.00 7.15  ? 90  LYS A CE  1 
ATOM   755  N  NZ  . LYS A 1 90  ? 9.211   14.491 -2.603  1.00 7.62  ? 90  LYS A NZ  1 
ATOM   756  N  N   . GLY A 1 91  ? 10.891  20.741 -4.748  1.00 7.27  ? 91  GLY A N   1 
ATOM   757  C  CA  . GLY A 1 91  ? 11.275  20.888 -6.149  1.00 7.82  ? 91  GLY A CA  1 
ATOM   758  C  C   . GLY A 1 91  ? 11.575  22.296 -6.587  1.00 7.92  ? 91  GLY A C   1 
ATOM   759  O  O   . GLY A 1 91  ? 11.780  22.503 -7.792  1.00 9.60  ? 91  GLY A O   1 
ATOM   760  N  N   . THR A 1 92  ? 11.638  23.256 -5.668  1.00 7.10  ? 92  THR A N   1 
ATOM   761  C  CA  . THR A 1 92  ? 11.971  24.615 -6.040  1.00 7.21  ? 92  THR A CA  1 
ATOM   762  C  C   . THR A 1 92  ? 13.489  24.827 -6.065  1.00 7.31  ? 92  THR A C   1 
ATOM   763  O  O   . THR A 1 92  ? 14.250  24.066 -5.474  1.00 8.35  ? 92  THR A O   1 
ATOM   764  C  CB  . THR A 1 92  ? 11.330  25.645 -5.076  1.00 6.81  ? 92  THR A CB  1 
ATOM   765  O  OG1 . THR A 1 92  ? 11.993  25.720 -3.814  1.00 6.74  ? 92  THR A OG1 1 
ATOM   766  C  CG2 . THR A 1 92  ? 9.836   25.384 -4.919  1.00 7.08  ? 92  THR A CG2 1 
ATOM   767  N  N   . THR A 1 93  ? 13.892  25.902 -6.750  1.00 7.96  ? 93  THR A N   1 
ATOM   768  C  CA  . THR A 1 93  ? 15.276  26.306 -6.851  1.00 9.19  ? 93  THR A CA  1 
ATOM   769  C  C   . THR A 1 93  ? 15.387  27.772 -6.482  1.00 8.51  ? 93  THR A C   1 
ATOM   770  O  O   . THR A 1 93  ? 14.709  28.608 -7.132  1.00 8.78  ? 93  THR A O   1 
ATOM   771  C  CB  . THR A 1 93  ? 15.771  26.095 -8.322  1.00 12.83 ? 93  THR A CB  1 
ATOM   772  O  OG1 . THR A 1 93  ? 15.650  24.693 -8.631  1.00 15.54 ? 93  THR A OG1 1 
ATOM   773  C  CG2 . THR A 1 93  ? 17.208  26.510 -8.514  1.00 14.28 ? 93  THR A CG2 1 
ATOM   774  N  N   . LEU A 1 94  ? 16.233  28.113 -5.538  1.00 8.12  ? 94  LEU A N   1 
ATOM   775  C  CA  . LEU A 1 94  ? 16.514  29.511 -5.233  1.00 7.72  ? 94  LEU A CA  1 
ATOM   776  C  C   . LEU A 1 94  ? 17.184  30.144 -6.453  1.00 7.80  ? 94  LEU A C   1 
ATOM   777  O  O   . LEU A 1 94  ? 18.168  29.601 -6.982  1.00 8.83  ? 94  LEU A O   1 
ATOM   778  C  CB  . LEU A 1 94  ? 17.411  29.569 -4.015  1.00 8.46  ? 94  LEU A CB  1 
ATOM   779  C  CG  . LEU A 1 94  ? 17.935  30.957 -3.605  1.00 8.48  ? 94  LEU A CG  1 
ATOM   780  C  CD1 . LEU A 1 94  ? 16.805  31.976 -3.407  1.00 8.18  ? 94  LEU A CD1 1 
ATOM   781  C  CD2 . LEU A 1 94  ? 18.787  30.821 -2.379  1.00 10.13 ? 94  LEU A CD2 1 
ATOM   782  N  N   . GLN A 1 95  ? 16.657  31.248 -6.936  1.00 7.46  ? 95  GLN A N   1 
ATOM   783  C  CA  . GLN A 1 95  ? 17.081  31.805 -8.199  1.00 8.04  ? 95  GLN A CA  1 
ATOM   784  C  C   . GLN A 1 95  ? 16.709  33.284 -8.276  1.00 7.67  ? 95  GLN A C   1 
ATOM   785  O  O   . GLN A 1 95  ? 16.043  33.845 -7.400  1.00 8.27  ? 95  GLN A O   1 
ATOM   786  C  CB  . GLN A 1 95  ? 16.494  31.029 -9.355  1.00 9.17  ? 95  GLN A CB  1 
ATOM   787  C  CG  . GLN A 1 95  ? 15.013  31.036 -9.412  1.00 9.78  ? 95  GLN A CG  1 
ATOM   788  C  CD  . GLN A 1 95  ? 14.499  30.100 -10.469 1.00 12.22 ? 95  GLN A CD  1 
ATOM   789  O  OE1 . GLN A 1 95  ? 13.996  28.983 -10.198 1.00 15.78 ? 95  GLN A OE1 1 
ATOM   790  N  NE2 . GLN A 1 95  ? 14.649  30.485 -11.701 1.00 16.16 ? 95  GLN A NE2 1 
ATOM   791  N  N   . GLY A 1 96  ? 17.151  33.916 -9.358  1.00 8.61  ? 96  GLY A N   1 
ATOM   792  C  CA  . GLY A 1 96  ? 16.626  35.235 -9.689  1.00 9.37  ? 96  GLY A CA  1 
ATOM   793  C  C   . GLY A 1 96  ? 16.965  36.304 -8.706  1.00 8.23  ? 96  GLY A C   1 
ATOM   794  O  O   . GLY A 1 96  ? 18.050  36.301 -8.064  1.00 8.29  ? 96  GLY A O   1 
ATOM   795  N  N   . ASP A 1 97  ? 16.052  37.266 -8.548  1.00 7.98  ? 97  ASP A N   1 
ATOM   796  C  CA  . ASP A 1 97  ? 16.300  38.423 -7.710  1.00 8.26  ? 97  ASP A CA  1 
ATOM   797  C  C   . ASP A 1 97  ? 16.515  38.045 -6.261  1.00 7.62  ? 97  ASP A C   1 
ATOM   798  O  O   . ASP A 1 97  ? 17.339  38.676 -5.581  1.00 8.06  ? 97  ASP A O   1 
ATOM   799  C  CB  . ASP A 1 97  ? 15.130  39.397 -7.816  1.00 8.93  ? 97  ASP A CB  1 
ATOM   800  C  CG  . ASP A 1 97  ? 14.973  40.083 -9.150  1.00 9.96  ? 97  ASP A CG  1 
ATOM   801  O  OD1 . ASP A 1 97  ? 15.976  40.228 -9.844  1.00 12.05 ? 97  ASP A OD1 1 
ATOM   802  O  OD2 . ASP A 1 97  ? 13.845  40.536 -9.443  1.00 13.69 ? 97  ASP A OD2 1 
ATOM   803  N  N   . LEU A 1 98  ? 15.765  37.062 -5.761  1.00 7.16  ? 98  LEU A N   1 
ATOM   804  C  CA  . LEU A 1 98  ? 15.927  36.723 -4.354  1.00 6.95  ? 98  LEU A CA  1 
ATOM   805  C  C   . LEU A 1 98  ? 17.288  36.094 -4.129  1.00 6.76  ? 98  LEU A C   1 
ATOM   806  O  O   . LEU A 1 98  ? 17.973  36.416 -3.134  1.00 7.40  ? 98  LEU A O   1 
ATOM   807  C  CB  . LEU A 1 98  ? 14.808  35.769 -3.891  1.00 7.19  ? 98  LEU A CB  1 
ATOM   808  C  CG  . LEU A 1 98  ? 14.942  35.302 -2.448  1.00 7.10  ? 98  LEU A CG  1 
ATOM   809  C  CD1 . LEU A 1 98  ? 14.957  36.447 -1.455  1.00 8.11  ? 98  LEU A CD1 1 
ATOM   810  C  CD2 . LEU A 1 98  ? 13.803  34.328 -2.123  1.00 8.23  ? 98  LEU A CD2 1 
ATOM   811  N  N   . LYS A 1 99  ? 17.740  35.217 -5.008  1.00 7.10  ? 99  LYS A N   1 
ATOM   812  C  CA  . LYS A 1 99  ? 19.082  34.649 -4.859  1.00 7.39  ? 99  LYS A CA  1 
ATOM   813  C  C   . LYS A 1 99  ? 20.118  35.747 -4.850  1.00 7.67  ? 99  LYS A C   1 
ATOM   814  O  O   . LYS A 1 99  ? 21.045  35.767 -4.033  1.00 8.14  ? 99  LYS A O   1 
ATOM   815  C  CB  . LYS A 1 99  ? 19.357  33.627 -5.967  0.88 7.13  ? 99  LYS A CB  1 
ATOM   816  C  CG  . LYS A 1 99  ? 20.721  32.923 -5.788  0.88 8.59  ? 99  LYS A CG  1 
ATOM   817  C  CD  . LYS A 1 99  ? 20.929  31.840 -6.835  0.88 9.23  ? 99  LYS A CD  1 
ATOM   818  C  CE  A LYS A 1 99  ? 22.215  31.089 -6.706  0.88 13.59 ? 99  LYS A CE  1 
ATOM   819  C  CE  B LYS A 1 99  ? 22.250  31.117 -6.604  0.12 8.40  ? 99  LYS A CE  1 
ATOM   820  N  NZ  A LYS A 1 99  ? 22.417  30.061 -7.762  0.88 14.52 ? 99  LYS A NZ  1 
ATOM   821  N  NZ  B LYS A 1 99  ? 23.388  32.016 -6.983  0.12 12.36 ? 99  LYS A NZ  1 
ATOM   822  N  N   . ALA A 1 100 ? 19.980  36.691 -5.823  1.00 8.03  ? 100 ALA A N   1 
ATOM   823  C  CA  . ALA A 1 100 ? 20.977  37.780 -5.888  1.00 8.50  ? 100 ALA A CA  1 
ATOM   824  C  C   . ALA A 1 100 ? 20.935  38.640 -4.647  1.00 8.46  ? 100 ALA A C   1 
ATOM   825  O  O   . ALA A 1 100 ? 22.020  39.061 -4.161  1.00 9.24  ? 100 ALA A O   1 
ATOM   826  C  CB  . ALA A 1 100 ? 20.699  38.628 -7.125  1.00 10.20 ? 100 ALA A CB  1 
ATOM   827  N  N   . ALA A 1 101 ? 19.784  38.888 -4.067  1.00 7.97  ? 101 ALA A N   1 
ATOM   828  C  CA  . ALA A 1 101 ? 19.708  39.693 -2.854  1.00 8.56  ? 101 ALA A CA  1 
ATOM   829  C  C   . ALA A 1 101 ? 20.312  38.975 -1.662  1.00 8.48  ? 101 ALA A C   1 
ATOM   830  O  O   . ALA A 1 101 ? 20.985  39.572 -0.812  1.00 9.54  ? 101 ALA A O   1 
ATOM   831  C  CB  . ALA A 1 101 ? 18.257  40.078 -2.607  1.00 9.60  ? 101 ALA A CB  1 
ATOM   832  N  N   . ILE A 1 102 ? 20.104  37.653 -1.560  1.00 8.19  ? 102 ILE A N   1 
ATOM   833  C  CA  . ILE A 1 102 ? 20.736  36.872 -0.522  1.00 8.14  ? 102 ILE A CA  1 
ATOM   834  C  C   . ILE A 1 102 ? 22.271  36.933 -0.666  1.00 8.94  ? 102 ILE A C   1 
ATOM   835  O  O   . ILE A 1 102 ? 23.000  37.108 0.309   1.00 10.38 ? 102 ILE A O   1 
ATOM   836  C  CB  . ILE A 1 102 ? 20.198  35.428 -0.519  1.00 7.97  ? 102 ILE A CB  1 
ATOM   837  C  CG1 . ILE A 1 102 ? 18.749  35.406 0.020   1.00 8.23  ? 102 ILE A CG1 1 
ATOM   838  C  CG2 . ILE A 1 102 ? 21.076  34.469 0.250   1.00 9.77  ? 102 ILE A CG2 1 
ATOM   839  C  CD1 . ILE A 1 102 ? 18.039  34.098 -0.084  1.00 8.48  ? 102 ILE A CD1 1 
ATOM   840  N  N   . GLU A 1 103 ? 22.739  36.779 -1.895  1.00 9.33  ? 103 GLU A N   1 
ATOM   841  C  CA  . GLU A 1 103 ? 24.207  36.842 -2.116  1.00 10.51 ? 103 GLU A CA  1 
ATOM   842  C  C   . GLU A 1 103 ? 24.740  38.211 -1.745  1.00 11.65 ? 103 GLU A C   1 
ATOM   843  O  O   . GLU A 1 103 ? 25.812  38.362 -1.174  1.00 13.51 ? 103 GLU A O   1 
ATOM   844  C  CB  . GLU A 1 103 ? 24.507  36.478 -3.585  1.00 12.36 ? 103 GLU A CB  1 
ATOM   845  C  CG  . GLU A 1 103 ? 24.251  34.997 -3.845  1.00 12.40 ? 103 GLU A CG  1 
ATOM   846  C  CD  . GLU A 1 103 ? 24.276  34.515 -5.263  1.00 14.24 ? 103 GLU A CD  1 
ATOM   847  O  OE1 . GLU A 1 103 ? 23.923  35.313 -6.173  1.00 16.57 ? 103 GLU A OE1 1 
ATOM   848  O  OE2 . GLU A 1 103 ? 24.602  33.339 -5.511  1.00 17.44 ? 103 GLU A OE2 1 
ATOM   849  N  N   . ARG A 1 104 ? 23.972  39.256 -2.098  1.00 11.20 ? 104 ARG A N   1 
ATOM   850  C  CA  . ARG A 1 104 ? 24.372  40.617 -1.752  1.00 11.78 ? 104 ARG A CA  1 
ATOM   851  C  C   . ARG A 1 104 ? 24.457  40.858 -0.274  1.00 12.87 ? 104 ARG A C   1 
ATOM   852  O  O   . ARG A 1 104 ? 25.420  41.459 0.239   1.00 14.88 ? 104 ARG A O   1 
ATOM   853  C  CB  . ARG A 1 104 ? 23.341  41.563 -2.371  1.00 11.92 ? 104 ARG A CB  1 
ATOM   854  C  CG  . ARG A 1 104 ? 23.576  43.029 -2.092  1.00 13.20 ? 104 ARG A CG  1 
ATOM   855  C  CD  . ARG A 1 104 ? 22.360  43.845 -2.496  1.00 13.26 ? 104 ARG A CD  1 
ATOM   856  N  NE  . ARG A 1 104 ? 21.239  43.544 -1.561  1.00 12.47 ? 104 ARG A NE  1 
ATOM   857  C  CZ  . ARG A 1 104 ? 19.966  43.709 -1.868  1.00 12.67 ? 104 ARG A CZ  1 
ATOM   858  N  NH1 . ARG A 1 104 ? 19.567  44.186 -3.042  1.00 16.89 ? 104 ARG A NH1 1 
ATOM   859  N  NH2 . ARG A 1 104 ? 19.021  43.353 -0.944  1.00 13.36 ? 104 ARG A NH2 1 
ATOM   860  N  N   . ASP A 1 105 ? 23.446  40.412 0.478   1.00 10.88 ? 105 ASP A N   1 
ATOM   861  C  CA  . ASP A 1 105 ? 23.297  40.806 1.881   1.00 12.12 ? 105 ASP A CA  1 
ATOM   862  C  C   . ASP A 1 105 ? 24.036  39.846 2.824   1.00 13.01 ? 105 ASP A C   1 
ATOM   863  O  O   . ASP A 1 105 ? 24.319  40.304 3.926   1.00 16.19 ? 105 ASP A O   1 
ATOM   864  C  CB  . ASP A 1 105 ? 21.832  40.970 2.224   1.00 11.56 ? 105 ASP A CB  1 
ATOM   865  C  CG  . ASP A 1 105 ? 21.191  42.132 1.544   1.00 11.70 ? 105 ASP A CG  1 
ATOM   866  O  OD1 . ASP A 1 105 ? 21.921  43.053 1.095   1.00 13.11 ? 105 ASP A OD1 1 
ATOM   867  O  OD2 . ASP A 1 105 ? 19.939  42.164 1.491   1.00 11.74 ? 105 ASP A OD2 1 
ATOM   868  N  N   . PHE A 1 106 ? 24.332  38.641 2.403   1.00 12.83 ? 106 PHE A N   1 
ATOM   869  C  CA  . PHE A 1 106 ? 25.026  37.678 3.198   1.00 13.99 ? 106 PHE A CA  1 
ATOM   870  C  C   . PHE A 1 106 ? 26.355  37.219 2.618   1.00 15.53 ? 106 PHE A C   1 
ATOM   871  O  O   . PHE A 1 106 ? 27.067  36.474 3.255   1.00 18.11 ? 106 PHE A O   1 
ATOM   872  C  CB  . PHE A 1 106 ? 24.175  36.414 3.452   1.00 13.06 ? 106 PHE A CB  1 
ATOM   873  C  CG  . PHE A 1 106 ? 22.860  36.731 4.138   1.00 11.32 ? 106 PHE A CG  1 
ATOM   874  C  CD1 . PHE A 1 106 ? 22.779  36.733 5.518   1.00 12.77 ? 106 PHE A CD1 1 
ATOM   875  C  CD2 . PHE A 1 106 ? 21.719  36.987 3.430   1.00 10.36 ? 106 PHE A CD2 1 
ATOM   876  C  CE1 . PHE A 1 106 ? 21.582  37.012 6.161   1.00 12.41 ? 106 PHE A CE1 1 
ATOM   877  C  CE2 . PHE A 1 106 ? 20.533  37.290 4.065   1.00 10.61 ? 106 PHE A CE2 1 
ATOM   878  C  CZ  . PHE A 1 106 ? 20.468  37.286 5.436   1.00 10.84 ? 106 PHE A CZ  1 
ATOM   879  N  N   . GLY A 1 107 ? 26.671  37.625 1.403   1.00 16.66 ? 107 GLY A N   1 
ATOM   880  C  CA  . GLY A 1 107 ? 27.922  37.270 0.746   1.00 18.22 ? 107 GLY A CA  1 
ATOM   881  C  C   . GLY A 1 107 ? 27.780  36.064 -0.165  1.00 17.65 ? 107 GLY A C   1 
ATOM   882  O  O   . GLY A 1 107 ? 28.429  35.996 -1.217  1.00 18.83 ? 107 GLY A O   1 
ATOM   883  N  N   . SER A 1 108 ? 26.982  35.074 0.238   1.00 17.22 ? 108 SER A N   1 
ATOM   884  C  CA  . SER A 1 108 ? 26.763  33.863 -0.531  1.00 16.40 ? 108 SER A CA  1 
ATOM   885  C  C   . SER A 1 108 ? 25.517  33.176 0.011   1.00 14.91 ? 108 SER A C   1 
ATOM   886  O  O   . SER A 1 108 ? 25.104  33.446 1.148   1.00 13.88 ? 108 SER A O   1 
ATOM   887  C  CB  . SER A 1 108 ? 27.923  32.856 -0.469  1.00 19.02 ? 108 SER A CB  1 
ATOM   888  O  OG  . SER A 1 108 ? 28.006  32.321 0.851   1.00 17.24 ? 108 SER A OG  1 
ATOM   889  N  N   . VAL A 1 109 ? 24.927  32.307 -0.797  1.00 14.66 ? 109 VAL A N   1 
ATOM   890  C  CA  . VAL A 1 109 ? 23.833  31.504 -0.297  1.00 14.41 ? 109 VAL A CA  1 
ATOM   891  C  C   . VAL A 1 109 ? 24.239  30.613 0.865   1.00 14.48 ? 109 VAL A C   1 
ATOM   892  O  O   . VAL A 1 109 ? 23.538  30.514 1.879   1.00 13.27 ? 109 VAL A O   1 
ATOM   893  C  CB  . VAL A 1 109 ? 23.196  30.665 -1.402  1.00 14.06 ? 109 VAL A CB  1 
ATOM   894  C  CG1 . VAL A 1 109 ? 22.147  29.741 -0.839  1.00 13.94 ? 109 VAL A CG1 1 
ATOM   895  C  CG2 . VAL A 1 109 ? 22.588  31.576 -2.474  1.00 13.81 ? 109 VAL A CG2 1 
ATOM   896  N  N   . ASP A 1 110 ? 25.450  30.020 0.797   1.00 15.97 ? 110 ASP A N   1 
ATOM   897  C  CA  . ASP A 1 110 ? 25.828  29.154 1.903   1.00 17.40 ? 110 ASP A CA  1 
ATOM   898  C  C   . ASP A 1 110 ? 26.051  29.940 3.179   1.00 15.73 ? 110 ASP A C   1 
ATOM   899  O  O   . ASP A 1 110 ? 25.733  29.410 4.261   1.00 15.47 ? 110 ASP A O   1 
ATOM   900  C  CB  A ASP A 1 110 ? 27.175  28.453 1.649   0.69 21.20 ? 110 ASP A CB  1 
ATOM   901  C  CB  B ASP A 1 110 ? 27.044  28.290 1.508   0.31 18.34 ? 110 ASP A CB  1 
ATOM   902  C  CG  A ASP A 1 110 ? 26.881  27.328 0.684   0.69 23.38 ? 110 ASP A CG  1 
ATOM   903  C  CG  B ASP A 1 110 ? 27.523  27.229 2.469   0.31 21.61 ? 110 ASP A CG  1 
ATOM   904  O  OD1 A ASP A 1 110 ? 25.694  26.985 0.513   0.69 21.05 ? 110 ASP A OD1 1 
ATOM   905  O  OD1 B ASP A 1 110 ? 26.995  26.089 2.552   0.31 24.30 ? 110 ASP A OD1 1 
ATOM   906  O  OD2 A ASP A 1 110 ? 27.870  26.843 0.130   0.69 29.52 ? 110 ASP A OD2 1 
ATOM   907  O  OD2 B ASP A 1 110 ? 28.513  27.455 3.206   0.31 26.53 ? 110 ASP A OD2 1 
ATOM   908  N  N   . ASN A 1 111 ? 26.563  31.172 3.126   1.00 15.89 ? 111 ASN A N   1 
ATOM   909  C  CA  . ASN A 1 111 ? 26.691  31.960 4.305   1.00 16.07 ? 111 ASN A CA  1 
ATOM   910  C  C   . ASN A 1 111 ? 25.300  32.223 4.913   1.00 13.52 ? 111 ASN A C   1 
ATOM   911  O  O   . ASN A 1 111 ? 25.122  32.140 6.137   1.00 13.58 ? 111 ASN A O   1 
ATOM   912  C  CB  . ASN A 1 111 ? 27.332  33.335 4.056   1.00 17.61 ? 111 ASN A CB  1 
ATOM   913  C  CG  . ASN A 1 111 ? 28.785  33.403 3.694   1.00 20.62 ? 111 ASN A CG  1 
ATOM   914  O  OD1 . ASN A 1 111 ? 29.299  34.430 3.204   1.00 23.91 ? 111 ASN A OD1 1 
ATOM   915  N  ND2 . ASN A 1 111 ? 29.431  32.270 3.881   1.00 22.86 ? 111 ASN A ND2 1 
ATOM   916  N  N   . PHE A 1 112 ? 24.338  32.579 4.087   1.00 12.49 ? 112 PHE A N   1 
ATOM   917  C  CA  . PHE A 1 112 ? 22.958  32.764 4.561   1.00 10.93 ? 112 PHE A CA  1 
ATOM   918  C  C   . PHE A 1 112 ? 22.457  31.489 5.211   1.00 10.47 ? 112 PHE A C   1 
ATOM   919  O  O   . PHE A 1 112 ? 21.855  31.534 6.296   1.00 9.94  ? 112 PHE A O   1 
ATOM   920  C  CB  . PHE A 1 112 ? 22.071  33.210 3.374   1.00 10.34 ? 112 PHE A CB  1 
ATOM   921  C  CG  . PHE A 1 112 ? 20.636  32.792 3.601   1.00 8.81  ? 112 PHE A CG  1 
ATOM   922  C  CD1 . PHE A 1 112 ? 19.832  33.453 4.522   1.00 9.68  ? 112 PHE A CD1 1 
ATOM   923  C  CD2 . PHE A 1 112 ? 20.090  31.718 2.953   1.00 10.25 ? 112 PHE A CD2 1 
ATOM   924  C  CE1 . PHE A 1 112 ? 18.555  32.973 4.798   1.00 10.66 ? 112 PHE A CE1 1 
ATOM   925  C  CE2 . PHE A 1 112 ? 18.867  31.235 3.192   1.00 11.78 ? 112 PHE A CE2 1 
ATOM   926  C  CZ  . PHE A 1 112 ? 18.127  31.843 4.161   1.00 12.67 ? 112 PHE A CZ  1 
ATOM   927  N  N   . LYS A 1 113 ? 22.626  30.336 4.578   1.00 10.88 ? 113 LYS A N   1 
ATOM   928  C  CA  . LYS A 1 113 ? 22.085  29.104 5.146   1.00 11.31 ? 113 LYS A CA  1 
ATOM   929  C  C   . LYS A 1 113 ? 22.698  28.849 6.495   1.00 10.83 ? 113 LYS A C   1 
ATOM   930  O  O   . LYS A 1 113 ? 22.009  28.417 7.420   1.00 10.79 ? 113 LYS A O   1 
ATOM   931  C  CB  . LYS A 1 113 ? 22.264  27.945 4.190   1.00 13.58 ? 113 LYS A CB  1 
ATOM   932  C  CG  . LYS A 1 113 ? 21.282  27.996 3.016   1.00 15.50 ? 113 LYS A CG  1 
ATOM   933  C  CD  . LYS A 1 113 ? 21.473  26.863 2.053   1.00 18.89 ? 113 LYS A CD  1 
ATOM   934  C  CE  . LYS A 1 113 ? 20.375  26.894 0.962   1.00 17.11 ? 113 LYS A CE  1 
ATOM   935  N  NZ  . LYS A 1 113 ? 20.855  25.916 -0.068  1.00 20.35 ? 113 LYS A NZ  1 
ATOM   936  N  N   . ALA A 1 114 ? 24.014  29.063 6.640   1.00 12.42 ? 114 ALA A N   1 
ATOM   937  C  CA  . ALA A 1 114 ? 24.662  28.847 7.921   1.00 13.06 ? 114 ALA A CA  1 
ATOM   938  C  C   . ALA A 1 114 ? 24.068  29.756 9.013   1.00 12.00 ? 114 ALA A C   1 
ATOM   939  O  O   . ALA A 1 114 ? 23.849  29.357 10.148  1.00 12.09 ? 114 ALA A O   1 
ATOM   940  C  CB  . ALA A 1 114 ? 26.178  29.094 7.815   1.00 17.54 ? 114 ALA A CB  1 
ATOM   941  N  N   . GLU A 1 115 ? 23.840  30.991 8.644   1.00 11.27 ? 115 GLU A N   1 
ATOM   942  C  CA  . GLU A 1 115 ? 23.289  31.944 9.600   1.00 11.50 ? 115 GLU A CA  1 
ATOM   943  C  C   . GLU A 1 115 ? 21.847  31.588 9.975   1.00 9.43  ? 115 GLU A C   1 
ATOM   944  O  O   . GLU A 1 115 ? 21.449  31.686 11.136  1.00 10.29 ? 115 GLU A O   1 
ATOM   945  C  CB  . GLU A 1 115 ? 23.362  33.349 9.004   1.00 12.79 ? 115 GLU A CB  1 
ATOM   946  C  CG  . GLU A 1 115 ? 22.988  34.407 9.986   1.00 13.44 ? 115 GLU A CG  1 
ATOM   947  C  CD  . GLU A 1 115 ? 23.177  35.844 9.546   1.00 13.96 ? 115 GLU A CD  1 
ATOM   948  O  OE1 . GLU A 1 115 ? 23.985  36.108 8.634   1.00 15.60 ? 115 GLU A OE1 1 
ATOM   949  O  OE2 . GLU A 1 115 ? 22.540  36.733 10.133  1.00 16.81 ? 115 GLU A OE2 1 
ATOM   950  N  N   . PHE A 1 116 ? 21.043  31.171 8.988   1.00 9.21  ? 116 PHE A N   1 
ATOM   951  C  CA  . PHE A 1 116 ? 19.685  30.748 9.272   1.00 8.10  ? 116 PHE A CA  1 
ATOM   952  C  C   . PHE A 1 116 ? 19.668  29.504 10.140  1.00 8.26  ? 116 PHE A C   1 
ATOM   953  O  O   . PHE A 1 116 ? 18.900  29.431 11.131  1.00 8.59  ? 116 PHE A O   1 
ATOM   954  C  CB  . PHE A 1 116 ? 18.937  30.523 7.932   1.00 8.14  ? 116 PHE A CB  1 
ATOM   955  C  CG  . PHE A 1 116 ? 17.464  30.256 8.149   1.00 7.40  ? 116 PHE A CG  1 
ATOM   956  C  CD1 . PHE A 1 116 ? 16.561  31.315 8.117   1.00 7.98  ? 116 PHE A CD1 1 
ATOM   957  C  CD2 . PHE A 1 116 ? 16.982  29.000 8.378   1.00 7.97  ? 116 PHE A CD2 1 
ATOM   958  C  CE1 . PHE A 1 116 ? 15.199  31.103 8.326   1.00 7.76  ? 116 PHE A CE1 1 
ATOM   959  C  CE2 . PHE A 1 116 ? 15.631  28.750 8.605   1.00 7.67  ? 116 PHE A CE2 1 
ATOM   960  C  CZ  . PHE A 1 116 ? 14.747  29.817 8.555   1.00 7.35  ? 116 PHE A CZ  1 
ATOM   961  N  N   . GLU A 1 117 ? 20.490  28.515 9.817   1.00 9.02  ? 117 GLU A N   1 
ATOM   962  C  CA  . GLU A 1 117 ? 20.549  27.317 10.665  1.00 10.00 ? 117 GLU A CA  1 
ATOM   963  C  C   . GLU A 1 117 ? 20.933  27.669 12.083  1.00 9.98  ? 117 GLU A C   1 
ATOM   964  O  O   . GLU A 1 117 ? 20.389  27.121 13.054  1.00 10.15 ? 117 GLU A O   1 
ATOM   965  C  CB  A GLU A 1 117 ? 21.480  26.253 10.088  0.53 11.63 ? 117 GLU A CB  1 
ATOM   966  C  CB  B GLU A 1 117 ? 21.586  26.334 10.149  0.47 12.94 ? 117 GLU A CB  1 
ATOM   967  C  CG  A GLU A 1 117 ? 20.982  25.483 8.902   0.53 10.18 ? 117 GLU A CG  1 
ATOM   968  C  CG  B GLU A 1 117 ? 21.310  25.865 8.743   0.47 11.02 ? 117 GLU A CG  1 
ATOM   969  C  CD  A GLU A 1 117 ? 21.662  24.209 8.484   0.53 9.92  ? 117 GLU A CD  1 
ATOM   970  C  CD  B GLU A 1 117 ? 22.485  25.130 8.171   0.47 11.71 ? 117 GLU A CD  1 
ATOM   971  O  OE1 A GLU A 1 117 ? 22.034  23.374 9.349   0.53 10.84 ? 117 GLU A OE1 1 
ATOM   972  O  OE1 B GLU A 1 117 ? 23.608  25.041 8.723   0.47 19.76 ? 117 GLU A OE1 1 
ATOM   973  O  OE2 A GLU A 1 117 ? 21.847  24.065 7.247   0.53 13.93 ? 117 GLU A OE2 1 
ATOM   974  O  OE2 B GLU A 1 117 ? 22.174  24.590 7.059   0.47 13.09 ? 117 GLU A OE2 1 
ATOM   975  N  N   . LYS A 1 118 ? 21.903  28.578 12.252  1.00 10.41 ? 118 LYS A N   1 
ATOM   976  C  CA  . LYS A 1 118 ? 22.357  28.956 13.574  1.00 11.59 ? 118 LYS A CA  1 
ATOM   977  C  C   . LYS A 1 118 ? 21.217  29.596 14.357  1.00 10.15 ? 118 LYS A C   1 
ATOM   978  O  O   . LYS A 1 118 ? 21.020  29.333 15.569  1.00 10.26 ? 118 LYS A O   1 
ATOM   979  C  CB  . LYS A 1 118 ? 23.580  29.860 13.484  1.00 14.43 ? 118 LYS A CB  1 
ATOM   980  C  CG  . LYS A 1 118 ? 24.130  30.239 14.872  1.00 18.62 ? 118 LYS A CG  1 
ATOM   981  C  CD  . LYS A 1 118 ? 25.497  30.812 14.883  1.00 33.46 ? 118 LYS A CD  1 
ATOM   982  C  CE  . LYS A 1 118 ? 25.693  31.837 15.979  1.00 40.33 ? 118 LYS A CE  1 
ATOM   983  N  NZ  . LYS A 1 118 ? 26.243  31.327 17.263  1.00 57.31 ? 118 LYS A NZ  1 
ATOM   984  N  N   . ALA A 1 119 ? 20.483  30.498 13.714  1.00 9.72  ? 119 ALA A N   1 
ATOM   985  C  CA  . ALA A 1 119 ? 19.371  31.166 14.391  1.00 9.49  ? 119 ALA A CA  1 
ATOM   986  C  C   . ALA A 1 119 ? 18.280  30.134 14.780  1.00 8.45  ? 119 ALA A C   1 
ATOM   987  O  O   . ALA A 1 119 ? 17.714  30.198 15.850  1.00 8.82  ? 119 ALA A O   1 
ATOM   988  C  CB  . ALA A 1 119 ? 18.781  32.261 13.527  1.00 10.88 ? 119 ALA A CB  1 
ATOM   989  N  N   . ALA A 1 120 ? 17.983  29.244 13.858  1.00 7.62  ? 120 ALA A N   1 
ATOM   990  C  CA  . ALA A 1 120 ? 16.958  28.239 14.086  1.00 7.31  ? 120 ALA A CA  1 
ATOM   991  C  C   . ALA A 1 120 ? 17.383  27.301 15.193  1.00 7.32  ? 120 ALA A C   1 
ATOM   992  O  O   . ALA A 1 120 ? 16.542  26.880 16.004  1.00 8.75  ? 120 ALA A O   1 
ATOM   993  C  CB  . ALA A 1 120 ? 16.676  27.459 12.824  1.00 7.87  ? 120 ALA A CB  1 
ATOM   994  N  N   . ALA A 1 121 ? 18.656  26.920 15.245  1.00 7.57  ? 121 ALA A N   1 
ATOM   995  C  CA  . ALA A 1 121 ? 19.151  25.994 16.251  1.00 7.95  ? 121 ALA A CA  1 
ATOM   996  C  C   . ALA A 1 121 ? 19.240  26.649 17.634  1.00 7.76  ? 121 ALA A C   1 
ATOM   997  O  O   . ALA A 1 121 ? 19.069  25.985 18.633  1.00 8.96  ? 121 ALA A O   1 
ATOM   998  C  CB  . ALA A 1 121 ? 20.520  25.431 15.861  1.00 9.20  ? 121 ALA A CB  1 
ATOM   999  N  N   . SER A 1 122 ? 19.543  27.949 17.662  1.00 8.02  ? 122 SER A N   1 
ATOM   1000 C  CA  . SER A 1 122 ? 19.873  28.627 18.913  1.00 8.65  ? 122 SER A CA  1 
ATOM   1001 C  C   . SER A 1 122 ? 18.662  29.285 19.587  1.00 8.43  ? 122 SER A C   1 
ATOM   1002 O  O   . SER A 1 122 ? 18.800  29.831 20.671  1.00 10.33 ? 122 SER A O   1 
ATOM   1003 C  CB  A SER A 1 122 ? 21.008  29.635 18.736  0.58 10.27 ? 122 SER A CB  1 
ATOM   1004 C  CB  B SER A 1 122 ? 20.850  29.788 18.684  0.42 10.99 ? 122 SER A CB  1 
ATOM   1005 O  OG  A SER A 1 122 ? 20.521  30.762 18.043  0.58 10.27 ? 122 SER A OG  1 
ATOM   1006 O  OG  B SER A 1 122 ? 22.000  29.356 17.988  0.42 13.08 ? 122 SER A OG  1 
ATOM   1007 N  N   . ARG A 1 123 ? 17.495  29.191 18.974  1.00 7.40  ? 123 ARG A N   1 
ATOM   1008 C  CA  . ARG A 1 123 ? 16.239  29.672 19.592  1.00 7.74  ? 123 ARG A CA  1 
ATOM   1009 C  C   . ARG A 1 123 ? 15.857  28.679 20.678  1.00 7.64  ? 123 ARG A C   1 
ATOM   1010 O  O   . ARG A 1 123 ? 15.313  27.617 20.395  1.00 9.51  ? 123 ARG A O   1 
ATOM   1011 C  CB  . ARG A 1 123 ? 15.204  29.792 18.488  1.00 8.67  ? 123 ARG A CB  1 
ATOM   1012 C  CG  . ARG A 1 123 ? 13.760  30.004 18.993  1.00 10.70 ? 123 ARG A CG  1 
ATOM   1013 C  CD  . ARG A 1 123 ? 13.601  31.028 20.079  1.00 10.39 ? 123 ARG A CD  1 
ATOM   1014 N  NE  . ARG A 1 123 ? 14.061  32.336 19.636  1.00 10.82 ? 123 ARG A NE  1 
ATOM   1015 C  CZ  . ARG A 1 123 ? 13.989  33.375 20.428  1.00 10.89 ? 123 ARG A CZ  1 
ATOM   1016 N  NH1 . ARG A 1 123 ? 13.465  33.235 21.678  1.00 11.80 ? 123 ARG A NH1 1 
ATOM   1017 N  NH2 . ARG A 1 123 ? 14.370  34.552 19.973  1.00 12.25 ? 123 ARG A NH2 1 
ATOM   1018 N  N   . PHE A 1 124 ? 16.115  29.021 21.945  1.00 7.34  ? 124 PHE A N   1 
ATOM   1019 C  CA  . PHE A 1 124 ? 15.953  28.116 23.045  1.00 6.97  ? 124 PHE A CA  1 
ATOM   1020 C  C   . PHE A 1 124 ? 14.493  28.146 23.511  1.00 7.07  ? 124 PHE A C   1 
ATOM   1021 O  O   . PHE A 1 124 ? 13.943  29.261 23.700  1.00 8.94  ? 124 PHE A O   1 
ATOM   1022 C  CB  . PHE A 1 124 ? 16.905  28.476 24.199  1.00 7.40  ? 124 PHE A CB  1 
ATOM   1023 C  CG  . PHE A 1 124 ? 16.952  27.400 25.227  1.00 7.19  ? 124 PHE A CG  1 
ATOM   1024 C  CD1 . PHE A 1 124 ? 17.696  26.232 25.003  1.00 7.66  ? 124 PHE A CD1 1 
ATOM   1025 C  CD2 . PHE A 1 124 ? 16.244  27.493 26.421  1.00 7.40  ? 124 PHE A CD2 1 
ATOM   1026 C  CE1 . PHE A 1 124 ? 17.723  25.218 25.914  1.00 7.93  ? 124 PHE A CE1 1 
ATOM   1027 C  CE2 . PHE A 1 124 ? 16.269  26.491 27.346  1.00 7.92  ? 124 PHE A CE2 1 
ATOM   1028 C  CZ  . PHE A 1 124 ? 17.003  25.347 27.090  1.00 7.89  ? 124 PHE A CZ  1 
ATOM   1029 N  N   . GLY A 1 125 ? 13.883  26.995 23.684  1.00 6.66  ? 125 GLY A N   1 
ATOM   1030 C  CA  . GLY A 1 125 ? 12.459  26.931 23.937  1.00 6.67  ? 125 GLY A CA  1 
ATOM   1031 C  C   . GLY A 1 125 ? 11.704  26.929 22.613  1.00 6.27  ? 125 GLY A C   1 
ATOM   1032 O  O   . GLY A 1 125 ? 12.180  26.422 21.600  1.00 7.21  ? 125 GLY A O   1 
ATOM   1033 N  N   . SER A 1 126 ? 10.484  27.461 22.642  1.00 6.12  ? 126 SER A N   1 
ATOM   1034 C  CA  . SER A 1 126 ? 9.621   27.483 21.462  1.00 6.10  ? 126 SER A CA  1 
ATOM   1035 C  C   . SER A 1 126 ? 9.847   28.752 20.664  1.00 6.08  ? 126 SER A C   1 
ATOM   1036 O  O   . SER A 1 126 ? 10.087  29.820 21.245  1.00 6.32  ? 126 SER A O   1 
ATOM   1037 C  CB  . SER A 1 126 ? 8.145   27.451 21.930  1.00 6.15  ? 126 SER A CB  1 
ATOM   1038 O  OG  . SER A 1 126 ? 7.847   26.317 22.696  1.00 6.71  ? 126 SER A OG  1 
ATOM   1039 N  N   . GLY A 1 127 ? 9.712   28.693 19.332  1.00 6.05  ? 127 GLY A N   1 
ATOM   1040 C  CA  . GLY A 1 127 ? 9.795   29.893 18.541  1.00 6.18  ? 127 GLY A CA  1 
ATOM   1041 C  C   . GLY A 1 127 ? 9.951   29.579 17.073  1.00 5.86  ? 127 GLY A C   1 
ATOM   1042 O  O   . GLY A 1 127 ? 9.588   28.496 16.619  1.00 6.19  ? 127 GLY A O   1 
ATOM   1043 N  N   . TRP A 1 128 ? 10.441  30.596 16.348  1.00 6.11  ? 128 TRP A N   1 
ATOM   1044 C  CA  . TRP A 1 128 ? 10.520  30.633 14.891  1.00 6.09  ? 128 TRP A CA  1 
ATOM   1045 C  C   . TRP A 1 128 ? 11.817  31.271 14.471  1.00 6.29  ? 128 TRP A C   1 
ATOM   1046 O  O   . TRP A 1 128 ? 12.302  32.203 15.114  1.00 7.09  ? 128 TRP A O   1 
ATOM   1047 C  CB  . TRP A 1 128 ? 9.346   31.499 14.309  1.00 6.31  ? 128 TRP A CB  1 
ATOM   1048 C  CG  . TRP A 1 128 ? 8.016   30.878 14.484  1.00 6.19  ? 128 TRP A CG  1 
ATOM   1049 C  CD1 . TRP A 1 128 ? 7.251   30.827 15.623  1.00 6.97  ? 128 TRP A CD1 1 
ATOM   1050 C  CD2 . TRP A 1 128 ? 7.262   30.173 13.488  1.00 6.05  ? 128 TRP A CD2 1 
ATOM   1051 N  NE1 . TRP A 1 128 ? 6.096   30.123 15.414  1.00 6.93  ? 128 TRP A NE1 1 
ATOM   1052 C  CE2 . TRP A 1 128 ? 6.068   29.727 14.100  1.00 6.50  ? 128 TRP A CE2 1 
ATOM   1053 C  CE3 . TRP A 1 128 ? 7.457   29.922 12.109  1.00 6.25  ? 128 TRP A CE3 1 
ATOM   1054 C  CZ2 . TRP A 1 128 ? 5.108   29.000 13.407  1.00 6.83  ? 128 TRP A CZ2 1 
ATOM   1055 C  CZ3 . TRP A 1 128 ? 6.485   29.218 11.426  1.00 6.66  ? 128 TRP A CZ3 1 
ATOM   1056 C  CH2 . TRP A 1 128 ? 5.321   28.768 12.070  1.00 6.93  ? 128 TRP A CH2 1 
ATOM   1057 N  N   . ALA A 1 129 ? 12.334  30.818 13.313  1.00 6.29  ? 129 ALA A N   1 
ATOM   1058 C  CA  . ALA A 1 129 ? 13.446  31.496 12.642  1.00 6.72  ? 129 ALA A CA  1 
ATOM   1059 C  C   . ALA A 1 129 ? 12.921  32.090 11.337  1.00 6.27  ? 129 ALA A C   1 
ATOM   1060 O  O   . ALA A 1 129 ? 12.108  31.456 10.656  1.00 6.92  ? 129 ALA A O   1 
ATOM   1061 C  CB  . ALA A 1 129 ? 14.584  30.518 12.371  1.00 8.16  ? 129 ALA A CB  1 
ATOM   1062 N  N   . TRP A 1 130 ? 13.424  33.250 10.954  1.00 6.20  ? 130 TRP A N   1 
ATOM   1063 C  CA  . TRP A 1 130 ? 12.889  34.002 9.852   1.00 5.92  ? 130 TRP A CA  1 
ATOM   1064 C  C   . TRP A 1 130 ? 13.990  34.571 8.950   1.00 6.26  ? 130 TRP A C   1 
ATOM   1065 O  O   . TRP A 1 130 ? 15.033  35.006 9.433   1.00 7.05  ? 130 TRP A O   1 
ATOM   1066 C  CB  . TRP A 1 130 ? 12.106  35.241 10.356  1.00 6.51  ? 130 TRP A CB  1 
ATOM   1067 C  CG  . TRP A 1 130 ? 11.067  34.945 11.373  1.00 6.28  ? 130 TRP A CG  1 
ATOM   1068 C  CD1 . TRP A 1 130 ? 11.181  35.038 12.739  1.00 6.76  ? 130 TRP A CD1 1 
ATOM   1069 C  CD2 . TRP A 1 130 ? 9.724   34.500 11.128  1.00 6.23  ? 130 TRP A CD2 1 
ATOM   1070 N  NE1 . TRP A 1 130 ? 9.992   34.698 13.346  1.00 6.54  ? 130 TRP A NE1 1 
ATOM   1071 C  CE2 . TRP A 1 130 ? 9.084   34.364 12.377  1.00 6.38  ? 130 TRP A CE2 1 
ATOM   1072 C  CE3 . TRP A 1 130 ? 9.003   34.212 9.961   1.00 6.81  ? 130 TRP A CE3 1 
ATOM   1073 C  CZ2 . TRP A 1 130 ? 7.755   33.965 12.484  1.00 7.12  ? 130 TRP A CZ2 1 
ATOM   1074 C  CZ3 . TRP A 1 130 ? 7.707   33.812 10.065  1.00 8.21  ? 130 TRP A CZ3 1 
ATOM   1075 C  CH2 . TRP A 1 130 ? 7.083   33.695 11.327  1.00 7.72  ? 130 TRP A CH2 1 
ATOM   1076 N  N   . LEU A 1 131 ? 13.679  34.619 7.649   1.00 6.05  ? 131 LEU A N   1 
ATOM   1077 C  CA  . LEU A 1 131 ? 14.370  35.492 6.704   1.00 6.27  ? 131 LEU A CA  1 
ATOM   1078 C  C   . LEU A 1 131 ? 13.432  36.700 6.527   1.00 6.01  ? 131 LEU A C   1 
ATOM   1079 O  O   . LEU A 1 131 ? 12.294  36.516 6.071   1.00 6.40  ? 131 LEU A O   1 
ATOM   1080 C  CB  . LEU A 1 131 ? 14.614  34.804 5.383   1.00 6.49  ? 131 LEU A CB  1 
ATOM   1081 C  CG  . LEU A 1 131 ? 15.169  35.680 4.280   1.00 6.86  ? 131 LEU A CG  1 
ATOM   1082 C  CD1 . LEU A 1 131 ? 16.529  36.253 4.626   1.00 8.03  ? 131 LEU A CD1 1 
ATOM   1083 C  CD2 . LEU A 1 131 ? 15.270  34.885 2.979   1.00 8.04  ? 131 LEU A CD2 1 
ATOM   1084 N  N   . VAL A 1 132 ? 13.881  37.889 6.907   1.00 6.54  ? 132 VAL A N   1 
ATOM   1085 C  CA  . VAL A 1 132 ? 13.082  39.108 6.820   1.00 6.58  ? 132 VAL A CA  1 
ATOM   1086 C  C   . VAL A 1 132 ? 13.745  40.092 5.851   1.00 7.13  ? 132 VAL A C   1 
ATOM   1087 O  O   . VAL A 1 132 ? 14.948  40.092 5.648   1.00 7.69  ? 132 VAL A O   1 
ATOM   1088 C  CB  . VAL A 1 132 ? 12.858  39.787 8.168   1.00 7.29  ? 132 VAL A CB  1 
ATOM   1089 C  CG1 . VAL A 1 132 ? 12.011  38.926 9.084   1.00 7.84  ? 132 VAL A CG1 1 
ATOM   1090 C  CG2 . VAL A 1 132 ? 14.163  40.209 8.836   1.00 8.02  ? 132 VAL A CG2 1 
ATOM   1091 N  N   . LEU A 1 133 ? 12.908  40.983 5.319   1.00 7.19  ? 133 LEU A N   1 
ATOM   1092 C  CA  . LEU A 1 133 ? 13.366  42.168 4.622   1.00 7.54  ? 133 LEU A CA  1 
ATOM   1093 C  C   . LEU A 1 133 ? 13.131  43.345 5.547   1.00 8.75  ? 133 LEU A C   1 
ATOM   1094 O  O   . LEU A 1 133 ? 12.004  43.623 5.936   1.00 9.88  ? 133 LEU A O   1 
ATOM   1095 C  CB  . LEU A 1 133 ? 12.566  42.336 3.305   1.00 8.63  ? 133 LEU A CB  1 
ATOM   1096 C  CG  . LEU A 1 133 ? 12.952  43.513 2.445   1.00 10.03 ? 133 LEU A CG  1 
ATOM   1097 C  CD1 . LEU A 1 133 ? 14.409  43.397 1.990   1.00 10.44 ? 133 LEU A CD1 1 
ATOM   1098 C  CD2 . LEU A 1 133 ? 12.058  43.586 1.212   1.00 16.06 ? 133 LEU A CD2 1 
ATOM   1099 N  N   A LYS A 1 134 ? 14.194  44.103 5.794   0.55 10.49 ? 134 LYS A N   1 
ATOM   1100 N  N   B LYS A 1 134 ? 14.221  43.963 6.009   0.45 10.80 ? 134 LYS A N   1 
ATOM   1101 C  CA  A LYS A 1 134 ? 14.050  45.376 6.481   0.55 11.68 ? 134 LYS A CA  1 
ATOM   1102 C  CA  B LYS A 1 134 ? 14.232  45.042 6.984   0.45 12.91 ? 134 LYS A CA  1 
ATOM   1103 C  C   A LYS A 1 134 ? 14.383  46.521 5.492   0.55 12.38 ? 134 LYS A C   1 
ATOM   1104 C  C   B LYS A 1 134 ? 15.145  46.149 6.459   0.45 14.47 ? 134 LYS A C   1 
ATOM   1105 O  O   A LYS A 1 134 ? 15.561  46.844 5.340   0.55 12.25 ? 134 LYS A O   1 
ATOM   1106 O  O   B LYS A 1 134 ? 16.328  45.919 6.198   0.45 12.04 ? 134 LYS A O   1 
ATOM   1107 C  CB  A LYS A 1 134 ? 14.960  45.441 7.688   0.55 12.67 ? 134 LYS A CB  1 
ATOM   1108 C  CB  B LYS A 1 134 ? 14.728  44.696 8.387   0.45 16.83 ? 134 LYS A CB  1 
ATOM   1109 C  CG  A LYS A 1 134 ? 14.896  44.195 8.565   0.55 13.24 ? 134 LYS A CG  1 
ATOM   1110 C  CG  B LYS A 1 134 ? 14.506  43.276 8.858   0.45 21.50 ? 134 LYS A CG  1 
ATOM   1111 C  CD  A LYS A 1 134 ? 15.763  44.494 9.769   0.55 17.17 ? 134 LYS A CD  1 
ATOM   1112 C  CD  B LYS A 1 134 ? 15.486  42.954 9.991   0.45 22.39 ? 134 LYS A CD  1 
ATOM   1113 C  CE  A LYS A 1 134 ? 15.939  43.379 10.735  0.55 20.65 ? 134 LYS A CE  1 
ATOM   1114 C  CE  B LYS A 1 134 ? 15.396  43.898 11.151  0.45 18.29 ? 134 LYS A CE  1 
ATOM   1115 N  NZ  A LYS A 1 134 ? 16.822  43.636 11.930  0.55 15.33 ? 134 LYS A NZ  1 
ATOM   1116 N  NZ  B LYS A 1 134 ? 16.370  43.546 12.258  0.45 27.45 ? 134 LYS A NZ  1 
ATOM   1117 N  N   A GLY A 1 135 ? 13.377  47.058 4.847   0.55 13.80 ? 135 GLY A N   1 
ATOM   1118 N  N   B GLY A 1 135 ? 14.590  47.369 6.310   0.45 15.93 ? 135 GLY A N   1 
ATOM   1119 C  CA  A GLY A 1 135 ? 13.502  48.086 3.843   0.55 14.94 ? 135 GLY A CA  1 
ATOM   1120 C  CA  B GLY A 1 135 ? 15.420  48.411 5.721   0.45 17.29 ? 135 GLY A CA  1 
ATOM   1121 C  C   A GLY A 1 135 ? 14.276  47.579 2.644   0.55 12.00 ? 135 GLY A C   1 
ATOM   1122 C  C   B GLY A 1 135 ? 16.067  48.032 4.396   0.45 14.17 ? 135 GLY A C   1 
ATOM   1123 O  O   A GLY A 1 135 ? 13.697  46.874 1.801   0.55 13.91 ? 135 GLY A O   1 
ATOM   1124 O  O   B GLY A 1 135 ? 17.207  48.357 4.141   0.45 17.11 ? 135 GLY A O   1 
ATOM   1125 N  N   A ASP A 1 136 ? 15.578  47.956 2.599   0.55 12.93 ? 136 ASP A N   1 
ATOM   1126 N  N   B ASP A 1 136 ? 15.328  47.347 3.524   0.45 15.01 ? 136 ASP A N   1 
ATOM   1127 C  CA  A ASP A 1 136 ? 16.512  47.549 1.560   0.55 15.78 ? 136 ASP A CA  1 
ATOM   1128 C  CA  B ASP A 1 136 ? 15.763  47.008 2.158   0.45 15.28 ? 136 ASP A CA  1 
ATOM   1129 C  C   A ASP A 1 136 ? 17.424  46.383 1.982   0.55 17.39 ? 136 ASP A C   1 
ATOM   1130 C  C   B ASP A 1 136 ? 17.050  46.216 1.984   0.45 17.85 ? 136 ASP A C   1 
ATOM   1131 O  O   A ASP A 1 136 ? 18.396  46.022 1.276   0.55 20.22 ? 136 ASP A O   1 
ATOM   1132 O  O   B ASP A 1 136 ? 17.800  46.092 1.016   0.45 15.71 ? 136 ASP A O   1 
ATOM   1133 C  CB  A ASP A 1 136 ? 17.272  48.821 1.121   0.55 22.45 ? 136 ASP A CB  1 
ATOM   1134 C  CB  B ASP A 1 136 ? 15.903  48.278 1.325   0.45 19.30 ? 136 ASP A CB  1 
ATOM   1135 C  CG  A ASP A 1 136 ? 16.573  49.585 -0.008  0.55 32.40 ? 136 ASP A CG  1 
ATOM   1136 C  CG  B ASP A 1 136 ? 14.527  48.745 0.866   0.45 27.35 ? 136 ASP A CG  1 
ATOM   1137 O  OD1 A ASP A 1 136 ? 15.612  49.058 -0.622  0.55 34.38 ? 136 ASP A OD1 1 
ATOM   1138 O  OD1 B ASP A 1 136 ? 13.545  48.016 1.137   0.45 27.36 ? 136 ASP A OD1 1 
ATOM   1139 O  OD2 A ASP A 1 136 ? 16.983  50.722 -0.326  0.55 41.33 ? 136 ASP A OD2 1 
ATOM   1140 O  OD2 B ASP A 1 136 ? 14.475  49.843 0.274   0.45 37.44 ? 136 ASP A OD2 1 
ATOM   1141 N  N   . LYS A 1 137 ? 17.273  45.654 3.132   1.00 14.52 ? 137 LYS A N   1 
ATOM   1142 C  CA  . LYS A 1 137 ? 18.292  44.630 3.420   1.00 12.46 ? 137 LYS A CA  1 
ATOM   1143 C  C   . LYS A 1 137 ? 17.681  43.381 4.067   1.00 11.59 ? 137 LYS A C   1 
ATOM   1144 O  O   . LYS A 1 137 ? 16.879  43.501 4.976   1.00 13.93 ? 137 LYS A O   1 
ATOM   1145 C  CB  . LYS A 1 137 ? 19.354  45.173 4.320   1.00 14.84 ? 137 LYS A CB  1 
ATOM   1146 C  CG  . LYS A 1 137 ? 20.588  44.349 4.522   1.00 15.75 ? 137 LYS A CG  1 
ATOM   1147 C  CD  . LYS A 1 137 ? 21.580  45.033 5.430   1.00 16.71 ? 137 LYS A CD  1 
ATOM   1148 C  CE  . LYS A 1 137 ? 22.767  44.130 5.685   1.00 19.92 ? 137 LYS A CE  1 
ATOM   1149 N  NZ  . LYS A 1 137 ? 23.864  44.768 6.417   1.00 29.78 ? 137 LYS A NZ  1 
ATOM   1150 N  N   . LEU A 1 138 ? 18.028  42.221 3.542   1.00 10.00 ? 138 LEU A N   1 
ATOM   1151 C  CA  . LEU A 1 138 ? 17.616  40.958 4.119   1.00 9.33  ? 138 LEU A CA  1 
ATOM   1152 C  C   . LEU A 1 138 ? 18.406  40.636 5.379   1.00 9.97  ? 138 LEU A C   1 
ATOM   1153 O  O   . LEU A 1 138 ? 19.575  40.994 5.520   1.00 12.31 ? 138 LEU A O   1 
ATOM   1154 C  CB  . LEU A 1 138 ? 17.809  39.838 3.107   1.00 9.13  ? 138 LEU A CB  1 
ATOM   1155 C  CG  . LEU A 1 138 ? 16.953  39.891 1.868   1.00 8.71  ? 138 LEU A CG  1 
ATOM   1156 C  CD1 . LEU A 1 138 ? 17.450  38.905 0.810   1.00 11.15 ? 138 LEU A CD1 1 
ATOM   1157 C  CD2 . LEU A 1 138 ? 15.489  39.613 2.189   1.00 8.96  ? 138 LEU A CD2 1 
ATOM   1158 N  N   . ALA A 1 139 ? 17.738  39.933 6.313   1.00 8.56  ? 139 ALA A N   1 
ATOM   1159 C  CA  . ALA A 1 139 ? 18.326  39.609 7.583   1.00 8.72  ? 139 ALA A CA  1 
ATOM   1160 C  C   . ALA A 1 139 ? 17.729  38.289 8.114   1.00 7.70  ? 139 ALA A C   1 
ATOM   1161 O  O   . ALA A 1 139 ? 16.591  37.956 7.753   1.00 7.89  ? 139 ALA A O   1 
ATOM   1162 C  CB  . ALA A 1 139 ? 18.105  40.706 8.625   1.00 9.65  ? 139 ALA A CB  1 
ATOM   1163 N  N   . VAL A 1 140 ? 18.486  37.616 8.970   1.00 8.22  ? 140 VAL A N   1 
ATOM   1164 C  CA  . VAL A 1 140 ? 17.994  36.455 9.692   1.00 7.95  ? 140 VAL A CA  1 
ATOM   1165 C  C   . VAL A 1 140 ? 17.711  36.892 11.117  1.00 7.81  ? 140 VAL A C   1 
ATOM   1166 O  O   . VAL A 1 140 ? 18.587  37.465 11.773  1.00 9.59  ? 140 VAL A O   1 
ATOM   1167 C  CB  . VAL A 1 140 ? 19.036  35.348 9.660   1.00 8.75  ? 140 VAL A CB  1 
ATOM   1168 C  CG1 . VAL A 1 140 ? 18.674  34.237 10.654  1.00 10.00 ? 140 VAL A CG1 1 
ATOM   1169 C  CG2 . VAL A 1 140 ? 19.159  34.783 8.241   1.00 9.73  ? 140 VAL A CG2 1 
ATOM   1170 N  N   . VAL A 1 141 ? 16.514  36.602 11.586  1.00 7.98  ? 141 VAL A N   1 
ATOM   1171 C  CA  . VAL A 1 141 ? 16.108  36.917 12.972  1.00 8.41  ? 141 VAL A CA  1 
ATOM   1172 C  C   . VAL A 1 141 ? 15.342  35.717 13.501  1.00 8.02  ? 141 VAL A C   1 
ATOM   1173 O  O   . VAL A 1 141 ? 14.897  34.847 12.780  1.00 8.47  ? 141 VAL A O   1 
ATOM   1174 C  CB  . VAL A 1 141 ? 15.288  38.220 13.048  1.00 9.55  ? 141 VAL A CB  1 
ATOM   1175 C  CG1 . VAL A 1 141 ? 16.076  39.416 12.557  1.00 11.45 ? 141 VAL A CG1 1 
ATOM   1176 C  CG2 . VAL A 1 141 ? 13.967  38.100 12.279  1.00 9.53  ? 141 VAL A CG2 1 
ATOM   1177 N  N   . SER A 1 142 ? 15.105  35.705 14.827  1.00 10.70 ? 142 SER A N   1 
ATOM   1178 C  CA  . SER A 1 142 ? 14.283  34.662 15.443  1.00 8.48  ? 142 SER A CA  1 
ATOM   1179 C  C   . SER A 1 142 ? 13.354  35.355 16.433  1.00 7.79  ? 142 SER A C   1 
ATOM   1180 O  O   . SER A 1 142 ? 13.623  36.444 16.911  1.00 8.93  ? 142 SER A O   1 
ATOM   1181 C  CB  . SER A 1 142 ? 15.014  33.454 16.071  1.00 10.33 ? 142 SER A CB  1 
ATOM   1182 O  OG  . SER A 1 142 ? 15.522  33.718 17.343  1.00 10.78 ? 142 SER A OG  1 
ATOM   1183 N  N   . THR A 1 143 ? 12.243  34.666 16.719  1.00 7.18  ? 143 THR A N   1 
ATOM   1184 C  CA  . THR A 1 143 ? 11.295  35.110 17.712  1.00 6.73  ? 143 THR A CA  1 
ATOM   1185 C  C   . THR A 1 143 ? 10.932  33.977 18.646  1.00 6.46  ? 143 THR A C   1 
ATOM   1186 O  O   . THR A 1 143 ? 11.076  32.778 18.336  1.00 6.79  ? 143 THR A O   1 
ATOM   1187 C  CB  . THR A 1 143 ? 10.004  35.659 17.052  1.00 6.99  ? 143 THR A CB  1 
ATOM   1188 O  OG1 . THR A 1 143 ? 9.464   34.626 16.219  1.00 6.92  ? 143 THR A OG1 1 
ATOM   1189 C  CG2 . THR A 1 143 ? 10.254  36.924 16.270  1.00 8.28  ? 143 THR A CG2 1 
ATOM   1190 N  N   . ALA A 1 144 ? 10.470  34.367 19.843  1.00 6.42  ? 144 ALA A N   1 
ATOM   1191 C  CA  . ALA A 1 144 ? 9.982   33.443 20.825  1.00 6.42  ? 144 ALA A CA  1 
ATOM   1192 C  C   . ALA A 1 144 ? 8.502   33.114 20.601  1.00 6.12  ? 144 ALA A C   1 
ATOM   1193 O  O   . ALA A 1 144 ? 7.717   33.963 20.181  1.00 6.76  ? 144 ALA A O   1 
ATOM   1194 C  CB  . ALA A 1 144 ? 10.106  34.073 22.222  1.00 7.16  ? 144 ALA A CB  1 
ATOM   1195 N  N   . ASN A 1 145 ? 8.130   31.898 20.974  1.00 6.09  ? 145 ASN A N   1 
ATOM   1196 C  CA  . ASN A 1 145 ? 6.740   31.481 21.075  1.00 5.81  ? 145 ASN A CA  1 
ATOM   1197 C  C   . ASN A 1 145 ? 6.044   31.716 19.756  1.00 5.57  ? 145 ASN A C   1 
ATOM   1198 O  O   . ASN A 1 145 ? 6.495   31.184 18.731  1.00 6.16  ? 145 ASN A O   1 
ATOM   1199 C  CB  . ASN A 1 145 ? 6.104   32.128 22.329  1.00 6.02  ? 145 ASN A CB  1 
ATOM   1200 C  CG  . ASN A 1 145 ? 6.945   31.779 23.538  1.00 6.40  ? 145 ASN A CG  1 
ATOM   1201 O  OD1 . ASN A 1 145 ? 7.377   30.619 23.699  1.00 6.95  ? 145 ASN A OD1 1 
ATOM   1202 N  ND2 . ASN A 1 145 ? 7.134   32.765 24.403  1.00 7.49  ? 145 ASN A ND2 1 
ATOM   1203 N  N   . GLN A 1 146 ? 4.903   32.438 19.723  1.00 5.74  ? 146 GLN A N   1 
ATOM   1204 C  CA  . GLN A 1 146 ? 4.231   32.748 18.462  1.00 5.88  ? 146 GLN A CA  1 
ATOM   1205 C  C   . GLN A 1 146 ? 4.423   34.195 18.062  1.00 5.80  ? 146 GLN A C   1 
ATOM   1206 O  O   . GLN A 1 146 ? 3.671   34.741 17.245  1.00 6.38  ? 146 GLN A O   1 
ATOM   1207 C  CB  . GLN A 1 146 ? 2.745   32.403 18.483  1.00 5.94  ? 146 GLN A CB  1 
ATOM   1208 C  CG  . GLN A 1 146 ? 2.467   30.911 18.620  1.00 6.04  ? 146 GLN A CG  1 
ATOM   1209 C  CD  . GLN A 1 146 ? 3.054   30.091 17.476  1.00 6.03  ? 146 GLN A CD  1 
ATOM   1210 O  OE1 . GLN A 1 146 ? 3.441   30.584 16.433  1.00 6.25  ? 146 GLN A OE1 1 
ATOM   1211 N  NE2 . GLN A 1 146 ? 3.120   28.761 17.718  1.00 6.43  ? 146 GLN A NE2 1 
ATOM   1212 N  N   . ASP A 1 147 ? 5.490   34.852 18.558  1.00 6.06  ? 147 ASP A N   1 
ATOM   1213 C  CA  . ASP A 1 147 ? 5.764   36.185 18.112  1.00 6.19  ? 147 ASP A CA  1 
ATOM   1214 C  C   . ASP A 1 147 ? 6.206   36.163 16.647  1.00 6.35  ? 147 ASP A C   1 
ATOM   1215 O  O   . ASP A 1 147 ? 6.779   35.172 16.163  1.00 6.95  ? 147 ASP A O   1 
ATOM   1216 C  CB  . ASP A 1 147 ? 6.822   36.843 18.987  1.00 6.70  ? 147 ASP A CB  1 
ATOM   1217 C  CG  . ASP A 1 147 ? 6.383   37.011 20.446  1.00 7.09  ? 147 ASP A CG  1 
ATOM   1218 O  OD1 . ASP A 1 147 ? 5.179   36.904 20.746  1.00 8.10  ? 147 ASP A OD1 1 
ATOM   1219 O  OD2 . ASP A 1 147 ? 7.293   37.320 21.266  1.00 8.84  ? 147 ASP A OD2 1 
ATOM   1220 N  N   . SER A 1 148 ? 5.974   37.286 15.958  1.00 6.39  ? 148 SER A N   1 
ATOM   1221 C  CA  . SER A 1 148 ? 6.357   37.464 14.574  1.00 6.53  ? 148 SER A CA  1 
ATOM   1222 C  C   . SER A 1 148 ? 7.097   38.760 14.411  1.00 6.26  ? 148 SER A C   1 
ATOM   1223 O  O   . SER A 1 148 ? 6.751   39.731 15.106  1.00 6.74  ? 148 SER A O   1 
ATOM   1224 C  CB  . SER A 1 148 ? 5.081   37.544 13.694  1.00 6.77  ? 148 SER A CB  1 
ATOM   1225 O  OG  . SER A 1 148 ? 5.387   38.027 12.411  1.00 7.37  ? 148 SER A OG  1 
ATOM   1226 N  N   . PRO A 1 149 ? 8.058   38.865 13.485  1.00 6.61  ? 149 PRO A N   1 
ATOM   1227 C  CA  . PRO A 1 149 ? 8.683   40.156 13.225  1.00 6.81  ? 149 PRO A CA  1 
ATOM   1228 C  C   . PRO A 1 149 ? 7.685   41.221 12.775  1.00 6.75  ? 149 PRO A C   1 
ATOM   1229 O  O   . PRO A 1 149 ? 7.958   42.416 12.926  1.00 7.33  ? 149 PRO A O   1 
ATOM   1230 C  CB  . PRO A 1 149 ? 9.723   39.845 12.132  1.00 7.47  ? 149 PRO A CB  1 
ATOM   1231 C  CG  . PRO A 1 149 ? 9.152   38.615 11.445  1.00 8.29  ? 149 PRO A CG  1 
ATOM   1232 C  CD  . PRO A 1 149 ? 8.557   37.813 12.564  1.00 7.08  ? 149 PRO A CD  1 
ATOM   1233 N  N   . LEU A 1 150 ? 6.527   40.818 12.237  1.00 6.87  ? 150 LEU A N   1 
ATOM   1234 C  CA  . LEU A 1 150 ? 5.505   41.813 11.883  1.00 6.81  ? 150 LEU A CA  1 
ATOM   1235 C  C   . LEU A 1 150 ? 5.027   42.568 13.122  1.00 7.28  ? 150 LEU A C   1 
ATOM   1236 O  O   . LEU A 1 150 ? 4.431   43.661 12.944  1.00 8.25  ? 150 LEU A O   1 
ATOM   1237 C  CB  . LEU A 1 150 ? 4.344   41.129 11.173  1.00 7.07  ? 150 LEU A CB  1 
ATOM   1238 C  CG  . LEU A 1 150 ? 4.662   40.673 9.744   1.00 7.73  ? 150 LEU A CG  1 
ATOM   1239 C  CD1 . LEU A 1 150 ? 3.492   39.875 9.178   1.00 9.68  ? 150 LEU A CD1 1 
ATOM   1240 C  CD2 . LEU A 1 150 ? 5.002   41.838 8.859   1.00 8.82  ? 150 LEU A CD2 1 
ATOM   1241 N  N   . MET A 1 151 ? 5.168   41.995 14.314  1.00 7.08  ? 151 MET A N   1 
ATOM   1242 C  CA  . MET A 1 151 ? 4.761   42.675 15.516  1.00 7.28  ? 151 MET A CA  1 
ATOM   1243 C  C   . MET A 1 151 ? 5.677   43.840 15.904  1.00 7.76  ? 151 MET A C   1 
ATOM   1244 O  O   . MET A 1 151 ? 5.295   44.670 16.721  1.00 9.14  ? 151 MET A O   1 
ATOM   1245 C  CB  . MET A 1 151 ? 4.698   41.708 16.690  1.00 7.28  ? 151 MET A CB  1 
ATOM   1246 C  CG  . MET A 1 151 ? 3.685   40.583 16.447  1.00 7.17  ? 151 MET A CG  1 
ATOM   1247 S  SD  . MET A 1 151 ? 3.822   39.363 17.778  1.00 7.10  ? 151 MET A SD  1 
ATOM   1248 C  CE  . MET A 1 151 ? 2.561   38.203 17.244  1.00 7.66  ? 151 MET A CE  1 
ATOM   1249 N  N   . GLY A 1 152 ? 6.888   43.880 15.318  1.00 8.22  ? 152 GLY A N   1 
ATOM   1250 C  CA  . GLY A 1 152 ? 7.826   44.931 15.603  1.00 8.68  ? 152 GLY A CA  1 
ATOM   1251 C  C   . GLY A 1 152 ? 8.754   44.625 16.752  1.00 8.46  ? 152 GLY A C   1 
ATOM   1252 O  O   . GLY A 1 152 ? 8.576   43.679 17.523  1.00 8.93  ? 152 GLY A O   1 
ATOM   1253 N  N   . GLU A 1 153 ? 9.786   45.481 16.882  1.00 9.44  ? 153 GLU A N   1 
ATOM   1254 C  CA  . GLU A 1 153 ? 10.880  45.241 17.817  1.00 9.99  ? 153 GLU A CA  1 
ATOM   1255 C  C   . GLU A 1 153 ? 10.389  45.316 19.251  1.00 10.47 ? 153 GLU A C   1 
ATOM   1256 O  O   . GLU A 1 153 ? 10.800  44.476 20.102  1.00 11.43 ? 153 GLU A O   1 
ATOM   1257 C  CB  . GLU A 1 153 ? 11.966  46.302 17.650  1.00 12.89 ? 153 GLU A CB  1 
ATOM   1258 C  CG  . GLU A 1 153 ? 12.723  46.266 16.356  1.00 13.22 ? 153 GLU A CG  1 
ATOM   1259 C  CD  . GLU A 1 153 ? 13.710  45.122 16.253  1.00 14.08 ? 153 GLU A CD  1 
ATOM   1260 O  OE1 . GLU A 1 153 ? 14.048  44.501 17.305  1.00 16.81 ? 153 GLU A OE1 1 
ATOM   1261 O  OE2 . GLU A 1 153 ? 14.133  44.792 15.115  1.00 15.88 ? 153 GLU A OE2 1 
ATOM   1262 N  N   . ALA A 1 154 ? 9.577   46.312 19.594  1.00 11.52 ? 154 ALA A N   1 
ATOM   1263 C  CA  . ALA A 1 154 ? 9.206   46.470 21.006  1.00 12.91 ? 154 ALA A CA  1 
ATOM   1264 C  C   . ALA A 1 154 ? 8.518   45.228 21.558  1.00 12.54 ? 154 ALA A C   1 
ATOM   1265 O  O   . ALA A 1 154 ? 8.787   44.778 22.677  1.00 15.75 ? 154 ALA A O   1 
ATOM   1266 C  CB  . ALA A 1 154 ? 8.283   47.685 21.147  1.00 14.76 ? 154 ALA A CB  1 
ATOM   1267 N  N   . ILE A 1 155 ? 7.621   44.639 20.749  1.00 9.86  ? 155 ILE A N   1 
ATOM   1268 C  CA  . ILE A 1 155 ? 6.933   43.451 21.221  1.00 10.44 ? 155 ILE A CA  1 
ATOM   1269 C  C   . ILE A 1 155 ? 7.780   42.175 21.061  1.00 10.04 ? 155 ILE A C   1 
ATOM   1270 O  O   . ILE A 1 155 ? 7.884   41.394 21.988  1.00 11.88 ? 155 ILE A O   1 
ATOM   1271 C  CB  . ILE A 1 155 ? 5.580   43.313 20.525  1.00 10.39 ? 155 ILE A CB  1 
ATOM   1272 C  CG1 . ILE A 1 155 ? 4.647   44.480 20.943  1.00 12.40 ? 155 ILE A CG1 1 
ATOM   1273 C  CG2 . ILE A 1 155 ? 4.953   41.954 20.763  1.00 11.86 ? 155 ILE A CG2 1 
ATOM   1274 C  CD1 . ILE A 1 155 ? 3.347   44.500 20.212  1.00 14.80 ? 155 ILE A CD1 1 
ATOM   1275 N  N   . SER A 1 156 ? 8.340   41.996 19.853  1.00 9.42  ? 156 SER A N   1 
ATOM   1276 C  CA  . SER A 1 156 ? 8.868   40.666 19.503  1.00 9.26  ? 156 SER A CA  1 
ATOM   1277 C  C   . SER A 1 156 ? 10.372  40.565 19.607  1.00 9.25  ? 156 SER A C   1 
ATOM   1278 O  O   . SER A 1 156 ? 10.896  39.453 19.482  1.00 9.20  ? 156 SER A O   1 
ATOM   1279 C  CB  . SER A 1 156 ? 8.490   40.282 18.086  1.00 8.96  ? 156 SER A CB  1 
ATOM   1280 O  OG  . SER A 1 156 ? 9.278   40.944 17.092  1.00 9.06  ? 156 SER A OG  1 
ATOM   1281 N  N   . GLY A 1 157 ? 11.107  41.658 19.729  1.00 9.42  ? 157 GLY A N   1 
ATOM   1282 C  CA  . GLY A 1 157 ? 12.547  41.625 19.655  1.00 9.86  ? 157 GLY A CA  1 
ATOM   1283 C  C   . GLY A 1 157 ? 13.101  41.500 18.253  1.00 9.76  ? 157 GLY A C   1 
ATOM   1284 O  O   . GLY A 1 157 ? 14.331  41.363 18.121  1.00 13.70 ? 157 GLY A O   1 
ATOM   1285 N  N   . ALA A 1 158 ? 12.238  41.575 17.247  1.00 9.15  ? 158 ALA A N   1 
ATOM   1286 C  CA  . ALA A 1 158 ? 12.631  41.443 15.858  1.00 9.64  ? 158 ALA A CA  1 
ATOM   1287 C  C   . ALA A 1 158 ? 11.715  42.340 15.038  1.00 8.46  ? 158 ALA A C   1 
ATOM   1288 O  O   . ALA A 1 158 ? 10.684  42.798 15.483  1.00 8.96  ? 158 ALA A O   1 
ATOM   1289 C  CB  . ALA A 1 158 ? 12.528  40.005 15.371  1.00 12.48 ? 158 ALA A CB  1 
ATOM   1290 N  N   . SER A 1 159 ? 12.097  42.558 13.766  1.00 9.00  ? 159 SER A N   1 
ATOM   1291 C  CA  . SER A 1 159 ? 11.263  43.331 12.874  1.00 8.53  ? 159 SER A CA  1 
ATOM   1292 C  C   . SER A 1 159 ? 11.620  42.953 11.441  1.00 8.15  ? 159 SER A C   1 
ATOM   1293 O  O   . SER A 1 159 ? 12.579  42.238 11.175  1.00 9.50  ? 159 SER A O   1 
ATOM   1294 C  CB  . SER A 1 159 ? 11.388  44.831 13.095  1.00 9.40  ? 159 SER A CB  1 
ATOM   1295 O  OG  . SER A 1 159 ? 12.700  45.269 12.867  1.00 12.08 ? 159 SER A OG  1 
ATOM   1296 N  N   . GLY A 1 160 ? 10.823  43.486 10.518  1.00 8.50  ? 160 GLY A N   1 
ATOM   1297 C  CA  . GLY A 1 160 ? 10.958  43.205 9.133   1.00 8.46  ? 160 GLY A CA  1 
ATOM   1298 C  C   . GLY A 1 160 ? 9.806   42.365 8.586   1.00 7.72  ? 160 GLY A C   1 
ATOM   1299 O  O   . GLY A 1 160 ? 9.051   41.719 9.329   1.00 9.39  ? 160 GLY A O   1 
ATOM   1300 N  N   . PHE A 1 161 ? 9.688   42.381 7.252   1.00 7.68  ? 161 PHE A N   1 
ATOM   1301 C  CA  . PHE A 1 161 ? 8.674   41.600 6.543   1.00 7.26  ? 161 PHE A CA  1 
ATOM   1302 C  C   . PHE A 1 161 ? 9.176   40.183 6.361   1.00 6.49  ? 161 PHE A C   1 
ATOM   1303 O  O   . PHE A 1 161 ? 10.264  39.996 5.797   1.00 6.77  ? 161 PHE A O   1 
ATOM   1304 C  CB  . PHE A 1 161 ? 8.399   42.260 5.198   1.00 7.44  ? 161 PHE A CB  1 
ATOM   1305 C  CG  . PHE A 1 161 ? 7.445   41.443 4.349   1.00 8.06  ? 161 PHE A CG  1 
ATOM   1306 C  CD1 . PHE A 1 161 ? 6.102   41.465 4.560   1.00 10.54 ? 161 PHE A CD1 1 
ATOM   1307 C  CD2 . PHE A 1 161 ? 7.966   40.632 3.358   1.00 11.03 ? 161 PHE A CD2 1 
ATOM   1308 C  CE1 . PHE A 1 161 ? 5.239   40.640 3.734   1.00 11.72 ? 161 PHE A CE1 1 
ATOM   1309 C  CE2 . PHE A 1 161 ? 7.168   39.843 2.544   1.00 12.90 ? 161 PHE A CE2 1 
ATOM   1310 C  CZ  . PHE A 1 161 ? 5.845   39.869 2.736   1.00 12.20 ? 161 PHE A CZ  1 
ATOM   1311 N  N   . PRO A 1 162 ? 8.437   39.152 6.805   1.00 6.49  ? 162 PRO A N   1 
ATOM   1312 C  CA  . PRO A 1 162 ? 8.969   37.784 6.715   1.00 6.45  ? 162 PRO A CA  1 
ATOM   1313 C  C   . PRO A 1 162 ? 8.819   37.221 5.325   1.00 6.15  ? 162 PRO A C   1 
ATOM   1314 O  O   . PRO A 1 162 ? 7.720   36.951 4.820   1.00 7.48  ? 162 PRO A O   1 
ATOM   1315 C  CB  . PRO A 1 162 ? 8.125   37.036 7.766   1.00 7.03  ? 162 PRO A CB  1 
ATOM   1316 C  CG  . PRO A 1 162 ? 6.823   37.780 7.821   1.00 7.68  ? 162 PRO A CG  1 
ATOM   1317 C  CD  . PRO A 1 162 ? 7.191   39.233 7.578   1.00 7.13  ? 162 PRO A CD  1 
ATOM   1318 N  N   . ILE A 1 163 ? 9.959   37.003 4.675   1.00 6.06  ? 163 ILE A N   1 
ATOM   1319 C  CA  . ILE A 1 163 ? 10.027  36.368 3.367   1.00 6.00  ? 163 ILE A CA  1 
ATOM   1320 C  C   . ILE A 1 163 ? 9.683   34.898 3.481   1.00 5.84  ? 163 ILE A C   1 
ATOM   1321 O  O   . ILE A 1 163 ? 8.906   34.369 2.666   1.00 6.38  ? 163 ILE A O   1 
ATOM   1322 C  CB  . ILE A 1 163 ? 11.408  36.620 2.747   1.00 6.46  ? 163 ILE A CB  1 
ATOM   1323 C  CG1 . ILE A 1 163 ? 11.670  38.115 2.536   1.00 7.87  ? 163 ILE A CG1 1 
ATOM   1324 C  CG2 . ILE A 1 163 ? 11.588  35.811 1.471   1.00 7.36  ? 163 ILE A CG2 1 
ATOM   1325 C  CD1 . ILE A 1 163 ? 10.801  38.784 1.526   1.00 8.80  ? 163 ILE A CD1 1 
ATOM   1326 N  N   . MET A 1 164 ? 10.290  34.226 4.459   1.00 6.10  ? 164 MET A N   1 
ATOM   1327 C  CA  . MET A 1 164 ? 9.976   32.829 4.778   1.00 5.92  ? 164 MET A CA  1 
ATOM   1328 C  C   . MET A 1 164 ? 10.340  32.621 6.240   1.00 6.06  ? 164 MET A C   1 
ATOM   1329 O  O   . MET A 1 164 ? 10.939  33.481 6.889   1.00 6.40  ? 164 MET A O   1 
ATOM   1330 C  CB  . MET A 1 164 ? 10.638  31.836 3.816   1.00 6.71  ? 164 MET A CB  1 
ATOM   1331 C  CG  . MET A 1 164 ? 12.136  31.814 3.786   1.00 7.63  ? 164 MET A CG  1 
ATOM   1332 S  SD  . MET A 1 164 ? 12.867  31.030 5.242   1.00 7.94  ? 164 MET A SD  1 
ATOM   1333 C  CE  . MET A 1 164 ? 14.554  30.854 4.660   1.00 9.05  ? 164 MET A CE  1 
ATOM   1334 N  N   . GLY A 1 165 ? 9.959   31.450 6.765   1.00 6.41  ? 165 GLY A N   1 
ATOM   1335 C  CA  . GLY A 1 165 ? 10.354  31.117 8.112   1.00 7.33  ? 165 GLY A CA  1 
ATOM   1336 C  C   . GLY A 1 165 ? 10.183  29.635 8.421   1.00 6.11  ? 165 GLY A C   1 
ATOM   1337 O  O   . GLY A 1 165 ? 9.542   28.887 7.667   1.00 6.97  ? 165 GLY A O   1 
ATOM   1338 N  N   . LEU A 1 166 ? 10.777  29.244 9.529   1.00 5.98  ? 166 LEU A N   1 
ATOM   1339 C  CA  . LEU A 1 166 ? 10.788  27.871 10.003  1.00 6.05  ? 166 LEU A CA  1 
ATOM   1340 C  C   . LEU A 1 166 ? 10.260  27.830 11.437  1.00 5.80  ? 166 LEU A C   1 
ATOM   1341 O  O   . LEU A 1 166 ? 10.770  28.499 12.319  1.00 6.46  ? 166 LEU A O   1 
ATOM   1342 C  CB  . LEU A 1 166 ? 12.205  27.269 9.989   1.00 6.58  ? 166 LEU A CB  1 
ATOM   1343 C  CG  . LEU A 1 166 ? 12.311  25.862 10.528  1.00 6.75  ? 166 LEU A CG  1 
ATOM   1344 C  CD1 . LEU A 1 166 ? 11.484  24.864 9.777   1.00 6.91  ? 166 LEU A CD1 1 
ATOM   1345 C  CD2 . LEU A 1 166 ? 13.771  25.413 10.526  1.00 8.09  ? 166 LEU A CD2 1 
ATOM   1346 N  N   . ASP A 1 167 ? 9.234   26.996 11.640  1.00 5.83  ? 167 ASP A N   1 
ATOM   1347 C  CA  . ASP A 1 167 ? 8.674   26.713 12.961  1.00 5.59  ? 167 ASP A CA  1 
ATOM   1348 C  C   . ASP A 1 167 ? 9.628   25.789 13.720  1.00 5.88  ? 167 ASP A C   1 
ATOM   1349 O  O   . ASP A 1 167 ? 9.895   24.691 13.244  1.00 6.84  ? 167 ASP A O   1 
ATOM   1350 C  CB  . ASP A 1 167 ? 7.352   25.999 12.739  1.00 5.86  ? 167 ASP A CB  1 
ATOM   1351 C  CG  . ASP A 1 167 ? 6.523   25.813 13.995  1.00 5.81  ? 167 ASP A CG  1 
ATOM   1352 O  OD1 . ASP A 1 167 ? 6.901   26.289 15.073  1.00 6.16  ? 167 ASP A OD1 1 
ATOM   1353 O  OD2 . ASP A 1 167 ? 5.412   25.210 13.789  1.00 6.33  ? 167 ASP A OD2 1 
ATOM   1354 N  N   . VAL A 1 168 ? 10.100  26.227 14.888  1.00 5.74  ? 168 VAL A N   1 
ATOM   1355 C  CA  . VAL A 1 168 ? 10.947  25.363 15.694  1.00 5.84  ? 168 VAL A CA  1 
ATOM   1356 C  C   . VAL A 1 168 ? 10.304  25.015 17.054  1.00 5.92  ? 168 VAL A C   1 
ATOM   1357 O  O   . VAL A 1 168 ? 10.991  24.519 17.949  1.00 6.55  ? 168 VAL A O   1 
ATOM   1358 C  CB  . VAL A 1 168 ? 12.398  25.870 15.868  1.00 6.54  ? 168 VAL A CB  1 
ATOM   1359 C  CG1 . VAL A 1 168 ? 13.070  25.912 14.479  1.00 7.62  ? 168 VAL A CG1 1 
ATOM   1360 C  CG2 . VAL A 1 168 ? 12.531  27.226 16.548  1.00 7.43  ? 168 VAL A CG2 1 
ATOM   1361 N  N   . TRP A 1 169 ? 8.974   25.147 17.155  1.00 6.00  ? 169 TRP A N   1 
ATOM   1362 C  CA  . TRP A 1 169 ? 8.290   24.472 18.259  1.00 5.87  ? 169 TRP A CA  1 
ATOM   1363 C  C   . TRP A 1 169 ? 8.485   22.968 18.150  1.00 5.95  ? 169 TRP A C   1 
ATOM   1364 O  O   . TRP A 1 169 ? 8.499   22.409 17.042  1.00 6.15  ? 169 TRP A O   1 
ATOM   1365 C  CB  . TRP A 1 169 ? 6.782   24.758 18.223  1.00 5.85  ? 169 TRP A CB  1 
ATOM   1366 C  CG  . TRP A 1 169 ? 6.406   26.143 18.654  1.00 6.00  ? 169 TRP A CG  1 
ATOM   1367 C  CD1 . TRP A 1 169 ? 6.853   27.341 18.177  1.00 5.86  ? 169 TRP A CD1 1 
ATOM   1368 C  CD2 . TRP A 1 169 ? 5.473   26.471 19.721  1.00 5.92  ? 169 TRP A CD2 1 
ATOM   1369 N  NE1 . TRP A 1 169 ? 6.259   28.382 18.862  1.00 5.89  ? 169 TRP A NE1 1 
ATOM   1370 C  CE2 . TRP A 1 169 ? 5.419   27.869 19.814  1.00 5.85  ? 169 TRP A CE2 1 
ATOM   1371 C  CE3 . TRP A 1 169 ? 4.721   25.680 20.625  1.00 6.21  ? 169 TRP A CE3 1 
ATOM   1372 C  CZ2 . TRP A 1 169 ? 4.588   28.522 20.750  1.00 6.01  ? 169 TRP A CZ2 1 
ATOM   1373 C  CZ3 . TRP A 1 169 ? 3.918   26.320 21.549  1.00 6.23  ? 169 TRP A CZ3 1 
ATOM   1374 C  CH2 . TRP A 1 169 ? 3.866   27.727 21.606  1.00 6.19  ? 169 TRP A CH2 1 
ATOM   1375 N  N   . GLU A 1 170 ? 8.585   22.308 19.301  1.00 5.99  ? 170 GLU A N   1 
ATOM   1376 C  CA  . GLU A 1 170 ? 8.790   20.880 19.299  1.00 5.96  ? 170 GLU A CA  1 
ATOM   1377 C  C   . GLU A 1 170 ? 7.704   20.103 18.576  1.00 6.20  ? 170 GLU A C   1 
ATOM   1378 O  O   . GLU A 1 170 ? 8.015   19.067 17.962  1.00 6.64  ? 170 GLU A O   1 
ATOM   1379 C  CB  . GLU A 1 170 ? 8.923   20.354 20.744  1.00 6.46  ? 170 GLU A CB  1 
ATOM   1380 C  CG  . GLU A 1 170 ? 10.159  20.892 21.439  1.00 6.61  ? 170 GLU A CG  1 
ATOM   1381 C  CD  . GLU A 1 170 ? 10.331  20.268 22.808  1.00 6.52  ? 170 GLU A CD  1 
ATOM   1382 O  OE1 . GLU A 1 170 ? 9.391   20.361 23.640  1.00 6.71  ? 170 GLU A OE1 1 
ATOM   1383 O  OE2 . GLU A 1 170 ? 11.398  19.640 23.039  1.00 8.41  ? 170 GLU A OE2 1 
ATOM   1384 N  N   . HIS A 1 171 ? 6.446   20.552 18.593  1.00 6.31  ? 171 HIS A N   1 
ATOM   1385 C  CA  . HIS A 1 171 ? 5.430   19.781 17.898  1.00 6.35  ? 171 HIS A CA  1 
ATOM   1386 C  C   . HIS A 1 171 ? 5.695   19.671 16.416  1.00 6.47  ? 171 HIS A C   1 
ATOM   1387 O  O   . HIS A 1 171 ? 5.146   18.781 15.766  1.00 7.37  ? 171 HIS A O   1 
ATOM   1388 C  CB  . HIS A 1 171 ? 4.017   20.379 18.120  1.00 6.35  ? 171 HIS A CB  1 
ATOM   1389 C  CG  . HIS A 1 171 ? 3.800   21.766 17.652  1.00 6.31  ? 171 HIS A CG  1 
ATOM   1390 N  ND1 . HIS A 1 171 ? 3.484   22.810 18.515  1.00 6.71  ? 171 HIS A ND1 1 
ATOM   1391 C  CD2 . HIS A 1 171 ? 3.780   22.332 16.404  1.00 6.45  ? 171 HIS A CD2 1 
ATOM   1392 C  CE1 . HIS A 1 171 ? 3.312   23.907 17.808  1.00 6.56  ? 171 HIS A CE1 1 
ATOM   1393 N  NE2 . HIS A 1 171 ? 3.481   23.681 16.493  1.00 6.56  ? 171 HIS A NE2 1 
ATOM   1394 N  N   . ALA A 1 172 ? 6.504   20.567 15.828  1.00 6.19  ? 172 ALA A N   1 
ATOM   1395 C  CA  . ALA A 1 172 ? 6.768   20.547 14.413  1.00 6.48  ? 172 ALA A CA  1 
ATOM   1396 C  C   . ALA A 1 172 ? 7.737   19.417 14.019  1.00 6.43  ? 172 ALA A C   1 
ATOM   1397 O  O   . ALA A 1 172 ? 7.818   19.087 12.844  1.00 7.66  ? 172 ALA A O   1 
ATOM   1398 C  CB  . ALA A 1 172 ? 7.328   21.894 13.959  1.00 7.06  ? 172 ALA A CB  1 
ATOM   1399 N  N   . TYR A 1 173 ? 8.486   18.859 14.986  1.00 6.67  ? 173 TYR A N   1 
ATOM   1400 C  CA  . TYR A 1 173 ? 9.540   17.910 14.645  1.00 7.01  ? 173 TYR A CA  1 
ATOM   1401 C  C   . TYR A 1 173 ? 9.643   16.735 15.601  1.00 7.11  ? 173 TYR A C   1 
ATOM   1402 O  O   . TYR A 1 173 ? 10.495  15.869 15.362  1.00 7.60  ? 173 TYR A O   1 
ATOM   1403 C  CB  . TYR A 1 173 ? 10.878  18.627 14.493  1.00 7.02  ? 173 TYR A CB  1 
ATOM   1404 C  CG  . TYR A 1 173 ? 11.455  19.326 15.696  1.00 7.22  ? 173 TYR A CG  1 
ATOM   1405 C  CD1 . TYR A 1 173 ? 12.303  18.689 16.584  1.00 8.12  ? 173 TYR A CD1 1 
ATOM   1406 C  CD2 . TYR A 1 173 ? 11.181  20.658 15.941  1.00 7.21  ? 173 TYR A CD2 1 
ATOM   1407 C  CE1 . TYR A 1 173 ? 12.848  19.296 17.687  1.00 8.44  ? 173 TYR A CE1 1 
ATOM   1408 C  CE2 . TYR A 1 173 ? 11.744  21.329 17.029  1.00 7.37  ? 173 TYR A CE2 1 
ATOM   1409 C  CZ  . TYR A 1 173 ? 12.586  20.653 17.890  1.00 7.50  ? 173 TYR A CZ  1 
ATOM   1410 O  OH  . TYR A 1 173 ? 13.138  21.350 18.928  1.00 8.22  ? 173 TYR A OH  1 
ATOM   1411 N  N   . PHE A 1 174 ? 8.813   16.621 16.628  1.00 8.47  ? 174 PHE A N   1 
ATOM   1412 C  CA  . PHE A 1 174 ? 9.029   15.578 17.617  1.00 10.03 ? 174 PHE A CA  1 
ATOM   1413 C  C   . PHE A 1 174 ? 8.831   14.193 17.051  1.00 9.67  ? 174 PHE A C   1 
ATOM   1414 O  O   . PHE A 1 174 ? 9.607   13.271 17.383  1.00 10.38 ? 174 PHE A O   1 
ATOM   1415 C  CB  . PHE A 1 174 ? 8.090   15.822 18.831  1.00 11.82 ? 174 PHE A CB  1 
ATOM   1416 C  CG  . PHE A 1 174 ? 8.317   14.804 19.929  1.00 9.34  ? 174 PHE A CG  1 
ATOM   1417 C  CD1 . PHE A 1 174 ? 9.165   15.039 20.948  1.00 10.71 ? 174 PHE A CD1 1 
ATOM   1418 C  CD2 . PHE A 1 174 ? 7.685   13.555 19.862  1.00 14.95 ? 174 PHE A CD2 1 
ATOM   1419 C  CE1 . PHE A 1 174 ? 9.421   14.093 21.959  1.00 11.89 ? 174 PHE A CE1 1 
ATOM   1420 C  CE2 . PHE A 1 174 ? 7.904   12.629 20.886  1.00 17.05 ? 174 PHE A CE2 1 
ATOM   1421 C  CZ  . PHE A 1 174 ? 8.724   12.918 21.899  1.00 13.86 ? 174 PHE A CZ  1 
ATOM   1422 N  N   . LEU A 1 175 ? 7.760   13.955 16.317  1.00 10.28 ? 175 LEU A N   1 
ATOM   1423 C  CA  . LEU A 1 175 ? 7.459   12.589 15.924  1.00 11.17 ? 175 LEU A CA  1 
ATOM   1424 C  C   . LEU A 1 175 ? 8.593   11.953 15.129  1.00 10.02 ? 175 LEU A C   1 
ATOM   1425 O  O   . LEU A 1 175 ? 8.917   10.787 15.355  1.00 12.96 ? 175 LEU A O   1 
ATOM   1426 C  CB  . LEU A 1 175 ? 6.182   12.484 15.132  1.00 12.53 ? 175 LEU A CB  1 
ATOM   1427 C  CG  . LEU A 1 175 ? 4.894   12.591 15.861  1.00 12.98 ? 175 LEU A CG  1 
ATOM   1428 C  CD1 . LEU A 1 175 ? 3.751   12.341 14.846  1.00 16.99 ? 175 LEU A CD1 1 
ATOM   1429 C  CD2 . LEU A 1 175 ? 4.851   11.592 17.018  1.00 16.89 ? 175 LEU A CD2 1 
ATOM   1430 N  N   . LYS A 1 176 ? 9.139   12.691 14.170  1.00 9.07  ? 176 LYS A N   1 
ATOM   1431 C  CA  . LYS A 1 176 ? 10.158  12.137 13.295  1.00 9.61  ? 176 LYS A CA  1 
ATOM   1432 C  C   . LYS A 1 176 ? 11.559  12.339 13.858  1.00 9.26  ? 176 LYS A C   1 
ATOM   1433 O  O   . LYS A 1 176 ? 12.429  11.497 13.648  1.00 11.35 ? 176 LYS A O   1 
ATOM   1434 C  CB  . LYS A 1 176 ? 10.039  12.745 11.914  1.00 9.18  ? 176 LYS A CB  1 
ATOM   1435 C  CG  . LYS A 1 176 ? 11.131  12.310 10.953  1.00 9.06  ? 176 LYS A CG  1 
ATOM   1436 C  CD  . LYS A 1 176 ? 10.815  12.694 9.503   1.00 8.84  ? 176 LYS A CD  1 
ATOM   1437 C  CE  . LYS A 1 176 ? 11.968  12.284 8.603   1.00 9.52  ? 176 LYS A CE  1 
ATOM   1438 N  NZ  . LYS A 1 176 ? 11.701  12.678 7.211   1.00 9.93  ? 176 LYS A NZ  1 
ATOM   1439 N  N   . PHE A 1 177 ? 11.809  13.475 14.509  1.00 8.61  ? 177 PHE A N   1 
ATOM   1440 C  CA  . PHE A 1 177 ? 13.132  13.885 14.846  1.00 8.71  ? 177 PHE A CA  1 
ATOM   1441 C  C   . PHE A 1 177 ? 13.417  13.897 16.340  1.00 8.90  ? 177 PHE A C   1 
ATOM   1442 O  O   . PHE A 1 177 ? 14.573  14.103 16.741  1.00 9.88  ? 177 PHE A O   1 
ATOM   1443 C  CB  . PHE A 1 177 ? 13.453  15.289 14.277  1.00 8.41  ? 177 PHE A CB  1 
ATOM   1444 C  CG  . PHE A 1 177 ? 13.282  15.384 12.784  1.00 8.36  ? 177 PHE A CG  1 
ATOM   1445 C  CD1 . PHE A 1 177 ? 12.058  15.823 12.253  1.00 8.15  ? 177 PHE A CD1 1 
ATOM   1446 C  CD2 . PHE A 1 177 ? 14.284  15.071 11.888  1.00 9.17  ? 177 PHE A CD2 1 
ATOM   1447 C  CE1 . PHE A 1 177 ? 11.858  15.935 10.877  1.00 8.31  ? 177 PHE A CE1 1 
ATOM   1448 C  CE2 . PHE A 1 177 ? 14.071  15.182 10.513  1.00 9.35  ? 177 PHE A CE2 1 
ATOM   1449 C  CZ  . PHE A 1 177 ? 12.879  15.643 10.022  1.00 8.73  ? 177 PHE A CZ  1 
ATOM   1450 N  N   . GLN A 1 178 ? 12.415  13.734 17.196  1.00 9.89  ? 178 GLN A N   1 
ATOM   1451 C  CA  . GLN A 1 178 ? 12.583  13.758 18.637  1.00 10.37 ? 178 GLN A CA  1 
ATOM   1452 C  C   . GLN A 1 178 ? 13.255  15.101 19.003  1.00 10.10 ? 178 GLN A C   1 
ATOM   1453 O  O   . GLN A 1 178 ? 12.732  16.146 18.649  1.00 10.36 ? 178 GLN A O   1 
ATOM   1454 C  CB  . GLN A 1 178 ? 13.240  12.480 19.175  1.00 12.56 ? 178 GLN A CB  1 
ATOM   1455 C  CG  . GLN A 1 178 ? 12.355  11.262 18.914  1.00 14.80 ? 178 GLN A CG  1 
ATOM   1456 C  CD  A GLN A 1 178 ? 12.609  10.701 17.533  0.41 13.72 ? 178 GLN A CD  1 
ATOM   1457 C  CD  B GLN A 1 178 ? 12.927  9.918  19.360  0.59 16.32 ? 178 GLN A CD  1 
ATOM   1458 O  OE1 A GLN A 1 178 ? 13.800  10.534 17.208  0.41 18.04 ? 178 GLN A OE1 1 
ATOM   1459 O  OE1 B GLN A 1 178 ? 14.131  9.857  19.652  0.59 20.03 ? 178 GLN A OE1 1 
ATOM   1460 N  NE2 A GLN A 1 178 ? 11.542  10.412 16.826  0.41 14.64 ? 178 GLN A NE2 1 
ATOM   1461 N  NE2 B GLN A 1 178 ? 12.047  8.940  19.455  0.59 20.17 ? 178 GLN A NE2 1 
ATOM   1462 N  N   . ASN A 1 179 ? 14.356  15.028 19.720  1.00 10.55 ? 179 ASN A N   1 
ATOM   1463 C  CA  . ASN A 1 179 ? 15.044  16.213 20.124  1.00 10.79 ? 179 ASN A CA  1 
ATOM   1464 C  C   . ASN A 1 179 ? 16.061  16.691 19.101  1.00 10.69 ? 179 ASN A C   1 
ATOM   1465 O  O   . ASN A 1 179 ? 16.741  17.697 19.343  1.00 12.25 ? 179 ASN A O   1 
ATOM   1466 C  CB  A ASN A 1 179 ? 15.719  15.941 21.453  0.49 10.16 ? 179 ASN A CB  1 
ATOM   1467 C  CB  B ASN A 1 179 ? 15.900  16.012 21.433  0.51 11.33 ? 179 ASN A CB  1 
ATOM   1468 C  CG  A ASN A 1 179 ? 16.774  14.873 21.243  0.49 8.67  ? 179 ASN A CG  1 
ATOM   1469 C  CG  B ASN A 1 179 ? 16.260  17.314 22.143  0.51 9.33  ? 179 ASN A CG  1 
ATOM   1470 O  OD1 A ASN A 1 179 ? 16.440  13.846 20.687  0.49 10.16 ? 179 ASN A OD1 1 
ATOM   1471 O  OD1 B ASN A 1 179 ? 15.524  18.306 22.052  0.51 8.95  ? 179 ASN A OD1 1 
ATOM   1472 N  ND2 A ASN A 1 179 ? 17.874  15.119 21.835  0.49 12.09 ? 179 ASN A ND2 1 
ATOM   1473 N  ND2 B ASN A 1 179 ? 17.451  17.586 22.871  0.51 11.33 ? 179 ASN A ND2 1 
ATOM   1474 N  N   . ARG A 1 180 ? 16.175  16.054 17.947  1.00 9.25  ? 180 ARG A N   1 
ATOM   1475 C  CA  . ARG A 1 180 ? 17.238  16.386 16.978  1.00 9.54  ? 180 ARG A CA  1 
ATOM   1476 C  C   . ARG A 1 180 ? 16.802  17.509 16.044  1.00 8.26  ? 180 ARG A C   1 
ATOM   1477 O  O   . ARG A 1 180 ? 16.673  17.379 14.831  1.00 8.42  ? 180 ARG A O   1 
ATOM   1478 C  CB  . ARG A 1 180 ? 17.605  15.137 16.166  1.00 9.98  ? 180 ARG A CB  1 
ATOM   1479 C  CG  . ARG A 1 180 ? 18.162  14.003 17.032  1.00 12.46 ? 180 ARG A CG  1 
ATOM   1480 C  CD  . ARG A 1 180 ? 18.433  12.742 16.183  1.00 13.64 ? 180 ARG A CD  1 
ATOM   1481 N  NE  . ARG A 1 180 ? 17.188  12.059 15.826  1.00 15.68 ? 180 ARG A NE  1 
ATOM   1482 C  CZ  . ARG A 1 180 ? 16.606  11.982 14.661  1.00 17.24 ? 180 ARG A CZ  1 
ATOM   1483 N  NH1 . ARG A 1 180 ? 17.098  12.598 13.587  1.00 20.37 ? 180 ARG A NH1 1 
ATOM   1484 N  NH2 . ARG A 1 180 ? 15.488  11.256 14.596  1.00 22.00 ? 180 ARG A NH2 1 
ATOM   1485 N  N   . ARG A 1 181 ? 16.623  18.690 16.662  1.00 8.29  ? 181 ARG A N   1 
ATOM   1486 C  CA  . ARG A 1 181 ? 16.233  19.867 15.879  1.00 7.92  ? 181 ARG A CA  1 
ATOM   1487 C  C   . ARG A 1 181 ? 17.199  20.117 14.718  1.00 7.50  ? 181 ARG A C   1 
ATOM   1488 O  O   . ARG A 1 181 ? 16.728  20.491 13.630  1.00 7.41  ? 181 ARG A O   1 
ATOM   1489 C  CB  . ARG A 1 181 ? 16.080  21.115 16.763  1.00 7.69  ? 181 ARG A CB  1 
ATOM   1490 C  CG  . ARG A 1 181 ? 15.315  22.212 16.019  1.00 7.46  ? 181 ARG A CG  1 
ATOM   1491 C  CD  . ARG A 1 181 ? 15.462  23.576 16.656  1.00 7.49  ? 181 ARG A CD  1 
ATOM   1492 N  NE  . ARG A 1 181 ? 14.783  23.632 17.951  1.00 7.17  ? 181 ARG A NE  1 
ATOM   1493 C  CZ  . ARG A 1 181 ? 14.829  24.739 18.714  1.00 7.38  ? 181 ARG A CZ  1 
ATOM   1494 N  NH1 . ARG A 1 181 ? 15.477  25.824 18.314  1.00 8.05  ? 181 ARG A NH1 1 
ATOM   1495 N  NH2 . ARG A 1 181 ? 14.205  24.743 19.899  1.00 8.08  ? 181 ARG A NH2 1 
ATOM   1496 N  N   . PRO A 1 182 ? 18.523  19.982 14.888  1.00 8.36  ? 182 PRO A N   1 
ATOM   1497 C  CA  . PRO A 1 182 ? 19.388  20.219 13.717  1.00 8.66  ? 182 PRO A CA  1 
ATOM   1498 C  C   . PRO A 1 182 ? 19.037  19.352 12.525  1.00 7.64  ? 182 PRO A C   1 
ATOM   1499 O  O   . PRO A 1 182 ? 19.224  19.822 11.381  1.00 8.18  ? 182 PRO A O   1 
ATOM   1500 C  CB  . PRO A 1 182 ? 20.802  19.990 14.291  1.00 9.86  ? 182 PRO A CB  1 
ATOM   1501 C  CG  . PRO A 1 182 ? 20.660  20.367 15.727  1.00 10.56 ? 182 PRO A CG  1 
ATOM   1502 C  CD  . PRO A 1 182 ? 19.322  19.795 16.120  1.00 9.49  ? 182 PRO A CD  1 
ATOM   1503 N  N   . ASP A 1 183 ? 18.629  18.120 12.728  1.00 7.96  ? 183 ASP A N   1 
ATOM   1504 C  CA  . ASP A 1 183 ? 18.281  17.244 11.624  1.00 8.15  ? 183 ASP A CA  1 
ATOM   1505 C  C   . ASP A 1 183 ? 17.011  17.730 10.912  1.00 8.05  ? 183 ASP A C   1 
ATOM   1506 O  O   . ASP A 1 183 ? 16.879  17.627 9.689   1.00 8.93  ? 183 ASP A O   1 
ATOM   1507 C  CB  . ASP A 1 183 ? 18.139  15.811 12.086  1.00 9.31  ? 183 ASP A CB  1 
ATOM   1508 C  CG  . ASP A 1 183 ? 19.493  15.177 12.464  1.00 12.59 ? 183 ASP A CG  1 
ATOM   1509 O  OD1 . ASP A 1 183 ? 20.527  15.634 11.881  1.00 13.63 ? 183 ASP A OD1 1 
ATOM   1510 O  OD2 . ASP A 1 183 ? 19.432  14.135 13.155  1.00 16.62 ? 183 ASP A OD2 1 
ATOM   1511 N  N   . TYR A 1 184 ? 16.057  18.238 11.701  1.00 7.33  ? 184 TYR A N   1 
ATOM   1512 C  CA  . TYR A 1 184 ? 14.822  18.842 11.142  1.00 6.95  ? 184 TYR A CA  1 
ATOM   1513 C  C   . TYR A 1 184 ? 15.172  20.099 10.316  1.00 6.47  ? 184 TYR A C   1 
ATOM   1514 O  O   . TYR A 1 184 ? 14.664  20.295 9.225   1.00 6.97  ? 184 TYR A O   1 
ATOM   1515 C  CB  . TYR A 1 184 ? 13.929  19.165 12.320  1.00 7.04  ? 184 TYR A CB  1 
ATOM   1516 C  CG  . TYR A 1 184 ? 12.763  20.097 12.013  1.00 6.70  ? 184 TYR A CG  1 
ATOM   1517 C  CD1 . TYR A 1 184 ? 11.720  19.717 11.183  1.00 6.98  ? 184 TYR A CD1 1 
ATOM   1518 C  CD2 . TYR A 1 184 ? 12.726  21.332 12.650  1.00 7.15  ? 184 TYR A CD2 1 
ATOM   1519 C  CE1 . TYR A 1 184 ? 10.634  20.594 10.963  1.00 7.02  ? 184 TYR A CE1 1 
ATOM   1520 C  CE2 . TYR A 1 184 ? 11.633  22.191 12.453  1.00 6.97  ? 184 TYR A CE2 1 
ATOM   1521 C  CZ  . TYR A 1 184 ? 10.622  21.823 11.631  1.00 6.54  ? 184 TYR A CZ  1 
ATOM   1522 O  OH  . TYR A 1 184 ? 9.509   22.630 11.419  1.00 6.96  ? 184 TYR A OH  1 
ATOM   1523 N  N   . ILE A 1 185 ? 16.073  20.937 10.859  1.00 6.61  ? 185 ILE A N   1 
ATOM   1524 C  CA  . ILE A 1 185 ? 16.498  22.128 10.159  1.00 7.43  ? 185 ILE A CA  1 
ATOM   1525 C  C   . ILE A 1 185 ? 17.111  21.773 8.802   1.00 7.43  ? 185 ILE A C   1 
ATOM   1526 O  O   . ILE A 1 185 ? 16.881  22.411 7.798   1.00 8.32  ? 185 ILE A O   1 
ATOM   1527 C  CB  . ILE A 1 185 ? 17.430  22.954 11.061  1.00 8.40  ? 185 ILE A CB  1 
ATOM   1528 C  CG1 . ILE A 1 185 ? 16.672  23.521 12.276  1.00 8.55  ? 185 ILE A CG1 1 
ATOM   1529 C  CG2 . ILE A 1 185 ? 18.133  24.044 10.282  1.00 10.85 ? 185 ILE A CG2 1 
ATOM   1530 C  CD1 . ILE A 1 185 ? 17.572  23.947 13.415  1.00 9.30  ? 185 ILE A CD1 1 
ATOM   1531 N  N   . LYS A 1 186 ? 17.940  20.680 8.799   0.64 5.47  ? 186 LYS A N   1 
ATOM   1532 C  CA  . LYS A 1 186 ? 18.521  20.249 7.515   0.64 7.45  ? 186 LYS A CA  1 
ATOM   1533 C  C   . LYS A 1 186 ? 17.435  19.896 6.512   1.00 7.37  ? 186 LYS A C   1 
ATOM   1534 O  O   . LYS A 1 186 ? 17.541  20.221 5.328   1.00 7.99  ? 186 LYS A O   1 
ATOM   1535 C  CB  A LYS A 1 186 ? 19.287  18.894 7.715   0.64 12.77 ? 186 LYS A CB  1 
ATOM   1536 C  CB  B LYS A 1 186 ? 19.700  19.330 7.811   0.24 8.88  ? 186 LYS A CB  1 
ATOM   1537 C  CB  C LYS A 1 186 ? 19.336  18.953 7.626   0.12 11.55 ? 186 LYS A CB  1 
ATOM   1538 C  CG  A LYS A 1 186 ? 20.630  18.929 8.388   0.64 14.68 ? 186 LYS A CG  1 
ATOM   1539 C  CG  B LYS A 1 186 ? 20.785  20.141 8.510   0.24 6.49  ? 186 LYS A CG  1 
ATOM   1540 C  CG  C LYS A 1 186 ? 20.460  18.638 8.536   0.12 6.50  ? 186 LYS A CG  1 
ATOM   1541 C  CD  A LYS A 1 186 ? 21.195  20.347 8.278   0.64 21.01 ? 186 LYS A CD  1 
ATOM   1542 C  CD  B LYS A 1 186 ? 21.848  19.142 9.012   0.24 9.58  ? 186 LYS A CD  1 
ATOM   1543 C  CD  C LYS A 1 186 ? 20.919  17.201 8.654   0.12 4.89  ? 186 LYS A CD  1 
ATOM   1544 C  CE  A LYS A 1 186 ? 22.176  20.744 9.355   0.64 22.76 ? 186 LYS A CE  1 
ATOM   1545 C  CE  B LYS A 1 186 ? 22.977  19.896 9.685   0.24 10.82 ? 186 LYS A CE  1 
ATOM   1546 C  CE  C LYS A 1 186 ? 22.231  17.069 9.396   0.12 6.70  ? 186 LYS A CE  1 
ATOM   1547 N  NZ  A LYS A 1 186 ? 23.595  21.027 9.078   0.64 22.49 ? 186 LYS A NZ  1 
ATOM   1548 N  NZ  B LYS A 1 186 ? 22.928  20.195 11.120  0.24 16.48 ? 186 LYS A NZ  1 
ATOM   1549 N  NZ  C LYS A 1 186 ? 22.477  15.664 9.820   0.12 9.43  ? 186 LYS A NZ  1 
ATOM   1550 N  N   . GLU A 1 187 ? 16.402  19.177 6.959   1.00 7.28  ? 187 GLU A N   1 
ATOM   1551 C  CA  . GLU A 1 187 ? 15.322  18.794 6.057   1.00 7.33  ? 187 GLU A CA  1 
ATOM   1552 C  C   . GLU A 1 187 ? 14.540  19.998 5.552   1.00 7.30  ? 187 GLU A C   1 
ATOM   1553 O  O   . GLU A 1 187 ? 14.027  19.987 4.431   1.00 7.72  ? 187 GLU A O   1 
ATOM   1554 C  CB  . GLU A 1 187 ? 14.373  17.769 6.695   1.00 7.97  ? 187 GLU A CB  1 
ATOM   1555 C  CG  . GLU A 1 187 ? 14.975  16.350 6.773   1.00 8.83  ? 187 GLU A CG  1 
ATOM   1556 C  CD  . GLU A 1 187 ? 15.110  15.680 5.423   1.00 8.16  ? 187 GLU A CD  1 
ATOM   1557 O  OE1 . GLU A 1 187 ? 15.530  14.468 5.444   1.00 11.34 ? 187 GLU A OE1 1 
ATOM   1558 O  OE2 . GLU A 1 187 ? 14.727  16.248 4.390   1.00 7.88  ? 187 GLU A OE2 1 
ATOM   1559 N  N   . PHE A 1 188 ? 14.472  21.075 6.357   1.00 7.10  ? 188 PHE A N   1 
ATOM   1560 C  CA  . PHE A 1 188 ? 13.803  22.280 5.877   1.00 7.01  ? 188 PHE A CA  1 
ATOM   1561 C  C   . PHE A 1 188 ? 14.373  22.749 4.562   1.00 6.71  ? 188 PHE A C   1 
ATOM   1562 O  O   . PHE A 1 188 ? 13.620  23.239 3.709   1.00 7.18  ? 188 PHE A O   1 
ATOM   1563 C  CB  . PHE A 1 188 ? 13.879  23.375 6.923   1.00 7.44  ? 188 PHE A CB  1 
ATOM   1564 C  CG  . PHE A 1 188 ? 13.276  24.707 6.498   1.00 7.55  ? 188 PHE A CG  1 
ATOM   1565 C  CD1 . PHE A 1 188 ? 11.919  24.807 6.219   1.00 7.50  ? 188 PHE A CD1 1 
ATOM   1566 C  CD2 . PHE A 1 188 ? 14.066  25.850 6.426   1.00 8.48  ? 188 PHE A CD2 1 
ATOM   1567 C  CE1 . PHE A 1 188 ? 11.356  26.070 5.926   1.00 8.19  ? 188 PHE A CE1 1 
ATOM   1568 C  CE2 . PHE A 1 188 ? 13.509  27.073 6.129   1.00 9.22  ? 188 PHE A CE2 1 
ATOM   1569 C  CZ  . PHE A 1 188 ? 12.142  27.206 5.873   1.00 8.58  ? 188 PHE A CZ  1 
ATOM   1570 N  N   . TRP A 1 189 ? 15.694  22.632 4.320   1.00 6.67  ? 189 TRP A N   1 
ATOM   1571 C  CA  . TRP A 1 189 ? 16.187  23.134 3.052   1.00 6.71  ? 189 TRP A CA  1 
ATOM   1572 C  C   . TRP A 1 189 ? 15.595  22.403 1.870   1.00 6.61  ? 189 TRP A C   1 
ATOM   1573 O  O   . TRP A 1 189 ? 15.578  22.960 0.772   1.00 7.07  ? 189 TRP A O   1 
ATOM   1574 C  CB  . TRP A 1 189 ? 17.731  23.110 2.967   1.00 7.51  ? 189 TRP A CB  1 
ATOM   1575 C  CG  . TRP A 1 189 ? 18.361  23.987 4.001   1.00 7.63  ? 189 TRP A CG  1 
ATOM   1576 C  CD1 . TRP A 1 189 ? 19.259  23.614 4.927   1.00 8.93  ? 189 TRP A CD1 1 
ATOM   1577 C  CD2 . TRP A 1 189 ? 18.141  25.402 4.188   1.00 7.58  ? 189 TRP A CD2 1 
ATOM   1578 N  NE1 . TRP A 1 189 ? 19.633  24.690 5.720   1.00 9.26  ? 189 TRP A NE1 1 
ATOM   1579 C  CE2 . TRP A 1 189 ? 18.949  25.792 5.276   1.00 7.98  ? 189 TRP A CE2 1 
ATOM   1580 C  CE3 . TRP A 1 189 ? 17.343  26.378 3.543   1.00 8.00  ? 189 TRP A CE3 1 
ATOM   1581 C  CZ2 . TRP A 1 189 ? 18.972  27.109 5.744   1.00 8.48  ? 189 TRP A CZ2 1 
ATOM   1582 C  CZ3 . TRP A 1 189 ? 17.357  27.655 4.026   1.00 8.68  ? 189 TRP A CZ3 1 
ATOM   1583 C  CH2 . TRP A 1 189 ? 18.158  28.020 5.109   1.00 8.54  ? 189 TRP A CH2 1 
ATOM   1584 N  N   . ASN A 1 190 ? 15.149  21.163 2.034   1.00 6.39  ? 190 ASN A N   1 
ATOM   1585 C  CA  . ASN A 1 190 ? 14.537  20.396 0.956   1.00 6.51  ? 190 ASN A CA  1 
ATOM   1586 C  C   . ASN A 1 190 ? 13.092  20.811 0.661   1.00 6.46  ? 190 ASN A C   1 
ATOM   1587 O  O   . ASN A 1 190 ? 12.565  20.451 -0.366  1.00 7.48  ? 190 ASN A O   1 
ATOM   1588 C  CB  . ASN A 1 190 ? 14.577  18.914 1.297   1.00 6.77  ? 190 ASN A CB  1 
ATOM   1589 C  CG  . ASN A 1 190 ? 16.037  18.417 1.361   1.00 6.90  ? 190 ASN A CG  1 
ATOM   1590 O  OD1 . ASN A 1 190 ? 16.859  18.814 0.524   1.00 9.49  ? 190 ASN A OD1 1 
ATOM   1591 N  ND2 . ASN A 1 190 ? 16.335  17.599 2.327   1.00 6.98  ? 190 ASN A ND2 1 
ATOM   1592 N  N   . VAL A 1 191 ? 12.461  21.515 1.619   1.00 6.00  ? 191 VAL A N   1 
ATOM   1593 C  CA  . VAL A 1 191 ? 11.056  21.890 1.471   1.00 6.03  ? 191 VAL A CA  1 
ATOM   1594 C  C   . VAL A 1 191 ? 10.785  23.378 1.599   1.00 6.11  ? 191 VAL A C   1 
ATOM   1595 O  O   . VAL A 1 191 ? 9.635   23.778 1.417   1.00 6.29  ? 191 VAL A O   1 
ATOM   1596 C  CB  . VAL A 1 191 ? 10.144  21.079 2.432   1.00 6.16  ? 191 VAL A CB  1 
ATOM   1597 C  CG1 . VAL A 1 191 ? 10.132  19.620 2.028   1.00 7.58  ? 191 VAL A CG1 1 
ATOM   1598 C  CG2 . VAL A 1 191 ? 10.566  21.233 3.880   1.00 6.83  ? 191 VAL A CG2 1 
ATOM   1599 N  N   . VAL A 1 192 ? 11.783  24.232 1.844   1.00 6.23  ? 192 VAL A N   1 
ATOM   1600 C  CA  . VAL A 1 192 ? 11.479  25.666 1.825   1.00 6.45  ? 192 VAL A CA  1 
ATOM   1601 C  C   . VAL A 1 192 ? 11.064  26.015 0.408   1.00 6.21  ? 192 VAL A C   1 
ATOM   1602 O  O   . VAL A 1 192 ? 11.718  25.692 -0.589  1.00 6.80  ? 192 VAL A O   1 
ATOM   1603 C  CB  . VAL A 1 192 ? 12.663  26.512 2.370   1.00 7.04  ? 192 VAL A CB  1 
ATOM   1604 C  CG1 . VAL A 1 192 ? 13.939  26.315 1.562   1.00 7.63  ? 192 VAL A CG1 1 
ATOM   1605 C  CG2 . VAL A 1 192 ? 12.261  27.981 2.433   1.00 7.92  ? 192 VAL A CG2 1 
ATOM   1606 N  N   . ASN A 1 193 ? 9.919   26.702 0.306   1.00 6.18  ? 193 ASN A N   1 
ATOM   1607 C  CA  . ASN A 1 193 ? 9.333   27.004 -1.008  1.00 6.15  ? 193 ASN A CA  1 
ATOM   1608 C  C   . ASN A 1 193 ? 9.969   28.271 -1.549  1.00 5.82  ? 193 ASN A C   1 
ATOM   1609 O  O   . ASN A 1 193 ? 9.532   29.405 -1.210  1.00 5.90  ? 193 ASN A O   1 
ATOM   1610 C  CB  . ASN A 1 193 ? 7.841   27.189 -0.842  1.00 6.14  ? 193 ASN A CB  1 
ATOM   1611 C  CG  . ASN A 1 193 ? 7.135   27.452 -2.159  1.00 5.77  ? 193 ASN A CG  1 
ATOM   1612 O  OD1 . ASN A 1 193 ? 7.796   27.668 -3.201  1.00 6.22  ? 193 ASN A OD1 1 
ATOM   1613 N  ND2 . ASN A 1 193 ? 5.817   27.462 -2.148  1.00 6.50  ? 193 ASN A ND2 1 
ATOM   1614 N  N   . TRP A 1 194 ? 11.027  28.147 -2.339  1.00 5.86  ? 194 TRP A N   1 
ATOM   1615 C  CA  . TRP A 1 194 ? 11.699  29.345 -2.827  1.00 5.74  ? 194 TRP A CA  1 
ATOM   1616 C  C   . TRP A 1 194 ? 10.810  30.122 -3.795  1.00 5.72  ? 194 TRP A C   1 
ATOM   1617 O  O   . TRP A 1 194 ? 11.003  31.319 -3.959  1.00 6.15  ? 194 TRP A O   1 
ATOM   1618 C  CB  . TRP A 1 194 ? 13.043  29.039 -3.449  1.00 6.16  ? 194 TRP A CB  1 
ATOM   1619 C  CG  . TRP A 1 194 ? 14.068  28.595 -2.447  1.00 6.23  ? 194 TRP A CG  1 
ATOM   1620 C  CD1 . TRP A 1 194 ? 14.690  27.379 -2.384  1.00 6.59  ? 194 TRP A CD1 1 
ATOM   1621 C  CD2 . TRP A 1 194 ? 14.592  29.372 -1.373  1.00 6.59  ? 194 TRP A CD2 1 
ATOM   1622 N  NE1 . TRP A 1 194 ? 15.580  27.350 -1.356  1.00 7.39  ? 194 TRP A NE1 1 
ATOM   1623 C  CE2 . TRP A 1 194 ? 15.531  28.554 -0.703  1.00 6.93  ? 194 TRP A CE2 1 
ATOM   1624 C  CE3 . TRP A 1 194 ? 14.353  30.670 -0.894  1.00 6.97  ? 194 TRP A CE3 1 
ATOM   1625 C  CZ2 . TRP A 1 194 ? 16.242  29.006 0.401   1.00 7.97  ? 194 TRP A CZ2 1 
ATOM   1626 C  CZ3 . TRP A 1 194 ? 15.058  31.120 0.223   1.00 7.98  ? 194 TRP A CZ3 1 
ATOM   1627 C  CH2 . TRP A 1 194 ? 15.985  30.295 0.855   1.00 8.22  ? 194 TRP A CH2 1 
ATOM   1628 N  N   . ASP A 1 195 ? 9.821   29.466 -4.423  1.00 5.78  ? 195 ASP A N   1 
ATOM   1629 C  CA  . ASP A 1 195 ? 8.920   30.189 -5.304  1.00 5.87  ? 195 ASP A CA  1 
ATOM   1630 C  C   . ASP A 1 195 ? 8.055   31.181 -4.521  1.00 5.91  ? 195 ASP A C   1 
ATOM   1631 O  O   . ASP A 1 195 ? 7.836   32.310 -4.962  1.00 6.08  ? 195 ASP A O   1 
ATOM   1632 C  CB  . ASP A 1 195 ? 8.039   29.217 -6.089  1.00 6.27  ? 195 ASP A CB  1 
ATOM   1633 C  CG  . ASP A 1 195 ? 8.814   28.280 -7.020  1.00 6.87  ? 195 ASP A CG  1 
ATOM   1634 O  OD1 . ASP A 1 195 ? 9.993   28.528 -7.280  1.00 8.42  ? 195 ASP A OD1 1 
ATOM   1635 O  OD2 . ASP A 1 195 ? 8.175   27.287 -7.466  1.00 8.31  ? 195 ASP A OD2 1 
ATOM   1636 N  N   . GLU A 1 196 ? 7.550   30.758 -3.367  1.00 5.91  ? 196 GLU A N   1 
ATOM   1637 C  CA  . GLU A 1 196 ? 6.744   31.656 -2.550  1.00 5.81  ? 196 GLU A CA  1 
ATOM   1638 C  C   . GLU A 1 196 ? 7.617   32.757 -1.948  1.00 5.64  ? 196 GLU A C   1 
ATOM   1639 O  O   . GLU A 1 196 ? 7.221   33.927 -1.887  1.00 5.96  ? 196 GLU A O   1 
ATOM   1640 C  CB  . GLU A 1 196 ? 5.999   30.915 -1.424  1.00 6.05  ? 196 GLU A CB  1 
ATOM   1641 C  CG  . GLU A 1 196 ? 4.979   31.824 -0.736  1.00 6.23  ? 196 GLU A CG  1 
ATOM   1642 C  CD  . GLU A 1 196 ? 3.792   32.232 -1.623  1.00 7.52  ? 196 GLU A CD  1 
ATOM   1643 O  OE1 . GLU A 1 196 ? 3.442   31.458 -2.550  1.00 8.52  ? 196 GLU A OE1 1 
ATOM   1644 O  OE2 . GLU A 1 196 ? 3.203   33.303 -1.361  1.00 10.76 ? 196 GLU A OE2 1 
ATOM   1645 N  N   . ALA A 1 197 ? 8.813   32.387 -1.488  1.00 5.78  ? 197 ALA A N   1 
ATOM   1646 C  CA  . ALA A 1 197 ? 9.749   33.393 -0.976  1.00 5.70  ? 197 ALA A CA  1 
ATOM   1647 C  C   . ALA A 1 197 ? 10.022  34.431 -2.057  1.00 5.66  ? 197 ALA A C   1 
ATOM   1648 O  O   . ALA A 1 197 ? 10.060  35.639 -1.787  1.00 6.04  ? 197 ALA A O   1 
ATOM   1649 C  CB  . ALA A 1 197 ? 11.027  32.686 -0.507  1.00 6.11  ? 197 ALA A CB  1 
ATOM   1650 N  N   . ALA A 1 198 ? 10.262  33.980 -3.292  1.00 5.76  ? 198 ALA A N   1 
ATOM   1651 C  CA  . ALA A 1 198 ? 10.527  34.880 -4.401  1.00 6.12  ? 198 ALA A CA  1 
ATOM   1652 C  C   . ALA A 1 198 ? 9.338   35.790 -4.689  1.00 5.85  ? 198 ALA A C   1 
ATOM   1653 O  O   . ALA A 1 198 ? 9.526   36.984 -4.986  1.00 6.20  ? 198 ALA A O   1 
ATOM   1654 C  CB  . ALA A 1 198 ? 10.893  34.096 -5.648  1.00 6.93  ? 198 ALA A CB  1 
ATOM   1655 N  N   . ALA A 1 199 ? 8.125   35.247 -4.622  1.00 5.75  ? 199 ALA A N   1 
ATOM   1656 C  CA  . ALA A 1 199 ? 6.932   36.066 -4.884  1.00 5.88  ? 199 ALA A CA  1 
ATOM   1657 C  C   . ALA A 1 199 ? 6.778   37.132 -3.803  1.00 5.70  ? 199 ALA A C   1 
ATOM   1658 O  O   . ALA A 1 199 ? 6.435   38.294 -4.095  1.00 6.18  ? 199 ALA A O   1 
ATOM   1659 C  CB  . ALA A 1 199 ? 5.700   35.173 -4.945  1.00 6.60  ? 199 ALA A CB  1 
ATOM   1660 N  N   . ARG A 1 200 ? 6.996   36.761 -2.546  1.00 5.67  ? 200 ARG A N   1 
ATOM   1661 C  CA  . ARG A 1 200 ? 6.903   37.716 -1.451  1.00 5.79  ? 200 ARG A CA  1 
ATOM   1662 C  C   . ARG A 1 200 ? 7.986   38.809 -1.589  1.00 5.90  ? 200 ARG A C   1 
ATOM   1663 O  O   . ARG A 1 200 ? 7.740   39.983 -1.375  1.00 6.38  ? 200 ARG A O   1 
ATOM   1664 C  CB  . ARG A 1 200 ? 6.992   36.968 -0.120  1.00 5.99  ? 200 ARG A CB  1 
ATOM   1665 C  CG  . ARG A 1 200 ? 5.716   36.136 0.137   1.00 5.75  ? 200 ARG A CG  1 
ATOM   1666 C  CD  . ARG A 1 200 ? 5.792   35.305 1.401   1.00 6.00  ? 200 ARG A CD  1 
ATOM   1667 N  NE  . ARG A 1 200 ? 5.850   36.085 2.634   1.00 6.24  ? 200 ARG A NE  1 
ATOM   1668 C  CZ  . ARG A 1 200 ? 4.783   36.600 3.263   1.00 6.06  ? 200 ARG A CZ  1 
ATOM   1669 N  NH1 . ARG A 1 200 ? 3.574   36.555 2.694   1.00 6.57  ? 200 ARG A NH1 1 
ATOM   1670 N  NH2 . ARG A 1 200 ? 4.942   37.187 4.431   1.00 7.06  ? 200 ARG A NH2 1 
ATOM   1671 N  N   . PHE A 1 201 ? 9.199   38.380 -1.971  1.00 6.09  ? 201 PHE A N   1 
ATOM   1672 C  CA  . PHE A 1 201 ? 10.274  39.342 -2.219  1.00 6.39  ? 201 PHE A CA  1 
ATOM   1673 C  C   . PHE A 1 201 ? 9.935   40.281 -3.351  1.00 6.44  ? 201 PHE A C   1 
ATOM   1674 O  O   . PHE A 1 201 ? 10.170  41.494 -3.252  1.00 6.82  ? 201 PHE A O   1 
ATOM   1675 C  CB  . PHE A 1 201 ? 11.587  38.577 -2.471  1.00 6.50  ? 201 PHE A CB  1 
ATOM   1676 C  CG  . PHE A 1 201 ? 12.778  39.506 -2.569  1.00 7.08  ? 201 PHE A CG  1 
ATOM   1677 C  CD1 . PHE A 1 201 ? 13.204  40.240 -1.483  1.00 8.17  ? 201 PHE A CD1 1 
ATOM   1678 C  CD2 . PHE A 1 201 ? 13.483  39.603 -3.750  1.00 7.89  ? 201 PHE A CD2 1 
ATOM   1679 C  CE1 . PHE A 1 201 ? 14.300  41.082 -1.562  1.00 9.17  ? 201 PHE A CE1 1 
ATOM   1680 C  CE2 . PHE A 1 201 ? 14.605  40.438 -3.826  1.00 9.13  ? 201 PHE A CE2 1 
ATOM   1681 C  CZ  . PHE A 1 201 ? 14.983  41.185 -2.750  1.00 9.27  ? 201 PHE A CZ  1 
ATOM   1682 N  N   . ALA A 1 202 ? 9.361   39.765 -4.446  1.00 6.21  ? 202 ALA A N   1 
ATOM   1683 C  CA  . ALA A 1 202 ? 8.999   40.620 -5.575  1.00 6.56  ? 202 ALA A CA  1 
ATOM   1684 C  C   . ALA A 1 202 ? 7.987   41.673 -5.155  1.00 6.53  ? 202 ALA A C   1 
ATOM   1685 O  O   . ALA A 1 202 ? 8.065   42.832 -5.622  1.00 7.15  ? 202 ALA A O   1 
ATOM   1686 C  CB  . ALA A 1 202 ? 8.453   39.782 -6.722  1.00 7.06  ? 202 ALA A CB  1 
ATOM   1687 N  N   . ALA A 1 203 ? 7.032   41.312 -4.311  1.00 6.25  ? 203 ALA A N   1 
ATOM   1688 C  CA  . ALA A 1 203 ? 5.998   42.248 -3.881  1.00 6.57  ? 203 ALA A CA  1 
ATOM   1689 C  C   . ALA A 1 203 ? 6.568   43.351 -2.982  1.00 6.77  ? 203 ALA A C   1 
ATOM   1690 O  O   . ALA A 1 203 ? 5.979   44.442 -2.906  1.00 8.11  ? 203 ALA A O   1 
ATOM   1691 C  CB  . ALA A 1 203 ? 4.892   41.516 -3.138  1.00 6.84  ? 203 ALA A CB  1 
ATOM   1692 N  N   . LYS A 1 204 ? 7.647   43.077 -2.254  1.00 7.35  ? 204 LYS A N   1 
ATOM   1693 C  CA  . LYS A 1 204 ? 8.121   43.938 -1.196  1.00 8.30  ? 204 LYS A CA  1 
ATOM   1694 C  C   . LYS A 1 204 ? 9.469   44.598 -1.444  1.00 9.20  ? 204 LYS A C   1 
ATOM   1695 O  O   . LYS A 1 204 ? 9.797   45.578 -0.716  1.00 11.26 ? 204 LYS A O   1 
ATOM   1696 C  CB  . LYS A 1 204 ? 8.148   43.157 0.138   1.00 8.59  ? 204 LYS A CB  1 
ATOM   1697 C  CG  . LYS A 1 204 ? 6.777   42.800 0.644   1.00 9.50  ? 204 LYS A CG  1 
ATOM   1698 C  CD  . LYS A 1 204 ? 6.066   44.057 1.124   1.00 11.64 ? 204 LYS A CD  1 
ATOM   1699 C  CE  . LYS A 1 204 ? 4.835   43.791 1.814   1.00 10.78 ? 204 LYS A CE  1 
ATOM   1700 N  NZ  . LYS A 1 204 ? 4.365   45.045 2.499   1.00 11.85 ? 204 LYS A NZ  1 
ATOM   1701 N  N   . LYS A 1 205 ? 10.252  44.146 -2.391  1.00 9.15  ? 205 LYS A N   1 
ATOM   1702 C  CA  . LYS A 1 205 ? 11.601  44.695 -2.604  1.00 11.01 ? 205 LYS A CA  1 
ATOM   1703 C  C   . LYS A 1 205 ? 11.562  46.165 -3.110  1.00 12.63 ? 205 LYS A C   1 
ATOM   1704 O  O   . LYS A 1 205 ? 10.570  46.624 -3.604  1.00 11.51 ? 205 LYS A O   1 
ATOM   1705 C  CB  . LYS A 1 205 ? 12.391  43.797 -3.536  0.77 10.22 ? 205 LYS A CB  1 
ATOM   1706 C  CG  . LYS A 1 205 ? 11.876  43.787 -4.994  0.77 9.74  ? 205 LYS A CG  1 
ATOM   1707 C  CD  . LYS A 1 205 ? 12.662  42.788 -5.806  0.77 13.16 ? 205 LYS A CD  1 
ATOM   1708 C  CE  . LYS A 1 205 ? 12.351  42.679 -7.275  0.77 19.90 ? 205 LYS A CE  1 
ATOM   1709 N  NZ  . LYS A 1 205 ? 12.845  43.924 -7.911  0.77 31.48 ? 205 LYS A NZ  1 
ATOM   1710 O  OXT . LYS A 1 205 ? 12.655  46.767 -3.024  1.00 21.10 ? 205 LYS A OXT 1 
ATOM   1711 N  N   A SER B 1 1   ? 32.072  16.831 36.346  0.44 24.61 ? 1   SER B N   1 
ATOM   1712 N  N   B SER B 1 1   ? 32.196  16.146 36.108  0.56 23.57 ? 1   SER B N   1 
ATOM   1713 C  CA  A SER B 1 1   ? 31.232  16.749 35.145  0.44 16.59 ? 1   SER B CA  1 
ATOM   1714 C  CA  B SER B 1 1   ? 31.229  16.414 35.045  0.56 18.75 ? 1   SER B CA  1 
ATOM   1715 C  C   A SER B 1 1   ? 29.890  16.146 35.526  0.44 15.21 ? 1   SER B C   1 
ATOM   1716 C  C   B SER B 1 1   ? 29.845  16.106 35.570  0.56 14.78 ? 1   SER B C   1 
ATOM   1717 O  O   A SER B 1 1   ? 29.689  15.158 36.233  0.44 13.51 ? 1   SER B O   1 
ATOM   1718 O  O   B SER B 1 1   ? 29.672  15.259 36.432  0.56 19.05 ? 1   SER B O   1 
ATOM   1719 C  CB  A SER B 1 1   ? 31.906  15.948 34.040  0.44 21.72 ? 1   SER B CB  1 
ATOM   1720 C  CB  B SER B 1 1   ? 31.521  15.545 33.829  0.56 17.13 ? 1   SER B CB  1 
ATOM   1721 O  OG  A SER B 1 1   ? 31.025  15.029 33.435  0.44 29.41 ? 1   SER B OG  1 
ATOM   1722 O  OG  B SER B 1 1   ? 32.790  15.772 33.297  0.56 17.75 ? 1   SER B OG  1 
ATOM   1723 N  N   . TYR B 1 2   ? 28.839  16.798 35.061  1.00 10.98 ? 2   TYR B N   1 
ATOM   1724 C  CA  . TYR B 1 2   ? 27.501  16.327 35.247  1.00 10.56 ? 2   TYR B CA  1 
ATOM   1725 C  C   . TYR B 1 2   ? 27.320  14.987 34.521  1.00 10.24 ? 2   TYR B C   1 
ATOM   1726 O  O   . TYR B 1 2   ? 27.978  14.732 33.503  1.00 10.47 ? 2   TYR B O   1 
ATOM   1727 C  CB  . TYR B 1 2   ? 26.511  17.308 34.600  1.00 10.50 ? 2   TYR B CB  1 
ATOM   1728 C  CG  . TYR B 1 2   ? 26.460  18.700 35.184  1.00 10.20 ? 2   TYR B CG  1 
ATOM   1729 C  CD1 . TYR B 1 2   ? 26.904  19.025 36.426  1.00 10.94 ? 2   TYR B CD1 1 
ATOM   1730 C  CD2 . TYR B 1 2   ? 25.868  19.734 34.475  1.00 11.20 ? 2   TYR B CD2 1 
ATOM   1731 C  CE1 . TYR B 1 2   ? 26.813  20.298 36.964  1.00 11.09 ? 2   TYR B CE1 1 
ATOM   1732 C  CE2 . TYR B 1 2   ? 25.743  21.021 34.933  1.00 10.49 ? 2   TYR B CE2 1 
ATOM   1733 C  CZ  . TYR B 1 2   ? 26.237  21.314 36.191  1.00 9.50  ? 2   TYR B CZ  1 
ATOM   1734 O  OH  . TYR B 1 2   ? 26.092  22.605 36.631  1.00 9.87  ? 2   TYR B OH  1 
ATOM   1735 N  N   . THR B 1 3   ? 26.420  14.182 35.037  1.00 10.97 ? 3   THR B N   1 
ATOM   1736 C  CA  . THR B 1 3   ? 26.037  12.947 34.425  1.00 11.00 ? 3   THR B CA  1 
ATOM   1737 C  C   . THR B 1 3   ? 24.509  12.836 34.421  1.00 10.61 ? 3   THR B C   1 
ATOM   1738 O  O   . THR B 1 3   ? 23.797  13.466 35.193  1.00 11.80 ? 3   THR B O   1 
ATOM   1739 C  CB  . THR B 1 3   ? 26.588  11.719 35.149  1.00 12.50 ? 3   THR B CB  1 
ATOM   1740 O  OG1 . THR B 1 3   ? 26.054  11.672 36.457  1.00 15.27 ? 3   THR B OG1 1 
ATOM   1741 C  CG2 . THR B 1 3   ? 28.104  11.795 35.211  1.00 15.84 ? 3   THR B CG2 1 
ATOM   1742 N  N   . LEU B 1 4   ? 24.006  12.022 33.506  1.00 10.95 ? 4   LEU B N   1 
ATOM   1743 C  CA  . LEU B 1 4   ? 22.571  11.748 33.448  1.00 10.46 ? 4   LEU B CA  1 
ATOM   1744 C  C   . LEU B 1 4   ? 22.219  10.877 34.627  1.00 10.56 ? 4   LEU B C   1 
ATOM   1745 O  O   . LEU B 1 4   ? 22.770  9.759  34.746  1.00 11.86 ? 4   LEU B O   1 
ATOM   1746 C  CB  . LEU B 1 4   ? 22.233  11.011 32.153  1.00 10.80 ? 4   LEU B CB  1 
ATOM   1747 C  CG  . LEU B 1 4   ? 20.731  10.752 31.985  1.00 10.26 ? 4   LEU B CG  1 
ATOM   1748 C  CD1 . LEU B 1 4   ? 19.993  12.040 31.663  1.00 11.48 ? 4   LEU B CD1 1 
ATOM   1749 C  CD2 . LEU B 1 4   ? 20.498  9.710  30.898  1.00 12.15 ? 4   LEU B CD2 1 
ATOM   1750 N  N   . PRO B 1 5   ? 21.365  11.299 35.528  1.00 10.45 ? 5   PRO B N   1 
ATOM   1751 C  CA  . PRO B 1 5   ? 21.081  10.474 36.719  1.00 10.82 ? 5   PRO B CA  1 
ATOM   1752 C  C   . PRO B 1 5   ? 20.254  9.275  36.333  1.00 10.80 ? 5   PRO B C   1 
ATOM   1753 O  O   . PRO B 1 5   ? 19.319  9.348  35.517  1.00 12.24 ? 5   PRO B O   1 
ATOM   1754 C  CB  . PRO B 1 5   ? 20.277  11.445 37.606  1.00 11.74 ? 5   PRO B CB  1 
ATOM   1755 C  CG  . PRO B 1 5   ? 19.561  12.335 36.633  1.00 12.34 ? 5   PRO B CG  1 
ATOM   1756 C  CD  . PRO B 1 5   ? 20.573  12.552 35.498  1.00 10.61 ? 5   PRO B CD  1 
ATOM   1757 N  N   . SER B 1 6   ? 20.534  8.123  36.946  1.00 12.33 ? 6   SER B N   1 
ATOM   1758 C  CA  . SER B 1 6   ? 19.645  6.984  36.835  1.00 13.62 ? 6   SER B CA  1 
ATOM   1759 C  C   . SER B 1 6   ? 18.314  7.386  37.450  1.00 12.14 ? 6   SER B C   1 
ATOM   1760 O  O   . SER B 1 6   ? 18.275  8.148  38.418  1.00 12.53 ? 6   SER B O   1 
ATOM   1761 C  CB  . SER B 1 6   ? 20.105  5.742  37.541  1.00 16.92 ? 6   SER B CB  1 
ATOM   1762 O  OG  . SER B 1 6   ? 20.551  5.995  38.857  1.00 22.25 ? 6   SER B OG  1 
ATOM   1763 N  N   . LEU B 1 7   ? 17.189  6.913  36.874  1.00 14.72 ? 7   LEU B N   1 
ATOM   1764 C  CA  . LEU B 1 7   ? 15.888  7.198  37.434  1.00 13.58 ? 7   LEU B CA  1 
ATOM   1765 C  C   . LEU B 1 7   ? 15.633  6.399  38.708  1.00 13.37 ? 7   LEU B C   1 
ATOM   1766 O  O   . LEU B 1 7   ? 16.233  5.354  38.965  1.00 17.90 ? 7   LEU B O   1 
ATOM   1767 C  CB  . LEU B 1 7   ? 14.765  6.846  36.450  1.00 12.85 ? 7   LEU B CB  1 
ATOM   1768 C  CG  . LEU B 1 7   ? 14.783  7.644  35.153  1.00 14.55 ? 7   LEU B CG  1 
ATOM   1769 C  CD1 . LEU B 1 7   ? 13.518  7.258  34.380  1.00 21.03 ? 7   LEU B CD1 1 
ATOM   1770 C  CD2 . LEU B 1 7   ? 14.774  9.115  35.403  1.00 23.66 ? 7   LEU B CD2 1 
ATOM   1771 N  N   . PRO B 1 8   ? 14.666  6.830  39.516  1.00 13.33 ? 8   PRO B N   1 
ATOM   1772 C  CA  . PRO B 1 8   ? 14.246  6.069  40.733  1.00 14.61 ? 8   PRO B CA  1 
ATOM   1773 C  C   . PRO B 1 8   ? 13.410  4.825  40.446  1.00 13.86 ? 8   PRO B C   1 
ATOM   1774 O  O   . PRO B 1 8   ? 13.010  4.126  41.355  1.00 18.83 ? 8   PRO B O   1 
ATOM   1775 C  CB  . PRO B 1 8   ? 13.438  7.078  41.560  1.00 14.95 ? 8   PRO B CB  1 
ATOM   1776 C  CG  . PRO B 1 8   ? 13.654  8.376  40.903  1.00 13.99 ? 8   PRO B CG  1 
ATOM   1777 C  CD  . PRO B 1 8   ? 13.983  8.109  39.465  1.00 12.54 ? 8   PRO B CD  1 
ATOM   1778 N  N   . TYR B 1 9   ? 13.105  4.558  39.190  1.00 12.49 ? 9   TYR B N   1 
ATOM   1779 C  CA  . TYR B 1 9   ? 12.109  3.609  38.786  1.00 12.38 ? 9   TYR B CA  1 
ATOM   1780 C  C   . TYR B 1 9   ? 12.377  3.247  37.326  1.00 11.88 ? 9   TYR B C   1 
ATOM   1781 O  O   . TYR B 1 9   ? 13.104  3.903  36.585  1.00 12.73 ? 9   TYR B O   1 
ATOM   1782 C  CB  . TYR B 1 9   ? 10.649  4.141  39.016  1.00 12.34 ? 9   TYR B CB  1 
ATOM   1783 C  CG  . TYR B 1 9   ? 10.578  5.602  38.631  1.00 11.02 ? 9   TYR B CG  1 
ATOM   1784 C  CD1 . TYR B 1 9   ? 10.692  5.993  37.318  1.00 11.71 ? 9   TYR B CD1 1 
ATOM   1785 C  CD2 . TYR B 1 9   ? 10.407  6.589  39.578  1.00 11.11 ? 9   TYR B CD2 1 
ATOM   1786 C  CE1 . TYR B 1 9   ? 10.600  7.347  36.949  1.00 10.65 ? 9   TYR B CE1 1 
ATOM   1787 C  CE2 . TYR B 1 9   ? 10.382  7.929  39.251  1.00 10.88 ? 9   TYR B CE2 1 
ATOM   1788 C  CZ  . TYR B 1 9   ? 10.475  8.314  37.913  1.00 10.05 ? 9   TYR B CZ  1 
ATOM   1789 O  OH  . TYR B 1 9   ? 10.512  9.622  37.561  1.00 10.17 ? 9   TYR B OH  1 
ATOM   1790 N  N   . ALA B 1 10  ? 11.754  2.169  36.856  1.00 12.03 ? 10  ALA B N   1 
ATOM   1791 C  CA  . ALA B 1 10  ? 11.715  1.763  35.471  1.00 12.51 ? 10  ALA B CA  1 
ATOM   1792 C  C   . ALA B 1 10  ? 10.928  2.763  34.634  1.00 10.65 ? 10  ALA B C   1 
ATOM   1793 O  O   . ALA B 1 10  ? 10.069  3.502  35.167  1.00 11.56 ? 10  ALA B O   1 
ATOM   1794 C  CB  . ALA B 1 10  ? 11.063  0.372  35.365  1.00 16.12 ? 10  ALA B CB  1 
ATOM   1795 N  N   . TYR B 1 11  ? 11.107  2.756  33.321  1.00 11.13 ? 11  TYR B N   1 
ATOM   1796 C  CA  . TYR B 1 11  ? 10.445  3.729  32.469  1.00 11.15 ? 11  TYR B CA  1 
ATOM   1797 C  C   . TYR B 1 11  ? 8.950   3.564  32.495  1.00 10.22 ? 11  TYR B C   1 
ATOM   1798 O  O   . TYR B 1 11  ? 8.222   4.527  32.179  1.00 10.72 ? 11  TYR B O   1 
ATOM   1799 C  CB  . TYR B 1 11  ? 10.993  3.658  31.040  1.00 11.67 ? 11  TYR B CB  1 
ATOM   1800 C  CG  . TYR B 1 11  ? 12.422  4.186  30.906  1.00 12.26 ? 11  TYR B CG  1 
ATOM   1801 C  CD1 . TYR B 1 11  ? 12.750  5.471  31.317  1.00 12.91 ? 11  TYR B CD1 1 
ATOM   1802 C  CD2 . TYR B 1 11  ? 13.441  3.414  30.382  1.00 14.26 ? 11  TYR B CD2 1 
ATOM   1803 C  CE1 . TYR B 1 11  ? 14.035  5.958  31.205  1.00 12.38 ? 11  TYR B CE1 1 
ATOM   1804 C  CE2 . TYR B 1 11  ? 14.737  3.875  30.247  1.00 14.15 ? 11  TYR B CE2 1 
ATOM   1805 C  CZ  . TYR B 1 11  ? 14.994  5.187  30.687  1.00 13.70 ? 11  TYR B CZ  1 
ATOM   1806 O  OH  . TYR B 1 11  ? 16.327  5.619  30.556  1.00 15.11 ? 11  TYR B OH  1 
ATOM   1807 N  N   . ASP B 1 12  ? 8.438   2.368  32.785  1.00 11.10 ? 12  ASP B N   1 
ATOM   1808 C  CA  . ASP B 1 12  ? 6.992   2.100  32.826  1.00 11.35 ? 12  ASP B CA  1 
ATOM   1809 C  C   . ASP B 1 12  ? 6.389   2.273  34.204  1.00 10.75 ? 12  ASP B C   1 
ATOM   1810 O  O   . ASP B 1 12  ? 5.183   1.975  34.368  1.00 12.44 ? 12  ASP B O   1 
ATOM   1811 C  CB  . ASP B 1 12  ? 6.674   0.692  32.299  1.00 12.99 ? 12  ASP B CB  1 
ATOM   1812 C  CG  . ASP B 1 12  ? 7.139   -0.425 33.183  1.00 16.08 ? 12  ASP B CG  1 
ATOM   1813 O  OD1 . ASP B 1 12  ? 7.842   -0.206 34.187  1.00 17.10 ? 12  ASP B OD1 1 
ATOM   1814 O  OD2 . ASP B 1 12  ? 6.788   -1.553 32.858  1.00 24.56 ? 12  ASP B OD2 1 
ATOM   1815 N  N   . ALA B 1 13  ? 7.125   2.831  35.141  1.00 10.88 ? 13  ALA B N   1 
ATOM   1816 C  CA  . ALA B 1 13  ? 6.635   2.854  36.508  1.00 11.61 ? 13  ALA B CA  1 
ATOM   1817 C  C   . ALA B 1 13  ? 5.517   3.881  36.764  1.00 10.86 ? 13  ALA B C   1 
ATOM   1818 O  O   . ALA B 1 13  ? 4.922   3.892  37.848  1.00 13.50 ? 13  ALA B O   1 
ATOM   1819 C  CB  . ALA B 1 13  ? 7.770   3.164  37.462  1.00 12.87 ? 13  ALA B CB  1 
ATOM   1820 N  N   . LEU B 1 14  ? 5.321   4.783  35.821  1.00 10.39 ? 14  LEU B N   1 
ATOM   1821 C  CA  . LEU B 1 14  ? 4.280   5.815  35.928  1.00 9.91  ? 14  LEU B CA  1 
ATOM   1822 C  C   . LEU B 1 14  ? 3.060   5.499  35.079  1.00 9.98  ? 14  LEU B C   1 
ATOM   1823 O  O   . LEU B 1 14  ? 2.108   6.295  35.035  1.00 10.70 ? 14  LEU B O   1 
ATOM   1824 C  CB  . LEU B 1 14  ? 4.869   7.184  35.640  1.00 9.98  ? 14  LEU B CB  1 
ATOM   1825 C  CG  . LEU B 1 14  ? 6.074   7.588  36.454  1.00 9.91  ? 14  LEU B CG  1 
ATOM   1826 C  CD1 . LEU B 1 14  ? 6.501   8.976  36.070  1.00 10.62 ? 14  LEU B CD1 1 
ATOM   1827 C  CD2 . LEU B 1 14  ? 5.872   7.514  37.975  1.00 10.93 ? 14  LEU B CD2 1 
ATOM   1828 N  N   . GLU B 1 15  ? 3.060   4.334  34.446  1.00 10.41 ? 15  GLU B N   1 
ATOM   1829 C  CA  . GLU B 1 15  ? 1.872   3.906  33.724  1.00 10.82 ? 15  GLU B CA  1 
ATOM   1830 C  C   . GLU B 1 15  ? 0.771   3.627  34.757  1.00 11.79 ? 15  GLU B C   1 
ATOM   1831 O  O   . GLU B 1 15  ? 1.060   3.176  35.880  1.00 13.72 ? 15  GLU B O   1 
ATOM   1832 C  CB  . GLU B 1 15  ? 2.169   2.591  32.967  1.00 11.31 ? 15  GLU B CB  1 
ATOM   1833 C  CG  . GLU B 1 15  ? 3.113   2.792  31.795  1.00 10.95 ? 15  GLU B CG  1 
ATOM   1834 C  CD  . GLU B 1 15  ? 2.495   3.414  30.559  1.00 10.29 ? 15  GLU B CD  1 
ATOM   1835 O  OE1 . GLU B 1 15  ? 1.302   3.748  30.607  1.00 11.31 ? 15  GLU B OE1 1 
ATOM   1836 O  OE2 . GLU B 1 15  ? 3.233   3.559  29.561  1.00 10.96 ? 15  GLU B OE2 1 
ATOM   1837 N  N   . PRO B 1 16  ? -0.482  3.832  34.421  1.00 12.71 ? 16  PRO B N   1 
ATOM   1838 C  CA  . PRO B 1 16  ? -0.994  4.211  33.116  1.00 12.69 ? 16  PRO B CA  1 
ATOM   1839 C  C   . PRO B 1 16  ? -1.132  5.702  32.901  1.00 12.26 ? 16  PRO B C   1 
ATOM   1840 O  O   . PRO B 1 16  ? -1.872  6.142  32.014  1.00 15.14 ? 16  PRO B O   1 
ATOM   1841 C  CB  . PRO B 1 16  ? -2.400  3.580  33.111  1.00 14.64 ? 16  PRO B CB  1 
ATOM   1842 C  CG  . PRO B 1 16  ? -2.836  3.784  34.549  1.00 15.02 ? 16  PRO B CG  1 
ATOM   1843 C  CD  . PRO B 1 16  ? -1.584  3.478  35.318  1.00 14.42 ? 16  PRO B CD  1 
ATOM   1844 N  N   . HIS B 1 17  ? -0.413  6.515  33.663  1.00 10.56 ? 17  HIS B N   1 
ATOM   1845 C  CA  . HIS B 1 17  ? -0.581  7.981  33.686  1.00 9.58  ? 17  HIS B CA  1 
ATOM   1846 C  C   . HIS B 1 17  ? 0.344   8.690  32.714  1.00 9.59  ? 17  HIS B C   1 
ATOM   1847 O  O   . HIS B 1 17  ? -0.115  9.470  31.852  1.00 10.59 ? 17  HIS B O   1 
ATOM   1848 C  CB  . HIS B 1 17  ? -0.422  8.495  35.114  1.00 9.60  ? 17  HIS B CB  1 
ATOM   1849 C  CG  . HIS B 1 17  ? -1.214  7.698  36.100  1.00 10.07 ? 17  HIS B CG  1 
ATOM   1850 N  ND1 . HIS B 1 17  ? -2.616  7.686  36.019  1.00 11.70 ? 17  HIS B ND1 1 
ATOM   1851 C  CD2 . HIS B 1 17  ? -0.860  6.851  37.098  1.00 12.37 ? 17  HIS B CD2 1 
ATOM   1852 C  CE1 . HIS B 1 17  ? -3.025  6.831  37.007  1.00 13.77 ? 17  HIS B CE1 1 
ATOM   1853 N  NE2 . HIS B 1 17  ? -2.002  6.332  37.657  1.00 14.08 ? 17  HIS B NE2 1 
ATOM   1854 N  N   . PHE B 1 18  ? 1.647   8.480  32.890  1.00 9.35  ? 18  PHE B N   1 
ATOM   1855 C  CA  . PHE B 1 18  ? 2.679   9.017  31.977  1.00 9.20  ? 18  PHE B CA  1 
ATOM   1856 C  C   . PHE B 1 18  ? 3.237   7.845  31.204  1.00 9.11  ? 18  PHE B C   1 
ATOM   1857 O  O   . PHE B 1 18  ? 3.563   6.799  31.773  1.00 10.38 ? 18  PHE B O   1 
ATOM   1858 C  CB  . PHE B 1 18  ? 3.789   9.733  32.715  1.00 9.50  ? 18  PHE B CB  1 
ATOM   1859 C  CG  . PHE B 1 18  ? 3.501   11.092 33.292  1.00 9.14  ? 18  PHE B CG  1 
ATOM   1860 C  CD1 . PHE B 1 18  ? 2.239   11.682 33.268  1.00 9.38  ? 18  PHE B CD1 1 
ATOM   1861 C  CD2 . PHE B 1 18  ? 4.526   11.812 33.881  1.00 9.37  ? 18  PHE B CD2 1 
ATOM   1862 C  CE1 . PHE B 1 18  ? 2.044   12.952 33.770  1.00 9.62  ? 18  PHE B CE1 1 
ATOM   1863 C  CE2 . PHE B 1 18  ? 4.335   13.081 34.401  1.00 9.37  ? 18  PHE B CE2 1 
ATOM   1864 C  CZ  . PHE B 1 18  ? 3.086   13.657 34.342  1.00 9.25  ? 18  PHE B CZ  1 
ATOM   1865 N  N   . ASP B 1 19  ? 3.355   7.977  29.892  1.00 8.93  ? 19  ASP B N   1 
ATOM   1866 C  CA  . ASP B 1 19  ? 3.712   6.879  29.036  1.00 9.20  ? 19  ASP B CA  1 
ATOM   1867 C  C   . ASP B 1 19  ? 5.201   6.552  29.037  1.00 9.16  ? 19  ASP B C   1 
ATOM   1868 O  O   . ASP B 1 19  ? 6.055   7.413  29.017  1.00 9.06  ? 19  ASP B O   1 
ATOM   1869 C  CB  . ASP B 1 19  ? 3.268   7.146  27.594  1.00 9.54  ? 19  ASP B CB  1 
ATOM   1870 C  CG  . ASP B 1 19  ? 3.866   8.409  26.985  1.00 9.39  ? 19  ASP B CG  1 
ATOM   1871 O  OD1 . ASP B 1 19  ? 3.580   9.494  27.525  1.00 9.65  ? 19  ASP B OD1 1 
ATOM   1872 O  OD2 . ASP B 1 19  ? 4.611   8.263  25.978  1.00 9.96  ? 19  ASP B OD2 1 
ATOM   1873 N  N   . LYS B 1 20  ? 5.458   5.220  29.022  1.00 8.92  ? 20  LYS B N   1 
ATOM   1874 C  CA  . LYS B 1 20  ? 6.827   4.721  29.132  1.00 9.61  ? 20  LYS B CA  1 
ATOM   1875 C  C   . LYS B 1 20  ? 7.711   5.188  27.963  1.00 9.06  ? 20  LYS B C   1 
ATOM   1876 O  O   . LYS B 1 20  ? 8.903   5.407  28.181  1.00 10.20 ? 20  LYS B O   1 
ATOM   1877 C  CB  . LYS B 1 20  ? 6.792   3.219  29.333  1.00 11.75 ? 20  LYS B CB  1 
ATOM   1878 C  CG  . LYS B 1 20  ? 6.239   2.462  28.177  1.00 12.02 ? 20  LYS B CG  1 
ATOM   1879 C  CD  . LYS B 1 20  ? 6.019   1.001  28.552  1.00 15.15 ? 20  LYS B CD  1 
ATOM   1880 C  CE  . LYS B 1 20  ? 5.546   0.165  27.389  1.00 22.53 ? 20  LYS B CE  1 
ATOM   1881 N  NZ  . LYS B 1 20  ? 5.141   -1.201 27.889  1.00 34.71 ? 20  LYS B NZ  1 
ATOM   1882 N  N   . GLN B 1 21  ? 7.184   5.279  26.751  1.00 9.29  ? 21  GLN B N   1 
ATOM   1883 C  CA  . GLN B 1 21  ? 8.073   5.663  25.642  1.00 9.50  ? 21  GLN B CA  1 
ATOM   1884 C  C   . GLN B 1 21  ? 8.549   7.103  25.839  1.00 9.41  ? 21  GLN B C   1 
ATOM   1885 O  O   . GLN B 1 21  ? 9.706   7.388  25.615  1.00 10.10 ? 21  GLN B O   1 
ATOM   1886 C  CB  A GLN B 1 21  ? 7.342   5.500  24.304  0.47 9.15  ? 21  GLN B CB  1 
ATOM   1887 C  CB  B GLN B 1 21  ? 7.365   5.532  24.299  0.53 12.04 ? 21  GLN B CB  1 
ATOM   1888 C  CG  A GLN B 1 21  ? 8.227   5.635  23.077  0.47 9.88  ? 21  GLN B CG  1 
ATOM   1889 C  CG  B GLN B 1 21  ? 8.105   6.033  23.061  0.53 15.06 ? 21  GLN B CG  1 
ATOM   1890 C  CD  A GLN B 1 21  ? 7.593   5.501  21.716  0.47 12.30 ? 21  GLN B CD  1 
ATOM   1891 C  CD  B GLN B 1 21  ? 9.265   5.108  22.673  0.53 16.76 ? 21  GLN B CD  1 
ATOM   1892 O  OE1 A GLN B 1 21  ? 8.112   5.945  20.650  0.47 19.01 ? 21  GLN B OE1 1 
ATOM   1893 O  OE1 B GLN B 1 21  ? 9.381   4.127  23.392  0.53 17.80 ? 21  GLN B OE1 1 
ATOM   1894 N  NE2 A GLN B 1 21  ? 6.432   4.834  21.659  0.47 17.60 ? 21  GLN B NE2 1 
ATOM   1895 N  NE2 B GLN B 1 21  ? 9.996   5.475  21.651  0.53 24.85 ? 21  GLN B NE2 1 
ATOM   1896 N  N   . THR B 1 22  ? 7.646   8.009  26.223  1.00 9.40  ? 22  THR B N   1 
ATOM   1897 C  CA  . THR B 1 22  ? 8.074   9.364  26.536  1.00 8.82  ? 22  THR B CA  1 
ATOM   1898 C  C   . THR B 1 22  ? 9.068   9.378  27.655  1.00 8.48  ? 22  THR B C   1 
ATOM   1899 O  O   . THR B 1 22  ? 10.075  10.074 27.598  1.00 9.05  ? 22  THR B O   1 
ATOM   1900 C  CB  . THR B 1 22  ? 6.891   10.266 26.875  1.00 9.18  ? 22  THR B CB  1 
ATOM   1901 O  OG1 . THR B 1 22  ? 6.102   10.416 25.663  1.00 10.14 ? 22  THR B OG1 1 
ATOM   1902 C  CG2 . THR B 1 22  ? 7.331   11.644 27.345  1.00 10.64 ? 22  THR B CG2 1 
ATOM   1903 N  N   . MET B 1 23  ? 8.835   8.626  28.740  1.00 8.72  ? 23  MET B N   1 
ATOM   1904 C  CA  . MET B 1 23  ? 9.820   8.629  29.827  1.00 8.87  ? 23  MET B CA  1 
ATOM   1905 C  C   . MET B 1 23  ? 11.227  8.329  29.305  1.00 8.76  ? 23  MET B C   1 
ATOM   1906 O  O   . MET B 1 23  ? 12.197  8.952  29.689  1.00 9.47  ? 23  MET B O   1 
ATOM   1907 C  CB  . MET B 1 23  ? 9.409   7.660  30.929  1.00 9.61  ? 23  MET B CB  1 
ATOM   1908 C  CG  . MET B 1 23  ? 8.143   8.045  31.671  1.00 9.50  ? 23  MET B CG  1 
ATOM   1909 S  SD  . MET B 1 23  ? 8.167   9.560  32.612  1.00 9.76  ? 23  MET B SD  1 
ATOM   1910 C  CE  . MET B 1 23  ? 9.383   9.210  33.857  1.00 11.30 ? 23  MET B CE  1 
ATOM   1911 N  N   . GLU B 1 24  ? 11.304  7.271  28.472  1.00 8.87  ? 24  GLU B N   1 
ATOM   1912 C  CA  . GLU B 1 24  ? 12.597  6.862  27.977  1.00 9.35  ? 24  GLU B CA  1 
ATOM   1913 C  C   . GLU B 1 24  ? 13.261  7.912  27.052  1.00 9.32  ? 24  GLU B C   1 
ATOM   1914 O  O   . GLU B 1 24  ? 14.451  8.192  27.175  1.00 9.47  ? 24  GLU B O   1 
ATOM   1915 C  CB  . GLU B 1 24  ? 12.494  5.512  27.290  1.00 10.74 ? 24  GLU B CB  1 
ATOM   1916 C  CG  . GLU B 1 24  ? 13.798  4.959  26.774  1.00 13.02 ? 24  GLU B CG  1 
ATOM   1917 C  CD  . GLU B 1 24  ? 13.718  3.523  26.362  1.00 18.99 ? 24  GLU B CD  1 
ATOM   1918 O  OE1 . GLU B 1 24  ? 12.684  2.864  26.502  1.00 21.84 ? 24  GLU B OE1 1 
ATOM   1919 O  OE2 . GLU B 1 24  ? 14.771  2.994  25.948  1.00 27.97 ? 24  GLU B OE2 1 
ATOM   1920 N  N   . ILE B 1 25  ? 12.498  8.470  26.117  1.00 8.91  ? 25  ILE B N   1 
ATOM   1921 C  CA  . ILE B 1 25  ? 13.023  9.505  25.223  1.00 8.62  ? 25  ILE B CA  1 
ATOM   1922 C  C   . ILE B 1 25  ? 13.462  10.718 26.042  1.00 7.96  ? 25  ILE B C   1 
ATOM   1923 O  O   . ILE B 1 25  ? 14.524  11.288 25.868  1.00 8.41  ? 25  ILE B O   1 
ATOM   1924 C  CB  . ILE B 1 25  ? 11.969  9.906  24.174  1.00 9.35  ? 25  ILE B CB  1 
ATOM   1925 C  CG1 . ILE B 1 25  ? 11.623  8.747  23.223  1.00 10.50 ? 25  ILE B CG1 1 
ATOM   1926 C  CG2 . ILE B 1 25  ? 12.433  11.115 23.414  1.00 9.70  ? 25  ILE B CG2 1 
ATOM   1927 C  CD1 . ILE B 1 25  ? 10.339  9.036  22.441  1.00 12.13 ? 25  ILE B CD1 1 
ATOM   1928 N  N   . HIS B 1 26  ? 12.547  11.144 26.918  1.00 8.01  ? 26  HIS B N   1 
ATOM   1929 C  CA  . HIS B 1 26  ? 12.712  12.357 27.698  1.00 7.65  ? 26  HIS B CA  1 
ATOM   1930 C  C   . HIS B 1 26  ? 14.012  12.303 28.532  1.00 7.53  ? 26  HIS B C   1 
ATOM   1931 O  O   . HIS B 1 26  ? 14.738  13.271 28.629  1.00 7.81  ? 26  HIS B O   1 
ATOM   1932 C  CB  . HIS B 1 26  ? 11.458  12.516 28.532  1.00 7.60  ? 26  HIS B CB  1 
ATOM   1933 C  CG  . HIS B 1 26  ? 11.264  13.839 29.177  1.00 7.04  ? 26  HIS B CG  1 
ATOM   1934 N  ND1 . HIS B 1 26  ? 10.171  14.076 29.997  1.00 7.49  ? 26  HIS B ND1 1 
ATOM   1935 C  CD2 . HIS B 1 26  ? 11.960  15.006 29.171  1.00 7.05  ? 26  HIS B CD2 1 
ATOM   1936 C  CE1 . HIS B 1 26  ? 10.241  15.336 30.405  1.00 7.20  ? 26  HIS B CE1 1 
ATOM   1937 N  NE2 . HIS B 1 26  ? 11.306  15.948 29.934  1.00 6.81  ? 26  HIS B NE2 1 
ATOM   1938 N  N   . HIS B 1 27  ? 14.227  11.125 29.142  1.00 7.82  ? 27  HIS B N   1 
ATOM   1939 C  CA  . HIS B 1 27  ? 15.421  10.908 29.947  1.00 8.51  ? 27  HIS B CA  1 
ATOM   1940 C  C   . HIS B 1 27  ? 16.698  10.796 29.081  1.00 8.30  ? 27  HIS B C   1 
ATOM   1941 O  O   . HIS B 1 27  ? 17.664  11.528 29.283  1.00 8.93  ? 27  HIS B O   1 
ATOM   1942 C  CB  . HIS B 1 27  ? 15.198  9.679  30.794  1.00 8.76  ? 27  HIS B CB  1 
ATOM   1943 C  CG  . HIS B 1 27  ? 16.299  9.328  31.737  1.00 9.48  ? 27  HIS B CG  1 
ATOM   1944 N  ND1 . HIS B 1 27  ? 16.862  8.055  31.679  1.00 11.63 ? 27  HIS B ND1 1 
ATOM   1945 C  CD2 . HIS B 1 27  ? 16.868  10.035 32.717  1.00 10.54 ? 27  HIS B CD2 1 
ATOM   1946 C  CE1 . HIS B 1 27  ? 17.756  8.047  32.642  1.00 12.47 ? 27  HIS B CE1 1 
ATOM   1947 N  NE2 . HIS B 1 27  ? 17.817  9.213  33.318  1.00 11.18 ? 27  HIS B NE2 1 
ATOM   1948 N  N   . THR B 1 28  ? 16.654  9.839  28.153  1.00 8.49  ? 28  THR B N   1 
ATOM   1949 C  CA  . THR B 1 28  ? 17.877  9.492  27.438  1.00 8.80  ? 28  THR B CA  1 
ATOM   1950 C  C   . THR B 1 28  ? 18.300  10.455 26.356  1.00 8.42  ? 28  THR B C   1 
ATOM   1951 O  O   . THR B 1 28  ? 19.463  10.423 25.951  1.00 9.29  ? 28  THR B O   1 
ATOM   1952 C  CB  . THR B 1 28  ? 17.813  8.053  26.838  1.00 9.78  ? 28  THR B CB  1 
ATOM   1953 O  OG1 . THR B 1 28  ? 16.837  8.042  25.804  1.00 10.65 ? 28  THR B OG1 1 
ATOM   1954 C  CG2 . THR B 1 28  ? 17.551  7.010  27.897  1.00 11.95 ? 28  THR B CG2 1 
ATOM   1955 N  N   . LYS B 1 29  ? 17.348  11.257 25.857  1.00 8.50  ? 29  LYS B N   1 
ATOM   1956 C  CA  . LYS B 1 29  ? 17.604  12.218 24.776  1.00 8.60  ? 29  LYS B CA  1 
ATOM   1957 C  C   . LYS B 1 29  ? 17.584  13.630 25.343  1.00 7.81  ? 29  LYS B C   1 
ATOM   1958 O  O   . LYS B 1 29  ? 18.598  14.303 25.428  1.00 8.73  ? 29  LYS B O   1 
ATOM   1959 C  CB  . LYS B 1 29  ? 16.652  12.009 23.612  1.00 9.13  ? 29  LYS B CB  1 
ATOM   1960 C  CG  A LYS B 1 29  ? 16.683  10.675 22.933  0.31 9.71  ? 29  LYS B CG  1 
ATOM   1961 C  CG  B LYS B 1 29  ? 16.720  10.587 23.119  0.69 14.06 ? 29  LYS B CG  1 
ATOM   1962 C  CD  A LYS B 1 29  ? 18.098  10.199 22.706  0.31 13.35 ? 29  LYS B CD  1 
ATOM   1963 C  CD  B LYS B 1 29  ? 17.835  10.203 22.250  0.69 17.05 ? 29  LYS B CD  1 
ATOM   1964 C  CE  A LYS B 1 29  ? 17.976  8.932  21.858  0.31 17.98 ? 29  LYS B CE  1 
ATOM   1965 C  CE  B LYS B 1 29  ? 17.685  8.851  21.508  0.69 22.01 ? 29  LYS B CE  1 
ATOM   1966 N  NZ  A LYS B 1 29  ? 16.579  8.776  21.379  0.31 16.60 ? 29  LYS B NZ  1 
ATOM   1967 N  NZ  B LYS B 1 29  ? 19.096  8.372  21.244  0.69 27.16 ? 29  LYS B NZ  1 
ATOM   1968 N  N   . HIS B 1 30  ? 16.393  14.122 25.786  1.00 7.57  ? 30  HIS B N   1 
ATOM   1969 C  CA  . HIS B 1 30  ? 16.306  15.520 26.170  1.00 7.44  ? 30  HIS B CA  1 
ATOM   1970 C  C   . HIS B 1 30  ? 17.173  15.838 27.359  1.00 7.45  ? 30  HIS B C   1 
ATOM   1971 O  O   . HIS B 1 30  ? 17.939  16.820 27.360  1.00 8.01  ? 30  HIS B O   1 
ATOM   1972 C  CB  . HIS B 1 30  ? 14.840  15.921 26.422  1.00 8.11  ? 30  HIS B CB  1 
ATOM   1973 C  CG  . HIS B 1 30  ? 14.008  15.759 25.193  1.00 8.09  ? 30  HIS B CG  1 
ATOM   1974 N  ND1 . HIS B 1 30  ? 13.578  16.717 24.320  1.00 9.24  ? 30  HIS B ND1 1 
ATOM   1975 C  CD2 . HIS B 1 30  ? 13.595  14.528 24.767  1.00 8.48  ? 30  HIS B CD2 1 
ATOM   1976 C  CE1 . HIS B 1 30  ? 12.867  16.036 23.368  1.00 7.66  ? 30  HIS B CE1 1 
ATOM   1977 N  NE2 . HIS B 1 30  ? 12.877  14.743 23.620  1.00 10.74 ? 30  HIS B NE2 1 
ATOM   1978 N  N   . HIS B 1 31  ? 17.064  15.069 28.461  1.00 7.66  ? 31  HIS B N   1 
ATOM   1979 C  CA  . HIS B 1 31  ? 17.847  15.378 29.636  1.00 7.69  ? 31  HIS B CA  1 
ATOM   1980 C  C   . HIS B 1 31  ? 19.353  15.222 29.340  1.00 7.85  ? 31  HIS B C   1 
ATOM   1981 O  O   . HIS B 1 31  ? 20.172  16.055 29.686  1.00 8.20  ? 31  HIS B O   1 
ATOM   1982 C  CB  . HIS B 1 31  ? 17.377  14.565 30.843  1.00 7.70  ? 31  HIS B CB  1 
ATOM   1983 C  CG  . HIS B 1 31  ? 18.008  14.954 32.127  1.00 7.70  ? 31  HIS B CG  1 
ATOM   1984 N  ND1 . HIS B 1 31  ? 17.653  14.332 33.319  1.00 8.22  ? 31  HIS B ND1 1 
ATOM   1985 C  CD2 . HIS B 1 31  ? 18.930  15.920 32.422  1.00 7.97  ? 31  HIS B CD2 1 
ATOM   1986 C  CE1 . HIS B 1 31  ? 18.357  14.898 34.266  1.00 8.25  ? 31  HIS B CE1 1 
ATOM   1987 N  NE2 . HIS B 1 31  ? 19.152  15.864 33.775  1.00 8.03  ? 31  HIS B NE2 1 
ATOM   1988 N  N   . GLN B 1 32  ? 19.710  14.141 28.641  1.00 8.24  ? 32  GLN B N   1 
ATOM   1989 C  CA  . GLN B 1 32  ? 21.112  13.902 28.284  1.00 8.44  ? 32  GLN B CA  1 
ATOM   1990 C  C   . GLN B 1 32  ? 21.693  15.112 27.566  1.00 8.21  ? 32  GLN B C   1 
ATOM   1991 O  O   . GLN B 1 32  ? 22.862  15.469 27.797  1.00 8.71  ? 32  GLN B O   1 
ATOM   1992 C  CB  . GLN B 1 32  ? 21.212  12.671 27.425  1.00 9.43  ? 32  GLN B CB  1 
ATOM   1993 C  CG  . GLN B 1 32  ? 22.663  12.307 27.054  1.00 10.06 ? 32  GLN B CG  1 
ATOM   1994 C  CD  . GLN B 1 32  ? 23.399  11.726 28.225  1.00 10.19 ? 32  GLN B CD  1 
ATOM   1995 O  OE1 . GLN B 1 32  ? 23.044  10.659 28.711  1.00 11.38 ? 32  GLN B OE1 1 
ATOM   1996 N  NE2 . GLN B 1 32  ? 24.414  12.414 28.734  1.00 11.41 ? 32  GLN B NE2 1 
ATOM   1997 N  N   . THR B 1 33  ? 20.940  15.716 26.624  1.00 8.44  ? 33  THR B N   1 
ATOM   1998 C  CA  . THR B 1 33  ? 21.473  16.840 25.876  1.00 8.16  ? 33  THR B CA  1 
ATOM   1999 C  C   . THR B 1 33  ? 21.794  18.020 26.791  1.00 7.74  ? 33  THR B C   1 
ATOM   2000 O  O   . THR B 1 33  ? 22.799  18.691 26.587  1.00 8.19  ? 33  THR B O   1 
ATOM   2001 C  CB  . THR B 1 33  ? 20.479  17.201 24.745  1.00 9.07  ? 33  THR B CB  1 
ATOM   2002 O  OG1 . THR B 1 33  ? 20.438  16.100 23.847  1.00 11.53 ? 33  THR B OG1 1 
ATOM   2003 C  CG2 . THR B 1 33  ? 20.872  18.448 24.018  1.00 10.69 ? 33  THR B CG2 1 
ATOM   2004 N  N   . TYR B 1 34  ? 20.933  18.292 27.813  1.00 7.70  ? 34  TYR B N   1 
ATOM   2005 C  CA  . TYR B 1 34  ? 21.264  19.383 28.733  1.00 7.77  ? 34  TYR B CA  1 
ATOM   2006 C  C   . TYR B 1 34  ? 22.546  19.059 29.505  1.00 7.70  ? 34  TYR B C   1 
ATOM   2007 O  O   . TYR B 1 34  ? 23.359  19.964 29.729  1.00 8.34  ? 34  TYR B O   1 
ATOM   2008 C  CB  . TYR B 1 34  ? 20.120  19.608 29.724  1.00 7.87  ? 34  TYR B CB  1 
ATOM   2009 C  CG  . TYR B 1 34  ? 18.870  20.155 29.088  1.00 7.77  ? 34  TYR B CG  1 
ATOM   2010 C  CD1 . TYR B 1 34  ? 18.895  21.268 28.276  1.00 8.16  ? 34  TYR B CD1 1 
ATOM   2011 C  CD2 . TYR B 1 34  ? 17.626  19.516 29.265  1.00 7.54  ? 34  TYR B CD2 1 
ATOM   2012 C  CE1 . TYR B 1 34  ? 17.743  21.769 27.668  1.00 9.06  ? 34  TYR B CE1 1 
ATOM   2013 C  CE2 . TYR B 1 34  ? 16.480  20.013 28.671  1.00 8.53  ? 34  TYR B CE2 1 
ATOM   2014 C  CZ  . TYR B 1 34  ? 16.536  21.150 27.872  1.00 8.95  ? 34  TYR B CZ  1 
ATOM   2015 O  OH  . TYR B 1 34  ? 15.392  21.614 27.290  1.00 10.69 ? 34  TYR B OH  1 
ATOM   2016 N  N   . VAL B 1 35  ? 22.700  17.819 29.958  1.00 8.01  ? 35  VAL B N   1 
ATOM   2017 C  CA  . VAL B 1 35  ? 23.948  17.408 30.638  1.00 8.43  ? 35  VAL B CA  1 
ATOM   2018 C  C   . VAL B 1 35  ? 25.139  17.707 29.742  1.00 8.45  ? 35  VAL B C   1 
ATOM   2019 O  O   . VAL B 1 35  ? 26.138  18.308 30.167  1.00 8.69  ? 35  VAL B O   1 
ATOM   2020 C  CB  . VAL B 1 35  ? 23.858  15.917 30.985  1.00 8.67  ? 35  VAL B CB  1 
ATOM   2021 C  CG1 . VAL B 1 35  ? 25.227  15.358 31.413  1.00 9.94  ? 35  VAL B CG1 1 
ATOM   2022 C  CG2 . VAL B 1 35  ? 22.836  15.683 32.084  1.00 10.09 ? 35  VAL B CG2 1 
ATOM   2023 N  N   . ASN B 1 36  ? 25.046  17.245 28.494  1.00 8.54  ? 36  ASN B N   1 
ATOM   2024 C  CA  . ASN B 1 36  ? 26.195  17.390 27.585  1.00 8.84  ? 36  ASN B CA  1 
ATOM   2025 C  C   . ASN B 1 36  ? 26.528  18.835 27.299  1.00 8.33  ? 36  ASN B C   1 
ATOM   2026 O  O   . ASN B 1 36  ? 27.693  19.254 27.295  1.00 9.17  ? 36  ASN B O   1 
ATOM   2027 C  CB  . ASN B 1 36  ? 25.926  16.626 26.294  1.00 10.08 ? 36  ASN B CB  1 
ATOM   2028 C  CG  . ASN B 1 36  ? 25.785  15.137 26.461  1.00 10.28 ? 36  ASN B CG  1 
ATOM   2029 O  OD1 . ASN B 1 36  ? 26.072  14.573 27.531  1.00 11.50 ? 36  ASN B OD1 1 
ATOM   2030 N  ND2 . ASN B 1 36  ? 25.369  14.482 25.392  1.00 12.07 ? 36  ASN B ND2 1 
ATOM   2031 N  N   . ASN B 1 37  ? 25.493  19.627 27.009  1.00 8.48  ? 37  ASN B N   1 
ATOM   2032 C  CA  . ASN B 1 37  ? 25.739  21.006 26.644  1.00 8.44  ? 37  ASN B CA  1 
ATOM   2033 C  C   . ASN B 1 37  ? 26.179  21.858 27.837  1.00 8.14  ? 37  ASN B C   1 
ATOM   2034 O  O   . ASN B 1 37  ? 26.983  22.767 27.679  1.00 9.64  ? 37  ASN B O   1 
ATOM   2035 C  CB  . ASN B 1 37  ? 24.513  21.589 25.925  1.00 9.13  ? 37  ASN B CB  1 
ATOM   2036 C  CG  . ASN B 1 37  ? 24.417  20.954 24.480  1.00 10.56 ? 37  ASN B CG  1 
ATOM   2037 O  OD1 . ASN B 1 37  ? 25.403  20.538 23.946  1.00 14.50 ? 37  ASN B OD1 1 
ATOM   2038 N  ND2 . ASN B 1 37  ? 23.244  20.978 23.914  1.00 12.13 ? 37  ASN B ND2 1 
ATOM   2039 N  N   . ALA B 1 38  ? 25.663  21.559 29.019  1.00 8.35  ? 38  ALA B N   1 
ATOM   2040 C  CA  . ALA B 1 38  ? 26.167  22.244 30.204  1.00 8.40  ? 38  ALA B CA  1 
ATOM   2041 C  C   . ALA B 1 38  ? 27.631  21.871 30.457  1.00 8.13  ? 38  ALA B C   1 
ATOM   2042 O  O   . ALA B 1 38  ? 28.466  22.753 30.732  1.00 8.69  ? 38  ALA B O   1 
ATOM   2043 C  CB  . ALA B 1 38  ? 25.339  21.859 31.461  1.00 9.08  ? 38  ALA B CB  1 
ATOM   2044 N  N   . ASN B 1 39  ? 27.957  20.576 30.341  1.00 8.30  ? 39  ASN B N   1 
ATOM   2045 C  CA  . ASN B 1 39  ? 29.365  20.182 30.553  1.00 8.61  ? 39  ASN B CA  1 
ATOM   2046 C  C   . ASN B 1 39  ? 30.286  20.896 29.589  1.00 8.77  ? 39  ASN B C   1 
ATOM   2047 O  O   . ASN B 1 39  ? 31.386  21.326 29.934  1.00 9.38  ? 39  ASN B O   1 
ATOM   2048 C  CB  . ASN B 1 39  ? 29.533  18.673 30.415  1.00 9.14  ? 39  ASN B CB  1 
ATOM   2049 C  CG  . ASN B 1 39  ? 29.088  17.933 31.667  1.00 9.39  ? 39  ASN B CG  1 
ATOM   2050 O  OD1 . ASN B 1 39  ? 29.097  18.492 32.762  1.00 10.17 ? 39  ASN B OD1 1 
ATOM   2051 N  ND2 . ASN B 1 39  ? 28.769  16.644 31.471  1.00 10.20 ? 39  ASN B ND2 1 
ATOM   2052 N  N   . ALA B 1 40  ? 29.870  21.036 28.314  1.00 9.39  ? 40  ALA B N   1 
ATOM   2053 C  CA  . ALA B 1 40  ? 30.727  21.687 27.334  1.00 9.53  ? 40  ALA B CA  1 
ATOM   2054 C  C   . ALA B 1 40  ? 30.984  23.114 27.738  1.00 9.24  ? 40  ALA B C   1 
ATOM   2055 O  O   . ALA B 1 40  ? 32.117  23.603 27.581  1.00 10.64 ? 40  ALA B O   1 
ATOM   2056 C  CB  . ALA B 1 40  ? 30.093  21.611 25.941  1.00 10.93 ? 40  ALA B CB  1 
ATOM   2057 N  N   . ALA B 1 41  ? 29.951  23.833 28.199  1.00 8.93  ? 41  ALA B N   1 
ATOM   2058 C  CA  . ALA B 1 41  ? 30.095  25.210 28.588  1.00 8.97  ? 41  ALA B CA  1 
ATOM   2059 C  C   . ALA B 1 41  ? 30.865  25.377 29.880  1.00 8.85  ? 41  ALA B C   1 
ATOM   2060 O  O   . ALA B 1 41  ? 31.406  26.456 30.149  1.00 10.54 ? 41  ALA B O   1 
ATOM   2061 C  CB  . ALA B 1 41  ? 28.708  25.843 28.684  1.00 10.57 ? 41  ALA B CB  1 
ATOM   2062 N  N   . LEU B 1 42  ? 30.898  24.353 30.723  1.00 8.43  ? 42  LEU B N   1 
ATOM   2063 C  CA  . LEU B 1 42  ? 31.591  24.415 32.008  1.00 8.43  ? 42  LEU B CA  1 
ATOM   2064 C  C   . LEU B 1 42  ? 33.054  24.014 31.918  1.00 8.66  ? 42  LEU B C   1 
ATOM   2065 O  O   . LEU B 1 42  ? 33.793  24.284 32.891  1.00 9.46  ? 42  LEU B O   1 
ATOM   2066 C  CB  . LEU B 1 42  ? 30.866  23.540 33.018  1.00 8.51  ? 42  LEU B CB  1 
ATOM   2067 C  CG  . LEU B 1 42  ? 29.572  24.142 33.573  1.00 9.50  ? 42  LEU B CG  1 
ATOM   2068 C  CD1 . LEU B 1 42  ? 28.675  23.097 34.197  1.00 9.93  ? 42  LEU B CD1 1 
ATOM   2069 C  CD2 . LEU B 1 42  ? 29.882  25.284 34.530  1.00 9.85  ? 42  LEU B CD2 1 
ATOM   2070 N  N   . GLU B 1 43  ? 33.513  23.430 30.842  1.00 8.83  ? 43  GLU B N   1 
ATOM   2071 C  CA  . GLU B 1 43  ? 34.889  22.913 30.852  1.00 9.40  ? 43  GLU B CA  1 
ATOM   2072 C  C   . GLU B 1 43  ? 35.885  24.013 31.110  1.00 8.88  ? 43  GLU B C   1 
ATOM   2073 O  O   . GLU B 1 43  ? 36.886  23.788 31.845  1.00 9.63  ? 43  GLU B O   1 
ATOM   2074 C  CB  . GLU B 1 43  ? 35.177  22.224 29.512  1.00 10.38 ? 43  GLU B CB  1 
ATOM   2075 C  CG  . GLU B 1 43  ? 36.556  21.564 29.589  1.00 13.75 ? 43  GLU B CG  1 
ATOM   2076 C  CD  . GLU B 1 43  ? 36.907  20.956 28.289  1.00 14.07 ? 43  GLU B CD  1 
ATOM   2077 O  OE1 . GLU B 1 43  ? 37.360  21.725 27.405  1.00 17.11 ? 43  GLU B OE1 1 
ATOM   2078 O  OE2 . GLU B 1 43  ? 36.800  19.721 28.133  1.00 18.35 ? 43  GLU B OE2 1 
ATOM   2079 N  N   . SER B 1 44  ? 35.693  25.185 30.562  1.00 8.98  ? 44  SER B N   1 
ATOM   2080 C  CA  . SER B 1 44  ? 36.602  26.314 30.746  1.00 9.55  ? 44  SER B CA  1 
ATOM   2081 C  C   . SER B 1 44  ? 36.459  27.004 32.084  1.00 9.14  ? 44  SER B C   1 
ATOM   2082 O  O   . SER B 1 44  ? 37.208  27.975 32.337  1.00 11.36 ? 44  SER B O   1 
ATOM   2083 C  CB  . SER B 1 44  ? 36.448  27.367 29.629  1.00 11.14 ? 44  SER B CB  1 
ATOM   2084 O  OG  . SER B 1 44  ? 35.225  28.045 29.766  1.00 12.59 ? 44  SER B OG  1 
ATOM   2085 N  N   . LEU B 1 45  ? 35.576  26.514 32.931  1.00 8.54  ? 45  LEU B N   1 
ATOM   2086 C  CA  . LEU B 1 45  ? 35.227  27.112 34.240  1.00 8.94  ? 45  LEU B CA  1 
ATOM   2087 C  C   . LEU B 1 45  ? 35.463  26.109 35.340  1.00 8.61  ? 45  LEU B C   1 
ATOM   2088 O  O   . LEU B 1 45  ? 34.496  25.655 35.998  1.00 8.90  ? 45  LEU B O   1 
ATOM   2089 C  CB  . LEU B 1 45  ? 33.770  27.538 34.206  1.00 9.86  ? 45  LEU B CB  1 
ATOM   2090 C  CG  . LEU B 1 45  ? 33.402  28.645 33.210  1.00 12.33 ? 45  LEU B CG  1 
ATOM   2091 C  CD1 . LEU B 1 45  ? 31.900  28.843 33.208  1.00 13.75 ? 45  LEU B CD1 1 
ATOM   2092 C  CD2 . LEU B 1 45  ? 34.181  29.893 33.460  1.00 19.90 ? 45  LEU B CD2 1 
ATOM   2093 N  N   . PRO B 1 46  ? 36.689  25.750 35.664  1.00 8.42  ? 46  PRO B N   1 
ATOM   2094 C  CA  . PRO B 1 46  ? 36.915  24.791 36.765  1.00 8.46  ? 46  PRO B CA  1 
ATOM   2095 C  C   . PRO B 1 46  ? 36.304  25.195 38.098  1.00 8.35  ? 46  PRO B C   1 
ATOM   2096 O  O   . PRO B 1 46  ? 36.015  24.327 38.904  1.00 9.16  ? 46  PRO B O   1 
ATOM   2097 C  CB  . PRO B 1 46  ? 38.462  24.744 36.880  1.00 9.39  ? 46  PRO B CB  1 
ATOM   2098 C  CG  . PRO B 1 46  ? 38.914  25.033 35.455  1.00 9.59  ? 46  PRO B CG  1 
ATOM   2099 C  CD  . PRO B 1 46  ? 37.962  26.135 35.013  1.00 9.83  ? 46  PRO B CD  1 
ATOM   2100 N  N   . GLU B 1 47  ? 36.137  26.508 38.324  1.00 8.87  ? 47  GLU B N   1 
ATOM   2101 C  CA  . GLU B 1 47  ? 35.561  26.980 39.579  1.00 8.71  ? 47  GLU B CA  1 
ATOM   2102 C  C   . GLU B 1 47  ? 34.032  26.801 39.651  1.00 8.32  ? 47  GLU B C   1 
ATOM   2103 O  O   . GLU B 1 47  ? 33.467  27.020 40.727  1.00 9.12  ? 47  GLU B O   1 
ATOM   2104 C  CB  . GLU B 1 47  ? 35.928  28.441 39.843  1.00 10.20 ? 47  GLU B CB  1 
ATOM   2105 C  CG  . GLU B 1 47  ? 35.317  29.485 38.930  1.00 10.40 ? 47  GLU B CG  1 
ATOM   2106 C  CD  . GLU B 1 47  ? 36.022  29.695 37.642  1.00 11.37 ? 47  GLU B CD  1 
ATOM   2107 O  OE1 . GLU B 1 47  ? 36.406  28.777 36.892  1.00 11.25 ? 47  GLU B OE1 1 
ATOM   2108 O  OE2 . GLU B 1 47  ? 36.278  30.905 37.379  1.00 17.82 ? 47  GLU B OE2 1 
ATOM   2109 N  N   . PHE B 1 48  ? 33.418  26.432 38.547  1.00 8.28  ? 48  PHE B N   1 
ATOM   2110 C  CA  . PHE B 1 48  ? 31.980  26.115 38.509  1.00 8.42  ? 48  PHE B CA  1 
ATOM   2111 C  C   . PHE B 1 48  ? 31.665  24.696 38.104  1.00 8.58  ? 48  PHE B C   1 
ATOM   2112 O  O   . PHE B 1 48  ? 30.587  24.190 38.451  1.00 9.33  ? 48  PHE B O   1 
ATOM   2113 C  CB  . PHE B 1 48  ? 31.228  27.093 37.575  1.00 9.08  ? 48  PHE B CB  1 
ATOM   2114 C  CG  . PHE B 1 48  ? 31.264  28.531 38.023  1.00 8.95  ? 48  PHE B CG  1 
ATOM   2115 C  CD1 . PHE B 1 48  ? 30.481  28.973 39.080  1.00 9.97  ? 48  PHE B CD1 1 
ATOM   2116 C  CD2 . PHE B 1 48  ? 32.063  29.451 37.375  1.00 9.81  ? 48  PHE B CD2 1 
ATOM   2117 C  CE1 . PHE B 1 48  ? 30.484  30.293 39.442  1.00 11.29 ? 48  PHE B CE1 1 
ATOM   2118 C  CE2 . PHE B 1 48  ? 32.088  30.788 37.788  1.00 9.82  ? 48  PHE B CE2 1 
ATOM   2119 C  CZ  . PHE B 1 48  ? 31.313  31.209 38.822  1.00 9.80  ? 48  PHE B CZ  1 
ATOM   2120 N  N   . ALA B 1 49  ? 32.538  24.024 37.326  1.00 8.64  ? 49  ALA B N   1 
ATOM   2121 C  CA  . ALA B 1 49  ? 32.210  22.784 36.655  1.00 8.47  ? 49  ALA B CA  1 
ATOM   2122 C  C   . ALA B 1 49  ? 31.839  21.641 37.564  1.00 8.61  ? 49  ALA B C   1 
ATOM   2123 O  O   . ALA B 1 49  ? 31.101  20.740 37.113  1.00 9.65  ? 49  ALA B O   1 
ATOM   2124 C  CB  . ALA B 1 49  ? 33.360  22.334 35.745  1.00 9.19  ? 49  ALA B CB  1 
ATOM   2125 N  N   . ASN B 1 50  ? 32.381  21.630 38.765  1.00 8.69  ? 50  ASN B N   1 
ATOM   2126 C  CA  . ASN B 1 50  ? 32.247  20.517 39.690  1.00 9.72  ? 50  ASN B CA  1 
ATOM   2127 C  C   . ASN B 1 50  ? 31.296  20.825 40.851  1.00 9.94  ? 50  ASN B C   1 
ATOM   2128 O  O   . ASN B 1 50  ? 31.137  19.979 41.731  1.00 13.92 ? 50  ASN B O   1 
ATOM   2129 C  CB  . ASN B 1 50  ? 33.631  20.104 40.190  1.00 10.17 ? 50  ASN B CB  1 
ATOM   2130 C  CG  . ASN B 1 50  ? 34.388  19.476 39.022  1.00 9.72  ? 50  ASN B CG  1 
ATOM   2131 O  OD1 . ASN B 1 50  ? 33.875  18.541 38.376  1.00 12.36 ? 50  ASN B OD1 1 
ATOM   2132 N  ND2 . ASN B 1 50  ? 35.556  19.948 38.714  1.00 10.76 ? 50  ASN B ND2 1 
ATOM   2133 N  N   . LEU B 1 51  ? 30.629  21.988 40.835  1.00 8.90  ? 51  LEU B N   1 
ATOM   2134 C  CA  . LEU B 1 51  ? 29.606  22.264 41.834  1.00 8.97  ? 51  LEU B CA  1 
ATOM   2135 C  C   . LEU B 1 51  ? 28.334  21.494 41.519  1.00 8.55  ? 51  LEU B C   1 
ATOM   2136 O  O   . LEU B 1 51  ? 28.053  21.212 40.351  1.00 9.28  ? 51  LEU B O   1 
ATOM   2137 C  CB  . LEU B 1 51  ? 29.309  23.765 41.849  1.00 9.98  ? 51  LEU B CB  1 
ATOM   2138 C  CG  . LEU B 1 51  ? 30.511  24.668 42.043  1.00 10.85 ? 51  LEU B CG  1 
ATOM   2139 C  CD1 . LEU B 1 51  ? 30.043  26.131 42.041  1.00 13.56 ? 51  LEU B CD1 1 
ATOM   2140 C  CD2 . LEU B 1 51  ? 31.312  24.333 43.275  1.00 13.52 ? 51  LEU B CD2 1 
ATOM   2141 N  N   . PRO B 1 52  ? 27.511  21.159 42.506  1.00 9.38  ? 52  PRO B N   1 
ATOM   2142 C  CA  . PRO B 1 52  ? 26.202  20.582 42.196  1.00 9.58  ? 52  PRO B CA  1 
ATOM   2143 C  C   . PRO B 1 52  ? 25.416  21.566 41.320  1.00 8.45  ? 52  PRO B C   1 
ATOM   2144 O  O   . PRO B 1 52  ? 25.450  22.773 41.509  1.00 8.69  ? 52  PRO B O   1 
ATOM   2145 C  CB  . PRO B 1 52  ? 25.541  20.459 43.568  1.00 11.39 ? 52  PRO B CB  1 
ATOM   2146 C  CG  . PRO B 1 52  ? 26.703  20.401 44.559  1.00 11.76 ? 52  PRO B CG  1 
ATOM   2147 C  CD  . PRO B 1 52  ? 27.717  21.326 43.962  1.00 10.45 ? 52  PRO B CD  1 
ATOM   2148 N  N   . VAL B 1 53  ? 24.646  21.003 40.384  1.00 8.35  ? 53  VAL B N   1 
ATOM   2149 C  CA  . VAL B 1 53  ? 23.902  21.852 39.450  1.00 8.09  ? 53  VAL B CA  1 
ATOM   2150 C  C   . VAL B 1 53  ? 22.906  22.771 40.176  1.00 8.13  ? 53  VAL B C   1 
ATOM   2151 O  O   . VAL B 1 53  ? 22.703  23.916 39.762  1.00 8.36  ? 53  VAL B O   1 
ATOM   2152 C  CB  . VAL B 1 53  ? 23.207  20.979 38.367  1.00 8.49  ? 53  VAL B CB  1 
ATOM   2153 C  CG1 . VAL B 1 53  ? 22.104  20.099 38.887  1.00 9.50  ? 53  VAL B CG1 1 
ATOM   2154 C  CG2 . VAL B 1 53  ? 22.722  21.886 37.248  1.00 9.08  ? 53  VAL B CG2 1 
ATOM   2155 N  N   . GLU B 1 54  ? 22.314  22.280 41.266  1.00 8.72  ? 54  GLU B N   1 
ATOM   2156 C  CA  . GLU B 1 54  ? 21.362  23.105 42.010  1.00 10.03 ? 54  GLU B CA  1 
ATOM   2157 C  C   . GLU B 1 54  ? 22.036  24.269 42.705  1.00 9.86  ? 54  GLU B C   1 
ATOM   2158 O  O   . GLU B 1 54  ? 21.373  25.260 42.985  1.00 11.02 ? 54  GLU B O   1 
ATOM   2159 C  CB  A GLU B 1 54  ? 20.380  22.326 42.887  0.44 11.24 ? 54  GLU B CB  1 
ATOM   2160 C  CB  B GLU B 1 54  ? 20.691  22.221 43.087  0.56 13.49 ? 54  GLU B CB  1 
ATOM   2161 C  CG  A GLU B 1 54  ? 20.956  21.657 44.085  0.44 12.22 ? 54  GLU B CG  1 
ATOM   2162 C  CG  B GLU B 1 54  ? 19.895  21.064 42.529  0.56 14.48 ? 54  GLU B CG  1 
ATOM   2163 C  CD  A GLU B 1 54  ? 21.828  20.458 43.948  0.44 13.66 ? 54  GLU B CD  1 
ATOM   2164 C  CD  B GLU B 1 54  ? 20.661  19.825 42.088  0.56 11.99 ? 54  GLU B CD  1 
ATOM   2165 O  OE1 A GLU B 1 54  ? 22.069  19.966 42.836  0.44 12.29 ? 54  GLU B OE1 1 
ATOM   2166 O  OE1 B GLU B 1 54  ? 21.861  19.661 42.409  0.56 12.58 ? 54  GLU B OE1 1 
ATOM   2167 O  OE2 A GLU B 1 54  ? 22.334  19.975 45.012  0.44 15.43 ? 54  GLU B OE2 1 
ATOM   2168 O  OE2 B GLU B 1 54  ? 20.067  18.919 41.405  0.56 11.61 ? 54  GLU B OE2 1 
ATOM   2169 N  N   . GLU B 1 55  ? 23.347  24.170 42.966  1.00 9.72  ? 55  GLU B N   1 
ATOM   2170 C  CA  . GLU B 1 55  ? 24.124  25.274 43.465  1.00 9.50  ? 55  GLU B CA  1 
ATOM   2171 C  C   . GLU B 1 55  ? 24.469  26.219 42.333  1.00 8.73  ? 55  GLU B C   1 
ATOM   2172 O  O   . GLU B 1 55  ? 24.379  27.452 42.455  1.00 9.00  ? 55  GLU B O   1 
ATOM   2173 C  CB  . GLU B 1 55  ? 25.390  24.794 44.190  1.00 10.80 ? 55  GLU B CB  1 
ATOM   2174 C  CG  . GLU B 1 55  ? 25.100  24.127 45.511  1.00 13.72 ? 55  GLU B CG  1 
ATOM   2175 C  CD  . GLU B 1 55  ? 24.301  25.003 46.432  1.00 15.81 ? 55  GLU B CD  1 
ATOM   2176 O  OE1 . GLU B 1 55  ? 23.175  24.605 46.903  1.00 22.90 ? 55  GLU B OE1 1 
ATOM   2177 O  OE2 . GLU B 1 55  ? 24.730  26.122 46.682  1.00 14.37 ? 55  GLU B OE2 1 
ATOM   2178 N  N   . LEU B 1 56  ? 24.907  25.680 41.184  1.00 8.06  ? 56  LEU B N   1 
ATOM   2179 C  CA  . LEU B 1 56  ? 25.274  26.536 40.063  1.00 7.90  ? 56  LEU B CA  1 
ATOM   2180 C  C   . LEU B 1 56  ? 24.142  27.499 39.676  1.00 7.87  ? 56  LEU B C   1 
ATOM   2181 O  O   . LEU B 1 56  ? 24.389  28.665 39.387  1.00 8.64  ? 56  LEU B O   1 
ATOM   2182 C  CB  . LEU B 1 56  ? 25.703  25.677 38.870  1.00 8.59  ? 56  LEU B CB  1 
ATOM   2183 C  CG  . LEU B 1 56  ? 26.153  26.513 37.677  1.00 10.35 ? 56  LEU B CG  1 
ATOM   2184 C  CD1 . LEU B 1 56  ? 27.305  27.442 38.019  1.00 13.39 ? 56  LEU B CD1 1 
ATOM   2185 C  CD2 . LEU B 1 56  ? 26.488  25.709 36.476  1.00 12.52 ? 56  LEU B CD2 1 
ATOM   2186 N  N   . ILE B 1 57  ? 22.902  26.993 39.668  1.00 7.88  ? 57  ILE B N   1 
ATOM   2187 C  CA  . ILE B 1 57  ? 21.813  27.862 39.179  1.00 8.20  ? 57  ILE B CA  1 
ATOM   2188 C  C   . ILE B 1 57  ? 21.446  28.959 40.177  1.00 8.76  ? 57  ILE B C   1 
ATOM   2189 O  O   . ILE B 1 57  ? 20.676  29.841 39.795  1.00 10.66 ? 57  ILE B O   1 
ATOM   2190 C  CB  . ILE B 1 57  ? 20.586  27.042 38.733  1.00 8.47  ? 57  ILE B CB  1 
ATOM   2191 C  CG1 . ILE B 1 57  ? 19.932  26.258 39.871  1.00 9.88  ? 57  ILE B CG1 1 
ATOM   2192 C  CG2 . ILE B 1 57  ? 20.961  26.160 37.554  1.00 9.78  ? 57  ILE B CG2 1 
ATOM   2193 C  CD1 . ILE B 1 57  ? 18.602  25.659 39.519  1.00 11.38 ? 57  ILE B CD1 1 
ATOM   2194 N  N   . THR B 1 58  ? 22.024  28.989 41.371  1.00 8.41  ? 58  THR B N   1 
ATOM   2195 C  CA  . THR B 1 58  ? 21.938  30.105 42.291  1.00 9.81  ? 58  THR B CA  1 
ATOM   2196 C  C   . THR B 1 58  ? 23.055  31.129 42.122  1.00 10.30 ? 58  THR B C   1 
ATOM   2197 O  O   . THR B 1 58  ? 23.050  32.143 42.821  1.00 13.54 ? 58  THR B O   1 
ATOM   2198 C  CB  . THR B 1 58  ? 21.930  29.655 43.774  1.00 9.68  ? 58  THR B CB  1 
ATOM   2199 O  OG1 . THR B 1 58  ? 23.207  29.220 44.195  1.00 9.72  ? 58  THR B OG1 1 
ATOM   2200 C  CG2 . THR B 1 58  ? 20.878  28.584 44.053  1.00 11.02 ? 58  THR B CG2 1 
ATOM   2201 N  N   A LYS B 1 59  ? 24.040  30.832 41.248  0.43 9.61  ? 59  LYS B N   1 
ATOM   2202 N  N   B LYS B 1 59  ? 23.964  30.890 41.188  0.57 9.60  ? 59  LYS B N   1 
ATOM   2203 C  CA  A LYS B 1 59  ? 25.317  31.497 40.990  0.43 9.72  ? 59  LYS B CA  1 
ATOM   2204 C  CA  B LYS B 1 59  ? 25.004  31.932 41.119  0.57 11.30 ? 59  LYS B CA  1 
ATOM   2205 C  C   A LYS B 1 59  ? 25.385  32.121 39.594  0.43 9.35  ? 59  LYS B C   1 
ATOM   2206 C  C   B LYS B 1 59  ? 25.337  32.222 39.671  0.57 9.79  ? 59  LYS B C   1 
ATOM   2207 O  O   A LYS B 1 59  ? 26.468  32.554 39.191  0.43 9.66  ? 59  LYS B O   1 
ATOM   2208 O  O   B LYS B 1 59  ? 26.466  32.458 39.261  0.57 10.63 ? 59  LYS B O   1 
ATOM   2209 C  CB  A LYS B 1 59  ? 26.575  30.606 41.164  0.43 9.62  ? 59  LYS B CB  1 
ATOM   2210 C  CB  B LYS B 1 59  ? 26.154  31.427 41.971  0.57 10.39 ? 59  LYS B CB  1 
ATOM   2211 C  CG  A LYS B 1 59  ? 26.716  30.068 42.576  0.43 8.29  ? 59  LYS B CG  1 
ATOM   2212 C  CG  B LYS B 1 59  ? 26.813  30.165 41.406  0.57 9.75  ? 59  LYS B CG  1 
ATOM   2213 C  CD  A LYS B 1 59  ? 27.656  28.877 42.711  0.43 9.19  ? 59  LYS B CD  1 
ATOM   2214 C  CD  B LYS B 1 59  ? 27.945  29.688 42.352  0.57 11.43 ? 59  LYS B CD  1 
ATOM   2215 C  CE  A LYS B 1 59  ? 27.574  28.205 44.059  0.43 9.78  ? 59  LYS B CE  1 
ATOM   2216 C  CE  B LYS B 1 59  ? 27.435  28.778 43.447  0.57 12.95 ? 59  LYS B CE  1 
ATOM   2217 N  NZ  A LYS B 1 59  ? 28.343  28.902 45.082  0.43 9.86  ? 59  LYS B NZ  1 
ATOM   2218 N  NZ  B LYS B 1 59  ? 28.369  28.777 44.612  0.57 19.70 ? 59  LYS B NZ  1 
ATOM   2219 N  N   . LEU B 1 60  ? 24.293  32.223 38.848  1.00 8.57  ? 60  LEU B N   1 
ATOM   2220 C  CA  . LEU B 1 60  ? 24.429  32.592 37.450  1.00 8.50  ? 60  LEU B CA  1 
ATOM   2221 C  C   . LEU B 1 60  ? 25.033  33.999 37.309  1.00 8.81  ? 60  LEU B C   1 
ATOM   2222 O  O   . LEU B 1 60  ? 25.770  34.228 36.368  1.00 9.50  ? 60  LEU B O   1 
ATOM   2223 C  CB  . LEU B 1 60  ? 23.088  32.481 36.744  1.00 8.76  ? 60  LEU B CB  1 
ATOM   2224 C  CG  . LEU B 1 60  ? 22.522  31.071 36.631  1.00 8.85  ? 60  LEU B CG  1 
ATOM   2225 C  CD1 . LEU B 1 60  ? 21.101  31.144 36.073  1.00 9.87  ? 60  LEU B CD1 1 
ATOM   2226 C  CD2 . LEU B 1 60  ? 23.350  30.146 35.799  1.00 10.97 ? 60  LEU B CD2 1 
ATOM   2227 N  N   . ASP B 1 61  ? 24.725  34.898 38.226  1.00 8.88  ? 61  ASP B N   1 
ATOM   2228 C  CA  . ASP B 1 61  ? 25.243  36.251 38.135  1.00 9.88  ? 61  ASP B CA  1 
ATOM   2229 C  C   . ASP B 1 61  ? 26.742  36.322 38.417  1.00 10.64 ? 61  ASP B C   1 
ATOM   2230 O  O   . ASP B 1 61  ? 27.321  37.408 38.213  1.00 14.77 ? 61  ASP B O   1 
ATOM   2231 C  CB  . ASP B 1 61  ? 24.508  37.207 39.057  1.00 10.57 ? 61  ASP B CB  1 
ATOM   2232 C  CG  . ASP B 1 61  ? 23.076  37.425 38.560  1.00 11.05 ? 61  ASP B CG  1 
ATOM   2233 O  OD1 . ASP B 1 61  ? 22.864  37.707 37.365  1.00 12.17 ? 61  ASP B OD1 1 
ATOM   2234 O  OD2 . ASP B 1 61  ? 22.172  37.213 39.435  1.00 12.16 ? 61  ASP B OD2 1 
ATOM   2235 N  N   . GLN B 1 62  ? 27.325  35.244 38.921  1.00 9.51  ? 62  GLN B N   1 
ATOM   2236 C  CA  . GLN B 1 62  ? 28.777  35.162 39.184  1.00 10.04 ? 62  GLN B CA  1 
ATOM   2237 C  C   . GLN B 1 62  ? 29.589  34.759 37.970  1.00 10.59 ? 62  GLN B C   1 
ATOM   2238 O  O   . GLN B 1 62  ? 30.809  34.824 38.013  1.00 10.98 ? 62  GLN B O   1 
ATOM   2239 C  CB  . GLN B 1 62  ? 28.996  34.131 40.268  1.00 10.63 ? 62  GLN B CB  1 
ATOM   2240 C  CG  . GLN B 1 62  ? 28.450  34.514 41.638  1.00 11.36 ? 62  GLN B CG  1 
ATOM   2241 C  CD  . GLN B 1 62  ? 29.377  35.448 42.374  1.00 11.42 ? 62  GLN B CD  1 
ATOM   2242 O  OE1 . GLN B 1 62  ? 29.764  36.505 41.851  1.00 12.10 ? 62  GLN B OE1 1 
ATOM   2243 N  NE2 . GLN B 1 62  ? 29.819  34.989 43.559  1.00 12.12 ? 62  GLN B NE2 1 
ATOM   2244 N  N   . LEU B 1 63  ? 28.927  34.276 36.891  1.00 10.52 ? 63  LEU B N   1 
ATOM   2245 C  CA  . LEU B 1 63  ? 29.596  33.749 35.708  1.00 10.29 ? 63  LEU B CA  1 
ATOM   2246 C  C   . LEU B 1 63  ? 30.197  34.850 34.850  1.00 10.89 ? 63  LEU B C   1 
ATOM   2247 O  O   . LEU B 1 63  ? 29.733  35.975 34.925  1.00 12.57 ? 63  LEU B O   1 
ATOM   2248 C  CB  . LEU B 1 63  ? 28.593  32.995 34.876  1.00 9.98  ? 63  LEU B CB  1 
ATOM   2249 C  CG  . LEU B 1 63  ? 28.059  31.691 35.470  1.00 9.83  ? 63  LEU B CG  1 
ATOM   2250 C  CD1 . LEU B 1 63  ? 26.832  31.207 34.693  1.00 10.08 ? 63  LEU B CD1 1 
ATOM   2251 C  CD2 . LEU B 1 63  ? 29.118  30.598 35.509  1.00 11.19 ? 63  LEU B CD2 1 
ATOM   2252 N  N   . PRO B 1 64  ? 31.120  34.500 33.986  1.00 10.99 ? 64  PRO B N   1 
ATOM   2253 C  CA  . PRO B 1 64  ? 31.496  35.445 32.919  1.00 11.97 ? 64  PRO B CA  1 
ATOM   2254 C  C   . PRO B 1 64  ? 30.278  35.766 32.068  1.00 12.36 ? 64  PRO B C   1 
ATOM   2255 O  O   . PRO B 1 64  ? 29.394  34.916 31.851  1.00 11.72 ? 64  PRO B O   1 
ATOM   2256 C  CB  . PRO B 1 64  ? 32.540  34.658 32.109  1.00 13.42 ? 64  PRO B CB  1 
ATOM   2257 C  CG  . PRO B 1 64  ? 33.087  33.669 33.067  1.00 12.82 ? 64  PRO B CG  1 
ATOM   2258 C  CD  . PRO B 1 64  ? 31.901  33.251 33.899  1.00 11.32 ? 64  PRO B CD  1 
ATOM   2259 N  N   . ALA B 1 65  ? 30.269  36.982 31.524  1.00 14.69 ? 65  ALA B N   1 
ATOM   2260 C  CA  . ALA B 1 65  ? 29.126  37.399 30.739  1.00 16.51 ? 65  ALA B CA  1 
ATOM   2261 C  C   . ALA B 1 65  ? 28.768  36.450 29.625  1.00 14.03 ? 65  ALA B C   1 
ATOM   2262 O  O   . ALA B 1 65  ? 27.575  36.206 29.366  1.00 16.57 ? 65  ALA B O   1 
ATOM   2263 C  CB  . ALA B 1 65  ? 29.424  38.776 30.103  1.00 28.75 ? 65  ALA B CB  1 
ATOM   2264 N  N   . ASP B 1 66  ? 29.748  35.868 28.949  1.00 15.33 ? 66  ASP B N   1 
ATOM   2265 C  CA  . ASP B 1 66  ? 29.435  35.063 27.782  1.00 15.08 ? 66  ASP B CA  1 
ATOM   2266 C  C   . ASP B 1 66  ? 28.944  33.707 28.172  1.00 12.06 ? 66  ASP B C   1 
ATOM   2267 O  O   . ASP B 1 66  ? 28.623  32.983 27.218  1.00 14.59 ? 66  ASP B O   1 
ATOM   2268 C  CB  A ASP B 1 66  ? 30.747  34.874 26.973  0.60 20.35 ? 66  ASP B CB  1 
ATOM   2269 C  CB  B ASP B 1 66  ? 30.605  35.027 26.800  0.40 20.27 ? 66  ASP B CB  1 
ATOM   2270 C  CG  A ASP B 1 66  ? 31.630  33.902 27.763  0.60 19.59 ? 66  ASP B CG  1 
ATOM   2271 C  CG  B ASP B 1 66  ? 31.773  34.216 27.295  0.40 20.09 ? 66  ASP B CG  1 
ATOM   2272 O  OD1 A ASP B 1 66  ? 31.987  34.219 28.924  0.60 33.95 ? 66  ASP B OD1 1 
ATOM   2273 O  OD1 B ASP B 1 66  ? 31.879  33.893 28.496  0.40 27.72 ? 66  ASP B OD1 1 
ATOM   2274 O  OD2 A ASP B 1 66  ? 31.975  32.858 27.185  0.60 34.79 ? 66  ASP B OD2 1 
ATOM   2275 O  OD2 B ASP B 1 66  ? 32.589  33.932 26.389  0.40 22.83 ? 66  ASP B OD2 1 
ATOM   2276 N  N   . LYS B 1 67  ? 28.905  33.347 29.445  1.00 10.72 ? 67  LYS B N   1 
ATOM   2277 C  CA  . LYS B 1 67  ? 28.456  32.052 29.883  1.00 10.20 ? 67  LYS B CA  1 
ATOM   2278 C  C   . LYS B 1 67  ? 27.047  32.046 30.482  1.00 9.79  ? 67  LYS B C   1 
ATOM   2279 O  O   . LYS B 1 67  ? 26.479  30.969 30.749  1.00 10.24 ? 67  LYS B O   1 
ATOM   2280 C  CB  . LYS B 1 67  ? 29.447  31.480 30.882  1.00 10.58 ? 67  LYS B CB  1 
ATOM   2281 C  CG  . LYS B 1 67  ? 30.831  31.233 30.371  1.00 11.06 ? 67  LYS B CG  1 
ATOM   2282 C  CD  . LYS B 1 67  ? 30.948  29.946 29.571  1.00 11.22 ? 67  LYS B CD  1 
ATOM   2283 C  CE  . LYS B 1 67  ? 32.387  29.685 29.167  1.00 13.06 ? 67  LYS B CE  1 
ATOM   2284 N  NZ  . LYS B 1 67  ? 32.598  28.368 28.573  1.00 13.14 ? 67  LYS B NZ  1 
ATOM   2285 N  N   . LYS B 1 68  ? 26.514  33.215 30.782  1.00 9.48  ? 68  LYS B N   1 
ATOM   2286 C  CA  . LYS B 1 68  ? 25.291  33.283 31.585  1.00 10.06 ? 68  LYS B CA  1 
ATOM   2287 C  C   . LYS B 1 68  ? 24.098  32.623 30.911  1.00 9.89  ? 68  LYS B C   1 
ATOM   2288 O  O   . LYS B 1 68  ? 23.346  31.927 31.563  1.00 11.26 ? 68  LYS B O   1 
ATOM   2289 C  CB  . LYS B 1 68  ? 24.984  34.760 31.942  1.00 10.29 ? 68  LYS B CB  1 
ATOM   2290 C  CG  . LYS B 1 68  ? 26.001  35.335 32.927  1.00 11.80 ? 68  LYS B CG  1 
ATOM   2291 C  CD  . LYS B 1 68  ? 25.850  36.799 33.247  1.00 12.91 ? 68  LYS B CD  1 
ATOM   2292 C  CE  . LYS B 1 68  ? 26.923  37.222 34.236  1.00 14.86 ? 68  LYS B CE  1 
ATOM   2293 N  NZ  . LYS B 1 68  ? 26.715  38.689 34.613  1.00 15.97 ? 68  LYS B NZ  1 
ATOM   2294 N  N   . THR B 1 69  ? 23.888  32.907 29.602  1.00 9.58  ? 69  THR B N   1 
ATOM   2295 C  CA  . THR B 1 69  ? 22.701  32.380 28.957  1.00 9.62  ? 69  THR B CA  1 
ATOM   2296 C  C   . THR B 1 69  ? 22.794  30.872 28.728  1.00 8.64  ? 69  THR B C   1 
ATOM   2297 O  O   . THR B 1 69  ? 21.863  30.137 29.030  1.00 8.63  ? 69  THR B O   1 
ATOM   2298 C  CB  . THR B 1 69  ? 22.455  33.088 27.603  1.00 11.11 ? 69  THR B CB  1 
ATOM   2299 O  OG1 . THR B 1 69  ? 22.225  34.473 27.896  1.00 13.24 ? 69  THR B OG1 1 
ATOM   2300 C  CG2 . THR B 1 69  ? 21.287  32.444 26.849  1.00 14.00 ? 69  THR B CG2 1 
ATOM   2301 N  N   . VAL B 1 70  ? 23.946  30.410 28.231  1.00 8.78  ? 70  VAL B N   1 
ATOM   2302 C  CA  . VAL B 1 70  ? 24.057  28.993 27.920  1.00 8.36  ? 70  VAL B CA  1 
ATOM   2303 C  C   . VAL B 1 70  ? 23.903  28.158 29.198  1.00 7.98  ? 70  VAL B C   1 
ATOM   2304 O  O   . VAL B 1 70  ? 23.362  27.057 29.151  1.00 8.14  ? 70  VAL B O   1 
ATOM   2305 C  CB  . VAL B 1 70  ? 25.354  28.684 27.147  1.00 9.08  ? 70  VAL B CB  1 
ATOM   2306 C  CG1 . VAL B 1 70  ? 26.613  28.948 27.965  1.00 10.31 ? 70  VAL B CG1 1 
ATOM   2307 C  CG2 . VAL B 1 70  ? 25.329  27.270 26.581  1.00 10.65 ? 70  VAL B CG2 1 
ATOM   2308 N  N   . LEU B 1 71  ? 24.424  28.647 30.321  1.00 7.96  ? 71  LEU B N   1 
ATOM   2309 C  CA  . LEU B 1 71  ? 24.298  27.896 31.562  1.00 8.10  ? 71  LEU B CA  1 
ATOM   2310 C  C   . LEU B 1 71  ? 22.952  28.065 32.219  1.00 8.31  ? 71  LEU B C   1 
ATOM   2311 O  O   . LEU B 1 71  ? 22.429  27.096 32.780  1.00 8.56  ? 71  LEU B O   1 
ATOM   2312 C  CB  . LEU B 1 71  ? 25.481  28.170 32.498  1.00 8.57  ? 71  LEU B CB  1 
ATOM   2313 C  CG  . LEU B 1 71  ? 26.760  27.500 32.022  1.00 10.04 ? 71  LEU B CG  1 
ATOM   2314 C  CD1 . LEU B 1 71  ? 27.966  27.996 32.797  1.00 11.42 ? 71  LEU B CD1 1 
ATOM   2315 C  CD2 . LEU B 1 71  ? 26.647  25.980 32.085  1.00 12.49 ? 71  LEU B CD2 1 
ATOM   2316 N  N   . ARG B 1 72  ? 22.337  29.243 32.148  1.00 8.19  ? 72  ARG B N   1 
ATOM   2317 C  CA  . ARG B 1 72  ? 20.925  29.355 32.551  1.00 8.09  ? 72  ARG B CA  1 
ATOM   2318 C  C   . ARG B 1 72  ? 20.111  28.259 31.887  1.00 7.56  ? 72  ARG B C   1 
ATOM   2319 O  O   . ARG B 1 72  ? 19.343  27.530 32.531  1.00 8.08  ? 72  ARG B O   1 
ATOM   2320 C  CB  . ARG B 1 72  ? 20.440  30.744 32.150  1.00 8.18  ? 72  ARG B CB  1 
ATOM   2321 C  CG  . ARG B 1 72  ? 18.936  30.997 32.308  1.00 8.49  ? 72  ARG B CG  1 
ATOM   2322 C  CD  . ARG B 1 72  ? 18.654  32.412 31.937  1.00 8.93  ? 72  ARG B CD  1 
ATOM   2323 N  NE  . ARG B 1 72  ? 17.214  32.701 31.882  1.00 8.71  ? 72  ARG B NE  1 
ATOM   2324 C  CZ  . ARG B 1 72  ? 16.727  33.913 31.673  1.00 8.91  ? 72  ARG B CZ  1 
ATOM   2325 N  NH1 . ARG B 1 72  ? 17.528  34.977 31.554  1.00 11.36 ? 72  ARG B NH1 1 
ATOM   2326 N  NH2 . ARG B 1 72  ? 15.408  34.062 31.583  1.00 9.29  ? 72  ARG B NH2 1 
ATOM   2327 N  N   . ASN B 1 73  ? 20.267  28.137 30.563  1.00 7.50  ? 73  ASN B N   1 
ATOM   2328 C  CA  . ASN B 1 73  ? 19.427  27.211 29.802  1.00 7.42  ? 73  ASN B CA  1 
ATOM   2329 C  C   . ASN B 1 73  ? 19.760  25.753 30.117  1.00 7.48  ? 73  ASN B C   1 
ATOM   2330 O  O   . ASN B 1 73  ? 18.875  24.947 30.316  1.00 7.50  ? 73  ASN B O   1 
ATOM   2331 C  CB  . ASN B 1 73  ? 19.585  27.519 28.308  1.00 7.46  ? 73  ASN B CB  1 
ATOM   2332 C  CG  . ASN B 1 73  ? 18.964  28.841 27.902  1.00 7.40  ? 73  ASN B CG  1 
ATOM   2333 O  OD1 . ASN B 1 73  ? 18.124  29.392 28.613  1.00 8.38  ? 73  ASN B OD1 1 
ATOM   2334 N  ND2 . ASN B 1 73  ? 19.366  29.339 26.734  1.00 8.21  ? 73  ASN B ND2 1 
ATOM   2335 N  N   . ASN B 1 74  ? 21.058  25.415 30.093  1.00 7.23  ? 74  ASN B N   1 
ATOM   2336 C  CA  . ASN B 1 74  ? 21.429  23.998 30.185  1.00 7.34  ? 74  ASN B CA  1 
ATOM   2337 C  C   . ASN B 1 74  ? 21.611  23.512 31.627  1.00 7.46  ? 74  ASN B C   1 
ATOM   2338 O  O   . ASN B 1 74  ? 21.219  22.385 31.921  1.00 7.88  ? 74  ASN B O   1 
ATOM   2339 C  CB  . ASN B 1 74  ? 22.678  23.709 29.353  1.00 7.79  ? 74  ASN B CB  1 
ATOM   2340 C  CG  . ASN B 1 74  ? 22.348  23.822 27.891  1.00 7.96  ? 74  ASN B CG  1 
ATOM   2341 O  OD1 . ASN B 1 74  ? 21.746  22.891 27.352  1.00 9.03  ? 74  ASN B OD1 1 
ATOM   2342 N  ND2 . ASN B 1 74  ? 22.738  24.917 27.249  1.00 9.14  ? 74  ASN B ND2 1 
ATOM   2343 N  N   . ALA B 1 75  ? 22.224  24.328 32.499  1.00 7.85  ? 75  ALA B N   1 
ATOM   2344 C  CA  . ALA B 1 75  ? 22.209  23.960 33.911  1.00 8.00  ? 75  ALA B CA  1 
ATOM   2345 C  C   . ALA B 1 75  ? 20.794  24.008 34.458  1.00 7.67  ? 75  ALA B C   1 
ATOM   2346 O  O   . ALA B 1 75  ? 20.398  23.157 35.229  1.00 7.67  ? 75  ALA B O   1 
ATOM   2347 C  CB  . ALA B 1 75  ? 23.153  24.834 34.733  1.00 8.68  ? 75  ALA B CB  1 
ATOM   2348 N  N   . GLY B 1 76  ? 19.980  24.995 34.027  1.00 7.49  ? 76  GLY B N   1 
ATOM   2349 C  CA  . GLY B 1 76  ? 18.561  24.950 34.373  1.00 7.54  ? 76  GLY B CA  1 
ATOM   2350 C  C   . GLY B 1 76  ? 17.930  23.659 33.920  1.00 7.10  ? 76  GLY B C   1 
ATOM   2351 O  O   . GLY B 1 76  ? 17.211  22.980 34.677  1.00 7.83  ? 76  GLY B O   1 
ATOM   2352 N  N   . GLY B 1 77  ? 18.197  23.247 32.675  1.00 7.14  ? 77  GLY B N   1 
ATOM   2353 C  CA  . GLY B 1 77  ? 17.587  22.016 32.170  1.00 7.28  ? 77  GLY B CA  1 
ATOM   2354 C  C   . GLY B 1 77  ? 18.005  20.827 32.992  1.00 7.41  ? 77  GLY B C   1 
ATOM   2355 O  O   . GLY B 1 77  ? 17.184  19.931 33.334  1.00 7.72  ? 77  GLY B O   1 
ATOM   2356 N  N   . HIS B 1 78  ? 19.282  20.716 33.335  1.00 7.33  ? 78  HIS B N   1 
ATOM   2357 C  CA  . HIS B 1 78  ? 19.751  19.564 34.143  1.00 7.22  ? 78  HIS B CA  1 
ATOM   2358 C  C   . HIS B 1 78  ? 19.140  19.603 35.553  1.00 7.31  ? 78  HIS B C   1 
ATOM   2359 O  O   . HIS B 1 78  ? 18.638  18.560 36.026  1.00 7.76  ? 78  HIS B O   1 
ATOM   2360 C  CB  . HIS B 1 78  ? 21.268  19.555 34.147  1.00 7.68  ? 78  HIS B CB  1 
ATOM   2361 C  CG  . HIS B 1 78  ? 21.878  18.472 34.946  1.00 7.99  ? 78  HIS B CG  1 
ATOM   2362 N  ND1 . HIS B 1 78  ? 21.365  17.188 34.963  1.00 8.34  ? 78  HIS B ND1 1 
ATOM   2363 C  CD2 . HIS B 1 78  ? 23.014  18.472 35.710  1.00 8.70  ? 78  HIS B CD2 1 
ATOM   2364 C  CE1 . HIS B 1 78  ? 22.167  16.460 35.719  1.00 9.05  ? 78  HIS B CE1 1 
ATOM   2365 N  NE2 . HIS B 1 78  ? 23.169  17.202 36.194  1.00 9.47  ? 78  HIS B NE2 1 
ATOM   2366 N  N   . ALA B 1 79  ? 19.151  20.756 36.187  1.00 7.20  ? 79  ALA B N   1 
ATOM   2367 C  CA  . ALA B 1 79  ? 18.559  20.833 37.551  1.00 7.48  ? 79  ALA B CA  1 
ATOM   2368 C  C   . ALA B 1 79  ? 17.087  20.468 37.491  1.00 7.30  ? 79  ALA B C   1 
ATOM   2369 O  O   . ALA B 1 79  ? 16.595  19.718 38.341  1.00 7.84  ? 79  ALA B O   1 
ATOM   2370 C  CB  . ALA B 1 79  ? 18.744  22.237 38.080  1.00 8.13  ? 79  ALA B CB  1 
ATOM   2371 N  N   . ASN B 1 80  ? 16.343  21.044 36.541  1.00 7.15  ? 80  ASN B N   1 
ATOM   2372 C  CA  . ASN B 1 80  ? 14.908  20.866 36.559  1.00 7.04  ? 80  ASN B CA  1 
ATOM   2373 C  C   . ASN B 1 80  ? 14.520  19.418 36.284  1.00 7.14  ? 80  ASN B C   1 
ATOM   2374 O  O   . ASN B 1 80  ? 13.620  18.883 36.928  1.00 7.51  ? 80  ASN B O   1 
ATOM   2375 C  CB  . ASN B 1 80  ? 14.237  21.780 35.522  1.00 7.05  ? 80  ASN B CB  1 
ATOM   2376 C  CG  . ASN B 1 80  ? 14.386  23.238 35.851  1.00 7.22  ? 80  ASN B CG  1 
ATOM   2377 O  OD1 . ASN B 1 80  ? 14.659  23.642 36.973  1.00 8.00  ? 80  ASN B OD1 1 
ATOM   2378 N  ND2 . ASN B 1 80  ? 14.145  24.055 34.811  1.00 8.51  ? 80  ASN B ND2 1 
ATOM   2379 N  N   . HIS B 1 81  ? 15.182  18.777 35.310  1.00 7.06  ? 81  HIS B N   1 
ATOM   2380 C  CA  . HIS B 1 81  ? 14.850  17.394 35.018  1.00 7.16  ? 81  HIS B CA  1 
ATOM   2381 C  C   . HIS B 1 81  ? 15.240  16.498 36.183  1.00 7.25  ? 81  HIS B C   1 
ATOM   2382 O  O   . HIS B 1 81  ? 14.521  15.546 36.499  1.00 7.78  ? 81  HIS B O   1 
ATOM   2383 C  CB  . HIS B 1 81  ? 15.471  16.908 33.707  1.00 7.16  ? 81  HIS B CB  1 
ATOM   2384 C  CG  . HIS B 1 81  ? 14.777  17.502 32.546  1.00 7.24  ? 81  HIS B CG  1 
ATOM   2385 N  ND1 . HIS B 1 81  ? 15.072  18.774 32.086  1.00 7.48  ? 81  HIS B ND1 1 
ATOM   2386 C  CD2 . HIS B 1 81  ? 13.749  17.088 31.784  1.00 7.42  ? 81  HIS B CD2 1 
ATOM   2387 C  CE1 . HIS B 1 81  ? 14.229  19.080 31.102  1.00 7.33  ? 81  HIS B CE1 1 
ATOM   2388 N  NE2 . HIS B 1 81  ? 13.393  18.076 30.891  1.00 7.27  ? 81  HIS B NE2 1 
ATOM   2389 N  N   . SER B 1 82  ? 16.390  16.760 36.815  1.00 7.79  ? 82  SER B N   1 
ATOM   2390 C  CA  . SER B 1 82  ? 16.812  15.936 37.948  1.00 8.30  ? 82  SER B CA  1 
ATOM   2391 C  C   . SER B 1 82  ? 15.756  15.985 39.047  1.00 7.50  ? 82  SER B C   1 
ATOM   2392 O  O   . SER B 1 82  ? 15.423  14.956 39.657  1.00 8.66  ? 82  SER B O   1 
ATOM   2393 C  CB  . SER B 1 82  ? 18.168  16.425 38.443  1.00 8.80  ? 82  SER B CB  1 
ATOM   2394 O  OG  . SER B 1 82  ? 19.177  16.217 37.467  1.00 8.96  ? 82  SER B OG  1 
ATOM   2395 N  N   . LEU B 1 83  ? 15.216  17.180 39.353  1.00 7.88  ? 83  LEU B N   1 
ATOM   2396 C  CA  . LEU B 1 83  ? 14.171  17.332 40.326  1.00 8.05  ? 83  LEU B CA  1 
ATOM   2397 C  C   . LEU B 1 83  ? 12.929  16.600 39.862  1.00 7.66  ? 83  LEU B C   1 
ATOM   2398 O  O   . LEU B 1 83  ? 12.257  15.909 40.658  1.00 8.67  ? 83  LEU B O   1 
ATOM   2399 C  CB  . LEU B 1 83  ? 13.911  18.818 40.558  1.00 8.80  ? 83  LEU B CB  1 
ATOM   2400 C  CG  . LEU B 1 83  ? 12.870  19.178 41.595  1.00 10.15 ? 83  LEU B CG  1 
ATOM   2401 C  CD1 . LEU B 1 83  ? 13.207  20.573 42.149  1.00 13.04 ? 83  LEU B CD1 1 
ATOM   2402 C  CD2 . LEU B 1 83  ? 11.442  19.095 41.153  1.00 12.57 ? 83  LEU B CD2 1 
ATOM   2403 N  N   . PHE B 1 84  ? 12.548  16.754 38.596  1.00 7.50  ? 84  PHE B N   1 
ATOM   2404 C  CA  . PHE B 1 84  ? 11.335  16.144 38.084  1.00 7.71  ? 84  PHE B CA  1 
ATOM   2405 C  C   . PHE B 1 84  ? 11.328  14.649 38.262  1.00 7.59  ? 84  PHE B C   1 
ATOM   2406 O  O   . PHE B 1 84  ? 10.334  14.084 38.723  1.00 8.36  ? 84  PHE B O   1 
ATOM   2407 C  CB  . PHE B 1 84  ? 11.199  16.547 36.606  1.00 7.64  ? 84  PHE B CB  1 
ATOM   2408 C  CG  . PHE B 1 84  ? 9.878   16.208 35.923  1.00 7.76  ? 84  PHE B CG  1 
ATOM   2409 C  CD1 . PHE B 1 84  ? 8.664   16.652 36.454  1.00 8.39  ? 84  PHE B CD1 1 
ATOM   2410 C  CD2 . PHE B 1 84  ? 9.864   15.500 34.746  1.00 8.53  ? 84  PHE B CD2 1 
ATOM   2411 C  CE1 . PHE B 1 84  ? 7.464   16.391 35.816  1.00 8.90  ? 84  PHE B CE1 1 
ATOM   2412 C  CE2 . PHE B 1 84  ? 8.660   15.252 34.078  1.00 9.27  ? 84  PHE B CE2 1 
ATOM   2413 C  CZ  . PHE B 1 84  ? 7.457   15.695 34.613  1.00 9.07  ? 84  PHE B CZ  1 
ATOM   2414 N  N   . TRP B 1 85  ? 12.442  13.956 37.938  1.00 7.67  ? 85  TRP B N   1 
ATOM   2415 C  CA  . TRP B 1 85  ? 12.376  12.513 38.036  1.00 8.18  ? 85  TRP B CA  1 
ATOM   2416 C  C   . TRP B 1 85  ? 12.134  12.072 39.481  1.00 8.65  ? 85  TRP B C   1 
ATOM   2417 O  O   . TRP B 1 85  ? 11.376  11.129 39.751  1.00 9.30  ? 85  TRP B O   1 
ATOM   2418 C  CB  . TRP B 1 85  ? 13.626  11.820 37.515  1.00 8.55  ? 85  TRP B CB  1 
ATOM   2419 C  CG  . TRP B 1 85  ? 14.084  12.262 36.155  1.00 8.04  ? 85  TRP B CG  1 
ATOM   2420 C  CD1 . TRP B 1 85  ? 15.338  12.654 35.824  1.00 8.60  ? 85  TRP B CD1 1 
ATOM   2421 C  CD2 . TRP B 1 85  ? 13.292  12.334 34.975  1.00 8.00  ? 85  TRP B CD2 1 
ATOM   2422 N  NE1 . TRP B 1 85  ? 15.411  12.971 34.507  1.00 8.73  ? 85  TRP B NE1 1 
ATOM   2423 C  CE2 . TRP B 1 85  ? 14.164  12.804 33.942  1.00 8.26  ? 85  TRP B CE2 1 
ATOM   2424 C  CE3 . TRP B 1 85  ? 11.970  12.069 34.652  1.00 9.56  ? 85  TRP B CE3 1 
ATOM   2425 C  CZ2 . TRP B 1 85  ? 13.715  13.007 32.652  1.00 9.13  ? 85  TRP B CZ2 1 
ATOM   2426 C  CZ3 . TRP B 1 85  ? 11.519  12.274 33.348  1.00 10.54 ? 85  TRP B CZ3 1 
ATOM   2427 C  CH2 . TRP B 1 85  ? 12.413  12.750 32.349  1.00 10.71 ? 85  TRP B CH2 1 
ATOM   2428 N  N   . LYS B 1 86  ? 12.828  12.723 40.419  1.00 8.71  ? 86  LYS B N   1 
ATOM   2429 C  CA  . LYS B 1 86  ? 12.671  12.400 41.838  1.00 9.25  ? 86  LYS B CA  1 
ATOM   2430 C  C   . LYS B 1 86  ? 11.316  12.831 42.364  1.00 9.18  ? 86  LYS B C   1 
ATOM   2431 O  O   . LYS B 1 86  ? 10.848  12.306 43.391  1.00 10.09 ? 86  LYS B O   1 
ATOM   2432 C  CB  . LYS B 1 86  ? 13.806  13.071 42.619  1.00 10.39 ? 86  LYS B CB  1 
ATOM   2433 C  CG  . LYS B 1 86  ? 15.154  12.420 42.398  1.00 12.77 ? 86  LYS B CG  1 
ATOM   2434 C  CD  . LYS B 1 86  ? 16.329  13.155 43.012  1.00 18.66 ? 86  LYS B CD  1 
ATOM   2435 C  CE  . LYS B 1 86  ? 16.523  12.642 44.426  1.00 31.59 ? 86  LYS B CE  1 
ATOM   2436 N  NZ  . LYS B 1 86  ? 17.836  13.224 44.825  1.00 33.57 ? 86  LYS B NZ  1 
ATOM   2437 N  N   . GLY B 1 87  ? 10.688  13.737 41.660  1.00 8.76  ? 87  GLY B N   1 
ATOM   2438 C  CA  . GLY B 1 87  ? 9.419   14.305 42.013  1.00 8.69  ? 87  GLY B CA  1 
ATOM   2439 C  C   . GLY B 1 87  ? 8.210   13.593 41.452  1.00 8.42  ? 87  GLY B C   1 
ATOM   2440 O  O   . GLY B 1 87  ? 7.073   14.119 41.607  1.00 8.81  ? 87  GLY B O   1 
ATOM   2441 N  N   . LEU B 1 88  ? 8.408   12.424 40.862  1.00 8.32  ? 88  LEU B N   1 
ATOM   2442 C  CA  . LEU B 1 88  ? 7.383   11.572 40.342  1.00 8.49  ? 88  LEU B CA  1 
ATOM   2443 C  C   . LEU B 1 88  ? 7.471   10.205 41.031  1.00 9.00  ? 88  LEU B C   1 
ATOM   2444 O  O   . LEU B 1 88  ? 8.568   9.718  41.220  1.00 10.40 ? 88  LEU B O   1 
ATOM   2445 C  CB  . LEU B 1 88  ? 7.525   11.371 38.820  1.00 8.65  ? 88  LEU B CB  1 
ATOM   2446 C  CG  . LEU B 1 88  ? 7.440   12.659 38.008  1.00 8.09  ? 88  LEU B CG  1 
ATOM   2447 C  CD1 . LEU B 1 88  ? 7.922   12.433 36.599  1.00 8.98  ? 88  LEU B CD1 1 
ATOM   2448 C  CD2 . LEU B 1 88  ? 6.031   13.230 37.989  1.00 9.55  ? 88  LEU B CD2 1 
ATOM   2449 N  N   . LYS B 1 89  ? 6.332   9.654  41.368  1.00 8.99  ? 89  LYS B N   1 
ATOM   2450 C  CA  . LYS B 1 89  ? 6.244   8.320  41.989  1.00 9.58  ? 89  LYS B CA  1 
ATOM   2451 C  C   . LYS B 1 89  ? 4.773   7.997  42.115  1.00 10.27 ? 89  LYS B C   1 
ATOM   2452 O  O   . LYS B 1 89  ? 4.017   8.854  42.589  1.00 11.94 ? 89  LYS B O   1 
ATOM   2453 C  CB  . LYS B 1 89  ? 6.866   8.283  43.356  1.00 10.45 ? 89  LYS B CB  1 
ATOM   2454 C  CG  . LYS B 1 89  ? 7.066   6.890  43.963  1.00 12.81 ? 89  LYS B CG  1 
ATOM   2455 C  CD  . LYS B 1 89  ? 7.881   6.877  45.240  1.00 14.49 ? 89  LYS B CD  1 
ATOM   2456 C  CE  . LYS B 1 89  ? 8.114   5.489  45.769  1.00 15.95 ? 89  LYS B CE  1 
ATOM   2457 N  NZ  . LYS B 1 89  ? 8.982   5.433  46.987  1.00 15.51 ? 89  LYS B NZ  1 
ATOM   2458 N  N   . LYS B 1 90  ? 4.344   6.801  41.698  1.00 11.07 ? 90  LYS B N   1 
ATOM   2459 C  CA  . LYS B 1 90  ? 3.054   6.327  42.067  1.00 12.37 ? 90  LYS B CA  1 
ATOM   2460 C  C   . LYS B 1 90  ? 3.011   5.871  43.531  1.00 12.98 ? 90  LYS B C   1 
ATOM   2461 O  O   . LYS B 1 90  ? 4.049   5.608  44.157  1.00 15.02 ? 90  LYS B O   1 
ATOM   2462 C  CB  . LYS B 1 90  ? 2.596   5.161  41.192  1.00 13.25 ? 90  LYS B CB  1 
ATOM   2463 C  CG  . LYS B 1 90  ? 2.373   5.562  39.767  1.00 13.72 ? 90  LYS B CG  1 
ATOM   2464 C  CD  . LYS B 1 90  ? 1.908   4.398  38.915  1.00 15.50 ? 90  LYS B CD  1 
ATOM   2465 C  CE  . LYS B 1 90  ? 0.513   3.898  39.205  1.00 15.87 ? 90  LYS B CE  1 
ATOM   2466 N  NZ  . LYS B 1 90  ? 0.271   2.588  38.482  1.00 20.32 ? 90  LYS B NZ  1 
ATOM   2467 N  N   A GLY B 1 91  ? 1.850   5.811  44.143  0.64 12.55 ? 91  GLY B N   1 
ATOM   2468 N  N   B GLY B 1 91  ? 1.754   5.876  43.935  0.36 13.36 ? 91  GLY B N   1 
ATOM   2469 C  CA  A GLY B 1 91  ? 1.847   5.178  45.457  0.64 10.34 ? 91  GLY B CA  1 
ATOM   2470 C  CA  B GLY B 1 91  ? 0.978   5.428  45.056  0.36 14.04 ? 91  GLY B CA  1 
ATOM   2471 C  C   A GLY B 1 91  ? 2.068   6.142  46.593  0.64 9.35  ? 91  GLY B C   1 
ATOM   2472 C  C   B GLY B 1 91  ? 1.146   6.272  46.312  0.36 13.15 ? 91  GLY B C   1 
ATOM   2473 O  O   A GLY B 1 91  ? 2.480   5.747  47.679  0.64 9.96  ? 91  GLY B O   1 
ATOM   2474 O  O   B GLY B 1 91  ? 0.843   5.676  47.350  0.36 14.05 ? 91  GLY B O   1 
ATOM   2475 N  N   A THR B 1 92  ? 1.776   7.442  46.339  0.64 10.71 ? 92  THR B N   1 
ATOM   2476 N  N   B THR B 1 92  ? 1.611   7.520  46.261  0.36 12.45 ? 92  THR B N   1 
ATOM   2477 C  CA  . THR B 1 92  ? 1.850   8.467  47.351  1.00 11.00 ? 92  THR B CA  1 
ATOM   2478 C  C   . THR B 1 92  ? 0.543   9.226  47.569  1.00 9.99  ? 92  THR B C   1 
ATOM   2479 O  O   . THR B 1 92  ? -0.316  9.225  46.673  1.00 11.13 ? 92  THR B O   1 
ATOM   2480 C  CB  . THR B 1 92  ? 3.020   9.481  47.118  1.00 10.14 ? 92  THR B CB  1 
ATOM   2481 O  OG1 . THR B 1 92  ? 2.599   10.490 46.189  1.00 9.65  ? 92  THR B OG1 1 
ATOM   2482 C  CG2 . THR B 1 92  ? 4.280   8.797  46.628  1.00 10.42 ? 92  THR B CG2 1 
ATOM   2483 N  N   . THR B 1 93  ? 0.416   9.854  48.712  1.00 9.95  ? 93  THR B N   1 
ATOM   2484 C  CA  . THR B 1 93  ? -0.777  10.584 49.087  1.00 9.89  ? 93  THR B CA  1 
ATOM   2485 C  C   . THR B 1 93  ? -0.347  11.918 49.689  1.00 9.42  ? 93  THR B C   1 
ATOM   2486 O  O   . THR B 1 93  ? 0.548   11.928 50.541  1.00 10.15 ? 93  THR B O   1 
ATOM   2487 C  CB  . THR B 1 93  ? -1.558  9.806  50.134  1.00 11.13 ? 93  THR B CB  1 
ATOM   2488 O  OG1 . THR B 1 93  ? -1.924  8.529  49.583  1.00 12.13 ? 93  THR B OG1 1 
ATOM   2489 C  CG2 . THR B 1 93  ? -2.842  10.537 50.559  1.00 12.41 ? 93  THR B CG2 1 
ATOM   2490 N  N   . LEU B 1 94  ? -1.014  12.995 49.293  1.00 9.29  ? 94  LEU B N   1 
ATOM   2491 C  CA  . LEU B 1 94  ? -0.830  14.284 49.926  1.00 9.34  ? 94  LEU B CA  1 
ATOM   2492 C  C   . LEU B 1 94  ? -1.403  14.182 51.334  1.00 10.13 ? 94  LEU B C   1 
ATOM   2493 O  O   . LEU B 1 94  ? -2.608  13.910 51.477  1.00 11.43 ? 94  LEU B O   1 
ATOM   2494 C  CB  . LEU B 1 94  ? -1.502  15.363 49.102  1.00 10.23 ? 94  LEU B CB  1 
ATOM   2495 C  CG  . LEU B 1 94  ? -1.485  16.770 49.727  1.00 9.96  ? 94  LEU B CG  1 
ATOM   2496 C  CD1 . LEU B 1 94  ? -0.110  17.265 50.075  1.00 10.22 ? 94  LEU B CD1 1 
ATOM   2497 C  CD2 . LEU B 1 94  ? -2.197  17.733 48.796  1.00 11.67 ? 94  LEU B CD2 1 
ATOM   2498 N  N   . GLN B 1 95  ? -0.589  14.395 52.357  1.00 9.78  ? 95  GLN B N   1 
ATOM   2499 C  CA  . GLN B 1 95  ? -1.023  14.128 53.729  1.00 10.58 ? 95  GLN B CA  1 
ATOM   2500 C  C   . GLN B 1 95  ? -0.052  14.858 54.666  1.00 10.79 ? 95  GLN B C   1 
ATOM   2501 O  O   . GLN B 1 95  ? 0.908   15.496 54.249  1.00 11.83 ? 95  GLN B O   1 
ATOM   2502 C  CB  . GLN B 1 95  ? -1.122  12.652 54.006  1.00 10.62 ? 95  GLN B CB  1 
ATOM   2503 C  CG  . GLN B 1 95  ? 0.192   11.911 53.897  1.00 10.97 ? 95  GLN B CG  1 
ATOM   2504 C  CD  . GLN B 1 95  ? 0.003   10.417 54.015  1.00 11.54 ? 95  GLN B CD  1 
ATOM   2505 O  OE1 . GLN B 1 95  ? -0.728  9.967  54.894  1.00 17.01 ? 95  GLN B OE1 1 
ATOM   2506 N  NE2 . GLN B 1 95  ? 0.695   9.617  53.224  1.00 11.59 ? 95  GLN B NE2 1 
ATOM   2507 N  N   . GLY B 1 96  ? -0.362  14.719 55.952  1.00 11.79 ? 96  GLY B N   1 
ATOM   2508 C  CA  . GLY B 1 96  ? 0.556   15.206 56.973  1.00 12.17 ? 96  GLY B CA  1 
ATOM   2509 C  C   . GLY B 1 96  ? 0.778   16.682 56.932  1.00 11.23 ? 96  GLY B C   1 
ATOM   2510 O  O   . GLY B 1 96  ? -0.076  17.514 56.566  1.00 11.92 ? 96  GLY B O   1 
ATOM   2511 N  N   . ASP B 1 97  ? 1.965   17.091 57.360  1.00 10.90 ? 97  ASP B N   1 
ATOM   2512 C  CA  . ASP B 1 97  ? 2.301   18.499 57.482  1.00 10.94 ? 97  ASP B CA  1 
ATOM   2513 C  C   . ASP B 1 97  ? 2.176   19.249 56.151  1.00 10.55 ? 97  ASP B C   1 
ATOM   2514 O  O   . ASP B 1 97  ? 1.729   20.394 56.137  1.00 11.58 ? 97  ASP B O   1 
ATOM   2515 C  CB  . ASP B 1 97  ? 3.717   18.669 57.991  1.00 11.71 ? 97  ASP B CB  1 
ATOM   2516 C  CG  . ASP B 1 97  ? 3.947   18.332 59.434  1.00 12.73 ? 97  ASP B CG  1 
ATOM   2517 O  OD1 . ASP B 1 97  ? 2.946   18.236 60.209  1.00 15.73 ? 97  ASP B OD1 1 
ATOM   2518 O  OD2 . ASP B 1 97  ? 5.121   18.146 59.752  1.00 16.07 ? 97  ASP B OD2 1 
ATOM   2519 N  N   . LEU B 1 98  ? 2.575   18.632 55.059  1.00 10.38 ? 98  LEU B N   1 
ATOM   2520 C  CA  . LEU B 1 98  ? 2.508   19.350 53.786  1.00 10.45 ? 98  LEU B CA  1 
ATOM   2521 C  C   . LEU B 1 98  ? 1.058   19.612 53.372  1.00 10.10 ? 98  LEU B C   1 
ATOM   2522 O  O   . LEU B 1 98  ? 0.733   20.703 52.916  1.00 10.34 ? 98  LEU B O   1 
ATOM   2523 C  CB  . LEU B 1 98  ? 3.241   18.597 52.690  1.00 10.07 ? 98  LEU B CB  1 
ATOM   2524 C  CG  . LEU B 1 98  ? 3.197   19.259 51.289  1.00 10.16 ? 98  LEU B CG  1 
ATOM   2525 C  CD1 . LEU B 1 98  ? 3.660   20.679 51.257  1.00 12.04 ? 98  LEU B CD1 1 
ATOM   2526 C  CD2 . LEU B 1 98  ? 3.949   18.376 50.309  1.00 11.49 ? 98  LEU B CD2 1 
ATOM   2527 N  N   . LYS B 1 99  ? 0.190   18.619 53.579  1.00 10.20 ? 99  LYS B N   1 
ATOM   2528 C  CA  . LYS B 1 99  ? -1.213  18.859 53.290  1.00 10.44 ? 99  LYS B CA  1 
ATOM   2529 C  C   . LYS B 1 99  ? -1.749  20.019 54.118  1.00 10.22 ? 99  LYS B C   1 
ATOM   2530 O  O   . LYS B 1 99  ? -2.472  20.886 53.635  1.00 10.63 ? 99  LYS B O   1 
ATOM   2531 C  CB  . LYS B 1 99  ? -2.053  17.604 53.544  1.00 10.90 ? 99  LYS B CB  1 
ATOM   2532 C  CG  . LYS B 1 99  ? -3.531  17.753 53.221  1.00 11.75 ? 99  LYS B CG  1 
ATOM   2533 C  CD  . LYS B 1 99  ? -4.268  16.458 53.359  1.00 12.97 ? 99  LYS B CD  1 
ATOM   2534 C  CE  . LYS B 1 99  ? -5.751  16.576 53.145  1.00 16.18 ? 99  LYS B CE  1 
ATOM   2535 N  NZ  . LYS B 1 99  ? -6.404  15.234 53.122  1.00 21.60 ? 99  LYS B NZ  1 
ATOM   2536 N  N   . ALA B 1 100 ? -1.439  20.014 55.436  1.00 10.61 ? 100 ALA B N   1 
ATOM   2537 C  CA  . ALA B 1 100 ? -1.942  21.072 56.278  1.00 10.90 ? 100 ALA B CA  1 
ATOM   2538 C  C   . ALA B 1 100 ? -1.406  22.435 55.841  1.00 10.64 ? 100 ALA B C   1 
ATOM   2539 O  O   . ALA B 1 100 ? -2.140  23.457 55.924  1.00 11.73 ? 100 ALA B O   1 
ATOM   2540 C  CB  . ALA B 1 100 ? -1.601  20.792 57.743  1.00 12.55 ? 100 ALA B CB  1 
ATOM   2541 N  N   . ALA B 1 101 ? -0.156  22.524 55.413  1.00 11.19 ? 101 ALA B N   1 
ATOM   2542 C  CA  . ALA B 1 101 ? 0.398   23.778 54.951  1.00 11.25 ? 101 ALA B CA  1 
ATOM   2543 C  C   . ALA B 1 101 ? -0.265  24.259 53.678  1.00 10.48 ? 101 ALA B C   1 
ATOM   2544 O  O   . ALA B 1 101 ? -0.523  25.451 53.505  1.00 11.36 ? 101 ALA B O   1 
ATOM   2545 C  CB  . ALA B 1 101 ? 1.902   23.678 54.771  1.00 12.27 ? 101 ALA B CB  1 
ATOM   2546 N  N   . ILE B 1 102 ? -0.551  23.335 52.758  1.00 10.21 ? 102 ILE B N   1 
ATOM   2547 C  CA  . ILE B 1 102 ? -1.292  23.660 51.518  1.00 10.29 ? 102 ILE B CA  1 
ATOM   2548 C  C   . ILE B 1 102 ? -2.644  24.218 51.900  1.00 10.33 ? 102 ILE B C   1 
ATOM   2549 O  O   . ILE B 1 102 ? -3.092  25.230 51.343  1.00 10.66 ? 102 ILE B O   1 
ATOM   2550 C  CB  . ILE B 1 102 ? -1.338  22.463 50.585  1.00 9.81  ? 102 ILE B CB  1 
ATOM   2551 C  CG1 . ILE B 1 102 ? 0.036   22.267 49.936  1.00 10.46 ? 102 ILE B CG1 1 
ATOM   2552 C  CG2 . ILE B 1 102 ? -2.427  22.638 49.530  1.00 11.03 ? 102 ILE B CG2 1 
ATOM   2553 C  CD1 . ILE B 1 102 ? 0.184   21.081 49.034  1.00 10.37 ? 102 ILE B CD1 1 
ATOM   2554 N  N   . GLU B 1 103 ? -3.344  23.558 52.823  1.00 11.10 ? 103 GLU B N   1 
ATOM   2555 C  CA  . GLU B 1 103 ? -4.657  24.051 53.238  1.00 12.16 ? 103 GLU B CA  1 
ATOM   2556 C  C   . GLU B 1 103 ? -4.575  25.412 53.859  1.00 12.70 ? 103 GLU B C   1 
ATOM   2557 O  O   . GLU B 1 103 ? -5.430  26.294 53.598  1.00 13.73 ? 103 GLU B O   1 
ATOM   2558 C  CB  . GLU B 1 103 ? -5.311  23.061 54.214  1.00 12.09 ? 103 GLU B CB  1 
ATOM   2559 C  CG  . GLU B 1 103 ? -5.632  21.747 53.495  1.00 11.84 ? 103 GLU B CG  1 
ATOM   2560 C  CD  . GLU B 1 103 ? -6.042  20.628 54.370  1.00 13.67 ? 103 GLU B CD  1 
ATOM   2561 O  OE1 . GLU B 1 103 ? -5.543  20.445 55.518  1.00 15.86 ? 103 GLU B OE1 1 
ATOM   2562 O  OE2 . GLU B 1 103 ? -6.872  19.813 53.897  1.00 14.58 ? 103 GLU B OE2 1 
ATOM   2563 N  N   A ARG B 1 104 ? -3.553  25.691 54.680  0.50 18.12 ? 104 ARG B N   1 
ATOM   2564 N  N   B ARG B 1 104 ? -3.546  25.665 54.653  0.50 18.48 ? 104 ARG B N   1 
ATOM   2565 C  CA  A ARG B 1 104 ? -3.339  26.991 55.309  0.50 20.42 ? 104 ARG B CA  1 
ATOM   2566 C  CA  B ARG B 1 104 ? -3.407  26.976 55.280  0.50 20.21 ? 104 ARG B CA  1 
ATOM   2567 C  C   A ARG B 1 104 ? -3.119  28.069 54.238  0.50 22.28 ? 104 ARG B C   1 
ATOM   2568 C  C   B ARG B 1 104 ? -3.125  28.062 54.237  0.50 22.32 ? 104 ARG B C   1 
ATOM   2569 O  O   A ARG B 1 104 ? -3.756  29.142 54.278  0.50 24.40 ? 104 ARG B O   1 
ATOM   2570 O  O   B ARG B 1 104 ? -3.736  29.153 54.300  0.50 24.35 ? 104 ARG B O   1 
ATOM   2571 C  CB  A ARG B 1 104 ? -2.082  26.939 56.174  0.50 29.63 ? 104 ARG B CB  1 
ATOM   2572 C  CB  B ARG B 1 104 ? -2.228  26.861 56.245  0.50 28.01 ? 104 ARG B CB  1 
ATOM   2573 C  CG  A ARG B 1 104 ? -1.533  28.303 56.595  0.50 31.16 ? 104 ARG B CG  1 
ATOM   2574 C  CG  B ARG B 1 104 ? -1.949  28.136 57.015  0.50 32.27 ? 104 ARG B CG  1 
ATOM   2575 C  CD  A ARG B 1 104 ? -0.198  28.121 57.314  0.50 33.16 ? 104 ARG B CD  1 
ATOM   2576 C  CD  B ARG B 1 104 ? -0.543  28.159 57.589  0.50 34.74 ? 104 ARG B CD  1 
ATOM   2577 N  NE  A ARG B 1 104 ? 0.887   27.954 56.354  0.50 32.18 ? 104 ARG B NE  1 
ATOM   2578 N  NE  B ARG B 1 104 ? 0.438   28.757 56.686  0.50 35.77 ? 104 ARG B NE  1 
ATOM   2579 C  CZ  A ARG B 1 104 ? 2.027   27.323 56.465  0.50 29.75 ? 104 ARG B CZ  1 
ATOM   2580 C  CZ  B ARG B 1 104 ? 1.540   29.415 56.951  0.50 29.19 ? 104 ARG B CZ  1 
ATOM   2581 N  NH1 A ARG B 1 104 ? 2.327   26.695 57.606  0.50 39.29 ? 104 ARG B NH1 1 
ATOM   2582 N  NH1 B ARG B 1 104 ? 1.913   29.631 58.225  0.50 45.86 ? 104 ARG B NH1 1 
ATOM   2583 N  NH2 A ARG B 1 104 ? 2.904   27.291 55.451  0.50 24.65 ? 104 ARG B NH2 1 
ATOM   2584 N  NH2 B ARG B 1 104 ? 2.273   29.869 55.922  0.50 34.26 ? 104 ARG B NH2 1 
ATOM   2585 N  N   . ASP B 1 105 ? -2.258  27.743 53.279  1.00 13.17 ? 105 ASP B N   1 
ATOM   2586 C  CA  . ASP B 1 105 ? -1.824  28.825 52.376  1.00 13.30 ? 105 ASP B CA  1 
ATOM   2587 C  C   . ASP B 1 105 ? -2.731  29.054 51.172  1.00 12.27 ? 105 ASP B C   1 
ATOM   2588 O  O   . ASP B 1 105 ? -2.692  30.137 50.619  1.00 14.52 ? 105 ASP B O   1 
ATOM   2589 C  CB  . ASP B 1 105 ? -0.376  28.540 51.943  1.00 13.67 ? 105 ASP B CB  1 
ATOM   2590 C  CG  . ASP B 1 105 ? 0.625   28.630 53.074  1.00 14.82 ? 105 ASP B CG  1 
ATOM   2591 O  OD1 . ASP B 1 105 ? 0.321   29.260 54.136  1.00 18.50 ? 105 ASP B OD1 1 
ATOM   2592 O  OD2 . ASP B 1 105 ? 1.787   28.126 52.925  1.00 14.68 ? 105 ASP B OD2 1 
ATOM   2593 N  N   . PHE B 1 106 ? -3.485  28.024 50.792  1.00 11.04 ? 106 PHE B N   1 
ATOM   2594 C  CA  . PHE B 1 106 ? -4.373  28.136 49.654  1.00 11.56 ? 106 PHE B CA  1 
ATOM   2595 C  C   . PHE B 1 106 ? -5.843  28.045 50.000  1.00 11.62 ? 106 PHE B C   1 
ATOM   2596 O  O   . PHE B 1 106 ? -6.698  28.231 49.148  1.00 13.68 ? 106 PHE B O   1 
ATOM   2597 C  CB  . PHE B 1 106 ? -4.071  27.043 48.620  1.00 10.63 ? 106 PHE B CB  1 
ATOM   2598 C  CG  . PHE B 1 106 ? -2.680  27.141 48.033  1.00 10.71 ? 106 PHE B CG  1 
ATOM   2599 C  CD1 . PHE B 1 106 ? -2.442  27.888 46.871  1.00 11.60 ? 106 PHE B CD1 1 
ATOM   2600 C  CD2 . PHE B 1 106 ? -1.600  26.537 48.592  1.00 10.60 ? 106 PHE B CD2 1 
ATOM   2601 C  CE1 . PHE B 1 106 ? -1.177  27.993 46.338  1.00 12.76 ? 106 PHE B CE1 1 
ATOM   2602 C  CE2 . PHE B 1 106 ? -0.326  26.590 48.045  1.00 11.89 ? 106 PHE B CE2 1 
ATOM   2603 C  CZ  . PHE B 1 106 ? -0.136  27.322 46.928  1.00 12.16 ? 106 PHE B CZ  1 
ATOM   2604 N  N   . GLY B 1 107 ? -6.151  27.730 51.268  1.00 12.20 ? 107 GLY B N   1 
ATOM   2605 C  CA  . GLY B 1 107 ? -7.482  27.535 51.751  1.00 13.00 ? 107 GLY B CA  1 
ATOM   2606 C  C   . GLY B 1 107 ? -7.951  26.115 51.748  1.00 12.14 ? 107 GLY B C   1 
ATOM   2607 O  O   . GLY B 1 107 ? -8.671  25.662 52.667  1.00 13.56 ? 107 GLY B O   1 
ATOM   2608 N  N   . SER B 1 108 ? -7.590  25.358 50.728  1.00 11.81 ? 108 SER B N   1 
ATOM   2609 C  CA  . SER B 1 108 ? -7.947  23.993 50.590  1.00 10.93 ? 108 SER B CA  1 
ATOM   2610 C  C   . SER B 1 108 ? -7.018  23.338 49.564  1.00 10.33 ? 108 SER B C   1 
ATOM   2611 O  O   . SER B 1 108 ? -6.378  24.004 48.762  1.00 10.54 ? 108 SER B O   1 
ATOM   2612 C  CB  . SER B 1 108 ? -9.375  23.768 50.093  1.00 12.18 ? 108 SER B CB  1 
ATOM   2613 O  OG  . SER B 1 108 ? -9.498  24.266 48.761  1.00 12.35 ? 108 SER B OG  1 
ATOM   2614 N  N   . VAL B 1 109 ? -6.940  22.004 49.613  1.00 10.11 ? 109 VAL B N   1 
ATOM   2615 C  CA  . VAL B 1 109 ? -6.219  21.283 48.578  1.00 9.90  ? 109 VAL B CA  1 
ATOM   2616 C  C   . VAL B 1 109 ? -6.785  21.576 47.216  1.00 9.91  ? 109 VAL B C   1 
ATOM   2617 O  O   . VAL B 1 109 ? -6.025  21.809 46.250  1.00 9.81  ? 109 VAL B O   1 
ATOM   2618 C  CB  . VAL B 1 109 ? -6.211  19.764 48.862  1.00 10.96 ? 109 VAL B CB  1 
ATOM   2619 C  CG1 . VAL B 1 109 ? -5.623  18.972 47.668  1.00 11.65 ? 109 VAL B CG1 1 
ATOM   2620 C  CG2 . VAL B 1 109 ? -5.366  19.459 50.114  1.00 11.68 ? 109 VAL B CG2 1 
ATOM   2621 N  N   . ASP B 1 110 ? -8.116  21.569 47.058  1.00 10.67 ? 110 ASP B N   1 
ATOM   2622 C  CA  . ASP B 1 110 ? -8.696  21.806 45.741  1.00 11.19 ? 110 ASP B CA  1 
ATOM   2623 C  C   . ASP B 1 110 ? -8.368  23.188 45.212  1.00 10.05 ? 110 ASP B C   1 
ATOM   2624 O  O   . ASP B 1 110 ? -8.178  23.358 44.015  1.00 9.79  ? 110 ASP B O   1 
ATOM   2625 C  CB  . ASP B 1 110 ? -10.165 21.497 45.708  1.00 13.34 ? 110 ASP B CB  1 
ATOM   2626 C  CG  . ASP B 1 110 ? -10.445 19.977 45.656  1.00 14.45 ? 110 ASP B CG  1 
ATOM   2627 O  OD1 . ASP B 1 110 ? -9.489  19.109 45.697  1.00 16.43 ? 110 ASP B OD1 1 
ATOM   2628 O  OD2 . ASP B 1 110 ? -11.643 19.730 45.598  1.00 19.86 ? 110 ASP B OD2 1 
ATOM   2629 N  N   . ASN B 1 111 ? -8.285  24.211 46.071  1.00 10.60 ? 111 ASN B N   1 
ATOM   2630 C  CA  . ASN B 1 111 ? -7.862  25.550 45.623  1.00 10.53 ? 111 ASN B CA  1 
ATOM   2631 C  C   . ASN B 1 111 ? -6.446  25.523 45.103  1.00 9.00  ? 111 ASN B C   1 
ATOM   2632 O  O   . ASN B 1 111 ? -6.139  26.112 44.054  1.00 9.97  ? 111 ASN B O   1 
ATOM   2633 C  CB  . ASN B 1 111 ? -7.959  26.581 46.739  1.00 11.82 ? 111 ASN B CB  1 
ATOM   2634 C  CG  . ASN B 1 111 ? -9.348  27.060 47.088  1.00 14.81 ? 111 ASN B CG  1 
ATOM   2635 O  OD1 . ASN B 1 111 ? -9.445  27.851 48.040  1.00 16.50 ? 111 ASN B OD1 1 
ATOM   2636 N  ND2 . ASN B 1 111 ? -10.318 26.563 46.396  1.00 18.36 ? 111 ASN B ND2 1 
ATOM   2637 N  N   . PHE B 1 112 ? -5.549  24.866 45.843  1.00 9.45  ? 112 PHE B N   1 
ATOM   2638 C  CA  . PHE B 1 112 ? -4.187  24.701 45.372  1.00 8.86  ? 112 PHE B CA  1 
ATOM   2639 C  C   . PHE B 1 112 ? -4.164  24.007 44.022  1.00 7.95  ? 112 PHE B C   1 
ATOM   2640 O  O   . PHE B 1 112 ? -3.455  24.477 43.107  1.00 8.35  ? 112 PHE B O   1 
ATOM   2641 C  CB  . PHE B 1 112 ? -3.366  23.945 46.448  1.00 8.92  ? 112 PHE B CB  1 
ATOM   2642 C  CG  . PHE B 1 112 ? -2.240  23.173 45.814  1.00 8.66  ? 112 PHE B CG  1 
ATOM   2643 C  CD1 . PHE B 1 112 ? -1.112  23.807 45.294  1.00 9.62  ? 112 PHE B CD1 1 
ATOM   2644 C  CD2 . PHE B 1 112 ? -2.312  21.805 45.714  1.00 8.97  ? 112 PHE B CD2 1 
ATOM   2645 C  CE1 . PHE B 1 112 ? -0.143  23.066 44.660  1.00 10.60 ? 112 PHE B CE1 1 
ATOM   2646 C  CE2 . PHE B 1 112 ? -1.332  21.059 45.067  1.00 10.35 ? 112 PHE B CE2 1 
ATOM   2647 C  CZ  . PHE B 1 112 ? -0.260  21.693 44.533  1.00 10.71 ? 112 PHE B CZ  1 
ATOM   2648 N  N   . LYS B 1 113 ? -4.901  22.906 43.885  1.00 8.15  ? 113 LYS B N   1 
ATOM   2649 C  CA  . LYS B 1 113 ? -4.837  22.175 42.624  1.00 7.67  ? 113 LYS B CA  1 
ATOM   2650 C  C   . LYS B 1 113 ? -5.322  23.032 41.488  1.00 7.71  ? 113 LYS B C   1 
ATOM   2651 O  O   . LYS B 1 113 ? -4.742  23.024 40.379  1.00 7.65  ? 113 LYS B O   1 
ATOM   2652 C  CB  . LYS B 1 113 ? -5.622  20.870 42.707  1.00 8.12  ? 113 LYS B CB  1 
ATOM   2653 C  CG  . LYS B 1 113 ? -4.970  19.850 43.630  1.00 8.51  ? 113 LYS B CG  1 
ATOM   2654 C  CD  . LYS B 1 113 ? -5.793  18.582 43.778  1.00 9.40  ? 113 LYS B CD  1 
ATOM   2655 C  CE  . LYS B 1 113 ? -6.015  17.842 42.473  1.00 9.78  ? 113 LYS B CE  1 
ATOM   2656 N  NZ  . LYS B 1 113 ? -6.653  16.527 42.708  1.00 10.58 ? 113 LYS B NZ  1 
ATOM   2657 N  N   . ALA B 1 114 ? -6.428  23.771 41.675  1.00 8.21  ? 114 ALA B N   1 
ATOM   2658 C  CA  . ALA B 1 114 ? -6.925  24.647 40.633  1.00 8.08  ? 114 ALA B CA  1 
ATOM   2659 C  C   . ALA B 1 114 ? -5.886  25.687 40.253  1.00 7.87  ? 114 ALA B C   1 
ATOM   2660 O  O   . ALA B 1 114 ? -5.682  25.987 39.063  1.00 8.23  ? 114 ALA B O   1 
ATOM   2661 C  CB  . ALA B 1 114 ? -8.209  25.338 41.086  1.00 9.30  ? 114 ALA B CB  1 
ATOM   2662 N  N   . GLU B 1 115 ? -5.213  26.306 41.238  1.00 8.19  ? 115 GLU B N   1 
ATOM   2663 C  CA  . GLU B 1 115 ? -4.219  27.304 40.938  1.00 8.14  ? 115 GLU B CA  1 
ATOM   2664 C  C   . GLU B 1 115 ? -3.046  26.687 40.189  1.00 7.72  ? 115 GLU B C   1 
ATOM   2665 O  O   . GLU B 1 115 ? -2.530  27.327 39.244  1.00 8.32  ? 115 GLU B O   1 
ATOM   2666 C  CB  A GLU B 1 115 ? -3.815  27.971 42.247  0.59 9.65  ? 115 GLU B CB  1 
ATOM   2667 C  CB  B GLU B 1 115 ? -3.715  28.008 42.204  0.41 10.93 ? 115 GLU B CB  1 
ATOM   2668 C  CG  A GLU B 1 115 ? -2.909  29.143 42.021  0.59 11.00 ? 115 GLU B CG  1 
ATOM   2669 C  CG  B GLU B 1 115 ? -4.725  28.999 42.767  0.41 13.31 ? 115 GLU B CG  1 
ATOM   2670 C  CD  A GLU B 1 115 ? -2.664  29.949 43.268  0.59 11.47 ? 115 GLU B CD  1 
ATOM   2671 C  CD  B GLU B 1 115 ? -5.241  29.989 41.731  0.41 17.66 ? 115 GLU B CD  1 
ATOM   2672 O  OE1 A GLU B 1 115 ? -3.429  29.818 44.210  0.59 13.14 ? 115 GLU B OE1 1 
ATOM   2673 O  OE1 B GLU B 1 115 ? -4.410  30.724 41.163  0.41 23.13 ? 115 GLU B OE1 1 
ATOM   2674 O  OE2 A GLU B 1 115 ? -1.738  30.716 43.221  0.59 14.99 ? 115 GLU B OE2 1 
ATOM   2675 O  OE2 B GLU B 1 115 ? -6.455  30.048 41.437  0.41 18.66 ? 115 GLU B OE2 1 
ATOM   2676 N  N   . PHE B 1 116 ? -2.620  25.506 40.575  1.00 7.36  ? 116 PHE B N   1 
ATOM   2677 C  CA  . PHE B 1 116 ? -1.524  24.826 39.882  1.00 7.14  ? 116 PHE B CA  1 
ATOM   2678 C  C   . PHE B 1 116 ? -1.941  24.505 38.437  1.00 7.29  ? 116 PHE B C   1 
ATOM   2679 O  O   . PHE B 1 116 ? -1.160  24.723 37.498  1.00 7.43  ? 116 PHE B O   1 
ATOM   2680 C  CB  . PHE B 1 116 ? -1.106  23.581 40.660  1.00 7.46  ? 116 PHE B CB  1 
ATOM   2681 C  CG  . PHE B 1 116 ? 0.177   22.981 40.125  1.00 7.31  ? 116 PHE B CG  1 
ATOM   2682 C  CD1 . PHE B 1 116 ? 1.402   23.362 40.634  1.00 7.71  ? 116 PHE B CD1 1 
ATOM   2683 C  CD2 . PHE B 1 116 ? 0.147   22.031 39.130  1.00 7.96  ? 116 PHE B CD2 1 
ATOM   2684 C  CE1 . PHE B 1 116 ? 2.576   22.807 40.166  1.00 8.61  ? 116 PHE B CE1 1 
ATOM   2685 C  CE2 . PHE B 1 116 ? 1.320   21.473 38.656  1.00 8.17  ? 116 PHE B CE2 1 
ATOM   2686 C  CZ  . PHE B 1 116 ? 2.548   21.864 39.157  1.00 8.14  ? 116 PHE B CZ  1 
ATOM   2687 N  N   . GLU B 1 117 ? -3.143  23.981 38.254  1.00 7.37  ? 117 GLU B N   1 
ATOM   2688 C  CA  . GLU B 1 117 ? -3.661  23.655 36.956  1.00 7.46  ? 117 GLU B CA  1 
ATOM   2689 C  C   . GLU B 1 117 ? -3.723  24.885 36.041  1.00 7.63  ? 117 GLU B C   1 
ATOM   2690 O  O   . GLU B 1 117 ? -3.418  24.805 34.847  1.00 7.88  ? 117 GLU B O   1 
ATOM   2691 C  CB  . GLU B 1 117 ? -5.043  23.003 37.050  1.00 7.75  ? 117 GLU B CB  1 
ATOM   2692 C  CG  . GLU B 1 117 ? -4.988  21.605 37.636  1.00 7.92  ? 117 GLU B CG  1 
ATOM   2693 C  CD  . GLU B 1 117 ? -6.281  21.133 38.240  1.00 7.82  ? 117 GLU B CD  1 
ATOM   2694 O  OE1 . GLU B 1 117 ? -7.346  21.725 37.936  1.00 8.84  ? 117 GLU B OE1 1 
ATOM   2695 O  OE2 . GLU B 1 117 ? -6.227  20.143 38.995  1.00 9.86  ? 117 GLU B OE2 1 
ATOM   2696 N  N   . LYS B 1 118 ? -4.147  26.015 36.600  1.00 7.85  ? 118 LYS B N   1 
ATOM   2697 C  CA  . LYS B 1 118 ? -4.217  27.256 35.845  1.00 8.75  ? 118 LYS B CA  1 
ATOM   2698 C  C   . LYS B 1 118 ? -2.836  27.716 35.434  1.00 8.30  ? 118 LYS B C   1 
ATOM   2699 O  O   . LYS B 1 118 ? -2.629  28.107 34.273  1.00 9.23  ? 118 LYS B O   1 
ATOM   2700 C  CB  A LYS B 1 118 ? -4.901  28.398 36.613  0.64 9.23  ? 118 LYS B CB  1 
ATOM   2701 C  CB  B LYS B 1 118 ? -4.988  28.292 36.682  0.36 12.41 ? 118 LYS B CB  1 
ATOM   2702 C  CG  A LYS B 1 118 ? -6.371  28.203 36.726  0.64 9.72  ? 118 LYS B CG  1 
ATOM   2703 C  CG  B LYS B 1 118 ? -5.426  29.441 35.796  0.36 16.16 ? 118 LYS B CG  1 
ATOM   2704 C  CD  A LYS B 1 118 ? -7.004  29.257 37.587  0.64 17.48 ? 118 LYS B CD  1 
ATOM   2705 C  CD  B LYS B 1 118 ? -6.919  29.528 35.678  0.36 21.67 ? 118 LYS B CD  1 
ATOM   2706 C  CE  A LYS B 1 118 ? -6.688  30.596 36.899  0.64 22.81 ? 118 LYS B CE  1 
ATOM   2707 C  CE  B LYS B 1 118 ? -7.448  30.676 36.522  0.36 24.69 ? 118 LYS B CE  1 
ATOM   2708 N  NZ  A LYS B 1 118 ? -7.809  31.637 37.058  0.64 24.92 ? 118 LYS B NZ  1 
ATOM   2709 N  NZ  B LYS B 1 118 ? -6.844  30.587 37.887  0.36 20.27 ? 118 LYS B NZ  1 
ATOM   2710 N  N   . ALA B 1 119 ? -1.889  27.700 36.366  1.00 8.63  ? 119 ALA B N   1 
ATOM   2711 C  CA  . ALA B 1 119 ? -0.542  28.150 36.044  1.00 8.52  ? 119 ALA B CA  1 
ATOM   2712 C  C   . ALA B 1 119 ? 0.091   27.248 34.995  1.00 7.88  ? 119 ALA B C   1 
ATOM   2713 O  O   . ALA B 1 119 ? 0.772   27.708 34.087  1.00 8.54  ? 119 ALA B O   1 
ATOM   2714 C  CB  . ALA B 1 119 ? 0.305   28.215 37.301  1.00 9.82  ? 119 ALA B CB  1 
ATOM   2715 N  N   . ALA B 1 120 ? -0.103  25.948 35.153  1.00 7.41  ? 120 ALA B N   1 
ATOM   2716 C  CA  . ALA B 1 120 ? 0.464   24.979 34.208  1.00 7.40  ? 120 ALA B CA  1 
ATOM   2717 C  C   . ALA B 1 120 ? -0.141  25.155 32.822  1.00 7.39  ? 120 ALA B C   1 
ATOM   2718 O  O   . ALA B 1 120 ? 0.571   25.024 31.827  1.00 8.46  ? 120 ALA B O   1 
ATOM   2719 C  CB  . ALA B 1 120 ? 0.270   23.585 34.710  1.00 7.43  ? 120 ALA B CB  1 
ATOM   2720 N  N   . ALA B 1 121 ? -1.457  25.445 32.742  1.00 7.21  ? 121 ALA B N   1 
ATOM   2721 C  CA  . ALA B 1 121 ? -2.080  25.619 31.446  1.00 7.58  ? 121 ALA B CA  1 
ATOM   2722 C  C   . ALA B 1 121 ? -1.725  26.956 30.795  1.00 7.47  ? 121 ALA B C   1 
ATOM   2723 O  O   . ALA B 1 121 ? -1.687  27.027 29.562  1.00 8.02  ? 121 ALA B O   1 
ATOM   2724 C  CB  . ALA B 1 121 ? -3.581  25.481 31.534  1.00 8.45  ? 121 ALA B CB  1 
ATOM   2725 N  N   A SER B 1 122 ? -1.490  28.019 31.568  0.51 7.74  ? 122 SER B N   1 
ATOM   2726 N  N   B SER B 1 122 ? -1.489  27.982 31.601  0.49 7.70  ? 122 SER B N   1 
ATOM   2727 C  CA  A SER B 1 122 ? -1.324  29.354 31.001  0.51 8.45  ? 122 SER B CA  1 
ATOM   2728 C  CA  B SER B 1 122 ? -1.313  29.366 31.186  0.49 7.69  ? 122 SER B CA  1 
ATOM   2729 C  C   A SER B 1 122 ? 0.123   29.726 30.697  0.51 8.28  ? 122 SER B C   1 
ATOM   2730 C  C   B SER B 1 122 ? 0.099   29.718 30.741  0.49 8.31  ? 122 SER B C   1 
ATOM   2731 O  O   A SER B 1 122 ? 0.401   30.830 30.248  0.51 9.31  ? 122 SER B O   1 
ATOM   2732 O  O   B SER B 1 122 ? 0.366   30.783 30.195  0.49 10.99 ? 122 SER B O   1 
ATOM   2733 C  CB  A SER B 1 122 ? -1.907  30.455 31.896  0.51 8.47  ? 122 SER B CB  1 
ATOM   2734 C  CB  B SER B 1 122 ? -1.771  30.321 32.313  0.49 9.03  ? 122 SER B CB  1 
ATOM   2735 O  OG  A SER B 1 122 ? -1.252  30.525 33.130  0.51 10.41 ? 122 SER B OG  1 
ATOM   2736 O  OG  B SER B 1 122 ? -3.172  30.220 32.538  0.49 12.77 ? 122 SER B OG  1 
ATOM   2737 N  N   . ARG B 1 123 ? 1.056   28.797 30.935  1.00 7.42  ? 123 ARG B N   1 
ATOM   2738 C  CA  . ARG B 1 123 ? 2.448   28.991 30.529  1.00 7.73  ? 123 ARG B CA  1 
ATOM   2739 C  C   . ARG B 1 123 ? 2.541   28.790 29.015  1.00 7.55  ? 123 ARG B C   1 
ATOM   2740 O  O   . ARG B 1 123 ? 2.608   27.642 28.558  1.00 9.46  ? 123 ARG B O   1 
ATOM   2741 C  CB  . ARG B 1 123 ? 3.308   28.017 31.328  1.00 9.07  ? 123 ARG B CB  1 
ATOM   2742 C  CG  . ARG B 1 123 ? 4.753   27.925 30.876  1.00 10.81 ? 123 ARG B CG  1 
ATOM   2743 C  CD  . ARG B 1 123 ? 5.424   29.205 30.593  1.00 10.78 ? 123 ARG B CD  1 
ATOM   2744 N  NE  . ARG B 1 123 ? 5.480   30.066 31.729  1.00 10.78 ? 123 ARG B NE  1 
ATOM   2745 C  CZ  . ARG B 1 123 ? 6.071   31.246 31.743  1.00 11.47 ? 123 ARG B CZ  1 
ATOM   2746 N  NH1 . ARG B 1 123 ? 6.624   31.674 30.606  1.00 12.59 ? 123 ARG B NH1 1 
ATOM   2747 N  NH2 . ARG B 1 123 ? 6.116   31.960 32.877  1.00 13.30 ? 123 ARG B NH2 1 
ATOM   2748 N  N   . PHE B 1 124 ? 2.549   29.866 28.279  1.00 7.14  ? 124 PHE B N   1 
ATOM   2749 C  CA  . PHE B 1 124 ? 2.515   29.785 26.813  1.00 6.83  ? 124 PHE B CA  1 
ATOM   2750 C  C   . PHE B 1 124 ? 3.933   29.522 26.299  1.00 6.85  ? 124 PHE B C   1 
ATOM   2751 O  O   . PHE B 1 124 ? 4.879   30.194 26.749  1.00 8.36  ? 124 PHE B O   1 
ATOM   2752 C  CB  . PHE B 1 124 ? 1.957   31.107 26.224  1.00 7.20  ? 124 PHE B CB  1 
ATOM   2753 C  CG  . PHE B 1 124 ? 1.648   30.945 24.753  1.00 6.81  ? 124 PHE B CG  1 
ATOM   2754 C  CD1 . PHE B 1 124 ? 0.496   30.298 24.337  1.00 7.41  ? 124 PHE B CD1 1 
ATOM   2755 C  CD2 . PHE B 1 124 ? 2.503   31.460 23.783  1.00 6.86  ? 124 PHE B CD2 1 
ATOM   2756 C  CE1 . PHE B 1 124 ? 0.214   30.120 22.987  1.00 7.52  ? 124 PHE B CE1 1 
ATOM   2757 C  CE2 . PHE B 1 124 ? 2.222   31.277 22.427  1.00 7.00  ? 124 PHE B CE2 1 
ATOM   2758 C  CZ  . PHE B 1 124 ? 1.079   30.618 22.029  1.00 7.58  ? 124 PHE B CZ  1 
ATOM   2759 N  N   . GLY B 1 125 ? 4.067   28.597 25.363  1.00 6.50  ? 125 GLY B N   1 
ATOM   2760 C  CA  . GLY B 1 125 ? 5.374   28.156 24.946  1.00 6.52  ? 125 GLY B CA  1 
ATOM   2761 C  C   . GLY B 1 125 ? 5.897   27.083 25.882  1.00 6.43  ? 125 GLY B C   1 
ATOM   2762 O  O   . GLY B 1 125 ? 5.124   26.305 26.476  1.00 7.33  ? 125 GLY B O   1 
ATOM   2763 N  N   . SER B 1 126 ? 7.218   27.024 26.030  1.00 6.12  ? 126 SER B N   1 
ATOM   2764 C  CA  . SER B 1 126 ? 7.855   25.997 26.843  1.00 6.24  ? 126 SER B CA  1 
ATOM   2765 C  C   . SER B 1 126 ? 8.038   26.504 28.276  1.00 6.11  ? 126 SER B C   1 
ATOM   2766 O  O   . SER B 1 126 ? 8.311   27.699 28.479  1.00 6.74  ? 126 SER B O   1 
ATOM   2767 C  CB  . SER B 1 126 ? 9.230   25.684 26.270  1.00 6.22  ? 126 SER B CB  1 
ATOM   2768 O  OG  . SER B 1 126 ? 9.169   25.231 24.942  1.00 6.90  ? 126 SER B OG  1 
ATOM   2769 N  N   . GLY B 1 127 ? 7.972   25.618 29.262  1.00 6.25  ? 127 GLY B N   1 
ATOM   2770 C  CA  . GLY B 1 127 ? 8.289   26.017 30.628  1.00 6.64  ? 127 GLY B CA  1 
ATOM   2771 C  C   . GLY B 1 127 ? 7.837   24.967 31.633  1.00 6.35  ? 127 GLY B C   1 
ATOM   2772 O  O   . GLY B 1 127 ? 7.686   23.807 31.310  1.00 6.54  ? 127 GLY B O   1 
ATOM   2773 N  N   . TRP B 1 128 ? 7.688   25.444 32.869  1.00 6.82  ? 128 TRP B N   1 
ATOM   2774 C  CA  . TRP B 1 128 ? 7.471   24.614 34.046  1.00 6.61  ? 128 TRP B CA  1 
ATOM   2775 C  C   . TRP B 1 128 ? 6.458   25.329 34.959  1.00 6.86  ? 128 TRP B C   1 
ATOM   2776 O  O   . TRP B 1 128 ? 6.454   26.541 35.058  1.00 7.60  ? 128 TRP B O   1 
ATOM   2777 C  CB  . TRP B 1 128 ? 8.774   24.476 34.879  1.00 7.29  ? 128 TRP B CB  1 
ATOM   2778 C  CG  . TRP B 1 128 ? 9.802   23.624 34.194  1.00 7.23  ? 128 TRP B CG  1 
ATOM   2779 C  CD1 . TRP B 1 128 ? 10.611  24.010 33.172  1.00 7.91  ? 128 TRP B CD1 1 
ATOM   2780 C  CD2 . TRP B 1 128 ? 10.101  22.250 34.451  1.00 7.24  ? 128 TRP B CD2 1 
ATOM   2781 N  NE1 . TRP B 1 128 ? 11.391  22.940 32.762  1.00 8.25  ? 128 TRP B NE1 1 
ATOM   2782 C  CE2 . TRP B 1 128 ? 11.099  21.856 33.553  1.00 7.69  ? 128 TRP B CE2 1 
ATOM   2783 C  CE3 . TRP B 1 128 ? 9.641   21.325 35.400  1.00 7.58  ? 128 TRP B CE3 1 
ATOM   2784 C  CZ2 . TRP B 1 128 ? 11.614  20.567 33.539  1.00 8.49  ? 128 TRP B CZ2 1 
ATOM   2785 C  CZ3 . TRP B 1 128 ? 10.171  20.036 35.387  1.00 8.30  ? 128 TRP B CZ3 1 
ATOM   2786 C  CH2 . TRP B 1 128 ? 11.140  19.677 34.490  1.00 8.55  ? 128 TRP B CH2 1 
ATOM   2787 N  N   . ALA B 1 129 ? 5.641   24.509 35.649  1.00 6.84  ? 129 ALA B N   1 
ATOM   2788 C  CA  . ALA B 1 129 ? 4.812   24.990 36.743  1.00 7.11  ? 129 ALA B CA  1 
ATOM   2789 C  C   . ALA B 1 129 ? 5.386   24.426 38.057  1.00 6.75  ? 129 ALA B C   1 
ATOM   2790 O  O   . ALA B 1 129 ? 5.789   23.278 38.101  1.00 7.82  ? 129 ALA B O   1 
ATOM   2791 C  CB  . ALA B 1 129 ? 3.382   24.546 36.569  1.00 8.35  ? 129 ALA B CB  1 
ATOM   2792 N  N   . TRP B 1 130 ? 5.355   25.232 39.104  1.00 7.33  ? 130 TRP B N   1 
ATOM   2793 C  CA  . TRP B 1 130 ? 6.015   24.908 40.354  1.00 7.38  ? 130 TRP B CA  1 
ATOM   2794 C  C   . TRP B 1 130 ? 5.121   25.174 41.558  1.00 7.40  ? 130 TRP B C   1 
ATOM   2795 O  O   . TRP B 1 130 ? 4.366   26.148 41.580  1.00 8.10  ? 130 TRP B O   1 
ATOM   2796 C  CB  . TRP B 1 130 ? 7.260   25.785 40.554  1.00 8.17  ? 130 TRP B CB  1 
ATOM   2797 C  CG  . TRP B 1 130 ? 8.253   25.819 39.443  1.00 7.76  ? 130 TRP B CG  1 
ATOM   2798 C  CD1 . TRP B 1 130 ? 8.322   26.704 38.441  1.00 7.87  ? 130 TRP B CD1 1 
ATOM   2799 C  CD2 . TRP B 1 130 ? 9.307   24.856 39.248  1.00 8.25  ? 130 TRP B CD2 1 
ATOM   2800 N  NE1 . TRP B 1 130 ? 9.375   26.388 37.610  1.00 8.03  ? 130 TRP B NE1 1 
ATOM   2801 C  CE2 . TRP B 1 130 ? 9.992   25.272 38.071  1.00 7.83  ? 130 TRP B CE2 1 
ATOM   2802 C  CE3 . TRP B 1 130 ? 9.735   23.728 39.921  1.00 9.09  ? 130 TRP B CE3 1 
ATOM   2803 C  CZ2 . TRP B 1 130 ? 11.101  24.557 37.605  1.00 9.16  ? 130 TRP B CZ2 1 
ATOM   2804 C  CZ3 . TRP B 1 130 ? 10.829  23.023 39.446  1.00 10.89 ? 130 TRP B CZ3 1 
ATOM   2805 C  CH2 . TRP B 1 130 ? 11.492  23.459 38.275  1.00 10.82 ? 130 TRP B CH2 1 
ATOM   2806 N  N   . LEU B 1 131 ? 5.287   24.333 42.563  1.00 7.42  ? 131 LEU B N   1 
ATOM   2807 C  CA  . LEU B 1 131 ? 4.917   24.652 43.939  1.00 7.87  ? 131 LEU B CA  1 
ATOM   2808 C  C   . LEU B 1 131 ? 6.221   25.027 44.652  1.00 7.96  ? 131 LEU B C   1 
ATOM   2809 O  O   . LEU B 1 131 ? 7.141   24.198 44.674  1.00 8.67  ? 131 LEU B O   1 
ATOM   2810 C  CB  . LEU B 1 131 ? 4.278   23.451 44.607  1.00 8.15  ? 131 LEU B CB  1 
ATOM   2811 C  CG  . LEU B 1 131 ? 3.949   23.621 46.107  1.00 8.78  ? 131 LEU B CG  1 
ATOM   2812 C  CD1 . LEU B 1 131 ? 2.946   24.744 46.336  1.00 9.76  ? 131 LEU B CD1 1 
ATOM   2813 C  CD2 . LEU B 1 131 ? 3.440   22.313 46.678  1.00 10.12 ? 131 LEU B CD2 1 
ATOM   2814 N  N   . VAL B 1 132 ? 6.315   26.249 45.138  1.00 8.30  ? 132 VAL B N   1 
ATOM   2815 C  CA  . VAL B 1 132 ? 7.518   26.737 45.816  1.00 8.95  ? 132 VAL B CA  1 
ATOM   2816 C  C   . VAL B 1 132 ? 7.173   27.121 47.251  1.00 9.28  ? 132 VAL B C   1 
ATOM   2817 O  O   . VAL B 1 132 ? 6.030   27.438 47.579  1.00 10.02 ? 132 VAL B O   1 
ATOM   2818 C  CB  . VAL B 1 132 ? 8.149   27.951 45.102  1.00 9.28  ? 132 VAL B CB  1 
ATOM   2819 C  CG1 . VAL B 1 132 ? 8.666   27.552 43.742  1.00 10.32 ? 132 VAL B CG1 1 
ATOM   2820 C  CG2 . VAL B 1 132 ? 7.174   29.149 44.995  1.00 10.63 ? 132 VAL B CG2 1 
ATOM   2821 N  N   . LEU B 1 133 ? 8.190   27.151 48.069  1.00 10.16 ? 133 LEU B N   1 
ATOM   2822 C  CA  . LEU B 1 133 ? 8.130   27.721 49.416  1.00 10.29 ? 133 LEU B CA  1 
ATOM   2823 C  C   . LEU B 1 133 ? 8.879   29.032 49.360  1.00 11.67 ? 133 LEU B C   1 
ATOM   2824 O  O   . LEU B 1 133 ? 10.100  29.076 49.159  1.00 12.90 ? 133 LEU B O   1 
ATOM   2825 C  CB  . LEU B 1 133 ? 8.742   26.751 50.406  1.00 11.83 ? 133 LEU B CB  1 
ATOM   2826 C  CG  . LEU B 1 133 ? 8.651   27.190 51.901  1.00 14.67 ? 133 LEU B CG  1 
ATOM   2827 C  CD1 . LEU B 1 133 ? 7.196   27.358 52.318  1.00 16.50 ? 133 LEU B CD1 1 
ATOM   2828 C  CD2 . LEU B 1 133 ? 9.274   26.133 52.742  1.00 19.94 ? 133 LEU B CD2 1 
ATOM   2829 N  N   . LYS B 1 134 ? 8.150   30.144 49.495  1.00 15.38 ? 134 LYS B N   1 
ATOM   2830 C  CA  . LYS B 1 134 ? 8.696   31.516 49.394  1.00 24.22 ? 134 LYS B CA  1 
ATOM   2831 C  C   . LYS B 1 134 ? 8.508   32.117 50.754  1.00 25.56 ? 134 LYS B C   1 
ATOM   2832 O  O   . LYS B 1 134 ? 7.412   32.416 51.165  1.00 26.70 ? 134 LYS B O   1 
ATOM   2833 C  CB  A LYS B 1 134 ? 8.005   32.180 48.210  0.76 31.06 ? 134 LYS B CB  1 
ATOM   2834 C  CB  B LYS B 1 134 ? 8.042   32.370 48.335  0.24 31.10 ? 134 LYS B CB  1 
ATOM   2835 C  CG  A LYS B 1 134 ? 8.533   33.528 47.789  0.76 29.38 ? 134 LYS B CG  1 
ATOM   2836 C  CG  B LYS B 1 134 ? 7.018   31.789 47.390  0.24 31.34 ? 134 LYS B CG  1 
ATOM   2837 C  CD  A LYS B 1 134 ? 8.377   33.869 46.306  0.76 33.74 ? 134 LYS B CD  1 
ATOM   2838 C  CD  B LYS B 1 134 ? 6.911   32.627 46.118  0.24 31.48 ? 134 LYS B CD  1 
ATOM   2839 C  CE  A LYS B 1 134 ? 6.913   33.674 45.908  0.76 35.12 ? 134 LYS B CE  1 
ATOM   2840 C  CE  B LYS B 1 134 ? 6.064   33.871 46.281  0.24 29.72 ? 134 LYS B CE  1 
ATOM   2841 N  NZ  A LYS B 1 134 ? 6.479   34.565 44.799  0.76 32.09 ? 134 LYS B NZ  1 
ATOM   2842 N  NZ  B LYS B 1 134 ? 6.049   34.683 45.022  0.24 27.26 ? 134 LYS B NZ  1 
ATOM   2843 N  N   . GLY B 1 135 ? 9.617   32.305 51.507  1.00 29.55 ? 135 GLY B N   1 
ATOM   2844 C  CA  . GLY B 1 135 ? 9.423   32.739 52.862  1.00 36.97 ? 135 GLY B CA  1 
ATOM   2845 C  C   . GLY B 1 135 ? 8.370   32.033 53.672  1.00 27.01 ? 135 GLY B C   1 
ATOM   2846 O  O   . GLY B 1 135 ? 7.367   32.639 54.118  1.00 36.63 ? 135 GLY B O   1 
ATOM   2847 N  N   . ASP B 1 136 ? 8.568   30.754 53.917  1.00 30.76 ? 136 ASP B N   1 
ATOM   2848 C  CA  . ASP B 1 136 ? 7.615   29.958 54.702  1.00 34.42 ? 136 ASP B CA  1 
ATOM   2849 C  C   . ASP B 1 136 ? 6.157   30.067 54.266  1.00 24.29 ? 136 ASP B C   1 
ATOM   2850 O  O   . ASP B 1 136 ? 5.259   29.563 54.971  1.00 25.68 ? 136 ASP B O   1 
ATOM   2851 C  CB  . ASP B 1 136 ? 7.886   30.283 56.183  1.00 33.96 ? 136 ASP B CB  1 
ATOM   2852 C  CG  . ASP B 1 136 ? 9.339   30.036 56.553  1.00 34.81 ? 136 ASP B CG  1 
ATOM   2853 O  OD1 . ASP B 1 136 ? 10.128  30.982 56.794  1.00 35.76 ? 136 ASP B OD1 1 
ATOM   2854 O  OD2 . ASP B 1 136 ? 9.634   28.806 56.560  1.00 49.88 ? 136 ASP B OD2 1 
ATOM   2855 N  N   . LYS B 1 137 ? 5.789   30.607 53.071  1.00 20.39 ? 137 LYS B N   1 
ATOM   2856 C  CA  . LYS B 1 137 ? 4.455   30.515 52.480  1.00 15.84 ? 137 LYS B CA  1 
ATOM   2857 C  C   . LYS B 1 137 ? 4.561   29.813 51.131  1.00 12.46 ? 137 LYS B C   1 
ATOM   2858 O  O   . LYS B 1 137 ? 5.375   30.163 50.278  1.00 14.59 ? 137 LYS B O   1 
ATOM   2859 C  CB  . LYS B 1 137 ? 3.851   31.907 52.280  1.00 21.92 ? 137 LYS B CB  1 
ATOM   2860 C  CG  . LYS B 1 137 ? 2.401   31.737 51.893  1.00 23.58 ? 137 LYS B CG  1 
ATOM   2861 C  CD  . LYS B 1 137 ? 1.643   33.025 51.991  1.00 27.41 ? 137 LYS B CD  1 
ATOM   2862 C  CE  . LYS B 1 137 ? 0.461   33.054 51.084  1.00 29.54 ? 137 LYS B CE  1 
ATOM   2863 N  NZ  . LYS B 1 137 ? -0.839  32.485 51.528  1.00 44.52 ? 137 LYS B NZ  1 
ATOM   2864 N  N   . LEU B 1 138 ? 3.724   28.814 50.945  1.00 11.32 ? 138 LEU B N   1 
ATOM   2865 C  CA  . LEU B 1 138 ? 3.671   28.068 49.714  1.00 10.38 ? 138 LEU B CA  1 
ATOM   2866 C  C   . LEU B 1 138 ? 2.992   28.894 48.619  1.00 10.49 ? 138 LEU B C   1 
ATOM   2867 O  O   . LEU B 1 138 ? 2.029   29.616 48.921  1.00 12.01 ? 138 LEU B O   1 
ATOM   2868 C  CB  . LEU B 1 138 ? 2.971   26.740 49.918  1.00 10.56 ? 138 LEU B CB  1 
ATOM   2869 C  CG  . LEU B 1 138 ? 3.661   25.733 50.804  1.00 11.39 ? 138 LEU B CG  1 
ATOM   2870 C  CD1 . LEU B 1 138 ? 2.724   24.676 51.268  1.00 12.95 ? 138 LEU B CD1 1 
ATOM   2871 C  CD2 . LEU B 1 138 ? 4.860   25.102 50.083  1.00 10.88 ? 138 LEU B CD2 1 
ATOM   2872 N  N   . ALA B 1 139 ? 3.469   28.732 47.410  1.00 10.14 ? 139 ALA B N   1 
ATOM   2873 C  CA  . ALA B 1 139 ? 2.934   29.487 46.281  1.00 10.17 ? 139 ALA B CA  1 
ATOM   2874 C  C   . ALA B 1 139 ? 3.079   28.667 45.013  1.00 8.79  ? 139 ALA B C   1 
ATOM   2875 O  O   . ALA B 1 139 ? 3.931   27.807 44.894  1.00 9.69  ? 139 ALA B O   1 
ATOM   2876 C  CB  . ALA B 1 139 ? 3.680   30.837 46.075  1.00 12.08 ? 139 ALA B CB  1 
ATOM   2877 N  N   . VAL B 1 140 ? 2.193   28.976 44.062  1.00 8.67  ? 140 VAL B N   1 
ATOM   2878 C  CA  . VAL B 1 140 ? 2.294   28.434 42.698  1.00 8.39  ? 140 VAL B CA  1 
ATOM   2879 C  C   . VAL B 1 140 ? 2.857   29.493 41.766  1.00 8.75  ? 140 VAL B C   1 
ATOM   2880 O  O   . VAL B 1 140 ? 2.332   30.627 41.734  1.00 10.27 ? 140 VAL B O   1 
ATOM   2881 C  CB  . VAL B 1 140 ? 0.886   27.995 42.218  1.00 9.27  ? 140 VAL B CB  1 
ATOM   2882 C  CG1 . VAL B 1 140 ? 0.892   27.732 40.720  1.00 10.18 ? 140 VAL B CG1 1 
ATOM   2883 C  CG2 . VAL B 1 140 ? 0.411   26.800 43.006  1.00 10.51 ? 140 VAL B CG2 1 
ATOM   2884 N  N   . VAL B 1 141 ? 3.873   29.125 41.019  1.00 8.77  ? 141 VAL B N   1 
ATOM   2885 C  CA  . VAL B 1 141 ? 4.507   30.017 40.068  1.00 9.48  ? 141 VAL B CA  1 
ATOM   2886 C  C   . VAL B 1 141 ? 4.833   29.198 38.806  1.00 9.03  ? 141 VAL B C   1 
ATOM   2887 O  O   . VAL B 1 141 ? 4.816   27.997 38.830  1.00 9.45  ? 141 VAL B O   1 
ATOM   2888 C  CB  . VAL B 1 141 ? 5.771   30.687 40.622  1.00 10.65 ? 141 VAL B CB  1 
ATOM   2889 C  CG1 . VAL B 1 141 ? 5.438   31.557 41.836  1.00 14.07 ? 141 VAL B CG1 1 
ATOM   2890 C  CG2 . VAL B 1 141 ? 6.838   29.656 40.979  1.00 10.99 ? 141 VAL B CG2 1 
ATOM   2891 N  N   . SER B 1 142 ? 5.116   29.900 37.705  1.00 10.74 ? 142 SER B N   1 
ATOM   2892 C  CA  . SER B 1 142 ? 5.575   29.203 36.489  1.00 9.09  ? 142 SER B CA  1 
ATOM   2893 C  C   . SER B 1 142 ? 6.832   29.944 36.005  1.00 7.81  ? 142 SER B C   1 
ATOM   2894 O  O   . SER B 1 142 ? 7.043   31.107 36.309  1.00 9.53  ? 142 SER B O   1 
ATOM   2895 C  CB  . SER B 1 142 ? 4.569   29.047 35.349  1.00 10.61 ? 142 SER B CB  1 
ATOM   2896 O  OG  . SER B 1 142 ? 4.366   30.173 34.616  1.00 11.94 ? 142 SER B OG  1 
ATOM   2897 N  N   . THR B 1 143 ? 7.636   29.221 35.226  1.00 7.64  ? 143 THR B N   1 
ATOM   2898 C  CA  . THR B 1 143 ? 8.805   29.776 34.584  1.00 7.32  ? 143 THR B CA  1 
ATOM   2899 C  C   . THR B 1 143 ? 8.786   29.380 33.104  1.00 7.02  ? 143 THR B C   1 
ATOM   2900 O  O   . THR B 1 143 ? 8.172   28.398 32.690  1.00 7.49  ? 143 THR B O   1 
ATOM   2901 C  CB  . THR B 1 143 ? 10.110  29.319 35.240  1.00 7.51  ? 143 THR B CB  1 
ATOM   2902 O  OG1 . THR B 1 143 ? 10.143  27.883 35.204  1.00 7.71  ? 143 THR B OG1 1 
ATOM   2903 C  CG2 . THR B 1 143 ? 10.236  29.844 36.659  1.00 8.73  ? 143 THR B CG2 1 
ATOM   2904 N  N   . ALA B 1 144 ? 9.535   30.196 32.329  1.00 7.11  ? 144 ALA B N   1 
ATOM   2905 C  CA  . ALA B 1 144 ? 9.776   29.933 30.929  1.00 6.94  ? 144 ALA B CA  1 
ATOM   2906 C  C   . ALA B 1 144 ? 10.948  28.992 30.725  1.00 6.71  ? 144 ALA B C   1 
ATOM   2907 O  O   . ALA B 1 144 ? 11.939  29.047 31.465  1.00 7.28  ? 144 ALA B O   1 
ATOM   2908 C  CB  . ALA B 1 144 ? 10.064  31.233 30.199  1.00 8.14  ? 144 ALA B CB  1 
ATOM   2909 N  N   . ASN B 1 145 ? 10.882  28.197 29.676  1.00 6.63  ? 145 ASN B N   1 
ATOM   2910 C  CA  . ASN B 1 145 ? 12.027  27.459 29.141  1.00 6.47  ? 145 ASN B CA  1 
ATOM   2911 C  C   . ASN B 1 145 ? 12.605  26.581 30.231  1.00 6.30  ? 145 ASN B C   1 
ATOM   2912 O  O   . ASN B 1 145 ? 11.849  25.761 30.787  1.00 6.74  ? 145 ASN B O   1 
ATOM   2913 C  CB  . ASN B 1 145 ? 12.973  28.426 28.433  1.00 6.70  ? 145 ASN B CB  1 
ATOM   2914 C  CG  . ASN B 1 145 ? 12.225  29.212 27.361  1.00 6.90  ? 145 ASN B CG  1 
ATOM   2915 O  OD1 . ASN B 1 145 ? 11.380  28.634 26.649  1.00 7.09  ? 145 ASN B OD1 1 
ATOM   2916 N  ND2 . ASN B 1 145 ? 12.507  30.497 27.307  1.00 7.83  ? 145 ASN B ND2 1 
ATOM   2917 N  N   . GLN B 1 146 ? 13.899  26.682 30.529  1.00 6.51  ? 146 GLN B N   1 
ATOM   2918 C  CA  . GLN B 1 146 ? 14.486  25.908 31.618  1.00 7.00  ? 146 GLN B CA  1 
ATOM   2919 C  C   . GLN B 1 146 ? 14.835  26.785 32.817  1.00 6.84  ? 146 GLN B C   1 
ATOM   2920 O  O   . GLN B 1 146 ? 15.645  26.405 33.665  1.00 7.53  ? 146 GLN B O   1 
ATOM   2921 C  CB  . GLN B 1 146 ? 15.716  25.087 31.170  1.00 6.87  ? 146 GLN B CB  1 
ATOM   2922 C  CG  . GLN B 1 146 ? 15.425  24.042 30.158  1.00 7.09  ? 146 GLN B CG  1 
ATOM   2923 C  CD  . GLN B 1 146 ? 14.410  23.004 30.632  1.00 6.91  ? 146 GLN B CD  1 
ATOM   2924 O  OE1 . GLN B 1 146 ? 14.125  22.860 31.827  1.00 7.50  ? 146 GLN B OE1 1 
ATOM   2925 N  NE2 . GLN B 1 146 ? 13.868  22.244 29.700  1.00 7.63  ? 146 GLN B NE2 1 
ATOM   2926 N  N   . ASP B 1 147 ? 14.159  27.914 32.952  1.00 7.08  ? 147 ASP B N   1 
ATOM   2927 C  CA  . ASP B 1 147 ? 14.384  28.747 34.117  1.00 6.99  ? 147 ASP B CA  1 
ATOM   2928 C  C   . ASP B 1 147 ? 13.819  28.037 35.368  1.00 7.27  ? 147 ASP B C   1 
ATOM   2929 O  O   . ASP B 1 147 ? 12.839  27.294 35.273  1.00 8.18  ? 147 ASP B O   1 
ATOM   2930 C  CB  . ASP B 1 147 ? 13.759  30.120 33.924  1.00 7.41  ? 147 ASP B CB  1 
ATOM   2931 C  CG  . ASP B 1 147 ? 14.352  30.915 32.790  1.00 7.65  ? 147 ASP B CG  1 
ATOM   2932 O  OD1 . ASP B 1 147 ? 15.464  30.567 32.300  1.00 8.55  ? 147 ASP B OD1 1 
ATOM   2933 O  OD2 . ASP B 1 147 ? 13.697  31.903 32.371  1.00 9.18  ? 147 ASP B OD2 1 
ATOM   2934 N  N   . SER B 1 148 ? 14.427  28.312 36.514  1.00 7.51  ? 148 SER B N   1 
ATOM   2935 C  CA  . SER B 1 148 ? 14.009  27.750 37.775  1.00 7.68  ? 148 SER B CA  1 
ATOM   2936 C  C   . SER B 1 148 ? 13.812  28.881 38.786  1.00 7.81  ? 148 SER B C   1 
ATOM   2937 O  O   . SER B 1 148 ? 14.606  29.837 38.779  1.00 8.02  ? 148 SER B O   1 
ATOM   2938 C  CB  . SER B 1 148 ? 15.100  26.854 38.331  1.00 8.00  ? 148 SER B CB  1 
ATOM   2939 O  OG  . SER B 1 148 ? 14.836  26.503 39.688  1.00 8.79  ? 148 SER B OG  1 
ATOM   2940 N  N   . PRO B 1 149 ? 12.863  28.765 39.724  1.00 8.16  ? 149 PRO B N   1 
ATOM   2941 C  CA  . PRO B 1 149 ? 12.759  29.771 40.779  1.00 8.33  ? 149 PRO B CA  1 
ATOM   2942 C  C   . PRO B 1 149 ? 14.041  29.886 41.611  1.00 8.86  ? 149 PRO B C   1 
ATOM   2943 O  O   . PRO B 1 149 ? 14.259  30.930 42.233  1.00 9.41  ? 149 PRO B O   1 
ATOM   2944 C  CB  . PRO B 1 149 ? 11.580  29.257 41.637  1.00 9.97  ? 149 PRO B CB  1 
ATOM   2945 C  CG  A PRO B 1 149 ? 11.518  27.790 41.359  0.43 9.38  ? 149 PRO B CG  1 
ATOM   2946 C  CG  B PRO B 1 149 ? 10.793  28.391 40.703  0.57 10.14 ? 149 PRO B CG  1 
ATOM   2947 C  CD  . PRO B 1 149 ? 11.849  27.698 39.860  1.00 8.45  ? 149 PRO B CD  1 
ATOM   2948 N  N   . LEU B 1 150 ? 14.889  28.851 41.654  1.00 8.29  ? 150 LEU B N   1 
ATOM   2949 C  CA  . LEU B 1 150 ? 16.155  28.958 42.349  1.00 9.08  ? 150 LEU B CA  1 
ATOM   2950 C  C   . LEU B 1 150 ? 17.077  30.005 41.750  1.00 9.04  ? 150 LEU B C   1 
ATOM   2951 O  O   . LEU B 1 150 ? 18.013  30.426 42.406  1.00 10.44 ? 150 LEU B O   1 
ATOM   2952 C  CB  . LEU B 1 150 ? 16.866  27.602 42.368  1.00 9.23  ? 150 LEU B CB  1 
ATOM   2953 C  CG  . LEU B 1 150 ? 16.227  26.579 43.308  1.00 10.81 ? 150 LEU B CG  1 
ATOM   2954 C  CD1 . LEU B 1 150 ? 16.807  25.202 43.081  1.00 14.17 ? 150 LEU B CD1 1 
ATOM   2955 C  CD2 . LEU B 1 150 ? 16.350  27.035 44.756  1.00 13.28 ? 150 LEU B CD2 1 
ATOM   2956 N  N   . MET B 1 151 ? 16.829  30.408 40.507  1.00 8.51  ? 151 MET B N   1 
ATOM   2957 C  CA  . MET B 1 151 ? 17.605  31.451 39.871  1.00 8.74  ? 151 MET B CA  1 
ATOM   2958 C  C   . MET B 1 151 ? 17.272  32.839 40.365  1.00 9.26  ? 151 MET B C   1 
ATOM   2959 O  O   . MET B 1 151 ? 18.049  33.761 40.134  1.00 11.25 ? 151 MET B O   1 
ATOM   2960 C  CB  . MET B 1 151 ? 17.455  31.379 38.348  1.00 8.29  ? 151 MET B CB  1 
ATOM   2961 C  CG  . MET B 1 151 ? 17.903  30.049 37.767  1.00 7.99  ? 151 MET B CG  1 
ATOM   2962 S  SD  . MET B 1 151 ? 17.440  29.993 36.017  1.00 8.13  ? 151 MET B SD  1 
ATOM   2963 C  CE  . MET B 1 151 ? 18.074  28.352 35.598  1.00 8.91  ? 151 MET B CE  1 
ATOM   2964 N  N   . GLY B 1 152 ? 16.122  32.985 41.030  1.00 9.48  ? 152 GLY B N   1 
ATOM   2965 C  CA  . GLY B 1 152 ? 15.672  34.270 41.522  1.00 10.13 ? 152 GLY B CA  1 
ATOM   2966 C  C   . GLY B 1 152 ? 14.790  35.012 40.545  1.00 10.39 ? 152 GLY B C   1 
ATOM   2967 O  O   . GLY B 1 152 ? 14.635  34.634 39.385  1.00 10.13 ? 152 GLY B O   1 
ATOM   2968 N  N   . GLU B 1 153 ? 14.183  36.093 41.061  1.00 11.77 ? 153 GLU B N   1 
ATOM   2969 C  CA  . GLU B 1 153 ? 13.184  36.820 40.330  1.00 12.40 ? 153 GLU B CA  1 
ATOM   2970 C  C   . GLU B 1 153 ? 13.702  37.553 39.103  1.00 11.99 ? 153 GLU B C   1 
ATOM   2971 O  O   . GLU B 1 153 ? 13.057  37.512 38.048  1.00 12.30 ? 153 GLU B O   1 
ATOM   2972 C  CB  . GLU B 1 153 ? 12.525  37.902 41.232  1.00 14.70 ? 153 GLU B CB  1 
ATOM   2973 C  CG  . GLU B 1 153 ? 11.731  37.439 42.357  1.00 18.20 ? 153 GLU B CG  1 
ATOM   2974 C  CD  . GLU B 1 153 ? 10.359  36.935 41.965  1.00 19.44 ? 153 GLU B CD  1 
ATOM   2975 O  OE1 . GLU B 1 153 ? 9.763   36.192 42.787  1.00 19.07 ? 153 GLU B OE1 1 
ATOM   2976 O  OE2 . GLU B 1 153 ? 9.833   37.238 40.863  1.00 22.69 ? 153 GLU B OE2 1 
ATOM   2977 N  N   . ALA B 1 154 ? 14.852  38.216 39.183  1.00 12.37 ? 154 ALA B N   1 
ATOM   2978 C  CA  . ALA B 1 154 ? 15.329  38.989 38.049  1.00 12.95 ? 154 ALA B CA  1 
ATOM   2979 C  C   . ALA B 1 154 ? 15.545  38.091 36.814  1.00 12.28 ? 154 ALA B C   1 
ATOM   2980 O  O   . ALA B 1 154 ? 15.217  38.526 35.724  1.00 15.25 ? 154 ALA B O   1 
ATOM   2981 C  CB  . ALA B 1 154 ? 16.568  39.748 38.468  1.00 15.09 ? 154 ALA B CB  1 
ATOM   2982 N  N   . ILE B 1 155 ? 16.097  36.901 37.073  1.00 11.36 ? 155 ILE B N   1 
ATOM   2983 C  CA  . ILE B 1 155 ? 16.338  35.995 35.941  1.00 10.88 ? 155 ILE B CA  1 
ATOM   2984 C  C   . ILE B 1 155 ? 15.090  35.286 35.514  1.00 10.78 ? 155 ILE B C   1 
ATOM   2985 O  O   . ILE B 1 155 ? 14.750  35.243 34.320  1.00 12.75 ? 155 ILE B O   1 
ATOM   2986 C  CB  . ILE B 1 155 ? 17.468  35.023 36.295  1.00 10.52 ? 155 ILE B CB  1 
ATOM   2987 C  CG1 . ILE B 1 155 ? 18.825  35.773 36.451  1.00 11.77 ? 155 ILE B CG1 1 
ATOM   2988 C  CG2 . ILE B 1 155 ? 17.614  33.898 35.299  1.00 11.71 ? 155 ILE B CG2 1 
ATOM   2989 C  CD1 . ILE B 1 155 ? 19.912  35.003 37.069  1.00 12.55 ? 155 ILE B CD1 1 
ATOM   2990 N  N   . SER B 1 156 ? 14.411  34.655 36.471  1.00 9.93  ? 156 SER B N   1 
ATOM   2991 C  CA  A SER B 1 156 ? 13.354  33.698 36.115  0.92 9.58  ? 156 SER B CA  1 
ATOM   2992 C  CA  B SER B 1 156 ? 13.359  33.705 36.132  0.08 9.73  ? 156 SER B CA  1 
ATOM   2993 C  C   . SER B 1 156 ? 11.939  34.232 36.160  1.00 9.46  ? 156 SER B C   1 
ATOM   2994 O  O   . SER B 1 156 ? 11.004  33.528 35.688  1.00 10.23 ? 156 SER B O   1 
ATOM   2995 C  CB  A SER B 1 156 ? 13.386  32.469 37.028  0.92 9.52  ? 156 SER B CB  1 
ATOM   2996 C  CB  B SER B 1 156 ? 13.398  32.528 37.131  0.08 8.85  ? 156 SER B CB  1 
ATOM   2997 O  OG  A SER B 1 156 ? 12.814  32.729 38.312  0.92 9.63  ? 156 SER B OG  1 
ATOM   2998 O  OG  B SER B 1 156 ? 14.684  31.938 37.137  0.08 11.19 ? 156 SER B OG  1 
ATOM   2999 N  N   . GLY B 1 157 ? 11.713  35.370 36.780  1.00 9.97  ? 157 GLY B N   1 
ATOM   3000 C  CA  . GLY B 1 157 ? 10.400  35.898 37.018  1.00 10.79 ? 157 GLY B CA  1 
ATOM   3001 C  C   . GLY B 1 157 ? 9.683   35.260 38.183  1.00 11.54 ? 157 GLY B C   1 
ATOM   3002 O  O   . GLY B 1 157 ? 8.499   35.563 38.437  1.00 16.31 ? 157 GLY B O   1 
ATOM   3003 N  N   . ALA B 1 158 ? 10.373  34.402 38.910  1.00 10.72 ? 158 ALA B N   1 
ATOM   3004 C  CA  . ALA B 1 158 ? 9.852   33.717 40.064  1.00 12.29 ? 158 ALA B CA  1 
ATOM   3005 C  C   . ALA B 1 158 ? 10.921  33.532 41.092  1.00 11.00 ? 158 ALA B C   1 
ATOM   3006 O  O   . ALA B 1 158 ? 12.124  33.722 40.842  1.00 11.53 ? 158 ALA B O   1 
ATOM   3007 C  CB  . ALA B 1 158 ? 9.318   32.330 39.675  1.00 16.56 ? 158 ALA B CB  1 
ATOM   3008 N  N   . SER B 1 159 ? 10.525  33.045 42.271  1.00 11.37 ? 159 SER B N   1 
ATOM   3009 C  CA  . SER B 1 159 ? 11.490  32.772 43.330  1.00 10.92 ? 159 SER B CA  1 
ATOM   3010 C  C   . SER B 1 159 ? 10.841  31.804 44.287  1.00 11.57 ? 159 SER B C   1 
ATOM   3011 O  O   . SER B 1 159 ? 9.671   31.502 44.222  1.00 13.69 ? 159 SER B O   1 
ATOM   3012 C  CB  . SER B 1 159 ? 11.989  34.028 44.028  1.00 12.76 ? 159 SER B CB  1 
ATOM   3013 O  OG  . SER B 1 159 ? 10.964  34.662 44.685  1.00 16.07 ? 159 SER B OG  1 
ATOM   3014 N  N   . GLY B 1 160 ? 11.680  31.323 45.208  1.00 12.47 ? 160 GLY B N   1 
ATOM   3015 C  CA  . GLY B 1 160 ? 11.288  30.371 46.196  1.00 13.14 ? 160 GLY B CA  1 
ATOM   3016 C  C   . GLY B 1 160 ? 11.971  29.022 45.992  1.00 12.05 ? 160 GLY B C   1 
ATOM   3017 O  O   . GLY B 1 160 ? 12.549  28.737 44.941  1.00 13.65 ? 160 GLY B O   1 
ATOM   3018 N  N   . PHE B 1 161 ? 11.872  28.239 47.052  1.00 11.66 ? 161 PHE B N   1 
ATOM   3019 C  CA  . PHE B 1 161 ? 12.483  26.897 47.040  1.00 11.05 ? 161 PHE B CA  1 
ATOM   3020 C  C   . PHE B 1 161 ? 11.507  25.899 46.400  1.00 9.79  ? 161 PHE B C   1 
ATOM   3021 O  O   . PHE B 1 161 ? 10.387  25.744 46.931  1.00 10.12 ? 161 PHE B O   1 
ATOM   3022 C  CB  . PHE B 1 161 ? 12.837  26.465 48.445  1.00 12.41 ? 161 PHE B CB  1 
ATOM   3023 C  CG  . PHE B 1 161 ? 13.403  25.046 48.577  1.00 14.37 ? 161 PHE B CG  1 
ATOM   3024 C  CD1 . PHE B 1 161 ? 14.582  24.673 48.038  1.00 17.00 ? 161 PHE B CD1 1 
ATOM   3025 C  CD2 . PHE B 1 161 ? 12.657  24.108 49.263  1.00 17.22 ? 161 PHE B CD2 1 
ATOM   3026 C  CE1 . PHE B 1 161 ? 15.088  23.376 48.131  1.00 18.95 ? 161 PHE B CE1 1 
ATOM   3027 C  CE2 . PHE B 1 161 ? 13.137  22.828 49.433  1.00 18.94 ? 161 PHE B CE2 1 
ATOM   3028 C  CZ  . PHE B 1 161 ? 14.339  22.456 48.846  1.00 21.62 ? 161 PHE B CZ  1 
ATOM   3029 N  N   . PRO B 1 162 ? 11.839  25.242 45.301  1.00 9.97  ? 162 PRO B N   1 
ATOM   3030 C  CA  . PRO B 1 162 ? 10.879  24.329 44.711  1.00 9.52  ? 162 PRO B CA  1 
ATOM   3031 C  C   . PRO B 1 162 ? 10.572  23.122 45.582  1.00 9.65  ? 162 PRO B C   1 
ATOM   3032 O  O   . PRO B 1 162 ? 11.474  22.439 46.043  1.00 13.20 ? 162 PRO B O   1 
ATOM   3033 C  CB  . PRO B 1 162 ? 11.583  23.870 43.426  1.00 12.28 ? 162 PRO B CB  1 
ATOM   3034 C  CG  . PRO B 1 162 ? 12.658  24.830 43.201  1.00 17.39 ? 162 PRO B CG  1 
ATOM   3035 C  CD  . PRO B 1 162 ? 13.065  25.387 44.524  1.00 11.30 ? 162 PRO B CD  1 
ATOM   3036 N  N   . ILE B 1 163 ? 9.306   22.857 45.790  1.00 8.69  ? 163 ILE B N   1 
ATOM   3037 C  CA  . ILE B 1 163 ? 8.796   21.704 46.461  1.00 8.81  ? 163 ILE B CA  1 
ATOM   3038 C  C   . ILE B 1 163 ? 8.544   20.581 45.449  1.00 8.78  ? 163 ILE B C   1 
ATOM   3039 O  O   . ILE B 1 163 ? 8.943   19.429 45.683  1.00 9.57  ? 163 ILE B O   1 
ATOM   3040 C  CB  . ILE B 1 163 ? 7.532   22.056 47.281  1.00 9.06  ? 163 ILE B CB  1 
ATOM   3041 C  CG1 . ILE B 1 163 ? 7.852   23.147 48.322  1.00 10.76 ? 163 ILE B CG1 1 
ATOM   3042 C  CG2 . ILE B 1 163 ? 6.931   20.823 47.904  1.00 10.52 ? 163 ILE B CG2 1 
ATOM   3043 C  CD1 . ILE B 1 163 ? 8.954   22.774 49.307  1.00 13.31 ? 163 ILE B CD1 1 
ATOM   3044 N  N   . MET B 1 164 ? 7.847   20.919 44.349  1.00 8.25  ? 164 MET B N   1 
ATOM   3045 C  CA  . MET B 1 164 ? 7.665   19.995 43.220  1.00 8.30  ? 164 MET B CA  1 
ATOM   3046 C  C   . MET B 1 164 ? 7.427   20.856 41.992  1.00 7.93  ? 164 MET B C   1 
ATOM   3047 O  O   . MET B 1 164 ? 7.255   22.056 42.064  1.00 8.06  ? 164 MET B O   1 
ATOM   3048 C  CB  . MET B 1 164 ? 6.569   18.961 43.505  1.00 8.76  ? 164 MET B CB  1 
ATOM   3049 C  CG  . MET B 1 164 ? 5.170   19.490 43.756  1.00 9.13  ? 164 MET B CG  1 
ATOM   3050 S  SD  . MET B 1 164 ? 4.375   20.095 42.247  1.00 8.86  ? 164 MET B SD  1 
ATOM   3051 C  CE  . MET B 1 164 ? 2.678   20.204 42.858  1.00 9.57  ? 164 MET B CE  1 
ATOM   3052 N  N   . GLY B 1 165 ? 7.430   20.161 40.846  1.00 8.47  ? 165 GLY B N   1 
ATOM   3053 C  CA  . GLY B 1 165 ? 7.112   20.883 39.610  1.00 9.37  ? 165 GLY B CA  1 
ATOM   3054 C  C   . GLY B 1 165 ? 6.675   19.917 38.503  1.00 7.75  ? 165 GLY B C   1 
ATOM   3055 O  O   . GLY B 1 165 ? 6.884   18.717 38.533  1.00 8.52  ? 165 GLY B O   1 
ATOM   3056 N  N   . LEU B 1 166 ? 6.032   20.546 37.508  1.00 7.19  ? 166 LEU B N   1 
ATOM   3057 C  CA  . LEU B 1 166 ? 5.554   19.871 36.329  1.00 7.01  ? 166 LEU B CA  1 
ATOM   3058 C  C   . LEU B 1 166 ? 6.177   20.487 35.098  1.00 6.72  ? 166 LEU B C   1 
ATOM   3059 O  O   . LEU B 1 166 ? 6.054   21.690 34.836  1.00 7.22  ? 166 LEU B O   1 
ATOM   3060 C  CB  . LEU B 1 166 ? 4.022   19.969 36.223  1.00 7.64  ? 166 LEU B CB  1 
ATOM   3061 C  CG  . LEU B 1 166 ? 3.423   19.349 34.969  1.00 7.62  ? 166 LEU B CG  1 
ATOM   3062 C  CD1 . LEU B 1 166 ? 3.700   17.864 34.853  1.00 7.86  ? 166 LEU B CD1 1 
ATOM   3063 C  CD2 . LEU B 1 166 ? 1.918   19.600 34.949  1.00 8.84  ? 166 LEU B CD2 1 
ATOM   3064 N  N   . ASP B 1 167 ? 6.804   19.639 34.272  1.00 6.72  ? 167 ASP B N   1 
ATOM   3065 C  CA  . ASP B 1 167 ? 7.376   20.025 32.987  1.00 6.33  ? 167 ASP B CA  1 
ATOM   3066 C  C   . ASP B 1 167 ? 6.250   20.180 31.974  1.00 6.74  ? 167 ASP B C   1 
ATOM   3067 O  O   . ASP B 1 167 ? 5.523   19.219 31.733  1.00 7.56  ? 167 ASP B O   1 
ATOM   3068 C  CB  . ASP B 1 167 ? 8.298   18.890 32.530  1.00 6.68  ? 167 ASP B CB  1 
ATOM   3069 C  CG  . ASP B 1 167 ? 9.154   19.199 31.346  1.00 6.77  ? 167 ASP B CG  1 
ATOM   3070 O  OD1 . ASP B 1 167 ? 9.086   20.314 30.788  1.00 7.17  ? 167 ASP B OD1 1 
ATOM   3071 O  OD2 . ASP B 1 167 ? 9.913   18.254 30.974  1.00 7.18  ? 167 ASP B OD2 1 
ATOM   3072 N  N   . VAL B 1 168 ? 6.102   21.378 31.392  1.00 6.33  ? 168 VAL B N   1 
ATOM   3073 C  CA  . VAL B 1 168 ? 5.089   21.593 30.372  1.00 6.42  ? 168 VAL B CA  1 
ATOM   3074 C  C   . VAL B 1 168 ? 5.705   21.914 29.003  1.00 6.58  ? 168 VAL B C   1 
ATOM   3075 O  O   . VAL B 1 168 ? 5.005   22.380 28.116  1.00 7.10  ? 168 VAL B O   1 
ATOM   3076 C  CB  . VAL B 1 168 ? 3.987   22.596 30.760  1.00 7.09  ? 168 VAL B CB  1 
ATOM   3077 C  CG1 . VAL B 1 168 ? 3.223   22.053 31.984  1.00 7.93  ? 168 VAL B CG1 1 
ATOM   3078 C  CG2 . VAL B 1 168 ? 4.481   23.984 31.042  1.00 8.10  ? 168 VAL B CG2 1 
ATOM   3079 N  N   . TRP B 1 169 ? 6.992   21.579 28.795  1.00 6.40  ? 169 TRP B N   1 
ATOM   3080 C  CA  . TRP B 1 169 ? 7.488   21.504 27.422  1.00 6.21  ? 169 TRP B CA  1 
ATOM   3081 C  C   . TRP B 1 169 ? 6.682   20.454 26.668  1.00 6.19  ? 169 TRP B C   1 
ATOM   3082 O  O   . TRP B 1 169 ? 6.315   19.404 27.192  1.00 6.59  ? 169 TRP B O   1 
ATOM   3083 C  CB  . TRP B 1 169 ? 8.967   21.098 27.373  1.00 6.35  ? 169 TRP B CB  1 
ATOM   3084 C  CG  . TRP B 1 169 ? 9.911   22.175 27.822  1.00 6.67  ? 169 TRP B CG  1 
ATOM   3085 C  CD1 . TRP B 1 169 ? 9.916   22.893 28.978  1.00 6.49  ? 169 TRP B CD1 1 
ATOM   3086 C  CD2 . TRP B 1 169 ? 11.019  22.669 27.034  1.00 6.42  ? 169 TRP B CD2 1 
ATOM   3087 N  NE1 . TRP B 1 169 ? 10.944  23.800 28.988  1.00 6.61  ? 169 TRP B NE1 1 
ATOM   3088 C  CE2 . TRP B 1 169 ? 11.636  23.673 27.800  1.00 6.46  ? 169 TRP B CE2 1 
ATOM   3089 C  CE3 . TRP B 1 169 ? 11.520  22.360 25.759  1.00 6.68  ? 169 TRP B CE3 1 
ATOM   3090 C  CZ2 . TRP B 1 169 ? 12.766  24.372 27.347  1.00 6.47  ? 169 TRP B CZ2 1 
ATOM   3091 C  CZ3 . TRP B 1 169 ? 12.642  23.058 25.319  1.00 7.02  ? 169 TRP B CZ3 1 
ATOM   3092 C  CH2 . TRP B 1 169 ? 13.243  24.035 26.087  1.00 6.84  ? 169 TRP B CH2 1 
ATOM   3093 N  N   . GLU B 1 170 ? 6.480   20.711 25.353  1.00 6.23  ? 170 GLU B N   1 
ATOM   3094 C  CA  . GLU B 1 170 ? 5.693   19.795 24.543  1.00 6.34  ? 170 GLU B CA  1 
ATOM   3095 C  C   . GLU B 1 170 ? 6.278   18.394 24.548  1.00 6.90  ? 170 GLU B C   1 
ATOM   3096 O  O   . GLU B 1 170 ? 5.479   17.422 24.469  1.00 7.26  ? 170 GLU B O   1 
ATOM   3097 C  CB  . GLU B 1 170 ? 5.573   20.330 23.117  1.00 6.44  ? 170 GLU B CB  1 
ATOM   3098 C  CG  . GLU B 1 170 ? 4.733   21.566 23.013  1.00 6.72  ? 170 GLU B CG  1 
ATOM   3099 C  CD  . GLU B 1 170 ? 4.537   22.018 21.577  1.00 6.40  ? 170 GLU B CD  1 
ATOM   3100 O  OE1 . GLU B 1 170 ? 5.553   22.202 20.863  1.00 6.52  ? 170 GLU B OE1 1 
ATOM   3101 O  OE2 . GLU B 1 170 ? 3.353   22.149 21.141  1.00 7.66  ? 170 GLU B OE2 1 
ATOM   3102 N  N   . HIS B 1 171 ? 7.588   18.225 24.578  1.00 6.68  ? 171 HIS B N   1 
ATOM   3103 C  CA  . HIS B 1 171 ? 8.141   16.854 24.543  1.00 7.09  ? 171 HIS B CA  1 
ATOM   3104 C  C   . HIS B 1 171 ? 7.643   16.012 25.704  1.00 7.05  ? 171 HIS B C   1 
ATOM   3105 O  O   . HIS B 1 171 ? 7.668   14.778 25.591  1.00 8.04  ? 171 HIS B O   1 
ATOM   3106 C  CB  . HIS B 1 171 ? 9.656   16.868 24.525  1.00 7.36  ? 171 HIS B CB  1 
ATOM   3107 C  CG  . HIS B 1 171 ? 10.355  17.499 25.676  1.00 7.15  ? 171 HIS B CG  1 
ATOM   3108 N  ND1 . HIS B 1 171 ? 11.153  18.603 25.544  1.00 7.24  ? 171 HIS B ND1 1 
ATOM   3109 C  CD2 . HIS B 1 171 ? 10.462  17.150 27.006  1.00 7.25  ? 171 HIS B CD2 1 
ATOM   3110 C  CE1 . HIS B 1 171 ? 11.704  18.902 26.719  1.00 7.21  ? 171 HIS B CE1 1 
ATOM   3111 N  NE2 . HIS B 1 171 ? 11.296  18.038 27.668  1.00 7.19  ? 171 HIS B NE2 1 
ATOM   3112 N  N   . ALA B 1 172 ? 7.249   16.618 26.819  1.00 6.99  ? 172 ALA B N   1 
ATOM   3113 C  CA  . ALA B 1 172 ? 6.832   15.859 27.994  1.00 7.18  ? 172 ALA B CA  1 
ATOM   3114 C  C   . ALA B 1 172 ? 5.465   15.190 27.803  1.00 7.32  ? 172 ALA B C   1 
ATOM   3115 O  O   . ALA B 1 172 ? 5.127   14.301 28.563  1.00 8.53  ? 172 ALA B O   1 
ATOM   3116 C  CB  . ALA B 1 172 ? 6.825   16.783 29.210  1.00 7.91  ? 172 ALA B CB  1 
ATOM   3117 N  N   . TYR B 1 173 ? 4.678   15.663 26.834  1.00 7.47  ? 173 TYR B N   1 
ATOM   3118 C  CA  . TYR B 1 173 ? 3.281   15.186 26.732  1.00 7.86  ? 173 TYR B CA  1 
ATOM   3119 C  C   . TYR B 1 173 ? 2.860   14.936 25.304  1.00 7.94  ? 173 TYR B C   1 
ATOM   3120 O  O   . TYR B 1 173 ? 1.683   14.569 25.078  1.00 8.61  ? 173 TYR B O   1 
ATOM   3121 C  CB  . TYR B 1 173 ? 2.341   16.126 27.491  1.00 7.85  ? 173 TYR B CB  1 
ATOM   3122 C  CG  . TYR B 1 173 ? 2.206   17.519 27.014  1.00 7.81  ? 173 TYR B CG  1 
ATOM   3123 C  CD1 . TYR B 1 173 ? 1.214   17.915 26.107  1.00 8.63  ? 173 TYR B CD1 1 
ATOM   3124 C  CD2 . TYR B 1 173 ? 3.036   18.535 27.479  1.00 7.66  ? 173 TYR B CD2 1 
ATOM   3125 C  CE1 . TYR B 1 173 ? 1.091   19.218 25.679  1.00 9.22  ? 173 TYR B CE1 1 
ATOM   3126 C  CE2 . TYR B 1 173 ? 2.929   19.841 27.094  1.00 7.65  ? 173 TYR B CE2 1 
ATOM   3127 C  CZ  . TYR B 1 173 ? 1.947   20.187 26.191  1.00 7.75  ? 173 TYR B CZ  1 
ATOM   3128 O  OH  . TYR B 1 173 ? 1.834   21.514 25.838  1.00 8.47  ? 173 TYR B OH  1 
ATOM   3129 N  N   . PHE B 1 174 ? 3.716   15.096 24.320  1.00 9.40  ? 174 PHE B N   1 
ATOM   3130 C  CA  . PHE B 1 174 ? 3.270   15.011 22.923  1.00 9.78  ? 174 PHE B CA  1 
ATOM   3131 C  C   . PHE B 1 174 ? 2.791   13.642 22.512  1.00 9.75  ? 174 PHE B C   1 
ATOM   3132 O  O   . PHE B 1 174 ? 1.731   13.521 21.867  1.00 10.47 ? 174 PHE B O   1 
ATOM   3133 C  CB  . PHE B 1 174 ? 4.403   15.411 21.990  1.00 11.94 ? 174 PHE B CB  1 
ATOM   3134 C  CG  . PHE B 1 174 ? 3.898   15.598 20.557  1.00 11.64 ? 174 PHE B CG  1 
ATOM   3135 C  CD1 . PHE B 1 174 ? 3.363   16.750 20.066  1.00 12.11 ? 174 PHE B CD1 1 
ATOM   3136 C  CD2 . PHE B 1 174 ? 3.904   14.554 19.671  1.00 19.00 ? 174 PHE B CD2 1 
ATOM   3137 C  CE1 . PHE B 1 174 ? 2.886   16.887 18.741  1.00 14.57 ? 174 PHE B CE1 1 
ATOM   3138 C  CE2 . PHE B 1 174 ? 3.438   14.656 18.398  1.00 19.64 ? 174 PHE B CE2 1 
ATOM   3139 C  CZ  . PHE B 1 174 ? 2.871   15.820 17.908  1.00 17.34 ? 174 PHE B CZ  1 
ATOM   3140 N  N   . LEU B 1 175 ? 3.541   12.567 22.824  1.00 10.18 ? 175 LEU B N   1 
ATOM   3141 C  CA  . LEU B 1 175 ? 3.158   11.278 22.266  1.00 10.90 ? 175 LEU B CA  1 
ATOM   3142 C  C   . LEU B 1 175 ? 1.781   10.859 22.707  1.00 11.26 ? 175 LEU B C   1 
ATOM   3143 O  O   . LEU B 1 175 ? 1.010   10.298 21.949  1.00 12.58 ? 175 LEU B O   1 
ATOM   3144 C  CB  . LEU B 1 175 ? 4.126   10.153 22.647  1.00 12.21 ? 175 LEU B CB  1 
ATOM   3145 C  CG  . LEU B 1 175 ? 5.440   10.189 21.932  1.00 12.45 ? 175 LEU B CG  1 
ATOM   3146 C  CD1 . LEU B 1 175 ? 6.282   9.014  22.380  1.00 15.61 ? 175 LEU B CD1 1 
ATOM   3147 C  CD2 . LEU B 1 175 ? 5.178   10.082 20.390  1.00 20.61 ? 175 LEU B CD2 1 
ATOM   3148 N  N   . LYS B 1 176 ? 1.506   11.026 23.999  1.00 10.78 ? 176 LYS B N   1 
ATOM   3149 C  CA  . LYS B 1 176 ? 0.253   10.545 24.544  1.00 11.07 ? 176 LYS B CA  1 
ATOM   3150 C  C   . LYS B 1 176 ? -0.868  11.570 24.477  1.00 10.84 ? 176 LYS B C   1 
ATOM   3151 O  O   . LYS B 1 176 ? -2.034  11.200 24.249  1.00 13.41 ? 176 LYS B O   1 
ATOM   3152 C  CB  . LYS B 1 176 ? 0.464   10.106 25.989  1.00 11.29 ? 176 LYS B CB  1 
ATOM   3153 C  CG  . LYS B 1 176 ? -0.814  9.606  26.645  1.00 12.17 ? 176 LYS B CG  1 
ATOM   3154 C  CD  . LYS B 1 176 ? -0.550  8.972  27.990  1.00 11.44 ? 176 LYS B CD  1 
ATOM   3155 C  CE  . LYS B 1 176 ? -1.840  8.573  28.657  1.00 12.42 ? 176 LYS B CE  1 
ATOM   3156 N  NZ  . LYS B 1 176 ? -1.636  7.871  29.921  1.00 12.83 ? 176 LYS B NZ  1 
ATOM   3157 N  N   . PHE B 1 177 ? -0.567  12.830 24.636  1.00 10.07 ? 177 PHE B N   1 
ATOM   3158 C  CA  . PHE B 1 177 ? -1.561  13.870 24.784  1.00 10.34 ? 177 PHE B CA  1 
ATOM   3159 C  C   . PHE B 1 177 ? -1.630  14.849 23.640  1.00 10.38 ? 177 PHE B C   1 
ATOM   3160 O  O   . PHE B 1 177 ? -2.581  15.678 23.574  1.00 11.20 ? 177 PHE B O   1 
ATOM   3161 C  CB  . PHE B 1 177 ? -1.395  14.632 26.112  1.00 10.03 ? 177 PHE B CB  1 
ATOM   3162 C  CG  . PHE B 1 177 ? -1.344  13.748 27.341  1.00 9.76  ? 177 PHE B CG  1 
ATOM   3163 C  CD1 . PHE B 1 177 ? -0.141  13.265 27.828  1.00 9.72  ? 177 PHE B CD1 1 
ATOM   3164 C  CD2 . PHE B 1 177 ? -2.516  13.364 27.993  1.00 10.33 ? 177 PHE B CD2 1 
ATOM   3165 C  CE1 . PHE B 1 177 ? -0.085  12.438 28.963  1.00 10.40 ? 177 PHE B CE1 1 
ATOM   3166 C  CE2 . PHE B 1 177 ? -2.457  12.567 29.126  1.00 10.92 ? 177 PHE B CE2 1 
ATOM   3167 C  CZ  . PHE B 1 177 ? -1.262  12.110 29.611  1.00 10.69 ? 177 PHE B CZ  1 
ATOM   3168 N  N   . GLN B 1 178 ? -0.653  14.879 22.733  1.00 11.43 ? 178 GLN B N   1 
ATOM   3169 C  CA  . GLN B 1 178 ? -0.595  15.821 21.642  1.00 11.28 ? 178 GLN B CA  1 
ATOM   3170 C  C   . GLN B 1 178 ? -0.676  17.231 22.210  1.00 10.46 ? 178 GLN B C   1 
ATOM   3171 O  O   . GLN B 1 178 ? 0.142   17.604 23.039  1.00 11.57 ? 178 GLN B O   1 
ATOM   3172 C  CB  . GLN B 1 178 ? -1.628  15.435 20.588  1.00 14.31 ? 178 GLN B CB  1 
ATOM   3173 C  CG  . GLN B 1 178 ? -1.351  14.164 19.832  1.00 24.56 ? 178 GLN B CG  1 
ATOM   3174 C  CD  . GLN B 1 178 ? -2.351  13.948 18.732  1.00 30.13 ? 178 GLN B CD  1 
ATOM   3175 O  OE1 . GLN B 1 178 ? -2.025  13.195 17.829  1.00 46.71 ? 178 GLN B OE1 1 
ATOM   3176 N  NE2 . GLN B 1 178 ? -3.546  14.502 18.783  1.00 38.07 ? 178 GLN B NE2 1 
ATOM   3177 N  N   . ASN B 1 179 ? -1.638  18.000 21.726  1.00 10.77 ? 179 ASN B N   1 
ATOM   3178 C  CA  . ASN B 1 179 ? -1.776  19.338 22.217  1.00 10.64 ? 179 ASN B CA  1 
ATOM   3179 C  C   . ASN B 1 179 ? -2.697  19.485 23.445  1.00 10.47 ? 179 ASN B C   1 
ATOM   3180 O  O   . ASN B 1 179 ? -2.922  20.630 23.867  1.00 11.81 ? 179 ASN B O   1 
ATOM   3181 C  CB  A ASN B 1 179 ? -2.432  20.113 21.064  0.56 10.63 ? 179 ASN B CB  1 
ATOM   3182 C  CB  B ASN B 1 179 ? -2.283  20.332 21.167  0.44 10.67 ? 179 ASN B CB  1 
ATOM   3183 C  CG  A ASN B 1 179 ? -2.051  21.582 21.159  0.56 9.02  ? 179 ASN B CG  1 
ATOM   3184 C  CG  B ASN B 1 179 ? -3.655  19.870 20.635  0.44 8.20  ? 179 ASN B CG  1 
ATOM   3185 O  OD1 A ASN B 1 179 ? -1.065  21.986 21.767  0.56 9.73  ? 179 ASN B OD1 1 
ATOM   3186 O  OD1 B ASN B 1 179 ? -4.454  20.731 20.327  0.44 20.44 ? 179 ASN B OD1 1 
ATOM   3187 N  ND2 A ASN B 1 179 ? -2.911  22.358 20.396  0.56 11.74 ? 179 ASN B ND2 1 
ATOM   3188 N  ND2 B ASN B 1 179 ? -3.755  18.563 20.417  0.44 17.11 ? 179 ASN B ND2 1 
ATOM   3189 N  N   . ARG B 1 180 ? -3.143  18.411 24.007  1.00 9.80  ? 180 ARG B N   1 
ATOM   3190 C  CA  . ARG B 1 180 ? -4.136  18.451 25.100  1.00 9.86  ? 180 ARG B CA  1 
ATOM   3191 C  C   . ARG B 1 180 ? -3.440  18.577 26.458  1.00 8.76  ? 180 ARG B C   1 
ATOM   3192 O  O   . ARG B 1 180 ? -3.487  17.713 27.319  1.00 9.17  ? 180 ARG B O   1 
ATOM   3193 C  CB  . ARG B 1 180 ? -5.018  17.233 25.027  1.00 10.94 ? 180 ARG B CB  1 
ATOM   3194 C  CG  . ARG B 1 180 ? -5.837  17.138 23.780  1.00 14.05 ? 180 ARG B CG  1 
ATOM   3195 C  CD  . ARG B 1 180 ? -6.661  15.874 23.716  1.00 16.23 ? 180 ARG B CD  1 
ATOM   3196 N  NE  . ARG B 1 180 ? -5.912  14.628 23.569  1.00 24.69 ? 180 ARG B NE  1 
ATOM   3197 C  CZ  . ARG B 1 180 ? -5.597  13.694 24.442  1.00 22.51 ? 180 ARG B CZ  1 
ATOM   3198 N  NH1 . ARG B 1 180 ? -5.895  13.720 25.754  1.00 31.47 ? 180 ARG B NH1 1 
ATOM   3199 N  NH2 . ARG B 1 180 ? -4.917  12.644 23.987  1.00 25.49 ? 180 ARG B NH2 1 
ATOM   3200 N  N   . ARG B 1 181 ? -2.791  19.724 26.655  1.00 8.57  ? 181 ARG B N   1 
ATOM   3201 C  CA  . ARG B 1 181 ? -2.042  19.936 27.886  1.00 8.02  ? 181 ARG B CA  1 
ATOM   3202 C  C   . ARG B 1 181 ? -2.937  19.786 29.115  1.00 7.93  ? 181 ARG B C   1 
ATOM   3203 O  O   . ARG B 1 181 ? -2.472  19.215 30.127  1.00 7.82  ? 181 ARG B O   1 
ATOM   3204 C  CB  . ARG B 1 181 ? -1.297  21.267 27.889  1.00 7.95  ? 181 ARG B CB  1 
ATOM   3205 C  CG  . ARG B 1 181 ? -0.193  21.295 28.955  1.00 7.60  ? 181 ARG B CG  1 
ATOM   3206 C  CD  . ARG B 1 181 ? 0.335   22.654 29.255  1.00 7.64  ? 181 ARG B CD  1 
ATOM   3207 N  NE  . ARG B 1 181 ? 1.105   23.220 28.136  1.00 7.65  ? 181 ARG B NE  1 
ATOM   3208 C  CZ  . ARG B 1 181 ? 1.608   24.434 28.161  1.00 7.45  ? 181 ARG B CZ  1 
ATOM   3209 N  NH1 . ARG B 1 181 ? 1.436   25.248 29.212  1.00 8.39  ? 181 ARG B NH1 1 
ATOM   3210 N  NH2 . ARG B 1 181 ? 2.307   24.905 27.122  1.00 8.14  ? 181 ARG B NH2 1 
ATOM   3211 N  N   . PRO B 1 182 ? -4.190  20.269 29.153  1.00 8.36  ? 182 PRO B N   1 
ATOM   3212 C  CA  . PRO B 1 182 ? -4.995  20.089 30.372  1.00 8.54  ? 182 PRO B CA  1 
ATOM   3213 C  C   . PRO B 1 182 ? -5.149  18.645 30.760  1.00 8.30  ? 182 PRO B C   1 
ATOM   3214 O  O   . PRO B 1 182 ? -5.243  18.339 31.959  1.00 8.27  ? 182 PRO B O   1 
ATOM   3215 C  CB  . PRO B 1 182 ? -6.321  20.798 30.020  1.00 9.46  ? 182 PRO B CB  1 
ATOM   3216 C  CG  . PRO B 1 182 ? -5.885  21.893 29.064  1.00 10.20 ? 182 PRO B CG  1 
ATOM   3217 C  CD  . PRO B 1 182 ? -4.834  21.189 28.195  1.00 9.76  ? 182 PRO B CD  1 
ATOM   3218 N  N   . ASP B 1 183 ? -5.243  17.714 29.811  1.00 8.62  ? 183 ASP B N   1 
ATOM   3219 C  CA  . ASP B 1 183 ? -5.352  16.286 30.119  1.00 8.98  ? 183 ASP B CA  1 
ATOM   3220 C  C   . ASP B 1 183 ? -4.076  15.766 30.795  1.00 8.44  ? 183 ASP B C   1 
ATOM   3221 O  O   . ASP B 1 183 ? -4.133  14.952 31.700  1.00 8.80  ? 183 ASP B O   1 
ATOM   3222 C  CB  . ASP B 1 183 ? -5.654  15.485 28.856  1.00 10.28 ? 183 ASP B CB  1 
ATOM   3223 C  CG  . ASP B 1 183 ? -7.117  15.738 28.374  1.00 14.45 ? 183 ASP B CG  1 
ATOM   3224 O  OD1 . ASP B 1 183 ? -7.990  16.019 29.170  1.00 19.27 ? 183 ASP B OD1 1 
ATOM   3225 O  OD2 . ASP B 1 183 ? -7.332  15.519 27.183  1.00 24.14 ? 183 ASP B OD2 1 
ATOM   3226 N  N   . TYR B 1 184 ? -2.920  16.210 30.283  1.00 8.21  ? 184 TYR B N   1 
ATOM   3227 C  CA  . TYR B 1 184 ? -1.624  15.839 30.852  1.00 7.70  ? 184 TYR B CA  1 
ATOM   3228 C  C   . TYR B 1 184 ? -1.514  16.386 32.283  1.00 7.26  ? 184 TYR B C   1 
ATOM   3229 O  O   . TYR B 1 184 ? -1.083  15.661 33.188  1.00 7.95  ? 184 TYR B O   1 
ATOM   3230 C  CB  . TYR B 1 184 ? -0.553  16.439 29.969  1.00 7.98  ? 184 TYR B CB  1 
ATOM   3231 C  CG  . TYR B 1 184 ? 0.846   16.446 30.532  1.00 7.47  ? 184 TYR B CG  1 
ATOM   3232 C  CD1 . TYR B 1 184 ? 1.549   15.291 30.841  1.00 7.83  ? 184 TYR B CD1 1 
ATOM   3233 C  CD2 . TYR B 1 184 ? 1.507   17.647 30.726  1.00 7.63  ? 184 TYR B CD2 1 
ATOM   3234 C  CE1 . TYR B 1 184 ? 2.845   15.329 31.310  1.00 7.62  ? 184 TYR B CE1 1 
ATOM   3235 C  CE2 . TYR B 1 184 ? 2.792   17.698 31.182  1.00 7.58  ? 184 TYR B CE2 1 
ATOM   3236 C  CZ  . TYR B 1 184 ? 3.481   16.541 31.473  1.00 7.62  ? 184 TYR B CZ  1 
ATOM   3237 O  OH  . TYR B 1 184 ? 4.775   16.549 31.931  1.00 7.86  ? 184 TYR B OH  1 
ATOM   3238 N  N   . ILE B 1 185 ? -1.914  17.624 32.491  1.00 7.32  ? 185 ILE B N   1 
ATOM   3239 C  CA  . ILE B 1 185 ? -1.888  18.251 33.810  1.00 7.34  ? 185 ILE B CA  1 
ATOM   3240 C  C   . ILE B 1 185 ? -2.737  17.437 34.796  1.00 7.44  ? 185 ILE B C   1 
ATOM   3241 O  O   . ILE B 1 185 ? -2.338  17.181 35.932  1.00 8.00  ? 185 ILE B O   1 
ATOM   3242 C  CB  . ILE B 1 185 ? -2.302  19.701 33.721  1.00 7.75  ? 185 ILE B CB  1 
ATOM   3243 C  CG1 . ILE B 1 185 ? -1.274  20.517 32.914  1.00 7.73  ? 185 ILE B CG1 1 
ATOM   3244 C  CG2 . ILE B 1 185 ? -2.506  20.295 35.103  1.00 9.43  ? 185 ILE B CG2 1 
ATOM   3245 C  CD1 . ILE B 1 185 ? -1.831  21.848 32.384  1.00 8.37  ? 185 ILE B CD1 1 
ATOM   3246 N  N   . LYS B 1 186 ? -3.919  17.006 34.357  1.00 7.56  ? 186 LYS B N   1 
ATOM   3247 C  CA  . LYS B 1 186 ? -4.751  16.173 35.219  1.00 8.02  ? 186 LYS B CA  1 
ATOM   3248 C  C   . LYS B 1 186 ? -4.040  14.884 35.604  1.00 7.78  ? 186 LYS B C   1 
ATOM   3249 O  O   . LYS B 1 186 ? -4.123  14.414 36.749  1.00 8.48  ? 186 LYS B O   1 
ATOM   3250 C  CB  . LYS B 1 186 ? -6.081  15.870 34.539  1.00 8.60  ? 186 LYS B CB  1 
ATOM   3251 C  CG  . LYS B 1 186 ? -7.025  17.046 34.474  1.00 8.69  ? 186 LYS B CG  1 
ATOM   3252 C  CD  . LYS B 1 186 ? -8.189  16.801 33.541  1.00 9.55  ? 186 LYS B CD  1 
ATOM   3253 C  CE  . LYS B 1 186 ? -9.150  17.978 33.548  1.00 10.23 ? 186 LYS B CE  1 
ATOM   3254 N  NZ  . LYS B 1 186 ? -10.309 17.786 32.617  1.00 11.50 ? 186 LYS B NZ  1 
ATOM   3255 N  N   . GLU B 1 187 ? -3.351  14.246 34.657  1.00 7.77  ? 187 GLU B N   1 
ATOM   3256 C  CA  . GLU B 1 187 ? -2.655  13.006 34.956  1.00 8.06  ? 187 GLU B CA  1 
ATOM   3257 C  C   . GLU B 1 187 ? -1.502  13.200 35.918  1.00 8.01  ? 187 GLU B C   1 
ATOM   3258 O  O   . GLU B 1 187 ? -1.165  12.286 36.670  1.00 8.31  ? 187 GLU B O   1 
ATOM   3259 C  CB  . GLU B 1 187 ? -2.181  12.321 33.643  1.00 8.61  ? 187 GLU B CB  1 
ATOM   3260 C  CG  . GLU B 1 187 ? -3.288  11.644 32.894  1.00 9.75  ? 187 GLU B CG  1 
ATOM   3261 C  CD  . GLU B 1 187 ? -3.832  10.386 33.557  1.00 10.06 ? 187 GLU B CD  1 
ATOM   3262 O  OE1 . GLU B 1 187 ? -4.757  9.805  32.913  1.00 12.71 ? 187 GLU B OE1 1 
ATOM   3263 O  OE2 . GLU B 1 187 ? -3.327  9.956  34.607  1.00 10.82 ? 187 GLU B OE2 1 
ATOM   3264 N  N   . PHE B 1 188 ? -0.892  14.388 35.926  1.00 7.81  ? 188 PHE B N   1 
ATOM   3265 C  CA  . PHE B 1 188 ? 0.207   14.645 36.851  1.00 8.10  ? 188 PHE B CA  1 
ATOM   3266 C  C   . PHE B 1 188 ? -0.235  14.384 38.282  1.00 7.58  ? 188 PHE B C   1 
ATOM   3267 O  O   . PHE B 1 188 ? 0.584   13.912 39.094  1.00 8.14  ? 188 PHE B O   1 
ATOM   3268 C  CB  . PHE B 1 188 ? 0.679   16.079 36.723  1.00 8.13  ? 188 PHE B CB  1 
ATOM   3269 C  CG  . PHE B 1 188 ? 1.710   16.533 37.699  1.00 7.99  ? 188 PHE B CG  1 
ATOM   3270 C  CD1 . PHE B 1 188 ? 2.969   15.954 37.773  1.00 8.27  ? 188 PHE B CD1 1 
ATOM   3271 C  CD2 . PHE B 1 188 ? 1.452   17.572 38.586  1.00 8.71  ? 188 PHE B CD2 1 
ATOM   3272 C  CE1 . PHE B 1 188 ? 3.955   16.427 38.628  1.00 8.15  ? 188 PHE B CE1 1 
ATOM   3273 C  CE2 . PHE B 1 188 ? 2.404   18.065 39.442  1.00 9.24  ? 188 PHE B CE2 1 
ATOM   3274 C  CZ  . PHE B 1 188 ? 3.673   17.489 39.469  1.00 8.91  ? 188 PHE B CZ  1 
ATOM   3275 N  N   . TRP B 1 189 ? -1.473  14.656 38.660  1.00 7.79  ? 189 TRP B N   1 
ATOM   3276 C  CA  . TRP B 1 189 ? -1.854  14.434 40.080  1.00 7.71  ? 189 TRP B CA  1 
ATOM   3277 C  C   . TRP B 1 189 ? -1.736  12.959 40.428  1.00 8.22  ? 189 TRP B C   1 
ATOM   3278 O  O   . TRP B 1 189 ? -1.576  12.668 41.655  1.00 8.89  ? 189 TRP B O   1 
ATOM   3279 C  CB  . TRP B 1 189 ? -3.289  14.949 40.342  1.00 8.51  ? 189 TRP B CB  1 
ATOM   3280 C  CG  . TRP B 1 189 ? -3.423  16.392 40.156  1.00 7.97  ? 189 TRP B CG  1 
ATOM   3281 C  CD1 . TRP B 1 189 ? -4.300  17.032 39.338  1.00 8.23  ? 189 TRP B CD1 1 
ATOM   3282 C  CD2 . TRP B 1 189 ? -2.625  17.436 40.788  1.00 7.69  ? 189 TRP B CD2 1 
ATOM   3283 N  NE1 . TRP B 1 189 ? -4.142  18.398 39.394  1.00 8.36  ? 189 TRP B NE1 1 
ATOM   3284 C  CE2 . TRP B 1 189 ? -3.137  18.668 40.266  1.00 7.94  ? 189 TRP B CE2 1 
ATOM   3285 C  CE3 . TRP B 1 189 ? -1.604  17.475 41.717  1.00 7.90  ? 189 TRP B CE3 1 
ATOM   3286 C  CZ2 . TRP B 1 189 ? -2.596  19.900 40.681  1.00 7.93  ? 189 TRP B CZ2 1 
ATOM   3287 C  CZ3 . TRP B 1 189 ? -1.070  18.695 42.098  1.00 8.39  ? 189 TRP B CZ3 1 
ATOM   3288 C  CH2 . TRP B 1 189 ? -1.557  19.897 41.583  1.00 8.33  ? 189 TRP B CH2 1 
ATOM   3289 N  N   . ASN B 1 190 ? -1.806  12.036 39.502  1.00 8.27  ? 190 ASN B N   1 
ATOM   3290 C  CA  . ASN B 1 190 ? -1.643  10.605 39.802  1.00 8.75  ? 190 ASN B CA  1 
ATOM   3291 C  C   . ASN B 1 190 ? -0.197  10.190 40.030  1.00 8.70  ? 190 ASN B C   1 
ATOM   3292 O  O   . ASN B 1 190 ? 0.025   9.085  40.529  1.00 10.13 ? 190 ASN B O   1 
ATOM   3293 C  CB  . ASN B 1 190 ? -2.273  9.799  38.695  1.00 9.26  ? 190 ASN B CB  1 
ATOM   3294 C  CG  . ASN B 1 190 ? -3.736  10.031 38.576  1.00 9.77  ? 190 ASN B CG  1 
ATOM   3295 O  OD1 . ASN B 1 190 ? -4.460  9.954  39.609  1.00 10.63 ? 190 ASN B OD1 1 
ATOM   3296 N  ND2 . ASN B 1 190 ? -4.254  10.305 37.410  1.00 10.53 ? 190 ASN B ND2 1 
ATOM   3297 N  N   . VAL B 1 191 ? 0.754   11.017 39.621  1.00 8.34  ? 191 VAL B N   1 
ATOM   3298 C  CA  . VAL B 1 191 ? 2.167   10.665 39.664  1.00 8.45  ? 191 VAL B CA  1 
ATOM   3299 C  C   . VAL B 1 191 ? 3.057   11.646 40.388  1.00 8.04  ? 191 VAL B C   1 
ATOM   3300 O  O   . VAL B 1 191 ? 4.236   11.326 40.606  1.00 8.93  ? 191 VAL B O   1 
ATOM   3301 C  CB  . VAL B 1 191 ? 2.715   10.365 38.260  1.00 9.00  ? 191 VAL B CB  1 
ATOM   3302 C  CG1 . VAL B 1 191 ? 2.088   9.080  37.733  1.00 10.68 ? 191 VAL B CG1 1 
ATOM   3303 C  CG2 . VAL B 1 191 ? 2.518   11.549 37.311  1.00 9.42  ? 191 VAL B CG2 1 
ATOM   3304 N  N   . VAL B 1 192 ? 2.545   12.798 40.868  1.00 8.36  ? 192 VAL B N   1 
ATOM   3305 C  CA  . VAL B 1 192 ? 3.428   13.662 41.655  1.00 8.30  ? 192 VAL B CA  1 
ATOM   3306 C  C   . VAL B 1 192 ? 3.786   12.913 42.934  1.00 8.44  ? 192 VAL B C   1 
ATOM   3307 O  O   . VAL B 1 192 ? 2.946   12.329 43.593  1.00 9.03  ? 192 VAL B O   1 
ATOM   3308 C  CB  . VAL B 1 192 ? 2.762   15.027 41.901  1.00 8.58  ? 192 VAL B CB  1 
ATOM   3309 C  CG1 . VAL B 1 192 ? 1.444   14.926 42.679  1.00 9.17  ? 192 VAL B CG1 1 
ATOM   3310 C  CG2 . VAL B 1 192 ? 3.693   15.971 42.614  1.00 9.50  ? 192 VAL B CG2 1 
ATOM   3311 N  N   . ASN B 1 193 ? 5.084   12.953 43.279  1.00 8.53  ? 193 ASN B N   1 
ATOM   3312 C  CA  . ASN B 1 193 ? 5.619   12.226 44.432  1.00 8.47  ? 193 ASN B CA  1 
ATOM   3313 C  C   . ASN B 1 193 ? 5.424   13.073 45.677  1.00 8.42  ? 193 ASN B C   1 
ATOM   3314 O  O   . ASN B 1 193 ? 6.233   13.956 45.996  1.00 8.86  ? 193 ASN B O   1 
ATOM   3315 C  CB  . ASN B 1 193 ? 7.067   11.896 44.217  1.00 8.78  ? 193 ASN B CB  1 
ATOM   3316 C  CG  . ASN B 1 193 ? 7.670   11.110 45.351  1.00 9.17  ? 193 ASN B CG  1 
ATOM   3317 O  OD1 . ASN B 1 193 ? 7.062   10.960 46.407  1.00 9.61  ? 193 ASN B OD1 1 
ATOM   3318 N  ND2 . ASN B 1 193 ? 8.899   10.647 45.180  1.00 10.27 ? 193 ASN B ND2 1 
ATOM   3319 N  N   . TRP B 1 194 ? 4.320   12.821 46.382  1.00 8.68  ? 194 TRP B N   1 
ATOM   3320 C  CA  . TRP B 1 194 ? 4.053   13.624 47.581  1.00 8.72  ? 194 TRP B CA  1 
ATOM   3321 C  C   . TRP B 1 194 ? 4.982   13.345 48.734  1.00 8.92  ? 194 TRP B C   1 
ATOM   3322 O  O   . TRP B 1 194 ? 5.104   14.170 49.630  1.00 10.06 ? 194 TRP B O   1 
ATOM   3323 C  CB  . TRP B 1 194 ? 2.599   13.470 48.012  1.00 8.98  ? 194 TRP B CB  1 
ATOM   3324 C  CG  . TRP B 1 194 ? 1.641   14.191 47.108  1.00 8.93  ? 194 TRP B CG  1 
ATOM   3325 C  CD1 . TRP B 1 194 ? 0.604   13.619 46.368  1.00 9.17  ? 194 TRP B CD1 1 
ATOM   3326 C  CD2 . TRP B 1 194 ? 1.585   15.603 46.829  1.00 9.25  ? 194 TRP B CD2 1 
ATOM   3327 N  NE1 . TRP B 1 194 ? -0.077  14.600 45.689  1.00 10.03 ? 194 TRP B NE1 1 
ATOM   3328 C  CE2 . TRP B 1 194 ? 0.508   15.811 45.931  1.00 9.70  ? 194 TRP B CE2 1 
ATOM   3329 C  CE3 . TRP B 1 194 ? 2.346   16.706 47.263  1.00 9.30  ? 194 TRP B CE3 1 
ATOM   3330 C  CZ2 . TRP B 1 194 ? 0.188   17.098 45.465  1.00 9.92  ? 194 TRP B CZ2 1 
ATOM   3331 C  CZ3 . TRP B 1 194 ? 2.012   17.946 46.774  1.00 10.09 ? 194 TRP B CZ3 1 
ATOM   3332 C  CH2 . TRP B 1 194 ? 0.969   18.143 45.905  1.00 10.47 ? 194 TRP B CH2 1 
ATOM   3333 N  N   . ASP B 1 195 ? 5.637   12.177 48.717  1.00 9.76  ? 195 ASP B N   1 
ATOM   3334 C  CA  . ASP B 1 195 ? 6.681   11.873 49.743  1.00 9.75  ? 195 ASP B CA  1 
ATOM   3335 C  C   . ASP B 1 195 ? 7.905   12.740 49.613  1.00 9.75  ? 195 ASP B C   1 
ATOM   3336 O  O   . ASP B 1 195 ? 8.388   13.324 50.577  1.00 10.21 ? 195 ASP B O   1 
ATOM   3337 C  CB  . ASP B 1 195 ? 7.049   10.391 49.700  1.00 10.20 ? 195 ASP B CB  1 
ATOM   3338 C  CG  . ASP B 1 195 ? 5.879   9.445  49.942  1.00 10.58 ? 195 ASP B CG  1 
ATOM   3339 O  OD1 . ASP B 1 195 ? 4.842   9.830  50.521  1.00 11.77 ? 195 ASP B OD1 1 
ATOM   3340 O  OD2 . ASP B 1 195 ? 6.037   8.258  49.563  1.00 11.31 ? 195 ASP B OD2 1 
ATOM   3341 N  N   . GLU B 1 196 ? 8.400   12.877 48.354  1.00 9.64  ? 196 GLU B N   1 
ATOM   3342 C  CA  . GLU B 1 196 ? 9.573   13.735 48.125  1.00 10.06 ? 196 GLU B CA  1 
ATOM   3343 C  C   . GLU B 1 196 ? 9.201   15.171 48.365  1.00 9.44  ? 196 GLU B C   1 
ATOM   3344 O  O   . GLU B 1 196 ? 9.940   15.948 48.924  1.00 10.16 ? 196 GLU B O   1 
ATOM   3345 C  CB  . GLU B 1 196 ? 10.134  13.512 46.701  1.00 10.83 ? 196 GLU B CB  1 
ATOM   3346 C  CG  . GLU B 1 196 ? 11.375  14.318 46.424  1.00 12.19 ? 196 GLU B CG  1 
ATOM   3347 C  CD  . GLU B 1 196 ? 12.618  14.041 47.215  1.00 15.12 ? 196 GLU B CD  1 
ATOM   3348 O  OE1 . GLU B 1 196 ? 12.763  12.884 47.588  1.00 20.73 ? 196 GLU B OE1 1 
ATOM   3349 O  OE2 . GLU B 1 196 ? 13.417  14.979 47.443  1.00 24.60 ? 196 GLU B OE2 1 
ATOM   3350 N  N   . ALA B 1 197 ? 7.985   15.592 47.919  1.00 9.18  ? 197 ALA B N   1 
ATOM   3351 C  CA  . ALA B 1 197 ? 7.515   16.929 48.175  1.00 9.08  ? 197 ALA B CA  1 
ATOM   3352 C  C   . ALA B 1 197 ? 7.524   17.199 49.690  1.00 8.54  ? 197 ALA B C   1 
ATOM   3353 O  O   . ALA B 1 197 ? 7.947   18.252 50.158  1.00 9.32  ? 197 ALA B O   1 
ATOM   3354 C  CB  . ALA B 1 197 ? 6.132   17.141 47.552  1.00 9.45  ? 197 ALA B CB  1 
ATOM   3355 N  N   . ALA B 1 198 ? 6.996   16.238 50.463  1.00 8.76  ? 198 ALA B N   1 
ATOM   3356 C  CA  . ALA B 1 198 ? 6.966   16.393 51.923  1.00 8.94  ? 198 ALA B CA  1 
ATOM   3357 C  C   . ALA B 1 198 ? 8.358   16.482 52.527  1.00 9.45  ? 198 ALA B C   1 
ATOM   3358 O  O   . ALA B 1 198 ? 8.562   17.245 53.483  1.00 10.16 ? 198 ALA B O   1 
ATOM   3359 C  CB  . ALA B 1 198 ? 6.183   15.246 52.550  1.00 10.43 ? 198 ALA B CB  1 
ATOM   3360 N  N   . ALA B 1 199 ? 9.296   15.712 52.010  1.00 9.96  ? 199 ALA B N   1 
ATOM   3361 C  CA  . ALA B 1 199 ? 10.678  15.733 52.478  1.00 11.03 ? 199 ALA B CA  1 
ATOM   3362 C  C   . ALA B 1 199 ? 11.306  17.100 52.188  1.00 11.35 ? 199 ALA B C   1 
ATOM   3363 O  O   . ALA B 1 199 ? 12.015  17.665 53.048  1.00 13.77 ? 199 ALA B O   1 
ATOM   3364 C  CB  . ALA B 1 199 ? 11.477  14.567 51.911  1.00 12.40 ? 199 ALA B CB  1 
ATOM   3365 N  N   . ARG B 1 200 ? 11.045  17.656 51.012  1.00 10.79 ? 200 ARG B N   1 
ATOM   3366 C  CA  . ARG B 1 200 ? 11.604  18.945 50.658  1.00 11.32 ? 200 ARG B CA  1 
ATOM   3367 C  C   . ARG B 1 200 ? 10.981  20.034 51.504  1.00 11.13 ? 200 ARG B C   1 
ATOM   3368 O  O   . ARG B 1 200 ? 11.657  20.968 51.947  1.00 14.16 ? 200 ARG B O   1 
ATOM   3369 C  CB  . ARG B 1 200 ? 11.424  19.185 49.164  1.00 11.03 ? 200 ARG B CB  1 
ATOM   3370 C  CG  . ARG B 1 200 ? 12.253  18.259 48.267  1.00 10.86 ? 200 ARG B CG  1 
ATOM   3371 C  CD  . ARG B 1 200 ? 12.037  18.497 46.776  1.00 10.78 ? 200 ARG B CD  1 
ATOM   3372 N  NE  . ARG B 1 200 ? 12.509  19.770 46.302  1.00 10.64 ? 200 ARG B NE  1 
ATOM   3373 C  CZ  . ARG B 1 200 ? 13.762  20.026 45.914  1.00 11.20 ? 200 ARG B CZ  1 
ATOM   3374 N  NH1 . ARG B 1 200 ? 14.688  19.041 45.857  1.00 14.36 ? 200 ARG B NH1 1 
ATOM   3375 N  NH2 . ARG B 1 200 ? 14.087  21.301 45.560  1.00 12.81 ? 200 ARG B NH2 1 
ATOM   3376 N  N   . PHE B 1 201 ? 9.661   19.934 51.755  1.00 10.76 ? 201 PHE B N   1 
ATOM   3377 C  CA  . PHE B 1 201 ? 8.996   20.910 52.613  1.00 11.05 ? 201 PHE B CA  1 
ATOM   3378 C  C   . PHE B 1 201 ? 9.552   20.850 54.021  1.00 11.44 ? 201 PHE B C   1 
ATOM   3379 O  O   . PHE B 1 201 ? 9.726   21.879 54.682  1.00 16.15 ? 201 PHE B O   1 
ATOM   3380 C  CB  . PHE B 1 201 ? 7.479   20.671 52.533  1.00 10.86 ? 201 PHE B CB  1 
ATOM   3381 C  CG  . PHE B 1 201 ? 6.694   21.616 53.437  1.00 11.28 ? 201 PHE B CG  1 
ATOM   3382 C  CD1 . PHE B 1 201 ? 6.596   22.939 53.111  1.00 12.68 ? 201 PHE B CD1 1 
ATOM   3383 C  CD2 . PHE B 1 201 ? 6.112   21.198 54.597  1.00 12.56 ? 201 PHE B CD2 1 
ATOM   3384 C  CE1 . PHE B 1 201 ? 5.911   23.844 53.932  1.00 13.15 ? 201 PHE B CE1 1 
ATOM   3385 C  CE2 . PHE B 1 201 ? 5.382   22.068 55.400  1.00 12.90 ? 201 PHE B CE2 1 
ATOM   3386 C  CZ  . PHE B 1 201 ? 5.301   23.409 55.071  1.00 12.81 ? 201 PHE B CZ  1 
ATOM   3387 N  N   . ALA B 1 202 ? 9.798   19.626 54.533  1.00 12.03 ? 202 ALA B N   1 
ATOM   3388 C  CA  . ALA B 1 202 ? 10.315  19.545 55.900  1.00 13.27 ? 202 ALA B CA  1 
ATOM   3389 C  C   . ALA B 1 202 ? 11.671  20.135 55.968  1.00 14.78 ? 202 ALA B C   1 
ATOM   3390 O  O   . ALA B 1 202 ? 12.035  20.732 57.013  1.00 17.68 ? 202 ALA B O   1 
ATOM   3391 C  CB  . ALA B 1 202 ? 10.342  18.071 56.315  1.00 15.02 ? 202 ALA B CB  1 
ATOM   3392 N  N   . ALA B 1 203 ? 12.517  19.983 54.939  1.00 15.34 ? 203 ALA B N   1 
ATOM   3393 C  CA  . ALA B 1 203 ? 13.904  20.459 54.938  1.00 20.44 ? 203 ALA B CA  1 
ATOM   3394 C  C   . ALA B 1 203 ? 13.973  21.954 54.817  1.00 19.77 ? 203 ALA B C   1 
ATOM   3395 O  O   . ALA B 1 203 ? 14.931  22.607 55.322  1.00 23.32 ? 203 ALA B O   1 
ATOM   3396 C  CB  . ALA B 1 203 ? 14.658  19.677 53.857  1.00 21.06 ? 203 ALA B CB  1 
ATOM   3397 N  N   . LYS B 1 204 ? 13.070  22.609 54.073  1.00 23.80 ? 204 LYS B N   1 
ATOM   3398 C  CA  . LYS B 1 204 ? 13.219  24.071 54.143  1.00 24.95 ? 204 LYS B CA  1 
ATOM   3399 C  C   . LYS B 1 204 ? 12.141  24.851 54.848  1.00 25.46 ? 204 LYS B C   1 
ATOM   3400 O  O   . LYS B 1 204 ? 12.110  26.083 54.931  1.00 41.47 ? 204 LYS B O   1 
ATOM   3401 C  CB  . LYS B 1 204 ? 13.337  24.584 52.731  1.00 27.27 ? 204 LYS B CB  1 
ATOM   3402 C  CG  . LYS B 1 204 ? 14.756  24.870 52.278  1.00 28.42 ? 204 LYS B CG  1 
ATOM   3403 C  CD  . LYS B 1 204 ? 15.665  23.704 52.470  1.00 37.23 ? 204 LYS B CD  1 
ATOM   3404 C  CE  . LYS B 1 204 ? 16.596  23.262 51.349  1.00 37.72 ? 204 LYS B CE  1 
ATOM   3405 N  NZ  . LYS B 1 204 ? 16.644  21.764 51.405  1.00 35.49 ? 204 LYS B NZ  1 
ATOM   3406 N  N   . LYS B 1 205 ? 11.123  24.188 55.424  1.00 21.21 ? 205 LYS B N   1 
ATOM   3407 C  CA  . LYS B 1 205 ? 10.096  24.975 56.142  1.00 26.17 ? 205 LYS B CA  1 
ATOM   3408 C  C   . LYS B 1 205 ? 10.684  25.687 57.340  1.00 32.11 ? 205 LYS B C   1 
ATOM   3409 O  O   . LYS B 1 205 ? 11.820  25.293 57.697  1.00 57.75 ? 205 LYS B O   1 
ATOM   3410 C  CB  . LYS B 1 205 ? 8.849   24.107 56.517  1.00 19.64 ? 205 LYS B CB  1 
ATOM   3411 C  CG  . LYS B 1 205 ? 9.069   23.030 57.588  1.00 25.82 ? 205 LYS B CG  1 
ATOM   3412 C  CD  . LYS B 1 205 ? 7.957   21.982 57.679  1.00 27.53 ? 205 LYS B CD  1 
ATOM   3413 C  CE  . LYS B 1 205 ? 8.065   20.941 58.793  1.00 23.16 ? 205 LYS B CE  1 
ATOM   3414 N  NZ  . LYS B 1 205 ? 6.758   20.456 59.260  1.00 30.42 ? 205 LYS B NZ  1 
ATOM   3415 O  OXT . LYS B 1 205 ? 10.065  26.600 57.943  1.00 39.68 ? 205 LYS B OXT 1 
HETATM 3416 MN MN  . MH2 C 2 .   ? 3.666   25.051 14.855  1.00 5.35  ? 206 MH2 A MN  1 
HETATM 3417 O  O1  . MH2 C 2 .   ? 4.529   26.624 16.252  1.00 6.39  ? 206 MH2 A O1  1 
HETATM 3418 MN MN  . MH2 D 2 .   ? 11.556  18.109 29.777  1.00 6.30  ? 206 MH2 B MN  1 
HETATM 3419 O  O1  . MH2 D 2 .   ? 11.557  20.367 29.716  1.00 7.38  ? 206 MH2 B O1  1 
HETATM 3420 O  O   . HOH E 3 .   ? 4.524   15.382 3.905   1.00 7.36  ? 207 HOH A O   1 
HETATM 3421 O  O   . HOH E 3 .   ? 8.205   22.767 24.186  1.00 7.01  ? 208 HOH A O   1 
HETATM 3422 O  O   . HOH E 3 .   ? 11.740  23.151 -2.788  1.00 6.93  ? 209 HOH A O   1 
HETATM 3423 O  O   . HOH E 3 .   ? 13.786  23.929 -1.125  1.00 7.37  ? 210 HOH A O   1 
HETATM 3424 O  O   . HOH E 3 .   ? 15.081  24.437 23.211  1.00 7.76  ? 211 HOH A O   1 
HETATM 3425 O  O   . HOH E 3 .   ? 9.076   29.996 1.475   1.00 7.10  ? 212 HOH A O   1 
HETATM 3426 O  O   . HOH E 3 .   ? -2.323  27.524 2.586   1.00 8.79  ? 213 HOH A O   1 
HETATM 3427 O  O   . HOH E 3 .   ? 11.068  24.019 20.703  1.00 7.79  ? 214 HOH A O   1 
HETATM 3428 O  O   . HOH E 3 .   ? 3.751   34.471 21.282  1.00 7.28  ? 215 HOH A O   1 
HETATM 3429 O  O   . HOH E 3 .   ? -3.857  15.263 2.713   1.00 6.93  ? 216 HOH A O   1 
HETATM 3430 O  O   . HOH E 3 .   ? 9.887   37.110 20.541  1.00 8.39  ? 217 HOH A O   1 
HETATM 3431 O  O   . HOH E 3 .   ? -1.972  29.081 4.814   1.00 7.43  ? 218 HOH A O   1 
HETATM 3432 O  O   . HOH E 3 .   ? 1.168   36.838 4.321   1.00 8.00  ? 219 HOH A O   1 
HETATM 3433 O  O   . HOH E 3 .   ? 11.892  30.895 23.024  1.00 8.41  ? 220 HOH A O   1 
HETATM 3434 O  O   . HOH E 3 .   ? 8.073   15.219 13.208  1.00 8.37  ? 221 HOH A O   1 
HETATM 3435 O  O   . HOH E 3 .   ? 18.607  23.229 18.264  1.00 9.53  ? 222 HOH A O   1 
HETATM 3436 O  O   . HOH E 3 .   ? 8.790   32.223 26.766  1.00 8.55  ? 223 HOH A O   1 
HETATM 3437 O  O   . HOH E 3 .   ? -4.875  32.001 6.901   1.00 7.98  ? 224 HOH A O   1 
HETATM 3438 O  O   . HOH E 3 .   ? 4.755   31.753 2.858   1.00 7.47  ? 225 HOH A O   1 
HETATM 3439 O  O   . HOH E 3 .   ? 7.385   32.088 2.120   1.00 8.22  ? 226 HOH A O   1 
HETATM 3440 O  O   . HOH E 3 .   ? 6.490   35.540 23.587  1.00 9.51  ? 227 HOH A O   1 
HETATM 3441 O  O   . HOH E 3 .   ? 2.778   38.208 6.079   1.00 8.86  ? 228 HOH A O   1 
HETATM 3442 O  O   . HOH E 3 .   ? 17.124  25.196 -0.163  1.00 8.89  ? 229 HOH A O   1 
HETATM 3443 O  O   . HOH E 3 .   ? 4.018   10.121 9.115   1.00 9.16  ? 230 HOH A O   1 
HETATM 3444 O  O   . HOH E 3 .   ? 15.661  24.181 -3.131  1.00 8.93  ? 231 HOH A O   1 
HETATM 3445 O  O   . HOH E 3 .   ? -3.575  31.300 4.595   1.00 8.15  ? 232 HOH A O   1 
HETATM 3446 O  O   . HOH E 3 .   ? 13.319  22.792 21.830  1.00 8.64  ? 233 HOH A O   1 
HETATM 3447 O  O   . HOH E 3 .   ? 4.200   36.323 10.741  1.00 9.54  ? 234 HOH A O   1 
HETATM 3448 O  O   . HOH E 3 .   ? 5.350   17.075 -3.511  1.00 8.30  ? 235 HOH A O   1 
HETATM 3449 O  O   . HOH E 3 .   ? 8.233   44.626 11.304  1.00 10.00 ? 236 HOH A O   1 
HETATM 3450 O  O   . HOH E 3 .   ? 0.520   34.929 7.566   1.00 8.10  ? 237 HOH A O   1 
HETATM 3451 O  O   . HOH E 3 .   ? 17.178  22.179 20.309  1.00 9.96  ? 238 HOH A O   1 
HETATM 3452 O  O   . HOH E 3 .   ? 3.226   24.768 -1.771  1.00 10.22 ? 239 HOH A O   1 
HETATM 3453 O  O   . HOH E 3 .   ? 8.735   29.053 4.960   1.00 9.61  ? 240 HOH A O   1 
HETATM 3454 O  O   . HOH E 3 .   ? 5.673   19.903 -3.037  1.00 10.58 ? 241 HOH A O   1 
HETATM 3455 O  O   . HOH E 3 .   ? 6.010   16.048 15.265  1.00 9.64  ? 242 HOH A O   1 
HETATM 3456 O  O   . HOH E 3 .   ? -14.538 35.968 16.557  1.00 28.18 ? 243 HOH A O   1 
HETATM 3457 O  O   . HOH E 3 .   ? 8.435   45.576 -4.858  1.00 9.66  ? 244 HOH A O   1 
HETATM 3458 O  O   . HOH E 3 .   ? -1.414  12.423 7.544   1.00 10.40 ? 245 HOH A O   1 
HETATM 3459 O  O   . HOH E 3 .   ? 0.590   26.673 21.866  1.00 10.89 ? 246 HOH A O   1 
HETATM 3460 O  O   . HOH E 3 .   ? 0.747   34.180 4.943   1.00 8.87  ? 247 HOH A O   1 
HETATM 3461 O  O   . HOH E 3 .   ? -8.126  40.259 12.998  1.00 11.24 ? 248 HOH A O   1 
HETATM 3462 O  O   . HOH E 3 .   ? 17.591  25.998 -4.049  1.00 10.68 ? 249 HOH A O   1 
HETATM 3463 O  O   . HOH E 3 .   ? -8.337  33.484 8.816   1.00 10.75 ? 250 HOH A O   1 
HETATM 3464 O  O   . HOH E 3 .   ? -1.992  24.999 19.429  1.00 9.88  ? 251 HOH A O   1 
HETATM 3465 O  O   . HOH E 3 .   ? -7.548  31.454 6.997   1.00 10.77 ? 252 HOH A O   1 
HETATM 3466 O  O   . HOH E 3 .   ? 5.394   10.428 11.505  1.00 10.23 ? 253 HOH A O   1 
HETATM 3467 O  O   . HOH E 3 .   ? 12.978  19.767 -2.991  1.00 9.13  ? 254 HOH A O   1 
HETATM 3468 O  O   . HOH E 3 .   ? -3.751  28.573 22.214  1.00 11.71 ? 255 HOH A O   1 
HETATM 3469 O  O   . HOH E 3 .   ? 13.621  35.812 -6.985  1.00 11.03 ? 256 HOH A O   1 
HETATM 3470 O  O   . HOH E 3 .   ? 12.015  27.106 -8.463  1.00 9.22  ? 257 HOH A O   1 
HETATM 3471 O  O   . HOH E 3 .   ? 2.575   29.065 -1.554  1.00 9.49  ? 258 HOH A O   1 
HETATM 3472 O  O   . HOH E 3 .   ? 26.043  26.768 4.825   1.00 24.34 ? 259 HOH A O   1 
HETATM 3473 O  O   . HOH E 3 .   ? 4.538   20.407 10.056  1.00 10.41 ? 260 HOH A O   1 
HETATM 3474 O  O   . HOH E 3 .   ? -2.156  26.431 21.780  1.00 9.68  ? 261 HOH A O   1 
HETATM 3475 O  O   . HOH E 3 .   ? 2.445   36.715 8.601   1.00 9.37  ? 262 HOH A O   1 
HETATM 3476 O  O   . HOH E 3 .   ? 19.822  19.915 3.938   1.00 12.04 ? 263 HOH A O   1 
HETATM 3477 O  O   . HOH E 3 .   ? 2.577   35.791 -2.676  1.00 10.94 ? 264 HOH A O   1 
HETATM 3478 O  O   . HOH E 3 .   ? -0.373  17.491 -2.916  1.00 10.17 ? 265 HOH A O   1 
HETATM 3479 O  O   . HOH E 3 .   ? -3.979  31.218 24.710  1.00 10.54 ? 266 HOH A O   1 
HETATM 3480 O  O   . HOH E 3 .   ? -9.313  21.053 12.637  1.00 9.64  ? 267 HOH A O   1 
HETATM 3481 O  O   . HOH E 3 .   ? 6.494   46.245 18.572  1.00 11.64 ? 268 HOH A O   1 
HETATM 3482 O  O   . HOH E 3 .   ? -2.204  33.054 25.787  1.00 11.49 ? 269 HOH A O   1 
HETATM 3483 O  O   . HOH E 3 .   ? 21.101  38.844 9.423   1.00 11.63 ? 270 HOH A O   1 
HETATM 3484 O  O   . HOH E 3 .   ? 21.020  22.102 11.223  1.00 24.68 ? 271 HOH A O   1 
HETATM 3485 O  O   . HOH E 3 .   ? 17.598  24.159 22.149  0.90 14.77 ? 272 HOH A O   1 
HETATM 3486 O  O   . HOH E 3 .   ? 13.984  20.311 22.862  1.00 12.30 ? 273 HOH A O   1 
HETATM 3487 O  O   . HOH E 3 .   ? 4.482   27.739 -4.765  1.00 10.15 ? 274 HOH A O   1 
HETATM 3488 O  O   . HOH E 3 .   ? 11.749  37.768 -6.442  1.00 12.62 ? 275 HOH A O   1 
HETATM 3489 O  O   . HOH E 3 .   ? -6.978  36.396 8.571   1.00 11.85 ? 276 HOH A O   1 
HETATM 3490 O  O   . HOH E 3 .   ? 17.875  32.410 17.528  1.00 12.78 ? 277 HOH A O   1 
HETATM 3491 O  O   . HOH E 3 .   ? 0.632   14.820 -2.436  1.00 11.05 ? 278 HOH A O   1 
HETATM 3492 O  O   . HOH E 3 .   ? -1.262  11.882 4.805   1.00 11.31 ? 279 HOH A O   1 
HETATM 3493 O  O   . HOH E 3 .   ? 5.954   9.438  7.291   1.00 11.04 ? 280 HOH A O   1 
HETATM 3494 O  O   . HOH E 3 .   ? 21.180  22.373 18.592  1.00 13.25 ? 281 HOH A O   1 
HETATM 3495 O  O   . HOH E 3 .   ? -12.307 36.572 14.831  0.39 19.91 ? 282 HOH A O   1 
HETATM 3496 O  O   . HOH E 3 .   ? 8.028   36.312 25.741  1.00 15.80 ? 283 HOH A O   1 
HETATM 3497 O  O   . HOH E 3 .   ? -8.858  32.564 23.914  0.90 11.83 ? 284 HOH A O   1 
HETATM 3498 O  O   . HOH E 3 .   ? 11.505  13.295 -3.607  1.00 14.01 ? 285 HOH A O   1 
HETATM 3499 O  O   . HOH E 3 .   ? 15.262  42.557 14.025  1.00 12.67 ? 286 HOH A O   1 
HETATM 3500 O  O   . HOH E 3 .   ? 1.849   19.763 21.349  1.00 10.59 ? 287 HOH A O   1 
HETATM 3501 O  O   . HOH E 3 .   ? -14.086 38.186 23.288  1.00 18.28 ? 288 HOH A O   1 
HETATM 3502 O  O   . HOH E 3 .   ? 7.480   32.949 -7.609  1.00 12.90 ? 289 HOH A O   1 
HETATM 3503 O  O   . HOH E 3 .   ? 16.936  31.706 22.587  1.00 12.89 ? 290 HOH A O   1 
HETATM 3504 O  O   . HOH E 3 .   ? -4.693  38.776 27.043  1.00 15.07 ? 291 HOH A O   1 
HETATM 3505 O  O   . HOH E 3 .   ? 15.153  20.212 20.228  1.00 12.00 ? 292 HOH A O   1 
HETATM 3506 O  O   . HOH E 3 .   ? -4.171  50.252 23.350  0.38 18.84 ? 293 HOH A O   1 
HETATM 3507 O  O   . HOH E 3 .   ? 9.135   11.629 6.656   1.00 13.03 ? 294 HOH A O   1 
HETATM 3508 O  O   . HOH E 3 .   ? 20.300  28.098 22.447  0.90 12.22 ? 295 HOH A O   1 
HETATM 3509 O  O   . HOH E 3 .   ? -9.834  19.675 10.291  0.90 12.75 ? 296 HOH A O   1 
HETATM 3510 O  O   . HOH E 3 .   ? -11.536 26.912 11.229  0.90 13.75 ? 297 HOH A O   1 
HETATM 3511 O  O   . HOH E 3 .   ? 18.413  26.496 21.247  0.90 21.36 ? 298 HOH A O   1 
HETATM 3512 O  O   . HOH E 3 .   ? -5.457  36.787 6.156   1.00 14.27 ? 299 HOH A O   1 
HETATM 3513 O  O   . HOH E 3 .   ? 2.011   40.743 5.305   1.00 14.22 ? 300 HOH A O   1 
HETATM 3514 O  O   . HOH E 3 .   ? 21.479  40.910 7.485   1.00 13.51 ? 301 HOH A O   1 
HETATM 3515 O  O   . HOH E 3 .   ? 28.033  38.942 -2.810  1.00 14.66 ? 302 HOH A O   1 
HETATM 3516 O  O   . HOH E 3 .   ? 1.209   42.388 7.384   0.90 11.70 ? 303 HOH A O   1 
HETATM 3517 O  O   . HOH E 3 .   ? 10.427  17.798 19.020  0.80 17.35 ? 304 HOH A O   1 
HETATM 3518 O  O   . HOH E 3 .   ? 20.403  28.031 -6.501  1.00 14.14 ? 305 HOH A O   1 
HETATM 3519 O  O   . HOH E 3 .   ? -2.353  28.542 -0.030  1.00 14.78 ? 306 HOH A O   1 
HETATM 3520 O  O   . HOH E 3 .   ? 9.636   47.697 15.041  1.00 14.61 ? 307 HOH A O   1 
HETATM 3521 O  O   . HOH E 3 .   ? 3.938   35.684 24.681  1.00 21.99 ? 308 HOH A O   1 
HETATM 3522 O  O   . HOH E 3 .   ? 1.641   34.419 27.586  1.00 17.63 ? 309 HOH A O   1 
HETATM 3523 O  O   . HOH E 3 .   ? -3.183  40.988 27.842  1.00 15.73 ? 310 HOH A O   1 
HETATM 3524 O  O   . HOH E 3 .   ? 8.155   9.962  11.098  0.90 13.44 ? 311 HOH A O   1 
HETATM 3525 O  O   . HOH E 3 .   ? 2.230   22.923 -3.436  1.00 13.39 ? 312 HOH A O   1 
HETATM 3526 O  O   . HOH E 3 .   ? -5.882  28.692 1.588   1.00 14.11 ? 313 HOH A O   1 
HETATM 3527 O  O   . HOH E 3 .   ? -6.749  31.323 25.286  1.00 14.85 ? 314 HOH A O   1 
HETATM 3528 O  O   . HOH E 3 .   ? 24.071  39.754 -5.763  1.00 14.22 ? 315 HOH A O   1 
HETATM 3529 O  O   . HOH E 3 .   ? 8.315   17.164 10.330  1.00 16.45 ? 316 HOH A O   1 
HETATM 3530 O  O   . HOH E 3 .   ? 1.764   44.731 16.854  1.00 14.53 ? 317 HOH A O   1 
HETATM 3531 O  O   . HOH E 3 .   ? 24.020  40.485 6.597   1.00 16.34 ? 318 HOH A O   1 
HETATM 3532 O  O   . HOH E 3 .   ? 11.613  40.174 -7.948  0.60 12.13 ? 319 HOH A O   1 
HETATM 3533 O  O   . HOH E 3 .   ? 13.309  38.163 19.002  1.00 17.10 ? 320 HOH A O   1 
HETATM 3534 O  O   . HOH E 3 .   ? 20.373  35.459 -9.365  1.00 17.35 ? 321 HOH A O   1 
HETATM 3535 O  O   . HOH E 3 .   ? 2.333   41.852 24.649  0.40 14.07 ? 322 HOH A O   1 
HETATM 3536 O  O   . HOH E 3 .   ? 0.789   24.714 19.641  0.90 15.52 ? 323 HOH A O   1 
HETATM 3537 O  O   . HOH E 3 .   ? 14.472  12.871 3.551   1.00 15.36 ? 324 HOH A O   1 
HETATM 3538 O  O   . HOH E 3 .   ? 5.859   44.254 6.733   1.00 14.40 ? 325 HOH A O   1 
HETATM 3539 O  O   . HOH E 3 .   ? 22.269  33.568 13.135  1.00 21.16 ? 326 HOH A O   1 
HETATM 3540 O  O   . HOH E 3 .   ? 7.820   46.961 12.723  0.90 17.48 ? 327 HOH A O   1 
HETATM 3541 O  O   . HOH E 3 .   ? 19.609  26.892 -2.389  1.00 17.50 ? 328 HOH A O   1 
HETATM 3542 O  O   . HOH E 3 .   ? 11.317  37.707 22.774  0.90 16.14 ? 329 HOH A O   1 
HETATM 3543 O  O   . HOH E 3 .   ? -13.584 29.984 19.430  1.00 25.60 ? 330 HOH A O   1 
HETATM 3544 O  O   . HOH E 3 .   ? 1.825   8.454  8.884   0.90 14.58 ? 331 HOH A O   1 
HETATM 3545 O  O   . HOH E 3 .   ? 18.039  41.302 -6.208  1.00 15.96 ? 332 HOH A O   1 
HETATM 3546 O  O   . HOH E 3 .   ? 10.636  45.878 5.351   0.90 15.94 ? 333 HOH A O   1 
HETATM 3547 O  O   A HOH E 3 .   ? -6.273  25.096 -0.762  0.70 13.30 ? 334 HOH A O   1 
HETATM 3548 O  O   . HOH E 3 .   ? -12.778 28.912 15.371  0.90 15.74 ? 335 HOH A O   1 
HETATM 3549 O  O   . HOH E 3 .   ? 16.662  37.696 16.264  1.00 19.15 ? 336 HOH A O   1 
HETATM 3550 O  O   . HOH E 3 .   ? 8.297   8.899  3.261   0.90 16.97 ? 337 HOH A O   1 
HETATM 3551 O  O   . HOH E 3 .   ? -8.967  48.952 21.601  0.90 28.99 ? 338 HOH A O   1 
HETATM 3552 O  O   . HOH E 3 .   ? 22.807  34.505 -8.522  1.00 15.53 ? 339 HOH A O   1 
HETATM 3553 O  O   . HOH E 3 .   ? -8.658  20.425 16.536  1.00 20.19 ? 340 HOH A O   1 
HETATM 3554 O  O   . HOH E 3 .   ? 22.224  17.582 12.136  0.80 27.92 ? 341 HOH A O   1 
HETATM 3555 O  O   . HOH E 3 .   ? 8.686   34.632 27.869  0.90 17.64 ? 342 HOH A O   1 
HETATM 3556 O  O   . HOH E 3 .   ? 27.016  29.485 -1.621  1.00 23.28 ? 343 HOH A O   1 
HETATM 3557 O  O   . HOH E 3 .   ? 24.213  44.462 1.651   0.90 18.76 ? 344 HOH A O   1 
HETATM 3558 O  O   . HOH E 3 .   ? 21.425  28.134 -4.048  1.00 23.03 ? 345 HOH A O   1 
HETATM 3559 O  O   . HOH E 3 .   ? 8.572   48.427 17.561  1.00 21.90 ? 346 HOH A O   1 
HETATM 3560 O  O   . HOH E 3 .   ? -11.667 24.016 10.615  0.90 16.54 ? 347 HOH A O   1 
HETATM 3561 O  O   . HOH E 3 .   ? 17.963  33.022 20.303  1.00 17.99 ? 348 HOH A O   1 
HETATM 3562 O  O   . HOH E 3 .   ? 25.844  31.952 -3.548  1.00 23.62 ? 349 HOH A O   1 
HETATM 3563 O  O   . HOH E 3 .   ? -10.522 30.449 24.230  0.90 24.03 ? 350 HOH A O   1 
HETATM 3564 O  O   . HOH E 3 .   ? 18.381  44.300 7.645   0.90 17.46 ? 351 HOH A O   1 
HETATM 3565 O  O   . HOH E 3 .   ? -1.386  44.096 28.155  1.00 18.75 ? 352 HOH A O   1 
HETATM 3566 O  O   . HOH E 3 .   ? 7.159   20.179 10.468  1.00 28.09 ? 353 HOH A O   1 
HETATM 3567 O  O   . HOH E 3 .   ? -12.192 23.177 16.231  0.90 19.04 ? 354 HOH A O   1 
HETATM 3568 O  O   . HOH E 3 .   ? -9.791  34.663 25.532  1.00 25.89 ? 355 HOH A O   1 
HETATM 3569 O  O   . HOH E 3 .   ? 20.848  45.791 0.960   0.90 17.68 ? 356 HOH A O   1 
HETATM 3570 O  O   . HOH E 3 .   ? 18.049  13.917 4.648   0.90 20.00 ? 357 HOH A O   1 
HETATM 3571 O  O   . HOH E 3 .   ? 14.443  21.334 -4.826  0.90 14.94 ? 358 HOH A O   1 
HETATM 3572 O  O   . HOH E 3 .   ? 7.135   45.217 8.957   1.00 20.53 ? 359 HOH A O   1 
HETATM 3573 O  O   . HOH E 3 .   ? 20.519  42.178 -5.211  0.90 23.03 ? 360 HOH A O   1 
HETATM 3574 O  O   . HOH E 3 .   ? 3.756   37.595 26.561  0.90 25.04 ? 361 HOH A O   1 
HETATM 3575 O  O   . HOH E 3 .   ? 15.016  31.667 24.630  0.90 30.31 ? 362 HOH A O   1 
HETATM 3576 O  O   . HOH E 3 .   ? -10.435 24.755 20.656  1.00 27.72 ? 363 HOH A O   1 
HETATM 3577 O  O   . HOH E 3 .   ? 20.008  39.849 11.871  1.00 20.68 ? 364 HOH A O   1 
HETATM 3578 O  O   . HOH E 3 .   ? -7.504  25.400 23.916  0.90 20.62 ? 365 HOH A O   1 
HETATM 3579 O  O   . HOH E 3 .   ? 10.326  40.405 23.039  1.00 21.84 ? 366 HOH A O   1 
HETATM 3580 O  O   . HOH E 3 .   ? 20.656  43.263 8.861   0.90 19.02 ? 367 HOH A O   1 
HETATM 3581 O  O   . HOH E 3 .   ? 16.139  40.706 15.999  0.90 20.17 ? 368 HOH A O   1 
HETATM 3582 O  O   . HOH E 3 .   ? -7.374  28.797 26.341  0.90 23.41 ? 369 HOH A O   1 
HETATM 3583 O  O   . HOH E 3 .   ? 6.534   38.429 27.009  1.00 29.58 ? 370 HOH A O   1 
HETATM 3584 O  O   . HOH E 3 .   ? 27.107  32.683 8.053   0.90 19.75 ? 371 HOH A O   1 
HETATM 3585 O  O   . HOH E 3 .   ? 10.656  36.681 25.286  1.00 17.65 ? 372 HOH A O   1 
HETATM 3586 O  O   . HOH E 3 .   ? 2.855   36.627 28.679  0.90 22.00 ? 373 HOH A O   1 
HETATM 3587 O  O   . HOH E 3 .   ? 22.005  32.825 15.890  0.90 21.02 ? 374 HOH A O   1 
HETATM 3588 O  O   . HOH E 3 .   ? 2.152   39.974 26.076  1.00 29.13 ? 375 HOH A O   1 
HETATM 3589 O  O   . HOH E 3 .   ? 24.701  37.531 -7.260  0.90 20.79 ? 376 HOH A O   1 
HETATM 3590 O  O   . HOH E 3 .   ? 19.039  24.422 -5.800  0.90 21.34 ? 377 HOH A O   1 
HETATM 3591 O  O   . HOH E 3 .   ? 13.162  16.999 -2.693  0.80 13.63 ? 378 HOH A O   1 
HETATM 3592 O  O   . HOH E 3 .   ? 19.347  42.592 11.459  0.90 20.90 ? 379 HOH A O   1 
HETATM 3593 O  O   . HOH E 3 .   ? -3.599  34.654 27.396  1.00 25.05 ? 380 HOH A O   1 
HETATM 3594 O  O   . HOH E 3 .   ? 24.809  38.666 8.347   1.00 23.95 ? 381 HOH A O   1 
HETATM 3595 O  O   . HOH E 3 .   ? 19.247  13.724 20.579  0.90 23.45 ? 382 HOH A O   1 
HETATM 3596 O  O   . HOH E 3 .   ? 19.571  32.526 -10.575 1.00 25.33 ? 383 HOH A O   1 
HETATM 3597 O  O   . HOH E 3 .   ? 31.203  35.762 -1.063  0.90 23.34 ? 384 HOH A O   1 
HETATM 3598 O  O   . HOH E 3 .   ? 9.365   46.562 7.761   0.90 23.77 ? 385 HOH A O   1 
HETATM 3599 O  O   . HOH E 3 .   ? 4.833   46.341 12.828  1.00 26.57 ? 386 HOH A O   1 
HETATM 3600 O  O   . HOH E 3 .   ? 21.233  36.374 12.343  1.00 27.27 ? 387 HOH A O   1 
HETATM 3601 O  O   . HOH E 3 .   ? 12.740  47.309 11.008  0.90 29.12 ? 388 HOH A O   1 
HETATM 3602 O  O   . HOH E 3 .   ? 19.852  34.087 16.684  1.00 24.68 ? 389 HOH A O   1 
HETATM 3603 O  O   A HOH E 3 .   ? 22.593  15.632 9.841   0.70 25.30 ? 390 HOH A O   1 
HETATM 3604 O  O   . HOH E 3 .   ? 12.249  8.995  12.666  0.90 27.43 ? 391 HOH A O   1 
HETATM 3605 O  O   . HOH E 3 .   ? 26.515  31.791 10.704  0.39 23.72 ? 392 HOH A O   1 
HETATM 3606 O  O   . HOH E 3 .   ? 24.902  24.498 0.998   1.00 23.35 ? 393 HOH A O   1 
HETATM 3607 O  O   . HOH E 3 .   ? 16.644  43.598 17.157  0.90 28.24 ? 394 HOH A O   1 
HETATM 3608 O  O   . HOH E 3 .   ? -12.876 44.301 12.230  1.00 26.00 ? 395 HOH A O   1 
HETATM 3609 O  O   . HOH E 3 .   ? 8.281   8.804  0.431   0.90 24.93 ? 396 HOH A O   1 
HETATM 3610 O  O   . HOH E 3 .   ? 20.806  25.640 -7.525  0.90 21.78 ? 397 HOH A O   1 
HETATM 3611 O  O   . HOH E 3 .   ? -11.299 44.384 26.079  0.39 22.86 ? 398 HOH A O   1 
HETATM 3612 O  O   . HOH E 3 .   ? 13.294  23.697 -9.609  0.90 25.89 ? 399 HOH A O   1 
HETATM 3613 O  O   . HOH E 3 .   ? -7.007  15.562 13.141  0.90 23.26 ? 400 HOH A O   1 
HETATM 3614 O  O   . HOH E 3 .   ? 13.784  35.272 23.520  0.90 24.55 ? 401 HOH A O   1 
HETATM 3615 O  O   . HOH E 3 .   ? -0.551  9.900  8.506   1.00 14.25 ? 402 HOH A O   1 
HETATM 3616 O  O   . HOH E 3 .   ? 14.593  45.426 19.847  0.90 28.45 ? 403 HOH A O   1 
HETATM 3617 O  O   . HOH E 3 .   ? 16.341  10.811 18.265  1.00 27.95 ? 404 HOH A O   1 
HETATM 3618 O  O   . HOH E 3 .   ? 23.251  22.822 5.383   0.39 18.47 ? 405 HOH A O   1 
HETATM 3619 O  O   . HOH E 3 .   ? 25.949  32.556 -7.667  0.80 22.71 ? 406 HOH A O   1 
HETATM 3620 O  O   . HOH E 3 .   ? 14.504  12.462 6.753   0.90 22.65 ? 407 HOH A O   1 
HETATM 3621 O  O   . HOH E 3 .   ? 27.526  36.565 5.866   0.90 26.91 ? 408 HOH A O   1 
HETATM 3622 O  O   . HOH E 3 .   ? 4.761   8.847  13.520  0.90 27.77 ? 409 HOH A O   1 
HETATM 3623 O  O   . HOH E 3 .   ? 30.991  37.640 2.877   1.00 26.41 ? 410 HOH A O   1 
HETATM 3624 O  O   . HOH E 3 .   ? -10.964 32.986 6.405   0.39 16.80 ? 411 HOH A O   1 
HETATM 3625 O  O   . HOH E 3 .   ? -13.441 28.477 12.685  0.90 28.55 ? 412 HOH A O   1 
HETATM 3626 O  O   . HOH E 3 .   ? 23.222  31.885 -9.776  0.90 22.55 ? 413 HOH A O   1 
HETATM 3627 O  O   . HOH E 3 .   ? 2.750   8.561  17.837  0.90 25.07 ? 414 HOH A O   1 
HETATM 3628 O  O   . HOH E 3 .   ? -8.152  46.201 29.096  0.39 16.70 ? 415 HOH A O   1 
HETATM 3629 O  O   . HOH E 3 .   ? -16.423 40.326 16.703  1.00 25.60 ? 416 HOH A O   1 
HETATM 3630 O  O   . HOH E 3 .   ? -9.036  26.435 25.880  0.39 17.51 ? 417 HOH A O   1 
HETATM 3631 O  O   . HOH E 3 .   ? 5.716   17.521 9.280   0.90 15.56 ? 418 HOH A O   1 
HETATM 3632 O  O   . HOH E 3 .   ? 23.827  19.140 6.395   1.00 20.78 ? 419 HOH A O   1 
HETATM 3633 O  O   . HOH E 3 .   ? -7.263  21.004 18.524  0.39 18.82 ? 420 HOH A O   1 
HETATM 3634 O  O   . HOH E 3 .   ? 17.492  22.241 -2.820  0.90 20.64 ? 421 HOH A O   1 
HETATM 3635 O  O   . HOH E 3 .   ? -1.115  24.450 -4.710  0.90 16.40 ? 422 HOH A O   1 
HETATM 3636 O  O   . HOH E 3 .   ? -1.882  33.506 4.646   0.90 11.62 ? 423 HOH A O   1 
HETATM 3637 O  O   . HOH E 3 .   ? -15.281 32.314 18.867  0.39 23.17 ? 424 HOH A O   1 
HETATM 3638 O  O   . HOH E 3 .   ? 3.103   44.341 6.927   1.00 23.78 ? 425 HOH A O   1 
HETATM 3639 O  O   . HOH E 3 .   ? 24.253  28.560 -4.138  1.00 28.96 ? 426 HOH A O   1 
HETATM 3640 O  O   . HOH E 3 .   ? 17.656  35.849 20.102  0.39 24.23 ? 427 HOH A O   1 
HETATM 3641 O  O   . HOH E 3 .   ? 11.926  46.899 8.469   0.39 15.90 ? 428 HOH A O   1 
HETATM 3642 O  O   . HOH E 3 .   ? 20.425  24.890 -10.113 0.39 22.40 ? 429 HOH A O   1 
HETATM 3643 O  O   . HOH E 3 .   ? 18.631  47.000 7.911   0.39 20.41 ? 430 HOH A O   1 
HETATM 3644 O  O   . HOH E 3 .   ? 10.423  45.482 24.869  0.39 22.93 ? 431 HOH A O   1 
HETATM 3645 O  O   . HOH E 3 .   ? 11.787  49.244 13.842  0.39 25.87 ? 432 HOH A O   1 
HETATM 3646 O  O   . HOH E 3 .   ? 16.010  46.974 14.498  0.39 19.55 ? 433 HOH A O   1 
HETATM 3647 O  O   . HOH E 3 .   ? 14.724  11.350 11.623  0.90 29.34 ? 434 HOH A O   1 
HETATM 3648 O  O   . HOH E 3 .   ? 20.708  19.935 19.936  0.90 15.70 ? 435 HOH A O   1 
HETATM 3649 O  O   . HOH E 3 .   ? 16.141  42.867 -6.391  0.39 23.87 ? 436 HOH A O   1 
HETATM 3650 O  O   . HOH E 3 .   ? 13.164  15.365 -2.690  0.90 13.06 ? 437 HOH A O   1 
HETATM 3651 O  O   . HOH E 3 .   ? -7.883  23.428 21.571  0.39 15.36 ? 438 HOH A O   1 
HETATM 3652 O  O   . HOH E 3 .   ? -6.061  32.548 27.616  0.39 24.11 ? 439 HOH A O   1 
HETATM 3653 O  O   . HOH E 3 .   ? -4.368  36.778 28.665  0.39 19.03 ? 440 HOH A O   1 
HETATM 3654 O  O   . HOH E 3 .   ? 22.506  26.478 18.857  0.39 22.00 ? 441 HOH A O   1 
HETATM 3655 O  O   . HOH E 3 .   ? -15.505 34.225 23.420  0.90 28.10 ? 442 HOH A O   1 
HETATM 3656 O  O   . HOH E 3 .   ? 23.161  28.303 21.377  0.39 19.33 ? 443 HOH A O   1 
HETATM 3657 O  O   . HOH E 3 .   ? 9.134   10.680 18.735  0.39 21.05 ? 444 HOH A O   1 
HETATM 3658 O  O   . HOH E 3 .   ? 21.140  15.196 19.408  0.39 15.72 ? 445 HOH A O   1 
HETATM 3659 O  O   . HOH E 3 .   ? 3.465   47.724 14.491  0.39 19.82 ? 446 HOH A O   1 
HETATM 3660 O  O   . HOH E 3 .   ? 17.259  22.863 -7.440  0.90 27.41 ? 447 HOH A O   1 
HETATM 3661 O  O   . HOH E 3 .   ? 11.853  38.253 27.073  1.00 34.74 ? 448 HOH A O   1 
HETATM 3662 O  O   . HOH E 3 .   ? -9.427  36.031 8.352   0.80 17.77 ? 449 HOH A O   1 
HETATM 3663 O  O   . HOH E 3 .   ? -10.564 26.761 22.153  0.39 23.26 ? 450 HOH A O   1 
HETATM 3664 O  O   . HOH E 3 .   ? -9.954  37.535 25.585  0.39 21.07 ? 451 HOH A O   1 
HETATM 3665 O  O   . HOH E 3 .   ? 27.495  40.102 4.928   0.39 25.66 ? 452 HOH A O   1 
HETATM 3666 O  O   . HOH E 3 .   ? -16.305 37.743 12.936  0.39 20.46 ? 453 HOH A O   1 
HETATM 3667 O  O   . HOH E 3 .   ? 14.152  37.009 21.492  0.39 21.10 ? 454 HOH A O   1 
HETATM 3668 O  O   . HOH E 3 .   ? -15.729 33.813 15.618  0.39 19.24 ? 455 HOH A O   1 
HETATM 3669 O  O   . HOH E 3 .   ? 11.975  9.861  5.644   0.39 19.00 ? 456 HOH A O   1 
HETATM 3670 O  O   . HOH E 3 .   ? -13.709 43.780 24.777  0.39 17.13 ? 457 HOH A O   1 
HETATM 3671 O  O   . HOH E 3 .   ? 20.740  32.698 21.097  0.60 22.64 ? 458 HOH A O   1 
HETATM 3672 O  O   . HOH E 3 .   ? 28.303  31.634 -4.055  0.39 23.15 ? 459 HOH A O   1 
HETATM 3673 O  O   B HOH E 3 .   ? 16.451  12.942 20.145  0.50 12.12 ? 460 HOH A O   1 
HETATM 3674 O  O   . HOH E 3 .   ? -8.680  38.718 27.353  0.38 21.02 ? 461 HOH A O   1 
HETATM 3675 O  O   . HOH E 3 .   ? 17.294  18.757 25.389  1.00 10.17 ? 462 HOH A O   1 
HETATM 3676 O  O   . HOH E 3 .   ? 23.101  22.788 16.430  1.00 20.73 ? 463 HOH A O   1 
HETATM 3677 O  O   . HOH E 3 .   ? 11.711  17.475 21.192  1.00 11.38 ? 464 HOH A O   1 
HETATM 3678 O  O   . HOH E 3 .   ? -2.971  28.607 24.801  1.00 11.44 ? 465 HOH A O   1 
HETATM 3679 O  O   . HOH E 3 .   ? 18.764  20.485 21.741  1.00 18.29 ? 466 HOH A O   1 
HETATM 3680 O  O   . HOH E 3 .   ? -4.701  27.895 26.754  0.60 16.04 ? 467 HOH A O   1 
HETATM 3681 O  O   . HOH E 3 .   ? 5.254   7.939  17.429  0.70 29.19 ? 468 HOH A O   1 
HETATM 3682 O  O   . HOH E 3 .   ? -10.403 38.396 10.058  0.90 19.85 ? 469 HOH A O   1 
HETATM 3683 O  O   . HOH E 3 .   ? -0.354  9.422  1.590   1.00 11.29 ? 470 HOH A O   1 
HETATM 3684 O  O   . HOH E 3 .   ? 25.401  27.247 22.471  0.39 20.85 ? 471 HOH A O   1 
HETATM 3685 O  O   . HOH E 3 .   ? 0.196   26.755 -4.637  1.00 22.39 ? 472 HOH A O   1 
HETATM 3686 O  O   . HOH E 3 .   ? -2.170  45.508 5.905   0.39 17.87 ? 473 HOH A O   1 
HETATM 3687 O  O   . HOH E 3 .   ? 10.923  37.860 29.249  0.39 22.23 ? 474 HOH A O   1 
HETATM 3688 O  O   . HOH E 3 .   ? 13.419  47.312 -6.160  0.90 32.67 ? 475 HOH A O   1 
HETATM 3689 O  O   . HOH E 3 .   ? 26.425  40.229 -4.558  0.90 11.32 ? 476 HOH A O   1 
HETATM 3690 O  O   . HOH E 3 .   ? -5.261  49.319 30.930  0.90 22.70 ? 477 HOH A O   1 
HETATM 3691 O  O   . HOH E 3 .   ? 14.068  32.134 -5.914  1.00 8.51  ? 478 HOH A O   1 
HETATM 3692 O  O   . HOH E 3 .   ? 2.402   34.779 0.775   1.00 8.33  ? 479 HOH A O   1 
HETATM 3693 O  O   . HOH E 3 .   ? 12.294  30.051 -6.820  1.00 8.36  ? 480 HOH A O   1 
HETATM 3694 O  O   . HOH E 3 .   ? 2.652   33.417 3.199   1.00 8.99  ? 481 HOH A O   1 
HETATM 3695 O  O   . HOH E 3 .   ? -8.233  45.781 7.380   1.00 9.73  ? 482 HOH A O   1 
HETATM 3696 O  O   . HOH E 3 .   ? 0.155   6.646  1.433   1.00 10.83 ? 483 HOH A O   1 
HETATM 3697 O  O   . HOH E 3 .   ? 7.174   15.164 -4.547  1.00 11.11 ? 484 HOH A O   1 
HETATM 3698 O  O   . HOH E 3 .   ? -2.160  35.354 6.815   1.00 12.65 ? 485 HOH A O   1 
HETATM 3699 O  O   . HOH E 3 .   ? 4.699   30.343 -4.860  0.90 11.79 ? 486 HOH A O   1 
HETATM 3700 O  O   . HOH E 3 .   ? 8.899   25.081 -8.849  1.00 12.42 ? 487 HOH A O   1 
HETATM 3701 O  O   . HOH E 3 .   ? 1.450   32.001 -4.345  1.00 12.88 ? 488 HOH A O   1 
HETATM 3702 O  O   . HOH E 3 .   ? 8.432   9.605  8.467   1.00 13.46 ? 489 HOH A O   1 
HETATM 3703 O  O   . HOH E 3 .   ? -7.912  12.666 8.011   1.00 12.39 ? 490 HOH A O   1 
HETATM 3704 O  O   . HOH E 3 .   ? 13.775  37.200 -10.340 0.90 14.31 ? 491 HOH A O   1 
HETATM 3705 O  O   . HOH E 3 .   ? -9.221  23.753 7.095   1.00 13.78 ? 492 HOH A O   1 
HETATM 3706 O  O   . HOH E 3 .   ? 9.115   43.893 -7.899  1.00 14.15 ? 493 HOH A O   1 
HETATM 3707 O  O   . HOH E 3 .   ? 6.281   45.669 4.480   0.90 15.05 ? 494 HOH A O   1 
HETATM 3708 O  O   . HOH E 3 .   ? -4.847  10.417 8.312   0.90 14.05 ? 495 HOH A O   1 
HETATM 3709 O  O   . HOH E 3 .   ? 12.663  34.126 -8.986  1.00 17.91 ? 496 HOH A O   1 
HETATM 3710 O  O   . HOH E 3 .   ? 10.588  49.130 -4.919  0.90 13.27 ? 497 HOH A O   1 
HETATM 3711 O  O   . HOH E 3 .   ? -1.824  41.683 4.049   1.00 13.40 ? 498 HOH A O   1 
HETATM 3712 O  O   . HOH E 3 .   ? -8.760  23.870 -1.373  0.90 14.25 ? 499 HOH A O   1 
HETATM 3713 O  O   . HOH E 3 .   ? 11.547  31.661 -8.965  1.00 18.87 ? 500 HOH A O   1 
HETATM 3714 O  O   . HOH E 3 .   ? 8.747   45.143 3.562   0.80 15.38 ? 501 HOH A O   1 
HETATM 3715 O  O   . HOH E 3 .   ? 19.780  29.603 -9.368  1.00 16.57 ? 502 HOH A O   1 
HETATM 3716 O  O   . HOH E 3 .   ? -5.643  31.072 2.789   1.00 15.29 ? 503 HOH A O   1 
HETATM 3717 O  O   . HOH E 3 .   ? -4.380  43.852 5.403   0.90 19.29 ? 504 HOH A O   1 
HETATM 3718 O  O   . HOH E 3 .   ? 0.227   51.122 26.623  0.90 15.46 ? 505 HOH A O   1 
HETATM 3719 O  O   . HOH E 3 .   ? 5.954   13.625 -1.547  0.90 15.75 ? 506 HOH A O   1 
HETATM 3720 O  O   . HOH E 3 .   ? -9.742  17.027 10.331  0.90 15.97 ? 507 HOH A O   1 
HETATM 3721 O  O   . HOH E 3 .   ? -8.790  28.516 3.083   1.00 16.35 ? 508 HOH A O   1 
HETATM 3722 O  O   . HOH E 3 .   ? -3.115  37.287 3.189   0.90 14.48 ? 509 HOH A O   1 
HETATM 3723 O  O   . HOH E 3 .   ? 4.343   47.873 19.406  1.00 17.60 ? 510 HOH A O   1 
HETATM 3724 O  O   . HOH E 3 .   ? 19.208  23.785 -1.329  0.90 18.90 ? 511 HOH A O   1 
HETATM 3725 O  O   . HOH E 3 .   ? 2.520   43.852 4.156   1.00 15.22 ? 512 HOH A O   1 
HETATM 3726 O  O   . HOH E 3 .   ? 21.933  20.827 5.463   1.00 21.25 ? 513 HOH A O   1 
HETATM 3727 O  O   . HOH E 3 .   ? 0.081   47.436 9.163   0.90 17.02 ? 514 HOH A O   1 
HETATM 3728 O  O   . HOH E 3 .   ? 5.411   7.136  5.848   1.00 19.57 ? 515 HOH A O   1 
HETATM 3729 O  O   . HOH E 3 .   ? 3.402   8.854  1.813   0.90 21.27 ? 516 HOH A O   1 
HETATM 3730 O  O   . HOH E 3 .   ? 15.348  33.083 -12.421 1.00 27.36 ? 517 HOH A O   1 
HETATM 3731 O  O   . HOH E 3 .   ? -9.214  38.408 6.303   1.00 24.13 ? 518 HOH A O   1 
HETATM 3732 O  O   . HOH E 3 .   ? -0.593  46.689 27.586  0.90 18.96 ? 519 HOH A O   1 
HETATM 3733 O  O   . HOH E 3 .   ? 10.267  36.157 -9.168  1.00 22.32 ? 520 HOH A O   1 
HETATM 3734 O  O   . HOH E 3 .   ? 2.694   47.141 17.252  1.00 25.26 ? 521 HOH A O   1 
HETATM 3735 O  O   . HOH E 3 .   ? 25.117  26.845 11.075  0.80 21.33 ? 522 HOH A O   1 
HETATM 3736 O  O   . HOH E 3 .   ? 11.549  46.108 -7.972  0.90 20.60 ? 523 HOH A O   1 
HETATM 3737 O  O   . HOH E 3 .   ? 14.301  46.174 -1.000  0.90 22.91 ? 524 HOH A O   1 
HETATM 3738 O  O   . HOH E 3 .   ? 1.968   46.452 26.906  1.00 22.03 ? 525 HOH A O   1 
HETATM 3739 O  O   . HOH E 3 .   ? 26.970  41.780 2.544   0.90 25.06 ? 526 HOH A O   1 
HETATM 3740 O  O   . HOH E 3 .   ? 23.571  26.522 -0.810  1.00 25.22 ? 527 HOH A O   1 
HETATM 3741 O  O   . HOH E 3 .   ? 16.190  44.235 -1.552  1.00 23.62 ? 528 HOH A O   1 
HETATM 3742 O  O   . HOH E 3 .   ? -7.767  15.177 10.608  0.90 21.82 ? 529 HOH A O   1 
HETATM 3743 O  O   . HOH E 3 .   ? -1.557  7.872  6.926   0.90 26.23 ? 530 HOH A O   1 
HETATM 3744 O  O   . HOH E 3 .   ? 8.918   31.626 -9.463  0.90 24.35 ? 531 HOH A O   1 
HETATM 3745 O  O   . HOH E 3 .   ? -0.309  43.479 5.422   0.90 22.78 ? 532 HOH A O   1 
HETATM 3746 O  O   . HOH E 3 .   ? 22.846  23.255 13.775  1.00 28.31 ? 533 HOH A O   1 
HETATM 3747 O  O   . HOH E 3 .   ? 4.721   43.966 24.889  1.00 30.32 ? 534 HOH A O   1 
HETATM 3748 O  O   . HOH E 3 .   ? 16.816  43.986 -4.275  1.00 24.74 ? 535 HOH A O   1 
HETATM 3749 O  O   . HOH E 3 .   ? 17.311  19.709 -1.997  0.90 22.02 ? 536 HOH A O   1 
HETATM 3750 O  O   . HOH E 3 .   ? 20.809  45.327 -5.496  1.00 25.39 ? 537 HOH A O   1 
HETATM 3751 O  O   . HOH E 3 .   ? 12.713  42.938 -10.532 0.80 26.01 ? 538 HOH A O   1 
HETATM 3752 O  O   . HOH E 3 .   ? 3.519   5.292  6.382   0.80 21.62 ? 539 HOH A O   1 
HETATM 3753 O  O   . HOH E 3 .   ? 13.348  27.115 -12.401 0.90 24.85 ? 540 HOH A O   1 
HETATM 3754 O  O   . HOH E 3 .   ? 1.628   5.889  8.115   0.80 25.35 ? 541 HOH A O   1 
HETATM 3755 O  O   . HOH E 3 .   ? 9.685   8.099  12.411  1.00 27.52 ? 542 HOH A O   1 
HETATM 3756 O  O   . HOH E 3 .   ? 1.872   5.474  4.177   0.90 21.04 ? 543 HOH A O   1 
HETATM 3757 O  O   . HOH E 3 .   ? 21.998  47.575 2.735   1.00 26.35 ? 544 HOH A O   1 
HETATM 3758 O  O   . HOH E 3 .   ? 28.353  34.269 -3.844  0.90 25.23 ? 545 HOH A O   1 
HETATM 3759 O  O   . HOH E 3 .   ? 20.935  16.743 16.950  0.90 27.58 ? 546 HOH A O   1 
HETATM 3760 O  O   . HOH E 3 .   ? 26.534  35.358 7.986   0.90 27.74 ? 547 HOH A O   1 
HETATM 3761 O  O   . HOH E 3 .   ? 14.849  9.508  0.611   1.00 33.00 ? 548 HOH A O   1 
HETATM 3762 O  O   . HOH E 3 .   ? 2.062   46.807 7.091   1.00 27.43 ? 549 HOH A O   1 
HETATM 3763 O  O   . HOH E 3 .   ? 24.630  28.712 -7.264  0.90 29.78 ? 550 HOH A O   1 
HETATM 3764 O  O   B HOH E 3 .   ? 17.225  51.416 1.083   0.80 21.39 ? 551 HOH A O   1 
HETATM 3765 O  O   . HOH E 3 .   ? 16.207  37.514 19.041  0.39 20.58 ? 552 HOH A O   1 
HETATM 3766 O  O   . HOH E 3 .   ? 25.468  42.716 7.112   0.39 16.68 ? 553 HOH A O   1 
HETATM 3767 O  O   . HOH E 3 .   ? 23.290  18.171 17.170  1.00 29.40 ? 554 HOH A O   1 
HETATM 3768 O  O   . HOH E 3 .   ? -3.388  27.059 -2.034  0.90 21.60 ? 555 HOH A O   1 
HETATM 3769 O  O   . HOH E 3 .   ? 12.574  7.753  1.581   1.00 38.22 ? 556 HOH A O   1 
HETATM 3770 O  O   . HOH E 3 .   ? -4.032  33.866 -0.049  0.90 13.59 ? 557 HOH A O   1 
HETATM 3771 O  O   . HOH E 3 .   ? 6.437   10.141 -1.067  0.90 15.16 ? 558 HOH A O   1 
HETATM 3772 O  O   . HOH E 3 .   ? -5.405  34.179 5.497   1.00 26.64 ? 559 HOH A O   1 
HETATM 3773 O  O   . HOH E 3 .   ? 13.153  49.248 -2.659  0.90 28.05 ? 560 HOH A O   1 
HETATM 3774 O  O   . HOH E 3 .   ? 17.804  15.103 8.752   1.00 24.56 ? 561 HOH A O   1 
HETATM 3775 O  O   . HOH E 3 .   ? 18.204  41.479 -8.985  0.39 19.14 ? 562 HOH A O   1 
HETATM 3776 O  O   . HOH E 3 .   ? 27.501  36.877 -7.101  0.80 23.41 ? 563 HOH A O   1 
HETATM 3777 O  O   . HOH E 3 .   ? 2.171   18.428 15.215  0.51 15.67 ? 564 HOH A O   1 
HETATM 3778 O  O   . HOH E 3 .   ? 6.138   48.259 5.096   0.39 14.48 ? 565 HOH A O   1 
HETATM 3779 O  O   . HOH E 3 .   ? -10.533 40.393 6.165   1.00 22.29 ? 566 HOH A O   1 
HETATM 3780 O  O   . HOH E 3 .   ? -14.641 30.765 11.833  0.90 25.25 ? 567 HOH A O   1 
HETATM 3781 O  O   . HOH E 3 .   ? -8.213  31.022 4.356   0.90 18.42 ? 568 HOH A O   1 
HETATM 3782 O  O   . HOH E 3 .   ? -7.938  28.972 -0.053  0.39 18.05 ? 569 HOH A O   1 
HETATM 3783 O  O   . HOH E 3 .   ? 5.576   7.714  3.013   1.00 30.63 ? 570 HOH A O   1 
HETATM 3784 O  O   . HOH E 3 .   ? 3.351   20.428 -2.449  0.80 22.74 ? 571 HOH A O   1 
HETATM 3785 O  O   . HOH E 3 .   ? 2.384   26.908 -3.184  0.90 16.57 ? 572 HOH A O   1 
HETATM 3786 O  O   . HOH E 3 .   ? -4.249  34.876 3.048   0.80 24.13 ? 573 HOH A O   1 
HETATM 3787 O  O   . HOH E 3 .   ? -16.270 37.955 15.615  0.39 22.10 ? 574 HOH A O   1 
HETATM 3788 O  O   . HOH E 3 .   ? -6.777  48.620 10.635  1.00 26.46 ? 575 HOH A O   1 
HETATM 3789 O  O   . HOH E 3 .   ? -4.838  51.555 12.279  0.39 24.27 ? 576 HOH A O   1 
HETATM 3790 O  O   . HOH E 3 .   ? 2.005   47.481 22.515  1.00 34.48 ? 577 HOH A O   1 
HETATM 3791 O  O   . HOH E 3 .   ? 13.585  34.444 -11.400 0.70 23.22 ? 578 HOH A O   1 
HETATM 3792 O  O   . HOH E 3 .   ? 23.941  25.702 13.219  1.00 27.65 ? 579 HOH A O   1 
HETATM 3793 O  O   . HOH E 3 .   ? 23.177  48.447 6.864   0.39 24.73 ? 580 HOH A O   1 
HETATM 3794 O  O   . HOH E 3 .   ? 21.377  47.259 8.851   0.39 21.93 ? 581 HOH A O   1 
HETATM 3795 O  O   . HOH E 3 .   ? 7.071   42.648 24.667  0.39 20.30 ? 582 HOH A O   1 
HETATM 3796 O  O   . HOH E 3 .   ? 17.563  46.258 12.268  0.39 26.72 ? 583 HOH A O   1 
HETATM 3797 O  O   . HOH E 3 .   ? 21.465  14.529 15.036  0.90 26.31 ? 584 HOH A O   1 
HETATM 3798 O  O   . HOH E 3 .   ? 4.038   31.093 -7.116  0.39 21.01 ? 585 HOH A O   1 
HETATM 3799 O  O   . HOH E 3 .   ? -5.267  51.287 8.437   0.90 26.02 ? 586 HOH A O   1 
HETATM 3800 O  O   . HOH E 3 .   ? -2.558  50.964 25.906  0.39 22.59 ? 587 HOH A O   1 
HETATM 3801 O  O   . HOH E 3 .   ? 2.297   52.407 19.887  0.39 16.29 ? 588 HOH A O   1 
HETATM 3802 O  O   . HOH E 3 .   ? -13.385 29.583 24.058  0.39 18.38 ? 589 HOH A O   1 
HETATM 3803 O  O   . HOH E 3 .   ? 1.795   9.127  15.487  0.39 22.76 ? 590 HOH A O   1 
HETATM 3804 O  O   . HOH E 3 .   ? 30.308  30.838 0.876   0.90 32.29 ? 591 HOH A O   1 
HETATM 3805 O  O   . HOH E 3 .   ? -10.138 27.255 1.229   0.90 28.36 ? 592 HOH A O   1 
HETATM 3806 O  O   . HOH E 3 .   ? 21.570  23.564 1.371   0.39 18.72 ? 593 HOH A O   1 
HETATM 3807 O  O   . HOH E 3 .   ? 31.729  34.906 1.536   0.39 19.95 ? 594 HOH A O   1 
HETATM 3808 O  O   . HOH E 3 .   ? 8.254   11.702 -2.528  0.90 31.80 ? 595 HOH A O   1 
HETATM 3809 O  O   . HOH E 3 .   ? 0.337   42.041 27.112  0.39 17.39 ? 596 HOH A O   1 
HETATM 3810 O  O   . HOH E 3 .   ? 25.614  43.430 4.030   0.39 19.89 ? 597 HOH A O   1 
HETATM 3811 O  O   . HOH E 3 .   ? 10.888  9.145  -1.167  0.39 25.94 ? 598 HOH A O   1 
HETATM 3812 O  O   . HOH E 3 .   ? 17.688  38.317 -11.201 0.80 25.31 ? 599 HOH A O   1 
HETATM 3813 O  O   . HOH E 3 .   ? -2.101  48.055 7.719   0.80 28.18 ? 600 HOH A O   1 
HETATM 3814 O  O   . HOH E 3 .   ? 8.339   11.660 -4.959  0.39 20.02 ? 601 HOH A O   1 
HETATM 3815 O  O   . HOH E 3 .   ? -1.954  43.935 30.756  0.39 19.67 ? 602 HOH A O   1 
HETATM 3816 O  O   . HOH E 3 .   ? 11.021  25.396 -10.327 0.39 19.60 ? 603 HOH A O   1 
HETATM 3817 O  O   . HOH E 3 .   ? -16.639 42.941 12.837  0.39 26.88 ? 604 HOH A O   1 
HETATM 3818 O  O   . HOH E 3 .   ? -6.629  49.246 27.420  0.39 28.82 ? 605 HOH A O   1 
HETATM 3819 O  O   . HOH E 3 .   ? 3.574   47.802 3.679   0.39 20.41 ? 606 HOH A O   1 
HETATM 3820 O  O   . HOH E 3 .   ? 18.998  48.993 5.860   1.00 33.23 ? 607 HOH A O   1 
HETATM 3821 O  O   . HOH E 3 .   ? 3.602   48.352 6.202   0.39 24.34 ? 608 HOH A O   1 
HETATM 3822 O  O   . HOH E 3 .   ? 24.929  16.585 18.587  0.39 23.07 ? 609 HOH A O   1 
HETATM 3823 O  O   . HOH E 3 .   ? -0.355  49.920 23.585  0.39 25.95 ? 610 HOH A O   1 
HETATM 3824 O  O   . HOH E 3 .   ? -7.993  17.162 19.876  0.39 21.59 ? 611 HOH A O   1 
HETATM 3825 O  O   . HOH E 3 .   ? -13.246 40.522 7.105   0.39 24.38 ? 612 HOH A O   1 
HETATM 3826 O  O   . HOH E 3 .   ? 7.153   8.706  15.699  0.39 27.44 ? 613 HOH A O   1 
HETATM 3827 O  O   . HOH E 3 .   ? 24.920  39.999 10.736  0.39 21.05 ? 614 HOH A O   1 
HETATM 3828 O  O   . HOH E 3 .   ? 20.571  40.961 -10.056 0.39 21.56 ? 615 HOH A O   1 
HETATM 3829 O  O   . HOH E 3 .   ? -12.784 38.536 8.279   0.80 55.19 ? 616 HOH A O   1 
HETATM 3830 O  O   . HOH E 3 .   ? -11.309 28.838 5.156   0.39 19.94 ? 617 HOH A O   1 
HETATM 3831 O  O   . HOH E 3 .   ? 12.647  11.075 -2.619  0.39 15.98 ? 618 HOH A O   1 
HETATM 3832 O  O   . HOH E 3 .   ? 22.105  24.649 -3.281  0.39 31.12 ? 619 HOH A O   1 
HETATM 3833 O  O   . HOH E 3 .   ? 24.198  30.539 19.711  0.39 24.72 ? 620 HOH A O   1 
HETATM 3834 O  O   . HOH E 3 .   ? 22.276  12.761 10.350  0.39 24.32 ? 621 HOH A O   1 
HETATM 3835 O  O   . HOH E 3 .   ? 0.643   49.674 14.135  0.39 27.47 ? 622 HOH A O   1 
HETATM 3836 O  O   . HOH E 3 .   ? -12.454 36.525 6.196   0.39 19.38 ? 623 HOH A O   1 
HETATM 3837 O  O   . HOH E 3 .   ? 19.478  18.209 19.841  0.39 26.33 ? 624 HOH A O   1 
HETATM 3838 O  O   . HOH E 3 .   ? -3.929  9.850  10.710  0.39 24.45 ? 625 HOH A O   1 
HETATM 3839 O  O   . HOH E 3 .   ? 8.025   6.448  5.339   0.39 20.54 ? 626 HOH A O   1 
HETATM 3840 O  O   . HOH E 3 .   ? 7.130   46.427 24.387  0.39 27.19 ? 627 HOH A O   1 
HETATM 3841 O  O   . HOH E 3 .   ? 13.442  7.340  13.957  0.39 25.79 ? 628 HOH A O   1 
HETATM 3842 O  O   . HOH E 3 .   ? -5.976  11.532 11.533  0.39 21.41 ? 629 HOH A O   1 
HETATM 3843 O  O   . HOH E 3 .   ? 9.721   49.057 2.610   0.39 23.33 ? 630 HOH A O   1 
HETATM 3844 O  O   . HOH E 3 .   ? 21.825  38.242 -10.643 0.39 28.20 ? 631 HOH A O   1 
HETATM 3845 O  O   . HOH E 3 .   ? -11.499 19.764 13.393  0.39 17.11 ? 632 HOH A O   1 
HETATM 3846 O  O   . HOH E 3 .   ? 10.702  7.733  3.667   0.39 23.04 ? 633 HOH A O   1 
HETATM 3847 O  O   . HOH E 3 .   ? -12.742 23.533 20.775  0.39 20.28 ? 634 HOH A O   1 
HETATM 3848 O  O   . HOH E 3 .   ? 27.100  28.518 11.493  0.39 24.75 ? 635 HOH A O   1 
HETATM 3849 O  O   . HOH E 3 .   ? 22.672  45.110 8.915   0.80 31.61 ? 636 HOH A O   1 
HETATM 3850 O  O   . HOH E 3 .   ? -7.739  51.505 16.986  0.39 19.59 ? 637 HOH A O   1 
HETATM 3851 O  O   . HOH E 3 .   ? 20.988  12.126 12.458  0.70 32.17 ? 638 HOH A O   1 
HETATM 3852 O  O   . HOH E 3 .   ? 12.083  44.312 22.516  0.39 22.52 ? 639 HOH A O   1 
HETATM 3853 O  O   . HOH E 3 .   ? 30.506  29.108 2.978   0.39 28.97 ? 640 HOH A O   1 
HETATM 3854 O  O   . HOH E 3 .   ? -0.242  5.547  6.714   0.39 24.04 ? 641 HOH A O   1 
HETATM 3855 O  O   . HOH E 3 .   ? 29.639  31.871 8.192   0.39 21.56 ? 642 HOH A O   1 
HETATM 3856 O  O   . HOH E 3 .   ? -8.494  10.291 11.569  0.39 18.70 ? 643 HOH A O   1 
HETATM 3857 O  O   . HOH E 3 .   ? -17.299 37.230 24.008  0.39 22.12 ? 644 HOH A O   1 
HETATM 3858 O  O   . HOH E 3 .   ? -18.755 36.721 16.221  0.39 29.66 ? 645 HOH A O   1 
HETATM 3859 O  O   . HOH E 3 .   ? 18.893  37.543 15.553  0.39 28.49 ? 646 HOH A O   1 
HETATM 3860 O  O   . HOH E 3 .   ? -1.706  40.031 29.956  0.80 35.55 ? 647 HOH A O   1 
HETATM 3861 O  O   . HOH E 3 .   ? 24.926  29.443 17.786  0.39 23.51 ? 648 HOH A O   1 
HETATM 3862 O  O   . HOH E 3 .   ? 16.107  41.260 20.097  0.60 30.82 ? 649 HOH A O   1 
HETATM 3863 O  O   . HOH E 3 .   ? 18.937  17.608 -0.676  0.39 17.67 ? 650 HOH A O   1 
HETATM 3864 O  O   . HOH E 3 .   ? -9.619  12.765 11.460  0.60 28.00 ? 651 HOH A O   1 
HETATM 3865 O  O   . HOH E 3 .   ? 15.345  48.362 10.844  0.60 27.01 ? 652 HOH A O   1 
HETATM 3866 O  O   . HOH E 3 .   ? 27.386  42.562 -1.233  0.90 10.66 ? 653 HOH A O   1 
HETATM 3867 O  O   . HOH E 3 .   ? 26.220  44.928 -0.228  0.80 15.58 ? 654 HOH A O   1 
HETATM 3868 O  O   . HOH E 3 .   ? 26.725  43.836 -1.298  0.80 18.79 ? 655 HOH A O   1 
HETATM 3869 O  O   . HOH E 3 .   ? 12.638  17.441 -4.328  0.90 17.05 ? 656 HOH A O   1 
HETATM 3870 O  O   . HOH E 3 .   ? -9.346  38.081 8.965   0.80 21.75 ? 657 HOH A O   1 
HETATM 3871 O  O   . HOH E 3 .   ? -11.301 37.440 13.048  0.39 15.44 ? 658 HOH A O   1 
HETATM 3872 O  O   . HOH E 3 .   ? 11.573  38.797 -8.856  0.40 11.56 ? 659 HOH A O   1 
HETATM 3873 O  O   B HOH E 3 .   ? 21.106  22.329 7.931   0.50 15.07 ? 660 HOH A O   1 
HETATM 3874 O  O   . HOH E 3 .   ? 26.255  26.960 -3.472  0.38 14.58 ? 661 HOH A O   1 
HETATM 3875 O  O   . HOH E 3 .   ? 10.793  8.406  7.860   0.38 18.33 ? 662 HOH A O   1 
HETATM 3876 O  O   . HOH E 3 .   ? 1.268   7.681  11.624  0.38 14.45 ? 663 HOH A O   1 
HETATM 3877 O  O   . HOH E 3 .   ? 8.397   48.846 11.138  0.38 18.91 ? 664 HOH A O   1 
HETATM 3878 O  O   . HOH E 3 .   ? 17.344  48.168 9.615   0.38 26.00 ? 665 HOH A O   1 
HETATM 3879 O  O   . HOH E 3 .   ? 0.921   38.590 29.765  0.38 16.50 ? 666 HOH A O   1 
HETATM 3880 O  O   . HOH E 3 .   ? 19.998  37.154 -11.128 0.38 19.82 ? 667 HOH A O   1 
HETATM 3881 O  O   . HOH E 3 .   ? 24.255  25.143 17.326  0.38 17.52 ? 668 HOH A O   1 
HETATM 3882 O  O   . HOH E 3 .   ? 7.796   49.779 4.117   0.38 21.57 ? 669 HOH A O   1 
HETATM 3883 O  O   . HOH E 3 .   ? 24.028  19.092 13.269  0.38 20.47 ? 670 HOH A O   1 
HETATM 3884 O  O   . HOH E 3 .   ? 10.827  46.868 1.322   0.38 18.07 ? 671 HOH A O   1 
HETATM 3885 O  O   . HOH E 3 .   ? 27.101  38.985 7.030   0.38 21.17 ? 672 HOH A O   1 
HETATM 3886 O  O   . HOH E 3 .   ? 24.930  21.983 12.649  0.38 21.90 ? 673 HOH A O   1 
HETATM 3887 O  O   . HOH E 3 .   ? 13.612  9.129  10.140  0.38 24.05 ? 674 HOH A O   1 
HETATM 3888 O  O   . HOH E 3 .   ? 28.149  36.007 10.196  0.38 23.24 ? 675 HOH A O   1 
HETATM 3889 O  O   . HOH E 3 .   ? -11.548 34.784 7.777   0.38 29.93 ? 676 HOH A O   1 
HETATM 3890 O  O   . HOH E 3 .   ? 15.837  33.583 24.181  0.38 15.96 ? 677 HOH A O   1 
HETATM 3891 O  O   . HOH E 3 .   ? 22.810  23.954 3.432   0.38 16.02 ? 678 HOH A O   1 
HETATM 3892 O  O   . HOH E 3 .   ? 13.571  10.647 6.104   0.38 17.76 ? 679 HOH A O   1 
HETATM 3893 O  O   . HOH E 3 .   ? -0.091  11.459 15.660  0.38 14.79 ? 680 HOH A O   1 
HETATM 3894 O  O   . HOH E 3 .   ? -0.767  52.784 22.426  0.38 25.02 ? 681 HOH A O   1 
HETATM 3895 O  O   . HOH E 3 .   ? -6.152  16.874 20.323  0.38 22.97 ? 682 HOH A O   1 
HETATM 3896 O  O   A HOH E 3 .   ? 24.198  25.741 6.714   0.38 17.67 ? 683 HOH A O   1 
HETATM 3897 O  O   . HOH F 3 .   ? -6.949  25.417 29.313  1.00 12.42 ? 207 HOH B O   1 
HETATM 3898 O  O   . HOH F 3 .   ? 20.339  23.965 22.986  1.00 14.76 ? 208 HOH B O   1 
HETATM 3899 O  O   . HOH F 3 .   ? -3.243  24.975 23.697  0.90 13.42 ? 209 HOH B O   1 
HETATM 3900 O  O   . HOH F 3 .   ? 21.979  23.904 20.819  1.00 17.51 ? 210 HOH B O   1 
HETATM 3901 O  O   . HOH F 3 .   ? 28.426  18.520 39.654  1.00 27.71 ? 211 HOH B O   1 
HETATM 3902 O  O   . HOH F 3 .   ? 6.059   -2.372 30.335  0.70 37.60 ? 212 HOH B O   1 
HETATM 3903 O  O   . HOH F 3 .   ? 11.674  5.618  46.112  0.80 33.99 ? 213 HOH B O   1 
HETATM 3904 O  O   . HOH F 3 .   ? 22.767  25.296 49.476  0.39 21.53 ? 214 HOH B O   1 
HETATM 3905 O  O   . HOH F 3 .   ? 7.770   24.563 60.505  0.39 20.73 ? 215 HOH B O   1 
HETATM 3906 O  O   . HOH F 3 .   ? -6.149  25.803 57.312  0.39 29.86 ? 216 HOH B O   1 
HETATM 3907 O  O   . HOH F 3 .   ? 32.034  40.813 30.889  0.38 23.80 ? 217 HOH B O   1 
HETATM 3908 O  O   . HOH F 3 .   ? 5.651   5.164  32.972  1.00 11.29 ? 218 HOH B O   1 
HETATM 3909 O  O   . HOH F 3 .   ? 7.652   23.743 21.681  1.00 6.93  ? 219 HOH B O   1 
HETATM 3910 O  O   . HOH F 3 .   ? 1.674   9.164  43.920  1.00 9.97  ? 220 HOH B O   1 
HETATM 3911 O  O   . HOH F 3 .   ? 0.314   11.516 43.309  1.00 9.80  ? 221 HOH B O   1 
HETATM 3912 O  O   . HOH F 3 .   ? 1.918   26.979 24.323  1.00 7.36  ? 222 HOH B O   1 
HETATM 3913 O  O   . HOH F 3 .   ? 7.246   15.701 44.103  1.00 9.64  ? 223 HOH B O   1 
HETATM 3914 O  O   . HOH F 3 .   ? 16.717  10.128 39.739  1.00 12.86 ? 224 HOH B O   1 
HETATM 3915 O  O   . HOH F 3 .   ? 5.027   23.657 25.606  1.00 7.79  ? 225 HOH B O   1 
HETATM 3916 O  O   . HOH F 3 .   ? 15.925  28.620 30.264  1.00 8.03  ? 226 HOH B O   1 
HETATM 3917 O  O   . HOH F 3 .   ? 13.104  0.809  32.426  1.00 22.92 ? 227 HOH B O   1 
HETATM 3918 O  O   . HOH F 3 .   ? 11.181  32.335 33.261  1.00 8.58  ? 228 HOH B O   1 
HETATM 3919 O  O   . HOH F 3 .   ? 17.160  12.780 39.134  1.00 12.23 ? 229 HOH B O   1 
HETATM 3920 O  O   . HOH F 3 .   ? 17.407  19.289 44.735  0.90 15.14 ? 230 HOH B O   1 
HETATM 3921 O  O   . HOH F 3 .   ? 7.352   30.201 27.889  1.00 8.91  ? 231 HOH B O   1 
HETATM 3922 O  O   . HOH F 3 .   ? 3.365   11.849 26.064  1.00 9.76  ? 232 HOH B O   1 
HETATM 3923 O  O   . HOH F 3 .   ? -2.296  24.667 28.134  1.00 8.82  ? 233 HOH B O   1 
HETATM 3924 O  O   . HOH F 3 .   ? 11.118  32.153 25.324  1.00 8.40  ? 234 HOH B O   1 
HETATM 3925 O  O   . HOH F 3 .   ? 21.237  15.043 38.839  1.00 13.77 ? 235 HOH B O   1 
HETATM 3926 O  O   . HOH F 3 .   ? 12.072  16.095 43.484  1.00 11.05 ? 236 HOH B O   1 
HETATM 3927 O  O   . HOH F 3 .   ? 9.650   17.069 44.365  1.00 12.21 ? 237 HOH B O   1 
HETATM 3928 O  O   . HOH F 3 .   ? 14.072  31.771 29.436  1.00 9.14  ? 238 HOH B O   1 
HETATM 3929 O  O   . HOH F 3 .   ? 16.633  21.931 44.337  1.00 12.03 ? 239 HOH B O   1 
HETATM 3930 O  O   . HOH F 3 .   ? -2.058  14.486 43.715  1.00 11.78 ? 240 HOH B O   1 
HETATM 3931 O  O   . HOH F 3 .   ? 4.564   4.251  25.655  1.00 11.21 ? 241 HOH B O   1 
HETATM 3932 O  O   . HOH F 3 .   ? -1.641  11.181 45.230  1.00 11.65 ? 242 HOH B O   1 
HETATM 3933 O  O   . HOH F 3 .   ? 19.484  13.628 40.446  0.90 12.71 ? 243 HOH B O   1 
HETATM 3934 O  O   . HOH F 3 .   ? 2.652   24.319 24.297  1.00 8.56  ? 244 HOH B O   1 
HETATM 3935 O  O   . HOH F 3 .   ? 15.086  23.881 39.785  1.00 11.03 ? 245 HOH B O   1 
HETATM 3936 O  O   . HOH F 3 .   ? 4.625   1.701  39.410  0.90 27.88 ? 246 HOH B O   1 
HETATM 3937 O  O   . HOH F 3 .   ? 14.636  31.630 44.870  1.00 15.55 ? 247 HOH B O   1 
HETATM 3938 O  O   . HOH F 3 .   ? 17.531  19.524 40.889  1.00 13.34 ? 248 HOH B O   1 
HETATM 3939 O  O   . HOH F 3 .   ? -1.281  24.511 25.583  1.00 8.92  ? 249 HOH B O   1 
HETATM 3940 O  O   . HOH F 3 .   ? 10.389  8.175  42.791  1.00 15.67 ? 250 HOH B O   1 
HETATM 3941 O  O   . HOH F 3 .   ? 7.426   16.959 40.673  0.90 11.17 ? 251 HOH B O   1 
HETATM 3942 O  O   . HOH F 3 .   ? 6.081   4.821  40.604  1.00 26.89 ? 252 HOH B O   1 
HETATM 3943 O  O   . HOH F 3 .   ? 5.863   12.842 24.462  1.00 10.88 ? 253 HOH B O   1 
HETATM 3944 O  O   . HOH F 3 .   ? 32.537  20.358 32.317  1.00 11.14 ? 254 HOH B O   1 
HETATM 3945 O  O   . HOH F 3 .   ? 13.882  22.409 58.434  0.39 24.82 ? 255 HOH B O   1 
HETATM 3946 O  O   . HOH F 3 .   ? 10.173  2.854  27.531  0.90 17.19 ? 256 HOH B O   1 
HETATM 3947 O  O   . HOH F 3 .   ? 15.959  22.374 24.859  1.00 10.58 ? 257 HOH B O   1 
HETATM 3948 O  O   . HOH F 3 .   ? 16.829  17.392 42.618  0.90 27.51 ? 258 HOH B O   1 
HETATM 3949 O  O   . HOH F 3 .   ? 27.981  23.163 38.442  1.00 10.19 ? 259 HOH B O   1 
HETATM 3950 O  O   . HOH F 3 .   ? -3.004  12.684 47.121  1.00 11.09 ? 260 HOH B O   1 
HETATM 3951 O  O   . HOH F 3 .   ? 25.181  15.576 37.419  1.00 13.11 ? 261 HOH B O   1 
HETATM 3952 O  O   . HOH F 3 .   ? 23.322  13.565 37.845  1.00 16.76 ? 262 HOH B O   1 
HETATM 3953 O  O   . HOH F 3 .   ? 3.722   6.424  24.150  1.00 12.35 ? 263 HOH B O   1 
HETATM 3954 O  O   . HOH F 3 .   ? -0.391  6.961  42.264  1.00 14.66 ? 264 HOH B O   1 
HETATM 3955 O  O   . HOH F 3 .   ? 20.775  22.106 24.956  0.90 12.20 ? 265 HOH B O   1 
HETATM 3956 O  O   . HOH F 3 .   ? 3.907   16.072 55.102  1.00 12.24 ? 266 HOH B O   1 
HETATM 3957 O  O   . HOH F 3 .   ? 2.296   9.012  50.711  1.00 12.45 ? 267 HOH B O   1 
HETATM 3958 O  O   . HOH F 3 .   ? 12.461  11.138 45.243  0.40 11.97 ? 268 HOH B O   1 
HETATM 3959 O  O   . HOH F 3 .   ? -9.658  21.775 42.261  1.00 10.71 ? 269 HOH B O   1 
HETATM 3960 O  O   . HOH F 3 .   ? 8.311   12.368 30.965  1.00 11.53 ? 270 HOH B O   1 
HETATM 3961 O  O   . HOH F 3 .   ? 18.351  21.072 24.367  1.00 10.16 ? 271 HOH B O   1 
HETATM 3962 O  O   . HOH F 3 .   ? 16.712  22.272 41.387  1.00 13.46 ? 272 HOH B O   1 
HETATM 3963 O  O   . HOH F 3 .   ? -6.373  14.109 38.291  1.00 10.45 ? 273 HOH B O   1 
HETATM 3964 O  O   . HOH F 3 .   ? 15.075  15.380 49.598  0.90 33.72 ? 274 HOH B O   1 
HETATM 3965 O  O   . HOH F 3 .   ? 10.000  0.596  38.698  1.00 17.75 ? 275 HOH B O   1 
HETATM 3966 O  O   . HOH F 3 .   ? 22.235  25.478 24.497  1.00 11.89 ? 276 HOH B O   1 
HETATM 3967 O  O   . HOH F 3 .   ? 21.513  9.016  27.159  1.00 12.75 ? 277 HOH B O   1 
HETATM 3968 O  O   . HOH F 3 .   ? 17.441  36.420 39.590  1.00 12.28 ? 278 HOH B O   1 
HETATM 3969 O  O   . HOH F 3 .   ? 21.435  28.092 25.026  1.00 11.72 ? 279 HOH B O   1 
HETATM 3970 O  O   . HOH F 3 .   ? 0.333   31.082 44.852  1.00 12.10 ? 280 HOH B O   1 
HETATM 3971 O  O   . HOH F 3 .   ? -5.893  20.469 33.922  1.00 10.98 ? 281 HOH B O   1 
HETATM 3972 O  O   . HOH F 3 .   ? -0.585  27.162 25.389  1.00 10.09 ? 282 HOH B O   1 
HETATM 3973 O  O   . HOH F 3 .   ? 1.172   23.486 22.003  1.00 12.83 ? 283 HOH B O   1 
HETATM 3974 O  O   . HOH F 3 .   ? 10.035  9.261  47.507  1.00 14.13 ? 284 HOH B O   1 
HETATM 3975 O  O   . HOH F 3 .   ? 6.370   17.649 55.215  1.00 13.12 ? 285 HOH B O   1 
HETATM 3976 O  O   . HOH F 3 .   ? 24.883  18.218 39.787  1.00 18.98 ? 286 HOH B O   1 
HETATM 3977 O  O   . HOH F 3 .   ? 1.693   30.329 34.092  1.00 12.04 ? 287 HOH B O   1 
HETATM 3978 O  O   . HOH F 3 .   ? 8.030   -0.647 36.974  0.90 24.85 ? 288 HOH B O   1 
HETATM 3979 O  O   . HOH F 3 .   ? 10.017  0.509  29.065  1.00 28.26 ? 289 HOH B O   1 
HETATM 3980 O  O   . HOH F 3 .   ? 2.336   3.569  27.025  1.00 13.64 ? 290 HOH B O   1 
HETATM 3981 O  O   . HOH F 3 .   ? -4.949  24.960 27.502  1.00 12.90 ? 291 HOH B O   1 
HETATM 3982 O  O   . HOH F 3 .   ? 30.732  20.165 34.351  1.00 11.85 ? 292 HOH B O   1 
HETATM 3983 O  O   . HOH F 3 .   ? 13.285  34.202 28.389  1.00 13.30 ? 293 HOH B O   1 
HETATM 3984 O  O   . HOH F 3 .   ? 27.108  24.123 25.238  1.00 13.50 ? 294 HOH B O   1 
HETATM 3985 O  O   . HOH F 3 .   ? -2.289  2.038  38.981  0.80 20.92 ? 295 HOH B O   1 
HETATM 3986 O  O   . HOH F 3 .   ? 7.587   34.422 42.489  1.00 16.63 ? 296 HOH B O   1 
HETATM 3987 O  O   . HOH F 3 .   ? 33.926  25.617 28.273  1.00 11.42 ? 297 HOH B O   1 
HETATM 3988 O  O   . HOH F 3 .   ? 8.025   12.134 53.186  1.00 13.01 ? 298 HOH B O   1 
HETATM 3989 O  O   . HOH F 3 .   ? 2.947   32.460 29.446  1.00 14.91 ? 299 HOH B O   1 
HETATM 3990 O  O   . HOH F 3 .   ? 25.869  32.139 27.020  1.00 14.55 ? 300 HOH B O   1 
HETATM 3991 O  O   . HOH F 3 .   ? -0.166  22.287 24.390  1.00 12.61 ? 301 HOH B O   1 
HETATM 3992 O  O   . HOH F 3 .   ? 29.316  38.173 36.639  1.00 13.39 ? 302 HOH B O   1 
HETATM 3993 O  O   . HOH F 3 .   ? 0.263   5.936  29.300  1.00 13.67 ? 303 HOH B O   1 
HETATM 3994 O  O   . HOH F 3 .   ? -1.484  31.241 27.820  1.00 12.98 ? 304 HOH B O   1 
HETATM 3995 O  O   . HOH F 3 .   ? 21.376  6.387  27.883  0.90 27.26 ? 305 HOH B O   1 
HETATM 3996 O  O   . HOH F 3 .   ? 25.784  11.427 31.287  0.90 14.70 ? 306 HOH B O   1 
HETATM 3997 O  O   . HOH F 3 .   ? -0.490  28.653 27.647  1.00 11.68 ? 307 HOH B O   1 
HETATM 3998 O  O   . HOH F 3 .   ? 23.565  17.754 42.146  0.39 28.11 ? 308 HOH B O   1 
HETATM 3999 O  O   . HOH F 3 .   ? 18.251  23.399 45.969  1.00 20.79 ? 309 HOH B O   1 
HETATM 4000 O  O   . HOH F 3 .   ? 0.441   31.474 47.609  1.00 17.14 ? 310 HOH B O   1 
HETATM 4001 O  O   . HOH F 3 .   ? -7.662  26.763 55.503  1.00 22.17 ? 311 HOH B O   1 
HETATM 4002 O  O   . HOH F 3 .   ? 20.105  25.208 45.468  1.00 19.53 ? 312 HOH B O   1 
HETATM 4003 O  O   . HOH F 3 .   ? 2.848   18.145 23.238  0.90 11.40 ? 313 HOH B O   1 
HETATM 4004 O  O   . HOH F 3 .   ? -5.154  13.776 50.753  0.80 21.30 ? 314 HOH B O   1 
HETATM 4005 O  O   . HOH F 3 .   ? 17.110  9.358  42.335  1.00 22.42 ? 315 HOH B O   1 
HETATM 4006 O  O   . HOH F 3 .   ? 14.903  36.624 43.797  1.00 18.54 ? 316 HOH B O   1 
HETATM 4007 O  O   . HOH F 3 .   ? 16.526  31.587 28.165  1.00 15.72 ? 317 HOH B O   1 
HETATM 4008 O  O   . HOH F 3 .   ? 18.718  31.570 24.789  1.00 15.17 ? 318 HOH B O   1 
HETATM 4009 O  O   . HOH F 3 .   ? 25.570  34.768 28.054  1.00 15.07 ? 319 HOH B O   1 
HETATM 4010 O  O   . HOH F 3 .   ? 0.943   6.837  24.492  1.00 23.78 ? 320 HOH B O   1 
HETATM 4011 O  O   . HOH F 3 .   ? 10.460  5.372  42.979  1.00 23.32 ? 321 HOH B O   1 
HETATM 4012 O  O   . HOH F 3 .   ? 20.277  8.676  40.370  1.00 20.84 ? 322 HOH B O   1 
HETATM 4013 O  O   . HOH F 3 .   ? 24.814  24.815 23.703  1.00 15.04 ? 323 HOH B O   1 
HETATM 4014 O  O   . HOH F 3 .   ? -4.179  23.712 57.823  1.00 23.69 ? 324 HOH B O   1 
HETATM 4015 O  O   . HOH F 3 .   ? 3.583   11.605 29.546  1.00 18.04 ? 325 HOH B O   1 
HETATM 4016 O  O   . HOH F 3 .   ? 21.206  32.471 39.722  1.00 16.50 ? 326 HOH B O   1 
HETATM 4017 O  O   . HOH F 3 .   ? -2.040  31.752 48.463  1.00 19.66 ? 327 HOH B O   1 
HETATM 4018 O  O   . HOH F 3 .   ? 7.161   18.321 57.860  1.00 15.09 ? 328 HOH B O   1 
HETATM 4019 O  O   . HOH F 3 .   ? 8.274   33.461 35.759  0.90 23.55 ? 329 HOH B O   1 
HETATM 4020 O  O   . HOH F 3 .   ? -2.685  17.038 57.379  1.00 17.49 ? 330 HOH B O   1 
HETATM 4021 O  O   . HOH F 3 .   ? 20.418  35.294 31.906  1.00 16.24 ? 331 HOH B O   1 
HETATM 4022 O  O   . HOH F 3 .   ? 14.647  19.566 25.444  1.00 15.11 ? 332 HOH B O   1 
HETATM 4023 O  O   . HOH F 3 .   ? -4.665  7.248  33.391  1.00 26.29 ? 333 HOH B O   1 
HETATM 4024 O  O   . HOH F 3 .   ? 15.980  27.921 47.964  0.39 17.40 ? 334 HOH B O   1 
HETATM 4025 O  O   . HOH F 3 .   ? -2.539  30.092 39.048  1.00 18.27 ? 335 HOH B O   1 
HETATM 4026 O  O   . HOH F 3 .   ? 15.372  34.157 45.309  0.39 24.52 ? 336 HOH B O   1 
HETATM 4027 O  O   . HOH F 3 .   ? -4.605  15.013 46.665  1.00 21.92 ? 337 HOH B O   1 
HETATM 4028 O  O   . HOH F 3 .   ? 10.447  34.657 32.018  1.00 20.70 ? 338 HOH B O   1 
HETATM 4029 O  O   . HOH F 3 .   ? 29.895  17.645 26.720  1.00 17.40 ? 339 HOH B O   1 
HETATM 4030 O  O   . HOH F 3 .   ? 5.417   2.191  24.075  1.00 20.79 ? 340 HOH B O   1 
HETATM 4031 O  O   . HOH F 3 .   ? 2.058   22.127 58.326  1.00 18.36 ? 341 HOH B O   1 
HETATM 4032 O  O   . HOH F 3 .   ? 12.229  29.180 50.934  0.39 23.09 ? 342 HOH B O   1 
HETATM 4033 O  O   . HOH F 3 .   ? 18.491  5.078  40.582  0.80 26.65 ? 343 HOH B O   1 
HETATM 4034 O  O   . HOH F 3 .   ? 28.293  14.882 29.175  0.90 18.28 ? 344 HOH B O   1 
HETATM 4035 O  O   . HOH F 3 .   ? 4.469   32.700 37.854  1.00 20.98 ? 345 HOH B O   1 
HETATM 4036 O  O   . HOH F 3 .   ? -0.802  2.261  29.870  1.00 16.69 ? 346 HOH B O   1 
HETATM 4037 O  O   . HOH F 3 .   ? 33.231  34.309 36.871  1.00 20.11 ? 347 HOH B O   1 
HETATM 4038 O  O   . HOH F 3 .   ? -5.053  18.182 56.790  1.00 19.39 ? 348 HOH B O   1 
HETATM 4039 O  O   . HOH F 3 .   ? 21.115  11.092 23.878  1.00 21.64 ? 349 HOH B O   1 
HETATM 4040 O  O   . HOH F 3 .   ? -8.943  18.220 30.231  0.90 17.99 ? 350 HOH B O   1 
HETATM 4041 O  O   . HOH F 3 .   ? 12.337  34.466 25.797  0.90 15.28 ? 351 HOH B O   1 
HETATM 4042 O  O   . HOH F 3 .   ? -9.988  20.452 48.964  0.90 14.27 ? 352 HOH B O   1 
HETATM 4043 O  O   . HOH F 3 .   ? -0.927  31.455 54.933  0.39 26.04 ? 353 HOH B O   1 
HETATM 4044 O  O   . HOH F 3 .   ? -5.360  15.605 49.324  0.80 29.70 ? 354 HOH B O   1 
HETATM 4045 O  O   . HOH F 3 .   ? 16.109  38.930 41.854  0.90 29.61 ? 355 HOH B O   1 
HETATM 4046 O  O   . HOH F 3 .   ? 24.354  8.639  29.996  1.00 27.50 ? 356 HOH B O   1 
HETATM 4047 O  O   . HOH F 3 .   ? 2.353   32.370 32.248  1.00 21.36 ? 357 HOH B O   1 
HETATM 4048 O  O   . HOH F 3 .   ? -8.351  20.519 51.716  1.00 16.28 ? 358 HOH B O   1 
HETATM 4049 O  O   . HOH F 3 .   ? 27.708  22.214 23.307  1.00 20.11 ? 359 HOH B O   1 
HETATM 4050 O  O   . HOH F 3 .   ? 4.736   32.901 48.958  0.39 14.26 ? 360 HOH B O   1 
HETATM 4051 O  O   . HOH F 3 .   ? 25.792  38.319 29.800  0.80 32.50 ? 361 HOH B O   1 
HETATM 4052 O  O   . HOH F 3 .   ? 5.987   13.680 31.083  1.00 21.61 ? 362 HOH B O   1 
HETATM 4053 O  O   . HOH F 3 .   ? 25.513  11.435 25.248  1.00 20.97 ? 363 HOH B O   1 
HETATM 4054 O  O   . HOH F 3 .   ? 28.925  26.188 25.053  1.00 21.55 ? 364 HOH B O   1 
HETATM 4055 O  O   A HOH F 3 .   ? 2.348   30.901 55.219  0.39 22.96 ? 365 HOH B O   1 
HETATM 4056 O  O   . HOH F 3 .   ? -7.239  10.129 34.165  0.90 14.97 ? 366 HOH B O   1 
HETATM 4057 O  O   . HOH F 3 .   ? -1.301  7.412  44.803  0.90 14.03 ? 367 HOH B O   1 
HETATM 4058 O  O   . HOH F 3 .   ? 15.356  30.139 47.138  0.39 22.00 ? 368 HOH B O   1 
HETATM 4059 O  O   . HOH F 3 .   ? 0.309   24.572 58.456  0.90 27.74 ? 369 HOH B O   1 
HETATM 4060 O  O   . HOH F 3 .   ? 17.667  34.138 28.195  1.00 16.79 ? 370 HOH B O   1 
HETATM 4061 O  O   . HOH F 3 .   ? 4.803   33.130 27.105  1.00 24.25 ? 371 HOH B O   1 
HETATM 4062 O  O   . HOH F 3 .   ? 25.169  16.058 22.934  1.00 22.61 ? 372 HOH B O   1 
HETATM 4063 O  O   . HOH F 3 .   ? 1.946   32.899 43.248  0.80 20.75 ? 373 HOH B O   1 
HETATM 4064 O  O   . HOH F 3 .   ? 23.196  19.577 21.266  1.00 20.02 ? 374 HOH B O   1 
HETATM 4065 O  O   . HOH F 3 .   ? 12.492  36.371 33.309  1.00 27.25 ? 375 HOH B O   1 
HETATM 4066 O  O   . HOH F 3 .   ? 2.383   33.752 47.891  1.00 28.94 ? 376 HOH B O   1 
HETATM 4067 O  O   . HOH F 3 .   ? 6.299   34.645 40.042  0.39 16.88 ? 377 HOH B O   1 
HETATM 4068 O  O   . HOH F 3 .   ? 24.592  23.414 21.413  0.90 21.41 ? 378 HOH B O   1 
HETATM 4069 O  O   . HOH F 3 .   ? 15.466  35.901 28.439  1.00 19.75 ? 379 HOH B O   1 
HETATM 4070 O  O   . HOH F 3 .   ? -7.654  28.343 43.304  0.80 16.52 ? 380 HOH B O   1 
HETATM 4071 O  O   . HOH F 3 .   ? 10.911  35.214 29.386  0.80 14.91 ? 381 HOH B O   1 
HETATM 4072 O  O   . HOH F 3 .   ? 18.262  34.161 25.509  0.90 17.94 ? 382 HOH B O   1 
HETATM 4073 O  O   . HOH F 3 .   ? -2.151  31.208 36.474  0.90 23.15 ? 383 HOH B O   1 
HETATM 4074 O  O   . HOH F 3 .   ? 20.106  35.102 29.203  0.90 20.22 ? 384 HOH B O   1 
HETATM 4075 O  O   . HOH F 3 .   ? -5.970  22.154 57.629  0.90 36.06 ? 385 HOH B O   1 
HETATM 4076 O  O   . HOH F 3 .   ? -5.140  10.999 47.413  0.90 21.67 ? 386 HOH B O   1 
HETATM 4077 O  O   . HOH F 3 .   ? -2.223  5.817  40.520  0.90 21.16 ? 387 HOH B O   1 
HETATM 4078 O  O   . HOH F 3 .   ? 3.443   34.394 45.004  0.90 25.47 ? 388 HOH B O   1 
HETATM 4079 O  O   . HOH F 3 .   ? 23.276  29.929 24.392  1.00 25.80 ? 389 HOH B O   1 
HETATM 4080 O  O   . HOH F 3 .   ? -3.572  31.449 46.352  0.90 24.05 ? 390 HOH B O   1 
HETATM 4081 O  O   . HOH F 3 .   ? -6.384  19.409 20.525  0.90 23.25 ? 391 HOH B O   1 
HETATM 4082 O  O   . HOH F 3 .   ? -2.912  14.284 57.027  1.00 21.92 ? 392 HOH B O   1 
HETATM 4083 O  O   . HOH F 3 .   ? -11.118 26.282 53.782  0.90 21.09 ? 393 HOH B O   1 
HETATM 4084 O  O   . HOH F 3 .   ? 13.825  31.338 49.015  0.39 20.91 ? 394 HOH B O   1 
HETATM 4085 O  O   . HOH F 3 .   ? 18.855  31.809 44.508  1.00 22.89 ? 395 HOH B O   1 
HETATM 4086 O  O   . HOH F 3 .   ? -0.522  31.159 40.821  0.39 17.53 ? 396 HOH B O   1 
HETATM 4087 O  O   . HOH F 3 .   ? 11.437  34.830 47.291  1.00 29.51 ? 397 HOH B O   1 
HETATM 4088 O  O   . HOH F 3 .   ? 0.359   31.805 35.955  0.90 21.12 ? 398 HOH B O   1 
HETATM 4089 O  O   . HOH F 3 .   ? -10.226 14.822 30.364  0.38 23.45 ? 399 HOH B O   1 
HETATM 4090 O  O   . HOH F 3 .   ? -3.106  8.752  23.696  0.39 21.92 ? 400 HOH B O   1 
HETATM 4091 O  O   A HOH F 3 .   ? -7.379  29.586 40.699  0.60 19.84 ? 401 HOH B O   1 
HETATM 4092 O  O   . HOH F 3 .   ? -9.165  17.055 43.999  1.00 22.07 ? 402 HOH B O   1 
HETATM 4093 O  O   . HOH F 3 .   ? 7.169   37.739 40.803  0.90 33.68 ? 403 HOH B O   1 
HETATM 4094 O  O   . HOH F 3 .   ? 33.698  23.645 40.247  1.00 9.64  ? 404 HOH B O   1 
HETATM 4095 O  O   . HOH F 3 .   ? -0.889  0.261  31.544  0.90 28.70 ? 405 HOH B O   1 
HETATM 4096 O  O   . HOH F 3 .   ? -6.329  11.607 50.065  0.39 22.00 ? 406 HOH B O   1 
HETATM 4097 O  O   . HOH F 3 .   ? 34.229  32.913 29.690  0.90 26.54 ? 407 HOH B O   1 
HETATM 4098 O  O   A HOH F 3 .   ? -0.298  6.275  49.044  0.80 16.89 ? 408 HOH B O   1 
HETATM 4099 O  O   . HOH F 3 .   ? 17.213  5.937  24.216  0.90 25.50 ? 409 HOH B O   1 
HETATM 4100 O  O   . HOH F 3 .   ? 7.379   34.314 30.260  0.39 16.98 ? 410 HOH B O   1 
HETATM 4101 O  O   . HOH F 3 .   ? 8.683   2.196  25.092  0.90 23.43 ? 411 HOH B O   1 
HETATM 4102 O  O   . HOH F 3 .   ? 9.459   39.071 38.805  0.39 24.55 ? 412 HOH B O   1 
HETATM 4103 O  O   . HOH F 3 .   ? -5.370  14.853 20.662  0.39 18.12 ? 413 HOH B O   1 
HETATM 4104 O  O   . HOH F 3 .   ? -8.197  18.418 39.432  1.00 10.61 ? 414 HOH B O   1 
HETATM 4105 O  O   . HOH F 3 .   ? -8.707  18.484 55.513  0.90 23.69 ? 415 HOH B O   1 
HETATM 4106 O  O   . HOH F 3 .   ? -4.267  7.666  31.063  1.00 28.34 ? 416 HOH B O   1 
HETATM 4107 O  O   . HOH F 3 .   ? -5.800  29.542 46.797  1.00 23.84 ? 417 HOH B O   1 
HETATM 4108 O  O   . HOH F 3 .   ? 3.928   5.627  21.605  1.00 28.80 ? 418 HOH B O   1 
HETATM 4109 O  O   . HOH F 3 .   ? -9.749  30.068 49.801  0.90 18.85 ? 419 HOH B O   1 
HETATM 4110 O  O   . HOH F 3 .   ? 27.249  12.563 38.393  0.39 24.14 ? 420 HOH B O   1 
HETATM 4111 O  O   . HOH F 3 .   ? 28.279  12.933 31.383  0.90 19.76 ? 421 HOH B O   1 
HETATM 4112 O  O   . HOH F 3 .   ? -6.410  15.474 55.999  0.39 28.62 ? 422 HOH B O   1 
HETATM 4113 O  O   . HOH F 3 .   ? 32.608  36.743 29.067  0.39 22.52 ? 423 HOH B O   1 
HETATM 4114 O  O   . HOH F 3 .   ? 36.583  22.146 34.239  1.00 11.03 ? 424 HOH B O   1 
HETATM 4115 O  O   . HOH F 3 .   ? 25.161  20.800 20.140  0.39 16.71 ? 425 HOH B O   1 
HETATM 4116 O  O   . HOH F 3 .   ? 5.999   10.236 30.125  0.90 23.56 ? 426 HOH B O   1 
HETATM 4117 O  O   . HOH F 3 .   ? -10.209 15.947 36.460  1.00 13.53 ? 427 HOH B O   1 
HETATM 4118 O  O   . HOH F 3 .   ? 20.428  13.389 22.984  1.00 27.42 ? 428 HOH B O   1 
HETATM 4119 O  O   . HOH F 3 .   ? -4.107  10.596 43.996  0.90 23.53 ? 429 HOH B O   1 
HETATM 4120 O  O   . HOH F 3 .   ? 14.140  4.460  43.923  0.39 18.94 ? 430 HOH B O   1 
HETATM 4121 O  O   . HOH F 3 .   ? 19.024  15.650 42.157  1.00 26.43 ? 431 HOH B O   1 
HETATM 4122 O  O   . HOH F 3 .   ? 32.324  18.644 27.273  1.00 24.85 ? 432 HOH B O   1 
HETATM 4123 O  O   . HOH F 3 .   ? 19.211  27.185 47.219  1.00 23.76 ? 433 HOH B O   1 
HETATM 4124 O  O   . HOH F 3 .   ? -8.109  16.678 49.735  0.39 23.92 ? 434 HOH B O   1 
HETATM 4125 O  O   . HOH F 3 .   ? 3.928   33.707 34.357  0.39 22.70 ? 435 HOH B O   1 
HETATM 4126 O  O   . HOH F 3 .   ? 11.677  32.800 49.092  0.39 21.10 ? 436 HOH B O   1 
HETATM 4127 O  O   . HOH F 3 .   ? -6.444  9.393  51.657  0.38 16.82 ? 437 HOH B O   1 
HETATM 4128 O  O   . HOH F 3 .   ? 5.793   35.051 50.413  0.39 18.61 ? 438 HOH B O   1 
HETATM 4129 O  O   . HOH F 3 .   ? 14.873  41.057 35.160  0.70 35.13 ? 439 HOH B O   1 
HETATM 4130 O  O   . HOH F 3 .   ? 13.731  38.001 45.720  0.38 21.28 ? 440 HOH B O   1 
HETATM 4131 O  O   . HOH F 3 .   ? 8.893   37.853 44.900  0.39 24.64 ? 441 HOH B O   1 
HETATM 4132 O  O   . HOH F 3 .   ? -4.301  10.699 25.893  0.39 19.30 ? 442 HOH B O   1 
HETATM 4133 O  O   . HOH F 3 .   ? -5.472  24.092 25.072  0.39 16.21 ? 443 HOH B O   1 
HETATM 4134 O  O   . HOH F 3 .   ? 4.577   22.054 59.234  0.38 19.14 ? 444 HOH B O   1 
HETATM 4135 O  O   . HOH F 3 .   ? -2.859  4.394  39.210  0.80 29.89 ? 445 HOH B O   1 
HETATM 4136 O  O   . HOH F 3 .   ? 22.397  16.465 21.874  0.39 21.25 ? 446 HOH B O   1 
HETATM 4137 O  O   . HOH F 3 .   ? 24.775  32.062 24.432  0.39 19.01 ? 447 HOH B O   1 
HETATM 4138 O  O   . HOH F 3 .   ? -4.626  28.912 29.937  0.39 16.13 ? 448 HOH B O   1 
HETATM 4139 O  O   . HOH F 3 .   ? 33.679  22.828 25.392  0.39 21.47 ? 449 HOH B O   1 
HETATM 4140 O  O   . HOH F 3 .   ? -4.050  31.319 28.998  0.39 22.95 ? 450 HOH B O   1 
HETATM 4141 O  O   . HOH F 3 .   ? 1.166   12.921 19.187  0.39 24.52 ? 451 HOH B O   1 
HETATM 4142 O  O   . HOH F 3 .   ? -7.583  20.710 22.596  0.39 18.32 ? 452 HOH B O   1 
HETATM 4143 O  O   . HOH F 3 .   ? 20.950  33.393 43.680  1.00 23.36 ? 453 HOH B O   1 
HETATM 4144 O  O   . HOH F 3 .   ? -4.057  8.398  47.933  0.90 14.88 ? 454 HOH B O   1 
HETATM 4145 O  O   . HOH F 3 .   ? 26.914  16.418 39.480  0.39 17.80 ? 455 HOH B O   1 
HETATM 4146 O  O   . HOH F 3 .   ? 26.854  18.409 23.140  1.00 29.66 ? 456 HOH B O   1 
HETATM 4147 O  O   . HOH F 3 .   ? 30.135  28.394 26.503  0.39 15.76 ? 457 HOH B O   1 
HETATM 4148 O  O   . HOH F 3 .   ? -5.824  31.570 50.594  0.39 22.78 ? 458 HOH B O   1 
HETATM 4149 O  O   . HOH F 3 .   ? 34.407  18.220 35.518  0.90 15.03 ? 459 HOH B O   1 
HETATM 4150 O  O   . HOH F 3 .   ? 7.327   34.610 33.154  0.39 24.56 ? 460 HOH B O   1 
HETATM 4151 O  O   . HOH F 3 .   ? 33.318  17.902 31.424  0.90 20.36 ? 461 HOH B O   1 
HETATM 4152 O  O   . HOH F 3 .   ? -2.791  4.297  29.732  0.90 22.84 ? 462 HOH B O   1 
HETATM 4153 O  O   . HOH F 3 .   ? 35.801  30.680 30.045  0.39 22.15 ? 463 HOH B O   1 
HETATM 4154 O  O   . HOH F 3 .   ? 0.129   34.013 31.614  0.39 24.79 ? 464 HOH B O   1 
HETATM 4155 O  O   . HOH F 3 .   ? -10.479 21.593 52.853  0.90 21.89 ? 465 HOH B O   1 
HETATM 4156 O  O   B HOH F 3 .   ? -4.210  17.518 20.250  0.90 17.76 ? 466 HOH B O   1 
HETATM 4157 O  O   . HOH F 3 .   ? 29.604  30.662 25.757  1.00 24.96 ? 467 HOH B O   1 
HETATM 4158 O  O   . HOH F 3 .   ? 9.214   28.864 24.902  1.00 6.54  ? 468 HOH B O   1 
HETATM 4159 O  O   . HOH F 3 .   ? -11.814 20.014 33.523  1.00 10.56 ? 469 HOH B O   1 
HETATM 4160 O  O   . HOH F 3 .   ? -5.286  23.039 33.254  1.00 9.83  ? 470 HOH B O   1 
HETATM 4161 O  O   . HOH F 3 .   ? -8.171  20.727 35.506  1.00 9.67  ? 471 HOH B O   1 
HETATM 4162 O  O   . HOH F 3 .   ? -9.448  22.037 39.594  1.00 10.26 ? 472 HOH B O   1 
HETATM 4163 O  O   . HOH F 3 .   ? 39.650  24.472 31.880  1.00 11.25 ? 473 HOH B O   1 
HETATM 4164 O  O   . HOH F 3 .   ? -7.568  15.834 40.120  1.00 10.46 ? 474 HOH B O   1 
HETATM 4165 O  O   . HOH F 3 .   ? 37.466  18.565 36.971  1.00 11.08 ? 475 HOH B O   1 
HETATM 4166 O  O   . HOH F 3 .   ? 34.655  22.912 42.736  1.00 11.57 ? 476 HOH B O   1 
HETATM 4167 O  O   . HOH F 3 .   ? 31.086  29.166 44.320  1.00 13.75 ? 477 HOH B O   1 
HETATM 4168 O  O   . HOH F 3 .   ? 22.787  34.815 40.458  1.00 12.22 ? 478 HOH B O   1 
HETATM 4169 O  O   . HOH F 3 .   ? 32.823  29.469 42.176  1.00 13.06 ? 479 HOH B O   1 
HETATM 4170 O  O   . HOH F 3 .   ? -8.464  13.777 36.500  0.90 12.48 ? 480 HOH B O   1 
HETATM 4171 O  O   . HOH F 3 .   ? -2.251  7.086  51.977  1.00 13.40 ? 481 HOH B O   1 
HETATM 4172 O  O   . HOH F 3 .   ? 24.494  39.385 35.971  1.00 14.54 ? 482 HOH B O   1 
HETATM 4173 O  O   . HOH F 3 .   ? 30.698  38.024 43.882  1.00 14.02 ? 483 HOH B O   1 
HETATM 4174 O  O   . HOH F 3 .   ? -4.810  14.921 43.965  1.00 13.00 ? 484 HOH B O   1 
HETATM 4175 O  O   . HOH F 3 .   ? 37.197  18.983 41.789  1.00 15.45 ? 485 HOH B O   1 
HETATM 4176 O  O   . HOH F 3 .   ? -6.192  12.030 40.146  1.00 13.61 ? 486 HOH B O   1 
HETATM 4177 O  O   . HOH F 3 .   ? -6.487  13.422 31.793  1.00 13.99 ? 487 HOH B O   1 
HETATM 4178 O  O   . HOH F 3 .   ? 8.487   7.383  48.913  1.00 12.11 ? 488 HOH B O   1 
HETATM 4179 O  O   . HOH F 3 .   ? 34.679  25.765 42.897  1.00 13.67 ? 489 HOH B O   1 
HETATM 4180 O  O   . HOH F 3 .   ? 35.340  15.483 33.948  1.00 16.01 ? 490 HOH B O   1 
HETATM 4181 O  O   . HOH F 3 .   ? -7.982  12.746 33.931  1.00 14.77 ? 491 HOH B O   1 
HETATM 4182 O  O   . HOH F 3 .   ? 22.863  36.004 34.860  0.90 17.76 ? 492 HOH B O   1 
HETATM 4183 O  O   . HOH F 3 .   ? -7.114  9.986  36.831  1.00 16.49 ? 493 HOH B O   1 
HETATM 4184 O  O   . HOH F 3 .   ? 37.823  24.446 27.871  0.90 18.57 ? 494 HOH B O   1 
HETATM 4185 O  O   . HOH F 3 .   ? -11.992 25.488 48.945  1.00 20.53 ? 495 HOH B O   1 
HETATM 4186 O  O   . HOH F 3 .   ? -1.304  5.296  46.642  0.80 16.30 ? 496 HOH B O   1 
HETATM 4187 O  O   . HOH F 3 .   ? -5.484  12.576 42.833  0.90 21.41 ? 497 HOH B O   1 
HETATM 4188 O  O   . HOH F 3 .   ? -2.143  17.549 60.058  0.90 23.21 ? 498 HOH B O   1 
HETATM 4189 O  O   . HOH F 3 .   ? -4.613  22.744 23.469  0.90 15.58 ? 499 HOH B O   1 
HETATM 4190 O  O   . HOH F 3 .   ? 12.443  34.172 53.851  0.90 22.43 ? 500 HOH B O   1 
HETATM 4191 O  O   . HOH F 3 .   ? -6.594  29.069 55.235  1.00 22.15 ? 501 HOH B O   1 
HETATM 4192 O  O   . HOH F 3 .   ? 27.320  26.969 46.875  0.90 18.78 ? 502 HOH B O   1 
HETATM 4193 O  O   . HOH F 3 .   ? -10.160 27.556 43.571  1.00 20.11 ? 503 HOH B O   1 
HETATM 4194 O  O   . HOH F 3 .   ? 28.768  24.950 45.723  1.00 23.93 ? 504 HOH B O   1 
HETATM 4195 O  O   . HOH F 3 .   ? -12.864 26.573 45.432  0.80 19.05 ? 505 HOH B O   1 
HETATM 4196 O  O   . HOH F 3 .   ? 9.150   1.306  40.924  0.90 21.34 ? 506 HOH B O   1 
HETATM 4197 O  O   . HOH F 3 .   ? 30.355  18.209 37.634  0.80 19.08 ? 507 HOH B O   1 
HETATM 4198 O  O   . HOH F 3 .   ? 8.258   3.811  41.960  0.90 21.44 ? 508 HOH B O   1 
HETATM 4199 O  O   . HOH F 3 .   ? 39.850  18.741 27.164  0.90 24.57 ? 509 HOH B O   1 
HETATM 4200 O  O   . HOH F 3 .   ? 5.140   3.560  45.560  0.90 20.34 ? 510 HOH B O   1 
HETATM 4201 O  O   . HOH F 3 .   ? 14.283  16.317 44.991  1.00 20.10 ? 511 HOH B O   1 
HETATM 4202 O  O   . HOH F 3 .   ? 17.040  20.767 56.471  0.90 32.70 ? 512 HOH B O   1 
HETATM 4203 O  O   . HOH F 3 .   ? -4.691  13.023 53.053  0.90 23.88 ? 513 HOH B O   1 
HETATM 4204 O  O   . HOH F 3 .   ? 17.375  4.985  34.870  1.00 29.54 ? 514 HOH B O   1 
HETATM 4205 O  O   . HOH F 3 .   ? -10.119 14.861 40.646  0.90 25.95 ? 515 HOH B O   1 
HETATM 4206 O  O   . HOH F 3 .   ? -6.929  28.225 28.893  0.90 20.72 ? 516 HOH B O   1 
HETATM 4207 O  O   . HOH F 3 .   ? -9.453  11.489 37.671  1.00 29.47 ? 517 HOH B O   1 
HETATM 4208 O  O   . HOH F 3 .   ? -13.378 21.537 44.779  0.90 24.45 ? 518 HOH B O   1 
HETATM 4209 O  O   . HOH F 3 .   ? 34.380  18.131 28.891  0.90 30.12 ? 519 HOH B O   1 
HETATM 4210 O  O   . HOH F 3 .   ? -5.109  28.826 32.649  0.90 22.18 ? 520 HOH B O   1 
HETATM 4211 O  O   . HOH F 3 .   ? 10.222  0.073  31.656  0.90 25.38 ? 521 HOH B O   1 
HETATM 4212 O  O   . HOH F 3 .   ? -9.174  29.789 34.556  0.90 20.75 ? 522 HOH B O   1 
HETATM 4213 O  O   . HOH F 3 .   ? 14.825  3.662  34.396  1.00 27.41 ? 523 HOH B O   1 
HETATM 4214 O  O   . HOH F 3 .   ? -3.866  8.553  53.705  1.00 25.09 ? 524 HOH B O   1 
HETATM 4215 O  O   . HOH F 3 .   ? 12.323  34.417 51.369  0.90 29.62 ? 525 HOH B O   1 
HETATM 4216 O  O   . HOH F 3 .   ? 15.055  8.987  44.269  1.00 23.46 ? 526 HOH B O   1 
HETATM 4217 O  O   . HOH F 3 .   ? 7.868   26.783 56.032  0.39 21.68 ? 527 HOH B O   1 
HETATM 4218 O  O   . HOH F 3 .   ? 34.600  36.160 35.621  0.90 24.55 ? 528 HOH B O   1 
HETATM 4219 O  O   . HOH F 3 .   ? 0.319   33.284 28.933  1.00 31.43 ? 529 HOH B O   1 
HETATM 4220 O  O   . HOH F 3 .   ? 8.236   32.017 58.925  0.80 23.32 ? 530 HOH B O   1 
HETATM 4221 O  O   . HOH F 3 .   ? 39.651  20.363 25.429  0.90 27.71 ? 531 HOH B O   1 
HETATM 4222 O  O   . HOH F 3 .   ? 1.890   3.387  48.779  1.00 22.19 ? 532 HOH B O   1 
HETATM 4223 O  O   . HOH F 3 .   ? -6.008  11.021 30.711  0.80 21.65 ? 533 HOH B O   1 
HETATM 4224 O  O   . HOH F 3 .   ? -5.740  7.420  49.948  0.90 24.68 ? 534 HOH B O   1 
HETATM 4225 O  O   . HOH F 3 .   ? 40.015  27.169 32.705  0.90 22.83 ? 535 HOH B O   1 
HETATM 4226 O  O   . HOH F 3 .   ? 14.410  6.811  23.422  0.39 18.59 ? 536 HOH B O   1 
HETATM 4227 O  O   . HOH F 3 .   ? -12.580 21.505 49.320  1.00 33.10 ? 537 HOH B O   1 
HETATM 4228 O  O   . HOH F 3 .   ? 19.700  38.028 39.047  0.90 19.40 ? 538 HOH B O   1 
HETATM 4229 O  O   . HOH F 3 .   ? 20.439  38.950 36.713  0.90 28.81 ? 539 HOH B O   1 
HETATM 4230 O  O   . HOH F 3 .   ? 35.068  15.531 38.672  1.00 28.66 ? 540 HOH B O   1 
HETATM 4231 O  O   . HOH F 3 .   ? -10.505 13.182 32.802  1.00 26.29 ? 541 HOH B O   1 
HETATM 4232 O  O   . HOH F 3 .   ? 22.264  7.076  33.929  0.90 24.79 ? 542 HOH B O   1 
HETATM 4233 O  O   . HOH F 3 .   ? 20.444  6.041  33.000  0.39 24.51 ? 543 HOH B O   1 
HETATM 4234 O  O   . HOH F 3 .   ? 18.217  3.949  29.648  0.90 24.33 ? 544 HOH B O   1 
HETATM 4235 O  O   . HOH F 3 .   ? 17.226  3.048  27.122  0.39 21.83 ? 545 HOH B O   1 
HETATM 4236 O  O   . HOH F 3 .   ? 11.875  -1.197 39.030  0.39 23.38 ? 546 HOH B O   1 
HETATM 4237 O  O   . HOH F 3 .   ? -0.482  0.342  34.319  0.80 25.34 ? 547 HOH B O   1 
HETATM 4238 O  O   . HOH F 3 .   ? 3.984   2.636  21.879  0.39 25.95 ? 548 HOH B O   1 
HETATM 4239 O  O   . HOH F 3 .   ? 27.804  11.874 23.809  0.39 26.99 ? 549 HOH B O   1 
HETATM 4240 O  O   . HOH F 3 .   ? 30.193  21.761 22.324  0.39 22.90 ? 550 HOH B O   1 
HETATM 4241 O  O   . HOH F 3 .   ? 32.308  19.765 23.379  0.39 31.34 ? 551 HOH B O   1 
HETATM 4242 O  O   . HOH F 3 .   ? 27.980  28.441 23.996  0.39 23.59 ? 552 HOH B O   1 
HETATM 4243 O  O   . HOH F 3 .   ? 29.717  28.233 21.710  0.39 33.91 ? 553 HOH B O   1 
HETATM 4244 O  O   . HOH F 3 .   ? 31.508  31.613 24.148  0.39 22.70 ? 554 HOH B O   1 
HETATM 4245 O  O   . HOH F 3 .   ? -10.542 14.935 43.167  0.39 26.41 ? 555 HOH B O   1 
HETATM 4246 O  O   . HOH F 3 .   ? 29.113  17.932 42.266  0.39 24.59 ? 556 HOH B O   1 
HETATM 4247 O  O   . HOH F 3 .   ? 19.728  18.578 46.134  0.39 23.96 ? 557 HOH B O   1 
HETATM 4248 O  O   . HOH F 3 .   ? 23.048  21.840 46.800  1.00 31.81 ? 558 HOH B O   1 
HETATM 4249 O  O   . HOH F 3 .   ? 25.561  21.260 48.008  0.39 26.01 ? 559 HOH B O   1 
HETATM 4250 O  O   . HOH F 3 .   ? 18.634  21.855 48.333  0.39 20.01 ? 560 HOH B O   1 
HETATM 4251 O  O   . HOH F 3 .   ? 21.904  33.717 33.568  0.90 13.80 ? 561 HOH B O   1 
HETATM 4252 O  O   . HOH F 3 .   ? 21.890  37.670 32.873  0.39 25.62 ? 562 HOH B O   1 
HETATM 4253 O  O   . HOH F 3 .   ? 26.873  39.993 32.166  0.39 15.24 ? 563 HOH B O   1 
HETATM 4254 O  O   . HOH F 3 .   ? 4.224   19.015 62.731  0.90 32.12 ? 564 HOH B O   1 
HETATM 4255 O  O   . HOH F 3 .   ? 32.629  38.690 31.651  0.39 19.80 ? 565 HOH B O   1 
HETATM 4256 O  O   . HOH F 3 .   ? 19.773  37.452 28.221  0.39 27.43 ? 566 HOH B O   1 
HETATM 4257 O  O   . HOH F 3 .   ? 15.463  12.053 47.745  1.00 33.12 ? 567 HOH B O   1 
HETATM 4258 O  O   . HOH F 3 .   ? 15.979  9.402  46.821  0.39 21.86 ? 568 HOH B O   1 
HETATM 4259 O  O   . HOH F 3 .   ? 6.858   2.447  44.055  0.90 33.08 ? 569 HOH B O   1 
HETATM 4260 O  O   . HOH F 3 .   ? 11.644  1.845  41.867  0.39 22.37 ? 570 HOH B O   1 
HETATM 4261 O  O   . HOH F 3 .   ? 1.580   2.452  42.963  0.80 31.79 ? 571 HOH B O   1 
HETATM 4262 O  O   . HOH F 3 .   ? -0.839  2.607  43.474  0.39 21.04 ? 572 HOH B O   1 
HETATM 4263 O  O   . HOH F 3 .   ? -5.436  10.576 53.296  0.39 17.33 ? 573 HOH B O   1 
HETATM 4264 O  O   . HOH F 3 .   ? -12.617 22.053 51.667  0.90 34.07 ? 574 HOH B O   1 
HETATM 4265 O  O   . HOH F 3 .   ? 15.196  13.834 51.801  0.39 24.60 ? 575 HOH B O   1 
HETATM 4266 O  O   . HOH F 3 .   ? 14.230  16.253 54.011  0.39 25.50 ? 576 HOH B O   1 
HETATM 4267 O  O   . HOH F 3 .   ? -3.865  12.169 21.425  1.00 33.81 ? 577 HOH B O   1 
HETATM 4268 O  O   . HOH F 3 .   ? -9.658  15.524 26.185  0.39 20.07 ? 578 HOH B O   1 
HETATM 4269 O  O   . HOH F 3 .   ? -9.077  8.512  33.000  0.39 25.23 ? 579 HOH B O   1 
HETATM 4270 O  O   . HOH F 3 .   ? 10.586  20.959 59.376  0.90 25.65 ? 580 HOH B O   1 
HETATM 4271 O  O   . HOH F 3 .   ? 10.739  23.185 60.838  0.39 27.85 ? 581 HOH B O   1 
HETATM 4272 O  O   . HOH F 3 .   ? 6.934   23.420 58.360  0.80 26.60 ? 582 HOH B O   1 
HETATM 4273 O  O   . HOH F 3 .   ? 4.440   24.168 58.462  0.39 30.07 ? 583 HOH B O   1 
HETATM 4274 O  O   . HOH F 3 .   ? -8.039  31.197 51.480  0.80 22.92 ? 584 HOH B O   1 
HETATM 4275 O  O   . HOH F 3 .   ? -4.816  7.614  41.064  1.00 27.12 ? 585 HOH B O   1 
HETATM 4276 O  O   . HOH F 3 .   ? 1.154   20.139 60.491  0.39 21.30 ? 586 HOH B O   1 
HETATM 4277 O  O   . HOH F 3 .   ? -8.464  9.985  30.258  1.00 28.25 ? 587 HOH B O   1 
HETATM 4278 O  O   . HOH F 3 .   ? 12.077  8.008  46.635  1.00 30.90 ? 588 HOH B O   1 
HETATM 4279 O  O   . HOH F 3 .   ? 16.776  3.072  37.439  0.39 25.88 ? 589 HOH B O   1 
HETATM 4280 O  O   . HOH F 3 .   ? -9.479  17.391 47.798  0.39 29.14 ? 590 HOH B O   1 
HETATM 4281 O  O   . HOH F 3 .   ? 15.958  37.379 31.124  0.39 22.85 ? 591 HOH B O   1 
HETATM 4282 O  O   . HOH F 3 .   ? 36.774  32.102 34.414  0.39 26.04 ? 592 HOH B O   1 
HETATM 4283 O  O   . HOH F 3 .   ? 28.857  22.707 46.958  0.39 32.55 ? 593 HOH B O   1 
HETATM 4284 O  O   . HOH F 3 .   ? 10.202  18.088 60.761  0.39 19.36 ? 594 HOH B O   1 
HETATM 4285 O  O   . HOH F 3 .   ? 19.758  25.198 49.699  0.39 24.33 ? 595 HOH B O   1 
HETATM 4286 O  O   . HOH F 3 .   ? 2.806   1.799  45.593  0.39 20.91 ? 596 HOH B O   1 
HETATM 4287 O  O   . HOH F 3 .   ? 2.217   33.718 38.939  0.39 26.99 ? 597 HOH B O   1 
HETATM 4288 O  O   . HOH F 3 .   ? 5.419   -0.672 37.962  0.39 20.29 ? 598 HOH B O   1 
HETATM 4289 O  O   . HOH F 3 .   ? 35.249  17.459 42.417  0.39 26.43 ? 599 HOH B O   1 
HETATM 4290 O  O   . HOH F 3 .   ? 9.814   34.484 55.511  0.39 17.98 ? 600 HOH B O   1 
HETATM 4291 O  O   . HOH F 3 .   ? -9.049  23.354 53.904  0.39 21.90 ? 601 HOH B O   1 
HETATM 4292 O  O   . HOH F 3 .   ? 31.002  21.003 45.400  0.39 23.43 ? 602 HOH B O   1 
HETATM 4293 O  O   . HOH F 3 .   ? 26.331  24.678 19.508  0.39 20.02 ? 603 HOH B O   1 
HETATM 4294 O  O   . HOH F 3 .   ? 29.238  17.681 24.002  0.39 26.97 ? 604 HOH B O   1 
HETATM 4295 O  O   . HOH F 3 .   ? 31.831  11.732 34.482  0.39 19.94 ? 605 HOH B O   1 
HETATM 4296 O  O   . HOH F 3 .   ? -8.748  11.381 40.466  0.39 23.53 ? 606 HOH B O   1 
HETATM 4297 O  O   . HOH F 3 .   ? 11.189  29.134 53.876  0.39 20.49 ? 607 HOH B O   1 
HETATM 4298 O  O   . HOH F 3 .   ? -1.416  10.973 20.644  0.39 18.55 ? 608 HOH B O   1 
HETATM 4299 O  O   . HOH F 3 .   ? -6.964  7.422  37.397  0.39 20.81 ? 609 HOH B O   1 
HETATM 4300 O  O   . HOH F 3 .   ? 34.925  27.151 26.254  0.39 18.57 ? 610 HOH B O   1 
HETATM 4301 O  O   . HOH F 3 .   ? -9.161  16.224 53.946  0.39 23.82 ? 611 HOH B O   1 
HETATM 4302 O  O   . HOH F 3 .   ? 33.902  38.245 34.401  0.80 22.25 ? 612 HOH B O   1 
HETATM 4303 O  O   . HOH F 3 .   ? 1.836   16.079 61.722  0.39 22.54 ? 613 HOH B O   1 
HETATM 4304 O  O   . HOH F 3 .   ? -6.220  6.065  31.512  0.39 21.19 ? 614 HOH B O   1 
HETATM 4305 O  O   . HOH F 3 .   ? 20.739  31.329 23.286  0.39 31.04 ? 615 HOH B O   1 
HETATM 4306 O  O   . HOH F 3 .   ? -10.967 20.035 54.993  0.39 22.63 ? 616 HOH B O   1 
HETATM 4307 O  O   . HOH F 3 .   ? -11.964 15.591 28.235  0.39 23.17 ? 617 HOH B O   1 
HETATM 4308 O  O   . HOH F 3 .   ? 12.843  38.439 34.617  0.39 28.07 ? 618 HOH B O   1 
HETATM 4309 O  O   . HOH F 3 .   ? -3.648  11.858 16.318  0.39 26.15 ? 619 HOH B O   1 
HETATM 4310 O  O   . HOH F 3 .   ? -7.411  26.334 59.534  0.60 27.98 ? 620 HOH B O   1 
HETATM 4311 O  O   . HOH F 3 .   ? -2.632  33.543 43.632  0.60 31.46 ? 621 HOH B O   1 
HETATM 4312 O  O   . HOH F 3 .   ? 24.132  9.226  25.617  0.60 30.77 ? 622 HOH B O   1 
HETATM 4313 O  O   . HOH F 3 .   ? 17.697  23.990 54.155  0.60 30.27 ? 623 HOH B O   1 
HETATM 4314 O  O   . HOH F 3 .   ? 4.502   31.196 57.435  0.39 26.21 ? 624 HOH B O   1 
HETATM 4315 O  O   . HOH F 3 .   ? 27.311  19.532 20.361  0.60 32.35 ? 625 HOH B O   1 
HETATM 4316 O  O   . HOH F 3 .   ? -1.997  10.207 57.039  0.70 12.87 ? 626 HOH B O   1 
HETATM 4317 O  O   . HOH F 3 .   ? -3.193  9.839  55.767  0.40 11.99 ? 627 HOH B O   1 
HETATM 4318 O  O   . HOH F 3 .   ? 12.089  9.804  44.182  0.60 16.39 ? 628 HOH B O   1 
HETATM 4319 O  O   A HOH F 3 .   ? -5.164  31.194 39.762  0.60 20.91 ? 629 HOH B O   1 
HETATM 4320 O  O   B HOH F 3 .   ? -2.917  23.097 21.108  0.40 13.48 ? 630 HOH B O   1 
HETATM 4321 O  O   . HOH F 3 .   ? -4.795  26.643 25.503  0.40 12.46 ? 631 HOH B O   1 
HETATM 4322 O  O   . HOH F 3 .   ? 13.195  38.495 31.481  0.38 19.67 ? 632 HOH B O   1 
HETATM 4323 O  O   . HOH F 3 .   ? 34.884  32.567 35.733  0.38 16.46 ? 633 HOH B O   1 
HETATM 4324 O  O   . HOH F 3 .   ? 24.164  18.182 46.137  0.38 20.53 ? 634 HOH B O   1 
HETATM 4325 O  O   . HOH F 3 .   ? -13.689 24.821 46.530  0.38 18.91 ? 635 HOH B O   1 
HETATM 4326 O  O   . HOH F 3 .   ? 33.696  19.818 25.371  0.38 23.50 ? 636 HOH B O   1 
HETATM 4327 O  O   . HOH F 3 .   ? 25.918  16.877 43.241  0.38 21.78 ? 637 HOH B O   1 
HETATM 4328 O  O   . HOH F 3 .   ? -1.162  19.828 61.123  0.38 18.41 ? 638 HOH B O   1 
HETATM 4329 O  O   . HOH F 3 .   ? 17.986  1.865  31.551  0.38 22.54 ? 639 HOH B O   1 
HETATM 4330 O  O   . HOH F 3 .   ? 15.387  37.856 26.526  0.38 19.81 ? 640 HOH B O   1 
HETATM 4331 O  O   . HOH F 3 .   ? 36.320  22.740 24.905  0.38 18.73 ? 641 HOH B O   1 
HETATM 4332 O  O   . HOH F 3 .   ? -2.598  4.480  44.127  0.38 20.41 ? 642 HOH B O   1 
HETATM 4333 O  O   . HOH F 3 .   ? 16.275  0.779  38.224  0.38 18.30 ? 643 HOH B O   1 
HETATM 4334 O  O   . HOH F 3 .   ? 22.187  26.657 21.001  0.38 13.34 ? 644 HOH B O   1 
HETATM 4335 O  O   . HOH F 3 .   ? 30.564  18.870 44.066  0.38 24.66 ? 645 HOH B O   1 
HETATM 4336 O  O   . HOH F 3 .   ? -8.984  18.156 50.657  0.38 18.66 ? 646 HOH B O   1 
HETATM 4337 O  O   B HOH F 3 .   ? 0.819   13.671 16.839  0.38 15.49 ? 647 HOH B O   1 
HETATM 4338 O  O   . HOH F 3 .   ? 38.026  18.112 26.326  0.38 15.44 ? 648 HOH B O   1 
HETATM 4339 O  O   B HOH F 3 .   ? 3.840   26.831 54.504  0.70 23.58 ? 649 HOH B O   1 
HETATM 4340 O  O   . HOH F 3 .   ? -3.552  31.263 34.845  0.38 19.41 ? 650 HOH B O   1 
HETATM 4341 O  O   . HOH F 3 .   ? -6.209  23.048 25.741  0.70 15.51 ? 651 HOH B O   1 
HETATM 4342 O  O   . HOH F 3 .   ? 10.365  10.604 50.026  0.38 16.83 ? 652 HOH B O   1 
HETATM 4343 O  O   . HOH F 3 .   ? 11.235  11.112 49.046  0.60 16.09 ? 653 HOH B O   1 
HETATM 4344 O  O   . HOH F 3 .   ? 20.465  34.086 41.448  0.38 17.42 ? 654 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   A SER A 1   ? 0.2784 0.4259 0.4318 0.2462  -0.0575 -0.0486 1   SER A N   
2    N  N   B SER A 1   ? 0.3004 0.3814 0.4652 0.2435  -0.0417 -0.0281 1   SER A N   
3    C  CA  A SER A 1   ? 0.2291 0.3671 0.3053 0.1998  0.0394  -0.0346 1   SER A CA  
4    C  CA  B SER A 1   ? 0.1914 0.3843 0.3300 0.1731  0.0705  0.0317  1   SER A CA  
5    C  C   A SER A 1   ? 0.1671 0.2728 0.1759 0.1252  -0.0151 -0.0403 1   SER A C   
6    C  C   B SER A 1   ? 0.2099 0.2561 0.2475 0.1399  0.0650  0.0324  1   SER A C   
7    O  O   A SER A 1   ? 0.1833 0.3154 0.1856 0.1287  -0.0578 -0.0426 1   SER A O   
8    O  O   B SER A 1   ? 0.1972 0.2173 0.2233 0.1082  0.0072  0.0191  1   SER A O   
9    C  CB  A SER A 1   ? 0.1585 0.5195 0.4184 0.1595  0.0847  -0.0249 1   SER A CB  
10   C  CB  B SER A 1   ? 0.2161 0.4367 0.3288 0.1233  0.1259  -0.0099 1   SER A CB  
11   O  OG  A SER A 1   ? 0.2172 0.7175 0.7471 0.0503  -0.0597 -0.0203 1   SER A OG  
12   O  OG  B SER A 1   ? 0.1085 0.6937 0.4987 0.0454  0.0407  -0.0520 1   SER A OG  
13   N  N   . TYR A 2   ? 0.1023 0.1621 0.1594 0.0381  -0.0004 -0.0327 2   TYR A N   
14   C  CA  . TYR A 2   ? 0.0903 0.1518 0.1310 0.0272  0.0057  -0.0259 2   TYR A CA  
15   C  C   . TYR A 2   ? 0.0943 0.1433 0.1182 0.0318  -0.0015 -0.0125 2   TYR A C   
16   O  O   . TYR A 2   ? 0.0890 0.1599 0.1459 0.0108  -0.0051 -0.0346 2   TYR A O   
17   C  CB  . TYR A 2   ? 0.0937 0.1351 0.1353 0.0293  0.0063  -0.0160 2   TYR A CB  
18   C  CG  . TYR A 2   ? 0.1081 0.1309 0.1172 0.0283  0.0020  -0.0254 2   TYR A CG  
19   C  CD1 . TYR A 2   ? 0.1114 0.1464 0.1118 0.0248  -0.0023 -0.0122 2   TYR A CD1 
20   C  CD2 . TYR A 2   ? 0.1375 0.1393 0.1050 0.0243  -0.0084 -0.0046 2   TYR A CD2 
21   C  CE1 . TYR A 2   ? 0.1100 0.1471 0.1145 0.0138  -0.0024 -0.0041 2   TYR A CE1 
22   C  CE2 . TYR A 2   ? 0.1380 0.1467 0.1017 0.0233  -0.0191 -0.0192 2   TYR A CE2 
23   C  CZ  . TYR A 2   ? 0.0992 0.1424 0.1098 0.0229  0.0053  -0.0207 2   TYR A CZ  
24   O  OH  . TYR A 2   ? 0.1049 0.1542 0.1095 0.0192  -0.0049 -0.0135 2   TYR A OH  
25   N  N   . THR A 3   ? 0.1052 0.1364 0.1194 0.0239  -0.0032 -0.0146 3   THR A N   
26   C  CA  . THR A 3   ? 0.0965 0.1447 0.1187 0.0203  -0.0057 -0.0147 3   THR A CA  
27   C  C   . THR A 3   ? 0.0883 0.1270 0.0982 0.0128  -0.0124 -0.0203 3   THR A C   
28   O  O   . THR A 3   ? 0.0877 0.1270 0.1118 0.0117  -0.0064 -0.0045 3   THR A O   
29   C  CB  . THR A 3   ? 0.1028 0.1952 0.1588 0.0328  -0.0338 -0.0325 3   THR A CB  
30   O  OG1 . THR A 3   ? 0.1663 0.2189 0.1332 0.0255  -0.0360 -0.0145 3   THR A OG1 
31   C  CG2 . THR A 3   ? 0.1166 0.2385 0.2503 0.0552  -0.0592 -0.0632 3   THR A CG2 
32   N  N   . LEU A 4   ? 0.0823 0.1260 0.0948 0.0057  0.0046  -0.0061 4   LEU A N   
33   C  CA  . LEU A 4   ? 0.0744 0.1168 0.0852 0.0058  -0.0018 -0.0065 4   LEU A CA  
34   C  C   . LEU A 4   ? 0.0736 0.1052 0.0917 0.0013  -0.0041 -0.0098 4   LEU A C   
35   O  O   . LEU A 4   ? 0.0841 0.1315 0.0876 -0.0068 -0.0100 -0.0110 4   LEU A O   
36   C  CB  . LEU A 4   ? 0.0736 0.1224 0.0970 0.0016  0.0043  -0.0081 4   LEU A CB  
37   C  CG  . LEU A 4   ? 0.0861 0.1163 0.0786 0.0066  0.0015  -0.0079 4   LEU A CG  
38   C  CD1 . LEU A 4   ? 0.0888 0.1164 0.0899 0.0037  -0.0061 -0.0009 4   LEU A CD1 
39   C  CD2 . LEU A 4   ? 0.1004 0.1190 0.1019 0.0028  -0.0060 0.0073  4   LEU A CD2 
40   N  N   . PRO A 5   ? 0.0738 0.1056 0.0833 -0.0004 -0.0021 -0.0094 5   PRO A N   
41   C  CA  . PRO A 5   ? 0.0723 0.0937 0.0848 0.0042  -0.0092 -0.0058 5   PRO A CA  
42   C  C   . PRO A 5   ? 0.0792 0.0799 0.0918 0.0018  -0.0054 0.0026  5   PRO A C   
43   O  O   . PRO A 5   ? 0.1026 0.0910 0.1075 0.0111  -0.0239 0.0047  5   PRO A O   
44   C  CB  . PRO A 5   ? 0.0950 0.0933 0.0879 -0.0064 -0.0001 -0.0059 5   PRO A CB  
45   C  CG  . PRO A 5   ? 0.0781 0.1132 0.0974 -0.0099 -0.0036 -0.0051 5   PRO A CG  
46   C  CD  . PRO A 5   ? 0.0786 0.1097 0.0868 -0.0047 -0.0113 -0.0076 5   PRO A CD  
47   N  N   . SER A 6   ? 0.0816 0.0841 0.0857 0.0059  -0.0099 -0.0065 6   SER A N   
48   C  CA  . SER A 6   ? 0.0760 0.0860 0.1212 0.0018  -0.0046 -0.0260 6   SER A CA  
49   C  C   . SER A 6   ? 0.0937 0.0772 0.0959 -0.0064 0.0047  -0.0154 6   SER A C   
50   O  O   . SER A 6   ? 0.0918 0.0748 0.1293 0.0012  -0.0034 -0.0039 6   SER A O   
51   C  CB  A SER A 6   ? 0.1088 0.1335 0.1202 0.0064  -0.0233 -0.0250 6   SER A CB  
52   C  CB  B SER A 6   ? 0.1296 0.0967 0.1703 0.0559  -0.0627 -0.0849 6   SER A CB  
53   O  OG  A SER A 6   ? 0.1395 0.1111 0.1128 0.0010  -0.0183 -0.0314 6   SER A OG  
54   O  OG  B SER A 6   ? 0.0979 0.1201 0.1137 -0.0045 -0.0082 -0.0133 6   SER A OG  
55   N  N   . LEU A 7   ? 0.0835 0.0774 0.1168 -0.0027 0.0132  -0.0134 7   LEU A N   
56   C  CA  . LEU A 7   ? 0.0856 0.0792 0.1105 -0.0018 0.0153  -0.0158 7   LEU A CA  
57   C  C   . LEU A 7   ? 0.0794 0.0733 0.1083 0.0027  0.0058  -0.0028 7   LEU A C   
58   O  O   . LEU A 7   ? 0.0802 0.0993 0.1089 0.0042  -0.0031 -0.0007 7   LEU A O   
59   C  CB  . LEU A 7   ? 0.0868 0.0876 0.0898 -0.0035 0.0037  -0.0077 7   LEU A CB  
60   C  CG  . LEU A 7   ? 0.1002 0.1267 0.0859 -0.0268 0.0072  -0.0090 7   LEU A CG  
61   C  CD1 . LEU A 7   ? 0.1791 0.1569 0.0989 -0.0050 0.0034  0.0280  7   LEU A CD1 
62   C  CD2 . LEU A 7   ? 0.1801 0.1551 0.0909 -0.0755 0.0184  -0.0222 7   LEU A CD2 
63   N  N   . PRO A 8   ? 0.0818 0.0785 0.1047 0.0038  0.0053  -0.0001 8   PRO A N   
64   C  CA  . PRO A 8   ? 0.0930 0.0849 0.0962 -0.0010 -0.0007 0.0053  8   PRO A CA  
65   C  C   . PRO A 8   ? 0.0935 0.0934 0.0922 0.0036  -0.0060 -0.0003 8   PRO A C   
66   O  O   . PRO A 8   ? 0.1730 0.1027 0.1002 0.0053  0.0151  -0.0038 8   PRO A O   
67   C  CB  . PRO A 8   ? 0.1048 0.1018 0.1219 -0.0149 0.0225  0.0029  8   PRO A CB  
68   C  CG  . PRO A 8   ? 0.1002 0.0954 0.1384 -0.0161 0.0116  -0.0150 8   PRO A CG  
69   C  CD  . PRO A 8   ? 0.0826 0.0928 0.1072 -0.0036 0.0052  -0.0194 8   PRO A CD  
70   N  N   . TYR A 9   ? 0.0836 0.0788 0.0962 0.0038  0.0027  0.0005  9   TYR A N   
71   C  CA  . TYR A 9   ? 0.0819 0.0824 0.0846 0.0041  -0.0058 -0.0113 9   TYR A CA  
72   C  C   . TYR A 9   ? 0.0724 0.0804 0.0916 0.0009  -0.0109 -0.0071 9   TYR A C   
73   O  O   . TYR A 9   ? 0.0892 0.0846 0.1038 0.0008  0.0116  -0.0151 9   TYR A O   
74   C  CB  . TYR A 9   ? 0.0797 0.0912 0.1051 -0.0039 0.0025  -0.0220 9   TYR A CB  
75   C  CG  . TYR A 9   ? 0.0726 0.0787 0.1075 0.0007  -0.0052 -0.0148 9   TYR A CG  
76   C  CD1 . TYR A 9   ? 0.0992 0.0772 0.1091 -0.0116 -0.0189 0.0040  9   TYR A CD1 
77   C  CD2 . TYR A 9   ? 0.0882 0.0895 0.0957 -0.0069 0.0070  -0.0091 9   TYR A CD2 
78   C  CE1 . TYR A 9   ? 0.0949 0.0792 0.1033 -0.0086 -0.0167 0.0039  9   TYR A CE1 
79   C  CE2 . TYR A 9   ? 0.0753 0.0800 0.0943 -0.0042 0.0041  -0.0110 9   TYR A CE2 
80   C  CZ  . TYR A 9   ? 0.0825 0.0713 0.0907 0.0005  -0.0085 -0.0020 9   TYR A CZ  
81   O  OH  . TYR A 9   ? 0.0931 0.0770 0.0909 -0.0033 -0.0053 -0.0045 9   TYR A OH  
82   N  N   . ALA A 10  ? 0.0803 0.0785 0.0871 0.0056  -0.0031 -0.0104 10  ALA A N   
83   C  CA  . ALA A 10  ? 0.0718 0.0859 0.0948 0.0013  -0.0004 -0.0052 10  ALA A CA  
84   C  C   . ALA A 10  ? 0.0678 0.0751 0.0928 -0.0008 -0.0005 -0.0119 10  ALA A C   
85   O  O   . ALA A 10  ? 0.0672 0.0804 0.1042 -0.0037 0.0015  -0.0060 10  ALA A O   
86   C  CB  . ALA A 10  ? 0.0956 0.0825 0.1110 -0.0055 -0.0112 -0.0028 10  ALA A CB  
87   N  N   . TYR A 11  ? 0.0632 0.0832 0.0927 -0.0010 -0.0051 -0.0051 11  TYR A N   
88   C  CA  . TYR A 11  ? 0.0702 0.0810 0.0887 0.0011  -0.0040 -0.0130 11  TYR A CA  
89   C  C   . TYR A 11  ? 0.0681 0.0915 0.0856 -0.0009 -0.0064 -0.0088 11  TYR A C   
90   O  O   . TYR A 11  ? 0.0696 0.0931 0.0990 0.0054  -0.0057 -0.0147 11  TYR A O   
91   C  CB  . TYR A 11  ? 0.0687 0.0820 0.0962 0.0046  -0.0011 -0.0044 11  TYR A CB  
92   C  CG  . TYR A 11  ? 0.0700 0.0878 0.0883 0.0032  -0.0017 -0.0044 11  TYR A CG  
93   C  CD1 . TYR A 11  ? 0.0755 0.0845 0.0901 -0.0015 -0.0010 -0.0098 11  TYR A CD1 
94   C  CD2 . TYR A 11  ? 0.0720 0.0897 0.0850 0.0007  -0.0009 -0.0046 11  TYR A CD2 
95   C  CE1 . TYR A 11  ? 0.0748 0.0878 0.0891 0.0010  -0.0006 -0.0118 11  TYR A CE1 
96   C  CE2 . TYR A 11  ? 0.0720 0.0955 0.0955 -0.0006 0.0015  -0.0065 11  TYR A CE2 
97   C  CZ  . TYR A 11  ? 0.0690 0.0928 0.0809 0.0041  0.0011  -0.0057 11  TYR A CZ  
98   O  OH  . TYR A 11  ? 0.0737 0.0946 0.1008 0.0042  0.0022  -0.0144 11  TYR A OH  
99   N  N   . ASP A 12  ? 0.0655 0.0825 0.0961 0.0000  -0.0061 -0.0100 12  ASP A N   
100  C  CA  . ASP A 12  ? 0.0733 0.0826 0.0986 0.0056  -0.0044 -0.0150 12  ASP A CA  
101  C  C   . ASP A 12  ? 0.0764 0.0860 0.0958 0.0019  -0.0067 -0.0197 12  ASP A C   
102  O  O   . ASP A 12  ? 0.0723 0.1011 0.1053 0.0059  0.0005  -0.0154 12  ASP A O   
103  C  CB  . ASP A 12  ? 0.0985 0.0821 0.1375 -0.0044 0.0085  -0.0270 12  ASP A CB  
104  C  CG  . ASP A 12  ? 0.0910 0.1289 0.1151 -0.0322 0.0176  -0.0497 12  ASP A CG  
105  O  OD1 . ASP A 12  ? 0.1135 0.1435 0.1477 0.0176  -0.0238 -0.0382 12  ASP A OD1 
106  O  OD2 . ASP A 12  ? 0.1277 0.1400 0.1573 -0.0380 0.0219  -0.0583 12  ASP A OD2 
107  N  N   . ALA A 13  ? 0.0701 0.0868 0.0828 0.0012  -0.0041 -0.0100 13  ALA A N   
108  C  CA  . ALA A 13  ? 0.0713 0.0997 0.0874 0.0028  -0.0035 -0.0087 13  ALA A CA  
109  C  C   . ALA A 13  ? 0.0685 0.1017 0.0892 0.0014  -0.0019 -0.0056 13  ALA A C   
110  O  O   . ALA A 13  ? 0.0752 0.1610 0.0933 -0.0029 0.0017  -0.0072 13  ALA A O   
111  C  CB  . ALA A 13  ? 0.0781 0.1078 0.0977 0.0056  -0.0013 0.0079  13  ALA A CB  
112  N  N   . LEU A 14  ? 0.0655 0.0871 0.0826 0.0014  -0.0069 -0.0080 14  LEU A N   
113  C  CA  . LEU A 14  ? 0.0698 0.0795 0.0952 0.0020  -0.0064 -0.0020 14  LEU A CA  
114  C  C   . LEU A 14  ? 0.0740 0.0840 0.0902 0.0082  0.0011  -0.0030 14  LEU A C   
115  O  O   . LEU A 14  ? 0.0680 0.0844 0.1039 0.0054  -0.0087 -0.0052 14  LEU A O   
116  C  CB  . LEU A 14  ? 0.0686 0.0839 0.0838 0.0018  -0.0088 -0.0033 14  LEU A CB  
117  C  CG  . LEU A 14  ? 0.0798 0.0840 0.0992 0.0083  0.0003  -0.0015 14  LEU A CG  
118  C  CD1 . LEU A 14  ? 0.1056 0.0871 0.1041 0.0078  0.0018  -0.0058 14  LEU A CD1 
119  C  CD2 . LEU A 14  ? 0.1017 0.0928 0.0954 0.0113  0.0002  0.0074  14  LEU A CD2 
120  N  N   . GLU A 15  ? 0.0728 0.0779 0.1053 0.0053  -0.0021 -0.0092 15  GLU A N   
121  C  CA  . GLU A 15  ? 0.0813 0.0795 0.0947 0.0079  -0.0012 0.0000  15  GLU A CA  
122  C  C   . GLU A 15  ? 0.0778 0.0757 0.1048 -0.0002 0.0012  -0.0036 15  GLU A C   
123  O  O   . GLU A 15  ? 0.0859 0.0965 0.1005 0.0059  0.0014  -0.0102 15  GLU A O   
124  C  CB  . GLU A 15  ? 0.0867 0.0835 0.1042 0.0022  0.0000  -0.0023 15  GLU A CB  
125  C  CG  . GLU A 15  ? 0.0826 0.0902 0.1170 -0.0013 0.0020  -0.0036 15  GLU A CG  
126  C  CD  . GLU A 15  ? 0.0914 0.0818 0.1011 -0.0042 0.0017  -0.0051 15  GLU A CD  
127  O  OE1 . GLU A 15  ? 0.0883 0.1075 0.1101 0.0033  0.0010  -0.0029 15  GLU A OE1 
128  O  OE2 . GLU A 15  ? 0.1065 0.0928 0.1130 0.0030  0.0141  -0.0071 15  GLU A OE2 
129  N  N   . PRO A 16  ? 0.0782 0.0824 0.1116 0.0029  0.0014  -0.0093 16  PRO A N   
130  C  CA  . PRO A 16  ? 0.0822 0.0807 0.1197 0.0122  0.0035  -0.0020 16  PRO A CA  
131  C  C   . PRO A 16  ? 0.0864 0.0868 0.0939 0.0135  0.0037  0.0003  16  PRO A C   
132  O  O   . PRO A 16  ? 0.1196 0.0930 0.1348 0.0224  -0.0300 -0.0045 16  PRO A O   
133  C  CB  . PRO A 16  ? 0.0970 0.0886 0.1299 0.0214  -0.0028 -0.0193 16  PRO A CB  
134  C  CG  . PRO A 16  ? 0.0844 0.1253 0.1160 0.0156  -0.0015 -0.0285 16  PRO A CG  
135  C  CD  . PRO A 16  ? 0.0798 0.1025 0.1194 0.0068  0.0082  -0.0166 16  PRO A CD  
136  N  N   . HIS A 17  ? 0.0741 0.0831 0.0994 0.0067  -0.0056 -0.0040 17  HIS A N   
137  C  CA  . HIS A 17  ? 0.0683 0.0868 0.1006 0.0031  -0.0024 -0.0035 17  HIS A CA  
138  C  C   . HIS A 17  ? 0.0679 0.0830 0.0974 0.0024  -0.0049 0.0018  17  HIS A C   
139  O  O   . HIS A 17  ? 0.0786 0.1022 0.0970 0.0150  -0.0102 0.0013  17  HIS A O   
140  C  CB  . HIS A 17  ? 0.0778 0.0834 0.0916 0.0044  -0.0037 -0.0041 17  HIS A CB  
141  C  CG  . HIS A 17  ? 0.0745 0.0877 0.1040 0.0022  -0.0025 -0.0110 17  HIS A CG  
142  N  ND1 . HIS A 17  ? 0.0803 0.1001 0.1021 0.0064  0.0037  -0.0106 17  HIS A ND1 
143  C  CD2 . HIS A 17  ? 0.0843 0.1098 0.0966 0.0000  -0.0047 -0.0069 17  HIS A CD2 
144  C  CE1 . HIS A 17  ? 0.0941 0.1170 0.1066 -0.0004 0.0065  -0.0191 17  HIS A CE1 
145  N  NE2 . HIS A 17  ? 0.0973 0.1209 0.0976 -0.0095 -0.0016 -0.0160 17  HIS A NE2 
146  N  N   . PHE A 18  ? 0.0701 0.0951 0.0893 0.0073  -0.0030 -0.0039 18  PHE A N   
147  C  CA  . PHE A 18  ? 0.0716 0.0907 0.0856 0.0070  0.0016  -0.0045 18  PHE A CA  
148  C  C   . PHE A 18  ? 0.0737 0.0890 0.0988 0.0054  -0.0025 -0.0066 18  PHE A C   
149  O  O   . PHE A 18  ? 0.0813 0.1102 0.0989 -0.0041 -0.0052 0.0018  18  PHE A O   
150  C  CB  . PHE A 18  ? 0.0788 0.0865 0.0942 0.0122  -0.0053 -0.0028 18  PHE A CB  
151  C  CG  . PHE A 18  ? 0.0872 0.0878 0.0801 0.0039  0.0065  -0.0028 18  PHE A CG  
152  C  CD1 . PHE A 18  ? 0.0907 0.0896 0.0933 0.0014  -0.0001 -0.0059 18  PHE A CD1 
153  C  CD2 . PHE A 18  ? 0.0989 0.0941 0.0811 0.0149  0.0001  0.0002  18  PHE A CD2 
154  C  CE1 . PHE A 18  ? 0.1010 0.0967 0.0802 -0.0024 -0.0049 -0.0039 18  PHE A CE1 
155  C  CE2 . PHE A 18  ? 0.1289 0.0869 0.0732 0.0153  0.0011  -0.0004 18  PHE A CE2 
156  C  CZ  . PHE A 18  ? 0.1258 0.0889 0.0810 -0.0010 0.0018  -0.0064 18  PHE A CZ  
157  N  N   . ASP A 19  ? 0.0816 0.0904 0.0895 0.0014  -0.0054 -0.0012 19  ASP A N   
158  C  CA  . ASP A 19  ? 0.0854 0.0826 0.0947 0.0058  -0.0012 -0.0013 19  ASP A CA  
159  C  C   . ASP A 19  ? 0.0843 0.0795 0.0902 0.0026  -0.0047 0.0001  19  ASP A C   
160  O  O   . ASP A 19  ? 0.0825 0.0827 0.1014 0.0057  -0.0020 -0.0048 19  ASP A O   
161  C  CB  . ASP A 19  ? 0.0866 0.0894 0.0987 0.0080  -0.0047 0.0022  19  ASP A CB  
162  C  CG  . ASP A 19  ? 0.0923 0.0923 0.0932 0.0103  -0.0072 0.0008  19  ASP A CG  
163  O  OD1 . ASP A 19  ? 0.0984 0.0956 0.1002 0.0068  -0.0143 -0.0066 19  ASP A OD1 
164  O  OD2 . ASP A 19  ? 0.1068 0.0880 0.1034 0.0084  0.0034  0.0001  19  ASP A OD2 
165  N  N   . LYS A 20  ? 0.0778 0.0871 0.0998 0.0019  -0.0001 -0.0047 20  LYS A N   
166  C  CA  . LYS A 20  ? 0.0831 0.0871 0.1060 0.0014  0.0014  0.0043  20  LYS A CA  
167  C  C   . LYS A 20  ? 0.0821 0.0853 0.1036 -0.0032 0.0015  -0.0091 20  LYS A C   
168  O  O   . LYS A 20  ? 0.0831 0.0845 0.1209 -0.0012 0.0034  -0.0046 20  LYS A O   
169  C  CB  . LYS A 20  ? 0.0868 0.1068 0.0990 0.0012  -0.0014 -0.0053 20  LYS A CB  
170  C  CG  . LYS A 20  ? 0.1038 0.1017 0.1248 -0.0015 -0.0048 -0.0190 20  LYS A CG  
171  C  CD  . LYS A 20  ? 0.1238 0.1237 0.1459 0.0151  -0.0189 -0.0395 20  LYS A CD  
172  C  CE  . LYS A 20  ? 0.2080 0.1055 0.2224 0.0064  -0.0916 -0.0415 20  LYS A CE  
173  N  NZ  . LYS A 20  ? 0.2084 0.1499 0.2027 0.0185  -0.0738 -0.0541 20  LYS A NZ  
174  N  N   . GLN A 21  ? 0.0963 0.0780 0.1035 0.0014  0.0069  -0.0024 21  GLN A N   
175  C  CA  . GLN A 21  ? 0.0983 0.0842 0.1177 -0.0062 0.0195  -0.0031 21  GLN A CA  
176  C  C   . GLN A 21  ? 0.0913 0.0890 0.0980 -0.0035 0.0072  -0.0031 21  GLN A C   
177  O  O   . GLN A 21  ? 0.0868 0.0988 0.1191 -0.0009 0.0134  -0.0091 21  GLN A O   
178  C  CB  A GLN A 21  ? 0.1474 0.0902 0.1215 0.0012  0.0220  0.0089  21  GLN A CB  
179  C  CB  B GLN A 21  ? 0.1488 0.0890 0.1109 0.0036  0.0277  0.0038  21  GLN A CB  
180  C  CG  A GLN A 21  ? 0.1533 0.0913 0.1344 -0.0254 0.0248  0.0023  21  GLN A CG  
181  C  CG  B GLN A 21  ? 0.2037 0.0945 0.1563 -0.0170 0.0789  0.0185  21  GLN A CG  
182  C  CD  A GLN A 21  ? 0.1484 0.0972 0.1705 -0.0216 0.0299  -0.0155 21  GLN A CD  
183  C  CD  B GLN A 21  ? 0.1883 0.2279 0.2849 -0.0235 0.0957  0.0703  21  GLN A CD  
184  O  OE1 A GLN A 21  ? 0.1776 0.2102 0.2040 -0.0201 0.0555  -0.0457 21  GLN A OE1 
185  O  OE1 B GLN A 21  ? 0.2237 0.2763 0.2350 0.0150  0.0540  0.0433  21  GLN A OE1 
186  N  NE2 A GLN A 21  ? 0.1427 0.1432 0.1685 -0.0044 0.0053  0.0155  21  GLN A NE2 
187  N  NE2 B GLN A 21  ? 0.1685 0.2388 0.4987 -0.0527 0.0000  -0.0011 21  GLN A NE2 
188  N  N   . THR A 22  ? 0.0888 0.0791 0.1019 0.0048  0.0076  -0.0056 22  THR A N   
189  C  CA  . THR A 22  ? 0.0905 0.0897 0.0910 0.0039  -0.0087 -0.0050 22  THR A CA  
190  C  C   . THR A 22  ? 0.0776 0.0828 0.0959 -0.0009 -0.0042 -0.0086 22  THR A C   
191  O  O   . THR A 22  ? 0.0836 0.0830 0.1028 0.0057  -0.0007 -0.0094 22  THR A O   
192  C  CB  . THR A 22  ? 0.0873 0.0933 0.0966 0.0096  -0.0158 -0.0083 22  THR A CB  
193  O  OG1 . THR A 22  ? 0.1170 0.1000 0.1002 0.0185  -0.0188 -0.0027 22  THR A OG1 
194  C  CG2 . THR A 22  ? 0.0948 0.0910 0.1148 0.0034  -0.0185 -0.0058 22  THR A CG2 
195  N  N   . MET A 23  ? 0.0722 0.0822 0.1025 0.0082  -0.0072 -0.0076 23  MET A N   
196  C  CA  . MET A 23  ? 0.0746 0.0747 0.1037 -0.0062 -0.0051 -0.0052 23  MET A CA  
197  C  C   . MET A 23  ? 0.0779 0.0835 0.0975 0.0014  -0.0080 -0.0010 23  MET A C   
198  O  O   . MET A 23  ? 0.0780 0.0796 0.1117 0.0039  -0.0006 -0.0016 23  MET A O   
199  C  CB  . MET A 23  ? 0.0804 0.0799 0.1054 -0.0025 -0.0064 -0.0104 23  MET A CB  
200  C  CG  . MET A 23  ? 0.0853 0.0841 0.0890 0.0014  -0.0051 0.0011  23  MET A CG  
201  S  SD  . MET A 23  ? 0.0863 0.0896 0.0907 -0.0058 -0.0033 -0.0003 23  MET A SD  
202  C  CE  . MET A 23  ? 0.1096 0.1032 0.1241 0.0106  0.0005  0.0197  23  MET A CE  
203  N  N   . GLU A 24  ? 0.0748 0.0825 0.1129 -0.0010 -0.0072 -0.0024 24  GLU A N   
204  C  CA  . GLU A 24  ? 0.0712 0.0922 0.1128 0.0000  -0.0022 0.0005  24  GLU A CA  
205  C  C   . GLU A 24  ? 0.0701 0.0845 0.1148 -0.0078 -0.0008 -0.0007 24  GLU A C   
206  O  O   . GLU A 24  ? 0.0788 0.0940 0.1266 0.0021  -0.0029 -0.0057 24  GLU A O   
207  C  CB  . GLU A 24  ? 0.0897 0.0966 0.0929 -0.0158 -0.0037 -0.0012 24  GLU A CB  
208  C  CG  . GLU A 24  ? 0.0910 0.1098 0.1018 -0.0163 0.0019  -0.0060 24  GLU A CG  
209  C  CD  . GLU A 24  ? 0.1027 0.1431 0.1471 -0.0374 0.0142  -0.0410 24  GLU A CD  
210  O  OE1 . GLU A 24  ? 0.1153 0.1312 0.1931 -0.0350 0.0207  -0.0513 24  GLU A OE1 
211  O  OE2 . GLU A 24  ? 0.1228 0.1896 0.2719 -0.0594 0.0557  -0.1130 24  GLU A OE2 
212  N  N   . ILE A 25  ? 0.0822 0.0800 0.1037 -0.0027 0.0075  -0.0023 25  ILE A N   
213  C  CA  . ILE A 25  ? 0.0902 0.0909 0.1005 -0.0031 0.0109  0.0024  25  ILE A CA  
214  C  C   . ILE A 25  ? 0.0732 0.0911 0.0816 0.0013  -0.0001 0.0025  25  ILE A C   
215  O  O   . ILE A 25  ? 0.0820 0.0928 0.0831 -0.0014 0.0010  0.0015  25  ILE A O   
216  C  CB  A ILE A 25  ? 0.1430 0.0988 0.1053 0.0111  0.0221  0.0241  25  ILE A CB  
217  C  CB  B ILE A 25  ? 0.0736 0.0903 0.1035 0.0041  0.0254  0.0061  25  ILE A CB  
218  C  CG1 A ILE A 25  ? 0.1379 0.0986 0.1442 0.0152  0.0525  0.0237  25  ILE A CG1 
219  C  CG1 B ILE A 25  ? 0.1488 0.0673 0.2261 0.0189  0.0250  0.0130  25  ILE A CG1 
220  C  CG2 A ILE A 25  ? 0.1792 0.1117 0.1042 0.0343  -0.0005 0.0221  25  ILE A CG2 
221  C  CG2 B ILE A 25  ? 0.0762 0.1289 0.1005 0.0248  0.0122  -0.0016 25  ILE A CG2 
222  C  CD1 A ILE A 25  ? 0.1913 0.1086 0.1269 0.0230  0.0031  0.0191  25  ILE A CD1 
223  C  CD1 B ILE A 25  ? 0.1192 0.0746 0.2906 -0.0263 0.1324  -0.0527 25  ILE A CD1 
224  N  N   . HIS A 26  ? 0.0763 0.0780 0.0853 0.0016  -0.0024 0.0019  26  HIS A N   
225  C  CA  . HIS A 26  ? 0.0729 0.0777 0.0768 0.0003  -0.0095 0.0021  26  HIS A CA  
226  C  C   . HIS A 26  ? 0.0656 0.0798 0.0759 -0.0007 -0.0040 -0.0002 26  HIS A C   
227  O  O   . HIS A 26  ? 0.0798 0.0853 0.0824 0.0014  -0.0057 -0.0046 26  HIS A O   
228  C  CB  . HIS A 26  ? 0.0707 0.0795 0.0870 0.0037  -0.0025 -0.0014 26  HIS A CB  
229  C  CG  . HIS A 26  ? 0.0687 0.0809 0.0711 0.0021  -0.0071 0.0048  26  HIS A CG  
230  N  ND1 . HIS A 26  ? 0.0754 0.0906 0.0745 0.0007  -0.0020 -0.0094 26  HIS A ND1 
231  C  CD2 . HIS A 26  ? 0.0636 0.0870 0.0704 0.0023  -0.0052 -0.0008 26  HIS A CD2 
232  C  CE1 . HIS A 26  ? 0.0743 0.0887 0.0743 -0.0035 -0.0016 -0.0050 26  HIS A CE1 
233  N  NE2 . HIS A 26  ? 0.0725 0.0791 0.0715 0.0010  -0.0024 -0.0008 26  HIS A NE2 
234  N  N   . HIS A 27  ? 0.0670 0.0800 0.0779 0.0044  -0.0057 0.0002  27  HIS A N   
235  C  CA  . HIS A 27  ? 0.0694 0.0779 0.0792 0.0082  -0.0030 0.0050  27  HIS A CA  
236  C  C   . HIS A 27  ? 0.0734 0.0848 0.0735 0.0027  -0.0088 -0.0020 27  HIS A C   
237  O  O   . HIS A 27  ? 0.0774 0.0938 0.0889 0.0036  0.0070  -0.0070 27  HIS A O   
238  C  CB  . HIS A 27  ? 0.0721 0.0846 0.0818 0.0100  -0.0020 -0.0009 27  HIS A CB  
239  C  CG  . HIS A 27  ? 0.0734 0.0851 0.0674 0.0039  -0.0041 -0.0037 27  HIS A CG  
240  N  ND1 . HIS A 27  ? 0.0749 0.0930 0.0869 0.0139  -0.0098 -0.0120 27  HIS A ND1 
241  C  CD2 . HIS A 27  ? 0.0790 0.0885 0.0833 0.0024  -0.0032 0.0018  27  HIS A CD2 
242  C  CE1 . HIS A 27  ? 0.0774 0.1056 0.0801 0.0103  -0.0060 -0.0093 27  HIS A CE1 
243  N  NE2 . HIS A 27  ? 0.0828 0.1004 0.0782 0.0123  -0.0019 -0.0014 27  HIS A NE2 
244  N  N   . THR A 28  ? 0.0684 0.0932 0.0854 0.0005  0.0033  0.0042  28  THR A N   
245  C  CA  . THR A 28  ? 0.0704 0.1065 0.0895 -0.0038 0.0021  -0.0005 28  THR A CA  
246  C  C   . THR A 28  ? 0.0752 0.0946 0.0952 -0.0050 0.0101  0.0018  28  THR A C   
247  O  O   . THR A 28  ? 0.0776 0.1230 0.0992 -0.0078 0.0101  -0.0005 28  THR A O   
248  C  CB  . THR A 28  ? 0.0794 0.1121 0.1045 -0.0113 0.0085  0.0034  28  THR A CB  
249  O  OG1 . THR A 28  ? 0.1029 0.1069 0.1180 -0.0153 0.0070  0.0056  28  THR A OG1 
250  C  CG2 . THR A 28  ? 0.0834 0.1216 0.1075 -0.0068 0.0025  -0.0165 28  THR A CG2 
251  N  N   . LYS A 29  ? 0.0771 0.1013 0.0901 -0.0032 0.0100  0.0066  29  LYS A N   
252  C  CA  . LYS A 29  ? 0.0826 0.1039 0.0905 -0.0041 0.0109  0.0077  29  LYS A CA  
253  C  C   . LYS A 29  ? 0.0908 0.1016 0.0819 -0.0015 0.0057  0.0090  29  LYS A C   
254  O  O   . LYS A 29  ? 0.0931 0.1124 0.1151 -0.0110 0.0206  -0.0083 29  LYS A O   
255  C  CB  A LYS A 29  ? 0.1910 0.0948 0.0896 -0.0066 -0.0236 0.0017  29  LYS A CB  
256  C  CB  B LYS A 29  ? 0.0853 0.1008 0.0850 -0.0036 0.0305  0.0089  29  LYS A CB  
257  C  CG  A LYS A 29  ? 0.1315 0.1098 0.1180 -0.0057 0.0230  0.0133  29  LYS A CG  
258  C  CG  B LYS A 29  ? 0.1042 0.1096 0.1382 -0.0097 -0.0050 0.0010  29  LYS A CG  
259  C  CD  A LYS A 29  ? 0.1809 0.1020 0.2212 -0.0114 -0.0487 0.0106  29  LYS A CD  
260  C  CD  B LYS A 29  ? 0.1276 0.1654 0.2148 -0.0483 0.0296  -0.0118 29  LYS A CD  
261  C  CE  A LYS A 29  ? 0.2700 0.0851 0.3612 -0.0371 0.0095  0.0143  29  LYS A CE  
262  C  CE  B LYS A 29  ? 0.2108 0.1794 0.3619 -0.1012 0.0245  0.0408  29  LYS A CE  
263  N  NZ  A LYS A 29  ? 0.2565 0.4720 0.6196 -0.0287 0.1421  0.0343  29  LYS A NZ  
264  N  NZ  B LYS A 29  ? 0.5346 0.2364 0.6482 -0.1500 -0.1812 0.1628  29  LYS A NZ  
265  N  N   . HIS A 30  ? 0.0820 0.1068 0.0784 -0.0031 -0.0029 0.0109  30  HIS A N   
266  C  CA  . HIS A 30  ? 0.0865 0.1011 0.0762 -0.0075 -0.0033 0.0074  30  HIS A CA  
267  C  C   . HIS A 30  ? 0.0779 0.1015 0.0732 -0.0077 0.0012  -0.0006 30  HIS A C   
268  O  O   . HIS A 30  ? 0.0939 0.1028 0.0714 -0.0087 0.0051  -0.0029 30  HIS A O   
269  C  CB  . HIS A 30  ? 0.0827 0.1213 0.0850 -0.0035 -0.0032 0.0084  30  HIS A CB  
270  C  CG  . HIS A 30  ? 0.0861 0.1181 0.0824 -0.0090 -0.0100 0.0113  30  HIS A CG  
271  N  ND1 . HIS A 30  ? 0.1481 0.1194 0.1046 -0.0026 -0.0373 0.0065  30  HIS A ND1 
272  C  CD2 . HIS A 30  ? 0.0901 0.1288 0.0778 -0.0032 -0.0059 0.0015  30  HIS A CD2 
273  C  CE1 . HIS A 30  ? 0.1413 0.1153 0.0968 -0.0046 -0.0251 0.0141  30  HIS A CE1 
274  N  NE2 . HIS A 30  ? 0.0934 0.1286 0.0861 -0.0012 -0.0050 0.0130  30  HIS A NE2 
275  N  N   . HIS A 31  ? 0.0864 0.0844 0.0720 0.0002  0.0013  0.0013  31  HIS A N   
276  C  CA  . HIS A 31  ? 0.0759 0.0907 0.0648 -0.0038 -0.0003 -0.0019 31  HIS A CA  
277  C  C   . HIS A 31  ? 0.0871 0.0890 0.0630 -0.0024 0.0031  -0.0015 31  HIS A C   
278  O  O   . HIS A 31  ? 0.0755 0.1006 0.0790 0.0024  0.0068  -0.0075 31  HIS A O   
279  C  CB  . HIS A 31  ? 0.0772 0.0864 0.0676 0.0032  0.0036  -0.0031 31  HIS A CB  
280  C  CG  . HIS A 31  ? 0.0686 0.0879 0.0694 -0.0053 0.0017  -0.0068 31  HIS A CG  
281  N  ND1 . HIS A 31  ? 0.0698 0.0859 0.0685 -0.0036 0.0019  -0.0020 31  HIS A ND1 
282  C  CD2 . HIS A 31  ? 0.0757 0.0836 0.0738 0.0014  0.0013  -0.0001 31  HIS A CD2 
283  C  CE1 . HIS A 31  ? 0.0676 0.0864 0.0698 -0.0023 -0.0061 -0.0007 31  HIS A CE1 
284  N  NE2 . HIS A 31  ? 0.0715 0.0873 0.0792 0.0011  -0.0017 -0.0024 31  HIS A NE2 
285  N  N   . GLN A 32  ? 0.0805 0.0955 0.0725 -0.0017 0.0036  -0.0024 32  GLN A N   
286  C  CA  . GLN A 32  ? 0.0754 0.1041 0.0783 -0.0029 -0.0025 0.0026  32  GLN A CA  
287  C  C   . GLN A 32  ? 0.0719 0.1119 0.0756 -0.0085 0.0062  -0.0027 32  GLN A C   
288  O  O   . GLN A 32  ? 0.0703 0.1263 0.0797 0.0003  0.0002  -0.0062 32  GLN A O   
289  C  CB  . GLN A 32  ? 0.0928 0.1056 0.0846 -0.0088 -0.0001 -0.0070 32  GLN A CB  
290  C  CG  . GLN A 32  ? 0.0963 0.1382 0.0904 -0.0227 0.0094  -0.0192 32  GLN A CG  
291  C  CD  . GLN A 32  ? 0.0796 0.1295 0.1066 -0.0118 0.0012  -0.0178 32  GLN A CD  
292  O  OE1 . GLN A 32  ? 0.0938 0.1433 0.1040 -0.0004 -0.0019 -0.0171 32  GLN A OE1 
293  N  NE2 . GLN A 32  ? 0.1030 0.1475 0.1331 0.0032  -0.0034 -0.0275 32  GLN A NE2 
294  N  N   . THR A 33  ? 0.0760 0.1111 0.0769 -0.0052 0.0038  -0.0027 33  THR A N   
295  C  CA  . THR A 33  ? 0.0785 0.1296 0.0712 -0.0034 0.0061  0.0008  33  THR A CA  
296  C  C   . THR A 33  ? 0.0741 0.1181 0.0697 -0.0005 0.0006  -0.0010 33  THR A C   
297  O  O   . THR A 33  ? 0.0792 0.1340 0.0761 0.0013  0.0072  -0.0077 33  THR A O   
298  C  CB  . THR A 33  ? 0.1015 0.1287 0.0805 0.0024  0.0031  0.0085  33  THR A CB  
299  O  OG1 . THR A 33  ? 0.1671 0.1275 0.0920 -0.0186 -0.0045 0.0079  33  THR A OG1 
300  C  CG2 . THR A 33  ? 0.1228 0.1390 0.0807 0.0105  -0.0115 0.0015  33  THR A CG2 
301  N  N   . TYR A 34  ? 0.0665 0.1143 0.0736 -0.0002 -0.0017 -0.0070 34  TYR A N   
302  C  CA  . TYR A 34  ? 0.0713 0.1084 0.0736 0.0002  0.0048  -0.0092 34  TYR A CA  
303  C  C   . TYR A 34  ? 0.0777 0.1054 0.0811 -0.0002 0.0079  -0.0168 34  TYR A C   
304  O  O   . TYR A 34  ? 0.0773 0.1205 0.0955 0.0071  0.0103  -0.0184 34  TYR A O   
305  C  CB  . TYR A 34  ? 0.0719 0.1082 0.0842 0.0014  0.0029  -0.0092 34  TYR A CB  
306  C  CG  . TYR A 34  ? 0.0690 0.1129 0.0704 -0.0041 -0.0009 -0.0071 34  TYR A CG  
307  C  CD1 . TYR A 34  ? 0.0808 0.1374 0.0760 -0.0164 0.0045  -0.0202 34  TYR A CD1 
308  C  CD2 . TYR A 34  ? 0.0716 0.1216 0.0715 -0.0032 -0.0004 -0.0060 34  TYR A CD2 
309  C  CE1 . TYR A 34  ? 0.0857 0.1779 0.0698 -0.0178 -0.0066 0.0006  34  TYR A CE1 
310  C  CE2 . TYR A 34  ? 0.0699 0.1327 0.0845 0.0068  0.0049  0.0052  34  TYR A CE2 
311  C  CZ  . TYR A 34  ? 0.0665 0.1855 0.0771 -0.0115 -0.0045 0.0225  34  TYR A CZ  
312  O  OH  . TYR A 34  ? 0.0744 0.2291 0.0946 -0.0017 -0.0077 0.0470  34  TYR A OH  
313  N  N   . VAL A 35  ? 0.0696 0.1104 0.0860 0.0096  0.0039  -0.0121 35  VAL A N   
314  C  CA  . VAL A 35  ? 0.0725 0.1141 0.0889 0.0021  0.0062  -0.0117 35  VAL A CA  
315  C  C   . VAL A 35  ? 0.0728 0.1335 0.0985 0.0119  0.0029  -0.0224 35  VAL A C   
316  O  O   . VAL A 35  ? 0.0821 0.1476 0.1016 0.0239  -0.0021 -0.0232 35  VAL A O   
317  C  CB  . VAL A 35  ? 0.0742 0.1193 0.0848 0.0076  -0.0033 -0.0110 35  VAL A CB  
318  C  CG1 . VAL A 35  ? 0.0768 0.1444 0.1057 0.0152  -0.0111 -0.0124 35  VAL A CG1 
319  C  CG2 . VAL A 35  ? 0.0753 0.1810 0.0848 0.0155  -0.0032 -0.0097 35  VAL A CG2 
320  N  N   . ASN A 36  ? 0.0679 0.1388 0.0984 0.0017  0.0096  -0.0244 36  ASN A N   
321  C  CA  . ASN A 36  ? 0.0774 0.1598 0.0946 0.0017  0.0104  -0.0269 36  ASN A CA  
322  C  C   . ASN A 36  ? 0.0730 0.1521 0.0978 -0.0074 0.0198  -0.0171 36  ASN A C   
323  O  O   . ASN A 36  ? 0.0803 0.1633 0.1136 0.0038  0.0138  -0.0402 36  ASN A O   
324  C  CB  . ASN A 36  ? 0.0844 0.1577 0.1247 -0.0103 0.0253  -0.0243 36  ASN A CB  
325  C  CG  . ASN A 36  ? 0.0977 0.1657 0.1264 -0.0203 0.0277  -0.0188 36  ASN A CG  
326  O  OD1 . ASN A 36  ? 0.1116 0.1805 0.1314 -0.0198 0.0027  -0.0397 36  ASN A OD1 
327  N  ND2 . ASN A 36  ? 0.1326 0.1581 0.1500 -0.0263 0.0410  -0.0253 36  ASN A ND2 
328  N  N   . ASN A 37  ? 0.0777 0.1411 0.0940 0.0015  0.0091  -0.0281 37  ASN A N   
329  C  CA  . ASN A 37  ? 0.0820 0.1532 0.0997 0.0005  0.0111  -0.0340 37  ASN A CA  
330  C  C   . ASN A 37  ? 0.0851 0.1554 0.0900 0.0017  0.0026  -0.0302 37  ASN A C   
331  O  O   . ASN A 37  ? 0.1184 0.1576 0.1141 0.0096  0.0253  -0.0335 37  ASN A O   
332  C  CB  . ASN A 37  ? 0.0831 0.1759 0.1041 0.0085  0.0052  -0.0298 37  ASN A CB  
333  C  CG  . ASN A 37  ? 0.1176 0.1713 0.1177 0.0244  -0.0075 -0.0193 37  ASN A CG  
334  O  OD1 . ASN A 37  ? 0.1295 0.2121 0.1631 -0.0149 -0.0167 0.0171  37  ASN A OD1 
335  N  ND2 . ASN A 37  ? 0.1623 0.2196 0.1086 0.0601  -0.0212 -0.0185 37  ASN A ND2 
336  N  N   . ALA A 38  ? 0.0849 0.1471 0.0922 0.0050  0.0083  -0.0295 38  ALA A N   
337  C  CA  . ALA A 38  ? 0.0853 0.1455 0.1119 0.0212  0.0053  -0.0220 38  ALA A CA  
338  C  C   . ALA A 38  ? 0.0886 0.1609 0.1143 0.0191  -0.0016 -0.0490 38  ALA A C   
339  O  O   . ALA A 38  ? 0.0990 0.1543 0.1284 0.0219  0.0062  -0.0397 38  ALA A O   
340  C  CB  . ALA A 38  ? 0.0834 0.1466 0.0996 0.0200  -0.0038 -0.0106 38  ALA A CB  
341  N  N   . ASN A 39  ? 0.0743 0.1670 0.1394 0.0207  -0.0034 -0.0505 39  ASN A N   
342  C  CA  . ASN A 39  ? 0.0823 0.1752 0.1359 0.0258  -0.0041 -0.0587 39  ASN A CA  
343  C  C   . ASN A 39  ? 0.0757 0.1863 0.1440 0.0181  0.0032  -0.0586 39  ASN A C   
344  O  O   . ASN A 39  ? 0.1018 0.2405 0.1656 0.0584  -0.0043 -0.0775 39  ASN A O   
345  C  CB  . ASN A 39  ? 0.0780 0.1912 0.1408 0.0178  -0.0039 -0.0630 39  ASN A CB  
346  C  CG  . ASN A 39  ? 0.0890 0.1803 0.1452 0.0148  -0.0042 -0.0498 39  ASN A CG  
347  O  OD1 . ASN A 39  ? 0.1308 0.1936 0.1515 0.0095  0.0074  -0.0466 39  ASN A OD1 
348  N  ND2 . ASN A 39  ? 0.0834 0.1876 0.1471 0.0186  -0.0140 -0.0521 39  ASN A ND2 
349  N  N   . ALA A 40  ? 0.0914 0.1894 0.1479 0.0155  0.0190  -0.0489 40  ALA A N   
350  C  CA  . ALA A 40  ? 0.0883 0.2210 0.1555 0.0001  0.0311  -0.0623 40  ALA A CA  
351  C  C   . ALA A 40  ? 0.1094 0.2113 0.1357 0.0110  0.0212  -0.0669 40  ALA A C   
352  O  O   . ALA A 40  ? 0.1058 0.2423 0.2048 0.0237  0.0341  -0.0885 40  ALA A O   
353  C  CB  . ALA A 40  ? 0.1420 0.2145 0.1574 -0.0154 0.0501  -0.0467 40  ALA A CB  
354  N  N   . ALA A 41  ? 0.0993 0.2031 0.1453 0.0160  0.0137  -0.0670 41  ALA A N   
355  C  CA  . ALA A 41  ? 0.1168 0.2094 0.1431 0.0116  0.0107  -0.0789 41  ALA A CA  
356  C  C   . ALA A 41  ? 0.1114 0.1993 0.1598 0.0199  0.0139  -0.0825 41  ALA A C   
357  O  O   . ALA A 41  ? 0.1972 0.2176 0.1905 0.0430  0.0068  -0.0986 41  ALA A O   
358  C  CB  . ALA A 41  ? 0.1136 0.2373 0.1744 0.0122  0.0043  -0.0720 41  ALA A CB  
359  N  N   . LEU A 42  ? 0.1115 0.1845 0.1674 0.0420  0.0003  -0.0698 42  LEU A N   
360  C  CA  . LEU A 42  ? 0.1104 0.1907 0.1782 0.0254  0.0083  -0.0592 42  LEU A CA  
361  C  C   . LEU A 42  ? 0.1190 0.2253 0.1659 0.0579  0.0002  -0.0745 42  LEU A C   
362  O  O   . LEU A 42  ? 0.1400 0.2472 0.1649 0.0719  0.0011  -0.0582 42  LEU A O   
363  C  CB  . LEU A 42  ? 0.1294 0.1958 0.1703 0.0505  0.0155  -0.0555 42  LEU A CB  
364  C  CG  . LEU A 42  ? 0.1282 0.2069 0.1636 0.0566  0.0042  -0.0244 42  LEU A CG  
365  C  CD1 . LEU A 42  ? 0.1869 0.2122 0.1962 0.0647  0.0672  -0.0024 42  LEU A CD1 
366  C  CD2 . LEU A 42  ? 0.1306 0.2135 0.1950 0.0370  -0.0177 -0.0148 42  LEU A CD2 
367  N  N   . GLU A 43  ? 0.0962 0.2449 0.1912 0.0394  0.0052  -0.0648 43  GLU A N   
368  C  CA  . GLU A 43  ? 0.1042 0.3333 0.2003 0.0386  -0.0038 -0.0814 43  GLU A CA  
369  C  C   . GLU A 43  ? 0.1134 0.3595 0.1882 0.0842  0.0092  -0.0652 43  GLU A C   
370  O  O   . GLU A 43  ? 0.1438 0.4172 0.2143 0.1072  -0.0209 -0.0714 43  GLU A O   
371  C  CB  . GLU A 43  ? 0.1015 0.3809 0.3401 0.0336  0.0557  -0.0222 43  GLU A CB  
372  C  CG  . GLU A 43  ? 0.2270 0.3143 0.4327 0.0978  0.0774  0.0034  43  GLU A CG  
373  C  CD  . GLU A 43  ? 0.3179 0.5454 0.5373 -0.1044 -0.0350 -0.0764 43  GLU A CD  
374  O  OE1 . GLU A 43  ? 0.3864 0.8842 0.8296 -0.2443 0.0568  -0.0823 43  GLU A OE1 
375  O  OE2 . GLU A 43  ? 0.4945 0.7100 0.5984 -0.1347 -0.2397 -0.0085 43  GLU A OE2 
376  N  N   . SER A 44  ? 0.1394 0.2862 0.1574 0.0834  0.0148  -0.0462 44  SER A N   
377  C  CA  . SER A 44  ? 0.1660 0.2962 0.1891 0.1003  0.0328  -0.0446 44  SER A CA  
378  C  C   . SER A 44  ? 0.1557 0.2913 0.2038 0.0854  0.0324  -0.0552 44  SER A C   
379  O  O   . SER A 44  ? 0.2562 0.2938 0.1764 0.1326  0.0597  -0.0334 44  SER A O   
380  C  CB  . SER A 44  ? 0.1985 0.3166 0.1823 0.0615  0.0506  -0.0827 44  SER A CB  
381  O  OG  . SER A 44  ? 0.2107 0.3130 0.1892 0.0484  0.0147  -0.0748 44  SER A OG  
382  N  N   . LEU A 45  ? 0.1345 0.2654 0.1618 0.0842  0.0080  -0.0599 45  LEU A N   
383  C  CA  . LEU A 45  ? 0.1544 0.2648 0.1691 0.0681  -0.0013 -0.0618 45  LEU A CA  
384  C  C   . LEU A 45  ? 0.1232 0.3102 0.1604 0.0602  0.0112  -0.0451 45  LEU A C   
385  O  O   . LEU A 45  ? 0.1225 0.2711 0.1777 0.0444  0.0173  -0.0610 45  LEU A O   
386  C  CB  . LEU A 45  ? 0.1478 0.2030 0.2075 0.0469  -0.0254 -0.0616 45  LEU A CB  
387  C  CG  . LEU A 45  ? 0.2068 0.2400 0.2126 0.0766  -0.0455 -0.0760 45  LEU A CG  
388  C  CD1 . LEU A 45  ? 0.1778 0.2620 0.2046 0.0244  -0.0414 -0.0404 45  LEU A CD1 
389  C  CD2 . LEU A 45  ? 0.2622 0.2312 0.1984 0.0113  -0.0111 -0.0717 45  LEU A CD2 
390  N  N   . PRO A 46  ? 0.1237 0.4447 0.1700 0.0943  0.0269  0.0047  46  PRO A N   
391  C  CA  . PRO A 46  ? 0.1373 0.4799 0.1855 0.0795  0.0022  0.0037  46  PRO A CA  
392  C  C   . PRO A 46  ? 0.1445 0.4747 0.1552 0.1022  0.0084  0.0137  46  PRO A C   
393  O  O   . PRO A 46  ? 0.2053 0.7094 0.1573 0.0491  0.0213  -0.0241 46  PRO A O   
394  C  CB  . PRO A 46  ? 0.1391 0.6924 0.2155 0.1233  0.0226  0.0774  46  PRO A CB  
395  C  CG  . PRO A 46  ? 0.1816 0.6371 0.2418 0.2043  0.0564  0.0747  46  PRO A CG  
396  C  CD  . PRO A 46  ? 0.1422 0.5391 0.1995 0.1480  0.0392  0.0270  46  PRO A CD  
397  N  N   . GLU A 47  ? 0.1922 0.3817 0.2007 0.1304  0.0218  0.0357  47  GLU A N   
398  C  CA  . GLU A 47  ? 0.2479 0.3532 0.2394 0.1571  0.0428  0.0810  47  GLU A CA  
399  C  C   . GLU A 47  ? 0.1878 0.3773 0.1637 0.1178  -0.0013 0.0474  47  GLU A C   
400  O  O   . GLU A 47  ? 0.3215 0.5377 0.1823 0.1909  0.0885  0.1252  47  GLU A O   
401  C  CB  . GLU A 47  ? 0.3096 0.3362 0.3689 0.1574  0.0338  0.0613  47  GLU A CB  
402  C  CG  . GLU A 47  ? 0.3660 0.4276 0.3553 0.1515  0.0300  -0.0402 47  GLU A CG  
403  C  CD  . GLU A 47  ? 0.4269 0.5756 0.2992 0.0040  -0.0032 -0.0895 47  GLU A CD  
404  O  OE1 . GLU A 47  ? 0.3463 0.3564 0.3716 0.1418  0.0445  -0.1059 47  GLU A OE1 
405  O  OE2 . GLU A 47  ? 0.3813 0.6465 0.3321 0.1192  0.0023  -0.1991 47  GLU A OE2 
406  N  N   . PHE A 48  ? 0.1252 0.2197 0.1845 0.0450  -0.0180 -0.0483 48  PHE A N   
407  C  CA  . PHE A 48  ? 0.1225 0.2051 0.1714 0.0310  0.0179  -0.0215 48  PHE A CA  
408  C  C   . PHE A 48  ? 0.1209 0.2111 0.1359 0.0278  0.0125  -0.0235 48  PHE A C   
409  O  O   . PHE A 48  ? 0.1051 0.2330 0.1387 0.0346  0.0060  -0.0277 48  PHE A O   
410  C  CB  . PHE A 48  ? 0.1370 0.1999 0.2165 0.0534  -0.0331 -0.0606 48  PHE A CB  
411  C  CG  . PHE A 48  ? 0.1494 0.1988 0.2489 0.0588  -0.0162 -0.0699 48  PHE A CG  
412  C  CD1 . PHE A 48  ? 0.2093 0.2574 0.3258 -0.0129 0.0298  -0.1216 48  PHE A CD1 
413  C  CD2 . PHE A 48  ? 0.1962 0.2045 0.2232 0.0588  -0.0277 -0.0684 48  PHE A CD2 
414  C  CE1 . PHE A 48  ? 0.2613 0.2591 0.2816 -0.0241 0.0123  -0.1140 48  PHE A CE1 
415  C  CE2 . PHE A 48  ? 0.2095 0.1983 0.2830 0.0630  -0.0152 -0.0842 48  PHE A CE2 
416  C  CZ  . PHE A 48  ? 0.2270 0.2374 0.2772 0.0257  -0.0216 -0.0946 48  PHE A CZ  
417  N  N   . ALA A 49  ? 0.1224 0.2546 0.1629 0.0145  0.0251  -0.0483 49  ALA A N   
418  C  CA  . ALA A 49  ? 0.1200 0.2417 0.1481 0.0107  0.0152  -0.0248 49  ALA A CA  
419  C  C   . ALA A 49  ? 0.1118 0.2174 0.1365 0.0115  0.0071  -0.0060 49  ALA A C   
420  O  O   . ALA A 49  ? 0.1537 0.2433 0.1901 0.0103  0.0087  -0.0497 49  ALA A O   
421  C  CB  . ALA A 49  ? 0.1399 0.3117 0.1595 -0.0224 0.0291  -0.0328 49  ALA A CB  
422  N  N   . ASN A 50  ? 0.1026 0.2547 0.1829 0.0016  -0.0033 0.0305  50  ASN A N   
423  C  CA  . ASN A 50  ? 0.1269 0.2960 0.1859 -0.0359 -0.0190 0.0762  50  ASN A CA  
424  C  C   . ASN A 50  ? 0.1212 0.1974 0.1519 0.0056  -0.0270 0.0537  50  ASN A C   
425  O  O   . ASN A 50  ? 0.1533 0.1897 0.1473 -0.0037 -0.0385 0.0522  50  ASN A O   
426  C  CB  . ASN A 50  ? 0.1135 0.5073 0.3564 0.0609  -0.0472 0.1830  50  ASN A CB  
427  C  CG  . ASN A 50  ? 0.1490 0.6433 0.4757 0.0501  0.0061  0.3014  50  ASN A CG  
428  O  OD1 . ASN A 50  ? 0.3952 0.6991 0.3875 -0.1322 0.0875  0.1969  50  ASN A OD1 
429  N  ND2 . ASN A 50  ? 0.1997 0.7393 0.8629 0.1108  0.1537  0.0748  50  ASN A ND2 
430  N  N   . LEU A 51  ? 0.0997 0.1601 0.1532 0.0305  -0.0080 0.0145  51  LEU A N   
431  C  CA  . LEU A 51  ? 0.1091 0.1246 0.1246 0.0251  -0.0104 0.0116  51  LEU A CA  
432  C  C   . LEU A 51  ? 0.1034 0.1079 0.1053 0.0163  -0.0258 0.0073  51  LEU A C   
433  O  O   . LEU A 51  ? 0.1084 0.1232 0.1066 0.0099  -0.0096 0.0139  51  LEU A O   
434  C  CB  . LEU A 51  ? 0.1140 0.1115 0.1378 0.0164  -0.0166 0.0007  51  LEU A CB  
435  C  CG  . LEU A 51  ? 0.1575 0.1349 0.1517 0.0129  -0.0208 0.0118  51  LEU A CG  
436  C  CD1 . LEU A 51  ? 0.1868 0.1155 0.2308 0.0352  0.0133  0.0233  51  LEU A CD1 
437  C  CD2 . LEU A 51  ? 0.2331 0.1445 0.1955 -0.0018 -0.0585 -0.0299 51  LEU A CD2 
438  N  N   . PRO A 52  ? 0.0950 0.1017 0.1175 0.0124  -0.0136 0.0190  52  PRO A N   
439  C  CA  . PRO A 52  ? 0.0987 0.0957 0.1036 0.0103  -0.0209 0.0132  52  PRO A CA  
440  C  C   . PRO A 52  ? 0.0840 0.0936 0.0938 0.0041  -0.0138 0.0143  52  PRO A C   
441  O  O   . PRO A 52  ? 0.0947 0.0988 0.1087 0.0072  -0.0279 0.0127  52  PRO A O   
442  C  CB  . PRO A 52  ? 0.1022 0.1238 0.1008 0.0139  -0.0165 0.0211  52  PRO A CB  
443  C  CG  . PRO A 52  ? 0.1316 0.1260 0.1007 0.0092  -0.0245 0.0218  52  PRO A CG  
444  C  CD  . PRO A 52  ? 0.1095 0.1202 0.1182 0.0200  -0.0203 0.0305  52  PRO A CD  
445  N  N   . VAL A 53  ? 0.0893 0.0935 0.0867 0.0097  -0.0195 0.0088  53  VAL A N   
446  C  CA  . VAL A 53  ? 0.0831 0.0983 0.0909 0.0078  -0.0161 0.0131  53  VAL A CA  
447  C  C   . VAL A 53  ? 0.0862 0.1047 0.0913 0.0066  -0.0226 0.0100  53  VAL A C   
448  O  O   . VAL A 53  ? 0.0974 0.1086 0.1023 0.0105  -0.0183 0.0079  53  VAL A O   
449  C  CB  . VAL A 53  ? 0.0919 0.0976 0.0841 0.0108  -0.0098 0.0110  53  VAL A CB  
450  C  CG1 . VAL A 53  ? 0.1016 0.1113 0.0910 0.0200  0.0054  0.0123  53  VAL A CG1 
451  C  CG2 . VAL A 53  ? 0.1032 0.1054 0.0848 0.0158  -0.0144 0.0114  53  VAL A CG2 
452  N  N   . GLU A 54  ? 0.0860 0.1207 0.1002 0.0006  -0.0095 0.0222  54  GLU A N   
453  C  CA  . GLU A 54  ? 0.0808 0.1349 0.1186 0.0031  -0.0182 0.0266  54  GLU A CA  
454  C  C   . GLU A 54  ? 0.0949 0.1380 0.1192 -0.0043 -0.0211 0.0291  54  GLU A C   
455  O  O   . GLU A 54  ? 0.0960 0.1466 0.1779 -0.0137 -0.0306 0.0452  54  GLU A O   
456  C  CB  . GLU A 54  ? 0.0870 0.2300 0.1084 -0.0195 -0.0008 0.0194  54  GLU A CB  
457  C  CG  . GLU A 54  ? 0.1155 0.1610 0.1184 -0.0011 -0.0073 -0.0096 54  GLU A CG  
458  C  CD  . GLU A 54  ? 0.1361 0.1395 0.0992 -0.0013 -0.0068 -0.0002 54  GLU A CD  
459  O  OE1 . GLU A 54  ? 0.1008 0.1145 0.1066 0.0098  0.0035  -0.0073 54  GLU A OE1 
460  O  OE2 . GLU A 54  ? 0.1023 0.1392 0.0991 0.0094  -0.0095 0.0003  54  GLU A OE2 
461  N  N   . GLU A 55  ? 0.1013 0.1215 0.1179 -0.0053 -0.0322 0.0313  55  GLU A N   
462  C  CA  . GLU A 55  ? 0.1054 0.1206 0.1201 -0.0129 -0.0324 0.0304  55  GLU A CA  
463  C  C   . GLU A 55  ? 0.0896 0.1091 0.1439 -0.0049 -0.0358 0.0166  55  GLU A C   
464  O  O   . GLU A 55  ? 0.1338 0.1037 0.1432 -0.0075 -0.0531 0.0265  55  GLU A O   
465  C  CB  . GLU A 55  ? 0.1225 0.1198 0.1507 -0.0141 -0.0368 0.0493  55  GLU A CB  
466  C  CG  . GLU A 55  ? 0.1415 0.1218 0.1562 -0.0157 -0.0631 0.0378  55  GLU A CG  
467  C  CD  . GLU A 55  ? 0.1347 0.1230 0.1379 0.0027  -0.0448 0.0266  55  GLU A CD  
468  O  OE1 . GLU A 55  ? 0.1655 0.1369 0.1954 -0.0020 -0.0911 0.0294  55  GLU A OE1 
469  O  OE2 . GLU A 55  ? 0.1814 0.1338 0.1408 0.0182  -0.0584 0.0286  55  GLU A OE2 
470  N  N   . LEU A 56  ? 0.0991 0.1136 0.1157 0.0016  -0.0317 0.0122  56  LEU A N   
471  C  CA  . LEU A 56  ? 0.1049 0.0938 0.1354 0.0129  -0.0254 0.0001  56  LEU A CA  
472  C  C   . LEU A 56  ? 0.1162 0.1001 0.1082 0.0042  -0.0295 -0.0014 56  LEU A C   
473  O  O   . LEU A 56  ? 0.1359 0.1085 0.1253 0.0152  -0.0376 -0.0089 56  LEU A O   
474  C  CB  . LEU A 56  ? 0.1057 0.1221 0.1146 0.0157  -0.0223 -0.0011 56  LEU A CB  
475  C  CG  . LEU A 56  ? 0.1451 0.1782 0.1382 0.0495  0.0184  0.0075  56  LEU A CG  
476  C  CD1 . LEU A 56  ? 0.2317 0.1974 0.1682 0.0680  0.0046  -0.0282 56  LEU A CD1 
477  C  CD2 . LEU A 56  ? 0.2286 0.2158 0.1218 -0.0132 0.0193  -0.0178 56  LEU A CD2 
478  N  N   . ILE A 57  ? 0.1047 0.0983 0.1068 0.0091  -0.0262 0.0118  57  ILE A N   
479  C  CA  . ILE A 57  ? 0.1028 0.0946 0.1282 -0.0045 -0.0385 0.0141  57  ILE A CA  
480  C  C   . ILE A 57  ? 0.1192 0.0948 0.1380 -0.0065 -0.0349 0.0207  57  ILE A C   
481  O  O   . ILE A 57  ? 0.1222 0.1104 0.1648 -0.0126 -0.0612 0.0194  57  ILE A O   
482  C  CB  . ILE A 57  ? 0.0970 0.0967 0.1313 0.0020  -0.0314 0.0058  57  ILE A CB  
483  C  CG1 . ILE A 57  ? 0.0948 0.1236 0.1216 -0.0010 -0.0297 0.0237  57  ILE A CG1 
484  C  CG2 . ILE A 57  ? 0.1106 0.0950 0.1484 -0.0083 -0.0325 0.0206  57  ILE A CG2 
485  C  CD1 . ILE A 57  ? 0.1148 0.1139 0.1687 -0.0073 0.0000  -0.0083 57  ILE A CD1 
486  N  N   . THR A 58  ? 0.1291 0.0981 0.1349 -0.0094 -0.0452 0.0174  58  THR A N   
487  C  CA  . THR A 58  ? 0.1302 0.1059 0.1412 -0.0133 -0.0347 0.0224  58  THR A CA  
488  C  C   . THR A 58  ? 0.1527 0.1229 0.1532 -0.0195 -0.0288 0.0070  58  THR A C   
489  O  O   . THR A 58  ? 0.2020 0.1064 0.1854 -0.0237 -0.0262 0.0098  58  THR A O   
490  C  CB  . THR A 58  ? 0.1248 0.1193 0.1407 -0.0120 -0.0323 0.0266  58  THR A CB  
491  O  OG1 . THR A 58  ? 0.1421 0.1219 0.1501 -0.0025 -0.0375 0.0269  58  THR A OG1 
492  C  CG2 . THR A 58  ? 0.1359 0.1188 0.1380 -0.0173 -0.0224 0.0239  58  THR A CG2 
493  N  N   . LYS A 59  ? 0.1579 0.0982 0.1683 0.0122  -0.0217 0.0144  59  LYS A N   
494  C  CA  . LYS A 59  ? 0.1958 0.1180 0.1516 0.0174  -0.0393 -0.0041 59  LYS A CA  
495  C  C   . LYS A 59  ? 0.1390 0.1188 0.1761 0.0046  -0.0200 -0.0073 59  LYS A C   
496  O  O   . LYS A 59  ? 0.1520 0.1392 0.2303 0.0247  -0.0093 -0.0205 59  LYS A O   
497  C  CB  . LYS A 59  ? 0.2013 0.1317 0.1831 0.0511  -0.0238 0.0055  59  LYS A CB  
498  C  CG  . LYS A 59  ? 0.2359 0.1653 0.1512 0.0484  -0.0308 0.0047  59  LYS A CG  
499  C  CD  . LYS A 59  ? 0.2606 0.1995 0.2144 0.0494  -0.0650 0.0302  59  LYS A CD  
500  C  CE  . LYS A 59  ? 0.3915 0.1806 0.2042 0.0018  -0.1140 0.0365  59  LYS A CE  
501  N  NZ  . LYS A 59  ? 0.5048 0.2818 0.2212 0.0400  -0.1795 0.0128  59  LYS A NZ  
502  N  N   . LEU A 60  ? 0.1522 0.1114 0.1492 0.0163  -0.0170 -0.0040 60  LEU A N   
503  C  CA  . LEU A 60  ? 0.1413 0.1112 0.1459 0.0068  0.0011  -0.0214 60  LEU A CA  
504  C  C   . LEU A 60  ? 0.1755 0.1272 0.1682 0.0122  0.0128  -0.0312 60  LEU A C   
505  O  O   . LEU A 60  ? 0.1925 0.1193 0.1629 0.0259  0.0059  -0.0256 60  LEU A O   
506  C  CB  . LEU A 60  ? 0.1479 0.1158 0.1657 0.0263  0.0073  -0.0016 60  LEU A CB  
507  C  CG  . LEU A 60  ? 0.1563 0.1113 0.1379 0.0272  0.0023  0.0072  60  LEU A CG  
508  C  CD1 . LEU A 60  ? 0.1654 0.1226 0.1671 0.0457  0.0382  0.0226  60  LEU A CD1 
509  C  CD2 . LEU A 60  ? 0.1619 0.1242 0.2375 0.0107  0.0261  -0.0395 60  LEU A CD2 
510  N  N   . ASP A 61  ? 0.1671 0.1200 0.2168 0.0024  0.0102  -0.0370 61  ASP A N   
511  C  CA  . ASP A 61  ? 0.2121 0.1450 0.2119 -0.0001 -0.0023 -0.0461 61  ASP A CA  
512  C  C   . ASP A 61  ? 0.2612 0.1366 0.2008 0.0404  0.0044  -0.0532 61  ASP A C   
513  O  O   . ASP A 61  ? 0.2806 0.1984 0.2062 0.0332  0.0031  -0.0614 61  ASP A O   
514  C  CB  A ASP A 61  ? 0.2669 0.1633 0.2249 -0.0478 -0.0293 -0.0349 61  ASP A CB  
515  C  CB  B ASP A 61  ? 0.2805 0.1173 0.2069 -0.0139 0.0203  -0.0377 61  ASP A CB  
516  C  CG  A ASP A 61  ? 0.3320 0.1517 0.2049 0.0059  0.0187  -0.0467 61  ASP A CG  
517  C  CG  B ASP A 61  ? 0.3188 0.1612 0.2209 -0.0575 -0.0604 -0.0078 61  ASP A CG  
518  O  OD1 A ASP A 61  ? 0.2014 0.2275 0.2587 -0.0062 0.0184  -0.1189 61  ASP A OD1 
519  O  OD1 B ASP A 61  ? 0.3682 0.3960 0.2377 -0.1605 0.0035  -0.1229 61  ASP A OD1 
520  O  OD2 A ASP A 61  ? 0.4466 0.2190 0.2476 0.1321  -0.0301 -0.0505 61  ASP A OD2 
521  O  OD2 B ASP A 61  ? 0.3053 0.1693 0.2780 -0.0376 -0.0801 0.0550  61  ASP A OD2 
522  N  N   . GLN A 62  ? 0.2093 0.1279 0.2210 0.0251  0.0080  -0.0222 62  GLN A N   
523  C  CA  . GLN A 62  ? 0.2262 0.1255 0.2954 0.0335  0.0213  -0.0327 62  GLN A CA  
524  C  C   . GLN A 62  ? 0.1743 0.1395 0.2471 0.0530  -0.0197 -0.0405 62  GLN A C   
525  O  O   . GLN A 62  ? 0.2116 0.1661 0.3159 0.0579  0.0262  -0.0562 62  GLN A O   
526  C  CB  . GLN A 62  ? 0.2203 0.2361 0.3103 0.1008  0.0239  0.0533  62  GLN A CB  
527  C  CG  . GLN A 62  ? 0.3452 0.2080 0.3695 0.0466  0.0189  0.0699  62  GLN A CG  
528  C  CD  . GLN A 62  ? 0.3699 0.2308 0.3145 0.1307  0.0800  0.0541  62  GLN A CD  
529  O  OE1 . GLN A 62  ? 0.5169 0.2457 0.3783 0.0924  0.1603  0.0489  62  GLN A OE1 
530  N  NE2 . GLN A 62  ? 0.3959 0.3333 0.3053 0.1278  0.0045  0.1031  62  GLN A NE2 
531  N  N   . LEU A 63  ? 0.1797 0.1469 0.2141 0.0337  0.0071  -0.0370 63  LEU A N   
532  C  CA  . LEU A 63  ? 0.1642 0.1550 0.2207 0.0342  0.0196  -0.0529 63  LEU A CA  
533  C  C   . LEU A 63  ? 0.1827 0.1611 0.2233 0.0458  0.0199  -0.0465 63  LEU A C   
534  O  O   . LEU A 63  ? 0.2284 0.1889 0.2342 -0.0050 0.0432  -0.0799 63  LEU A O   
535  C  CB  . LEU A 63  ? 0.1720 0.1548 0.1894 0.0276  0.0046  -0.0405 63  LEU A CB  
536  C  CG  . LEU A 63  ? 0.1663 0.1402 0.1785 0.0339  -0.0057 -0.0232 63  LEU A CG  
537  C  CD1 . LEU A 63  ? 0.1826 0.1355 0.1598 0.0326  0.0013  -0.0244 63  LEU A CD1 
538  C  CD2 . LEU A 63  ? 0.1688 0.1700 0.2080 0.0361  -0.0163 -0.0421 63  LEU A CD2 
539  N  N   . PRO A 64  ? 0.1971 0.1904 0.2465 0.0132  0.0421  -0.1109 64  PRO A N   
540  C  CA  . PRO A 64  ? 0.1857 0.1971 0.2367 0.0240  0.0261  -0.0836 64  PRO A CA  
541  C  C   . PRO A 64  ? 0.1766 0.1707 0.2869 0.0205  0.0023  -0.1157 64  PRO A C   
542  O  O   . PRO A 64  ? 0.1847 0.1839 0.2599 0.0202  0.0370  -0.1172 64  PRO A O   
543  C  CB  . PRO A 64  ? 0.1782 0.2691 0.2518 0.0234  0.0385  -0.1175 64  PRO A CB  
544  C  CG  . PRO A 64  ? 0.1621 0.3578 0.2900 0.0646  0.0159  -0.1298 64  PRO A CG  
545  C  CD  . PRO A 64  ? 0.1867 0.2101 0.2448 0.0417  0.0225  -0.1010 64  PRO A CD  
546  N  N   . ALA A 65  ? 0.1743 0.2101 0.3095 0.0437  -0.0145 -0.1575 65  ALA A N   
547  C  CA  . ALA A 65  ? 0.1613 0.2141 0.3883 0.0415  -0.0592 -0.1831 65  ALA A CA  
548  C  C   . ALA A 65  ? 0.1699 0.2350 0.2622 0.0421  -0.0110 -0.1558 65  ALA A C   
549  O  O   . ALA A 65  ? 0.1716 0.2152 0.2505 0.0273  -0.0225 -0.1199 65  ALA A O   
550  C  CB  . ALA A 65  ? 0.3118 0.2690 0.4532 0.1091  -0.1645 -0.2454 65  ALA A CB  
551  N  N   . ASP A 66  ? 0.1811 0.2978 0.2332 0.0325  0.0067  -0.1703 66  ASP A N   
552  C  CA  . ASP A 66  ? 0.2167 0.3344 0.1805 0.0060  0.0179  -0.1347 66  ASP A CA  
553  C  C   . ASP A 66  ? 0.1538 0.2563 0.1655 0.0328  0.0059  -0.0869 66  ASP A C   
554  O  O   . ASP A 66  ? 0.1954 0.2812 0.1713 -0.0034 0.0058  -0.0754 66  ASP A O   
555  C  CB  . ASP A 66  ? 0.2601 0.3922 0.2323 -0.0027 0.0662  -0.1719 66  ASP A CB  
556  C  CG  . ASP A 66  ? 0.2173 0.6148 0.2554 0.0130  0.0725  -0.1777 66  ASP A CG  
557  O  OD1 . ASP A 66  ? 0.3191 0.3869 0.2767 0.0497  0.0331  -0.1720 66  ASP A OD1 
558  O  OD2 . ASP A 66  ? 0.2624 1.1193 0.3719 0.0679  0.1358  -0.1863 66  ASP A OD2 
559  N  N   . LYS A 67  ? 0.1428 0.2349 0.1623 0.0095  0.0191  -0.1002 67  LYS A N   
560  C  CA  . LYS A 67  ? 0.1487 0.1697 0.1624 0.0226  0.0059  -0.0770 67  LYS A CA  
561  C  C   . LYS A 67  ? 0.1347 0.1358 0.1392 0.0197  0.0049  -0.0477 67  LYS A C   
562  O  O   . LYS A 67  ? 0.1453 0.1378 0.1520 0.0233  -0.0050 -0.0640 67  LYS A O   
563  C  CB  . LYS A 67  ? 0.1308 0.2134 0.1965 0.0505  -0.0167 -0.0962 67  LYS A CB  
564  C  CG  . LYS A 67  ? 0.1595 0.2319 0.1961 0.0329  0.0049  -0.0891 67  LYS A CG  
565  C  CD  . LYS A 67  ? 0.1544 0.2439 0.2298 0.0218  0.0330  -0.0904 67  LYS A CD  
566  C  CE  . LYS A 67  ? 0.1667 0.2424 0.2106 0.0254  0.0308  -0.0942 67  LYS A CE  
567  N  NZ  . LYS A 67  ? 0.1800 0.2649 0.2417 -0.0124 0.0588  -0.1127 67  LYS A NZ  
568  N  N   . LYS A 68  ? 0.1368 0.1623 0.1482 0.0221  -0.0079 -0.0805 68  LYS A N   
569  C  CA  . LYS A 68  ? 0.1386 0.1174 0.1621 0.0244  0.0031  -0.0477 68  LYS A CA  
570  C  C   . LYS A 68  ? 0.1313 0.1118 0.1302 0.0138  -0.0001 -0.0394 68  LYS A C   
571  O  O   . LYS A 68  ? 0.1554 0.1148 0.1379 0.0283  0.0169  -0.0332 68  LYS A O   
572  C  CB  A LYS A 68  ? 0.1663 0.1193 0.1746 0.0131  0.0194  -0.0724 68  LYS A CB  
573  C  CB  B LYS A 68  ? 0.1656 0.1123 0.2209 0.0134  -0.0246 -0.0391 68  LYS A CB  
574  C  CG  A LYS A 68  ? 0.1375 0.1731 0.1574 0.0142  0.0008  -0.0695 68  LYS A CG  
575  C  CG  B LYS A 68  ? 0.2467 0.1106 0.2353 0.0271  -0.0599 -0.0337 68  LYS A CG  
576  C  CD  A LYS A 68  ? 0.1831 0.1305 0.1291 -0.0019 0.0069  -0.0260 68  LYS A CD  
577  C  CD  B LYS A 68  ? 0.3529 0.1232 0.2435 0.0148  -0.1235 -0.0278 68  LYS A CD  
578  C  CE  A LYS A 68  ? 0.1641 0.2066 0.1798 -0.0365 -0.0028 -0.0264 68  LYS A CE  
579  C  CE  B LYS A 68  ? 0.3285 0.1035 0.2750 0.0539  -0.1261 -0.0607 68  LYS A CE  
580  N  NZ  A LYS A 68  ? 0.1739 0.2232 0.2616 -0.0222 0.0347  -0.1272 68  LYS A NZ  
581  N  NZ  B LYS A 68  ? 0.1444 0.1106 0.1411 0.0133  0.0230  -0.0205 68  LYS A NZ  
582  N  NZ  C LYS A 68  ? 0.2852 0.0750 0.1537 -0.0036 -0.0735 -0.0249 68  LYS A NZ  
583  N  N   . THR A 69  ? 0.1256 0.1346 0.1242 0.0255  -0.0063 -0.0534 69  THR A N   
584  C  CA  . THR A 69  ? 0.1225 0.1293 0.1221 0.0168  -0.0084 -0.0449 69  THR A CA  
585  C  C   . THR A 69  ? 0.1140 0.1189 0.1020 0.0149  0.0069  -0.0313 69  THR A C   
586  O  O   . THR A 69  ? 0.1008 0.1187 0.0888 0.0092  0.0038  -0.0271 69  THR A O   
587  C  CB  . THR A 69  ? 0.1557 0.1534 0.1215 0.0244  -0.0269 -0.0556 69  THR A CB  
588  O  OG1 . THR A 69  ? 0.1898 0.1702 0.1831 0.0313  -0.0674 -0.0881 69  THR A OG1 
589  C  CG2 . THR A 69  ? 0.2217 0.1501 0.1402 0.0389  -0.0377 -0.0460 69  THR A CG2 
590  N  N   . VAL A 70  ? 0.1095 0.1345 0.1013 0.0136  0.0039  -0.0449 70  VAL A N   
591  C  CA  . VAL A 70  ? 0.1091 0.1311 0.0983 0.0080  0.0100  -0.0341 70  VAL A CA  
592  C  C   . VAL A 70  ? 0.0908 0.1196 0.0965 -0.0056 0.0138  -0.0281 70  VAL A C   
593  O  O   . VAL A 70  ? 0.0991 0.1067 0.0934 0.0006  0.0109  -0.0234 70  VAL A O   
594  C  CB  . VAL A 70  ? 0.1119 0.1653 0.1251 0.0000  0.0344  -0.0443 70  VAL A CB  
595  C  CG1 . VAL A 70  ? 0.1113 0.1797 0.1656 0.0049  0.0333  -0.0555 70  VAL A CG1 
596  C  CG2 . VAL A 70  ? 0.1213 0.1798 0.1605 -0.0226 0.0528  -0.0501 70  VAL A CG2 
597  N  N   . LEU A 71  ? 0.1037 0.1157 0.1005 0.0212  0.0005  -0.0328 71  LEU A N   
598  C  CA  . LEU A 71  ? 0.1002 0.1109 0.0955 0.0153  -0.0117 -0.0210 71  LEU A CA  
599  C  C   . LEU A 71  ? 0.1053 0.0904 0.0988 0.0129  -0.0061 -0.0130 71  LEU A C   
600  O  O   . LEU A 71  ? 0.1041 0.0999 0.0881 0.0155  -0.0125 -0.0204 71  LEU A O   
601  C  CB  . LEU A 71  ? 0.1082 0.1260 0.1147 0.0275  -0.0183 -0.0299 71  LEU A CB  
602  C  CG  . LEU A 71  ? 0.1024 0.1620 0.1363 0.0344  -0.0093 -0.0250 71  LEU A CG  
603  C  CD1 . LEU A 71  ? 0.1206 0.1719 0.1875 0.0414  -0.0118 -0.0648 71  LEU A CD1 
604  C  CD2 . LEU A 71  ? 0.1021 0.1580 0.1803 0.0249  -0.0228 -0.0488 71  LEU A CD2 
605  N  N   . ARG A 72  ? 0.1002 0.1027 0.0984 0.0140  -0.0055 -0.0283 72  ARG A N   
606  C  CA  . ARG A 72  ? 0.1045 0.0934 0.0851 0.0016  0.0042  -0.0179 72  ARG A CA  
607  C  C   . ARG A 72  ? 0.0910 0.0949 0.0887 -0.0014 -0.0012 -0.0097 72  ARG A C   
608  O  O   . ARG A 72  ? 0.0940 0.0962 0.0769 0.0058  0.0042  -0.0100 72  ARG A O   
609  C  CB  . ARG A 72  ? 0.1048 0.1015 0.0934 0.0011  -0.0070 -0.0156 72  ARG A CB  
610  C  CG  . ARG A 72  ? 0.1049 0.1063 0.0881 -0.0073 0.0031  -0.0224 72  ARG A CG  
611  C  CD  . ARG A 72  ? 0.0990 0.1226 0.1064 -0.0064 0.0031  -0.0287 72  ARG A CD  
612  N  NE  . ARG A 72  ? 0.1034 0.1178 0.0935 -0.0026 0.0048  -0.0345 72  ARG A NE  
613  C  CZ  . ARG A 72  ? 0.1095 0.1189 0.1042 -0.0099 0.0041  -0.0352 72  ARG A CZ  
614  N  NH1 . ARG A 72  ? 0.1193 0.1677 0.1175 0.0093  -0.0129 -0.0698 72  ARG A NH1 
615  N  NH2 . ARG A 72  ? 0.1037 0.1483 0.1167 -0.0066 -0.0014 -0.0469 72  ARG A NH2 
616  N  N   . ASN A 73  ? 0.0823 0.0917 0.0771 0.0019  -0.0028 -0.0127 73  ASN A N   
617  C  CA  . ASN A 73  ? 0.0781 0.0922 0.0772 0.0002  0.0031  -0.0156 73  ASN A CA  
618  C  C   . ASN A 73  ? 0.0768 0.0960 0.0732 0.0014  0.0068  -0.0052 73  ASN A C   
619  O  O   . ASN A 73  ? 0.0747 0.1028 0.0715 0.0092  0.0016  -0.0165 73  ASN A O   
620  C  CB  . ASN A 73  ? 0.0795 0.1016 0.0769 0.0052  0.0029  -0.0061 73  ASN A CB  
621  C  CG  . ASN A 73  ? 0.0829 0.1003 0.0792 0.0128  0.0030  -0.0145 73  ASN A CG  
622  O  OD1 . ASN A 73  ? 0.0812 0.1274 0.0846 0.0025  0.0003  -0.0263 73  ASN A OD1 
623  N  ND2 . ASN A 73  ? 0.1000 0.1165 0.0761 0.0219  -0.0022 -0.0136 73  ASN A ND2 
624  N  N   . ASN A 74  ? 0.0720 0.0959 0.0761 0.0050  0.0039  -0.0180 74  ASN A N   
625  C  CA  . ASN A 74  ? 0.0684 0.1064 0.0756 0.0049  0.0017  -0.0166 74  ASN A CA  
626  C  C   . ASN A 74  ? 0.0659 0.0906 0.0856 -0.0006 0.0046  -0.0127 74  ASN A C   
627  O  O   . ASN A 74  ? 0.0780 0.0959 0.0764 0.0035  0.0022  -0.0128 74  ASN A O   
628  C  CB  . ASN A 74  ? 0.0724 0.1147 0.0830 -0.0010 0.0084  -0.0098 74  ASN A CB  
629  C  CG  . ASN A 74  ? 0.0759 0.1154 0.0887 -0.0043 0.0070  -0.0149 74  ASN A CG  
630  O  OD1 . ASN A 74  ? 0.0947 0.1133 0.0902 0.0000  0.0094  -0.0122 74  ASN A OD1 
631  N  ND2 . ASN A 74  ? 0.1046 0.1209 0.0810 -0.0003 0.0130  -0.0111 74  ASN A ND2 
632  N  N   . ALA A 75  ? 0.0773 0.1027 0.0757 0.0109  -0.0033 -0.0169 75  ALA A N   
633  C  CA  . ALA A 75  ? 0.0795 0.0962 0.0744 0.0104  -0.0071 -0.0143 75  ALA A CA  
634  C  C   . ALA A 75  ? 0.0796 0.0786 0.0855 0.0109  -0.0076 -0.0066 75  ALA A C   
635  O  O   . ALA A 75  ? 0.0832 0.0858 0.0704 0.0133  -0.0031 -0.0036 75  ALA A O   
636  C  CB  . ALA A 75  ? 0.0880 0.0938 0.1024 0.0197  -0.0045 -0.0132 75  ALA A CB  
637  N  N   . GLY A 76  ? 0.0758 0.0916 0.0740 0.0088  -0.0013 -0.0131 76  GLY A N   
638  C  CA  . GLY A 76  ? 0.0700 0.0965 0.0703 0.0035  -0.0042 -0.0069 76  GLY A CA  
639  C  C   . GLY A 76  ? 0.0653 0.0923 0.0681 0.0070  -0.0042 -0.0054 76  GLY A C   
640  O  O   . GLY A 76  ? 0.0677 0.0965 0.0708 0.0064  0.0000  -0.0044 76  GLY A O   
641  N  N   . GLY A 77  ? 0.0690 0.0920 0.0660 0.0110  -0.0046 -0.0066 77  GLY A N   
642  C  CA  . GLY A 77  ? 0.0694 0.0910 0.0670 0.0094  -0.0054 -0.0037 77  GLY A CA  
643  C  C   . GLY A 77  ? 0.0675 0.0846 0.0672 0.0067  -0.0031 -0.0053 77  GLY A C   
644  O  O   . GLY A 77  ? 0.0730 0.0855 0.0749 0.0123  -0.0009 -0.0094 77  GLY A O   
645  N  N   . HIS A 78  ? 0.0646 0.0864 0.0709 0.0068  -0.0045 -0.0107 78  HIS A N   
646  C  CA  . HIS A 78  ? 0.0663 0.0855 0.0674 0.0078  -0.0011 -0.0070 78  HIS A CA  
647  C  C   . HIS A 78  ? 0.0661 0.0827 0.0779 0.0116  -0.0004 -0.0011 78  HIS A C   
648  O  O   . HIS A 78  ? 0.0661 0.0938 0.0679 0.0042  -0.0008 -0.0104 78  HIS A O   
649  C  CB  . HIS A 78  ? 0.0640 0.0871 0.0735 0.0070  -0.0005 -0.0045 78  HIS A CB  
650  C  CG  . HIS A 78  ? 0.0667 0.0907 0.0771 0.0036  -0.0066 -0.0032 78  HIS A CG  
651  N  ND1 . HIS A 78  ? 0.0748 0.0958 0.0783 0.0083  -0.0030 -0.0078 78  HIS A ND1 
652  C  CD2 . HIS A 78  ? 0.0794 0.0951 0.0936 0.0117  -0.0100 -0.0042 78  HIS A CD2 
653  C  CE1 . HIS A 78  ? 0.0789 0.0931 0.0882 0.0054  -0.0088 -0.0078 78  HIS A CE1 
654  N  NE2 . HIS A 78  ? 0.0756 0.1010 0.0958 0.0085  -0.0124 -0.0084 78  HIS A NE2 
655  N  N   . ALA A 79  ? 0.0693 0.0840 0.0671 0.0073  -0.0052 -0.0032 79  ALA A N   
656  C  CA  . ALA A 79  ? 0.0741 0.0792 0.0716 0.0059  0.0019  0.0030  79  ALA A CA  
657  C  C   . ALA A 79  ? 0.0639 0.0795 0.0739 0.0055  -0.0034 -0.0017 79  ALA A C   
658  O  O   . ALA A 79  ? 0.0700 0.0898 0.0683 0.0039  -0.0010 -0.0029 79  ALA A O   
659  C  CB  . ALA A 79  ? 0.0852 0.0797 0.0830 0.0047  0.0018  0.0013  79  ALA A CB  
660  N  N   . ASN A 80  ? 0.0641 0.0811 0.0714 0.0065  -0.0017 -0.0014 80  ASN A N   
661  C  CA  . ASN A 80  ? 0.0607 0.0876 0.0640 0.0061  -0.0046 -0.0028 80  ASN A CA  
662  C  C   . ASN A 80  ? 0.0639 0.0860 0.0652 0.0097  -0.0052 0.0002  80  ASN A C   
663  O  O   . ASN A 80  ? 0.0677 0.0889 0.0655 0.0017  0.0015  -0.0068 80  ASN A O   
664  C  CB  . ASN A 80  ? 0.0673 0.0804 0.0654 0.0090  -0.0038 -0.0027 80  ASN A CB  
665  C  CG  . ASN A 80  ? 0.0739 0.0837 0.0688 0.0032  -0.0022 -0.0021 80  ASN A CG  
666  O  OD1 . ASN A 80  ? 0.0913 0.0843 0.0740 -0.0032 -0.0038 -0.0054 80  ASN A OD1 
667  N  ND2 . ASN A 80  ? 0.1115 0.0947 0.0698 0.0042  -0.0164 -0.0056 80  ASN A ND2 
668  N  N   . HIS A 81  ? 0.0623 0.0808 0.0671 0.0037  -0.0016 -0.0072 81  HIS A N   
669  C  CA  . HIS A 81  ? 0.0610 0.0805 0.0604 0.0047  -0.0018 -0.0010 81  HIS A CA  
670  C  C   . HIS A 81  ? 0.0668 0.0768 0.0674 -0.0045 -0.0008 0.0006  81  HIS A C   
671  O  O   . HIS A 81  ? 0.0684 0.0828 0.0614 0.0019  -0.0057 -0.0071 81  HIS A O   
672  C  CB  . HIS A 81  ? 0.0669 0.0834 0.0721 0.0049  -0.0015 -0.0011 81  HIS A CB  
673  C  CG  . HIS A 81  ? 0.0699 0.0788 0.0677 0.0032  0.0001  0.0021  81  HIS A CG  
674  N  ND1 . HIS A 81  ? 0.0692 0.0863 0.0725 0.0100  -0.0061 -0.0037 81  HIS A ND1 
675  C  CD2 . HIS A 81  ? 0.0735 0.0916 0.0646 0.0055  -0.0091 -0.0053 81  HIS A CD2 
676  C  CE1 . HIS A 81  ? 0.0759 0.0980 0.0636 0.0067  -0.0030 -0.0094 81  HIS A CE1 
677  N  NE2 . HIS A 81  ? 0.0724 0.0974 0.0661 0.0036  -0.0039 -0.0014 81  HIS A NE2 
678  N  N   . SER A 82  ? 0.0658 0.0815 0.0606 0.0021  -0.0064 -0.0001 82  SER A N   
679  C  CA  . SER A 82  ? 0.0622 0.0832 0.0689 0.0001  -0.0065 0.0019  82  SER A CA  
680  C  C   . SER A 82  ? 0.0690 0.0772 0.0652 0.0009  -0.0096 0.0031  82  SER A C   
681  O  O   . SER A 82  ? 0.0771 0.0890 0.0638 -0.0031 -0.0039 -0.0053 82  SER A O   
682  C  CB  . SER A 82  ? 0.0674 0.0886 0.0710 0.0020  -0.0018 0.0020  82  SER A CB  
683  O  OG  . SER A 82  ? 0.0672 0.1008 0.0765 0.0065  -0.0027 -0.0016 82  SER A OG  
684  N  N   . LEU A 83  ? 0.0688 0.0772 0.0641 -0.0007 -0.0003 -0.0071 83  LEU A N   
685  C  CA  . LEU A 83  ? 0.0713 0.0782 0.0673 0.0041  0.0024  -0.0006 83  LEU A CA  
686  C  C   . LEU A 83  ? 0.0685 0.0711 0.0735 -0.0023 0.0012  -0.0050 83  LEU A C   
687  O  O   . LEU A 83  ? 0.0740 0.0818 0.0666 -0.0026 0.0029  -0.0052 83  LEU A O   
688  C  CB  . LEU A 83  ? 0.0764 0.0784 0.0783 -0.0034 0.0053  -0.0094 83  LEU A CB  
689  C  CG  . LEU A 83  ? 0.0828 0.0932 0.0899 -0.0128 0.0091  -0.0046 83  LEU A CG  
690  C  CD1 . LEU A 83  ? 0.0917 0.0915 0.1178 -0.0150 -0.0170 0.0008  83  LEU A CD1 
691  C  CD2 . LEU A 83  ? 0.0790 0.1118 0.1390 -0.0052 0.0039  -0.0301 83  LEU A CD2 
692  N  N   . PHE A 84  ? 0.0694 0.0810 0.0670 0.0037  0.0025  -0.0035 84  PHE A N   
693  C  CA  . PHE A 84  ? 0.0594 0.0843 0.0729 0.0067  -0.0012 -0.0026 84  PHE A CA  
694  C  C   . PHE A 84  ? 0.0684 0.0789 0.0679 0.0075  -0.0010 -0.0015 84  PHE A C   
695  O  O   . PHE A 84  ? 0.0665 0.0892 0.0682 0.0099  0.0036  -0.0005 84  PHE A O   
696  C  CB  . PHE A 84  ? 0.0679 0.0890 0.0705 0.0075  -0.0007 -0.0023 84  PHE A CB  
697  C  CG  . PHE A 84  ? 0.0755 0.0955 0.0649 0.0118  -0.0071 -0.0077 84  PHE A CG  
698  C  CD1 . PHE A 84  ? 0.0770 0.1014 0.0748 0.0121  -0.0118 -0.0029 84  PHE A CD1 
699  C  CD2 . PHE A 84  ? 0.0946 0.0906 0.0769 0.0074  0.0021  -0.0032 84  PHE A CD2 
700  C  CE1 . PHE A 84  ? 0.0801 0.1113 0.0831 0.0238  -0.0112 -0.0154 84  PHE A CE1 
701  C  CE2 . PHE A 84  ? 0.1203 0.0984 0.0797 0.0127  -0.0011 -0.0015 84  PHE A CE2 
702  C  CZ  . PHE A 84  ? 0.1062 0.1061 0.0780 0.0276  -0.0076 -0.0161 84  PHE A CZ  
703  N  N   . TRP A 85  ? 0.0689 0.0758 0.0605 0.0063  0.0012  -0.0022 85  TRP A N   
704  C  CA  . TRP A 85  ? 0.0695 0.0718 0.0690 0.0018  0.0029  0.0000  85  TRP A CA  
705  C  C   . TRP A 85  ? 0.0692 0.0683 0.0701 -0.0031 -0.0027 -0.0014 85  TRP A C   
706  O  O   . TRP A 85  ? 0.0872 0.0727 0.0682 -0.0026 0.0021  -0.0073 85  TRP A O   
707  C  CB  . TRP A 85  ? 0.0704 0.0779 0.0677 0.0006  -0.0017 0.0023  85  TRP A CB  
708  C  CG  . TRP A 85  ? 0.0667 0.0777 0.0693 -0.0059 0.0001  -0.0022 85  TRP A CG  
709  C  CD1 . TRP A 85  ? 0.0768 0.0774 0.0751 -0.0018 -0.0008 -0.0082 85  TRP A CD1 
710  C  CD2 . TRP A 85  ? 0.0726 0.0864 0.0687 -0.0007 -0.0005 0.0032  85  TRP A CD2 
711  N  NE1 . TRP A 85  ? 0.0791 0.0867 0.0754 -0.0034 0.0083  -0.0076 85  TRP A NE1 
712  C  CE2 . TRP A 85  ? 0.0788 0.0947 0.0703 -0.0080 -0.0009 0.0009  85  TRP A CE2 
713  C  CE3 . TRP A 85  ? 0.0859 0.0987 0.0980 0.0176  0.0113  0.0247  85  TRP A CE3 
714  C  CZ2 . TRP A 85  ? 0.0878 0.1325 0.0818 -0.0191 0.0001  0.0221  85  TRP A CZ2 
715  C  CZ3 . TRP A 85  ? 0.0965 0.1257 0.1175 0.0176  0.0055  0.0440  85  TRP A CZ3 
716  C  CH2 . TRP A 85  ? 0.1176 0.1248 0.0926 0.0057  -0.0093 0.0364  85  TRP A CH2 
717  N  N   . LYS A 86  ? 0.0788 0.0755 0.0630 0.0021  0.0027  -0.0004 86  LYS A N   
718  C  CA  . LYS A 86  ? 0.0814 0.0717 0.0666 -0.0046 -0.0044 0.0052  86  LYS A CA  
719  C  C   . LYS A 86  ? 0.0777 0.0721 0.0717 -0.0024 -0.0006 0.0004  86  LYS A C   
720  O  O   . LYS A 86  ? 0.0846 0.0907 0.0701 -0.0008 0.0015  -0.0001 86  LYS A O   
721  C  CB  . LYS A 86  ? 0.0810 0.0746 0.0863 -0.0001 -0.0026 0.0087  86  LYS A CB  
722  C  CG  . LYS A 86  ? 0.0837 0.1117 0.0902 0.0114  0.0075  0.0077  86  LYS A CG  
723  C  CD  . LYS A 86  ? 0.1037 0.1137 0.1236 0.0230  0.0127  0.0384  86  LYS A CD  
724  C  CE  . LYS A 86  ? 0.0952 0.1615 0.1612 0.0283  0.0299  0.0408  86  LYS A CE  
725  N  NZ  . LYS A 86  ? 0.1241 0.1772 0.2077 0.0544  0.0450  0.0565  86  LYS A NZ  
726  N  N   . GLY A 87  ? 0.0744 0.0806 0.0701 0.0003  0.0008  -0.0018 87  GLY A N   
727  C  CA  . GLY A 87  ? 0.0759 0.0837 0.0769 -0.0069 -0.0018 0.0012  87  GLY A CA  
728  C  C   . GLY A 87  ? 0.0715 0.0979 0.0668 -0.0029 -0.0008 0.0033  87  GLY A C   
729  O  O   . GLY A 87  ? 0.0653 0.1043 0.0872 -0.0048 -0.0015 0.0019  87  GLY A O   
730  N  N   . LEU A 88  ? 0.0684 0.0842 0.0756 0.0038  0.0013  -0.0018 88  LEU A N   
731  C  CA  . LEU A 88  ? 0.0692 0.0915 0.0766 0.0086  0.0014  -0.0021 88  LEU A CA  
732  C  C   . LEU A 88  ? 0.0652 0.0919 0.0731 0.0043  0.0016  0.0051  88  LEU A C   
733  O  O   . LEU A 88  ? 0.0630 0.1178 0.0798 0.0012  -0.0031 -0.0006 88  LEU A O   
734  C  CB  . LEU A 88  ? 0.0738 0.0885 0.0741 0.0136  0.0024  -0.0028 88  LEU A CB  
735  C  CG  . LEU A 88  ? 0.0862 0.0872 0.0711 0.0124  0.0038  -0.0011 88  LEU A CG  
736  C  CD1 . LEU A 88  ? 0.0994 0.1133 0.0759 0.0114  0.0074  0.0116  88  LEU A CD1 
737  C  CD2 . LEU A 88  ? 0.0872 0.1193 0.0813 0.0024  -0.0060 0.0009  88  LEU A CD2 
738  N  N   . LYS A 89  ? 0.0695 0.0825 0.0770 0.0007  -0.0003 -0.0056 89  LYS A N   
739  C  CA  . LYS A 89  ? 0.0714 0.0812 0.0825 -0.0032 -0.0025 -0.0030 89  LYS A CA  
740  C  C   . LYS A 89  ? 0.0741 0.0876 0.0792 -0.0045 0.0040  -0.0024 89  LYS A C   
741  O  O   . LYS A 89  ? 0.0714 0.1013 0.1034 -0.0062 0.0032  -0.0295 89  LYS A O   
742  C  CB  . LYS A 89  ? 0.0759 0.0866 0.0783 -0.0061 -0.0008 -0.0024 89  LYS A CB  
743  C  CG  . LYS A 89  ? 0.0964 0.0900 0.0819 -0.0004 -0.0070 -0.0027 89  LYS A CG  
744  C  CD  . LYS A 89  ? 0.0892 0.0925 0.0896 -0.0068 -0.0115 0.0057  89  LYS A CD  
745  C  CE  . LYS A 89  ? 0.0909 0.0984 0.0787 -0.0042 -0.0084 -0.0051 89  LYS A CE  
746  N  NZ  . LYS A 89  ? 0.1072 0.0971 0.0959 -0.0105 -0.0044 0.0062  89  LYS A NZ  
747  N  N   . LYS A 90  ? 0.0764 0.0806 0.0859 0.0001  -0.0041 -0.0127 90  LYS A N   
748  C  CA  . LYS A 90  ? 0.0791 0.0836 0.0852 -0.0040 -0.0070 -0.0115 90  LYS A CA  
749  C  C   . LYS A 90  ? 0.0869 0.0816 0.0860 -0.0037 -0.0073 -0.0128 90  LYS A C   
750  O  O   . LYS A 90  ? 0.0990 0.0993 0.0876 -0.0070 -0.0042 -0.0038 90  LYS A O   
751  C  CB  . LYS A 90  ? 0.0920 0.0795 0.0920 0.0009  -0.0071 -0.0065 90  LYS A CB  
752  C  CG  . LYS A 90  ? 0.0909 0.0923 0.0836 0.0048  -0.0034 -0.0114 90  LYS A CG  
753  C  CD  . LYS A 90  ? 0.0817 0.0874 0.0910 0.0051  0.0030  -0.0056 90  LYS A CD  
754  C  CE  . LYS A 90  ? 0.0855 0.0882 0.0981 -0.0005 0.0032  -0.0095 90  LYS A CE  
755  N  NZ  . LYS A 90  ? 0.0978 0.0847 0.1069 0.0022  0.0021  -0.0101 90  LYS A NZ  
756  N  N   . GLY A 91  ? 0.0989 0.0931 0.0841 -0.0041 -0.0018 -0.0156 91  GLY A N   
757  C  CA  . GLY A 91  ? 0.1118 0.0973 0.0879 -0.0082 0.0068  -0.0183 91  GLY A CA  
758  C  C   . GLY A 91  ? 0.1068 0.1107 0.0835 -0.0104 0.0100  -0.0168 91  GLY A C   
759  O  O   . GLY A 91  ? 0.1591 0.1169 0.0889 -0.0151 0.0111  -0.0150 91  GLY A O   
760  N  N   . THR A 92  ? 0.1004 0.0853 0.0842 -0.0071 0.0070  -0.0073 92  THR A N   
761  C  CA  . THR A 92  ? 0.0902 0.1021 0.0815 -0.0031 0.0044  -0.0006 92  THR A CA  
762  C  C   . THR A 92  ? 0.0878 0.0919 0.0980 -0.0072 0.0084  -0.0080 92  THR A C   
763  O  O   . THR A 92  ? 0.0878 0.1069 0.1227 0.0011  0.0040  -0.0034 92  THR A O   
764  C  CB  . THR A 92  ? 0.0800 0.0901 0.0888 -0.0082 -0.0015 -0.0076 92  THR A CB  
765  O  OG1 . THR A 92  ? 0.0833 0.0869 0.0859 -0.0032 -0.0015 -0.0057 92  THR A OG1 
766  C  CG2 . THR A 92  ? 0.0789 0.0994 0.0908 -0.0022 0.0009  -0.0090 92  THR A CG2 
767  N  N   . THR A 93  ? 0.0880 0.1015 0.1129 0.0021  0.0128  -0.0014 93  THR A N   
768  C  CA  . THR A 93  ? 0.0874 0.1036 0.1583 -0.0046 0.0316  -0.0021 93  THR A CA  
769  C  C   . THR A 93  ? 0.0810 0.1130 0.1291 -0.0034 0.0203  0.0013  93  THR A C   
770  O  O   . THR A 93  ? 0.0901 0.1052 0.1384 -0.0072 0.0024  -0.0043 93  THR A O   
771  C  CB  . THR A 93  ? 0.1366 0.1395 0.2113 -0.0212 0.0828  -0.0522 93  THR A CB  
772  O  OG1 . THR A 93  ? 0.1987 0.1393 0.2525 -0.0283 0.1022  -0.0633 93  THR A OG1 
773  C  CG2 . THR A 93  ? 0.1347 0.1931 0.2148 -0.0292 0.0849  -0.0372 93  THR A CG2 
774  N  N   . LEU A 94  ? 0.0873 0.1105 0.1106 0.0073  0.0196  0.0050  94  LEU A N   
775  C  CA  . LEU A 94  ? 0.0841 0.1040 0.1053 0.0067  0.0142  0.0019  94  LEU A CA  
776  C  C   . LEU A 94  ? 0.0856 0.1125 0.0983 0.0019  0.0205  -0.0008 94  LEU A C   
777  O  O   . LEU A 94  ? 0.0897 0.1228 0.1230 0.0034  0.0296  0.0026  94  LEU A O   
778  C  CB  . LEU A 94  ? 0.0888 0.1247 0.1079 0.0039  0.0090  0.0054  94  LEU A CB  
779  C  CG  . LEU A 94  ? 0.0775 0.1270 0.1176 0.0014  0.0199  -0.0096 94  LEU A CG  
780  C  CD1 . LEU A 94  ? 0.0835 0.1287 0.0985 0.0015  0.0134  -0.0055 94  LEU A CD1 
781  C  CD2 . LEU A 94  ? 0.1110 0.1368 0.1370 0.0133  -0.0066 -0.0108 94  LEU A CD2 
782  N  N   . GLN A 95  ? 0.0852 0.1066 0.0918 -0.0048 0.0123  -0.0072 95  GLN A N   
783  C  CA  . GLN A 95  ? 0.0993 0.1161 0.0900 -0.0073 0.0149  -0.0035 95  GLN A CA  
784  C  C   . GLN A 95  ? 0.0873 0.1099 0.0940 -0.0074 0.0005  -0.0015 95  GLN A C   
785  O  O   . GLN A 95  ? 0.1018 0.1113 0.1012 -0.0067 0.0044  -0.0050 95  GLN A O   
786  C  CB  . GLN A 95  ? 0.1223 0.1215 0.1047 -0.0137 0.0126  -0.0225 95  GLN A CB  
787  C  CG  . GLN A 95  ? 0.1212 0.1389 0.1114 -0.0130 -0.0057 0.0000  95  GLN A CG  
788  C  CD  . GLN A 95  ? 0.1692 0.1786 0.1163 -0.0663 -0.0012 -0.0068 95  GLN A CD  
789  O  OE1 . GLN A 95  ? 0.2574 0.1902 0.1519 -0.0865 0.0052  -0.0097 95  GLN A OE1 
790  N  NE2 . GLN A 95  ? 0.2791 0.2250 0.1099 -0.1316 -0.0034 -0.0048 95  GLN A NE2 
791  N  N   . GLY A 96  ? 0.1131 0.1154 0.0986 -0.0141 0.0010  -0.0033 96  GLY A N   
792  C  CA  . GLY A 96  ? 0.1358 0.1164 0.1038 -0.0195 -0.0112 0.0025  96  GLY A CA  
793  C  C   . GLY A 96  ? 0.0972 0.1201 0.0955 -0.0211 -0.0005 0.0111  96  GLY A C   
794  O  O   . GLY A 96  ? 0.0947 0.1260 0.0943 -0.0164 -0.0018 0.0034  96  GLY A O   
795  N  N   . ASP A 97  ? 0.0908 0.1203 0.0920 -0.0203 -0.0105 0.0063  97  ASP A N   
796  C  CA  . ASP A 97  ? 0.0940 0.1184 0.1015 -0.0174 0.0025  0.0082  97  ASP A CA  
797  C  C   . ASP A 97  ? 0.0824 0.1124 0.0946 -0.0188 0.0011  0.0064  97  ASP A C   
798  O  O   . ASP A 97  ? 0.0872 0.1257 0.0934 -0.0298 0.0001  0.0036  97  ASP A O   
799  C  CB  . ASP A 97  ? 0.1002 0.1191 0.1199 -0.0119 -0.0104 0.0127  97  ASP A CB  
800  C  CG  . ASP A 97  ? 0.1125 0.1534 0.1125 -0.0213 0.0011  0.0177  97  ASP A CG  
801  O  OD1 . ASP A 97  ? 0.1146 0.1880 0.1551 -0.0176 0.0029  0.0663  97  ASP A OD1 
802  O  OD2 . ASP A 97  ? 0.1280 0.2422 0.1500 0.0300  0.0167  0.0769  97  ASP A OD2 
803  N  N   . LEU A 98  ? 0.0768 0.1061 0.0890 -0.0193 0.0028  0.0023  98  LEU A N   
804  C  CA  . LEU A 98  ? 0.0712 0.1001 0.0930 -0.0148 0.0073  0.0014  98  LEU A CA  
805  C  C   . LEU A 98  ? 0.0655 0.1081 0.0832 -0.0192 0.0056  0.0000  98  LEU A C   
806  O  O   . LEU A 98  ? 0.0703 0.1172 0.0937 -0.0172 0.0073  -0.0080 98  LEU A O   
807  C  CB  . LEU A 98  ? 0.0658 0.1081 0.0993 -0.0147 0.0029  0.0094  98  LEU A CB  
808  C  CG  . LEU A 98  ? 0.0616 0.1096 0.0987 -0.0009 0.0053  0.0134  98  LEU A CG  
809  C  CD1 . LEU A 98  ? 0.0785 0.1210 0.1085 0.0019  0.0107  0.0030  98  LEU A CD1 
810  C  CD2 . LEU A 98  ? 0.0696 0.1233 0.1197 -0.0107 0.0052  0.0267  98  LEU A CD2 
811  N  N   . LYS A 99  ? 0.0678 0.1136 0.0884 -0.0123 -0.0021 -0.0013 99  LYS A N   
812  C  CA  . LYS A 99  ? 0.0668 0.1229 0.0912 -0.0079 0.0016  -0.0012 99  LYS A CA  
813  C  C   . LYS A 99  ? 0.0706 0.1359 0.0851 -0.0181 0.0079  -0.0037 99  LYS A C   
814  O  O   . LYS A 99  ? 0.0670 0.1549 0.0875 -0.0132 0.0079  -0.0104 99  LYS A O   
815  C  CB  . LYS A 99  ? 0.0672 0.1140 0.0895 -0.0054 0.0014  0.0000  99  LYS A CB  
816  C  CG  . LYS A 99  ? 0.0737 0.1440 0.1087 0.0015  0.0013  -0.0152 99  LYS A CG  
817  C  CD  . LYS A 99  ? 0.0835 0.1385 0.1288 -0.0081 0.0156  -0.0191 99  LYS A CD  
818  C  CE  A LYS A 99  ? 0.1034 0.1990 0.2138 0.0232  0.0119  -0.0369 99  LYS A CE  
819  C  CE  B LYS A 99  ? 0.1359 0.1204 0.0630 0.0241  0.0242  0.0422  99  LYS A CE  
820  N  NZ  A LYS A 99  ? 0.1479 0.1797 0.2241 0.0218  0.0531  -0.0152 99  LYS A NZ  
821  N  NZ  B LYS A 99  ? 0.0783 0.1825 0.2088 0.0591  0.0678  0.0932  99  LYS A NZ  
822  N  N   . ALA A 100 ? 0.0796 0.1384 0.0870 -0.0316 0.0033  -0.0029 100 ALA A N   
823  C  CA  . ALA A 100 ? 0.0840 0.1455 0.0936 -0.0380 0.0114  -0.0037 100 ALA A CA  
824  C  C   . ALA A 100 ? 0.0793 0.1499 0.0923 -0.0366 0.0079  -0.0047 100 ALA A C   
825  O  O   . ALA A 100 ? 0.0803 0.1783 0.0925 -0.0474 0.0058  -0.0156 100 ALA A O   
826  C  CB  . ALA A 100 ? 0.1234 0.1642 0.0999 -0.0598 0.0064  0.0118  100 ALA A CB  
827  N  N   . ALA A 101 ? 0.0769 0.1327 0.0931 -0.0291 0.0095  -0.0061 101 ALA A N   
828  C  CA  . ALA A 101 ? 0.0845 0.1347 0.1060 -0.0376 0.0141  -0.0122 101 ALA A CA  
829  C  C   . ALA A 101 ? 0.0770 0.1519 0.0932 -0.0412 0.0207  -0.0180 101 ALA A C   
830  O  O   . ALA A 101 ? 0.0861 0.1869 0.0894 -0.0559 0.0208  -0.0259 101 ALA A O   
831  C  CB  . ALA A 101 ? 0.0890 0.1453 0.1303 -0.0325 0.0119  -0.0270 101 ALA A CB  
832  N  N   . ILE A 102 ? 0.0654 0.1545 0.0910 -0.0272 0.0093  -0.0131 102 ILE A N   
833  C  CA  . ILE A 102 ? 0.0619 0.1611 0.0861 -0.0237 0.0068  -0.0116 102 ILE A CA  
834  C  C   . ILE A 102 ? 0.0645 0.1842 0.0909 -0.0241 0.0084  -0.0177 102 ILE A C   
835  O  O   . ILE A 102 ? 0.0697 0.2342 0.0903 -0.0365 0.0050  -0.0199 102 ILE A O   
836  C  CB  . ILE A 102 ? 0.0647 0.1576 0.0805 -0.0122 0.0062  -0.0059 102 ILE A CB  
837  C  CG1 . ILE A 102 ? 0.0739 0.1385 0.1003 -0.0145 0.0214  -0.0105 102 ILE A CG1 
838  C  CG2 . ILE A 102 ? 0.0751 0.1858 0.1102 -0.0060 -0.0024 0.0064  102 ILE A CG2 
839  C  CD1 . ILE A 102 ? 0.0723 0.1422 0.1078 -0.0094 0.0089  -0.0051 102 ILE A CD1 
840  N  N   . GLU A 103 ? 0.0634 0.1916 0.0994 -0.0298 0.0132  -0.0219 103 GLU A N   
841  C  CA  . GLU A 103 ? 0.0613 0.2353 0.1026 -0.0289 0.0118  -0.0166 103 GLU A CA  
842  C  C   . GLU A 103 ? 0.0795 0.2636 0.0997 -0.0575 0.0185  -0.0343 103 GLU A C   
843  O  O   . GLU A 103 ? 0.0719 0.3385 0.1028 -0.0630 0.0145  -0.0297 103 GLU A O   
844  C  CB  . GLU A 103 ? 0.0729 0.2817 0.1152 -0.0303 0.0243  -0.0451 103 GLU A CB  
845  C  CG  . GLU A 103 ? 0.0805 0.2746 0.1160 -0.0002 0.0021  -0.0399 103 GLU A CG  
846  C  CD  . GLU A 103 ? 0.1038 0.3217 0.1156 -0.0266 0.0216  -0.0574 103 GLU A CD  
847  O  OE1 . GLU A 103 ? 0.1473 0.3718 0.1105 0.0014  0.0186  -0.0504 103 GLU A OE1 
848  O  OE2 . GLU A 103 ? 0.1685 0.3309 0.1634 -0.0093 0.0389  -0.0780 103 GLU A OE2 
849  N  N   . ARG A 104 ? 0.0903 0.2339 0.1012 -0.0702 0.0249  -0.0315 104 ARG A N   
850  C  CA  . ARG A 104 ? 0.1030 0.2488 0.0957 -0.0890 0.0250  -0.0326 104 ARG A CA  
851  C  C   . ARG A 104 ? 0.1003 0.2804 0.1082 -0.0926 0.0289  -0.0483 104 ARG A C   
852  O  O   . ARG A 104 ? 0.1124 0.3437 0.1093 -0.1211 0.0280  -0.0615 104 ARG A O   
853  C  CB  . ARG A 104 ? 0.1304 0.2103 0.1121 -0.0921 0.0366  -0.0333 104 ARG A CB  
854  C  CG  . ARG A 104 ? 0.1504 0.2235 0.1276 -0.1079 0.0473  -0.0342 104 ARG A CG  
855  C  CD  . ARG A 104 ? 0.1836 0.1990 0.1213 -0.0934 0.0506  -0.0213 104 ARG A CD  
856  N  NE  . ARG A 104 ? 0.1625 0.1752 0.1361 -0.0610 0.0441  -0.0144 104 ARG A NE  
857  C  CZ  . ARG A 104 ? 0.1766 0.1721 0.1328 -0.0598 0.0364  -0.0092 104 ARG A CZ  
858  N  NH1 . ARG A 104 ? 0.2014 0.2847 0.1558 -0.0863 0.0083  0.0300  104 ARG A NH1 
859  N  NH2 . ARG A 104 ? 0.1666 0.1858 0.1552 -0.0733 0.0421  -0.0136 104 ARG A NH2 
860  N  N   . ASP A 105 ? 0.0961 0.2280 0.0894 -0.0743 0.0240  -0.0272 105 ASP A N   
861  C  CA  . ASP A 105 ? 0.1121 0.2475 0.1010 -0.0887 0.0312  -0.0475 105 ASP A CA  
862  C  C   . ASP A 105 ? 0.1011 0.3037 0.0894 -0.0853 0.0118  -0.0326 105 ASP A C   
863  O  O   . ASP A 105 ? 0.1523 0.3550 0.1079 -0.1014 0.0113  -0.0572 105 ASP A O   
864  C  CB  . ASP A 105 ? 0.1150 0.2360 0.0883 -0.0787 0.0222  -0.0307 105 ASP A CB  
865  C  CG  . ASP A 105 ? 0.1353 0.2084 0.1006 -0.0832 0.0382  -0.0340 105 ASP A CG  
866  O  OD1 . ASP A 105 ? 0.1499 0.2186 0.1298 -0.0893 0.0446  -0.0304 105 ASP A OD1 
867  O  OD2 . ASP A 105 ? 0.1371 0.1857 0.1233 -0.0588 0.0463  -0.0256 105 ASP A OD2 
868  N  N   . PHE A 106 ? 0.0919 0.3031 0.0927 -0.0710 0.0002  -0.0195 106 PHE A N   
869  C  CA  . PHE A 106 ? 0.0844 0.3342 0.1128 -0.0564 0.0004  -0.0187 106 PHE A CA  
870  C  C   . PHE A 106 ? 0.0742 0.3909 0.1251 -0.0569 -0.0022 0.0031  106 PHE A C   
871  O  O   . PHE A 106 ? 0.0754 0.4786 0.1340 -0.0279 0.0038  0.0248  106 PHE A O   
872  C  CB  . PHE A 106 ? 0.0737 0.3084 0.1142 -0.0369 0.0120  -0.0004 106 PHE A CB  
873  C  CG  . PHE A 106 ? 0.0828 0.2494 0.0978 -0.0326 0.0104  -0.0195 106 PHE A CG  
874  C  CD1 . PHE A 106 ? 0.1091 0.2739 0.1021 -0.0535 0.0067  -0.0162 106 PHE A CD1 
875  C  CD2 . PHE A 106 ? 0.0859 0.2005 0.1074 -0.0174 0.0158  -0.0204 106 PHE A CD2 
876  C  CE1 . PHE A 106 ? 0.1299 0.2501 0.0914 -0.0476 0.0221  -0.0264 106 PHE A CE1 
877  C  CE2 . PHE A 106 ? 0.0925 0.1960 0.1145 -0.0267 0.0236  -0.0183 106 PHE A CE2 
878  C  CZ  . PHE A 106 ? 0.1260 0.1697 0.1161 -0.0264 0.0261  -0.0268 106 PHE A CZ  
879  N  N   . GLY A 107 ? 0.0746 0.4381 0.1205 -0.0633 0.0096  0.0089  107 GLY A N   
880  C  CA  . GLY A 107 ? 0.0684 0.4930 0.1309 -0.0609 0.0094  0.0033  107 GLY A CA  
881  C  C   . GLY A 107 ? 0.0794 0.4570 0.1343 -0.0353 0.0174  0.0275  107 GLY A C   
882  O  O   . GLY A 107 ? 0.1101 0.4556 0.1496 -0.0417 0.0477  0.0163  107 GLY A O   
883  N  N   . SER A 108 ? 0.0785 0.4359 0.1398 -0.0158 0.0200  0.0316  108 SER A N   
884  C  CA  . SER A 108 ? 0.0812 0.4175 0.1244 0.0185  0.0152  0.0394  108 SER A CA  
885  C  C   . SER A 108 ? 0.0741 0.3782 0.1142 0.0315  0.0244  0.0051  108 SER A C   
886  O  O   . SER A 108 ? 0.0808 0.3459 0.1009 0.0036  0.0163  0.0123  108 SER A O   
887  C  CB  . SER A 108 ? 0.0865 0.4906 0.1453 0.0546  0.0366  0.0436  108 SER A CB  
888  O  OG  . SER A 108 ? 0.0975 0.4203 0.1372 0.0518  0.0205  0.0306  108 SER A OG  
889  N  N   . VAL A 109 ? 0.0985 0.3586 0.0997 0.0396  0.0188  0.0087  109 VAL A N   
890  C  CA  . VAL A 109 ? 0.0917 0.3480 0.1078 0.0449  0.0138  0.0026  109 VAL A CA  
891  C  C   . VAL A 109 ? 0.1005 0.3381 0.1117 0.0501  0.0204  0.0091  109 VAL A C   
892  O  O   . VAL A 109 ? 0.0909 0.3103 0.1031 0.0290  0.0116  -0.0143 109 VAL A O   
893  C  CB  . VAL A 109 ? 0.1362 0.2847 0.1133 0.0719  0.0129  -0.0121 109 VAL A CB  
894  C  CG1 . VAL A 109 ? 0.1490 0.2668 0.1139 0.0659  0.0011  -0.0071 109 VAL A CG1 
895  C  CG2 . VAL A 109 ? 0.1415 0.2654 0.1179 0.0545  0.0008  -0.0140 109 VAL A CG2 
896  N  N   . ASP A 110 ? 0.1080 0.3841 0.1147 0.0665  0.0177  0.0157  110 ASP A N   
897  C  CA  . ASP A 110 ? 0.1348 0.3976 0.1288 0.0918  0.0092  0.0061  110 ASP A CA  
898  C  C   . ASP A 110 ? 0.1020 0.3753 0.1202 0.0731  0.0114  0.0338  110 ASP A C   
899  O  O   . ASP A 110 ? 0.1034 0.3707 0.1138 0.0657  0.0009  0.0224  110 ASP A O   
900  C  CB  A ASP A 110 ? 0.1573 0.4355 0.2126 0.1320  -0.0174 -0.0346 110 ASP A CB  
901  C  CB  B ASP A 110 ? 0.1061 0.4845 0.1064 0.1129  -0.0066 0.0025  110 ASP A CB  
902  C  CG  A ASP A 110 ? 0.2608 0.4181 0.2093 0.1114  0.0385  -0.0367 110 ASP A CG  
903  C  CG  B ASP A 110 ? 0.2027 0.4799 0.1385 0.1558  -0.0428 -0.0135 110 ASP A CG  
904  O  OD1 A ASP A 110 ? 0.2839 0.3161 0.1999 0.1195  -0.0291 -0.0177 110 ASP A OD1 
905  O  OD1 B ASP A 110 ? 0.2736 0.4212 0.2285 0.2054  0.0251  -0.0329 110 ASP A OD1 
906  O  OD2 A ASP A 110 ? 0.3272 0.4847 0.3098 0.1532  0.0849  -0.0720 110 ASP A OD2 
907  O  OD2 B ASP A 110 ? 0.2966 0.5617 0.1496 0.2310  -0.1230 -0.0808 110 ASP A OD2 
908  N  N   . ASN A 111 ? 0.0793 0.4143 0.1101 0.0408  0.0062  0.0325  111 ASN A N   
909  C  CA  . ASN A 111 ? 0.0664 0.4168 0.1273 0.0064  0.0116  0.0263  111 ASN A CA  
910  C  C   . ASN A 111 ? 0.0696 0.3289 0.1152 0.0027  0.0025  0.0243  111 ASN A C   
911  O  O   . ASN A 111 ? 0.0759 0.3386 0.1016 0.0050  -0.0025 0.0218  111 ASN A O   
912  C  CB  . ASN A 111 ? 0.0744 0.4476 0.1471 -0.0253 0.0070  0.0326  111 ASN A CB  
913  C  CG  . ASN A 111 ? 0.0866 0.5106 0.1862 -0.0405 0.0173  0.0238  111 ASN A CG  
914  O  OD1 . ASN A 111 ? 0.1084 0.5423 0.2578 -0.0744 0.0203  0.0236  111 ASN A OD1 
915  N  ND2 . ASN A 111 ? 0.0716 0.5374 0.2594 0.0051  0.0062  -0.0084 111 ASN A ND2 
916  N  N   . PHE A 112 ? 0.0719 0.3020 0.1006 -0.0042 0.0047  0.0245  112 PHE A N   
917  C  CA  . PHE A 112 ? 0.0706 0.2489 0.0958 -0.0100 -0.0036 0.0121  112 PHE A CA  
918  C  C   . PHE A 112 ? 0.0686 0.2373 0.0918 -0.0068 -0.0039 0.0054  112 PHE A C   
919  O  O   . PHE A 112 ? 0.0793 0.2083 0.0900 0.0057  0.0006  0.0032  112 PHE A O   
920  C  CB  . PHE A 112 ? 0.0719 0.2310 0.0900 -0.0173 -0.0040 0.0018  112 PHE A CB  
921  C  CG  . PHE A 112 ? 0.0708 0.1647 0.0994 -0.0039 -0.0034 0.0088  112 PHE A CG  
922  C  CD1 . PHE A 112 ? 0.0889 0.1808 0.0981 0.0014  0.0027  0.0060  112 PHE A CD1 
923  C  CD2 . PHE A 112 ? 0.0904 0.1737 0.1254 -0.0003 -0.0202 -0.0076 112 PHE A CD2 
924  C  CE1 . PHE A 112 ? 0.0855 0.1981 0.1216 0.0340  0.0120  0.0312  112 PHE A CE1 
925  C  CE2 . PHE A 112 ? 0.0902 0.1495 0.2078 -0.0014 -0.0361 0.0113  112 PHE A CE2 
926  C  CZ  . PHE A 112 ? 0.0783 0.1745 0.2286 -0.0016 -0.0055 0.0618  112 PHE A CZ  
927  N  N   . LYS A 113 ? 0.0838 0.2440 0.0854 0.0228  0.0030  -0.0018 113 LYS A N   
928  C  CA  . LYS A 113 ? 0.1055 0.2269 0.0973 0.0299  0.0019  -0.0040 113 LYS A CA  
929  C  C   . LYS A 113 ? 0.0933 0.2223 0.0959 0.0285  0.0037  0.0008  113 LYS A C   
930  O  O   . LYS A 113 ? 0.0977 0.2082 0.1041 0.0309  0.0040  0.0025  113 LYS A O   
931  C  CB  . LYS A 113 ? 0.1570 0.2505 0.1086 0.0560  0.0001  -0.0203 113 LYS A CB  
932  C  CG  . LYS A 113 ? 0.2155 0.2666 0.1070 0.1135  -0.0219 -0.0233 113 LYS A CG  
933  C  CD  . LYS A 113 ? 0.2733 0.2777 0.1669 0.1122  -0.0685 -0.0584 113 LYS A CD  
934  C  CE  . LYS A 113 ? 0.2574 0.2724 0.1205 0.0626  -0.0519 0.0100  113 LYS A CE  
935  N  NZ  . LYS A 113 ? 0.2229 0.3752 0.1752 0.0573  -0.0404 -0.0636 113 LYS A NZ  
936  N  N   . ALA A 114 ? 0.0939 0.2819 0.0963 0.0527  0.0080  0.0250  114 ALA A N   
937  C  CA  . ALA A 114 ? 0.0804 0.3102 0.1057 0.0458  0.0031  0.0141  114 ALA A CA  
938  C  C   . ALA A 114 ? 0.0749 0.2761 0.1049 0.0170  -0.0019 0.0232  114 ALA A C   
939  O  O   . ALA A 114 ? 0.0820 0.2775 0.1000 0.0202  0.0053  0.0205  114 ALA A O   
940  C  CB  . ALA A 114 ? 0.0719 0.4280 0.1666 0.0608  0.0087  0.0365  114 ALA A CB  
941  N  N   . GLU A 115 ? 0.0726 0.2649 0.0909 -0.0066 -0.0037 0.0073  115 GLU A N   
942  C  CA  . GLU A 115 ? 0.0814 0.2586 0.0970 -0.0288 -0.0073 0.0028  115 GLU A CA  
943  C  C   . GLU A 115 ? 0.0888 0.1768 0.0928 -0.0175 0.0009  -0.0034 115 GLU A C   
944  O  O   . GLU A 115 ? 0.0908 0.2074 0.0926 -0.0305 -0.0017 -0.0014 115 GLU A O   
945  C  CB  . GLU A 115 ? 0.1045 0.2508 0.1305 -0.0557 0.0019  0.0078  115 GLU A CB  
946  C  CG  . GLU A 115 ? 0.1102 0.2648 0.1358 -0.0240 -0.0116 0.0098  115 GLU A CG  
947  C  CD  . GLU A 115 ? 0.1294 0.2664 0.1347 -0.0477 -0.0076 -0.0032 115 GLU A CD  
948  O  OE1 . GLU A 115 ? 0.1590 0.2767 0.1570 -0.0563 -0.0014 0.0100  115 GLU A OE1 
949  O  OE2 . GLU A 115 ? 0.1625 0.2624 0.2136 -0.0434 0.0076  -0.0254 115 GLU A OE2 
950  N  N   . PHE A 116 ? 0.0679 0.1880 0.0941 -0.0046 -0.0052 0.0005  116 PHE A N   
951  C  CA  . PHE A 116 ? 0.0703 0.1491 0.0884 0.0010  -0.0001 -0.0084 116 PHE A CA  
952  C  C   . PHE A 116 ? 0.0752 0.1594 0.0791 -0.0030 -0.0039 -0.0080 116 PHE A C   
953  O  O   . PHE A 116 ? 0.0799 0.1597 0.0868 0.0011  0.0032  -0.0066 116 PHE A O   
954  C  CB  . PHE A 116 ? 0.0715 0.1544 0.0834 0.0042  -0.0050 -0.0120 116 PHE A CB  
955  C  CG  . PHE A 116 ? 0.0742 0.1329 0.0740 0.0044  -0.0001 -0.0165 116 PHE A CG  
956  C  CD1 . PHE A 116 ? 0.0803 0.1259 0.0970 0.0009  0.0006  -0.0055 116 PHE A CD1 
957  C  CD2 . PHE A 116 ? 0.0840 0.1199 0.0991 0.0092  -0.0035 -0.0162 116 PHE A CD2 
958  C  CE1 . PHE A 116 ? 0.0783 0.1182 0.0985 0.0082  0.0024  -0.0072 116 PHE A CE1 
959  C  CE2 . PHE A 116 ? 0.0806 0.1152 0.0958 0.0059  0.0003  -0.0137 116 PHE A CE2 
960  C  CZ  . PHE A 116 ? 0.0761 0.1159 0.0873 -0.0026 -0.0001 -0.0066 116 PHE A CZ  
961  N  N   . GLU A 117 ? 0.0779 0.1750 0.0897 0.0145  0.0014  -0.0052 117 GLU A N   
962  C  CA  . GLU A 117 ? 0.0949 0.1804 0.1047 0.0276  0.0084  0.0003  117 GLU A CA  
963  C  C   . GLU A 117 ? 0.0850 0.1977 0.0966 0.0266  0.0068  0.0051  117 GLU A C   
964  O  O   . GLU A 117 ? 0.1006 0.1865 0.0984 0.0255  0.0079  0.0114  117 GLU A O   
965  C  CB  A GLU A 117 ? 0.1369 0.1997 0.1053 0.0467  0.0108  -0.0063 117 GLU A CB  
966  C  CB  B GLU A 117 ? 0.1648 0.2213 0.1058 0.0778  -0.0027 -0.0024 117 GLU A CB  
967  C  CG  A GLU A 117 ? 0.0963 0.2053 0.0850 0.0469  0.0053  0.0069  117 GLU A CG  
968  C  CG  B GLU A 117 ? 0.1262 0.1732 0.1191 0.0009  0.0123  -0.0086 117 GLU A CG  
969  C  CD  A GLU A 117 ? 0.0936 0.1966 0.0868 0.0332  -0.0038 -0.0007 117 GLU A CD  
970  C  CD  B GLU A 117 ? 0.1367 0.1853 0.1228 0.0335  -0.0048 -0.0127 117 GLU A CD  
971  O  OE1 A GLU A 117 ? 0.1347 0.1713 0.1057 0.0367  0.0035  -0.0054 117 GLU A OE1 
972  O  OE1 B GLU A 117 ? 0.1439 0.3676 0.2394 0.0559  -0.0416 -0.1359 117 GLU A OE1 
973  O  OE2 A GLU A 117 ? 0.1247 0.3051 0.0994 0.1220  -0.0088 -0.0167 117 GLU A OE2 
974  O  OE2 B GLU A 117 ? 0.1177 0.2095 0.1700 0.0128  -0.0011 -0.0521 117 GLU A OE2 
975  N  N   . LYS A 118 ? 0.0848 0.2168 0.0939 0.0168  -0.0011 0.0104  118 LYS A N   
976  C  CA  . LYS A 118 ? 0.0850 0.2569 0.0985 0.0034  -0.0140 0.0121  118 LYS A CA  
977  C  C   . LYS A 118 ? 0.0928 0.2002 0.0924 -0.0169 -0.0140 0.0008  118 LYS A C   
978  O  O   . LYS A 118 ? 0.1039 0.1961 0.0898 -0.0173 -0.0055 0.0076  118 LYS A O   
979  C  CB  . LYS A 118 ? 0.0877 0.3233 0.1372 -0.0258 -0.0103 0.0240  118 LYS A CB  
980  C  CG  . LYS A 118 ? 0.1574 0.3759 0.1741 -0.0719 -0.0131 -0.0337 118 LYS A CG  
981  C  CD  . LYS A 118 ? 0.2452 0.5489 0.4774 -0.1943 -0.1052 -0.0607 118 LYS A CD  
982  C  CE  . LYS A 118 ? 0.3842 0.6660 0.4821 -0.3223 -0.0328 -0.1164 118 LYS A CE  
983  N  NZ  . LYS A 118 ? 0.5712 1.1115 0.4950 0.0011  -0.1291 -0.2509 118 LYS A NZ  
984  N  N   . ALA A 119 ? 0.1037 0.1759 0.0899 -0.0171 0.0010  -0.0035 119 ALA A N   
985  C  CA  . ALA A 119 ? 0.1121 0.1429 0.1057 -0.0232 0.0083  -0.0154 119 ALA A CA  
986  C  C   . ALA A 119 ? 0.0940 0.1274 0.0997 -0.0049 0.0052  -0.0119 119 ALA A C   
987  O  O   . ALA A 119 ? 0.1107 0.1371 0.0874 -0.0038 0.0063  -0.0097 119 ALA A O   
988  C  CB  . ALA A 119 ? 0.1511 0.1288 0.1333 -0.0152 0.0230  -0.0036 119 ALA A CB  
989  N  N   . ALA A 120 ? 0.0854 0.1162 0.0881 0.0049  -0.0034 -0.0083 120 ALA A N   
990  C  CA  . ALA A 120 ? 0.0704 0.1150 0.0923 0.0124  0.0019  -0.0054 120 ALA A CA  
991  C  C   . ALA A 120 ? 0.0815 0.1182 0.0785 0.0052  -0.0044 -0.0034 120 ALA A C   
992  O  O   . ALA A 120 ? 0.0865 0.1453 0.1008 0.0148  0.0035  0.0135  120 ALA A O   
993  C  CB  . ALA A 120 ? 0.0835 0.1264 0.0892 0.0123  -0.0104 -0.0051 120 ALA A CB  
994  N  N   . ALA A 121 ? 0.0763 0.1300 0.0815 0.0094  -0.0037 -0.0049 121 ALA A N   
995  C  CA  . ALA A 121 ? 0.0820 0.1260 0.0941 0.0180  -0.0066 -0.0056 121 ALA A CA  
996  C  C   . ALA A 121 ? 0.0718 0.1277 0.0955 0.0115  -0.0042 -0.0025 121 ALA A C   
997  O  O   . ALA A 121 ? 0.1123 0.1409 0.0872 0.0175  -0.0054 -0.0035 121 ALA A O   
998  C  CB  . ALA A 121 ? 0.0981 0.1572 0.0943 0.0335  -0.0055 -0.0064 121 ALA A CB  
999  N  N   . SER A 122 ? 0.0803 0.1399 0.0846 0.0064  0.0002  -0.0052 122 SER A N   
1000 C  CA  . SER A 122 ? 0.0806 0.1525 0.0958 0.0048  -0.0010 -0.0165 122 SER A CA  
1001 C  C   . SER A 122 ? 0.0749 0.1565 0.0889 -0.0004 -0.0046 -0.0198 122 SER A C   
1002 O  O   . SER A 122 ? 0.0971 0.1973 0.0982 0.0082  -0.0171 -0.0414 122 SER A O   
1003 C  CB  A SER A 122 ? 0.0799 0.1733 0.1371 -0.0077 -0.0120 -0.0067 122 SER A CB  
1004 C  CB  B SER A 122 ? 0.0805 0.2201 0.1171 -0.0301 0.0048  -0.0395 122 SER A CB  
1005 O  OG  A SER A 122 ? 0.1168 0.1736 0.0998 -0.0304 -0.0175 0.0060  122 SER A OG  
1006 O  OG  B SER A 122 ? 0.0820 0.2333 0.1817 -0.0172 0.0089  -0.0579 122 SER A OG  
1007 N  N   . ARG A 123 ? 0.0781 0.1277 0.0754 0.0084  -0.0065 -0.0121 123 ARG A N   
1008 C  CA  . ARG A 123 ? 0.0776 0.1461 0.0702 0.0073  -0.0072 -0.0090 123 ARG A CA  
1009 C  C   . ARG A 123 ? 0.0881 0.1237 0.0783 0.0025  -0.0048 -0.0219 123 ARG A C   
1010 O  O   . ARG A 123 ? 0.1379 0.1485 0.0751 -0.0306 -0.0049 -0.0189 123 ARG A O   
1011 C  CB  . ARG A 123 ? 0.0815 0.1678 0.0800 0.0119  -0.0077 -0.0083 123 ARG A CB  
1012 C  CG  . ARG A 123 ? 0.0779 0.2202 0.1084 0.0153  0.0044  -0.0105 123 ARG A CG  
1013 C  CD  . ARG A 123 ? 0.0913 0.2118 0.0916 0.0419  0.0014  0.0191  123 ARG A CD  
1014 N  NE  . ARG A 123 ? 0.1018 0.2092 0.1002 0.0380  0.0047  0.0037  123 ARG A NE  
1015 C  CZ  . ARG A 123 ? 0.0892 0.2200 0.1045 0.0272  -0.0143 -0.0144 123 ARG A CZ  
1016 N  NH1 . ARG A 123 ? 0.1027 0.2390 0.1064 0.0278  -0.0001 -0.0217 123 ARG A NH1 
1017 N  NH2 . ARG A 123 ? 0.1228 0.2107 0.1318 0.0138  -0.0080 -0.0343 123 ARG A NH2 
1018 N  N   . PHE A 124 ? 0.0886 0.1123 0.0781 0.0077  -0.0117 -0.0087 124 PHE A N   
1019 C  CA  . PHE A 124 ? 0.0750 0.1126 0.0775 0.0113  -0.0105 -0.0147 124 PHE A CA  
1020 C  C   . PHE A 124 ? 0.0821 0.1110 0.0756 0.0068  -0.0134 -0.0136 124 PHE A C   
1021 O  O   . PHE A 124 ? 0.0828 0.1097 0.1470 0.0104  0.0071  -0.0145 124 PHE A O   
1022 C  CB  . PHE A 124 ? 0.0772 0.1272 0.0769 0.0054  -0.0091 -0.0062 124 PHE A CB  
1023 C  CG  . PHE A 124 ? 0.0746 0.1238 0.0749 0.0040  -0.0100 -0.0121 124 PHE A CG  
1024 C  CD1 . PHE A 124 ? 0.0833 0.1290 0.0789 0.0137  -0.0092 -0.0096 124 PHE A CD1 
1025 C  CD2 . PHE A 124 ? 0.0766 0.1195 0.0852 0.0114  -0.0061 -0.0073 124 PHE A CD2 
1026 C  CE1 . PHE A 124 ? 0.0865 0.1314 0.0836 0.0200  -0.0032 -0.0072 124 PHE A CE1 
1027 C  CE2 . PHE A 124 ? 0.0858 0.1397 0.0756 0.0132  -0.0009 -0.0031 124 PHE A CE2 
1028 C  CZ  . PHE A 124 ? 0.0933 0.1225 0.0838 0.0151  -0.0047 -0.0003 124 PHE A CZ  
1029 N  N   . GLY A 125 ? 0.0708 0.1073 0.0748 0.0150  -0.0144 -0.0091 125 GLY A N   
1030 C  CA  . GLY A 125 ? 0.0747 0.1118 0.0670 0.0135  -0.0116 -0.0049 125 GLY A CA  
1031 C  C   . GLY A 125 ? 0.0722 0.1020 0.0641 0.0057  -0.0088 -0.0075 125 GLY A C   
1032 O  O   . GLY A 125 ? 0.0725 0.1247 0.0768 0.0142  -0.0106 -0.0222 125 GLY A O   
1033 N  N   . SER A 126 ? 0.0706 0.1040 0.0580 0.0102  -0.0084 0.0005  126 SER A N   
1034 C  CA  . SER A 126 ? 0.0710 0.0973 0.0635 0.0095  -0.0075 -0.0031 126 SER A CA  
1035 C  C   . SER A 126 ? 0.0697 0.0985 0.0629 0.0105  0.0036  -0.0041 126 SER A C   
1036 O  O   . SER A 126 ? 0.0788 0.0988 0.0624 0.0069  -0.0068 -0.0056 126 SER A O   
1037 C  CB  . SER A 126 ? 0.0700 0.0977 0.0657 0.0088  -0.0067 0.0039  126 SER A CB  
1038 O  OG  . SER A 126 ? 0.0787 0.0988 0.0775 0.0031  -0.0066 0.0061  126 SER A OG  
1039 N  N   . GLY A 127 ? 0.0766 0.0905 0.0626 0.0078  -0.0049 -0.0023 127 GLY A N   
1040 C  CA  . GLY A 127 ? 0.0787 0.0966 0.0594 0.0034  -0.0063 -0.0010 127 GLY A CA  
1041 C  C   . GLY A 127 ? 0.0623 0.0947 0.0656 0.0111  -0.0030 0.0006  127 GLY A C   
1042 O  O   . GLY A 127 ? 0.0756 0.0924 0.0673 0.0011  -0.0022 -0.0057 127 GLY A O   
1043 N  N   . TRP A 128 ? 0.0748 0.0945 0.0628 0.0027  -0.0016 -0.0056 128 TRP A N   
1044 C  CA  . TRP A 128 ? 0.0758 0.0957 0.0597 0.0018  -0.0017 -0.0019 128 TRP A CA  
1045 C  C   . TRP A 128 ? 0.0756 0.0954 0.0679 0.0063  0.0027  -0.0039 128 TRP A C   
1046 O  O   . TRP A 128 ? 0.0847 0.1086 0.0759 -0.0063 0.0063  -0.0109 128 TRP A O   
1047 C  CB  . TRP A 128 ? 0.0789 0.1001 0.0608 0.0060  -0.0026 -0.0004 128 TRP A CB  
1048 C  CG  . TRP A 128 ? 0.0784 0.0910 0.0659 0.0105  -0.0014 0.0048  128 TRP A CG  
1049 C  CD1 . TRP A 128 ? 0.0822 0.1111 0.0714 0.0103  0.0046  0.0060  128 TRP A CD1 
1050 C  CD2 . TRP A 128 ? 0.0680 0.0908 0.0712 0.0133  -0.0004 0.0040  128 TRP A CD2 
1051 N  NE1 . TRP A 128 ? 0.0799 0.1080 0.0755 0.0145  0.0033  0.0047  128 TRP A NE1 
1052 C  CE2 . TRP A 128 ? 0.0724 0.1001 0.0745 0.0166  0.0023  0.0079  128 TRP A CE2 
1053 C  CE3 . TRP A 128 ? 0.0734 0.0954 0.0688 0.0066  -0.0037 -0.0007 128 TRP A CE3 
1054 C  CZ2 . TRP A 128 ? 0.0696 0.0963 0.0937 0.0087  -0.0066 0.0157  128 TRP A CZ2 
1055 C  CZ3 . TRP A 128 ? 0.0782 0.0978 0.0769 0.0057  -0.0085 -0.0025 128 TRP A CZ3 
1056 C  CH2 . TRP A 128 ? 0.0754 0.0937 0.0941 0.0111  -0.0101 0.0048  128 TRP A CH2 
1057 N  N   . ALA A 129 ? 0.0734 0.1013 0.0644 0.0018  0.0036  -0.0063 129 ALA A N   
1058 C  CA  . ALA A 129 ? 0.0699 0.1130 0.0726 0.0042  0.0050  0.0059  129 ALA A CA  
1059 C  C   . ALA A 129 ? 0.0757 0.0990 0.0636 0.0066  0.0004  -0.0028 129 ALA A C   
1060 O  O   . ALA A 129 ? 0.0910 0.0997 0.0721 -0.0052 -0.0153 0.0017  129 ALA A O   
1061 C  CB  . ALA A 129 ? 0.0792 0.1434 0.0876 0.0264  0.0005  0.0168  129 ALA A CB  
1062 N  N   . TRP A 130 ? 0.0640 0.1010 0.0705 0.0000  -0.0008 -0.0024 130 TRP A N   
1063 C  CA  . TRP A 130 ? 0.0643 0.0971 0.0637 -0.0052 -0.0009 -0.0032 130 TRP A CA  
1064 C  C   . TRP A 130 ? 0.0630 0.0983 0.0764 -0.0019 0.0028  -0.0002 130 TRP A C   
1065 O  O   . TRP A 130 ? 0.0701 0.1201 0.0775 -0.0137 -0.0037 0.0017  130 TRP A O   
1066 C  CB  . TRP A 130 ? 0.0706 0.0943 0.0825 -0.0023 0.0030  -0.0014 130 TRP A CB  
1067 C  CG  . TRP A 130 ? 0.0709 0.0956 0.0723 0.0043  0.0000  -0.0036 130 TRP A CG  
1068 C  CD1 . TRP A 130 ? 0.0734 0.0992 0.0845 -0.0049 0.0065  -0.0124 130 TRP A CD1 
1069 C  CD2 . TRP A 130 ? 0.0731 0.0879 0.0759 0.0067  0.0048  0.0000  130 TRP A CD2 
1070 N  NE1 . TRP A 130 ? 0.0780 0.0954 0.0750 -0.0008 0.0046  -0.0037 130 TRP A NE1 
1071 C  CE2 . TRP A 130 ? 0.0698 0.0937 0.0790 0.0049  0.0020  0.0017  130 TRP A CE2 
1072 C  CE3 . TRP A 130 ? 0.0779 0.1025 0.0783 0.0000  -0.0030 -0.0025 130 TRP A CE3 
1073 C  CZ2 . TRP A 130 ? 0.0707 0.1051 0.0949 0.0062  0.0067  0.0060  130 TRP A CZ2 
1074 C  CZ3 . TRP A 130 ? 0.0745 0.1444 0.0931 -0.0017 -0.0135 0.0091  130 TRP A CZ3 
1075 C  CH2 . TRP A 130 ? 0.0675 0.1275 0.0983 -0.0015 -0.0073 0.0136  130 TRP A CH2 
1076 N  N   . LEU A 131 ? 0.0669 0.0926 0.0703 -0.0047 -0.0012 0.0020  131 LEU A N   
1077 C  CA  . LEU A 131 ? 0.0655 0.0990 0.0736 -0.0076 -0.0023 -0.0009 131 LEU A CA  
1078 C  C   . LEU A 131 ? 0.0711 0.0894 0.0681 -0.0064 0.0047  -0.0031 131 LEU A C   
1079 O  O   . LEU A 131 ? 0.0654 0.0964 0.0814 -0.0082 -0.0062 -0.0027 131 LEU A O   
1080 C  CB  . LEU A 131 ? 0.0696 0.0996 0.0772 -0.0043 0.0023  -0.0065 131 LEU A CB  
1081 C  CG  . LEU A 131 ? 0.0719 0.1116 0.0772 -0.0041 0.0051  -0.0019 131 LEU A CG  
1082 C  CD1 . LEU A 131 ? 0.0819 0.1363 0.0868 -0.0167 0.0132  -0.0040 131 LEU A CD1 
1083 C  CD2 . LEU A 131 ? 0.1016 0.1326 0.0713 -0.0064 0.0081  -0.0019 131 LEU A CD2 
1084 N  N   . VAL A 132 ? 0.0723 0.0986 0.0776 -0.0112 0.0017  -0.0050 132 VAL A N   
1085 C  CA  . VAL A 132 ? 0.0801 0.0847 0.0851 -0.0151 0.0084  -0.0017 132 VAL A CA  
1086 C  C   . VAL A 132 ? 0.0889 0.0989 0.0832 -0.0144 0.0069  -0.0018 132 VAL A C   
1087 O  O   . VAL A 132 ? 0.0775 0.1114 0.1033 -0.0169 0.0131  0.0062  132 VAL A O   
1088 C  CB  . VAL A 132 ? 0.0914 0.0941 0.0913 -0.0114 0.0159  -0.0031 132 VAL A CB  
1089 C  CG1 . VAL A 132 ? 0.0939 0.1154 0.0887 -0.0249 0.0134  0.0002  132 VAL A CG1 
1090 C  CG2 . VAL A 132 ? 0.0944 0.1155 0.0948 -0.0225 0.0149  -0.0192 132 VAL A CG2 
1091 N  N   . LEU A 133 ? 0.0872 0.0951 0.0908 -0.0178 0.0082  0.0055  133 LEU A N   
1092 C  CA  . LEU A 133 ? 0.0977 0.0953 0.0934 -0.0110 0.0149  0.0051  133 LEU A CA  
1093 C  C   . LEU A 133 ? 0.1093 0.1012 0.1219 -0.0269 0.0304  -0.0077 133 LEU A C   
1094 O  O   . LEU A 133 ? 0.1167 0.1082 0.1504 -0.0248 0.0413  -0.0192 133 LEU A O   
1095 C  CB  . LEU A 133 ? 0.0944 0.1296 0.1040 -0.0110 0.0106  0.0202  133 LEU A CB  
1096 C  CG  . LEU A 133 ? 0.1250 0.1210 0.1350 -0.0009 0.0126  0.0339  133 LEU A CG  
1097 C  CD1 . LEU A 133 ? 0.1261 0.1482 0.1223 -0.0180 0.0247  0.0303  133 LEU A CD1 
1098 C  CD2 . LEU A 133 ? 0.1400 0.3009 0.1695 0.0036  -0.0009 0.1120  133 LEU A CD2 
1099 N  N   A LYS A 134 ? 0.1314 0.1233 0.1440 -0.0460 0.0412  -0.0308 134 LYS A N   
1100 N  N   B LYS A 134 ? 0.1190 0.1518 0.1394 -0.0463 0.0473  -0.0483 134 LYS A N   
1101 C  CA  A LYS A 134 ? 0.1595 0.1293 0.1549 -0.0485 0.0472  -0.0316 134 LYS A CA  
1102 C  CA  B LYS A 134 ? 0.1179 0.2011 0.1714 -0.0363 0.0301  -0.0886 134 LYS A CA  
1103 C  C   A LYS A 134 ? 0.1556 0.1152 0.1995 -0.0438 0.0485  -0.0258 134 LYS A C   
1104 C  C   B LYS A 134 ? 0.1387 0.1633 0.2477 -0.0382 0.0261  -0.1049 134 LYS A C   
1105 O  O   A LYS A 134 ? 0.1626 0.1563 0.1465 -0.0651 0.0390  -0.0222 134 LYS A O   
1106 O  O   B LYS A 134 ? 0.1206 0.1477 0.1891 -0.0411 -0.0040 -0.0566 134 LYS A O   
1107 C  CB  A LYS A 134 ? 0.1758 0.1290 0.1766 -0.0652 0.0320  -0.0432 134 LYS A CB  
1108 C  CB  B LYS A 134 ? 0.2334 0.2068 0.1994 -0.0473 -0.0427 -0.1029 134 LYS A CB  
1109 C  CG  A LYS A 134 ? 0.1841 0.1146 0.2044 -0.0482 -0.0108 -0.0261 134 LYS A CG  
1110 C  CG  B LYS A 134 ? 0.2617 0.2352 0.3201 0.0459  -0.0292 -0.0122 134 LYS A CG  
1111 C  CD  A LYS A 134 ? 0.2940 0.2399 0.1183 -0.1073 0.0219  -0.0613 134 LYS A CD  
1112 C  CD  B LYS A 134 ? 0.3268 0.3367 0.1873 0.0015  -0.0030 -0.0341 134 LYS A CD  
1113 C  CE  A LYS A 134 ? 0.3927 0.2735 0.1186 -0.1197 -0.0262 -0.0417 134 LYS A CE  
1114 C  CE  B LYS A 134 ? 0.1576 0.2659 0.2715 0.0147  0.0830  -0.0557 134 LYS A CE  
1115 N  NZ  A LYS A 134 ? 0.2058 0.2283 0.1482 -0.0644 0.0323  -0.0675 134 LYS A NZ  
1116 N  NZ  B LYS A 134 ? 0.5058 0.3982 0.1390 -0.0515 -0.0011 0.0265  134 LYS A NZ  
1117 N  N   A GLY A 135 ? 0.1526 0.1571 0.2147 -0.0295 0.0725  0.0092  135 GLY A N   
1118 N  N   B GLY A 135 ? 0.1585 0.1644 0.2825 -0.0208 0.0366  -0.1275 135 GLY A N   
1119 C  CA  A GLY A 135 ? 0.1953 0.1587 0.2137 -0.0306 0.0638  0.0052  135 GLY A CA  
1120 C  CA  B GLY A 135 ? 0.1805 0.1563 0.3199 -0.0228 0.0070  -0.0950 135 GLY A CA  
1121 C  C   A GLY A 135 ? 0.1489 0.1324 0.1747 -0.0180 0.0152  0.0081  135 GLY A C   
1122 C  C   B GLY A 135 ? 0.1544 0.1080 0.2760 0.0035  -0.0099 -0.0305 135 GLY A C   
1123 O  O   A GLY A 135 ? 0.1966 0.1331 0.1986 -0.0265 -0.0154 0.0142  135 GLY A O   
1124 O  O   B GLY A 135 ? 0.1626 0.1765 0.3109 -0.0206 -0.0106 0.0242  135 GLY A O   
1125 N  N   A ASP A 136 ? 0.1714 0.1630 0.1567 -0.0441 0.0296  -0.0077 136 ASP A N   
1126 N  N   B ASP A 136 ? 0.1864 0.1305 0.2534 -0.0263 -0.0098 -0.0119 136 ASP A N   
1127 C  CA  A ASP A 136 ? 0.1960 0.1751 0.2285 -0.0198 0.0773  0.0032  136 ASP A CA  
1128 C  CA  B ASP A 136 ? 0.1689 0.1642 0.2475 -0.0490 -0.0120 -0.0080 136 ASP A CA  
1129 C  C   A ASP A 136 ? 0.2859 0.1599 0.2150 0.0162  0.0275  -0.0357 136 ASP A C   
1130 C  C   B ASP A 136 ? 0.2555 0.1785 0.2442 0.0252  -0.0228 -0.0473 136 ASP A C   
1131 O  O   A ASP A 136 ? 0.2918 0.2183 0.2582 0.0753  0.0704  0.0939  136 ASP A O   
1132 O  O   B ASP A 136 ? 0.2495 0.1916 0.1560 0.0912  -0.0899 -0.0426 136 ASP A O   
1133 C  CB  A ASP A 136 ? 0.2364 0.2609 0.3555 -0.0397 0.0952  0.1376  136 ASP A CB  
1134 C  CB  B ASP A 136 ? 0.2494 0.1902 0.2940 0.0112  0.0486  0.0314  136 ASP A CB  
1135 C  CG  A ASP A 136 ? 0.2972 0.4554 0.4786 -0.0534 0.0528  0.2811  136 ASP A CG  
1136 C  CG  B ASP A 136 ? 0.2871 0.2274 0.5247 0.0015  -0.0256 0.1257  136 ASP A CG  
1137 O  OD1 A ASP A 136 ? 0.2286 0.5970 0.4807 -0.0030 0.0541  0.2326  136 ASP A OD1 
1138 O  OD1 B ASP A 136 ? 0.2616 0.3106 0.4673 -0.0319 0.0008  0.0091  136 ASP A OD1 
1139 O  OD2 A ASP A 136 ? 0.8109 0.3235 0.4360 -0.0568 -0.0490 0.1820  136 ASP A OD2 
1140 O  OD2 B ASP A 136 ? 0.4728 0.2758 0.6741 0.1056  0.0173  0.2053  136 ASP A OD2 
1141 N  N   . LYS A 137 ? 0.1541 0.1754 0.2223 -0.0180 0.0363  -0.0386 137 LYS A N   
1142 C  CA  . LYS A 137 ? 0.1594 0.1563 0.1577 -0.0385 0.0422  -0.0315 137 LYS A CA  
1143 C  C   . LYS A 137 ? 0.1341 0.1794 0.1269 -0.0372 0.0442  -0.0235 137 LYS A C   
1144 O  O   . LYS A 137 ? 0.1574 0.2266 0.1451 -0.0409 0.0653  -0.0365 137 LYS A O   
1145 C  CB  . LYS A 137 ? 0.1683 0.2402 0.1553 -0.0754 0.0192  -0.0167 137 LYS A CB  
1146 C  CG  . LYS A 137 ? 0.1819 0.2061 0.2104 -0.0922 0.0016  -0.0084 137 LYS A CG  
1147 C  CD  . LYS A 137 ? 0.1828 0.2592 0.1930 -0.0931 -0.0113 -0.0010 137 LYS A CD  
1148 C  CE  . LYS A 137 ? 0.1656 0.3041 0.2871 -0.0812 0.0019  -0.0132 137 LYS A CE  
1149 N  NZ  . LYS A 137 ? 0.2352 0.4576 0.4387 -0.1268 -0.1258 0.0211  137 LYS A NZ  
1150 N  N   . LEU A 138 ? 0.1092 0.1692 0.1017 -0.0527 0.0261  -0.0041 138 LEU A N   
1151 C  CA  . LEU A 138 ? 0.0878 0.1669 0.0997 -0.0401 0.0098  0.0028  138 LEU A CA  
1152 C  C   . LEU A 138 ? 0.0956 0.1852 0.0980 -0.0535 0.0099  -0.0003 138 LEU A C   
1153 O  O   . LEU A 138 ? 0.1001 0.2549 0.1126 -0.0735 0.0005  0.0293  138 LEU A O   
1154 C  CB  . LEU A 138 ? 0.0824 0.1641 0.1003 -0.0346 0.0132  0.0080  138 LEU A CB  
1155 C  CG  . LEU A 138 ? 0.0970 0.1471 0.0869 -0.0156 0.0153  0.0024  138 LEU A CG  
1156 C  CD1 . LEU A 138 ? 0.1282 0.1873 0.1083 -0.0060 0.0288  -0.0191 138 LEU A CD1 
1157 C  CD2 . LEU A 138 ? 0.0920 0.1506 0.0980 -0.0199 0.0096  -0.0097 138 LEU A CD2 
1158 N  N   . ALA A 139 ? 0.0827 0.1508 0.0916 -0.0336 0.0113  -0.0050 139 ALA A N   
1159 C  CA  . ALA A 139 ? 0.0886 0.1534 0.0894 -0.0381 0.0048  -0.0084 139 ALA A CA  
1160 C  C   . ALA A 139 ? 0.0782 0.1356 0.0790 -0.0232 0.0072  -0.0195 139 ALA A C   
1161 O  O   . ALA A 139 ? 0.0725 0.1310 0.0962 -0.0236 -0.0069 -0.0022 139 ALA A O   
1162 C  CB  . ALA A 139 ? 0.1137 0.1557 0.0974 -0.0416 0.0058  -0.0181 139 ALA A CB  
1163 N  N   . VAL A 140 ? 0.0687 0.1568 0.0870 -0.0273 0.0014  -0.0144 140 VAL A N   
1164 C  CA  . VAL A 140 ? 0.0658 0.1542 0.0821 -0.0177 -0.0032 -0.0145 140 VAL A CA  
1165 C  C   . VAL A 140 ? 0.0749 0.1368 0.0852 -0.0213 0.0028  -0.0096 140 VAL A C   
1166 O  O   . VAL A 140 ? 0.0860 0.1871 0.0914 -0.0429 0.0013  -0.0209 140 VAL A O   
1167 C  CB  . VAL A 140 ? 0.0801 0.1557 0.0968 -0.0134 0.0084  -0.0156 140 VAL A CB  
1168 C  CG1 . VAL A 140 ? 0.1022 0.1582 0.1196 -0.0033 0.0082  0.0032  140 VAL A CG1 
1169 C  CG2 . VAL A 140 ? 0.1068 0.1599 0.1029 0.0003  0.0124  -0.0163 140 VAL A CG2 
1170 N  N   . VAL A 141 ? 0.0787 0.1432 0.0811 -0.0267 0.0089  -0.0216 141 VAL A N   
1171 C  CA  . VAL A 141 ? 0.0888 0.1607 0.0701 -0.0380 0.0071  -0.0253 141 VAL A CA  
1172 C  C   . VAL A 141 ? 0.0761 0.1556 0.0729 -0.0273 0.0020  -0.0187 141 VAL A C   
1173 O  O   . VAL A 141 ? 0.1001 0.1386 0.0832 -0.0263 0.0011  -0.0126 141 VAL A O   
1174 C  CB  . VAL A 141 ? 0.1090 0.1519 0.1022 -0.0460 0.0204  -0.0445 141 VAL A CB  
1175 C  CG1 . VAL A 141 ? 0.1354 0.1512 0.1482 -0.0487 0.0357  -0.0422 141 VAL A CG1 
1176 C  CG2 . VAL A 141 ? 0.1027 0.1463 0.1131 -0.0192 0.0188  -0.0293 141 VAL A CG2 
1177 N  N   . SER A 142 ? 0.1157 0.2129 0.0780 -0.0745 0.0186  -0.0310 142 SER A N   
1178 C  CA  . SER A 142 ? 0.0813 0.1575 0.0835 -0.0135 0.0133  -0.0102 142 SER A CA  
1179 C  C   . SER A 142 ? 0.0788 0.1303 0.0871 -0.0105 0.0061  -0.0129 142 SER A C   
1180 O  O   . SER A 142 ? 0.1047 0.1362 0.0983 -0.0306 0.0070  -0.0128 142 SER A O   
1181 C  CB  . SER A 142 ? 0.1104 0.1806 0.1014 0.0223  -0.0131 -0.0405 142 SER A CB  
1182 O  OG  . SER A 142 ? 0.1111 0.1981 0.1006 0.0233  -0.0152 -0.0285 142 SER A OG  
1183 N  N   . THR A 143 ? 0.0799 0.1153 0.0778 -0.0051 0.0104  -0.0147 143 THR A N   
1184 C  CA  . THR A 143 ? 0.0802 0.1022 0.0734 -0.0006 0.0018  -0.0085 143 THR A CA  
1185 C  C   . THR A 143 ? 0.0672 0.1080 0.0704 -0.0015 -0.0038 -0.0079 143 THR A C   
1186 O  O   . THR A 143 ? 0.0785 0.1045 0.0752 0.0030  -0.0046 -0.0105 143 THR A O   
1187 C  CB  . THR A 143 ? 0.0910 0.1052 0.0694 -0.0008 0.0031  -0.0059 143 THR A CB  
1188 O  OG1 . THR A 143 ? 0.0845 0.1072 0.0711 0.0019  0.0022  -0.0064 143 THR A OG1 
1189 C  CG2 . THR A 143 ? 0.1282 0.1047 0.0818 0.0023  -0.0028 -0.0030 143 THR A CG2 
1190 N  N   . ALA A 144 ? 0.0753 0.0997 0.0690 -0.0033 0.0000  -0.0106 144 ALA A N   
1191 C  CA  . ALA A 144 ? 0.0706 0.1032 0.0701 0.0025  -0.0048 -0.0022 144 ALA A CA  
1192 C  C   . ALA A 144 ? 0.0731 0.0944 0.0649 0.0026  -0.0051 -0.0074 144 ALA A C   
1193 O  O   . ALA A 144 ? 0.0731 0.1026 0.0811 0.0033  -0.0076 -0.0007 144 ALA A O   
1194 C  CB  . ALA A 144 ? 0.0884 0.1182 0.0654 -0.0031 -0.0080 -0.0108 144 ALA A CB  
1195 N  N   . ASN A 145 ? 0.0650 0.0945 0.0717 0.0101  -0.0055 -0.0004 145 ASN A N   
1196 C  CA  . ASN A 145 ? 0.0647 0.0932 0.0628 0.0126  -0.0038 -0.0001 145 ASN A CA  
1197 C  C   . ASN A 145 ? 0.0691 0.0818 0.0607 0.0014  -0.0025 -0.0007 145 ASN A C   
1198 O  O   . ASN A 145 ? 0.0778 0.0905 0.0659 0.0116  -0.0001 -0.0029 145 ASN A O   
1199 C  CB  . ASN A 145 ? 0.0652 0.1024 0.0610 0.0030  -0.0001 -0.0002 145 ASN A CB  
1200 C  CG  . ASN A 145 ? 0.0769 0.1059 0.0602 0.0043  -0.0006 0.0018  145 ASN A CG  
1201 O  OD1 . ASN A 145 ? 0.0826 0.1057 0.0757 0.0091  -0.0028 0.0025  145 ASN A OD1 
1202 N  ND2 . ASN A 145 ? 0.0977 0.1112 0.0756 -0.0014 -0.0112 -0.0083 145 ASN A ND2 
1203 N  N   . GLN A 146 ? 0.0675 0.0907 0.0600 0.0095  -0.0074 -0.0002 146 GLN A N   
1204 C  CA  . GLN A 146 ? 0.0658 0.0908 0.0667 0.0049  -0.0064 -0.0082 146 GLN A CA  
1205 C  C   . GLN A 146 ? 0.0717 0.0859 0.0627 0.0108  -0.0037 -0.0054 146 GLN A C   
1206 O  O   . GLN A 146 ? 0.0800 0.0911 0.0713 0.0072  -0.0120 -0.0021 146 GLN A O   
1207 C  CB  . GLN A 146 ? 0.0654 0.0901 0.0702 0.0066  -0.0050 -0.0064 146 GLN A CB  
1208 C  CG  . GLN A 146 ? 0.0648 0.0971 0.0675 0.0041  -0.0009 -0.0094 146 GLN A CG  
1209 C  CD  . GLN A 146 ? 0.0600 0.0960 0.0731 0.0025  -0.0013 -0.0039 146 GLN A CD  
1210 O  OE1 . GLN A 146 ? 0.0731 0.0999 0.0644 0.0034  0.0017  -0.0045 146 GLN A OE1 
1211 N  NE2 . GLN A 146 ? 0.0787 0.0911 0.0747 0.0068  -0.0082 -0.0019 146 GLN A NE2 
1212 N  N   . ASP A 147 ? 0.0727 0.0849 0.0728 0.0068  -0.0088 0.0017  147 ASP A N   
1213 C  CA  . ASP A 147 ? 0.0739 0.0880 0.0732 0.0082  -0.0040 -0.0071 147 ASP A CA  
1214 C  C   . ASP A 147 ? 0.0783 0.0897 0.0733 -0.0032 -0.0014 -0.0025 147 ASP A C   
1215 O  O   . ASP A 147 ? 0.0960 0.0885 0.0796 0.0072  0.0066  -0.0067 147 ASP A O   
1216 C  CB  . ASP A 147 ? 0.0831 0.0880 0.0835 0.0010  -0.0011 -0.0127 147 ASP A CB  
1217 C  CG  . ASP A 147 ? 0.0909 0.0954 0.0829 0.0027  -0.0015 -0.0166 147 ASP A CG  
1218 O  OD1 . ASP A 147 ? 0.1042 0.1181 0.0853 -0.0086 0.0119  -0.0252 147 ASP A OD1 
1219 O  OD2 . ASP A 147 ? 0.0971 0.1440 0.0949 0.0102  -0.0096 -0.0389 147 ASP A OD2 
1220 N  N   . SER A 148 ? 0.0850 0.0842 0.0738 0.0022  -0.0004 -0.0069 148 SER A N   
1221 C  CA  . SER A 148 ? 0.0890 0.0872 0.0717 -0.0023 -0.0011 0.0029  148 SER A CA  
1222 C  C   . SER A 148 ? 0.0821 0.0889 0.0669 -0.0089 -0.0106 -0.0054 148 SER A C   
1223 O  O   . SER A 148 ? 0.0914 0.0868 0.0779 -0.0063 -0.0014 -0.0075 148 SER A O   
1224 C  CB  . SER A 148 ? 0.0857 0.0907 0.0809 -0.0116 -0.0107 -0.0038 148 SER A CB  
1225 O  OG  . SER A 148 ? 0.1072 0.0937 0.0793 -0.0174 -0.0104 0.0053  148 SER A OG  
1226 N  N   . PRO A 149 ? 0.0848 0.0882 0.0783 -0.0069 0.0014  -0.0058 149 PRO A N   
1227 C  CA  . PRO A 149 ? 0.0830 0.0975 0.0781 -0.0133 -0.0075 -0.0043 149 PRO A CA  
1228 C  C   . PRO A 149 ? 0.0899 0.0874 0.0792 -0.0067 -0.0090 -0.0043 149 PRO A C   
1229 O  O   . PRO A 149 ? 0.0994 0.0932 0.0861 -0.0161 -0.0021 -0.0106 149 PRO A O   
1230 C  CB  . PRO A 149 ? 0.0926 0.1059 0.0854 -0.0077 0.0067  -0.0038 149 PRO A CB  
1231 C  CG  . PRO A 149 ? 0.1005 0.1076 0.1069 -0.0088 0.0152  -0.0098 149 PRO A CG  
1232 C  CD  . PRO A 149 ? 0.0938 0.0898 0.0852 0.0044  -0.0005 -0.0036 149 PRO A CD  
1233 N  N   . LEU A 150 ? 0.0841 0.0900 0.0867 -0.0019 -0.0055 -0.0032 150 LEU A N   
1234 C  CA  . LEU A 150 ? 0.0983 0.0823 0.0780 -0.0051 -0.0053 -0.0041 150 LEU A CA  
1235 C  C   . LEU A 150 ? 0.1019 0.0860 0.0887 -0.0029 -0.0068 -0.0033 150 LEU A C   
1236 O  O   . LEU A 150 ? 0.1186 0.0979 0.0969 0.0081  -0.0108 -0.0006 150 LEU A O   
1237 C  CB  . LEU A 150 ? 0.0942 0.0927 0.0816 -0.0005 -0.0112 -0.0015 150 LEU A CB  
1238 C  CG  . LEU A 150 ? 0.1042 0.0991 0.0904 0.0043  -0.0198 -0.0094 150 LEU A CG  
1239 C  CD1 . LEU A 150 ? 0.1286 0.1243 0.1149 -0.0121 -0.0341 -0.0248 150 LEU A CD1 
1240 C  CD2 . LEU A 150 ? 0.1430 0.1039 0.0880 0.0044  0.0054  -0.0045 150 LEU A CD2 
1241 N  N   . MET A 151 ? 0.0982 0.0885 0.0823 0.0004  -0.0083 -0.0096 151 MET A N   
1242 C  CA  . MET A 151 ? 0.0958 0.0906 0.0903 -0.0007 -0.0044 -0.0126 151 MET A CA  
1243 C  C   . MET A 151 ? 0.1183 0.0855 0.0911 -0.0029 -0.0031 -0.0067 151 MET A C   
1244 O  O   . MET A 151 ? 0.1357 0.0928 0.1187 -0.0032 0.0121  -0.0248 151 MET A O   
1245 C  CB  . MET A 151 ? 0.0964 0.0903 0.0899 -0.0023 0.0010  -0.0091 151 MET A CB  
1246 C  CG  . MET A 151 ? 0.0828 0.0997 0.0898 -0.0014 -0.0065 -0.0084 151 MET A CG  
1247 S  SD  . MET A 151 ? 0.0882 0.0962 0.0854 0.0058  -0.0008 -0.0025 151 MET A SD  
1248 C  CE  . MET A 151 ? 0.0817 0.1028 0.1065 0.0004  -0.0021 0.0038  151 MET A CE  
1249 N  N   . GLY A 152 ? 0.1167 0.0960 0.0994 -0.0166 0.0000  -0.0208 152 GLY A N   
1250 C  CA  . GLY A 152 ? 0.1233 0.1004 0.1060 -0.0247 0.0072  -0.0166 152 GLY A CA  
1251 C  C   . GLY A 152 ? 0.1273 0.1029 0.0911 -0.0170 0.0026  -0.0249 152 GLY A C   
1252 O  O   . GLY A 152 ? 0.1193 0.1123 0.1078 -0.0094 0.0112  -0.0241 152 GLY A O   
1253 N  N   . GLU A 153 ? 0.1257 0.1121 0.1210 -0.0211 -0.0019 -0.0300 153 GLU A N   
1254 C  CA  . GLU A 153 ? 0.1140 0.1416 0.1239 -0.0136 0.0014  -0.0388 153 GLU A CA  
1255 C  C   . GLU A 153 ? 0.1388 0.1419 0.1172 -0.0218 -0.0069 -0.0502 153 GLU A C   
1256 O  O   . GLU A 153 ? 0.1423 0.1650 0.1272 -0.0238 -0.0152 -0.0379 153 GLU A O   
1257 C  CB  . GLU A 153 ? 0.1475 0.1869 0.1555 -0.0486 0.0043  -0.0554 153 GLU A CB  
1258 C  CG  . GLU A 153 ? 0.1649 0.1679 0.1694 -0.0409 0.0245  -0.0458 153 GLU A CG  
1259 C  CD  . GLU A 153 ? 0.1391 0.2252 0.1705 -0.0255 0.0098  -0.0500 153 GLU A CD  
1260 O  OE1 . GLU A 153 ? 0.2015 0.2111 0.2261 -0.0135 -0.0140 -0.0275 153 GLU A OE1 
1261 O  OE2 . GLU A 153 ? 0.1443 0.2588 0.2001 -0.0317 0.0095  -0.1070 153 GLU A OE2 
1262 N  N   . ALA A 154 ? 0.1562 0.1467 0.1349 -0.0181 0.0015  -0.0639 154 ALA A N   
1263 C  CA  . ALA A 154 ? 0.1758 0.1678 0.1469 -0.0086 -0.0021 -0.0791 154 ALA A CA  
1264 C  C   . ALA A 154 ? 0.1784 0.1876 0.1102 -0.0036 -0.0125 -0.0510 154 ALA A C   
1265 O  O   . ALA A 154 ? 0.2222 0.2675 0.1086 -0.0257 -0.0390 -0.0447 154 ALA A O   
1266 C  CB  . ALA A 154 ? 0.2201 0.1628 0.1780 -0.0060 0.0251  -0.0917 154 ALA A CB  
1267 N  N   . ILE A 155 ? 0.1326 0.1464 0.0957 0.0117  -0.0075 -0.0272 155 ILE A N   
1268 C  CA  . ILE A 155 ? 0.1340 0.1646 0.0979 0.0158  0.0076  -0.0156 155 ILE A CA  
1269 C  C   . ILE A 155 ? 0.1258 0.1539 0.1019 0.0078  0.0043  -0.0018 155 ILE A C   
1270 O  O   . ILE A 155 ? 0.1529 0.1952 0.1033 0.0075  -0.0022 0.0123  155 ILE A O   
1271 C  CB  . ILE A 155 ? 0.1200 0.1675 0.1072 0.0109  0.0098  0.0023  155 ILE A CB  
1272 C  CG1 . ILE A 155 ? 0.1347 0.1949 0.1416 0.0301  0.0198  -0.0060 155 ILE A CG1 
1273 C  CG2 . ILE A 155 ? 0.1396 0.1876 0.1234 -0.0060 -0.0063 0.0295  155 ILE A CG2 
1274 C  CD1 . ILE A 155 ? 0.1442 0.2115 0.2069 0.0398  -0.0110 -0.0007 155 ILE A CD1 
1275 N  N   . SER A 156 ? 0.1227 0.1298 0.1053 0.0058  0.0078  -0.0043 156 SER A N   
1276 C  CA  . SER A 156 ? 0.1123 0.1239 0.1155 0.0000  0.0023  -0.0020 156 SER A CA  
1277 C  C   . SER A 156 ? 0.1159 0.1330 0.1024 -0.0024 -0.0005 -0.0027 156 SER A C   
1278 O  O   . SER A 156 ? 0.1062 0.1331 0.1102 -0.0009 -0.0030 -0.0014 156 SER A O   
1279 C  CB  . SER A 156 ? 0.1052 0.1135 0.1217 -0.0068 -0.0035 -0.0101 156 SER A CB  
1280 O  OG  . SER A 156 ? 0.1135 0.1154 0.1155 -0.0199 -0.0063 -0.0160 156 SER A OG  
1281 N  N   . GLY A 157 ? 0.1137 0.1487 0.0954 -0.0144 -0.0049 -0.0215 157 GLY A N   
1282 C  CA  . GLY A 157 ? 0.1188 0.1460 0.1099 -0.0217 -0.0068 -0.0222 157 GLY A CA  
1283 C  C   . GLY A 157 ? 0.1017 0.1607 0.1086 -0.0174 -0.0065 -0.0247 157 GLY A C   
1284 O  O   . GLY A 157 ? 0.1030 0.2878 0.1297 -0.0031 -0.0027 -0.0235 157 GLY A O   
1285 N  N   . ALA A 158 ? 0.1007 0.1417 0.1053 -0.0066 0.0023  -0.0204 158 ALA A N   
1286 C  CA  . ALA A 158 ? 0.1123 0.1558 0.0982 0.0014  0.0067  -0.0177 158 ALA A CA  
1287 C  C   . ALA A 158 ? 0.1025 0.1240 0.0948 -0.0089 0.0041  -0.0218 158 ALA A C   
1288 O  O   . ALA A 158 ? 0.1110 0.1325 0.0968 -0.0119 0.0087  -0.0148 158 ALA A O   
1289 C  CB  . ALA A 158 ? 0.1971 0.1555 0.1217 0.0358  0.0106  -0.0207 158 ALA A CB  
1290 N  N   . SER A 159 ? 0.1086 0.1323 0.1011 -0.0094 0.0036  -0.0230 159 SER A N   
1291 C  CA  . SER A 159 ? 0.1072 0.1194 0.0976 -0.0228 0.0102  -0.0259 159 SER A CA  
1292 C  C   . SER A 159 ? 0.1084 0.1058 0.0953 -0.0197 0.0127  -0.0169 159 SER A C   
1293 O  O   . SER A 159 ? 0.1187 0.1436 0.0988 -0.0103 0.0116  -0.0261 159 SER A O   
1294 C  CB  . SER A 159 ? 0.1266 0.1194 0.1113 -0.0211 0.0192  -0.0331 159 SER A CB  
1295 O  OG  . SER A 159 ? 0.1528 0.1539 0.1524 -0.0580 0.0266  -0.0445 159 SER A OG  
1296 N  N   . GLY A 160 ? 0.1171 0.1033 0.1027 -0.0174 0.0076  -0.0263 160 GLY A N   
1297 C  CA  . GLY A 160 ? 0.1220 0.1112 0.0881 -0.0238 0.0044  -0.0222 160 GLY A CA  
1298 C  C   . GLY A 160 ? 0.1043 0.1006 0.0885 -0.0184 0.0081  -0.0089 160 GLY A C   
1299 O  O   . GLY A 160 ? 0.1442 0.1192 0.0933 -0.0387 0.0101  -0.0112 160 GLY A O   
1300 N  N   . PHE A 161 ? 0.1121 0.0958 0.0839 -0.0209 0.0064  -0.0134 161 PHE A N   
1301 C  CA  . PHE A 161 ? 0.0972 0.0919 0.0866 -0.0094 0.0102  -0.0127 161 PHE A CA  
1302 C  C   . PHE A 161 ? 0.0864 0.0848 0.0755 -0.0152 0.0016  -0.0087 161 PHE A C   
1303 O  O   . PHE A 161 ? 0.0784 0.0913 0.0875 -0.0126 0.0072  -0.0039 161 PHE A O   
1304 C  CB  . PHE A 161 ? 0.1034 0.0843 0.0950 -0.0118 0.0065  -0.0042 161 PHE A CB  
1305 C  CG  . PHE A 161 ? 0.1177 0.0897 0.0990 -0.0138 -0.0150 0.0115  161 PHE A CG  
1306 C  CD1 . PHE A 161 ? 0.1154 0.1760 0.1090 -0.0273 -0.0264 0.0160  161 PHE A CD1 
1307 C  CD2 . PHE A 161 ? 0.1766 0.1109 0.1316 0.0097  -0.0449 -0.0256 161 PHE A CD2 
1308 C  CE1 . PHE A 161 ? 0.1315 0.1769 0.1369 -0.0474 -0.0218 0.0297  161 PHE A CE1 
1309 C  CE2 . PHE A 161 ? 0.1726 0.1290 0.1888 -0.0009 -0.0583 -0.0462 161 PHE A CE2 
1310 C  CZ  . PHE A 161 ? 0.1887 0.1071 0.1676 -0.0306 -0.0357 0.0052  161 PHE A CZ  
1311 N  N   . PRO A 162 ? 0.0778 0.0878 0.0810 -0.0065 0.0058  -0.0059 162 PRO A N   
1312 C  CA  . PRO A 162 ? 0.0844 0.0820 0.0787 -0.0096 -0.0002 -0.0022 162 PRO A CA  
1313 C  C   . PRO A 162 ? 0.0718 0.0856 0.0762 -0.0013 -0.0031 -0.0034 162 PRO A C   
1314 O  O   . PRO A 162 ? 0.0747 0.1230 0.0864 -0.0009 -0.0056 -0.0280 162 PRO A O   
1315 C  CB  . PRO A 162 ? 0.0949 0.0893 0.0828 -0.0142 0.0068  -0.0048 162 PRO A CB  
1316 C  CG  . PRO A 162 ? 0.0924 0.0930 0.1064 -0.0104 0.0178  -0.0062 162 PRO A CG  
1317 C  CD  . PRO A 162 ? 0.0903 0.0901 0.0905 -0.0135 0.0149  -0.0087 162 PRO A CD  
1318 N  N   . ILE A 163 ? 0.0641 0.0830 0.0830 -0.0044 -0.0036 -0.0062 163 ILE A N   
1319 C  CA  . ILE A 163 ? 0.0744 0.0824 0.0713 -0.0045 0.0007  -0.0040 163 ILE A CA  
1320 C  C   . ILE A 163 ? 0.0734 0.0823 0.0662 -0.0043 0.0005  0.0014  163 ILE A C   
1321 O  O   . ILE A 163 ? 0.0801 0.0859 0.0764 -0.0103 -0.0120 -0.0003 163 ILE A O   
1322 C  CB  . ILE A 163 ? 0.0703 0.1019 0.0732 -0.0132 -0.0008 -0.0028 163 ILE A CB  
1323 C  CG1 . ILE A 163 ? 0.1014 0.1126 0.0852 -0.0286 0.0108  -0.0066 163 ILE A CG1 
1324 C  CG2 . ILE A 163 ? 0.0833 0.1106 0.0856 -0.0124 0.0134  -0.0117 163 ILE A CG2 
1325 C  CD1 . ILE A 163 ? 0.1340 0.1013 0.0991 -0.0170 0.0053  0.0076  163 ILE A CD1 
1326 N  N   . MET A 164 ? 0.0716 0.0849 0.0754 -0.0041 -0.0055 -0.0011 164 MET A N   
1327 C  CA  . MET A 164 ? 0.0731 0.0792 0.0725 0.0002  -0.0063 0.0011  164 MET A CA  
1328 C  C   . MET A 164 ? 0.0697 0.0844 0.0762 0.0010  -0.0031 -0.0037 164 MET A C   
1329 O  O   . MET A 164 ? 0.0855 0.0890 0.0689 -0.0005 -0.0048 -0.0039 164 MET A O   
1330 C  CB  . MET A 164 ? 0.0916 0.0889 0.0745 0.0062  -0.0001 -0.0044 164 MET A CB  
1331 C  CG  . MET A 164 ? 0.0900 0.1169 0.0832 0.0000  0.0064  -0.0167 164 MET A CG  
1332 S  SD  . MET A 164 ? 0.0810 0.1216 0.0992 0.0140  -0.0014 -0.0119 164 MET A SD  
1333 C  CE  . MET A 164 ? 0.0835 0.1313 0.1290 0.0048  0.0014  -0.0131 164 MET A CE  
1334 N  N   . GLY A 165 ? 0.0795 0.0897 0.0743 -0.0010 -0.0029 0.0074  165 GLY A N   
1335 C  CA  . GLY A 165 ? 0.1216 0.0852 0.0718 0.0017  -0.0107 0.0034  165 GLY A CA  
1336 C  C   . GLY A 165 ? 0.0761 0.0873 0.0689 0.0049  0.0005  0.0016  165 GLY A C   
1337 O  O   . GLY A 165 ? 0.0966 0.0949 0.0735 -0.0014 -0.0115 0.0018  165 GLY A O   
1338 N  N   . LEU A 166 ? 0.0757 0.0849 0.0667 -0.0010 -0.0018 -0.0003 166 LEU A N   
1339 C  CA  . LEU A 166 ? 0.0701 0.0903 0.0695 0.0062  0.0031  -0.0001 166 LEU A CA  
1340 C  C   . LEU A 166 ? 0.0647 0.0914 0.0641 0.0076  0.0020  -0.0017 166 LEU A C   
1341 O  O   . LEU A 166 ? 0.0798 0.0955 0.0702 -0.0008 -0.0006 -0.0032 166 LEU A O   
1342 C  CB  . LEU A 166 ? 0.0709 0.1036 0.0754 0.0089  0.0033  -0.0071 166 LEU A CB  
1343 C  CG  . LEU A 166 ? 0.0765 0.1094 0.0705 0.0184  0.0016  -0.0046 166 LEU A CG  
1344 C  CD1 . LEU A 166 ? 0.0851 0.1017 0.0758 0.0142  0.0042  0.0005  166 LEU A CD1 
1345 C  CD2 . LEU A 166 ? 0.0792 0.1201 0.1082 0.0182  -0.0077 -0.0040 166 LEU A CD2 
1346 N  N   . ASP A 167 ? 0.0666 0.0963 0.0585 0.0038  -0.0022 -0.0038 167 ASP A N   
1347 C  CA  . ASP A 167 ? 0.0671 0.0870 0.0584 0.0055  -0.0053 -0.0044 167 ASP A CA  
1348 C  C   . ASP A 167 ? 0.0628 0.0924 0.0682 0.0042  -0.0023 -0.0022 167 ASP A C   
1349 O  O   . ASP A 167 ? 0.0917 0.0982 0.0701 0.0203  -0.0098 -0.0109 167 ASP A O   
1350 C  CB  . ASP A 167 ? 0.0652 0.0882 0.0694 0.0073  0.0002  -0.0025 167 ASP A CB  
1351 C  CG  . ASP A 167 ? 0.0698 0.0811 0.0698 0.0084  0.0011  -0.0008 167 ASP A CG  
1352 O  OD1 . ASP A 167 ? 0.0690 0.0999 0.0652 0.0013  -0.0009 -0.0079 167 ASP A OD1 
1353 O  OD2 . ASP A 167 ? 0.0757 0.0901 0.0748 -0.0035 -0.0019 -0.0058 167 ASP A OD2 
1354 N  N   . VAL A 168 ? 0.0697 0.0856 0.0627 0.0080  -0.0018 -0.0024 168 VAL A N   
1355 C  CA  . VAL A 168 ? 0.0658 0.0972 0.0588 0.0075  -0.0056 -0.0014 168 VAL A CA  
1356 C  C   . VAL A 168 ? 0.0692 0.0924 0.0634 0.0069  -0.0071 -0.0059 168 VAL A C   
1357 O  O   . VAL A 168 ? 0.0711 0.1131 0.0646 0.0089  -0.0076 0.0027  168 VAL A O   
1358 C  CB  . VAL A 168 ? 0.0644 0.1099 0.0743 0.0095  -0.0024 -0.0014 168 VAL A CB  
1359 C  CG1 . VAL A 168 ? 0.0679 0.1480 0.0738 0.0103  -0.0020 0.0088  168 VAL A CG1 
1360 C  CG2 . VAL A 168 ? 0.0697 0.1260 0.0867 -0.0043 -0.0117 -0.0107 168 VAL A CG2 
1361 N  N   . TRP A 169 ? 0.0685 0.0899 0.0697 0.0057  0.0009  0.0039  169 TRP A N   
1362 C  CA  . TRP A 169 ? 0.0756 0.0890 0.0586 0.0054  0.0006  -0.0031 169 TRP A CA  
1363 C  C   . TRP A 169 ? 0.0639 0.0910 0.0712 0.0086  -0.0032 -0.0021 169 TRP A C   
1364 O  O   . TRP A 169 ? 0.0756 0.0941 0.0639 0.0070  -0.0027 -0.0071 169 TRP A O   
1365 C  CB  . TRP A 169 ? 0.0684 0.0936 0.0604 0.0058  -0.0038 -0.0018 169 TRP A CB  
1366 C  CG  . TRP A 169 ? 0.0710 0.0918 0.0651 0.0094  -0.0002 -0.0009 169 TRP A CG  
1367 C  CD1 . TRP A 169 ? 0.0674 0.0931 0.0623 0.0019  -0.0051 -0.0065 169 TRP A CD1 
1368 C  CD2 . TRP A 169 ? 0.0693 0.0935 0.0621 0.0086  -0.0018 -0.0041 169 TRP A CD2 
1369 N  NE1 . TRP A 169 ? 0.0671 0.0856 0.0711 0.0040  -0.0007 -0.0031 169 TRP A NE1 
1370 C  CE2 . TRP A 169 ? 0.0655 0.0923 0.0646 0.0053  -0.0054 0.0021  169 TRP A CE2 
1371 C  CE3 . TRP A 169 ? 0.0731 0.0907 0.0720 0.0039  -0.0004 0.0030  169 TRP A CE3 
1372 C  CZ2 . TRP A 169 ? 0.0699 0.0902 0.0684 0.0088  -0.0079 -0.0092 169 TRP A CZ2 
1373 C  CZ3 . TRP A 169 ? 0.0713 0.0958 0.0697 0.0009  0.0017  -0.0017 169 TRP A CZ3 
1374 C  CH2 . TRP A 169 ? 0.0707 0.1037 0.0610 0.0057  -0.0014 -0.0079 169 TRP A CH2 
1375 N  N   . GLU A 170 ? 0.0745 0.0871 0.0660 0.0084  -0.0026 -0.0053 170 GLU A N   
1376 C  CA  . GLU A 170 ? 0.0759 0.0867 0.0638 0.0142  -0.0027 0.0007  170 GLU A CA  
1377 C  C   . GLU A 170 ? 0.0808 0.0908 0.0638 0.0035  -0.0032 -0.0013 170 GLU A C   
1378 O  O   . GLU A 170 ? 0.0926 0.0884 0.0714 0.0090  -0.0092 -0.0063 170 GLU A O   
1379 C  CB  . GLU A 170 ? 0.0770 0.1000 0.0685 0.0067  -0.0014 0.0051  170 GLU A CB  
1380 C  CG  . GLU A 170 ? 0.0766 0.1069 0.0676 0.0083  -0.0062 0.0023  170 GLU A CG  
1381 C  CD  . GLU A 170 ? 0.0801 0.0920 0.0756 0.0097  -0.0068 -0.0026 170 GLU A CD  
1382 O  OE1 . GLU A 170 ? 0.0865 0.0995 0.0688 0.0110  -0.0015 0.0004  170 GLU A OE1 
1383 O  OE2 . GLU A 170 ? 0.0867 0.1482 0.0846 0.0331  -0.0025 0.0190  170 GLU A OE2 
1384 N  N   . HIS A 171 ? 0.0755 0.0962 0.0681 0.0069  0.0012  -0.0046 171 HIS A N   
1385 C  CA  . HIS A 171 ? 0.0829 0.0891 0.0692 0.0042  -0.0040 -0.0023 171 HIS A CA  
1386 C  C   . HIS A 171 ? 0.0847 0.0909 0.0702 0.0096  -0.0058 -0.0013 171 HIS A C   
1387 O  O   . HIS A 171 ? 0.1004 0.1046 0.0751 -0.0119 -0.0045 -0.0051 171 HIS A O   
1388 C  CB  . HIS A 171 ? 0.0723 0.0978 0.0713 -0.0041 -0.0017 0.0035  171 HIS A CB  
1389 C  CG  . HIS A 171 ? 0.0713 0.0960 0.0725 0.0021  -0.0065 0.0018  171 HIS A CG  
1390 N  ND1 . HIS A 171 ? 0.0792 0.1024 0.0732 0.0004  -0.0064 0.0045  171 HIS A ND1 
1391 C  CD2 . HIS A 171 ? 0.0785 0.0906 0.0760 0.0059  -0.0022 0.0018  171 HIS A CD2 
1392 C  CE1 . HIS A 171 ? 0.0802 0.0959 0.0729 0.0036  -0.0068 -0.0060 171 HIS A CE1 
1393 N  NE2 . HIS A 171 ? 0.0802 0.0963 0.0726 0.0009  -0.0029 -0.0016 171 HIS A NE2 
1394 N  N   . ALA A 172 ? 0.0779 0.0908 0.0665 0.0074  -0.0030 -0.0038 172 ALA A N   
1395 C  CA  . ALA A 172 ? 0.0747 0.1000 0.0717 0.0093  -0.0031 -0.0057 172 ALA A CA  
1396 C  C   . ALA A 172 ? 0.0801 0.0961 0.0682 0.0081  -0.0043 -0.0067 172 ALA A C   
1397 O  O   . ALA A 172 ? 0.1027 0.1162 0.0721 0.0121  -0.0033 -0.0054 172 ALA A O   
1398 C  CB  . ALA A 172 ? 0.0942 0.0960 0.0779 0.0048  -0.0011 0.0049  172 ALA A CB  
1399 N  N   . TYR A 173 ? 0.0861 0.0933 0.0742 0.0108  0.0036  -0.0005 173 TYR A N   
1400 C  CA  . TYR A 173 ? 0.0862 0.1048 0.0754 0.0128  0.0035  -0.0007 173 TYR A CA  
1401 C  C   . TYR A 173 ? 0.0882 0.1070 0.0748 0.0175  -0.0023 -0.0014 173 TYR A C   
1402 O  O   . TYR A 173 ? 0.1013 0.1062 0.0813 0.0198  0.0048  -0.0021 173 TYR A O   
1403 C  CB  . TYR A 173 ? 0.0861 0.1100 0.0706 0.0091  -0.0005 -0.0039 173 TYR A CB  
1404 C  CG  . TYR A 173 ? 0.0746 0.1108 0.0889 0.0105  0.0037  -0.0020 173 TYR A CG  
1405 C  CD1 . TYR A 173 ? 0.1008 0.1074 0.1003 0.0158  -0.0112 0.0020  173 TYR A CD1 
1406 C  CD2 . TYR A 173 ? 0.0839 0.1081 0.0821 0.0157  0.0016  0.0002  173 TYR A CD2 
1407 C  CE1 . TYR A 173 ? 0.0935 0.1160 0.1114 0.0124  -0.0122 -0.0011 173 TYR A CE1 
1408 C  CE2 . TYR A 173 ? 0.0776 0.1138 0.0885 0.0090  0.0048  -0.0104 173 TYR A CE2 
1409 C  CZ  . TYR A 173 ? 0.0864 0.1167 0.0818 0.0076  0.0038  -0.0014 173 TYR A CZ  
1410 O  OH  . TYR A 173 ? 0.0974 0.1311 0.0839 0.0033  -0.0030 -0.0090 173 TYR A OH  
1411 N  N   . PHE A 174 ? 0.1127 0.1068 0.1023 0.0345  0.0284  0.0229  174 PHE A N   
1412 C  CA  . PHE A 174 ? 0.1447 0.1336 0.1027 0.0520  0.0381  0.0304  174 PHE A CA  
1413 C  C   . PHE A 174 ? 0.1115 0.1271 0.1287 0.0367  0.0320  0.0426  174 PHE A C   
1414 O  O   . PHE A 174 ? 0.1188 0.1256 0.1501 0.0379  0.0250  0.0441  174 PHE A O   
1415 C  CB  . PHE A 174 ? 0.1626 0.1624 0.1238 0.0569  0.0640  0.0458  174 PHE A CB  
1416 C  CG  . PHE A 174 ? 0.1216 0.1324 0.1009 0.0167  0.0220  0.0192  174 PHE A CG  
1417 C  CD1 . PHE A 174 ? 0.1832 0.1121 0.1118 -0.0011 0.0142  -0.0222 174 PHE A CD1 
1418 C  CD2 . PHE A 174 ? 0.2387 0.2112 0.1180 -0.0981 -0.0190 0.0426  174 PHE A CD2 
1419 C  CE1 . PHE A 174 ? 0.2076 0.1382 0.1060 0.0337  -0.0251 -0.0232 174 PHE A CE1 
1420 C  CE2 . PHE A 174 ? 0.3607 0.1629 0.1240 -0.1045 -0.0137 0.0276  174 PHE A CE2 
1421 C  CZ  . PHE A 174 ? 0.2750 0.1354 0.1160 0.0162  0.0098  0.0032  174 PHE A CZ  
1422 N  N   . LEU A 175 ? 0.1175 0.1359 0.1373 0.0359  0.0344  0.0449  175 LEU A N   
1423 C  CA  . LEU A 175 ? 0.1351 0.1286 0.1606 0.0147  0.0173  0.0584  175 LEU A CA  
1424 C  C   . LEU A 175 ? 0.1309 0.1054 0.1446 0.0124  -0.0017 0.0299  175 LEU A C   
1425 O  O   . LEU A 175 ? 0.1672 0.1148 0.2103 0.0293  0.0120  0.0514  175 LEU A O   
1426 C  CB  . LEU A 175 ? 0.1306 0.1752 0.1702 0.0158  0.0029  0.0562  175 LEU A CB  
1427 C  CG  . LEU A 175 ? 0.1587 0.1376 0.1967 0.0326  0.0370  0.0156  175 LEU A CG  
1428 C  CD1 . LEU A 175 ? 0.1425 0.2233 0.2799 -0.0260 -0.0082 0.1180  175 LEU A CD1 
1429 C  CD2 . LEU A 175 ? 0.1774 0.2464 0.2178 -0.0044 0.0329  0.0862  175 LEU A CD2 
1430 N  N   . LYS A 176 ? 0.1214 0.0985 0.1246 0.0182  -0.0047 0.0090  176 LYS A N   
1431 C  CA  . LYS A 176 ? 0.1209 0.1078 0.1365 0.0199  -0.0020 0.0084  176 LYS A CA  
1432 C  C   . LYS A 176 ? 0.1237 0.1180 0.1099 0.0360  -0.0055 0.0014  176 LYS A C   
1433 O  O   . LYS A 176 ? 0.1546 0.1227 0.1539 0.0579  -0.0292 -0.0172 176 LYS A O   
1434 C  CB  . LYS A 176 ? 0.1152 0.1135 0.1200 0.0189  -0.0092 -0.0113 176 LYS A CB  
1435 C  CG  . LYS A 176 ? 0.1105 0.1132 0.1206 0.0208  -0.0090 -0.0071 176 LYS A CG  
1436 C  CD  . LYS A 176 ? 0.1036 0.1072 0.1250 0.0174  -0.0072 -0.0023 176 LYS A CD  
1437 C  CE  . LYS A 176 ? 0.1129 0.1204 0.1285 0.0199  -0.0088 0.0062  176 LYS A CE  
1438 N  NZ  . LYS A 176 ? 0.1151 0.1326 0.1297 0.0271  0.0006  0.0150  176 LYS A NZ  
1439 N  N   . PHE A 177 ? 0.1109 0.1048 0.1113 0.0277  0.0050  0.0057  177 PHE A N   
1440 C  CA  . PHE A 177 ? 0.1124 0.1216 0.0969 0.0366  0.0033  -0.0022 177 PHE A CA  
1441 C  C   . PHE A 177 ? 0.1110 0.1279 0.0991 0.0381  0.0073  0.0065  177 PHE A C   
1442 O  O   . PHE A 177 ? 0.1111 0.1652 0.0991 0.0435  -0.0008 -0.0062 177 PHE A O   
1443 C  CB  . PHE A 177 ? 0.1057 0.1214 0.0926 0.0211  -0.0074 -0.0043 177 PHE A CB  
1444 C  CG  . PHE A 177 ? 0.1074 0.1167 0.0934 0.0086  0.0007  -0.0080 177 PHE A CG  
1445 C  CD1 . PHE A 177 ? 0.1136 0.1012 0.0951 0.0151  -0.0054 -0.0093 177 PHE A CD1 
1446 C  CD2 . PHE A 177 ? 0.1017 0.1460 0.1008 0.0058  0.0073  -0.0085 177 PHE A CD2 
1447 C  CE1 . PHE A 177 ? 0.1162 0.1024 0.0970 0.0076  -0.0052 -0.0001 177 PHE A CE1 
1448 C  CE2 . PHE A 177 ? 0.1129 0.1422 0.1004 -0.0005 0.0143  -0.0114 177 PHE A CE2 
1449 C  CZ  . PHE A 177 ? 0.1277 0.1115 0.0925 -0.0047 -0.0009 0.0056  177 PHE A CZ  
1450 N  N   . GLN A 178 ? 0.1194 0.1492 0.1072 0.0401  0.0150  0.0155  178 GLN A N   
1451 C  CA  . GLN A 178 ? 0.1457 0.1408 0.1073 0.0381  0.0194  0.0163  178 GLN A CA  
1452 C  C   . GLN A 178 ? 0.1325 0.1488 0.1026 0.0463  0.0204  0.0189  178 GLN A C   
1453 O  O   . GLN A 178 ? 0.1258 0.1408 0.1271 0.0400  0.0060  0.0105  178 GLN A O   
1454 C  CB  . GLN A 178 ? 0.2203 0.1469 0.1101 0.0317  -0.0051 0.0256  178 GLN A CB  
1455 C  CG  . GLN A 178 ? 0.2667 0.1450 0.1508 0.0121  -0.0099 0.0161  178 GLN A CG  
1456 C  CD  A GLN A 178 ? 0.2195 0.1487 0.1529 0.0251  -0.0313 0.0110  178 GLN A CD  
1457 C  CD  B GLN A 178 ? 0.3586 0.1443 0.1174 0.0066  -0.0567 0.0068  178 GLN A CD  
1458 O  OE1 A GLN A 178 ? 0.2199 0.2488 0.2168 0.0957  -0.0556 -0.0430 178 GLN A OE1 
1459 O  OE1 B GLN A 178 ? 0.3877 0.1883 0.1851 0.0475  -0.1119 0.0342  178 GLN A OE1 
1460 N  NE2 A GLN A 178 ? 0.2263 0.1352 0.1949 0.0089  -0.0413 0.0004  178 GLN A NE2 
1461 N  NE2 B GLN A 178 ? 0.4546 0.1645 0.1475 -0.0480 0.0096  0.0086  178 GLN A NE2 
1462 N  N   . ASN A 179 ? 0.1626 0.1493 0.0888 0.0444  0.0024  0.0137  179 ASN A N   
1463 C  CA  . ASN A 179 ? 0.1611 0.1656 0.0831 0.0507  0.0059  0.0073  179 ASN A CA  
1464 C  C   . ASN A 179 ? 0.1819 0.1371 0.0873 0.0278  0.0028  0.0055  179 ASN A C   
1465 O  O   . ASN A 179 ? 0.2364 0.1547 0.0745 0.0061  -0.0121 0.0094  179 ASN A O   
1466 C  CB  A ASN A 179 ? 0.1388 0.1513 0.0958 0.0434  0.0030  0.0103  179 ASN A CB  
1467 C  CB  B ASN A 179 ? 0.2060 0.1386 0.0857 0.0227  0.0018  0.0071  179 ASN A CB  
1468 C  CG  A ASN A 179 ? 0.1550 0.1058 0.0686 0.0367  -0.0277 -0.0073 179 ASN A CG  
1469 C  CG  B ASN A 179 ? 0.1042 0.1310 0.1192 0.0196  0.0216  0.0076  179 ASN A CG  
1470 O  OD1 A ASN A 179 ? 0.1584 0.1193 0.1082 0.0246  -0.0273 0.0070  179 ASN A OD1 
1471 O  OD1 B ASN A 179 ? 0.1188 0.1281 0.0930 0.0092  -0.0122 -0.0021 179 ASN A OD1 
1472 N  ND2 A ASN A 179 ? 0.1226 0.1736 0.1633 0.0266  -0.0257 -0.0192 179 ASN A ND2 
1473 N  ND2 B ASN A 179 ? 0.1355 0.2389 0.0559 0.0749  -0.0219 -0.0299 179 ASN A ND2 
1474 N  N   . ARG A 180 ? 0.1282 0.1361 0.0871 0.0321  0.0045  0.0138  180 ARG A N   
1475 C  CA  . ARG A 180 ? 0.1288 0.1472 0.0864 0.0431  0.0042  0.0164  180 ARG A CA  
1476 C  C   . ARG A 180 ? 0.1024 0.1293 0.0820 0.0345  -0.0022 0.0021  180 ARG A C   
1477 O  O   . ARG A 180 ? 0.1122 0.1280 0.0798 0.0366  0.0010  0.0020  180 ARG A O   
1478 C  CB  . ARG A 180 ? 0.1326 0.1307 0.1160 0.0492  0.0048  0.0048  180 ARG A CB  
1479 C  CG  . ARG A 180 ? 0.1759 0.1466 0.1510 0.0641  0.0075  0.0330  180 ARG A CG  
1480 C  CD  . ARG A 180 ? 0.1806 0.1623 0.1754 0.0896  0.0169  0.0181  180 ARG A CD  
1481 N  NE  . ARG A 180 ? 0.2142 0.1540 0.2276 0.0882  -0.0030 -0.0108 180 ARG A NE  
1482 C  CZ  . ARG A 180 ? 0.2448 0.1562 0.2542 0.0637  -0.0216 -0.0139 180 ARG A CZ  
1483 N  NH1 . ARG A 180 ? 0.3716 0.1733 0.2289 0.0719  -0.0334 0.0065  180 ARG A NH1 
1484 N  NH2 . ARG A 180 ? 0.2392 0.1679 0.4290 0.0602  -0.0443 -0.0684 180 ARG A NH2 
1485 N  N   . ARG A 181 ? 0.1098 0.1288 0.0764 0.0316  -0.0059 0.0014  181 ARG A N   
1486 C  CA  . ARG A 181 ? 0.0979 0.1303 0.0727 0.0348  -0.0017 -0.0008 181 ARG A CA  
1487 C  C   . ARG A 181 ? 0.0907 0.1208 0.0735 0.0234  -0.0066 -0.0055 181 ARG A C   
1488 O  O   . ARG A 181 ? 0.0872 0.1245 0.0698 0.0266  -0.0046 -0.0057 181 ARG A O   
1489 C  CB  . ARG A 181 ? 0.0871 0.1351 0.0699 0.0222  -0.0011 -0.0034 181 ARG A CB  
1490 C  CG  . ARG A 181 ? 0.0871 0.1256 0.0707 0.0151  0.0003  -0.0076 181 ARG A CG  
1491 C  CD  . ARG A 181 ? 0.0814 0.1286 0.0746 0.0176  0.0000  -0.0078 181 ARG A CD  
1492 N  NE  . ARG A 181 ? 0.0821 0.1147 0.0757 0.0073  -0.0026 -0.0091 181 ARG A NE  
1493 C  CZ  . ARG A 181 ? 0.0946 0.1213 0.0645 0.0152  -0.0053 -0.0094 181 ARG A CZ  
1494 N  NH1 . ARG A 181 ? 0.1098 0.1175 0.0783 0.0011  -0.0073 -0.0041 181 ARG A NH1 
1495 N  NH2 . ARG A 181 ? 0.1017 0.1331 0.0722 0.0144  0.0052  -0.0081 181 ARG A NH2 
1496 N  N   . PRO A 182 ? 0.0852 0.1540 0.0782 0.0308  -0.0041 -0.0021 182 PRO A N   
1497 C  CA  . PRO A 182 ? 0.0809 0.1611 0.0869 0.0225  0.0005  -0.0078 182 PRO A CA  
1498 C  C   . PRO A 182 ? 0.0744 0.1353 0.0804 0.0289  -0.0022 -0.0048 182 PRO A C   
1499 O  O   . PRO A 182 ? 0.0826 0.1434 0.0848 0.0231  -0.0030 0.0009  182 PRO A O   
1500 C  CB  . PRO A 182 ? 0.0840 0.1892 0.1014 0.0234  -0.0059 -0.0134 182 PRO A CB  
1501 C  CG  . PRO A 182 ? 0.0941 0.1932 0.1140 0.0315  -0.0194 -0.0179 182 PRO A CG  
1502 C  CD  . PRO A 182 ? 0.0929 0.1748 0.0930 0.0380  -0.0129 -0.0010 182 PRO A CD  
1503 N  N   . ASP A 183 ? 0.0954 0.1256 0.0813 0.0344  -0.0030 -0.0027 183 ASP A N   
1504 C  CA  . ASP A 183 ? 0.0985 0.1248 0.0865 0.0368  0.0030  -0.0052 183 ASP A CA  
1505 C  C   . ASP A 183 ? 0.0922 0.1247 0.0892 0.0302  0.0060  -0.0080 183 ASP A C   
1506 O  O   . ASP A 183 ? 0.0985 0.1514 0.0894 0.0402  -0.0042 -0.0198 183 ASP A O   
1507 C  CB  . ASP A 183 ? 0.1287 0.1199 0.1052 0.0393  0.0034  -0.0027 183 ASP A CB  
1508 C  CG  . ASP A 183 ? 0.1707 0.1616 0.1459 0.0821  0.0336  0.0307  183 ASP A CG  
1509 O  OD1 . ASP A 183 ? 0.1305 0.2136 0.1740 0.0695  0.0040  0.0216  183 ASP A OD1 
1510 O  OD2 . ASP A 183 ? 0.2498 0.2003 0.1812 0.1233  0.0598  0.0636  183 ASP A OD2 
1511 N  N   . TYR A 184 ? 0.0882 0.1114 0.0787 0.0301  -0.0021 -0.0043 184 TYR A N   
1512 C  CA  . TYR A 184 ? 0.0734 0.1057 0.0850 0.0198  0.0011  -0.0035 184 TYR A CA  
1513 C  C   . TYR A 184 ? 0.0749 0.1014 0.0695 0.0196  0.0002  -0.0073 184 TYR A C   
1514 O  O   . TYR A 184 ? 0.0778 0.1160 0.0709 0.0148  -0.0033 -0.0097 184 TYR A O   
1515 C  CB  . TYR A 184 ? 0.0785 0.1118 0.0773 0.0238  0.0022  0.0065  184 TYR A CB  
1516 C  CG  . TYR A 184 ? 0.0751 0.1033 0.0762 0.0169  0.0056  0.0028  184 TYR A CG  
1517 C  CD1 . TYR A 184 ? 0.0863 0.1062 0.0726 0.0194  -0.0005 -0.0022 184 TYR A CD1 
1518 C  CD2 . TYR A 184 ? 0.0791 0.1123 0.0804 0.0180  -0.0008 -0.0056 184 TYR A CD2 
1519 C  CE1 . TYR A 184 ? 0.0842 0.1089 0.0737 0.0098  -0.0009 -0.0007 184 TYR A CE1 
1520 C  CE2 . TYR A 184 ? 0.0807 0.1026 0.0816 0.0116  -0.0015 -0.0100 184 TYR A CE2 
1521 C  CZ  . TYR A 184 ? 0.0731 0.1032 0.0723 0.0156  0.0052  -0.0005 184 TYR A CZ  
1522 O  OH  . TYR A 184 ? 0.0761 0.1056 0.0828 0.0136  -0.0005 -0.0043 184 TYR A OH  
1523 N  N   . ILE A 185 ? 0.0808 0.1031 0.0670 0.0185  -0.0105 -0.0018 185 ILE A N   
1524 C  CA  . ILE A 185 ? 0.0788 0.1174 0.0861 0.0136  -0.0059 -0.0003 185 ILE A CA  
1525 C  C   . ILE A 185 ? 0.0796 0.1151 0.0877 0.0031  -0.0024 0.0038  185 ILE A C   
1526 O  O   . ILE A 185 ? 0.0833 0.1390 0.0939 0.0061  -0.0051 0.0258  185 ILE A O   
1527 C  CB  . ILE A 185 ? 0.0976 0.1146 0.1070 0.0077  -0.0089 -0.0072 185 ILE A CB  
1528 C  CG1 . ILE A 185 ? 0.0986 0.1064 0.1199 0.0133  -0.0176 -0.0173 185 ILE A CG1 
1529 C  CG2 . ILE A 185 ? 0.1303 0.1449 0.1370 -0.0280 -0.0057 -0.0043 185 ILE A CG2 
1530 C  CD1 . ILE A 185 ? 0.1092 0.1313 0.1127 0.0147  -0.0159 -0.0169 185 ILE A CD1 
1531 N  N   . LYS A 186 ? 0.0507 0.1174 0.0395 0.0123  -0.0017 0.0087  186 LYS A N   
1532 C  CA  . LYS A 186 ? 0.0545 0.1682 0.0603 0.0284  0.0080  0.0101  186 LYS A CA  
1533 C  C   . LYS A 186 ? 0.0788 0.1266 0.0748 0.0288  0.0019  -0.0072 186 LYS A C   
1534 O  O   . LYS A 186 ? 0.0826 0.1459 0.0750 0.0308  0.0089  0.0029  186 LYS A O   
1535 C  CB  A LYS A 186 ? 0.1158 0.2602 0.1091 0.1039  0.0166  0.0246  186 LYS A CB  
1536 C  CB  B LYS A 186 ? 0.0397 0.2339 0.0637 0.0372  0.0097  -0.0116 186 LYS A CB  
1537 C  CB  C LYS A 186 ? 0.1111 0.2424 0.0855 0.1116  0.0184  0.0262  186 LYS A CB  
1538 C  CG  A LYS A 186 ? 0.1315 0.2864 0.1398 0.0877  -0.0077 0.0385  186 LYS A CG  
1539 C  CG  B LYS A 186 ? 0.0505 0.1291 0.0668 0.0364  0.0103  0.0227  186 LYS A CG  
1540 C  CG  C LYS A 186 ? 0.0641 0.0773 0.1054 0.0118  0.0207  0.0588  186 LYS A CG  
1541 C  CD  A LYS A 186 ? 0.2698 0.3105 0.2181 0.0139  -0.0523 -0.0152 186 LYS A CD  
1542 C  CD  B LYS A 186 ? 0.0513 0.2326 0.0802 0.0817  -0.0041 0.0107  186 LYS A CD  
1543 C  CD  C LYS A 186 ? 0.0373 0.0762 0.0724 0.0355  0.0313  -0.0031 186 LYS A CD  
1544 C  CE  A LYS A 186 ? 0.1998 0.4241 0.2408 0.0146  -0.0391 -0.0114 186 LYS A CE  
1545 C  CE  B LYS A 186 ? 0.0729 0.2581 0.0799 0.0480  -0.0091 0.0246  186 LYS A CE  
1546 C  CE  C LYS A 186 ? 0.0392 0.1152 0.1002 0.0431  0.0276  0.0707  186 LYS A CE  
1547 N  NZ  A LYS A 186 ? 0.1746 0.4109 0.2689 0.0984  0.0216  -0.0997 186 LYS A NZ  
1548 N  NZ  B LYS A 186 ? 0.2638 0.2294 0.1330 0.0667  0.0132  -0.1029 186 LYS A NZ  
1549 N  NZ  C LYS A 186 ? 0.1803 0.1188 0.0593 0.1162  0.0508  0.0341  186 LYS A NZ  
1550 N  N   . GLU A 187 ? 0.0864 0.1075 0.0827 0.0246  0.0071  -0.0013 187 GLU A N   
1551 C  CA  . GLU A 187 ? 0.1011 0.1056 0.0717 0.0123  0.0037  -0.0100 187 GLU A CA  
1552 C  C   . GLU A 187 ? 0.0931 0.1090 0.0751 0.0111  -0.0040 -0.0111 187 GLU A C   
1553 O  O   . GLU A 187 ? 0.1019 0.1139 0.0775 0.0017  -0.0093 -0.0028 187 GLU A O   
1554 C  CB  . GLU A 187 ? 0.1068 0.1109 0.0851 0.0099  0.0018  -0.0002 187 GLU A CB  
1555 C  CG  . GLU A 187 ? 0.1301 0.1075 0.0980 0.0058  0.0039  0.0046  187 GLU A CG  
1556 C  CD  . GLU A 187 ? 0.0937 0.1126 0.1039 0.0159  0.0001  0.0030  187 GLU A CD  
1557 O  OE1 . GLU A 187 ? 0.1614 0.1283 0.1411 0.0442  -0.0185 -0.0166 187 GLU A OE1 
1558 O  OE2 . GLU A 187 ? 0.0897 0.1161 0.0935 0.0087  -0.0015 -0.0122 187 GLU A OE2 
1559 N  N   . PHE A 188 ? 0.0844 0.1090 0.0765 0.0185  -0.0140 -0.0061 188 PHE A N   
1560 C  CA  . PHE A 188 ? 0.0773 0.1100 0.0792 0.0224  -0.0088 -0.0086 188 PHE A CA  
1561 C  C   . PHE A 188 ? 0.0731 0.0979 0.0838 0.0180  -0.0084 -0.0127 188 PHE A C   
1562 O  O   . PHE A 188 ? 0.0734 0.1162 0.0832 0.0238  -0.0050 -0.0080 188 PHE A O   
1563 C  CB  . PHE A 188 ? 0.0819 0.1237 0.0773 0.0234  -0.0170 -0.0146 188 PHE A CB  
1564 C  CG  . PHE A 188 ? 0.0887 0.1167 0.0814 0.0275  0.0031  -0.0131 188 PHE A CG  
1565 C  CD1 . PHE A 188 ? 0.0873 0.1141 0.0835 0.0195  0.0022  -0.0031 188 PHE A CD1 
1566 C  CD2 . PHE A 188 ? 0.1009 0.1218 0.0996 0.0102  -0.0073 -0.0235 188 PHE A CD2 
1567 C  CE1 . PHE A 188 ? 0.1019 0.1276 0.0818 0.0350  0.0092  0.0022  188 PHE A CE1 
1568 C  CE2 . PHE A 188 ? 0.1317 0.1159 0.1026 0.0061  -0.0056 -0.0252 188 PHE A CE2 
1569 C  CZ  . PHE A 188 ? 0.1284 0.1078 0.0900 0.0208  -0.0004 -0.0119 188 PHE A CZ  
1570 N  N   . TRP A 189 ? 0.0693 0.0945 0.0898 0.0106  -0.0069 -0.0086 189 TRP A N   
1571 C  CA  . TRP A 189 ? 0.0677 0.0910 0.0962 0.0107  -0.0095 -0.0098 189 TRP A CA  
1572 C  C   . TRP A 189 ? 0.0689 0.0911 0.0910 0.0187  -0.0002 -0.0015 189 TRP A C   
1573 O  O   . TRP A 189 ? 0.0817 0.0959 0.0908 0.0076  0.0000  0.0001  189 TRP A O   
1574 C  CB  . TRP A 189 ? 0.0695 0.1028 0.1131 0.0118  -0.0039 -0.0075 189 TRP A CB  
1575 C  CG  . TRP A 189 ? 0.0682 0.1058 0.1158 0.0093  -0.0060 -0.0061 189 TRP A CG  
1576 C  CD1 . TRP A 189 ? 0.0844 0.1143 0.1405 0.0175  -0.0245 -0.0100 189 TRP A CD1 
1577 C  CD2 . TRP A 189 ? 0.0734 0.1071 0.1077 0.0065  -0.0032 -0.0053 189 TRP A CD2 
1578 N  NE1 . TRP A 189 ? 0.0975 0.1209 0.1336 0.0139  -0.0364 -0.0103 189 TRP A NE1 
1579 C  CE2 . TRP A 189 ? 0.0889 0.1112 0.1031 0.0102  -0.0098 -0.0083 189 TRP A CE2 
1580 C  CE3 . TRP A 189 ? 0.0867 0.1061 0.1113 0.0073  -0.0129 -0.0123 189 TRP A CE3 
1581 C  CZ2 . TRP A 189 ? 0.1064 0.1233 0.0925 0.0047  -0.0237 -0.0148 189 TRP A CZ2 
1582 C  CZ3 . TRP A 189 ? 0.1207 0.1075 0.1016 0.0162  -0.0221 -0.0164 189 TRP A CZ3 
1583 C  CH2 . TRP A 189 ? 0.1098 0.1152 0.0994 0.0147  -0.0169 -0.0215 189 TRP A CH2 
1584 N  N   . ASN A 190 ? 0.0658 0.0891 0.0879 0.0103  0.0048  -0.0057 190 ASN A N   
1585 C  CA  . ASN A 190 ? 0.0708 0.0905 0.0863 0.0081  0.0047  -0.0113 190 ASN A CA  
1586 C  C   . ASN A 190 ? 0.0757 0.0901 0.0798 0.0085  0.0049  -0.0057 190 ASN A C   
1587 O  O   . ASN A 190 ? 0.0864 0.1123 0.0853 0.0189  -0.0061 -0.0190 190 ASN A O   
1588 C  CB  . ASN A 190 ? 0.0736 0.0957 0.0880 0.0165  0.0065  -0.0034 190 ASN A CB  
1589 C  CG  . ASN A 190 ? 0.0742 0.0974 0.0905 0.0151  0.0095  -0.0134 190 ASN A CG  
1590 O  OD1 . ASN A 190 ? 0.0888 0.1426 0.1293 0.0347  0.0333  0.0190  190 ASN A OD1 
1591 N  ND2 . ASN A 190 ? 0.0719 0.1037 0.0894 0.0142  -0.0009 -0.0110 190 ASN A ND2 
1592 N  N   . VAL A 191 ? 0.0631 0.0866 0.0783 0.0103  -0.0021 -0.0070 191 VAL A N   
1593 C  CA  . VAL A 191 ? 0.0650 0.0869 0.0771 0.0116  -0.0054 -0.0052 191 VAL A CA  
1594 C  C   . VAL A 191 ? 0.0636 0.0912 0.0773 0.0054  -0.0007 0.0005  191 VAL A C   
1595 O  O   . VAL A 191 ? 0.0688 0.0840 0.0864 0.0089  -0.0042 -0.0027 191 VAL A O   
1596 C  CB  . VAL A 191 ? 0.0627 0.0841 0.0873 0.0070  -0.0017 0.0020  191 VAL A CB  
1597 C  CG1 . VAL A 191 ? 0.0796 0.0872 0.1210 0.0035  0.0008  -0.0036 191 VAL A CG1 
1598 C  CG2 . VAL A 191 ? 0.0782 0.1001 0.0812 0.0086  -0.0013 0.0075  191 VAL A CG2 
1599 N  N   . VAL A 192 ? 0.0680 0.0826 0.0861 0.0069  -0.0078 0.0029  192 VAL A N   
1600 C  CA  . VAL A 192 ? 0.0788 0.0847 0.0817 0.0052  -0.0108 -0.0010 192 VAL A CA  
1601 C  C   . VAL A 192 ? 0.0686 0.0829 0.0844 0.0047  0.0004  0.0067  192 VAL A C   
1602 O  O   . VAL A 192 ? 0.0745 0.0920 0.0918 0.0101  -0.0030 0.0062  192 VAL A O   
1603 C  CB  . VAL A 192 ? 0.0868 0.0857 0.0951 0.0035  -0.0090 0.0006  192 VAL A CB  
1604 C  CG1 . VAL A 192 ? 0.0860 0.1075 0.0964 -0.0010 -0.0056 -0.0086 192 VAL A CG1 
1605 C  CG2 . VAL A 192 ? 0.1040 0.0932 0.1039 0.0052  -0.0185 -0.0124 192 VAL A CG2 
1606 N  N   . ASN A 193 ? 0.0687 0.0926 0.0734 0.0045  -0.0042 0.0064  193 ASN A N   
1607 C  CA  . ASN A 193 ? 0.0728 0.0790 0.0817 0.0045  -0.0011 0.0067  193 ASN A CA  
1608 C  C   . ASN A 193 ? 0.0687 0.0796 0.0726 -0.0004 -0.0010 -0.0013 193 ASN A C   
1609 O  O   . ASN A 193 ? 0.0696 0.0740 0.0807 0.0052  0.0010  -0.0006 193 ASN A O   
1610 C  CB  . ASN A 193 ? 0.0710 0.0805 0.0819 -0.0031 0.0006  0.0081  193 ASN A CB  
1611 C  CG  . ASN A 193 ? 0.0742 0.0661 0.0791 -0.0022 -0.0007 0.0064  193 ASN A CG  
1612 O  OD1 . ASN A 193 ? 0.0707 0.0886 0.0769 -0.0017 -0.0036 -0.0018 193 ASN A OD1 
1613 N  ND2 . ASN A 193 ? 0.0682 0.0869 0.0921 -0.0031 -0.0020 0.0045  193 ASN A ND2 
1614 N  N   . TRP A 194 ? 0.0630 0.0747 0.0851 0.0017  0.0024  -0.0003 194 TRP A N   
1615 C  CA  . TRP A 194 ? 0.0725 0.0739 0.0716 0.0018  -0.0023 -0.0021 194 TRP A CA  
1616 C  C   . TRP A 194 ? 0.0671 0.0785 0.0716 0.0030  0.0033  -0.0028 194 TRP A C   
1617 O  O   . TRP A 194 ? 0.0695 0.0833 0.0809 0.0015  0.0022  -0.0003 194 TRP A O   
1618 C  CB  . TRP A 194 ? 0.0634 0.0875 0.0830 -0.0013 0.0042  -0.0021 194 TRP A CB  
1619 C  CG  . TRP A 194 ? 0.0646 0.0943 0.0779 0.0002  0.0056  0.0001  194 TRP A CG  
1620 C  CD1 . TRP A 194 ? 0.0669 0.0911 0.0924 0.0034  0.0084  -0.0001 194 TRP A CD1 
1621 C  CD2 . TRP A 194 ? 0.0639 0.1008 0.0857 -0.0035 0.0016  -0.0014 194 TRP A CD2 
1622 N  NE1 . TRP A 194 ? 0.0680 0.1103 0.1023 0.0108  0.0028  0.0089  194 TRP A NE1 
1623 C  CE2 . TRP A 194 ? 0.0707 0.1083 0.0845 0.0066  0.0025  0.0034  194 TRP A CE2 
1624 C  CE3 . TRP A 194 ? 0.0729 0.1009 0.0909 -0.0031 -0.0003 -0.0082 194 TRP A CE3 
1625 C  CZ2 . TRP A 194 ? 0.0690 0.1389 0.0951 0.0016  -0.0086 0.0071  194 TRP A CZ2 
1626 C  CZ3 . TRP A 194 ? 0.0931 0.1133 0.0967 -0.0082 -0.0034 -0.0175 194 TRP A CZ3 
1627 C  CH2 . TRP A 194 ? 0.0845 0.1363 0.0917 -0.0125 -0.0119 -0.0092 194 TRP A CH2 
1628 N  N   . ASP A 195 ? 0.0728 0.0758 0.0708 0.0035  0.0000  -0.0032 195 ASP A N   
1629 C  CA  . ASP A 195 ? 0.0711 0.0789 0.0731 0.0023  -0.0033 -0.0012 195 ASP A CA  
1630 C  C   . ASP A 195 ? 0.0631 0.0819 0.0797 -0.0014 -0.0017 -0.0009 195 ASP A C   
1631 O  O   . ASP A 195 ? 0.0771 0.0788 0.0751 0.0031  -0.0009 0.0018  195 ASP A O   
1632 C  CB  . ASP A 195 ? 0.0727 0.0892 0.0765 0.0001  -0.0012 -0.0042 195 ASP A CB  
1633 C  CG  . ASP A 195 ? 0.0884 0.0929 0.0798 -0.0034 0.0062  -0.0136 195 ASP A CG  
1634 O  OD1 . ASP A 195 ? 0.0887 0.1200 0.1111 -0.0086 0.0094  -0.0333 195 ASP A OD1 
1635 O  OD2 . ASP A 195 ? 0.1037 0.1154 0.0966 -0.0175 0.0057  -0.0294 195 ASP A OD2 
1636 N  N   . GLU A 196 ? 0.0740 0.0731 0.0775 0.0019  0.0011  -0.0001 196 GLU A N   
1637 C  CA  . GLU A 196 ? 0.0697 0.0749 0.0761 0.0011  0.0051  -0.0041 196 GLU A CA  
1638 C  C   . GLU A 196 ? 0.0629 0.0802 0.0711 -0.0036 0.0008  0.0030  196 GLU A C   
1639 O  O   . GLU A 196 ? 0.0670 0.0738 0.0858 -0.0012 0.0026  0.0023  196 GLU A O   
1640 C  CB  . GLU A 196 ? 0.0658 0.0768 0.0872 -0.0080 0.0023  0.0046  196 GLU A CB  
1641 C  CG  . GLU A 196 ? 0.0712 0.0879 0.0775 -0.0051 0.0064  0.0031  196 GLU A CG  
1642 C  CD  . GLU A 196 ? 0.0827 0.1124 0.0908 0.0131  0.0080  0.0098  196 GLU A CD  
1643 O  OE1 . GLU A 196 ? 0.0890 0.1292 0.1055 -0.0111 -0.0166 0.0008  196 GLU A OE1 
1644 O  OE2 . GLU A 196 ? 0.1563 0.1607 0.0920 0.0755  -0.0017 -0.0080 196 GLU A OE2 
1645 N  N   . ALA A 197 ? 0.0660 0.0707 0.0828 -0.0015 0.0014  -0.0001 197 ALA A N   
1646 C  CA  . ALA A 197 ? 0.0608 0.0808 0.0751 0.0013  -0.0032 -0.0026 197 ALA A CA  
1647 C  C   . ALA A 197 ? 0.0580 0.0777 0.0795 0.0012  -0.0068 -0.0025 197 ALA A C   
1648 O  O   . ALA A 197 ? 0.0694 0.0820 0.0781 -0.0004 -0.0023 -0.0005 197 ALA A O   
1649 C  CB  . ALA A 197 ? 0.0676 0.0833 0.0813 0.0020  -0.0086 0.0043  197 ALA A CB  
1650 N  N   . ALA A 198 ? 0.0658 0.0780 0.0749 0.0008  0.0023  0.0026  198 ALA A N   
1651 C  CA  . ALA A 198 ? 0.0682 0.0778 0.0864 -0.0008 0.0056  0.0042  198 ALA A CA  
1652 C  C   . ALA A 198 ? 0.0692 0.0833 0.0698 0.0020  0.0004  0.0038  198 ALA A C   
1653 O  O   . ALA A 198 ? 0.0741 0.0813 0.0800 0.0011  0.0016  0.0044  198 ALA A O   
1654 C  CB  . ALA A 198 ? 0.0905 0.0910 0.0818 0.0057  0.0149  0.0035  198 ALA A CB  
1655 N  N   . ALA A 199 ? 0.0649 0.0814 0.0721 0.0038  -0.0033 -0.0028 199 ALA A N   
1656 C  CA  . ALA A 199 ? 0.0680 0.0780 0.0775 0.0031  -0.0076 0.0049  199 ALA A CA  
1657 C  C   . ALA A 199 ? 0.0621 0.0786 0.0757 -0.0032 -0.0002 0.0062  199 ALA A C   
1658 O  O   . ALA A 199 ? 0.0749 0.0830 0.0770 0.0060  -0.0009 0.0084  199 ALA A O   
1659 C  CB  . ALA A 199 ? 0.0657 0.0904 0.0946 0.0015  -0.0127 -0.0079 199 ALA A CB  
1660 N  N   . ARG A 200 ? 0.0656 0.0744 0.0755 0.0021  0.0037  0.0000  200 ARG A N   
1661 C  CA  . ARG A 200 ? 0.0668 0.0777 0.0757 -0.0042 0.0006  -0.0034 200 ARG A CA  
1662 C  C   . ARG A 200 ? 0.0702 0.0779 0.0762 -0.0047 -0.0013 0.0035  200 ARG A C   
1663 O  O   . ARG A 200 ? 0.0767 0.0802 0.0857 -0.0017 0.0047  -0.0027 200 ARG A O   
1664 C  CB  . ARG A 200 ? 0.0685 0.0824 0.0767 -0.0057 0.0067  0.0038  200 ARG A CB  
1665 C  CG  . ARG A 200 ? 0.0674 0.0831 0.0678 -0.0040 -0.0007 -0.0029 200 ARG A CG  
1666 C  CD  . ARG A 200 ? 0.0723 0.0775 0.0783 -0.0013 0.0020  0.0019  200 ARG A CD  
1667 N  NE  . ARG A 200 ? 0.0651 0.0948 0.0772 -0.0045 -0.0011 0.0018  200 ARG A NE  
1668 C  CZ  . ARG A 200 ? 0.0687 0.0801 0.0814 -0.0039 0.0023  0.0043  200 ARG A CZ  
1669 N  NH1 . ARG A 200 ? 0.0654 0.0960 0.0883 -0.0013 -0.0036 0.0036  200 ARG A NH1 
1670 N  NH2 . ARG A 200 ? 0.0793 0.1089 0.0802 -0.0085 0.0031  -0.0054 200 ARG A NH2 
1671 N  N   . PHE A 201 ? 0.0652 0.0800 0.0861 -0.0046 0.0024  0.0004  201 PHE A N   
1672 C  CA  . PHE A 201 ? 0.0749 0.0827 0.0852 -0.0109 0.0060  -0.0004 201 PHE A CA  
1673 C  C   . PHE A 201 ? 0.0707 0.0793 0.0947 -0.0061 0.0067  -0.0020 201 PHE A C   
1674 O  O   . PHE A 201 ? 0.0844 0.0785 0.0962 -0.0089 -0.0019 0.0033  201 PHE A O   
1675 C  CB  . PHE A 201 ? 0.0698 0.0892 0.0881 -0.0053 0.0025  0.0054  201 PHE A CB  
1676 C  CG  . PHE A 201 ? 0.0661 0.0937 0.1090 0.0000  0.0041  0.0030  201 PHE A CG  
1677 C  CD1 . PHE A 201 ? 0.0891 0.1213 0.1000 -0.0182 -0.0031 0.0060  201 PHE A CD1 
1678 C  CD2 . PHE A 201 ? 0.0840 0.1053 0.1107 -0.0077 0.0120  0.0025  201 PHE A CD2 
1679 C  CE1 . PHE A 201 ? 0.0836 0.1343 0.1303 -0.0211 -0.0111 -0.0148 201 PHE A CE1 
1680 C  CE2 . PHE A 201 ? 0.0900 0.1227 0.1344 -0.0119 0.0262  0.0070  201 PHE A CE2 
1681 C  CZ  . PHE A 201 ? 0.0812 0.1214 0.1497 -0.0221 0.0124  0.0007  201 PHE A CZ  
1682 N  N   . ALA A 202 ? 0.0712 0.0755 0.0894 0.0009  0.0013  0.0022  202 ALA A N   
1683 C  CA  . ALA A 202 ? 0.0796 0.0788 0.0909 -0.0026 0.0126  0.0116  202 ALA A CA  
1684 C  C   . ALA A 202 ? 0.0792 0.0825 0.0863 0.0019  0.0035  0.0054  202 ALA A C   
1685 O  O   . ALA A 202 ? 0.0931 0.0818 0.0968 -0.0014 0.0059  0.0138  202 ALA A O   
1686 C  CB  . ALA A 202 ? 0.0845 0.0993 0.0844 0.0074  0.0092  0.0038  202 ALA A CB  
1687 N  N   . ALA A 203 ? 0.0763 0.0748 0.0863 0.0025  0.0051  0.0106  203 ALA A N   
1688 C  CA  . ALA A 203 ? 0.0853 0.0740 0.0903 0.0045  0.0094  0.0037  203 ALA A CA  
1689 C  C   . ALA A 203 ? 0.0941 0.0725 0.0905 0.0014  0.0038  0.0091  203 ALA A C   
1690 O  O   . ALA A 203 ? 0.1001 0.0765 0.1314 0.0083  0.0054  0.0023  203 ALA A O   
1691 C  CB  . ALA A 203 ? 0.0782 0.0856 0.0962 0.0014  0.0051  0.0045  203 ALA A CB  
1692 N  N   . LYS A 204 ? 0.1084 0.0835 0.0873 0.0058  -0.0064 0.0018  204 LYS A N   
1693 C  CA  . LYS A 204 ? 0.1509 0.0739 0.0906 0.0046  -0.0071 0.0010  204 LYS A CA  
1694 C  C   . LYS A 204 ? 0.1613 0.0862 0.1019 -0.0129 -0.0240 0.0042  204 LYS A C   
1695 O  O   . LYS A 204 ? 0.2099 0.0937 0.1241 -0.0298 -0.0376 -0.0050 204 LYS A O   
1696 C  CB  . LYS A 204 ? 0.1443 0.0921 0.0898 -0.0034 -0.0110 -0.0009 204 LYS A CB  
1697 C  CG  . LYS A 204 ? 0.1483 0.1252 0.0875 0.0032  -0.0124 0.0140  204 LYS A CG  
1698 C  CD  . LYS A 204 ? 0.1482 0.1594 0.1347 0.0267  0.0065  0.0423  204 LYS A CD  
1699 C  CE  . LYS A 204 ? 0.1218 0.1584 0.1294 -0.0135 -0.0218 0.0231  204 LYS A CE  
1700 N  NZ  . LYS A 204 ? 0.1319 0.2035 0.1147 0.0377  -0.0175 0.0083  204 LYS A NZ  
1701 N  N   . LYS A 205 ? 0.1370 0.1045 0.1062 -0.0297 -0.0134 0.0050  205 LYS A N   
1702 C  CA  . LYS A 205 ? 0.1463 0.1291 0.1430 -0.0567 -0.0274 0.0203  205 LYS A CA  
1703 C  C   . LYS A 205 ? 0.2010 0.1261 0.1528 -0.0661 -0.0557 0.0233  205 LYS A C   
1704 O  O   . LYS A 205 ? 0.1794 0.1080 0.1498 -0.0377 -0.0163 0.0193  205 LYS A O   
1705 C  CB  . LYS A 205 ? 0.1074 0.1315 0.1493 -0.0462 -0.0098 0.0443  205 LYS A CB  
1706 C  CG  . LYS A 205 ? 0.1050 0.1368 0.1281 -0.0202 0.0084  0.0516  205 LYS A CG  
1707 C  CD  . LYS A 205 ? 0.1349 0.1900 0.1752 0.0299  0.0510  0.0461  205 LYS A CD  
1708 C  CE  . LYS A 205 ? 0.3037 0.2939 0.1583 0.1659  0.0835  0.0478  205 LYS A CE  
1709 N  NZ  . LYS A 205 ? 0.5279 0.3668 0.3014 0.2692  0.2519  0.1988  205 LYS A NZ  
1710 O  OXT . LYS A 205 ? 0.2380 0.1782 0.3854 -0.1198 -0.1364 0.1245  205 LYS A OXT 
1711 N  N   A SER B 1   ? 0.1925 0.5273 0.2153 -0.0200 -0.0394 0.1640  1   SER B N   
1712 N  N   B SER B 1   ? 0.1378 0.4284 0.3293 0.0558  -0.0705 0.0121  1   SER B N   
1713 C  CA  A SER B 1   ? 0.1054 0.3247 0.2004 0.0590  0.0052  0.1060  1   SER B CA  
1714 C  CA  B SER B 1   ? 0.1199 0.3138 0.2785 0.0673  -0.0178 0.0457  1   SER B CA  
1715 C  C   A SER B 1   ? 0.1199 0.2649 0.1929 0.0727  0.0365  0.0657  1   SER B C   
1716 C  C   B SER B 1   ? 0.1388 0.2218 0.2010 0.0104  -0.0543 0.0820  1   SER B C   
1717 O  O   A SER B 1   ? 0.0968 0.2778 0.1386 0.0327  -0.0205 0.0533  1   SER B O   
1718 O  O   B SER B 1   ? 0.3261 0.1822 0.2155 0.0175  -0.0325 0.0731  1   SER B O   
1719 C  CB  A SER B 1   ? 0.1711 0.3915 0.2628 0.0275  0.1162  0.0940  1   SER B CB  
1720 C  CB  B SER B 1   ? 0.0783 0.2454 0.3272 -0.0232 -0.0215 0.0174  1   SER B CB  
1721 O  OG  A SER B 1   ? 0.3400 0.3822 0.3953 0.0087  0.1250  -0.0279 1   SER B OG  
1722 O  OG  B SER B 1   ? 0.0896 0.1838 0.4011 0.0360  0.0252  0.0179  1   SER B OG  
1723 N  N   . TYR B 2   ? 0.1042 0.1836 0.1294 0.0172  -0.0166 0.0098  2   TYR B N   
1724 C  CA  . TYR B 2   ? 0.1147 0.1654 0.1211 0.0144  -0.0068 0.0180  2   TYR B CA  
1725 C  C   . TYR B 2   ? 0.1078 0.1709 0.1104 0.0218  -0.0149 0.0196  2   TYR B C   
1726 O  O   . TYR B 2   ? 0.1226 0.1585 0.1169 0.0230  -0.0011 0.0171  2   TYR B O   
1727 C  CB  . TYR B 2   ? 0.1096 0.1667 0.1229 0.0226  -0.0052 0.0048  2   TYR B CB  
1728 C  CG  . TYR B 2   ? 0.0860 0.1729 0.1287 0.0157  -0.0086 -0.0117 2   TYR B CG  
1729 C  CD1 . TYR B 2   ? 0.1177 0.1690 0.1289 0.0241  -0.0298 0.0061  2   TYR B CD1 
1730 C  CD2 . TYR B 2   ? 0.1556 0.1494 0.1205 -0.0065 -0.0300 0.0097  2   TYR B CD2 
1731 C  CE1 . TYR B 2   ? 0.1264 0.1742 0.1209 0.0205  -0.0313 -0.0051 2   TYR B CE1 
1732 C  CE2 . TYR B 2   ? 0.1204 0.1696 0.1085 0.0093  -0.0193 0.0032  2   TYR B CE2 
1733 C  CZ  . TYR B 2   ? 0.0921 0.1596 0.1091 -0.0012 -0.0122 0.0043  2   TYR B CZ  
1734 O  OH  . TYR B 2   ? 0.0927 0.1644 0.1180 0.0035  -0.0036 0.0086  2   TYR B OH  
1735 N  N   . THR B 3   ? 0.1175 0.1735 0.1260 0.0111  -0.0117 0.0140  3   THR B N   
1736 C  CA  . THR B 3   ? 0.1153 0.1603 0.1425 0.0237  -0.0074 0.0191  3   THR B CA  
1737 C  C   . THR B 3   ? 0.1109 0.1471 0.1450 0.0181  0.0069  0.0008  3   THR B C   
1738 O  O   . THR B 3   ? 0.1210 0.1609 0.1664 0.0284  0.0091  -0.0014 3   THR B O   
1739 C  CB  . THR B 3   ? 0.1317 0.1801 0.1632 0.0189  -0.0062 0.0391  3   THR B CB  
1740 O  OG1 . THR B 3   ? 0.1859 0.2154 0.1787 0.0157  0.0060  0.0668  3   THR B OG1 
1741 C  CG2 . THR B 3   ? 0.1274 0.2236 0.2508 0.0301  -0.0340 0.0774  3   THR B CG2 
1742 N  N   . LEU B 4   ? 0.1158 0.1527 0.1473 0.0237  0.0010  0.0022  4   LEU B N   
1743 C  CA  . LEU B 4   ? 0.1110 0.1477 0.1387 0.0299  0.0019  0.0143  4   LEU B CA  
1744 C  C   . LEU B 4   ? 0.1156 0.1482 0.1376 0.0353  -0.0018 0.0153  4   LEU B C   
1745 O  O   . LEU B 4   ? 0.1474 0.1557 0.1478 0.0494  0.0063  0.0278  4   LEU B O   
1746 C  CB  . LEU B 4   ? 0.1190 0.1545 0.1367 0.0339  -0.0041 0.0108  4   LEU B CB  
1747 C  CG  . LEU B 4   ? 0.1161 0.1459 0.1277 0.0197  0.0018  0.0190  4   LEU B CG  
1748 C  CD1 . LEU B 4   ? 0.1190 0.1688 0.1484 0.0329  -0.0158 0.0227  4   LEU B CD1 
1749 C  CD2 . LEU B 4   ? 0.1537 0.1671 0.1408 0.0152  -0.0073 0.0104  4   LEU B CD2 
1750 N  N   . PRO B 5   ? 0.1347 0.1554 0.1071 0.0452  -0.0056 0.0121  5   PRO B N   
1751 C  CA  . PRO B 5   ? 0.1185 0.1657 0.1271 0.0261  -0.0089 0.0131  5   PRO B CA  
1752 C  C   . PRO B 5   ? 0.1213 0.1688 0.1202 0.0378  -0.0053 0.0174  5   PRO B C   
1753 O  O   . PRO B 5   ? 0.1523 0.1834 0.1293 0.0157  -0.0282 0.0177  5   PRO B O   
1754 C  CB  . PRO B 5   ? 0.1342 0.1970 0.1149 0.0298  -0.0048 0.0039  5   PRO B CB  
1755 C  CG  . PRO B 5   ? 0.1448 0.1730 0.1511 0.0521  0.0193  0.0246  5   PRO B CG  
1756 C  CD  . PRO B 5   ? 0.1344 0.1555 0.1131 0.0361  -0.0036 -0.0008 5   PRO B CD  
1757 N  N   . SER B 6   ? 0.1438 0.1701 0.1544 0.0480  -0.0062 0.0211  6   SER B N   
1758 C  CA  . SER B 6   ? 0.1628 0.1673 0.1873 0.0364  0.0152  -0.0102 6   SER B CA  
1759 C  C   . SER B 6   ? 0.1536 0.1487 0.1591 0.0273  -0.0010 -0.0014 6   SER B C   
1760 O  O   . SER B 6   ? 0.1445 0.1571 0.1746 0.0251  0.0052  -0.0048 6   SER B O   
1761 C  CB  . SER B 6   ? 0.1901 0.1801 0.2725 0.0550  0.0305  0.0176  6   SER B CB  
1762 O  OG  . SER B 6   ? 0.3210 0.2506 0.2737 0.0486  -0.0360 0.0753  6   SER B OG  
1763 N  N   . LEU B 7   ? 0.1630 0.1691 0.2271 0.0295  -0.0035 -0.0449 7   LEU B N   
1764 C  CA  . LEU B 7   ? 0.1471 0.1359 0.2330 0.0058  -0.0102 -0.0010 7   LEU B CA  
1765 C  C   . LEU B 7   ? 0.1819 0.1199 0.2063 0.0213  -0.0355 0.0019  7   LEU B C   
1766 O  O   . LEU B 7   ? 0.2098 0.1426 0.3277 0.0479  -0.0476 0.0167  7   LEU B O   
1767 C  CB  . LEU B 7   ? 0.1529 0.1483 0.1871 0.0117  -0.0026 0.0286  7   LEU B CB  
1768 C  CG  . LEU B 7   ? 0.2328 0.1376 0.1826 0.0439  0.0456  0.0157  7   LEU B CG  
1769 C  CD1 . LEU B 7   ? 0.2474 0.3950 0.1568 0.0484  0.0057  0.0853  7   LEU B CD1 
1770 C  CD2 . LEU B 7   ? 0.5704 0.1334 0.1951 0.0805  0.1789  0.0261  7   LEU B CD2 
1771 N  N   . PRO B 8   ? 0.1923 0.1348 0.1795 0.0208  -0.0359 0.0060  8   PRO B N   
1772 C  CA  . PRO B 8   ? 0.2361 0.1549 0.1642 0.0121  -0.0598 0.0108  8   PRO B CA  
1773 C  C   . PRO B 8   ? 0.2245 0.1552 0.1469 0.0079  -0.0430 0.0190  8   PRO B C   
1774 O  O   . PRO B 8   ? 0.3982 0.1871 0.1300 -0.0320 -0.0365 0.0321  8   PRO B O   
1775 C  CB  . PRO B 8   ? 0.2479 0.1647 0.1556 -0.0094 -0.0272 0.0041  8   PRO B CB  
1776 C  CG  . PRO B 8   ? 0.2141 0.1628 0.1545 0.0185  -0.0239 0.0039  8   PRO B CG  
1777 C  CD  . PRO B 8   ? 0.1730 0.1470 0.1566 0.0285  -0.0146 0.0027  8   PRO B CD  
1778 N  N   . TYR B 9   ? 0.2005 0.1339 0.1402 0.0099  -0.0396 0.0207  9   TYR B N   
1779 C  CA  . TYR B 9   ? 0.2170 0.1136 0.1397 0.0113  -0.0318 0.0184  9   TYR B CA  
1780 C  C   . TYR B 9   ? 0.1817 0.1264 0.1433 0.0142  -0.0236 0.0148  9   TYR B C   
1781 O  O   . TYR B 9   ? 0.1859 0.1362 0.1617 0.0084  -0.0149 0.0252  9   TYR B O   
1782 C  CB  . TYR B 9   ? 0.2008 0.1288 0.1393 0.0075  -0.0209 0.0101  9   TYR B CB  
1783 C  CG  . TYR B 9   ? 0.1655 0.1294 0.1238 0.0034  -0.0220 0.0033  9   TYR B CG  
1784 C  CD1 . TYR B 9   ? 0.2031 0.1174 0.1244 0.0247  -0.0140 -0.0010 9   TYR B CD1 
1785 C  CD2 . TYR B 9   ? 0.1760 0.1358 0.1104 0.0127  0.0175  0.0127  9   TYR B CD2 
1786 C  CE1 . TYR B 9   ? 0.1774 0.1162 0.1108 0.0123  -0.0171 0.0037  9   TYR B CE1 
1787 C  CE2 . TYR B 9   ? 0.1715 0.1323 0.1097 0.0238  0.0033  0.0105  9   TYR B CE2 
1788 C  CZ  . TYR B 9   ? 0.1337 0.1235 0.1248 0.0168  0.0023  0.0119  9   TYR B CZ  
1789 O  OH  . TYR B 9   ? 0.1550 0.1162 0.1151 0.0176  -0.0031 0.0094  9   TYR B OH  
1790 N  N   . ALA B 10  ? 0.2016 0.1197 0.1359 0.0110  -0.0171 0.0089  10  ALA B N   
1791 C  CA  . ALA B 10  ? 0.2111 0.1221 0.1420 0.0319  -0.0227 0.0003  10  ALA B CA  
1792 C  C   . ALA B 10  ? 0.1536 0.1168 0.1341 0.0149  -0.0091 -0.0009 10  ALA B C   
1793 O  O   . ALA B 10  ? 0.1867 0.1213 0.1313 0.0202  -0.0007 -0.0106 10  ALA B O   
1794 C  CB  . ALA B 10  ? 0.3419 0.1141 0.1566 0.0182  -0.0221 -0.0064 10  ALA B CB  
1795 N  N   . TYR B 11  ? 0.1642 0.1230 0.1356 0.0208  -0.0055 -0.0046 11  TYR B N   
1796 C  CA  . TYR B 11  ? 0.1615 0.1227 0.1393 0.0211  0.0091  0.0128  11  TYR B CA  
1797 C  C   . TYR B 11  ? 0.1629 0.1093 0.1163 0.0124  -0.0002 -0.0079 11  TYR B C   
1798 O  O   . TYR B 11  ? 0.1516 0.1187 0.1371 0.0080  0.0002  0.0078  11  TYR B O   
1799 C  CB  . TYR B 11  ? 0.1724 0.1323 0.1387 0.0124  0.0177  0.0000  11  TYR B CB  
1800 C  CG  . TYR B 11  ? 0.1594 0.1747 0.1317 0.0184  0.0036  0.0084  11  TYR B CG  
1801 C  CD1 . TYR B 11  ? 0.1646 0.1420 0.1840 0.0196  -0.0102 0.0264  11  TYR B CD1 
1802 C  CD2 . TYR B 11  ? 0.1754 0.1777 0.1885 0.0131  0.0355  -0.0114 11  TYR B CD2 
1803 C  CE1 . TYR B 11  ? 0.1684 0.1523 0.1497 0.0171  -0.0017 -0.0042 11  TYR B CE1 
1804 C  CE2 . TYR B 11  ? 0.1544 0.1627 0.2205 0.0291  -0.0029 -0.0249 11  TYR B CE2 
1805 C  CZ  . TYR B 11  ? 0.1968 0.1420 0.1816 0.0315  0.0214  0.0009  11  TYR B CZ  
1806 O  OH  . TYR B 11  ? 0.1838 0.1608 0.2297 0.0188  0.0134  -0.0137 11  TYR B OH  
1807 N  N   . ASP B 12  ? 0.1761 0.1117 0.1341 0.0035  0.0040  -0.0070 12  ASP B N   
1808 C  CA  . ASP B 12  ? 0.1814 0.1163 0.1334 -0.0168 0.0021  -0.0066 12  ASP B CA  
1809 C  C   . ASP B 12  ? 0.1714 0.1025 0.1347 -0.0022 -0.0019 0.0053  12  ASP B C   
1810 O  O   . ASP B 12  ? 0.1836 0.1322 0.1567 -0.0219 0.0106  0.0131  12  ASP B O   
1811 C  CB  . ASP B 12  ? 0.1941 0.1259 0.1736 -0.0025 0.0048  -0.0228 12  ASP B CB  
1812 C  CG  . ASP B 12  ? 0.2660 0.1115 0.2337 -0.0176 -0.0291 -0.0033 12  ASP B CG  
1813 O  OD1 . ASP B 12  ? 0.2529 0.1424 0.2544 -0.0133 -0.0402 0.0297  12  ASP B OD1 
1814 O  OD2 . ASP B 12  ? 0.5271 0.1221 0.2839 -0.0690 -0.0439 -0.0135 12  ASP B OD2 
1815 N  N   . ALA B 13  ? 0.1737 0.1154 0.1243 -0.0080 0.0069  0.0050  13  ALA B N   
1816 C  CA  . ALA B 13  ? 0.1878 0.1328 0.1206 0.0057  0.0051  0.0126  13  ALA B CA  
1817 C  C   . ALA B 13  ? 0.1669 0.1248 0.1208 -0.0050 0.0129  0.0058  13  ALA B C   
1818 O  O   . ALA B 13  ? 0.2294 0.1601 0.1234 -0.0026 0.0327  0.0196  13  ALA B O   
1819 C  CB  . ALA B 13  ? 0.1744 0.1916 0.1230 0.0073  0.0028  0.0024  13  ALA B CB  
1820 N  N   . LEU B 14  ? 0.1629 0.1169 0.1150 -0.0024 0.0121  0.0012  14  LEU B N   
1821 C  CA  . LEU B 14  ? 0.1534 0.1130 0.1102 -0.0084 0.0093  -0.0088 14  LEU B CA  
1822 C  C   . LEU B 14  ? 0.1634 0.1140 0.1018 -0.0111 0.0120  -0.0071 14  LEU B C   
1823 O  O   . LEU B 14  ? 0.1553 0.1259 0.1254 -0.0054 0.0139  -0.0234 14  LEU B O   
1824 C  CB  . LEU B 14  ? 0.1632 0.1144 0.1015 -0.0048 0.0136  -0.0059 14  LEU B CB  
1825 C  CG  . LEU B 14  ? 0.1495 0.1203 0.1066 -0.0112 0.0032  -0.0059 14  LEU B CG  
1826 C  CD1 . LEU B 14  ? 0.1590 0.1188 0.1258 -0.0030 0.0115  -0.0120 14  LEU B CD1 
1827 C  CD2 . LEU B 14  ? 0.1682 0.1327 0.1145 -0.0036 0.0031  -0.0017 14  LEU B CD2 
1828 N  N   . GLU B 15  ? 0.1595 0.1133 0.1229 -0.0151 0.0090  -0.0139 15  GLU B N   
1829 C  CA  . GLU B 15  ? 0.1756 0.1236 0.1120 -0.0299 0.0140  -0.0216 15  GLU B CA  
1830 C  C   . GLU B 15  ? 0.1897 0.1380 0.1203 -0.0429 0.0344  -0.0310 15  GLU B C   
1831 O  O   . GLU B 15  ? 0.2367 0.1606 0.1240 -0.0554 0.0366  -0.0152 15  GLU B O   
1832 C  CB  . GLU B 15  ? 0.1875 0.1182 0.1239 -0.0147 0.0215  -0.0199 15  GLU B CB  
1833 C  CG  . GLU B 15  ? 0.1581 0.1270 0.1310 -0.0101 0.0216  -0.0125 15  GLU B CG  
1834 C  CD  . GLU B 15  ? 0.1409 0.1274 0.1228 -0.0249 0.0208  -0.0337 15  GLU B CD  
1835 O  OE1 . GLU B 15  ? 0.1521 0.1485 0.1293 -0.0136 0.0141  -0.0192 15  GLU B OE1 
1836 O  OE2 . GLU B 15  ? 0.1576 0.1391 0.1196 -0.0258 0.0202  -0.0234 15  GLU B OE2 
1837 N  N   . PRO B 16  ? 0.1837 0.1464 0.1527 -0.0609 0.0447  -0.0384 16  PRO B N   
1838 C  CA  . PRO B 16  ? 0.1610 0.1593 0.1617 -0.0375 0.0319  -0.0581 16  PRO B CA  
1839 C  C   . PRO B 16  ? 0.1521 0.1697 0.1442 -0.0337 0.0216  -0.0428 16  PRO B C   
1840 O  O   . PRO B 16  ? 0.2168 0.2041 0.1542 -0.0628 -0.0288 -0.0240 16  PRO B O   
1841 C  CB  . PRO B 16  ? 0.1758 0.1700 0.2106 -0.0444 0.0352  -0.0636 16  PRO B CB  
1842 C  CG  . PRO B 16  ? 0.1858 0.1627 0.2222 -0.0502 0.0642  -0.0465 16  PRO B CG  
1843 C  CD  . PRO B 16  ? 0.1938 0.1654 0.1888 -0.0471 0.0721  -0.0270 16  PRO B CD  
1844 N  N   . HIS B 17  ? 0.1320 0.1427 0.1264 -0.0220 0.0176  -0.0307 17  HIS B N   
1845 C  CA  . HIS B 17  ? 0.1140 0.1463 0.1037 -0.0063 0.0108  -0.0132 17  HIS B CA  
1846 C  C   . HIS B 17  ? 0.1207 0.1398 0.1041 -0.0136 0.0134  -0.0192 17  HIS B C   
1847 O  O   . HIS B 17  ? 0.1229 0.1625 0.1170 -0.0101 0.0128  -0.0025 17  HIS B O   
1848 C  CB  . HIS B 17  ? 0.1404 0.1239 0.1004 0.0021  0.0100  -0.0087 17  HIS B CB  
1849 C  CG  . HIS B 17  ? 0.1443 0.1253 0.1131 -0.0167 0.0258  -0.0239 17  HIS B CG  
1850 N  ND1 . HIS B 17  ? 0.1558 0.1518 0.1369 -0.0338 0.0317  -0.0245 17  HIS B ND1 
1851 C  CD2 . HIS B 17  ? 0.2096 0.1253 0.1351 0.0116  0.0578  0.0076  17  HIS B CD2 
1852 C  CE1 . HIS B 17  ? 0.2056 0.1848 0.1326 -0.0652 0.0583  -0.0375 17  HIS B CE1 
1853 N  NE2 . HIS B 17  ? 0.2572 0.1248 0.1529 -0.0175 0.0733  -0.0031 17  HIS B NE2 
1854 N  N   . PHE B 18  ? 0.1217 0.1344 0.0991 -0.0026 0.0061  -0.0054 18  PHE B N   
1855 C  CA  . PHE B 18  ? 0.1163 0.1363 0.0971 -0.0093 0.0095  -0.0091 18  PHE B CA  
1856 C  C   . PHE B 18  ? 0.1255 0.1226 0.0979 -0.0087 0.0099  -0.0084 18  PHE B C   
1857 O  O   . PHE B 18  ? 0.1529 0.1386 0.1030 0.0047  0.0001  0.0035  18  PHE B O   
1858 C  CB  . PHE B 18  ? 0.1296 0.1364 0.0948 -0.0078 -0.0058 -0.0130 18  PHE B CB  
1859 C  CG  . PHE B 18  ? 0.1296 0.1369 0.0807 -0.0093 0.0061  -0.0039 18  PHE B CG  
1860 C  CD1 . PHE B 18  ? 0.1328 0.1307 0.0929 -0.0080 0.0053  -0.0033 18  PHE B CD1 
1861 C  CD2 . PHE B 18  ? 0.1337 0.1307 0.0917 -0.0148 -0.0069 0.0042  18  PHE B CD2 
1862 C  CE1 . PHE B 18  ? 0.1361 0.1332 0.0960 -0.0040 0.0006  -0.0011 18  PHE B CE1 
1863 C  CE2 . PHE B 18  ? 0.1409 0.1304 0.0848 -0.0177 -0.0148 0.0007  18  PHE B CE2 
1864 C  CZ  . PHE B 18  ? 0.1497 0.1246 0.0770 -0.0098 -0.0050 -0.0021 18  PHE B CZ  
1865 N  N   . ASP B 19  ? 0.1196 0.1168 0.1029 -0.0051 0.0048  -0.0093 19  ASP B N   
1866 C  CA  . ASP B 19  ? 0.1277 0.1198 0.1019 -0.0101 0.0043  -0.0146 19  ASP B CA  
1867 C  C   . ASP B 19  ? 0.1337 0.1234 0.0908 -0.0069 0.0037  -0.0181 19  ASP B C   
1868 O  O   . ASP B 19  ? 0.1201 0.1143 0.1098 -0.0040 0.0015  -0.0134 19  ASP B O   
1869 C  CB  . ASP B 19  ? 0.1243 0.1298 0.1085 -0.0127 0.0047  -0.0228 19  ASP B CB  
1870 C  CG  . ASP B 19  ? 0.1242 0.1280 0.1046 -0.0060 -0.0022 -0.0196 19  ASP B CG  
1871 O  OD1 . ASP B 19  ? 0.1335 0.1221 0.1110 -0.0083 0.0002  -0.0136 19  ASP B OD1 
1872 O  OD2 . ASP B 19  ? 0.1335 0.1371 0.1077 -0.0165 0.0108  -0.0179 19  ASP B OD2 
1873 N  N   . LYS B 20  ? 0.1240 0.1126 0.1024 -0.0066 0.0018  -0.0096 20  LYS B N   
1874 C  CA  . LYS B 20  ? 0.1310 0.1262 0.1080 0.0063  -0.0007 -0.0053 20  LYS B CA  
1875 C  C   . LYS B 20  ? 0.1219 0.1086 0.1139 -0.0026 0.0010  -0.0173 20  LYS B C   
1876 O  O   . LYS B 20  ? 0.1280 0.1263 0.1335 -0.0058 0.0028  -0.0222 20  LYS B O   
1877 C  CB  . LYS B 20  ? 0.1798 0.1154 0.1513 -0.0004 0.0087  -0.0060 20  LYS B CB  
1878 C  CG  . LYS B 20  ? 0.1642 0.1436 0.1489 -0.0055 0.0051  -0.0153 20  LYS B CG  
1879 C  CD  . LYS B 20  ? 0.2671 0.1490 0.1594 -0.0471 0.0191  -0.0365 20  LYS B CD  
1880 C  CE  . LYS B 20  ? 0.4574 0.1924 0.2061 -0.1182 -0.0188 -0.0492 20  LYS B CE  
1881 N  NZ  . LYS B 20  ? 0.7921 0.1698 0.3569 -0.1590 -0.0298 -0.0536 20  LYS B NZ  
1882 N  N   . GLN B 21  ? 0.1226 0.1196 0.1108 -0.0075 0.0106  -0.0162 21  GLN B N   
1883 C  CA  . GLN B 21  ? 0.1258 0.1217 0.1136 -0.0101 0.0144  -0.0241 21  GLN B CA  
1884 C  C   . GLN B 21  ? 0.1247 0.1168 0.1162 0.0002  0.0107  -0.0189 21  GLN B C   
1885 O  O   . GLN B 21  ? 0.1178 0.1314 0.1346 -0.0027 0.0129  -0.0196 21  GLN B O   
1886 C  CB  A GLN B 21  ? 0.0953 0.1402 0.1119 -0.0072 0.0209  -0.0243 21  GLN B CB  
1887 C  CB  B GLN B 21  ? 0.2073 0.1468 0.1034 -0.0195 -0.0075 -0.0252 21  GLN B CB  
1888 C  CG  A GLN B 21  ? 0.1314 0.1282 0.1157 -0.0111 0.0314  -0.0215 21  GLN B CG  
1889 C  CG  B GLN B 21  ? 0.1990 0.2575 0.1156 -0.0256 0.0105  -0.0269 21  GLN B CG  
1890 C  CD  A GLN B 21  ? 0.2166 0.1326 0.1181 0.0264  -0.0019 0.0050  21  GLN B CD  
1891 C  CD  B GLN B 21  ? 0.2222 0.2532 0.1614 -0.0341 0.0145  -0.0974 21  GLN B CD  
1892 O  OE1 A GLN B 21  ? 0.4178 0.1926 0.1120 -0.0210 0.0406  -0.0272 21  GLN B OE1 
1893 O  OE1 B GLN B 21  ? 0.2563 0.2477 0.1723 0.0039  0.0047  -0.1107 21  GLN B OE1 
1894 N  NE2 A GLN B 21  ? 0.1731 0.3373 0.1583 0.0153  -0.0158 -0.1043 21  GLN B NE2 
1895 N  NE2 B GLN B 21  ? 0.3268 0.2745 0.3431 -0.0216 0.1656  -0.0685 21  GLN B NE2 
1896 N  N   . THR B 22  ? 0.1117 0.1181 0.1275 -0.0054 0.0077  -0.0131 22  THR B N   
1897 C  CA  . THR B 22  ? 0.1137 0.1128 0.1086 -0.0020 0.0054  -0.0058 22  THR B CA  
1898 C  C   . THR B 22  ? 0.1023 0.0998 0.1203 0.0047  0.0017  -0.0069 22  THR B C   
1899 O  O   . THR B 22  ? 0.1095 0.1116 0.1229 -0.0045 0.0045  -0.0111 22  THR B O   
1900 C  CB  . THR B 22  ? 0.1102 0.1221 0.1166 0.0044  -0.0182 -0.0147 22  THR B CB  
1901 O  OG1 . THR B 22  ? 0.1282 0.1291 0.1278 -0.0003 -0.0257 -0.0072 22  THR B OG1 
1902 C  CG2 . THR B 22  ? 0.1495 0.1149 0.1400 0.0067  -0.0143 -0.0165 22  THR B CG2 
1903 N  N   . MET B 23  ? 0.1117 0.1022 0.1173 -0.0014 -0.0071 -0.0062 23  MET B N   
1904 C  CA  . MET B 23  ? 0.1112 0.1122 0.1135 0.0010  -0.0089 -0.0138 23  MET B CA  
1905 C  C   . MET B 23  ? 0.1191 0.1009 0.1128 0.0125  -0.0055 -0.0087 23  MET B C   
1906 O  O   . MET B 23  ? 0.1106 0.1150 0.1344 -0.0024 -0.0088 -0.0159 23  MET B O   
1907 C  CB  . MET B 23  ? 0.1353 0.1126 0.1173 -0.0045 0.0004  -0.0081 23  MET B CB  
1908 C  CG  . MET B 23  ? 0.1247 0.1216 0.1147 -0.0069 -0.0032 -0.0059 23  MET B CG  
1909 S  SD  . MET B 23  ? 0.1422 0.1216 0.1069 0.0105  0.0012  -0.0031 23  MET B SD  
1910 C  CE  . MET B 23  ? 0.1520 0.1558 0.1214 -0.0126 -0.0226 -0.0108 23  MET B CE  
1911 N  N   . GLU B 24  ? 0.1160 0.1010 0.1201 0.0027  -0.0090 -0.0111 24  GLU B N   
1912 C  CA  . GLU B 24  ? 0.1204 0.1049 0.1299 0.0113  -0.0015 -0.0056 24  GLU B CA  
1913 C  C   . GLU B 24  ? 0.1272 0.0999 0.1270 0.0191  0.0074  -0.0103 24  GLU B C   
1914 O  O   . GLU B 24  ? 0.1103 0.1148 0.1346 0.0144  -0.0004 -0.0133 24  GLU B O   
1915 C  CB  . GLU B 24  ? 0.1588 0.1063 0.1428 0.0149  0.0118  -0.0139 24  GLU B CB  
1916 C  CG  . GLU B 24  ? 0.1655 0.1373 0.1918 0.0234  0.0118  -0.0246 24  GLU B CG  
1917 C  CD  . GLU B 24  ? 0.2146 0.1509 0.3562 0.0329  0.0343  -0.0748 24  GLU B CD  
1918 O  OE1 . GLU B 24  ? 0.2716 0.1439 0.4144 -0.0080 0.0642  -0.0861 24  GLU B OE1 
1919 O  OE2 . GLU B 24  ? 0.2691 0.2618 0.5316 0.0773  0.0717  -0.1672 24  GLU B OE2 
1920 N  N   . ILE B 25  ? 0.1148 0.1061 0.1174 0.0131  -0.0037 -0.0232 25  ILE B N   
1921 C  CA  . ILE B 25  ? 0.1102 0.1129 0.1043 0.0124  0.0010  -0.0195 25  ILE B CA  
1922 C  C   . ILE B 25  ? 0.0991 0.1122 0.0913 0.0133  -0.0032 -0.0080 25  ILE B C   
1923 O  O   . ILE B 25  ? 0.0988 0.1153 0.1054 0.0097  -0.0001 -0.0046 25  ILE B O   
1924 C  CB  . ILE B 25  ? 0.1207 0.1239 0.1108 0.0136  -0.0067 -0.0253 25  ILE B CB  
1925 C  CG1 . ILE B 25  ? 0.1443 0.1469 0.1078 -0.0056 -0.0094 -0.0278 25  ILE B CG1 
1926 C  CG2 . ILE B 25  ? 0.1330 0.1349 0.1005 0.0087  -0.0215 -0.0102 25  ILE B CG2 
1927 C  CD1 . ILE B 25  ? 0.1518 0.1591 0.1500 -0.0136 -0.0309 -0.0233 25  ILE B CD1 
1928 N  N   . HIS B 26  ? 0.1053 0.1024 0.0966 0.0061  0.0048  -0.0084 26  HIS B N   
1929 C  CA  . HIS B 26  ? 0.1008 0.1010 0.0890 0.0061  -0.0013 -0.0099 26  HIS B CA  
1930 C  C   . HIS B 26  ? 0.0862 0.1014 0.0984 0.0164  0.0045  -0.0038 26  HIS B C   
1931 O  O   . HIS B 26  ? 0.0945 0.1040 0.0983 0.0085  -0.0042 -0.0014 26  HIS B O   
1932 C  CB  . HIS B 26  ? 0.0902 0.1066 0.0919 0.0062  -0.0067 -0.0083 26  HIS B CB  
1933 C  CG  . HIS B 26  ? 0.0875 0.0991 0.0808 0.0135  -0.0074 0.0025  26  HIS B CG  
1934 N  ND1 . HIS B 26  ? 0.0977 0.0981 0.0888 0.0112  0.0003  -0.0029 26  HIS B ND1 
1935 C  CD2 . HIS B 26  ? 0.0852 0.0944 0.0881 0.0159  -0.0030 -0.0025 26  HIS B CD2 
1936 C  CE1 . HIS B 26  ? 0.0965 0.0994 0.0776 0.0151  0.0026  0.0003  26  HIS B CE1 
1937 N  NE2 . HIS B 26  ? 0.0835 0.1013 0.0741 0.0144  -0.0066 0.0009  26  HIS B NE2 
1938 N  N   . HIS B 27  ? 0.1041 0.1012 0.0919 0.0103  -0.0060 -0.0056 27  HIS B N   
1939 C  CA  . HIS B 27  ? 0.1029 0.1090 0.1114 0.0180  -0.0012 0.0005  27  HIS B CA  
1940 C  C   . HIS B 27  ? 0.1053 0.1003 0.1098 0.0227  0.0008  0.0006  27  HIS B C   
1941 O  O   . HIS B 27  ? 0.1004 0.1234 0.1152 0.0098  -0.0056 -0.0053 27  HIS B O   
1942 C  CB  . HIS B 27  ? 0.1102 0.1211 0.1016 0.0214  -0.0009 0.0053  27  HIS B CB  
1943 C  CG  . HIS B 27  ? 0.1027 0.1420 0.1155 0.0141  -0.0017 0.0238  27  HIS B CG  
1944 N  ND1 . HIS B 27  ? 0.1431 0.1618 0.1369 0.0453  -0.0026 0.0094  27  HIS B ND1 
1945 C  CD2 . HIS B 27  ? 0.1214 0.1680 0.1110 0.0077  -0.0130 0.0224  27  HIS B CD2 
1946 C  CE1 . HIS B 27  ? 0.1313 0.1915 0.1510 0.0313  -0.0099 0.0486  27  HIS B CE1 
1947 N  NE2 . HIS B 27  ? 0.1091 0.1848 0.1310 0.0037  -0.0133 0.0491  27  HIS B NE2 
1948 N  N   . THR B 28  ? 0.0999 0.1146 0.1081 0.0192  -0.0028 -0.0067 28  THR B N   
1949 C  CA  . THR B 28  ? 0.1059 0.1209 0.1077 0.0223  -0.0048 -0.0089 28  THR B CA  
1950 C  C   . THR B 28  ? 0.1054 0.1150 0.0997 0.0202  -0.0073 -0.0155 28  THR B C   
1951 O  O   . THR B 28  ? 0.1024 0.1278 0.1227 0.0291  0.0044  -0.0078 28  THR B O   
1952 C  CB  . THR B 28  ? 0.1191 0.1256 0.1268 0.0261  0.0042  -0.0139 28  THR B CB  
1953 O  OG1 . THR B 28  ? 0.1473 0.1231 0.1341 0.0156  0.0033  -0.0277 28  THR B OG1 
1954 C  CG2 . THR B 28  ? 0.1679 0.1217 0.1645 0.0416  0.0110  -0.0026 28  THR B CG2 
1955 N  N   . LYS B 29  ? 0.1100 0.1097 0.1031 0.0202  0.0037  -0.0036 29  LYS B N   
1956 C  CA  . LYS B 29  ? 0.1080 0.1192 0.0997 0.0159  0.0049  -0.0078 29  LYS B CA  
1957 C  C   . LYS B 29  ? 0.0939 0.1190 0.0837 0.0167  0.0003  -0.0057 29  LYS B C   
1958 O  O   . LYS B 29  ? 0.0879 0.1323 0.1113 0.0105  -0.0012 -0.0167 29  LYS B O   
1959 C  CB  . LYS B 29  ? 0.1146 0.1403 0.0920 0.0047  0.0008  -0.0137 29  LYS B CB  
1960 C  CG  A LYS B 29  ? 0.1745 0.1154 0.0792 -0.0161 0.0306  0.0059  29  LYS B CG  
1961 C  CG  B LYS B 29  ? 0.2613 0.1542 0.1189 -0.0020 -0.0129 -0.0415 29  LYS B CG  
1962 C  CD  A LYS B 29  ? 0.1824 0.2225 0.1024 0.0133  0.0197  -0.0884 29  LYS B CD  
1963 C  CD  B LYS B 29  ? 0.1888 0.2558 0.2033 0.0840  -0.0653 -0.0874 29  LYS B CD  
1964 C  CE  A LYS B 29  ? 0.2434 0.2958 0.1439 0.0761  -0.0672 -0.1542 29  LYS B CE  
1965 C  CE  B LYS B 29  ? 0.3821 0.2696 0.1845 0.1182  -0.0835 -0.0996 29  LYS B CE  
1966 N  NZ  A LYS B 29  ? 0.2621 0.1591 0.2097 0.0767  -0.1192 -0.0830 29  LYS B NZ  
1967 N  NZ  B LYS B 29  ? 0.4706 0.3008 0.2605 0.1686  0.0728  -0.0577 29  LYS B NZ  
1968 N  N   . HIS B 30  ? 0.0870 0.1113 0.0895 0.0116  -0.0024 -0.0036 30  HIS B N   
1969 C  CA  . HIS B 30  ? 0.0923 0.1035 0.0867 0.0101  -0.0020 -0.0017 30  HIS B CA  
1970 C  C   . HIS B 30  ? 0.0871 0.1077 0.0884 0.0164  -0.0013 -0.0033 30  HIS B C   
1971 O  O   . HIS B 30  ? 0.1014 0.1141 0.0890 0.0071  -0.0010 -0.0030 30  HIS B O   
1972 C  CB  . HIS B 30  ? 0.0943 0.1182 0.0956 0.0156  -0.0015 0.0001  30  HIS B CB  
1973 C  CG  . HIS B 30  ? 0.0972 0.1151 0.0951 0.0193  -0.0023 -0.0034 30  HIS B CG  
1974 N  ND1 . HIS B 30  ? 0.1169 0.1357 0.0987 0.0218  0.0015  0.0044  30  HIS B ND1 
1975 C  CD2 . HIS B 30  ? 0.1025 0.1025 0.1171 0.0099  -0.0155 -0.0012 30  HIS B CD2 
1976 C  CE1 . HIS B 30  ? 0.0852 0.1221 0.0838 0.0230  -0.0092 -0.0054 30  HIS B CE1 
1977 N  NE2 . HIS B 30  ? 0.1263 0.1484 0.1333 0.0079  -0.0211 -0.0048 30  HIS B NE2 
1978 N  N   . HIS B 31  ? 0.0960 0.1038 0.0911 0.0062  -0.0032 -0.0027 31  HIS B N   
1979 C  CA  . HIS B 31  ? 0.0955 0.1120 0.0847 0.0080  -0.0045 0.0003  31  HIS B CA  
1980 C  C   . HIS B 31  ? 0.0964 0.1149 0.0872 0.0117  -0.0084 -0.0002 31  HIS B C   
1981 O  O   . HIS B 31  ? 0.0974 0.1166 0.0975 0.0079  -0.0026 -0.0080 31  HIS B O   
1982 C  CB  . HIS B 31  ? 0.0896 0.1120 0.0910 0.0025  -0.0046 0.0005  31  HIS B CB  
1983 C  CG  . HIS B 31  ? 0.0950 0.1106 0.0869 0.0231  -0.0097 0.0023  31  HIS B CG  
1984 N  ND1 . HIS B 31  ? 0.1032 0.1154 0.0938 0.0199  -0.0043 0.0044  31  HIS B ND1 
1985 C  CD2 . HIS B 31  ? 0.0871 0.1236 0.0920 0.0133  -0.0089 -0.0038 31  HIS B CD2 
1986 C  CE1 . HIS B 31  ? 0.0970 0.1236 0.0928 0.0264  -0.0095 0.0007  31  HIS B CE1 
1987 N  NE2 . HIS B 31  ? 0.0948 0.1184 0.0918 0.0239  -0.0116 -0.0014 31  HIS B NE2 
1988 N  N   . GLN B 32  ? 0.1020 0.1163 0.0947 0.0155  -0.0063 -0.0058 32  GLN B N   
1989 C  CA  . GLN B 32  ? 0.0938 0.1304 0.0966 0.0207  -0.0198 -0.0099 32  GLN B CA  
1990 C  C   . GLN B 32  ? 0.0806 0.1253 0.1061 0.0224  -0.0046 -0.0146 32  GLN B C   
1991 O  O   . GLN B 32  ? 0.0866 0.1413 0.1031 0.0194  -0.0054 -0.0127 32  GLN B O   
1992 C  CB  . GLN B 32  ? 0.1034 0.1279 0.1269 0.0230  -0.0086 -0.0188 32  GLN B CB  
1993 C  CG  . GLN B 32  ? 0.1129 0.1411 0.1282 0.0390  -0.0025 -0.0099 32  GLN B CG  
1994 C  CD  . GLN B 32  ? 0.1123 0.1326 0.1422 0.0406  -0.0014 -0.0134 32  GLN B CD  
1995 O  OE1 . GLN B 32  ? 0.1326 0.1508 0.1492 0.0277  -0.0060 0.0131  32  GLN B OE1 
1996 N  NE2 . GLN B 32  ? 0.1230 0.1516 0.1589 0.0241  -0.0184 -0.0108 32  GLN B NE2 
1997 N  N   . THR B 33  ? 0.0905 0.1301 0.0999 0.0160  -0.0030 -0.0092 33  THR B N   
1998 C  CA  . THR B 33  ? 0.0875 0.1328 0.0899 0.0125  -0.0073 -0.0038 33  THR B CA  
1999 C  C   . THR B 33  ? 0.0827 0.1250 0.0864 0.0188  -0.0053 -0.0038 33  THR B C   
2000 O  O   . THR B 33  ? 0.0785 0.1384 0.0944 0.0084  -0.0052 -0.0081 33  THR B O   
2001 C  CB  . THR B 33  ? 0.1044 0.1451 0.0952 0.0036  -0.0122 -0.0066 33  THR B CB  
2002 O  OG1 . THR B 33  ? 0.1694 0.1683 0.1003 -0.0261 -0.0167 -0.0145 33  THR B OG1 
2003 C  CG2 . THR B 33  ? 0.1257 0.1768 0.1035 -0.0195 -0.0167 0.0216  33  THR B CG2 
2004 N  N   . TYR B 34  ? 0.0827 0.1250 0.0849 0.0167  -0.0089 0.0027  34  TYR B N   
2005 C  CA  . TYR B 34  ? 0.0846 0.1287 0.0817 0.0184  -0.0094 -0.0036 34  TYR B CA  
2006 C  C   . TYR B 34  ? 0.0823 0.1285 0.0818 0.0139  -0.0092 -0.0019 34  TYR B C   
2007 O  O   . TYR B 34  ? 0.0855 0.1350 0.0963 0.0088  -0.0108 -0.0078 34  TYR B O   
2008 C  CB  . TYR B 34  ? 0.0854 0.1227 0.0909 0.0154  -0.0132 -0.0114 34  TYR B CB  
2009 C  CG  . TYR B 34  ? 0.0913 0.1228 0.0812 0.0219  -0.0019 -0.0046 34  TYR B CG  
2010 C  CD1 . TYR B 34  ? 0.0998 0.1122 0.0982 0.0188  0.0013  0.0024  34  TYR B CD1 
2011 C  CD2 . TYR B 34  ? 0.0883 0.1062 0.0920 0.0178  -0.0062 -0.0016 34  TYR B CD2 
2012 C  CE1 . TYR B 34  ? 0.1074 0.1362 0.1005 0.0381  0.0073  0.0176  34  TYR B CE1 
2013 C  CE2 . TYR B 34  ? 0.0929 0.1325 0.0989 0.0292  0.0024  -0.0095 34  TYR B CE2 
2014 C  CZ  . TYR B 34  ? 0.0915 0.1562 0.0922 0.0414  0.0020  0.0107  34  TYR B CZ  
2015 O  OH  . TYR B 34  ? 0.1054 0.1997 0.1013 0.0632  -0.0053 0.0205  34  TYR B OH  
2016 N  N   . VAL B 35  ? 0.0799 0.1303 0.0943 0.0133  -0.0085 0.0000  35  VAL B N   
2017 C  CA  . VAL B 35  ? 0.0850 0.1443 0.0910 0.0184  -0.0169 0.0052  35  VAL B CA  
2018 C  C   . VAL B 35  ? 0.0842 0.1349 0.1018 0.0236  -0.0129 0.0067  35  VAL B C   
2019 O  O   . VAL B 35  ? 0.0885 0.1435 0.0983 0.0128  -0.0155 0.0021  35  VAL B O   
2020 C  CB  . VAL B 35  ? 0.0897 0.1355 0.1040 0.0151  -0.0160 0.0085  35  VAL B CB  
2021 C  CG1 . VAL B 35  ? 0.0968 0.1524 0.1286 0.0230  -0.0209 0.0206  35  VAL B CG1 
2022 C  CG2 . VAL B 35  ? 0.0936 0.1645 0.1251 0.0263  -0.0061 0.0258  35  VAL B CG2 
2023 N  N   . ASN B 36  ? 0.0861 0.1353 0.1030 0.0203  -0.0074 -0.0054 36  ASN B N   
2024 C  CA  . ASN B 36  ? 0.0798 0.1478 0.1084 0.0181  -0.0040 -0.0070 36  ASN B CA  
2025 C  C   . ASN B 36  ? 0.0802 0.1526 0.0838 0.0168  -0.0085 -0.0017 36  ASN B C   
2026 O  O   . ASN B 36  ? 0.0798 0.1485 0.1201 0.0110  -0.0022 -0.0077 36  ASN B O   
2027 C  CB  . ASN B 36  ? 0.1083 0.1545 0.1204 0.0259  -0.0052 -0.0205 36  ASN B CB  
2028 C  CG  . ASN B 36  ? 0.1132 0.1532 0.1240 0.0263  0.0086  -0.0168 36  ASN B CG  
2029 O  OD1 . ASN B 36  ? 0.1322 0.1516 0.1531 0.0229  -0.0069 -0.0128 36  ASN B OD1 
2030 N  ND2 . ASN B 36  ? 0.1333 0.1743 0.1511 0.0007  0.0170  -0.0431 36  ASN B ND2 
2031 N  N   . ASN B 37  ? 0.0844 0.1443 0.0937 0.0109  -0.0074 -0.0032 37  ASN B N   
2032 C  CA  . ASN B 37  ? 0.0776 0.1447 0.0985 0.0135  -0.0096 -0.0051 37  ASN B CA  
2033 C  C   . ASN B 37  ? 0.0779 0.1403 0.0909 0.0106  -0.0140 -0.0014 37  ASN B C   
2034 O  O   . ASN B 37  ? 0.0996 0.1694 0.0975 -0.0026 -0.0084 -0.0022 37  ASN B O   
2035 C  CB  . ASN B 37  ? 0.0993 0.1510 0.0966 0.0184  -0.0214 0.0044  37  ASN B CB  
2036 C  CG  . ASN B 37  ? 0.1138 0.1984 0.0891 0.0033  -0.0231 0.0128  37  ASN B CG  
2037 O  OD1 . ASN B 37  ? 0.1618 0.2717 0.1173 0.0447  -0.0203 -0.0430 37  ASN B OD1 
2038 N  ND2 . ASN B 37  ? 0.1354 0.2113 0.1142 -0.0159 -0.0273 0.0108  37  ASN B ND2 
2039 N  N   . ALA B 38  ? 0.0839 0.1364 0.0971 0.0139  -0.0070 -0.0014 38  ALA B N   
2040 C  CA  . ALA B 38  ? 0.0838 0.1453 0.0901 0.0115  -0.0172 -0.0088 38  ALA B CA  
2041 C  C   . ALA B 38  ? 0.0885 0.1403 0.0799 0.0103  -0.0104 -0.0054 38  ALA B C   
2042 O  O   . ALA B 38  ? 0.0801 0.1433 0.1069 0.0044  -0.0107 -0.0058 38  ALA B O   
2043 C  CB  . ALA B 38  ? 0.0795 0.1655 0.1000 0.0178  -0.0068 -0.0057 38  ALA B CB  
2044 N  N   . ASN B 39  ? 0.0782 0.1383 0.0988 0.0060  -0.0075 -0.0046 39  ASN B N   
2045 C  CA  . ASN B 39  ? 0.0802 0.1484 0.0985 0.0154  -0.0115 -0.0076 39  ASN B CA  
2046 C  C   . ASN B 39  ? 0.0785 0.1467 0.1078 0.0165  -0.0049 -0.0034 39  ASN B C   
2047 O  O   . ASN B 39  ? 0.0771 0.1656 0.1138 0.0160  -0.0129 0.0051  39  ASN B O   
2048 C  CB  . ASN B 39  ? 0.0860 0.1502 0.1110 0.0130  -0.0074 0.0059  39  ASN B CB  
2049 C  CG  . ASN B 39  ? 0.0852 0.1475 0.1242 0.0139  -0.0026 0.0044  39  ASN B CG  
2050 O  OD1 . ASN B 39  ? 0.1063 0.1606 0.1194 -0.0031 -0.0016 0.0038  39  ASN B OD1 
2051 N  ND2 . ASN B 39  ? 0.1084 0.1472 0.1320 0.0160  -0.0151 0.0130  39  ASN B ND2 
2052 N  N   . ALA B 40  ? 0.0868 0.1642 0.1057 0.0151  -0.0076 0.0019  40  ALA B N   
2053 C  CA  . ALA B 40  ? 0.0931 0.1622 0.1067 0.0098  0.0050  -0.0028 40  ALA B CA  
2054 C  C   . ALA B 40  ? 0.0938 0.1588 0.0987 0.0098  -0.0098 0.0039  40  ALA B C   
2055 O  O   . ALA B 40  ? 0.0893 0.1797 0.1352 -0.0009 0.0062  -0.0100 40  ALA B O   
2056 C  CB  . ALA B 40  ? 0.1175 0.1905 0.1072 -0.0003 -0.0102 -0.0050 40  ALA B CB  
2057 N  N   . ALA B 41  ? 0.0893 0.1528 0.0970 0.0116  -0.0062 0.0100  41  ALA B N   
2058 C  CA  . ALA B 41  ? 0.0924 0.1518 0.0964 0.0130  -0.0107 0.0102  41  ALA B CA  
2059 C  C   . ALA B 41  ? 0.0871 0.1463 0.1028 0.0134  -0.0040 0.0080  41  ALA B C   
2060 O  O   . ALA B 41  ? 0.1351 0.1486 0.1168 -0.0070 -0.0207 0.0047  41  ALA B O   
2061 C  CB  . ALA B 41  ? 0.1020 0.1735 0.1261 0.0259  -0.0273 0.0022  41  ALA B CB  
2062 N  N   . LEU B 42  ? 0.0832 0.1401 0.0969 0.0101  -0.0088 0.0080  42  LEU B N   
2063 C  CA  . LEU B 42  ? 0.0801 0.1518 0.0885 0.0081  -0.0130 -0.0024 42  LEU B CA  
2064 C  C   . LEU B 42  ? 0.0843 0.1543 0.0904 -0.0019 -0.0039 0.0095  42  LEU B C   
2065 O  O   . LEU B 42  ? 0.0793 0.1854 0.0947 -0.0036 -0.0059 0.0090  42  LEU B O   
2066 C  CB  . LEU B 42  ? 0.0737 0.1499 0.0999 0.0059  -0.0092 0.0099  42  LEU B CB  
2067 C  CG  . LEU B 42  ? 0.0827 0.1863 0.0918 0.0181  -0.0028 0.0106  42  LEU B CG  
2068 C  CD1 . LEU B 42  ? 0.0842 0.1840 0.1092 0.0055  -0.0013 0.0087  42  LEU B CD1 
2069 C  CD2 . LEU B 42  ? 0.0903 0.1587 0.1253 0.0218  0.0014  0.0053  42  LEU B CD2 
2070 N  N   . GLU B 43  ? 0.0784 0.1609 0.0962 0.0113  -0.0069 0.0148  43  GLU B N   
2071 C  CA  . GLU B 43  ? 0.0744 0.1778 0.1050 0.0104  -0.0117 0.0077  43  GLU B CA  
2072 C  C   . GLU B 43  ? 0.0811 0.1516 0.1046 0.0130  0.0007  0.0106  43  GLU B C   
2073 O  O   . GLU B 43  ? 0.0742 0.1775 0.1142 0.0067  -0.0058 0.0121  43  GLU B O   
2074 C  CB  . GLU B 43  ? 0.0986 0.1685 0.1270 0.0158  -0.0063 -0.0017 43  GLU B CB  
2075 C  CG  . GLU B 43  ? 0.1060 0.2365 0.1798 0.0357  -0.0155 -0.0482 43  GLU B CG  
2076 C  CD  . GLU B 43  ? 0.1423 0.2329 0.1592 0.0602  -0.0199 -0.0244 43  GLU B CD  
2077 O  OE1 . GLU B 43  ? 0.2306 0.2510 0.1686 0.0354  -0.0248 -0.0161 43  GLU B OE1 
2078 O  OE2 . GLU B 43  ? 0.3097 0.2342 0.1533 0.0517  0.0457  -0.0305 43  GLU B OE2 
2079 N  N   . SER B 44  ? 0.0788 0.1709 0.0915 0.0098  -0.0002 0.0093  44  SER B N   
2080 C  CA  . SER B 44  ? 0.0828 0.1655 0.1146 0.0020  0.0035  0.0150  44  SER B CA  
2081 C  C   . SER B 44  ? 0.0893 0.1444 0.1136 0.0078  -0.0085 0.0144  44  SER B C   
2082 O  O   . SER B 44  ? 0.1225 0.1617 0.1474 -0.0222 -0.0123 0.0195  44  SER B O   
2083 C  CB  . SER B 44  ? 0.1114 0.1914 0.1204 -0.0017 0.0004  0.0302  44  SER B CB  
2084 O  OG  . SER B 44  ? 0.1191 0.2068 0.1524 0.0145  -0.0114 0.0531  44  SER B OG  
2085 N  N   . LEU B 45  ? 0.0878 0.1379 0.0986 0.0103  -0.0097 0.0070  45  LEU B N   
2086 C  CA  . LEU B 45  ? 0.0995 0.1382 0.1021 0.0140  -0.0108 0.0032  45  LEU B CA  
2087 C  C   . LEU B 45  ? 0.0942 0.1368 0.0962 0.0158  -0.0113 -0.0082 45  LEU B C   
2088 O  O   . LEU B 45  ? 0.0875 0.1444 0.1063 0.0145  -0.0089 -0.0006 45  LEU B O   
2089 C  CB  . LEU B 45  ? 0.1168 0.1624 0.0952 0.0423  -0.0078 -0.0013 45  LEU B CB  
2090 C  CG  . LEU B 45  ? 0.1442 0.1751 0.1492 0.0553  -0.0175 0.0108  45  LEU B CG  
2091 C  CD1 . LEU B 45  ? 0.1507 0.2442 0.1275 0.0895  -0.0121 0.0184  45  LEU B CD1 
2092 C  CD2 . LEU B 45  ? 0.2371 0.1926 0.3262 0.0044  -0.1087 0.0807  45  LEU B CD2 
2093 N  N   . PRO B 46  ? 0.0889 0.1323 0.0989 0.0159  0.0022  0.0011  46  PRO B N   
2094 C  CA  . PRO B 46  ? 0.0896 0.1333 0.0984 0.0249  -0.0028 0.0065  46  PRO B CA  
2095 C  C   . PRO B 46  ? 0.0808 0.1445 0.0918 0.0154  -0.0160 -0.0028 46  PRO B C   
2096 O  O   . PRO B 46  ? 0.0900 0.1595 0.0985 0.0185  -0.0014 0.0056  46  PRO B O   
2097 C  CB  . PRO B 46  ? 0.0825 0.1637 0.1105 0.0215  -0.0002 0.0012  46  PRO B CB  
2098 C  CG  . PRO B 46  ? 0.0901 0.1702 0.1039 0.0171  -0.0053 -0.0043 46  PRO B CG  
2099 C  CD  . PRO B 46  ? 0.0896 0.1594 0.1246 0.0156  0.0075  0.0116  46  PRO B CD  
2100 N  N   . GLU B 47  ? 0.0791 0.1501 0.1076 0.0212  -0.0061 -0.0135 47  GLU B N   
2101 C  CA  . GLU B 47  ? 0.0781 0.1538 0.0990 0.0181  -0.0130 -0.0144 47  GLU B CA  
2102 C  C   . GLU B 47  ? 0.0799 0.1389 0.0972 0.0148  -0.0124 -0.0119 47  GLU B C   
2103 O  O   . GLU B 47  ? 0.0854 0.1626 0.0985 0.0221  -0.0048 -0.0165 47  GLU B O   
2104 C  CB  . GLU B 47  ? 0.0976 0.1650 0.1249 0.0032  0.0012  -0.0283 47  GLU B CB  
2105 C  CG  . GLU B 47  ? 0.1091 0.1479 0.1382 0.0058  0.0078  -0.0171 47  GLU B CG  
2106 C  CD  . GLU B 47  ? 0.1244 0.1496 0.1580 0.0330  0.0271  0.0011  47  GLU B CD  
2107 O  OE1 . GLU B 47  ? 0.1493 0.1532 0.1251 0.0116  -0.0041 -0.0021 47  GLU B OE1 
2108 O  OE2 . GLU B 47  ? 0.2868 0.1554 0.2350 -0.0110 0.1170  -0.0185 47  GLU B OE2 
2109 N  N   . PHE B 48  ? 0.0747 0.1319 0.1078 0.0121  -0.0074 -0.0089 48  PHE B N   
2110 C  CA  . PHE B 48  ? 0.0695 0.1436 0.1068 0.0141  -0.0088 -0.0045 48  PHE B CA  
2111 C  C   . PHE B 48  ? 0.0817 0.1431 0.1011 0.0205  -0.0061 -0.0008 48  PHE B C   
2112 O  O   . PHE B 48  ? 0.0848 0.1470 0.1227 0.0145  -0.0005 -0.0051 48  PHE B O   
2113 C  CB  . PHE B 48  ? 0.0941 0.1394 0.1117 0.0256  -0.0217 -0.0168 48  PHE B CB  
2114 C  CG  . PHE B 48  ? 0.0853 0.1414 0.1134 0.0117  -0.0163 -0.0154 48  PHE B CG  
2115 C  CD1 . PHE B 48  ? 0.1050 0.1400 0.1339 0.0075  0.0057  -0.0254 48  PHE B CD1 
2116 C  CD2 . PHE B 48  ? 0.1089 0.1442 0.1195 0.0184  -0.0027 -0.0147 48  PHE B CD2 
2117 C  CE1 . PHE B 48  ? 0.1393 0.1505 0.1393 0.0048  0.0062  -0.0326 48  PHE B CE1 
2118 C  CE2 . PHE B 48  ? 0.1051 0.1372 0.1308 0.0052  -0.0230 -0.0172 48  PHE B CE2 
2119 C  CZ  . PHE B 48  ? 0.1156 0.1272 0.1297 0.0147  -0.0200 -0.0128 48  PHE B CZ  
2120 N  N   . ALA B 49  ? 0.0822 0.1419 0.1042 0.0175  -0.0087 -0.0106 49  ALA B N   
2121 C  CA  . ALA B 49  ? 0.0818 0.1376 0.1024 0.0198  -0.0141 -0.0058 49  ALA B CA  
2122 C  C   . ALA B 49  ? 0.0878 0.1409 0.0985 0.0223  -0.0064 -0.0046 49  ALA B C   
2123 O  O   . ALA B 49  ? 0.1122 0.1362 0.1182 0.0015  -0.0019 -0.0018 49  ALA B O   
2124 C  CB  . ALA B 49  ? 0.0861 0.1462 0.1167 0.0125  -0.0032 -0.0100 49  ALA B CB  
2125 N  N   . ASN B 50  ? 0.0919 0.1338 0.1044 0.0128  -0.0034 -0.0007 50  ASN B N   
2126 C  CA  . ASN B 50  ? 0.1038 0.1548 0.1106 0.0316  0.0081  0.0126  50  ASN B CA  
2127 C  C   . ASN B 50  ? 0.1249 0.1488 0.1040 0.0248  0.0120  0.0154  50  ASN B C   
2128 O  O   . ASN B 50  ? 0.1917 0.1908 0.1465 0.0721  0.0530  0.0489  50  ASN B O   
2129 C  CB  . ASN B 50  ? 0.1192 0.1388 0.1285 0.0316  -0.0029 0.0162  50  ASN B CB  
2130 C  CG  . ASN B 50  ? 0.1044 0.1294 0.1355 0.0187  -0.0016 -0.0104 50  ASN B CG  
2131 O  OD1 . ASN B 50  ? 0.1232 0.1604 0.1860 0.0125  0.0083  -0.0402 50  ASN B OD1 
2132 N  ND2 . ASN B 50  ? 0.1020 0.1734 0.1335 0.0206  -0.0206 -0.0040 50  ASN B ND2 
2133 N  N   . LEU B 51  ? 0.0887 0.1466 0.1027 0.0142  -0.0076 -0.0019 51  LEU B N   
2134 C  CA  . LEU B 51  ? 0.0911 0.1602 0.0895 0.0111  -0.0104 -0.0060 51  LEU B CA  
2135 C  C   . LEU B 51  ? 0.0944 0.1396 0.0909 0.0197  -0.0106 -0.0011 51  LEU B C   
2136 O  O   . LEU B 51  ? 0.0987 0.1577 0.0964 0.0063  -0.0121 -0.0077 51  LEU B O   
2137 C  CB  . LEU B 51  ? 0.1040 0.1561 0.1191 0.0118  0.0114  -0.0077 51  LEU B CB  
2138 C  CG  . LEU B 51  ? 0.1318 0.1673 0.1133 -0.0170 0.0133  -0.0261 51  LEU B CG  
2139 C  CD1 . LEU B 51  ? 0.1801 0.1681 0.1671 -0.0126 0.0493  -0.0221 51  LEU B CD1 
2140 C  CD2 . LEU B 51  ? 0.1697 0.1995 0.1445 -0.0259 -0.0239 -0.0391 51  LEU B CD2 
2141 N  N   . PRO B 52  ? 0.0905 0.1699 0.0961 0.0136  -0.0122 0.0197  52  PRO B N   
2142 C  CA  . PRO B 52  ? 0.0985 0.1529 0.1126 0.0070  -0.0198 0.0285  52  PRO B CA  
2143 C  C   . PRO B 52  ? 0.0760 0.1417 0.1033 0.0075  -0.0103 0.0108  52  PRO B C   
2144 O  O   . PRO B 52  ? 0.0939 0.1438 0.0925 0.0046  -0.0192 0.0017  52  PRO B O   
2145 C  CB  . PRO B 52  ? 0.1120 0.1952 0.1255 0.0134  0.0005  0.0492  52  PRO B CB  
2146 C  CG  . PRO B 52  ? 0.1254 0.2134 0.1078 0.0089  0.0038  0.0300  52  PRO B CG  
2147 C  CD  . PRO B 52  ? 0.1138 0.1915 0.0919 0.0106  -0.0110 0.0190  52  PRO B CD  
2148 N  N   . VAL B 53  ? 0.0850 0.1343 0.0978 0.0093  -0.0098 0.0017  53  VAL B N   
2149 C  CA  . VAL B 53  ? 0.0798 0.1304 0.0970 0.0111  -0.0072 0.0016  53  VAL B CA  
2150 C  C   . VAL B 53  ? 0.0809 0.1315 0.0963 0.0007  -0.0065 -0.0037 53  VAL B C   
2151 O  O   . VAL B 53  ? 0.0870 0.1342 0.0963 0.0101  -0.0151 0.0025  53  VAL B O   
2152 C  CB  . VAL B 53  ? 0.0822 0.1312 0.1094 0.0099  -0.0106 -0.0054 53  VAL B CB  
2153 C  CG1 . VAL B 53  ? 0.0936 0.1444 0.1230 0.0042  -0.0010 -0.0056 53  VAL B CG1 
2154 C  CG2 . VAL B 53  ? 0.0928 0.1539 0.0983 0.0114  -0.0210 0.0026  53  VAL B CG2 
2155 N  N   . GLU B 54  ? 0.0932 0.1341 0.1039 0.0081  0.0045  0.0008  54  GLU B N   
2156 C  CA  . GLU B 54  ? 0.1001 0.1599 0.1210 0.0127  0.0154  -0.0021 54  GLU B CA  
2157 C  C   . GLU B 54  ? 0.1218 0.1478 0.1050 0.0173  0.0106  0.0046  54  GLU B C   
2158 O  O   . GLU B 54  ? 0.1254 0.1689 0.1245 0.0213  0.0033  -0.0211 54  GLU B O   
2159 C  CB  A GLU B 54  ? 0.1569 0.1461 0.1239 0.0181  0.0519  0.0128  54  GLU B CB  
2160 C  CB  B GLU B 54  ? 0.1067 0.2125 0.1934 -0.0122 0.0625  0.0131  54  GLU B CB  
2161 C  CG  A GLU B 54  ? 0.1120 0.2117 0.1406 -0.0111 0.0088  0.0219  54  GLU B CG  
2162 C  CG  B GLU B 54  ? 0.0930 0.2121 0.2452 -0.0072 0.0410  0.0245  54  GLU B CG  
2163 C  CD  A GLU B 54  ? 0.1356 0.2458 0.1375 0.0290  0.0342  0.0678  54  GLU B CD  
2164 C  CD  B GLU B 54  ? 0.0843 0.2016 0.1698 0.0021  0.0061  0.0329  54  GLU B CD  
2165 O  OE1 A GLU B 54  ? 0.1264 0.1968 0.1439 0.0138  -0.0293 0.0338  54  GLU B OE1 
2166 O  OE1 B GLU B 54  ? 0.0900 0.2400 0.1482 0.0031  -0.0095 0.0248  54  GLU B OE1 
2167 O  OE2 A GLU B 54  ? 0.1497 0.3044 0.1320 0.0357  0.0010  0.0434  54  GLU B OE2 
2168 O  OE2 B GLU B 54  ? 0.0825 0.2112 0.1474 -0.0101 -0.0075 0.0579  54  GLU B OE2 
2169 N  N   . GLU B 55  ? 0.1206 0.1465 0.1024 0.0154  0.0094  -0.0032 55  GLU B N   
2170 C  CA  . GLU B 55  ? 0.1270 0.1567 0.0774 0.0157  -0.0105 -0.0123 55  GLU B CA  
2171 C  C   . GLU B 55  ? 0.1003 0.1485 0.0829 0.0136  -0.0168 -0.0184 55  GLU B C   
2172 O  O   . GLU B 55  ? 0.1081 0.1453 0.0886 0.0176  -0.0134 -0.0185 55  GLU B O   
2173 C  CB  . GLU B 55  ? 0.1482 0.1637 0.0982 0.0267  -0.0178 -0.0030 55  GLU B CB  
2174 C  CG  . GLU B 55  ? 0.2448 0.1658 0.1105 0.0264  -0.0379 0.0021  55  GLU B CG  
2175 C  CD  . GLU B 55  ? 0.3069 0.1754 0.1184 -0.0245 0.0416  0.0032  55  GLU B CD  
2176 O  OE1 . GLU B 55  ? 0.3841 0.2546 0.2315 -0.0754 0.1319  -0.0276 55  GLU B OE1 
2177 O  OE2 . GLU B 55  ? 0.2157 0.1926 0.1375 0.0003  0.0041  -0.0257 55  GLU B OE2 
2178 N  N   . LEU B 56  ? 0.0894 0.1328 0.0842 0.0105  -0.0119 -0.0128 56  LEU B N   
2179 C  CA  . LEU B 56  ? 0.0792 0.1263 0.0946 0.0023  -0.0081 -0.0128 56  LEU B CA  
2180 C  C   . LEU B 56  ? 0.0877 0.1255 0.0859 0.0036  -0.0096 -0.0174 56  LEU B C   
2181 O  O   . LEU B 56  ? 0.0983 0.1228 0.1074 0.0000  -0.0124 -0.0196 56  LEU B O   
2182 C  CB  . LEU B 56  ? 0.0733 0.1553 0.0978 0.0026  -0.0065 -0.0181 56  LEU B CB  
2183 C  CG  . LEU B 56  ? 0.0956 0.1955 0.1022 -0.0101 0.0019  0.0008  56  LEU B CG  
2184 C  CD1 . LEU B 56  ? 0.1327 0.2514 0.1246 -0.0630 0.0120  0.0086  56  LEU B CD1 
2185 C  CD2 . LEU B 56  ? 0.1252 0.2374 0.1132 0.0260  -0.0035 -0.0185 56  LEU B CD2 
2186 N  N   . ILE B 57  ? 0.0805 0.1312 0.0878 0.0103  -0.0087 -0.0080 57  ILE B N   
2187 C  CA  . ILE B 57  ? 0.0860 0.1309 0.0946 0.0056  -0.0137 -0.0131 57  ILE B CA  
2188 C  C   . ILE B 57  ? 0.0955 0.1320 0.1052 0.0129  -0.0125 -0.0169 57  ILE B C   
2189 O  O   . ILE B 57  ? 0.1250 0.1557 0.1242 0.0323  -0.0387 -0.0326 57  ILE B O   
2190 C  CB  . ILE B 57  ? 0.0884 0.1350 0.0984 0.0094  -0.0152 -0.0107 57  ILE B CB  
2191 C  CG1 . ILE B 57  ? 0.0903 0.1451 0.1400 0.0072  -0.0081 0.0083  57  ILE B CG1 
2192 C  CG2 . ILE B 57  ? 0.1072 0.1506 0.1138 0.0099  -0.0236 -0.0211 57  ILE B CG2 
2193 C  CD1 . ILE B 57  ? 0.1058 0.1314 0.1951 -0.0076 0.0022  -0.0267 57  ILE B CD1 
2194 N  N   . THR B 58  ? 0.1056 0.1309 0.0830 0.0165  -0.0113 -0.0100 58  THR B N   
2195 C  CA  . THR B 58  ? 0.1299 0.1453 0.0976 0.0325  -0.0147 -0.0250 58  THR B CA  
2196 C  C   . THR B 58  ? 0.1712 0.1283 0.0920 0.0076  -0.0328 -0.0140 58  THR B C   
2197 O  O   . THR B 58  ? 0.2650 0.1325 0.1168 0.0161  -0.0323 -0.0264 58  THR B O   
2198 C  CB  . THR B 58  ? 0.1151 0.1612 0.0915 0.0184  -0.0108 -0.0171 58  THR B CB  
2199 O  OG1 . THR B 58  ? 0.1306 0.1492 0.0895 0.0149  -0.0170 -0.0163 58  THR B OG1 
2200 C  CG2 . THR B 58  ? 0.1317 0.1690 0.1181 0.0118  0.0002  -0.0209 58  THR B CG2 
2201 N  N   A LYS B 59  ? 0.1423 0.1251 0.0978 -0.0068 -0.0351 -0.0051 59  LYS B N   
2202 N  N   B LYS B 59  ? 0.1565 0.1156 0.0925 0.0036  -0.0341 0.0034  59  LYS B N   
2203 C  CA  A LYS B 59  ? 0.1500 0.0959 0.1237 -0.0307 -0.0649 -0.0031 59  LYS B CA  
2204 C  CA  B LYS B 59  ? 0.1724 0.1391 0.1178 -0.0147 -0.0533 0.0195  59  LYS B CA  
2205 C  C   A LYS B 59  ? 0.1185 0.1420 0.0946 0.0001  -0.0214 -0.0285 59  LYS B C   
2206 C  C   B LYS B 59  ? 0.1388 0.1133 0.1199 -0.0183 -0.0464 -0.0017 59  LYS B C   
2207 O  O   A LYS B 59  ? 0.1117 0.1101 0.1454 0.0068  -0.0267 -0.0071 59  LYS B O   
2208 O  O   B LYS B 59  ? 0.1256 0.1479 0.1306 -0.0110 -0.0497 -0.0084 59  LYS B O   
2209 C  CB  A LYS B 59  ? 0.1343 0.1468 0.0843 -0.0050 -0.0173 -0.0216 59  LYS B CB  
2210 C  CB  B LYS B 59  ? 0.1504 0.1353 0.1089 0.0141  -0.0438 -0.0263 59  LYS B CB  
2211 C  CG  A LYS B 59  ? 0.1037 0.1168 0.0943 0.0040  0.0051  -0.0069 59  LYS B CG  
2212 C  CG  B LYS B 59  ? 0.0936 0.1740 0.1027 -0.0104 -0.0053 -0.0485 59  LYS B CG  
2213 C  CD  A LYS B 59  ? 0.0831 0.1245 0.1418 0.0059  -0.0163 -0.0182 59  LYS B CD  
2214 C  CD  B LYS B 59  ? 0.1203 0.1538 0.1601 0.0123  -0.0270 -0.0456 59  LYS B CD  
2215 C  CE  A LYS B 59  ? 0.1264 0.1091 0.1362 0.0269  -0.0195 -0.0217 59  LYS B CE  
2216 C  CE  B LYS B 59  ? 0.1668 0.1307 0.1945 0.0000  -0.0697 -0.0154 59  LYS B CE  
2217 N  NZ  A LYS B 59  ? 0.0959 0.1262 0.1524 0.0373  -0.0294 -0.0282 59  LYS B NZ  
2218 N  NZ  B LYS B 59  ? 0.3281 0.1690 0.2513 -0.0179 -0.1731 0.0227  59  LYS B NZ  
2219 N  N   . LEU B 60  ? 0.1160 0.1211 0.0885 -0.0018 -0.0188 -0.0052 60  LEU B N   
2220 C  CA  . LEU B 60  ? 0.1018 0.1303 0.0910 -0.0080 -0.0150 -0.0141 60  LEU B CA  
2221 C  C   . LEU B 60  ? 0.1090 0.1256 0.1001 0.0003  -0.0202 -0.0043 60  LEU B C   
2222 O  O   . LEU B 60  ? 0.1116 0.1555 0.0938 -0.0154 -0.0157 -0.0094 60  LEU B O   
2223 C  CB  . LEU B 60  ? 0.1008 0.1416 0.0903 -0.0097 -0.0233 0.0012  60  LEU B CB  
2224 C  CG  . LEU B 60  ? 0.1056 0.1482 0.0825 -0.0191 -0.0098 -0.0065 60  LEU B CG  
2225 C  CD1 . LEU B 60  ? 0.0984 0.1659 0.1109 -0.0150 -0.0078 -0.0095 60  LEU B CD1 
2226 C  CD2 . LEU B 60  ? 0.1209 0.1700 0.1260 -0.0192 0.0020  -0.0415 60  LEU B CD2 
2227 N  N   . ASP B 61  ? 0.1005 0.1366 0.1004 -0.0043 -0.0210 -0.0181 61  ASP B N   
2228 C  CA  . ASP B 61  ? 0.1161 0.1265 0.1329 -0.0056 -0.0237 -0.0073 61  ASP B CA  
2229 C  C   . ASP B 61  ? 0.1172 0.1241 0.1631 -0.0058 -0.0205 -0.0206 61  ASP B C   
2230 O  O   . ASP B 61  ? 0.1216 0.1331 0.3066 -0.0165 -0.0182 -0.0062 61  ASP B O   
2231 C  CB  . ASP B 61  ? 0.1147 0.1269 0.1600 0.0057  -0.0348 -0.0248 61  ASP B CB  
2232 C  CG  . ASP B 61  ? 0.1326 0.1507 0.1367 0.0159  -0.0353 -0.0244 61  ASP B CG  
2233 O  OD1 . ASP B 61  ? 0.1436 0.1626 0.1564 0.0131  -0.0506 -0.0219 61  ASP B OD1 
2234 O  OD2 . ASP B 61  ? 0.1230 0.1755 0.1635 0.0113  -0.0260 -0.0432 61  ASP B OD2 
2235 N  N   . GLN B 62  ? 0.1040 0.1403 0.1172 -0.0034 -0.0180 -0.0240 62  GLN B N   
2236 C  CA  . GLN B 62  ? 0.1012 0.1572 0.1230 0.0009  -0.0224 -0.0349 62  GLN B CA  
2237 C  C   . GLN B 62  ? 0.1029 0.1826 0.1170 0.0044  -0.0257 -0.0260 62  GLN B C   
2238 O  O   . GLN B 62  ? 0.0976 0.1805 0.1389 -0.0034 -0.0207 -0.0220 62  GLN B O   
2239 C  CB  . GLN B 62  ? 0.1101 0.1652 0.1287 -0.0069 -0.0216 -0.0274 62  GLN B CB  
2240 C  CG  . GLN B 62  ? 0.1195 0.1900 0.1222 -0.0072 -0.0302 -0.0255 62  GLN B CG  
2241 C  CD  . GLN B 62  ? 0.1410 0.1759 0.1172 -0.0115 -0.0141 -0.0217 62  GLN B CD  
2242 O  OE1 . GLN B 62  ? 0.1532 0.1927 0.1137 -0.0205 -0.0116 -0.0181 62  GLN B OE1 
2243 N  NE2 . GLN B 62  ? 0.1529 0.1858 0.1217 -0.0141 -0.0422 -0.0312 62  GLN B NE2 
2244 N  N   . LEU B 63  ? 0.0969 0.1789 0.1239 0.0055  -0.0222 -0.0418 63  LEU B N   
2245 C  CA  . LEU B 63  ? 0.1155 0.1641 0.1115 0.0160  -0.0212 -0.0236 63  LEU B CA  
2246 C  C   . LEU B 63  ? 0.1169 0.1509 0.1458 0.0031  -0.0246 -0.0257 63  LEU B C   
2247 O  O   . LEU B 63  ? 0.1581 0.1584 0.1613 0.0291  -0.0352 -0.0324 63  LEU B O   
2248 C  CB  . LEU B 63  ? 0.1036 0.1776 0.0978 0.0098  -0.0218 -0.0126 63  LEU B CB  
2249 C  CG  . LEU B 63  ? 0.1105 0.1649 0.0981 0.0157  -0.0273 -0.0156 63  LEU B CG  
2250 C  CD1 . LEU B 63  ? 0.1011 0.1888 0.0930 0.0094  -0.0177 -0.0182 63  LEU B CD1 
2251 C  CD2 . LEU B 63  ? 0.1079 0.1816 0.1357 0.0185  -0.0305 -0.0068 63  LEU B CD2 
2252 N  N   . PRO B 64  ? 0.1199 0.1511 0.1467 -0.0001 -0.0172 -0.0022 64  PRO B N   
2253 C  CA  . PRO B 64  ? 0.1266 0.1518 0.1764 -0.0068 -0.0184 0.0110  64  PRO B CA  
2254 C  C   . PRO B 64  ? 0.1603 0.1473 0.1623 -0.0143 -0.0359 0.0068  64  PRO B C   
2255 O  O   . PRO B 64  ? 0.1441 0.1586 0.1425 -0.0137 -0.0071 -0.0148 64  PRO B O   
2256 C  CB  . PRO B 64  ? 0.1659 0.1879 0.1561 0.0004  0.0069  0.0058  64  PRO B CB  
2257 C  CG  . PRO B 64  ? 0.1465 0.1527 0.1878 0.0109  0.0300  -0.0019 64  PRO B CG  
2258 C  CD  . PRO B 64  ? 0.1132 0.1675 0.1495 0.0107  0.0063  -0.0084 64  PRO B CD  
2259 N  N   . ALA B 65  ? 0.1842 0.1523 0.2216 -0.0022 -0.0612 0.0147  65  ALA B N   
2260 C  CA  . ALA B 65  ? 0.2415 0.1537 0.2323 0.0203  -0.1074 -0.0136 65  ALA B CA  
2261 C  C   . ALA B 65  ? 0.2115 0.1449 0.1767 0.0005  -0.0618 0.0193  65  ALA B C   
2262 O  O   . ALA B 65  ? 0.2126 0.1741 0.2430 0.0273  -0.1094 -0.0150 65  ALA B O   
2263 C  CB  . ALA B 65  ? 0.5920 0.1430 0.3574 -0.0257 -0.2597 0.0399  65  ALA B CB  
2264 N  N   . ASP B 66  ? 0.2264 0.1672 0.1887 -0.0039 -0.0170 0.0413  66  ASP B N   
2265 C  CA  . ASP B 66  ? 0.2009 0.2085 0.1638 0.0122  -0.0075 0.0398  66  ASP B CA  
2266 C  C   . ASP B 66  ? 0.1321 0.1992 0.1270 0.0182  -0.0095 0.0048  66  ASP B C   
2267 O  O   . ASP B 66  ? 0.1701 0.2562 0.1281 0.0072  -0.0064 -0.0220 66  ASP B O   
2268 C  CB  A ASP B 66  ? 0.2702 0.2783 0.2246 -0.0241 0.0763  0.0523  66  ASP B CB  
2269 C  CB  B ASP B 66  ? 0.3233 0.2320 0.2148 0.0067  0.0864  0.0800  66  ASP B CB  
2270 C  CG  A ASP B 66  ? 0.1723 0.2896 0.2823 -0.0052 0.0747  0.0064  66  ASP B CG  
2271 C  CG  B ASP B 66  ? 0.2041 0.3176 0.2416 -0.0289 0.1394  0.0882  66  ASP B CG  
2272 O  OD1 A ASP B 66  ? 0.4353 0.6140 0.2408 0.1345  0.0182  0.0282  66  ASP B OD1 
2273 O  OD1 B ASP B 66  ? 0.2849 0.4863 0.2818 0.1040  0.1292  0.1772  66  ASP B OD1 
2274 O  OD2 A ASP B 66  ? 0.3507 0.2728 0.6985 0.0106  -0.0934 -0.1744 66  ASP B OD2 
2275 O  OD2 B ASP B 66  ? 0.2951 0.2591 0.3132 -0.0572 0.1900  -0.0156 66  ASP B OD2 
2276 N  N   . LYS B 67  ? 0.1245 0.1559 0.1271 0.0068  -0.0165 -0.0074 67  LYS B N   
2277 C  CA  . LYS B 67  ? 0.1126 0.1461 0.1289 0.0096  -0.0207 -0.0122 67  LYS B CA  
2278 C  C   . LYS B 67  ? 0.1078 0.1403 0.1238 0.0060  -0.0294 -0.0174 67  LYS B C   
2279 O  O   . LYS B 67  ? 0.1194 0.1367 0.1330 0.0063  -0.0279 -0.0085 67  LYS B O   
2280 C  CB  . LYS B 67  ? 0.0985 0.1619 0.1417 0.0092  -0.0259 -0.0012 67  LYS B CB  
2281 C  CG  . LYS B 67  ? 0.1035 0.1724 0.1445 0.0054  -0.0166 0.0025  67  LYS B CG  
2282 C  CD  . LYS B 67  ? 0.1283 0.1574 0.1406 0.0126  -0.0104 0.0173  67  LYS B CD  
2283 C  CE  . LYS B 67  ? 0.1388 0.1646 0.1929 -0.0046 0.0284  0.0008  67  LYS B CE  
2284 N  NZ  . LYS B 67  ? 0.1669 0.1617 0.1706 0.0077  0.0388  0.0203  67  LYS B NZ  
2285 N  N   . LYS B 68  ? 0.1118 0.1321 0.1164 0.0078  -0.0185 -0.0101 68  LYS B N   
2286 C  CA  . LYS B 68  ? 0.1052 0.1516 0.1255 0.0050  -0.0212 -0.0180 68  LYS B CA  
2287 C  C   . LYS B 68  ? 0.1095 0.1449 0.1214 0.0072  -0.0277 -0.0046 68  LYS B C   
2288 O  O   . LYS B 68  ? 0.1221 0.1958 0.1099 -0.0131 -0.0136 -0.0068 68  LYS B O   
2289 C  CB  . LYS B 68  ? 0.1294 0.1483 0.1134 0.0079  -0.0071 -0.0152 68  LYS B CB  
2290 C  CG  . LYS B 68  ? 0.1419 0.1579 0.1484 0.0062  -0.0171 -0.0225 68  LYS B CG  
2291 C  CD  . LYS B 68  ? 0.1520 0.1644 0.1743 0.0120  -0.0394 -0.0328 68  LYS B CD  
2292 C  CE  . LYS B 68  ? 0.1683 0.2261 0.1702 -0.0082 -0.0238 -0.0629 68  LYS B CE  
2293 N  NZ  . LYS B 68  ? 0.2228 0.2058 0.1782 -0.0578 0.0070  -0.0581 68  LYS B NZ  
2294 N  N   . THR B 69  ? 0.1097 0.1337 0.1206 0.0018  -0.0261 -0.0046 69  THR B N   
2295 C  CA  . THR B 69  ? 0.1029 0.1400 0.1225 0.0044  -0.0281 -0.0015 69  THR B CA  
2296 C  C   . THR B 69  ? 0.0890 0.1461 0.0931 0.0026  -0.0255 0.0032  69  THR B C   
2297 O  O   . THR B 69  ? 0.0932 0.1371 0.0978 0.0045  -0.0191 0.0035  69  THR B O   
2298 C  CB  . THR B 69  ? 0.1202 0.1535 0.1485 -0.0031 -0.0468 0.0233  69  THR B CB  
2299 O  OG1 . THR B 69  ? 0.1461 0.1542 0.2027 0.0173  -0.0572 0.0309  69  THR B OG1 
2300 C  CG2 . THR B 69  ? 0.1378 0.2208 0.1734 -0.0195 -0.0826 0.0333  69  THR B CG2 
2301 N  N   . VAL B 70  ? 0.0910 0.1408 0.1020 0.0016  -0.0173 0.0036  70  VAL B N   
2302 C  CA  . VAL B 70  ? 0.0941 0.1370 0.0867 -0.0073 -0.0140 -0.0046 70  VAL B CA  
2303 C  C   . VAL B 70  ? 0.0803 0.1351 0.0876 0.0103  -0.0099 -0.0061 70  VAL B C   
2304 O  O   . VAL B 70  ? 0.0925 0.1327 0.0843 -0.0002 -0.0069 -0.0047 70  VAL B O   
2305 C  CB  . VAL B 70  ? 0.1044 0.1462 0.0945 -0.0005 0.0008  0.0061  70  VAL B CB  
2306 C  CG1 . VAL B 70  ? 0.0940 0.1760 0.1216 -0.0030 0.0000  -0.0072 70  VAL B CG1 
2307 C  CG2 . VAL B 70  ? 0.1108 0.1760 0.1177 -0.0043 0.0177  -0.0287 70  VAL B CG2 
2308 N  N   . LEU B 71  ? 0.0881 0.1271 0.0874 0.0028  -0.0150 -0.0078 71  LEU B N   
2309 C  CA  . LEU B 71  ? 0.0949 0.1299 0.0829 0.0095  -0.0186 -0.0016 71  LEU B CA  
2310 C  C   . LEU B 71  ? 0.0955 0.1328 0.0874 0.0106  -0.0211 -0.0011 71  LEU B C   
2311 O  O   . LEU B 71  ? 0.0974 0.1345 0.0935 0.0134  -0.0134 0.0052  71  LEU B O   
2312 C  CB  . LEU B 71  ? 0.0913 0.1408 0.0937 0.0151  -0.0217 -0.0157 71  LEU B CB  
2313 C  CG  . LEU B 71  ? 0.0902 0.1926 0.0986 0.0293  -0.0202 -0.0098 71  LEU B CG  
2314 C  CD1 . LEU B 71  ? 0.0913 0.1935 0.1490 0.0122  -0.0302 0.0232  71  LEU B CD1 
2315 C  CD2 . LEU B 71  ? 0.1269 0.1821 0.1657 0.0497  -0.0457 -0.0540 71  LEU B CD2 
2316 N  N   . ARG B 72  ? 0.0902 0.1259 0.0950 0.0082  -0.0142 -0.0099 72  ARG B N   
2317 C  CA  . ARG B 72  ? 0.0917 0.1295 0.0862 0.0059  -0.0066 -0.0102 72  ARG B CA  
2318 C  C   . ARG B 72  ? 0.0857 0.1161 0.0854 0.0095  -0.0078 -0.0098 72  ARG B C   
2319 O  O   . ARG B 72  ? 0.1022 0.1232 0.0818 0.0118  -0.0079 -0.0036 72  ARG B O   
2320 C  CB  . ARG B 72  ? 0.0976 0.1216 0.0916 0.0077  -0.0070 -0.0123 72  ARG B CB  
2321 C  CG  . ARG B 72  ? 0.0965 0.1270 0.0992 0.0095  -0.0069 -0.0102 72  ARG B CG  
2322 C  CD  . ARG B 72  ? 0.0905 0.1248 0.1241 0.0050  -0.0046 -0.0033 72  ARG B CD  
2323 N  NE  . ARG B 72  ? 0.0956 0.1052 0.1299 0.0020  -0.0069 -0.0029 72  ARG B NE  
2324 C  CZ  . ARG B 72  ? 0.1090 0.1175 0.1123 0.0036  -0.0164 0.0030  72  ARG B CZ  
2325 N  NH1 . ARG B 72  ? 0.1230 0.1155 0.1931 -0.0035 -0.0092 0.0271  72  ARG B NH1 
2326 N  NH2 . ARG B 72  ? 0.1068 0.1135 0.1326 0.0075  -0.0013 -0.0050 72  ARG B NH2 
2327 N  N   . ASN B 73  ? 0.0791 0.1266 0.0795 0.0089  -0.0139 -0.0087 73  ASN B N   
2328 C  CA  . ASN B 73  ? 0.0753 0.1237 0.0830 0.0095  -0.0101 0.0016  73  ASN B CA  
2329 C  C   . ASN B 73  ? 0.0782 0.1281 0.0780 0.0091  -0.0063 -0.0057 73  ASN B C   
2330 O  O   . ASN B 73  ? 0.0780 0.1173 0.0899 0.0143  -0.0017 0.0021  73  ASN B O   
2331 C  CB  . ASN B 73  ? 0.0794 0.1211 0.0831 0.0040  -0.0069 0.0039  73  ASN B CB  
2332 C  CG  . ASN B 73  ? 0.0728 0.1292 0.0790 0.0020  -0.0189 -0.0025 73  ASN B CG  
2333 O  OD1 . ASN B 73  ? 0.0860 0.1272 0.1052 0.0122  -0.0073 0.0041  73  ASN B OD1 
2334 N  ND2 . ASN B 73  ? 0.0908 0.1364 0.0849 -0.0025 -0.0173 0.0066  73  ASN B ND2 
2335 N  N   . ASN B 74  ? 0.0719 0.1171 0.0857 0.0077  -0.0097 0.0006  74  ASN B N   
2336 C  CA  . ASN B 74  ? 0.0815 0.1136 0.0836 0.0122  -0.0053 -0.0069 74  ASN B CA  
2337 C  C   . ASN B 74  ? 0.0794 0.1114 0.0925 0.0136  -0.0016 0.0004  74  ASN B C   
2338 O  O   . ASN B 74  ? 0.0836 0.1245 0.0914 0.0141  -0.0029 -0.0023 74  ASN B O   
2339 C  CB  . ASN B 74  ? 0.0764 0.1273 0.0923 0.0121  -0.0027 -0.0007 74  ASN B CB  
2340 C  CG  . ASN B 74  ? 0.0802 0.1356 0.0868 0.0100  0.0014  -0.0131 74  ASN B CG  
2341 O  OD1 . ASN B 74  ? 0.1036 0.1312 0.1082 0.0052  0.0028  -0.0097 74  ASN B OD1 
2342 N  ND2 . ASN B 74  ? 0.1172 0.1426 0.0873 -0.0069 -0.0043 -0.0052 74  ASN B ND2 
2343 N  N   . ALA B 75  ? 0.0763 0.1343 0.0876 0.0043  -0.0085 0.0071  75  ALA B N   
2344 C  CA  . ALA B 75  ? 0.0824 0.1295 0.0923 0.0114  -0.0135 0.0055  75  ALA B CA  
2345 C  C   . ALA B 75  ? 0.0808 0.1306 0.0799 0.0055  -0.0225 0.0033  75  ALA B C   
2346 O  O   . ALA B 75  ? 0.0819 0.1222 0.0875 0.0120  -0.0140 -0.0004 75  ALA B O   
2347 C  CB  . ALA B 75  ? 0.0728 0.1568 0.1002 0.0002  -0.0168 0.0081  75  ALA B CB  
2348 N  N   . GLY B 76  ? 0.0784 0.1187 0.0875 0.0069  -0.0081 0.0031  76  GLY B N   
2349 C  CA  . GLY B 76  ? 0.0732 0.1229 0.0904 0.0107  -0.0089 -0.0066 76  GLY B CA  
2350 C  C   . GLY B 76  ? 0.0763 0.1146 0.0789 0.0120  -0.0066 0.0017  76  GLY B C   
2351 O  O   . GLY B 76  ? 0.0822 0.1215 0.0939 0.0114  -0.0075 0.0009  76  GLY B O   
2352 N  N   . GLY B 77  ? 0.0714 0.1195 0.0805 0.0115  -0.0106 -0.0020 77  GLY B N   
2353 C  CA  . GLY B 77  ? 0.0784 0.1135 0.0847 0.0108  -0.0160 -0.0048 77  GLY B CA  
2354 C  C   . GLY B 77  ? 0.0796 0.1107 0.0913 0.0108  -0.0055 -0.0043 77  GLY B C   
2355 O  O   . GLY B 77  ? 0.0867 0.1145 0.0922 0.0090  -0.0138 -0.0012 77  GLY B O   
2356 N  N   . HIS B 78  ? 0.0740 0.1221 0.0822 0.0138  -0.0124 0.0014  78  HIS B N   
2357 C  CA  . HIS B 78  ? 0.0800 0.1117 0.0827 0.0193  -0.0119 -0.0032 78  HIS B CA  
2358 C  C   . HIS B 78  ? 0.0783 0.1119 0.0878 0.0135  -0.0121 0.0020  78  HIS B C   
2359 O  O   . HIS B 78  ? 0.0859 0.1150 0.0940 0.0178  -0.0086 0.0012  78  HIS B O   
2360 C  CB  . HIS B 78  ? 0.0752 0.1223 0.0945 0.0126  -0.0082 -0.0025 78  HIS B CB  
2361 C  CG  . HIS B 78  ? 0.0816 0.1263 0.0957 0.0236  -0.0117 -0.0062 78  HIS B CG  
2362 N  ND1 . HIS B 78  ? 0.0879 0.1291 0.0998 0.0209  -0.0162 -0.0018 78  HIS B ND1 
2363 C  CD2 . HIS B 78  ? 0.0843 0.1294 0.1169 0.0203  -0.0209 -0.0042 78  HIS B CD2 
2364 C  CE1 . HIS B 78  ? 0.0992 0.1341 0.1106 0.0226  -0.0125 0.0123  78  HIS B CE1 
2365 N  NE2 . HIS B 78  ? 0.0982 0.1471 0.1143 0.0348  -0.0169 -0.0003 78  HIS B NE2 
2366 N  N   . ALA B 79  ? 0.0753 0.1156 0.0826 0.0077  -0.0068 -0.0015 79  ALA B N   
2367 C  CA  . ALA B 79  ? 0.0783 0.1331 0.0727 0.0171  -0.0185 -0.0001 79  ALA B CA  
2368 C  C   . ALA B 79  ? 0.0843 0.1082 0.0850 0.0167  -0.0038 0.0022  79  ALA B C   
2369 O  O   . ALA B 79  ? 0.0840 0.1277 0.0861 0.0146  -0.0129 0.0005  79  ALA B O   
2370 C  CB  . ALA B 79  ? 0.0883 0.1333 0.0872 0.0086  -0.0052 -0.0054 79  ALA B CB  
2371 N  N   . ASN B 80  ? 0.0756 0.1084 0.0877 0.0128  -0.0117 -0.0020 80  ASN B N   
2372 C  CA  . ASN B 80  ? 0.0804 0.1083 0.0787 0.0134  -0.0089 -0.0014 80  ASN B CA  
2373 C  C   . ASN B 80  ? 0.0751 0.1140 0.0820 0.0100  -0.0105 -0.0041 80  ASN B C   
2374 O  O   . ASN B 80  ? 0.0822 0.1128 0.0903 0.0122  -0.0110 0.0035  80  ASN B O   
2375 C  CB  . ASN B 80  ? 0.0779 0.1161 0.0741 0.0083  -0.0160 -0.0012 80  ASN B CB  
2376 C  CG  . ASN B 80  ? 0.0812 0.1099 0.0832 0.0110  -0.0083 0.0001  80  ASN B CG  
2377 O  OD1 . ASN B 80  ? 0.1105 0.1109 0.0825 0.0112  -0.0137 -0.0045 80  ASN B OD1 
2378 N  ND2 . ASN B 80  ? 0.1225 0.1067 0.0941 0.0119  -0.0229 0.0018  80  ASN B ND2 
2379 N  N   . HIS B 81  ? 0.0776 0.1102 0.0806 0.0149  -0.0131 0.0037  81  HIS B N   
2380 C  CA  . HIS B 81  ? 0.0830 0.1036 0.0853 0.0141  -0.0089 0.0049  81  HIS B CA  
2381 C  C   . HIS B 81  ? 0.0883 0.1120 0.0752 0.0129  -0.0089 -0.0006 81  HIS B C   
2382 O  O   . HIS B 81  ? 0.0940 0.1122 0.0893 0.0191  -0.0109 0.0030  81  HIS B O   
2383 C  CB  . HIS B 81  ? 0.0830 0.1019 0.0872 0.0150  -0.0108 -0.0011 81  HIS B CB  
2384 C  CG  . HIS B 81  ? 0.0833 0.1050 0.0867 0.0123  -0.0105 -0.0045 81  HIS B CG  
2385 N  ND1 . HIS B 81  ? 0.0826 0.1071 0.0944 0.0132  -0.0193 0.0063  81  HIS B ND1 
2386 C  CD2 . HIS B 81  ? 0.0904 0.1027 0.0888 0.0117  -0.0083 -0.0001 81  HIS B CD2 
2387 C  CE1 . HIS B 81  ? 0.0891 0.1052 0.0840 0.0087  -0.0197 0.0048  81  HIS B CE1 
2388 N  NE2 . HIS B 81  ? 0.0931 0.1011 0.0821 0.0138  -0.0123 0.0025  81  HIS B NE2 
2389 N  N   . SER B 82  ? 0.0853 0.1221 0.0887 0.0214  -0.0108 0.0096  82  SER B N   
2390 C  CA  . SER B 82  ? 0.0982 0.1337 0.0835 0.0327  -0.0123 0.0147  82  SER B CA  
2391 C  C   . SER B 82  ? 0.0961 0.1118 0.0769 0.0158  -0.0203 0.0042  82  SER B C   
2392 O  O   . SER B 82  ? 0.1099 0.1239 0.0950 0.0218  -0.0013 0.0071  82  SER B O   
2393 C  CB  . SER B 82  ? 0.0926 0.1468 0.0952 0.0216  -0.0146 0.0205  82  SER B CB  
2394 O  OG  . SER B 82  ? 0.0903 0.1567 0.0936 0.0286  -0.0073 0.0077  82  SER B OG  
2395 N  N   . LEU B 83  ? 0.0881 0.1281 0.0833 0.0123  -0.0112 0.0034  83  LEU B N   
2396 C  CA  . LEU B 83  ? 0.1019 0.1208 0.0833 0.0119  -0.0136 -0.0008 83  LEU B CA  
2397 C  C   . LEU B 83  ? 0.0950 0.1126 0.0836 0.0128  0.0032  0.0030  83  LEU B C   
2398 O  O   . LEU B 83  ? 0.1096 0.1229 0.0969 0.0119  0.0018  0.0074  83  LEU B O   
2399 C  CB  . LEU B 83  ? 0.1149 0.1212 0.0983 0.0162  0.0021  -0.0030 83  LEU B CB  
2400 C  CG  . LEU B 83  ? 0.1285 0.1474 0.1098 0.0246  0.0116  -0.0018 83  LEU B CG  
2401 C  CD1 . LEU B 83  ? 0.1743 0.1592 0.1618 0.0215  0.0251  -0.0266 83  LEU B CD1 
2402 C  CD2 . LEU B 83  ? 0.1228 0.1636 0.1910 0.0298  0.0093  -0.0023 83  LEU B CD2 
2403 N  N   . PHE B 84  ? 0.0833 0.1128 0.0887 0.0108  -0.0069 0.0077  84  PHE B N   
2404 C  CA  . PHE B 84  ? 0.0845 0.1160 0.0923 0.0106  -0.0077 0.0087  84  PHE B CA  
2405 C  C   . PHE B 84  ? 0.0874 0.1191 0.0820 0.0065  -0.0091 0.0109  84  PHE B C   
2406 O  O   . PHE B 84  ? 0.0999 0.1262 0.0916 0.0128  -0.0067 0.0126  84  PHE B O   
2407 C  CB  . PHE B 84  ? 0.0903 0.1050 0.0949 0.0025  -0.0066 0.0161  84  PHE B CB  
2408 C  CG  . PHE B 84  ? 0.0911 0.1083 0.0956 0.0084  -0.0088 0.0149  84  PHE B CG  
2409 C  CD1 . PHE B 84  ? 0.0921 0.1125 0.1143 0.0139  -0.0110 0.0051  84  PHE B CD1 
2410 C  CD2 . PHE B 84  ? 0.1087 0.1304 0.0850 0.0008  -0.0107 0.0150  84  PHE B CD2 
2411 C  CE1 . PHE B 84  ? 0.0966 0.1199 0.1218 0.0135  -0.0095 0.0259  84  PHE B CE1 
2412 C  CE2 . PHE B 84  ? 0.1235 0.1450 0.0836 -0.0139 -0.0159 0.0171  84  PHE B CE2 
2413 C  CZ  . PHE B 84  ? 0.1105 0.1233 0.1107 -0.0099 -0.0228 0.0323  84  PHE B CZ  
2414 N  N   . TRP B 85  ? 0.0967 0.1101 0.0846 0.0133  -0.0051 0.0104  85  TRP B N   
2415 C  CA  . TRP B 85  ? 0.1118 0.1109 0.0882 0.0069  -0.0027 0.0033  85  TRP B CA  
2416 C  C   . TRP B 85  ? 0.1191 0.1140 0.0954 0.0126  -0.0022 0.0165  85  TRP B C   
2417 O  O   . TRP B 85  ? 0.1338 0.1218 0.0976 0.0052  0.0008  0.0123  85  TRP B O   
2418 C  CB  . TRP B 85  ? 0.1166 0.1161 0.0922 0.0228  -0.0085 0.0102  85  TRP B CB  
2419 C  CG  . TRP B 85  ? 0.1153 0.1042 0.0858 0.0214  -0.0067 0.0091  85  TRP B CG  
2420 C  CD1 . TRP B 85  ? 0.1105 0.1187 0.0976 0.0163  0.0015  0.0045  85  TRP B CD1 
2421 C  CD2 . TRP B 85  ? 0.1115 0.1048 0.0877 0.0212  -0.0009 0.0052  85  TRP B CD2 
2422 N  NE1 . TRP B 85  ? 0.1140 0.1155 0.1021 0.0122  0.0020  0.0026  85  TRP B NE1 
2423 C  CE2 . TRP B 85  ? 0.1147 0.1079 0.0913 0.0208  0.0045  0.0094  85  TRP B CE2 
2424 C  CE3 . TRP B 85  ? 0.1175 0.1542 0.0915 0.0200  -0.0058 0.0076  85  TRP B CE3 
2425 C  CZ2 . TRP B 85  ? 0.1372 0.1249 0.0846 0.0281  0.0062  0.0041  85  TRP B CZ2 
2426 C  CZ3 . TRP B 85  ? 0.1175 0.1769 0.1061 0.0236  -0.0184 0.0067  85  TRP B CZ3 
2427 C  CH2 . TRP B 85  ? 0.1468 0.1650 0.0952 0.0317  -0.0042 0.0178  85  TRP B CH2 
2428 N  N   . LYS B 86  ? 0.1312 0.1197 0.0802 0.0148  -0.0030 0.0064  86  LYS B N   
2429 C  CA  . LYS B 86  ? 0.1387 0.1325 0.0803 0.0293  -0.0040 0.0152  86  LYS B CA  
2430 C  C   . LYS B 86  ? 0.1312 0.1346 0.0830 0.0131  -0.0029 0.0120  86  LYS B C   
2431 O  O   . LYS B 86  ? 0.1335 0.1654 0.0846 0.0113  -0.0075 0.0132  86  LYS B O   
2432 C  CB  . LYS B 86  ? 0.1267 0.1733 0.0948 0.0272  -0.0174 0.0112  86  LYS B CB  
2433 C  CG  . LYS B 86  ? 0.1278 0.2063 0.1510 0.0314  -0.0003 0.0409  86  LYS B CG  
2434 C  CD  . LYS B 86  ? 0.1470 0.3284 0.2334 0.0261  -0.0821 0.0271  86  LYS B CD  
2435 C  CE  . LYS B 86  ? 0.4661 0.5206 0.2135 -0.1461 -0.1444 0.0330  86  LYS B CE  
2436 N  NZ  . LYS B 86  ? 0.4829 0.4185 0.3743 -0.0684 -0.3047 0.0898  86  LYS B NZ  
2437 N  N   . GLY B 87  ? 0.1198 0.1187 0.0943 0.0143  0.0025  0.0083  87  GLY B N   
2438 C  CA  . GLY B 87  ? 0.1112 0.1233 0.0956 0.0054  -0.0062 0.0004  87  GLY B CA  
2439 C  C   . GLY B 87  ? 0.1173 0.1182 0.0846 0.0151  -0.0079 0.0070  87  GLY B C   
2440 O  O   . GLY B 87  ? 0.1159 0.1246 0.0942 0.0102  -0.0096 0.0053  87  GLY B O   
2441 N  N   . LEU B 88  ? 0.1105 0.1234 0.0824 0.0129  -0.0113 0.0077  88  LEU B N   
2442 C  CA  . LEU B 88  ? 0.1209 0.1187 0.0828 0.0106  -0.0065 0.0083  88  LEU B CA  
2443 C  C   . LEU B 88  ? 0.1293 0.1195 0.0931 0.0128  0.0075  0.0122  88  LEU B C   
2444 O  O   . LEU B 88  ? 0.1404 0.1322 0.1224 0.0309  0.0031  0.0276  88  LEU B O   
2445 C  CB  . LEU B 88  ? 0.1263 0.1119 0.0904 0.0107  -0.0100 0.0060  88  LEU B CB  
2446 C  CG  . LEU B 88  ? 0.1111 0.1238 0.0724 0.0042  -0.0162 0.0060  88  LEU B CG  
2447 C  CD1 . LEU B 88  ? 0.1183 0.1303 0.0927 0.0131  -0.0058 0.0085  88  LEU B CD1 
2448 C  CD2 . LEU B 88  ? 0.1196 0.1390 0.1042 0.0206  0.0073  0.0238  88  LEU B CD2 
2449 N  N   . LYS B 89  ? 0.1395 0.1138 0.0881 0.0126  -0.0022 0.0093  89  LYS B N   
2450 C  CA  . LYS B 89  ? 0.1604 0.1111 0.0927 0.0109  0.0143  0.0108  89  LYS B CA  
2451 C  C   . LYS B 89  ? 0.1688 0.1171 0.1043 0.0012  0.0205  0.0020  89  LYS B C   
2452 O  O   . LYS B 89  ? 0.1778 0.1174 0.1583 -0.0009 0.0513  0.0040  89  LYS B O   
2453 C  CB  . LYS B 89  ? 0.1870 0.1158 0.0940 0.0136  -0.0047 0.0122  89  LYS B CB  
2454 C  CG  . LYS B 89  ? 0.2625 0.1277 0.0965 0.0170  -0.0031 0.0233  89  LYS B CG  
2455 C  CD  . LYS B 89  ? 0.2955 0.1523 0.1029 0.0402  -0.0191 0.0204  89  LYS B CD  
2456 C  CE  . LYS B 89  ? 0.3233 0.1636 0.1191 0.0066  -0.0383 0.0352  89  LYS B CE  
2457 N  NZ  . LYS B 89  ? 0.2700 0.2073 0.1119 0.0530  -0.0108 0.0315  89  LYS B NZ  
2458 N  N   . LYS B 90  ? 0.1784 0.1239 0.1182 -0.0031 0.0136  -0.0018 90  LYS B N   
2459 C  CA  . LYS B 90  ? 0.1922 0.1340 0.1437 -0.0162 0.0171  -0.0065 90  LYS B CA  
2460 C  C   . LYS B 90  ? 0.2107 0.1436 0.1388 -0.0206 0.0257  0.0120  90  LYS B C   
2461 O  O   . LYS B 90  ? 0.2245 0.1732 0.1731 0.0212  0.0314  0.0590  90  LYS B O   
2462 C  CB  . LYS B 90  ? 0.2005 0.1469 0.1561 -0.0297 0.0071  -0.0027 90  LYS B CB  
2463 C  CG  . LYS B 90  ? 0.2000 0.1859 0.1354 -0.0243 0.0196  -0.0157 90  LYS B CG  
2464 C  CD  . LYS B 90  ? 0.2548 0.1936 0.1404 -0.0596 0.0028  0.0082  90  LYS B CD  
2465 C  CE  . LYS B 90  ? 0.2519 0.2036 0.1473 -0.0473 0.0183  -0.0125 90  LYS B CE  
2466 N  NZ  . LYS B 90  ? 0.3777 0.2476 0.1469 -0.1447 0.0326  -0.0108 90  LYS B NZ  
2467 N  N   A GLY B 91  ? 0.2051 0.1399 0.1318 -0.0187 0.0061  0.0068  91  GLY B N   
2468 N  N   B GLY B 91  ? 0.2193 0.1043 0.1841 -0.0216 0.0468  0.0004  91  GLY B N   
2469 C  CA  A GLY B 91  ? 0.1366 0.1255 0.1309 -0.0155 0.0074  0.0135  91  GLY B CA  
2470 C  CA  B GLY B 91  ? 0.2211 0.1215 0.1909 -0.0047 0.0587  0.0010  91  GLY B CA  
2471 C  C   A GLY B 91  ? 0.1081 0.1265 0.1206 -0.0137 0.0097  0.0196  91  GLY B C   
2472 C  C   B GLY B 91  ? 0.2003 0.1348 0.1647 -0.0139 0.0240  0.0246  91  GLY B C   
2473 O  O   A GLY B 91  ? 0.1465 0.1129 0.1192 -0.0086 0.0127  0.0252  91  GLY B O   
2474 O  O   B GLY B 91  ? 0.2214 0.1363 0.1763 0.0094  -0.0053 0.0640  91  GLY B O   
2475 N  N   A THR B 92  ? 0.1658 0.1179 0.1234 -0.0072 0.0216  0.0264  92  THR B N   
2476 N  N   B THR B 92  ? 0.2045 0.1161 0.1525 -0.0014 0.0295  0.0129  92  THR B N   
2477 C  CA  . THR B 92  ? 0.1719 0.1366 0.1094 0.0177  0.0233  0.0240  92  THR B CA  
2478 C  C   . THR B 92  ? 0.1597 0.1229 0.0969 -0.0035 -0.0076 0.0207  92  THR B C   
2479 O  O   . THR B 92  ? 0.1582 0.1595 0.1052 -0.0088 0.0034  0.0028  92  THR B O   
2480 C  CB  . THR B 92  ? 0.1654 0.1250 0.0951 0.0149  -0.0054 0.0107  92  THR B CB  
2481 O  OG1 . THR B 92  ? 0.1429 0.1245 0.0995 -0.0017 -0.0057 0.0210  92  THR B OG1 
2482 C  CG2 . THR B 92  ? 0.1484 0.1427 0.1047 0.0095  -0.0049 0.0161  92  THR B CG2 
2483 N  N   . THR B 93  ? 0.1369 0.1533 0.0879 0.0195  0.0008  0.0139  93  THR B N   
2484 C  CA  . THR B 93  ? 0.1243 0.1533 0.0981 0.0096  -0.0049 0.0227  93  THR B CA  
2485 C  C   . THR B 93  ? 0.1137 0.1605 0.0838 0.0167  -0.0046 0.0082  93  THR B C   
2486 O  O   . THR B 93  ? 0.1250 0.1667 0.0938 0.0252  -0.0135 0.0089  93  THR B O   
2487 C  CB  . THR B 93  ? 0.1534 0.1619 0.1077 0.0178  0.0061  0.0203  93  THR B CB  
2488 O  OG1 . THR B 93  ? 0.1570 0.1630 0.1411 -0.0022 0.0246  0.0254  93  THR B OG1 
2489 C  CG2 . THR B 93  ? 0.1397 0.1880 0.1437 0.0187  0.0153  0.0273  93  THR B CG2 
2490 N  N   . LEU B 94  ? 0.1239 0.1463 0.0829 0.0132  -0.0087 0.0178  94  LEU B N   
2491 C  CA  . LEU B 94  ? 0.1170 0.1597 0.0783 0.0080  -0.0082 0.0075  94  LEU B CA  
2492 C  C   . LEU B 94  ? 0.1166 0.1765 0.0920 0.0039  -0.0023 0.0074  94  LEU B C   
2493 O  O   . LEU B 94  ? 0.1213 0.2195 0.0934 0.0054  0.0016  -0.0082 94  LEU B O   
2494 C  CB  . LEU B 94  ? 0.1372 0.1554 0.0959 0.0258  -0.0093 0.0001  94  LEU B CB  
2495 C  CG  . LEU B 94  ? 0.1242 0.1615 0.0928 0.0186  -0.0012 -0.0052 94  LEU B CG  
2496 C  CD1 . LEU B 94  ? 0.1324 0.1551 0.1010 0.0117  -0.0169 0.0063  94  LEU B CD1 
2497 C  CD2 . LEU B 94  ? 0.1545 0.1724 0.1167 0.0433  -0.0335 -0.0258 94  LEU B CD2 
2498 N  N   . GLN B 95  ? 0.1243 0.1666 0.0806 0.0060  -0.0073 0.0110  95  GLN B N   
2499 C  CA  . GLN B 95  ? 0.1283 0.1872 0.0866 0.0115  -0.0043 0.0112  95  GLN B CA  
2500 C  C   . GLN B 95  ? 0.1501 0.1814 0.0786 0.0040  -0.0067 0.0149  95  GLN B C   
2501 O  O   . GLN B 95  ? 0.1525 0.2123 0.0846 -0.0064 -0.0152 0.0090  95  GLN B O   
2502 C  CB  . GLN B 95  ? 0.1309 0.1773 0.0952 0.0175  -0.0065 0.0162  95  GLN B CB  
2503 C  CG  . GLN B 95  ? 0.1213 0.1925 0.1030 0.0129  0.0017  0.0297  95  GLN B CG  
2504 C  CD  . GLN B 95  ? 0.1129 0.1892 0.1364 0.0195  0.0104  0.0683  95  GLN B CD  
2505 O  OE1 . GLN B 95  ? 0.1636 0.2440 0.2387 0.0640  0.0652  0.1371  95  GLN B OE1 
2506 N  NE2 . GLN B 95  ? 0.1270 0.1789 0.1344 0.0021  -0.0137 0.0398  95  GLN B NE2 
2507 N  N   . GLY B 96  ? 0.1828 0.1864 0.0786 0.0181  -0.0063 0.0067  96  GLY B N   
2508 C  CA  . GLY B 96  ? 0.1734 0.1922 0.0970 0.0183  -0.0167 -0.0039 96  GLY B CA  
2509 C  C   . GLY B 96  ? 0.1614 0.1859 0.0796 0.0191  -0.0102 0.0132  96  GLY B C   
2510 O  O   . GLY B 96  ? 0.1613 0.2048 0.0867 0.0307  -0.0087 0.0099  96  GLY B O   
2511 N  N   . ASP B 97  ? 0.1485 0.1827 0.0830 0.0300  -0.0028 0.0002  97  ASP B N   
2512 C  CA  . ASP B 97  ? 0.1523 0.1759 0.0873 0.0288  -0.0068 -0.0050 97  ASP B CA  
2513 C  C   . ASP B 97  ? 0.1465 0.1635 0.0909 0.0182  -0.0172 -0.0173 97  ASP B C   
2514 O  O   . ASP B 97  ? 0.1754 0.1768 0.0879 0.0310  -0.0090 -0.0047 97  ASP B O   
2515 C  CB  . ASP B 97  ? 0.1561 0.1860 0.1028 0.0262  -0.0138 0.0026  97  ASP B CB  
2516 C  CG  . ASP B 97  ? 0.1885 0.1968 0.0983 0.0224  -0.0288 0.0028  97  ASP B CG  
2517 O  OD1 . ASP B 97  ? 0.2313 0.2738 0.0926 0.0646  -0.0058 0.0087  97  ASP B OD1 
2518 O  OD2 . ASP B 97  ? 0.2116 0.2519 0.1471 0.0363  -0.0526 0.0218  97  ASP B OD2 
2519 N  N   . LEU B 98  ? 0.1450 0.1622 0.0871 0.0248  -0.0022 -0.0045 98  LEU B N   
2520 C  CA  . LEU B 98  ? 0.1455 0.1653 0.0863 0.0206  -0.0096 -0.0025 98  LEU B CA  
2521 C  C   . LEU B 98  ? 0.1389 0.1637 0.0811 0.0177  0.0040  0.0022  98  LEU B C   
2522 O  O   . LEU B 98  ? 0.1407 0.1652 0.0872 0.0283  -0.0001 -0.0023 98  LEU B O   
2523 C  CB  . LEU B 98  ? 0.1286 0.1756 0.0782 0.0226  -0.0131 -0.0093 98  LEU B CB  
2524 C  CG  . LEU B 98  ? 0.1160 0.1845 0.0855 0.0252  -0.0153 -0.0085 98  LEU B CG  
2525 C  CD1 . LEU B 98  ? 0.1754 0.1814 0.1007 0.0047  0.0075  -0.0041 98  LEU B CD1 
2526 C  CD2 . LEU B 98  ? 0.1481 0.2022 0.0862 0.0283  -0.0035 -0.0072 98  LEU B CD2 
2527 N  N   . LYS B 99  ? 0.1302 0.1759 0.0814 0.0259  -0.0056 0.0008  99  LYS B N   
2528 C  CA  . LYS B 99  ? 0.1359 0.1715 0.0894 0.0221  -0.0025 -0.0055 99  LYS B CA  
2529 C  C   . LYS B 99  ? 0.1319 0.1636 0.0928 0.0220  -0.0020 0.0018  99  LYS B C   
2530 O  O   . LYS B 99  ? 0.1372 0.1752 0.0914 0.0240  -0.0006 0.0099  99  LYS B O   
2531 C  CB  . LYS B 99  ? 0.1467 0.1692 0.0983 0.0166  -0.0089 -0.0002 99  LYS B CB  
2532 C  CG  . LYS B 99  ? 0.1450 0.1806 0.1210 0.0102  0.0059  0.0204  99  LYS B CG  
2533 C  CD  . LYS B 99  ? 0.1471 0.1897 0.1561 0.0105  -0.0072 0.0191  99  LYS B CD  
2534 C  CE  . LYS B 99  ? 0.1485 0.2230 0.2432 0.0049  -0.0079 0.0316  99  LYS B CE  
2535 N  NZ  . LYS B 99  ? 0.1690 0.2364 0.4154 -0.0176 -0.0272 0.0815  99  LYS B NZ  
2536 N  N   . ALA B 100 ? 0.1455 0.1740 0.0837 0.0229  0.0043  -0.0018 100 ALA B N   
2537 C  CA  . ALA B 100 ? 0.1499 0.1806 0.0838 0.0183  -0.0006 -0.0072 100 ALA B CA  
2538 C  C   . ALA B 100 ? 0.1542 0.1765 0.0737 0.0193  -0.0001 -0.0087 100 ALA B C   
2539 O  O   . ALA B 100 ? 0.1737 0.1872 0.0846 0.0410  -0.0038 -0.0154 100 ALA B O   
2540 C  CB  . ALA B 100 ? 0.1954 0.1998 0.0816 0.0413  0.0100  0.0036  100 ALA B CB  
2541 N  N   . ALA B 101 ? 0.1507 0.1884 0.0861 0.0140  0.0072  -0.0108 101 ALA B N   
2542 C  CA  . ALA B 101 ? 0.1511 0.1789 0.0976 -0.0042 -0.0116 -0.0284 101 ALA B CA  
2543 C  C   . ALA B 101 ? 0.1374 0.1585 0.1024 0.0120  0.0160  -0.0180 101 ALA B C   
2544 O  O   . ALA B 101 ? 0.1641 0.1593 0.1081 0.0121  0.0089  -0.0170 101 ALA B O   
2545 C  CB  . ALA B 101 ? 0.1445 0.1916 0.1301 0.0058  -0.0142 -0.0115 101 ALA B CB  
2546 N  N   . ILE B 102 ? 0.1469 0.1587 0.0822 0.0214  0.0008  -0.0115 102 ILE B N   
2547 C  CA  . ILE B 102 ? 0.1408 0.1575 0.0929 0.0263  0.0064  -0.0025 102 ILE B CA  
2548 C  C   . ILE B 102 ? 0.1493 0.1492 0.0941 0.0169  0.0165  -0.0047 102 ILE B C   
2549 O  O   . ILE B 102 ? 0.1479 0.1614 0.0958 0.0324  0.0155  -0.0021 102 ILE B O   
2550 C  CB  . ILE B 102 ? 0.1288 0.1637 0.0801 0.0283  -0.0055 0.0010  102 ILE B CB  
2551 C  CG1 . ILE B 102 ? 0.1317 0.1677 0.0981 0.0250  -0.0009 -0.0146 102 ILE B CG1 
2552 C  CG2 . ILE B 102 ? 0.1384 0.1853 0.0955 0.0309  -0.0094 -0.0026 102 ILE B CG2 
2553 C  CD1 . ILE B 102 ? 0.1228 0.1589 0.1124 0.0113  0.0017  -0.0105 102 ILE B CD1 
2554 N  N   . GLU B 103 ? 0.1532 0.1724 0.0959 0.0394  0.0216  0.0110  103 GLU B N   
2555 C  CA  . GLU B 103 ? 0.1571 0.1896 0.1152 0.0447  0.0341  0.0123  103 GLU B CA  
2556 C  C   . GLU B 103 ? 0.1719 0.1925 0.1180 0.0497  0.0478  0.0109  103 GLU B C   
2557 O  O   . GLU B 103 ? 0.2057 0.1867 0.1294 0.0467  0.0560  0.0011  103 GLU B O   
2558 C  CB  . GLU B 103 ? 0.1417 0.2029 0.1148 0.0272  0.0241  -0.0003 103 GLU B CB  
2559 C  CG  . GLU B 103 ? 0.1255 0.2061 0.1182 0.0108  0.0053  0.0108  103 GLU B CG  
2560 C  CD  . GLU B 103 ? 0.1813 0.2193 0.1188 0.0046  0.0189  0.0106  103 GLU B CD  
2561 O  OE1 . GLU B 103 ? 0.1942 0.2692 0.1394 0.0157  0.0020  0.0404  103 GLU B OE1 
2562 O  OE2 . GLU B 103 ? 0.2003 0.2041 0.1497 -0.0025 0.0103  0.0295  103 GLU B OE2 
2563 N  N   A ARG B 104 ? 0.2734 0.2550 0.1600 0.0348  -0.0070 -0.0248 104 ARG B N   
2564 N  N   B ARG B 104 ? 0.2689 0.2523 0.1809 0.0420  -0.0115 -0.0298 104 ARG B N   
2565 C  CA  A ARG B 104 ? 0.3554 0.2575 0.1630 -0.0200 0.0593  -0.0329 104 ARG B CA  
2566 C  CA  B ARG B 104 ? 0.3478 0.2538 0.1664 -0.0143 0.0665  -0.0356 104 ARG B CA  
2567 C  C   A ARG B 104 ? 0.3901 0.2495 0.2070 0.0654  0.1309  -0.0129 104 ARG B C   
2568 C  C   B ARG B 104 ? 0.3887 0.2521 0.2072 0.0681  0.1302  -0.0099 104 ARG B C   
2569 O  O   A ARG B 104 ? 0.3997 0.2747 0.2525 0.0927  0.1020  -0.0331 104 ARG B O   
2570 O  O   B ARG B 104 ? 0.4080 0.2668 0.2505 0.0882  0.1041  -0.0359 104 ARG B O   
2571 C  CB  A ARG B 104 ? 0.5384 0.4074 0.1799 -0.0465 -0.0792 -0.0830 104 ARG B CB  
2572 C  CB  B ARG B 104 ? 0.4998 0.4162 0.1482 -0.1030 -0.0309 -0.0262 104 ARG B CB  
2573 C  CG  A ARG B 104 ? 0.4356 0.4635 0.2848 -0.0836 0.0231  -0.1406 104 ARG B CG  
2574 C  CG  B ARG B 104 ? 0.4528 0.4981 0.2754 -0.0753 0.0199  -0.1439 104 ARG B CG  
2575 C  CD  A ARG B 104 ? 0.4141 0.6271 0.2189 -0.1125 0.0511  -0.1313 104 ARG B CD  
2576 C  CD  B ARG B 104 ? 0.5123 0.5852 0.2224 -0.1728 -0.0460 -0.0332 104 ARG B CD  
2577 N  NE  A ARG B 104 ? 0.4731 0.5444 0.2051 0.0520  0.0456  -0.1910 104 ARG B NE  
2578 N  NE  B ARG B 104 ? 0.4867 0.5822 0.2900 -0.1651 -0.0135 -0.0381 104 ARG B NE  
2579 C  CZ  A ARG B 104 ? 0.5276 0.4248 0.1779 0.0491  0.0058  -0.1062 104 ARG B CZ  
2580 C  CZ  B ARG B 104 ? 0.3496 0.5180 0.2416 -0.0178 0.0082  -0.1477 104 ARG B CZ  
2581 N  NH1 A ARG B 104 ? 0.5393 0.7262 0.2273 -0.1164 -0.0505 0.0413  104 ARG B NH1 
2582 N  NH1 B ARG B 104 ? 0.6063 0.8268 0.3091 0.0436  -0.1287 -0.2246 104 ARG B NH1 
2583 N  NH2 A ARG B 104 ? 0.3637 0.3479 0.2249 0.0179  -0.0224 -0.0312 104 ARG B NH2 
2584 N  NH2 B ARG B 104 ? 0.4794 0.3938 0.4286 -0.0484 0.1408  -0.1235 104 ARG B NH2 
2585 N  N   . ASP B 105 ? 0.2080 0.1770 0.1156 0.0150  0.0112  -0.0281 105 ASP B N   
2586 C  CA  . ASP B 105 ? 0.2019 0.1679 0.1357 0.0051  0.0146  -0.0402 105 ASP B CA  
2587 C  C   . ASP B 105 ? 0.1816 0.1513 0.1333 0.0039  0.0388  -0.0199 105 ASP B C   
2588 O  O   . ASP B 105 ? 0.2246 0.1534 0.1736 -0.0067 0.0226  -0.0056 105 ASP B O   
2589 C  CB  . ASP B 105 ? 0.2008 0.1947 0.1240 0.0062  0.0230  -0.0506 105 ASP B CB  
2590 C  CG  . ASP B 105 ? 0.1815 0.2532 0.1286 -0.0276 0.0391  -0.0682 105 ASP B CG  
2591 O  OD1 . ASP B 105 ? 0.2074 0.3543 0.1411 -0.0167 0.0196  -0.1124 105 ASP B OD1 
2592 O  OD2 . ASP B 105 ? 0.1855 0.2461 0.1263 -0.0268 0.0225  -0.0395 105 ASP B OD2 
2593 N  N   . PHE B 106 ? 0.1716 0.1395 0.1083 0.0095  0.0245  -0.0053 106 PHE B N   
2594 C  CA  . PHE B 106 ? 0.1617 0.1594 0.1181 0.0281  0.0262  -0.0045 106 PHE B CA  
2595 C  C   . PHE B 106 ? 0.1689 0.1666 0.1058 0.0335  0.0247  -0.0034 106 PHE B C   
2596 O  O   . PHE B 106 ? 0.1608 0.2272 0.1318 0.0496  0.0280  0.0004  106 PHE B O   
2597 C  CB  . PHE B 106 ? 0.1533 0.1514 0.0994 0.0161  0.0186  -0.0063 106 PHE B CB  
2598 C  CG  . PHE B 106 ? 0.1535 0.1467 0.1069 0.0102  0.0261  -0.0177 106 PHE B CG  
2599 C  CD1 . PHE B 106 ? 0.1905 0.1404 0.1099 0.0125  0.0328  -0.0027 106 PHE B CD1 
2600 C  CD2 . PHE B 106 ? 0.1421 0.1672 0.0935 -0.0079 0.0058  -0.0155 106 PHE B CD2 
2601 C  CE1 . PHE B 106 ? 0.1711 0.1937 0.1201 -0.0200 0.0249  -0.0283 106 PHE B CE1 
2602 C  CE2 . PHE B 106 ? 0.1394 0.2040 0.1085 -0.0240 0.0172  -0.0362 106 PHE B CE2 
2603 C  CZ  . PHE B 106 ? 0.1597 0.1918 0.1105 -0.0329 0.0195  -0.0304 106 PHE B CZ  
2604 N  N   . GLY B 107 ? 0.1805 0.1617 0.1215 0.0400  0.0420  0.0156  107 GLY B N   
2605 C  CA  . GLY B 107 ? 0.1757 0.1788 0.1393 0.0461  0.0394  0.0098  107 GLY B CA  
2606 C  C   . GLY B 107 ? 0.1525 0.1846 0.1243 0.0364  0.0371  0.0094  107 GLY B C   
2607 O  O   . GLY B 107 ? 0.1754 0.2063 0.1337 0.0434  0.0617  0.0094  107 GLY B O   
2608 N  N   . SER B 108 ? 0.1651 0.1762 0.1073 0.0279  0.0390  0.0151  108 SER B N   
2609 C  CA  . SER B 108 ? 0.1355 0.1817 0.0981 0.0242  0.0299  0.0133  108 SER B CA  
2610 C  C   . SER B 108 ? 0.1273 0.1713 0.0938 0.0181  0.0231  0.0101  108 SER B C   
2611 O  O   . SER B 108 ? 0.1447 0.1706 0.0850 0.0265  0.0219  0.0154  108 SER B O   
2612 C  CB  . SER B 108 ? 0.1387 0.2260 0.0980 0.0305  0.0190  0.0150  108 SER B CB  
2613 O  OG  . SER B 108 ? 0.1514 0.2080 0.1097 0.0392  0.0273  0.0179  108 SER B OG  
2614 N  N   . VAL B 109 ? 0.1264 0.1743 0.0835 0.0135  0.0139  0.0085  109 VAL B N   
2615 C  CA  . VAL B 109 ? 0.1296 0.1647 0.0820 0.0213  0.0139  0.0130  109 VAL B CA  
2616 C  C   . VAL B 109 ? 0.1287 0.1626 0.0854 0.0193  0.0131  0.0106  109 VAL B C   
2617 O  O   . VAL B 109 ? 0.1383 0.1477 0.0868 0.0207  0.0248  0.0177  109 VAL B O   
2618 C  CB  . VAL B 109 ? 0.1496 0.1737 0.0929 0.0250  0.0054  0.0208  109 VAL B CB  
2619 C  CG1 . VAL B 109 ? 0.1748 0.1708 0.0970 0.0349  -0.0005 0.0108  109 VAL B CG1 
2620 C  CG2 . VAL B 109 ? 0.1657 0.1844 0.0936 0.0296  -0.0035 0.0235  109 VAL B CG2 
2621 N  N   . ASP B 110 ? 0.1321 0.1924 0.0809 -0.0036 0.0057  0.0226  110 ASP B N   
2622 C  CA  . ASP B 110 ? 0.1295 0.1974 0.0985 0.0028  0.0035  0.0270  110 ASP B CA  
2623 C  C   . ASP B 110 ? 0.1056 0.1790 0.0972 0.0301  0.0153  0.0159  110 ASP B C   
2624 O  O   . ASP B 110 ? 0.1094 0.1812 0.0812 0.0297  0.0072  0.0245  110 ASP B O   
2625 C  CB  . ASP B 110 ? 0.1366 0.2345 0.1357 -0.0012 -0.0066 0.0695  110 ASP B CB  
2626 C  CG  . ASP B 110 ? 0.1494 0.2320 0.1677 -0.0118 -0.0313 0.0369  110 ASP B CG  
2627 O  OD1 . ASP B 110 ? 0.2108 0.2264 0.1870 0.0106  0.0308  0.0240  110 ASP B OD1 
2628 O  OD2 . ASP B 110 ? 0.1752 0.3237 0.2556 -0.0601 -0.0447 0.1014  110 ASP B OD2 
2629 N  N   . ASN B 111 ? 0.1319 0.1772 0.0935 0.0381  0.0280  0.0205  111 ASN B N   
2630 C  CA  . ASN B 111 ? 0.1378 0.1665 0.0959 0.0399  0.0294  0.0153  111 ASN B CA  
2631 C  C   . ASN B 111 ? 0.1246 0.1397 0.0777 0.0311  0.0102  0.0027  111 ASN B C   
2632 O  O   . ASN B 111 ? 0.1354 0.1536 0.0898 0.0414  0.0231  0.0183  111 ASN B O   
2633 C  CB  . ASN B 111 ? 0.1619 0.1787 0.1086 0.0527  0.0304  0.0044  111 ASN B CB  
2634 C  CG  . ASN B 111 ? 0.1907 0.2431 0.1288 0.0816  0.0602  0.0082  111 ASN B CG  
2635 O  OD1 . ASN B 111 ? 0.2211 0.2291 0.1768 0.0705  0.0785  -0.0043 111 ASN B OD1 
2636 N  ND2 . ASN B 111 ? 0.1608 0.4151 0.1217 0.1326  0.0196  -0.0234 111 ASN B ND2 
2637 N  N   . PHE B 112 ? 0.1364 0.1473 0.0754 0.0347  0.0134  0.0105  112 PHE B N   
2638 C  CA  . PHE B 112 ? 0.1255 0.1349 0.0764 0.0294  0.0063  0.0050  112 PHE B CA  
2639 C  C   . PHE B 112 ? 0.1022 0.1222 0.0776 0.0222  -0.0059 0.0000  112 PHE B C   
2640 O  O   . PHE B 112 ? 0.1047 0.1395 0.0732 0.0100  0.0042  0.0003  112 PHE B O   
2641 C  CB  . PHE B 112 ? 0.1255 0.1354 0.0779 0.0134  -0.0073 -0.0028 112 PHE B CB  
2642 C  CG  . PHE B 112 ? 0.1182 0.1404 0.0703 0.0171  -0.0064 -0.0055 112 PHE B CG  
2643 C  CD1 . PHE B 112 ? 0.1260 0.1503 0.0891 -0.0101 -0.0086 -0.0043 112 PHE B CD1 
2644 C  CD2 . PHE B 112 ? 0.1086 0.1388 0.0933 0.0131  -0.0154 -0.0066 112 PHE B CD2 
2645 C  CE1 . PHE B 112 ? 0.0990 0.2162 0.0873 0.0042  -0.0116 0.0122  112 PHE B CE1 
2646 C  CE2 . PHE B 112 ? 0.1277 0.1624 0.1030 0.0312  -0.0241 -0.0160 112 PHE B CE2 
2647 C  CZ  . PHE B 112 ? 0.1189 0.2043 0.0836 0.0383  -0.0088 -0.0171 112 PHE B CZ  
2648 N  N   . LYS B 113 ? 0.1082 0.1324 0.0691 0.0191  0.0080  0.0029  113 LYS B N   
2649 C  CA  . LYS B 113 ? 0.0945 0.1230 0.0738 0.0152  -0.0009 -0.0047 113 LYS B CA  
2650 C  C   . LYS B 113 ? 0.0836 0.1289 0.0804 0.0155  0.0065  -0.0008 113 LYS B C   
2651 O  O   . LYS B 113 ? 0.0901 0.1292 0.0713 0.0112  0.0049  0.0020  113 LYS B O   
2652 C  CB  . LYS B 113 ? 0.0887 0.1335 0.0864 0.0161  0.0015  0.0081  113 LYS B CB  
2653 C  CG  . LYS B 113 ? 0.1081 0.1398 0.0756 0.0151  -0.0062 0.0108  113 LYS B CG  
2654 C  CD  . LYS B 113 ? 0.1290 0.1393 0.0888 0.0034  0.0000  0.0027  113 LYS B CD  
2655 C  CE  . LYS B 113 ? 0.1186 0.1480 0.1049 0.0013  0.0055  0.0022  113 LYS B CE  
2656 N  NZ  . LYS B 113 ? 0.1425 0.1418 0.1175 -0.0104 0.0019  0.0004  113 LYS B NZ  
2657 N  N   . ALA B 114 ? 0.0943 0.1352 0.0826 0.0178  0.0045  0.0128  114 ALA B N   
2658 C  CA  . ALA B 114 ? 0.0829 0.1463 0.0777 0.0232  -0.0008 0.0059  114 ALA B CA  
2659 C  C   . ALA B 114 ? 0.0889 0.1273 0.0828 0.0191  0.0080  0.0086  114 ALA B C   
2660 O  O   . ALA B 114 ? 0.0922 0.1445 0.0759 0.0207  -0.0006 0.0026  114 ALA B O   
2661 C  CB  . ALA B 114 ? 0.0859 0.1622 0.1054 0.0249  0.0155  0.0221  114 ALA B CB  
2662 N  N   . GLU B 115 ? 0.0998 0.1311 0.0804 0.0230  0.0100  -0.0001 115 GLU B N   
2663 C  CA  . GLU B 115 ? 0.1045 0.1251 0.0798 0.0207  0.0010  -0.0023 115 GLU B CA  
2664 C  C   . GLU B 115 ? 0.0963 0.1222 0.0750 0.0092  -0.0016 -0.0064 115 GLU B C   
2665 O  O   . GLU B 115 ? 0.1069 0.1264 0.0829 0.0077  0.0027  -0.0008 115 GLU B O   
2666 C  CB  A GLU B 115 ? 0.1444 0.1378 0.0844 0.0134  0.0057  -0.0122 115 GLU B CB  
2667 C  CB  B GLU B 115 ? 0.1826 0.1268 0.1060 0.0038  0.0106  -0.0328 115 GLU B CB  
2668 C  CG  A GLU B 115 ? 0.1615 0.1234 0.1331 0.0113  -0.0080 -0.0112 115 GLU B CG  
2669 C  CG  B GLU B 115 ? 0.2188 0.1468 0.1401 0.0068  0.0411  -0.0557 115 GLU B CG  
2670 C  CD  A GLU B 115 ? 0.1708 0.1279 0.1370 0.0082  0.0123  -0.0145 115 GLU B CD  
2671 C  CD  B GLU B 115 ? 0.2749 0.1304 0.2656 0.0564  0.1220  0.0255  115 GLU B CD  
2672 O  OE1 A GLU B 115 ? 0.1825 0.1845 0.1320 -0.0314 -0.0012 -0.0257 115 GLU B OE1 
2673 O  OE1 B GLU B 115 ? 0.4012 0.1388 0.3390 -0.0073 0.1831  0.0047  115 GLU B OE1 
2674 O  OE2 A GLU B 115 ? 0.1436 0.2186 0.2072 -0.0226 0.0191  -0.0896 115 GLU B OE2 
2675 O  OE2 B GLU B 115 ? 0.2976 0.2122 0.1993 0.1051  0.0924  0.0497  115 GLU B OE2 
2676 N  N   . PHE B 116 ? 0.0902 0.1137 0.0757 0.0031  0.0019  -0.0051 116 PHE B N   
2677 C  CA  . PHE B 116 ? 0.0784 0.1220 0.0710 0.0071  -0.0018 -0.0064 116 PHE B CA  
2678 C  C   . PHE B 116 ? 0.0875 0.1121 0.0773 0.0119  -0.0011 -0.0004 116 PHE B C   
2679 O  O   . PHE B 116 ? 0.0872 0.1241 0.0711 0.0052  0.0055  0.0019  116 PHE B O   
2680 C  CB  . PHE B 116 ? 0.0866 0.1250 0.0718 0.0071  -0.0068 0.0002  116 PHE B CB  
2681 C  CG  . PHE B 116 ? 0.0911 0.1185 0.0682 0.0085  -0.0072 0.0014  116 PHE B CG  
2682 C  CD1 . PHE B 116 ? 0.0932 0.1242 0.0756 0.0070  -0.0028 -0.0004 116 PHE B CD1 
2683 C  CD2 . PHE B 116 ? 0.0939 0.1274 0.0811 0.0124  -0.0121 -0.0072 116 PHE B CD2 
2684 C  CE1 . PHE B 116 ? 0.0825 0.1401 0.1044 0.0026  -0.0030 -0.0038 116 PHE B CE1 
2685 C  CE2 . PHE B 116 ? 0.0989 0.1260 0.0856 0.0111  0.0020  -0.0067 116 PHE B CE2 
2686 C  CZ  . PHE B 116 ? 0.0852 0.1314 0.0928 0.0080  0.0077  0.0022  116 PHE B CZ  
2687 N  N   . GLU B 117 ? 0.0803 0.1281 0.0717 0.0075  0.0047  -0.0051 117 GLU B N   
2688 C  CA  . GLU B 117 ? 0.0765 0.1296 0.0775 0.0104  -0.0016 -0.0023 117 GLU B CA  
2689 C  C   . GLU B 117 ? 0.0788 0.1345 0.0764 0.0045  -0.0046 -0.0040 117 GLU B C   
2690 O  O   . GLU B 117 ? 0.0858 0.1439 0.0698 0.0054  0.0018  -0.0033 117 GLU B O   
2691 C  CB  . GLU B 117 ? 0.0779 0.1364 0.0803 0.0052  -0.0023 0.0022  117 GLU B CB  
2692 C  CG  . GLU B 117 ? 0.0829 0.1317 0.0865 0.0064  0.0035  -0.0098 117 GLU B CG  
2693 C  CD  . GLU B 117 ? 0.0890 0.1159 0.0921 0.0083  -0.0011 -0.0003 117 GLU B CD  
2694 O  OE1 . GLU B 117 ? 0.0769 0.1574 0.1014 0.0062  0.0022  0.0103  117 GLU B OE1 
2695 O  OE2 . GLU B 117 ? 0.0915 0.1463 0.1367 0.0126  0.0043  0.0266  117 GLU B OE2 
2696 N  N   . LYS B 118 ? 0.0931 0.1326 0.0726 0.0134  0.0020  0.0000  118 LYS B N   
2697 C  CA  . LYS B 118 ? 0.1136 0.1361 0.0827 0.0249  0.0010  0.0075  118 LYS B CA  
2698 C  C   . LYS B 118 ? 0.1071 0.1245 0.0838 0.0230  0.0065  0.0089  118 LYS B C   
2699 O  O   . LYS B 118 ? 0.1223 0.1420 0.0863 0.0180  0.0172  0.0092  118 LYS B O   
2700 C  CB  A LYS B 118 ? 0.1118 0.1525 0.0865 0.0489  0.0029  0.0178  118 LYS B CB  
2701 C  CB  B LYS B 118 ? 0.1679 0.1608 0.1429 0.0677  0.0714  0.0389  118 LYS B CB  
2702 C  CG  A LYS B 118 ? 0.1088 0.1595 0.1010 0.0152  -0.0135 0.0052  118 LYS B CG  
2703 C  CG  B LYS B 118 ? 0.2821 0.1995 0.1326 0.1262  0.0879  0.0515  118 LYS B CG  
2704 C  CD  A LYS B 118 ? 0.1174 0.2039 0.3427 0.0454  0.0234  -0.0874 118 LYS B CD  
2705 C  CD  B LYS B 118 ? 0.3017 0.2377 0.2839 0.1222  -0.0474 0.0444  118 LYS B CD  
2706 C  CE  A LYS B 118 ? 0.3093 0.1926 0.3647 0.0863  -0.0822 -0.0297 118 LYS B CE  
2707 C  CE  B LYS B 118 ? 0.2192 0.3478 0.3711 0.1448  0.0298  -0.0032 118 LYS B CE  
2708 N  NZ  A LYS B 118 ? 0.1745 0.2528 0.5193 0.0308  0.0887  0.0719  118 LYS B NZ  
2709 N  NZ  B LYS B 118 ? 0.2233 0.2875 0.2594 0.0936  0.1546  0.0445  118 LYS B NZ  
2710 N  N   . ALA B 119 ? 0.1183 0.1289 0.0808 0.0099  0.0064  -0.0093 119 ALA B N   
2711 C  CA  . ALA B 119 ? 0.1223 0.1160 0.0854 0.0018  0.0038  0.0015  119 ALA B CA  
2712 C  C   . ALA B 119 ? 0.0984 0.1239 0.0771 -0.0031 -0.0012 0.0013  119 ALA B C   
2713 O  O   . ALA B 119 ? 0.1057 0.1285 0.0901 0.0022  0.0086  0.0057  119 ALA B O   
2714 C  CB  . ALA B 119 ? 0.1255 0.1509 0.0967 -0.0152 -0.0036 -0.0148 119 ALA B CB  
2715 N  N   . ALA B 120 ? 0.0877 0.1238 0.0702 0.0035  0.0012  -0.0015 120 ALA B N   
2716 C  CA  . ALA B 120 ? 0.0780 0.1320 0.0711 0.0097  0.0035  0.0014  120 ALA B CA  
2717 C  C   . ALA B 120 ? 0.0786 0.1209 0.0812 0.0095  0.0030  0.0023  120 ALA B C   
2718 O  O   . ALA B 120 ? 0.0839 0.1647 0.0728 0.0128  0.0079  0.0024  120 ALA B O   
2719 C  CB  . ALA B 120 ? 0.0816 0.1255 0.0752 0.0086  -0.0031 0.0040  120 ALA B CB  
2720 N  N   . ALA B 121 ? 0.0809 0.1262 0.0669 0.0032  -0.0048 0.0036  121 ALA B N   
2721 C  CA  . ALA B 121 ? 0.0884 0.1350 0.0647 0.0059  -0.0022 -0.0027 121 ALA B CA  
2722 C  C   . ALA B 121 ? 0.0761 0.1328 0.0748 0.0126  -0.0007 0.0073  121 ALA B C   
2723 O  O   . ALA B 121 ? 0.1026 0.1249 0.0771 0.0118  0.0014  0.0066  121 ALA B O   
2724 C  CB  . ALA B 121 ? 0.0791 0.1586 0.0835 0.0031  -0.0034 0.0139  121 ALA B CB  
2725 N  N   A SER B 122 ? 0.0814 0.1324 0.0802 0.0095  0.0031  0.0026  122 SER B N   
2726 N  N   B SER B 122 ? 0.0860 0.1243 0.0824 0.0194  -0.0028 0.0052  122 SER B N   
2727 C  CA  A SER B 122 ? 0.0895 0.1280 0.1035 0.0227  0.0232  -0.0019 122 SER B CA  
2728 C  CA  B SER B 122 ? 0.0855 0.1302 0.0765 0.0212  -0.0081 0.0095  122 SER B CA  
2729 C  C   A SER B 122 ? 0.0912 0.1315 0.0917 0.0163  0.0203  0.0179  122 SER B C   
2730 C  C   B SER B 122 ? 0.0927 0.1182 0.1049 0.0139  0.0068  -0.0005 122 SER B C   
2731 O  O   A SER B 122 ? 0.1184 0.1162 0.1193 0.0199  0.0256  0.0081  122 SER B O   
2732 O  O   B SER B 122 ? 0.1086 0.1433 0.1658 0.0349  0.0275  0.0481  122 SER B O   
2733 C  CB  A SER B 122 ? 0.1006 0.1312 0.0901 0.0098  0.0265  0.0056  122 SER B CB  
2734 C  CB  B SER B 122 ? 0.1180 0.1177 0.1076 0.0256  0.0227  0.0169  122 SER B CB  
2735 O  OG  A SER B 122 ? 0.1382 0.1557 0.1015 0.0025  0.0100  -0.0091 122 SER B OG  
2736 O  OG  B SER B 122 ? 0.1139 0.2274 0.1439 0.0552  0.0229  0.0125  122 SER B OG  
2737 N  N   . ARG B 123 ? 0.0863 0.1177 0.0781 0.0134  0.0074  0.0103  123 ARG B N   
2738 C  CA  . ARG B 123 ? 0.0871 0.1266 0.0800 0.0127  0.0041  0.0079  123 ARG B CA  
2739 C  C   . ARG B 123 ? 0.0889 0.1179 0.0801 0.0130  0.0058  0.0056  123 ARG B C   
2740 O  O   . ARG B 123 ? 0.1543 0.1143 0.0909 0.0146  0.0265  0.0072  123 ARG B O   
2741 C  CB  . ARG B 123 ? 0.0964 0.1626 0.0855 0.0302  0.0020  0.0148  123 ARG B CB  
2742 C  CG  . ARG B 123 ? 0.0974 0.1945 0.1191 0.0383  0.0102  0.0292  123 ARG B CG  
2743 C  CD  . ARG B 123 ? 0.0920 0.2157 0.1018 0.0220  0.0052  0.0287  123 ARG B CD  
2744 N  NE  . ARG B 123 ? 0.0922 0.2011 0.1161 0.0096  0.0035  0.0437  123 ARG B NE  
2745 C  CZ  . ARG B 123 ? 0.0958 0.1905 0.1494 0.0172  -0.0029 0.0380  123 ARG B CZ  
2746 N  NH1 . ARG B 123 ? 0.1177 0.2037 0.1571 -0.0071 0.0023  0.0532  123 ARG B NH1 
2747 N  NH2 . ARG B 123 ? 0.1269 0.1848 0.1937 0.0091  0.0310  0.0090  123 ARG B NH2 
2748 N  N   . PHE B 124 ? 0.0851 0.1108 0.0752 0.0057  -0.0003 0.0008  124 PHE B N   
2749 C  CA  . PHE B 124 ? 0.0792 0.1051 0.0752 0.0164  0.0018  0.0035  124 PHE B CA  
2750 C  C   . PHE B 124 ? 0.0731 0.1027 0.0845 0.0095  -0.0053 0.0030  124 PHE B C   
2751 O  O   . PHE B 124 ? 0.0758 0.1276 0.1143 0.0073  -0.0040 -0.0283 124 PHE B O   
2752 C  CB  . PHE B 124 ? 0.0899 0.1034 0.0802 0.0187  0.0051  0.0032  124 PHE B CB  
2753 C  CG  . PHE B 124 ? 0.0850 0.0975 0.0763 0.0219  0.0046  0.0025  124 PHE B CG  
2754 C  CD1 . PHE B 124 ? 0.0861 0.1094 0.0861 0.0027  0.0089  0.0135  124 PHE B CD1 
2755 C  CD2 . PHE B 124 ? 0.0809 0.1014 0.0783 0.0127  -0.0004 -0.0024 124 PHE B CD2 
2756 C  CE1 . PHE B 124 ? 0.0859 0.1142 0.0856 -0.0002 -0.0015 0.0055  124 PHE B CE1 
2757 C  CE2 . PHE B 124 ? 0.0812 0.1151 0.0695 0.0097  0.0012  0.0016  124 PHE B CE2 
2758 C  CZ  . PHE B 124 ? 0.0894 0.1184 0.0803 0.0081  0.0053  -0.0058 124 PHE B CZ  
2759 N  N   . GLY B 125 ? 0.0696 0.1030 0.0742 0.0138  -0.0042 -0.0011 125 GLY B N   
2760 C  CA  . GLY B 125 ? 0.0732 0.1032 0.0714 0.0143  -0.0050 0.0009  125 GLY B CA  
2761 C  C   . GLY B 125 ? 0.0795 0.0981 0.0668 0.0081  -0.0017 -0.0006 125 GLY B C   
2762 O  O   . GLY B 125 ? 0.0731 0.1044 0.1010 0.0059  0.0051  0.0116  125 GLY B O   
2763 N  N   . SER B 126 ? 0.0724 0.0975 0.0627 0.0072  -0.0081 0.0014  126 SER B N   
2764 C  CA  . SER B 126 ? 0.0772 0.0972 0.0627 0.0110  -0.0071 0.0011  126 SER B CA  
2765 C  C   . SER B 126 ? 0.0664 0.1004 0.0654 0.0120  -0.0073 -0.0032 126 SER B C   
2766 O  O   . SER B 126 ? 0.0815 0.1000 0.0744 0.0121  -0.0112 -0.0053 126 SER B O   
2767 C  CB  . SER B 126 ? 0.0773 0.0951 0.0637 0.0116  -0.0060 -0.0034 126 SER B CB  
2768 O  OG  . SER B 126 ? 0.0862 0.1076 0.0682 0.0117  -0.0059 -0.0089 126 SER B OG  
2769 N  N   . GLY B 127 ? 0.0798 0.0904 0.0673 0.0093  -0.0073 -0.0026 127 GLY B N   
2770 C  CA  . GLY B 127 ? 0.0859 0.1018 0.0647 0.0079  -0.0031 -0.0025 127 GLY B CA  
2771 C  C   . GLY B 127 ? 0.0725 0.1033 0.0653 0.0113  -0.0073 -0.0016 127 GLY B C   
2772 O  O   . GLY B 127 ? 0.0798 0.0987 0.0699 0.0105  -0.0062 -0.0018 127 GLY B O   
2773 N  N   . TRP B 128 ? 0.0949 0.1011 0.0632 0.0105  -0.0036 -0.0030 128 TRP B N   
2774 C  CA  . TRP B 128 ? 0.0852 0.0931 0.0728 0.0055  0.0018  0.0005  128 TRP B CA  
2775 C  C   . TRP B 128 ? 0.0899 0.1084 0.0623 0.0072  -0.0054 -0.0019 128 TRP B C   
2776 O  O   . TRP B 128 ? 0.1017 0.1052 0.0819 0.0086  0.0079  -0.0041 128 TRP B O   
2777 C  CB  . TRP B 128 ? 0.0901 0.1156 0.0712 0.0088  -0.0034 0.0003  128 TRP B CB  
2778 C  CG  . TRP B 128 ? 0.0802 0.1209 0.0737 0.0086  -0.0108 -0.0016 128 TRP B CG  
2779 C  CD1 . TRP B 128 ? 0.0876 0.1290 0.0840 0.0045  -0.0044 0.0045  128 TRP B CD1 
2780 C  CD2 . TRP B 128 ? 0.0772 0.1253 0.0726 0.0120  -0.0143 0.0029  128 TRP B CD2 
2781 N  NE1 . TRP B 128 ? 0.0791 0.1437 0.0906 0.0104  0.0011  0.0034  128 TRP B NE1 
2782 C  CE2 . TRP B 128 ? 0.0693 0.1381 0.0847 0.0056  -0.0084 -0.0044 128 TRP B CE2 
2783 C  CE3 . TRP B 128 ? 0.0923 0.1186 0.0770 0.0054  -0.0102 0.0012  128 TRP B CE3 
2784 C  CZ2 . TRP B 128 ? 0.0882 0.1415 0.0929 0.0168  -0.0199 -0.0142 128 TRP B CZ2 
2785 C  CZ3 . TRP B 128 ? 0.0998 0.1225 0.0932 0.0110  -0.0150 0.0032  128 TRP B CZ3 
2786 C  CH2 . TRP B 128 ? 0.0914 0.1296 0.1037 0.0171  -0.0224 -0.0152 128 TRP B CH2 
2787 N  N   . ALA B 129 ? 0.0863 0.1064 0.0672 0.0071  -0.0010 -0.0023 129 ALA B N   
2788 C  CA  . ALA B 129 ? 0.0870 0.1160 0.0671 0.0110  -0.0011 0.0057  129 ALA B CA  
2789 C  C   . ALA B 129 ? 0.0841 0.1048 0.0677 0.0077  -0.0054 -0.0006 129 ALA B C   
2790 O  O   . ALA B 129 ? 0.1093 0.1139 0.0741 0.0130  -0.0098 -0.0028 129 ALA B O   
2791 C  CB  . ALA B 129 ? 0.0894 0.1427 0.0850 0.0083  -0.0091 0.0035  129 ALA B CB  
2792 N  N   . TRP B 130 ? 0.0896 0.1175 0.0714 0.0174  -0.0085 -0.0032 130 TRP B N   
2793 C  CA  . TRP B 130 ? 0.0928 0.1253 0.0623 0.0143  -0.0099 0.0006  130 TRP B CA  
2794 C  C   . TRP B 130 ? 0.0931 0.1120 0.0760 0.0121  -0.0026 -0.0110 130 TRP B C   
2795 O  O   . TRP B 130 ? 0.1041 0.1256 0.0779 0.0170  -0.0035 -0.0062 130 TRP B O   
2796 C  CB  . TRP B 130 ? 0.0901 0.1454 0.0748 0.0054  -0.0044 -0.0167 130 TRP B CB  
2797 C  CG  . TRP B 130 ? 0.0846 0.1268 0.0835 0.0054  -0.0083 -0.0113 130 TRP B CG  
2798 C  CD1 . TRP B 130 ? 0.0960 0.1258 0.0774 -0.0022 -0.0041 -0.0052 130 TRP B CD1 
2799 C  CD2 . TRP B 130 ? 0.0844 0.1538 0.0752 0.0128  -0.0045 -0.0023 130 TRP B CD2 
2800 N  NE1 . TRP B 130 ? 0.0923 0.1369 0.0758 0.0045  0.0008  -0.0051 130 TRP B NE1 
2801 C  CE2 . TRP B 130 ? 0.0861 0.1355 0.0761 -0.0007 -0.0058 -0.0026 130 TRP B CE2 
2802 C  CE3 . TRP B 130 ? 0.1057 0.1505 0.0891 0.0162  0.0013  0.0070  130 TRP B CE3 
2803 C  CZ2 . TRP B 130 ? 0.0902 0.1737 0.0844 0.0170  0.0013  -0.0053 130 TRP B CZ2 
2804 C  CZ3 . TRP B 130 ? 0.1098 0.1950 0.1089 0.0439  -0.0018 0.0208  130 TRP B CZ3 
2805 C  CH2 . TRP B 130 ? 0.1038 0.2033 0.1042 0.0449  0.0062  0.0061  130 TRP B CH2 
2806 N  N   . LEU B 131 ? 0.0975 0.1185 0.0659 0.0081  -0.0001 -0.0076 131 LEU B N   
2807 C  CA  . LEU B 131 ? 0.0951 0.1339 0.0702 0.0112  -0.0048 -0.0105 131 LEU B CA  
2808 C  C   . LEU B 131 ? 0.0998 0.1368 0.0660 0.0040  -0.0036 -0.0073 131 LEU B C   
2809 O  O   . LEU B 131 ? 0.1074 0.1382 0.0839 0.0117  -0.0121 -0.0093 131 LEU B O   
2810 C  CB  . LEU B 131 ? 0.1105 0.1315 0.0678 0.0044  -0.0030 -0.0051 131 LEU B CB  
2811 C  CG  . LEU B 131 ? 0.1131 0.1524 0.0680 -0.0028 -0.0002 -0.0087 131 LEU B CG  
2812 C  CD1 . LEU B 131 ? 0.1319 0.1617 0.0771 0.0066  0.0082  -0.0141 131 LEU B CD1 
2813 C  CD2 . LEU B 131 ? 0.1392 0.1675 0.0778 -0.0103 0.0072  0.0020  131 LEU B CD2 
2814 N  N   . VAL B 132 ? 0.0984 0.1359 0.0809 0.0037  -0.0118 -0.0155 132 VAL B N   
2815 C  CA  . VAL B 132 ? 0.1062 0.1478 0.0861 0.0010  -0.0099 -0.0243 132 VAL B CA  
2816 C  C   . VAL B 132 ? 0.1221 0.1513 0.0790 0.0053  -0.0075 -0.0195 132 VAL B C   
2817 O  O   . VAL B 132 ? 0.1214 0.1765 0.0829 -0.0021 0.0003  -0.0284 132 VAL B O   
2818 C  CB  . VAL B 132 ? 0.1204 0.1430 0.0891 -0.0094 -0.0064 -0.0238 132 VAL B CB  
2819 C  CG1 . VAL B 132 ? 0.1361 0.1633 0.0927 0.0150  0.0007  -0.0087 132 VAL B CG1 
2820 C  CG2 . VAL B 132 ? 0.1461 0.1495 0.1083 0.0008  0.0167  -0.0149 132 VAL B CG2 
2821 N  N   . LEU B 133 ? 0.1226 0.1735 0.0901 0.0010  -0.0106 -0.0313 133 LEU B N   
2822 C  CA  . LEU B 133 ? 0.1233 0.1807 0.0871 -0.0083 -0.0097 -0.0309 133 LEU B CA  
2823 C  C   . LEU B 133 ? 0.1666 0.1745 0.1022 -0.0242 0.0087  -0.0368 133 LEU B C   
2824 O  O   . LEU B 133 ? 0.1559 0.1988 0.1355 -0.0366 0.0085  -0.0504 133 LEU B O   
2825 C  CB  . LEU B 133 ? 0.1689 0.1958 0.0848 -0.0128 -0.0116 -0.0165 133 LEU B CB  
2826 C  CG  . LEU B 133 ? 0.1788 0.2946 0.0839 -0.0276 -0.0263 -0.0401 133 LEU B CG  
2827 C  CD1 . LEU B 133 ? 0.2061 0.3316 0.0892 -0.0319 0.0162  -0.0319 133 LEU B CD1 
2828 C  CD2 . LEU B 133 ? 0.2486 0.4026 0.1062 -0.0195 -0.0741 0.0042  133 LEU B CD2 
2829 N  N   . LYS B 134 ? 0.2013 0.1554 0.2278 -0.0322 0.0714  -0.0417 134 LYS B N   
2830 C  CA  . LYS B 134 ? 0.3529 0.1682 0.3991 -0.0673 0.1103  -0.0136 134 LYS B CA  
2831 C  C   . LYS B 134 ? 0.2246 0.2215 0.5251 -0.0900 0.1319  -0.1649 134 LYS B C   
2832 O  O   . LYS B 134 ? 0.2495 0.1987 0.5662 -0.0209 0.1608  -0.0366 134 LYS B O   
2833 C  CB  A LYS B 134 ? 0.4335 0.1807 0.5661 -0.0187 0.0527  0.0843  134 LYS B CB  
2834 C  CB  B LYS B 134 ? 0.4042 0.1842 0.5932 -0.0457 0.0694  0.0811  134 LYS B CB  
2835 C  CG  A LYS B 134 ? 0.3933 0.2219 0.5011 -0.0234 0.1889  0.0698  134 LYS B CG  
2836 C  CG  B LYS B 134 ? 0.4383 0.2421 0.5103 0.0029  0.0370  0.1066  134 LYS B CG  
2837 C  CD  A LYS B 134 ? 0.4600 0.2911 0.5308 0.0350  0.1257  0.1049  134 LYS B CD  
2838 C  CD  B LYS B 134 ? 0.3981 0.2417 0.5563 -0.0137 0.1313  0.1490  134 LYS B CD  
2839 C  CE  A LYS B 134 ? 0.4475 0.3112 0.5758 0.0586  0.1306  0.1003  134 LYS B CE  
2840 C  CE  B LYS B 134 ? 0.3693 0.2007 0.5592 -0.0520 0.1338  0.1577  134 LYS B CE  
2841 N  NZ  A LYS B 134 ? 0.3938 0.3782 0.4475 0.1162  0.2136  0.0556  134 LYS B NZ  
2842 N  NZ  B LYS B 134 ? 0.2885 0.3282 0.4190 0.1574  0.2885  0.0946  134 LYS B NZ  
2843 N  N   . GLY B 135 ? 0.2497 0.3027 0.5703 -0.0735 0.1085  -0.2425 135 GLY B N   
2844 C  CA  . GLY B 135 ? 0.4284 0.4237 0.5527 -0.1724 0.0957  -0.2435 135 GLY B CA  
2845 C  C   . GLY B 135 ? 0.2410 0.4228 0.3625 -0.0826 -0.0923 -0.1392 135 GLY B C   
2846 O  O   . GLY B 135 ? 0.4050 0.5464 0.4405 -0.0256 0.0478  -0.2287 135 GLY B O   
2847 N  N   . ASP B 136 ? 0.3633 0.4101 0.3953 -0.1136 -0.1653 -0.1450 136 ASP B N   
2848 C  CA  . ASP B 136 ? 0.4215 0.4771 0.4090 -0.1408 -0.2146 -0.0404 136 ASP B CA  
2849 C  C   . ASP B 136 ? 0.3757 0.3630 0.1842 -0.0749 -0.0847 -0.0979 136 ASP B C   
2850 O  O   . ASP B 136 ? 0.4274 0.4046 0.1435 -0.0243 -0.0486 -0.0469 136 ASP B O   
2851 C  CB  . ASP B 136 ? 0.3718 0.5157 0.4028 -0.0827 -0.2126 -0.0356 136 ASP B CB  
2852 C  CG  . ASP B 136 ? 0.4351 0.3771 0.5104 0.0330  -0.2800 -0.1721 136 ASP B CG  
2853 O  OD1 . ASP B 136 ? 0.3802 0.5382 0.4403 -0.0413 -0.2317 -0.2226 136 ASP B OD1 
2854 O  OD2 . ASP B 136 ? 0.7835 0.4155 0.6961 0.1625  -0.2218 -0.2027 136 ASP B OD2 
2855 N  N   . LYS B 137 ? 0.3051 0.2920 0.1774 -0.0970 -0.0349 -0.0913 137 LYS B N   
2856 C  CA  . LYS B 137 ? 0.2571 0.2068 0.1377 -0.0689 0.0178  -0.0707 137 LYS B CA  
2857 C  C   . LYS B 137 ? 0.1666 0.1890 0.1179 -0.0299 0.0065  -0.0446 137 LYS B C   
2858 O  O   . LYS B 137 ? 0.1881 0.2217 0.1446 -0.0555 0.0264  -0.0390 137 LYS B O   
2859 C  CB  . LYS B 137 ? 0.4011 0.2393 0.1925 0.0069  0.0498  -0.0864 137 LYS B CB  
2860 C  CG  . LYS B 137 ? 0.4261 0.2632 0.2065 0.0695  -0.0315 -0.0849 137 LYS B CG  
2861 C  CD  . LYS B 137 ? 0.4679 0.2511 0.3226 0.0684  0.0693  -0.0443 137 LYS B CD  
2862 C  CE  . LYS B 137 ? 0.4437 0.3155 0.3634 0.1567  0.0722  -0.0121 137 LYS B CE  
2863 N  NZ  . LYS B 137 ? 0.6003 0.4365 0.6548 -0.1709 -0.1111 0.1961  137 LYS B NZ  
2864 N  N   . LEU B 138 ? 0.1404 0.1967 0.0928 -0.0150 0.0042  -0.0368 138 LEU B N   
2865 C  CA  . LEU B 138 ? 0.1302 0.1842 0.0800 -0.0071 -0.0141 -0.0329 138 LEU B CA  
2866 C  C   . LEU B 138 ? 0.1246 0.1818 0.0922 0.0043  -0.0052 -0.0350 138 LEU B C   
2867 O  O   . LEU B 138 ? 0.1541 0.2099 0.0922 0.0288  -0.0025 -0.0343 138 LEU B O   
2868 C  CB  . LEU B 138 ? 0.1238 0.1838 0.0936 -0.0069 0.0026  -0.0362 138 LEU B CB  
2869 C  CG  . LEU B 138 ? 0.1460 0.1910 0.0956 -0.0089 0.0027  -0.0260 138 LEU B CG  
2870 C  CD1 . LEU B 138 ? 0.1716 0.2078 0.1127 -0.0225 0.0014  -0.0152 138 LEU B CD1 
2871 C  CD2 . LEU B 138 ? 0.1489 0.1714 0.0933 0.0077  -0.0059 -0.0149 138 LEU B CD2 
2872 N  N   . ALA B 139 ? 0.1319 0.1588 0.0947 0.0160  -0.0027 -0.0314 139 ALA B N   
2873 C  CA  . ALA B 139 ? 0.1350 0.1552 0.0962 0.0107  0.0022  -0.0275 139 ALA B CA  
2874 C  C   . ALA B 139 ? 0.1095 0.1374 0.0872 0.0006  0.0038  -0.0173 139 ALA B C   
2875 O  O   . ALA B 139 ? 0.1119 0.1607 0.0956 0.0165  -0.0098 -0.0284 139 ALA B O   
2876 C  CB  . ALA B 139 ? 0.1760 0.1492 0.1339 -0.0252 0.0023  -0.0475 139 ALA B CB  
2877 N  N   . VAL B 140 ? 0.1014 0.1417 0.0865 0.0117  0.0033  -0.0170 140 VAL B N   
2878 C  CA  . VAL B 140 ? 0.1069 0.1280 0.0837 0.0104  0.0082  -0.0196 140 VAL B CA  
2879 C  C   . VAL B 140 ? 0.1186 0.1167 0.0970 0.0038  0.0212  -0.0159 140 VAL B C   
2880 O  O   . VAL B 140 ? 0.1302 0.1374 0.1225 0.0298  0.0344  0.0018  140 VAL B O   
2881 C  CB  . VAL B 140 ? 0.1020 0.1557 0.0943 -0.0010 0.0048  -0.0186 140 VAL B CB  
2882 C  CG1 . VAL B 140 ? 0.1173 0.1699 0.0995 0.0076  -0.0127 -0.0169 140 VAL B CG1 
2883 C  CG2 . VAL B 140 ? 0.1268 0.1720 0.1003 -0.0135 0.0110  -0.0173 140 VAL B CG2 
2884 N  N   . VAL B 141 ? 0.1043 0.1207 0.1082 0.0130  0.0237  -0.0109 141 VAL B N   
2885 C  CA  . VAL B 141 ? 0.1277 0.1177 0.1150 0.0115  0.0317  0.0022  141 VAL B CA  
2886 C  C   . VAL B 141 ? 0.1194 0.1197 0.1038 0.0277  0.0264  -0.0015 141 VAL B C   
2887 O  O   . VAL B 141 ? 0.1474 0.1221 0.0897 0.0162  0.0218  -0.0038 141 VAL B O   
2888 C  CB  . VAL B 141 ? 0.1347 0.1299 0.1400 -0.0024 0.0361  -0.0187 141 VAL B CB  
2889 C  CG1 . VAL B 141 ? 0.1467 0.1756 0.2124 -0.0171 0.0443  -0.0844 141 VAL B CG1 
2890 C  CG2 . VAL B 141 ? 0.1240 0.1451 0.1483 -0.0035 0.0191  -0.0265 141 VAL B CG2 
2891 N  N   . SER B 142 ? 0.1550 0.1272 0.1260 0.0378  0.0637  0.0173  142 SER B N   
2892 C  CA  . SER B 142 ? 0.0983 0.1458 0.1013 0.0129  0.0182  0.0038  142 SER B CA  
2893 C  C   . SER B 142 ? 0.0947 0.1208 0.0814 0.0103  0.0062  -0.0130 142 SER B C   
2894 O  O   . SER B 142 ? 0.1222 0.1315 0.1083 0.0062  0.0226  -0.0219 142 SER B O   
2895 C  CB  . SER B 142 ? 0.0911 0.1591 0.1529 0.0031  -0.0085 0.0357  142 SER B CB  
2896 O  OG  . SER B 142 ? 0.1197 0.1662 0.1677 0.0105  -0.0042 0.0401  142 SER B OG  
2897 N  N   . THR B 143 ? 0.0888 0.1130 0.0884 0.0081  0.0074  -0.0083 143 THR B N   
2898 C  CA  . THR B 143 ? 0.0876 0.1125 0.0779 0.0040  0.0006  -0.0129 143 THR B CA  
2899 C  C   . THR B 143 ? 0.0830 0.1065 0.0772 0.0138  -0.0074 -0.0073 143 THR B C   
2900 O  O   . THR B 143 ? 0.0972 0.1061 0.0811 0.0049  -0.0037 -0.0069 143 THR B O   
2901 C  CB  . THR B 143 ? 0.0908 0.1171 0.0774 -0.0020 -0.0064 -0.0012 143 THR B CB  
2902 O  OG1 . THR B 143 ? 0.0873 0.1231 0.0825 0.0031  -0.0071 -0.0018 143 THR B OG1 
2903 C  CG2 . THR B 143 ? 0.1102 0.1323 0.0893 0.0020  -0.0122 -0.0151 143 THR B CG2 
2904 N  N   . ALA B 144 ? 0.0846 0.1089 0.0767 0.0087  -0.0002 -0.0076 144 ALA B N   
2905 C  CA  . ALA B 144 ? 0.0788 0.1125 0.0725 0.0154  -0.0073 -0.0096 144 ALA B CA  
2906 C  C   . ALA B 144 ? 0.0744 0.1082 0.0723 0.0082  -0.0050 -0.0029 144 ALA B C   
2907 O  O   . ALA B 144 ? 0.0804 0.1173 0.0789 0.0143  -0.0149 -0.0094 144 ALA B O   
2908 C  CB  . ALA B 144 ? 0.1154 0.1155 0.0786 0.0248  -0.0024 0.0036  144 ALA B CB  
2909 N  N   . ASN B 145 ? 0.0655 0.1061 0.0803 0.0135  -0.0057 -0.0050 145 ASN B N   
2910 C  CA  . ASN B 145 ? 0.0693 0.1002 0.0764 0.0111  -0.0012 -0.0011 145 ASN B CA  
2911 C  C   . ASN B 145 ? 0.0749 0.0914 0.0730 0.0095  -0.0041 -0.0085 145 ASN B C   
2912 O  O   . ASN B 145 ? 0.0784 0.1075 0.0703 0.0032  -0.0088 0.0025  145 ASN B O   
2913 C  CB  . ASN B 145 ? 0.0700 0.1065 0.0781 0.0127  -0.0040 -0.0012 145 ASN B CB  
2914 C  CG  . ASN B 145 ? 0.0827 0.1083 0.0713 0.0098  0.0002  -0.0038 145 ASN B CG  
2915 O  OD1 . ASN B 145 ? 0.0833 0.1124 0.0737 0.0074  -0.0105 -0.0021 145 ASN B OD1 
2916 N  ND2 . ASN B 145 ? 0.1033 0.1087 0.0856 0.0043  -0.0105 0.0018  145 ASN B ND2 
2917 N  N   . GLN B 146 ? 0.0692 0.1019 0.0761 0.0076  -0.0079 0.0037  146 GLN B N   
2918 C  CA  . GLN B 146 ? 0.0749 0.1126 0.0783 0.0167  -0.0081 -0.0009 146 GLN B CA  
2919 C  C   . GLN B 146 ? 0.0775 0.1069 0.0755 0.0053  -0.0087 -0.0020 146 GLN B C   
2920 O  O   . GLN B 146 ? 0.0854 0.1187 0.0819 0.0176  -0.0199 -0.0018 146 GLN B O   
2921 C  CB  . GLN B 146 ? 0.0721 0.1059 0.0832 0.0130  -0.0084 -0.0005 146 GLN B CB  
2922 C  CG  . GLN B 146 ? 0.0710 0.1081 0.0905 0.0187  0.0015  0.0074  146 GLN B CG  
2923 C  CD  . GLN B 146 ? 0.0767 0.1004 0.0854 0.0164  -0.0021 -0.0015 146 GLN B CD  
2924 O  OE1 . GLN B 146 ? 0.0814 0.1133 0.0902 0.0133  0.0017  0.0048  146 GLN B OE1 
2925 N  NE2 . GLN B 146 ? 0.0863 0.1077 0.0961 0.0133  -0.0104 0.0042  146 GLN B NE2 
2926 N  N   . ASP B 147 ? 0.0791 0.1151 0.0749 0.0121  -0.0131 -0.0075 147 ASP B N   
2927 C  CA  . ASP B 147 ? 0.0803 0.1119 0.0733 0.0058  -0.0120 -0.0074 147 ASP B CA  
2928 C  C   . ASP B 147 ? 0.0773 0.1174 0.0814 0.0042  -0.0054 -0.0090 147 ASP B C   
2929 O  O   . ASP B 147 ? 0.0876 0.1349 0.0883 -0.0035 -0.0107 0.0001  147 ASP B O   
2930 C  CB  . ASP B 147 ? 0.0839 0.1124 0.0851 0.0049  -0.0090 -0.0151 147 ASP B CB  
2931 C  CG  . ASP B 147 ? 0.0886 0.1059 0.0960 0.0026  -0.0071 -0.0066 147 ASP B CG  
2932 O  OD1 . ASP B 147 ? 0.1007 0.1169 0.1074 -0.0003 0.0125  -0.0104 147 ASP B OD1 
2933 O  OD2 . ASP B 147 ? 0.0919 0.1258 0.1311 0.0057  -0.0040 0.0092  147 ASP B OD2 
2934 N  N   . SER B 148 ? 0.0781 0.1319 0.0753 0.0010  -0.0068 -0.0072 148 SER B N   
2935 C  CA  . SER B 148 ? 0.0901 0.1272 0.0746 0.0000  -0.0124 -0.0114 148 SER B CA  
2936 C  C   . SER B 148 ? 0.0897 0.1320 0.0752 0.0042  -0.0072 -0.0106 148 SER B C   
2937 O  O   . SER B 148 ? 0.0882 0.1261 0.0905 0.0016  -0.0041 -0.0169 148 SER B O   
2938 C  CB  . SER B 148 ? 0.0979 0.1218 0.0842 0.0089  -0.0029 -0.0015 148 SER B CB  
2939 O  OG  . SER B 148 ? 0.1193 0.1370 0.0778 0.0096  -0.0074 -0.0023 148 SER B OG  
2940 N  N   . PRO B 149 ? 0.0830 0.1419 0.0852 0.0011  -0.0030 -0.0132 149 PRO B N   
2941 C  CA  . PRO B 149 ? 0.0959 0.1380 0.0827 -0.0007 0.0025  -0.0137 149 PRO B CA  
2942 C  C   . PRO B 149 ? 0.0995 0.1443 0.0929 0.0062  0.0039  -0.0219 149 PRO B C   
2943 O  O   . PRO B 149 ? 0.1082 0.1525 0.0969 0.0073  -0.0040 -0.0343 149 PRO B O   
2944 C  CB  . PRO B 149 ? 0.0995 0.1810 0.0983 -0.0009 0.0088  -0.0354 149 PRO B CB  
2945 C  CG  A PRO B 149 ? 0.1106 0.1644 0.0812 -0.0048 -0.0135 0.0112  149 PRO B CG  
2946 C  CG  B PRO B 149 ? 0.1007 0.1702 0.1144 -0.0174 0.0219  -0.0378 149 PRO B CG  
2947 C  CD  . PRO B 149 ? 0.0963 0.1418 0.0831 -0.0032 -0.0006 -0.0109 149 PRO B CD  
2948 N  N   . LEU B 150 ? 0.0996 0.1345 0.0808 0.0015  -0.0102 -0.0159 150 LEU B N   
2949 C  CA  . LEU B 150 ? 0.1043 0.1478 0.0931 0.0066  -0.0112 -0.0162 150 LEU B CA  
2950 C  C   . LEU B 150 ? 0.0949 0.1515 0.0972 0.0081  -0.0117 -0.0120 150 LEU B C   
2951 O  O   . LEU B 150 ? 0.1202 0.1639 0.1126 -0.0110 -0.0315 -0.0149 150 LEU B O   
2952 C  CB  . LEU B 150 ? 0.1047 0.1515 0.0947 0.0115  -0.0247 -0.0131 150 LEU B CB  
2953 C  CG  . LEU B 150 ? 0.1254 0.1759 0.1094 0.0111  -0.0182 0.0018  150 LEU B CG  
2954 C  CD1 . LEU B 150 ? 0.2421 0.1596 0.1367 0.0042  -0.0112 0.0167  150 LEU B CD1 
2955 C  CD2 . LEU B 150 ? 0.1870 0.2196 0.0982 0.0079  -0.0274 0.0119  150 LEU B CD2 
2956 N  N   . MET B 151 ? 0.0941 0.1388 0.0904 0.0055  -0.0133 -0.0155 151 MET B N   
2957 C  CA  . MET B 151 ? 0.0931 0.1415 0.0977 -0.0015 -0.0141 -0.0204 151 MET B CA  
2958 C  C   . MET B 151 ? 0.1173 0.1396 0.0952 -0.0089 -0.0111 -0.0215 151 MET B C   
2959 O  O   . MET B 151 ? 0.1335 0.1538 0.1399 -0.0171 -0.0007 -0.0286 151 MET B O   
2960 C  CB  . MET B 151 ? 0.0960 0.1198 0.0990 0.0030  -0.0079 -0.0150 151 MET B CB  
2961 C  CG  . MET B 151 ? 0.0871 0.1223 0.0942 0.0035  -0.0182 -0.0125 151 MET B CG  
2962 S  SD  . MET B 151 ? 0.0897 0.1257 0.0936 0.0018  -0.0089 -0.0116 151 MET B SD  
2963 C  CE  . MET B 151 ? 0.0940 0.1439 0.1005 -0.0028 -0.0026 -0.0276 151 MET B CE  
2964 N  N   . GLY B 152 ? 0.1167 0.1317 0.1117 -0.0022 -0.0100 -0.0246 152 GLY B N   
2965 C  CA  . GLY B 152 ? 0.1436 0.1330 0.1083 -0.0018 -0.0052 -0.0315 152 GLY B CA  
2966 C  C   . GLY B 152 ? 0.1298 0.1380 0.1271 0.0019  -0.0146 -0.0374 152 GLY B C   
2967 O  O   . GLY B 152 ? 0.1226 0.1476 0.1148 0.0004  -0.0041 -0.0302 152 GLY B O   
2968 N  N   . GLU B 153 ? 0.1482 0.1442 0.1548 0.0095  -0.0060 -0.0461 153 GLU B N   
2969 C  CA  . GLU B 153 ? 0.1449 0.1620 0.1641 0.0177  -0.0204 -0.0372 153 GLU B CA  
2970 C  C   . GLU B 153 ? 0.1387 0.1400 0.1769 0.0206  -0.0084 -0.0368 153 GLU B C   
2971 O  O   . GLU B 153 ? 0.1525 0.1396 0.1752 0.0152  -0.0294 -0.0244 153 GLU B O   
2972 C  CB  . GLU B 153 ? 0.1709 0.2139 0.1737 0.0610  0.0058  -0.0230 153 GLU B CB  
2973 C  CG  . GLU B 153 ? 0.2492 0.1916 0.2506 -0.0070 0.0736  -0.0477 153 GLU B CG  
2974 C  CD  . GLU B 153 ? 0.1944 0.2532 0.2909 0.0502  0.0450  0.0167  153 GLU B CD  
2975 O  OE1 . GLU B 153 ? 0.2034 0.2065 0.3145 0.0247  0.0448  -0.0039 153 GLU B OE1 
2976 O  OE2 . GLU B 153 ? 0.2631 0.2973 0.3018 0.0891  0.0292  0.0159  153 GLU B OE2 
2977 N  N   . ALA B 154 ? 0.1482 0.1422 0.1795 0.0151  -0.0278 -0.0361 154 ALA B N   
2978 C  CA  . ALA B 154 ? 0.1527 0.1306 0.2086 0.0117  -0.0178 -0.0236 154 ALA B CA  
2979 C  C   . ALA B 154 ? 0.1560 0.1346 0.1761 -0.0030 -0.0063 -0.0036 154 ALA B C   
2980 O  O   . ALA B 154 ? 0.2244 0.1672 0.1877 0.0341  -0.0050 0.0221  154 ALA B O   
2981 C  CB  . ALA B 154 ? 0.1591 0.1545 0.2597 -0.0040 -0.0347 -0.0287 154 ALA B CB  
2982 N  N   . ILE B 155 ? 0.1293 0.1397 0.1627 -0.0022 -0.0171 -0.0175 155 ILE B N   
2983 C  CA  . ILE B 155 ? 0.1263 0.1407 0.1464 0.0008  0.0064  -0.0151 155 ILE B CA  
2984 C  C   . ILE B 155 ? 0.1182 0.1624 0.1290 0.0092  -0.0021 -0.0139 155 ILE B C   
2985 O  O   . ILE B 155 ? 0.1577 0.2095 0.1174 0.0003  -0.0095 0.0019  155 ILE B O   
2986 C  CB  . ILE B 155 ? 0.1104 0.1644 0.1248 -0.0037 0.0003  -0.0117 155 ILE B CB  
2987 C  CG1 . ILE B 155 ? 0.1119 0.1665 0.1687 -0.0110 0.0133  0.0111  155 ILE B CG1 
2988 C  CG2 . ILE B 155 ? 0.1455 0.1631 0.1364 0.0209  0.0040  -0.0223 155 ILE B CG2 
2989 C  CD1 . ILE B 155 ? 0.1078 0.2064 0.1625 -0.0052 -0.0034 0.0001  155 ILE B CD1 
2990 N  N   . SER B 156 ? 0.1147 0.1417 0.1207 0.0097  -0.0051 -0.0162 156 SER B N   
2991 C  CA  A SER B 156 ? 0.1098 0.1398 0.1145 0.0110  -0.0075 -0.0217 156 SER B CA  
2992 C  CA  B SER B 156 ? 0.1123 0.1595 0.0980 0.0067  0.0086  -0.0436 156 SER B CA  
2993 C  C   . SER B 156 ? 0.1154 0.1458 0.0983 0.0023  -0.0046 -0.0101 156 SER B C   
2994 O  O   . SER B 156 ? 0.1120 0.1523 0.1243 0.0035  -0.0042 -0.0230 156 SER B O   
2995 C  CB  A SER B 156 ? 0.1046 0.1486 0.1087 0.0077  0.0046  -0.0194 156 SER B CB  
2996 C  CB  B SER B 156 ? 0.1083 0.1231 0.1050 -0.0111 -0.0581 -0.0615 156 SER B CB  
2997 O  OG  A SER B 156 ? 0.1115 0.1433 0.1112 0.0124  0.0027  -0.0368 156 SER B OG  
2998 O  OG  B SER B 156 ? 0.1165 0.1658 0.1428 0.0085  0.0589  0.0077  156 SER B OG  
2999 N  N   . GLY B 157 ? 0.1159 0.1419 0.1209 0.0190  -0.0121 -0.0241 157 GLY B N   
3000 C  CA  . GLY B 157 ? 0.1331 0.1416 0.1351 0.0209  -0.0054 -0.0121 157 GLY B CA  
3001 C  C   . GLY B 157 ? 0.1202 0.1905 0.1280 0.0343  -0.0018 -0.0147 157 GLY B C   
3002 O  O   . GLY B 157 ? 0.1314 0.2807 0.2078 0.0559  0.0210  0.0004  157 GLY B O   
3003 N  N   . ALA B 158 ? 0.1262 0.1637 0.1176 0.0155  0.0071  -0.0188 158 ALA B N   
3004 C  CA  . ALA B 158 ? 0.1243 0.2081 0.1345 0.0100  0.0086  -0.0003 158 ALA B CA  
3005 C  C   . ALA B 158 ? 0.1255 0.1794 0.1132 0.0109  0.0025  -0.0199 158 ALA B C   
3006 O  O   . ALA B 158 ? 0.1294 0.1776 0.1310 0.0008  0.0170  -0.0191 158 ALA B O   
3007 C  CB  . ALA B 158 ? 0.2053 0.2670 0.1571 -0.0930 -0.0017 0.0031  158 ALA B CB  
3008 N  N   . SER B 159 ? 0.1272 0.1825 0.1223 0.0024  0.0112  -0.0214 159 SER B N   
3009 C  CA  . SER B 159 ? 0.1457 0.1492 0.1198 0.0098  0.0106  -0.0240 159 SER B CA  
3010 C  C   . SER B 159 ? 0.1644 0.1596 0.1154 0.0084  0.0017  -0.0326 159 SER B C   
3011 O  O   . SER B 159 ? 0.1667 0.1988 0.1546 -0.0043 0.0304  -0.0048 159 SER B O   
3012 C  CB  . SER B 159 ? 0.1780 0.1771 0.1298 0.0019  -0.0113 -0.0342 159 SER B CB  
3013 O  OG  . SER B 159 ? 0.2767 0.1799 0.1540 0.0252  0.0221  -0.0525 159 SER B OG  
3014 N  N   . GLY B 160 ? 0.1850 0.1751 0.1138 -0.0025 0.0105  -0.0116 160 GLY B N   
3015 C  CA  . GLY B 160 ? 0.2079 0.1621 0.1293 -0.0016 0.0214  -0.0139 160 GLY B CA  
3016 C  C   . GLY B 160 ? 0.1793 0.1585 0.1199 -0.0156 -0.0018 -0.0213 160 GLY B C   
3017 O  O   . GLY B 160 ? 0.2315 0.1708 0.1165 -0.0020 0.0204  -0.0225 160 GLY B O   
3018 N  N   . PHE B 161 ? 0.1591 0.1669 0.1170 -0.0192 -0.0002 -0.0224 161 PHE B N   
3019 C  CA  . PHE B 161 ? 0.1397 0.1660 0.1143 -0.0221 -0.0089 -0.0144 161 PHE B CA  
3020 C  C   . PHE B 161 ? 0.1145 0.1606 0.0968 -0.0032 -0.0127 -0.0038 161 PHE B C   
3021 O  O   . PHE B 161 ? 0.1237 0.1571 0.1038 0.0001  -0.0042 -0.0089 161 PHE B O   
3022 C  CB  . PHE B 161 ? 0.1360 0.2207 0.1147 -0.0095 -0.0273 -0.0234 161 PHE B CB  
3023 C  CG  . PHE B 161 ? 0.1713 0.2537 0.1211 0.0215  -0.0550 -0.0006 161 PHE B CG  
3024 C  CD1 . PHE B 161 ? 0.1975 0.3232 0.1253 0.0823  -0.0561 -0.0135 161 PHE B CD1 
3025 C  CD2 . PHE B 161 ? 0.2121 0.2451 0.1973 -0.0128 -0.0839 0.0186  161 PHE B CD2 
3026 C  CE1 . PHE B 161 ? 0.2749 0.3145 0.1307 0.0883  -0.0367 -0.0114 161 PHE B CE1 
3027 C  CE2 . PHE B 161 ? 0.3167 0.2469 0.1561 0.0068  -0.0245 -0.0033 161 PHE B CE2 
3028 C  CZ  . PHE B 161 ? 0.3238 0.3124 0.1854 0.0532  -0.0214 -0.0213 161 PHE B CZ  
3029 N  N   . PRO B 162 ? 0.1192 0.1461 0.1134 -0.0028 -0.0015 -0.0075 162 PRO B N   
3030 C  CA  . PRO B 162 ? 0.1145 0.1522 0.0953 0.0017  -0.0123 0.0012  162 PRO B CA  
3031 C  C   . PRO B 162 ? 0.1099 0.1313 0.1255 0.0118  -0.0085 -0.0081 162 PRO B C   
3032 O  O   . PRO B 162 ? 0.1194 0.1748 0.2072 0.0050  -0.0346 0.0427  162 PRO B O   
3033 C  CB  . PRO B 162 ? 0.1521 0.1833 0.1312 -0.0091 0.0234  -0.0317 162 PRO B CB  
3034 C  CG  . PRO B 162 ? 0.1959 0.3142 0.1507 -0.0918 0.0476  -0.0760 162 PRO B CG  
3035 C  CD  . PRO B 162 ? 0.1201 0.1835 0.1259 -0.0088 0.0090  -0.0079 162 PRO B CD  
3036 N  N   . ILE B 163 ? 0.1136 0.1326 0.0840 0.0077  -0.0143 -0.0011 163 ILE B N   
3037 C  CA  . ILE B 163 ? 0.1162 0.1389 0.0798 0.0110  -0.0216 -0.0032 163 ILE B CA  
3038 C  C   . ILE B 163 ? 0.1190 0.1410 0.0735 0.0093  -0.0223 0.0051  163 ILE B C   
3039 O  O   . ILE B 163 ? 0.1378 0.1348 0.0912 0.0181  -0.0210 0.0032  163 ILE B O   
3040 C  CB  . ILE B 163 ? 0.1258 0.1442 0.0740 0.0080  -0.0122 0.0004  163 ILE B CB  
3041 C  CG1 . ILE B 163 ? 0.1710 0.1549 0.0830 0.0107  -0.0097 -0.0098 163 ILE B CG1 
3042 C  CG2 . ILE B 163 ? 0.1454 0.1669 0.0874 -0.0055 -0.0192 0.0100  163 ILE B CG2 
3043 C  CD1 . ILE B 163 ? 0.2383 0.1665 0.1010 0.0245  -0.0507 -0.0359 163 ILE B CD1 
3044 N  N   . MET B 164 ? 0.1155 0.1256 0.0725 0.0165  -0.0174 0.0001  164 MET B N   
3045 C  CA  . MET B 164 ? 0.1023 0.1378 0.0752 0.0138  -0.0193 -0.0024 164 MET B CA  
3046 C  C   . MET B 164 ? 0.1012 0.1250 0.0750 0.0083  -0.0158 -0.0085 164 MET B C   
3047 O  O   . MET B 164 ? 0.1068 0.1275 0.0721 0.0018  -0.0123 -0.0038 164 MET B O   
3048 C  CB  . MET B 164 ? 0.1298 0.1224 0.0807 0.0075  -0.0159 0.0003  164 MET B CB  
3049 C  CG  . MET B 164 ? 0.1227 0.1335 0.0908 -0.0012 -0.0065 -0.0004 164 MET B CG  
3050 S  SD  . MET B 164 ? 0.1026 0.1409 0.0931 0.0099  -0.0090 -0.0007 164 MET B SD  
3051 C  CE  . MET B 164 ? 0.1117 0.1434 0.1085 0.0050  -0.0075 -0.0072 164 MET B CE  
3052 N  N   . GLY B 165 ? 0.1262 0.1254 0.0703 0.0270  -0.0180 -0.0018 165 GLY B N   
3053 C  CA  . GLY B 165 ? 0.1745 0.1109 0.0705 0.0114  -0.0284 0.0027  165 GLY B CA  
3054 C  C   . GLY B 165 ? 0.1065 0.1195 0.0686 0.0130  -0.0084 0.0043  165 GLY B C   
3055 O  O   . GLY B 165 ? 0.1276 0.1138 0.0823 0.0164  -0.0182 -0.0025 165 GLY B O   
3056 N  N   . LEU B 166 ? 0.0968 0.1094 0.0671 0.0103  -0.0068 0.0065  166 LEU B N   
3057 C  CA  . LEU B 166 ? 0.0935 0.1009 0.0718 0.0050  0.0008  0.0009  166 LEU B CA  
3058 C  C   . LEU B 166 ? 0.0828 0.1077 0.0647 0.0062  -0.0038 0.0012  166 LEU B C   
3059 O  O   . LEU B 166 ? 0.0971 0.1062 0.0709 0.0096  -0.0006 0.0023  166 LEU B O   
3060 C  CB  . LEU B 166 ? 0.0928 0.1160 0.0814 0.0081  0.0019  0.0051  166 LEU B CB  
3061 C  CG  . LEU B 166 ? 0.0876 0.1213 0.0805 0.0071  -0.0029 0.0086  166 LEU B CG  
3062 C  CD1 . LEU B 166 ? 0.0996 0.1168 0.0821 0.0045  0.0011  0.0053  166 LEU B CD1 
3063 C  CD2 . LEU B 166 ? 0.0902 0.1294 0.1162 0.0072  -0.0042 0.0069  166 LEU B CD2 
3064 N  N   . ASP B 167 ? 0.0855 0.1046 0.0652 0.0085  -0.0085 0.0054  167 ASP B N   
3065 C  CA  . ASP B 167 ? 0.0792 0.0913 0.0698 0.0117  -0.0060 0.0024  167 ASP B CA  
3066 C  C   . ASP B 167 ? 0.0777 0.1062 0.0721 0.0084  -0.0032 0.0021  167 ASP B C   
3067 O  O   . ASP B 167 ? 0.0895 0.1049 0.0929 0.0032  -0.0150 0.0085  167 ASP B O   
3068 C  CB  . ASP B 167 ? 0.0823 0.0980 0.0736 0.0125  -0.0013 0.0004  167 ASP B CB  
3069 C  CG  . ASP B 167 ? 0.0815 0.1038 0.0717 0.0014  -0.0067 0.0025  167 ASP B CG  
3070 O  OD1 . ASP B 167 ? 0.0874 0.1060 0.0792 0.0192  -0.0020 0.0083  167 ASP B OD1 
3071 O  OD2 . ASP B 167 ? 0.0940 0.0957 0.0828 0.0148  0.0028  0.0017  167 ASP B OD2 
3072 N  N   . VAL B 168 ? 0.0775 0.0991 0.0638 0.0064  -0.0046 0.0022  168 VAL B N   
3073 C  CA  . VAL B 168 ? 0.0721 0.0991 0.0728 0.0029  -0.0028 0.0083  168 VAL B CA  
3074 C  C   . VAL B 168 ? 0.0821 0.0993 0.0685 0.0149  -0.0012 0.0031  168 VAL B C   
3075 O  O   . VAL B 168 ? 0.0792 0.1161 0.0746 0.0162  -0.0013 0.0064  168 VAL B O   
3076 C  CB  . VAL B 168 ? 0.0842 0.1176 0.0677 0.0190  0.0041  0.0014  168 VAL B CB  
3077 C  CG1 . VAL B 168 ? 0.0869 0.1352 0.0793 0.0185  0.0047  0.0048  168 VAL B CG1 
3078 C  CG2 . VAL B 168 ? 0.0950 0.1135 0.0994 0.0233  0.0053  -0.0002 168 VAL B CG2 
3079 N  N   . TRP B 169 ? 0.0724 0.1070 0.0639 0.0078  -0.0094 0.0000  169 TRP B N   
3080 C  CA  . TRP B 169 ? 0.0809 0.0974 0.0574 0.0064  -0.0066 -0.0027 169 TRP B CA  
3081 C  C   . TRP B 169 ? 0.0760 0.0926 0.0667 0.0158  -0.0030 -0.0002 169 TRP B C   
3082 O  O   . TRP B 169 ? 0.0861 0.0956 0.0687 0.0097  -0.0038 0.0042  169 TRP B O   
3083 C  CB  . TRP B 169 ? 0.0789 0.0945 0.0678 0.0109  -0.0049 0.0024  169 TRP B CB  
3084 C  CG  . TRP B 169 ? 0.0747 0.1031 0.0757 0.0074  -0.0040 0.0008  169 TRP B CG  
3085 C  CD1 . TRP B 169 ? 0.0730 0.1012 0.0724 0.0105  -0.0025 -0.0025 169 TRP B CD1 
3086 C  CD2 . TRP B 169 ? 0.0763 0.0973 0.0702 0.0146  -0.0025 -0.0014 169 TRP B CD2 
3087 N  NE1 . TRP B 169 ? 0.0728 0.1018 0.0765 0.0112  -0.0018 -0.0051 169 TRP B NE1 
3088 C  CE2 . TRP B 169 ? 0.0752 0.0999 0.0704 0.0186  -0.0019 -0.0037 169 TRP B CE2 
3089 C  CE3 . TRP B 169 ? 0.0773 0.1092 0.0673 0.0144  -0.0084 -0.0084 169 TRP B CE3 
3090 C  CZ2 . TRP B 169 ? 0.0717 0.0991 0.0751 0.0088  -0.0095 -0.0021 169 TRP B CZ2 
3091 C  CZ3 . TRP B 169 ? 0.0808 0.1180 0.0677 0.0128  -0.0005 0.0048  169 TRP B CZ3 
3092 C  CH2 . TRP B 169 ? 0.0820 0.1127 0.0654 0.0143  -0.0048 0.0038  169 TRP B CH2 
3093 N  N   . GLU B 170 ? 0.0766 0.0934 0.0667 0.0072  -0.0066 0.0060  170 GLU B N   
3094 C  CA  . GLU B 170 ? 0.0757 0.1008 0.0644 0.0074  -0.0047 -0.0004 170 GLU B CA  
3095 C  C   . GLU B 170 ? 0.0942 0.0947 0.0732 0.0038  0.0007  0.0021  170 GLU B C   
3096 O  O   . GLU B 170 ? 0.0952 0.0934 0.0874 0.0019  -0.0061 0.0010  170 GLU B O   
3097 C  CB  . GLU B 170 ? 0.0773 0.1008 0.0666 0.0104  0.0028  0.0034  170 GLU B CB  
3098 C  CG  . GLU B 170 ? 0.0855 0.1080 0.0619 0.0148  -0.0029 0.0024  170 GLU B CG  
3099 C  CD  . GLU B 170 ? 0.0818 0.0969 0.0647 0.0085  -0.0079 0.0001  170 GLU B CD  
3100 O  OE1 . GLU B 170 ? 0.0804 0.1028 0.0644 0.0028  -0.0030 -0.0021 170 GLU B OE1 
3101 O  OE2 . GLU B 170 ? 0.0778 0.1381 0.0749 0.0128  -0.0059 0.0077  170 GLU B OE2 
3102 N  N   . HIS B 171 ? 0.0854 0.0954 0.0728 0.0126  -0.0025 0.0068  171 HIS B N   
3103 C  CA  . HIS B 171 ? 0.0944 0.0961 0.0789 0.0148  0.0034  -0.0046 171 HIS B CA  
3104 C  C   . HIS B 171 ? 0.0920 0.0967 0.0791 0.0126  -0.0073 -0.0003 171 HIS B C   
3105 O  O   . HIS B 171 ? 0.1158 0.1009 0.0886 0.0185  0.0041  0.0055  171 HIS B O   
3106 C  CB  . HIS B 171 ? 0.0948 0.1083 0.0763 0.0191  -0.0029 -0.0057 171 HIS B CB  
3107 C  CG  . HIS B 171 ? 0.0904 0.1064 0.0749 0.0186  -0.0012 0.0042  171 HIS B CG  
3108 N  ND1 . HIS B 171 ? 0.1016 0.0951 0.0785 0.0200  -0.0060 0.0040  171 HIS B ND1 
3109 C  CD2 . HIS B 171 ? 0.0929 0.1049 0.0777 0.0111  0.0003  0.0052  171 HIS B CD2 
3110 C  CE1 . HIS B 171 ? 0.0946 0.1011 0.0782 0.0166  -0.0018 0.0035  171 HIS B CE1 
3111 N  NE2 . HIS B 171 ? 0.0838 0.1039 0.0855 0.0138  -0.0095 0.0083  171 HIS B NE2 
3112 N  N   . ALA B 172 ? 0.0904 0.0982 0.0771 0.0087  0.0036  0.0033  172 ALA B N   
3113 C  CA  . ALA B 172 ? 0.0945 0.0986 0.0797 0.0103  -0.0057 0.0091  172 ALA B CA  
3114 C  C   . ALA B 172 ? 0.0905 0.1010 0.0865 0.0136  -0.0007 -0.0005 172 ALA B C   
3115 O  O   . ALA B 172 ? 0.1133 0.1137 0.0970 0.0031  0.0049  0.0149  172 ALA B O   
3116 C  CB  . ALA B 172 ? 0.1035 0.1172 0.0798 0.0019  -0.0069 0.0006  172 ALA B CB  
3117 N  N   . TYR B 173 ? 0.0843 0.1076 0.0919 0.0032  0.0032  0.0008  173 TYR B N   
3118 C  CA  . TYR B 173 ? 0.0888 0.1198 0.0899 0.0042  -0.0005 -0.0092 173 TYR B CA  
3119 C  C   . TYR B 173 ? 0.0956 0.1151 0.0911 -0.0001 0.0007  -0.0042 173 TYR B C   
3120 O  O   . TYR B 173 ? 0.0973 0.1403 0.0894 -0.0034 0.0023  -0.0030 173 TYR B O   
3121 C  CB  . TYR B 173 ? 0.0899 0.1257 0.0827 0.0050  0.0065  0.0001  173 TYR B CB  
3122 C  CG  . TYR B 173 ? 0.0924 0.1226 0.0816 0.0130  0.0033  -0.0057 173 TYR B CG  
3123 C  CD1 . TYR B 173 ? 0.1077 0.1149 0.1052 0.0102  -0.0190 -0.0143 173 TYR B CD1 
3124 C  CD2 . TYR B 173 ? 0.0838 0.1239 0.0835 0.0060  0.0011  0.0006  173 TYR B CD2 
3125 C  CE1 . TYR B 173 ? 0.1066 0.1374 0.1063 0.0106  -0.0253 0.0005  173 TYR B CE1 
3126 C  CE2 . TYR B 173 ? 0.0813 0.1279 0.0814 0.0066  0.0065  -0.0064 173 TYR B CE2 
3127 C  CZ  . TYR B 173 ? 0.0940 0.1147 0.0859 0.0109  0.0042  0.0004  173 TYR B CZ  
3128 O  OH  . TYR B 173 ? 0.1105 0.1246 0.0865 0.0130  0.0057  0.0000  173 TYR B OH  
3129 N  N   . PHE B 174 ? 0.0964 0.1680 0.0927 -0.0104 0.0112  -0.0273 174 PHE B N   
3130 C  CA  . PHE B 174 ? 0.1109 0.1676 0.0930 -0.0043 0.0153  -0.0026 174 PHE B CA  
3131 C  C   . PHE B 174 ? 0.1125 0.1763 0.0815 -0.0055 0.0039  -0.0164 174 PHE B C   
3132 O  O   . PHE B 174 ? 0.1150 0.1801 0.1028 0.0046  0.0004  -0.0242 174 PHE B O   
3133 C  CB  . PHE B 174 ? 0.1326 0.2022 0.1188 -0.0149 0.0446  -0.0084 174 PHE B CB  
3134 C  CG  . PHE B 174 ? 0.1589 0.1735 0.1099 -0.0157 0.0436  -0.0039 174 PHE B CG  
3135 C  CD1 . PHE B 174 ? 0.1604 0.1352 0.1647 -0.0320 0.0448  -0.0044 174 PHE B CD1 
3136 C  CD2 . PHE B 174 ? 0.4223 0.2073 0.0923 0.1104  0.0559  -0.0068 174 PHE B CD2 
3137 C  CE1 . PHE B 174 ? 0.1958 0.1452 0.2125 -0.0238 0.0133  0.0582  174 PHE B CE1 
3138 C  CE2 . PHE B 174 ? 0.4430 0.1892 0.1140 0.0362  0.0240  -0.0225 174 PHE B CE2 
3139 C  CZ  . PHE B 174 ? 0.3096 0.2191 0.1301 -0.0416 -0.0002 0.0467  174 PHE B CZ  
3140 N  N   . LEU B 175 ? 0.1094 0.1762 0.1012 0.0109  -0.0042 -0.0201 175 LEU B N   
3141 C  CA  . LEU B 175 ? 0.1344 0.1839 0.0958 0.0145  -0.0132 -0.0232 175 LEU B CA  
3142 C  C   . LEU B 175 ? 0.1354 0.1692 0.1234 0.0042  -0.0091 -0.0489 175 LEU B C   
3143 O  O   . LEU B 175 ? 0.1582 0.1915 0.1285 0.0064  -0.0351 -0.0375 175 LEU B O   
3144 C  CB  . LEU B 175 ? 0.1552 0.1850 0.1239 0.0369  -0.0037 -0.0309 175 LEU B CB  
3145 C  CG  . LEU B 175 ? 0.1600 0.1948 0.1181 0.0244  0.0087  -0.0198 175 LEU B CG  
3146 C  CD1 . LEU B 175 ? 0.2121 0.2193 0.1617 0.0835  0.0325  -0.0172 175 LEU B CD1 
3147 C  CD2 . LEU B 175 ? 0.2738 0.3936 0.1155 0.1448  0.0266  -0.0326 175 LEU B CD2 
3148 N  N   . LYS B 176 ? 0.1357 0.1627 0.1112 -0.0140 -0.0144 -0.0158 176 LYS B N   
3149 C  CA  . LYS B 176 ? 0.1186 0.1578 0.1441 -0.0130 -0.0083 -0.0207 176 LYS B CA  
3150 C  C   . LYS B 176 ? 0.1178 0.1585 0.1355 -0.0241 -0.0105 -0.0149 176 LYS B C   
3151 O  O   . LYS B 176 ? 0.1278 0.1761 0.2056 -0.0177 -0.0424 -0.0373 176 LYS B O   
3152 C  CB  . LYS B 176 ? 0.1265 0.1545 0.1478 -0.0002 0.0090  -0.0115 176 LYS B CB  
3153 C  CG  . LYS B 176 ? 0.1325 0.1587 0.1710 -0.0139 0.0108  -0.0081 176 LYS B CG  
3154 C  CD  . LYS B 176 ? 0.1212 0.1562 0.1575 -0.0184 0.0068  -0.0209 176 LYS B CD  
3155 C  CE  . LYS B 176 ? 0.1372 0.1857 0.1489 -0.0111 0.0224  -0.0229 176 LYS B CE  
3156 N  NZ  . LYS B 176 ? 0.1655 0.1781 0.1439 -0.0203 0.0079  -0.0195 176 LYS B NZ  
3157 N  N   . PHE B 177 ? 0.1028 0.1614 0.1185 -0.0113 -0.0030 -0.0247 177 PHE B N   
3158 C  CA  . PHE B 177 ? 0.0864 0.1724 0.1341 -0.0106 0.0028  -0.0113 177 PHE B CA  
3159 C  C   . PHE B 177 ? 0.0897 0.1694 0.1354 -0.0132 0.0050  -0.0241 177 PHE B C   
3160 O  O   . PHE B 177 ? 0.0909 0.2040 0.1307 0.0044  0.0025  0.0044  177 PHE B O   
3161 C  CB  . PHE B 177 ? 0.1052 0.1430 0.1328 -0.0130 0.0119  -0.0084 177 PHE B CB  
3162 C  CG  . PHE B 177 ? 0.1081 0.1379 0.1248 -0.0192 0.0137  -0.0137 177 PHE B CG  
3163 C  CD1 . PHE B 177 ? 0.1185 0.1361 0.1149 -0.0167 0.0056  -0.0174 177 PHE B CD1 
3164 C  CD2 . PHE B 177 ? 0.1191 0.1431 0.1301 -0.0120 0.0264  -0.0215 177 PHE B CD2 
3165 C  CE1 . PHE B 177 ? 0.1425 0.1420 0.1107 -0.0197 0.0002  -0.0143 177 PHE B CE1 
3166 C  CE2 . PHE B 177 ? 0.1422 0.1428 0.1301 -0.0269 0.0241  -0.0272 177 PHE B CE2 
3167 C  CZ  . PHE B 177 ? 0.1564 0.1296 0.1203 -0.0164 0.0177  -0.0202 177 PHE B CZ  
3168 N  N   . GLN B 178 ? 0.1074 0.2056 0.1211 0.0066  0.0069  -0.0164 178 GLN B N   
3169 C  CA  . GLN B 178 ? 0.1067 0.2148 0.1070 0.0023  -0.0060 -0.0217 178 GLN B CA  
3170 C  C   . GLN B 178 ? 0.0877 0.2087 0.1011 0.0053  0.0136  -0.0005 178 GLN B C   
3171 O  O   . GLN B 178 ? 0.0973 0.1869 0.1554 -0.0017 -0.0209 0.0011  178 GLN B O   
3172 C  CB  . GLN B 178 ? 0.1327 0.2777 0.1334 -0.0180 -0.0133 -0.0197 178 GLN B CB  
3173 C  CG  . GLN B 178 ? 0.2694 0.4354 0.2283 0.0086  -0.0256 -0.1810 178 GLN B CG  
3174 C  CD  . GLN B 178 ? 0.2921 0.5634 0.2893 -0.1314 -0.0465 -0.1645 178 GLN B CD  
3175 O  OE1 . GLN B 178 ? 0.5012 1.0635 0.2099 0.1165  -0.1282 -0.2736 178 GLN B OE1 
3176 N  NE2 . GLN B 178 ? 0.3306 0.8172 0.2988 -0.0245 -0.1325 -0.2115 178 GLN B NE2 
3177 N  N   . ASN B 179 ? 0.1156 0.2056 0.0881 0.0046  -0.0018 0.0025  179 ASN B N   
3178 C  CA  . ASN B 179 ? 0.1132 0.1955 0.0954 -0.0100 -0.0068 0.0190  179 ASN B CA  
3179 C  C   . ASN B 179 ? 0.1238 0.1885 0.0855 0.0072  -0.0153 -0.0007 179 ASN B C   
3180 O  O   . ASN B 179 ? 0.1638 0.1874 0.0973 -0.0064 0.0013  0.0133  179 ASN B O   
3181 C  CB  A ASN B 179 ? 0.1586 0.1528 0.0925 -0.0101 -0.0174 -0.0113 179 ASN B CB  
3182 C  CB  B ASN B 179 ? 0.1171 0.1946 0.0937 -0.0077 0.0049  0.0050  179 ASN B CB  
3183 C  CG  A ASN B 179 ? 0.0992 0.1587 0.0847 -0.0242 0.0171  -0.0224 179 ASN B CG  
3184 C  CG  B ASN B 179 ? 0.1268 0.1234 0.0616 -0.0334 -0.0191 0.0074  179 ASN B CG  
3185 O  OD1 A ASN B 179 ? 0.1478 0.1355 0.0864 -0.0170 0.0085  -0.0083 179 ASN B OD1 
3186 O  OD1 B ASN B 179 ? 0.2059 0.1981 0.3728 -0.0051 -0.1028 0.1017  179 ASN B OD1 
3187 N  ND2 A ASN B 179 ? 0.1940 0.1696 0.0824 0.0553  0.0415  0.0110  179 ASN B ND2 
3188 N  ND2 B ASN B 179 ? 0.2273 0.1643 0.2584 -0.0149 -0.0018 -0.0683 179 ASN B ND2 
3189 N  N   . ARG B 180 ? 0.0903 0.2012 0.0810 0.0015  -0.0033 0.0002  180 ARG B N   
3190 C  CA  . ARG B 180 ? 0.0944 0.1935 0.0866 0.0053  -0.0043 -0.0158 180 ARG B CA  
3191 C  C   . ARG B 180 ? 0.0883 0.1607 0.0837 0.0021  -0.0027 -0.0094 180 ARG B C   
3192 O  O   . ARG B 180 ? 0.1016 0.1622 0.0844 -0.0148 -0.0004 -0.0059 180 ARG B O   
3193 C  CB  . ARG B 180 ? 0.1005 0.2260 0.0893 -0.0164 -0.0008 -0.0185 180 ARG B CB  
3194 C  CG  . ARG B 180 ? 0.1132 0.3024 0.1184 -0.0178 -0.0083 -0.0512 180 ARG B CG  
3195 C  CD  . ARG B 180 ? 0.1101 0.3479 0.1589 -0.0611 -0.0117 -0.0451 180 ARG B CD  
3196 N  NE  . ARG B 180 ? 0.1644 0.3052 0.4687 -0.0731 -0.1196 -0.0676 180 ARG B NE  
3197 C  CZ  . ARG B 180 ? 0.1841 0.2902 0.3812 -0.0402 -0.0437 -0.1082 180 ARG B CZ  
3198 N  NH1 . ARG B 180 ? 0.3607 0.5080 0.3270 0.0174  -0.1436 -0.2019 180 ARG B NH1 
3199 N  NH2 . ARG B 180 ? 0.2266 0.2765 0.4653 -0.0420 -0.0430 -0.1497 180 ARG B NH2 
3200 N  N   . ARG B 181 ? 0.0971 0.1468 0.0819 0.0034  -0.0036 0.0035  181 ARG B N   
3201 C  CA  . ARG B 181 ? 0.0853 0.1415 0.0778 0.0038  -0.0051 0.0040  181 ARG B CA  
3202 C  C   . ARG B 181 ? 0.0762 0.1397 0.0854 0.0016  -0.0035 0.0043  181 ARG B C   
3203 O  O   . ARG B 181 ? 0.0848 0.1268 0.0856 0.0004  0.0039  0.0044  181 ARG B O   
3204 C  CB  . ARG B 181 ? 0.0877 0.1207 0.0935 0.0114  0.0037  0.0066  181 ARG B CB  
3205 C  CG  . ARG B 181 ? 0.0833 0.1270 0.0785 0.0094  0.0027  0.0123  181 ARG B CG  
3206 C  CD  . ARG B 181 ? 0.0878 0.1282 0.0744 0.0122  0.0085  0.0093  181 ARG B CD  
3207 N  NE  . ARG B 181 ? 0.0924 0.1226 0.0758 0.0093  0.0076  0.0035  181 ARG B NE  
3208 C  CZ  . ARG B 181 ? 0.0947 0.1127 0.0757 0.0125  0.0046  0.0040  181 ARG B CZ  
3209 N  NH1 . ARG B 181 ? 0.1243 0.1191 0.0755 0.0128  0.0115  0.0013  181 ARG B NH1 
3210 N  NH2 . ARG B 181 ? 0.1110 0.1290 0.0693 0.0091  0.0057  0.0088  181 ARG B NH2 
3211 N  N   . PRO B 182 ? 0.0858 0.1527 0.0792 0.0121  0.0007  0.0056  182 PRO B N   
3212 C  CA  . PRO B 182 ? 0.0866 0.1480 0.0900 0.0078  0.0083  0.0080  182 PRO B CA  
3213 C  C   . PRO B 182 ? 0.0787 0.1485 0.0880 0.0039  0.0023  0.0036  182 PRO B C   
3214 O  O   . PRO B 182 ? 0.0906 0.1411 0.0827 0.0002  -0.0020 0.0026  182 PRO B O   
3215 C  CB  . PRO B 182 ? 0.0931 0.1669 0.0994 0.0156  0.0076  0.0151  182 PRO B CB  
3216 C  CG  . PRO B 182 ? 0.1009 0.1790 0.1077 0.0306  0.0091  0.0290  182 PRO B CG  
3217 C  CD  . PRO B 182 ? 0.0904 0.1808 0.0999 0.0274  0.0058  0.0192  182 PRO B CD  
3218 N  N   . ASP B 183 ? 0.0852 0.1565 0.0858 -0.0082 0.0008  -0.0036 183 ASP B N   
3219 C  CA  . ASP B 183 ? 0.0916 0.1551 0.0946 -0.0085 0.0080  -0.0086 183 ASP B CA  
3220 C  C   . ASP B 183 ? 0.0903 0.1370 0.0934 -0.0087 0.0085  -0.0122 183 ASP B C   
3221 O  O   . ASP B 183 ? 0.0989 0.1416 0.0939 -0.0160 0.0098  -0.0018 183 ASP B O   
3222 C  CB  . ASP B 183 ? 0.1094 0.1607 0.1204 -0.0177 -0.0053 -0.0186 183 ASP B CB  
3223 C  CG  . ASP B 183 ? 0.1197 0.2569 0.1722 -0.0479 -0.0271 -0.0411 183 ASP B CG  
3224 O  OD1 . ASP B 183 ? 0.1097 0.3457 0.2768 0.0008  -0.0224 -0.1364 183 ASP B OD1 
3225 O  OD2 . ASP B 183 ? 0.1575 0.6096 0.1502 -0.1534 -0.0351 -0.0007 183 ASP B OD2 
3226 N  N   . TYR B 184 ? 0.0855 0.1370 0.0895 -0.0078 0.0059  -0.0081 184 TYR B N   
3227 C  CA  . TYR B 184 ? 0.0862 0.1250 0.0814 -0.0012 0.0033  -0.0077 184 TYR B CA  
3228 C  C   . TYR B 184 ? 0.0901 0.1078 0.0778 -0.0054 0.0039  0.0029  184 TYR B C   
3229 O  O   . TYR B 184 ? 0.1026 0.1139 0.0854 0.0021  0.0011  -0.0005 184 TYR B O   
3230 C  CB  . TYR B 184 ? 0.0947 0.1246 0.0841 0.0002  0.0077  -0.0023 184 TYR B CB  
3231 C  CG  . TYR B 184 ? 0.0924 0.1197 0.0717 -0.0020 0.0047  -0.0004 184 TYR B CG  
3232 C  CD1 . TYR B 184 ? 0.1010 0.1122 0.0844 -0.0005 0.0107  -0.0023 184 TYR B CD1 
3233 C  CD2 . TYR B 184 ? 0.0976 0.1077 0.0845 0.0044  0.0047  0.0054  184 TYR B CD2 
3234 C  CE1 . TYR B 184 ? 0.0982 0.1119 0.0795 0.0049  0.0001  -0.0022 184 TYR B CE1 
3235 C  CE2 . TYR B 184 ? 0.0909 0.1149 0.0821 -0.0002 0.0010  0.0034  184 TYR B CE2 
3236 C  CZ  . TYR B 184 ? 0.0928 0.1096 0.0870 0.0044  0.0130  -0.0016 184 TYR B CZ  
3237 O  OH  . TYR B 184 ? 0.0906 0.1209 0.0872 0.0061  -0.0047 0.0085  184 TYR B OH  
3238 N  N   . ILE B 185 ? 0.0826 0.1224 0.0730 0.0030  -0.0022 -0.0020 185 ILE B N   
3239 C  CA  . ILE B 185 ? 0.0793 0.1214 0.0782 0.0015  0.0048  -0.0041 185 ILE B CA  
3240 C  C   . ILE B 185 ? 0.0801 0.1183 0.0844 0.0023  -0.0006 -0.0017 185 ILE B C   
3241 O  O   . ILE B 185 ? 0.0954 0.1321 0.0766 -0.0042 -0.0016 0.0006  185 ILE B O   
3242 C  CB  . ILE B 185 ? 0.0872 0.1221 0.0851 0.0037  0.0042  -0.0040 185 ILE B CB  
3243 C  CG1 . ILE B 185 ? 0.0855 0.1175 0.0908 -0.0001 0.0032  -0.0047 185 ILE B CG1 
3244 C  CG2 . ILE B 185 ? 0.1356 0.1255 0.0972 0.0029  0.0263  -0.0077 185 ILE B CG2 
3245 C  CD1 . ILE B 185 ? 0.0872 0.1317 0.0991 0.0025  -0.0052 0.0031  185 ILE B CD1 
3246 N  N   . LYS B 186 ? 0.0886 0.1271 0.0715 -0.0044 0.0015  -0.0010 186 LYS B N   
3247 C  CA  . LYS B 186 ? 0.0877 0.1360 0.0809 -0.0059 0.0112  0.0089  186 LYS B CA  
3248 C  C   . LYS B 186 ? 0.0935 0.1175 0.0846 -0.0111 0.0027  0.0026  186 LYS B C   
3249 O  O   . LYS B 186 ? 0.1005 0.1375 0.0842 -0.0019 0.0075  0.0094  186 LYS B O   
3250 C  CB  . LYS B 186 ? 0.0877 0.1343 0.1047 -0.0083 0.0028  0.0173  186 LYS B CB  
3251 C  CG  . LYS B 186 ? 0.0855 0.1386 0.1061 -0.0027 0.0016  0.0036  186 LYS B CG  
3252 C  CD  . LYS B 186 ? 0.0914 0.1497 0.1216 -0.0001 -0.0125 -0.0003 186 LYS B CD  
3253 C  CE  . LYS B 186 ? 0.0918 0.1607 0.1364 0.0122  -0.0049 -0.0028 186 LYS B CE  
3254 N  NZ  . LYS B 186 ? 0.0985 0.1925 0.1458 0.0167  -0.0243 -0.0213 186 LYS B NZ  
3255 N  N   . GLU B 187 ? 0.0977 0.1189 0.0787 -0.0037 -0.0008 0.0032  187 GLU B N   
3256 C  CA  . GLU B 187 ? 0.1064 0.1122 0.0877 -0.0098 -0.0008 0.0019  187 GLU B CA  
3257 C  C   . GLU B 187 ? 0.1064 0.1144 0.0834 -0.0005 0.0018  -0.0039 187 GLU B C   
3258 O  O   . GLU B 187 ? 0.1166 0.1155 0.0834 0.0013  -0.0088 0.0026  187 GLU B O   
3259 C  CB  . GLU B 187 ? 0.1251 0.1148 0.0872 -0.0134 0.0107  -0.0084 187 GLU B CB  
3260 C  CG  . GLU B 187 ? 0.1389 0.1391 0.0925 -0.0114 0.0062  -0.0090 187 GLU B CG  
3261 C  CD  . GLU B 187 ? 0.1330 0.1351 0.1141 -0.0284 0.0002  -0.0114 187 GLU B CD  
3262 O  OE1 . GLU B 187 ? 0.1435 0.1783 0.1612 -0.0399 -0.0046 -0.0283 187 GLU B OE1 
3263 O  OE2 . GLU B 187 ? 0.1630 0.1411 0.1069 -0.0355 0.0120  -0.0031 187 GLU B OE2 
3264 N  N   . PHE B 188 ? 0.1038 0.1137 0.0791 -0.0004 -0.0038 0.0108  188 PHE B N   
3265 C  CA  . PHE B 188 ? 0.0997 0.1221 0.0861 0.0000  -0.0068 0.0047  188 PHE B CA  
3266 C  C   . PHE B 188 ? 0.1016 0.1054 0.0808 -0.0025 -0.0046 0.0043  188 PHE B C   
3267 O  O   . PHE B 188 ? 0.1056 0.1155 0.0881 0.0071  -0.0075 0.0111  188 PHE B O   
3268 C  CB  . PHE B 188 ? 0.0974 0.1168 0.0946 0.0030  -0.0051 0.0178  188 PHE B CB  
3269 C  CG  . PHE B 188 ? 0.0963 0.1199 0.0873 0.0023  -0.0041 0.0176  188 PHE B CG  
3270 C  CD1 . PHE B 188 ? 0.1010 0.1244 0.0888 -0.0004 -0.0065 0.0024  188 PHE B CD1 
3271 C  CD2 . PHE B 188 ? 0.1167 0.1147 0.0995 0.0099  -0.0081 0.0136  188 PHE B CD2 
3272 C  CE1 . PHE B 188 ? 0.1013 0.1328 0.0756 -0.0018 -0.0165 0.0103  188 PHE B CE1 
3273 C  CE2 . PHE B 188 ? 0.1297 0.1163 0.1052 -0.0021 -0.0082 0.0049  188 PHE B CE2 
3274 C  CZ  . PHE B 188 ? 0.1239 0.1232 0.0915 -0.0097 -0.0156 0.0116  188 PHE B CZ  
3275 N  N   . TRP B 189 ? 0.1074 0.1158 0.0729 0.0038  -0.0109 0.0037  189 TRP B N   
3276 C  CA  . TRP B 189 ? 0.1014 0.1161 0.0755 0.0001  0.0020  0.0008  189 TRP B CA  
3277 C  C   . TRP B 189 ? 0.1153 0.1177 0.0793 -0.0016 -0.0037 -0.0012 189 TRP B C   
3278 O  O   . TRP B 189 ? 0.1304 0.1211 0.0865 0.0051  -0.0031 0.0051  189 TRP B O   
3279 C  CB  . TRP B 189 ? 0.1088 0.1281 0.0865 -0.0019 -0.0019 0.0113  189 TRP B CB  
3280 C  CG  . TRP B 189 ? 0.0996 0.1229 0.0802 0.0045  -0.0001 -0.0029 189 TRP B CG  
3281 C  CD1 . TRP B 189 ? 0.0887 0.1270 0.0970 0.0007  -0.0035 -0.0007 189 TRP B CD1 
3282 C  CD2 . TRP B 189 ? 0.0938 0.1121 0.0863 0.0061  0.0017  0.0046  189 TRP B CD2 
3283 N  NE1 . TRP B 189 ? 0.0968 0.1245 0.0962 0.0078  -0.0070 0.0025  189 TRP B NE1 
3284 C  CE2 . TRP B 189 ? 0.0926 0.1209 0.0883 0.0032  -0.0070 0.0081  189 TRP B CE2 
3285 C  CE3 . TRP B 189 ? 0.1028 0.1200 0.0773 0.0057  -0.0062 0.0016  189 TRP B CE3 
3286 C  CZ2 . TRP B 189 ? 0.1020 0.1074 0.0920 0.0062  -0.0046 0.0005  189 TRP B CZ2 
3287 C  CZ3 . TRP B 189 ? 0.1050 0.1251 0.0887 0.0088  -0.0080 -0.0039 189 TRP B CZ3 
3288 C  CH2 . TRP B 189 ? 0.1124 0.1180 0.0861 0.0007  -0.0082 -0.0022 189 TRP B CH2 
3289 N  N   . ASN B 190 ? 0.1206 0.1083 0.0852 0.0049  0.0113  0.0004  190 ASN B N   
3290 C  CA  . ASN B 190 ? 0.1236 0.1141 0.0947 -0.0068 0.0143  0.0042  190 ASN B CA  
3291 C  C   . ASN B 190 ? 0.1255 0.1204 0.0846 -0.0048 0.0093  0.0037  190 ASN B C   
3292 O  O   . ASN B 190 ? 0.1459 0.1205 0.1185 -0.0019 0.0092  0.0204  190 ASN B O   
3293 C  CB  . ASN B 190 ? 0.1302 0.1196 0.1019 -0.0103 0.0166  -0.0039 190 ASN B CB  
3294 C  CG  . ASN B 190 ? 0.1409 0.1268 0.1036 -0.0090 0.0091  0.0098  190 ASN B CG  
3295 O  OD1 . ASN B 190 ? 0.1339 0.1573 0.1126 -0.0109 0.0226  0.0066  190 ASN B OD1 
3296 N  ND2 . ASN B 190 ? 0.1576 0.1362 0.1064 0.0011  -0.0064 -0.0019 190 ASN B ND2 
3297 N  N   . VAL B 191 ? 0.1229 0.1035 0.0902 -0.0051 0.0070  0.0052  191 VAL B N   
3298 C  CA  . VAL B 191 ? 0.1209 0.1134 0.0867 0.0115  0.0005  0.0128  191 VAL B CA  
3299 C  C   . VAL B 191 ? 0.1214 0.1052 0.0788 0.0055  -0.0009 0.0120  191 VAL B C   
3300 O  O   . VAL B 191 ? 0.1209 0.1197 0.0986 0.0088  -0.0011 0.0039  191 VAL B O   
3301 C  CB  . VAL B 191 ? 0.1298 0.1185 0.0939 0.0120  0.0041  -0.0028 191 VAL B CB  
3302 C  CG1 . VAL B 191 ? 0.1342 0.1373 0.1343 0.0085  0.0049  -0.0305 191 VAL B CG1 
3303 C  CG2 . VAL B 191 ? 0.1323 0.1408 0.0849 0.0069  0.0014  0.0079  191 VAL B CG2 
3304 N  N   . VAL B 192 ? 0.1185 0.1222 0.0770 0.0102  -0.0044 0.0040  192 VAL B N   
3305 C  CA  . VAL B 192 ? 0.1205 0.1181 0.0769 0.0141  -0.0014 -0.0003 192 VAL B CA  
3306 C  C   . VAL B 192 ? 0.1267 0.1253 0.0687 0.0074  -0.0039 0.0050  192 VAL B C   
3307 O  O   . VAL B 192 ? 0.1266 0.1340 0.0826 0.0061  -0.0048 0.0055  192 VAL B O   
3308 C  CB  . VAL B 192 ? 0.1251 0.1156 0.0851 0.0094  0.0006  0.0109  192 VAL B CB  
3309 C  CG1 . VAL B 192 ? 0.1238 0.1284 0.0963 0.0159  -0.0082 0.0017  192 VAL B CG1 
3310 C  CG2 . VAL B 192 ? 0.1383 0.1298 0.0927 0.0058  -0.0192 0.0020  192 VAL B CG2 
3311 N  N   . ASN B 193 ? 0.1203 0.1208 0.0829 0.0125  -0.0072 0.0060  193 ASN B N   
3312 C  CA  . ASN B 193 ? 0.1277 0.1154 0.0788 0.0044  -0.0099 0.0092  193 ASN B CA  
3313 C  C   . ASN B 193 ? 0.1287 0.1132 0.0780 0.0138  -0.0112 0.0137  193 ASN B C   
3314 O  O   . ASN B 193 ? 0.1343 0.1227 0.0796 0.0019  -0.0130 0.0041  193 ASN B O   
3315 C  CB  . ASN B 193 ? 0.1345 0.1167 0.0826 0.0130  -0.0179 0.0072  193 ASN B CB  
3316 C  CG  . ASN B 193 ? 0.1388 0.1229 0.0867 0.0157  -0.0058 0.0116  193 ASN B CG  
3317 O  OD1 . ASN B 193 ? 0.1335 0.1382 0.0933 0.0147  -0.0155 0.0170  193 ASN B OD1 
3318 N  ND2 . ASN B 193 ? 0.1382 0.1379 0.1142 0.0290  -0.0065 0.0131  193 ASN B ND2 
3319 N  N   . TRP B 194 ? 0.1322 0.1216 0.0760 0.0151  -0.0100 0.0126  194 TRP B N   
3320 C  CA  . TRP B 194 ? 0.1240 0.1249 0.0825 0.0117  -0.0095 0.0107  194 TRP B CA  
3321 C  C   . TRP B 194 ? 0.1333 0.1336 0.0723 0.0030  -0.0230 0.0073  194 TRP B C   
3322 O  O   . TRP B 194 ? 0.1503 0.1454 0.0865 0.0102  -0.0216 0.0076  194 TRP B O   
3323 C  CB  . TRP B 194 ? 0.1275 0.1407 0.0730 0.0176  -0.0065 0.0104  194 TRP B CB  
3324 C  CG  . TRP B 194 ? 0.1186 0.1403 0.0802 0.0096  -0.0094 0.0129  194 TRP B CG  
3325 C  CD1 . TRP B 194 ? 0.1240 0.1442 0.0802 -0.0013 -0.0022 0.0051  194 TRP B CD1 
3326 C  CD2 . TRP B 194 ? 0.1302 0.1400 0.0812 0.0121  0.0027  0.0142  194 TRP B CD2 
3327 N  NE1 . TRP B 194 ? 0.1282 0.1726 0.0805 0.0161  -0.0101 0.0049  194 TRP B NE1 
3328 C  CE2 . TRP B 194 ? 0.1300 0.1570 0.0817 0.0230  -0.0069 0.0025  194 TRP B CE2 
3329 C  CE3 . TRP B 194 ? 0.1275 0.1410 0.0851 0.0121  -0.0078 0.0007  194 TRP B CE3 
3330 C  CZ2 . TRP B 194 ? 0.1372 0.1627 0.0769 0.0297  -0.0069 0.0037  194 TRP B CZ2 
3331 C  CZ3 . TRP B 194 ? 0.1340 0.1310 0.1184 0.0232  -0.0064 0.0031  194 TRP B CZ3 
3332 C  CH2 . TRP B 194 ? 0.1390 0.1577 0.1012 0.0336  -0.0011 0.0043  194 TRP B CH2 
3333 N  N   . ASP B 195 ? 0.1548 0.1329 0.0832 0.0108  -0.0312 0.0169  195 ASP B N   
3334 C  CA  . ASP B 195 ? 0.1524 0.1417 0.0765 0.0158  -0.0291 0.0187  195 ASP B CA  
3335 C  C   . ASP B 195 ? 0.1441 0.1351 0.0914 0.0147  -0.0238 0.0215  195 ASP B C   
3336 O  O   . ASP B 195 ? 0.1518 0.1513 0.0846 0.0109  -0.0272 0.0132  195 ASP B O   
3337 C  CB  . ASP B 195 ? 0.1454 0.1379 0.1044 0.0015  -0.0246 0.0232  195 ASP B CB  
3338 C  CG  . ASP B 195 ? 0.1614 0.1466 0.0940 0.0108  -0.0176 0.0204  195 ASP B CG  
3339 O  OD1 . ASP B 195 ? 0.1535 0.1721 0.1215 0.0135  -0.0132 0.0406  195 ASP B OD1 
3340 O  OD2 . ASP B 195 ? 0.1813 0.1411 0.1072 -0.0096 -0.0229 0.0194  195 ASP B OD2 
3341 N  N   . GLU B 196 ? 0.1326 0.1431 0.0906 0.0229  -0.0236 0.0127  196 GLU B N   
3342 C  CA  . GLU B 196 ? 0.1277 0.1527 0.1019 0.0098  -0.0170 0.0008  196 GLU B CA  
3343 C  C   . GLU B 196 ? 0.1270 0.1415 0.0901 0.0165  -0.0142 0.0136  196 GLU B C   
3344 O  O   . GLU B 196 ? 0.1212 0.1588 0.1060 0.0005  -0.0320 0.0051  196 GLU B O   
3345 C  CB  . GLU B 196 ? 0.1301 0.1838 0.0978 0.0199  -0.0172 -0.0031 196 GLU B CB  
3346 C  CG  . GLU B 196 ? 0.1406 0.1956 0.1271 0.0074  0.0065  -0.0029 196 GLU B CG  
3347 C  CD  . GLU B 196 ? 0.1355 0.2563 0.1825 -0.0100 -0.0045 0.0477  196 GLU B CD  
3348 O  OE1 . GLU B 196 ? 0.1642 0.2986 0.3249 -0.0192 -0.0456 0.1336  196 GLU B OE1 
3349 O  OE2 . GLU B 196 ? 0.2178 0.3465 0.3705 -0.0966 -0.1102 0.1164  196 GLU B OE2 
3350 N  N   . ALA B 197 ? 0.1137 0.1466 0.0885 0.0101  -0.0225 -0.0008 197 ALA B N   
3351 C  CA  . ALA B 197 ? 0.1233 0.1381 0.0836 0.0102  -0.0120 0.0124  197 ALA B CA  
3352 C  C   . ALA B 197 ? 0.1082 0.1322 0.0842 0.0094  -0.0172 0.0099  197 ALA B C   
3353 O  O   . ALA B 197 ? 0.1275 0.1387 0.0878 0.0014  -0.0176 -0.0025 197 ALA B O   
3354 C  CB  . ALA B 197 ? 0.1321 0.1449 0.0821 0.0169  -0.0236 0.0100  197 ALA B CB  
3355 N  N   . ALA B 198 ? 0.1188 0.1360 0.0781 0.0012  -0.0198 0.0039  198 ALA B N   
3356 C  CA  . ALA B 198 ? 0.1169 0.1394 0.0835 0.0061  -0.0130 0.0046  198 ALA B CA  
3357 C  C   . ALA B 198 ? 0.1293 0.1462 0.0836 0.0121  -0.0259 0.0120  198 ALA B C   
3358 O  O   . ALA B 198 ? 0.1261 0.1719 0.0882 -0.0006 -0.0230 0.0065  198 ALA B O   
3359 C  CB  . ALA B 198 ? 0.1455 0.1593 0.0915 0.0094  -0.0118 0.0242  198 ALA B CB  
3360 N  N   . ALA B 199 ? 0.1209 0.1687 0.0886 0.0116  -0.0176 0.0154  199 ALA B N   
3361 C  CA  . ALA B 199 ? 0.1233 0.1938 0.1021 0.0139  -0.0297 0.0185  199 ALA B CA  
3362 C  C   . ALA B 199 ? 0.1422 0.1946 0.0944 -0.0164 -0.0331 0.0112  199 ALA B C   
3363 O  O   . ALA B 199 ? 0.1568 0.2575 0.1091 -0.0335 -0.0558 0.0192  199 ALA B O   
3364 C  CB  . ALA B 199 ? 0.1476 0.2206 0.1028 0.0461  -0.0245 0.0223  199 ALA B CB  
3365 N  N   . ARG B 200 ? 0.1242 0.1768 0.1092 -0.0080 -0.0287 0.0072  200 ARG B N   
3366 C  CA  . ARG B 200 ? 0.1409 0.1776 0.1116 -0.0165 -0.0295 0.0219  200 ARG B CA  
3367 C  C   . ARG B 200 ? 0.1518 0.1718 0.0992 -0.0162 -0.0373 0.0140  200 ARG B C   
3368 O  O   . ARG B 200 ? 0.1723 0.2263 0.1395 -0.0514 -0.0271 -0.0202 200 ARG B O   
3369 C  CB  . ARG B 200 ? 0.1247 0.1868 0.1077 -0.0033 -0.0271 0.0055  200 ARG B CB  
3370 C  CG  . ARG B 200 ? 0.1178 0.1744 0.1203 0.0103  -0.0260 0.0160  200 ARG B CG  
3371 C  CD  . ARG B 200 ? 0.1178 0.1709 0.1209 0.0105  -0.0135 -0.0017 200 ARG B CD  
3372 N  NE  . ARG B 200 ? 0.1265 0.1688 0.1087 0.0124  -0.0196 0.0129  200 ARG B NE  
3373 C  CZ  . ARG B 200 ? 0.1113 0.1890 0.1251 0.0107  -0.0076 0.0101  200 ARG B CZ  
3374 N  NH1 . ARG B 200 ? 0.1436 0.1983 0.2035 0.0304  0.0028  0.0119  200 ARG B NH1 
3375 N  NH2 . ARG B 200 ? 0.1357 0.1812 0.1700 0.0091  -0.0168 0.0179  200 ARG B NH2 
3376 N  N   . PHE B 201 ? 0.1671 0.1462 0.0956 -0.0169 -0.0311 0.0061  201 PHE B N   
3377 C  CA  . PHE B 201 ? 0.1682 0.1586 0.0931 -0.0055 -0.0394 -0.0016 201 PHE B CA  
3378 C  C   . PHE B 201 ? 0.1605 0.1769 0.0972 -0.0291 -0.0440 0.0049  201 PHE B C   
3379 O  O   . PHE B 201 ? 0.3071 0.1955 0.1112 -0.0770 -0.0865 0.0108  201 PHE B O   
3380 C  CB  . PHE B 201 ? 0.1665 0.1584 0.0878 -0.0102 -0.0403 -0.0064 201 PHE B CB  
3381 C  CG  . PHE B 201 ? 0.1765 0.1620 0.0903 -0.0089 -0.0365 -0.0167 201 PHE B CG  
3382 C  CD1 . PHE B 201 ? 0.2002 0.1725 0.1091 0.0117  -0.0226 -0.0016 201 PHE B CD1 
3383 C  CD2 . PHE B 201 ? 0.1961 0.1739 0.1071 -0.0064 -0.0307 0.0001  201 PHE B CD2 
3384 C  CE1 . PHE B 201 ? 0.1955 0.1609 0.1431 0.0080  -0.0221 -0.0179 201 PHE B CE1 
3385 C  CE2 . PHE B 201 ? 0.1762 0.1895 0.1244 -0.0240 -0.0139 -0.0067 201 PHE B CE2 
3386 C  CZ  . PHE B 201 ? 0.1729 0.1824 0.1316 0.0026  -0.0325 -0.0084 201 PHE B CZ  
3387 N  N   . ALA B 202 ? 0.1650 0.1979 0.0943 -0.0230 -0.0344 0.0232  202 ALA B N   
3388 C  CA  . ALA B 202 ? 0.1511 0.2448 0.1083 -0.0034 -0.0494 0.0170  202 ALA B CA  
3389 C  C   . ALA B 202 ? 0.1774 0.2521 0.1320 -0.0267 -0.0530 -0.0083 202 ALA B C   
3390 O  O   . ALA B 202 ? 0.2246 0.3079 0.1392 -0.0364 -0.0742 -0.0268 202 ALA B O   
3391 C  CB  . ALA B 202 ? 0.1773 0.2586 0.1347 -0.0147 -0.0595 0.0547  202 ALA B CB  
3392 N  N   . ALA B 203 ? 0.1473 0.2917 0.1438 -0.0322 -0.0527 0.0030  203 ALA B N   
3393 C  CA  . ALA B 203 ? 0.1555 0.3879 0.2333 -0.0788 -0.0448 -0.0710 203 ALA B CA  
3394 C  C   . ALA B 203 ? 0.1885 0.3826 0.1802 -0.1122 -0.0180 -0.0460 203 ALA B C   
3395 O  O   . ALA B 203 ? 0.2508 0.4042 0.2311 -0.1098 -0.0837 -0.0780 203 ALA B O   
3396 C  CB  . ALA B 203 ? 0.1576 0.4075 0.2350 -0.0292 -0.0167 -0.0238 203 ALA B CB  
3397 N  N   . LYS B 204 ? 0.1693 0.3839 0.3510 -0.0688 -0.0710 -0.0886 204 LYS B N   
3398 C  CA  . LYS B 204 ? 0.2381 0.3912 0.3186 -0.1224 -0.0345 0.0196  204 LYS B CA  
3399 C  C   . LYS B 204 ? 0.3439 0.3081 0.3153 -0.1151 -0.0164 -0.0263 204 LYS B C   
3400 O  O   . LYS B 204 ? 0.4965 0.3133 0.7659 -0.1649 0.0795  -0.0579 204 LYS B O   
3401 C  CB  . LYS B 204 ? 0.2879 0.5146 0.2337 -0.0656 -0.1159 -0.0309 204 LYS B CB  
3402 C  CG  . LYS B 204 ? 0.3119 0.6136 0.1543 -0.0638 -0.0866 0.0615  204 LYS B CG  
3403 C  CD  . LYS B 204 ? 0.4023 0.7979 0.2143 0.1164  -0.0841 -0.0280 204 LYS B CD  
3404 C  CE  . LYS B 204 ? 0.4061 0.8545 0.1728 0.0887  -0.0350 0.0939  204 LYS B CE  
3405 N  NZ  . LYS B 204 ? 0.2306 0.8431 0.2747 0.1112  -0.0862 -0.0556 204 LYS B NZ  
3406 N  N   . LYS B 205 ? 0.2522 0.2868 0.2667 -0.0130 -0.0424 0.0617  205 LYS B N   
3407 C  CA  . LYS B 205 ? 0.3689 0.2936 0.3317 -0.0419 0.0205  -0.0421 205 LYS B CA  
3408 C  C   . LYS B 205 ? 0.4125 0.3918 0.4156 -0.1093 -0.0355 -0.0611 205 LYS B C   
3409 O  O   . LYS B 205 ? 0.6008 0.6649 0.9284 0.0663  -0.3418 -0.2383 205 LYS B O   
3410 C  CB  . LYS B 205 ? 0.2997 0.2428 0.2038 0.0160  0.0042  -0.0473 205 LYS B CB  
3411 C  CG  . LYS B 205 ? 0.3374 0.3016 0.3418 0.0232  -0.0411 0.0356  205 LYS B CG  
3412 C  CD  . LYS B 205 ? 0.3810 0.2879 0.3770 0.0087  -0.0029 0.0358  205 LYS B CD  
3413 C  CE  . LYS B 205 ? 0.3220 0.2791 0.2788 0.0505  0.0124  -0.0110 205 LYS B CE  
3414 N  NZ  . LYS B 205 ? 0.3684 0.4145 0.3727 -0.0603 -0.0275 0.0472  205 LYS B NZ  
3415 O  OXT . LYS B 205 ? 0.7158 0.3817 0.4101 0.0285  -0.2147 -0.1273 205 LYS B OXT 
3416 MN MN  . MH2 C .   ? 0.0630 0.0812 0.0590 0.0053  -0.0038 -0.0022 206 MH2 A MN  
3417 O  O1  . MH2 C .   ? 0.0789 0.0931 0.0710 0.0057  -0.0025 -0.0114 206 MH2 A O1  
3418 MN MN  . MH2 D .   ? 0.0764 0.0926 0.0705 0.0137  -0.0071 0.0028  206 MH2 B MN  
3419 O  O1  . MH2 D .   ? 0.0856 0.1062 0.0887 0.0099  -0.0041 0.0045  206 MH2 B O1  
3420 O  O   . HOH E .   ? 0.0705 0.1127 0.0965 0.0041  0.0005  -0.0012 207 HOH A O   
3421 O  O   . HOH E .   ? 0.0847 0.1011 0.0804 0.0124  0.0019  0.0027  208 HOH A O   
3422 O  O   . HOH E .   ? 0.0822 0.0885 0.0925 0.0011  0.0075  -0.0104 209 HOH A O   
3423 O  O   . HOH E .   ? 0.0801 0.0968 0.1030 0.0081  0.0011  -0.0042 210 HOH A O   
3424 O  O   . HOH E .   ? 0.0861 0.1187 0.0902 0.0182  -0.0025 -0.0038 211 HOH A O   
3425 O  O   . HOH E .   ? 0.0928 0.0890 0.0879 0.0068  -0.0003 -0.0100 212 HOH A O   
3426 O  O   . HOH E .   ? 0.0978 0.1090 0.1272 -0.0169 0.0098  -0.0278 213 HOH A O   
3427 O  O   . HOH E .   ? 0.0917 0.1203 0.0841 -0.0025 -0.0071 -0.0016 214 HOH A O   
3428 O  O   . HOH E .   ? 0.0870 0.1037 0.0860 0.0068  0.0036  -0.0145 215 HOH A O   
3429 O  O   . HOH E .   ? 0.0723 0.1015 0.0896 -0.0076 -0.0035 -0.0057 216 HOH A O   
3430 O  O   . HOH E .   ? 0.0968 0.1107 0.1112 0.0013  -0.0034 -0.0178 217 HOH A O   
3431 O  O   . HOH E .   ? 0.0808 0.1123 0.0894 -0.0097 -0.0040 -0.0041 218 HOH A O   
3432 O  O   . HOH E .   ? 0.0795 0.1348 0.0895 0.0099  0.0007  0.0000  219 HOH A O   
3433 O  O   . HOH E .   ? 0.1119 0.1087 0.0991 0.0134  -0.0152 -0.0155 220 HOH A O   
3434 O  O   . HOH E .   ? 0.1010 0.1051 0.1120 0.0076  -0.0040 -0.0016 221 HOH A O   
3435 O  O   . HOH E .   ? 0.1157 0.1565 0.0900 0.0083  -0.0226 -0.0014 222 HOH A O   
3436 O  O   . HOH E .   ? 0.0994 0.1395 0.0861 0.0035  -0.0152 0.0018  223 HOH A O   
3437 O  O   . HOH E .   ? 0.0907 0.1144 0.0979 0.0158  -0.0112 -0.0001 224 HOH A O   
3438 O  O   . HOH E .   ? 0.0863 0.1063 0.0913 0.0025  0.0040  0.0002  225 HOH A O   
3439 O  O   . HOH E .   ? 0.0812 0.0910 0.1400 -0.0049 0.0001  -0.0185 226 HOH A O   
3440 O  O   . HOH E .   ? 0.1422 0.1194 0.0996 0.0092  -0.0115 -0.0094 227 HOH A O   
3441 O  O   . HOH E .   ? 0.0928 0.1527 0.0913 0.0053  0.0082  -0.0099 228 HOH A O   
3442 O  O   . HOH E .   ? 0.0926 0.1227 0.1224 0.0061  -0.0089 0.0177  229 HOH A O   
3443 O  O   . HOH E .   ? 0.1182 0.1033 0.1268 0.0075  0.0001  -0.0026 230 HOH A O   
3444 O  O   . HOH E .   ? 0.1129 0.1128 0.1137 0.0167  0.0101  0.0027  231 HOH A O   
3445 O  O   . HOH E .   ? 0.0949 0.1185 0.0963 0.0024  -0.0070 -0.0087 232 HOH A O   
3446 O  O   . HOH E .   ? 0.1034 0.1350 0.0898 0.0110  -0.0006 -0.0098 233 HOH A O   
3447 O  O   . HOH E .   ? 0.1547 0.1108 0.0969 -0.0272 -0.0317 0.0039  234 HOH A O   
3448 O  O   . HOH E .   ? 0.1030 0.1107 0.1018 -0.0064 -0.0044 0.0004  235 HOH A O   
3449 O  O   . HOH E .   ? 0.1339 0.1113 0.1348 -0.0098 0.0081  0.0046  236 HOH A O   
3450 O  O   . HOH E .   ? 0.1067 0.0929 0.1082 0.0027  -0.0082 -0.0002 237 HOH A O   
3451 O  O   . HOH E .   ? 0.1210 0.1602 0.0973 0.0135  -0.0141 -0.0164 238 HOH A O   
3452 O  O   . HOH E .   ? 0.0879 0.1879 0.1126 -0.0061 -0.0012 0.0367  239 HOH A O   
3453 O  O   . HOH E .   ? 0.1392 0.1152 0.1109 -0.0176 -0.0313 0.0100  240 HOH A O   
3454 O  O   . HOH E .   ? 0.1009 0.1039 0.1974 -0.0150 -0.0174 -0.0167 241 HOH A O   
3455 O  O   . HOH E .   ? 0.1417 0.1200 0.1046 0.0314  -0.0216 -0.0119 242 HOH A O   
3456 O  O   . HOH E .   ? 0.3944 0.3375 0.3388 0.1682  -0.0982 -0.0756 243 HOH A O   
3457 O  O   . HOH E .   ? 0.1306 0.1021 0.1344 -0.0011 0.0070  0.0076  244 HOH A O   
3458 O  O   . HOH E .   ? 0.1141 0.1090 0.1720 -0.0142 0.0017  -0.0237 245 HOH A O   
3459 O  O   . HOH E .   ? 0.0849 0.2297 0.0991 -0.0088 0.0076  0.0290  246 HOH A O   
3460 O  O   . HOH E .   ? 0.1066 0.1210 0.1093 0.0136  0.0099  -0.0192 247 HOH A O   
3461 O  O   . HOH E .   ? 0.1480 0.1531 0.1260 0.0186  -0.0085 -0.0175 248 HOH A O   
3462 O  O   . HOH E .   ? 0.1242 0.1299 0.1517 0.0156  0.0072  0.0247  249 HOH A O   
3463 O  O   . HOH E .   ? 0.1235 0.1611 0.1239 0.0495  -0.0159 -0.0005 250 HOH A O   
3464 O  O   . HOH E .   ? 0.1107 0.1739 0.0908 -0.0029 -0.0005 -0.0056 251 HOH A O   
3465 O  O   . HOH E .   ? 0.1010 0.1572 0.1512 0.0021  0.0015  -0.0159 252 HOH A O   
3466 O  O   . HOH E .   ? 0.1440 0.1019 0.1429 0.0071  0.0028  0.0095  253 HOH A O   
3467 O  O   . HOH E .   ? 0.1161 0.1331 0.0976 0.0150  0.0008  -0.0231 254 HOH A O   
3468 O  O   . HOH E .   ? 0.1639 0.1709 0.1100 0.0290  0.0126  0.0130  255 HOH A O   
3469 O  O   . HOH E .   ? 0.0825 0.1935 0.1431 -0.0251 0.0089  -0.0418 256 HOH A O   
3470 O  O   . HOH E .   ? 0.1151 0.1254 0.1098 0.0096  0.0149  -0.0062 257 HOH A O   
3471 O  O   . HOH E .   ? 0.1070 0.1380 0.1154 -0.0066 -0.0027 0.0075  258 HOH A O   
3472 O  O   . HOH E .   ? 0.2833 0.3993 0.2422 0.0689  0.0272  0.0025  259 HOH A O   
3473 O  O   . HOH E .   ? 0.1017 0.1746 0.1193 0.0280  -0.0088 -0.0419 260 HOH A O   
3474 O  O   . HOH E .   ? 0.0790 0.1907 0.0980 0.0029  0.0044  -0.0092 261 HOH A O   
3475 O  O   . HOH E .   ? 0.1330 0.1113 0.1116 -0.0139 -0.0327 0.0055  262 HOH A O   
3476 O  O   . HOH E .   ? 0.1196 0.1943 0.1436 0.0722  0.0496  0.0358  263 HOH A O   
3477 O  O   . HOH E .   ? 0.1578 0.1117 0.1461 -0.0254 -0.0184 0.0282  264 HOH A O   
3478 O  O   . HOH E .   ? 0.1407 0.1343 0.1113 -0.0008 -0.0025 -0.0267 265 HOH A O   
3479 O  O   . HOH E .   ? 0.1547 0.1515 0.0942 -0.0021 -0.0019 0.0107  266 HOH A O   
3480 O  O   . HOH E .   ? 0.1055 0.1425 0.1182 -0.0085 -0.0062 -0.0103 267 HOH A O   
3481 O  O   . HOH E .   ? 0.1827 0.1340 0.1255 0.0007  -0.0110 -0.0431 268 HOH A O   
3482 O  O   . HOH E .   ? 0.1460 0.1481 0.1426 -0.0149 0.0311  0.0017  269 HOH A O   
3483 O  O   . HOH E .   ? 0.0971 0.2164 0.1282 -0.0518 -0.0004 -0.0056 270 HOH A O   
3484 O  O   . HOH E .   ? 0.1467 0.3345 0.4565 -0.0212 -0.0158 0.1837  271 HOH A O   
3485 O  O   . HOH E .   ? 0.1235 0.2627 0.1749 -0.0191 0.0496  -0.1014 272 HOH A O   
3486 O  O   . HOH E .   ? 0.1308 0.1598 0.1769 0.0070  0.0283  0.0223  273 HOH A O   
3487 O  O   . HOH E .   ? 0.1174 0.1438 0.1244 0.0166  -0.0023 0.0047  274 HOH A O   
3488 O  O   . HOH E .   ? 0.1082 0.1682 0.2031 0.0123  0.0514  0.0397  275 HOH A O   
3489 O  O   . HOH E .   ? 0.1731 0.1291 0.1479 -0.0125 0.0282  -0.0134 276 HOH A O   
3490 O  O   . HOH E .   ? 0.1582 0.1832 0.1442 0.0279  -0.0402 -0.0395 277 HOH A O   
3491 O  O   . HOH E .   ? 0.1417 0.1325 0.1457 0.0104  -0.0277 -0.0316 278 HOH A O   
3492 O  O   . HOH E .   ? 0.1292 0.1192 0.1811 -0.0002 -0.0134 -0.0035 279 HOH A O   
3493 O  O   . HOH E .   ? 0.1534 0.1314 0.1349 0.0212  0.0264  0.0117  280 HOH A O   
3494 O  O   . HOH E .   ? 0.1434 0.1901 0.1698 0.0453  -0.0464 -0.0221 281 HOH A O   
3495 O  O   . HOH E .   ? 0.2136 0.2073 0.3357 0.0671  -0.1086 -0.1402 282 HOH A O   
3496 O  O   . HOH E .   ? 0.2430 0.1785 0.1789 -0.0102 -0.0696 -0.0104 283 HOH A O   
3497 O  O   . HOH E .   ? 0.1356 0.2131 0.1006 -0.0055 0.0234  -0.0192 284 HOH A O   
3498 O  O   . HOH E .   ? 0.1467 0.1587 0.2270 0.0242  0.0397  -0.0587 285 HOH A O   
3499 O  O   . HOH E .   ? 0.1304 0.1971 0.1540 -0.0208 0.0035  -0.0433 286 HOH A O   
3500 O  O   . HOH E .   ? 0.1533 0.1488 0.1001 -0.0053 -0.0224 0.0093  287 HOH A O   
3501 O  O   . HOH E .   ? 0.2075 0.2366 0.2505 0.0665  0.0329  -0.0659 288 HOH A O   
3502 O  O   . HOH E .   ? 0.2081 0.1788 0.1032 0.0394  -0.0085 0.0106  289 HOH A O   
3503 O  O   . HOH E .   ? 0.2034 0.1391 0.1472 -0.0090 -0.0070 -0.0222 290 HOH A O   
3504 O  O   . HOH E .   ? 0.1710 0.2488 0.1528 0.0282  0.0289  -0.0832 291 HOH A O   
3505 O  O   . HOH E .   ? 0.1408 0.1796 0.1357 0.0047  -0.0465 -0.0112 292 HOH A O   
3506 O  O   . HOH E .   ? 0.2803 0.2197 0.2158 -0.0339 -0.0085 -0.0842 293 HOH A O   
3507 O  O   . HOH E .   ? 0.1327 0.2180 0.1444 -0.0188 -0.0034 -0.0097 294 HOH A O   
3508 O  O   . HOH E .   ? 0.1422 0.1948 0.1273 0.0032  -0.0275 0.0005  295 HOH A O   
3509 O  O   . HOH E .   ? 0.1269 0.1980 0.1597 -0.0027 -0.0149 -0.0492 296 HOH A O   
3510 O  O   . HOH E .   ? 0.1219 0.2402 0.1606 -0.0118 0.0027  -0.0087 297 HOH A O   
3511 O  O   . HOH E .   ? 0.3304 0.3051 0.1760 -0.1670 0.1175  -0.1228 298 HOH A O   
3512 O  O   . HOH E .   ? 0.1680 0.1413 0.2329 -0.0025 -0.0812 0.0049  299 HOH A O   
3513 O  O   . HOH E .   ? 0.1338 0.2282 0.1782 0.0270  -0.0003 0.0079  300 HOH A O   
3514 O  O   . HOH E .   ? 0.1255 0.2559 0.1321 -0.0694 0.0004  0.0053  301 HOH A O   
3515 O  O   . HOH E .   ? 0.1040 0.2594 0.1937 -0.0694 0.0218  0.0009  302 HOH A O   
3516 O  O   . HOH E .   ? 0.1430 0.1356 0.1661 0.0065  0.0108  0.0299  303 HOH A O   
3517 O  O   . HOH E .   ? 0.2028 0.2084 0.2481 -0.0385 0.0697  -0.0748 304 HOH A O   
3518 O  O   . HOH E .   ? 0.1468 0.2134 0.1770 0.0526  -0.0015 -0.0163 305 HOH A O   
3519 O  O   . HOH E .   ? 0.1721 0.2124 0.1772 -0.0371 -0.0299 0.0207  306 HOH A O   
3520 O  O   . HOH E .   ? 0.2255 0.1453 0.1845 -0.0250 0.0275  -0.0108 307 HOH A O   
3521 O  O   . HOH E .   ? 0.1309 0.5315 0.1732 -0.0581 0.0102  -0.1574 308 HOH A O   
3522 O  O   . HOH E .   ? 0.3089 0.1877 0.1734 0.0545  -0.1114 -0.0468 309 HOH A O   
3523 O  O   . HOH E .   ? 0.2346 0.1964 0.1665 0.0271  0.0072  -0.0844 310 HOH A O   
3524 O  O   . HOH E .   ? 0.1755 0.1561 0.1792 0.0034  0.0118  -0.0186 311 HOH A O   
3525 O  O   . HOH E .   ? 0.1322 0.1760 0.2006 -0.0213 -0.0226 0.0077  312 HOH A O   
3526 O  O   . HOH E .   ? 0.2187 0.1220 0.1955 0.0069  -0.0808 0.0088  313 HOH A O   
3527 O  O   . HOH E .   ? 0.1670 0.2449 0.1525 -0.0046 0.0299  0.0013  314 HOH A O   
3528 O  O   . HOH E .   ? 0.1220 0.2999 0.1186 -0.0863 0.0220  -0.0203 315 HOH A O   
3529 O  O   . HOH E .   ? 0.1420 0.1942 0.2888 -0.0290 -0.0333 0.0890  316 HOH A O   
3530 O  O   . HOH E .   ? 0.2531 0.1531 0.1459 0.0296  -0.0406 -0.0027 317 HOH A O   
3531 O  O   . HOH E .   ? 0.1401 0.3405 0.1402 -0.0696 0.0114  -0.0338 318 HOH A O   
3532 O  O   . HOH E .   ? 0.1432 0.1774 0.1402 -0.0127 0.0344  0.0217  319 HOH A O   
3533 O  O   . HOH E .   ? 0.1463 0.2501 0.2533 0.0284  -0.0484 -0.1256 320 HOH A O   
3534 O  O   . HOH E .   ? 0.1470 0.3437 0.1687 0.0203  0.0249  -0.0815 321 HOH A O   
3535 O  O   . HOH E .   ? 0.1619 0.1715 0.2010 0.0648  -0.0074 -0.0825 322 HOH A O   
3536 O  O   . HOH E .   ? 0.1328 0.2178 0.2391 0.0188  0.0049  -0.0708 323 HOH A O   
3537 O  O   . HOH E .   ? 0.1379 0.2208 0.2250 0.0164  0.0339  -0.0446 324 HOH A O   
3538 O  O   . HOH E .   ? 0.1738 0.2082 0.1650 0.0150  0.0217  0.0111  325 HOH A O   
3539 O  O   . HOH E .   ? 0.2420 0.3320 0.2300 -0.1509 0.0325  -0.0853 326 HOH A O   
3540 O  O   . HOH E .   ? 0.2887 0.1853 0.1901 0.0356  0.0222  -0.0257 327 HOH A O   
3541 O  O   . HOH E .   ? 0.2057 0.2463 0.2129 -0.0280 -0.0648 0.0624  328 HOH A O   
3542 O  O   . HOH E .   ? 0.2389 0.2150 0.1592 -0.0430 -0.0703 -0.0054 329 HOH A O   
3543 O  O   . HOH E .   ? 0.1224 0.3944 0.4558 -0.0471 0.0725  -0.1038 330 HOH A O   
3544 O  O   . HOH E .   ? 0.1575 0.1166 0.2798 -0.0142 -0.0165 -0.0202 331 HOH A O   
3545 O  O   . HOH E .   ? 0.2261 0.1782 0.2021 -0.0968 -0.0592 0.0488  332 HOH A O   
3546 O  O   . HOH E .   ? 0.1809 0.1770 0.2479 0.0191  -0.0162 0.0171  333 HOH A O   
3547 O  O   A HOH E .   ? 0.1556 0.1937 0.1561 0.0719  0.0057  0.0053  334 HOH A O   
3548 O  O   . HOH E .   ? 0.1562 0.2237 0.2183 -0.0281 -0.0057 -0.0179 335 HOH A O   
3549 O  O   . HOH E .   ? 0.2114 0.3552 0.1611 -0.1337 -0.0156 -0.0726 336 HOH A O   
3550 O  O   . HOH E .   ? 0.2318 0.1270 0.2860 0.0227  0.0640  -0.0438 337 HOH A O   
3551 O  O   . HOH E .   ? 0.2789 0.4042 0.4183 0.1679  -0.0247 -0.1308 338 HOH A O   
3552 O  O   . HOH E .   ? 0.2232 0.2055 0.1614 -0.0407 0.0084  -0.0066 339 HOH A O   
3553 O  O   . HOH E .   ? 0.2109 0.3414 0.2148 0.0003  0.0916  0.0201  340 HOH A O   
3554 O  O   . HOH E .   ? 0.3664 0.3603 0.3340 0.1345  0.1310  0.0532  341 HOH A O   
3555 O  O   . HOH E .   ? 0.2383 0.2135 0.2183 0.0460  -0.0033 -0.0182 342 HOH A O   
3556 O  O   . HOH E .   ? 0.2075 0.4995 0.1775 0.0992  0.0744  -0.0114 343 HOH A O   
3557 O  O   . HOH E .   ? 0.1697 0.2797 0.2636 -0.0612 0.0351  -0.1061 344 HOH A O   
3558 O  O   . HOH E .   ? 0.2076 0.4607 0.2068 -0.1012 -0.0128 -0.0188 345 HOH A O   
3559 O  O   . HOH E .   ? 0.3196 0.2375 0.2752 0.1044  0.0600  0.0236  346 HOH A O   
3560 O  O   . HOH E .   ? 0.1249 0.3327 0.1709 0.0129  0.0019  -0.0336 347 HOH A O   
3561 O  O   . HOH E .   ? 0.2769 0.2511 0.1554 -0.0376 -0.0324 0.0100  348 HOH A O   
3562 O  O   . HOH E .   ? 0.2339 0.5122 0.1512 0.1529  0.0637  -0.0304 349 HOH A O   
3563 O  O   . HOH E .   ? 0.2196 0.3237 0.3698 -0.0580 -0.0875 0.1157  350 HOH A O   
3564 O  O   . HOH E .   ? 0.1962 0.2608 0.2064 -0.0696 0.0306  -0.0674 351 HOH A O   
3565 O  O   . HOH E .   ? 0.2850 0.1990 0.2282 -0.0307 -0.0247 -0.0572 352 HOH A O   
3566 O  O   . HOH E .   ? 0.1598 0.6100 0.2974 0.0283  0.1044  0.1969  353 HOH A O   
3567 O  O   . HOH E .   ? 0.1980 0.2542 0.2713 -0.0879 0.0750  -0.0947 354 HOH A O   
3568 O  O   . HOH E .   ? 0.3105 0.3951 0.2780 0.0420  0.1115  -0.1163 355 HOH A O   
3569 O  O   . HOH E .   ? 0.2616 0.1727 0.2375 -0.0338 0.0194  -0.0107 356 HOH A O   
3570 O  O   . HOH E .   ? 0.1882 0.2663 0.3056 0.0438  0.0488  -0.0139 357 HOH A O   
3571 O  O   . HOH E .   ? 0.1699 0.1738 0.2238 0.0236  0.0186  0.0050  358 HOH A O   
3572 O  O   . HOH E .   ? 0.3138 0.2433 0.2228 -0.0734 -0.1013 0.0711  359 HOH A O   
3573 O  O   . HOH E .   ? 0.2061 0.2832 0.3857 -0.0992 0.0721  -0.1131 360 HOH A O   
3574 O  O   . HOH E .   ? 0.2642 0.4687 0.2184 0.0162  -0.0325 -0.1430 361 HOH A O   
3575 O  O   . HOH E .   ? 0.2537 0.2286 0.6693 -0.0030 0.1532  -0.1881 362 HOH A O   
3576 O  O   . HOH E .   ? 0.4570 0.3159 0.2803 -0.0198 -0.0754 0.0765  363 HOH A O   
3577 O  O   . HOH E .   ? 0.2579 0.2866 0.2412 -0.0661 -0.0380 -0.0363 364 HOH A O   
3578 O  O   . HOH E .   ? 0.1991 0.2758 0.3085 0.0261  0.0377  0.0538  365 HOH A O   
3579 O  O   . HOH E .   ? 0.3367 0.2564 0.2366 0.0546  -0.0905 -0.0113 366 HOH A O   
3580 O  O   . HOH E .   ? 0.1995 0.3031 0.2202 -0.0618 -0.0100 -0.0221 367 HOH A O   
3581 O  O   . HOH E .   ? 0.2067 0.3575 0.2024 0.0479  0.0082  -0.0474 368 HOH A O   
3582 O  O   . HOH E .   ? 0.3974 0.2935 0.1988 -0.0623 0.0217  0.0922  369 HOH A O   
3583 O  O   . HOH E .   ? 0.4384 0.3246 0.3610 0.0917  -0.1096 -0.0881 370 HOH A O   
3584 O  O   . HOH E .   ? 0.1495 0.3949 0.2060 -0.0127 -0.0441 0.0435  371 HOH A O   
3585 O  O   . HOH E .   ? 0.2707 0.2039 0.1961 0.0022  -0.0758 -0.0091 372 HOH A O   
3586 O  O   . HOH E .   ? 0.2534 0.3623 0.2202 -0.0519 -0.0150 -0.0202 373 HOH A O   
3587 O  O   . HOH E .   ? 0.2450 0.3645 0.1893 -0.0142 -0.0223 -0.0617 374 HOH A O   
3588 O  O   . HOH E .   ? 0.2662 0.5226 0.3180 0.0590  -0.0182 -0.1820 375 HOH A O   
3589 O  O   . HOH E .   ? 0.2268 0.3174 0.2458 -0.0417 0.1047  -0.0290 376 HOH A O   
3590 O  O   . HOH E .   ? 0.2242 0.3967 0.1901 0.1381  0.0577  0.0321  377 HOH A O   
3591 O  O   . HOH E .   ? 0.1561 0.1984 0.1633 0.0187  0.0108  -0.0209 378 HOH A O   
3592 O  O   . HOH E .   ? 0.2497 0.3037 0.2406 -0.0471 -0.0360 -0.0949 379 HOH A O   
3593 O  O   . HOH E .   ? 0.3388 0.3112 0.3020 0.1110  0.0113  -0.1079 380 HOH A O   
3594 O  O   . HOH E .   ? 0.2029 0.4585 0.2486 -0.0997 0.0035  -0.0285 381 HOH A O   
3595 O  O   . HOH E .   ? 0.3629 0.2672 0.2608 0.0167  0.0318  0.0210  382 HOH A O   
3596 O  O   . HOH E .   ? 0.2912 0.3894 0.2819 -0.0225 0.1231  -0.0512 383 HOH A O   
3597 O  O   . HOH E .   ? 0.1515 0.4983 0.2371 -0.0888 0.0426  0.0143  384 HOH A O   
3598 O  O   . HOH E .   ? 0.3451 0.2302 0.3278 -0.0420 0.1047  -0.0097 385 HOH A O   
3599 O  O   . HOH E .   ? 0.3797 0.1482 0.4815 -0.0377 0.0345  0.0362  386 HOH A O   
3600 O  O   . HOH E .   ? 0.2843 0.3830 0.3689 -0.1039 -0.0587 -0.0734 387 HOH A O   
3601 O  O   . HOH E .   ? 0.3241 0.2993 0.4831 -0.0117 0.1601  0.1474  388 HOH A O   
3602 O  O   . HOH E .   ? 0.2320 0.2821 0.4238 -0.0549 0.0539  -0.1181 389 HOH A O   
3603 O  O   A HOH E .   ? 0.2999 0.4026 0.2589 0.0719  0.0505  0.0754  390 HOH A O   
3604 O  O   . HOH E .   ? 0.4829 0.1782 0.3810 0.1195  -0.0656 -0.0290 391 HOH A O   
3605 O  O   . HOH E .   ? 0.1405 0.4859 0.2750 0.0192  0.0963  0.1437  392 HOH A O   
3606 O  O   . HOH E .   ? 0.2984 0.2910 0.2976 0.0884  -0.0115 -0.0023 393 HOH A O   
3607 O  O   . HOH E .   ? 0.2041 0.4218 0.4471 0.0205  0.0561  0.0219  394 HOH A O   
3608 O  O   . HOH E .   ? 0.2941 0.4228 0.2709 0.0417  0.1035  0.0054  395 HOH A O   
3609 O  O   . HOH E .   ? 0.2346 0.2977 0.4150 0.0414  -0.0572 -0.1874 396 HOH A O   
3610 O  O   . HOH E .   ? 0.1892 0.2659 0.3725 0.0235  0.0298  -0.0642 397 HOH A O   
3611 O  O   . HOH E .   ? 0.2098 0.3057 0.3530 -0.0414 0.0844  -0.1999 398 HOH A O   
3612 O  O   . HOH E .   ? 0.3482 0.3252 0.3102 -0.0162 0.2133  0.0564  399 HOH A O   
3613 O  O   . HOH E .   ? 0.3114 0.2157 0.3566 -0.1161 0.0311  0.0428  400 HOH A O   
3614 O  O   . HOH E .   ? 0.3875 0.2752 0.2700 -0.0447 -0.0713 -0.0372 401 HOH A O   
3615 O  O   . HOH E .   ? 0.1612 0.1502 0.2301 -0.0151 0.0206  0.0168  402 HOH A O   
3616 O  O   . HOH E .   ? 0.2780 0.4888 0.3141 0.0092  -0.0546 -0.1525 403 HOH A O   
3617 O  O   . HOH E .   ? 0.2632 0.2389 0.5601 0.0425  0.0414  0.0038  404 HOH A O   
3618 O  O   . HOH E .   ? 0.1572 0.3531 0.1916 0.0418  0.0726  -0.1420 405 HOH A O   
3619 O  O   . HOH E .   ? 0.3044 0.3357 0.2228 0.0054  0.0984  -0.0342 406 HOH A O   
3620 O  O   . HOH E .   ? 0.1982 0.2696 0.3929 0.0597  0.0766  0.0829  407 HOH A O   
3621 O  O   . HOH E .   ? 0.3307 0.4770 0.2149 -0.0853 -0.0317 -0.0185 408 HOH A O   
3622 O  O   . HOH E .   ? 0.5083 0.2865 0.2604 -0.0674 -0.0200 0.1339  409 HOH A O   
3623 O  O   . HOH E .   ? 0.2729 0.4134 0.3172 -0.0127 -0.1459 -0.0160 410 HOH A O   
3624 O  O   . HOH E .   ? 0.2022 0.2110 0.2251 0.0604  -0.0263 0.0791  411 HOH A O   
3625 O  O   . HOH E .   ? 0.2254 0.4929 0.3666 0.1360  0.0217  -0.0717 412 HOH A O   
3626 O  O   . HOH E .   ? 0.3463 0.2819 0.2287 0.0440  0.0783  0.0281  413 HOH A O   
3627 O  O   . HOH E .   ? 0.2858 0.2540 0.4126 -0.0500 -0.0280 0.0228  414 HOH A O   
3628 O  O   . HOH E .   ? 0.1501 0.2807 0.2039 0.0558  0.0045  -0.1335 415 HOH A O   
3629 O  O   . HOH E .   ? 0.2358 0.4218 0.3151 -0.0062 0.0423  0.0322  416 HOH A O   
3630 O  O   . HOH E .   ? 0.2226 0.2492 0.1936 0.0296  -0.0727 0.0549  417 HOH A O   
3631 O  O   . HOH E .   ? 0.1521 0.2572 0.1820 0.0310  0.0046  -0.0383 418 HOH A O   
3632 O  O   . HOH E .   ? 0.2244 0.2855 0.2796 0.0756  0.1066  0.0022  419 HOH A O   
3633 O  O   . HOH E .   ? 0.1928 0.2940 0.2284 -0.0947 0.0706  -0.1161 420 HOH A O   
3634 O  O   . HOH E .   ? 0.2457 0.2820 0.2567 0.1180  0.0661  0.0385  421 HOH A O   
3635 O  O   . HOH E .   ? 0.2525 0.1852 0.1853 -0.0029 0.0227  0.0410  422 HOH A O   
3636 O  O   . HOH E .   ? 0.1320 0.1760 0.1336 -0.0229 0.0027  -0.0016 423 HOH A O   
3637 O  O   . HOH E .   ? 0.1355 0.3653 0.3794 -0.0747 0.0494  -0.0860 424 HOH A O   
3638 O  O   . HOH E .   ? 0.1694 0.3726 0.3615 -0.0630 -0.0086 0.2295  425 HOH A O   
3639 O  O   . HOH E .   ? 0.3341 0.4494 0.3170 0.2183  -0.0310 -0.1042 426 HOH A O   
3640 O  O   . HOH E .   ? 0.3255 0.1918 0.4033 -0.1157 0.0432  -0.0188 427 HOH A O   
3641 O  O   . HOH E .   ? 0.2811 0.1731 0.1499 0.0794  0.0132  -0.0097 428 HOH A O   
3642 O  O   . HOH E .   ? 0.2538 0.4364 0.1608 0.1165  0.0069  -0.0516 429 HOH A O   
3643 O  O   . HOH E .   ? 0.2188 0.1850 0.3718 -0.0561 0.1203  -0.0681 430 HOH A O   
3644 O  O   . HOH E .   ? 0.4339 0.2926 0.1448 -0.0896 0.0232  -0.0757 431 HOH A O   
3645 O  O   . HOH E .   ? 0.2627 0.2159 0.5043 -0.0893 0.0234  -0.0181 432 HOH A O   
3646 O  O   . HOH E .   ? 0.2326 0.2588 0.2513 -0.0646 0.0335  0.0058  433 HOH A O   
3647 O  O   . HOH E .   ? 0.3000 0.3833 0.4316 0.1044  -0.0578 -0.0340 434 HOH A O   
3648 O  O   . HOH E .   ? 0.1649 0.2169 0.2148 0.0071  -0.0205 0.0273  435 HOH A O   
3649 O  O   . HOH E .   ? 0.1855 0.3364 0.3851 -0.1567 0.1200  -0.1181 436 HOH A O   
3650 O  O   . HOH E .   ? 0.1651 0.1871 0.1440 0.0112  -0.0083 -0.0200 437 HOH A O   
3651 O  O   . HOH E .   ? 0.2043 0.2232 0.1560 -0.0515 0.0708  0.0060  438 HOH A O   
3652 O  O   . HOH E .   ? 0.4390 0.3069 0.1700 0.1448  -0.0244 -0.1022 439 HOH A O   
3653 O  O   . HOH E .   ? 0.3777 0.1628 0.1823 -0.0170 0.1281  -0.0525 440 HOH A O   
3654 O  O   . HOH E .   ? 0.2254 0.2156 0.3948 0.0739  -0.0728 0.0798  441 HOH A O   
3655 O  O   . HOH E .   ? 0.2842 0.5290 0.2544 0.1395  0.1536  0.0824  442 HOH A O   
3656 O  O   . HOH E .   ? 0.2147 0.3805 0.1393 0.1365  0.0147  0.0383  443 HOH A O   
3657 O  O   . HOH E .   ? 0.1849 0.3782 0.2369 0.0142  -0.0303 0.1581  444 HOH A O   
3658 O  O   . HOH E .   ? 0.1876 0.2365 0.1732 0.0294  0.0401  0.0027  445 HOH A O   
3659 O  O   . HOH E .   ? 0.2507 0.1898 0.3124 -0.0765 0.0581  -0.0854 446 HOH A O   
3660 O  O   . HOH E .   ? 0.2736 0.3209 0.4469 0.0919  -0.0613 -0.1426 447 HOH A O   
3661 O  O   . HOH E .   ? 0.5321 0.3994 0.3884 -0.1088 -0.1400 -0.1383 448 HOH A O   
3662 O  O   . HOH E .   ? 0.1724 0.2873 0.2154 0.0086  -0.0252 0.0322  449 HOH A O   
3663 O  O   . HOH E .   ? 0.4025 0.2801 0.2011 -0.2086 0.0507  -0.0670 450 HOH A O   
3664 O  O   . HOH E .   ? 0.3110 0.3083 0.1813 -0.0148 0.0306  -0.0610 451 HOH A O   
3665 O  O   . HOH E .   ? 0.1688 0.4591 0.3471 -0.0278 0.1165  0.0327  452 HOH A O   
3666 O  O   . HOH E .   ? 0.2196 0.2554 0.3024 0.1182  0.0040  -0.0510 453 HOH A O   
3667 O  O   . HOH E .   ? 0.2388 0.2535 0.3096 0.0366  -0.1123 -0.1428 454 HOH A O   
3668 O  O   . HOH E .   ? 0.1529 0.3251 0.2530 0.0442  -0.0571 -0.0619 455 HOH A O   
3669 O  O   . HOH E .   ? 0.3009 0.1541 0.2670 0.0887  0.1405  0.0291  456 HOH A O   
3670 O  O   . HOH E .   ? 0.2572 0.2361 0.1577 0.0000  0.0495  -0.0415 457 HOH A O   
3671 O  O   . HOH E .   ? 0.2729 0.3193 0.2680 -0.0481 0.0255  0.0564  458 HOH A O   
3672 O  O   . HOH E .   ? 0.1631 0.4967 0.2198 0.1250  0.0932  0.0498  459 HOH A O   
3673 O  O   B HOH E .   ? 0.1886 0.1368 0.1350 0.0414  -0.0192 0.0180  460 HOH A O   
3674 O  O   . HOH E .   ? 0.2936 0.2589 0.2460 -0.0978 -0.0591 -0.0423 461 HOH A O   
3675 O  O   . HOH E .   ? 0.1068 0.1513 0.1281 0.0202  0.0036  0.0143  462 HOH A O   
3676 O  O   . HOH E .   ? 0.2249 0.2605 0.3023 0.0345  0.0403  0.0748  463 HOH A O   
3677 O  O   . HOH E .   ? 0.1550 0.1416 0.1359 0.0391  0.0138  0.0116  464 HOH A O   
3678 O  O   . HOH E .   ? 0.1208 0.1710 0.1430 -0.0026 0.0006  0.0232  465 HOH A O   
3679 O  O   . HOH E .   ? 0.2070 0.3285 0.1593 0.1205  0.0338  0.0817  466 HOH A O   
3680 O  O   . HOH E .   ? 0.1820 0.2818 0.1456 -0.0009 0.0392  0.0293  467 HOH A O   
3681 O  O   . HOH E .   ? 0.4774 0.3316 0.3002 0.0477  0.0031  -0.1290 468 HOH A O   
3682 O  O   . HOH E .   ? 0.2764 0.2053 0.2726 0.0558  -0.0284 -0.0071 469 HOH A O   
3683 O  O   . HOH E .   ? 0.1150 0.1571 0.1568 0.0021  -0.0083 -0.0120 470 HOH A O   
3684 O  O   . HOH E .   ? 0.3981 0.2080 0.1862 -0.0402 -0.0578 0.0950  471 HOH A O   
3685 O  O   . HOH E .   ? 0.2870 0.2294 0.3344 -0.0810 -0.1559 0.0789  472 HOH A O   
3686 O  O   . HOH E .   ? 0.2642 0.2341 0.1808 0.1500  0.0319  0.0359  473 HOH A O   
3687 O  O   . HOH E .   ? 0.3931 0.1457 0.3056 0.0585  0.0091  0.0299  474 HOH A O   
3688 O  O   . HOH E .   ? 0.4760 0.3755 0.3898 -0.1717 -0.0066 0.0268  475 HOH A O   
3689 O  O   . HOH E .   ? 0.1337 0.1716 0.1248 -0.0476 0.0105  0.0083  476 HOH A O   
3690 O  O   . HOH E .   ? 0.2545 0.2674 0.3406 -0.0288 0.0560  -0.1287 477 HOH A O   
3691 O  O   . HOH E .   ? 0.0796 0.1133 0.1306 -0.0020 0.0126  -0.0077 478 HOH A O   
3692 O  O   . HOH E .   ? 0.0959 0.1164 0.1043 -0.0007 -0.0058 -0.0143 479 HOH A O   
3693 O  O   . HOH E .   ? 0.0895 0.1190 0.1091 -0.0064 0.0123  -0.0173 480 HOH A O   
3694 O  O   . HOH E .   ? 0.1125 0.1118 0.1173 0.0171  0.0194  0.0077  481 HOH A O   
3695 O  O   . HOH E .   ? 0.1391 0.1122 0.1183 -0.0020 -0.0118 0.0034  482 HOH A O   
3696 O  O   . HOH E .   ? 0.1139 0.1752 0.1222 -0.0007 -0.0038 -0.0183 483 HOH A O   
3697 O  O   . HOH E .   ? 0.1428 0.1419 0.1374 0.0186  -0.0364 -0.0346 484 HOH A O   
3698 O  O   . HOH E .   ? 0.1378 0.2001 0.1427 0.0525  0.0159  0.0298  485 HOH A O   
3699 O  O   . HOH E .   ? 0.1372 0.1733 0.1377 -0.0191 -0.0144 -0.0327 486 HOH A O   
3700 O  O   . HOH E .   ? 0.2246 0.1198 0.1277 -0.0052 0.0286  -0.0204 487 HOH A O   
3701 O  O   . HOH E .   ? 0.1707 0.1528 0.1659 0.0150  -0.0456 0.0177  488 HOH A O   
3702 O  O   . HOH E .   ? 0.1619 0.1796 0.1701 0.0389  0.0118  0.0308  489 HOH A O   
3703 O  O   . HOH E .   ? 0.1570 0.1800 0.1338 -0.0140 0.0068  0.0022  490 HOH A O   
3704 O  O   . HOH E .   ? 0.1573 0.1771 0.2092 0.0001  -0.0896 -0.0251 491 HOH A O   
3705 O  O   . HOH E .   ? 0.2471 0.1347 0.1418 -0.0175 -0.0013 -0.0249 492 HOH A O   
3706 O  O   . HOH E .   ? 0.2115 0.1872 0.1388 0.0228  0.0463  0.0438  493 HOH A O   
3707 O  O   . HOH E .   ? 0.1852 0.2282 0.1585 -0.0380 0.0211  0.0144  494 HOH A O   
3708 O  O   . HOH E .   ? 0.1706 0.1242 0.2390 -0.0214 -0.0441 -0.0100 495 HOH A O   
3709 O  O   . HOH E .   ? 0.2311 0.2109 0.2385 -0.0364 0.0010  -0.0929 496 HOH A O   
3710 O  O   . HOH E .   ? 0.1475 0.1537 0.2030 -0.0267 -0.0296 0.0400  497 HOH A O   
3711 O  O   . HOH E .   ? 0.1730 0.1517 0.1846 0.0104  -0.0211 0.0175  498 HOH A O   
3712 O  O   . HOH E .   ? 0.1852 0.1657 0.1907 0.0090  -0.0025 -0.0424 499 HOH A O   
3713 O  O   . HOH E .   ? 0.2042 0.2641 0.2487 -0.0186 -0.0359 0.1007  500 HOH A O   
3714 O  O   . HOH E .   ? 0.1932 0.2319 0.1592 0.0143  0.0047  0.0645  501 HOH A O   
3715 O  O   . HOH E .   ? 0.1795 0.2824 0.1678 0.0035  0.0503  -0.0096 502 HOH A O   
3716 O  O   . HOH E .   ? 0.2406 0.1475 0.1930 0.0167  -0.1111 -0.0071 503 HOH A O   
3717 O  O   . HOH E .   ? 0.3483 0.1870 0.1978 0.1235  -0.1556 -0.0478 504 HOH A O   
3718 O  O   . HOH E .   ? 0.1766 0.2676 0.1432 -0.0047 0.0192  -0.0225 505 HOH A O   
3719 O  O   . HOH E .   ? 0.1959 0.1802 0.2224 0.0092  -0.0227 -0.0167 506 HOH A O   
3720 O  O   . HOH E .   ? 0.1616 0.2054 0.2396 -0.0361 0.0199  -0.0745 507 HOH A O   
3721 O  O   . HOH E .   ? 0.2434 0.1811 0.1967 0.0782  -0.0683 -0.0045 508 HOH A O   
3722 O  O   . HOH E .   ? 0.1377 0.2161 0.1965 0.0204  0.0215  -0.0067 509 HOH A O   
3723 O  O   . HOH E .   ? 0.2400 0.2012 0.2275 0.0385  -0.0267 -0.0893 510 HOH A O   
3724 O  O   . HOH E .   ? 0.1900 0.2655 0.2626 0.1063  0.0662  0.0934  511 HOH A O   
3725 O  O   . HOH E .   ? 0.1857 0.2313 0.1613 -0.0038 -0.0104 0.0302  512 HOH A O   
3726 O  O   . HOH E .   ? 0.1192 0.4769 0.2114 0.0468  0.0203  0.1034  513 HOH A O   
3727 O  O   . HOH E .   ? 0.2290 0.2304 0.1872 0.0317  0.0109  0.0671  514 HOH A O   
3728 O  O   . HOH E .   ? 0.2959 0.1638 0.2840 -0.0327 -0.0268 -0.0359 515 HOH A O   
3729 O  O   . HOH E .   ? 0.2096 0.3049 0.2936 0.0262  0.0398  0.0018  516 HOH A O   
3730 O  O   . HOH E .   ? 0.5155 0.2559 0.2681 -0.0937 0.0065  0.0233  517 HOH A O   
3731 O  O   . HOH E .   ? 0.2237 0.4743 0.2188 -0.0410 0.0600  0.0377  518 HOH A O   
3732 O  O   . HOH E .   ? 0.2495 0.2517 0.2193 -0.0245 0.0320  -0.0868 519 HOH A O   
3733 O  O   . HOH E .   ? 0.2056 0.3591 0.2833 -0.0582 0.0345  0.0581  520 HOH A O   
3734 O  O   . HOH E .   ? 0.4254 0.2436 0.2908 -0.1264 -0.1476 0.0475  521 HOH A O   
3735 O  O   . HOH E .   ? 0.2043 0.3908 0.2155 0.1109  -0.0699 0.0159  522 HOH A O   
3736 O  O   . HOH E .   ? 0.2319 0.3265 0.2243 0.0614  0.0228  0.1027  523 HOH A O   
3737 O  O   . HOH E .   ? 0.2674 0.2628 0.3403 -0.0111 0.0873  -0.0337 524 HOH A O   
3738 O  O   . HOH E .   ? 0.2304 0.2869 0.3198 -0.0243 0.0295  -0.1233 525 HOH A O   
3739 O  O   . HOH E .   ? 0.2111 0.4780 0.2631 -0.1596 0.0927  -0.0969 526 HOH A O   
3740 O  O   . HOH E .   ? 0.2576 0.2895 0.4111 0.1157  -0.0759 -0.0933 527 HOH A O   
3741 O  O   . HOH E .   ? 0.2699 0.2903 0.3372 -0.0067 -0.0676 -0.0935 528 HOH A O   
3742 O  O   . HOH E .   ? 0.2530 0.2217 0.3544 0.0190  0.0910  -0.0629 529 HOH A O   
3743 O  O   . HOH E .   ? 0.2230 0.2071 0.5663 0.0175  -0.0527 -0.0419 530 HOH A O   
3744 O  O   . HOH E .   ? 0.3058 0.3482 0.2710 0.0728  0.0430  -0.1317 531 HOH A O   
3745 O  O   . HOH E .   ? 0.2420 0.1787 0.4450 -0.0130 -0.1292 0.0464  532 HOH A O   
3746 O  O   . HOH E .   ? 0.3286 0.3557 0.3914 0.0066  0.1285  -0.0538 533 HOH A O   
3747 O  O   . HOH E .   ? 0.5496 0.3898 0.2127 0.1565  -0.0587 -0.1075 534 HOH A O   
3748 O  O   . HOH E .   ? 0.2240 0.4895 0.2265 -0.1130 -0.0023 0.0379  535 HOH A O   
3749 O  O   . HOH E .   ? 0.2212 0.4131 0.2024 0.0009  0.0108  0.0648  536 HOH A O   
3750 O  O   . HOH E .   ? 0.2439 0.3442 0.3767 -0.0383 0.0732  0.1296  537 HOH A O   
3751 O  O   . HOH E .   ? 0.3410 0.3682 0.2793 -0.1173 -0.0635 0.1269  538 HOH A O   
3752 O  O   . HOH E .   ? 0.2618 0.3179 0.2418 -0.0628 -0.0291 0.0010  539 HOH A O   
3753 O  O   . HOH E .   ? 0.4948 0.2439 0.2055 -0.1496 -0.0065 -0.0595 540 HOH A O   
3754 O  O   . HOH E .   ? 0.4109 0.1642 0.3880 -0.0141 -0.0862 -0.0718 541 HOH A O   
3755 O  O   . HOH E .   ? 0.4015 0.3160 0.3281 0.0372  -0.1675 0.0183  542 HOH A O   
3756 O  O   . HOH E .   ? 0.2791 0.2261 0.2942 -0.0261 -0.0097 0.0372  543 HOH A O   
3757 O  O   . HOH E .   ? 0.4147 0.2994 0.2872 -0.0739 -0.0035 -0.0466 544 HOH A O   
3758 O  O   . HOH E .   ? 0.3004 0.4046 0.2535 -0.1991 -0.0081 0.0637  545 HOH A O   
3759 O  O   . HOH E .   ? 0.2064 0.3543 0.4870 0.0496  -0.0640 -0.0062 546 HOH A O   
3760 O  O   . HOH E .   ? 0.1998 0.4320 0.4222 -0.0200 0.0067  -0.0372 547 HOH A O   
3761 O  O   . HOH E .   ? 0.1829 0.3451 0.7258 0.0200  0.0671  -0.1200 548 HOH A O   
3762 O  O   . HOH E .   ? 0.4619 0.2093 0.3710 0.0523  -0.0754 -0.0100 549 HOH A O   
3763 O  O   . HOH E .   ? 0.2485 0.4689 0.4142 0.1824  -0.0234 -0.0880 550 HOH A O   
3764 O  O   B HOH E .   ? 0.2455 0.2195 0.3478 -0.0581 0.0443  0.0312  551 HOH A O   
3765 O  O   . HOH E .   ? 0.3031 0.3224 0.1564 -0.0773 -0.1234 0.0252  552 HOH A O   
3766 O  O   . HOH E .   ? 0.1929 0.2198 0.2211 -0.0913 0.0146  -0.0718 553 HOH A O   
3767 O  O   . HOH E .   ? 0.3950 0.2532 0.4687 0.0407  -0.1067 0.0163  554 HOH A O   
3768 O  O   . HOH E .   ? 0.2883 0.2550 0.2773 0.0564  -0.0579 -0.0686 555 HOH A O   
3769 O  O   . HOH E .   ? 0.3574 0.4670 0.6277 0.2287  0.0566  -0.1426 556 HOH A O   
3770 O  O   . HOH E .   ? 0.1292 0.1927 0.1946 -0.0204 -0.0096 0.0552  557 HOH A O   
3771 O  O   . HOH E .   ? 0.1595 0.1662 0.2502 0.0009  0.0076  -0.0568 558 HOH A O   
3772 O  O   . HOH E .   ? 0.3233 0.2917 0.3971 -0.1583 -0.0385 0.0251  559 HOH A O   
3773 O  O   . HOH E .   ? 0.4095 0.1870 0.4694 -0.0411 -0.2285 0.0007  560 HOH A O   
3774 O  O   . HOH E .   ? 0.4123 0.3098 0.2111 0.2262  -0.0439 -0.0824 561 HOH A O   
3775 O  O   . HOH E .   ? 0.2469 0.2758 0.2045 -0.1661 -0.1016 0.1049  562 HOH A O   
3776 O  O   . HOH E .   ? 0.2483 0.2374 0.4037 -0.0363 0.1323  0.0510  563 HOH A O   
3777 O  O   . HOH E .   ? 0.1710 0.3035 0.1210 -0.0555 0.0222  -0.0602 564 HOH A O   
3778 O  O   . HOH E .   ? 0.2621 0.1485 0.1398 0.0311  -0.0134 -0.0336 565 HOH A O   
3779 O  O   . HOH E .   ? 0.3535 0.2867 0.2069 -0.0349 0.0282  0.0370  566 HOH A O   
3780 O  O   . HOH E .   ? 0.2701 0.3787 0.3107 0.0147  -0.1016 -0.0326 567 HOH A O   
3781 O  O   . HOH E .   ? 0.2893 0.1965 0.2140 0.0279  -0.0637 -0.0485 568 HOH A O   
3782 O  O   . HOH E .   ? 0.3412 0.1096 0.2350 -0.0219 -0.1574 0.0570  569 HOH A O   
3783 O  O   . HOH E .   ? 0.2391 0.2958 0.6290 -0.0026 -0.0813 0.0511  570 HOH A O   
3784 O  O   . HOH E .   ? 0.2230 0.2447 0.3964 0.0576  -0.0097 -0.1083 571 HOH A O   
3785 O  O   . HOH E .   ? 0.2049 0.1890 0.2358 -0.0921 0.1112  -0.1057 572 HOH A O   
3786 O  O   . HOH E .   ? 0.2939 0.2070 0.4158 -0.0801 0.1484  -0.0179 573 HOH A O   
3787 O  O   . HOH E .   ? 0.1598 0.3533 0.3267 0.1273  0.0204  0.0609  574 HOH A O   
3788 O  O   . HOH E .   ? 0.3049 0.3265 0.3739 -0.0356 -0.1046 0.0978  575 HOH A O   
3789 O  O   . HOH E .   ? 0.2747 0.4597 0.1877 0.0830  -0.0069 -0.0292 576 HOH A O   
3790 O  O   . HOH E .   ? 0.4128 0.3614 0.5358 0.0472  -0.1389 -0.0004 577 HOH A O   
3791 O  O   . HOH E .   ? 0.2830 0.3597 0.2394 -0.1116 -0.0061 0.0567  578 HOH A O   
3792 O  O   . HOH E .   ? 0.3008 0.3480 0.4015 0.0462  0.0005  0.0123  579 HOH A O   
3793 O  O   . HOH E .   ? 0.2183 0.2983 0.4232 -0.0526 -0.0486 -0.0377 580 HOH A O   
3794 O  O   . HOH E .   ? 0.3147 0.1961 0.3224 -0.0799 -0.0860 0.0100  581 HOH A O   
3795 O  O   . HOH E .   ? 0.1726 0.4539 0.1449 0.0924  0.0752  0.0988  582 HOH A O   
3796 O  O   . HOH E .   ? 0.4367 0.2118 0.3667 -0.1255 -0.0875 -0.0668 583 HOH A O   
3797 O  O   . HOH E .   ? 0.3266 0.3464 0.3267 0.1566  -0.0814 -0.0288 584 HOH A O   
3798 O  O   . HOH E .   ? 0.4689 0.2138 0.1154 -0.1581 -0.0890 0.0569  585 HOH A O   
3799 O  O   . HOH E .   ? 0.3871 0.3514 0.2501 0.0201  -0.1347 -0.0470 586 HOH A O   
3800 O  O   . HOH E .   ? 0.1478 0.3491 0.3613 -0.0574 -0.0146 -0.0633 587 HOH A O   
3801 O  O   . HOH E .   ? 0.2475 0.1794 0.1919 0.0079  -0.0068 0.0037  588 HOH A O   
3802 O  O   . HOH E .   ? 0.2188 0.2939 0.1858 -0.0660 -0.0353 0.0503  589 HOH A O   
3803 O  O   . HOH E .   ? 0.3858 0.2059 0.2730 -0.0281 -0.0514 -0.0561 590 HOH A O   
3804 O  O   . HOH E .   ? 0.2248 0.5637 0.4385 0.1598  0.1583  0.1215  591 HOH A O   
3805 O  O   . HOH E .   ? 0.2751 0.2920 0.5105 0.1471  -0.0611 0.0052  592 HOH A O   
3806 O  O   . HOH E .   ? 0.2228 0.2456 0.2430 0.0596  0.0293  0.0534  593 HOH A O   
3807 O  O   . HOH E .   ? 0.0973 0.4469 0.2139 -0.0405 0.0478  0.0144  594 HOH A O   
3808 O  O   . HOH E .   ? 0.5404 0.2619 0.4060 -0.1890 0.1010  -0.0690 595 HOH A O   
3809 O  O   . HOH E .   ? 0.1808 0.1579 0.3222 -0.0469 -0.0299 0.0636  596 HOH A O   
3810 O  O   . HOH E .   ? 0.1792 0.3437 0.2328 -0.0500 0.0335  -0.1221 597 HOH A O   
3811 O  O   . HOH E .   ? 0.2451 0.3723 0.3684 0.0377  0.0279  -0.2617 598 HOH A O   
3812 O  O   . HOH E .   ? 0.3367 0.2990 0.3260 0.0796  0.1065  0.1244  599 HOH A O   
3813 O  O   . HOH E .   ? 0.3539 0.3341 0.3829 -0.1013 -0.1791 0.2073  600 HOH A O   
3814 O  O   . HOH E .   ? 0.2077 0.2258 0.3273 0.0951  -0.0286 0.0225  601 HOH A O   
3815 O  O   . HOH E .   ? 0.3428 0.1854 0.2192 -0.0814 0.0236  -0.0391 602 HOH A O   
3816 O  O   . HOH E .   ? 0.2049 0.2628 0.2770 0.1406  0.1162  0.1858  603 HOH A O   
3817 O  O   . HOH E .   ? 0.2883 0.4228 0.3104 -0.0128 0.1020  0.0643  604 HOH A O   
3818 O  O   . HOH E .   ? 0.3781 0.2412 0.4757 0.1880  0.0904  -0.1587 605 HOH A O   
3819 O  O   . HOH E .   ? 0.2646 0.1902 0.3207 -0.0117 0.1458  -0.0777 606 HOH A O   
3820 O  O   . HOH E .   ? 0.3421 0.3887 0.5319 -0.1363 0.0215  -0.1169 607 HOH A O   
3821 O  O   . HOH E .   ? 0.4955 0.2280 0.2010 0.1630  -0.0034 0.0192  608 HOH A O   
3822 O  O   . HOH E .   ? 0.3458 0.2537 0.2773 -0.0609 0.0081  -0.0935 609 HOH A O   
3823 O  O   . HOH E .   ? 0.4435 0.3525 0.1902 -0.2468 0.0863  -0.1490 610 HOH A O   
3824 O  O   . HOH E .   ? 0.2259 0.3686 0.2257 0.0515  0.0828  0.0845  611 HOH A O   
3825 O  O   . HOH E .   ? 0.3609 0.2999 0.2657 0.0820  0.1936  0.0577  612 HOH A O   
3826 O  O   . HOH E .   ? 0.3433 0.2071 0.4922 -0.0173 0.2012  0.1155  613 HOH A O   
3827 O  O   . HOH E .   ? 0.3270 0.2963 0.1764 -0.0304 -0.0313 -0.0599 614 HOH A O   
3828 O  O   . HOH E .   ? 0.1508 0.4472 0.2210 0.0971  0.0049  -0.1123 615 HOH A O   
3829 O  O   . HOH E .   ? 0.6508 0.6849 0.7613 -0.0520 -0.0234 -0.0518 616 HOH A O   
3830 O  O   . HOH E .   ? 0.2976 0.2263 0.2338 -0.0540 -0.0039 -0.1225 617 HOH A O   
3831 O  O   . HOH E .   ? 0.2212 0.1914 0.1946 0.0993  0.0531  0.0541  618 HOH A O   
3832 O  O   . HOH E .   ? 0.3700 0.3328 0.4795 -0.1209 -0.1544 0.0545  619 HOH A O   
3833 O  O   . HOH E .   ? 0.2063 0.2690 0.4639 -0.0060 -0.0683 0.1293  620 HOH A O   
3834 O  O   . HOH E .   ? 0.4575 0.2278 0.2388 0.1315  0.2171  0.0780  621 HOH A O   
3835 O  O   . HOH E .   ? 0.3196 0.1462 0.5781 -0.1138 0.0625  -0.0672 622 HOH A O   
3836 O  O   . HOH E .   ? 0.2975 0.2511 0.1879 0.0561  0.0159  -0.0412 623 HOH A O   
3837 O  O   . HOH E .   ? 0.1456 0.4624 0.3923 -0.0357 -0.0767 0.2885  624 HOH A O   
3838 O  O   . HOH E .   ? 0.2919 0.4299 0.2071 -0.1810 -0.0891 0.1130  625 HOH A O   
3839 O  O   . HOH E .   ? 0.2677 0.1576 0.3551 -0.0377 0.0854  0.0022  626 HOH A O   
3840 O  O   . HOH E .   ? 0.3445 0.3312 0.3572 0.0845  0.1761  -0.1174 627 HOH A O   
3841 O  O   . HOH E .   ? 0.4180 0.2223 0.3398 -0.0533 -0.0090 -0.0486 628 HOH A O   
3842 O  O   . HOH E .   ? 0.3194 0.2558 0.2385 -0.1094 0.0816  0.0727  629 HOH A O   
3843 O  O   . HOH E .   ? 0.2702 0.2269 0.3893 -0.0359 0.0310  -0.1531 630 HOH A O   
3844 O  O   . HOH E .   ? 0.2192 0.6139 0.2383 0.0604  0.1184  -0.0425 631 HOH A O   
3845 O  O   . HOH E .   ? 0.1751 0.2709 0.2041 -0.0962 0.0839  -0.0565 632 HOH A O   
3846 O  O   . HOH E .   ? 0.2792 0.1996 0.3965 0.1161  -0.0949 -0.0093 633 HOH A O   
3847 O  O   . HOH E .   ? 0.1761 0.3383 0.2561 -0.1017 0.0001  -0.0231 634 HOH A O   
3848 O  O   . HOH E .   ? 0.3509 0.3586 0.2308 -0.0413 0.0627  -0.0138 635 HOH A O   
3849 O  O   . HOH E .   ? 0.2774 0.5203 0.4034 -0.1686 0.0565  0.0169  636 HOH A O   
3850 O  O   . HOH E .   ? 0.2312 0.2564 0.2568 0.0452  0.0310  -0.0500 637 HOH A O   
3851 O  O   . HOH E .   ? 0.3657 0.2252 0.6317 0.1453  0.0298  0.0032  638 HOH A O   
3852 O  O   . HOH E .   ? 0.2852 0.3702 0.2001 0.1340  -0.1205 -0.0753 639 HOH A O   
3853 O  O   . HOH E .   ? 0.3539 0.3635 0.3834 0.0205  -0.2051 -0.0895 640 HOH A O   
3854 O  O   . HOH E .   ? 0.3469 0.1329 0.4336 0.0700  -0.1957 -0.0993 641 HOH A O   
3855 O  O   . HOH E .   ? 0.1505 0.3979 0.2710 0.0550  -0.0412 0.0992  642 HOH A O   
3856 O  O   . HOH E .   ? 0.2758 0.2474 0.1874 -0.0879 0.0171  0.0073  643 HOH A O   
3857 O  O   . HOH E .   ? 0.2991 0.2990 0.2423 0.0678  0.0915  -0.0534 644 HOH A O   
3858 O  O   . HOH E .   ? 0.3359 0.3073 0.4839 -0.0891 -0.0667 0.0632  645 HOH A O   
3859 O  O   . HOH E .   ? 0.1561 0.6057 0.3205 0.0132  0.0100  0.0204  646 HOH A O   
3860 O  O   . HOH E .   ? 0.6318 0.3304 0.3885 -0.1045 -0.0602 -0.1271 647 HOH A O   
3861 O  O   . HOH E .   ? 0.2833 0.2999 0.3102 -0.0207 0.0211  -0.0980 648 HOH A O   
3862 O  O   . HOH E .   ? 0.2007 0.5626 0.4077 -0.0997 -0.0338 0.0218  649 HOH A O   
3863 O  O   . HOH E .   ? 0.2196 0.2644 0.1872 0.1278  0.0242  -0.0312 650 HOH A O   
3864 O  O   . HOH E .   ? 0.4488 0.3147 0.3004 0.0744  -0.0045 0.0586  651 HOH A O   
3865 O  O   . HOH E .   ? 0.3809 0.2666 0.3788 -0.1647 0.1401  -0.1067 652 HOH A O   
3866 O  O   . HOH E .   ? 0.1069 0.1690 0.1291 -0.0286 0.0120  -0.0007 653 HOH A O   
3867 O  O   . HOH E .   ? 0.1538 0.2081 0.2302 -0.0380 0.0068  -0.0538 654 HOH A O   
3868 O  O   . HOH E .   ? 0.1973 0.2513 0.2654 -0.0610 0.0361  0.0181  655 HOH A O   
3869 O  O   . HOH E .   ? 0.2936 0.1608 0.1936 0.0007  -0.0354 -0.0007 656 HOH A O   
3870 O  O   . HOH E .   ? 0.2112 0.2566 0.3587 0.0446  0.0772  0.0443  657 HOH A O   
3871 O  O   . HOH E .   ? 0.1896 0.1885 0.2085 0.0413  0.0156  -0.0004 658 HOH A O   
3872 O  O   . HOH E .   ? 0.1102 0.1802 0.1486 0.0094  0.0174  0.0633  659 HOH A O   
3873 O  O   B HOH E .   ? 0.1278 0.3023 0.1427 -0.0091 0.0046  -0.0477 660 HOH A O   
3874 O  O   . HOH E .   ? 0.2048 0.1584 0.1906 0.0030  -0.0161 0.0032  661 HOH A O   
3875 O  O   . HOH E .   ? 0.1752 0.2547 0.2668 0.1124  0.0024  -0.0437 662 HOH A O   
3876 O  O   . HOH E .   ? 0.2189 0.1472 0.1830 -0.0427 -0.0149 -0.0099 663 HOH A O   
3877 O  O   . HOH E .   ? 0.1893 0.2672 0.2620 -0.0483 -0.0081 0.0680  664 HOH A O   
3878 O  O   . HOH E .   ? 0.3136 0.2668 0.4076 -0.0626 0.0080  -0.1728 665 HOH A O   
3879 O  O   . HOH E .   ? 0.2638 0.2078 0.1552 -0.0221 -0.0515 -0.0091 666 HOH A O   
3880 O  O   . HOH E .   ? 0.2798 0.3144 0.1588 -0.0111 0.0308  -0.0525 667 HOH A O   
3881 O  O   . HOH E .   ? 0.1656 0.2872 0.2130 0.0156  0.0342  0.0483  668 HOH A O   
3882 O  O   . HOH E .   ? 0.2799 0.1740 0.3658 0.0280  0.0400  -0.0577 669 HOH A O   
3883 O  O   . HOH E .   ? 0.1896 0.4212 0.1669 0.0931  0.0144  0.0441  670 HOH A O   
3884 O  O   . HOH E .   ? 0.2186 0.2467 0.2214 -0.0347 -0.0274 -0.1065 671 HOH A O   
3885 O  O   . HOH E .   ? 0.1822 0.4212 0.2010 -0.0541 0.0301  0.0156  672 HOH A O   
3886 O  O   . HOH E .   ? 0.2118 0.3705 0.2498 0.0893  0.0221  -0.1155 673 HOH A O   
3887 O  O   . HOH E .   ? 0.3942 0.2707 0.2488 0.0728  -0.0602 -0.0533 674 HOH A O   
3888 O  O   . HOH E .   ? 0.2867 0.3579 0.2383 -0.0712 -0.0379 -0.0491 675 HOH A O   
3889 O  O   . HOH E .   ? 0.5002 0.2989 0.3382 -0.0445 0.0063  -0.0477 676 HOH A O   
3890 O  O   . HOH E .   ? 0.2667 0.2326 0.1070 0.0061  -0.0549 -0.0398 677 HOH A O   
3891 O  O   . HOH E .   ? 0.1499 0.1593 0.2995 -0.0515 -0.0409 0.0437  678 HOH A O   
3892 O  O   . HOH E .   ? 0.2337 0.2371 0.2042 0.1136  0.0306  0.0163  679 HOH A O   
3893 O  O   . HOH E .   ? 0.2179 0.1827 0.1615 -0.0064 0.0118  -0.0480 680 HOH A O   
3894 O  O   . HOH E .   ? 0.2872 0.3182 0.3454 0.0826  -0.0559 -0.0466 681 HOH A O   
3895 O  O   . HOH E .   ? 0.3284 0.3052 0.2390 0.0014  -0.1177 0.0414  682 HOH A O   
3896 O  O   A HOH E .   ? 0.1944 0.2607 0.2162 0.0359  0.0643  -0.0578 683 HOH A O   
3897 O  O   . HOH F .   ? 0.1410 0.1946 0.1361 0.0230  0.0412  0.0152  207 HOH B O   
3898 O  O   . HOH F .   ? 0.1746 0.2101 0.1762 0.0234  -0.0249 -0.0319 208 HOH B O   
3899 O  O   . HOH F .   ? 0.1399 0.2503 0.1198 -0.0144 0.0031  0.0562  209 HOH B O   
3900 O  O   . HOH F .   ? 0.2193 0.2457 0.2004 0.0250  -0.0165 -0.0603 210 HOH B O   
3901 O  O   . HOH F .   ? 0.5019 0.2292 0.3218 0.0457  -0.2012 -0.0227 211 HOH B O   
3902 O  O   . HOH F .   ? 0.4383 0.4330 0.5573 -0.0228 -0.1827 -0.0335 212 HOH B O   
3903 O  O   . HOH F .   ? 0.5210 0.3871 0.3835 0.1282  -0.0092 -0.1703 213 HOH B O   
3904 O  O   . HOH F .   ? 0.3237 0.3486 0.1458 0.0687  0.1024  -0.0063 214 HOH B O   
3905 O  O   . HOH F .   ? 0.2454 0.2457 0.2966 -0.0393 0.0502  -0.0614 215 HOH B O   
3906 O  O   . HOH F .   ? 0.3501 0.3818 0.4026 0.1168  0.2067  -0.0880 216 HOH B O   
3907 O  O   . HOH F .   ? 0.3416 0.3641 0.1986 -0.0685 0.0341  -0.0301 217 HOH B O   
3908 O  O   . HOH F .   ? 0.1689 0.1209 0.1390 -0.0007 0.0191  -0.0031 218 HOH B O   
3909 O  O   . HOH F .   ? 0.0786 0.1115 0.0731 0.0064  -0.0037 -0.0083 219 HOH B O   
3910 O  O   . HOH F .   ? 0.1348 0.1343 0.1099 -0.0099 0.0113  0.0053  220 HOH B O   
3911 O  O   . HOH F .   ? 0.1477 0.1271 0.0978 -0.0041 -0.0034 0.0133  221 HOH B O   
3912 O  O   . HOH F .   ? 0.0843 0.1195 0.0757 0.0085  0.0000  0.0003  222 HOH B O   
3913 O  O   . HOH F .   ? 0.1377 0.1336 0.0949 0.0061  -0.0086 0.0019  223 HOH B O   
3914 O  O   . HOH F .   ? 0.1521 0.1636 0.1729 0.0363  -0.0097 -0.0063 224 HOH B O   
3915 O  O   . HOH F .   ? 0.1047 0.1089 0.0824 0.0177  0.0088  0.0022  225 HOH B O   
3916 O  O   . HOH F .   ? 0.0822 0.1178 0.1052 -0.0001 0.0018  -0.0068 226 HOH B O   
3917 O  O   . HOH F .   ? 0.3458 0.2682 0.2568 0.1379  0.0689  0.0434  227 HOH B O   
3918 O  O   . HOH F .   ? 0.0967 0.1204 0.1088 0.0068  -0.0084 -0.0161 228 HOH B O   
3919 O  O   . HOH F .   ? 0.1538 0.1676 0.1435 0.0604  0.0289  0.0393  229 HOH B O   
3920 O  O   . HOH F .   ? 0.1895 0.2110 0.1747 0.0368  -0.0144 0.0190  230 HOH B O   
3921 O  O   . HOH F .   ? 0.1091 0.1118 0.1175 0.0034  -0.0194 0.0030  231 HOH B O   
3922 O  O   . HOH F .   ? 0.1208 0.1318 0.1183 0.0023  -0.0053 -0.0170 232 HOH B O   
3923 O  O   . HOH F .   ? 0.1151 0.1355 0.0845 0.0085  0.0029  0.0066  233 HOH B O   
3924 O  O   . HOH F .   ? 0.1081 0.1241 0.0869 0.0180  -0.0069 0.0065  234 HOH B O   
3925 O  O   . HOH F .   ? 0.1350 0.2367 0.1514 0.0589  -0.0257 0.0220  235 HOH B O   
3926 O  O   . HOH F .   ? 0.1441 0.1599 0.1158 0.0102  -0.0028 -0.0109 236 HOH B O   
3927 O  O   . HOH F .   ? 0.1400 0.1707 0.1531 0.0123  0.0056  -0.0476 237 HOH B O   
3928 O  O   . HOH F .   ? 0.1185 0.1226 0.1061 -0.0090 -0.0157 -0.0108 238 HOH B O   
3929 O  O   . HOH F .   ? 0.1395 0.2061 0.1117 0.0258  -0.0052 0.0117  239 HOH B O   
3930 O  O   . HOH F .   ? 0.1662 0.1794 0.1022 0.0303  -0.0233 -0.0226 240 HOH B O   
3931 O  O   . HOH F .   ? 0.1531 0.1566 0.1161 -0.0115 0.0023  -0.0206 241 HOH B O   
3932 O  O   . HOH F .   ? 0.1787 0.1532 0.1109 -0.0116 -0.0025 0.0096  242 HOH B O   
3933 O  O   . HOH F .   ? 0.1462 0.2159 0.1208 0.0460  -0.0071 0.0343  243 HOH B O   
3934 O  O   . HOH F .   ? 0.1090 0.1256 0.0908 0.0145  0.0043  0.0054  244 HOH B O   
3935 O  O   . HOH F .   ? 0.1776 0.1359 0.1054 0.0076  -0.0263 -0.0018 245 HOH B O   
3936 O  O   . HOH F .   ? 0.3071 0.3766 0.3756 0.0548  0.0801  0.1916  246 HOH B O   
3937 O  O   . HOH F .   ? 0.2062 0.2627 0.1218 0.0229  -0.0310 -0.0366 247 HOH B O   
3938 O  O   . HOH F .   ? 0.1603 0.2311 0.1155 0.0422  -0.0272 -0.0201 248 HOH B O   
3939 O  O   . HOH F .   ? 0.1139 0.1304 0.0945 0.0072  0.0121  0.0095  249 HOH B O   
3940 O  O   . HOH F .   ? 0.2407 0.2182 0.1368 0.0601  -0.0017 0.0243  250 HOH B O   
3941 O  O   . HOH F .   ? 0.1789 0.1411 0.1046 0.0244  -0.0123 0.0119  251 HOH B O   
3942 O  O   . HOH F .   ? 0.2681 0.2403 0.5133 0.0037  0.1178  -0.2056 252 HOH B O   
3943 O  O   . HOH F .   ? 0.1401 0.1458 0.1273 -0.0072 -0.0262 0.0041  253 HOH B O   
3944 O  O   . HOH F .   ? 0.0979 0.1709 0.1544 0.0189  -0.0033 0.0202  254 HOH B O   
3945 O  O   . HOH F .   ? 0.4148 0.3496 0.1785 -0.0826 -0.0943 -0.0628 255 HOH B O   
3946 O  O   . HOH F .   ? 0.2328 0.1575 0.2630 0.0106  0.0278  -0.0871 256 HOH B O   
3947 O  O   . HOH F .   ? 0.1200 0.1785 0.1037 0.0540  0.0081  0.0194  257 HOH B O   
3948 O  O   . HOH F .   ? 0.2846 0.3116 0.4489 -0.0565 0.2027  -0.0277 258 HOH B O   
3949 O  O   . HOH F .   ? 0.1004 0.1582 0.1287 0.0043  -0.0097 0.0101  259 HOH B O   
3950 O  O   . HOH F .   ? 0.1345 0.1838 0.1030 0.0125  -0.0235 0.0115  260 HOH B O   
3951 O  O   . HOH F .   ? 0.1240 0.2356 0.1385 0.0385  -0.0158 0.0324  261 HOH B O   
3952 O  O   . HOH F .   ? 0.1825 0.2605 0.1939 0.0369  0.0039  0.0312  262 HOH B O   
3953 O  O   . HOH F .   ? 0.1799 0.1761 0.1135 -0.0145 -0.0052 -0.0277 263 HOH B O   
3954 O  O   . HOH F .   ? 0.2552 0.1567 0.1450 -0.0594 0.0131  0.0183  264 HOH B O   
3955 O  O   . HOH F .   ? 0.1268 0.2114 0.1255 -0.0037 -0.0075 -0.0257 265 HOH B O   
3956 O  O   . HOH F .   ? 0.1650 0.1762 0.1239 0.0075  -0.0102 0.0118  266 HOH B O   
3957 O  O   . HOH F .   ? 0.1405 0.2041 0.1285 0.0373  0.0063  0.0591  267 HOH B O   
3958 O  O   . HOH F .   ? 0.1518 0.1727 0.1304 0.0145  -0.0495 0.0454  268 HOH B O   
3959 O  O   . HOH F .   ? 0.1104 0.1855 0.1112 0.0147  0.0079  0.0183  269 HOH B O   
3960 O  O   . HOH F .   ? 0.1177 0.1565 0.1638 0.0035  0.0163  0.0273  270 HOH B O   
3961 O  O   . HOH F .   ? 0.1017 0.1520 0.1323 0.0217  0.0077  0.0198  271 HOH B O   
3962 O  O   . HOH F .   ? 0.1699 0.1976 0.1438 0.0523  -0.0241 0.0078  272 HOH B O   
3963 O  O   . HOH F .   ? 0.1090 0.1658 0.1223 -0.0023 0.0131  -0.0113 273 HOH B O   
3964 O  O   . HOH F .   ? 0.4207 0.4348 0.4258 -0.0355 -0.1798 -0.0812 274 HOH B O   
3965 O  O   . HOH F .   ? 0.2578 0.1741 0.2426 -0.0034 0.0099  0.0508  275 HOH B O   
3966 O  O   . HOH F .   ? 0.1641 0.1865 0.1012 0.0180  -0.0166 -0.0091 276 HOH B O   
3967 O  O   . HOH F .   ? 0.1414 0.1368 0.2061 0.0294  -0.0319 -0.0075 277 HOH B O   
3968 O  O   . HOH F .   ? 0.1431 0.1441 0.1794 0.0027  -0.0055 -0.0013 278 HOH B O   
3969 O  O   . HOH F .   ? 0.1380 0.1945 0.1127 0.0158  0.0000  -0.0119 279 HOH B O   
3970 O  O   . HOH F .   ? 0.1475 0.1858 0.1265 0.0224  0.0130  -0.0345 280 HOH B O   
3971 O  O   . HOH F .   ? 0.1266 0.1657 0.1249 0.0087  0.0231  -0.0021 281 HOH B O   
3972 O  O   . HOH F .   ? 0.1147 0.1453 0.1234 0.0092  0.0149  0.0155  282 HOH B O   
3973 O  O   . HOH F .   ? 0.1165 0.2024 0.1684 -0.0063 0.0238  -0.0663 283 HOH B O   
3974 O  O   . HOH F .   ? 0.1770 0.1972 0.1627 0.0103  -0.0334 0.0736  284 HOH B O   
3975 O  O   . HOH F .   ? 0.1663 0.1917 0.1407 -0.0006 -0.0044 -0.0240 285 HOH B O   
3976 O  O   . HOH F .   ? 0.2178 0.2144 0.2890 0.0125  -0.0118 -0.0451 286 HOH B O   
3977 O  O   . HOH F .   ? 0.1267 0.1550 0.1759 0.0014  0.0008  0.0150  287 HOH B O   
3978 O  O   . HOH F .   ? 0.3096 0.3373 0.2973 -0.0920 -0.0216 -0.0386 288 HOH B O   
3979 O  O   . HOH F .   ? 0.3251 0.3212 0.4274 -0.0776 -0.0070 -0.0996 289 HOH B O   
3980 O  O   . HOH F .   ? 0.1855 0.1997 0.1329 -0.0418 0.0268  -0.0227 290 HOH B O   
3981 O  O   . HOH F .   ? 0.1133 0.2518 0.1251 0.0333  0.0242  0.0291  291 HOH B O   
3982 O  O   . HOH F .   ? 0.1247 0.2031 0.1224 -0.0174 -0.0054 0.0034  292 HOH B O   
3983 O  O   . HOH F .   ? 0.1805 0.1629 0.1620 0.0226  -0.0250 -0.0018 293 HOH B O   
3984 O  O   . HOH F .   ? 0.1661 0.2290 0.1179 0.0257  -0.0153 0.0298  294 HOH B O   
3985 O  O   . HOH F .   ? 0.2477 0.3019 0.2453 -0.0644 0.0840  -0.0066 295 HOH B O   
3986 O  O   . HOH F .   ? 0.2099 0.2077 0.2143 0.0199  0.0620  -0.0387 296 HOH B O   
3987 O  O   . HOH F .   ? 0.1260 0.1892 0.1187 -0.0005 -0.0066 0.0247  297 HOH B O   
3988 O  O   . HOH F .   ? 0.1744 0.1925 0.1274 -0.0360 -0.0401 0.0536  298 HOH B O   
3989 O  O   . HOH F .   ? 0.1793 0.1670 0.2201 -0.0468 0.0378  -0.0630 299 HOH B O   
3990 O  O   . HOH F .   ? 0.1416 0.2139 0.1973 -0.0401 -0.0081 0.0310  300 HOH B O   
3991 O  O   . HOH F .   ? 0.1939 0.1578 0.1276 0.0566  -0.0300 -0.0178 301 HOH B O   
3992 O  O   . HOH F .   ? 0.2126 0.1664 0.1298 -0.0277 -0.0155 -0.0119 302 HOH B O   
3993 O  O   . HOH F .   ? 0.1770 0.1585 0.1841 -0.0012 0.0244  0.0012  303 HOH B O   
3994 O  O   . HOH F .   ? 0.1605 0.1773 0.1554 0.0247  0.0124  0.0056  304 HOH B O   
3995 O  O   . HOH F .   ? 0.2861 0.2743 0.4754 0.0315  -0.0201 0.1001  305 HOH B O   
3996 O  O   . HOH F .   ? 0.1486 0.2112 0.1988 0.0253  0.0148  0.0011  306 HOH B O   
3997 O  O   . HOH F .   ? 0.1595 0.1753 0.1092 -0.0113 0.0074  -0.0018 307 HOH B O   
3998 O  O   . HOH F .   ? 0.2815 0.2689 0.5178 0.1102  -0.1137 -0.0802 308 HOH B O   
3999 O  O   . HOH F .   ? 0.3132 0.3153 0.1613 -0.0940 -0.0557 0.0373  309 HOH B O   
4000 O  O   . HOH F .   ? 0.2368 0.2588 0.1555 0.0391  0.0133  -0.0667 310 HOH B O   
4001 O  O   . HOH F .   ? 0.2776 0.3462 0.2185 0.0374  0.0552  -0.0329 311 HOH B O   
4002 O  O   . HOH F .   ? 0.2917 0.2888 0.1617 -0.0288 0.0818  -0.0212 312 HOH B O   
4003 O  O   . HOH F .   ? 0.1319 0.1616 0.1396 0.0133  0.0010  0.0296  313 HOH B O   
4004 O  O   . HOH F .   ? 0.1719 0.2798 0.3578 0.0033  -0.0248 -0.0815 314 HOH B O   
4005 O  O   . HOH F .   ? 0.3179 0.2516 0.2825 0.0470  -0.0791 0.0604  315 HOH B O   
4006 O  O   . HOH F .   ? 0.2619 0.2617 0.1807 0.0263  -0.0269 -0.0984 316 HOH B O   
4007 O  O   . HOH F .   ? 0.1462 0.1879 0.2631 0.0436  0.0392  0.0666  317 HOH B O   
4008 O  O   . HOH F .   ? 0.1979 0.1508 0.2276 -0.0195 -0.0795 0.0273  318 HOH B O   
4009 O  O   . HOH F .   ? 0.1988 0.2038 0.1699 -0.0183 -0.0426 0.0447  319 HOH B O   
4010 O  O   . HOH F .   ? 0.2181 0.4280 0.2573 -0.0419 0.0163  0.0660  320 HOH B O   
4011 O  O   . HOH F .   ? 0.3631 0.2175 0.3056 0.0390  0.0721  0.0765  321 HOH B O   
4012 O  O   . HOH F .   ? 0.2128 0.3796 0.1994 0.1040  -0.0399 0.0095  322 HOH B O   
4013 O  O   . HOH F .   ? 0.1797 0.2490 0.1429 0.0459  -0.0239 -0.0121 323 HOH B O   
4014 O  O   . HOH F .   ? 0.3015 0.4535 0.1452 0.1429  0.0411  -0.0480 324 HOH B O   
4015 O  O   . HOH F .   ? 0.2745 0.2283 0.1828 0.0695  -0.0029 -0.0715 325 HOH B O   
4016 O  O   . HOH F .   ? 0.2431 0.2288 0.1550 -0.0610 -0.0779 0.0349  326 HOH B O   
4017 O  O   . HOH F .   ? 0.2706 0.2311 0.2452 0.0725  0.0695  0.0505  327 HOH B O   
4018 O  O   . HOH F .   ? 0.1706 0.2286 0.1740 0.0042  -0.0345 -0.0473 328 HOH B O   
4019 O  O   . HOH F .   ? 0.1699 0.3113 0.4134 0.1302  0.0245  0.0374  329 HOH B O   
4020 O  O   . HOH F .   ? 0.1647 0.2707 0.2292 0.0419  0.0194  0.0911  330 HOH B O   
4021 O  O   . HOH F .   ? 0.1490 0.2092 0.2588 -0.0355 -0.0472 0.0588  331 HOH B O   
4022 O  O   . HOH F .   ? 0.1177 0.1699 0.2866 0.0120  0.0086  0.0128  332 HOH B O   
4023 O  O   . HOH F .   ? 0.2851 0.2511 0.4628 0.0637  -0.0327 -0.0222 333 HOH B O   
4024 O  O   . HOH F .   ? 0.2511 0.2521 0.1580 -0.0905 -0.0280 0.0154  334 HOH B O   
4025 O  O   . HOH F .   ? 0.3046 0.1427 0.2470 0.0006  0.0947  -0.0195 335 HOH B O   
4026 O  O   . HOH F .   ? 0.3771 0.3339 0.2206 -0.0345 -0.1122 -0.0794 336 HOH B O   
4027 O  O   . HOH F .   ? 0.3087 0.2320 0.2923 0.1343  -0.0442 -0.0118 337 HOH B O   
4028 O  O   . HOH F .   ? 0.2921 0.2598 0.2347 0.0762  -0.0049 0.0918  338 HOH B O   
4029 O  O   . HOH F .   ? 0.1555 0.2491 0.2567 0.0745  0.0464  -0.0046 339 HOH B O   
4030 O  O   . HOH F .   ? 0.3132 0.2732 0.2036 0.0752  0.0506  -0.0659 340 HOH B O   
4031 O  O   . HOH F .   ? 0.2891 0.2571 0.1513 0.0115  -0.0147 -0.0345 341 HOH B O   
4032 O  O   . HOH F .   ? 0.2751 0.3295 0.2726 0.0185  -0.1918 -0.0944 342 HOH B O   
4033 O  O   . HOH F .   ? 0.2568 0.4201 0.3355 0.1009  -0.0100 0.0117  343 HOH B O   
4034 O  O   . HOH F .   ? 0.1646 0.2986 0.2316 0.0763  -0.0563 -0.0702 344 HOH B O   
4035 O  O   . HOH F .   ? 0.2980 0.1582 0.3409 0.0681  0.1175  0.0218  345 HOH B O   
4036 O  O   . HOH F .   ? 0.1821 0.2165 0.2356 -0.0329 -0.0068 -0.0798 346 HOH B O   
4037 O  O   . HOH F .   ? 0.1362 0.2565 0.3715 0.0028  0.0397  -0.0727 347 HOH B O   
4038 O  O   . HOH F .   ? 0.2195 0.2949 0.2223 0.0339  0.0440  0.1021  348 HOH B O   
4039 O  O   . HOH F .   ? 0.2017 0.4211 0.1996 0.0029  0.0489  0.0197  349 HOH B O   
4040 O  O   . HOH F .   ? 0.2262 0.2866 0.1706 0.0435  0.0554  -0.0335 350 HOH B O   
4041 O  O   . HOH F .   ? 0.2659 0.1467 0.1680 -0.0077 -0.0497 -0.0071 351 HOH B O   
4042 O  O   . HOH F .   ? 0.1554 0.2453 0.1415 -0.0012 0.0210  0.0302  352 HOH B O   
4043 O  O   . HOH F .   ? 0.4811 0.2655 0.2428 0.0978  0.0461  -0.1212 353 HOH B O   
4044 O  O   . HOH F .   ? 0.4207 0.2404 0.4673 -0.0656 0.2441  -0.0673 354 HOH B O   
4045 O  O   . HOH F .   ? 0.3717 0.4271 0.3261 -0.0130 -0.1265 -0.1417 355 HOH B O   
4046 O  O   . HOH F .   ? 0.3897 0.2956 0.3594 0.1449  -0.0960 0.0326  356 HOH B O   
4047 O  O   . HOH F .   ? 0.3662 0.2109 0.2344 -0.0022 0.0389  -0.0260 357 HOH B O   
4048 O  O   . HOH F .   ? 0.2118 0.2627 0.1439 -0.0206 0.0556  0.0257  358 HOH B O   
4049 O  O   . HOH F .   ? 0.2125 0.3259 0.2255 0.0299  -0.0193 -0.0219 359 HOH B O   
4050 O  O   . HOH F .   ? 0.2269 0.1750 0.1399 -0.0318 0.0448  -0.0308 360 HOH B O   
4051 O  O   . HOH F .   ? 0.4750 0.4625 0.2974 0.2832  -0.0668 0.0466  361 HOH B O   
4052 O  O   . HOH F .   ? 0.2258 0.4327 0.1625 0.1658  0.0447  0.1167  362 HOH B O   
4053 O  O   . HOH F .   ? 0.2622 0.2074 0.3273 0.0292  0.0906  -0.0833 363 HOH B O   
4054 O  O   . HOH F .   ? 0.2790 0.2848 0.2550 -0.0944 0.0685  -0.0208 364 HOH B O   
4055 O  O   A HOH F .   ? 0.3617 0.2855 0.2251 -0.0489 0.0631  -0.0261 365 HOH B O   
4056 O  O   . HOH F .   ? 0.1590 0.2055 0.2044 -0.0167 0.0163  -0.0197 366 HOH B O   
4057 O  O   . HOH F .   ? 0.1948 0.1959 0.1423 -0.0312 0.0202  0.0077  367 HOH B O   
4058 O  O   . HOH F .   ? 0.2868 0.3423 0.2066 0.1296  -0.0319 0.0595  368 HOH B O   
4059 O  O   . HOH F .   ? 0.4858 0.3184 0.2498 0.0751  -0.0893 -0.0514 369 HOH B O   
4060 O  O   . HOH F .   ? 0.2259 0.1776 0.2343 0.0115  0.0382  0.0056  370 HOH B O   
4061 O  O   . HOH F .   ? 0.1818 0.2300 0.5096 -0.0280 0.0577  -0.1345 371 HOH B O   
4062 O  O   . HOH F .   ? 0.3443 0.3268 0.1880 0.0763  0.0130  0.0326  372 HOH B O   
4063 O  O   . HOH F .   ? 0.3072 0.2210 0.2603 0.0342  0.0125  -0.0740 373 HOH B O   
4064 O  O   . HOH F .   ? 0.1954 0.3728 0.1924 0.0656  0.0088  -0.0634 374 HOH B O   
4065 O  O   . HOH F .   ? 0.3511 0.4220 0.2622 0.0027  -0.0762 0.0392  375 HOH B O   
4066 O  O   . HOH F .   ? 0.3788 0.2761 0.4446 0.0301  0.0563  -0.0581 376 HOH B O   
4067 O  O   . HOH F .   ? 0.1188 0.2804 0.2421 0.0015  -0.0169 0.1196  377 HOH B O   
4068 O  O   . HOH F .   ? 0.3233 0.3296 0.1604 0.0440  0.0190  -0.0165 378 HOH B O   
4069 O  O   . HOH F .   ? 0.2696 0.1927 0.2882 -0.0089 -0.0392 0.0207  379 HOH B O   
4070 O  O   . HOH F .   ? 0.1716 0.2140 0.2421 0.0355  -0.0227 -0.0045 380 HOH B O   
4071 O  O   . HOH F .   ? 0.2093 0.1865 0.1706 0.0153  -0.0194 -0.0316 381 HOH B O   
4072 O  O   . HOH F .   ? 0.2728 0.1799 0.2291 0.0422  -0.0434 -0.0103 382 HOH B O   
4073 O  O   . HOH F .   ? 0.3530 0.2358 0.2908 0.0172  0.0661  0.0651  383 HOH B O   
4074 O  O   . HOH F .   ? 0.2364 0.2723 0.2597 0.0125  -0.0157 0.0839  384 HOH B O   
4075 O  O   . HOH F .   ? 0.4930 0.5659 0.3114 0.0272  -0.1662 -0.0391 385 HOH B O   
4076 O  O   . HOH F .   ? 0.2402 0.2702 0.3128 -0.0886 -0.0073 0.0166  386 HOH B O   
4077 O  O   . HOH F .   ? 0.3270 0.2439 0.2330 0.0057  0.1044  0.0449  387 HOH B O   
4078 O  O   . HOH F .   ? 0.2646 0.2672 0.4362 -0.0034 -0.0305 -0.0731 388 HOH B O   
4079 O  O   . HOH F .   ? 0.2382 0.3516 0.3906 -0.1174 -0.0721 0.1173  389 HOH B O   
4080 O  O   . HOH F .   ? 0.3486 0.2886 0.2767 0.0707  0.0031  -0.0386 390 HOH B O   
4081 O  O   . HOH F .   ? 0.1773 0.4245 0.2817 -0.0164 0.0214  0.0685  391 HOH B O   
4082 O  O   . HOH F .   ? 0.2504 0.2671 0.3153 -0.0393 0.1185  -0.0333 392 HOH B O   
4083 O  O   . HOH F .   ? 0.2102 0.2848 0.3062 0.0577  0.1003  0.0064  393 HOH B O   
4084 O  O   . HOH F .   ? 0.3298 0.3644 0.1000 0.0432  -0.0633 0.0197  394 HOH B O   
4085 O  O   . HOH F .   ? 0.2381 0.3905 0.2411 -0.0376 -0.0139 -0.1546 395 HOH B O   
4086 O  O   . HOH F .   ? 0.2191 0.1804 0.2666 0.0478  0.0134  0.0020  396 HOH B O   
4087 O  O   . HOH F .   ? 0.3982 0.4654 0.2577 0.0475  0.0407  -0.1135 397 HOH B O   
4088 O  O   . HOH F .   ? 0.2864 0.2095 0.3066 -0.0061 0.1008  -0.0592 398 HOH B O   
4089 O  O   . HOH F .   ? 0.1847 0.3708 0.3354 -0.0270 -0.0562 0.0660  399 HOH B O   
4090 O  O   . HOH F .   ? 0.2509 0.2286 0.3534 -0.1080 -0.0974 -0.0270 400 HOH B O   
4091 O  O   A HOH F .   ? 0.2649 0.2692 0.2197 0.0836  -0.0736 -0.0192 401 HOH B O   
4092 O  O   . HOH F .   ? 0.1927 0.3290 0.3168 -0.0432 0.0715  -0.0869 402 HOH B O   
4093 O  O   . HOH F .   ? 0.3353 0.6005 0.3439 0.1797  0.0175  -0.0015 403 HOH B O   
4094 O  O   . HOH F .   ? 0.0971 0.1611 0.1081 0.0113  -0.0097 -0.0119 404 HOH B O   
4095 O  O   . HOH F .   ? 0.5386 0.1818 0.3699 0.0048  -0.0226 0.0148  405 HOH B O   
4096 O  O   . HOH F .   ? 0.1642 0.3094 0.3623 -0.0021 0.0913  0.0505  406 HOH B O   
4097 O  O   . HOH F .   ? 0.2607 0.4094 0.3382 0.1195  0.0207  -0.0218 407 HOH B O   
4098 O  O   A HOH F .   ? 0.2690 0.1963 0.1766 -0.0394 0.0320  -0.0017 408 HOH B O   
4099 O  O   . HOH F .   ? 0.4670 0.2583 0.2437 0.0792  -0.0497 -0.1238 409 HOH B O   
4100 O  O   . HOH F .   ? 0.2511 0.2137 0.1805 -0.0180 0.0796  0.0119  410 HOH B O   
4101 O  O   . HOH F .   ? 0.3747 0.3042 0.2111 -0.0025 0.0612  -0.0123 411 HOH B O   
4102 O  O   . HOH F .   ? 0.3766 0.3015 0.2549 0.0435  0.1417  -0.0154 412 HOH B O   
4103 O  O   . HOH F .   ? 0.1768 0.1909 0.3208 -0.0703 0.0129  -0.0798 413 HOH B O   
4104 O  O   . HOH F .   ? 0.1106 0.1571 0.1354 0.0084  0.0077  0.0153  414 HOH B O   
4105 O  O   . HOH F .   ? 0.2446 0.3286 0.3271 0.0063  0.0666  0.1222  415 HOH B O   
4106 O  O   . HOH F .   ? 0.2267 0.4984 0.3518 -0.0081 0.0414  -0.0598 416 HOH B O   
4107 O  O   . HOH F .   ? 0.2789 0.3284 0.2985 -0.0422 -0.0671 0.1189  417 HOH B O   
4108 O  O   . HOH F .   ? 0.5795 0.3768 0.1380 -0.0098 0.0321  -0.0566 418 HOH B O   
4109 O  O   . HOH F .   ? 0.2124 0.2558 0.2482 0.0242  0.0278  -0.0704 419 HOH B O   
4110 O  O   . HOH F .   ? 0.3161 0.3737 0.2275 -0.1212 0.0350  -0.0236 420 HOH B O   
4111 O  O   . HOH F .   ? 0.2110 0.2808 0.2591 0.0390  -0.0224 0.0457  421 HOH B O   
4112 O  O   . HOH F .   ? 0.3389 0.4040 0.3445 -0.0047 0.1956  0.0585  422 HOH B O   
4113 O  O   . HOH F .   ? 0.1765 0.4595 0.2197 -0.1342 -0.0094 0.1367  423 HOH B O   
4114 O  O   . HOH F .   ? 0.1050 0.1836 0.1304 0.0107  -0.0097 0.0048  424 HOH B O   
4115 O  O   . HOH F .   ? 0.1796 0.2513 0.2039 -0.0111 0.0566  -0.0281 425 HOH B O   
4116 O  O   . HOH F .   ? 0.3122 0.2267 0.3561 -0.0256 0.1504  -0.0078 426 HOH B O   
4117 O  O   . HOH F .   ? 0.1415 0.1922 0.1805 0.0171  -0.0060 0.0046  427 HOH B O   
4118 O  O   . HOH F .   ? 0.3058 0.2867 0.4494 0.0633  0.1257  0.0003  428 HOH B O   
4119 O  O   . HOH F .   ? 0.3326 0.2099 0.3515 -0.0554 -0.1333 0.0925  429 HOH B O   
4120 O  O   . HOH F .   ? 0.4132 0.1919 0.1145 -0.0389 -0.0510 0.0258  430 HOH B O   
4121 O  O   . HOH F .   ? 0.2875 0.5427 0.1738 0.1541  -0.0560 -0.0833 431 HOH B O   
4122 O  O   . HOH F .   ? 0.2284 0.2999 0.4160 0.0582  -0.0458 -0.0258 432 HOH B O   
4123 O  O   . HOH F .   ? 0.3452 0.3368 0.2209 -0.0100 0.0409  -0.0308 433 HOH B O   
4124 O  O   . HOH F .   ? 0.1499 0.3573 0.4018 -0.0664 0.0127  0.1247  434 HOH B O   
4125 O  O   . HOH F .   ? 0.2553 0.3083 0.2988 -0.0721 0.1046  -0.1491 435 HOH B O   
4126 O  O   . HOH F .   ? 0.1937 0.2880 0.3201 -0.0899 0.0345  -0.1328 436 HOH B O   
4127 O  O   . HOH F .   ? 0.1926 0.2305 0.2159 -0.0354 -0.0059 -0.0050 437 HOH B O   
4128 O  O   . HOH F .   ? 0.2127 0.2871 0.2071 -0.0469 0.0227  -0.0411 438 HOH B O   
4129 O  O   . HOH F .   ? 0.5866 0.2939 0.4543 0.1351  0.0273  0.1949  439 HOH B O   
4130 O  O   . HOH F .   ? 0.2800 0.3139 0.2148 0.0586  0.0451  -0.1325 440 HOH B O   
4131 O  O   . HOH F .   ? 0.3827 0.2009 0.3525 0.0432  0.0770  -0.0936 441 HOH B O   
4132 O  O   . HOH F .   ? 0.1848 0.2882 0.2604 -0.0979 -0.0310 0.0090  442 HOH B O   
4133 O  O   . HOH F .   ? 0.1935 0.2606 0.1619 0.0429  -0.0222 -0.0819 443 HOH B O   
4134 O  O   . HOH F .   ? 0.1811 0.3522 0.1938 -0.0366 0.0109  -0.0957 444 HOH B O   
4135 O  O   . HOH F .   ? 0.4686 0.3403 0.3267 -0.0807 -0.0225 -0.0150 445 HOH B O   
4136 O  O   . HOH F .   ? 0.2545 0.3120 0.2408 0.0620  0.0171  -0.0945 446 HOH B O   
4137 O  O   . HOH F .   ? 0.3013 0.2726 0.1483 -0.1189 0.0140  -0.0324 447 HOH B O   
4138 O  O   . HOH F .   ? 0.1190 0.1982 0.2957 0.0151  -0.0231 -0.0068 448 HOH B O   
4139 O  O   . HOH F .   ? 0.1570 0.4499 0.2088 0.0259  0.0939  -0.0929 449 HOH B O   
4140 O  O   . HOH F .   ? 0.1611 0.5316 0.1792 -0.0753 -0.0122 0.1992  450 HOH B O   
4141 O  O   . HOH F .   ? 0.3943 0.3784 0.1592 0.0131  -0.0043 -0.1125 451 HOH B O   
4142 O  O   . HOH F .   ? 0.2272 0.3312 0.1377 0.0177  -0.0650 0.0183  452 HOH B O   
4143 O  O   . HOH F .   ? 0.3038 0.3369 0.2470 -0.0720 -0.0635 -0.0883 453 HOH B O   
4144 O  O   . HOH F .   ? 0.1773 0.2052 0.1828 -0.0193 -0.0145 -0.0154 454 HOH B O   
4145 O  O   . HOH F .   ? 0.1679 0.3207 0.1876 -0.0195 -0.0015 -0.0687 455 HOH B O   
4146 O  O   . HOH F .   ? 0.3233 0.4401 0.3635 0.0253  0.0666  -0.0330 456 HOH B O   
4147 O  O   . HOH F .   ? 0.2481 0.2162 0.1344 -0.0542 -0.0157 0.0039  457 HOH B O   
4148 O  O   . HOH F .   ? 0.2833 0.2693 0.3129 0.1268  0.0549  0.0181  458 HOH B O   
4149 O  O   . HOH F .   ? 0.1565 0.2300 0.1846 0.0213  -0.0022 -0.0155 459 HOH B O   
4150 O  O   . HOH F .   ? 0.2896 0.1460 0.4976 0.0309  -0.1164 -0.0562 460 HOH B O   
4151 O  O   . HOH F .   ? 0.3131 0.2226 0.2378 0.0855  -0.0037 -0.0209 461 HOH B O   
4152 O  O   . HOH F .   ? 0.2158 0.2580 0.3942 -0.0422 0.0556  -0.1150 462 HOH B O   
4153 O  O   . HOH F .   ? 0.2177 0.1087 0.5152 -0.0267 -0.0641 0.0592  463 HOH B O   
4154 O  O   . HOH F .   ? 0.3705 0.3447 0.2268 0.0737  -0.0047 0.0568  464 HOH B O   
4155 O  O   . HOH F .   ? 0.2375 0.3181 0.2761 0.0265  0.0885  0.0838  465 HOH B O   
4156 O  O   B HOH F .   ? 0.2393 0.2479 0.1875 -0.0117 -0.0728 -0.0169 466 HOH B O   
4157 O  O   . HOH F .   ? 0.4070 0.2677 0.2738 -0.0146 0.0724  0.0316  467 HOH B O   
4158 O  O   . HOH F .   ? 0.0783 0.1055 0.0647 0.0072  -0.0062 -0.0033 468 HOH B O   
4159 O  O   . HOH F .   ? 0.0897 0.1753 0.1361 0.0181  -0.0164 -0.0040 469 HOH B O   
4160 O  O   . HOH F .   ? 0.1004 0.1516 0.1216 -0.0116 0.0087  0.0015  470 HOH B O   
4161 O  O   . HOH F .   ? 0.0878 0.1685 0.1110 0.0044  -0.0017 -0.0045 471 HOH B O   
4162 O  O   . HOH F .   ? 0.1126 0.1326 0.1444 0.0096  0.0344  -0.0020 472 HOH B O   
4163 O  O   . HOH F .   ? 0.0870 0.2187 0.1219 0.0007  0.0099  0.0235  473 HOH B O   
4164 O  O   . HOH F .   ? 0.1257 0.1428 0.1289 -0.0066 0.0168  0.0022  474 HOH B O   
4165 O  O   . HOH F .   ? 0.1276 0.1746 0.1187 -0.0018 0.0201  -0.0116 475 HOH B O   
4166 O  O   . HOH F .   ? 0.1145 0.2095 0.1157 0.0270  0.0096  0.0139  476 HOH B O   
4167 O  O   . HOH F .   ? 0.1310 0.2439 0.1476 0.0139  -0.0105 0.0073  477 HOH B O   
4168 O  O   . HOH F .   ? 0.1364 0.1910 0.1370 -0.0067 -0.0184 -0.0240 478 HOH B O   
4169 O  O   . HOH F .   ? 0.1394 0.2004 0.1563 0.0304  -0.0133 -0.0573 479 HOH B O   
4170 O  O   . HOH F .   ? 0.1234 0.1770 0.1738 -0.0081 0.0184  -0.0100 480 HOH B O   
4171 O  O   . HOH F .   ? 0.1457 0.2126 0.1507 -0.0375 -0.0220 0.0491  481 HOH B O   
4172 O  O   . HOH F .   ? 0.2171 0.1808 0.1547 0.0188  -0.0212 -0.0092 482 HOH B O   
4173 O  O   . HOH F .   ? 0.1916 0.2259 0.1153 -0.0595 -0.0561 -0.0033 483 HOH B O   
4174 O  O   . HOH F .   ? 0.1534 0.1677 0.1728 0.0217  -0.0043 0.0102  484 HOH B O   
4175 O  O   . HOH F .   ? 0.2291 0.2180 0.1401 0.0194  0.0302  0.0308  485 HOH B O   
4176 O  O   . HOH F .   ? 0.1643 0.1945 0.1582 0.0095  0.0319  0.0188  486 HOH B O   
4177 O  O   . HOH F .   ? 0.1621 0.2056 0.1638 -0.0544 -0.0013 -0.0198 487 HOH B O   
4178 O  O   . HOH F .   ? 0.1864 0.1702 0.1033 0.0049  -0.0115 0.0211  488 HOH B O   
4179 O  O   . HOH F .   ? 0.1558 0.2053 0.1583 0.0342  -0.0192 -0.0039 489 HOH B O   
4180 O  O   . HOH F .   ? 0.1447 0.2425 0.2213 -0.0329 -0.0046 -0.0032 490 HOH B O   
4181 O  O   . HOH F .   ? 0.1734 0.1826 0.2050 -0.0386 0.0339  -0.0268 491 HOH B O   
4182 O  O   . HOH F .   ? 0.2040 0.3090 0.1619 -0.0588 0.0018  -0.0891 492 HOH B O   
4183 O  O   . HOH F .   ? 0.1768 0.2409 0.2087 -0.0058 0.0133  -0.0152 493 HOH B O   
4184 O  O   . HOH F .   ? 0.1500 0.3377 0.2180 0.0297  -0.0210 0.0076  494 HOH B O   
4185 O  O   . HOH F .   ? 0.1717 0.3569 0.2516 0.0779  0.0267  0.0256  495 HOH B O   
4186 O  O   . HOH F .   ? 0.1933 0.2372 0.1889 -0.0178 0.0489  0.0606  496 HOH B O   
4187 O  O   . HOH F .   ? 0.3746 0.2352 0.2035 -0.0501 -0.0006 0.0253  497 HOH B O   
4188 O  O   . HOH F .   ? 0.2968 0.3855 0.1997 0.1164  0.0398  0.0669  498 HOH B O   
4189 O  O   . HOH F .   ? 0.1930 0.2129 0.1861 0.0091  0.0027  0.0391  499 HOH B O   
4190 O  O   . HOH F .   ? 0.3457 0.2854 0.2212 -0.1450 -0.1073 0.0015  500 HOH B O   
4191 O  O   . HOH F .   ? 0.2307 0.3882 0.2228 0.0529  0.0175  -0.0180 501 HOH B O   
4192 O  O   . HOH F .   ? 0.2806 0.2390 0.1941 0.0546  0.0611  -0.0015 502 HOH B O   
4193 O  O   . HOH F .   ? 0.2060 0.2901 0.2681 0.1000  -0.0111 -0.0143 503 HOH B O   
4194 O  O   . HOH F .   ? 0.2728 0.4108 0.2258 0.1176  -0.0221 -0.0668 504 HOH B O   
4195 O  O   . HOH F .   ? 0.2738 0.3009 0.1492 0.1188  -0.0402 -0.0631 505 HOH B O   
4196 O  O   . HOH F .   ? 0.3085 0.2243 0.2779 0.0564  0.0377  0.0796  506 HOH B O   
4197 O  O   . HOH F .   ? 0.2358 0.2710 0.2180 -0.0030 -0.0534 0.0217  507 HOH B O   
4198 O  O   . HOH F .   ? 0.3938 0.2146 0.2063 0.0957  0.0853  0.0216  508 HOH B O   
4199 O  O   . HOH F .   ? 0.3366 0.3630 0.2341 -0.0122 0.1031  -0.0496 509 HOH B O   
4200 O  O   . HOH F .   ? 0.2873 0.2596 0.2258 0.0229  0.0213  0.0484  510 HOH B O   
4201 O  O   . HOH F .   ? 0.2380 0.2084 0.3172 0.0165  -0.1227 -0.0177 511 HOH B O   
4202 O  O   . HOH F .   ? 0.3621 0.3157 0.5645 -0.1337 -0.1884 0.0881  512 HOH B O   
4203 O  O   . HOH F .   ? 0.2793 0.2379 0.3903 -0.0542 0.1070  -0.0645 513 HOH B O   
4204 O  O   . HOH F .   ? 0.3694 0.2696 0.4832 -0.0203 0.0650  -0.1711 514 HOH B O   
4205 O  O   . HOH F .   ? 0.2915 0.4113 0.2832 -0.1846 0.0431  0.0366  515 HOH B O   
4206 O  O   . HOH F .   ? 0.1980 0.2592 0.3300 -0.0226 -0.0286 0.0831  516 HOH B O   
4207 O  O   . HOH F .   ? 0.4699 0.3093 0.3407 -0.1157 0.0601  0.0520  517 HOH B O   
4208 O  O   . HOH F .   ? 0.1460 0.4425 0.3405 0.0198  0.0376  0.2192  518 HOH B O   
4209 O  O   . HOH F .   ? 0.2281 0.4996 0.4169 0.0776  -0.0312 -0.1319 519 HOH B O   
4210 O  O   . HOH F .   ? 0.2497 0.2820 0.3111 0.0565  -0.0577 0.0377  520 HOH B O   
4211 O  O   . HOH F .   ? 0.3700 0.2447 0.3496 0.0296  0.0305  -0.0728 521 HOH B O   
4212 O  O   . HOH F .   ? 0.2663 0.3125 0.2098 -0.0436 -0.0011 -0.0011 522 HOH B O   
4213 O  O   . HOH F .   ? 0.3734 0.3936 0.2743 -0.1115 0.0610  -0.0400 523 HOH B O   
4214 O  O   . HOH F .   ? 0.5007 0.2551 0.1975 -0.1076 0.0584  -0.0290 524 HOH B O   
4215 O  O   . HOH F .   ? 0.5266 0.3806 0.2183 0.0621  -0.0772 0.0808  525 HOH B O   
4216 O  O   . HOH F .   ? 0.3320 0.3921 0.1671 -0.0901 -0.0338 0.0176  526 HOH B O   
4217 O  O   . HOH F .   ? 0.2939 0.4354 0.0945 0.0375  -0.0532 0.0338  527 HOH B O   
4218 O  O   . HOH F .   ? 0.2907 0.2574 0.3848 -0.0552 0.0742  -0.0164 528 HOH B O   
4219 O  O   . HOH F .   ? 0.6042 0.3010 0.2890 -0.0060 0.0518  -0.0631 529 HOH B O   
4220 O  O   . HOH F .   ? 0.1787 0.3944 0.3130 -0.0117 -0.0224 -0.2169 530 HOH B O   
4221 O  O   . HOH F .   ? 0.2417 0.4510 0.3602 0.0012  -0.1692 0.0418  531 HOH B O   
4222 O  O   . HOH F .   ? 0.3175 0.2580 0.2677 -0.0338 0.0152  0.1079  532 HOH B O   
4223 O  O   . HOH F .   ? 0.2529 0.2311 0.3385 -0.0505 0.0722  -0.1053 533 HOH B O   
4224 O  O   . HOH F .   ? 0.2877 0.3557 0.2942 -0.1522 0.0849  -0.0769 534 HOH B O   
4225 O  O   . HOH F .   ? 0.3369 0.2415 0.2891 -0.0643 0.1309  -0.0707 535 HOH B O   
4226 O  O   . HOH F .   ? 0.2183 0.2025 0.2857 0.0856  0.0434  -0.0608 536 HOH B O   
4227 O  O   . HOH F .   ? 0.3150 0.4025 0.5403 0.0091  0.0602  0.0485  537 HOH B O   
4228 O  O   . HOH F .   ? 0.1404 0.1942 0.4026 -0.0045 -0.0403 0.0437  538 HOH B O   
4229 O  O   . HOH F .   ? 0.2682 0.1985 0.6282 0.0343  -0.2218 -0.0206 539 HOH B O   
4230 O  O   . HOH F .   ? 0.2738 0.5045 0.3108 -0.0659 -0.0087 -0.0533 540 HOH B O   
4231 O  O   . HOH F .   ? 0.2266 0.3199 0.4524 -0.0134 -0.0435 -0.1407 541 HOH B O   
4232 O  O   . HOH F .   ? 0.4683 0.2394 0.2343 0.0882  0.0259  -0.0005 542 HOH B O   
4233 O  O   . HOH F .   ? 0.3513 0.2047 0.3752 0.1395  0.1246  0.0362  543 HOH B O   
4234 O  O   . HOH F .   ? 0.2499 0.2650 0.4095 0.0304  -0.0494 -0.0166 544 HOH B O   
4235 O  O   . HOH F .   ? 0.4134 0.2203 0.1959 0.0338  0.0272  -0.0300 545 HOH B O   
4236 O  O   . HOH F .   ? 0.2649 0.2543 0.3690 0.1161  0.0914  -0.0370 546 HOH B O   
4237 O  O   . HOH F .   ? 0.3172 0.3279 0.3178 -0.1616 0.0869  -0.0820 547 HOH B O   
4238 O  O   . HOH F .   ? 0.4125 0.3588 0.2146 0.0920  0.0467  -0.1723 548 HOH B O   
4239 O  O   . HOH F .   ? 0.3495 0.3214 0.3548 -0.0660 0.1340  -0.0971 549 HOH B O   
4240 O  O   . HOH F .   ? 0.2739 0.4196 0.1764 0.0436  0.0526  0.0796  550 HOH B O   
4241 O  O   . HOH F .   ? 0.4419 0.4566 0.2923 0.0594  0.1210  0.0307  551 HOH B O   
4242 O  O   . HOH F .   ? 0.2372 0.3311 0.3282 -0.0142 0.0711  0.0065  552 HOH B O   
4243 O  O   . HOH F .   ? 0.4453 0.3750 0.4683 -0.1135 -0.0581 0.1187  553 HOH B O   
4244 O  O   . HOH F .   ? 0.1867 0.3231 0.3526 0.0331  0.1103  0.0314  554 HOH B O   
4245 O  O   . HOH F .   ? 0.4364 0.3068 0.2604 -0.1322 0.0535  -0.0095 555 HOH B O   
4246 O  O   . HOH F .   ? 0.3734 0.2848 0.2761 0.0505  0.0328  -0.1076 556 HOH B O   
4247 O  O   . HOH F .   ? 0.2018 0.4538 0.2549 0.0951  -0.0540 0.0404  557 HOH B O   
4248 O  O   . HOH F .   ? 0.4619 0.3795 0.3674 -0.1399 -0.0787 0.0123  558 HOH B O   
4249 O  O   . HOH F .   ? 0.4795 0.3597 0.1489 0.0488  0.0447  0.0598  559 HOH B O   
4250 O  O   . HOH F .   ? 0.2486 0.3186 0.1930 -0.0330 -0.0274 0.0632  560 HOH B O   
4251 O  O   . HOH F .   ? 0.1803 0.1780 0.1659 -0.0111 -0.0297 -0.0273 561 HOH B O   
4252 O  O   . HOH F .   ? 0.5184 0.2913 0.1636 0.1772  -0.0631 0.0060  562 HOH B O   
4253 O  O   . HOH F .   ? 0.2806 0.1646 0.1338 0.0205  -0.0340 0.0159  563 HOH B O   
4254 O  O   . HOH F .   ? 0.6340 0.4057 0.1808 0.1051  -0.1140 0.0087  564 HOH B O   
4255 O  O   . HOH F .   ? 0.2196 0.2186 0.3141 -0.0832 -0.0580 0.0580  565 HOH B O   
4256 O  O   . HOH F .   ? 0.2866 0.4416 0.3138 -0.0014 0.0643  0.0019  566 HOH B O   
4257 O  O   . HOH F .   ? 0.3112 0.5584 0.3888 0.1703  0.0542  0.1008  567 HOH B O   
4258 O  O   . HOH F .   ? 0.2849 0.3293 0.2166 0.0822  -0.0319 -0.0959 568 HOH B O   
4259 O  O   . HOH F .   ? 0.5134 0.2817 0.4618 -0.0610 0.0732  -0.1682 569 HOH B O   
4260 O  O   . HOH F .   ? 0.2782 0.3277 0.2442 -0.1330 -0.0115 0.0799  570 HOH B O   
4261 O  O   . HOH F .   ? 0.3242 0.3330 0.5507 -0.1627 0.0461  0.0208  571 HOH B O   
4262 O  O   . HOH F .   ? 0.2020 0.3696 0.2277 0.0080  0.1081  -0.0159 572 HOH B O   
4263 O  O   . HOH F .   ? 0.2217 0.1932 0.2437 0.0573  0.0447  -0.0226 573 HOH B O   
4264 O  O   . HOH F .   ? 0.4317 0.4221 0.4407 0.1108  0.0219  -0.0604 574 HOH B O   
4265 O  O   . HOH F .   ? 0.2259 0.2200 0.4887 0.0115  -0.1827 0.0341  575 HOH B O   
4266 O  O   . HOH F .   ? 0.3145 0.3620 0.2924 -0.0137 -0.1965 0.1686  576 HOH B O   
4267 O  O   . HOH F .   ? 0.3563 0.4144 0.5140 0.1011  -0.0024 0.0673  577 HOH B O   
4268 O  O   . HOH F .   ? 0.1711 0.4236 0.1679 -0.0479 -0.1165 0.0015  578 HOH B O   
4269 O  O   . HOH F .   ? 0.1957 0.3366 0.4263 -0.1413 0.0062  -0.1915 579 HOH B O   
4270 O  O   . HOH F .   ? 0.3968 0.4111 0.1668 -0.0492 -0.0516 -0.0299 580 HOH B O   
4271 O  O   . HOH F .   ? 0.4045 0.4494 0.2045 -0.0485 -0.0195 -0.1483 581 HOH B O   
4272 O  O   . HOH F .   ? 0.3985 0.3831 0.2292 -0.0953 0.0103  0.0498  582 HOH B O   
4273 O  O   . HOH F .   ? 0.4166 0.4687 0.2574 0.1240  0.1486  -0.2220 583 HOH B O   
4274 O  O   . HOH F .   ? 0.3802 0.2777 0.2128 0.0151  -0.0402 -0.0081 584 HOH B O   
4275 O  O   . HOH F .   ? 0.5315 0.3055 0.1933 -0.0441 0.0288  0.0920  585 HOH B O   
4276 O  O   . HOH F .   ? 0.3713 0.3692 0.0687 0.1963  0.0090  0.0144  586 HOH B O   
4277 O  O   . HOH F .   ? 0.2926 0.3508 0.4301 -0.0823 0.0336  -0.1143 587 HOH B O   
4278 O  O   . HOH F .   ? 0.4104 0.5035 0.2603 0.1676  -0.0253 0.0501  588 HOH B O   
4279 O  O   . HOH F .   ? 0.3588 0.2162 0.4082 0.1401  0.0146  -0.1192 589 HOH B O   
4280 O  O   . HOH F .   ? 0.4429 0.3175 0.3469 -0.1477 -0.1275 0.2334  590 HOH B O   
4281 O  O   . HOH F .   ? 0.4096 0.1613 0.2972 0.1472  -0.0185 0.0262  591 HOH B O   
4282 O  O   . HOH F .   ? 0.1952 0.3734 0.4206 -0.0457 0.0738  -0.1594 592 HOH B O   
4283 O  O   . HOH F .   ? 0.4761 0.3488 0.4119 -0.0244 -0.1602 0.2662  593 HOH B O   
4284 O  O   . HOH F .   ? 0.2185 0.2603 0.2570 0.0145  -0.0789 -0.1165 594 HOH B O   
4285 O  O   . HOH F .   ? 0.3711 0.3342 0.2189 -0.0284 0.1915  -0.0856 595 HOH B O   
4286 O  O   . HOH F .   ? 0.2998 0.1925 0.3022 -0.0912 -0.0753 0.0219  596 HOH B O   
4287 O  O   . HOH F .   ? 0.4080 0.2987 0.3188 0.0943  0.0808  0.0960  597 HOH B O   
4288 O  O   . HOH F .   ? 0.2425 0.2055 0.3230 0.0100  0.0510  0.0620  598 HOH B O   
4289 O  O   . HOH F .   ? 0.2264 0.3340 0.4436 -0.0675 0.0346  0.1216  599 HOH B O   
4290 O  O   . HOH F .   ? 0.1966 0.3022 0.1842 -0.1006 -0.0291 -0.0811 600 HOH B O   
4291 O  O   . HOH F .   ? 0.3285 0.1890 0.3147 -0.0362 0.0727  0.0581  601 HOH B O   
4292 O  O   . HOH F .   ? 0.1966 0.3412 0.3526 0.0921  0.0763  0.1929  602 HOH B O   
4293 O  O   . HOH F .   ? 0.2382 0.2737 0.2489 0.0040  -0.0513 0.0863  603 HOH B O   
4294 O  O   . HOH F .   ? 0.2509 0.3268 0.4472 0.0531  0.1747  -0.0332 604 HOH B O   
4295 O  O   . HOH F .   ? 0.2001 0.3153 0.2422 0.0051  -0.0602 0.0465  605 HOH B O   
4296 O  O   . HOH F .   ? 0.1481 0.3911 0.3548 -0.0268 0.0879  0.0287  606 HOH B O   
4297 O  O   . HOH F .   ? 0.1618 0.3167 0.3000 0.0104  -0.0355 -0.1720 607 HOH B O   
4298 O  O   . HOH F .   ? 0.1612 0.3258 0.2177 0.0381  -0.0342 0.0493  608 HOH B O   
4299 O  O   . HOH F .   ? 0.3362 0.2242 0.2302 0.0639  -0.0067 0.0799  609 HOH B O   
4300 O  O   . HOH F .   ? 0.2063 0.3121 0.1872 -0.0885 -0.0250 0.0771  610 HOH B O   
4301 O  O   . HOH F .   ? 0.1184 0.3868 0.3998 0.0317  -0.0027 -0.0496 611 HOH B O   
4302 O  O   . HOH F .   ? 0.2816 0.2629 0.3007 -0.0186 -0.0447 0.0358  612 HOH B O   
4303 O  O   . HOH F .   ? 0.3481 0.2212 0.2872 -0.0552 -0.0972 0.0916  613 HOH B O   
4304 O  O   . HOH F .   ? 0.2819 0.1629 0.3603 -0.0120 0.0755  -0.1051 614 HOH B O   
4305 O  O   . HOH F .   ? 0.5723 0.3176 0.2894 0.1712  -0.0273 0.1202  615 HOH B O   
4306 O  O   . HOH F .   ? 0.1995 0.3475 0.3130 -0.0290 0.0952  0.1047  616 HOH B O   
4307 O  O   . HOH F .   ? 0.1403 0.2813 0.4585 -0.0072 -0.0404 -0.0201 617 HOH B O   
4308 O  O   . HOH F .   ? 0.2942 0.3936 0.3787 0.0170  0.0903  0.0341  618 HOH B O   
4309 O  O   . HOH F .   ? 0.3422 0.2612 0.3901 -0.0426 -0.1102 -0.1074 619 HOH B O   
4310 O  O   . HOH F .   ? 0.3359 0.4383 0.2889 0.0285  0.1238  0.1052  620 HOH B O   
4311 O  O   . HOH F .   ? 0.4013 0.4370 0.3569 0.0790  -0.1997 0.0140  621 HOH B O   
4312 O  O   . HOH F .   ? 0.5299 0.2920 0.3473 -0.0976 0.1077  0.0557  622 HOH B O   
4313 O  O   . HOH F .   ? 0.3223 0.5195 0.3083 -0.1421 0.0951  0.0649  623 HOH B O   
4314 O  O   . HOH F .   ? 0.3443 0.3697 0.2819 -0.0050 -0.0810 -0.0306 624 HOH B O   
4315 O  O   . HOH F .   ? 0.3567 0.5387 0.3339 -0.0430 0.0777  -0.1033 625 HOH B O   
4316 O  O   . HOH F .   ? 0.1444 0.1689 0.1756 0.0066  0.0044  0.0088  626 HOH B O   
4317 O  O   . HOH F .   ? 0.1560 0.1648 0.1349 -0.0139 0.0029  -0.0187 627 HOH B O   
4318 O  O   . HOH F .   ? 0.2746 0.2031 0.1450 0.0194  0.0038  0.0558  628 HOH B O   
4319 O  O   A HOH F .   ? 0.2542 0.2326 0.3076 0.0731  0.0111  -0.0351 629 HOH B O   
4320 O  O   B HOH F .   ? 0.1321 0.2050 0.1750 -0.0014 -0.0062 0.0657  630 HOH B O   
4321 O  O   . HOH F .   ? 0.1527 0.1854 0.1355 0.0091  0.0413  0.0416  631 HOH B O   
4322 O  O   . HOH F .   ? 0.2054 0.2659 0.2761 -0.0301 -0.0490 -0.0626 632 HOH B O   
4323 O  O   . HOH F .   ? 0.1988 0.2025 0.2239 0.0167  -0.0113 0.0083  633 HOH B O   
4324 O  O   . HOH F .   ? 0.1628 0.3404 0.2769 0.0479  0.0150  0.0813  634 HOH B O   
4325 O  O   . HOH F .   ? 0.2514 0.3237 0.1434 -0.0231 -0.0686 -0.0544 635 HOH B O   
4326 O  O   . HOH F .   ? 0.1825 0.4163 0.2942 -0.0572 0.0307  -0.0499 636 HOH B O   
4327 O  O   . HOH F .   ? 0.3472 0.3066 0.1737 0.0677  -0.0123 0.0205  637 HOH B O   
4328 O  O   . HOH F .   ? 0.1828 0.3784 0.1384 -0.0469 0.0145  0.0585  638 HOH B O   
4329 O  O   . HOH F .   ? 0.3611 0.2204 0.2748 0.0865  -0.0206 0.0691  639 HOH B O   
4330 O  O   . HOH F .   ? 0.3074 0.1898 0.2553 -0.0476 -0.0860 0.0714  640 HOH B O   
4331 O  O   . HOH F .   ? 0.1768 0.3549 0.1802 -0.0206 0.0264  -0.0117 641 HOH B O   
4332 O  O   . HOH F .   ? 0.2052 0.3630 0.2074 0.0388  -0.0229 -0.0287 642 HOH B O   
4333 O  O   . HOH F .   ? 0.1738 0.3054 0.2161 0.0318  0.0089  0.0818  643 HOH B O   
4334 O  O   . HOH F .   ? 0.1463 0.2133 0.1474 0.0558  -0.0180 -0.0047 644 HOH B O   
4335 O  O   . HOH F .   ? 0.4717 0.2561 0.2093 0.0522  -0.0041 0.0539  645 HOH B O   
4336 O  O   . HOH F .   ? 0.2721 0.2447 0.1921 -0.0177 -0.0010 0.0251  646 HOH B O   
4337 O  O   B HOH F .   ? 0.2405 0.1889 0.1592 0.0255  -0.0110 -0.0007 647 HOH B O   
4338 O  O   . HOH F .   ? 0.2265 0.1926 0.1675 0.0331  -0.0272 -0.0229 648 HOH B O   
4339 O  O   B HOH F .   ? 0.4134 0.2437 0.2388 0.0758  0.1469  0.0137  649 HOH B O   
4340 O  O   . HOH F .   ? 0.3378 0.2527 0.1468 -0.0238 0.0000  -0.0222 650 HOH B O   
4341 O  O   . HOH F .   ? 0.1695 0.2619 0.1578 -0.0279 -0.0127 -0.0066 651 HOH B O   
4342 O  O   . HOH F .   ? 0.2042 0.1956 0.2397 -0.0175 0.0233  -0.0321 652 HOH B O   
4343 O  O   . HOH F .   ? 0.1959 0.1750 0.2405 -0.0490 0.0380  0.0079  653 HOH B O   
4344 O  O   . HOH F .   ? 0.1560 0.3357 0.1704 0.0116  0.0253  0.0610  654 HOH B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   1   SER SER A . n 
A 1 2   TYR 2   2   2   TYR TYR A . n 
A 1 3   THR 3   3   3   THR THR A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   SER 6   6   6   SER SER A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   TYR 9   9   9   TYR TYR A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  TYR 11  11  11  TYR TYR A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  PRO 16  16  16  PRO PRO A . n 
A 1 17  HIS 17  17  17  HIS HIS A . n 
A 1 18  PHE 18  18  18  PHE PHE A . n 
A 1 19  ASP 19  19  19  ASP ASP A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  THR 22  22  22  THR THR A . n 
A 1 23  MET 23  23  23  MET MET A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  HIS 27  27  27  HIS HIS A . n 
A 1 28  THR 28  28  28  THR THR A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  HIS 30  30  30  HIS HIS A . n 
A 1 31  HIS 31  31  31  HIS HIS A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  ASN 36  36  36  ASN ASN A . n 
A 1 37  ASN 37  37  37  ASN ASN A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  PRO 46  46  46  PRO PRO A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  PHE 48  48  48  PHE PHE A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  ASN 50  50  50  ASN ASN A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  ILE 57  57  57  ILE ILE A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  GLN 62  62  62  GLN GLN A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  ASN 74  74  74  ASN ASN A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  HIS 78  78  78  HIS HIS A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  HIS 81  81  81  HIS HIS A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  TRP 85  85  85  TRP TRP A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  THR 92  92  92  THR THR A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 ILE 102 102 102 ILE ILE A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 PHE 106 106 106 PHE PHE A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 ASN 111 111 111 ASN ASN A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 LYS 113 113 113 LYS LYS A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 ARG 123 123 123 ARG ARG A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 SER 126 126 126 SER SER A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 TRP 128 128 128 TRP TRP A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 TRP 130 130 130 TRP TRP A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 LYS 134 134 134 LYS LYS A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ASP 136 136 136 ASP ASP A . n 
A 1 137 LYS 137 137 137 LYS LYS A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 SER 142 142 142 SER SER A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 GLN 146 146 146 GLN GLN A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 MET 151 151 151 MET MET A . n 
A 1 152 GLY 152 152 152 GLY GLY A . n 
A 1 153 GLU 153 153 153 GLU GLU A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 PHE 161 161 161 PHE PHE A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 MET 164 164 164 MET MET A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 ASP 167 167 167 ASP ASP A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 TRP 169 169 169 TRP TRP A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 HIS 171 171 171 HIS HIS A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 PHE 174 174 174 PHE PHE A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 PHE 177 177 177 PHE PHE A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 ASN 179 179 179 ASN ASN A . n 
A 1 180 ARG 180 180 180 ARG ARG A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 PRO 182 182 182 PRO PRO A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 TYR 184 184 184 TYR TYR A . n 
A 1 185 ILE 185 185 185 ILE ILE A . n 
A 1 186 LYS 186 186 186 LYS LYS A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 PHE 188 188 188 PHE PHE A . n 
A 1 189 TRP 189 189 189 TRP TRP A . n 
A 1 190 ASN 190 190 190 ASN ASN A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 VAL 192 192 192 VAL VAL A . n 
A 1 193 ASN 193 193 193 ASN ASN A . n 
A 1 194 TRP 194 194 194 TRP TRP A . n 
A 1 195 ASP 195 195 195 ASP ASP A . n 
A 1 196 GLU 196 196 196 GLU GLU A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 ALA 198 198 198 ALA ALA A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 ARG 200 200 200 ARG ARG A . n 
A 1 201 PHE 201 201 201 PHE PHE A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 LYS 204 204 204 LYS LYS A . n 
A 1 205 LYS 205 205 205 LYS LYS A . n 
B 1 1   SER 1   1   1   SER SER B . n 
B 1 2   TYR 2   2   2   TYR TYR B . n 
B 1 3   THR 3   3   3   THR THR B . n 
B 1 4   LEU 4   4   4   LEU LEU B . n 
B 1 5   PRO 5   5   5   PRO PRO B . n 
B 1 6   SER 6   6   6   SER SER B . n 
B 1 7   LEU 7   7   7   LEU LEU B . n 
B 1 8   PRO 8   8   8   PRO PRO B . n 
B 1 9   TYR 9   9   9   TYR TYR B . n 
B 1 10  ALA 10  10  10  ALA ALA B . n 
B 1 11  TYR 11  11  11  TYR TYR B . n 
B 1 12  ASP 12  12  12  ASP ASP B . n 
B 1 13  ALA 13  13  13  ALA ALA B . n 
B 1 14  LEU 14  14  14  LEU LEU B . n 
B 1 15  GLU 15  15  15  GLU GLU B . n 
B 1 16  PRO 16  16  16  PRO PRO B . n 
B 1 17  HIS 17  17  17  HIS HIS B . n 
B 1 18  PHE 18  18  18  PHE PHE B . n 
B 1 19  ASP 19  19  19  ASP ASP B . n 
B 1 20  LYS 20  20  20  LYS LYS B . n 
B 1 21  GLN 21  21  21  GLN GLN B . n 
B 1 22  THR 22  22  22  THR THR B . n 
B 1 23  MET 23  23  23  MET MET B . n 
B 1 24  GLU 24  24  24  GLU GLU B . n 
B 1 25  ILE 25  25  25  ILE ILE B . n 
B 1 26  HIS 26  26  26  HIS HIS B . n 
B 1 27  HIS 27  27  27  HIS HIS B . n 
B 1 28  THR 28  28  28  THR THR B . n 
B 1 29  LYS 29  29  29  LYS LYS B . n 
B 1 30  HIS 30  30  30  HIS HIS B . n 
B 1 31  HIS 31  31  31  HIS HIS B . n 
B 1 32  GLN 32  32  32  GLN GLN B . n 
B 1 33  THR 33  33  33  THR THR B . n 
B 1 34  TYR 34  34  34  TYR TYR B . n 
B 1 35  VAL 35  35  35  VAL VAL B . n 
B 1 36  ASN 36  36  36  ASN ASN B . n 
B 1 37  ASN 37  37  37  ASN ASN B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  ASN 39  39  39  ASN ASN B . n 
B 1 40  ALA 40  40  40  ALA ALA B . n 
B 1 41  ALA 41  41  41  ALA ALA B . n 
B 1 42  LEU 42  42  42  LEU LEU B . n 
B 1 43  GLU 43  43  43  GLU GLU B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  LEU 45  45  45  LEU LEU B . n 
B 1 46  PRO 46  46  46  PRO PRO B . n 
B 1 47  GLU 47  47  47  GLU GLU B . n 
B 1 48  PHE 48  48  48  PHE PHE B . n 
B 1 49  ALA 49  49  49  ALA ALA B . n 
B 1 50  ASN 50  50  50  ASN ASN B . n 
B 1 51  LEU 51  51  51  LEU LEU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  VAL 53  53  53  VAL VAL B . n 
B 1 54  GLU 54  54  54  GLU GLU B . n 
B 1 55  GLU 55  55  55  GLU GLU B . n 
B 1 56  LEU 56  56  56  LEU LEU B . n 
B 1 57  ILE 57  57  57  ILE ILE B . n 
B 1 58  THR 58  58  58  THR THR B . n 
B 1 59  LYS 59  59  59  LYS LYS B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  GLN 62  62  62  GLN GLN B . n 
B 1 63  LEU 63  63  63  LEU LEU B . n 
B 1 64  PRO 64  64  64  PRO PRO B . n 
B 1 65  ALA 65  65  65  ALA ALA B . n 
B 1 66  ASP 66  66  66  ASP ASP B . n 
B 1 67  LYS 67  67  67  LYS LYS B . n 
B 1 68  LYS 68  68  68  LYS LYS B . n 
B 1 69  THR 69  69  69  THR THR B . n 
B 1 70  VAL 70  70  70  VAL VAL B . n 
B 1 71  LEU 71  71  71  LEU LEU B . n 
B 1 72  ARG 72  72  72  ARG ARG B . n 
B 1 73  ASN 73  73  73  ASN ASN B . n 
B 1 74  ASN 74  74  74  ASN ASN B . n 
B 1 75  ALA 75  75  75  ALA ALA B . n 
B 1 76  GLY 76  76  76  GLY GLY B . n 
B 1 77  GLY 77  77  77  GLY GLY B . n 
B 1 78  HIS 78  78  78  HIS HIS B . n 
B 1 79  ALA 79  79  79  ALA ALA B . n 
B 1 80  ASN 80  80  80  ASN ASN B . n 
B 1 81  HIS 81  81  81  HIS HIS B . n 
B 1 82  SER 82  82  82  SER SER B . n 
B 1 83  LEU 83  83  83  LEU LEU B . n 
B 1 84  PHE 84  84  84  PHE PHE B . n 
B 1 85  TRP 85  85  85  TRP TRP B . n 
B 1 86  LYS 86  86  86  LYS LYS B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  LEU 88  88  88  LEU LEU B . n 
B 1 89  LYS 89  89  89  LYS LYS B . n 
B 1 90  LYS 90  90  90  LYS LYS B . n 
B 1 91  GLY 91  91  91  GLY GLY B . n 
B 1 92  THR 92  92  92  THR THR B . n 
B 1 93  THR 93  93  93  THR THR B . n 
B 1 94  LEU 94  94  94  LEU LEU B . n 
B 1 95  GLN 95  95  95  GLN GLN B . n 
B 1 96  GLY 96  96  96  GLY GLY B . n 
B 1 97  ASP 97  97  97  ASP ASP B . n 
B 1 98  LEU 98  98  98  LEU LEU B . n 
B 1 99  LYS 99  99  99  LYS LYS B . n 
B 1 100 ALA 100 100 100 ALA ALA B . n 
B 1 101 ALA 101 101 101 ALA ALA B . n 
B 1 102 ILE 102 102 102 ILE ILE B . n 
B 1 103 GLU 103 103 103 GLU GLU B . n 
B 1 104 ARG 104 104 104 ARG ARG B . n 
B 1 105 ASP 105 105 105 ASP ASP B . n 
B 1 106 PHE 106 106 106 PHE PHE B . n 
B 1 107 GLY 107 107 107 GLY GLY B . n 
B 1 108 SER 108 108 108 SER SER B . n 
B 1 109 VAL 109 109 109 VAL VAL B . n 
B 1 110 ASP 110 110 110 ASP ASP B . n 
B 1 111 ASN 111 111 111 ASN ASN B . n 
B 1 112 PHE 112 112 112 PHE PHE B . n 
B 1 113 LYS 113 113 113 LYS LYS B . n 
B 1 114 ALA 114 114 114 ALA ALA B . n 
B 1 115 GLU 115 115 115 GLU GLU B . n 
B 1 116 PHE 116 116 116 PHE PHE B . n 
B 1 117 GLU 117 117 117 GLU GLU B . n 
B 1 118 LYS 118 118 118 LYS LYS B . n 
B 1 119 ALA 119 119 119 ALA ALA B . n 
B 1 120 ALA 120 120 120 ALA ALA B . n 
B 1 121 ALA 121 121 121 ALA ALA B . n 
B 1 122 SER 122 122 122 SER SER B . n 
B 1 123 ARG 123 123 123 ARG ARG B . n 
B 1 124 PHE 124 124 124 PHE PHE B . n 
B 1 125 GLY 125 125 125 GLY GLY B . n 
B 1 126 SER 126 126 126 SER SER B . n 
B 1 127 GLY 127 127 127 GLY GLY B . n 
B 1 128 TRP 128 128 128 TRP TRP B . n 
B 1 129 ALA 129 129 129 ALA ALA B . n 
B 1 130 TRP 130 130 130 TRP TRP B . n 
B 1 131 LEU 131 131 131 LEU LEU B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 LEU 133 133 133 LEU LEU B . n 
B 1 134 LYS 134 134 134 LYS LYS B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ASP 136 136 136 ASP ASP B . n 
B 1 137 LYS 137 137 137 LYS LYS B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 VAL 140 140 140 VAL VAL B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 SER 142 142 142 SER SER B . n 
B 1 143 THR 143 143 143 THR THR B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 ASN 145 145 145 ASN ASN B . n 
B 1 146 GLN 146 146 146 GLN GLN B . n 
B 1 147 ASP 147 147 147 ASP ASP B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 PRO 149 149 149 PRO PRO B . n 
B 1 150 LEU 150 150 150 LEU LEU B . n 
B 1 151 MET 151 151 151 MET MET B . n 
B 1 152 GLY 152 152 152 GLY GLY B . n 
B 1 153 GLU 153 153 153 GLU GLU B . n 
B 1 154 ALA 154 154 154 ALA ALA B . n 
B 1 155 ILE 155 155 155 ILE ILE B . n 
B 1 156 SER 156 156 156 SER SER B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 ALA 158 158 158 ALA ALA B . n 
B 1 159 SER 159 159 159 SER SER B . n 
B 1 160 GLY 160 160 160 GLY GLY B . n 
B 1 161 PHE 161 161 161 PHE PHE B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 ILE 163 163 163 ILE ILE B . n 
B 1 164 MET 164 164 164 MET MET B . n 
B 1 165 GLY 165 165 165 GLY GLY B . n 
B 1 166 LEU 166 166 166 LEU LEU B . n 
B 1 167 ASP 167 167 167 ASP ASP B . n 
B 1 168 VAL 168 168 168 VAL VAL B . n 
B 1 169 TRP 169 169 169 TRP TRP B . n 
B 1 170 GLU 170 170 170 GLU GLU B . n 
B 1 171 HIS 171 171 171 HIS HIS B . n 
B 1 172 ALA 172 172 172 ALA ALA B . n 
B 1 173 TYR 173 173 173 TYR TYR B . n 
B 1 174 PHE 174 174 174 PHE PHE B . n 
B 1 175 LEU 175 175 175 LEU LEU B . n 
B 1 176 LYS 176 176 176 LYS LYS B . n 
B 1 177 PHE 177 177 177 PHE PHE B . n 
B 1 178 GLN 178 178 178 GLN GLN B . n 
B 1 179 ASN 179 179 179 ASN ASN B . n 
B 1 180 ARG 180 180 180 ARG ARG B . n 
B 1 181 ARG 181 181 181 ARG ARG B . n 
B 1 182 PRO 182 182 182 PRO PRO B . n 
B 1 183 ASP 183 183 183 ASP ASP B . n 
B 1 184 TYR 184 184 184 TYR TYR B . n 
B 1 185 ILE 185 185 185 ILE ILE B . n 
B 1 186 LYS 186 186 186 LYS LYS B . n 
B 1 187 GLU 187 187 187 GLU GLU B . n 
B 1 188 PHE 188 188 188 PHE PHE B . n 
B 1 189 TRP 189 189 189 TRP TRP B . n 
B 1 190 ASN 190 190 190 ASN ASN B . n 
B 1 191 VAL 191 191 191 VAL VAL B . n 
B 1 192 VAL 192 192 192 VAL VAL B . n 
B 1 193 ASN 193 193 193 ASN ASN B . n 
B 1 194 TRP 194 194 194 TRP TRP B . n 
B 1 195 ASP 195 195 195 ASP ASP B . n 
B 1 196 GLU 196 196 196 GLU GLU B . n 
B 1 197 ALA 197 197 197 ALA ALA B . n 
B 1 198 ALA 198 198 198 ALA ALA B . n 
B 1 199 ALA 199 199 199 ALA ALA B . n 
B 1 200 ARG 200 200 200 ARG ARG B . n 
B 1 201 PHE 201 201 201 PHE PHE B . n 
B 1 202 ALA 202 202 202 ALA ALA B . n 
B 1 203 ALA 203 203 203 ALA ALA B . n 
B 1 204 LYS 204 204 204 LYS LYS B . n 
B 1 205 LYS 205 205 205 LYS LYS B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1870  ? 
1 MORE         -12   ? 
1 'SSA (A^2)'  17220 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 26  ? A HIS 26  ? 1_555 MN ? C MH2 . ? A MH2 206 ? 1_555 O1  ? C MH2 .   ? A MH2 206 ? 1_555 172.3 ? 
2  NE2 ? A HIS 26  ? A HIS 26  ? 1_555 MN ? C MH2 . ? A MH2 206 ? 1_555 NE2 ? A HIS 81  ? A HIS 81  ? 1_555 92.9  ? 
3  O1  ? C MH2 .   ? A MH2 206 ? 1_555 MN ? C MH2 . ? A MH2 206 ? 1_555 NE2 ? A HIS 81  ? A HIS 81  ? 1_555 92.0  ? 
4  NE2 ? A HIS 26  ? A HIS 26  ? 1_555 MN ? C MH2 . ? A MH2 206 ? 1_555 OD2 ? A ASP 167 ? A ASP 167 ? 1_555 85.9  ? 
5  O1  ? C MH2 .   ? A MH2 206 ? 1_555 MN ? C MH2 . ? A MH2 206 ? 1_555 OD2 ? A ASP 167 ? A ASP 167 ? 1_555 86.7  ? 
6  NE2 ? A HIS 81  ? A HIS 81  ? 1_555 MN ? C MH2 . ? A MH2 206 ? 1_555 OD2 ? A ASP 167 ? A ASP 167 ? 1_555 112.8 ? 
7  NE2 ? A HIS 26  ? A HIS 26  ? 1_555 MN ? C MH2 . ? A MH2 206 ? 1_555 NE2 ? A HIS 171 ? A HIS 171 ? 1_555 91.6  ? 
8  O1  ? C MH2 .   ? A MH2 206 ? 1_555 MN ? C MH2 . ? A MH2 206 ? 1_555 NE2 ? A HIS 171 ? A HIS 171 ? 1_555 90.3  ? 
9  NE2 ? A HIS 81  ? A HIS 81  ? 1_555 MN ? C MH2 . ? A MH2 206 ? 1_555 NE2 ? A HIS 171 ? A HIS 171 ? 1_555 125.8 ? 
10 OD2 ? A ASP 167 ? A ASP 167 ? 1_555 MN ? C MH2 . ? A MH2 206 ? 1_555 NE2 ? A HIS 171 ? A HIS 171 ? 1_555 121.3 ? 
11 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 MN ? D MH2 . ? B MH2 206 ? 1_555 O1  ? D MH2 .   ? B MH2 206 ? 1_555 172.9 ? 
12 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 MN ? D MH2 . ? B MH2 206 ? 1_555 NE2 ? B HIS 81  ? B HIS 81  ? 1_555 92.6  ? 
13 O1  ? D MH2 .   ? B MH2 206 ? 1_555 MN ? D MH2 . ? B MH2 206 ? 1_555 NE2 ? B HIS 81  ? B HIS 81  ? 1_555 91.7  ? 
14 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 MN ? D MH2 . ? B MH2 206 ? 1_555 OD2 ? B ASP 167 ? B ASP 167 ? 1_555 86.3  ? 
15 O1  ? D MH2 .   ? B MH2 206 ? 1_555 MN ? D MH2 . ? B MH2 206 ? 1_555 OD2 ? B ASP 167 ? B ASP 167 ? 1_555 86.9  ? 
16 NE2 ? B HIS 81  ? B HIS 81  ? 1_555 MN ? D MH2 . ? B MH2 206 ? 1_555 OD2 ? B ASP 167 ? B ASP 167 ? 1_555 112.7 ? 
17 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 MN ? D MH2 . ? B MH2 206 ? 1_555 NE2 ? B HIS 171 ? B HIS 171 ? 1_555 91.4  ? 
18 O1  ? D MH2 .   ? B MH2 206 ? 1_555 MN ? D MH2 . ? B MH2 206 ? 1_555 NE2 ? B HIS 171 ? B HIS 171 ? 1_555 90.4  ? 
19 NE2 ? B HIS 81  ? B HIS 81  ? 1_555 MN ? D MH2 . ? B MH2 206 ? 1_555 NE2 ? B HIS 171 ? B HIS 171 ? 1_555 128.2 ? 
20 OD2 ? B ASP 167 ? B ASP 167 ? 1_555 MN ? D MH2 . ? B MH2 206 ? 1_555 NE2 ? B HIS 171 ? B HIS 171 ? 1_555 119.1 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-12-18 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Atomic model'              
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
AMoRE     phasing          . ? 3 
SHELXL-97 refinement       . ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB  A PHE 18  ? ? CG A PHE 18  ? ? CD2 A PHE 18  ? ? 116.34 120.80 -4.46 0.70 N 
2  1 OE1 A GLU 54  ? ? CD A GLU 54  ? ? OE2 A GLU 54  ? ? 131.35 123.30 8.05  1.20 N 
3  1 CB  A ASP 66  ? ? CG A ASP 66  ? ? OD1 A ASP 66  ? ? 125.42 118.30 7.12  0.90 N 
4  1 CB  A ASP 66  ? ? CG A ASP 66  ? ? OD2 A ASP 66  ? ? 111.78 118.30 -6.52 0.90 N 
5  1 NE  A ARG 180 ? ? CZ A ARG 180 ? ? NH2 A ARG 180 ? ? 116.70 120.30 -3.60 0.50 N 
6  1 CB  A LYS 186 ? B CA A LYS 186 ? ? C   A LYS 186 ? ? 122.75 110.40 12.35 2.00 N 
7  1 CA  A LYS 186 ? ? CB A LYS 186 ? C CG  A LYS 186 ? C 128.86 113.40 15.46 2.20 N 
8  1 C   B LYS 90  ? ? N  B GLY 91  ? B CA  B GLY 91  ? B 138.82 122.30 16.52 2.10 Y 
9  1 CB  B ASP 110 ? ? CG B ASP 110 ? ? OD2 B ASP 110 ? ? 112.15 118.30 -6.15 0.90 N 
10 1 CB  B ASP 136 ? ? CG B ASP 136 ? ? OD2 B ASP 136 ? ? 112.48 118.30 -5.82 0.90 N 
11 1 NE  B ARG 180 ? ? CZ B ARG 180 ? ? NH1 B ARG 180 ? ? 125.43 120.30 5.13  0.50 N 
12 1 NE  B ARG 180 ? ? CZ B ARG 180 ? ? NH2 B ARG 180 ? ? 117.07 120.30 -3.23 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 89  ? ? -175.15 143.77  
2 1 ASP A 136 ? B 57.26   19.52   
3 1 ASN A 145 ? ? 55.63   -126.45 
4 1 GLN A 178 ? ? 55.83   -126.12 
5 1 LYS B 29  ? ? -108.11 -68.19  
6 1 LYS B 89  ? ? -175.33 131.73  
7 1 ASP B 136 ? ? 50.08   14.24   
8 1 ASN B 145 ? ? 57.27   -125.61 
9 1 GLN B 178 ? ? 54.97   -124.83 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE ION, 1 HYDROXYL COORDINATED' MH2 
3 water                                   HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MH2 1   206 206  MH2 MH2 A . 
D 2 MH2 1   206 206  MH2 MH2 B . 
E 3 HOH 1   207 1    HOH HOH A . 
E 3 HOH 2   208 2    HOH HOH A . 
E 3 HOH 3   209 3    HOH HOH A . 
E 3 HOH 4   210 4    HOH HOH A . 
E 3 HOH 5   211 5    HOH HOH A . 
E 3 HOH 6   212 6    HOH HOH A . 
E 3 HOH 7   213 7    HOH HOH A . 
E 3 HOH 8   214 8    HOH HOH A . 
E 3 HOH 9   215 9    HOH HOH A . 
E 3 HOH 10  216 10   HOH HOH A . 
E 3 HOH 11  217 11   HOH HOH A . 
E 3 HOH 12  218 12   HOH HOH A . 
E 3 HOH 13  219 13   HOH HOH A . 
E 3 HOH 14  220 14   HOH HOH A . 
E 3 HOH 15  221 15   HOH HOH A . 
E 3 HOH 16  222 16   HOH HOH A . 
E 3 HOH 17  223 17   HOH HOH A . 
E 3 HOH 18  224 18   HOH HOH A . 
E 3 HOH 19  225 19   HOH HOH A . 
E 3 HOH 20  226 20   HOH HOH A . 
E 3 HOH 21  227 21   HOH HOH A . 
E 3 HOH 22  228 22   HOH HOH A . 
E 3 HOH 23  229 23   HOH HOH A . 
E 3 HOH 24  230 24   HOH HOH A . 
E 3 HOH 25  231 25   HOH HOH A . 
E 3 HOH 26  232 26   HOH HOH A . 
E 3 HOH 27  233 27   HOH HOH A . 
E 3 HOH 28  234 28   HOH HOH A . 
E 3 HOH 29  235 29   HOH HOH A . 
E 3 HOH 30  236 30   HOH HOH A . 
E 3 HOH 31  237 31   HOH HOH A . 
E 3 HOH 32  238 32   HOH HOH A . 
E 3 HOH 33  239 33   HOH HOH A . 
E 3 HOH 34  240 34   HOH HOH A . 
E 3 HOH 35  241 35   HOH HOH A . 
E 3 HOH 36  242 36   HOH HOH A . 
E 3 HOH 37  243 37   HOH HOH A . 
E 3 HOH 38  244 38   HOH HOH A . 
E 3 HOH 39  245 39   HOH HOH A . 
E 3 HOH 40  246 40   HOH HOH A . 
E 3 HOH 41  247 41   HOH HOH A . 
E 3 HOH 42  248 42   HOH HOH A . 
E 3 HOH 43  249 43   HOH HOH A . 
E 3 HOH 44  250 44   HOH HOH A . 
E 3 HOH 45  251 45   HOH HOH A . 
E 3 HOH 46  252 46   HOH HOH A . 
E 3 HOH 47  253 47   HOH HOH A . 
E 3 HOH 48  254 48   HOH HOH A . 
E 3 HOH 49  255 49   HOH HOH A . 
E 3 HOH 50  256 50   HOH HOH A . 
E 3 HOH 51  257 51   HOH HOH A . 
E 3 HOH 52  258 52   HOH HOH A . 
E 3 HOH 53  259 53   HOH HOH A . 
E 3 HOH 54  260 54   HOH HOH A . 
E 3 HOH 55  261 55   HOH HOH A . 
E 3 HOH 56  262 56   HOH HOH A . 
E 3 HOH 57  263 57   HOH HOH A . 
E 3 HOH 58  264 58   HOH HOH A . 
E 3 HOH 59  265 59   HOH HOH A . 
E 3 HOH 60  266 60   HOH HOH A . 
E 3 HOH 61  267 61   HOH HOH A . 
E 3 HOH 62  268 62   HOH HOH A . 
E 3 HOH 63  269 63   HOH HOH A . 
E 3 HOH 64  270 64   HOH HOH A . 
E 3 HOH 65  271 65   HOH HOH A . 
E 3 HOH 66  272 66   HOH HOH A . 
E 3 HOH 67  273 67   HOH HOH A . 
E 3 HOH 68  274 68   HOH HOH A . 
E 3 HOH 69  275 69   HOH HOH A . 
E 3 HOH 70  276 70   HOH HOH A . 
E 3 HOH 71  277 71   HOH HOH A . 
E 3 HOH 72  278 72   HOH HOH A . 
E 3 HOH 73  279 73   HOH HOH A . 
E 3 HOH 74  280 74   HOH HOH A . 
E 3 HOH 75  281 75   HOH HOH A . 
E 3 HOH 76  282 76   HOH HOH A . 
E 3 HOH 77  283 77   HOH HOH A . 
E 3 HOH 78  284 79   HOH HOH A . 
E 3 HOH 79  285 80   HOH HOH A . 
E 3 HOH 80  286 81   HOH HOH A . 
E 3 HOH 81  287 82   HOH HOH A . 
E 3 HOH 82  288 83   HOH HOH A . 
E 3 HOH 83  289 84   HOH HOH A . 
E 3 HOH 84  290 85   HOH HOH A . 
E 3 HOH 85  291 86   HOH HOH A . 
E 3 HOH 86  292 87   HOH HOH A . 
E 3 HOH 87  293 88   HOH HOH A . 
E 3 HOH 88  294 89   HOH HOH A . 
E 3 HOH 89  295 90   HOH HOH A . 
E 3 HOH 90  296 91   HOH HOH A . 
E 3 HOH 91  297 92   HOH HOH A . 
E 3 HOH 92  298 93   HOH HOH A . 
E 3 HOH 93  299 94   HOH HOH A . 
E 3 HOH 94  300 95   HOH HOH A . 
E 3 HOH 95  301 97   HOH HOH A . 
E 3 HOH 96  302 98   HOH HOH A . 
E 3 HOH 97  303 99   HOH HOH A . 
E 3 HOH 98  304 100  HOH HOH A . 
E 3 HOH 99  305 101  HOH HOH A . 
E 3 HOH 100 306 102  HOH HOH A . 
E 3 HOH 101 307 103  HOH HOH A . 
E 3 HOH 102 308 104  HOH HOH A . 
E 3 HOH 103 309 105  HOH HOH A . 
E 3 HOH 104 310 106  HOH HOH A . 
E 3 HOH 105 311 108  HOH HOH A . 
E 3 HOH 106 312 109  HOH HOH A . 
E 3 HOH 107 313 110  HOH HOH A . 
E 3 HOH 108 314 111  HOH HOH A . 
E 3 HOH 109 315 112  HOH HOH A . 
E 3 HOH 110 316 113  HOH HOH A . 
E 3 HOH 111 317 114  HOH HOH A . 
E 3 HOH 112 318 115  HOH HOH A . 
E 3 HOH 113 319 116  HOH HOH A . 
E 3 HOH 114 320 117  HOH HOH A . 
E 3 HOH 115 321 118  HOH HOH A . 
E 3 HOH 116 322 119  HOH HOH A . 
E 3 HOH 117 323 120  HOH HOH A . 
E 3 HOH 118 324 121  HOH HOH A . 
E 3 HOH 119 325 122  HOH HOH A . 
E 3 HOH 120 326 123  HOH HOH A . 
E 3 HOH 121 327 124  HOH HOH A . 
E 3 HOH 122 328 125  HOH HOH A . 
E 3 HOH 123 329 126  HOH HOH A . 
E 3 HOH 124 330 127  HOH HOH A . 
E 3 HOH 125 331 128  HOH HOH A . 
E 3 HOH 126 332 129  HOH HOH A . 
E 3 HOH 127 333 130  HOH HOH A . 
E 3 HOH 128 334 131  HOH HOH A . 
E 3 HOH 129 335 132  HOH HOH A . 
E 3 HOH 130 336 133  HOH HOH A . 
E 3 HOH 131 337 135  HOH HOH A . 
E 3 HOH 132 338 136  HOH HOH A . 
E 3 HOH 133 339 137  HOH HOH A . 
E 3 HOH 134 340 138  HOH HOH A . 
E 3 HOH 135 341 139  HOH HOH A . 
E 3 HOH 136 342 140  HOH HOH A . 
E 3 HOH 137 343 141  HOH HOH A . 
E 3 HOH 138 344 142  HOH HOH A . 
E 3 HOH 139 345 143  HOH HOH A . 
E 3 HOH 140 346 144  HOH HOH A . 
E 3 HOH 141 347 145  HOH HOH A . 
E 3 HOH 142 348 146  HOH HOH A . 
E 3 HOH 143 349 147  HOH HOH A . 
E 3 HOH 144 350 148  HOH HOH A . 
E 3 HOH 145 351 149  HOH HOH A . 
E 3 HOH 146 352 150  HOH HOH A . 
E 3 HOH 147 353 151  HOH HOH A . 
E 3 HOH 148 354 152  HOH HOH A . 
E 3 HOH 149 355 153  HOH HOH A . 
E 3 HOH 150 356 154  HOH HOH A . 
E 3 HOH 151 357 155  HOH HOH A . 
E 3 HOH 152 358 156  HOH HOH A . 
E 3 HOH 153 359 157  HOH HOH A . 
E 3 HOH 154 360 158  HOH HOH A . 
E 3 HOH 155 361 159  HOH HOH A . 
E 3 HOH 156 362 160  HOH HOH A . 
E 3 HOH 157 363 161  HOH HOH A . 
E 3 HOH 158 364 162  HOH HOH A . 
E 3 HOH 159 365 163  HOH HOH A . 
E 3 HOH 160 366 164  HOH HOH A . 
E 3 HOH 161 367 165  HOH HOH A . 
E 3 HOH 162 368 166  HOH HOH A . 
E 3 HOH 163 369 167  HOH HOH A . 
E 3 HOH 164 370 168  HOH HOH A . 
E 3 HOH 165 371 169  HOH HOH A . 
E 3 HOH 166 372 170  HOH HOH A . 
E 3 HOH 167 373 171  HOH HOH A . 
E 3 HOH 168 374 172  HOH HOH A . 
E 3 HOH 169 375 173  HOH HOH A . 
E 3 HOH 170 376 174  HOH HOH A . 
E 3 HOH 171 377 175  HOH HOH A . 
E 3 HOH 172 378 176  HOH HOH A . 
E 3 HOH 173 379 177  HOH HOH A . 
E 3 HOH 174 380 178  HOH HOH A . 
E 3 HOH 175 381 179  HOH HOH A . 
E 3 HOH 176 382 180  HOH HOH A . 
E 3 HOH 177 383 181  HOH HOH A . 
E 3 HOH 178 384 182  HOH HOH A . 
E 3 HOH 179 385 183  HOH HOH A . 
E 3 HOH 180 386 184  HOH HOH A . 
E 3 HOH 181 387 185  HOH HOH A . 
E 3 HOH 182 388 186  HOH HOH A . 
E 3 HOH 183 389 187  HOH HOH A . 
E 3 HOH 184 390 188  HOH HOH A . 
E 3 HOH 185 391 189  HOH HOH A . 
E 3 HOH 186 392 190  HOH HOH A . 
E 3 HOH 187 393 191  HOH HOH A . 
E 3 HOH 188 394 192  HOH HOH A . 
E 3 HOH 189 395 193  HOH HOH A . 
E 3 HOH 190 396 194  HOH HOH A . 
E 3 HOH 191 397 195  HOH HOH A . 
E 3 HOH 192 398 196  HOH HOH A . 
E 3 HOH 193 399 197  HOH HOH A . 
E 3 HOH 194 400 198  HOH HOH A . 
E 3 HOH 195 401 199  HOH HOH A . 
E 3 HOH 196 402 200  HOH HOH A . 
E 3 HOH 197 403 201  HOH HOH A . 
E 3 HOH 198 404 202  HOH HOH A . 
E 3 HOH 199 405 203  HOH HOH A . 
E 3 HOH 200 406 204  HOH HOH A . 
E 3 HOH 201 407 205  HOH HOH A . 
E 3 HOH 202 408 206  HOH HOH A . 
E 3 HOH 203 409 207  HOH HOH A . 
E 3 HOH 204 410 208  HOH HOH A . 
E 3 HOH 205 411 209  HOH HOH A . 
E 3 HOH 206 412 210  HOH HOH A . 
E 3 HOH 207 413 211  HOH HOH A . 
E 3 HOH 208 414 212  HOH HOH A . 
E 3 HOH 209 415 213  HOH HOH A . 
E 3 HOH 210 416 214  HOH HOH A . 
E 3 HOH 211 417 215  HOH HOH A . 
E 3 HOH 212 418 216  HOH HOH A . 
E 3 HOH 213 419 217  HOH HOH A . 
E 3 HOH 214 420 218  HOH HOH A . 
E 3 HOH 215 421 219  HOH HOH A . 
E 3 HOH 216 422 220  HOH HOH A . 
E 3 HOH 217 423 221  HOH HOH A . 
E 3 HOH 218 424 222  HOH HOH A . 
E 3 HOH 219 425 223  HOH HOH A . 
E 3 HOH 220 426 224  HOH HOH A . 
E 3 HOH 221 427 225  HOH HOH A . 
E 3 HOH 222 428 226  HOH HOH A . 
E 3 HOH 223 429 227  HOH HOH A . 
E 3 HOH 224 430 228  HOH HOH A . 
E 3 HOH 225 431 229  HOH HOH A . 
E 3 HOH 226 432 230  HOH HOH A . 
E 3 HOH 227 433 231  HOH HOH A . 
E 3 HOH 228 434 232  HOH HOH A . 
E 3 HOH 229 435 233  HOH HOH A . 
E 3 HOH 230 436 234  HOH HOH A . 
E 3 HOH 231 437 237  HOH HOH A . 
E 3 HOH 232 438 238  HOH HOH A . 
E 3 HOH 233 439 239  HOH HOH A . 
E 3 HOH 234 440 240  HOH HOH A . 
E 3 HOH 235 441 241  HOH HOH A . 
E 3 HOH 236 442 242  HOH HOH A . 
E 3 HOH 237 443 245  HOH HOH A . 
E 3 HOH 238 444 246  HOH HOH A . 
E 3 HOH 239 445 247  HOH HOH A . 
E 3 HOH 240 446 248  HOH HOH A . 
E 3 HOH 241 447 249  HOH HOH A . 
E 3 HOH 242 448 250  HOH HOH A . 
E 3 HOH 243 449 251  HOH HOH A . 
E 3 HOH 244 450 252  HOH HOH A . 
E 3 HOH 245 451 253  HOH HOH A . 
E 3 HOH 246 452 254  HOH HOH A . 
E 3 HOH 247 453 255  HOH HOH A . 
E 3 HOH 248 454 256  HOH HOH A . 
E 3 HOH 249 455 257  HOH HOH A . 
E 3 HOH 250 456 259  HOH HOH A . 
E 3 HOH 251 457 260  HOH HOH A . 
E 3 HOH 252 458 261  HOH HOH A . 
E 3 HOH 253 459 262  HOH HOH A . 
E 3 HOH 254 460 264  HOH HOH A . 
E 3 HOH 255 461 266  HOH HOH A . 
E 3 HOH 256 462 1045 HOH HOH A . 
E 3 HOH 257 463 1078 HOH HOH A . 
E 3 HOH 258 464 1082 HOH HOH A . 
E 3 HOH 259 465 1096 HOH HOH A . 
E 3 HOH 260 466 1107 HOH HOH A . 
E 3 HOH 261 467 1134 HOH HOH A . 
E 3 HOH 262 468 1212 HOH HOH A . 
E 3 HOH 263 469 1235 HOH HOH A . 
E 3 HOH 264 470 1236 HOH HOH A . 
E 3 HOH 265 471 1239 HOH HOH A . 
E 3 HOH 266 472 1243 HOH HOH A . 
E 3 HOH 267 473 1244 HOH HOH A . 
E 3 HOH 268 474 1250 HOH HOH A . 
E 3 HOH 269 475 1258 HOH HOH A . 
E 3 HOH 270 476 1263 HOH HOH A . 
E 3 HOH 271 477 1265 HOH HOH A . 
E 3 HOH 272 478 2002 HOH HOH A . 
E 3 HOH 273 479 2003 HOH HOH A . 
E 3 HOH 274 480 2005 HOH HOH A . 
E 3 HOH 275 481 2007 HOH HOH A . 
E 3 HOH 276 482 2008 HOH HOH A . 
E 3 HOH 277 483 2012 HOH HOH A . 
E 3 HOH 278 484 2013 HOH HOH A . 
E 3 HOH 279 485 2017 HOH HOH A . 
E 3 HOH 280 486 2019 HOH HOH A . 
E 3 HOH 281 487 2020 HOH HOH A . 
E 3 HOH 282 488 2022 HOH HOH A . 
E 3 HOH 283 489 2023 HOH HOH A . 
E 3 HOH 284 490 2027 HOH HOH A . 
E 3 HOH 285 491 2031 HOH HOH A . 
E 3 HOH 286 492 2032 HOH HOH A . 
E 3 HOH 287 493 2034 HOH HOH A . 
E 3 HOH 288 494 2038 HOH HOH A . 
E 3 HOH 289 495 2039 HOH HOH A . 
E 3 HOH 290 496 2040 HOH HOH A . 
E 3 HOH 291 497 2044 HOH HOH A . 
E 3 HOH 292 498 2045 HOH HOH A . 
E 3 HOH 293 499 2046 HOH HOH A . 
E 3 HOH 294 500 2047 HOH HOH A . 
E 3 HOH 295 501 2048 HOH HOH A . 
E 3 HOH 296 502 2049 HOH HOH A . 
E 3 HOH 297 503 2051 HOH HOH A . 
E 3 HOH 298 504 2052 HOH HOH A . 
E 3 HOH 299 505 2053 HOH HOH A . 
E 3 HOH 300 506 2054 HOH HOH A . 
E 3 HOH 301 507 2056 HOH HOH A . 
E 3 HOH 302 508 2057 HOH HOH A . 
E 3 HOH 303 509 2058 HOH HOH A . 
E 3 HOH 304 510 2059 HOH HOH A . 
E 3 HOH 305 511 2060 HOH HOH A . 
E 3 HOH 306 512 2061 HOH HOH A . 
E 3 HOH 307 513 2062 HOH HOH A . 
E 3 HOH 308 514 2064 HOH HOH A . 
E 3 HOH 309 515 2068 HOH HOH A . 
E 3 HOH 310 516 2069 HOH HOH A . 
E 3 HOH 311 517 2070 HOH HOH A . 
E 3 HOH 312 518 2071 HOH HOH A . 
E 3 HOH 313 519 2072 HOH HOH A . 
E 3 HOH 314 520 2076 HOH HOH A . 
E 3 HOH 315 521 2080 HOH HOH A . 
E 3 HOH 316 522 2083 HOH HOH A . 
E 3 HOH 317 523 2085 HOH HOH A . 
E 3 HOH 318 524 2086 HOH HOH A . 
E 3 HOH 319 525 2087 HOH HOH A . 
E 3 HOH 320 526 2089 HOH HOH A . 
E 3 HOH 321 527 2091 HOH HOH A . 
E 3 HOH 322 528 2092 HOH HOH A . 
E 3 HOH 323 529 2093 HOH HOH A . 
E 3 HOH 324 530 2096 HOH HOH A . 
E 3 HOH 325 531 2098 HOH HOH A . 
E 3 HOH 326 532 2099 HOH HOH A . 
E 3 HOH 327 533 2103 HOH HOH A . 
E 3 HOH 328 534 2105 HOH HOH A . 
E 3 HOH 329 535 2107 HOH HOH A . 
E 3 HOH 330 536 2109 HOH HOH A . 
E 3 HOH 331 537 2115 HOH HOH A . 
E 3 HOH 332 538 2116 HOH HOH A . 
E 3 HOH 333 539 2117 HOH HOH A . 
E 3 HOH 334 540 2120 HOH HOH A . 
E 3 HOH 335 541 2121 HOH HOH A . 
E 3 HOH 336 542 2123 HOH HOH A . 
E 3 HOH 337 543 2125 HOH HOH A . 
E 3 HOH 338 544 2126 HOH HOH A . 
E 3 HOH 339 545 2128 HOH HOH A . 
E 3 HOH 340 546 2129 HOH HOH A . 
E 3 HOH 341 547 2131 HOH HOH A . 
E 3 HOH 342 548 2132 HOH HOH A . 
E 3 HOH 343 549 2133 HOH HOH A . 
E 3 HOH 344 550 2134 HOH HOH A . 
E 3 HOH 345 551 2135 HOH HOH A . 
E 3 HOH 346 552 2136 HOH HOH A . 
E 3 HOH 347 553 2137 HOH HOH A . 
E 3 HOH 348 554 2138 HOH HOH A . 
E 3 HOH 349 555 2142 HOH HOH A . 
E 3 HOH 350 556 2143 HOH HOH A . 
E 3 HOH 351 557 2145 HOH HOH A . 
E 3 HOH 352 558 2146 HOH HOH A . 
E 3 HOH 353 559 2147 HOH HOH A . 
E 3 HOH 354 560 2152 HOH HOH A . 
E 3 HOH 355 561 2153 HOH HOH A . 
E 3 HOH 356 562 2154 HOH HOH A . 
E 3 HOH 357 563 2155 HOH HOH A . 
E 3 HOH 358 564 2156 HOH HOH A . 
E 3 HOH 359 565 2158 HOH HOH A . 
E 3 HOH 360 566 2159 HOH HOH A . 
E 3 HOH 361 567 2163 HOH HOH A . 
E 3 HOH 362 568 2164 HOH HOH A . 
E 3 HOH 363 569 2165 HOH HOH A . 
E 3 HOH 364 570 2166 HOH HOH A . 
E 3 HOH 365 571 2167 HOH HOH A . 
E 3 HOH 366 572 2168 HOH HOH A . 
E 3 HOH 367 573 2169 HOH HOH A . 
E 3 HOH 368 574 2170 HOH HOH A . 
E 3 HOH 369 575 2171 HOH HOH A . 
E 3 HOH 370 576 2172 HOH HOH A . 
E 3 HOH 371 577 2173 HOH HOH A . 
E 3 HOH 372 578 2174 HOH HOH A . 
E 3 HOH 373 579 2175 HOH HOH A . 
E 3 HOH 374 580 2176 HOH HOH A . 
E 3 HOH 375 581 2177 HOH HOH A . 
E 3 HOH 376 582 2178 HOH HOH A . 
E 3 HOH 377 583 2179 HOH HOH A . 
E 3 HOH 378 584 2180 HOH HOH A . 
E 3 HOH 379 585 2181 HOH HOH A . 
E 3 HOH 380 586 2182 HOH HOH A . 
E 3 HOH 381 587 2191 HOH HOH A . 
E 3 HOH 382 588 2193 HOH HOH A . 
E 3 HOH 383 589 2200 HOH HOH A . 
E 3 HOH 384 590 2223 HOH HOH A . 
E 3 HOH 385 591 2234 HOH HOH A . 
E 3 HOH 386 592 2236 HOH HOH A . 
E 3 HOH 387 593 2237 HOH HOH A . 
E 3 HOH 388 594 2238 HOH HOH A . 
E 3 HOH 389 595 2239 HOH HOH A . 
E 3 HOH 390 596 2240 HOH HOH A . 
E 3 HOH 391 597 2243 HOH HOH A . 
E 3 HOH 392 598 2244 HOH HOH A . 
E 3 HOH 393 599 2246 HOH HOH A . 
E 3 HOH 394 600 2247 HOH HOH A . 
E 3 HOH 395 601 2248 HOH HOH A . 
E 3 HOH 396 602 2251 HOH HOH A . 
E 3 HOH 397 603 2253 HOH HOH A . 
E 3 HOH 398 604 2255 HOH HOH A . 
E 3 HOH 399 605 2256 HOH HOH A . 
E 3 HOH 400 606 2259 HOH HOH A . 
E 3 HOH 401 607 2261 HOH HOH A . 
E 3 HOH 402 608 2262 HOH HOH A . 
E 3 HOH 403 609 2263 HOH HOH A . 
E 3 HOH 404 610 2265 HOH HOH A . 
E 3 HOH 405 611 2266 HOH HOH A . 
E 3 HOH 406 612 2267 HOH HOH A . 
E 3 HOH 407 613 2268 HOH HOH A . 
E 3 HOH 408 614 2271 HOH HOH A . 
E 3 HOH 409 615 2272 HOH HOH A . 
E 3 HOH 410 616 2273 HOH HOH A . 
E 3 HOH 411 617 2274 HOH HOH A . 
E 3 HOH 412 618 2275 HOH HOH A . 
E 3 HOH 413 619 2276 HOH HOH A . 
E 3 HOH 414 620 2280 HOH HOH A . 
E 3 HOH 415 621 2282 HOH HOH A . 
E 3 HOH 416 622 2283 HOH HOH A . 
E 3 HOH 417 623 2284 HOH HOH A . 
E 3 HOH 418 624 2285 HOH HOH A . 
E 3 HOH 419 625 2288 HOH HOH A . 
E 3 HOH 420 626 2289 HOH HOH A . 
E 3 HOH 421 627 2290 HOH HOH A . 
E 3 HOH 422 628 2291 HOH HOH A . 
E 3 HOH 423 629 2294 HOH HOH A . 
E 3 HOH 424 630 2295 HOH HOH A . 
E 3 HOH 425 631 2296 HOH HOH A . 
E 3 HOH 426 632 2299 HOH HOH A . 
E 3 HOH 427 633 2300 HOH HOH A . 
E 3 HOH 428 634 2301 HOH HOH A . 
E 3 HOH 429 635 2303 HOH HOH A . 
E 3 HOH 430 636 2304 HOH HOH A . 
E 3 HOH 431 637 2306 HOH HOH A . 
E 3 HOH 432 638 2309 HOH HOH A . 
E 3 HOH 433 639 2310 HOH HOH A . 
E 3 HOH 434 640 2311 HOH HOH A . 
E 3 HOH 435 641 2312 HOH HOH A . 
E 3 HOH 436 642 2313 HOH HOH A . 
E 3 HOH 437 643 2315 HOH HOH A . 
E 3 HOH 438 644 2319 HOH HOH A . 
E 3 HOH 439 645 2321 HOH HOH A . 
E 3 HOH 440 646 2322 HOH HOH A . 
E 3 HOH 441 647 2323 HOH HOH A . 
E 3 HOH 442 648 2326 HOH HOH A . 
E 3 HOH 443 649 2327 HOH HOH A . 
E 3 HOH 444 650 2330 HOH HOH A . 
E 3 HOH 445 651 2331 HOH HOH A . 
E 3 HOH 446 652 2332 HOH HOH A . 
E 3 HOH 447 653 2336 HOH HOH A . 
E 3 HOH 448 654 2337 HOH HOH A . 
E 3 HOH 449 655 2338 HOH HOH A . 
E 3 HOH 450 656 2341 HOH HOH A . 
E 3 HOH 451 657 2342 HOH HOH A . 
E 3 HOH 452 658 2343 HOH HOH A . 
E 3 HOH 453 659 2344 HOH HOH A . 
E 3 HOH 454 660 2348 HOH HOH A . 
E 3 HOH 455 661 2350 HOH HOH A . 
E 3 HOH 456 662 2354 HOH HOH A . 
E 3 HOH 457 663 2357 HOH HOH A . 
E 3 HOH 458 664 2358 HOH HOH A . 
E 3 HOH 459 665 2361 HOH HOH A . 
E 3 HOH 460 666 2363 HOH HOH A . 
E 3 HOH 461 667 2364 HOH HOH A . 
E 3 HOH 462 668 2365 HOH HOH A . 
E 3 HOH 463 669 2366 HOH HOH A . 
E 3 HOH 464 670 2368 HOH HOH A . 
E 3 HOH 465 671 2371 HOH HOH A . 
E 3 HOH 466 672 2372 HOH HOH A . 
E 3 HOH 467 673 2373 HOH HOH A . 
E 3 HOH 468 674 2375 HOH HOH A . 
E 3 HOH 469 675 2376 HOH HOH A . 
E 3 HOH 470 676 2377 HOH HOH A . 
E 3 HOH 471 677 2378 HOH HOH A . 
E 3 HOH 472 678 2382 HOH HOH A . 
E 3 HOH 473 679 2383 HOH HOH A . 
E 3 HOH 474 680 2384 HOH HOH A . 
E 3 HOH 475 681 2386 HOH HOH A . 
E 3 HOH 476 682 2390 HOH HOH A . 
E 3 HOH 477 683 2395 HOH HOH A . 
F 3 HOH 1   207 78   HOH HOH B . 
F 3 HOH 2   208 96   HOH HOH B . 
F 3 HOH 3   209 107  HOH HOH B . 
F 3 HOH 4   210 134  HOH HOH B . 
F 3 HOH 5   211 235  HOH HOH B . 
F 3 HOH 6   212 236  HOH HOH B . 
F 3 HOH 7   213 243  HOH HOH B . 
F 3 HOH 8   214 244  HOH HOH B . 
F 3 HOH 9   215 258  HOH HOH B . 
F 3 HOH 10  216 263  HOH HOH B . 
F 3 HOH 11  217 265  HOH HOH B . 
F 3 HOH 12  218 1001 HOH HOH B . 
F 3 HOH 13  219 1002 HOH HOH B . 
F 3 HOH 14  220 1003 HOH HOH B . 
F 3 HOH 15  221 1004 HOH HOH B . 
F 3 HOH 16  222 1005 HOH HOH B . 
F 3 HOH 17  223 1006 HOH HOH B . 
F 3 HOH 18  224 1007 HOH HOH B . 
F 3 HOH 19  225 1008 HOH HOH B . 
F 3 HOH 20  226 1009 HOH HOH B . 
F 3 HOH 21  227 1010 HOH HOH B . 
F 3 HOH 22  228 1011 HOH HOH B . 
F 3 HOH 23  229 1012 HOH HOH B . 
F 3 HOH 24  230 1013 HOH HOH B . 
F 3 HOH 25  231 1014 HOH HOH B . 
F 3 HOH 26  232 1015 HOH HOH B . 
F 3 HOH 27  233 1016 HOH HOH B . 
F 3 HOH 28  234 1017 HOH HOH B . 
F 3 HOH 29  235 1018 HOH HOH B . 
F 3 HOH 30  236 1019 HOH HOH B . 
F 3 HOH 31  237 1020 HOH HOH B . 
F 3 HOH 32  238 1021 HOH HOH B . 
F 3 HOH 33  239 1022 HOH HOH B . 
F 3 HOH 34  240 1023 HOH HOH B . 
F 3 HOH 35  241 1024 HOH HOH B . 
F 3 HOH 36  242 1025 HOH HOH B . 
F 3 HOH 37  243 1026 HOH HOH B . 
F 3 HOH 38  244 1027 HOH HOH B . 
F 3 HOH 39  245 1028 HOH HOH B . 
F 3 HOH 40  246 1029 HOH HOH B . 
F 3 HOH 41  247 1030 HOH HOH B . 
F 3 HOH 42  248 1031 HOH HOH B . 
F 3 HOH 43  249 1032 HOH HOH B . 
F 3 HOH 44  250 1033 HOH HOH B . 
F 3 HOH 45  251 1034 HOH HOH B . 
F 3 HOH 46  252 1035 HOH HOH B . 
F 3 HOH 47  253 1036 HOH HOH B . 
F 3 HOH 48  254 1037 HOH HOH B . 
F 3 HOH 49  255 1038 HOH HOH B . 
F 3 HOH 50  256 1039 HOH HOH B . 
F 3 HOH 51  257 1040 HOH HOH B . 
F 3 HOH 52  258 1041 HOH HOH B . 
F 3 HOH 53  259 1042 HOH HOH B . 
F 3 HOH 54  260 1043 HOH HOH B . 
F 3 HOH 55  261 1044 HOH HOH B . 
F 3 HOH 56  262 1046 HOH HOH B . 
F 3 HOH 57  263 1047 HOH HOH B . 
F 3 HOH 58  264 1048 HOH HOH B . 
F 3 HOH 59  265 1049 HOH HOH B . 
F 3 HOH 60  266 1050 HOH HOH B . 
F 3 HOH 61  267 1051 HOH HOH B . 
F 3 HOH 62  268 1052 HOH HOH B . 
F 3 HOH 63  269 1053 HOH HOH B . 
F 3 HOH 64  270 1054 HOH HOH B . 
F 3 HOH 65  271 1055 HOH HOH B . 
F 3 HOH 66  272 1056 HOH HOH B . 
F 3 HOH 67  273 1057 HOH HOH B . 
F 3 HOH 68  274 1058 HOH HOH B . 
F 3 HOH 69  275 1059 HOH HOH B . 
F 3 HOH 70  276 1060 HOH HOH B . 
F 3 HOH 71  277 1061 HOH HOH B . 
F 3 HOH 72  278 1062 HOH HOH B . 
F 3 HOH 73  279 1063 HOH HOH B . 
F 3 HOH 74  280 1064 HOH HOH B . 
F 3 HOH 75  281 1065 HOH HOH B . 
F 3 HOH 76  282 1066 HOH HOH B . 
F 3 HOH 77  283 1067 HOH HOH B . 
F 3 HOH 78  284 1068 HOH HOH B . 
F 3 HOH 79  285 1069 HOH HOH B . 
F 3 HOH 80  286 1070 HOH HOH B . 
F 3 HOH 81  287 1071 HOH HOH B . 
F 3 HOH 82  288 1072 HOH HOH B . 
F 3 HOH 83  289 1073 HOH HOH B . 
F 3 HOH 84  290 1074 HOH HOH B . 
F 3 HOH 85  291 1075 HOH HOH B . 
F 3 HOH 86  292 1076 HOH HOH B . 
F 3 HOH 87  293 1077 HOH HOH B . 
F 3 HOH 88  294 1079 HOH HOH B . 
F 3 HOH 89  295 1080 HOH HOH B . 
F 3 HOH 90  296 1081 HOH HOH B . 
F 3 HOH 91  297 1083 HOH HOH B . 
F 3 HOH 92  298 1084 HOH HOH B . 
F 3 HOH 93  299 1085 HOH HOH B . 
F 3 HOH 94  300 1086 HOH HOH B . 
F 3 HOH 95  301 1087 HOH HOH B . 
F 3 HOH 96  302 1088 HOH HOH B . 
F 3 HOH 97  303 1089 HOH HOH B . 
F 3 HOH 98  304 1090 HOH HOH B . 
F 3 HOH 99  305 1091 HOH HOH B . 
F 3 HOH 100 306 1092 HOH HOH B . 
F 3 HOH 101 307 1093 HOH HOH B . 
F 3 HOH 102 308 1094 HOH HOH B . 
F 3 HOH 103 309 1095 HOH HOH B . 
F 3 HOH 104 310 1097 HOH HOH B . 
F 3 HOH 105 311 1098 HOH HOH B . 
F 3 HOH 106 312 1099 HOH HOH B . 
F 3 HOH 107 313 1100 HOH HOH B . 
F 3 HOH 108 314 1101 HOH HOH B . 
F 3 HOH 109 315 1102 HOH HOH B . 
F 3 HOH 110 316 1103 HOH HOH B . 
F 3 HOH 111 317 1104 HOH HOH B . 
F 3 HOH 112 318 1105 HOH HOH B . 
F 3 HOH 113 319 1106 HOH HOH B . 
F 3 HOH 114 320 1108 HOH HOH B . 
F 3 HOH 115 321 1109 HOH HOH B . 
F 3 HOH 116 322 1110 HOH HOH B . 
F 3 HOH 117 323 1111 HOH HOH B . 
F 3 HOH 118 324 1112 HOH HOH B . 
F 3 HOH 119 325 1113 HOH HOH B . 
F 3 HOH 120 326 1114 HOH HOH B . 
F 3 HOH 121 327 1115 HOH HOH B . 
F 3 HOH 122 328 1116 HOH HOH B . 
F 3 HOH 123 329 1117 HOH HOH B . 
F 3 HOH 124 330 1118 HOH HOH B . 
F 3 HOH 125 331 1119 HOH HOH B . 
F 3 HOH 126 332 1120 HOH HOH B . 
F 3 HOH 127 333 1121 HOH HOH B . 
F 3 HOH 128 334 1122 HOH HOH B . 
F 3 HOH 129 335 1123 HOH HOH B . 
F 3 HOH 130 336 1124 HOH HOH B . 
F 3 HOH 131 337 1125 HOH HOH B . 
F 3 HOH 132 338 1126 HOH HOH B . 
F 3 HOH 133 339 1127 HOH HOH B . 
F 3 HOH 134 340 1128 HOH HOH B . 
F 3 HOH 135 341 1129 HOH HOH B . 
F 3 HOH 136 342 1130 HOH HOH B . 
F 3 HOH 137 343 1131 HOH HOH B . 
F 3 HOH 138 344 1132 HOH HOH B . 
F 3 HOH 139 345 1133 HOH HOH B . 
F 3 HOH 140 346 1135 HOH HOH B . 
F 3 HOH 141 347 1136 HOH HOH B . 
F 3 HOH 142 348 1137 HOH HOH B . 
F 3 HOH 143 349 1138 HOH HOH B . 
F 3 HOH 144 350 1139 HOH HOH B . 
F 3 HOH 145 351 1140 HOH HOH B . 
F 3 HOH 146 352 1141 HOH HOH B . 
F 3 HOH 147 353 1142 HOH HOH B . 
F 3 HOH 148 354 1143 HOH HOH B . 
F 3 HOH 149 355 1144 HOH HOH B . 
F 3 HOH 150 356 1145 HOH HOH B . 
F 3 HOH 151 357 1146 HOH HOH B . 
F 3 HOH 152 358 1147 HOH HOH B . 
F 3 HOH 153 359 1148 HOH HOH B . 
F 3 HOH 154 360 1149 HOH HOH B . 
F 3 HOH 155 361 1150 HOH HOH B . 
F 3 HOH 156 362 1151 HOH HOH B . 
F 3 HOH 157 363 1152 HOH HOH B . 
F 3 HOH 158 364 1153 HOH HOH B . 
F 3 HOH 159 365 1154 HOH HOH B . 
F 3 HOH 160 366 1155 HOH HOH B . 
F 3 HOH 161 367 1156 HOH HOH B . 
F 3 HOH 162 368 1157 HOH HOH B . 
F 3 HOH 163 369 1158 HOH HOH B . 
F 3 HOH 164 370 1159 HOH HOH B . 
F 3 HOH 165 371 1160 HOH HOH B . 
F 3 HOH 166 372 1161 HOH HOH B . 
F 3 HOH 167 373 1162 HOH HOH B . 
F 3 HOH 168 374 1163 HOH HOH B . 
F 3 HOH 169 375 1164 HOH HOH B . 
F 3 HOH 170 376 1165 HOH HOH B . 
F 3 HOH 171 377 1166 HOH HOH B . 
F 3 HOH 172 378 1167 HOH HOH B . 
F 3 HOH 173 379 1168 HOH HOH B . 
F 3 HOH 174 380 1169 HOH HOH B . 
F 3 HOH 175 381 1170 HOH HOH B . 
F 3 HOH 176 382 1171 HOH HOH B . 
F 3 HOH 177 383 1172 HOH HOH B . 
F 3 HOH 178 384 1173 HOH HOH B . 
F 3 HOH 179 385 1174 HOH HOH B . 
F 3 HOH 180 386 1175 HOH HOH B . 
F 3 HOH 181 387 1176 HOH HOH B . 
F 3 HOH 182 388 1177 HOH HOH B . 
F 3 HOH 183 389 1178 HOH HOH B . 
F 3 HOH 184 390 1179 HOH HOH B . 
F 3 HOH 185 391 1180 HOH HOH B . 
F 3 HOH 186 392 1181 HOH HOH B . 
F 3 HOH 187 393 1182 HOH HOH B . 
F 3 HOH 188 394 1183 HOH HOH B . 
F 3 HOH 189 395 1184 HOH HOH B . 
F 3 HOH 190 396 1185 HOH HOH B . 
F 3 HOH 191 397 1186 HOH HOH B . 
F 3 HOH 192 398 1187 HOH HOH B . 
F 3 HOH 193 399 1188 HOH HOH B . 
F 3 HOH 194 400 1189 HOH HOH B . 
F 3 HOH 195 401 1190 HOH HOH B . 
F 3 HOH 196 402 1191 HOH HOH B . 
F 3 HOH 197 403 1192 HOH HOH B . 
F 3 HOH 198 404 1193 HOH HOH B . 
F 3 HOH 199 405 1194 HOH HOH B . 
F 3 HOH 200 406 1195 HOH HOH B . 
F 3 HOH 201 407 1196 HOH HOH B . 
F 3 HOH 202 408 1197 HOH HOH B . 
F 3 HOH 203 409 1198 HOH HOH B . 
F 3 HOH 204 410 1199 HOH HOH B . 
F 3 HOH 205 411 1200 HOH HOH B . 
F 3 HOH 206 412 1201 HOH HOH B . 
F 3 HOH 207 413 1202 HOH HOH B . 
F 3 HOH 208 414 1203 HOH HOH B . 
F 3 HOH 209 415 1204 HOH HOH B . 
F 3 HOH 210 416 1205 HOH HOH B . 
F 3 HOH 211 417 1206 HOH HOH B . 
F 3 HOH 212 418 1207 HOH HOH B . 
F 3 HOH 213 419 1208 HOH HOH B . 
F 3 HOH 214 420 1209 HOH HOH B . 
F 3 HOH 215 421 1210 HOH HOH B . 
F 3 HOH 216 422 1211 HOH HOH B . 
F 3 HOH 217 423 1213 HOH HOH B . 
F 3 HOH 218 424 1214 HOH HOH B . 
F 3 HOH 219 425 1215 HOH HOH B . 
F 3 HOH 220 426 1216 HOH HOH B . 
F 3 HOH 221 427 1217 HOH HOH B . 
F 3 HOH 222 428 1218 HOH HOH B . 
F 3 HOH 223 429 1219 HOH HOH B . 
F 3 HOH 224 430 1220 HOH HOH B . 
F 3 HOH 225 431 1221 HOH HOH B . 
F 3 HOH 226 432 1222 HOH HOH B . 
F 3 HOH 227 433 1223 HOH HOH B . 
F 3 HOH 228 434 1224 HOH HOH B . 
F 3 HOH 229 435 1225 HOH HOH B . 
F 3 HOH 230 436 1226 HOH HOH B . 
F 3 HOH 231 437 1227 HOH HOH B . 
F 3 HOH 232 438 1228 HOH HOH B . 
F 3 HOH 233 439 1229 HOH HOH B . 
F 3 HOH 234 440 1230 HOH HOH B . 
F 3 HOH 235 441 1231 HOH HOH B . 
F 3 HOH 236 442 1232 HOH HOH B . 
F 3 HOH 237 443 1233 HOH HOH B . 
F 3 HOH 238 444 1234 HOH HOH B . 
F 3 HOH 239 445 1237 HOH HOH B . 
F 3 HOH 240 446 1238 HOH HOH B . 
F 3 HOH 241 447 1240 HOH HOH B . 
F 3 HOH 242 448 1241 HOH HOH B . 
F 3 HOH 243 449 1242 HOH HOH B . 
F 3 HOH 244 450 1245 HOH HOH B . 
F 3 HOH 245 451 1246 HOH HOH B . 
F 3 HOH 246 452 1247 HOH HOH B . 
F 3 HOH 247 453 1248 HOH HOH B . 
F 3 HOH 248 454 1249 HOH HOH B . 
F 3 HOH 249 455 1251 HOH HOH B . 
F 3 HOH 250 456 1252 HOH HOH B . 
F 3 HOH 251 457 1253 HOH HOH B . 
F 3 HOH 252 458 1254 HOH HOH B . 
F 3 HOH 253 459 1255 HOH HOH B . 
F 3 HOH 254 460 1256 HOH HOH B . 
F 3 HOH 255 461 1257 HOH HOH B . 
F 3 HOH 256 462 1259 HOH HOH B . 
F 3 HOH 257 463 1260 HOH HOH B . 
F 3 HOH 258 464 1261 HOH HOH B . 
F 3 HOH 259 465 1262 HOH HOH B . 
F 3 HOH 260 466 1264 HOH HOH B . 
F 3 HOH 261 467 1266 HOH HOH B . 
F 3 HOH 262 468 2001 HOH HOH B . 
F 3 HOH 263 469 2004 HOH HOH B . 
F 3 HOH 264 470 2006 HOH HOH B . 
F 3 HOH 265 471 2009 HOH HOH B . 
F 3 HOH 266 472 2010 HOH HOH B . 
F 3 HOH 267 473 2011 HOH HOH B . 
F 3 HOH 268 474 2014 HOH HOH B . 
F 3 HOH 269 475 2015 HOH HOH B . 
F 3 HOH 270 476 2016 HOH HOH B . 
F 3 HOH 271 477 2018 HOH HOH B . 
F 3 HOH 272 478 2021 HOH HOH B . 
F 3 HOH 273 479 2024 HOH HOH B . 
F 3 HOH 274 480 2025 HOH HOH B . 
F 3 HOH 275 481 2026 HOH HOH B . 
F 3 HOH 276 482 2028 HOH HOH B . 
F 3 HOH 277 483 2029 HOH HOH B . 
F 3 HOH 278 484 2030 HOH HOH B . 
F 3 HOH 279 485 2033 HOH HOH B . 
F 3 HOH 280 486 2035 HOH HOH B . 
F 3 HOH 281 487 2036 HOH HOH B . 
F 3 HOH 282 488 2037 HOH HOH B . 
F 3 HOH 283 489 2041 HOH HOH B . 
F 3 HOH 284 490 2042 HOH HOH B . 
F 3 HOH 285 491 2043 HOH HOH B . 
F 3 HOH 286 492 2050 HOH HOH B . 
F 3 HOH 287 493 2055 HOH HOH B . 
F 3 HOH 288 494 2063 HOH HOH B . 
F 3 HOH 289 495 2065 HOH HOH B . 
F 3 HOH 290 496 2066 HOH HOH B . 
F 3 HOH 291 497 2067 HOH HOH B . 
F 3 HOH 292 498 2073 HOH HOH B . 
F 3 HOH 293 499 2074 HOH HOH B . 
F 3 HOH 294 500 2075 HOH HOH B . 
F 3 HOH 295 501 2077 HOH HOH B . 
F 3 HOH 296 502 2078 HOH HOH B . 
F 3 HOH 297 503 2079 HOH HOH B . 
F 3 HOH 298 504 2081 HOH HOH B . 
F 3 HOH 299 505 2082 HOH HOH B . 
F 3 HOH 300 506 2084 HOH HOH B . 
F 3 HOH 301 507 2088 HOH HOH B . 
F 3 HOH 302 508 2090 HOH HOH B . 
F 3 HOH 303 509 2094 HOH HOH B . 
F 3 HOH 304 510 2095 HOH HOH B . 
F 3 HOH 305 511 2097 HOH HOH B . 
F 3 HOH 306 512 2100 HOH HOH B . 
F 3 HOH 307 513 2102 HOH HOH B . 
F 3 HOH 308 514 2104 HOH HOH B . 
F 3 HOH 309 515 2106 HOH HOH B . 
F 3 HOH 310 516 2108 HOH HOH B . 
F 3 HOH 311 517 2110 HOH HOH B . 
F 3 HOH 312 518 2111 HOH HOH B . 
F 3 HOH 313 519 2112 HOH HOH B . 
F 3 HOH 314 520 2113 HOH HOH B . 
F 3 HOH 315 521 2114 HOH HOH B . 
F 3 HOH 316 522 2118 HOH HOH B . 
F 3 HOH 317 523 2119 HOH HOH B . 
F 3 HOH 318 524 2122 HOH HOH B . 
F 3 HOH 319 525 2124 HOH HOH B . 
F 3 HOH 320 526 2127 HOH HOH B . 
F 3 HOH 321 527 2130 HOH HOH B . 
F 3 HOH 322 528 2139 HOH HOH B . 
F 3 HOH 323 529 2140 HOH HOH B . 
F 3 HOH 324 530 2141 HOH HOH B . 
F 3 HOH 325 531 2144 HOH HOH B . 
F 3 HOH 326 532 2148 HOH HOH B . 
F 3 HOH 327 533 2149 HOH HOH B . 
F 3 HOH 328 534 2150 HOH HOH B . 
F 3 HOH 329 535 2151 HOH HOH B . 
F 3 HOH 330 536 2157 HOH HOH B . 
F 3 HOH 331 537 2160 HOH HOH B . 
F 3 HOH 332 538 2161 HOH HOH B . 
F 3 HOH 333 539 2162 HOH HOH B . 
F 3 HOH 334 540 2183 HOH HOH B . 
F 3 HOH 335 541 2184 HOH HOH B . 
F 3 HOH 336 542 2185 HOH HOH B . 
F 3 HOH 337 543 2186 HOH HOH B . 
F 3 HOH 338 544 2187 HOH HOH B . 
F 3 HOH 339 545 2188 HOH HOH B . 
F 3 HOH 340 546 2189 HOH HOH B . 
F 3 HOH 341 547 2190 HOH HOH B . 
F 3 HOH 342 548 2192 HOH HOH B . 
F 3 HOH 343 549 2194 HOH HOH B . 
F 3 HOH 344 550 2195 HOH HOH B . 
F 3 HOH 345 551 2196 HOH HOH B . 
F 3 HOH 346 552 2197 HOH HOH B . 
F 3 HOH 347 553 2198 HOH HOH B . 
F 3 HOH 348 554 2199 HOH HOH B . 
F 3 HOH 349 555 2201 HOH HOH B . 
F 3 HOH 350 556 2202 HOH HOH B . 
F 3 HOH 351 557 2203 HOH HOH B . 
F 3 HOH 352 558 2204 HOH HOH B . 
F 3 HOH 353 559 2205 HOH HOH B . 
F 3 HOH 354 560 2206 HOH HOH B . 
F 3 HOH 355 561 2207 HOH HOH B . 
F 3 HOH 356 562 2208 HOH HOH B . 
F 3 HOH 357 563 2209 HOH HOH B . 
F 3 HOH 358 564 2210 HOH HOH B . 
F 3 HOH 359 565 2211 HOH HOH B . 
F 3 HOH 360 566 2212 HOH HOH B . 
F 3 HOH 361 567 2213 HOH HOH B . 
F 3 HOH 362 568 2214 HOH HOH B . 
F 3 HOH 363 569 2215 HOH HOH B . 
F 3 HOH 364 570 2216 HOH HOH B . 
F 3 HOH 365 571 2217 HOH HOH B . 
F 3 HOH 366 572 2218 HOH HOH B . 
F 3 HOH 367 573 2219 HOH HOH B . 
F 3 HOH 368 574 2220 HOH HOH B . 
F 3 HOH 369 575 2221 HOH HOH B . 
F 3 HOH 370 576 2222 HOH HOH B . 
F 3 HOH 371 577 2224 HOH HOH B . 
F 3 HOH 372 578 2225 HOH HOH B . 
F 3 HOH 373 579 2226 HOH HOH B . 
F 3 HOH 374 580 2227 HOH HOH B . 
F 3 HOH 375 581 2228 HOH HOH B . 
F 3 HOH 376 582 2229 HOH HOH B . 
F 3 HOH 377 583 2230 HOH HOH B . 
F 3 HOH 378 584 2231 HOH HOH B . 
F 3 HOH 379 585 2233 HOH HOH B . 
F 3 HOH 380 586 2235 HOH HOH B . 
F 3 HOH 381 587 2241 HOH HOH B . 
F 3 HOH 382 588 2242 HOH HOH B . 
F 3 HOH 383 589 2245 HOH HOH B . 
F 3 HOH 384 590 2249 HOH HOH B . 
F 3 HOH 385 591 2250 HOH HOH B . 
F 3 HOH 386 592 2252 HOH HOH B . 
F 3 HOH 387 593 2254 HOH HOH B . 
F 3 HOH 388 594 2257 HOH HOH B . 
F 3 HOH 389 595 2258 HOH HOH B . 
F 3 HOH 390 596 2260 HOH HOH B . 
F 3 HOH 391 597 2264 HOH HOH B . 
F 3 HOH 392 598 2269 HOH HOH B . 
F 3 HOH 393 599 2270 HOH HOH B . 
F 3 HOH 394 600 2277 HOH HOH B . 
F 3 HOH 395 601 2278 HOH HOH B . 
F 3 HOH 396 602 2279 HOH HOH B . 
F 3 HOH 397 603 2281 HOH HOH B . 
F 3 HOH 398 604 2286 HOH HOH B . 
F 3 HOH 399 605 2287 HOH HOH B . 
F 3 HOH 400 606 2292 HOH HOH B . 
F 3 HOH 401 607 2293 HOH HOH B . 
F 3 HOH 402 608 2297 HOH HOH B . 
F 3 HOH 403 609 2298 HOH HOH B . 
F 3 HOH 404 610 2302 HOH HOH B . 
F 3 HOH 405 611 2305 HOH HOH B . 
F 3 HOH 406 612 2307 HOH HOH B . 
F 3 HOH 407 613 2308 HOH HOH B . 
F 3 HOH 408 614 2314 HOH HOH B . 
F 3 HOH 409 615 2316 HOH HOH B . 
F 3 HOH 410 616 2317 HOH HOH B . 
F 3 HOH 411 617 2318 HOH HOH B . 
F 3 HOH 412 618 2320 HOH HOH B . 
F 3 HOH 413 619 2324 HOH HOH B . 
F 3 HOH 414 620 2325 HOH HOH B . 
F 3 HOH 415 621 2328 HOH HOH B . 
F 3 HOH 416 622 2329 HOH HOH B . 
F 3 HOH 417 623 2333 HOH HOH B . 
F 3 HOH 418 624 2334 HOH HOH B . 
F 3 HOH 419 625 2335 HOH HOH B . 
F 3 HOH 420 626 2339 HOH HOH B . 
F 3 HOH 421 627 2340 HOH HOH B . 
F 3 HOH 422 628 2345 HOH HOH B . 
F 3 HOH 423 629 2346 HOH HOH B . 
F 3 HOH 424 630 2347 HOH HOH B . 
F 3 HOH 425 631 2349 HOH HOH B . 
F 3 HOH 426 632 2351 HOH HOH B . 
F 3 HOH 427 633 2352 HOH HOH B . 
F 3 HOH 428 634 2353 HOH HOH B . 
F 3 HOH 429 635 2355 HOH HOH B . 
F 3 HOH 430 636 2356 HOH HOH B . 
F 3 HOH 431 637 2359 HOH HOH B . 
F 3 HOH 432 638 2360 HOH HOH B . 
F 3 HOH 433 639 2362 HOH HOH B . 
F 3 HOH 434 640 2367 HOH HOH B . 
F 3 HOH 435 641 2369 HOH HOH B . 
F 3 HOH 436 642 2370 HOH HOH B . 
F 3 HOH 437 643 2374 HOH HOH B . 
F 3 HOH 438 644 2379 HOH HOH B . 
F 3 HOH 439 645 2380 HOH HOH B . 
F 3 HOH 440 646 2381 HOH HOH B . 
F 3 HOH 441 647 2385 HOH HOH B . 
F 3 HOH 442 648 2387 HOH HOH B . 
F 3 HOH 443 649 2388 HOH HOH B . 
F 3 HOH 444 650 2389 HOH HOH B . 
F 3 HOH 445 651 2391 HOH HOH B . 
F 3 HOH 446 652 2392 HOH HOH B . 
F 3 HOH 447 653 2393 HOH HOH B . 
F 3 HOH 448 654 2394 HOH HOH B . 
#