data_1JYF
# 
_entry.id   1JYF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.341 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JYF         
RCSB  RCSB014331   
WWPDB D_1000014331 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1JYE 
_pdbx_database_related.details        'Structure of a Dimeric Lac Repressor with C-terminal Deletion and K84L Substitution' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JYF 
_pdbx_database_status.recvd_initial_deposition_date   2001-09-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bell, C.E.'     1 
'Barry, J.'      2 
'Matthews, K.S.' 3 
'Lewis, M.'      4 
# 
_citation.id                        primary 
_citation.title                     
'Structure of a variant of lac repressor with increased thermostability and decreased affinity for operator.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            313 
_citation.page_first                99 
_citation.page_last                 109 
_citation.year                      2001 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11601849 
_citation.pdbx_database_id_DOI      10.1006/jmbi.2001.5041 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bell, C.E.'     1 ? 
primary 'Barry, J.'      2 ? 
primary 'Matthews, K.S.' 3 ? 
primary 'Lewis, M.'      4 ? 
# 
_cell.entry_id           1JYF 
_cell.length_a           91.700 
_cell.length_b           91.700 
_cell.length_c           222.300 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JYF 
_symmetry.space_group_name_H-M             'I 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                98 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Lactose Operon Repressor' 37442.715 1  ? ? 'C-TERMINAL DELETION' ? 
2 non-polymer syn GLYCEROL                   92.094    1  ? ? ?                     ? 
3 water       nat water                      18.015    18 ? ? ?                     ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIV
AAIKSRADQLGASVVVSMVERSGVEACKTAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSII
FSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPT
AMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLP
VSLVKRKTTLAPNTQTASPRALADSLMQL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIV
AAIKSRADQLGASVVVSMVERSGVEACKTAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSII
FSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPT
AMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLP
VSLVKRKTTLAPNTQTASPRALADSLMQL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   PRO n 
1 4   VAL n 
1 5   THR n 
1 6   LEU n 
1 7   TYR n 
1 8   ASP n 
1 9   VAL n 
1 10  ALA n 
1 11  GLU n 
1 12  TYR n 
1 13  ALA n 
1 14  GLY n 
1 15  VAL n 
1 16  SER n 
1 17  TYR n 
1 18  GLN n 
1 19  THR n 
1 20  VAL n 
1 21  SER n 
1 22  ARG n 
1 23  VAL n 
1 24  VAL n 
1 25  ASN n 
1 26  GLN n 
1 27  ALA n 
1 28  SER n 
1 29  HIS n 
1 30  VAL n 
1 31  SER n 
1 32  ALA n 
1 33  LYS n 
1 34  THR n 
1 35  ARG n 
1 36  GLU n 
1 37  LYS n 
1 38  VAL n 
1 39  GLU n 
1 40  ALA n 
1 41  ALA n 
1 42  MET n 
1 43  ALA n 
1 44  GLU n 
1 45  LEU n 
1 46  ASN n 
1 47  TYR n 
1 48  ILE n 
1 49  PRO n 
1 50  ASN n 
1 51  ARG n 
1 52  VAL n 
1 53  ALA n 
1 54  GLN n 
1 55  GLN n 
1 56  LEU n 
1 57  ALA n 
1 58  GLY n 
1 59  LYS n 
1 60  GLN n 
1 61  SER n 
1 62  LEU n 
1 63  LEU n 
1 64  ILE n 
1 65  GLY n 
1 66  VAL n 
1 67  ALA n 
1 68  THR n 
1 69  SER n 
1 70  SER n 
1 71  LEU n 
1 72  ALA n 
1 73  LEU n 
1 74  HIS n 
1 75  ALA n 
1 76  PRO n 
1 77  SER n 
1 78  GLN n 
1 79  ILE n 
1 80  VAL n 
1 81  ALA n 
1 82  ALA n 
1 83  ILE n 
1 84  LYS n 
1 85  SER n 
1 86  ARG n 
1 87  ALA n 
1 88  ASP n 
1 89  GLN n 
1 90  LEU n 
1 91  GLY n 
1 92  ALA n 
1 93  SER n 
1 94  VAL n 
1 95  VAL n 
1 96  VAL n 
1 97  SER n 
1 98  MET n 
1 99  VAL n 
1 100 GLU n 
1 101 ARG n 
1 102 SER n 
1 103 GLY n 
1 104 VAL n 
1 105 GLU n 
1 106 ALA n 
1 107 CYS n 
1 108 LYS n 
1 109 THR n 
1 110 ALA n 
1 111 VAL n 
1 112 HIS n 
1 113 ASN n 
1 114 LEU n 
1 115 LEU n 
1 116 ALA n 
1 117 GLN n 
1 118 ARG n 
1 119 VAL n 
1 120 SER n 
1 121 GLY n 
1 122 LEU n 
1 123 ILE n 
1 124 ILE n 
1 125 ASN n 
1 126 TYR n 
1 127 PRO n 
1 128 LEU n 
1 129 ASP n 
1 130 ASP n 
1 131 GLN n 
1 132 ASP n 
1 133 ALA n 
1 134 ILE n 
1 135 ALA n 
1 136 VAL n 
1 137 GLU n 
1 138 ALA n 
1 139 ALA n 
1 140 CYS n 
1 141 THR n 
1 142 ASN n 
1 143 VAL n 
1 144 PRO n 
1 145 ALA n 
1 146 LEU n 
1 147 PHE n 
1 148 LEU n 
1 149 ASP n 
1 150 VAL n 
1 151 SER n 
1 152 ASP n 
1 153 GLN n 
1 154 THR n 
1 155 PRO n 
1 156 ILE n 
1 157 ASN n 
1 158 SER n 
1 159 ILE n 
1 160 ILE n 
1 161 PHE n 
1 162 SER n 
1 163 HIS n 
1 164 GLU n 
1 165 ASP n 
1 166 GLY n 
1 167 THR n 
1 168 ARG n 
1 169 LEU n 
1 170 GLY n 
1 171 VAL n 
1 172 GLU n 
1 173 HIS n 
1 174 LEU n 
1 175 VAL n 
1 176 ALA n 
1 177 LEU n 
1 178 GLY n 
1 179 HIS n 
1 180 GLN n 
1 181 GLN n 
1 182 ILE n 
1 183 ALA n 
1 184 LEU n 
1 185 LEU n 
1 186 ALA n 
1 187 GLY n 
1 188 PRO n 
1 189 LEU n 
1 190 SER n 
1 191 SER n 
1 192 VAL n 
1 193 SER n 
1 194 ALA n 
1 195 ARG n 
1 196 LEU n 
1 197 ARG n 
1 198 LEU n 
1 199 ALA n 
1 200 GLY n 
1 201 TRP n 
1 202 HIS n 
1 203 LYS n 
1 204 TYR n 
1 205 LEU n 
1 206 THR n 
1 207 ARG n 
1 208 ASN n 
1 209 GLN n 
1 210 ILE n 
1 211 GLN n 
1 212 PRO n 
1 213 ILE n 
1 214 ALA n 
1 215 GLU n 
1 216 ARG n 
1 217 GLU n 
1 218 GLY n 
1 219 ASP n 
1 220 TRP n 
1 221 SER n 
1 222 ALA n 
1 223 MET n 
1 224 SER n 
1 225 GLY n 
1 226 PHE n 
1 227 GLN n 
1 228 GLN n 
1 229 THR n 
1 230 MET n 
1 231 GLN n 
1 232 MET n 
1 233 LEU n 
1 234 ASN n 
1 235 GLU n 
1 236 GLY n 
1 237 ILE n 
1 238 VAL n 
1 239 PRO n 
1 240 THR n 
1 241 ALA n 
1 242 MET n 
1 243 LEU n 
1 244 VAL n 
1 245 ALA n 
1 246 ASN n 
1 247 ASP n 
1 248 GLN n 
1 249 MET n 
1 250 ALA n 
1 251 LEU n 
1 252 GLY n 
1 253 ALA n 
1 254 MET n 
1 255 ARG n 
1 256 ALA n 
1 257 ILE n 
1 258 THR n 
1 259 GLU n 
1 260 SER n 
1 261 GLY n 
1 262 LEU n 
1 263 ARG n 
1 264 VAL n 
1 265 GLY n 
1 266 ALA n 
1 267 ASP n 
1 268 ILE n 
1 269 SER n 
1 270 VAL n 
1 271 VAL n 
1 272 GLY n 
1 273 TYR n 
1 274 ASP n 
1 275 ASP n 
1 276 THR n 
1 277 GLU n 
1 278 ASP n 
1 279 SER n 
1 280 SER n 
1 281 CYS n 
1 282 TYR n 
1 283 ILE n 
1 284 PRO n 
1 285 PRO n 
1 286 LEU n 
1 287 THR n 
1 288 THR n 
1 289 ILE n 
1 290 LYS n 
1 291 GLN n 
1 292 ASP n 
1 293 PHE n 
1 294 ARG n 
1 295 LEU n 
1 296 LEU n 
1 297 GLY n 
1 298 GLN n 
1 299 THR n 
1 300 SER n 
1 301 VAL n 
1 302 ASP n 
1 303 ARG n 
1 304 LEU n 
1 305 LEU n 
1 306 GLN n 
1 307 LEU n 
1 308 SER n 
1 309 GLN n 
1 310 GLY n 
1 311 GLN n 
1 312 ALA n 
1 313 VAL n 
1 314 LYS n 
1 315 GLY n 
1 316 ASN n 
1 317 GLN n 
1 318 LEU n 
1 319 LEU n 
1 320 PRO n 
1 321 VAL n 
1 322 SER n 
1 323 LEU n 
1 324 VAL n 
1 325 LYS n 
1 326 ARG n 
1 327 LYS n 
1 328 THR n 
1 329 THR n 
1 330 LEU n 
1 331 ALA n 
1 332 PRO n 
1 333 ASN n 
1 334 THR n 
1 335 GLN n 
1 336 THR n 
1 337 ALA n 
1 338 SER n 
1 339 PRO n 
1 340 ARG n 
1 341 ALA n 
1 342 LEU n 
1 343 ALA n 
1 344 ASP n 
1 345 SER n 
1 346 LEU n 
1 347 MET n 
1 348 GLN n 
1 349 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 LacI 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               TB-1 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pJC-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LACI_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIV
AAIKSRADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSII
FSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPT
AMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLP
VSLVKRKTTLAPNTQTASPRALADSLMQL
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P03023 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1JYF 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 349 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P03023 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  349 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       349 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1JYF 
_struct_ref_seq_dif.mon_id                       THR 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      109 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P03023 
_struct_ref_seq_dif.db_mon_id                    ALA 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          109 
_struct_ref_seq_dif.details                      'SEE REMARK 999' 
_struct_ref_seq_dif.pdbx_auth_seq_num            109 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1JYF 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.12 
_exptl_crystal.density_percent_sol   60.56 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_details    'Sodium Citrate, Sodium Acetate, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Osmic Mirrors' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.54 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1JYF 
_reflns.observed_criterion_sigma_I   -2.0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             45.6 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   9811 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.1680000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        4.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              ? 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           0.5070000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.5 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1JYF 
_refine.ls_number_reflns_obs                     9765 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               2855017.57 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             19.89 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    98.9 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2030000 
_refine.ls_R_factor_R_free                       0.2520000 
_refine.ls_R_factor_R_free_error                 0.008 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.3 
_refine.ls_number_reflns_R_free                  1009 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               44.7 
_refine.aniso_B[1][1]                            5.17 
_refine.aniso_B[2][2]                            5.17 
_refine.aniso_B[3][3]                            -10.33 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.339368 
_refine.solvent_model_param_bsol                 26.301 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'Lac repressor dimer' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           2855017.57 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1JYF 
_refine_analyze.Luzzati_coordinate_error_obs    0.33 
_refine_analyze.Luzzati_sigma_a_obs             0.45 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.44 
_refine_analyze.Luzzati_sigma_a_free            0.53 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2035 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             18 
_refine_hist.number_atoms_total               2059 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        19.89 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.8  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.84  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.27  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.25  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.85  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.92  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.19 
_refine_ls_shell.number_reflns_R_work             1415 
_refine_ls_shell.R_factor_R_work                  0.3130000 
_refine_ls_shell.percent_reflns_obs               98.3 
_refine_ls_shell.R_factor_R_free                  0.3390000 
_refine_ls_shell.R_factor_R_free_error            0.027 
_refine_ls_shell.percent_reflns_R_free            10.1 
_refine_ls_shell.number_reflns_R_free             159 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM  PROTEIN.TOP      'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM    WATER.TOP        'X-RAY DIFFRACTION' 
3 CARBOHYDRATE.PARAM CARBOHYDRATE.TOP 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1JYF 
_struct.title                     'Structure of the Dimeric Lac Repressor with an 11-residue C-terminal Deletion.' 
_struct.pdbx_descriptor           'Lactose Operon Repressor' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JYF 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'Gene Regulation, Protein Stability, Protein DNA-binding, TRANSCRIPTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LEU A 73  ? LEU A 90  ? LEU A 73  LEU A 90  1 ? 18 
HELX_P HELX_P2 2 GLY A 103 ? GLN A 117 ? GLY A 103 GLN A 117 1 ? 15 
HELX_P HELX_P3 3 ASP A 129 ? CYS A 140 ? ASP A 129 CYS A 140 1 ? 12 
HELX_P HELX_P4 4 SER A 162 ? LEU A 177 ? SER A 162 LEU A 177 1 ? 16 
HELX_P HELX_P5 5 SER A 191 ? ASN A 208 ? SER A 191 ASN A 208 1 ? 18 
HELX_P HELX_P6 6 SER A 221 ? GLU A 235 ? SER A 221 GLU A 235 1 ? 15 
HELX_P HELX_P7 7 ASN A 246 ? GLU A 259 ? ASN A 246 GLU A 259 1 ? 14 
HELX_P HELX_P8 8 GLU A 277 ? TYR A 282 ? GLU A 277 TYR A 282 5 ? 6  
HELX_P HELX_P9 9 ASP A 292 ? SER A 308 ? ASP A 292 SER A 308 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ILE 
_struct_mon_prot_cis.label_seq_id           283 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ILE 
_struct_mon_prot_cis.auth_seq_id            283 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    284 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     284 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.41 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
B 1 2 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 93  ? VAL A 99  ? SER A 93  VAL A 99  
A 2 LEU A 63  ? SER A 69  ? LEU A 63  SER A 69  
A 3 LEU A 122 ? ASN A 125 ? LEU A 122 ASN A 125 
A 4 ALA A 145 ? PHE A 147 ? ALA A 145 PHE A 147 
B 1 SER A 158 ? PHE A 161 ? SER A 158 PHE A 161 
B 2 ASN A 316 ? LEU A 319 ? ASN A 316 LEU A 319 
C 1 ALA A 214 ? GLU A 217 ? ALA A 214 GLU A 217 
C 2 ILE A 182 ? ALA A 186 ? ILE A 182 ALA A 186 
C 3 ALA A 241 ? VAL A 244 ? ALA A 241 VAL A 244 
C 4 SER A 269 ? ASP A 274 ? SER A 269 ASP A 274 
C 5 THR A 287 ? LYS A 290 ? THR A 287 LYS A 290 
C 6 SER A 322 ? VAL A 324 ? SER A 322 VAL A 324 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O SER A 97  ? O SER A 97  N VAL A 66  ? N VAL A 66  
A 2 3 N GLY A 65  ? N GLY A 65  O ILE A 123 ? O ILE A 123 
A 3 4 N LEU A 122 ? N LEU A 122 O LEU A 146 ? O LEU A 146 
B 1 2 N ILE A 160 ? N ILE A 160 O LEU A 319 ? O LEU A 319 
C 1 2 O ARG A 216 ? O ARG A 216 N LEU A 184 ? N LEU A 184 
C 2 3 N LEU A 185 ? N LEU A 185 O LEU A 243 ? O LEU A 243 
C 3 4 N MET A 242 ? N MET A 242 O VAL A 271 ? O VAL A 271 
C 4 5 N ASP A 274 ? N ASP A 274 O ILE A 289 ? O ILE A 289 
C 5 6 N LYS A 290 ? N LYS A 290 O SER A 322 ? O SER A 322 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    GOL 
_struct_site.pdbx_auth_seq_id     350 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    7 
_struct_site.details              'BINDING SITE FOR RESIDUE GOL A 350' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 7 ALA A 75  ? ALA A 75  . ? 1_555 ? 
2 AC1 7 SER A 193 ? SER A 193 . ? 1_555 ? 
3 AC1 7 ARG A 197 ? ARG A 197 . ? 1_555 ? 
4 AC1 7 ASN A 246 ? ASN A 246 . ? 1_555 ? 
5 AC1 7 ASP A 274 ? ASP A 274 . ? 1_555 ? 
6 AC1 7 GLN A 291 ? GLN A 291 . ? 1_555 ? 
7 AC1 7 HOH C .   ? HOH A 366 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1JYF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JYF 
_atom_sites.fract_transf_matrix[1][1]   0.010905 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010905 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004498 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LEU A 1 62  ? 55.829 64.222 83.106  1.00 62.37  ? 62  LEU A N   1 
ATOM   2    C CA  . LEU A 1 62  ? 56.049 63.312 81.952  1.00 62.99  ? 62  LEU A CA  1 
ATOM   3    C C   . LEU A 1 62  ? 57.409 62.611 81.983  1.00 62.93  ? 62  LEU A C   1 
ATOM   4    O O   . LEU A 1 62  ? 57.609 61.620 81.279  1.00 64.40  ? 62  LEU A O   1 
ATOM   5    C CB  . LEU A 1 62  ? 55.883 64.073 80.627  1.00 63.87  ? 62  LEU A CB  1 
ATOM   6    C CG  . LEU A 1 62  ? 56.110 65.592 80.574  1.00 64.71  ? 62  LEU A CG  1 
ATOM   7    C CD1 . LEU A 1 62  ? 57.384 65.969 81.328  1.00 64.42  ? 62  LEU A CD1 1 
ATOM   8    C CD2 . LEU A 1 62  ? 56.168 66.046 79.108  1.00 63.55  ? 62  LEU A CD2 1 
ATOM   9    N N   . LEU A 1 63  ? 58.347 63.114 82.781  1.00 61.13  ? 63  LEU A N   1 
ATOM   10   C CA  . LEU A 1 63  ? 59.657 62.468 82.879  1.00 60.03  ? 63  LEU A CA  1 
ATOM   11   C C   . LEU A 1 63  ? 59.864 61.839 84.255  1.00 60.80  ? 63  LEU A C   1 
ATOM   12   O O   . LEU A 1 63  ? 60.161 62.544 85.220  1.00 60.83  ? 63  LEU A O   1 
ATOM   13   C CB  . LEU A 1 63  ? 60.782 63.466 82.627  1.00 57.99  ? 63  LEU A CB  1 
ATOM   14   C CG  . LEU A 1 63  ? 62.146 62.849 82.938  1.00 56.14  ? 63  LEU A CG  1 
ATOM   15   C CD1 . LEU A 1 63  ? 62.345 61.618 82.090  1.00 56.38  ? 63  LEU A CD1 1 
ATOM   16   C CD2 . LEU A 1 63  ? 63.239 63.846 82.687  1.00 55.63  ? 63  LEU A CD2 1 
ATOM   17   N N   . ILE A 1 64  ? 59.721 60.517 84.345  1.00 61.52  ? 64  ILE A N   1 
ATOM   18   C CA  . ILE A 1 64  ? 59.890 59.828 85.626  1.00 62.19  ? 64  ILE A CA  1 
ATOM   19   C C   . ILE A 1 64  ? 61.335 59.393 85.866  1.00 61.94  ? 64  ILE A C   1 
ATOM   20   O O   . ILE A 1 64  ? 62.114 59.219 84.922  1.00 61.34  ? 64  ILE A O   1 
ATOM   21   C CB  . ILE A 1 64  ? 58.969 58.573 85.750  1.00 62.90  ? 64  ILE A CB  1 
ATOM   22   C CG1 . ILE A 1 64  ? 59.388 57.507 84.742  1.00 64.77  ? 64  ILE A CG1 1 
ATOM   23   C CG2 . ILE A 1 64  ? 57.511 58.957 85.525  1.00 62.47  ? 64  ILE A CG2 1 
ATOM   24   C CD1 . ILE A 1 64  ? 58.598 56.214 84.867  1.00 67.03  ? 64  ILE A CD1 1 
ATOM   25   N N   . GLY A 1 65  ? 61.679 59.228 87.142  1.00 61.24  ? 65  GLY A N   1 
ATOM   26   C CA  . GLY A 1 65  ? 63.022 58.819 87.514  1.00 60.80  ? 65  GLY A CA  1 
ATOM   27   C C   . GLY A 1 65  ? 63.044 57.589 88.405  1.00 59.90  ? 65  GLY A C   1 
ATOM   28   O O   . GLY A 1 65  ? 62.482 57.588 89.500  1.00 60.96  ? 65  GLY A O   1 
ATOM   29   N N   . VAL A 1 66  ? 63.702 56.536 87.933  1.00 58.29  ? 66  VAL A N   1 
ATOM   30   C CA  . VAL A 1 66  ? 63.796 55.288 88.679  1.00 56.31  ? 66  VAL A CA  1 
ATOM   31   C C   . VAL A 1 66  ? 65.184 55.091 89.297  1.00 55.97  ? 66  VAL A C   1 
ATOM   32   O O   . VAL A 1 66  ? 66.200 55.181 88.611  1.00 56.92  ? 66  VAL A O   1 
ATOM   33   C CB  . VAL A 1 66  ? 63.487 54.075 87.753  1.00 55.82  ? 66  VAL A CB  1 
ATOM   34   C CG1 . VAL A 1 66  ? 63.571 52.767 88.539  1.00 54.49  ? 66  VAL A CG1 1 
ATOM   35   C CG2 . VAL A 1 66  ? 62.108 54.244 87.113  1.00 55.03  ? 66  VAL A CG2 1 
ATOM   36   N N   . ALA A 1 67  ? 65.228 54.847 90.600  1.00 54.97  ? 67  ALA A N   1 
ATOM   37   C CA  . ALA A 1 67  ? 66.490 54.583 91.279  1.00 54.98  ? 67  ALA A CA  1 
ATOM   38   C C   . ALA A 1 67  ? 66.389 53.094 91.605  1.00 55.21  ? 67  ALA A C   1 
ATOM   39   O O   . ALA A 1 67  ? 65.622 52.697 92.473  1.00 55.76  ? 67  ALA A O   1 
ATOM   40   C CB  . ALA A 1 67  ? 66.602 55.407 92.548  1.00 53.68  ? 67  ALA A CB  1 
ATOM   41   N N   . THR A 1 68  ? 67.152 52.272 90.896  1.00 55.51  ? 68  THR A N   1 
ATOM   42   C CA  . THR A 1 68  ? 67.089 50.831 91.088  1.00 56.52  ? 68  THR A CA  1 
ATOM   43   C C   . THR A 1 68  ? 68.398 50.195 91.559  1.00 56.97  ? 68  THR A C   1 
ATOM   44   O O   . THR A 1 68  ? 69.387 50.884 91.804  1.00 56.64  ? 68  THR A O   1 
ATOM   45   C CB  . THR A 1 68  ? 66.609 50.161 89.765  1.00 57.22  ? 68  THR A CB  1 
ATOM   46   O OG1 . THR A 1 68  ? 66.580 48.735 89.908  1.00 58.46  ? 68  THR A OG1 1 
ATOM   47   C CG2 . THR A 1 68  ? 67.527 50.539 88.613  1.00 57.15  ? 68  THR A CG2 1 
ATOM   48   N N   . SER A 1 69  ? 68.377 48.874 91.715  1.00 58.31  ? 69  SER A N   1 
ATOM   49   C CA  . SER A 1 69  ? 69.546 48.104 92.132  1.00 59.62  ? 69  SER A CA  1 
ATOM   50   C C   . SER A 1 69  ? 70.183 47.613 90.847  1.00 60.34  ? 69  SER A C   1 
ATOM   51   O O   . SER A 1 69  ? 69.516 47.578 89.811  1.00 60.28  ? 69  SER A O   1 
ATOM   52   C CB  . SER A 1 69  ? 69.129 46.897 92.971  1.00 59.70  ? 69  SER A CB  1 
ATOM   53   O OG  . SER A 1 69  ? 68.372 47.292 94.098  1.00 62.04  ? 69  SER A OG  1 
ATOM   54   N N   . SER A 1 70  ? 71.453 47.220 90.900  1.00 61.38  ? 70  SER A N   1 
ATOM   55   C CA  . SER A 1 70  ? 72.119 46.754 89.689  1.00 62.34  ? 70  SER A CA  1 
ATOM   56   C C   . SER A 1 70  ? 71.290 45.770 88.870  1.00 62.55  ? 70  SER A C   1 
ATOM   57   O O   . SER A 1 70  ? 70.749 44.772 89.388  1.00 62.52  ? 70  SER A O   1 
ATOM   58   C CB  . SER A 1 70  ? 73.487 46.150 90.005  1.00 61.53  ? 70  SER A CB  1 
ATOM   59   O OG  . SER A 1 70  ? 74.495 47.124 89.791  1.00 62.90  ? 70  SER A OG  1 
ATOM   60   N N   . LEU A 1 71  ? 71.194 46.081 87.580  1.00 60.21  ? 71  LEU A N   1 
ATOM   61   C CA  . LEU A 1 71  ? 70.437 45.270 86.658  1.00 58.51  ? 71  LEU A CA  1 
ATOM   62   C C   . LEU A 1 71  ? 71.000 43.872 86.553  1.00 57.40  ? 71  LEU A C   1 
ATOM   63   O O   . LEU A 1 71  ? 70.434 43.020 85.875  1.00 58.28  ? 71  LEU A O   1 
ATOM   64   C CB  . LEU A 1 71  ? 70.396 45.937 85.287  1.00 58.48  ? 71  LEU A CB  1 
ATOM   65   C CG  . LEU A 1 71  ? 69.539 47.207 85.250  1.00 59.45  ? 71  LEU A CG  1 
ATOM   66   C CD1 . LEU A 1 71  ? 68.137 46.890 85.775  1.00 58.63  ? 71  LEU A CD1 1 
ATOM   67   C CD2 . LEU A 1 71  ? 70.185 48.303 86.084  1.00 58.83  ? 71  LEU A CD2 1 
ATOM   68   N N   . ALA A 1 72  ? 72.113 43.633 87.232  1.00 55.54  ? 72  ALA A N   1 
ATOM   69   C CA  . ALA A 1 72  ? 72.734 42.315 87.224  1.00 53.56  ? 72  ALA A CA  1 
ATOM   70   C C   . ALA A 1 72  ? 71.692 41.224 87.504  1.00 52.13  ? 72  ALA A C   1 
ATOM   71   O O   . ALA A 1 72  ? 71.833 40.085 87.048  1.00 52.76  ? 72  ALA A O   1 
ATOM   72   C CB  . ALA A 1 72  ? 73.834 42.260 88.276  1.00 54.55  ? 72  ALA A CB  1 
ATOM   73   N N   . LEU A 1 73  ? 70.649 41.574 88.254  1.00 49.46  ? 73  LEU A N   1 
ATOM   74   C CA  . LEU A 1 73  ? 69.606 40.616 88.589  1.00 47.34  ? 73  LEU A CA  1 
ATOM   75   C C   . LEU A 1 73  ? 68.425 40.722 87.634  1.00 47.28  ? 73  LEU A C   1 
ATOM   76   O O   . LEU A 1 73  ? 67.956 41.815 87.324  1.00 48.07  ? 73  LEU A O   1 
ATOM   77   C CB  . LEU A 1 73  ? 69.141 40.833 90.031  1.00 46.33  ? 73  LEU A CB  1 
ATOM   78   C CG  . LEU A 1 73  ? 70.160 40.573 91.152  1.00 44.84  ? 73  LEU A CG  1 
ATOM   79   C CD1 . LEU A 1 73  ? 69.539 40.943 92.490  1.00 44.92  ? 73  LEU A CD1 1 
ATOM   80   C CD2 . LEU A 1 73  ? 70.595 39.110 91.163  1.00 41.99  ? 73  LEU A CD2 1 
ATOM   81   N N   . HIS A 1 74  ? 67.940 39.578 87.175  1.00 47.23  ? 74  HIS A N   1 
ATOM   82   C CA  . HIS A 1 74  ? 66.827 39.542 86.239  1.00 48.20  ? 74  HIS A CA  1 
ATOM   83   C C   . HIS A 1 74  ? 65.572 40.281 86.702  1.00 47.85  ? 74  HIS A C   1 
ATOM   84   O O   . HIS A 1 74  ? 64.885 40.905 85.900  1.00 47.97  ? 74  HIS A O   1 
ATOM   85   C CB  . HIS A 1 74  ? 66.475 38.091 85.919  1.00 49.74  ? 74  HIS A CB  1 
ATOM   86   C CG  . HIS A 1 74  ? 67.659 37.254 85.545  1.00 51.31  ? 74  HIS A CG  1 
ATOM   87   N ND1 . HIS A 1 74  ? 68.876 37.801 85.199  1.00 52.38  ? 74  HIS A ND1 1 
ATOM   88   C CD2 . HIS A 1 74  ? 67.809 35.912 85.446  1.00 51.84  ? 74  HIS A CD2 1 
ATOM   89   C CE1 . HIS A 1 74  ? 69.725 36.833 84.904  1.00 51.84  ? 74  HIS A CE1 1 
ATOM   90   N NE2 . HIS A 1 74  ? 69.102 35.677 85.045  1.00 52.31  ? 74  HIS A NE2 1 
ATOM   91   N N   . ALA A 1 75  ? 65.274 40.213 87.994  1.00 47.63  ? 75  ALA A N   1 
ATOM   92   C CA  . ALA A 1 75  ? 64.088 40.870 88.532  1.00 46.77  ? 75  ALA A CA  1 
ATOM   93   C C   . ALA A 1 75  ? 64.063 42.395 88.361  1.00 45.98  ? 75  ALA A C   1 
ATOM   94   O O   . ALA A 1 75  ? 63.167 42.933 87.712  1.00 45.25  ? 75  ALA A O   1 
ATOM   95   C CB  . ALA A 1 75  ? 63.914 40.498 90.003  1.00 47.03  ? 75  ALA A CB  1 
ATOM   96   N N   . PRO A 1 76  ? 65.034 43.115 88.942  1.00 45.41  ? 76  PRO A N   1 
ATOM   97   C CA  . PRO A 1 76  ? 65.014 44.572 88.782  1.00 46.84  ? 76  PRO A CA  1 
ATOM   98   C C   . PRO A 1 76  ? 64.959 44.974 87.317  1.00 48.72  ? 76  PRO A C   1 
ATOM   99   O O   . PRO A 1 76  ? 64.230 45.897 86.941  1.00 50.46  ? 76  PRO A O   1 
ATOM   100  C CB  . PRO A 1 76  ? 66.311 45.014 89.446  1.00 46.73  ? 76  PRO A CB  1 
ATOM   101  C CG  . PRO A 1 76  ? 66.489 43.999 90.509  1.00 47.04  ? 76  PRO A CG  1 
ATOM   102  C CD  . PRO A 1 76  ? 66.149 42.704 89.805  1.00 45.76  ? 76  PRO A CD  1 
ATOM   103  N N   . SER A 1 77  ? 65.731 44.277 86.488  1.00 48.38  ? 77  SER A N   1 
ATOM   104  C CA  . SER A 1 77  ? 65.755 44.568 85.062  1.00 46.41  ? 77  SER A CA  1 
ATOM   105  C C   . SER A 1 77  ? 64.354 44.557 84.476  1.00 44.63  ? 77  SER A C   1 
ATOM   106  O O   . SER A 1 77  ? 63.850 45.596 84.046  1.00 42.26  ? 77  SER A O   1 
ATOM   107  C CB  . SER A 1 77  ? 66.616 43.546 84.342  1.00 46.58  ? 77  SER A CB  1 
ATOM   108  O OG  . SER A 1 77  ? 67.967 43.697 84.726  1.00 49.62  ? 77  SER A OG  1 
ATOM   109  N N   . GLN A 1 78  ? 63.732 43.378 84.474  1.00 44.21  ? 78  GLN A N   1 
ATOM   110  C CA  . GLN A 1 78  ? 62.384 43.216 83.939  1.00 45.06  ? 78  GLN A CA  1 
ATOM   111  C C   . GLN A 1 78  ? 61.422 44.287 84.452  1.00 45.73  ? 78  GLN A C   1 
ATOM   112  O O   . GLN A 1 78  ? 60.504 44.694 83.732  1.00 46.43  ? 78  GLN A O   1 
ATOM   113  C CB  . GLN A 1 78  ? 61.822 41.824 84.270  1.00 43.61  ? 78  GLN A CB  1 
ATOM   114  C CG  . GLN A 1 78  ? 62.630 40.661 83.698  1.00 43.88  ? 78  GLN A CG  1 
ATOM   115  C CD  . GLN A 1 78  ? 61.867 39.326 83.666  1.00 43.68  ? 78  GLN A CD  1 
ATOM   116  O OE1 . GLN A 1 78  ? 62.471 38.259 83.511  1.00 44.97  ? 78  GLN A OE1 1 
ATOM   117  N NE2 . GLN A 1 78  ? 60.546 39.386 83.793  1.00 40.78  ? 78  GLN A NE2 1 
ATOM   118  N N   . ILE A 1 79  ? 61.630 44.743 85.687  1.00 45.33  ? 79  ILE A N   1 
ATOM   119  C CA  . ILE A 1 79  ? 60.770 45.771 86.276  1.00 44.77  ? 79  ILE A CA  1 
ATOM   120  C C   . ILE A 1 79  ? 60.990 47.107 85.576  1.00 45.32  ? 79  ILE A C   1 
ATOM   121  O O   . ILE A 1 79  ? 60.030 47.789 85.208  1.00 45.01  ? 79  ILE A O   1 
ATOM   122  C CB  . ILE A 1 79  ? 61.033 45.922 87.803  1.00 43.98  ? 79  ILE A CB  1 
ATOM   123  C CG1 . ILE A 1 79  ? 60.457 44.710 88.545  1.00 42.99  ? 79  ILE A CG1 1 
ATOM   124  C CG2 . ILE A 1 79  ? 60.411 47.210 88.330  1.00 42.71  ? 79  ILE A CG2 1 
ATOM   125  C CD1 . ILE A 1 79  ? 60.722 44.713 90.028  1.00 40.63  ? 79  ILE A CD1 1 
ATOM   126  N N   . VAL A 1 80  ? 62.252 47.479 85.381  1.00 46.58  ? 80  VAL A N   1 
ATOM   127  C CA  . VAL A 1 80  ? 62.567 48.733 84.706  1.00 47.33  ? 80  VAL A CA  1 
ATOM   128  C C   . VAL A 1 80  ? 62.008 48.680 83.285  1.00 48.40  ? 80  VAL A C   1 
ATOM   129  O O   . VAL A 1 80  ? 61.541 49.691 82.742  1.00 48.26  ? 80  VAL A O   1 
ATOM   130  C CB  . VAL A 1 80  ? 64.078 48.970 84.660  1.00 45.98  ? 80  VAL A CB  1 
ATOM   131  C CG1 . VAL A 1 80  ? 64.381 50.207 83.844  1.00 46.87  ? 80  VAL A CG1 1 
ATOM   132  C CG2 . VAL A 1 80  ? 64.602 49.140 86.069  1.00 46.33  ? 80  VAL A CG2 1 
ATOM   133  N N   . ALA A 1 81  ? 62.054 47.490 82.693  1.00 48.62  ? 81  ALA A N   1 
ATOM   134  C CA  . ALA A 1 81  ? 61.529 47.283 81.351  1.00 48.81  ? 81  ALA A CA  1 
ATOM   135  C C   . ALA A 1 81  ? 60.016 47.492 81.398  1.00 48.71  ? 81  ALA A C   1 
ATOM   136  O O   . ALA A 1 81  ? 59.442 48.142 80.529  1.00 48.60  ? 81  ALA A O   1 
ATOM   137  C CB  . ALA A 1 81  ? 61.854 45.877 80.875  1.00 48.51  ? 81  ALA A CB  1 
ATOM   138  N N   . ALA A 1 82  ? 59.379 46.938 82.426  1.00 48.95  ? 82  ALA A N   1 
ATOM   139  C CA  . ALA A 1 82  ? 57.935 47.071 82.593  1.00 48.56  ? 82  ALA A CA  1 
ATOM   140  C C   . ALA A 1 82  ? 57.578 48.539 82.781  1.00 48.45  ? 82  ALA A C   1 
ATOM   141  O O   . ALA A 1 82  ? 56.598 49.021 82.207  1.00 49.22  ? 82  ALA A O   1 
ATOM   142  C CB  . ALA A 1 82  ? 57.460 46.257 83.793  1.00 47.51  ? 82  ALA A CB  1 
ATOM   143  N N   . ILE A 1 83  ? 58.372 49.246 83.582  1.00 46.90  ? 83  ILE A N   1 
ATOM   144  C CA  . ILE A 1 83  ? 58.124 50.660 83.824  1.00 45.38  ? 83  ILE A CA  1 
ATOM   145  C C   . ILE A 1 83  ? 58.256 51.438 82.534  1.00 45.96  ? 83  ILE A C   1 
ATOM   146  O O   . ILE A 1 83  ? 57.427 52.286 82.232  1.00 46.14  ? 83  ILE A O   1 
ATOM   147  C CB  . ILE A 1 83  ? 59.107 51.243 84.839  1.00 44.94  ? 83  ILE A CB  1 
ATOM   148  C CG1 . ILE A 1 83  ? 58.780 50.711 86.232  1.00 44.75  ? 83  ILE A CG1 1 
ATOM   149  C CG2 . ILE A 1 83  ? 59.057 52.766 84.800  1.00 43.99  ? 83  ILE A CG2 1 
ATOM   150  C CD1 . ILE A 1 83  ? 59.681 51.254 87.314  1.00 45.23  ? 83  ILE A CD1 1 
ATOM   151  N N   . LYS A 1 84  ? 59.304 51.148 81.773  1.00 47.09  ? 84  LYS A N   1 
ATOM   152  C CA  . LYS A 1 84  ? 59.528 51.832 80.505  1.00 48.21  ? 84  LYS A CA  1 
ATOM   153  C C   . LYS A 1 84  ? 58.330 51.597 79.597  1.00 47.84  ? 84  LYS A C   1 
ATOM   154  O O   . LYS A 1 84  ? 57.830 52.525 78.965  1.00 47.13  ? 84  LYS A O   1 
ATOM   155  C CB  . LYS A 1 84  ? 60.802 51.300 79.841  1.00 50.01  ? 84  LYS A CB  1 
ATOM   156  C CG  . LYS A 1 84  ? 61.266 52.062 78.592  1.00 51.32  ? 84  LYS A CG  1 
ATOM   157  C CD  . LYS A 1 84  ? 60.521 51.649 77.324  1.00 51.18  ? 84  LYS A CD  1 
ATOM   158  C CE  . LYS A 1 84  ? 61.157 52.280 76.085  1.00 49.74  ? 84  LYS A CE  1 
ATOM   159  N NZ  . LYS A 1 84  ? 61.190 53.766 76.177  1.00 47.21  ? 84  LYS A NZ  1 
ATOM   160  N N   . SER A 1 85  ? 57.878 50.346 79.555  1.00 47.81  ? 85  SER A N   1 
ATOM   161  C CA  . SER A 1 85  ? 56.736 49.939 78.744  1.00 48.22  ? 85  SER A CA  1 
ATOM   162  C C   . SER A 1 85  ? 55.486 50.784 79.006  1.00 50.05  ? 85  SER A C   1 
ATOM   163  O O   . SER A 1 85  ? 54.865 51.289 78.074  1.00 50.09  ? 85  SER A O   1 
ATOM   164  C CB  . SER A 1 85  ? 56.424 48.465 78.998  1.00 45.68  ? 85  SER A CB  1 
ATOM   165  O OG  . SER A 1 85  ? 55.184 48.109 78.424  1.00 43.84  ? 85  SER A OG  1 
ATOM   166  N N   . ARG A 1 86  ? 55.110 50.936 80.269  1.00 52.25  ? 86  ARG A N   1 
ATOM   167  C CA  . ARG A 1 86  ? 53.936 51.736 80.598  1.00 54.57  ? 86  ARG A CA  1 
ATOM   168  C C   . ARG A 1 86  ? 54.171 53.204 80.257  1.00 55.72  ? 86  ARG A C   1 
ATOM   169  O O   . ARG A 1 86  ? 53.307 53.855 79.666  1.00 56.09  ? 86  ARG A O   1 
ATOM   170  C CB  . ARG A 1 86  ? 53.600 51.610 82.085  1.00 56.16  ? 86  ARG A CB  1 
ATOM   171  C CG  . ARG A 1 86  ? 52.421 52.462 82.513  1.00 56.67  ? 86  ARG A CG  1 
ATOM   172  C CD  . ARG A 1 86  ? 51.208 52.149 81.671  1.00 57.70  ? 86  ARG A CD  1 
ATOM   173  N NE  . ARG A 1 86  ? 50.034 52.872 82.136  1.00 58.99  ? 86  ARG A NE  1 
ATOM   174  C CZ  . ARG A 1 86  ? 48.812 52.687 81.654  1.00 59.51  ? 86  ARG A CZ  1 
ATOM   175  N NH1 . ARG A 1 86  ? 48.607 51.801 80.687  1.00 58.33  ? 86  ARG A NH1 1 
ATOM   176  N NH2 . ARG A 1 86  ? 47.795 53.377 82.150  1.00 59.39  ? 86  ARG A NH2 1 
ATOM   177  N N   . ALA A 1 87  ? 55.340 53.715 80.640  1.00 55.86  ? 87  ALA A N   1 
ATOM   178  C CA  . ALA A 1 87  ? 55.708 55.101 80.376  1.00 56.60  ? 87  ALA A CA  1 
ATOM   179  C C   . ALA A 1 87  ? 55.516 55.411 78.894  1.00 58.23  ? 87  ALA A C   1 
ATOM   180  O O   . ALA A 1 87  ? 55.087 56.506 78.521  1.00 58.15  ? 87  ALA A O   1 
ATOM   181  C CB  . ALA A 1 87  ? 57.150 55.335 80.773  1.00 55.07  ? 87  ALA A CB  1 
ATOM   182  N N   . ASP A 1 88  ? 55.843 54.438 78.051  1.00 59.31  ? 88  ASP A N   1 
ATOM   183  C CA  . ASP A 1 88  ? 55.698 54.597 76.611  1.00 59.98  ? 88  ASP A CA  1 
ATOM   184  C C   . ASP A 1 88  ? 54.224 54.733 76.269  1.00 60.47  ? 88  ASP A C   1 
ATOM   185  O O   . ASP A 1 88  ? 53.839 55.609 75.498  1.00 61.66  ? 88  ASP A O   1 
ATOM   186  C CB  . ASP A 1 88  ? 56.280 53.387 75.870  1.00 59.71  ? 88  ASP A CB  1 
ATOM   187  C CG  . ASP A 1 88  ? 57.786 53.469 75.695  1.00 58.73  ? 88  ASP A CG  1 
ATOM   188  O OD1 . ASP A 1 88  ? 58.374 52.494 75.180  1.00 59.56  ? 88  ASP A OD1 1 
ATOM   189  O OD2 . ASP A 1 88  ? 58.379 54.504 76.061  1.00 58.81  ? 88  ASP A OD2 1 
ATOM   190  N N   . GLN A 1 89  ? 53.408 53.856 76.845  1.00 60.55  ? 89  GLN A N   1 
ATOM   191  C CA  . GLN A 1 89  ? 51.972 53.867 76.607  1.00 60.72  ? 89  GLN A CA  1 
ATOM   192  C C   . GLN A 1 89  ? 51.339 55.194 77.013  1.00 60.14  ? 89  GLN A C   1 
ATOM   193  O O   . GLN A 1 89  ? 50.365 55.636 76.406  1.00 59.30  ? 89  GLN A O   1 
ATOM   194  C CB  . GLN A 1 89  ? 51.303 52.736 77.382  1.00 62.06  ? 89  GLN A CB  1 
ATOM   195  C CG  . GLN A 1 89  ? 51.675 51.346 76.921  1.00 64.69  ? 89  GLN A CG  1 
ATOM   196  C CD  . GLN A 1 89  ? 51.097 50.278 77.829  1.00 67.73  ? 89  GLN A CD  1 
ATOM   197  O OE1 . GLN A 1 89  ? 49.886 50.224 78.047  1.00 68.75  ? 89  GLN A OE1 1 
ATOM   198  N NE2 . GLN A 1 89  ? 51.964 49.421 78.370  1.00 69.71  ? 89  GLN A NE2 1 
ATOM   199  N N   . LEU A 1 90  ? 51.891 55.827 78.044  1.00 59.99  ? 90  LEU A N   1 
ATOM   200  C CA  . LEU A 1 90  ? 51.357 57.099 78.519  1.00 60.10  ? 90  LEU A CA  1 
ATOM   201  C C   . LEU A 1 90  ? 52.134 58.273 77.920  1.00 59.73  ? 90  LEU A C   1 
ATOM   202  O O   . LEU A 1 90  ? 51.922 59.426 78.290  1.00 59.33  ? 90  LEU A O   1 
ATOM   203  C CB  . LEU A 1 90  ? 51.409 57.154 80.053  1.00 60.10  ? 90  LEU A CB  1 
ATOM   204  C CG  . LEU A 1 90  ? 50.815 55.951 80.799  1.00 60.25  ? 90  LEU A CG  1 
ATOM   205  C CD1 . LEU A 1 90  ? 50.939 56.164 82.289  1.00 61.09  ? 90  LEU A CD1 1 
ATOM   206  C CD2 . LEU A 1 90  ? 49.362 55.760 80.421  1.00 60.25  ? 90  LEU A CD2 1 
ATOM   207  N N   . GLY A 1 91  ? 53.030 57.968 76.989  1.00 59.37  ? 91  GLY A N   1 
ATOM   208  C CA  . GLY A 1 91  ? 53.819 59.003 76.353  1.00 59.11  ? 91  GLY A CA  1 
ATOM   209  C C   . GLY A 1 91  ? 54.702 59.733 77.340  1.00 59.72  ? 91  GLY A C   1 
ATOM   210  O O   . GLY A 1 91  ? 54.705 60.963 77.379  1.00 60.84  ? 91  GLY A O   1 
ATOM   211  N N   . ALA A 1 92  ? 55.457 58.980 78.135  1.00 59.07  ? 92  ALA A N   1 
ATOM   212  C CA  . ALA A 1 92  ? 56.344 59.572 79.127  1.00 58.00  ? 92  ALA A CA  1 
ATOM   213  C C   . ALA A 1 92  ? 57.768 59.062 78.951  1.00 58.80  ? 92  ALA A C   1 
ATOM   214  O O   . ALA A 1 92  ? 57.997 58.069 78.252  1.00 58.49  ? 92  ALA A O   1 
ATOM   215  C CB  . ALA A 1 92  ? 55.845 59.251 80.519  1.00 57.25  ? 92  ALA A CB  1 
ATOM   216  N N   . SER A 1 93  ? 58.716 59.750 79.592  1.00 59.63  ? 93  SER A N   1 
ATOM   217  C CA  . SER A 1 93  ? 60.143 59.408 79.535  1.00 59.77  ? 93  SER A CA  1 
ATOM   218  C C   . SER A 1 93  ? 60.615 58.741 80.831  1.00 59.77  ? 93  SER A C   1 
ATOM   219  O O   . SER A 1 93  ? 60.056 58.992 81.903  1.00 60.39  ? 93  SER A O   1 
ATOM   220  C CB  . SER A 1 93  ? 60.979 60.668 79.286  1.00 59.64  ? 93  SER A CB  1 
ATOM   221  O OG  . SER A 1 93  ? 60.710 61.228 78.014  1.00 60.48  ? 93  SER A OG  1 
ATOM   222  N N   . VAL A 1 94  ? 61.653 57.911 80.732  1.00 58.38  ? 94  VAL A N   1 
ATOM   223  C CA  . VAL A 1 94  ? 62.184 57.205 81.896  1.00 57.53  ? 94  VAL A CA  1 
ATOM   224  C C   . VAL A 1 94  ? 63.709 57.337 82.060  1.00 57.76  ? 94  VAL A C   1 
ATOM   225  O O   . VAL A 1 94  ? 64.474 56.745 81.297  1.00 58.68  ? 94  VAL A O   1 
ATOM   226  C CB  . VAL A 1 94  ? 61.829 55.694 81.826  1.00 56.51  ? 94  VAL A CB  1 
ATOM   227  C CG1 . VAL A 1 94  ? 62.338 54.989 83.059  1.00 58.11  ? 94  VAL A CG1 1 
ATOM   228  C CG2 . VAL A 1 94  ? 60.331 55.504 81.704  1.00 54.70  ? 94  VAL A CG2 1 
ATOM   229  N N   . VAL A 1 95  ? 64.146 58.104 83.060  1.00 57.14  ? 95  VAL A N   1 
ATOM   230  C CA  . VAL A 1 95  ? 65.579 58.295 83.327  1.00 55.82  ? 95  VAL A CA  1 
ATOM   231  C C   . VAL A 1 95  ? 65.994 57.343 84.446  1.00 55.81  ? 95  VAL A C   1 
ATOM   232  O O   . VAL A 1 95  ? 65.646 57.564 85.605  1.00 57.01  ? 95  VAL A O   1 
ATOM   233  C CB  . VAL A 1 95  ? 65.891 59.734 83.803  1.00 54.68  ? 95  VAL A CB  1 
ATOM   234  C CG1 . VAL A 1 95  ? 67.384 59.911 83.962  1.00 53.39  ? 95  VAL A CG1 1 
ATOM   235  C CG2 . VAL A 1 95  ? 65.344 60.744 82.823  1.00 54.93  ? 95  VAL A CG2 1 
ATOM   236  N N   . VAL A 1 96  ? 66.751 56.300 84.118  1.00 54.25  ? 96  VAL A N   1 
ATOM   237  C CA  . VAL A 1 96  ? 67.154 55.332 85.134  1.00 52.33  ? 96  VAL A CA  1 
ATOM   238  C C   . VAL A 1 96  ? 68.506 55.592 85.778  1.00 52.95  ? 96  VAL A C   1 
ATOM   239  O O   . VAL A 1 96  ? 69.510 55.749 85.087  1.00 53.40  ? 96  VAL A O   1 
ATOM   240  C CB  . VAL A 1 96  ? 67.169 53.903 84.554  1.00 51.22  ? 96  VAL A CB  1 
ATOM   241  C CG1 . VAL A 1 96  ? 67.439 52.887 85.654  1.00 49.49  ? 96  VAL A CG1 1 
ATOM   242  C CG2 . VAL A 1 96  ? 65.844 53.612 83.870  1.00 50.55  ? 96  VAL A CG2 1 
ATOM   243  N N   . SER A 1 97  ? 68.518 55.639 87.108  1.00 54.08  ? 97  SER A N   1 
ATOM   244  C CA  . SER A 1 97  ? 69.746 55.843 87.877  1.00 56.12  ? 97  SER A CA  1 
ATOM   245  C C   . SER A 1 97  ? 69.970 54.554 88.675  1.00 58.27  ? 97  SER A C   1 
ATOM   246  O O   . SER A 1 97  ? 69.002 53.876 89.016  1.00 58.32  ? 97  SER A O   1 
ATOM   247  C CB  . SER A 1 97  ? 69.597 57.039 88.824  1.00 54.76  ? 97  SER A CB  1 
ATOM   248  O OG  . SER A 1 97  ? 70.781 57.240 89.582  1.00 53.88  ? 97  SER A OG  1 
ATOM   249  N N   . MET A 1 98  ? 71.228 54.211 88.967  1.00 61.19  ? 98  MET A N   1 
ATOM   250  C CA  . MET A 1 98  ? 71.543 52.979 89.705  1.00 62.83  ? 98  MET A CA  1 
ATOM   251  C C   . MET A 1 98  ? 72.256 53.189 91.026  1.00 64.95  ? 98  MET A C   1 
ATOM   252  O O   . MET A 1 98  ? 73.042 54.118 91.177  1.00 64.84  ? 98  MET A O   1 
ATOM   253  C CB  . MET A 1 98  ? 72.378 52.053 88.834  1.00 61.99  ? 98  MET A CB  1 
ATOM   254  C CG  . MET A 1 98  ? 71.649 51.632 87.584  1.00 65.66  ? 98  MET A CG  1 
ATOM   255  S SD  . MET A 1 98  ? 72.692 50.740 86.448  1.00 69.59  ? 98  MET A SD  1 
ATOM   256  C CE  . MET A 1 98  ? 72.995 49.221 87.413  1.00 69.48  ? 98  MET A CE  1 
ATOM   257  N N   . VAL A 1 99  ? 71.973 52.307 91.982  1.00 68.65  ? 99  VAL A N   1 
ATOM   258  C CA  . VAL A 1 99  ? 72.572 52.375 93.312  1.00 72.46  ? 99  VAL A CA  1 
ATOM   259  C C   . VAL A 1 99  ? 73.760 51.422 93.428  1.00 75.92  ? 99  VAL A C   1 
ATOM   260  O O   . VAL A 1 99  ? 73.645 50.240 93.088  1.00 76.20  ? 99  VAL A O   1 
ATOM   261  C CB  . VAL A 1 99  ? 71.544 52.015 94.397  1.00 71.73  ? 99  VAL A CB  1 
ATOM   262  C CG1 . VAL A 1 99  ? 72.196 52.062 95.773  1.00 71.37  ? 99  VAL A CG1 1 
ATOM   263  C CG2 . VAL A 1 99  ? 70.369 52.970 94.327  1.00 70.84  ? 99  VAL A CG2 1 
ATOM   264  N N   . GLU A 1 100 ? 74.888 51.945 93.915  1.00 79.35  ? 100 GLU A N   1 
ATOM   265  C CA  . GLU A 1 100 ? 76.120 51.170 94.069  1.00 82.51  ? 100 GLU A CA  1 
ATOM   266  C C   . GLU A 1 100 ? 75.972 50.001 95.042  1.00 84.29  ? 100 GLU A C   1 
ATOM   267  O O   . GLU A 1 100 ? 76.919 49.635 95.739  1.00 84.50  ? 100 GLU A O   1 
ATOM   268  C CB  . GLU A 1 100 ? 77.275 52.090 94.510  1.00 83.26  ? 100 GLU A CB  1 
ATOM   269  C CG  . GLU A 1 100 ? 77.154 52.709 95.911  1.00 85.24  ? 100 GLU A CG  1 
ATOM   270  C CD  . GLU A 1 100 ? 77.570 51.754 97.036  1.00 87.06  ? 100 GLU A CD  1 
ATOM   271  O OE1 . GLU A 1 100 ? 78.703 51.229 96.987  1.00 87.61  ? 100 GLU A OE1 1 
ATOM   272  O OE2 . GLU A 1 100 ? 76.770 51.528 97.973  1.00 87.41  ? 100 GLU A OE2 1 
ATOM   273  N N   . ARG A 1 101 ? 74.779 49.412 95.057  1.00 86.48  ? 101 ARG A N   1 
ATOM   274  C CA  . ARG A 1 101 ? 74.430 48.280 95.914  1.00 88.92  ? 101 ARG A CA  1 
ATOM   275  C C   . ARG A 1 101 ? 74.101 48.752 97.324  1.00 89.15  ? 101 ARG A C   1 
ATOM   276  O O   . ARG A 1 101 ? 73.491 49.807 97.512  1.00 89.36  ? 101 ARG A O   1 
ATOM   277  C CB  . ARG A 1 101 ? 75.562 47.241 95.999  1.00 91.62  ? 101 ARG A CB  1 
ATOM   278  C CG  . ARG A 1 101 ? 76.366 47.001 94.725  1.00 95.20  ? 101 ARG A CG  1 
ATOM   279  C CD  . ARG A 1 101 ? 75.510 46.635 93.529  1.00 97.44  ? 101 ARG A CD  1 
ATOM   280  N NE  . ARG A 1 101 ? 76.336 46.347 92.356  1.00 99.96  ? 101 ARG A NE  1 
ATOM   281  C CZ  . ARG A 1 101 ? 77.206 47.197 91.811  1.00 100.71 ? 101 ARG A CZ  1 
ATOM   282  N NH1 . ARG A 1 101 ? 77.380 48.410 92.327  1.00 100.69 ? 101 ARG A NH1 1 
ATOM   283  N NH2 . ARG A 1 101 ? 77.905 46.834 90.741  1.00 101.21 ? 101 ARG A NH2 1 
ATOM   284  N N   . SER A 1 102 ? 74.536 47.961 98.303  1.00 89.15  ? 102 SER A N   1 
ATOM   285  C CA  . SER A 1 102 ? 74.306 48.210 99.726  1.00 88.78  ? 102 SER A CA  1 
ATOM   286  C C   . SER A 1 102 ? 74.574 49.619 100.255 1.00 87.95  ? 102 SER A C   1 
ATOM   287  O O   . SER A 1 102 ? 75.555 50.271 99.889  1.00 86.42  ? 102 SER A O   1 
ATOM   288  C CB  . SER A 1 102 ? 75.110 47.208 100.560 1.00 89.14  ? 102 SER A CB  1 
ATOM   289  O OG  . SER A 1 102 ? 74.727 45.875 100.269 1.00 89.27  ? 102 SER A OG  1 
ATOM   290  N N   . GLY A 1 103 ? 73.682 50.062 101.138 1.00 87.71  ? 103 GLY A N   1 
ATOM   291  C CA  . GLY A 1 103 ? 73.802 51.373 101.741 1.00 88.14  ? 103 GLY A CA  1 
ATOM   292  C C   . GLY A 1 103 ? 72.657 52.330 101.445 1.00 87.88  ? 103 GLY A C   1 
ATOM   293  O O   . GLY A 1 103 ? 72.336 52.585 100.281 1.00 87.97  ? 103 GLY A O   1 
ATOM   294  N N   . VAL A 1 104 ? 72.035 52.854 102.501 1.00 87.11  ? 104 VAL A N   1 
ATOM   295  C CA  . VAL A 1 104 ? 70.947 53.818 102.352 1.00 85.82  ? 104 VAL A CA  1 
ATOM   296  C C   . VAL A 1 104 ? 71.550 55.061 101.705 1.00 85.70  ? 104 VAL A C   1 
ATOM   297  O O   . VAL A 1 104 ? 70.900 55.758 100.920 1.00 84.88  ? 104 VAL A O   1 
ATOM   298  C CB  . VAL A 1 104 ? 70.346 54.212 103.722 1.00 85.11  ? 104 VAL A CB  1 
ATOM   299  C CG1 . VAL A 1 104 ? 71.430 54.779 104.625 1.00 84.64  ? 104 VAL A CG1 1 
ATOM   300  C CG2 . VAL A 1 104 ? 69.236 55.235 103.529 1.00 84.32  ? 104 VAL A CG2 1 
ATOM   301  N N   . GLU A 1 105 ? 72.810 55.319 102.047 1.00 85.41  ? 105 GLU A N   1 
ATOM   302  C CA  . GLU A 1 105 ? 73.544 56.454 101.520 1.00 84.84  ? 105 GLU A CA  1 
ATOM   303  C C   . GLU A 1 105 ? 73.601 56.401 100.008 1.00 83.89  ? 105 GLU A C   1 
ATOM   304  O O   . GLU A 1 105 ? 73.296 57.384 99.331  1.00 83.68  ? 105 GLU A O   1 
ATOM   305  C CB  . GLU A 1 105 ? 74.957 56.470 102.092 1.00 85.68  ? 105 GLU A CB  1 
ATOM   306  C CG  . GLU A 1 105 ? 74.989 56.932 103.523 1.00 88.34  ? 105 GLU A CG  1 
ATOM   307  C CD  . GLU A 1 105 ? 74.222 58.231 103.707 1.00 89.86  ? 105 GLU A CD  1 
ATOM   308  O OE1 . GLU A 1 105 ? 74.524 59.204 102.982 1.00 90.02  ? 105 GLU A OE1 1 
ATOM   309  O OE2 . GLU A 1 105 ? 73.318 58.279 104.571 1.00 90.81  ? 105 GLU A OE2 1 
ATOM   310  N N   . ALA A 1 106 ? 73.996 55.247 99.484  1.00 82.52  ? 106 ALA A N   1 
ATOM   311  C CA  . ALA A 1 106 ? 74.080 55.063 98.045  1.00 81.77  ? 106 ALA A CA  1 
ATOM   312  C C   . ALA A 1 106 ? 72.740 55.446 97.420  1.00 81.17  ? 106 ALA A C   1 
ATOM   313  O O   . ALA A 1 106 ? 72.683 56.043 96.340  1.00 80.68  ? 106 ALA A O   1 
ATOM   314  C CB  . ALA A 1 106 ? 74.414 53.616 97.729  1.00 81.89  ? 106 ALA A CB  1 
ATOM   315  N N   . CYS A 1 107 ? 71.661 55.108 98.118  1.00 79.76  ? 107 CYS A N   1 
ATOM   316  C CA  . CYS A 1 107 ? 70.323 55.408 97.637  1.00 78.03  ? 107 CYS A CA  1 
ATOM   317  C C   . CYS A 1 107 ? 70.081 56.917 97.635  1.00 77.66  ? 107 CYS A C   1 
ATOM   318  O O   . CYS A 1 107 ? 69.764 57.500 96.596  1.00 76.99  ? 107 CYS A O   1 
ATOM   319  C CB  . CYS A 1 107 ? 69.288 54.705 98.516  1.00 76.94  ? 107 CYS A CB  1 
ATOM   320  S SG  . CYS A 1 107 ? 67.731 54.348 97.680  1.00 74.48  ? 107 CYS A SG  1 
ATOM   321  N N   . LYS A 1 108 ? 70.240 57.544 98.800  1.00 77.22  ? 108 LYS A N   1 
ATOM   322  C CA  . LYS A 1 108 ? 70.041 58.986 98.943  1.00 77.06  ? 108 LYS A CA  1 
ATOM   323  C C   . LYS A 1 108 ? 70.686 59.763 97.792  1.00 77.56  ? 108 LYS A C   1 
ATOM   324  O O   . LYS A 1 108 ? 70.085 60.674 97.222  1.00 76.15  ? 108 LYS A O   1 
ATOM   325  C CB  . LYS A 1 108 ? 70.630 59.464 100.277 1.00 75.58  ? 108 LYS A CB  1 
ATOM   326  C CG  . LYS A 1 108 ? 70.092 58.720 101.488 1.00 74.30  ? 108 LYS A CG  1 
ATOM   327  C CD  . LYS A 1 108 ? 70.721 59.192 102.796 1.00 73.97  ? 108 LYS A CD  1 
ATOM   328  C CE  . LYS A 1 108 ? 70.285 60.601 103.177 1.00 74.36  ? 108 LYS A CE  1 
ATOM   329  N NZ  . LYS A 1 108 ? 70.870 61.026 104.487 1.00 74.74  ? 108 LYS A NZ  1 
ATOM   330  N N   . THR A 1 109 ? 71.912 59.385 97.455  1.00 79.09  ? 109 THR A N   1 
ATOM   331  C CA  . THR A 1 109 ? 72.656 60.034 96.388  1.00 80.70  ? 109 THR A CA  1 
ATOM   332  C C   . THR A 1 109 ? 71.999 59.882 95.016  1.00 82.20  ? 109 THR A C   1 
ATOM   333  O O   . THR A 1 109 ? 71.980 60.828 94.223  1.00 82.86  ? 109 THR A O   1 
ATOM   334  C CB  . THR A 1 109 ? 74.089 59.485 96.323  1.00 80.27  ? 109 THR A CB  1 
ATOM   335  O OG1 . THR A 1 109 ? 74.719 59.666 97.597  1.00 79.22  ? 109 THR A OG1 1 
ATOM   336  C CG2 . THR A 1 109 ? 74.895 60.213 95.248  1.00 80.21  ? 109 THR A CG2 1 
ATOM   337  N N   . ALA A 1 110 ? 71.467 58.697 94.729  1.00 83.30  ? 110 ALA A N   1 
ATOM   338  C CA  . ALA A 1 110 ? 70.815 58.458 93.443  1.00 84.15  ? 110 ALA A CA  1 
ATOM   339  C C   . ALA A 1 110 ? 69.615 59.389 93.302  1.00 84.61  ? 110 ALA A C   1 
ATOM   340  O O   . ALA A 1 110 ? 69.228 59.760 92.193  1.00 84.16  ? 110 ALA A O   1 
ATOM   341  C CB  . ALA A 1 110 ? 70.371 56.996 93.332  1.00 83.60  ? 110 ALA A CB  1 
ATOM   342  N N   . VAL A 1 111 ? 69.027 59.757 94.437  1.00 85.62  ? 111 VAL A N   1 
ATOM   343  C CA  . VAL A 1 111 ? 67.881 60.656 94.443  1.00 86.59  ? 111 VAL A CA  1 
ATOM   344  C C   . VAL A 1 111 ? 68.368 61.980 93.866  1.00 87.71  ? 111 VAL A C   1 
ATOM   345  O O   . VAL A 1 111 ? 67.731 62.559 92.989  1.00 87.40  ? 111 VAL A O   1 
ATOM   346  C CB  . VAL A 1 111 ? 67.353 60.887 95.882  1.00 86.31  ? 111 VAL A CB  1 
ATOM   347  C CG1 . VAL A 1 111 ? 66.088 61.726 95.854  1.00 85.40  ? 111 VAL A CG1 1 
ATOM   348  C CG2 . VAL A 1 111 ? 67.085 59.559 96.551  1.00 85.65  ? 111 VAL A CG2 1 
ATOM   349  N N   . HIS A 1 112 ? 69.517 62.437 94.361  1.00 88.87  ? 112 HIS A N   1 
ATOM   350  C CA  . HIS A 1 112 ? 70.127 63.687 93.914  1.00 89.62  ? 112 HIS A CA  1 
ATOM   351  C C   . HIS A 1 112 ? 70.339 63.692 92.405  1.00 89.14  ? 112 HIS A C   1 
ATOM   352  O O   . HIS A 1 112 ? 70.019 64.673 91.728  1.00 89.03  ? 112 HIS A O   1 
ATOM   353  C CB  . HIS A 1 112 ? 71.467 63.891 94.623  1.00 90.94  ? 112 HIS A CB  1 
ATOM   354  C CG  . HIS A 1 112 ? 71.351 63.988 96.112  1.00 92.67  ? 112 HIS A CG  1 
ATOM   355  N ND1 . HIS A 1 112 ? 72.448 63.968 96.946  1.00 93.66  ? 112 HIS A ND1 1 
ATOM   356  C CD2 . HIS A 1 112 ? 70.268 64.113 96.916  1.00 93.45  ? 112 HIS A CD2 1 
ATOM   357  C CE1 . HIS A 1 112 ? 72.046 64.075 98.200  1.00 94.35  ? 112 HIS A CE1 1 
ATOM   358  N NE2 . HIS A 1 112 ? 70.728 64.165 98.210  1.00 94.65  ? 112 HIS A NE2 1 
ATOM   359  N N   . ASN A 1 113 ? 70.891 62.597 91.888  1.00 88.50  ? 113 ASN A N   1 
ATOM   360  C CA  . ASN A 1 113 ? 71.137 62.458 90.455  1.00 87.79  ? 113 ASN A CA  1 
ATOM   361  C C   . ASN A 1 113 ? 69.851 62.675 89.665  1.00 86.96  ? 113 ASN A C   1 
ATOM   362  O O   . ASN A 1 113 ? 69.817 63.478 88.726  1.00 87.44  ? 113 ASN A O   1 
ATOM   363  C CB  . ASN A 1 113 ? 71.687 61.064 90.137  1.00 88.29  ? 113 ASN A CB  1 
ATOM   364  C CG  . ASN A 1 113 ? 73.176 60.955 90.371  1.00 88.79  ? 113 ASN A CG  1 
ATOM   365  O OD1 . ASN A 1 113 ? 73.672 61.264 91.456  1.00 90.01  ? 113 ASN A OD1 1 
ATOM   366  N ND2 . ASN A 1 113 ? 73.901 60.507 89.350  1.00 88.47  ? 113 ASN A ND2 1 
ATOM   367  N N   . LEU A 1 114 ? 68.802 61.948 90.053  1.00 84.99  ? 114 LEU A N   1 
ATOM   368  C CA  . LEU A 1 114 ? 67.501 62.028 89.395  1.00 82.57  ? 114 LEU A CA  1 
ATOM   369  C C   . LEU A 1 114 ? 66.805 63.362 89.665  1.00 82.25  ? 114 LEU A C   1 
ATOM   370  O O   . LEU A 1 114 ? 66.108 63.884 88.796  1.00 82.28  ? 114 LEU A O   1 
ATOM   371  C CB  . LEU A 1 114 ? 66.620 60.853 89.843  1.00 80.80  ? 114 LEU A CB  1 
ATOM   372  C CG  . LEU A 1 114 ? 67.033 59.474 89.309  1.00 78.35  ? 114 LEU A CG  1 
ATOM   373  C CD1 . LEU A 1 114 ? 66.390 58.366 90.121  1.00 77.09  ? 114 LEU A CD1 1 
ATOM   374  C CD2 . LEU A 1 114 ? 66.645 59.376 87.846  1.00 76.49  ? 114 LEU A CD2 1 
ATOM   375  N N   . LEU A 1 115 ? 66.997 63.910 90.866  1.00 81.89  ? 115 LEU A N   1 
ATOM   376  C CA  . LEU A 1 115 ? 66.403 65.198 91.233  1.00 80.98  ? 115 LEU A CA  1 
ATOM   377  C C   . LEU A 1 115 ? 67.035 66.273 90.368  1.00 81.17  ? 115 LEU A C   1 
ATOM   378  O O   . LEU A 1 115 ? 66.362 67.191 89.890  1.00 80.13  ? 115 LEU A O   1 
ATOM   379  C CB  . LEU A 1 115 ? 66.675 65.522 92.703  1.00 79.74  ? 115 LEU A CB  1 
ATOM   380  C CG  . LEU A 1 115 ? 65.889 64.743 93.752  1.00 78.70  ? 115 LEU A CG  1 
ATOM   381  C CD1 . LEU A 1 115 ? 66.268 65.243 95.139  1.00 77.65  ? 115 LEU A CD1 1 
ATOM   382  C CD2 . LEU A 1 115 ? 64.396 64.912 93.496  1.00 77.45  ? 115 LEU A CD2 1 
ATOM   383  N N   . ALA A 1 116 ? 68.346 66.148 90.192  1.00 81.72  ? 116 ALA A N   1 
ATOM   384  C CA  . ALA A 1 116 ? 69.105 67.071 89.375  1.00 82.40  ? 116 ALA A CA  1 
ATOM   385  C C   . ALA A 1 116 ? 68.448 67.102 87.999  1.00 83.63  ? 116 ALA A C   1 
ATOM   386  O O   . ALA A 1 116 ? 68.047 68.163 87.520  1.00 84.86  ? 116 ALA A O   1 
ATOM   387  C CB  . ALA A 1 116 ? 70.548 66.599 89.266  1.00 81.31  ? 116 ALA A CB  1 
ATOM   388  N N   . GLN A 1 117 ? 68.315 65.928 87.381  1.00 84.53  ? 117 GLN A N   1 
ATOM   389  C CA  . GLN A 1 117 ? 67.709 65.801 86.052  1.00 85.08  ? 117 GLN A CA  1 
ATOM   390  C C   . GLN A 1 117 ? 66.328 66.449 85.960  1.00 84.74  ? 117 GLN A C   1 
ATOM   391  O O   . GLN A 1 117 ? 65.800 66.657 84.865  1.00 84.31  ? 117 GLN A O   1 
ATOM   392  C CB  . GLN A 1 117 ? 67.601 64.323 85.661  1.00 85.71  ? 117 GLN A CB  1 
ATOM   393  C CG  . GLN A 1 117 ? 68.919 63.563 85.690  1.00 87.74  ? 117 GLN A CG  1 
ATOM   394  C CD  . GLN A 1 117 ? 70.101 64.411 85.242  1.00 89.56  ? 117 GLN A CD  1 
ATOM   395  O OE1 . GLN A 1 117 ? 70.710 65.119 86.048  1.00 90.99  ? 117 GLN A OE1 1 
ATOM   396  N NE2 . GLN A 1 117 ? 70.422 64.355 83.952  1.00 89.16  ? 117 GLN A NE2 1 
ATOM   397  N N   . ARG A 1 118 ? 65.757 66.761 87.121  1.00 84.56  ? 118 ARG A N   1 
ATOM   398  C CA  . ARG A 1 118 ? 64.442 67.386 87.229  1.00 83.82  ? 118 ARG A CA  1 
ATOM   399  C C   . ARG A 1 118 ? 63.294 66.490 86.769  1.00 82.09  ? 118 ARG A C   1 
ATOM   400  O O   . ARG A 1 118 ? 62.450 66.899 85.968  1.00 82.64  ? 118 ARG A O   1 
ATOM   401  C CB  . ARG A 1 118 ? 64.415 68.713 86.461  1.00 85.55  ? 118 ARG A CB  1 
ATOM   402  C CG  . ARG A 1 118 ? 65.351 69.763 87.043  1.00 88.51  ? 118 ARG A CG  1 
ATOM   403  C CD  . ARG A 1 118 ? 64.772 71.162 86.904  1.00 91.40  ? 118 ARG A CD  1 
ATOM   404  N NE  . ARG A 1 118 ? 64.758 71.644 85.524  1.00 94.12  ? 118 ARG A NE  1 
ATOM   405  C CZ  . ARG A 1 118 ? 64.110 72.737 85.123  1.00 95.30  ? 118 ARG A CZ  1 
ATOM   406  N NH1 . ARG A 1 118 ? 63.415 73.460 85.997  1.00 95.42  ? 118 ARG A NH1 1 
ATOM   407  N NH2 . ARG A 1 118 ? 64.165 73.115 83.850  1.00 95.25  ? 118 ARG A NH2 1 
ATOM   408  N N   . VAL A 1 119 ? 63.264 65.265 87.286  1.00 78.87  ? 119 VAL A N   1 
ATOM   409  C CA  . VAL A 1 119 ? 62.205 64.329 86.944  1.00 76.15  ? 119 VAL A CA  1 
ATOM   410  C C   . VAL A 1 119 ? 60.958 64.752 87.708  1.00 73.94  ? 119 VAL A C   1 
ATOM   411  O O   . VAL A 1 119 ? 61.051 65.275 88.817  1.00 73.16  ? 119 VAL A O   1 
ATOM   412  C CB  . VAL A 1 119 ? 62.580 62.873 87.333  1.00 76.68  ? 119 VAL A CB  1 
ATOM   413  C CG1 . VAL A 1 119 ? 63.774 62.401 86.509  1.00 76.97  ? 119 VAL A CG1 1 
ATOM   414  C CG2 . VAL A 1 119 ? 62.904 62.789 88.814  1.00 76.50  ? 119 VAL A CG2 1 
ATOM   415  N N   . SER A 1 120 ? 59.792 64.540 87.111  1.00 71.81  ? 120 SER A N   1 
ATOM   416  C CA  . SER A 1 120 ? 58.537 64.909 87.756  1.00 69.93  ? 120 SER A CA  1 
ATOM   417  C C   . SER A 1 120 ? 57.938 63.753 88.571  1.00 68.86  ? 120 SER A C   1 
ATOM   418  O O   . SER A 1 120 ? 56.733 63.717 88.844  1.00 68.39  ? 120 SER A O   1 
ATOM   419  C CB  . SER A 1 120 ? 57.539 65.411 86.702  1.00 69.27  ? 120 SER A CB  1 
ATOM   420  O OG  . SER A 1 120 ? 57.520 64.582 85.555  1.00 69.07  ? 120 SER A OG  1 
ATOM   421  N N   . GLY A 1 121 ? 58.801 62.821 88.970  1.00 67.25  ? 121 GLY A N   1 
ATOM   422  C CA  . GLY A 1 121 ? 58.373 61.671 89.752  1.00 63.42  ? 121 GLY A CA  1 
ATOM   423  C C   . GLY A 1 121 ? 59.522 60.704 89.992  1.00 60.84  ? 121 GLY A C   1 
ATOM   424  O O   . GLY A 1 121 ? 60.424 60.586 89.159  1.00 60.48  ? 121 GLY A O   1 
ATOM   425  N N   . LEU A 1 122 ? 59.490 60.011 91.127  1.00 58.23  ? 122 LEU A N   1 
ATOM   426  C CA  . LEU A 1 122 ? 60.537 59.054 91.475  1.00 54.78  ? 122 LEU A CA  1 
ATOM   427  C C   . LEU A 1 122 ? 60.031 57.681 91.898  1.00 51.73  ? 122 LEU A C   1 
ATOM   428  O O   . LEU A 1 122 ? 59.260 57.559 92.839  1.00 52.06  ? 122 LEU A O   1 
ATOM   429  C CB  . LEU A 1 122 ? 61.410 59.610 92.599  1.00 55.03  ? 122 LEU A CB  1 
ATOM   430  C CG  . LEU A 1 122 ? 62.518 60.582 92.207  1.00 56.42  ? 122 LEU A CG  1 
ATOM   431  C CD1 . LEU A 1 122 ? 63.266 60.997 93.464  1.00 57.01  ? 122 LEU A CD1 1 
ATOM   432  C CD2 . LEU A 1 122 ? 63.478 59.923 91.213  1.00 55.17  ? 122 LEU A CD2 1 
ATOM   433  N N   . ILE A 1 123 ? 60.473 56.649 91.196  1.00 48.74  ? 123 ILE A N   1 
ATOM   434  C CA  . ILE A 1 123 ? 60.100 55.292 91.538  1.00 46.39  ? 123 ILE A CA  1 
ATOM   435  C C   . ILE A 1 123 ? 61.356 54.663 92.119  1.00 46.15  ? 123 ILE A C   1 
ATOM   436  O O   . ILE A 1 123 ? 62.357 54.525 91.417  1.00 45.78  ? 123 ILE A O   1 
ATOM   437  C CB  . ILE A 1 123 ? 59.666 54.504 90.309  1.00 45.95  ? 123 ILE A CB  1 
ATOM   438  C CG1 . ILE A 1 123 ? 58.322 55.029 89.808  1.00 47.22  ? 123 ILE A CG1 1 
ATOM   439  C CG2 . ILE A 1 123 ? 59.559 53.040 90.651  1.00 46.54  ? 123 ILE A CG2 1 
ATOM   440  C CD1 . ILE A 1 123 ? 57.687 54.172 88.723  1.00 47.21  ? 123 ILE A CD1 1 
ATOM   441  N N   . ILE A 1 124 ? 61.301 54.283 93.394  1.00 45.08  ? 124 ILE A N   1 
ATOM   442  C CA  . ILE A 1 124 ? 62.457 53.702 94.076  1.00 44.27  ? 124 ILE A CA  1 
ATOM   443  C C   . ILE A 1 124 ? 62.432 52.173 94.235  1.00 45.65  ? 124 ILE A C   1 
ATOM   444  O O   . ILE A 1 124 ? 61.869 51.643 95.202  1.00 46.37  ? 124 ILE A O   1 
ATOM   445  C CB  . ILE A 1 124 ? 62.621 54.351 95.462  1.00 41.99  ? 124 ILE A CB  1 
ATOM   446  C CG1 . ILE A 1 124 ? 62.416 55.858 95.337  1.00 39.92  ? 124 ILE A CG1 1 
ATOM   447  C CG2 . ILE A 1 124 ? 63.991 54.043 96.035  1.00 40.51  ? 124 ILE A CG2 1 
ATOM   448  C CD1 . ILE A 1 124 ? 63.172 56.480 94.204  1.00 36.90  ? 124 ILE A CD1 1 
ATOM   449  N N   . ASN A 1 125 ? 63.064 51.475 93.289  1.00 45.52  ? 125 ASN A N   1 
ATOM   450  C CA  . ASN A 1 125 ? 63.127 50.015 93.304  1.00 45.79  ? 125 ASN A CA  1 
ATOM   451  C C   . ASN A 1 125 ? 64.415 49.524 93.941  1.00 45.58  ? 125 ASN A C   1 
ATOM   452  O O   . ASN A 1 125 ? 65.229 48.867 93.303  1.00 45.52  ? 125 ASN A O   1 
ATOM   453  C CB  . ASN A 1 125 ? 63.021 49.464 91.883  1.00 47.29  ? 125 ASN A CB  1 
ATOM   454  C CG  . ASN A 1 125 ? 63.084 47.948 91.838  1.00 50.12  ? 125 ASN A CG  1 
ATOM   455  O OD1 . ASN A 1 125 ? 62.761 47.266 92.818  1.00 52.03  ? 125 ASN A OD1 1 
ATOM   456  N ND2 . ASN A 1 125 ? 63.487 47.409 90.691  1.00 50.77  ? 125 ASN A ND2 1 
ATOM   457  N N   . TYR A 1 126 ? 64.588 49.843 95.213  1.00 45.37  ? 126 TYR A N   1 
ATOM   458  C CA  . TYR A 1 126 ? 65.774 49.452 95.945  1.00 45.11  ? 126 TYR A CA  1 
ATOM   459  C C   . TYR A 1 126 ? 65.333 49.076 97.353  1.00 45.66  ? 126 TYR A C   1 
ATOM   460  O O   . TYR A 1 126 ? 64.468 49.732 97.928  1.00 46.94  ? 126 TYR A O   1 
ATOM   461  C CB  . TYR A 1 126 ? 66.745 50.633 95.984  1.00 45.26  ? 126 TYR A CB  1 
ATOM   462  C CG  . TYR A 1 126 ? 68.000 50.380 96.774  1.00 46.04  ? 126 TYR A CG  1 
ATOM   463  C CD1 . TYR A 1 126 ? 69.019 49.566 96.272  1.00 46.25  ? 126 TYR A CD1 1 
ATOM   464  C CD2 . TYR A 1 126 ? 68.153 50.916 98.048  1.00 46.49  ? 126 TYR A CD2 1 
ATOM   465  C CE1 . TYR A 1 126 ? 70.158 49.287 97.026  1.00 46.45  ? 126 TYR A CE1 1 
ATOM   466  C CE2 . TYR A 1 126 ? 69.283 50.646 98.811  1.00 48.35  ? 126 TYR A CE2 1 
ATOM   467  C CZ  . TYR A 1 126 ? 70.281 49.830 98.298  1.00 48.51  ? 126 TYR A CZ  1 
ATOM   468  O OH  . TYR A 1 126 ? 71.378 49.544 99.081  1.00 49.71  ? 126 TYR A OH  1 
ATOM   469  N N   . PRO A 1 127 ? 65.911 48.009 97.926  1.00 45.92  ? 127 PRO A N   1 
ATOM   470  C CA  . PRO A 1 127 ? 65.554 47.568 99.280  1.00 46.69  ? 127 PRO A CA  1 
ATOM   471  C C   . PRO A 1 127 ? 65.880 48.607 100.352 1.00 47.63  ? 127 PRO A C   1 
ATOM   472  O O   . PRO A 1 127 ? 66.971 49.177 100.363 1.00 49.23  ? 127 PRO A O   1 
ATOM   473  C CB  . PRO A 1 127 ? 66.367 46.286 99.446  1.00 45.24  ? 127 PRO A CB  1 
ATOM   474  C CG  . PRO A 1 127 ? 67.576 46.560 98.622  1.00 44.71  ? 127 PRO A CG  1 
ATOM   475  C CD  . PRO A 1 127 ? 66.988 47.169 97.377  1.00 45.81  ? 127 PRO A CD  1 
ATOM   476  N N   . LEU A 1 128 ? 64.934 48.849 101.255 1.00 47.40  ? 128 LEU A N   1 
ATOM   477  C CA  . LEU A 1 128 ? 65.133 49.824 102.319 1.00 47.58  ? 128 LEU A CA  1 
ATOM   478  C C   . LEU A 1 128 ? 64.421 49.415 103.599 1.00 50.15  ? 128 LEU A C   1 
ATOM   479  O O   . LEU A 1 128 ? 63.274 48.970 103.563 1.00 51.87  ? 128 LEU A O   1 
ATOM   480  C CB  . LEU A 1 128 ? 64.630 51.198 101.872 1.00 43.46  ? 128 LEU A CB  1 
ATOM   481  C CG  . LEU A 1 128 ? 65.503 51.928 100.858 1.00 40.40  ? 128 LEU A CG  1 
ATOM   482  C CD1 . LEU A 1 128 ? 64.810 53.178 100.356 1.00 38.72  ? 128 LEU A CD1 1 
ATOM   483  C CD2 . LEU A 1 128 ? 66.826 52.265 101.519 1.00 39.28  ? 128 LEU A CD2 1 
ATOM   484  N N   . ASP A 1 129 ? 65.106 49.572 104.727 1.00 52.51  ? 129 ASP A N   1 
ATOM   485  C CA  . ASP A 1 129 ? 64.540 49.230 106.030 1.00 54.84  ? 129 ASP A CA  1 
ATOM   486  C C   . ASP A 1 129 ? 63.595 50.344 106.456 1.00 55.76  ? 129 ASP A C   1 
ATOM   487  O O   . ASP A 1 129 ? 63.732 51.487 106.015 1.00 55.26  ? 129 ASP A O   1 
ATOM   488  C CB  . ASP A 1 129 ? 65.663 49.060 107.053 1.00 56.83  ? 129 ASP A CB  1 
ATOM   489  C CG  . ASP A 1 129 ? 66.705 48.039 106.605 1.00 59.98  ? 129 ASP A CG  1 
ATOM   490  O OD1 . ASP A 1 129 ? 67.878 48.161 107.014 1.00 61.89  ? 129 ASP A OD1 1 
ATOM   491  O OD2 . ASP A 1 129 ? 66.352 47.107 105.848 1.00 60.45  ? 129 ASP A OD2 1 
ATOM   492  N N   . ASP A 1 130 ? 62.636 50.011 107.309 1.00 57.33  ? 130 ASP A N   1 
ATOM   493  C CA  . ASP A 1 130 ? 61.657 50.987 107.769 1.00 59.40  ? 130 ASP A CA  1 
ATOM   494  C C   . ASP A 1 130 ? 62.203 52.387 108.015 1.00 60.25  ? 130 ASP A C   1 
ATOM   495  O O   . ASP A 1 130 ? 61.593 53.367 107.595 1.00 60.80  ? 130 ASP A O   1 
ATOM   496  C CB  . ASP A 1 130 ? 60.965 50.480 109.032 1.00 61.61  ? 130 ASP A CB  1 
ATOM   497  C CG  . ASP A 1 130 ? 59.558 49.969 108.762 1.00 64.22  ? 130 ASP A CG  1 
ATOM   498  O OD1 . ASP A 1 130 ? 58.679 50.804 108.449 1.00 65.80  ? 130 ASP A OD1 1 
ATOM   499  O OD2 . ASP A 1 130 ? 59.331 48.738 108.859 1.00 64.49  ? 130 ASP A OD2 1 
ATOM   500  N N   . GLN A 1 131 ? 63.355 52.483 108.674 1.00 61.15  ? 131 GLN A N   1 
ATOM   501  C CA  . GLN A 1 131 ? 63.961 53.779 108.990 1.00 61.56  ? 131 GLN A CA  1 
ATOM   502  C C   . GLN A 1 131 ? 64.597 54.437 107.778 1.00 60.57  ? 131 GLN A C   1 
ATOM   503  O O   . GLN A 1 131 ? 64.396 55.627 107.530 1.00 60.63  ? 131 GLN A O   1 
ATOM   504  C CB  . GLN A 1 131 ? 65.021 53.625 110.076 1.00 63.54  ? 131 GLN A CB  1 
ATOM   505  C CG  . GLN A 1 131 ? 64.615 52.715 111.209 1.00 69.21  ? 131 GLN A CG  1 
ATOM   506  C CD  . GLN A 1 131 ? 64.293 51.308 110.723 1.00 73.09  ? 131 GLN A CD  1 
ATOM   507  O OE1 . GLN A 1 131 ? 65.033 50.726 109.917 1.00 75.05  ? 131 GLN A OE1 1 
ATOM   508  N NE2 . GLN A 1 131 ? 63.186 50.751 111.212 1.00 74.65  ? 131 GLN A NE2 1 
ATOM   509  N N   . ASP A 1 132 ? 65.372 53.662 107.030 1.00 59.06  ? 132 ASP A N   1 
ATOM   510  C CA  . ASP A 1 132 ? 66.038 54.182 105.847 1.00 57.66  ? 132 ASP A CA  1 
ATOM   511  C C   . ASP A 1 132 ? 65.043 54.656 104.807 1.00 56.61  ? 132 ASP A C   1 
ATOM   512  O O   . ASP A 1 132 ? 65.255 55.679 104.161 1.00 56.09  ? 132 ASP A O   1 
ATOM   513  C CB  . ASP A 1 132 ? 66.935 53.113 105.248 1.00 58.04  ? 132 ASP A CB  1 
ATOM   514  C CG  . ASP A 1 132 ? 67.998 52.667 106.207 1.00 59.66  ? 132 ASP A CG  1 
ATOM   515  O OD1 . ASP A 1 132 ? 68.825 53.517 106.598 1.00 60.83  ? 132 ASP A OD1 1 
ATOM   516  O OD2 . ASP A 1 132 ? 68.003 51.475 106.579 1.00 61.13  ? 132 ASP A OD2 1 
ATOM   517  N N   . ALA A 1 133 ? 63.956 53.912 104.646 1.00 56.01  ? 133 ALA A N   1 
ATOM   518  C CA  . ALA A 1 133 ? 62.941 54.280 103.672 1.00 55.90  ? 133 ALA A CA  1 
ATOM   519  C C   . ALA A 1 133 ? 62.419 55.661 104.019 1.00 55.20  ? 133 ALA A C   1 
ATOM   520  O O   . ALA A 1 133 ? 62.331 56.539 103.161 1.00 55.06  ? 133 ALA A O   1 
ATOM   521  C CB  . ALA A 1 133 ? 61.808 53.268 103.682 1.00 56.27  ? 133 ALA A CB  1 
ATOM   522  N N   . ILE A 1 134 ? 62.077 55.844 105.289 1.00 54.39  ? 134 ILE A N   1 
ATOM   523  C CA  . ILE A 1 134 ? 61.573 57.123 105.770 1.00 54.00  ? 134 ILE A CA  1 
ATOM   524  C C   . ILE A 1 134 ? 62.551 58.228 105.375 1.00 53.98  ? 134 ILE A C   1 
ATOM   525  O O   . ILE A 1 134 ? 62.161 59.251 104.804 1.00 53.77  ? 134 ILE A O   1 
ATOM   526  C CB  . ILE A 1 134 ? 61.416 57.108 107.313 1.00 52.92  ? 134 ILE A CB  1 
ATOM   527  C CG1 . ILE A 1 134 ? 60.265 56.178 107.711 1.00 50.77  ? 134 ILE A CG1 1 
ATOM   528  C CG2 . ILE A 1 134 ? 61.197 58.522 107.831 1.00 52.25  ? 134 ILE A CG2 1 
ATOM   529  C CD1 . ILE A 1 134 ? 60.070 56.036 109.207 1.00 48.45  ? 134 ILE A CD1 1 
ATOM   530  N N   . ALA A 1 135 ? 63.824 57.994 105.684 1.00 53.87  ? 135 ALA A N   1 
ATOM   531  C CA  . ALA A 1 135 ? 64.899 58.931 105.386 1.00 53.97  ? 135 ALA A CA  1 
ATOM   532  C C   . ALA A 1 135 ? 64.958 59.277 103.903 1.00 54.07  ? 135 ALA A C   1 
ATOM   533  O O   . ALA A 1 135 ? 64.835 60.439 103.523 1.00 52.63  ? 135 ALA A O   1 
ATOM   534  C CB  . ALA A 1 135 ? 66.228 58.340 105.833 1.00 53.22  ? 135 ALA A CB  1 
ATOM   535  N N   . VAL A 1 136 ? 65.153 58.259 103.072 1.00 55.46  ? 136 VAL A N   1 
ATOM   536  C CA  . VAL A 1 136 ? 65.234 58.452 101.635 1.00 57.44  ? 136 VAL A CA  1 
ATOM   537  C C   . VAL A 1 136 ? 64.106 59.340 101.136 1.00 60.05  ? 136 VAL A C   1 
ATOM   538  O O   . VAL A 1 136 ? 64.324 60.215 100.300 1.00 60.18  ? 136 VAL A O   1 
ATOM   539  C CB  . VAL A 1 136 ? 65.180 57.114 100.890 1.00 56.82  ? 136 VAL A CB  1 
ATOM   540  C CG1 . VAL A 1 136 ? 65.280 57.348 99.396  1.00 56.90  ? 136 VAL A CG1 1 
ATOM   541  C CG2 . VAL A 1 136 ? 66.311 56.228 101.350 1.00 57.00  ? 136 VAL A CG2 1 
ATOM   542  N N   . GLU A 1 137 ? 62.897 59.121 101.642 1.00 63.08  ? 137 GLU A N   1 
ATOM   543  C CA  . GLU A 1 137 ? 61.778 59.947 101.214 1.00 65.91  ? 137 GLU A CA  1 
ATOM   544  C C   . GLU A 1 137 ? 62.019 61.367 101.681 1.00 67.05  ? 137 GLU A C   1 
ATOM   545  O O   . GLU A 1 137 ? 61.831 62.322 100.932 1.00 67.56  ? 137 GLU A O   1 
ATOM   546  C CB  . GLU A 1 137 ? 60.464 59.465 101.807 1.00 66.33  ? 137 GLU A CB  1 
ATOM   547  C CG  . GLU A 1 137 ? 59.300 60.303 101.321 1.00 69.73  ? 137 GLU A CG  1 
ATOM   548  C CD  . GLU A 1 137 ? 58.027 60.047 102.088 1.00 72.26  ? 137 GLU A CD  1 
ATOM   549  O OE1 . GLU A 1 137 ? 57.992 60.376 103.292 1.00 74.67  ? 137 GLU A OE1 1 
ATOM   550  O OE2 . GLU A 1 137 ? 57.063 59.517 101.489 1.00 74.05  ? 137 GLU A OE2 1 
ATOM   551  N N   . ALA A 1 138 ? 62.426 61.491 102.938 1.00 68.50  ? 138 ALA A N   1 
ATOM   552  C CA  . ALA A 1 138 ? 62.705 62.785 103.536 1.00 69.97  ? 138 ALA A CA  1 
ATOM   553  C C   . ALA A 1 138 ? 63.621 63.605 102.629 1.00 71.45  ? 138 ALA A C   1 
ATOM   554  O O   . ALA A 1 138 ? 63.319 64.750 102.285 1.00 70.09  ? 138 ALA A O   1 
ATOM   555  C CB  . ALA A 1 138 ? 63.355 62.586 104.897 1.00 68.74  ? 138 ALA A CB  1 
ATOM   556  N N   . ALA A 1 139 ? 64.742 63.001 102.246 1.00 74.13  ? 139 ALA A N   1 
ATOM   557  C CA  . ALA A 1 139 ? 65.720 63.657 101.388 1.00 76.98  ? 139 ALA A CA  1 
ATOM   558  C C   . ALA A 1 139 ? 65.228 63.718 99.949  1.00 78.81  ? 139 ALA A C   1 
ATOM   559  O O   . ALA A 1 139 ? 65.844 64.357 99.096  1.00 79.34  ? 139 ALA A O   1 
ATOM   560  C CB  . ALA A 1 139 ? 67.054 62.916 101.458 1.00 77.39  ? 139 ALA A CB  1 
ATOM   561  N N   . CYS A 1 140 ? 64.118 63.043 99.679  1.00 80.82  ? 140 CYS A N   1 
ATOM   562  C CA  . CYS A 1 140 ? 63.552 63.045 98.341  1.00 82.85  ? 140 CYS A CA  1 
ATOM   563  C C   . CYS A 1 140 ? 62.765 64.341 98.185  1.00 83.40  ? 140 CYS A C   1 
ATOM   564  O O   . CYS A 1 140 ? 61.794 64.419 97.434  1.00 83.20  ? 140 CYS A O   1 
ATOM   565  C CB  . CYS A 1 140 ? 62.632 61.844 98.160  1.00 83.53  ? 140 CYS A CB  1 
ATOM   566  S SG  . CYS A 1 140 ? 62.150 61.592 96.455  1.00 88.90  ? 140 CYS A SG  1 
ATOM   567  N N   . THR A 1 141 ? 63.213 65.350 98.925  1.00 84.89  ? 141 THR A N   1 
ATOM   568  C CA  . THR A 1 141 ? 62.623 66.682 98.949  1.00 85.55  ? 141 THR A CA  1 
ATOM   569  C C   . THR A 1 141 ? 61.390 66.885 98.072  1.00 85.87  ? 141 THR A C   1 
ATOM   570  O O   . THR A 1 141 ? 61.480 67.331 96.926  1.00 85.44  ? 141 THR A O   1 
ATOM   571  C CB  . THR A 1 141 ? 63.681 67.754 98.593  1.00 85.71  ? 141 THR A CB  1 
ATOM   572  O OG1 . THR A 1 141 ? 64.202 67.504 97.281  1.00 86.19  ? 141 THR A OG1 1 
ATOM   573  C CG2 . THR A 1 141 ? 64.826 67.722 99.604  1.00 84.68  ? 141 THR A CG2 1 
ATOM   574  N N   . ASN A 1 142 ? 60.240 66.533 98.634  1.00 86.40  ? 142 ASN A N   1 
ATOM   575  C CA  . ASN A 1 142 ? 58.949 66.690 97.973  1.00 87.34  ? 142 ASN A CA  1 
ATOM   576  C C   . ASN A 1 142 ? 58.614 65.814 96.765  1.00 86.17  ? 142 ASN A C   1 
ATOM   577  O O   . ASN A 1 142 ? 57.766 64.920 96.884  1.00 87.22  ? 142 ASN A O   1 
ATOM   578  C CB  . ASN A 1 142 ? 58.740 68.162 97.616  1.00 89.60  ? 142 ASN A CB  1 
ATOM   579  C CG  . ASN A 1 142 ? 58.714 69.053 98.845  1.00 92.18  ? 142 ASN A CG  1 
ATOM   580  O OD1 . ASN A 1 142 ? 58.435 70.250 98.752  1.00 94.07  ? 142 ASN A OD1 1 
ATOM   581  N ND2 . ASN A 1 142 ? 59.009 68.470 100.010 1.00 92.55  ? 142 ASN A ND2 1 
ATOM   582  N N   . VAL A 1 143 ? 59.243 66.068 95.613  1.00 82.60  ? 143 VAL A N   1 
ATOM   583  C CA  . VAL A 1 143 ? 58.963 65.282 94.403  1.00 78.75  ? 143 VAL A CA  1 
ATOM   584  C C   . VAL A 1 143 ? 58.395 63.907 94.765  1.00 75.89  ? 143 VAL A C   1 
ATOM   585  O O   . VAL A 1 143 ? 58.973 63.177 95.572  1.00 76.49  ? 143 VAL A O   1 
ATOM   586  C CB  . VAL A 1 143 ? 60.231 65.081 93.537  1.00 78.48  ? 143 VAL A CB  1 
ATOM   587  C CG1 . VAL A 1 143 ? 59.892 64.260 92.297  1.00 77.10  ? 143 VAL A CG1 1 
ATOM   588  C CG2 . VAL A 1 143 ? 60.800 66.425 93.132  1.00 78.32  ? 143 VAL A CG2 1 
ATOM   589  N N   . PRO A 1 144 ? 57.249 63.542 94.174  1.00 71.95  ? 144 PRO A N   1 
ATOM   590  C CA  . PRO A 1 144 ? 56.618 62.250 94.455  1.00 68.66  ? 144 PRO A CA  1 
ATOM   591  C C   . PRO A 1 144 ? 57.587 61.069 94.546  1.00 64.89  ? 144 PRO A C   1 
ATOM   592  O O   . PRO A 1 144 ? 58.391 60.841 93.644  1.00 64.53  ? 144 PRO A O   1 
ATOM   593  C CB  . PRO A 1 144 ? 55.600 62.108 93.317  1.00 69.82  ? 144 PRO A CB  1 
ATOM   594  C CG  . PRO A 1 144 ? 56.155 62.990 92.227  1.00 71.41  ? 144 PRO A CG  1 
ATOM   595  C CD  . PRO A 1 144 ? 56.631 64.179 93.001  1.00 71.71  ? 144 PRO A CD  1 
ATOM   596  N N   . ALA A 1 145 ? 57.503 60.330 95.651  1.00 60.84  ? 145 ALA A N   1 
ATOM   597  C CA  . ALA A 1 145 ? 58.365 59.175 95.885  1.00 56.85  ? 145 ALA A CA  1 
ATOM   598  C C   . ALA A 1 145 ? 57.579 57.903 96.199  1.00 54.20  ? 145 ALA A C   1 
ATOM   599  O O   . ALA A 1 145 ? 57.027 57.740 97.290  1.00 54.09  ? 145 ALA A O   1 
ATOM   600  C CB  . ALA A 1 145 ? 59.328 59.472 97.015  1.00 57.16  ? 145 ALA A CB  1 
ATOM   601  N N   . LEU A 1 146 ? 57.550 57.000 95.230  1.00 50.39  ? 146 LEU A N   1 
ATOM   602  C CA  . LEU A 1 146 ? 56.849 55.735 95.361  1.00 47.47  ? 146 LEU A CA  1 
ATOM   603  C C   . LEU A 1 146 ? 57.880 54.611 95.465  1.00 45.84  ? 146 LEU A C   1 
ATOM   604  O O   . LEU A 1 146 ? 58.614 54.354 94.511  1.00 46.54  ? 146 LEU A O   1 
ATOM   605  C CB  . LEU A 1 146 ? 55.953 55.534 94.134  1.00 47.30  ? 146 LEU A CB  1 
ATOM   606  C CG  . LEU A 1 146 ? 55.108 54.266 94.006  1.00 48.00  ? 146 LEU A CG  1 
ATOM   607  C CD1 . LEU A 1 146 ? 54.215 54.098 95.231  1.00 47.37  ? 146 LEU A CD1 1 
ATOM   608  C CD2 . LEU A 1 146 ? 54.274 54.354 92.736  1.00 46.83  ? 146 LEU A CD2 1 
ATOM   609  N N   . PHE A 1 147 ? 57.941 53.950 96.622  1.00 43.35  ? 147 PHE A N   1 
ATOM   610  C CA  . PHE A 1 147 ? 58.900 52.859 96.842  1.00 41.18  ? 147 PHE A CA  1 
ATOM   611  C C   . PHE A 1 147 ? 58.347 51.524 96.375  1.00 39.66  ? 147 PHE A C   1 
ATOM   612  O O   . PHE A 1 147 ? 57.142 51.294 96.433  1.00 40.45  ? 147 PHE A O   1 
ATOM   613  C CB  . PHE A 1 147 ? 59.269 52.760 98.319  1.00 39.31  ? 147 PHE A CB  1 
ATOM   614  C CG  . PHE A 1 147 ? 59.889 54.004 98.867  1.00 39.19  ? 147 PHE A CG  1 
ATOM   615  C CD1 . PHE A 1 147 ? 59.261 55.236 98.716  1.00 39.40  ? 147 PHE A CD1 1 
ATOM   616  C CD2 . PHE A 1 147 ? 61.090 53.946 99.558  1.00 39.59  ? 147 PHE A CD2 1 
ATOM   617  C CE1 . PHE A 1 147 ? 59.817 56.389 99.245  1.00 39.48  ? 147 PHE A CE1 1 
ATOM   618  C CE2 . PHE A 1 147 ? 61.658 55.092 100.092 1.00 39.31  ? 147 PHE A CE2 1 
ATOM   619  C CZ  . PHE A 1 147 ? 61.020 56.317 99.937  1.00 40.02  ? 147 PHE A CZ  1 
ATOM   620  N N   . LEU A 1 148 ? 59.226 50.640 95.918  1.00 37.55  ? 148 LEU A N   1 
ATOM   621  C CA  . LEU A 1 148 ? 58.783 49.339 95.436  1.00 37.31  ? 148 LEU A CA  1 
ATOM   622  C C   . LEU A 1 148 ? 59.432 48.155 96.154  1.00 37.20  ? 148 LEU A C   1 
ATOM   623  O O   . LEU A 1 148 ? 59.071 47.000 95.903  1.00 35.59  ? 148 LEU A O   1 
ATOM   624  C CB  . LEU A 1 148 ? 59.050 49.222 93.937  1.00 37.78  ? 148 LEU A CB  1 
ATOM   625  C CG  . LEU A 1 148 ? 58.428 50.250 92.993  1.00 37.50  ? 148 LEU A CG  1 
ATOM   626  C CD1 . LEU A 1 148 ? 59.022 50.060 91.609  1.00 36.07  ? 148 LEU A CD1 1 
ATOM   627  C CD2 . LEU A 1 148 ? 56.917 50.085 92.957  1.00 37.97  ? 148 LEU A CD2 1 
ATOM   628  N N   . ASP A 1 149 ? 60.392 48.431 97.034  1.00 36.80  ? 149 ASP A N   1 
ATOM   629  C CA  . ASP A 1 149 ? 61.060 47.356 97.758  1.00 35.78  ? 149 ASP A CA  1 
ATOM   630  C C   . ASP A 1 149 ? 61.250 47.685 99.219  1.00 34.21  ? 149 ASP A C   1 
ATOM   631  O O   . ASP A 1 149 ? 62.371 47.861 99.685  1.00 33.64  ? 149 ASP A O   1 
ATOM   632  C CB  . ASP A 1 149 ? 62.414 47.027 97.122  1.00 38.57  ? 149 ASP A CB  1 
ATOM   633  C CG  . ASP A 1 149 ? 62.996 45.720 97.635  1.00 39.94  ? 149 ASP A CG  1 
ATOM   634  O OD1 . ASP A 1 149 ? 62.217 44.782 97.882  1.00 41.46  ? 149 ASP A OD1 1 
ATOM   635  O OD2 . ASP A 1 149 ? 64.229 45.616 97.778  1.00 41.01  ? 149 ASP A OD2 1 
ATOM   636  N N   . VAL A 1 150 ? 60.131 47.766 99.930  1.00 33.53  ? 150 VAL A N   1 
ATOM   637  C CA  . VAL A 1 150 ? 60.109 48.056 101.356 1.00 32.06  ? 150 VAL A CA  1 
ATOM   638  C C   . VAL A 1 150 ? 59.027 47.187 101.949 1.00 32.05  ? 150 VAL A C   1 
ATOM   639  O O   . VAL A 1 150 ? 58.430 46.376 101.245 1.00 31.89  ? 150 VAL A O   1 
ATOM   640  C CB  . VAL A 1 150 ? 59.741 49.513 101.631 1.00 30.85  ? 150 VAL A CB  1 
ATOM   641  C CG1 . VAL A 1 150 ? 60.884 50.423 101.225 1.00 31.39  ? 150 VAL A CG1 1 
ATOM   642  C CG2 . VAL A 1 150 ? 58.479 49.868 100.868 1.00 29.27  ? 150 VAL A CG2 1 
ATOM   643  N N   . SER A 1 151 ? 58.783 47.358 103.243 1.00 32.96  ? 151 SER A N   1 
ATOM   644  C CA  . SER A 1 151 ? 57.747 46.603 103.934 1.00 33.71  ? 151 SER A CA  1 
ATOM   645  C C   . SER A 1 151 ? 56.419 47.328 103.841 1.00 35.29  ? 151 SER A C   1 
ATOM   646  O O   . SER A 1 151 ? 56.377 48.561 103.817 1.00 34.87  ? 151 SER A O   1 
ATOM   647  C CB  . SER A 1 151 ? 58.084 46.438 105.401 1.00 33.26  ? 151 SER A CB  1 
ATOM   648  O OG  . SER A 1 151 ? 56.921 46.042 106.099 1.00 32.35  ? 151 SER A OG  1 
ATOM   649  N N   . ASP A 1 152 ? 55.331 46.564 103.807 1.00 37.37  ? 152 ASP A N   1 
ATOM   650  C CA  . ASP A 1 152 ? 54.006 47.162 103.715 1.00 39.23  ? 152 ASP A CA  1 
ATOM   651  C C   . ASP A 1 152 ? 53.662 47.957 104.969 1.00 39.62  ? 152 ASP A C   1 
ATOM   652  O O   . ASP A 1 152 ? 52.678 48.687 104.996 1.00 39.15  ? 152 ASP A O   1 
ATOM   653  C CB  . ASP A 1 152 ? 52.947 46.087 103.421 1.00 39.49  ? 152 ASP A CB  1 
ATOM   654  C CG  . ASP A 1 152 ? 53.080 44.869 104.305 1.00 41.81  ? 152 ASP A CG  1 
ATOM   655  O OD1 . ASP A 1 152 ? 54.222 44.488 104.623 1.00 43.37  ? 152 ASP A OD1 1 
ATOM   656  O OD2 . ASP A 1 152 ? 52.043 44.274 104.665 1.00 43.17  ? 152 ASP A OD2 1 
ATOM   657  N N   . GLN A 1 153 ? 54.501 47.843 105.992 1.00 40.61  ? 153 GLN A N   1 
ATOM   658  C CA  . GLN A 1 153 ? 54.284 48.562 107.238 1.00 42.53  ? 153 GLN A CA  1 
ATOM   659  C C   . GLN A 1 153 ? 54.902 49.953 107.243 1.00 42.89  ? 153 GLN A C   1 
ATOM   660  O O   . GLN A 1 153 ? 54.412 50.848 107.921 1.00 43.71  ? 153 GLN A O   1 
ATOM   661  C CB  . GLN A 1 153 ? 54.839 47.759 108.409 1.00 46.22  ? 153 GLN A CB  1 
ATOM   662  C CG  . GLN A 1 153 ? 54.006 46.536 108.755 1.00 51.79  ? 153 GLN A CG  1 
ATOM   663  C CD  . GLN A 1 153 ? 52.623 46.904 109.267 1.00 55.30  ? 153 GLN A CD  1 
ATOM   664  O OE1 . GLN A 1 153 ? 52.480 47.463 110.365 1.00 57.45  ? 153 GLN A OE1 1 
ATOM   665  N NE2 . GLN A 1 153 ? 51.594 46.603 108.471 1.00 55.45  ? 153 GLN A NE2 1 
ATOM   666  N N   . THR A 1 154 ? 55.980 50.141 106.493 1.00 43.66  ? 154 THR A N   1 
ATOM   667  C CA  . THR A 1 154 ? 56.628 51.449 106.441 1.00 43.60  ? 154 THR A CA  1 
ATOM   668  C C   . THR A 1 154 ? 55.648 52.523 105.987 1.00 43.23  ? 154 THR A C   1 
ATOM   669  O O   . THR A 1 154 ? 54.993 52.390 104.958 1.00 44.36  ? 154 THR A O   1 
ATOM   670  C CB  . THR A 1 154 ? 57.802 51.462 105.466 1.00 44.09  ? 154 THR A CB  1 
ATOM   671  O OG1 . THR A 1 154 ? 58.702 50.390 105.783 1.00 44.95  ? 154 THR A OG1 1 
ATOM   672  C CG2 . THR A 1 154 ? 58.523 52.802 105.549 1.00 42.65  ? 154 THR A CG2 1 
ATOM   673  N N   . PRO A 1 155 ? 55.559 53.617 106.740 1.00 42.11  ? 155 PRO A N   1 
ATOM   674  C CA  . PRO A 1 155 ? 54.667 54.742 106.456 1.00 41.12  ? 155 PRO A CA  1 
ATOM   675  C C   . PRO A 1 155 ? 55.055 55.637 105.290 1.00 40.55  ? 155 PRO A C   1 
ATOM   676  O O   . PRO A 1 155 ? 55.354 56.809 105.486 1.00 41.23  ? 155 PRO A O   1 
ATOM   677  C CB  . PRO A 1 155 ? 54.669 55.502 107.767 1.00 41.70  ? 155 PRO A CB  1 
ATOM   678  C CG  . PRO A 1 155 ? 56.078 55.321 108.218 1.00 42.67  ? 155 PRO A CG  1 
ATOM   679  C CD  . PRO A 1 155 ? 56.308 53.847 107.984 1.00 41.98  ? 155 PRO A CD  1 
ATOM   680  N N   . ILE A 1 156 ? 55.037 55.093 104.079 1.00 40.68  ? 156 ILE A N   1 
ATOM   681  C CA  . ILE A 1 156 ? 55.369 55.865 102.881 1.00 41.13  ? 156 ILE A CA  1 
ATOM   682  C C   . ILE A 1 156 ? 54.605 55.305 101.689 1.00 40.71  ? 156 ILE A C   1 
ATOM   683  O O   . ILE A 1 156 ? 54.006 54.237 101.788 1.00 40.55  ? 156 ILE A O   1 
ATOM   684  C CB  . ILE A 1 156 ? 56.884 55.822 102.572 1.00 42.19  ? 156 ILE A CB  1 
ATOM   685  C CG1 . ILE A 1 156 ? 57.387 54.375 102.582 1.00 44.06  ? 156 ILE A CG1 1 
ATOM   686  C CG2 . ILE A 1 156 ? 57.640 56.648 103.585 1.00 42.47  ? 156 ILE A CG2 1 
ATOM   687  C CD1 . ILE A 1 156 ? 58.877 54.222 102.277 1.00 44.50  ? 156 ILE A CD1 1 
ATOM   688  N N   . ASN A 1 157 ? 54.615 56.027 100.571 1.00 40.89  ? 157 ASN A N   1 
ATOM   689  C CA  . ASN A 1 157 ? 53.913 55.577 99.368  1.00 42.00  ? 157 ASN A CA  1 
ATOM   690  C C   . ASN A 1 157 ? 54.619 54.380 98.764  1.00 40.58  ? 157 ASN A C   1 
ATOM   691  O O   . ASN A 1 157 ? 55.709 54.515 98.223  1.00 42.64  ? 157 ASN A O   1 
ATOM   692  C CB  . ASN A 1 157 ? 53.871 56.689 98.330  1.00 45.17  ? 157 ASN A CB  1 
ATOM   693  C CG  . ASN A 1 157 ? 52.990 57.838 98.745  1.00 49.03  ? 157 ASN A CG  1 
ATOM   694  O OD1 . ASN A 1 157 ? 53.009 58.899 98.115  1.00 52.74  ? 157 ASN A OD1 1 
ATOM   695  N ND2 . ASN A 1 157 ? 52.203 57.641 99.802  1.00 48.13  ? 157 ASN A ND2 1 
ATOM   696  N N   . SER A 1 158 ? 54.003 53.209 98.829  1.00 38.28  ? 158 SER A N   1 
ATOM   697  C CA  . SER A 1 158 ? 54.659 52.037 98.282  1.00 36.82  ? 158 SER A CA  1 
ATOM   698  C C   . SER A 1 158 ? 53.732 51.090 97.552  1.00 35.60  ? 158 SER A C   1 
ATOM   699  O O   . SER A 1 158 ? 52.515 51.156 97.701  1.00 36.25  ? 158 SER A O   1 
ATOM   700  C CB  . SER A 1 158 ? 55.374 51.268 99.400  1.00 36.46  ? 158 SER A CB  1 
ATOM   701  O OG  . SER A 1 158 ? 54.452 50.752 100.349 1.00 35.70  ? 158 SER A OG  1 
ATOM   702  N N   . ILE A 1 159 ? 54.336 50.223 96.746  1.00 32.72  ? 159 ILE A N   1 
ATOM   703  C CA  . ILE A 1 159 ? 53.620 49.196 96.009  1.00 29.73  ? 159 ILE A CA  1 
ATOM   704  C C   . ILE A 1 159 ? 54.522 47.971 96.057  1.00 29.04  ? 159 ILE A C   1 
ATOM   705  O O   . ILE A 1 159 ? 55.684 48.037 95.652  1.00 28.69  ? 159 ILE A O   1 
ATOM   706  C CB  . ILE A 1 159 ? 53.402 49.567 94.531  1.00 28.77  ? 159 ILE A CB  1 
ATOM   707  C CG1 . ILE A 1 159 ? 52.680 50.909 94.424  1.00 29.15  ? 159 ILE A CG1 1 
ATOM   708  C CG2 . ILE A 1 159 ? 52.600 48.466 93.838  1.00 24.60  ? 159 ILE A CG2 1 
ATOM   709  C CD1 . ILE A 1 159 ? 52.216 51.250 93.011  1.00 27.71  ? 159 ILE A CD1 1 
ATOM   710  N N   . ILE A 1 160 ? 54.004 46.862 96.574  1.00 27.11  ? 160 ILE A N   1 
ATOM   711  C CA  . ILE A 1 160 ? 54.784 45.637 96.645  1.00 25.56  ? 160 ILE A CA  1 
ATOM   712  C C   . ILE A 1 160 ? 53.890 44.419 96.460  1.00 25.93  ? 160 ILE A C   1 
ATOM   713  O O   . ILE A 1 160 ? 52.669 44.506 96.524  1.00 25.70  ? 160 ILE A O   1 
ATOM   714  C CB  . ILE A 1 160 ? 55.509 45.501 98.000  1.00 24.72  ? 160 ILE A CB  1 
ATOM   715  C CG1 . ILE A 1 160 ? 54.547 44.974 99.057  1.00 25.15  ? 160 ILE A CG1 1 
ATOM   716  C CG2 . ILE A 1 160 ? 56.050 46.850 98.446  1.00 23.33  ? 160 ILE A CG2 1 
ATOM   717  C CD1 . ILE A 1 160 ? 55.174 44.808 100.424 1.00 26.74  ? 160 ILE A CD1 1 
ATOM   718  N N   . PHE A 1 161 ? 54.505 43.277 96.220  1.00 26.63  ? 161 PHE A N   1 
ATOM   719  C CA  . PHE A 1 161 ? 53.745 42.060 96.057  1.00 28.25  ? 161 PHE A CA  1 
ATOM   720  C C   . PHE A 1 161 ? 53.491 41.494 97.428  1.00 29.98  ? 161 PHE A C   1 
ATOM   721  O O   . PHE A 1 161 ? 54.306 41.661 98.329  1.00 31.95  ? 161 PHE A O   1 
ATOM   722  C CB  . PHE A 1 161 ? 54.535 41.074 95.228  1.00 28.77  ? 161 PHE A CB  1 
ATOM   723  C CG  . PHE A 1 161 ? 54.624 41.459 93.797  1.00 31.26  ? 161 PHE A CG  1 
ATOM   724  C CD1 . PHE A 1 161 ? 53.507 41.359 92.975  1.00 31.67  ? 161 PHE A CD1 1 
ATOM   725  C CD2 . PHE A 1 161 ? 55.809 41.960 93.270  1.00 30.71  ? 161 PHE A CD2 1 
ATOM   726  C CE1 . PHE A 1 161 ? 53.571 41.751 91.653  1.00 32.24  ? 161 PHE A CE1 1 
ATOM   727  C CE2 . PHE A 1 161 ? 55.884 42.358 91.946  1.00 29.52  ? 161 PHE A CE2 1 
ATOM   728  C CZ  . PHE A 1 161 ? 54.768 42.254 91.137  1.00 32.59  ? 161 PHE A CZ  1 
ATOM   729  N N   . SER A 1 162 ? 52.365 40.822 97.602  1.00 31.94  ? 162 SER A N   1 
ATOM   730  C CA  . SER A 1 162 ? 52.063 40.255 98.903  1.00 34.47  ? 162 SER A CA  1 
ATOM   731  C C   . SER A 1 162 ? 52.991 39.107 99.265  1.00 35.12  ? 162 SER A C   1 
ATOM   732  O O   . SER A 1 162 ? 52.797 37.977 98.816  1.00 35.07  ? 162 SER A O   1 
ATOM   733  C CB  . SER A 1 162 ? 50.624 39.758 98.956  1.00 36.04  ? 162 SER A CB  1 
ATOM   734  O OG  . SER A 1 162 ? 50.354 39.189 100.224 1.00 38.17  ? 162 SER A OG  1 
ATOM   735  N N   . HIS A 1 163 ? 54.001 39.398 100.076 1.00 35.00  ? 163 HIS A N   1 
ATOM   736  C CA  . HIS A 1 163 ? 54.921 38.363 100.506 1.00 36.40  ? 163 HIS A CA  1 
ATOM   737  C C   . HIS A 1 163 ? 54.116 37.334 101.287 1.00 34.98  ? 163 HIS A C   1 
ATOM   738  O O   . HIS A 1 163 ? 54.413 36.143 101.252 1.00 34.42  ? 163 HIS A O   1 
ATOM   739  C CB  . HIS A 1 163 ? 56.015 38.955 101.395 1.00 41.24  ? 163 HIS A CB  1 
ATOM   740  C CG  . HIS A 1 163 ? 55.510 39.964 102.378 1.00 46.52  ? 163 HIS A CG  1 
ATOM   741  N ND1 . HIS A 1 163 ? 54.410 39.739 103.180 1.00 48.30  ? 163 HIS A ND1 1 
ATOM   742  C CD2 . HIS A 1 163 ? 55.944 41.211 102.679 1.00 48.13  ? 163 HIS A CD2 1 
ATOM   743  C CE1 . HIS A 1 163 ? 54.188 40.805 103.929 1.00 48.98  ? 163 HIS A CE1 1 
ATOM   744  N NE2 . HIS A 1 163 ? 55.105 41.713 103.645 1.00 48.26  ? 163 HIS A NE2 1 
ATOM   745  N N   . GLU A 1 164 ? 53.084 37.805 101.982 1.00 33.69  ? 164 GLU A N   1 
ATOM   746  C CA  . GLU A 1 164 ? 52.226 36.933 102.776 1.00 32.83  ? 164 GLU A CA  1 
ATOM   747  C C   . GLU A 1 164 ? 51.596 35.813 101.957 1.00 33.64  ? 164 GLU A C   1 
ATOM   748  O O   . GLU A 1 164 ? 51.571 34.654 102.383 1.00 33.80  ? 164 GLU A O   1 
ATOM   749  C CB  . GLU A 1 164 ? 51.126 37.753 103.446 1.00 31.42  ? 164 GLU A CB  1 
ATOM   750  C CG  . GLU A 1 164 ? 51.595 38.571 104.628 1.00 31.82  ? 164 GLU A CG  1 
ATOM   751  C CD  . GLU A 1 164 ? 51.807 37.734 105.874 1.00 32.91  ? 164 GLU A CD  1 
ATOM   752  O OE1 . GLU A 1 164 ? 52.472 38.225 106.804 1.00 34.99  ? 164 GLU A OE1 1 
ATOM   753  O OE2 . GLU A 1 164 ? 51.307 36.594 105.936 1.00 31.64  ? 164 GLU A OE2 1 
ATOM   754  N N   . ASP A 1 165 ? 51.081 36.152 100.783 1.00 33.90  ? 165 ASP A N   1 
ATOM   755  C CA  . ASP A 1 165 ? 50.459 35.143 99.949  1.00 36.11  ? 165 ASP A CA  1 
ATOM   756  C C   . ASP A 1 165 ? 51.493 34.316 99.210  1.00 35.46  ? 165 ASP A C   1 
ATOM   757  O O   . ASP A 1 165 ? 51.376 33.096 99.113  1.00 34.70  ? 165 ASP A O   1 
ATOM   758  C CB  . ASP A 1 165 ? 49.505 35.797 98.958  1.00 39.68  ? 165 ASP A CB  1 
ATOM   759  C CG  . ASP A 1 165 ? 48.340 36.477 99.643  1.00 43.27  ? 165 ASP A CG  1 
ATOM   760  O OD1 . ASP A 1 165 ? 48.401 37.708 99.842  1.00 44.93  ? 165 ASP A OD1 1 
ATOM   761  O OD2 . ASP A 1 165 ? 47.365 35.774 99.995  1.00 45.39  ? 165 ASP A OD2 1 
ATOM   762  N N   . GLY A 1 166 ? 52.512 34.991 98.694  1.00 35.53  ? 166 GLY A N   1 
ATOM   763  C CA  . GLY A 1 166 ? 53.559 34.303 97.964  1.00 34.70  ? 166 GLY A CA  1 
ATOM   764  C C   . GLY A 1 166 ? 54.154 33.177 98.774  1.00 33.99  ? 166 GLY A C   1 
ATOM   765  O O   . GLY A 1 166 ? 54.462 32.113 98.245  1.00 35.31  ? 166 GLY A O   1 
ATOM   766  N N   . THR A 1 167 ? 54.314 33.409 100.070 1.00 32.47  ? 167 THR A N   1 
ATOM   767  C CA  . THR A 1 167 ? 54.877 32.401 100.950 1.00 30.66  ? 167 THR A CA  1 
ATOM   768  C C   . THR A 1 167 ? 53.866 31.318 101.364 1.00 30.24  ? 167 THR A C   1 
ATOM   769  O O   . THR A 1 167 ? 54.211 30.139 101.439 1.00 28.82  ? 167 THR A O   1 
ATOM   770  C CB  . THR A 1 167 ? 55.513 33.073 102.178 1.00 29.37  ? 167 THR A CB  1 
ATOM   771  O OG1 . THR A 1 167 ? 54.720 34.195 102.583 1.00 27.40  ? 167 THR A OG1 1 
ATOM   772  C CG2 . THR A 1 167 ? 56.907 33.556 101.839 1.00 27.57  ? 167 THR A CG2 1 
ATOM   773  N N   . ARG A 1 168 ? 52.622 31.706 101.619 1.00 30.67  ? 168 ARG A N   1 
ATOM   774  C CA  . ARG A 1 168 ? 51.607 30.725 101.984 1.00 32.44  ? 168 ARG A CA  1 
ATOM   775  C C   . ARG A 1 168 ? 51.408 29.739 100.816 1.00 32.28  ? 168 ARG A C   1 
ATOM   776  O O   . ARG A 1 168 ? 51.280 28.527 101.018 1.00 30.84  ? 168 ARG A O   1 
ATOM   777  C CB  . ARG A 1 168 ? 50.284 31.430 102.309 1.00 33.73  ? 168 ARG A CB  1 
ATOM   778  C CG  . ARG A 1 168 ? 49.116 30.476 102.545 1.00 37.67  ? 168 ARG A CG  1 
ATOM   779  C CD  . ARG A 1 168 ? 47.796 31.208 102.787 1.00 42.46  ? 168 ARG A CD  1 
ATOM   780  N NE  . ARG A 1 168 ? 47.465 32.150 101.710 1.00 50.20  ? 168 ARG A NE  1 
ATOM   781  C CZ  . ARG A 1 168 ? 47.045 31.816 100.484 1.00 51.46  ? 168 ARG A CZ  1 
ATOM   782  N NH1 . ARG A 1 168 ? 46.884 30.540 100.137 1.00 51.03  ? 168 ARG A NH1 1 
ATOM   783  N NH2 . ARG A 1 168 ? 46.787 32.770 99.592  1.00 50.56  ? 168 ARG A NH2 1 
ATOM   784  N N   . LEU A 1 169 ? 51.399 30.270 99.595  1.00 31.81  ? 169 LEU A N   1 
ATOM   785  C CA  . LEU A 1 169 ? 51.213 29.460 98.392  1.00 31.79  ? 169 LEU A CA  1 
ATOM   786  C C   . LEU A 1 169 ? 52.248 28.359 98.236  1.00 32.19  ? 169 LEU A C   1 
ATOM   787  O O   . LEU A 1 169 ? 51.898 27.218 97.937  1.00 34.21  ? 169 LEU A O   1 
ATOM   788  C CB  . LEU A 1 169 ? 51.246 30.332 97.130  1.00 30.73  ? 169 LEU A CB  1 
ATOM   789  C CG  . LEU A 1 169 ? 50.082 31.271 96.818  1.00 29.50  ? 169 LEU A CG  1 
ATOM   790  C CD1 . LEU A 1 169 ? 50.349 32.034 95.534  1.00 29.51  ? 169 LEU A CD1 1 
ATOM   791  C CD2 . LEU A 1 169 ? 48.822 30.466 96.685  1.00 29.25  ? 169 LEU A CD2 1 
ATOM   792  N N   . GLY A 1 170 ? 53.520 28.708 98.415  1.00 30.85  ? 170 GLY A N   1 
ATOM   793  C CA  . GLY A 1 170 ? 54.579 27.726 98.277  1.00 29.38  ? 170 GLY A CA  1 
ATOM   794  C C   . GLY A 1 170 ? 54.516 26.685 99.378  1.00 29.59  ? 170 GLY A C   1 
ATOM   795  O O   . GLY A 1 170 ? 54.675 25.486 99.138  1.00 28.88  ? 170 GLY A O   1 
ATOM   796  N N   . VAL A 1 171 ? 54.280 27.142 100.601 1.00 28.85  ? 171 VAL A N   1 
ATOM   797  C CA  . VAL A 1 171 ? 54.202 26.225 101.718 1.00 28.03  ? 171 VAL A CA  1 
ATOM   798  C C   . VAL A 1 171 ? 53.005 25.297 101.559 1.00 28.85  ? 171 VAL A C   1 
ATOM   799  O O   . VAL A 1 171 ? 53.111 24.092 101.790 1.00 30.25  ? 171 VAL A O   1 
ATOM   800  C CB  . VAL A 1 171 ? 54.124 26.989 103.056 1.00 26.83  ? 171 VAL A CB  1 
ATOM   801  C CG1 . VAL A 1 171 ? 53.740 26.056 104.200 1.00 24.21  ? 171 VAL A CG1 1 
ATOM   802  C CG2 . VAL A 1 171 ? 55.468 27.606 103.344 1.00 25.92  ? 171 VAL A CG2 1 
ATOM   803  N N   . GLU A 1 172 ? 51.868 25.836 101.143 1.00 28.50  ? 172 GLU A N   1 
ATOM   804  C CA  . GLU A 1 172 ? 50.703 24.984 100.983 1.00 28.61  ? 172 GLU A CA  1 
ATOM   805  C C   . GLU A 1 172 ? 50.809 24.035 99.793  1.00 28.87  ? 172 GLU A C   1 
ATOM   806  O O   . GLU A 1 172 ? 50.350 22.897 99.864  1.00 28.09  ? 172 GLU A O   1 
ATOM   807  C CB  . GLU A 1 172 ? 49.454 25.843 100.903 1.00 26.60  ? 172 GLU A CB  1 
ATOM   808  C CG  . GLU A 1 172 ? 49.160 26.490 102.223 1.00 27.34  ? 172 GLU A CG  1 
ATOM   809  C CD  . GLU A 1 172 ? 48.026 27.467 102.143 1.00 30.11  ? 172 GLU A CD  1 
ATOM   810  O OE1 . GLU A 1 172 ? 47.613 27.992 103.201 1.00 32.96  ? 172 GLU A OE1 1 
ATOM   811  O OE2 . GLU A 1 172 ? 47.552 27.715 101.019 1.00 31.20  ? 172 GLU A OE2 1 
ATOM   812  N N   . HIS A 1 173 ? 51.432 24.491 98.709  1.00 29.93  ? 173 HIS A N   1 
ATOM   813  C CA  . HIS A 1 173 ? 51.598 23.646 97.528  1.00 31.06  ? 173 HIS A CA  1 
ATOM   814  C C   . HIS A 1 173 ? 52.417 22.425 97.915  1.00 31.35  ? 173 HIS A C   1 
ATOM   815  O O   . HIS A 1 173 ? 52.060 21.295 97.597  1.00 31.89  ? 173 HIS A O   1 
ATOM   816  C CB  . HIS A 1 173 ? 52.312 24.407 96.405  1.00 30.88  ? 173 HIS A CB  1 
ATOM   817  C CG  . HIS A 1 173 ? 52.595 23.570 95.194  1.00 31.57  ? 173 HIS A CG  1 
ATOM   818  N ND1 . HIS A 1 173 ? 51.600 22.954 94.466  1.00 31.86  ? 173 HIS A ND1 1 
ATOM   819  C CD2 . HIS A 1 173 ? 53.762 23.241 94.590  1.00 32.20  ? 173 HIS A CD2 1 
ATOM   820  C CE1 . HIS A 1 173 ? 52.143 22.281 93.467  1.00 32.36  ? 173 HIS A CE1 1 
ATOM   821  N NE2 . HIS A 1 173 ? 53.453 22.438 93.520  1.00 30.69  ? 173 HIS A NE2 1 
ATOM   822  N N   . LEU A 1 174 ? 53.524 22.669 98.603  1.00 31.85  ? 174 LEU A N   1 
ATOM   823  C CA  . LEU A 1 174 ? 54.390 21.598 99.054  1.00 31.92  ? 174 LEU A CA  1 
ATOM   824  C C   . LEU A 1 174 ? 53.676 20.709 100.069 1.00 33.27  ? 174 LEU A C   1 
ATOM   825  O O   . LEU A 1 174 ? 53.806 19.480 100.043 1.00 33.28  ? 174 LEU A O   1 
ATOM   826  C CB  . LEU A 1 174 ? 55.650 22.188 99.679  1.00 30.12  ? 174 LEU A CB  1 
ATOM   827  C CG  . LEU A 1 174 ? 56.639 22.688 98.641  1.00 30.58  ? 174 LEU A CG  1 
ATOM   828  C CD1 . LEU A 1 174 ? 57.838 23.336 99.315  1.00 29.98  ? 174 LEU A CD1 1 
ATOM   829  C CD2 . LEU A 1 174 ? 57.065 21.503 97.788  1.00 29.90  ? 174 LEU A CD2 1 
ATOM   830  N N   . VAL A 1 175 ? 52.915 21.329 100.962 1.00 33.57  ? 175 VAL A N   1 
ATOM   831  C CA  . VAL A 1 175 ? 52.213 20.566 101.976 1.00 34.18  ? 175 VAL A CA  1 
ATOM   832  C C   . VAL A 1 175 ? 51.157 19.662 101.361 1.00 33.27  ? 175 VAL A C   1 
ATOM   833  O O   . VAL A 1 175 ? 51.176 18.459 101.589 1.00 33.57  ? 175 VAL A O   1 
ATOM   834  C CB  . VAL A 1 175 ? 51.577 21.494 103.050 1.00 35.19  ? 175 VAL A CB  1 
ATOM   835  C CG1 . VAL A 1 175 ? 50.640 20.695 103.942 1.00 33.89  ? 175 VAL A CG1 1 
ATOM   836  C CG2 . VAL A 1 175 ? 52.679 22.124 103.916 1.00 33.29  ? 175 VAL A CG2 1 
ATOM   837  N N   . ALA A 1 176 ? 50.250 20.232 100.577 1.00 33.50  ? 176 ALA A N   1 
ATOM   838  C CA  . ALA A 1 176 ? 49.193 19.443 99.941  1.00 34.51  ? 176 ALA A CA  1 
ATOM   839  C C   . ALA A 1 176 ? 49.778 18.289 99.121  1.00 35.76  ? 176 ALA A C   1 
ATOM   840  O O   . ALA A 1 176 ? 49.174 17.224 99.010  1.00 36.30  ? 176 ALA A O   1 
ATOM   841  C CB  . ALA A 1 176 ? 48.329 20.336 99.056  1.00 33.25  ? 176 ALA A CB  1 
ATOM   842  N N   . LEU A 1 177 ? 50.952 18.504 98.539  1.00 36.33  ? 177 LEU A N   1 
ATOM   843  C CA  . LEU A 1 177 ? 51.610 17.465 97.762  1.00 36.38  ? 177 LEU A CA  1 
ATOM   844  C C   . LEU A 1 177 ? 52.092 16.383 98.704  1.00 36.96  ? 177 LEU A C   1 
ATOM   845  O O   . LEU A 1 177 ? 52.677 15.390 98.273  1.00 38.26  ? 177 LEU A O   1 
ATOM   846  C CB  . LEU A 1 177 ? 52.807 18.036 97.015  1.00 37.11  ? 177 LEU A CB  1 
ATOM   847  C CG  . LEU A 1 177 ? 52.470 18.615 95.649  1.00 38.52  ? 177 LEU A CG  1 
ATOM   848  C CD1 . LEU A 1 177 ? 53.675 19.354 95.082  1.00 39.96  ? 177 LEU A CD1 1 
ATOM   849  C CD2 . LEU A 1 177 ? 52.035 17.479 94.734  1.00 37.84  ? 177 LEU A CD2 1 
ATOM   850  N N   . GLY A 1 178 ? 51.867 16.600 99.995  1.00 36.44  ? 178 GLY A N   1 
ATOM   851  C CA  . GLY A 1 178 ? 52.274 15.641 101.001 1.00 36.12  ? 178 GLY A CA  1 
ATOM   852  C C   . GLY A 1 178 ? 53.728 15.719 101.426 1.00 37.02  ? 178 GLY A C   1 
ATOM   853  O O   . GLY A 1 178 ? 54.313 14.716 101.817 1.00 38.12  ? 178 GLY A O   1 
ATOM   854  N N   . HIS A 1 179 ? 54.325 16.899 101.363 1.00 37.39  ? 179 HIS A N   1 
ATOM   855  C CA  . HIS A 1 179 ? 55.715 17.038 101.767 1.00 37.20  ? 179 HIS A CA  1 
ATOM   856  C C   . HIS A 1 179 ? 55.845 17.345 103.247 1.00 39.40  ? 179 HIS A C   1 
ATOM   857  O O   . HIS A 1 179 ? 54.947 17.946 103.841 1.00 40.04  ? 179 HIS A O   1 
ATOM   858  C CB  . HIS A 1 179 ? 56.369 18.151 100.971 1.00 35.22  ? 179 HIS A CB  1 
ATOM   859  C CG  . HIS A 1 179 ? 56.858 17.714 99.635  1.00 33.90  ? 179 HIS A CG  1 
ATOM   860  N ND1 . HIS A 1 179 ? 57.932 16.866 99.484  1.00 32.08  ? 179 HIS A ND1 1 
ATOM   861  C CD2 . HIS A 1 179 ? 56.404 17.980 98.388  1.00 34.13  ? 179 HIS A CD2 1 
ATOM   862  C CE1 . HIS A 1 179 ? 58.119 16.626 98.199  1.00 33.91  ? 179 HIS A CE1 1 
ATOM   863  N NE2 . HIS A 1 179 ? 57.205 17.289 97.513  1.00 34.41  ? 179 HIS A NE2 1 
ATOM   864  N N   . GLN A 1 180 ? 56.962 16.933 103.842 1.00 40.91  ? 180 GLN A N   1 
ATOM   865  C CA  . GLN A 1 180 ? 57.210 17.201 105.255 1.00 41.99  ? 180 GLN A CA  1 
ATOM   866  C C   . GLN A 1 180 ? 58.663 17.493 105.553 1.00 40.69  ? 180 GLN A C   1 
ATOM   867  O O   . GLN A 1 180 ? 58.966 18.242 106.473 1.00 39.87  ? 180 GLN A O   1 
ATOM   868  C CB  . GLN A 1 180 ? 56.712 16.053 106.118 1.00 45.13  ? 180 GLN A CB  1 
ATOM   869  C CG  . GLN A 1 180 ? 55.212 15.958 106.089 1.00 52.29  ? 180 GLN A CG  1 
ATOM   870  C CD  . GLN A 1 180 ? 54.671 15.121 107.209 1.00 57.86  ? 180 GLN A CD  1 
ATOM   871  O OE1 . GLN A 1 180 ? 54.924 13.910 107.277 1.00 60.19  ? 180 GLN A OE1 1 
ATOM   872  N NE2 . GLN A 1 180 ? 53.920 15.758 108.112 1.00 60.17  ? 180 GLN A NE2 1 
ATOM   873  N N   . GLN A 1 181 ? 59.569 16.892 104.793 1.00 40.79  ? 181 GLN A N   1 
ATOM   874  C CA  . GLN A 1 181 ? 60.986 17.186 104.977 1.00 40.92  ? 181 GLN A CA  1 
ATOM   875  C C   . GLN A 1 181 ? 61.251 18.385 104.067 1.00 39.18  ? 181 GLN A C   1 
ATOM   876  O O   . GLN A 1 181 ? 61.517 18.219 102.874 1.00 40.43  ? 181 GLN A O   1 
ATOM   877  C CB  . GLN A 1 181 ? 61.853 15.999 104.553 1.00 43.71  ? 181 GLN A CB  1 
ATOM   878  C CG  . GLN A 1 181 ? 61.775 14.809 105.489 1.00 46.38  ? 181 GLN A CG  1 
ATOM   879  C CD  . GLN A 1 181 ? 61.876 15.224 106.944 1.00 48.82  ? 181 GLN A CD  1 
ATOM   880  O OE1 . GLN A 1 181 ? 60.920 15.763 107.508 1.00 50.65  ? 181 GLN A OE1 1 
ATOM   881  N NE2 . GLN A 1 181 ? 63.039 14.994 107.557 1.00 48.17  ? 181 GLN A NE2 1 
ATOM   882  N N   . ILE A 1 182 ? 61.163 19.591 104.625 1.00 35.06  ? 182 ILE A N   1 
ATOM   883  C CA  . ILE A 1 182 ? 61.348 20.799 103.837 1.00 30.74  ? 182 ILE A CA  1 
ATOM   884  C C   . ILE A 1 182 ? 62.540 21.649 104.238 1.00 30.35  ? 182 ILE A C   1 
ATOM   885  O O   . ILE A 1 182 ? 62.801 21.847 105.413 1.00 31.13  ? 182 ILE A O   1 
ATOM   886  C CB  . ILE A 1 182 ? 60.097 21.658 103.905 1.00 28.03  ? 182 ILE A CB  1 
ATOM   887  C CG1 . ILE A 1 182 ? 58.911 20.861 103.379 1.00 26.69  ? 182 ILE A CG1 1 
ATOM   888  C CG2 . ILE A 1 182 ? 60.279 22.908 103.081 1.00 28.99  ? 182 ILE A CG2 1 
ATOM   889  C CD1 . ILE A 1 182 ? 57.607 21.580 103.512 1.00 27.19  ? 182 ILE A CD1 1 
ATOM   890  N N   . ALA A 1 183 ? 63.268 22.150 103.247 1.00 30.22  ? 183 ALA A N   1 
ATOM   891  C CA  . ALA A 1 183 ? 64.427 22.997 103.509 1.00 29.84  ? 183 ALA A CA  1 
ATOM   892  C C   . ALA A 1 183 ? 64.165 24.370 102.895 1.00 29.51  ? 183 ALA A C   1 
ATOM   893  O O   . ALA A 1 183 ? 63.430 24.484 101.906 1.00 29.81  ? 183 ALA A O   1 
ATOM   894  C CB  . ALA A 1 183 ? 65.688 22.373 102.908 1.00 28.38  ? 183 ALA A CB  1 
ATOM   895  N N   . LEU A 1 184 ? 64.754 25.408 103.484 1.00 27.73  ? 184 LEU A N   1 
ATOM   896  C CA  . LEU A 1 184 ? 64.566 26.765 102.986 1.00 26.26  ? 184 LEU A CA  1 
ATOM   897  C C   . LEU A 1 184 ? 65.885 27.393 102.550 1.00 26.21  ? 184 LEU A C   1 
ATOM   898  O O   . LEU A 1 184 ? 66.902 27.273 103.241 1.00 25.21  ? 184 LEU A O   1 
ATOM   899  C CB  . LEU A 1 184 ? 63.931 27.643 104.069 1.00 25.64  ? 184 LEU A CB  1 
ATOM   900  C CG  . LEU A 1 184 ? 62.661 27.155 104.773 1.00 25.27  ? 184 LEU A CG  1 
ATOM   901  C CD1 . LEU A 1 184 ? 62.293 28.134 105.886 1.00 22.12  ? 184 LEU A CD1 1 
ATOM   902  C CD2 . LEU A 1 184 ? 61.527 27.016 103.759 1.00 24.15  ? 184 LEU A CD2 1 
ATOM   903  N N   . LEU A 1 185 ? 65.863 28.058 101.397 1.00 25.50  ? 185 LEU A N   1 
ATOM   904  C CA  . LEU A 1 185 ? 67.047 28.736 100.874 1.00 24.73  ? 185 LEU A CA  1 
ATOM   905  C C   . LEU A 1 185 ? 66.662 30.186 100.683 1.00 24.56  ? 185 LEU A C   1 
ATOM   906  O O   . LEU A 1 185 ? 66.099 30.563 99.663  1.00 23.78  ? 185 LEU A O   1 
ATOM   907  C CB  . LEU A 1 185 ? 67.479 28.135 99.540  1.00 24.03  ? 185 LEU A CB  1 
ATOM   908  C CG  . LEU A 1 185 ? 68.699 28.822 98.933  1.00 22.48  ? 185 LEU A CG  1 
ATOM   909  C CD1 . LEU A 1 185 ? 69.757 29.051 99.994  1.00 22.93  ? 185 LEU A CD1 1 
ATOM   910  C CD2 . LEU A 1 185 ? 69.245 27.969 97.833  1.00 22.12  ? 185 LEU A CD2 1 
ATOM   911  N N   . ALA A 1 186 ? 66.972 31.004 101.675 1.00 24.83  ? 186 ALA A N   1 
ATOM   912  C CA  . ALA A 1 186 ? 66.601 32.404 101.625 1.00 25.83  ? 186 ALA A CA  1 
ATOM   913  C C   . ALA A 1 186 ? 67.504 33.246 100.762 1.00 26.35  ? 186 ALA A C   1 
ATOM   914  O O   . ALA A 1 186 ? 68.519 32.779 100.263 1.00 26.50  ? 186 ALA A O   1 
ATOM   915  C CB  . ALA A 1 186 ? 66.575 32.970 103.031 1.00 25.03  ? 186 ALA A CB  1 
ATOM   916  N N   . GLY A 1 187 ? 67.102 34.499 100.589 1.00 27.40  ? 187 GLY A N   1 
ATOM   917  C CA  . GLY A 1 187 ? 67.894 35.447 99.836  1.00 28.02  ? 187 GLY A CA  1 
ATOM   918  C C   . GLY A 1 187 ? 68.764 36.150 100.865 1.00 28.35  ? 187 GLY A C   1 
ATOM   919  O O   . GLY A 1 187 ? 68.648 35.862 102.056 1.00 27.78  ? 187 GLY A O   1 
ATOM   920  N N   . PRO A 1 188 ? 69.645 37.074 100.457 1.00 28.83  ? 188 PRO A N   1 
ATOM   921  C CA  . PRO A 1 188 ? 70.486 37.752 101.454 1.00 27.26  ? 188 PRO A CA  1 
ATOM   922  C C   . PRO A 1 188 ? 69.624 38.509 102.466 1.00 26.66  ? 188 PRO A C   1 
ATOM   923  O O   . PRO A 1 188 ? 68.850 39.408 102.101 1.00 26.36  ? 188 PRO A O   1 
ATOM   924  C CB  . PRO A 1 188 ? 71.357 38.667 100.598 1.00 26.16  ? 188 PRO A CB  1 
ATOM   925  C CG  . PRO A 1 188 ? 70.453 38.990 99.439  1.00 27.16  ? 188 PRO A CG  1 
ATOM   926  C CD  . PRO A 1 188 ? 69.818 37.665 99.117  1.00 27.59  ? 188 PRO A CD  1 
ATOM   927  N N   . LEU A 1 189 ? 69.758 38.144 103.738 1.00 24.43  ? 189 LEU A N   1 
ATOM   928  C CA  . LEU A 1 189 ? 68.956 38.762 104.786 1.00 23.88  ? 189 LEU A CA  1 
ATOM   929  C C   . LEU A 1 189 ? 69.120 40.265 104.978 1.00 23.75  ? 189 LEU A C   1 
ATOM   930  O O   . LEU A 1 189 ? 68.394 40.880 105.755 1.00 23.93  ? 189 LEU A O   1 
ATOM   931  C CB  . LEU A 1 189 ? 69.163 38.021 106.107 1.00 21.78  ? 189 LEU A CB  1 
ATOM   932  C CG  . LEU A 1 189 ? 68.622 36.591 106.059 1.00 19.30  ? 189 LEU A CG  1 
ATOM   933  C CD1 . LEU A 1 189 ? 68.768 35.958 107.418 1.00 20.15  ? 189 LEU A CD1 1 
ATOM   934  C CD2 . LEU A 1 189 ? 67.161 36.601 105.640 1.00 18.01  ? 189 LEU A CD2 1 
ATOM   935  N N   . SER A 1 190 ? 70.063 40.864 104.268 1.00 24.66  ? 190 SER A N   1 
ATOM   936  C CA  . SER A 1 190 ? 70.235 42.305 104.359 1.00 25.47  ? 190 SER A CA  1 
ATOM   937  C C   . SER A 1 190 ? 69.118 42.938 103.532 1.00 27.27  ? 190 SER A C   1 
ATOM   938  O O   . SER A 1 190 ? 68.848 44.132 103.628 1.00 28.19  ? 190 SER A O   1 
ATOM   939  C CB  . SER A 1 190 ? 71.594 42.706 103.804 1.00 25.13  ? 190 SER A CB  1 
ATOM   940  O OG  . SER A 1 190 ? 71.862 42.035 102.591 1.00 24.62  ? 190 SER A OG  1 
ATOM   941  N N   . SER A 1 191 ? 68.465 42.110 102.724 1.00 28.70  ? 191 SER A N   1 
ATOM   942  C CA  . SER A 1 191 ? 67.374 42.557 101.874 1.00 30.17  ? 191 SER A CA  1 
ATOM   943  C C   . SER A 1 191 ? 66.020 42.438 102.557 1.00 32.12  ? 191 SER A C   1 
ATOM   944  O O   . SER A 1 191 ? 65.598 41.342 102.933 1.00 33.33  ? 191 SER A O   1 
ATOM   945  C CB  . SER A 1 191 ? 67.340 41.736 100.591 1.00 30.44  ? 191 SER A CB  1 
ATOM   946  O OG  . SER A 1 191 ? 66.126 41.943 99.884  1.00 30.14  ? 191 SER A OG  1 
ATOM   947  N N   . VAL A 1 192 ? 65.331 43.563 102.708 1.00 33.03  ? 192 VAL A N   1 
ATOM   948  C CA  . VAL A 1 192 ? 64.013 43.547 103.327 1.00 33.12  ? 192 VAL A CA  1 
ATOM   949  C C   . VAL A 1 192 ? 63.140 42.511 102.608 1.00 34.49  ? 192 VAL A C   1 
ATOM   950  O O   . VAL A 1 192 ? 62.353 41.803 103.244 1.00 35.91  ? 192 VAL A O   1 
ATOM   951  C CB  . VAL A 1 192 ? 63.352 44.943 103.257 1.00 31.08  ? 192 VAL A CB  1 
ATOM   952  C CG1 . VAL A 1 192 ? 63.233 45.389 101.821 1.00 31.31  ? 192 VAL A CG1 1 
ATOM   953  C CG2 . VAL A 1 192 ? 61.995 44.909 103.919 1.00 29.68  ? 192 VAL A CG2 1 
ATOM   954  N N   . SER A 1 193 ? 63.290 42.410 101.287 1.00 34.42  ? 193 SER A N   1 
ATOM   955  C CA  . SER A 1 193 ? 62.522 41.440 100.504 1.00 34.09  ? 193 SER A CA  1 
ATOM   956  C C   . SER A 1 193 ? 62.829 40.030 100.986 1.00 32.13  ? 193 SER A C   1 
ATOM   957  O O   . SER A 1 193 ? 61.928 39.273 101.346 1.00 30.74  ? 193 SER A O   1 
ATOM   958  C CB  . SER A 1 193 ? 62.877 41.531 99.014  1.00 37.45  ? 193 SER A CB  1 
ATOM   959  O OG  . SER A 1 193 ? 62.123 42.520 98.331  1.00 42.01  ? 193 SER A OG  1 
ATOM   960  N N   . ALA A 1 194 ? 64.114 39.686 100.985 1.00 30.45  ? 194 ALA A N   1 
ATOM   961  C CA  . ALA A 1 194 ? 64.551 38.365 101.413 1.00 29.57  ? 194 ALA A CA  1 
ATOM   962  C C   . ALA A 1 194 ? 63.973 38.045 102.784 1.00 29.56  ? 194 ALA A C   1 
ATOM   963  O O   . ALA A 1 194 ? 63.492 36.932 103.017 1.00 29.52  ? 194 ALA A O   1 
ATOM   964  C CB  . ALA A 1 194 ? 66.079 38.301 101.450 1.00 28.37  ? 194 ALA A CB  1 
ATOM   965  N N   . ARG A 1 195 ? 64.010 39.031 103.681 1.00 28.68  ? 195 ARG A N   1 
ATOM   966  C CA  . ARG A 1 195 ? 63.493 38.860 105.035 1.00 26.64  ? 195 ARG A CA  1 
ATOM   967  C C   . ARG A 1 195 ? 62.000 38.570 105.091 1.00 25.47  ? 195 ARG A C   1 
ATOM   968  O O   . ARG A 1 195 ? 61.594 37.529 105.602 1.00 25.10  ? 195 ARG A O   1 
ATOM   969  C CB  . ARG A 1 195 ? 63.800 40.088 105.889 1.00 25.59  ? 195 ARG A CB  1 
ATOM   970  C CG  . ARG A 1 195 ? 65.259 40.214 106.278 1.00 26.15  ? 195 ARG A CG  1 
ATOM   971  C CD  . ARG A 1 195 ? 65.414 41.095 107.505 1.00 25.41  ? 195 ARG A CD  1 
ATOM   972  N NE  . ARG A 1 195 ? 64.886 42.442 107.284 1.00 27.16  ? 195 ARG A NE  1 
ATOM   973  C CZ  . ARG A 1 195 ? 65.525 43.404 106.624 1.00 25.57  ? 195 ARG A CZ  1 
ATOM   974  N NH1 . ARG A 1 195 ? 64.954 44.595 106.475 1.00 23.62  ? 195 ARG A NH1 1 
ATOM   975  N NH2 . ARG A 1 195 ? 66.736 43.177 106.125 1.00 23.55  ? 195 ARG A NH2 1 
ATOM   976  N N   . LEU A 1 196 ? 61.184 39.482 104.568 1.00 24.40  ? 196 LEU A N   1 
ATOM   977  C CA  . LEU A 1 196 ? 59.734 39.293 104.581 1.00 24.06  ? 196 LEU A CA  1 
ATOM   978  C C   . LEU A 1 196 ? 59.409 37.906 104.078 1.00 25.37  ? 196 LEU A C   1 
ATOM   979  O O   . LEU A 1 196 ? 58.492 37.243 104.571 1.00 24.98  ? 196 LEU A O   1 
ATOM   980  C CB  . LEU A 1 196 ? 59.054 40.320 103.688 1.00 21.76  ? 196 LEU A CB  1 
ATOM   981  C CG  . LEU A 1 196 ? 59.187 41.742 104.211 1.00 21.27  ? 196 LEU A CG  1 
ATOM   982  C CD1 . LEU A 1 196 ? 58.811 42.743 103.144 1.00 23.18  ? 196 LEU A CD1 1 
ATOM   983  C CD2 . LEU A 1 196 ? 58.314 41.887 105.419 1.00 19.12  ? 196 LEU A CD2 1 
ATOM   984  N N   . ARG A 1 197 ? 60.198 37.473 103.102 1.00 26.96  ? 197 ARG A N   1 
ATOM   985  C CA  . ARG A 1 197 ? 60.029 36.173 102.473 1.00 29.07  ? 197 ARG A CA  1 
ATOM   986  C C   . ARG A 1 197 ? 60.422 35.007 103.390 1.00 29.69  ? 197 ARG A C   1 
ATOM   987  O O   . ARG A 1 197 ? 59.708 34.006 103.462 1.00 30.73  ? 197 ARG A O   1 
ATOM   988  C CB  . ARG A 1 197 ? 60.835 36.143 101.173 1.00 29.70  ? 197 ARG A CB  1 
ATOM   989  C CG  . ARG A 1 197 ? 60.288 35.197 100.126 1.00 31.60  ? 197 ARG A CG  1 
ATOM   990  C CD  . ARG A 1 197 ? 60.882 35.496 98.753  1.00 31.14  ? 197 ARG A CD  1 
ATOM   991  N NE  . ARG A 1 197 ? 60.451 36.787 98.222  1.00 28.75  ? 197 ARG A NE  1 
ATOM   992  C CZ  . ARG A 1 197 ? 61.030 37.387 97.187  1.00 29.20  ? 197 ARG A CZ  1 
ATOM   993  N NH1 . ARG A 1 197 ? 62.057 36.814 96.582  1.00 31.06  ? 197 ARG A NH1 1 
ATOM   994  N NH2 . ARG A 1 197 ? 60.588 38.556 96.749  1.00 29.40  ? 197 ARG A NH2 1 
ATOM   995  N N   . LEU A 1 198 ? 61.543 35.130 104.095 1.00 28.26  ? 198 LEU A N   1 
ATOM   996  C CA  . LEU A 1 198 ? 61.968 34.060 104.991 1.00 27.62  ? 198 LEU A CA  1 
ATOM   997  C C   . LEU A 1 198 ? 60.999 33.924 106.166 1.00 27.50  ? 198 LEU A C   1 
ATOM   998  O O   . LEU A 1 198 ? 60.564 32.820 106.496 1.00 27.08  ? 198 LEU A O   1 
ATOM   999  C CB  . LEU A 1 198 ? 63.390 34.322 105.505 1.00 26.58  ? 198 LEU A CB  1 
ATOM   1000 C CG  . LEU A 1 198 ? 63.951 33.388 106.582 1.00 25.46  ? 198 LEU A CG  1 
ATOM   1001 C CD1 . LEU A 1 198 ? 63.985 31.966 106.079 1.00 23.49  ? 198 LEU A CD1 1 
ATOM   1002 C CD2 . LEU A 1 198 ? 65.341 33.842 106.970 1.00 25.62  ? 198 LEU A CD2 1 
ATOM   1003 N N   . ALA A 1 199 ? 60.654 35.044 106.794 1.00 26.79  ? 199 ALA A N   1 
ATOM   1004 C CA  . ALA A 1 199 ? 59.737 35.009 107.927 1.00 26.94  ? 199 ALA A CA  1 
ATOM   1005 C C   . ALA A 1 199 ? 58.390 34.458 107.475 1.00 27.66  ? 199 ALA A C   1 
ATOM   1006 O O   . ALA A 1 199 ? 57.690 33.786 108.239 1.00 27.90  ? 199 ALA A O   1 
ATOM   1007 C CB  . ALA A 1 199 ? 59.570 36.403 108.520 1.00 24.24  ? 199 ALA A CB  1 
ATOM   1008 N N   . GLY A 1 200 ? 58.035 34.742 106.224 1.00 27.99  ? 200 GLY A N   1 
ATOM   1009 C CA  . GLY A 1 200 ? 56.779 34.256 105.689 1.00 27.42  ? 200 GLY A CA  1 
ATOM   1010 C C   . GLY A 1 200 ? 56.749 32.740 105.646 1.00 27.61  ? 200 GLY A C   1 
ATOM   1011 O O   . GLY A 1 200 ? 55.767 32.114 106.061 1.00 26.49  ? 200 GLY A O   1 
ATOM   1012 N N   . TRP A 1 201 ? 57.827 32.142 105.146 1.00 27.03  ? 201 TRP A N   1 
ATOM   1013 C CA  . TRP A 1 201 ? 57.891 30.695 105.064 1.00 28.62  ? 201 TRP A CA  1 
ATOM   1014 C C   . TRP A 1 201 ? 57.684 30.094 106.433 1.00 29.60  ? 201 TRP A C   1 
ATOM   1015 O O   . TRP A 1 201 ? 56.814 29.244 106.617 1.00 31.53  ? 201 TRP A O   1 
ATOM   1016 C CB  . TRP A 1 201 ? 59.235 30.220 104.500 1.00 29.27  ? 201 TRP A CB  1 
ATOM   1017 C CG  . TRP A 1 201 ? 59.355 30.356 102.998 1.00 29.60  ? 201 TRP A CG  1 
ATOM   1018 C CD1 . TRP A 1 201 ? 58.356 30.212 102.077 1.00 27.59  ? 201 TRP A CD1 1 
ATOM   1019 C CD2 . TRP A 1 201 ? 60.545 30.647 102.254 1.00 28.94  ? 201 TRP A CD2 1 
ATOM   1020 N NE1 . TRP A 1 201 ? 58.848 30.399 100.813 1.00 27.88  ? 201 TRP A NE1 1 
ATOM   1021 C CE2 . TRP A 1 201 ? 60.189 30.665 100.890 1.00 27.53  ? 201 TRP A CE2 1 
ATOM   1022 C CE3 . TRP A 1 201 ? 61.878 30.893 102.609 1.00 29.66  ? 201 TRP A CE3 1 
ATOM   1023 C CZ2 . TRP A 1 201 ? 61.113 30.920 99.878  1.00 27.64  ? 201 TRP A CZ2 1 
ATOM   1024 C CZ3 . TRP A 1 201 ? 62.800 31.148 101.599 1.00 30.51  ? 201 TRP A CZ3 1 
ATOM   1025 C CH2 . TRP A 1 201 ? 62.409 31.158 100.248 1.00 29.21  ? 201 TRP A CH2 1 
ATOM   1026 N N   . HIS A 1 202 ? 58.477 30.542 107.398 1.00 29.49  ? 202 HIS A N   1 
ATOM   1027 C CA  . HIS A 1 202 ? 58.363 30.033 108.750 1.00 29.07  ? 202 HIS A CA  1 
ATOM   1028 C C   . HIS A 1 202 ? 56.934 30.162 109.265 1.00 29.03  ? 202 HIS A C   1 
ATOM   1029 O O   . HIS A 1 202 ? 56.395 29.214 109.834 1.00 30.14  ? 202 HIS A O   1 
ATOM   1030 C CB  . HIS A 1 202 ? 59.341 30.760 109.670 1.00 30.00  ? 202 HIS A CB  1 
ATOM   1031 C CG  . HIS A 1 202 ? 60.760 30.311 109.510 1.00 32.21  ? 202 HIS A CG  1 
ATOM   1032 N ND1 . HIS A 1 202 ? 61.182 29.047 109.861 1.00 33.72  ? 202 HIS A ND1 1 
ATOM   1033 C CD2 . HIS A 1 202 ? 61.845 30.940 108.996 1.00 33.42  ? 202 HIS A CD2 1 
ATOM   1034 C CE1 . HIS A 1 202 ? 62.465 28.914 109.569 1.00 33.61  ? 202 HIS A CE1 1 
ATOM   1035 N NE2 . HIS A 1 202 ? 62.892 30.048 109.042 1.00 33.07  ? 202 HIS A NE2 1 
ATOM   1036 N N   . LYS A 1 203 ? 56.303 31.311 109.049 1.00 27.68  ? 203 LYS A N   1 
ATOM   1037 C CA  . LYS A 1 203 ? 54.936 31.490 109.524 1.00 28.32  ? 203 LYS A CA  1 
ATOM   1038 C C   . LYS A 1 203 ? 53.977 30.399 109.066 1.00 29.81  ? 203 LYS A C   1 
ATOM   1039 O O   . LYS A 1 203 ? 53.286 29.785 109.881 1.00 31.06  ? 203 LYS A O   1 
ATOM   1040 C CB  . LYS A 1 203 ? 54.371 32.834 109.082 1.00 26.41  ? 203 LYS A CB  1 
ATOM   1041 C CG  . LYS A 1 203 ? 52.905 33.021 109.439 1.00 23.15  ? 203 LYS A CG  1 
ATOM   1042 C CD  . LYS A 1 203 ? 52.431 34.375 108.976 1.00 25.83  ? 203 LYS A CD  1 
ATOM   1043 C CE  . LYS A 1 203 ? 50.928 34.516 109.099 1.00 28.66  ? 203 LYS A CE  1 
ATOM   1044 N NZ  . LYS A 1 203 ? 50.474 35.892 108.715 1.00 29.60  ? 203 LYS A NZ  1 
ATOM   1045 N N   . TYR A 1 204 ? 53.924 30.152 107.763 1.00 29.84  ? 204 TYR A N   1 
ATOM   1046 C CA  . TYR A 1 204 ? 53.008 29.147 107.255 1.00 29.11  ? 204 TYR A CA  1 
ATOM   1047 C C   . TYR A 1 204 ? 53.441 27.726 107.513 1.00 28.75  ? 204 TYR A C   1 
ATOM   1048 O O   . TYR A 1 204 ? 52.609 26.833 107.617 1.00 28.05  ? 204 TYR A O   1 
ATOM   1049 C CB  . TYR A 1 204 ? 52.746 29.410 105.780 1.00 28.91  ? 204 TYR A CB  1 
ATOM   1050 C CG  . TYR A 1 204 ? 52.047 30.729 105.636 1.00 29.41  ? 204 TYR A CG  1 
ATOM   1051 C CD1 . TYR A 1 204 ? 50.697 30.856 105.970 1.00 28.41  ? 204 TYR A CD1 1 
ATOM   1052 C CD2 . TYR A 1 204 ? 52.763 31.886 105.331 1.00 30.31  ? 204 TYR A CD2 1 
ATOM   1053 C CE1 . TYR A 1 204 ? 50.080 32.095 106.022 1.00 26.90  ? 204 TYR A CE1 1 
ATOM   1054 C CE2 . TYR A 1 204 ? 52.151 33.136 105.377 1.00 30.41  ? 204 TYR A CE2 1 
ATOM   1055 C CZ  . TYR A 1 204 ? 50.812 33.226 105.729 1.00 28.62  ? 204 TYR A CZ  1 
ATOM   1056 O OH  . TYR A 1 204 ? 50.217 34.453 105.820 1.00 30.41  ? 204 TYR A OH  1 
ATOM   1057 N N   . LEU A 1 205 ? 54.740 27.504 107.633 1.00 28.51  ? 205 LEU A N   1 
ATOM   1058 C CA  . LEU A 1 205 ? 55.200 26.165 107.930 1.00 29.58  ? 205 LEU A CA  1 
ATOM   1059 C C   . LEU A 1 205 ? 54.771 25.857 109.364 1.00 30.86  ? 205 LEU A C   1 
ATOM   1060 O O   . LEU A 1 205 ? 54.383 24.729 109.682 1.00 31.36  ? 205 LEU A O   1 
ATOM   1061 C CB  . LEU A 1 205 ? 56.717 26.072 107.785 1.00 29.20  ? 205 LEU A CB  1 
ATOM   1062 C CG  . LEU A 1 205 ? 57.209 25.867 106.353 1.00 29.20  ? 205 LEU A CG  1 
ATOM   1063 C CD1 . LEU A 1 205 ? 58.720 25.750 106.360 1.00 28.06  ? 205 LEU A CD1 1 
ATOM   1064 C CD2 . LEU A 1 205 ? 56.578 24.602 105.758 1.00 28.42  ? 205 LEU A CD2 1 
ATOM   1065 N N   . THR A 1 206 ? 54.832 26.867 110.226 1.00 30.89  ? 206 THR A N   1 
ATOM   1066 C CA  . THR A 1 206 ? 54.423 26.697 111.615 1.00 30.94  ? 206 THR A CA  1 
ATOM   1067 C C   . THR A 1 206 ? 52.918 26.412 111.670 1.00 30.13  ? 206 THR A C   1 
ATOM   1068 O O   . THR A 1 206 ? 52.476 25.500 112.366 1.00 29.33  ? 206 THR A O   1 
ATOM   1069 C CB  . THR A 1 206 ? 54.752 27.959 112.466 1.00 31.14  ? 206 THR A CB  1 
ATOM   1070 O OG1 . THR A 1 206 ? 56.172 28.068 112.638 1.00 32.42  ? 206 THR A OG1 1 
ATOM   1071 C CG2 . THR A 1 206 ? 54.114 27.869 113.840 1.00 31.78  ? 206 THR A CG2 1 
ATOM   1072 N N   . ARG A 1 207 ? 52.130 27.184 110.934 1.00 30.43  ? 207 ARG A N   1 
ATOM   1073 C CA  . ARG A 1 207 ? 50.687 26.963 110.925 1.00 31.41  ? 207 ARG A CA  1 
ATOM   1074 C C   . ARG A 1 207 ? 50.380 25.544 110.472 1.00 30.36  ? 207 ARG A C   1 
ATOM   1075 O O   . ARG A 1 207 ? 49.404 24.941 110.904 1.00 30.67  ? 207 ARG A O   1 
ATOM   1076 C CB  . ARG A 1 207 ? 49.980 27.940 109.989 1.00 33.02  ? 207 ARG A CB  1 
ATOM   1077 C CG  . ARG A 1 207 ? 49.923 29.359 110.466 1.00 36.41  ? 207 ARG A CG  1 
ATOM   1078 C CD  . ARG A 1 207 ? 48.855 30.072 109.696 1.00 41.47  ? 207 ARG A CD  1 
ATOM   1079 N NE  . ARG A 1 207 ? 48.801 31.492 110.011 1.00 48.89  ? 207 ARG A NE  1 
ATOM   1080 C CZ  . ARG A 1 207 ? 47.951 32.340 109.437 1.00 52.93  ? 207 ARG A CZ  1 
ATOM   1081 N NH1 . ARG A 1 207 ? 47.087 31.898 108.525 1.00 54.67  ? 207 ARG A NH1 1 
ATOM   1082 N NH2 . ARG A 1 207 ? 47.974 33.629 109.758 1.00 53.86  ? 207 ARG A NH2 1 
ATOM   1083 N N   . ASN A 1 208 ? 51.210 25.012 109.588 1.00 29.29  ? 208 ASN A N   1 
ATOM   1084 C CA  . ASN A 1 208 ? 51.003 23.659 109.117 1.00 28.76  ? 208 ASN A CA  1 
ATOM   1085 C C   . ASN A 1 208 ? 51.773 22.674 109.972 1.00 28.52  ? 208 ASN A C   1 
ATOM   1086 O O   . ASN A 1 208 ? 51.975 21.526 109.593 1.00 28.20  ? 208 ASN A O   1 
ATOM   1087 C CB  . ASN A 1 208 ? 51.417 23.544 107.660 1.00 29.09  ? 208 ASN A CB  1 
ATOM   1088 C CG  . ASN A 1 208 ? 50.286 23.880 106.724 1.00 29.72  ? 208 ASN A CG  1 
ATOM   1089 O OD1 . ASN A 1 208 ? 49.382 23.071 106.515 1.00 30.01  ? 208 ASN A OD1 1 
ATOM   1090 N ND2 . ASN A 1 208 ? 50.312 25.085 106.167 1.00 30.31  ? 208 ASN A ND2 1 
ATOM   1091 N N   . GLN A 1 209 ? 52.203 23.146 111.133 1.00 28.41  ? 209 GLN A N   1 
ATOM   1092 C CA  . GLN A 1 209 ? 52.941 22.327 112.080 1.00 29.51  ? 209 GLN A CA  1 
ATOM   1093 C C   . GLN A 1 209 ? 54.124 21.572 111.491 1.00 29.68  ? 209 GLN A C   1 
ATOM   1094 O O   . GLN A 1 209 ? 54.232 20.359 111.654 1.00 30.77  ? 209 GLN A O   1 
ATOM   1095 C CB  . GLN A 1 209 ? 51.984 21.346 112.739 1.00 28.38  ? 209 GLN A CB  1 
ATOM   1096 C CG  . GLN A 1 209 ? 50.690 22.013 113.118 1.00 30.67  ? 209 GLN A CG  1 
ATOM   1097 C CD  . GLN A 1 209 ? 49.874 21.198 114.080 1.00 30.46  ? 209 GLN A CD  1 
ATOM   1098 O OE1 . GLN A 1 209 ? 48.769 21.589 114.448 1.00 30.89  ? 209 GLN A OE1 1 
ATOM   1099 N NE2 . GLN A 1 209 ? 50.411 20.059 114.502 1.00 30.18  ? 209 GLN A NE2 1 
ATOM   1100 N N   . ILE A 1 210 ? 55.016 22.290 110.819 1.00 28.34  ? 210 ILE A N   1 
ATOM   1101 C CA  . ILE A 1 210 ? 56.188 21.663 110.234 1.00 28.48  ? 210 ILE A CA  1 
ATOM   1102 C C   . ILE A 1 210 ? 57.409 22.549 110.439 1.00 28.85  ? 210 ILE A C   1 
ATOM   1103 O O   . ILE A 1 210 ? 57.357 23.743 110.171 1.00 31.16  ? 210 ILE A O   1 
ATOM   1104 C CB  . ILE A 1 210 ? 56.009 21.444 108.714 1.00 29.01  ? 210 ILE A CB  1 
ATOM   1105 C CG1 . ILE A 1 210 ? 54.817 20.530 108.441 1.00 30.43  ? 210 ILE A CG1 1 
ATOM   1106 C CG2 . ILE A 1 210 ? 57.257 20.811 108.120 1.00 28.72  ? 210 ILE A CG2 1 
ATOM   1107 C CD1 . ILE A 1 210 ? 54.565 20.298 106.958 1.00 29.56  ? 210 ILE A CD1 1 
ATOM   1108 N N   . GLN A 1 211 ? 58.502 21.989 110.937 1.00 27.72  ? 211 GLN A N   1 
ATOM   1109 C CA  . GLN A 1 211 ? 59.704 22.791 111.089 1.00 28.16  ? 211 GLN A CA  1 
ATOM   1110 C C   . GLN A 1 211 ? 60.628 22.335 109.963 1.00 28.72  ? 211 GLN A C   1 
ATOM   1111 O O   . GLN A 1 211 ? 60.841 21.135 109.770 1.00 28.22  ? 211 GLN A O   1 
ATOM   1112 C CB  . GLN A 1 211 ? 60.376 22.545 112.432 1.00 29.56  ? 211 GLN A CB  1 
ATOM   1113 C CG  . GLN A 1 211 ? 59.703 23.179 113.638 1.00 30.98  ? 211 GLN A CG  1 
ATOM   1114 C CD  . GLN A 1 211 ? 60.376 22.746 114.939 1.00 31.85  ? 211 GLN A CD  1 
ATOM   1115 O OE1 . GLN A 1 211 ? 60.401 21.559 115.265 1.00 32.61  ? 211 GLN A OE1 1 
ATOM   1116 N NE2 . GLN A 1 211 ? 60.933 23.703 115.675 1.00 28.90  ? 211 GLN A NE2 1 
ATOM   1117 N N   . PRO A 1 212 ? 61.179 23.285 109.192 1.00 27.88  ? 212 PRO A N   1 
ATOM   1118 C CA  . PRO A 1 212 ? 62.071 22.904 108.096 1.00 26.83  ? 212 PRO A CA  1 
ATOM   1119 C C   . PRO A 1 212 ? 63.232 22.092 108.635 1.00 26.70  ? 212 PRO A C   1 
ATOM   1120 O O   . PRO A 1 212 ? 63.690 22.339 109.740 1.00 28.81  ? 212 PRO A O   1 
ATOM   1121 C CB  . PRO A 1 212 ? 62.505 24.252 107.527 1.00 27.09  ? 212 PRO A CB  1 
ATOM   1122 C CG  . PRO A 1 212 ? 62.498 25.137 108.727 1.00 28.34  ? 212 PRO A CG  1 
ATOM   1123 C CD  . PRO A 1 212 ? 61.213 24.739 109.418 1.00 27.61  ? 212 PRO A CD  1 
ATOM   1124 N N   . ILE A 1 213 ? 63.713 21.121 107.870 1.00 26.46  ? 213 ILE A N   1 
ATOM   1125 C CA  . ILE A 1 213 ? 64.819 20.318 108.348 1.00 26.75  ? 213 ILE A CA  1 
ATOM   1126 C C   . ILE A 1 213 ? 66.150 21.009 108.136 1.00 27.70  ? 213 ILE A C   1 
ATOM   1127 O O   . ILE A 1 213 ? 67.193 20.420 108.379 1.00 29.01  ? 213 ILE A O   1 
ATOM   1128 C CB  . ILE A 1 213 ? 64.876 18.952 107.664 1.00 25.90  ? 213 ILE A CB  1 
ATOM   1129 C CG1 . ILE A 1 213 ? 65.362 19.103 106.233 1.00 25.22  ? 213 ILE A CG1 1 
ATOM   1130 C CG2 . ILE A 1 213 ? 63.511 18.313 107.695 1.00 26.76  ? 213 ILE A CG2 1 
ATOM   1131 C CD1 . ILE A 1 213 ? 65.564 17.791 105.550 1.00 26.56  ? 213 ILE A CD1 1 
ATOM   1132 N N   . ALA A 1 214 ? 66.110 22.257 107.687 1.00 28.71  ? 214 ALA A N   1 
ATOM   1133 C CA  . ALA A 1 214 ? 67.327 23.030 107.444 1.00 29.54  ? 214 ALA A CA  1 
ATOM   1134 C C   . ALA A 1 214 ? 66.976 24.294 106.691 1.00 29.69  ? 214 ALA A C   1 
ATOM   1135 O O   . ALA A 1 214 ? 66.055 24.297 105.874 1.00 31.97  ? 214 ALA A O   1 
ATOM   1136 C CB  . ALA A 1 214 ? 68.335 22.212 106.624 1.00 27.20  ? 214 ALA A CB  1 
ATOM   1137 N N   . GLU A 1 215 ? 67.697 25.372 106.968 1.00 28.89  ? 215 GLU A N   1 
ATOM   1138 C CA  . GLU A 1 215 ? 67.452 26.615 106.260 1.00 29.49  ? 215 GLU A CA  1 
ATOM   1139 C C   . GLU A 1 215 ? 68.774 27.326 105.983 1.00 30.31  ? 215 GLU A C   1 
ATOM   1140 O O   . GLU A 1 215 ? 69.683 27.306 106.806 1.00 30.48  ? 215 GLU A O   1 
ATOM   1141 C CB  . GLU A 1 215 ? 66.489 27.505 107.049 1.00 28.52  ? 215 GLU A CB  1 
ATOM   1142 C CG  . GLU A 1 215 ? 67.037 28.161 108.296 1.00 29.54  ? 215 GLU A CG  1 
ATOM   1143 C CD  . GLU A 1 215 ? 66.031 29.125 108.909 1.00 32.13  ? 215 GLU A CD  1 
ATOM   1144 O OE1 . GLU A 1 215 ? 65.395 28.776 109.933 1.00 31.84  ? 215 GLU A OE1 1 
ATOM   1145 O OE2 . GLU A 1 215 ? 65.864 30.232 108.346 1.00 33.63  ? 215 GLU A OE2 1 
ATOM   1146 N N   . ARG A 1 216 ? 68.892 27.931 104.806 1.00 31.51  ? 216 ARG A N   1 
ATOM   1147 C CA  . ARG A 1 216 ? 70.123 28.621 104.438 1.00 32.40  ? 216 ARG A CA  1 
ATOM   1148 C C   . ARG A 1 216 ? 69.931 29.986 103.808 1.00 31.62  ? 216 ARG A C   1 
ATOM   1149 O O   . ARG A 1 216 ? 68.809 30.413 103.524 1.00 32.69  ? 216 ARG A O   1 
ATOM   1150 C CB  . ARG A 1 216 ? 70.955 27.741 103.506 1.00 32.10  ? 216 ARG A CB  1 
ATOM   1151 C CG  . ARG A 1 216 ? 71.636 26.612 104.227 1.00 33.90  ? 216 ARG A CG  1 
ATOM   1152 C CD  . ARG A 1 216 ? 72.090 25.576 103.258 1.00 37.77  ? 216 ARG A CD  1 
ATOM   1153 N NE  . ARG A 1 216 ? 72.886 24.531 103.898 1.00 43.21  ? 216 ARG A NE  1 
ATOM   1154 C CZ  . ARG A 1 216 ? 74.168 24.657 104.233 1.00 44.31  ? 216 ARG A CZ  1 
ATOM   1155 N NH1 . ARG A 1 216 ? 74.816 25.794 103.998 1.00 43.41  ? 216 ARG A NH1 1 
ATOM   1156 N NH2 . ARG A 1 216 ? 74.812 23.629 104.774 1.00 44.83  ? 216 ARG A NH2 1 
ATOM   1157 N N   . GLU A 1 217 ? 71.047 30.665 103.584 1.00 30.38  ? 217 GLU A N   1 
ATOM   1158 C CA  . GLU A 1 217 ? 71.014 31.993 103.001 1.00 31.17  ? 217 GLU A CA  1 
ATOM   1159 C C   . GLU A 1 217 ? 71.943 32.138 101.797 1.00 31.63  ? 217 GLU A C   1 
ATOM   1160 O O   . GLU A 1 217 ? 73.121 31.776 101.851 1.00 31.97  ? 217 GLU A O   1 
ATOM   1161 C CB  . GLU A 1 217 ? 71.368 33.016 104.075 1.00 30.32  ? 217 GLU A CB  1 
ATOM   1162 C CG  . GLU A 1 217 ? 71.582 34.416 103.567 1.00 31.86  ? 217 GLU A CG  1 
ATOM   1163 C CD  . GLU A 1 217 ? 71.697 35.417 104.698 1.00 31.48  ? 217 GLU A CD  1 
ATOM   1164 O OE1 . GLU A 1 217 ? 72.103 35.009 105.808 1.00 31.36  ? 217 GLU A OE1 1 
ATOM   1165 O OE2 . GLU A 1 217 ? 71.390 36.606 104.470 1.00 31.43  ? 217 GLU A OE2 1 
ATOM   1166 N N   . GLY A 1 218 ? 71.390 32.657 100.708 1.00 30.81  ? 218 GLY A N   1 
ATOM   1167 C CA  . GLY A 1 218 ? 72.162 32.860 99.501  1.00 31.06  ? 218 GLY A CA  1 
ATOM   1168 C C   . GLY A 1 218 ? 72.235 34.347 99.224  1.00 31.04  ? 218 GLY A C   1 
ATOM   1169 O O   . GLY A 1 218 ? 72.090 35.147 100.149 1.00 30.47  ? 218 GLY A O   1 
ATOM   1170 N N   . ASP A 1 219 ? 72.456 34.726 97.966  1.00 30.69  ? 219 ASP A N   1 
ATOM   1171 C CA  . ASP A 1 219 ? 72.535 36.138 97.615  1.00 31.46  ? 219 ASP A CA  1 
ATOM   1172 C C   . ASP A 1 219 ? 71.827 36.487 96.304  1.00 33.13  ? 219 ASP A C   1 
ATOM   1173 O O   . ASP A 1 219 ? 72.218 37.439 95.623  1.00 33.67  ? 219 ASP A O   1 
ATOM   1174 C CB  . ASP A 1 219 ? 73.988 36.577 97.517  1.00 29.42  ? 219 ASP A CB  1 
ATOM   1175 C CG  . ASP A 1 219 ? 74.729 35.841 96.442  1.00 30.01  ? 219 ASP A CG  1 
ATOM   1176 O OD1 . ASP A 1 219 ? 74.057 35.285 95.548  1.00 30.94  ? 219 ASP A OD1 1 
ATOM   1177 O OD2 . ASP A 1 219 ? 75.974 35.822 96.479  1.00 30.66  ? 219 ASP A OD2 1 
ATOM   1178 N N   . TRP A 1 220 ? 70.798 35.721 95.950  1.00 32.69  ? 220 TRP A N   1 
ATOM   1179 C CA  . TRP A 1 220 ? 70.042 35.984 94.735  1.00 31.99  ? 220 TRP A CA  1 
ATOM   1180 C C   . TRP A 1 220 ? 70.697 35.371 93.505  1.00 32.77  ? 220 TRP A C   1 
ATOM   1181 O O   . TRP A 1 220 ? 70.039 35.148 92.490  1.00 33.20  ? 220 TRP A O   1 
ATOM   1182 C CB  . TRP A 1 220 ? 69.898 37.493 94.520  1.00 30.40  ? 220 TRP A CB  1 
ATOM   1183 C CG  . TRP A 1 220 ? 69.095 38.210 95.554  1.00 30.32  ? 220 TRP A CG  1 
ATOM   1184 C CD1 . TRP A 1 220 ? 69.384 39.420 96.119  1.00 31.17  ? 220 TRP A CD1 1 
ATOM   1185 C CD2 . TRP A 1 220 ? 67.820 37.819 96.078  1.00 30.81  ? 220 TRP A CD2 1 
ATOM   1186 N NE1 . TRP A 1 220 ? 68.366 39.813 96.959  1.00 31.51  ? 220 TRP A NE1 1 
ATOM   1187 C CE2 . TRP A 1 220 ? 67.393 38.849 96.952  1.00 30.85  ? 220 TRP A CE2 1 
ATOM   1188 C CE3 . TRP A 1 220 ? 66.994 36.703 95.892  1.00 30.71  ? 220 TRP A CE3 1 
ATOM   1189 C CZ2 . TRP A 1 220 ? 66.176 38.795 97.635  1.00 29.78  ? 220 TRP A CZ2 1 
ATOM   1190 C CZ3 . TRP A 1 220 ? 65.781 36.649 96.573  1.00 31.27  ? 220 TRP A CZ3 1 
ATOM   1191 C CH2 . TRP A 1 220 ? 65.386 37.692 97.435  1.00 30.70  ? 220 TRP A CH2 1 
ATOM   1192 N N   . SER A 1 221 ? 71.995 35.112 93.581  1.00 33.29  ? 221 SER A N   1 
ATOM   1193 C CA  . SER A 1 221 ? 72.699 34.528 92.445  1.00 33.77  ? 221 SER A CA  1 
ATOM   1194 C C   . SER A 1 221 ? 72.392 33.039 92.363  1.00 35.67  ? 221 SER A C   1 
ATOM   1195 O O   . SER A 1 221 ? 71.935 32.427 93.332  1.00 36.37  ? 221 SER A O   1 
ATOM   1196 C CB  . SER A 1 221 ? 74.203 34.698 92.604  1.00 32.98  ? 221 SER A CB  1 
ATOM   1197 O OG  . SER A 1 221 ? 74.724 33.676 93.440  1.00 31.15  ? 221 SER A OG  1 
ATOM   1198 N N   . ALA A 1 222 ? 72.656 32.450 91.206  1.00 36.61  ? 222 ALA A N   1 
ATOM   1199 C CA  . ALA A 1 222 ? 72.412 31.031 91.030  1.00 36.16  ? 222 ALA A CA  1 
ATOM   1200 C C   . ALA A 1 222 ? 73.591 30.280 91.634  1.00 37.01  ? 222 ALA A C   1 
ATOM   1201 O O   . ALA A 1 222 ? 73.439 29.178 92.158  1.00 36.78  ? 222 ALA A O   1 
ATOM   1202 C CB  . ALA A 1 222 ? 72.277 30.710 89.560  1.00 35.82  ? 222 ALA A CB  1 
ATOM   1203 N N   . MET A 1 223 ? 74.773 30.882 91.565  1.00 37.42  ? 223 MET A N   1 
ATOM   1204 C CA  . MET A 1 223 ? 75.943 30.231 92.121  1.00 38.02  ? 223 MET A CA  1 
ATOM   1205 C C   . MET A 1 223 ? 75.714 30.047 93.617  1.00 37.34  ? 223 MET A C   1 
ATOM   1206 O O   . MET A 1 223 ? 76.033 28.995 94.168  1.00 37.70  ? 223 MET A O   1 
ATOM   1207 C CB  . MET A 1 223 ? 77.207 31.062 91.863  1.00 39.81  ? 223 MET A CB  1 
ATOM   1208 C CG  . MET A 1 223 ? 78.533 30.342 92.154  1.00 43.25  ? 223 MET A CG  1 
ATOM   1209 S SD  . MET A 1 223 ? 78.775 28.733 91.270  1.00 53.21  ? 223 MET A SD  1 
ATOM   1210 C CE  . MET A 1 223 ? 79.187 29.242 89.594  1.00 48.20  ? 223 MET A CE  1 
ATOM   1211 N N   . SER A 1 224 ? 75.136 31.053 94.273  1.00 35.70  ? 224 SER A N   1 
ATOM   1212 C CA  . SER A 1 224 ? 74.897 30.940 95.708  1.00 34.18  ? 224 SER A CA  1 
ATOM   1213 C C   . SER A 1 224 ? 73.884 29.844 95.956  1.00 33.01  ? 224 SER A C   1 
ATOM   1214 O O   . SER A 1 224 ? 73.990 29.106 96.928  1.00 31.95  ? 224 SER A O   1 
ATOM   1215 C CB  . SER A 1 224 ? 74.395 32.258 96.307  1.00 33.67  ? 224 SER A CB  1 
ATOM   1216 O OG  . SER A 1 224 ? 73.060 32.528 95.938  1.00 35.89  ? 224 SER A OG  1 
ATOM   1217 N N   . GLY A 1 225 ? 72.901 29.735 95.068  1.00 33.42  ? 225 GLY A N   1 
ATOM   1218 C CA  . GLY A 1 225 ? 71.900 28.698 95.216  1.00 33.39  ? 225 GLY A CA  1 
ATOM   1219 C C   . GLY A 1 225 ? 72.562 27.340 95.066  1.00 34.18  ? 225 GLY A C   1 
ATOM   1220 O O   . GLY A 1 225 ? 72.196 26.372 95.736  1.00 34.30  ? 225 GLY A O   1 
ATOM   1221 N N   . PHE A 1 226 ? 73.556 27.277 94.185  1.00 34.09  ? 226 PHE A N   1 
ATOM   1222 C CA  . PHE A 1 226 ? 74.277 26.041 93.936  1.00 33.99  ? 226 PHE A CA  1 
ATOM   1223 C C   . PHE A 1 226 ? 75.162 25.638 95.098  1.00 33.92  ? 226 PHE A C   1 
ATOM   1224 O O   . PHE A 1 226 ? 75.202 24.476 95.481  1.00 32.74  ? 226 PHE A O   1 
ATOM   1225 C CB  . PHE A 1 226 ? 75.155 26.170 92.695  1.00 34.62  ? 226 PHE A CB  1 
ATOM   1226 C CG  . PHE A 1 226 ? 76.032 24.968 92.458  1.00 33.98  ? 226 PHE A CG  1 
ATOM   1227 C CD1 . PHE A 1 226 ? 75.477 23.754 92.047  1.00 32.97  ? 226 PHE A CD1 1 
ATOM   1228 C CD2 . PHE A 1 226 ? 77.402 25.035 92.684  1.00 31.67  ? 226 PHE A CD2 1 
ATOM   1229 C CE1 . PHE A 1 226 ? 76.276 22.628 91.867  1.00 31.36  ? 226 PHE A CE1 1 
ATOM   1230 C CE2 . PHE A 1 226 ? 78.199 23.916 92.506  1.00 29.99  ? 226 PHE A CE2 1 
ATOM   1231 C CZ  . PHE A 1 226 ? 77.635 22.711 92.097  1.00 29.27  ? 226 PHE A CZ  1 
ATOM   1232 N N   . GLN A 1 227 ? 75.896 26.596 95.640  1.00 35.53  ? 227 GLN A N   1 
ATOM   1233 C CA  . GLN A 1 227 ? 76.781 26.297 96.746  1.00 38.92  ? 227 GLN A CA  1 
ATOM   1234 C C   . GLN A 1 227 ? 76.015 25.937 98.003  1.00 39.40  ? 227 GLN A C   1 
ATOM   1235 O O   . GLN A 1 227 ? 76.358 24.973 98.690  1.00 40.50  ? 227 GLN A O   1 
ATOM   1236 C CB  . GLN A 1 227 ? 77.708 27.472 97.011  1.00 41.48  ? 227 GLN A CB  1 
ATOM   1237 C CG  . GLN A 1 227 ? 78.707 27.701 95.889  1.00 47.76  ? 227 GLN A CG  1 
ATOM   1238 C CD  . GLN A 1 227 ? 79.634 28.869 96.171  1.00 51.60  ? 227 GLN A CD  1 
ATOM   1239 O OE1 . GLN A 1 227 ? 79.178 29.990 96.445  1.00 52.82  ? 227 GLN A OE1 1 
ATOM   1240 N NE2 . GLN A 1 227 ? 80.942 28.618 96.107  1.00 52.25  ? 227 GLN A NE2 1 
ATOM   1241 N N   . GLN A 1 228 ? 74.972 26.697 98.310  1.00 39.05  ? 228 GLN A N   1 
ATOM   1242 C CA  . GLN A 1 228 ? 74.184 26.398 99.495  1.00 38.33  ? 228 GLN A CA  1 
ATOM   1243 C C   . GLN A 1 228 ? 73.585 25.002 99.397  1.00 38.31  ? 228 GLN A C   1 
ATOM   1244 O O   . GLN A 1 228 ? 73.806 24.164 100.271 1.00 38.17  ? 228 GLN A O   1 
ATOM   1245 C CB  . GLN A 1 228 ? 73.071 27.431 99.685  1.00 37.45  ? 228 GLN A CB  1 
ATOM   1246 C CG  . GLN A 1 228 ? 73.585 28.796 100.092 1.00 37.33  ? 228 GLN A CG  1 
ATOM   1247 C CD  . GLN A 1 228 ? 74.479 28.729 101.312 1.00 37.35  ? 228 GLN A CD  1 
ATOM   1248 O OE1 . GLN A 1 228 ? 74.013 28.495 102.425 1.00 39.80  ? 228 GLN A OE1 1 
ATOM   1249 N NE2 . GLN A 1 228 ? 75.774 28.922 101.107 1.00 36.70  ? 228 GLN A NE2 1 
ATOM   1250 N N   . THR A 1 229 ? 72.849 24.741 98.322  1.00 38.05  ? 229 THR A N   1 
ATOM   1251 C CA  . THR A 1 229 ? 72.212 23.442 98.165  1.00 39.04  ? 229 THR A CA  1 
ATOM   1252 C C   . THR A 1 229 ? 73.190 22.288 98.211  1.00 40.43  ? 229 THR A C   1 
ATOM   1253 O O   . THR A 1 229 ? 72.854 21.202 98.681  1.00 41.49  ? 229 THR A O   1 
ATOM   1254 C CB  . THR A 1 229 ? 71.424 23.355 96.858  1.00 37.98  ? 229 THR A CB  1 
ATOM   1255 O OG1 . THR A 1 229 ? 70.455 24.407 96.823  1.00 39.57  ? 229 THR A OG1 1 
ATOM   1256 C CG2 . THR A 1 229 ? 70.696 22.028 96.766  1.00 36.45  ? 229 THR A CG2 1 
ATOM   1257 N N   . MET A 1 230 ? 74.404 22.510 97.734  1.00 42.28  ? 230 MET A N   1 
ATOM   1258 C CA  . MET A 1 230 ? 75.369 21.431 97.744  1.00 44.42  ? 230 MET A CA  1 
ATOM   1259 C C   . MET A 1 230 ? 75.944 21.270 99.137  1.00 44.07  ? 230 MET A C   1 
ATOM   1260 O O   . MET A 1 230 ? 76.046 20.154 99.633  1.00 44.43  ? 230 MET A O   1 
ATOM   1261 C CB  . MET A 1 230 ? 76.474 21.673 96.719  1.00 48.30  ? 230 MET A CB  1 
ATOM   1262 C CG  . MET A 1 230 ? 77.145 20.390 96.254  1.00 52.06  ? 230 MET A CG  1 
ATOM   1263 S SD  . MET A 1 230 ? 78.574 20.698 95.207  1.00 60.12  ? 230 MET A SD  1 
ATOM   1264 C CE  . MET A 1 230 ? 79.765 21.376 96.434  1.00 55.41  ? 230 MET A CE  1 
ATOM   1265 N N   . GLN A 1 231 ? 76.314 22.372 99.782  1.00 44.38  ? 231 GLN A N   1 
ATOM   1266 C CA  . GLN A 1 231 ? 76.839 22.269 101.137 1.00 44.48  ? 231 GLN A CA  1 
ATOM   1267 C C   . GLN A 1 231 ? 75.829 21.443 101.915 1.00 43.60  ? 231 GLN A C   1 
ATOM   1268 O O   . GLN A 1 231 ? 76.183 20.477 102.584 1.00 43.61  ? 231 GLN A O   1 
ATOM   1269 C CB  . GLN A 1 231 ? 76.964 23.640 101.790 1.00 47.30  ? 231 GLN A CB  1 
ATOM   1270 C CG  . GLN A 1 231 ? 77.950 24.577 101.120 1.00 54.24  ? 231 GLN A CG  1 
ATOM   1271 C CD  . GLN A 1 231 ? 78.168 25.866 101.912 1.00 58.72  ? 231 GLN A CD  1 
ATOM   1272 O OE1 . GLN A 1 231 ? 78.861 26.786 101.457 1.00 59.44  ? 231 GLN A OE1 1 
ATOM   1273 N NE2 . GLN A 1 231 ? 77.578 25.934 103.108 1.00 61.67  ? 231 GLN A NE2 1 
ATOM   1274 N N   . MET A 1 232 ? 74.559 21.819 101.804 1.00 42.31  ? 232 MET A N   1 
ATOM   1275 C CA  . MET A 1 232 ? 73.497 21.102 102.498 1.00 41.89  ? 232 MET A CA  1 
ATOM   1276 C C   . MET A 1 232 ? 73.540 19.604 102.240 1.00 41.28  ? 232 MET A C   1 
ATOM   1277 O O   . MET A 1 232 ? 73.637 18.816 103.176 1.00 41.76  ? 232 MET A O   1 
ATOM   1278 C CB  . MET A 1 232 ? 72.113 21.625 102.094 1.00 40.66  ? 232 MET A CB  1 
ATOM   1279 C CG  . MET A 1 232 ? 70.969 20.846 102.740 1.00 38.72  ? 232 MET A CG  1 
ATOM   1280 S SD  . MET A 1 232 ? 69.323 21.444 102.326 1.00 37.71  ? 232 MET A SD  1 
ATOM   1281 C CE  . MET A 1 232 ? 69.152 20.800 100.655 1.00 38.93  ? 232 MET A CE  1 
ATOM   1282 N N   . LEU A 1 233 ? 73.455 19.211 100.975 1.00 40.58  ? 233 LEU A N   1 
ATOM   1283 C CA  . LEU A 1 233 ? 73.470 17.799 100.634 1.00 39.82  ? 233 LEU A CA  1 
ATOM   1284 C C   . LEU A 1 233 ? 74.740 17.111 101.130 1.00 40.94  ? 233 LEU A C   1 
ATOM   1285 O O   . LEU A 1 233 ? 74.707 15.944 101.528 1.00 41.89  ? 233 LEU A O   1 
ATOM   1286 C CB  . LEU A 1 233 ? 73.303 17.622 99.122  1.00 38.02  ? 233 LEU A CB  1 
ATOM   1287 C CG  . LEU A 1 233 ? 71.941 18.037 98.547  1.00 37.41  ? 233 LEU A CG  1 
ATOM   1288 C CD1 . LEU A 1 233 ? 71.933 17.840 97.041  1.00 34.37  ? 233 LEU A CD1 1 
ATOM   1289 C CD2 . LEU A 1 233 ? 70.830 17.216 99.196  1.00 35.64  ? 233 LEU A CD2 1 
ATOM   1290 N N   . ASN A 1 234 ? 75.856 17.833 101.129 1.00 40.94  ? 234 ASN A N   1 
ATOM   1291 C CA  . ASN A 1 234 ? 77.112 17.258 101.597 1.00 42.13  ? 234 ASN A CA  1 
ATOM   1292 C C   . ASN A 1 234 ? 77.056 16.954 103.095 1.00 41.98  ? 234 ASN A C   1 
ATOM   1293 O O   . ASN A 1 234 ? 77.660 15.992 103.568 1.00 41.57  ? 234 ASN A O   1 
ATOM   1294 C CB  . ASN A 1 234 ? 78.277 18.206 101.300 1.00 44.60  ? 234 ASN A CB  1 
ATOM   1295 C CG  . ASN A 1 234 ? 78.467 18.446 99.809  1.00 47.14  ? 234 ASN A CG  1 
ATOM   1296 O OD1 . ASN A 1 234 ? 78.169 17.575 98.989  1.00 47.48  ? 234 ASN A OD1 1 
ATOM   1297 N ND2 . ASN A 1 234 ? 78.979 19.625 99.454  1.00 48.51  ? 234 ASN A ND2 1 
ATOM   1298 N N   . GLU A 1 235 ? 76.331 17.785 103.837 1.00 42.69  ? 235 GLU A N   1 
ATOM   1299 C CA  . GLU A 1 235 ? 76.174 17.599 105.274 1.00 41.94  ? 235 GLU A CA  1 
ATOM   1300 C C   . GLU A 1 235 ? 75.301 16.405 105.554 1.00 40.60  ? 235 GLU A C   1 
ATOM   1301 O O   . GLU A 1 235 ? 75.176 15.992 106.695 1.00 42.48  ? 235 GLU A O   1 
ATOM   1302 C CB  . GLU A 1 235 ? 75.506 18.803 105.923 1.00 44.40  ? 235 GLU A CB  1 
ATOM   1303 C CG  . GLU A 1 235 ? 76.387 20.007 106.092 1.00 50.15  ? 235 GLU A CG  1 
ATOM   1304 C CD  . GLU A 1 235 ? 75.781 21.008 107.051 1.00 53.60  ? 235 GLU A CD  1 
ATOM   1305 O OE1 . GLU A 1 235 ? 76.450 22.021 107.353 1.00 56.05  ? 235 GLU A OE1 1 
ATOM   1306 O OE2 . GLU A 1 235 ? 74.635 20.778 107.503 1.00 54.11  ? 235 GLU A OE2 1 
ATOM   1307 N N   . GLY A 1 236 ? 74.674 15.864 104.521 1.00 38.71  ? 236 GLY A N   1 
ATOM   1308 C CA  . GLY A 1 236 ? 73.816 14.719 104.726 1.00 37.76  ? 236 GLY A CA  1 
ATOM   1309 C C   . GLY A 1 236 ? 72.353 15.083 104.874 1.00 37.56  ? 236 GLY A C   1 
ATOM   1310 O O   . GLY A 1 236 ? 71.506 14.200 104.983 1.00 38.26  ? 236 GLY A O   1 
ATOM   1311 N N   . ILE A 1 237 ? 72.044 16.377 104.892 1.00 36.87  ? 237 ILE A N   1 
ATOM   1312 C CA  . ILE A 1 237 ? 70.655 16.814 105.001 1.00 34.84  ? 237 ILE A CA  1 
ATOM   1313 C C   . ILE A 1 237 ? 69.993 16.659 103.634 1.00 34.60  ? 237 ILE A C   1 
ATOM   1314 O O   . ILE A 1 237 ? 70.402 17.294 102.666 1.00 35.66  ? 237 ILE A O   1 
ATOM   1315 C CB  . ILE A 1 237 ? 70.564 18.275 105.426 1.00 33.56  ? 237 ILE A CB  1 
ATOM   1316 C CG1 . ILE A 1 237 ? 71.300 18.470 106.748 1.00 31.36  ? 237 ILE A CG1 1 
ATOM   1317 C CG2 . ILE A 1 237 ? 69.101 18.679 105.569 1.00 34.52  ? 237 ILE A CG2 1 
ATOM   1318 C CD1 . ILE A 1 237 ? 71.206 19.873 107.278 1.00 32.65  ? 237 ILE A CD1 1 
ATOM   1319 N N   . VAL A 1 238 ? 68.968 15.819 103.556 1.00 32.56  ? 238 VAL A N   1 
ATOM   1320 C CA  . VAL A 1 238 ? 68.295 15.570 102.287 1.00 30.16  ? 238 VAL A CA  1 
ATOM   1321 C C   . VAL A 1 238 ? 66.786 15.730 102.385 1.00 29.63  ? 238 VAL A C   1 
ATOM   1322 O O   . VAL A 1 238 ? 66.086 14.825 102.822 1.00 31.26  ? 238 VAL A O   1 
ATOM   1323 C CB  . VAL A 1 238 ? 68.614 14.157 101.803 1.00 28.13  ? 238 VAL A CB  1 
ATOM   1324 C CG1 . VAL A 1 238 ? 67.973 13.909 100.457 1.00 27.51  ? 238 VAL A CG1 1 
ATOM   1325 C CG2 . VAL A 1 238 ? 70.118 13.978 101.740 1.00 26.74  ? 238 VAL A CG2 1 
ATOM   1326 N N   . PRO A 1 239 ? 66.263 16.885 101.963 1.00 28.32  ? 239 PRO A N   1 
ATOM   1327 C CA  . PRO A 1 239 ? 64.826 17.165 102.010 1.00 27.89  ? 239 PRO A CA  1 
ATOM   1328 C C   . PRO A 1 239 ? 64.090 16.548 100.841 1.00 26.81  ? 239 PRO A C   1 
ATOM   1329 O O   . PRO A 1 239 ? 64.723 16.054 99.917  1.00 27.61  ? 239 PRO A O   1 
ATOM   1330 C CB  . PRO A 1 239 ? 64.786 18.685 101.960 1.00 28.27  ? 239 PRO A CB  1 
ATOM   1331 C CG  . PRO A 1 239 ? 65.903 18.982 101.009 1.00 28.86  ? 239 PRO A CG  1 
ATOM   1332 C CD  . PRO A 1 239 ? 67.010 18.061 101.484 1.00 28.04  ? 239 PRO A CD  1 
ATOM   1333 N N   . THR A 1 240 ? 62.761 16.559 100.888 1.00 26.16  ? 240 THR A N   1 
ATOM   1334 C CA  . THR A 1 240 ? 61.972 16.035 99.778  1.00 29.11  ? 240 THR A CA  1 
ATOM   1335 C C   . THR A 1 240 ? 61.503 17.241 98.973  1.00 30.57  ? 240 THR A C   1 
ATOM   1336 O O   . THR A 1 240 ? 60.957 17.106 97.876  1.00 31.73  ? 240 THR A O   1 
ATOM   1337 C CB  . THR A 1 240 ? 60.721 15.213 100.227 1.00 29.22  ? 240 THR A CB  1 
ATOM   1338 O OG1 . THR A 1 240 ? 59.845 16.031 101.017 1.00 32.01  ? 240 THR A OG1 1 
ATOM   1339 C CG2 . THR A 1 240 ? 61.138 13.996 101.016 1.00 27.24  ? 240 THR A CG2 1 
ATOM   1340 N N   . ALA A 1 241 ? 61.725 18.429 99.529  1.00 30.98  ? 241 ALA A N   1 
ATOM   1341 C CA  . ALA A 1 241 ? 61.348 19.664 98.858  1.00 30.88  ? 241 ALA A CA  1 
ATOM   1342 C C   . ALA A 1 241 ? 62.120 20.841 99.422  1.00 30.82  ? 241 ALA A C   1 
ATOM   1343 O O   . ALA A 1 241 ? 62.594 20.800 100.557 1.00 30.56  ? 241 ALA A O   1 
ATOM   1344 C CB  . ALA A 1 241 ? 59.858 19.907 98.996  1.00 30.92  ? 241 ALA A CB  1 
ATOM   1345 N N   . MET A 1 242 ? 62.247 21.884 98.607  1.00 30.48  ? 242 MET A N   1 
ATOM   1346 C CA  . MET A 1 242 ? 62.946 23.101 98.993  1.00 29.75  ? 242 MET A CA  1 
ATOM   1347 C C   . MET A 1 242 ? 62.131 24.308 98.577  1.00 30.72  ? 242 MET A C   1 
ATOM   1348 O O   . MET A 1 242 ? 61.423 24.263 97.566  1.00 32.08  ? 242 MET A O   1 
ATOM   1349 C CB  . MET A 1 242 ? 64.308 23.186 98.306  1.00 27.53  ? 242 MET A CB  1 
ATOM   1350 C CG  . MET A 1 242 ? 65.347 22.238 98.849  1.00 28.60  ? 242 MET A CG  1 
ATOM   1351 S SD  . MET A 1 242 ? 66.912 22.382 97.992  1.00 26.35  ? 242 MET A SD  1 
ATOM   1352 C CE  . MET A 1 242 ? 67.470 24.033 98.568  1.00 26.55  ? 242 MET A CE  1 
ATOM   1353 N N   . LEU A 1 243 ? 62.223 25.374 99.370  1.00 29.80  ? 243 LEU A N   1 
ATOM   1354 C CA  . LEU A 1 243 ? 61.551 26.635 99.073  1.00 29.38  ? 243 LEU A CA  1 
ATOM   1355 C C   . LEU A 1 243 ? 62.682 27.642 98.859  1.00 30.31  ? 243 LEU A C   1 
ATOM   1356 O O   . LEU A 1 243 ? 63.439 27.933 99.782  1.00 31.52  ? 243 LEU A O   1 
ATOM   1357 C CB  . LEU A 1 243 ? 60.666 27.065 100.241 1.00 27.51  ? 243 LEU A CB  1 
ATOM   1358 C CG  . LEU A 1 243 ? 59.284 26.418 100.324 1.00 27.15  ? 243 LEU A CG  1 
ATOM   1359 C CD1 . LEU A 1 243 ? 58.624 26.752 101.650 1.00 26.34  ? 243 LEU A CD1 1 
ATOM   1360 C CD2 . LEU A 1 243 ? 58.434 26.908 99.170  1.00 25.26  ? 243 LEU A CD2 1 
ATOM   1361 N N   . VAL A 1 244 ? 62.821 28.157 97.641  1.00 30.96  ? 244 VAL A N   1 
ATOM   1362 C CA  . VAL A 1 244 ? 63.902 29.098 97.360  1.00 31.79  ? 244 VAL A CA  1 
ATOM   1363 C C   . VAL A 1 244 ? 63.413 30.538 97.172  1.00 30.93  ? 244 VAL A C   1 
ATOM   1364 O O   . VAL A 1 244 ? 62.358 30.774 96.589  1.00 31.48  ? 244 VAL A O   1 
ATOM   1365 C CB  . VAL A 1 244 ? 64.730 28.633 96.123  1.00 32.67  ? 244 VAL A CB  1 
ATOM   1366 C CG1 . VAL A 1 244 ? 65.973 29.499 95.966  1.00 33.78  ? 244 VAL A CG1 1 
ATOM   1367 C CG2 . VAL A 1 244 ? 65.137 27.172 96.282  1.00 30.87  ? 244 VAL A CG2 1 
ATOM   1368 N N   . ALA A 1 245 ? 64.198 31.487 97.678  1.00 30.50  ? 245 ALA A N   1 
ATOM   1369 C CA  . ALA A 1 245 ? 63.873 32.909 97.634  1.00 30.29  ? 245 ALA A CA  1 
ATOM   1370 C C   . ALA A 1 245 ? 63.752 33.529 96.254  1.00 30.91  ? 245 ALA A C   1 
ATOM   1371 O O   . ALA A 1 245 ? 63.253 34.645 96.126  1.00 31.05  ? 245 ALA A O   1 
ATOM   1372 C CB  . ALA A 1 245 ? 64.882 33.691 98.459  1.00 30.87  ? 245 ALA A CB  1 
ATOM   1373 N N   . ASN A 1 246 ? 64.217 32.835 95.220  1.00 31.00  ? 246 ASN A N   1 
ATOM   1374 C CA  . ASN A 1 246 ? 64.096 33.377 93.868  1.00 30.50  ? 246 ASN A CA  1 
ATOM   1375 C C   . ASN A 1 246 ? 64.483 32.358 92.804  1.00 29.32  ? 246 ASN A C   1 
ATOM   1376 O O   . ASN A 1 246 ? 65.206 31.406 93.076  1.00 29.05  ? 246 ASN A O   1 
ATOM   1377 C CB  . ASN A 1 246 ? 64.920 34.670 93.738  1.00 30.75  ? 246 ASN A CB  1 
ATOM   1378 C CG  . ASN A 1 246 ? 66.329 34.432 93.255  1.00 29.90  ? 246 ASN A CG  1 
ATOM   1379 O OD1 . ASN A 1 246 ? 66.959 33.427 93.579  1.00 30.46  ? 246 ASN A OD1 1 
ATOM   1380 N ND2 . ASN A 1 246 ? 66.843 35.377 92.487  1.00 28.65  ? 246 ASN A ND2 1 
ATOM   1381 N N   . ASP A 1 247 ? 63.988 32.561 91.589  1.00 29.52  ? 247 ASP A N   1 
ATOM   1382 C CA  . ASP A 1 247 ? 64.249 31.632 90.498  1.00 28.31  ? 247 ASP A CA  1 
ATOM   1383 C C   . ASP A 1 247 ? 65.696 31.414 90.127  1.00 27.73  ? 247 ASP A C   1 
ATOM   1384 O O   . ASP A 1 247 ? 66.081 30.298 89.794  1.00 28.85  ? 247 ASP A O   1 
ATOM   1385 C CB  . ASP A 1 247 ? 63.461 32.035 89.258  1.00 28.35  ? 247 ASP A CB  1 
ATOM   1386 C CG  . ASP A 1 247 ? 61.969 31.838 89.432  1.00 28.86  ? 247 ASP A CG  1 
ATOM   1387 O OD1 . ASP A 1 247 ? 61.561 31.104 90.359  1.00 27.37  ? 247 ASP A OD1 1 
ATOM   1388 O OD2 . ASP A 1 247 ? 61.205 32.409 88.629  1.00 29.19  ? 247 ASP A OD2 1 
ATOM   1389 N N   . GLN A 1 248 ? 66.511 32.459 90.165  1.00 27.52  ? 248 GLN A N   1 
ATOM   1390 C CA  . GLN A 1 248 ? 67.910 32.266 89.823  1.00 26.64  ? 248 GLN A CA  1 
ATOM   1391 C C   . GLN A 1 248 ? 68.523 31.279 90.818  1.00 26.16  ? 248 GLN A C   1 
ATOM   1392 O O   . GLN A 1 248 ? 69.049 30.241 90.420  1.00 25.39  ? 248 GLN A O   1 
ATOM   1393 C CB  . GLN A 1 248 ? 68.665 33.595 89.829  1.00 26.82  ? 248 GLN A CB  1 
ATOM   1394 C CG  . GLN A 1 248 ? 68.138 34.608 88.822  1.00 29.00  ? 248 GLN A CG  1 
ATOM   1395 C CD  . GLN A 1 248 ? 69.136 35.727 88.522  1.00 31.54  ? 248 GLN A CD  1 
ATOM   1396 O OE1 . GLN A 1 248 ? 68.801 36.910 88.585  1.00 31.77  ? 248 GLN A OE1 1 
ATOM   1397 N NE2 . GLN A 1 248 ? 70.364 35.349 88.181  1.00 32.50  ? 248 GLN A NE2 1 
ATOM   1398 N N   . MET A 1 249 ? 68.442 31.579 92.111  1.00 25.37  ? 249 MET A N   1 
ATOM   1399 C CA  . MET A 1 249 ? 68.993 30.663 93.100  1.00 25.39  ? 249 MET A CA  1 
ATOM   1400 C C   . MET A 1 249 ? 68.355 29.297 92.935  1.00 25.47  ? 249 MET A C   1 
ATOM   1401 O O   . MET A 1 249 ? 69.028 28.274 93.064  1.00 26.38  ? 249 MET A O   1 
ATOM   1402 C CB  . MET A 1 249 ? 68.730 31.151 94.512  1.00 25.88  ? 249 MET A CB  1 
ATOM   1403 C CG  . MET A 1 249 ? 69.559 32.321 94.940  1.00 28.56  ? 249 MET A CG  1 
ATOM   1404 S SD  . MET A 1 249 ? 69.324 32.561 96.694  1.00 30.68  ? 249 MET A SD  1 
ATOM   1405 C CE  . MET A 1 249 ? 67.665 33.156 96.698  1.00 30.26  ? 249 MET A CE  1 
ATOM   1406 N N   . ALA A 1 250 ? 67.053 29.284 92.660  1.00 23.53  ? 250 ALA A N   1 
ATOM   1407 C CA  . ALA A 1 250 ? 66.333 28.038 92.468  1.00 23.31  ? 250 ALA A CA  1 
ATOM   1408 C C   . ALA A 1 250 ? 67.042 27.230 91.392  1.00 24.45  ? 250 ALA A C   1 
ATOM   1409 O O   . ALA A 1 250 ? 67.167 26.009 91.486  1.00 22.72  ? 250 ALA A O   1 
ATOM   1410 C CB  . ALA A 1 250 ? 64.922 28.324 92.044  1.00 23.24  ? 250 ALA A CB  1 
ATOM   1411 N N   . LEU A 1 251 ? 67.512 27.931 90.366  1.00 26.80  ? 251 LEU A N   1 
ATOM   1412 C CA  . LEU A 1 251 ? 68.220 27.294 89.264  1.00 28.38  ? 251 LEU A CA  1 
ATOM   1413 C C   . LEU A 1 251 ? 69.510 26.649 89.762  1.00 28.95  ? 251 LEU A C   1 
ATOM   1414 O O   . LEU A 1 251 ? 69.867 25.546 89.335  1.00 28.72  ? 251 LEU A O   1 
ATOM   1415 C CB  . LEU A 1 251 ? 68.545 28.324 88.178  1.00 28.65  ? 251 LEU A CB  1 
ATOM   1416 C CG  . LEU A 1 251 ? 69.493 27.829 87.076  1.00 30.57  ? 251 LEU A CG  1 
ATOM   1417 C CD1 . LEU A 1 251 ? 68.830 26.697 86.313  1.00 30.11  ? 251 LEU A CD1 1 
ATOM   1418 C CD2 . LEU A 1 251 ? 69.861 28.973 86.136  1.00 29.13  ? 251 LEU A CD2 1 
ATOM   1419 N N   . GLY A 1 252 ? 70.201 27.350 90.660  1.00 28.91  ? 252 GLY A N   1 
ATOM   1420 C CA  . GLY A 1 252 ? 71.442 26.841 91.208  1.00 29.22  ? 252 GLY A CA  1 
ATOM   1421 C C   . GLY A 1 252 ? 71.151 25.606 92.025  1.00 30.19  ? 252 GLY A C   1 
ATOM   1422 O O   . GLY A 1 252 ? 71.832 24.583 91.907  1.00 30.27  ? 252 GLY A O   1 
ATOM   1423 N N   . ALA A 1 253 ? 70.119 25.703 92.853  1.00 30.59  ? 253 ALA A N   1 
ATOM   1424 C CA  . ALA A 1 253 ? 69.724 24.584 93.683  1.00 31.75  ? 253 ALA A CA  1 
ATOM   1425 C C   . ALA A 1 253 ? 69.532 23.363 92.794  1.00 33.38  ? 253 ALA A C   1 
ATOM   1426 O O   . ALA A 1 253 ? 70.129 22.313 93.025  1.00 35.43  ? 253 ALA A O   1 
ATOM   1427 C CB  . ALA A 1 253 ? 68.439 24.906 94.410  1.00 30.36  ? 253 ALA A CB  1 
ATOM   1428 N N   . MET A 1 254 ? 68.721 23.506 91.755  1.00 33.64  ? 254 MET A N   1 
ATOM   1429 C CA  . MET A 1 254 ? 68.461 22.388 90.865  1.00 33.59  ? 254 MET A CA  1 
ATOM   1430 C C   . MET A 1 254 ? 69.712 21.742 90.292  1.00 34.81  ? 254 MET A C   1 
ATOM   1431 O O   . MET A 1 254 ? 69.723 20.538 90.040  1.00 35.46  ? 254 MET A O   1 
ATOM   1432 C CB  . MET A 1 254 ? 67.552 22.832 89.738  1.00 31.07  ? 254 MET A CB  1 
ATOM   1433 C CG  . MET A 1 254 ? 66.226 23.301 90.233  1.00 31.16  ? 254 MET A CG  1 
ATOM   1434 S SD  . MET A 1 254 ? 65.339 24.091 88.938  1.00 30.51  ? 254 MET A SD  1 
ATOM   1435 C CE  . MET A 1 254 ? 65.021 22.696 87.888  1.00 32.64  ? 254 MET A CE  1 
ATOM   1436 N N   . ARG A 1 255 ? 70.771 22.516 90.087  1.00 35.19  ? 255 ARG A N   1 
ATOM   1437 C CA  . ARG A 1 255 ? 71.970 21.914 89.533  1.00 36.75  ? 255 ARG A CA  1 
ATOM   1438 C C   . ARG A 1 255 ? 72.647 21.023 90.565  1.00 37.80  ? 255 ARG A C   1 
ATOM   1439 O O   . ARG A 1 255 ? 73.041 19.895 90.255  1.00 38.92  ? 255 ARG A O   1 
ATOM   1440 C CB  . ARG A 1 255 ? 72.957 22.970 89.042  1.00 36.90  ? 255 ARG A CB  1 
ATOM   1441 C CG  . ARG A 1 255 ? 74.088 22.356 88.224  1.00 36.03  ? 255 ARG A CG  1 
ATOM   1442 C CD  . ARG A 1 255 ? 75.185 23.353 87.928  1.00 35.03  ? 255 ARG A CD  1 
ATOM   1443 N NE  . ARG A 1 255 ? 76.491 22.751 88.158  1.00 33.71  ? 255 ARG A NE  1 
ATOM   1444 C CZ  . ARG A 1 255 ? 77.565 23.436 88.531  1.00 34.26  ? 255 ARG A CZ  1 
ATOM   1445 N NH1 . ARG A 1 255 ? 77.491 24.749 88.709  1.00 36.09  ? 255 ARG A NH1 1 
ATOM   1446 N NH2 . ARG A 1 255 ? 78.704 22.805 88.764  1.00 33.31  ? 255 ARG A NH2 1 
ATOM   1447 N N   . ALA A 1 256 ? 72.779 21.522 91.792  1.00 37.21  ? 256 ALA A N   1 
ATOM   1448 C CA  . ALA A 1 256 ? 73.408 20.739 92.855  1.00 36.49  ? 256 ALA A CA  1 
ATOM   1449 C C   . ALA A 1 256 ? 72.644 19.433 93.048  1.00 34.65  ? 256 ALA A C   1 
ATOM   1450 O O   . ALA A 1 256 ? 73.235 18.371 93.179  1.00 34.10  ? 256 ALA A O   1 
ATOM   1451 C CB  . ALA A 1 256 ? 73.433 21.534 94.166  1.00 35.62  ? 256 ALA A CB  1 
ATOM   1452 N N   . ILE A 1 257 ? 71.322 19.518 93.054  1.00 34.02  ? 257 ILE A N   1 
ATOM   1453 C CA  . ILE A 1 257 ? 70.497 18.335 93.233  1.00 34.49  ? 257 ILE A CA  1 
ATOM   1454 C C   . ILE A 1 257 ? 70.813 17.308 92.150  1.00 35.85  ? 257 ILE A C   1 
ATOM   1455 O O   . ILE A 1 257 ? 71.087 16.140 92.447  1.00 36.27  ? 257 ILE A O   1 
ATOM   1456 C CB  . ILE A 1 257 ? 68.990 18.689 93.170  1.00 33.01  ? 257 ILE A CB  1 
ATOM   1457 C CG1 . ILE A 1 257 ? 68.630 19.633 94.318  1.00 31.68  ? 257 ILE A CG1 1 
ATOM   1458 C CG2 . ILE A 1 257 ? 68.153 17.423 93.234  1.00 30.47  ? 257 ILE A CG2 1 
ATOM   1459 C CD1 . ILE A 1 257 ? 67.189 20.067 94.323  1.00 32.71  ? 257 ILE A CD1 1 
ATOM   1460 N N   . THR A 1 258 ? 70.774 17.753 90.896  1.00 35.57  ? 258 THR A N   1 
ATOM   1461 C CA  . THR A 1 258 ? 71.044 16.880 89.769  1.00 34.94  ? 258 THR A CA  1 
ATOM   1462 C C   . THR A 1 258 ? 72.417 16.255 89.895  1.00 35.34  ? 258 THR A C   1 
ATOM   1463 O O   . THR A 1 258 ? 72.559 15.042 89.794  1.00 36.24  ? 258 THR A O   1 
ATOM   1464 C CB  . THR A 1 258 ? 70.960 17.647 88.433  1.00 34.87  ? 258 THR A CB  1 
ATOM   1465 O OG1 . THR A 1 258 ? 69.616 18.088 88.229  1.00 35.75  ? 258 THR A OG1 1 
ATOM   1466 C CG2 . THR A 1 258 ? 71.366 16.758 87.264  1.00 33.35  ? 258 THR A CG2 1 
ATOM   1467 N N   . GLU A 1 259 ? 73.428 17.080 90.125  1.00 35.21  ? 259 GLU A N   1 
ATOM   1468 C CA  . GLU A 1 259 ? 74.786 16.575 90.253  1.00 37.61  ? 259 GLU A CA  1 
ATOM   1469 C C   . GLU A 1 259 ? 74.991 15.712 91.511  1.00 39.28  ? 259 GLU A C   1 
ATOM   1470 O O   . GLU A 1 259 ? 76.105 15.270 91.810  1.00 39.80  ? 259 GLU A O   1 
ATOM   1471 C CB  . GLU A 1 259 ? 75.766 17.744 90.233  1.00 38.33  ? 259 GLU A CB  1 
ATOM   1472 C CG  . GLU A 1 259 ? 75.465 18.733 89.125  1.00 39.67  ? 259 GLU A CG  1 
ATOM   1473 C CD  . GLU A 1 259 ? 76.639 19.618 88.791  1.00 40.31  ? 259 GLU A CD  1 
ATOM   1474 O OE1 . GLU A 1 259 ? 77.433 19.923 89.708  1.00 41.16  ? 259 GLU A OE1 1 
ATOM   1475 O OE2 . GLU A 1 259 ? 76.753 20.017 87.612  1.00 40.44  ? 259 GLU A OE2 1 
ATOM   1476 N N   . SER A 1 260 ? 73.905 15.485 92.245  1.00 40.84  ? 260 SER A N   1 
ATOM   1477 C CA  . SER A 1 260 ? 73.914 14.652 93.444  1.00 39.40  ? 260 SER A CA  1 
ATOM   1478 C C   . SER A 1 260 ? 73.137 13.401 93.096  1.00 39.24  ? 260 SER A C   1 
ATOM   1479 O O   . SER A 1 260 ? 72.521 12.785 93.954  1.00 41.10  ? 260 SER A O   1 
ATOM   1480 C CB  . SER A 1 260 ? 73.219 15.354 94.608  1.00 39.02  ? 260 SER A CB  1 
ATOM   1481 O OG  . SER A 1 260 ? 74.097 16.260 95.236  1.00 39.94  ? 260 SER A OG  1 
ATOM   1482 N N   . GLY A 1 261 ? 73.152 13.046 91.819  1.00 37.94  ? 261 GLY A N   1 
ATOM   1483 C CA  . GLY A 1 261 ? 72.442 11.868 91.371  1.00 37.38  ? 261 GLY A CA  1 
ATOM   1484 C C   . GLY A 1 261 ? 70.981 11.881 91.755  1.00 37.26  ? 261 GLY A C   1 
ATOM   1485 O O   . GLY A 1 261 ? 70.313 10.856 91.685  1.00 39.37  ? 261 GLY A O   1 
ATOM   1486 N N   . LEU A 1 262 ? 70.473 13.037 92.154  1.00 36.06  ? 262 LEU A N   1 
ATOM   1487 C CA  . LEU A 1 262 ? 69.081 13.134 92.551  1.00 36.10  ? 262 LEU A CA  1 
ATOM   1488 C C   . LEU A 1 262 ? 68.250 13.854 91.507  1.00 37.28  ? 262 LEU A C   1 
ATOM   1489 O O   . LEU A 1 262 ? 68.702 14.827 90.908  1.00 38.73  ? 262 LEU A O   1 
ATOM   1490 C CB  . LEU A 1 262 ? 68.996 13.855 93.884  1.00 36.04  ? 262 LEU A CB  1 
ATOM   1491 C CG  . LEU A 1 262 ? 69.618 13.008 94.985  1.00 35.44  ? 262 LEU A CG  1 
ATOM   1492 C CD1 . LEU A 1 262 ? 70.118 13.867 96.134  1.00 35.50  ? 262 LEU A CD1 1 
ATOM   1493 C CD2 . LEU A 1 262 ? 68.582 11.999 95.433  1.00 34.90  ? 262 LEU A CD2 1 
ATOM   1494 N N   . ARG A 1 263 ? 67.033 13.374 91.291  1.00 37.98  ? 263 ARG A N   1 
ATOM   1495 C CA  . ARG A 1 263 ? 66.143 13.975 90.305  1.00 39.78  ? 263 ARG A CA  1 
ATOM   1496 C C   . ARG A 1 263 ? 65.347 15.124 90.873  1.00 39.68  ? 263 ARG A C   1 
ATOM   1497 O O   . ARG A 1 263 ? 64.630 14.957 91.859  1.00 40.34  ? 263 ARG A O   1 
ATOM   1498 C CB  . ARG A 1 263 ? 65.147 12.950 89.780  1.00 41.88  ? 263 ARG A CB  1 
ATOM   1499 C CG  . ARG A 1 263 ? 65.750 11.820 89.011  1.00 44.77  ? 263 ARG A CG  1 
ATOM   1500 C CD  . ARG A 1 263 ? 64.766 10.695 88.961  1.00 47.16  ? 263 ARG A CD  1 
ATOM   1501 N NE  . ARG A 1 263 ? 64.516 10.191 90.304  1.00 50.94  ? 263 ARG A NE  1 
ATOM   1502 C CZ  . ARG A 1 263 ? 63.665 9.213  90.582  1.00 53.26  ? 263 ARG A CZ  1 
ATOM   1503 N NH1 . ARG A 1 263 ? 62.977 8.635  89.604  1.00 54.77  ? 263 ARG A NH1 1 
ATOM   1504 N NH2 . ARG A 1 263 ? 63.507 8.808  91.834  1.00 54.69  ? 263 ARG A NH2 1 
ATOM   1505 N N   . VAL A 1 264 ? 65.460 16.288 90.243  1.00 39.35  ? 264 VAL A N   1 
ATOM   1506 C CA  . VAL A 1 264 ? 64.706 17.448 90.686  1.00 37.54  ? 264 VAL A CA  1 
ATOM   1507 C C   . VAL A 1 264 ? 63.241 17.098 90.441  1.00 38.01  ? 264 VAL A C   1 
ATOM   1508 O O   . VAL A 1 264 ? 62.857 16.719 89.336  1.00 37.43  ? 264 VAL A O   1 
ATOM   1509 C CB  . VAL A 1 264 ? 65.098 18.716 89.887  1.00 35.79  ? 264 VAL A CB  1 
ATOM   1510 C CG1 . VAL A 1 264 ? 64.095 19.832 90.138  1.00 34.99  ? 264 VAL A CG1 1 
ATOM   1511 C CG2 . VAL A 1 264 ? 66.493 19.170 90.292  1.00 33.71  ? 264 VAL A CG2 1 
ATOM   1512 N N   . GLY A 1 265 ? 62.435 17.194 91.489  1.00 39.38  ? 265 GLY A N   1 
ATOM   1513 C CA  . GLY A 1 265 ? 61.025 16.882 91.360  1.00 40.74  ? 265 GLY A CA  1 
ATOM   1514 C C   . GLY A 1 265 ? 60.697 15.514 91.922  1.00 41.30  ? 265 GLY A C   1 
ATOM   1515 O O   . GLY A 1 265 ? 59.970 15.396 92.910  1.00 42.73  ? 265 GLY A O   1 
ATOM   1516 N N   . ALA A 1 266 ? 61.239 14.477 91.294  1.00 40.77  ? 266 ALA A N   1 
ATOM   1517 C CA  . ALA A 1 266 ? 60.993 13.111 91.730  1.00 39.63  ? 266 ALA A CA  1 
ATOM   1518 C C   . ALA A 1 266 ? 61.608 12.844 93.097  1.00 38.76  ? 266 ALA A C   1 
ATOM   1519 O O   . ALA A 1 266 ? 61.019 12.144 93.921  1.00 38.88  ? 266 ALA A O   1 
ATOM   1520 C CB  . ALA A 1 266 ? 61.545 12.136 90.708  1.00 39.83  ? 266 ALA A CB  1 
ATOM   1521 N N   . ASP A 1 267 ? 62.788 13.401 93.339  1.00 37.73  ? 267 ASP A N   1 
ATOM   1522 C CA  . ASP A 1 267 ? 63.460 13.206 94.616  1.00 38.59  ? 267 ASP A CA  1 
ATOM   1523 C C   . ASP A 1 267 ? 63.350 14.450 95.499  1.00 38.23  ? 267 ASP A C   1 
ATOM   1524 O O   . ASP A 1 267 ? 62.880 14.379 96.636  1.00 39.06  ? 267 ASP A O   1 
ATOM   1525 C CB  . ASP A 1 267 ? 64.931 12.850 94.385  1.00 39.79  ? 267 ASP A CB  1 
ATOM   1526 C CG  . ASP A 1 267 ? 65.098 11.661 93.465  1.00 41.16  ? 267 ASP A CG  1 
ATOM   1527 O OD1 . ASP A 1 267 ? 66.247 11.248 93.204  1.00 43.37  ? 267 ASP A OD1 1 
ATOM   1528 O OD2 . ASP A 1 267 ? 64.071 11.139 92.995  1.00 41.64  ? 267 ASP A OD2 1 
ATOM   1529 N N   . ILE A 1 268 ? 63.785 15.589 94.974  1.00 36.86  ? 268 ILE A N   1 
ATOM   1530 C CA  . ILE A 1 268 ? 63.717 16.837 95.718  1.00 34.30  ? 268 ILE A CA  1 
ATOM   1531 C C   . ILE A 1 268 ? 62.917 17.888 94.942  1.00 33.50  ? 268 ILE A C   1 
ATOM   1532 O O   . ILE A 1 268 ? 63.432 18.496 94.008  1.00 33.30  ? 268 ILE A O   1 
ATOM   1533 C CB  . ILE A 1 268 ? 65.134 17.390 96.002  1.00 32.39  ? 268 ILE A CB  1 
ATOM   1534 C CG1 . ILE A 1 268 ? 65.933 16.377 96.810  1.00 30.14  ? 268 ILE A CG1 1 
ATOM   1535 C CG2 . ILE A 1 268 ? 65.047 18.696 96.773  1.00 33.59  ? 268 ILE A CG2 1 
ATOM   1536 C CD1 . ILE A 1 268 ? 67.301 16.860 97.206  1.00 26.49  ? 268 ILE A CD1 1 
ATOM   1537 N N   . SER A 1 269 ? 61.655 18.085 95.315  1.00 32.07  ? 269 SER A N   1 
ATOM   1538 C CA  . SER A 1 269 ? 60.829 19.090 94.653  1.00 31.75  ? 269 SER A CA  1 
ATOM   1539 C C   . SER A 1 269 ? 61.457 20.445 94.968  1.00 31.74  ? 269 SER A C   1 
ATOM   1540 O O   . SER A 1 269 ? 62.082 20.605 96.017  1.00 33.04  ? 269 SER A O   1 
ATOM   1541 C CB  . SER A 1 269 ? 59.395 19.048 95.189  1.00 32.15  ? 269 SER A CB  1 
ATOM   1542 O OG  . SER A 1 269 ? 58.734 17.840 94.842  1.00 31.61  ? 269 SER A OG  1 
ATOM   1543 N N   . VAL A 1 270 ? 61.298 21.414 94.069  1.00 30.30  ? 270 VAL A N   1 
ATOM   1544 C CA  . VAL A 1 270 ? 61.869 22.752 94.257  1.00 28.40  ? 270 VAL A CA  1 
ATOM   1545 C C   . VAL A 1 270 ? 60.857 23.817 93.879  1.00 29.49  ? 270 VAL A C   1 
ATOM   1546 O O   . VAL A 1 270 ? 60.179 23.689 92.859  1.00 30.92  ? 270 VAL A O   1 
ATOM   1547 C CB  . VAL A 1 270 ? 63.111 22.965 93.362  1.00 26.80  ? 270 VAL A CB  1 
ATOM   1548 C CG1 . VAL A 1 270 ? 63.565 24.402 93.438  1.00 27.23  ? 270 VAL A CG1 1 
ATOM   1549 C CG2 . VAL A 1 270 ? 64.233 22.050 93.788  1.00 26.87  ? 270 VAL A CG2 1 
ATOM   1550 N N   . VAL A 1 271 ? 60.742 24.868 94.686  1.00 29.63  ? 271 VAL A N   1 
ATOM   1551 C CA  . VAL A 1 271 ? 59.805 25.940 94.353  1.00 30.37  ? 271 VAL A CA  1 
ATOM   1552 C C   . VAL A 1 271 ? 60.524 27.280 94.352  1.00 32.03  ? 271 VAL A C   1 
ATOM   1553 O O   . VAL A 1 271 ? 60.992 27.745 95.394  1.00 32.45  ? 271 VAL A O   1 
ATOM   1554 C CB  . VAL A 1 271 ? 58.623 26.022 95.338  1.00 29.53  ? 271 VAL A CB  1 
ATOM   1555 C CG1 . VAL A 1 271 ? 57.639 27.091 94.867  1.00 27.50  ? 271 VAL A CG1 1 
ATOM   1556 C CG2 . VAL A 1 271 ? 57.925 24.680 95.436  1.00 29.30  ? 271 VAL A CG2 1 
ATOM   1557 N N   . GLY A 1 272 ? 60.604 27.894 93.172  1.00 32.53  ? 272 GLY A N   1 
ATOM   1558 C CA  . GLY A 1 272 ? 61.278 29.172 93.033  1.00 32.49  ? 272 GLY A CA  1 
ATOM   1559 C C   . GLY A 1 272 ? 60.424 30.358 93.433  1.00 33.51  ? 272 GLY A C   1 
ATOM   1560 O O   . GLY A 1 272 ? 59.395 30.207 94.100  1.00 32.98  ? 272 GLY A O   1 
ATOM   1561 N N   . TYR A 1 273 ? 60.852 31.547 93.019  1.00 33.73  ? 273 TYR A N   1 
ATOM   1562 C CA  . TYR A 1 273 ? 60.132 32.770 93.344  1.00 33.59  ? 273 TYR A CA  1 
ATOM   1563 C C   . TYR A 1 273 ? 60.440 33.838 92.297  1.00 33.51  ? 273 TYR A C   1 
ATOM   1564 O O   . TYR A 1 273 ? 61.604 34.058 91.969  1.00 32.67  ? 273 TYR A O   1 
ATOM   1565 C CB  . TYR A 1 273 ? 60.554 33.258 94.738  1.00 34.05  ? 273 TYR A CB  1 
ATOM   1566 C CG  . TYR A 1 273 ? 59.483 34.019 95.498  1.00 35.22  ? 273 TYR A CG  1 
ATOM   1567 C CD1 . TYR A 1 273 ? 59.121 35.317 95.135  1.00 35.00  ? 273 TYR A CD1 1 
ATOM   1568 C CD2 . TYR A 1 273 ? 58.814 33.429 96.568  1.00 35.07  ? 273 TYR A CD2 1 
ATOM   1569 C CE1 . TYR A 1 273 ? 58.120 36.001 95.816  1.00 33.76  ? 273 TYR A CE1 1 
ATOM   1570 C CE2 . TYR A 1 273 ? 57.813 34.103 97.251  1.00 33.73  ? 273 TYR A CE2 1 
ATOM   1571 C CZ  . TYR A 1 273 ? 57.472 35.384 96.870  1.00 34.17  ? 273 TYR A CZ  1 
ATOM   1572 O OH  . TYR A 1 273 ? 56.470 36.040 97.539  1.00 34.97  ? 273 TYR A OH  1 
ATOM   1573 N N   . ASP A 1 274 ? 59.380 34.472 91.786  1.00 33.52  ? 274 ASP A N   1 
ATOM   1574 C CA  . ASP A 1 274 ? 59.418 35.550 90.785  1.00 32.96  ? 274 ASP A CA  1 
ATOM   1575 C C   . ASP A 1 274 ? 58.739 35.176 89.484  1.00 33.75  ? 274 ASP A C   1 
ATOM   1576 O O   . ASP A 1 274 ? 57.803 35.837 89.041  1.00 34.35  ? 274 ASP A O   1 
ATOM   1577 C CB  . ASP A 1 274 ? 60.844 35.976 90.411  1.00 34.02  ? 274 ASP A CB  1 
ATOM   1578 C CG  . ASP A 1 274 ? 61.558 36.733 91.515  1.00 36.45  ? 274 ASP A CG  1 
ATOM   1579 O OD1 . ASP A 1 274 ? 60.881 37.381 92.339  1.00 37.52  ? 274 ASP A OD1 1 
ATOM   1580 O OD2 . ASP A 1 274 ? 62.812 36.695 91.540  1.00 37.49  ? 274 ASP A OD2 1 
ATOM   1581 N N   . ASP A 1 275 ? 59.234 34.095 88.889  1.00 34.61  ? 275 ASP A N   1 
ATOM   1582 C CA  . ASP A 1 275 ? 58.806 33.596 87.582  1.00 33.22  ? 275 ASP A CA  1 
ATOM   1583 C C   . ASP A 1 275 ? 59.452 34.523 86.548  1.00 33.77  ? 275 ASP A C   1 
ATOM   1584 O O   . ASP A 1 275 ? 58.769 35.162 85.747  1.00 32.84  ? 275 ASP A O   1 
ATOM   1585 C CB  . ASP A 1 275 ? 57.285 33.599 87.405  1.00 30.15  ? 275 ASP A CB  1 
ATOM   1586 C CG  . ASP A 1 275 ? 56.860 33.035 86.044  1.00 31.52  ? 275 ASP A CG  1 
ATOM   1587 O OD1 . ASP A 1 275 ? 57.397 31.981 85.629  1.00 29.36  ? 275 ASP A OD1 1 
ATOM   1588 O OD2 . ASP A 1 275 ? 55.987 33.639 85.384  1.00 31.48  ? 275 ASP A OD2 1 
ATOM   1589 N N   . THR A 1 276 ? 60.780 34.619 86.607  1.00 34.49  ? 276 THR A N   1 
ATOM   1590 C CA  . THR A 1 276 ? 61.523 35.449 85.670  1.00 36.21  ? 276 THR A CA  1 
ATOM   1591 C C   . THR A 1 276 ? 61.338 34.800 84.311  1.00 37.77  ? 276 THR A C   1 
ATOM   1592 O O   . THR A 1 276 ? 60.789 33.698 84.211  1.00 38.64  ? 276 THR A O   1 
ATOM   1593 C CB  . THR A 1 276 ? 63.032 35.516 86.010  1.00 35.95  ? 276 THR A CB  1 
ATOM   1594 O OG1 . THR A 1 276 ? 63.564 34.187 86.104  1.00 38.37  ? 276 THR A OG1 1 
ATOM   1595 C CG2 . THR A 1 276 ? 63.252 36.249 87.317  1.00 33.51  ? 276 THR A CG2 1 
ATOM   1596 N N   . GLU A 1 277 ? 61.805 35.460 83.260  1.00 38.71  ? 277 GLU A N   1 
ATOM   1597 C CA  . GLU A 1 277 ? 61.604 34.915 81.936  1.00 39.39  ? 277 GLU A CA  1 
ATOM   1598 C C   . GLU A 1 277 ? 62.095 33.485 81.745  1.00 39.12  ? 277 GLU A C   1 
ATOM   1599 O O   . GLU A 1 277 ? 61.296 32.600 81.451  1.00 39.29  ? 277 GLU A O   1 
ATOM   1600 C CB  . GLU A 1 277 ? 62.220 35.837 80.892  1.00 41.75  ? 277 GLU A CB  1 
ATOM   1601 C CG  . GLU A 1 277 ? 61.496 35.733 79.568  1.00 47.80  ? 277 GLU A CG  1 
ATOM   1602 C CD  . GLU A 1 277 ? 60.005 36.027 79.698  1.00 50.11  ? 277 GLU A CD  1 
ATOM   1603 O OE1 . GLU A 1 277 ? 59.216 35.534 78.860  1.00 52.21  ? 277 GLU A OE1 1 
ATOM   1604 O OE2 . GLU A 1 277 ? 59.622 36.762 80.633  1.00 52.16  ? 277 GLU A OE2 1 
ATOM   1605 N N   . ASP A 1 278 ? 63.393 33.264 81.938  1.00 38.98  ? 278 ASP A N   1 
ATOM   1606 C CA  . ASP A 1 278 ? 64.028 31.952 81.758  1.00 38.71  ? 278 ASP A CA  1 
ATOM   1607 C C   . ASP A 1 278 ? 63.467 30.756 82.525  1.00 38.99  ? 278 ASP A C   1 
ATOM   1608 O O   . ASP A 1 278 ? 63.548 29.619 82.051  1.00 38.12  ? 278 ASP A O   1 
ATOM   1609 C CB  . ASP A 1 278 ? 65.515 32.045 82.097  1.00 39.19  ? 278 ASP A CB  1 
ATOM   1610 C CG  . ASP A 1 278 ? 66.268 32.982 81.186  1.00 41.26  ? 278 ASP A CG  1 
ATOM   1611 O OD1 . ASP A 1 278 ? 67.463 33.229 81.467  1.00 43.35  ? 278 ASP A OD1 1 
ATOM   1612 O OD2 . ASP A 1 278 ? 65.679 33.463 80.193  1.00 40.14  ? 278 ASP A OD2 1 
ATOM   1613 N N   . SER A 1 279 ? 62.916 31.002 83.709  1.00 39.26  ? 279 SER A N   1 
ATOM   1614 C CA  . SER A 1 279 ? 62.404 29.924 84.551  1.00 39.35  ? 279 SER A CA  1 
ATOM   1615 C C   . SER A 1 279 ? 61.543 28.852 83.865  1.00 37.90  ? 279 SER A C   1 
ATOM   1616 O O   . SER A 1 279 ? 61.572 27.685 84.265  1.00 37.11  ? 279 SER A O   1 
ATOM   1617 C CB  . SER A 1 279 ? 61.649 30.513 85.744  1.00 39.52  ? 279 SER A CB  1 
ATOM   1618 O OG  . SER A 1 279 ? 60.525 31.253 85.304  1.00 45.41  ? 279 SER A OG  1 
ATOM   1619 N N   . SER A 1 280 ? 60.790 29.221 82.836  1.00 36.45  ? 280 SER A N   1 
ATOM   1620 C CA  . SER A 1 280 ? 59.946 28.230 82.168  1.00 36.70  ? 280 SER A CA  1 
ATOM   1621 C C   . SER A 1 280 ? 60.725 27.265 81.270  1.00 36.73  ? 280 SER A C   1 
ATOM   1622 O O   . SER A 1 280 ? 60.149 26.342 80.686  1.00 35.62  ? 280 SER A O   1 
ATOM   1623 C CB  . SER A 1 280 ? 58.850 28.915 81.348  1.00 35.89  ? 280 SER A CB  1 
ATOM   1624 O OG  . SER A 1 280 ? 59.369 29.490 80.167  1.00 37.46  ? 280 SER A OG  1 
ATOM   1625 N N   . CYS A 1 281 ? 62.032 27.476 81.165  1.00 36.61  ? 281 CYS A N   1 
ATOM   1626 C CA  . CYS A 1 281 ? 62.863 26.618 80.342  1.00 35.96  ? 281 CYS A CA  1 
ATOM   1627 C C   . CYS A 1 281 ? 64.031 26.055 81.133  1.00 36.30  ? 281 CYS A C   1 
ATOM   1628 O O   . CYS A 1 281 ? 65.061 25.695 80.567  1.00 37.95  ? 281 CYS A O   1 
ATOM   1629 C CB  . CYS A 1 281 ? 63.362 27.380 79.113  1.00 35.91  ? 281 CYS A CB  1 
ATOM   1630 S SG  . CYS A 1 281 ? 62.050 27.772 77.929  1.00 37.19  ? 281 CYS A SG  1 
ATOM   1631 N N   . TYR A 1 282 ? 63.886 25.997 82.452  1.00 35.73  ? 282 TYR A N   1 
ATOM   1632 C CA  . TYR A 1 282 ? 64.939 25.407 83.269  1.00 35.38  ? 282 TYR A CA  1 
ATOM   1633 C C   . TYR A 1 282 ? 64.728 23.914 83.094  1.00 35.02  ? 282 TYR A C   1 
ATOM   1634 O O   . TYR A 1 282 ? 63.759 23.498 82.460  1.00 34.21  ? 282 TYR A O   1 
ATOM   1635 C CB  . TYR A 1 282 ? 64.781 25.770 84.751  1.00 35.37  ? 282 TYR A CB  1 
ATOM   1636 C CG  . TYR A 1 282 ? 65.193 27.179 85.123  1.00 34.56  ? 282 TYR A CG  1 
ATOM   1637 C CD1 . TYR A 1 282 ? 65.964 27.958 84.266  1.00 33.84  ? 282 TYR A CD1 1 
ATOM   1638 C CD2 . TYR A 1 282 ? 64.826 27.725 86.347  1.00 35.38  ? 282 TYR A CD2 1 
ATOM   1639 C CE1 . TYR A 1 282 ? 66.354 29.240 84.616  1.00 33.03  ? 282 TYR A CE1 1 
ATOM   1640 C CE2 . TYR A 1 282 ? 65.214 29.009 86.708  1.00 34.62  ? 282 TYR A CE2 1 
ATOM   1641 C CZ  . TYR A 1 282 ? 65.974 29.758 85.837  1.00 33.53  ? 282 TYR A CZ  1 
ATOM   1642 O OH  . TYR A 1 282 ? 66.346 31.029 86.189  1.00 33.80  ? 282 TYR A OH  1 
ATOM   1643 N N   . ILE A 1 283 ? 65.609 23.094 83.647  1.00 34.81  ? 283 ILE A N   1 
ATOM   1644 C CA  . ILE A 1 283 ? 65.410 21.663 83.486  1.00 34.45  ? 283 ILE A CA  1 
ATOM   1645 C C   . ILE A 1 283 ? 65.309 20.907 84.807  1.00 32.93  ? 283 ILE A C   1 
ATOM   1646 O O   . ILE A 1 283 ? 66.299 20.739 85.514  1.00 34.21  ? 283 ILE A O   1 
ATOM   1647 C CB  . ILE A 1 283 ? 66.526 21.043 82.626  1.00 34.74  ? 283 ILE A CB  1 
ATOM   1648 C CG1 . ILE A 1 283 ? 66.628 21.782 81.290  1.00 36.50  ? 283 ILE A CG1 1 
ATOM   1649 C CG2 . ILE A 1 283 ? 66.213 19.589 82.345  1.00 33.51  ? 283 ILE A CG2 1 
ATOM   1650 C CD1 . ILE A 1 283 ? 67.701 21.221 80.368  1.00 37.43  ? 283 ILE A CD1 1 
ATOM   1651 N N   . PRO A 1 284 ? 64.096 20.466 85.169  1.00 31.13  ? 284 PRO A N   1 
ATOM   1652 C CA  . PRO A 1 284 ? 62.856 20.657 84.405  1.00 30.61  ? 284 PRO A CA  1 
ATOM   1653 C C   . PRO A 1 284 ? 62.240 22.027 84.656  1.00 30.04  ? 284 PRO A C   1 
ATOM   1654 O O   . PRO A 1 284 ? 62.675 22.753 85.540  1.00 29.07  ? 284 PRO A O   1 
ATOM   1655 C CB  . PRO A 1 284 ? 61.959 19.533 84.914  1.00 30.59  ? 284 PRO A CB  1 
ATOM   1656 C CG  . PRO A 1 284 ? 62.406 19.364 86.326  1.00 30.81  ? 284 PRO A CG  1 
ATOM   1657 C CD  . PRO A 1 284 ? 63.912 19.437 86.207  1.00 30.00  ? 284 PRO A CD  1 
ATOM   1658 N N   . PRO A 1 285 ? 61.223 22.402 83.871  1.00 30.76  ? 285 PRO A N   1 
ATOM   1659 C CA  . PRO A 1 285 ? 60.584 23.705 84.065  1.00 31.74  ? 285 PRO A CA  1 
ATOM   1660 C C   . PRO A 1 285 ? 60.238 23.946 85.542  1.00 32.17  ? 285 PRO A C   1 
ATOM   1661 O O   . PRO A 1 285 ? 59.602 23.123 86.198  1.00 32.68  ? 285 PRO A O   1 
ATOM   1662 C CB  . PRO A 1 285 ? 59.370 23.612 83.149  1.00 31.57  ? 285 PRO A CB  1 
ATOM   1663 C CG  . PRO A 1 285 ? 59.933 22.846 81.986  1.00 29.40  ? 285 PRO A CG  1 
ATOM   1664 C CD  . PRO A 1 285 ? 60.677 21.729 82.679  1.00 30.72  ? 285 PRO A CD  1 
ATOM   1665 N N   . LEU A 1 286 ? 60.658 25.096 86.051  1.00 32.69  ? 286 LEU A N   1 
ATOM   1666 C CA  . LEU A 1 286 ? 60.471 25.448 87.456  1.00 32.73  ? 286 LEU A CA  1 
ATOM   1667 C C   . LEU A 1 286 ? 59.114 25.963 87.936  1.00 32.41  ? 286 LEU A C   1 
ATOM   1668 O O   . LEU A 1 286 ? 58.550 26.901 87.376  1.00 32.25  ? 286 LEU A O   1 
ATOM   1669 C CB  . LEU A 1 286 ? 61.551 26.462 87.846  1.00 31.72  ? 286 LEU A CB  1 
ATOM   1670 C CG  . LEU A 1 286 ? 61.485 27.107 89.223  1.00 30.76  ? 286 LEU A CG  1 
ATOM   1671 C CD1 . LEU A 1 286 ? 61.592 26.028 90.283  1.00 31.56  ? 286 LEU A CD1 1 
ATOM   1672 C CD2 . LEU A 1 286 ? 62.612 28.119 89.362  1.00 29.81  ? 286 LEU A CD2 1 
ATOM   1673 N N   . THR A 1 287 ? 58.607 25.338 88.995  1.00 32.32  ? 287 THR A N   1 
ATOM   1674 C CA  . THR A 1 287 ? 57.350 25.749 89.616  1.00 32.22  ? 287 THR A CA  1 
ATOM   1675 C C   . THR A 1 287 ? 57.744 26.940 90.479  1.00 31.19  ? 287 THR A C   1 
ATOM   1676 O O   . THR A 1 287 ? 58.732 26.872 91.217  1.00 30.92  ? 287 THR A O   1 
ATOM   1677 C CB  . THR A 1 287 ? 56.786 24.638 90.517  1.00 33.28  ? 287 THR A CB  1 
ATOM   1678 O OG1 . THR A 1 287 ? 56.110 23.664 89.711  1.00 34.96  ? 287 THR A OG1 1 
ATOM   1679 C CG2 . THR A 1 287 ? 55.824 25.215 91.542  1.00 34.88  ? 287 THR A CG2 1 
ATOM   1680 N N   . THR A 1 288 ? 56.988 28.027 90.411  1.00 28.48  ? 288 THR A N   1 
ATOM   1681 C CA  . THR A 1 288 ? 57.383 29.191 91.185  1.00 27.61  ? 288 THR A CA  1 
ATOM   1682 C C   . THR A 1 288 ? 56.248 30.151 91.462  1.00 25.85  ? 288 THR A C   1 
ATOM   1683 O O   . THR A 1 288 ? 55.181 30.033 90.885  1.00 25.73  ? 288 THR A O   1 
ATOM   1684 C CB  . THR A 1 288 ? 58.501 29.942 90.442  1.00 27.91  ? 288 THR A CB  1 
ATOM   1685 O OG1 . THR A 1 288 ? 58.751 31.209 91.061  1.00 29.44  ? 288 THR A OG1 1 
ATOM   1686 C CG2 . THR A 1 288 ? 58.094 30.163 89.011  1.00 29.28  ? 288 THR A CG2 1 
ATOM   1687 N N   . ILE A 1 289 ? 56.490 31.096 92.361  1.00 24.90  ? 289 ILE A N   1 
ATOM   1688 C CA  . ILE A 1 289 ? 55.490 32.090 92.706  1.00 25.26  ? 289 ILE A CA  1 
ATOM   1689 C C   . ILE A 1 289 ? 55.665 33.230 91.741  1.00 24.84  ? 289 ILE A C   1 
ATOM   1690 O O   . ILE A 1 289 ? 56.721 33.846 91.688  1.00 23.53  ? 289 ILE A O   1 
ATOM   1691 C CB  . ILE A 1 289 ? 55.666 32.621 94.152  1.00 25.54  ? 289 ILE A CB  1 
ATOM   1692 C CG1 . ILE A 1 289 ? 55.547 31.467 95.143  1.00 24.52  ? 289 ILE A CG1 1 
ATOM   1693 C CG2 . ILE A 1 289 ? 54.593 33.659 94.469  1.00 25.41  ? 289 ILE A CG2 1 
ATOM   1694 C CD1 . ILE A 1 289 ? 54.284 30.645 94.969  1.00 22.46  ? 289 ILE A CD1 1 
ATOM   1695 N N   . LYS A 1 290 ? 54.621 33.513 90.977  1.00 27.66  ? 290 LYS A N   1 
ATOM   1696 C CA  . LYS A 1 290 ? 54.691 34.569 89.991  1.00 31.10  ? 290 LYS A CA  1 
ATOM   1697 C C   . LYS A 1 290 ? 54.541 35.962 90.570  1.00 32.75  ? 290 LYS A C   1 
ATOM   1698 O O   . LYS A 1 290 ? 53.631 36.223 91.358  1.00 34.33  ? 290 LYS A O   1 
ATOM   1699 C CB  . LYS A 1 290 ? 53.629 34.360 88.911  1.00 31.61  ? 290 LYS A CB  1 
ATOM   1700 C CG  . LYS A 1 290 ? 53.781 35.326 87.746  1.00 35.62  ? 290 LYS A CG  1 
ATOM   1701 C CD  . LYS A 1 290 ? 52.622 35.247 86.769  1.00 38.30  ? 290 LYS A CD  1 
ATOM   1702 C CE  . LYS A 1 290 ? 52.741 36.322 85.694  1.00 39.38  ? 290 LYS A CE  1 
ATOM   1703 N NZ  . LYS A 1 290 ? 51.453 36.500 84.962  1.00 41.97  ? 290 LYS A NZ  1 
ATOM   1704 N N   . GLN A 1 291 ? 55.454 36.847 90.176  1.00 33.60  ? 291 GLN A N   1 
ATOM   1705 C CA  . GLN A 1 291 ? 55.428 38.245 90.592  1.00 35.80  ? 291 GLN A CA  1 
ATOM   1706 C C   . GLN A 1 291 ? 55.404 39.078 89.312  1.00 37.24  ? 291 GLN A C   1 
ATOM   1707 O O   . GLN A 1 291 ? 56.444 39.475 88.780  1.00 36.97  ? 291 GLN A O   1 
ATOM   1708 C CB  . GLN A 1 291 ? 56.654 38.595 91.442  1.00 35.00  ? 291 GLN A CB  1 
ATOM   1709 C CG  . GLN A 1 291 ? 56.559 38.093 92.872  1.00 36.24  ? 291 GLN A CG  1 
ATOM   1710 C CD  . GLN A 1 291 ? 57.663 38.630 93.764  1.00 36.00  ? 291 GLN A CD  1 
ATOM   1711 O OE1 . GLN A 1 291 ? 58.840 38.470 93.464  1.00 37.25  ? 291 GLN A OE1 1 
ATOM   1712 N NE2 . GLN A 1 291 ? 57.284 39.270 94.869  1.00 34.33  ? 291 GLN A NE2 1 
ATOM   1713 N N   . ASP A 1 292 ? 54.195 39.333 88.824  1.00 38.69  ? 292 ASP A N   1 
ATOM   1714 C CA  . ASP A 1 292 ? 53.996 40.086 87.597  1.00 40.78  ? 292 ASP A CA  1 
ATOM   1715 C C   . ASP A 1 292 ? 54.590 41.497 87.570  1.00 40.47  ? 292 ASP A C   1 
ATOM   1716 O O   . ASP A 1 292 ? 53.893 42.485 87.815  1.00 38.14  ? 292 ASP A O   1 
ATOM   1717 C CB  . ASP A 1 292 ? 52.503 40.138 87.282  1.00 43.35  ? 292 ASP A CB  1 
ATOM   1718 C CG  . ASP A 1 292 ? 52.225 40.624 85.881  1.00 45.55  ? 292 ASP A CG  1 
ATOM   1719 O OD1 . ASP A 1 292 ? 51.107 40.373 85.383  1.00 47.67  ? 292 ASP A OD1 1 
ATOM   1720 O OD2 . ASP A 1 292 ? 53.123 41.258 85.280  1.00 47.47  ? 292 ASP A OD2 1 
ATOM   1721 N N   . PHE A 1 293 ? 55.880 41.572 87.247  1.00 42.06  ? 293 PHE A N   1 
ATOM   1722 C CA  . PHE A 1 293 ? 56.609 42.839 87.171  1.00 43.94  ? 293 PHE A CA  1 
ATOM   1723 C C   . PHE A 1 293 ? 55.972 43.716 86.108  1.00 45.26  ? 293 PHE A C   1 
ATOM   1724 O O   . PHE A 1 293 ? 56.040 44.952 86.174  1.00 45.63  ? 293 PHE A O   1 
ATOM   1725 C CB  . PHE A 1 293 ? 58.070 42.584 86.805  1.00 42.81  ? 293 PHE A CB  1 
ATOM   1726 C CG  . PHE A 1 293 ? 58.714 41.524 87.635  1.00 42.48  ? 293 PHE A CG  1 
ATOM   1727 C CD1 . PHE A 1 293 ? 59.084 41.781 88.949  1.00 41.46  ? 293 PHE A CD1 1 
ATOM   1728 C CD2 . PHE A 1 293 ? 58.906 40.248 87.119  1.00 40.95  ? 293 PHE A CD2 1 
ATOM   1729 C CE1 . PHE A 1 293 ? 59.632 40.785 89.735  1.00 39.89  ? 293 PHE A CE1 1 
ATOM   1730 C CE2 . PHE A 1 293 ? 59.452 39.248 87.896  1.00 39.26  ? 293 PHE A CE2 1 
ATOM   1731 C CZ  . PHE A 1 293 ? 59.816 39.517 89.209  1.00 40.42  ? 293 PHE A CZ  1 
ATOM   1732 N N   . ARG A 1 294 ? 55.365 43.068 85.117  1.00 44.53  ? 294 ARG A N   1 
ATOM   1733 C CA  . ARG A 1 294 ? 54.700 43.802 84.056  1.00 44.43  ? 294 ARG A CA  1 
ATOM   1734 C C   . ARG A 1 294 ? 53.632 44.629 84.775  1.00 42.48  ? 294 ARG A C   1 
ATOM   1735 O O   . ARG A 1 294 ? 53.567 45.856 84.645  1.00 42.77  ? 294 ARG A O   1 
ATOM   1736 C CB  . ARG A 1 294 ? 54.078 42.825 83.054  1.00 46.32  ? 294 ARG A CB  1 
ATOM   1737 C CG  . ARG A 1 294 ? 53.981 43.375 81.646  1.00 52.41  ? 294 ARG A CG  1 
ATOM   1738 C CD  . ARG A 1 294 ? 53.700 42.282 80.622  1.00 59.21  ? 294 ARG A CD  1 
ATOM   1739 N NE  . ARG A 1 294 ? 52.555 41.450 80.996  1.00 66.19  ? 294 ARG A NE  1 
ATOM   1740 C CZ  . ARG A 1 294 ? 51.764 40.819 80.128  1.00 68.22  ? 294 ARG A CZ  1 
ATOM   1741 N NH1 . ARG A 1 294 ? 51.988 40.926 78.821  1.00 69.04  ? 294 ARG A NH1 1 
ATOM   1742 N NH2 . ARG A 1 294 ? 50.749 40.077 80.565  1.00 68.53  ? 294 ARG A NH2 1 
ATOM   1743 N N   . LEU A 1 295 ? 52.824 43.948 85.575  1.00 39.50  ? 295 LEU A N   1 
ATOM   1744 C CA  . LEU A 1 295 ? 51.781 44.609 86.336  1.00 36.57  ? 295 LEU A CA  1 
ATOM   1745 C C   . LEU A 1 295 ? 52.382 45.662 87.248  1.00 36.31  ? 295 LEU A C   1 
ATOM   1746 O O   . LEU A 1 295 ? 51.900 46.792 87.299  1.00 36.82  ? 295 LEU A O   1 
ATOM   1747 C CB  . LEU A 1 295 ? 51.011 43.589 87.168  1.00 32.91  ? 295 LEU A CB  1 
ATOM   1748 C CG  . LEU A 1 295 ? 49.948 44.159 88.094  1.00 28.80  ? 295 LEU A CG  1 
ATOM   1749 C CD1 . LEU A 1 295 ? 49.082 45.171 87.376  1.00 27.20  ? 295 LEU A CD1 1 
ATOM   1750 C CD2 . LEU A 1 295 ? 49.127 43.018 88.603  1.00 28.80  ? 295 LEU A CD2 1 
ATOM   1751 N N   . LEU A 1 296 ? 53.437 45.294 87.966  1.00 35.87  ? 296 LEU A N   1 
ATOM   1752 C CA  . LEU A 1 296 ? 54.079 46.238 88.872  1.00 35.97  ? 296 LEU A CA  1 
ATOM   1753 C C   . LEU A 1 296 ? 54.540 47.443 88.101  1.00 36.21  ? 296 LEU A C   1 
ATOM   1754 O O   . LEU A 1 296 ? 54.330 48.574 88.529  1.00 35.64  ? 296 LEU A O   1 
ATOM   1755 C CB  . LEU A 1 296 ? 55.283 45.612 89.580  1.00 35.68  ? 296 LEU A CB  1 
ATOM   1756 C CG  . LEU A 1 296 ? 56.090 46.570 90.468  1.00 34.57  ? 296 LEU A CG  1 
ATOM   1757 C CD1 . LEU A 1 296 ? 55.168 47.305 91.424  1.00 34.41  ? 296 LEU A CD1 1 
ATOM   1758 C CD2 . LEU A 1 296 ? 57.137 45.791 91.239  1.00 32.66  ? 296 LEU A CD2 1 
ATOM   1759 N N   . GLY A 1 297 ? 55.170 47.189 86.958  1.00 37.34  ? 297 GLY A N   1 
ATOM   1760 C CA  . GLY A 1 297 ? 55.661 48.269 86.131  1.00 39.72  ? 297 GLY A CA  1 
ATOM   1761 C C   . GLY A 1 297 ? 54.556 49.255 85.830  1.00 41.99  ? 297 GLY A C   1 
ATOM   1762 O O   . GLY A 1 297 ? 54.677 50.449 86.102  1.00 40.96  ? 297 GLY A O   1 
ATOM   1763 N N   . GLN A 1 298 ? 53.464 48.747 85.273  1.00 44.73  ? 298 GLN A N   1 
ATOM   1764 C CA  . GLN A 1 298 ? 52.327 49.583 84.930  1.00 48.03  ? 298 GLN A CA  1 
ATOM   1765 C C   . GLN A 1 298 ? 51.808 50.366 86.129  1.00 49.03  ? 298 GLN A C   1 
ATOM   1766 O O   . GLN A 1 298 ? 51.839 51.595 86.139  1.00 51.03  ? 298 GLN A O   1 
ATOM   1767 C CB  . GLN A 1 298 ? 51.202 48.725 84.372  1.00 49.77  ? 298 GLN A CB  1 
ATOM   1768 C CG  . GLN A 1 298 ? 49.942 49.495 84.068  1.00 53.60  ? 298 GLN A CG  1 
ATOM   1769 C CD  . GLN A 1 298 ? 48.729 48.813 84.647  1.00 57.02  ? 298 GLN A CD  1 
ATOM   1770 O OE1 . GLN A 1 298 ? 48.572 48.730 85.866  1.00 58.61  ? 298 GLN A OE1 1 
ATOM   1771 N NE2 . GLN A 1 298 ? 47.867 48.302 83.777  1.00 59.83  ? 298 GLN A NE2 1 
ATOM   1772 N N   . THR A 1 299 ? 51.333 49.647 87.138  1.00 48.45  ? 299 THR A N   1 
ATOM   1773 C CA  . THR A 1 299 ? 50.795 50.273 88.335  1.00 48.17  ? 299 THR A CA  1 
ATOM   1774 C C   . THR A 1 299 ? 51.698 51.332 88.972  1.00 48.50  ? 299 THR A C   1 
ATOM   1775 O O   . THR A 1 299 ? 51.240 52.428 89.305  1.00 48.07  ? 299 THR A O   1 
ATOM   1776 C CB  . THR A 1 299 ? 50.475 49.221 89.392  1.00 48.12  ? 299 THR A CB  1 
ATOM   1777 O OG1 . THR A 1 299 ? 49.592 48.242 88.833  1.00 47.48  ? 299 THR A OG1 1 
ATOM   1778 C CG2 . THR A 1 299 ? 49.811 49.872 90.600  1.00 49.20  ? 299 THR A CG2 1 
ATOM   1779 N N   . SER A 1 300 ? 52.975 51.013 89.152  1.00 48.20  ? 300 SER A N   1 
ATOM   1780 C CA  . SER A 1 300 ? 53.883 51.975 89.763  1.00 49.37  ? 300 SER A CA  1 
ATOM   1781 C C   . SER A 1 300 ? 53.984 53.231 88.904  1.00 49.54  ? 300 SER A C   1 
ATOM   1782 O O   . SER A 1 300 ? 54.160 54.341 89.416  1.00 49.18  ? 300 SER A O   1 
ATOM   1783 C CB  . SER A 1 300 ? 55.274 51.356 89.971  1.00 49.84  ? 300 SER A CB  1 
ATOM   1784 O OG  . SER A 1 300 ? 55.907 51.043 88.743  1.00 52.44  ? 300 SER A OG  1 
ATOM   1785 N N   . VAL A 1 301 ? 53.864 53.056 87.593  1.00 49.42  ? 301 VAL A N   1 
ATOM   1786 C CA  . VAL A 1 301 ? 53.942 54.186 86.681  1.00 50.80  ? 301 VAL A CA  1 
ATOM   1787 C C   . VAL A 1 301 ? 52.702 55.050 86.825  1.00 50.72  ? 301 VAL A C   1 
ATOM   1788 O O   . VAL A 1 301 ? 52.801 56.242 87.126  1.00 49.94  ? 301 VAL A O   1 
ATOM   1789 C CB  . VAL A 1 301 ? 54.060 53.717 85.219  1.00 51.63  ? 301 VAL A CB  1 
ATOM   1790 C CG1 . VAL A 1 301 ? 53.939 54.904 84.270  1.00 52.10  ? 301 VAL A CG1 1 
ATOM   1791 C CG2 . VAL A 1 301 ? 55.388 53.031 85.016  1.00 52.79  ? 301 VAL A CG2 1 
ATOM   1792 N N   . ASP A 1 302 ? 51.543 54.426 86.612  1.00 50.55  ? 302 ASP A N   1 
ATOM   1793 C CA  . ASP A 1 302 ? 50.252 55.094 86.706  1.00 49.85  ? 302 ASP A CA  1 
ATOM   1794 C C   . ASP A 1 302 ? 50.074 55.865 88.010  1.00 51.08  ? 302 ASP A C   1 
ATOM   1795 O O   . ASP A 1 302 ? 49.668 57.031 87.994  1.00 52.29  ? 302 ASP A O   1 
ATOM   1796 C CB  . ASP A 1 302 ? 49.103 54.082 86.583  1.00 47.92  ? 302 ASP A CB  1 
ATOM   1797 C CG  . ASP A 1 302 ? 48.950 53.523 85.181  1.00 47.40  ? 302 ASP A CG  1 
ATOM   1798 O OD1 . ASP A 1 302 ? 49.080 54.293 84.207  1.00 47.93  ? 302 ASP A OD1 1 
ATOM   1799 O OD2 . ASP A 1 302 ? 48.675 52.312 85.052  1.00 46.48  ? 302 ASP A OD2 1 
ATOM   1800 N N   . ARG A 1 303 ? 50.376 55.225 89.137  1.00 51.26  ? 303 ARG A N   1 
ATOM   1801 C CA  . ARG A 1 303 ? 50.194 55.880 90.425  1.00 51.27  ? 303 ARG A CA  1 
ATOM   1802 C C   . ARG A 1 303 ? 51.103 57.087 90.583  1.00 50.51  ? 303 ARG A C   1 
ATOM   1803 O O   . ARG A 1 303 ? 50.720 58.094 91.178  1.00 50.35  ? 303 ARG A O   1 
ATOM   1804 C CB  . ARG A 1 303 ? 50.414 54.895 91.580  1.00 52.18  ? 303 ARG A CB  1 
ATOM   1805 C CG  . ARG A 1 303 ? 49.911 55.436 92.916  1.00 52.98  ? 303 ARG A CG  1 
ATOM   1806 C CD  . ARG A 1 303 ? 50.140 54.475 94.062  1.00 55.13  ? 303 ARG A CD  1 
ATOM   1807 N NE  . ARG A 1 303 ? 50.269 55.196 95.331  1.00 57.63  ? 303 ARG A NE  1 
ATOM   1808 C CZ  . ARG A 1 303 ? 50.574 54.629 96.500  1.00 57.95  ? 303 ARG A CZ  1 
ATOM   1809 N NH1 . ARG A 1 303 ? 50.783 53.317 96.574  1.00 56.31  ? 303 ARG A NH1 1 
ATOM   1810 N NH2 . ARG A 1 303 ? 50.689 55.379 97.596  1.00 55.71  ? 303 ARG A NH2 1 
ATOM   1811 N N   . LEU A 1 304 ? 52.307 56.996 90.042  1.00 50.02  ? 304 LEU A N   1 
ATOM   1812 C CA  . LEU A 1 304 ? 53.229 58.112 90.147  1.00 49.89  ? 304 LEU A CA  1 
ATOM   1813 C C   . LEU A 1 304 ? 52.643 59.325 89.439  1.00 49.54  ? 304 LEU A C   1 
ATOM   1814 O O   . LEU A 1 304 ? 52.575 60.416 90.008  1.00 48.26  ? 304 LEU A O   1 
ATOM   1815 C CB  . LEU A 1 304 ? 54.578 57.756 89.520  1.00 49.49  ? 304 LEU A CB  1 
ATOM   1816 C CG  . LEU A 1 304 ? 55.656 58.810 89.768  1.00 48.15  ? 304 LEU A CG  1 
ATOM   1817 C CD1 . LEU A 1 304 ? 55.857 58.989 91.271  1.00 47.20  ? 304 LEU A CD1 1 
ATOM   1818 C CD2 . LEU A 1 304 ? 56.942 58.392 89.092  1.00 47.34  ? 304 LEU A CD2 1 
ATOM   1819 N N   . LEU A 1 305 ? 52.214 59.132 88.197  1.00 49.93  ? 305 LEU A N   1 
ATOM   1820 C CA  . LEU A 1 305 ? 51.648 60.231 87.436  1.00 52.39  ? 305 LEU A CA  1 
ATOM   1821 C C   . LEU A 1 305 ? 50.501 60.859 88.207  1.00 54.25  ? 305 LEU A C   1 
ATOM   1822 O O   . LEU A 1 305 ? 50.324 62.076 88.174  1.00 56.06  ? 305 LEU A O   1 
ATOM   1823 C CB  . LEU A 1 305 ? 51.174 59.763 86.051  1.00 52.60  ? 305 LEU A CB  1 
ATOM   1824 C CG  . LEU A 1 305 ? 52.238 59.174 85.097  1.00 53.96  ? 305 LEU A CG  1 
ATOM   1825 C CD1 . LEU A 1 305 ? 51.658 59.047 83.689  1.00 51.81  ? 305 LEU A CD1 1 
ATOM   1826 C CD2 . LEU A 1 305 ? 53.485 60.053 85.070  1.00 52.14  ? 305 LEU A CD2 1 
ATOM   1827 N N   . GLN A 1 306 ? 49.732 60.036 88.915  1.00 55.43  ? 306 GLN A N   1 
ATOM   1828 C CA  . GLN A 1 306 ? 48.611 60.537 89.712  1.00 55.74  ? 306 GLN A CA  1 
ATOM   1829 C C   . GLN A 1 306 ? 49.084 61.286 90.959  1.00 55.79  ? 306 GLN A C   1 
ATOM   1830 O O   . GLN A 1 306 ? 48.543 62.333 91.314  1.00 55.94  ? 306 GLN A O   1 
ATOM   1831 C CB  . GLN A 1 306 ? 47.714 59.386 90.145  1.00 56.10  ? 306 GLN A CB  1 
ATOM   1832 C CG  . GLN A 1 306 ? 46.854 58.820 89.053  1.00 58.89  ? 306 GLN A CG  1 
ATOM   1833 C CD  . GLN A 1 306 ? 46.140 57.559 89.491  1.00 61.00  ? 306 GLN A CD  1 
ATOM   1834 O OE1 . GLN A 1 306 ? 45.319 57.015 88.758  1.00 63.92  ? 306 GLN A OE1 1 
ATOM   1835 N NE2 . GLN A 1 306 ? 46.456 57.081 90.690  1.00 60.85  ? 306 GLN A NE2 1 
ATOM   1836 N N   . LEU A 1 307 ? 50.088 60.742 91.633  1.00 54.96  ? 307 LEU A N   1 
ATOM   1837 C CA  . LEU A 1 307 ? 50.602 61.373 92.831  1.00 55.02  ? 307 LEU A CA  1 
ATOM   1838 C C   . LEU A 1 307 ? 51.061 62.783 92.548  1.00 55.96  ? 307 LEU A C   1 
ATOM   1839 O O   . LEU A 1 307 ? 50.889 63.673 93.375  1.00 55.96  ? 307 LEU A O   1 
ATOM   1840 C CB  . LEU A 1 307 ? 51.757 60.555 93.397  1.00 55.03  ? 307 LEU A CB  1 
ATOM   1841 C CG  . LEU A 1 307 ? 51.310 59.364 94.243  1.00 55.12  ? 307 LEU A CG  1 
ATOM   1842 C CD1 . LEU A 1 307 ? 52.393 58.301 94.310  1.00 55.05  ? 307 LEU A CD1 1 
ATOM   1843 C CD2 . LEU A 1 307 ? 50.943 59.872 95.626  1.00 54.16  ? 307 LEU A CD2 1 
ATOM   1844 N N   . SER A 1 308 ? 51.639 62.980 91.367  1.00 58.12  ? 308 SER A N   1 
ATOM   1845 C CA  . SER A 1 308 ? 52.150 64.289 90.965  1.00 60.17  ? 308 SER A CA  1 
ATOM   1846 C C   . SER A 1 308 ? 51.022 65.286 90.770  1.00 60.78  ? 308 SER A C   1 
ATOM   1847 O O   . SER A 1 308 ? 51.234 66.492 90.835  1.00 61.29  ? 308 SER A O   1 
ATOM   1848 C CB  . SER A 1 308 ? 52.934 64.176 89.661  1.00 60.24  ? 308 SER A CB  1 
ATOM   1849 O OG  . SER A 1 308 ? 52.048 64.014 88.571  1.00 60.26  ? 308 SER A OG  1 
ATOM   1850 N N   . GLN A 1 309 ? 49.827 64.769 90.514  1.00 62.03  ? 309 GLN A N   1 
ATOM   1851 C CA  . GLN A 1 309 ? 48.653 65.604 90.311  1.00 62.57  ? 309 GLN A CA  1 
ATOM   1852 C C   . GLN A 1 309 ? 47.773 65.578 91.559  1.00 63.12  ? 309 GLN A C   1 
ATOM   1853 O O   . GLN A 1 309 ? 46.555 65.749 91.467  1.00 63.93  ? 309 GLN A O   1 
ATOM   1854 C CB  . GLN A 1 309 ? 47.847 65.089 89.124  1.00 62.79  ? 309 GLN A CB  1 
ATOM   1855 C CG  . GLN A 1 309 ? 48.623 64.963 87.837  1.00 64.80  ? 309 GLN A CG  1 
ATOM   1856 C CD  . GLN A 1 309 ? 47.767 64.400 86.713  1.00 67.48  ? 309 GLN A CD  1 
ATOM   1857 O OE1 . GLN A 1 309 ? 47.239 63.289 86.812  1.00 67.58  ? 309 GLN A OE1 1 
ATOM   1858 N NE2 . GLN A 1 309 ? 47.620 65.170 85.639  1.00 68.99  ? 309 GLN A NE2 1 
ATOM   1859 N N   . GLY A 1 310 ? 48.392 65.350 92.716  1.00 63.19  ? 310 GLY A N   1 
ATOM   1860 C CA  . GLY A 1 310 ? 47.658 65.300 93.971  1.00 62.56  ? 310 GLY A CA  1 
ATOM   1861 C C   . GLY A 1 310 ? 46.263 64.719 93.845  1.00 62.42  ? 310 GLY A C   1 
ATOM   1862 O O   . GLY A 1 310 ? 45.278 65.331 94.243  1.00 61.12  ? 310 GLY A O   1 
ATOM   1863 N N   . GLN A 1 311 ? 46.169 63.533 93.271  1.00 63.99  ? 311 GLN A N   1 
ATOM   1864 C CA  . GLN A 1 311 ? 44.873 62.897 93.111  1.00 65.91  ? 311 GLN A CA  1 
ATOM   1865 C C   . GLN A 1 311 ? 45.048 61.394 93.251  1.00 65.43  ? 311 GLN A C   1 
ATOM   1866 O O   . GLN A 1 311 ? 44.403 60.611 92.545  1.00 64.52  ? 311 GLN A O   1 
ATOM   1867 C CB  . GLN A 1 311 ? 44.260 63.249 91.743  1.00 67.68  ? 311 GLN A CB  1 
ATOM   1868 C CG  . GLN A 1 311 ? 45.004 62.687 90.529  1.00 70.16  ? 311 GLN A CG  1 
ATOM   1869 C CD  . GLN A 1 311 ? 44.441 63.183 89.193  1.00 71.78  ? 311 GLN A CD  1 
ATOM   1870 O OE1 . GLN A 1 311 ? 44.842 62.711 88.122  1.00 71.50  ? 311 GLN A OE1 1 
ATOM   1871 N NE2 . GLN A 1 311 ? 43.515 64.141 89.252  1.00 72.55  ? 311 GLN A NE2 1 
ATOM   1872 N N   . ALA A 1 312 ? 45.923 61.000 94.177  1.00 64.41  ? 312 ALA A N   1 
ATOM   1873 C CA  . ALA A 1 312 ? 46.185 59.587 94.402  1.00 64.67  ? 312 ALA A CA  1 
ATOM   1874 C C   . ALA A 1 312 ? 46.270 59.168 95.866  1.00 64.64  ? 312 ALA A C   1 
ATOM   1875 O O   . ALA A 1 312 ? 46.474 59.991 96.766  1.00 63.38  ? 312 ALA A O   1 
ATOM   1876 C CB  . ALA A 1 312 ? 47.461 59.182 93.679  1.00 64.47  ? 312 ALA A CB  1 
ATOM   1877 N N   . VAL A 1 313 ? 46.113 57.862 96.075  1.00 64.77  ? 313 VAL A N   1 
ATOM   1878 C CA  . VAL A 1 313 ? 46.173 57.243 97.397  1.00 65.07  ? 313 VAL A CA  1 
ATOM   1879 C C   . VAL A 1 313 ? 47.577 57.444 97.978  1.00 64.53  ? 313 VAL A C   1 
ATOM   1880 O O   . VAL A 1 313 ? 48.573 57.128 97.323  1.00 65.28  ? 313 VAL A O   1 
ATOM   1881 C CB  . VAL A 1 313 ? 45.869 55.712 97.306  1.00 65.03  ? 313 VAL A CB  1 
ATOM   1882 C CG1 . VAL A 1 313 ? 44.604 55.470 96.482  1.00 64.50  ? 313 VAL A CG1 1 
ATOM   1883 C CG2 . VAL A 1 313 ? 47.031 54.981 96.680  1.00 63.41  ? 313 VAL A CG2 1 
ATOM   1884 N N   . LYS A 1 314 ? 47.670 57.966 99.197  1.00 62.46  ? 314 LYS A N   1 
ATOM   1885 C CA  . LYS A 1 314 ? 48.986 58.186 99.778  1.00 60.48  ? 314 LYS A CA  1 
ATOM   1886 C C   . LYS A 1 314 ? 49.420 57.148 100.808 1.00 57.80  ? 314 LYS A C   1 
ATOM   1887 O O   . LYS A 1 314 ? 50.007 57.490 101.832 1.00 59.60  ? 314 LYS A O   1 
ATOM   1888 C CB  . LYS A 1 314 ? 49.086 59.607 100.365 1.00 61.78  ? 314 LYS A CB  1 
ATOM   1889 C CG  . LYS A 1 314 ? 47.972 60.024 101.328 1.00 64.45  ? 314 LYS A CG  1 
ATOM   1890 C CD  . LYS A 1 314 ? 48.088 59.370 102.712 1.00 65.81  ? 314 LYS A CD  1 
ATOM   1891 C CE  . LYS A 1 314 ? 47.010 59.891 103.667 1.00 66.88  ? 314 LYS A CE  1 
ATOM   1892 N NZ  . LYS A 1 314 ? 47.013 59.195 104.985 1.00 66.26  ? 314 LYS A NZ  1 
ATOM   1893 N N   . GLY A 1 315 ? 49.154 55.876 100.528 1.00 53.38  ? 315 GLY A N   1 
ATOM   1894 C CA  . GLY A 1 315 ? 49.558 54.829 101.451 1.00 49.00  ? 315 GLY A CA  1 
ATOM   1895 C C   . GLY A 1 315 ? 50.341 53.711 100.784 1.00 45.81  ? 315 GLY A C   1 
ATOM   1896 O O   . GLY A 1 315 ? 51.185 53.957 99.928  1.00 46.62  ? 315 GLY A O   1 
ATOM   1897 N N   . ASN A 1 316 ? 50.061 52.476 101.179 1.00 42.47  ? 316 ASN A N   1 
ATOM   1898 C CA  . ASN A 1 316 ? 50.722 51.316 100.601 1.00 39.12  ? 316 ASN A CA  1 
ATOM   1899 C C   . ASN A 1 316 ? 49.741 50.446 99.829  1.00 38.35  ? 316 ASN A C   1 
ATOM   1900 O O   . ASN A 1 316 ? 48.620 50.224 100.269 1.00 39.06  ? 316 ASN A O   1 
ATOM   1901 C CB  . ASN A 1 316 ? 51.350 50.454 101.684 1.00 38.18  ? 316 ASN A CB  1 
ATOM   1902 C CG  . ASN A 1 316 ? 51.582 49.035 101.215 1.00 37.67  ? 316 ASN A CG  1 
ATOM   1903 O OD1 . ASN A 1 316 ? 52.541 48.759 100.496 1.00 39.02  ? 316 ASN A OD1 1 
ATOM   1904 N ND2 . ASN A 1 316 ? 50.687 48.128 101.595 1.00 35.42  ? 316 ASN A ND2 1 
ATOM   1905 N N   . GLN A 1 317 ? 50.186 49.943 98.684  1.00 38.21  ? 317 GLN A N   1 
ATOM   1906 C CA  . GLN A 1 317 ? 49.390 49.075 97.825  1.00 36.67  ? 317 GLN A CA  1 
ATOM   1907 C C   . GLN A 1 317 ? 50.020 47.695 97.879  1.00 34.22  ? 317 GLN A C   1 
ATOM   1908 O O   . GLN A 1 317 ? 51.222 47.574 98.103  1.00 34.84  ? 317 GLN A O   1 
ATOM   1909 C CB  . GLN A 1 317 ? 49.444 49.574 96.383  1.00 40.20  ? 317 GLN A CB  1 
ATOM   1910 C CG  . GLN A 1 317 ? 48.140 50.091 95.822  1.00 47.51  ? 317 GLN A CG  1 
ATOM   1911 C CD  . GLN A 1 317 ? 48.308 51.430 95.113  1.00 52.40  ? 317 GLN A CD  1 
ATOM   1912 O OE1 . GLN A 1 317 ? 49.028 51.543 94.118  1.00 54.67  ? 317 GLN A OE1 1 
ATOM   1913 N NE2 . GLN A 1 317 ? 47.640 52.455 95.631  1.00 54.92  ? 317 GLN A NE2 1 
ATOM   1914 N N   . LEU A 1 318 ? 49.219 46.656 97.680  1.00 30.98  ? 318 LEU A N   1 
ATOM   1915 C CA  . LEU A 1 318 ? 49.743 45.296 97.668  1.00 29.42  ? 318 LEU A CA  1 
ATOM   1916 C C   . LEU A 1 318 ? 49.243 44.606 96.427  1.00 29.83  ? 318 LEU A C   1 
ATOM   1917 O O   . LEU A 1 318 ? 48.044 44.396 96.267  1.00 30.60  ? 318 LEU A O   1 
ATOM   1918 C CB  . LEU A 1 318 ? 49.287 44.488 98.885  1.00 29.00  ? 318 LEU A CB  1 
ATOM   1919 C CG  . LEU A 1 318 ? 49.938 44.669 100.260 1.00 27.59  ? 318 LEU A CG  1 
ATOM   1920 C CD1 . LEU A 1 318 ? 49.253 43.751 101.229 1.00 25.97  ? 318 LEU A CD1 1 
ATOM   1921 C CD2 . LEU A 1 318 ? 51.415 44.351 100.213 1.00 27.54  ? 318 LEU A CD2 1 
ATOM   1922 N N   . LEU A 1 319 ? 50.169 44.265 95.542  1.00 31.05  ? 319 LEU A N   1 
ATOM   1923 C CA  . LEU A 1 319 ? 49.839 43.575 94.303  1.00 30.68  ? 319 LEU A CA  1 
ATOM   1924 C C   . LEU A 1 319 ? 49.700 42.086 94.598  1.00 30.28  ? 319 LEU A C   1 
ATOM   1925 O O   . LEU A 1 319 ? 50.424 41.534 95.423  1.00 31.66  ? 319 LEU A O   1 
ATOM   1926 C CB  . LEU A 1 319 ? 50.949 43.803 93.287  1.00 32.14  ? 319 LEU A CB  1 
ATOM   1927 C CG  . LEU A 1 319 ? 51.144 45.279 92.937  1.00 33.14  ? 319 LEU A CG  1 
ATOM   1928 C CD1 . LEU A 1 319 ? 52.466 45.469 92.202  1.00 34.19  ? 319 LEU A CD1 1 
ATOM   1929 C CD2 . LEU A 1 319 ? 49.974 45.755 92.094  1.00 30.39  ? 319 LEU A CD2 1 
ATOM   1930 N N   . PRO A 1 320 ? 48.761 41.413 93.932  1.00 29.00  ? 320 PRO A N   1 
ATOM   1931 C CA  . PRO A 1 320 ? 48.560 39.978 94.157  1.00 27.32  ? 320 PRO A CA  1 
ATOM   1932 C C   . PRO A 1 320 ? 49.695 39.148 93.573  1.00 24.27  ? 320 PRO A C   1 
ATOM   1933 O O   . PRO A 1 320 ? 50.555 39.679 92.886  1.00 23.97  ? 320 PRO A O   1 
ATOM   1934 C CB  . PRO A 1 320 ? 47.239 39.715 93.454  1.00 28.24  ? 320 PRO A CB  1 
ATOM   1935 C CG  . PRO A 1 320 ? 47.333 40.636 92.272  1.00 29.54  ? 320 PRO A CG  1 
ATOM   1936 C CD  . PRO A 1 320 ? 47.845 41.920 92.898  1.00 29.25  ? 320 PRO A CD  1 
ATOM   1937 N N   . VAL A 1 321 ? 49.709 37.854 93.871  1.00 22.41  ? 321 VAL A N   1 
ATOM   1938 C CA  . VAL A 1 321 ? 50.730 36.957 93.331  1.00 22.96  ? 321 VAL A CA  1 
ATOM   1939 C C   . VAL A 1 321 ? 50.073 35.624 93.046  1.00 23.51  ? 321 VAL A C   1 
ATOM   1940 O O   . VAL A 1 321 ? 48.901 35.441 93.345  1.00 25.40  ? 321 VAL A O   1 
ATOM   1941 C CB  . VAL A 1 321 ? 51.910 36.723 94.301  1.00 22.08  ? 321 VAL A CB  1 
ATOM   1942 C CG1 . VAL A 1 321 ? 52.746 37.994 94.438  1.00 20.93  ? 321 VAL A CG1 1 
ATOM   1943 C CG2 . VAL A 1 321 ? 51.391 36.262 95.633  1.00 21.13  ? 321 VAL A CG2 1 
ATOM   1944 N N   . SER A 1 322 ? 50.808 34.689 92.465  1.00 24.58  ? 322 SER A N   1 
ATOM   1945 C CA  . SER A 1 322 ? 50.205 33.401 92.169  1.00 25.20  ? 322 SER A CA  1 
ATOM   1946 C C   . SER A 1 322 ? 51.215 32.292 91.972  1.00 25.61  ? 322 SER A C   1 
ATOM   1947 O O   . SER A 1 322 ? 52.387 32.536 91.707  1.00 24.43  ? 322 SER A O   1 
ATOM   1948 C CB  . SER A 1 322 ? 49.324 33.508 90.929  1.00 24.89  ? 322 SER A CB  1 
ATOM   1949 O OG  . SER A 1 322 ? 50.091 33.894 89.804  1.00 26.18  ? 322 SER A OG  1 
ATOM   1950 N N   . LEU A 1 323 ? 50.722 31.067 92.102  1.00 26.82  ? 323 LEU A N   1 
ATOM   1951 C CA  . LEU A 1 323 ? 51.520 29.864 91.959  1.00 27.55  ? 323 LEU A CA  1 
ATOM   1952 C C   . LEU A 1 323 ? 51.484 29.389 90.518  1.00 29.19  ? 323 LEU A C   1 
ATOM   1953 O O   . LEU A 1 323 ? 50.421 29.300 89.917  1.00 30.42  ? 323 LEU A O   1 
ATOM   1954 C CB  . LEU A 1 323 ? 50.956 28.767 92.854  1.00 26.56  ? 323 LEU A CB  1 
ATOM   1955 C CG  . LEU A 1 323 ? 51.663 27.423 92.765  1.00 26.89  ? 323 LEU A CG  1 
ATOM   1956 C CD1 . LEU A 1 323 ? 53.021 27.545 93.410  1.00 27.13  ? 323 LEU A CD1 1 
ATOM   1957 C CD2 . LEU A 1 323 ? 50.841 26.357 93.458  1.00 27.98  ? 323 LEU A CD2 1 
ATOM   1958 N N   . VAL A 1 324 ? 52.648 29.082 89.967  1.00 30.02  ? 324 VAL A N   1 
ATOM   1959 C CA  . VAL A 1 324 ? 52.737 28.593 88.600  1.00 30.58  ? 324 VAL A CA  1 
ATOM   1960 C C   . VAL A 1 324 ? 53.280 27.170 88.685  1.00 32.91  ? 324 VAL A C   1 
ATOM   1961 O O   . VAL A 1 324 ? 54.489 26.956 88.861  1.00 34.29  ? 324 VAL A O   1 
ATOM   1962 C CB  . VAL A 1 324 ? 53.689 29.470 87.747  1.00 29.63  ? 324 VAL A CB  1 
ATOM   1963 C CG1 . VAL A 1 324 ? 53.761 28.942 86.330  1.00 24.97  ? 324 VAL A CG1 1 
ATOM   1964 C CG2 . VAL A 1 324 ? 53.214 30.916 87.761  1.00 28.10  ? 324 VAL A CG2 1 
ATOM   1965 N N   . LYS A 1 325 ? 52.376 26.200 88.582  1.00 33.54  ? 325 LYS A N   1 
ATOM   1966 C CA  . LYS A 1 325 ? 52.749 24.794 88.656  1.00 33.73  ? 325 LYS A CA  1 
ATOM   1967 C C   . LYS A 1 325 ? 53.447 24.305 87.392  1.00 32.39  ? 325 LYS A C   1 
ATOM   1968 O O   . LYS A 1 325 ? 52.898 24.391 86.300  1.00 32.67  ? 325 LYS A O   1 
ATOM   1969 C CB  . LYS A 1 325 ? 51.505 23.945 88.911  1.00 35.60  ? 325 LYS A CB  1 
ATOM   1970 C CG  . LYS A 1 325 ? 50.779 24.290 90.200  1.00 40.18  ? 325 LYS A CG  1 
ATOM   1971 C CD  . LYS A 1 325 ? 49.522 23.439 90.380  1.00 42.75  ? 325 LYS A CD  1 
ATOM   1972 C CE  . LYS A 1 325 ? 48.685 23.927 91.557  1.00 43.98  ? 325 LYS A CE  1 
ATOM   1973 N NZ  . LYS A 1 325 ? 47.365 23.234 91.628  1.00 45.85  ? 325 LYS A NZ  1 
ATOM   1974 N N   . ARG A 1 326 ? 54.662 23.794 87.537  1.00 31.08  ? 326 ARG A N   1 
ATOM   1975 C CA  . ARG A 1 326 ? 55.388 23.285 86.387  1.00 30.88  ? 326 ARG A CA  1 
ATOM   1976 C C   . ARG A 1 326 ? 55.887 21.862 86.587  1.00 32.78  ? 326 ARG A C   1 
ATOM   1977 O O   . ARG A 1 326 ? 55.127 20.990 86.989  1.00 34.19  ? 326 ARG A O   1 
ATOM   1978 C CB  . ARG A 1 326 ? 56.531 24.233 86.017  1.00 27.98  ? 326 ARG A CB  1 
ATOM   1979 C CG  . ARG A 1 326 ? 56.002 25.450 85.291  1.00 26.10  ? 326 ARG A CG  1 
ATOM   1980 C CD  . ARG A 1 326 ? 57.054 26.478 84.905  1.00 26.12  ? 326 ARG A CD  1 
ATOM   1981 N NE  . ARG A 1 326 ? 56.405 27.606 84.233  1.00 25.79  ? 326 ARG A NE  1 
ATOM   1982 C CZ  . ARG A 1 326 ? 56.779 28.877 84.338  1.00 25.71  ? 326 ARG A CZ  1 
ATOM   1983 N NH1 . ARG A 1 326 ? 57.816 29.212 85.092  1.00 25.88  ? 326 ARG A NH1 1 
ATOM   1984 N NH2 . ARG A 1 326 ? 56.094 29.820 83.705  1.00 26.79  ? 326 ARG A NH2 1 
ATOM   1985 N N   . LYS A 1 327 ? 57.161 21.615 86.335  1.00 34.47  ? 327 LYS A N   1 
ATOM   1986 C CA  . LYS A 1 327 ? 57.669 20.259 86.458  1.00 35.66  ? 327 LYS A CA  1 
ATOM   1987 C C   . LYS A 1 327 ? 58.692 20.018 87.565  1.00 36.69  ? 327 LYS A C   1 
ATOM   1988 O O   . LYS A 1 327 ? 59.506 19.097 87.455  1.00 37.24  ? 327 LYS A O   1 
ATOM   1989 C CB  . LYS A 1 327 ? 58.281 19.848 85.122  1.00 36.71  ? 327 LYS A CB  1 
ATOM   1990 C CG  . LYS A 1 327 ? 57.382 20.080 83.923  1.00 36.55  ? 327 LYS A CG  1 
ATOM   1991 C CD  . LYS A 1 327 ? 56.189 19.145 83.950  1.00 38.53  ? 327 LYS A CD  1 
ATOM   1992 C CE  . LYS A 1 327 ? 55.329 19.326 82.708  1.00 41.05  ? 327 LYS A CE  1 
ATOM   1993 N NZ  . LYS A 1 327 ? 54.088 18.493 82.737  1.00 42.84  ? 327 LYS A NZ  1 
ATOM   1994 N N   . THR A 1 328 ? 58.671 20.822 88.624  1.00 36.80  ? 328 THR A N   1 
ATOM   1995 C CA  . THR A 1 328 ? 59.643 20.628 89.699  1.00 36.72  ? 328 THR A CA  1 
ATOM   1996 C C   . THR A 1 328 ? 59.030 20.274 91.048  1.00 36.83  ? 328 THR A C   1 
ATOM   1997 O O   . THR A 1 328 ? 59.747 20.101 92.039  1.00 35.79  ? 328 THR A O   1 
ATOM   1998 C CB  . THR A 1 328 ? 60.551 21.864 89.877  1.00 37.38  ? 328 THR A CB  1 
ATOM   1999 O OG1 . THR A 1 328 ? 59.755 23.057 89.832  1.00 38.68  ? 328 THR A OG1 1 
ATOM   2000 C CG2 . THR A 1 328 ? 61.630 21.897 88.796  1.00 34.43  ? 328 THR A CG2 1 
ATOM   2001 N N   . THR A 1 329 ? 57.707 20.160 91.089  1.00 36.81  ? 329 THR A N   1 
ATOM   2002 C CA  . THR A 1 329 ? 57.034 19.794 92.327  1.00 37.28  ? 329 THR A CA  1 
ATOM   2003 C C   . THR A 1 329 ? 56.252 18.502 92.146  1.00 37.62  ? 329 THR A C   1 
ATOM   2004 O O   . THR A 1 329 ? 55.493 18.346 91.194  1.00 37.31  ? 329 THR A O   1 
ATOM   2005 C CB  . THR A 1 329 ? 56.084 20.896 92.791  1.00 36.88  ? 329 THR A CB  1 
ATOM   2006 O OG1 . THR A 1 329 ? 55.228 21.270 91.708  1.00 38.22  ? 329 THR A OG1 1 
ATOM   2007 C CG2 . THR A 1 329 ? 56.870 22.105 93.257  1.00 37.24  ? 329 THR A CG2 1 
ATOM   2008 N N   . LEU A 1 330 ? 56.455 17.570 93.067  1.00 38.85  ? 330 LEU A N   1 
ATOM   2009 C CA  . LEU A 1 330 ? 55.776 16.280 93.023  1.00 40.74  ? 330 LEU A CA  1 
ATOM   2010 C C   . LEU A 1 330 ? 55.668 15.761 94.446  1.00 43.11  ? 330 LEU A C   1 
ATOM   2011 O O   . LEU A 1 330 ? 56.266 16.335 95.359  1.00 44.24  ? 330 LEU A O   1 
ATOM   2012 C CB  . LEU A 1 330 ? 56.588 15.278 92.194  1.00 38.72  ? 330 LEU A CB  1 
ATOM   2013 C CG  . LEU A 1 330 ? 56.552 15.282 90.667  1.00 34.60  ? 330 LEU A CG  1 
ATOM   2014 C CD1 . LEU A 1 330 ? 57.711 14.460 90.126  1.00 32.61  ? 330 LEU A CD1 1 
ATOM   2015 C CD2 . LEU A 1 330 ? 55.235 14.721 90.198  1.00 32.95  ? 330 LEU A CD2 1 
ATOM   2016 N N   . ALA A 1 331 ? 54.919 14.676 94.632  1.00 44.66  ? 331 ALA A N   1 
ATOM   2017 C CA  . ALA A 1 331 ? 54.768 14.078 95.956  1.00 46.10  ? 331 ALA A CA  1 
ATOM   2018 C C   . ALA A 1 331 ? 56.082 13.424 96.382  1.00 47.76  ? 331 ALA A C   1 
ATOM   2019 O O   . ALA A 1 331 ? 56.893 13.018 95.548  1.00 46.75  ? 331 ALA A O   1 
ATOM   2020 C CB  . ALA A 1 331 ? 53.658 13.048 95.945  1.00 45.08  ? 331 ALA A CB  1 
ATOM   2021 N N   . PRO A 1 332 ? 56.314 13.322 97.695  1.00 49.77  ? 332 PRO A N   1 
ATOM   2022 C CA  . PRO A 1 332 ? 57.555 12.706 98.164  1.00 52.29  ? 332 PRO A CA  1 
ATOM   2023 C C   . PRO A 1 332 ? 57.573 11.240 97.771  1.00 55.58  ? 332 PRO A C   1 
ATOM   2024 O O   . PRO A 1 332 ? 56.540 10.672 97.417  1.00 54.47  ? 332 PRO A O   1 
ATOM   2025 C CB  . PRO A 1 332 ? 57.484 12.889 99.676  1.00 50.73  ? 332 PRO A CB  1 
ATOM   2026 C CG  . PRO A 1 332 ? 56.591 14.084 99.842  1.00 50.57  ? 332 PRO A CG  1 
ATOM   2027 C CD  . PRO A 1 332 ? 55.524 13.836 98.822  1.00 49.13  ? 332 PRO A CD  1 
ATOM   2028 N N   . ASN A 1 333 ? 58.744 10.624 97.840  1.00 60.74  ? 333 ASN A N   1 
ATOM   2029 C CA  . ASN A 1 333 ? 58.850 9.217  97.490  1.00 66.44  ? 333 ASN A CA  1 
ATOM   2030 C C   . ASN A 1 333 ? 58.826 8.325  98.744  1.00 68.09  ? 333 ASN A C   1 
ATOM   2031 O O   . ASN A 1 333 ? 57.934 7.444  98.823  1.00 69.28  ? 333 ASN A O   1 
ATOM   2032 C CB  . ASN A 1 333 ? 60.129 8.974  96.680  1.00 68.91  ? 333 ASN A CB  1 
ATOM   2033 C CG  . ASN A 1 333 ? 60.110 7.639  95.949  1.00 71.82  ? 333 ASN A CG  1 
ATOM   2034 O OD1 . ASN A 1 333 ? 61.031 7.321  95.193  1.00 73.55  ? 333 ASN A OD1 1 
ATOM   2035 N ND2 . ASN A 1 333 ? 59.055 6.850  96.169  1.00 72.15  ? 333 ASN A ND2 1 
HETATM 2036 C C1  . GOL B 2 .   ? 64.673 39.151 93.702  1.00 38.18  ? 350 GOL A C1  1 
HETATM 2037 O O1  . GOL B 2 .   ? 64.832 38.151 92.704  1.00 36.23  ? 350 GOL A O1  1 
HETATM 2038 C C2  . GOL B 2 .   ? 63.201 39.551 93.812  1.00 40.66  ? 350 GOL A C2  1 
HETATM 2039 O O2  . GOL B 2 .   ? 62.418 38.404 94.096  1.00 38.82  ? 350 GOL A O2  1 
HETATM 2040 C C3  . GOL B 2 .   ? 63.012 40.597 94.920  1.00 45.11  ? 350 GOL A C3  1 
HETATM 2041 O O3  . GOL B 2 .   ? 61.625 40.873 95.122  1.00 48.44  ? 350 GOL A O3  1 
HETATM 2042 O O   . HOH C 3 .   ? 59.260 14.965 95.572  1.00 39.67  ? 351 HOH A O   1 
HETATM 2043 O O   . HOH C 3 .   ? 61.020 19.830 107.470 1.00 33.18  ? 352 HOH A O   1 
HETATM 2044 O O   . HOH C 3 .   ? 62.253 43.435 107.949 1.00 33.15  ? 353 HOH A O   1 
HETATM 2045 O O   . HOH C 3 .   ? 50.690 31.870 112.815 1.00 21.09  ? 354 HOH A O   1 
HETATM 2046 O O   . HOH C 3 .   ? 64.495 34.944 101.720 1.00 32.56  ? 355 HOH A O   1 
HETATM 2047 O O   . HOH C 3 .   ? 69.490 48.735 101.996 1.00 23.63  ? 356 HOH A O   1 
HETATM 2048 O O   . HOH C 3 .   ? 57.464 25.964 111.866 1.00 27.21  ? 357 HOH A O   1 
HETATM 2049 O O   . HOH C 3 .   ? 55.758 38.444 97.110  1.00 33.03  ? 358 HOH A O   1 
HETATM 2050 O O   . HOH C 3 .   ? 65.783 25.917 111.150 0.5  44.65  ? 359 HOH A O   1 
HETATM 2051 O O   . HOH C 3 .   ? 51.681 40.876 102.479 1.00 38.43  ? 360 HOH A O   1 
HETATM 2052 O O   . HOH C 3 .   ? 64.770 31.426 110.727 1.00 30.98  ? 361 HOH A O   1 
HETATM 2053 O O   . HOH C 3 .   ? 69.717 25.077 108.939 1.00 37.52  ? 362 HOH A O   1 
HETATM 2054 O O   . HOH C 3 .   ? 65.565 43.078 97.373  1.00 25.52  ? 363 HOH A O   1 
HETATM 2055 O O   . HOH C 3 .   ? 68.014 43.018 96.066  1.00 21.02  ? 364 HOH A O   1 
HETATM 2056 O O   . HOH C 3 .   ? 65.187 35.589 82.933  1.00 36.15  ? 365 HOH A O   1 
HETATM 2057 O O   . HOH C 3 .   ? 60.617 43.694 95.171  1.00 32.12  ? 366 HOH A O   1 
HETATM 2058 O O   . HOH C 3 .   ? 58.612 36.573 83.255  1.00 20.78  ? 367 HOH A O   1 
HETATM 2059 O O   . HOH C 3 .   ? 64.284 34.608 77.778  1.00 34.02  ? 368 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   LYS 2   2   ?   ?   ?   A . n 
A 1 3   PRO 3   3   ?   ?   ?   A . n 
A 1 4   VAL 4   4   ?   ?   ?   A . n 
A 1 5   THR 5   5   ?   ?   ?   A . n 
A 1 6   LEU 6   6   ?   ?   ?   A . n 
A 1 7   TYR 7   7   ?   ?   ?   A . n 
A 1 8   ASP 8   8   ?   ?   ?   A . n 
A 1 9   VAL 9   9   ?   ?   ?   A . n 
A 1 10  ALA 10  10  ?   ?   ?   A . n 
A 1 11  GLU 11  11  ?   ?   ?   A . n 
A 1 12  TYR 12  12  ?   ?   ?   A . n 
A 1 13  ALA 13  13  ?   ?   ?   A . n 
A 1 14  GLY 14  14  ?   ?   ?   A . n 
A 1 15  VAL 15  15  ?   ?   ?   A . n 
A 1 16  SER 16  16  ?   ?   ?   A . n 
A 1 17  TYR 17  17  ?   ?   ?   A . n 
A 1 18  GLN 18  18  ?   ?   ?   A . n 
A 1 19  THR 19  19  ?   ?   ?   A . n 
A 1 20  VAL 20  20  ?   ?   ?   A . n 
A 1 21  SER 21  21  ?   ?   ?   A . n 
A 1 22  ARG 22  22  ?   ?   ?   A . n 
A 1 23  VAL 23  23  ?   ?   ?   A . n 
A 1 24  VAL 24  24  ?   ?   ?   A . n 
A 1 25  ASN 25  25  ?   ?   ?   A . n 
A 1 26  GLN 26  26  ?   ?   ?   A . n 
A 1 27  ALA 27  27  ?   ?   ?   A . n 
A 1 28  SER 28  28  ?   ?   ?   A . n 
A 1 29  HIS 29  29  ?   ?   ?   A . n 
A 1 30  VAL 30  30  ?   ?   ?   A . n 
A 1 31  SER 31  31  ?   ?   ?   A . n 
A 1 32  ALA 32  32  ?   ?   ?   A . n 
A 1 33  LYS 33  33  ?   ?   ?   A . n 
A 1 34  THR 34  34  ?   ?   ?   A . n 
A 1 35  ARG 35  35  ?   ?   ?   A . n 
A 1 36  GLU 36  36  ?   ?   ?   A . n 
A 1 37  LYS 37  37  ?   ?   ?   A . n 
A 1 38  VAL 38  38  ?   ?   ?   A . n 
A 1 39  GLU 39  39  ?   ?   ?   A . n 
A 1 40  ALA 40  40  ?   ?   ?   A . n 
A 1 41  ALA 41  41  ?   ?   ?   A . n 
A 1 42  MET 42  42  ?   ?   ?   A . n 
A 1 43  ALA 43  43  ?   ?   ?   A . n 
A 1 44  GLU 44  44  ?   ?   ?   A . n 
A 1 45  LEU 45  45  ?   ?   ?   A . n 
A 1 46  ASN 46  46  ?   ?   ?   A . n 
A 1 47  TYR 47  47  ?   ?   ?   A . n 
A 1 48  ILE 48  48  ?   ?   ?   A . n 
A 1 49  PRO 49  49  ?   ?   ?   A . n 
A 1 50  ASN 50  50  ?   ?   ?   A . n 
A 1 51  ARG 51  51  ?   ?   ?   A . n 
A 1 52  VAL 52  52  ?   ?   ?   A . n 
A 1 53  ALA 53  53  ?   ?   ?   A . n 
A 1 54  GLN 54  54  ?   ?   ?   A . n 
A 1 55  GLN 55  55  ?   ?   ?   A . n 
A 1 56  LEU 56  56  ?   ?   ?   A . n 
A 1 57  ALA 57  57  ?   ?   ?   A . n 
A 1 58  GLY 58  58  ?   ?   ?   A . n 
A 1 59  LYS 59  59  ?   ?   ?   A . n 
A 1 60  GLN 60  60  ?   ?   ?   A . n 
A 1 61  SER 61  61  ?   ?   ?   A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  SER 69  69  69  SER SER A . n 
A 1 70  SER 70  70  70  SER SER A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  HIS 74  74  74  HIS HIS A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  GLN 78  78  78  GLN GLN A . n 
A 1 79  ILE 79  79  79  ILE ILE A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  ARG 86  86  86  ARG ARG A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  SER 97  97  97  SER SER A . n 
A 1 98  MET 98  98  98  MET MET A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 ARG 101 101 101 ARG ARG A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 GLY 103 103 103 GLY GLY A . n 
A 1 104 VAL 104 104 104 VAL VAL A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 ALA 106 106 106 ALA ALA A . n 
A 1 107 CYS 107 107 107 CYS CYS A . n 
A 1 108 LYS 108 108 108 LYS LYS A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 ALA 110 110 110 ALA ALA A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 HIS 112 112 112 HIS HIS A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 GLN 117 117 117 GLN GLN A . n 
A 1 118 ARG 118 118 118 ARG ARG A . n 
A 1 119 VAL 119 119 119 VAL VAL A . n 
A 1 120 SER 120 120 120 SER SER A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 ASN 125 125 125 ASN ASN A . n 
A 1 126 TYR 126 126 126 TYR TYR A . n 
A 1 127 PRO 127 127 127 PRO PRO A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 GLN 131 131 131 GLN GLN A . n 
A 1 132 ASP 132 132 132 ASP ASP A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 ILE 134 134 134 ILE ILE A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 GLU 137 137 137 GLU GLU A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 CYS 140 140 140 CYS CYS A . n 
A 1 141 THR 141 141 141 THR THR A . n 
A 1 142 ASN 142 142 142 ASN ASN A . n 
A 1 143 VAL 143 143 143 VAL VAL A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 PHE 147 147 147 PHE PHE A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 ASP 149 149 149 ASP ASP A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 SER 151 151 151 SER SER A . n 
A 1 152 ASP 152 152 152 ASP ASP A . n 
A 1 153 GLN 153 153 153 GLN GLN A . n 
A 1 154 THR 154 154 154 THR THR A . n 
A 1 155 PRO 155 155 155 PRO PRO A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 ASN 157 157 157 ASN ASN A . n 
A 1 158 SER 158 158 158 SER SER A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 ILE 160 160 160 ILE ILE A . n 
A 1 161 PHE 161 161 161 PHE PHE A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 HIS 163 163 163 HIS HIS A . n 
A 1 164 GLU 164 164 164 GLU GLU A . n 
A 1 165 ASP 165 165 165 ASP ASP A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 THR 167 167 167 THR THR A . n 
A 1 168 ARG 168 168 168 ARG ARG A . n 
A 1 169 LEU 169 169 169 LEU LEU A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 GLU 172 172 172 GLU GLU A . n 
A 1 173 HIS 173 173 173 HIS HIS A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 HIS 179 179 179 HIS HIS A . n 
A 1 180 GLN 180 180 180 GLN GLN A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 ILE 182 182 182 ILE ILE A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 LEU 184 184 184 LEU LEU A . n 
A 1 185 LEU 185 185 185 LEU LEU A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 GLY 187 187 187 GLY GLY A . n 
A 1 188 PRO 188 188 188 PRO PRO A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 SER 190 190 190 SER SER A . n 
A 1 191 SER 191 191 191 SER SER A . n 
A 1 192 VAL 192 192 192 VAL VAL A . n 
A 1 193 SER 193 193 193 SER SER A . n 
A 1 194 ALA 194 194 194 ALA ALA A . n 
A 1 195 ARG 195 195 195 ARG ARG A . n 
A 1 196 LEU 196 196 196 LEU LEU A . n 
A 1 197 ARG 197 197 197 ARG ARG A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 GLY 200 200 200 GLY GLY A . n 
A 1 201 TRP 201 201 201 TRP TRP A . n 
A 1 202 HIS 202 202 202 HIS HIS A . n 
A 1 203 LYS 203 203 203 LYS LYS A . n 
A 1 204 TYR 204 204 204 TYR TYR A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 THR 206 206 206 THR THR A . n 
A 1 207 ARG 207 207 207 ARG ARG A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 GLN 209 209 209 GLN GLN A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 GLN 211 211 211 GLN GLN A . n 
A 1 212 PRO 212 212 212 PRO PRO A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 ALA 214 214 214 ALA ALA A . n 
A 1 215 GLU 215 215 215 GLU GLU A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 GLU 217 217 217 GLU GLU A . n 
A 1 218 GLY 218 218 218 GLY GLY A . n 
A 1 219 ASP 219 219 219 ASP ASP A . n 
A 1 220 TRP 220 220 220 TRP TRP A . n 
A 1 221 SER 221 221 221 SER SER A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 MET 223 223 223 MET MET A . n 
A 1 224 SER 224 224 224 SER SER A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 PHE 226 226 226 PHE PHE A . n 
A 1 227 GLN 227 227 227 GLN GLN A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 THR 229 229 229 THR THR A . n 
A 1 230 MET 230 230 230 MET MET A . n 
A 1 231 GLN 231 231 231 GLN GLN A . n 
A 1 232 MET 232 232 232 MET MET A . n 
A 1 233 LEU 233 233 233 LEU LEU A . n 
A 1 234 ASN 234 234 234 ASN ASN A . n 
A 1 235 GLU 235 235 235 GLU GLU A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 ILE 237 237 237 ILE ILE A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 PRO 239 239 239 PRO PRO A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 MET 242 242 242 MET MET A . n 
A 1 243 LEU 243 243 243 LEU LEU A . n 
A 1 244 VAL 244 244 244 VAL VAL A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 ASN 246 246 246 ASN ASN A . n 
A 1 247 ASP 247 247 247 ASP ASP A . n 
A 1 248 GLN 248 248 248 GLN GLN A . n 
A 1 249 MET 249 249 249 MET MET A . n 
A 1 250 ALA 250 250 250 ALA ALA A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 GLY 252 252 252 GLY GLY A . n 
A 1 253 ALA 253 253 253 ALA ALA A . n 
A 1 254 MET 254 254 254 MET MET A . n 
A 1 255 ARG 255 255 255 ARG ARG A . n 
A 1 256 ALA 256 256 256 ALA ALA A . n 
A 1 257 ILE 257 257 257 ILE ILE A . n 
A 1 258 THR 258 258 258 THR THR A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 SER 260 260 260 SER SER A . n 
A 1 261 GLY 261 261 261 GLY GLY A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ARG 263 263 263 ARG ARG A . n 
A 1 264 VAL 264 264 264 VAL VAL A . n 
A 1 265 GLY 265 265 265 GLY GLY A . n 
A 1 266 ALA 266 266 266 ALA ALA A . n 
A 1 267 ASP 267 267 267 ASP ASP A . n 
A 1 268 ILE 268 268 268 ILE ILE A . n 
A 1 269 SER 269 269 269 SER SER A . n 
A 1 270 VAL 270 270 270 VAL VAL A . n 
A 1 271 VAL 271 271 271 VAL VAL A . n 
A 1 272 GLY 272 272 272 GLY GLY A . n 
A 1 273 TYR 273 273 273 TYR TYR A . n 
A 1 274 ASP 274 274 274 ASP ASP A . n 
A 1 275 ASP 275 275 275 ASP ASP A . n 
A 1 276 THR 276 276 276 THR THR A . n 
A 1 277 GLU 277 277 277 GLU GLU A . n 
A 1 278 ASP 278 278 278 ASP ASP A . n 
A 1 279 SER 279 279 279 SER SER A . n 
A 1 280 SER 280 280 280 SER SER A . n 
A 1 281 CYS 281 281 281 CYS CYS A . n 
A 1 282 TYR 282 282 282 TYR TYR A . n 
A 1 283 ILE 283 283 283 ILE ILE A . n 
A 1 284 PRO 284 284 284 PRO PRO A . n 
A 1 285 PRO 285 285 285 PRO PRO A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 THR 287 287 287 THR THR A . n 
A 1 288 THR 288 288 288 THR THR A . n 
A 1 289 ILE 289 289 289 ILE ILE A . n 
A 1 290 LYS 290 290 290 LYS LYS A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 ASP 292 292 292 ASP ASP A . n 
A 1 293 PHE 293 293 293 PHE PHE A . n 
A 1 294 ARG 294 294 294 ARG ARG A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 GLY 297 297 297 GLY GLY A . n 
A 1 298 GLN 298 298 298 GLN GLN A . n 
A 1 299 THR 299 299 299 THR THR A . n 
A 1 300 SER 300 300 300 SER SER A . n 
A 1 301 VAL 301 301 301 VAL VAL A . n 
A 1 302 ASP 302 302 302 ASP ASP A . n 
A 1 303 ARG 303 303 303 ARG ARG A . n 
A 1 304 LEU 304 304 304 LEU LEU A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLN 306 306 306 GLN GLN A . n 
A 1 307 LEU 307 307 307 LEU LEU A . n 
A 1 308 SER 308 308 308 SER SER A . n 
A 1 309 GLN 309 309 309 GLN GLN A . n 
A 1 310 GLY 310 310 310 GLY GLY A . n 
A 1 311 GLN 311 311 311 GLN GLN A . n 
A 1 312 ALA 312 312 312 ALA ALA A . n 
A 1 313 VAL 313 313 313 VAL VAL A . n 
A 1 314 LYS 314 314 314 LYS LYS A . n 
A 1 315 GLY 315 315 315 GLY GLY A . n 
A 1 316 ASN 316 316 316 ASN ASN A . n 
A 1 317 GLN 317 317 317 GLN GLN A . n 
A 1 318 LEU 318 318 318 LEU LEU A . n 
A 1 319 LEU 319 319 319 LEU LEU A . n 
A 1 320 PRO 320 320 320 PRO PRO A . n 
A 1 321 VAL 321 321 321 VAL VAL A . n 
A 1 322 SER 322 322 322 SER SER A . n 
A 1 323 LEU 323 323 323 LEU LEU A . n 
A 1 324 VAL 324 324 324 VAL VAL A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ARG 326 326 326 ARG ARG A . n 
A 1 327 LYS 327 327 327 LYS LYS A . n 
A 1 328 THR 328 328 328 THR THR A . n 
A 1 329 THR 329 329 329 THR THR A . n 
A 1 330 LEU 330 330 330 LEU LEU A . n 
A 1 331 ALA 331 331 331 ALA ALA A . n 
A 1 332 PRO 332 332 332 PRO PRO A . n 
A 1 333 ASN 333 333 333 ASN ASN A . n 
A 1 334 THR 334 334 ?   ?   ?   A . n 
A 1 335 GLN 335 335 ?   ?   ?   A . n 
A 1 336 THR 336 336 ?   ?   ?   A . n 
A 1 337 ALA 337 337 ?   ?   ?   A . n 
A 1 338 SER 338 338 ?   ?   ?   A . n 
A 1 339 PRO 339 339 ?   ?   ?   A . n 
A 1 340 ARG 340 340 ?   ?   ?   A . n 
A 1 341 ALA 341 341 ?   ?   ?   A . n 
A 1 342 LEU 342 342 ?   ?   ?   A . n 
A 1 343 ALA 343 343 ?   ?   ?   A . n 
A 1 344 ASP 344 344 ?   ?   ?   A . n 
A 1 345 SER 345 345 ?   ?   ?   A . n 
A 1 346 LEU 346 346 ?   ?   ?   A . n 
A 1 347 MET 347 347 ?   ?   ?   A . n 
A 1 348 GLN 348 348 ?   ?   ?   A . n 
A 1 349 LEU 349 349 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 GOL 1  350 1  GOL GLL A . 
C 3 HOH 1  351 1  HOH WAT A . 
C 3 HOH 2  352 2  HOH WAT A . 
C 3 HOH 3  353 3  HOH WAT A . 
C 3 HOH 4  354 4  HOH WAT A . 
C 3 HOH 5  355 5  HOH WAT A . 
C 3 HOH 6  356 6  HOH WAT A . 
C 3 HOH 7  357 7  HOH WAT A . 
C 3 HOH 8  358 8  HOH WAT A . 
C 3 HOH 9  359 9  HOH WAT A . 
C 3 HOH 10 360 10 HOH WAT A . 
C 3 HOH 11 361 11 HOH WAT A . 
C 3 HOH 12 362 12 HOH WAT A . 
C 3 HOH 13 363 13 HOH WAT A . 
C 3 HOH 14 364 14 HOH WAT A . 
C 3 HOH 15 365 15 HOH WAT A . 
C 3 HOH 16 366 16 HOH WAT A . 
C 3 HOH 17 367 17 HOH WAT A . 
C 3 HOH 18 368 18 HOH WAT A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3620  ? 
1 MORE         -25   ? 
1 'SSA (A^2)'  20330 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z           1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 5_655 -x+3/2,y,-z+3/4 -1.0000000000 0.0000000000 0.0000000000 137.5500000000 0.0000000000 
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 166.7250000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     359 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   C 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-10-18 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2011-11-16 
5 'Structure model' 1 4 2021-04-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Atomic model'              
5 5 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' pdbx_struct_assembly      
2 5 'Structure model' pdbx_struct_assembly_gen  
3 5 'Structure model' pdbx_struct_assembly_prop 
4 5 'Structure model' pdbx_struct_oper_list     
5 5 'Structure model' struct_site               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_pdbx_struct_assembly_prop.biol_id' 
2 5 'Structure model' '_struct_site.pdbx_auth_asym_id'     
3 5 'Structure model' '_struct_site.pdbx_auth_comp_id'     
4 5 'Structure model' '_struct_site.pdbx_auth_seq_id'      
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE  phasing          .         ? 1 
CNS    refinement       1.0       ? 2 
MOSFLM 'data reduction' .         ? 3 
CCP4   'data scaling'   '(SCALA)' ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 100 ? ? -62.19  34.00   
2  1 ARG A 101 ? ? 80.11   -141.48 
3  1 THR A 141 ? ? 1.29    85.10   
4  1 ASN A 142 ? ? 69.10   -72.21  
5  1 VAL A 143 ? ? -23.39  127.75  
6  1 SER A 162 ? ? -68.62  99.32   
7  1 GLN A 180 ? ? -143.49 -31.41  
8  1 ALA A 214 ? ? 169.00  145.99  
9  1 TRP A 220 ? ? 84.00   -22.26  
10 1 GLU A 259 ? ? -67.27  3.90    
11 1 ASP A 274 ? ? 116.88  -57.78  
12 1 ASP A 275 ? ? 76.24   56.83   
13 1 ASP A 292 ? ? -57.83  83.74   
14 1 GLN A 311 ? ? -146.02 38.28   
15 1 LYS A 314 ? ? -102.03 41.90   
16 1 ARG A 326 ? ? -127.06 -129.39 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A LYS 2   ? A LYS 2   
3  1 Y 1 A PRO 3   ? A PRO 3   
4  1 Y 1 A VAL 4   ? A VAL 4   
5  1 Y 1 A THR 5   ? A THR 5   
6  1 Y 1 A LEU 6   ? A LEU 6   
7  1 Y 1 A TYR 7   ? A TYR 7   
8  1 Y 1 A ASP 8   ? A ASP 8   
9  1 Y 1 A VAL 9   ? A VAL 9   
10 1 Y 1 A ALA 10  ? A ALA 10  
11 1 Y 1 A GLU 11  ? A GLU 11  
12 1 Y 1 A TYR 12  ? A TYR 12  
13 1 Y 1 A ALA 13  ? A ALA 13  
14 1 Y 1 A GLY 14  ? A GLY 14  
15 1 Y 1 A VAL 15  ? A VAL 15  
16 1 Y 1 A SER 16  ? A SER 16  
17 1 Y 1 A TYR 17  ? A TYR 17  
18 1 Y 1 A GLN 18  ? A GLN 18  
19 1 Y 1 A THR 19  ? A THR 19  
20 1 Y 1 A VAL 20  ? A VAL 20  
21 1 Y 1 A SER 21  ? A SER 21  
22 1 Y 1 A ARG 22  ? A ARG 22  
23 1 Y 1 A VAL 23  ? A VAL 23  
24 1 Y 1 A VAL 24  ? A VAL 24  
25 1 Y 1 A ASN 25  ? A ASN 25  
26 1 Y 1 A GLN 26  ? A GLN 26  
27 1 Y 1 A ALA 27  ? A ALA 27  
28 1 Y 1 A SER 28  ? A SER 28  
29 1 Y 1 A HIS 29  ? A HIS 29  
30 1 Y 1 A VAL 30  ? A VAL 30  
31 1 Y 1 A SER 31  ? A SER 31  
32 1 Y 1 A ALA 32  ? A ALA 32  
33 1 Y 1 A LYS 33  ? A LYS 33  
34 1 Y 1 A THR 34  ? A THR 34  
35 1 Y 1 A ARG 35  ? A ARG 35  
36 1 Y 1 A GLU 36  ? A GLU 36  
37 1 Y 1 A LYS 37  ? A LYS 37  
38 1 Y 1 A VAL 38  ? A VAL 38  
39 1 Y 1 A GLU 39  ? A GLU 39  
40 1 Y 1 A ALA 40  ? A ALA 40  
41 1 Y 1 A ALA 41  ? A ALA 41  
42 1 Y 1 A MET 42  ? A MET 42  
43 1 Y 1 A ALA 43  ? A ALA 43  
44 1 Y 1 A GLU 44  ? A GLU 44  
45 1 Y 1 A LEU 45  ? A LEU 45  
46 1 Y 1 A ASN 46  ? A ASN 46  
47 1 Y 1 A TYR 47  ? A TYR 47  
48 1 Y 1 A ILE 48  ? A ILE 48  
49 1 Y 1 A PRO 49  ? A PRO 49  
50 1 Y 1 A ASN 50  ? A ASN 50  
51 1 Y 1 A ARG 51  ? A ARG 51  
52 1 Y 1 A VAL 52  ? A VAL 52  
53 1 Y 1 A ALA 53  ? A ALA 53  
54 1 Y 1 A GLN 54  ? A GLN 54  
55 1 Y 1 A GLN 55  ? A GLN 55  
56 1 Y 1 A LEU 56  ? A LEU 56  
57 1 Y 1 A ALA 57  ? A ALA 57  
58 1 Y 1 A GLY 58  ? A GLY 58  
59 1 Y 1 A LYS 59  ? A LYS 59  
60 1 Y 1 A GLN 60  ? A GLN 60  
61 1 Y 1 A SER 61  ? A SER 61  
62 1 Y 1 A THR 334 ? A THR 334 
63 1 Y 1 A GLN 335 ? A GLN 335 
64 1 Y 1 A THR 336 ? A THR 336 
65 1 Y 1 A ALA 337 ? A ALA 337 
66 1 Y 1 A SER 338 ? A SER 338 
67 1 Y 1 A PRO 339 ? A PRO 339 
68 1 Y 1 A ARG 340 ? A ARG 340 
69 1 Y 1 A ALA 341 ? A ALA 341 
70 1 Y 1 A LEU 342 ? A LEU 342 
71 1 Y 1 A ALA 343 ? A ALA 343 
72 1 Y 1 A ASP 344 ? A ASP 344 
73 1 Y 1 A SER 345 ? A SER 345 
74 1 Y 1 A LEU 346 ? A LEU 346 
75 1 Y 1 A MET 347 ? A MET 347 
76 1 Y 1 A GLN 348 ? A GLN 348 
77 1 Y 1 A LEU 349 ? A LEU 349 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 GLYCEROL GOL 
3 water    HOH 
#