data_1K3X
# 
_entry.id   1K3X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1K3X         
NDB   PD0254       
RCSB  RCSB014529   
WWPDB D_1000014529 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1K3X 
_pdbx_database_status.recvd_initial_deposition_date   2001-10-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Golan, G.'       1 
'Zharkov, D.O.'   2 
'Gilboa, R.'      3 
'Fernandes, A.S.' 4 
'Kycia, J.H.'     5 
'Gerchman, S.E.'  6 
'Rieger, R.A.'    7 
'Grollman, A.P.'  8 
'Shoham, G.'      9 
# 
_citation.id                        primary 
_citation.title                     'Structural analysis of an Escherichia coli endonuclease VIII covalent reaction intermediate.' 
_citation.journal_abbrev            'EMBO J.' 
_citation.journal_volume            21 
_citation.page_first                789 
_citation.page_last                 800 
_citation.year                      2002 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11847126 
_citation.pdbx_database_id_DOI      10.1093/emboj/21.4.789 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zharkov, D.O.'   1 
primary 'Golan, G.'       2 
primary 'Gilboa, R.'      3 
primary 'Fernandes, A.S.' 4 
primary 'Gerchman, S.E.'  5 
primary 'Kycia, J.H.'     6 
primary 'Rieger, R.A.'    7 
primary 'Grollman, A.P.'  8 
primary 'Shoham, G.'      9 
# 
_cell.entry_id           1K3X 
_cell.length_a           76.495 
_cell.length_b           76.495 
_cell.length_c           164.310 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1K3X 
_symmetry.space_group_name_H-M             'P 43 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                95 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*GP*GP*CP*(BRU)P*(BRU)P*CP*AP*(BRU)P*CP*CP*(BRU)P*GP*G)-3'" 4218.051  1   ?       ? ? ? 
2 polymer     syn "5'-D(*CP*CP*AP*GP*GP*AP*(PED)P*GP*AP*AP*GP*CP*C)-3'"             3863.531  1   ?       ? ? ? 
3 polymer     man 'Endonuclease VIII'                                               29814.994 1   3.2.2.- ? ? ? 
4 non-polymer syn 'ZINC ION'                                                        65.409    1   ?       ? ? ? 
5 non-polymer syn 'SULFATE ION'                                                     96.063    5   ?       ? ? ? 
6 non-polymer syn GLYCEROL                                                          92.094    4   ?       ? ? ? 
7 water       nat water                                                             18.015    488 ?       ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes '(DG)(DG)(DC)(BRU)(BRU)(DC)(DA)(BRU)(DC)(DC)(BRU)(DG)(DG)' GGCUUCAUCCUGG B ? 
2 polydeoxyribonucleotide no yes '(DC)(DC)(DA)(DG)(DG)(DA)(PED)(DG)(DA)(DA)(DG)(DC)(DC)' CCAGGAXGAAGCC C ? 
3 'polypeptide(L)'        no no  
;PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTG
EEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQ
AFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQVDENKHHGALFRFKVFHRDGEPCERC
GSIIEKTTLSSRPFYWCPGCQH
;
;PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTG
EEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQ
AFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQVDENKHHGALFRFKVFHRDGEPCERC
GSIIEKTTLSSRPFYWCPGCQH
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DG  n 
1 3   DC  n 
1 4   BRU n 
1 5   BRU n 
1 6   DC  n 
1 7   DA  n 
1 8   BRU n 
1 9   DC  n 
1 10  DC  n 
1 11  BRU n 
1 12  DG  n 
1 13  DG  n 
2 1   DC  n 
2 2   DC  n 
2 3   DA  n 
2 4   DG  n 
2 5   DG  n 
2 6   DA  n 
2 7   PED n 
2 8   DG  n 
2 9   DA  n 
2 10  DA  n 
2 11  DG  n 
2 12  DC  n 
2 13  DC  n 
3 1   PRO n 
3 2   GLU n 
3 3   GLY n 
3 4   PRO n 
3 5   GLU n 
3 6   ILE n 
3 7   ARG n 
3 8   ARG n 
3 9   ALA n 
3 10  ALA n 
3 11  ASP n 
3 12  ASN n 
3 13  LEU n 
3 14  GLU n 
3 15  ALA n 
3 16  ALA n 
3 17  ILE n 
3 18  LYS n 
3 19  GLY n 
3 20  LYS n 
3 21  PRO n 
3 22  LEU n 
3 23  THR n 
3 24  ASP n 
3 25  VAL n 
3 26  TRP n 
3 27  PHE n 
3 28  ALA n 
3 29  PHE n 
3 30  PRO n 
3 31  GLN n 
3 32  LEU n 
3 33  LYS n 
3 34  THR n 
3 35  TYR n 
3 36  GLN n 
3 37  SER n 
3 38  GLN n 
3 39  LEU n 
3 40  ILE n 
3 41  GLY n 
3 42  GLN n 
3 43  HIS n 
3 44  VAL n 
3 45  THR n 
3 46  HIS n 
3 47  VAL n 
3 48  GLU n 
3 49  THR n 
3 50  ARG n 
3 51  GLY n 
3 52  LYS n 
3 53  ALA n 
3 54  LEU n 
3 55  LEU n 
3 56  THR n 
3 57  HIS n 
3 58  PHE n 
3 59  SER n 
3 60  ASN n 
3 61  ASP n 
3 62  LEU n 
3 63  THR n 
3 64  LEU n 
3 65  TYR n 
3 66  SER n 
3 67  HIS n 
3 68  ASN n 
3 69  GLN n 
3 70  LEU n 
3 71  TYR n 
3 72  GLY n 
3 73  VAL n 
3 74  TRP n 
3 75  ARG n 
3 76  VAL n 
3 77  VAL n 
3 78  ASP n 
3 79  THR n 
3 80  GLY n 
3 81  GLU n 
3 82  GLU n 
3 83  PRO n 
3 84  GLN n 
3 85  THR n 
3 86  THR n 
3 87  ARG n 
3 88  VAL n 
3 89  LEU n 
3 90  ARG n 
3 91  VAL n 
3 92  LYS n 
3 93  LEU n 
3 94  GLN n 
3 95  THR n 
3 96  ALA n 
3 97  ASP n 
3 98  LYS n 
3 99  THR n 
3 100 ILE n 
3 101 LEU n 
3 102 LEU n 
3 103 TYR n 
3 104 SER n 
3 105 ALA n 
3 106 SER n 
3 107 ASP n 
3 108 ILE n 
3 109 GLU n 
3 110 MET n 
3 111 LEU n 
3 112 ARG n 
3 113 PRO n 
3 114 GLU n 
3 115 GLN n 
3 116 LEU n 
3 117 THR n 
3 118 THR n 
3 119 HIS n 
3 120 PRO n 
3 121 PHE n 
3 122 LEU n 
3 123 GLN n 
3 124 ARG n 
3 125 VAL n 
3 126 GLY n 
3 127 PRO n 
3 128 ASP n 
3 129 VAL n 
3 130 LEU n 
3 131 ASP n 
3 132 PRO n 
3 133 ASN n 
3 134 LEU n 
3 135 THR n 
3 136 PRO n 
3 137 GLU n 
3 138 VAL n 
3 139 VAL n 
3 140 LYS n 
3 141 GLU n 
3 142 ARG n 
3 143 LEU n 
3 144 LEU n 
3 145 SER n 
3 146 PRO n 
3 147 ARG n 
3 148 PHE n 
3 149 ARG n 
3 150 ASN n 
3 151 ARG n 
3 152 GLN n 
3 153 PHE n 
3 154 ALA n 
3 155 GLY n 
3 156 LEU n 
3 157 LEU n 
3 158 LEU n 
3 159 ASP n 
3 160 GLN n 
3 161 ALA n 
3 162 PHE n 
3 163 LEU n 
3 164 ALA n 
3 165 GLY n 
3 166 LEU n 
3 167 GLY n 
3 168 ASN n 
3 169 TYR n 
3 170 LEU n 
3 171 ARG n 
3 172 VAL n 
3 173 GLU n 
3 174 ILE n 
3 175 LEU n 
3 176 TRP n 
3 177 GLN n 
3 178 VAL n 
3 179 GLY n 
3 180 LEU n 
3 181 THR n 
3 182 GLY n 
3 183 ASN n 
3 184 HIS n 
3 185 LYS n 
3 186 ALA n 
3 187 LYS n 
3 188 ASP n 
3 189 LEU n 
3 190 ASN n 
3 191 ALA n 
3 192 ALA n 
3 193 GLN n 
3 194 LEU n 
3 195 ASP n 
3 196 ALA n 
3 197 LEU n 
3 198 ALA n 
3 199 HIS n 
3 200 ALA n 
3 201 LEU n 
3 202 LEU n 
3 203 GLU n 
3 204 ILE n 
3 205 PRO n 
3 206 ARG n 
3 207 PHE n 
3 208 SER n 
3 209 TYR n 
3 210 ALA n 
3 211 THR n 
3 212 ARG n 
3 213 GLY n 
3 214 GLN n 
3 215 VAL n 
3 216 ASP n 
3 217 GLU n 
3 218 ASN n 
3 219 LYS n 
3 220 HIS n 
3 221 HIS n 
3 222 GLY n 
3 223 ALA n 
3 224 LEU n 
3 225 PHE n 
3 226 ARG n 
3 227 PHE n 
3 228 LYS n 
3 229 VAL n 
3 230 PHE n 
3 231 HIS n 
3 232 ARG n 
3 233 ASP n 
3 234 GLY n 
3 235 GLU n 
3 236 PRO n 
3 237 CYS n 
3 238 GLU n 
3 239 ARG n 
3 240 CYS n 
3 241 GLY n 
3 242 SER n 
3 243 ILE n 
3 244 ILE n 
3 245 GLU n 
3 246 LYS n 
3 247 THR n 
3 248 THR n 
3 249 LEU n 
3 250 SER n 
3 251 SER n 
3 252 ARG n 
3 253 PRO n 
3 254 PHE n 
3 255 TYR n 
3 256 TRP n 
3 257 CYS n 
3 258 PRO n 
3 259 GLY n 
3 260 CYS n 
3 261 GLN n 
3 262 HIS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 nei 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP END8_ECOLI 3 
;PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKPYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTG
EEPQTTRVLRVKLQTADKTILLYSASDIEMLTPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQ
AFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQVDENKHHGALFRFKVFHRDGEPCERC
GSIIEKTTLSSRPFYWCPGCQH
;
1 P50465 ? 
2 PDB 1K3X       1 ? ? 1K3X   ? 
3 PDB 1K3X       2 ? ? 1K3X   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1K3X A 1 ? 262 ? P50465 1   ? 262 ? 1   262 
2 2 1K3X B 1 ? 13  ? 1K3X   401 ? 413 ? 401 413 
3 3 1K3X C 1 ? 13  ? 1K3X   421 ? 433 ? 421 433 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1K3X THR A 34  ? UNP P50465 PRO 34  'SEE REMARK 999' 34  1 
1 1K3X ARG A 112 ? UNP P50465 THR 112 'SEE REMARK 999' 112 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                    ?                                                     
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                   ?                                                     
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                 ?                                                     
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                            ?                                                     
'C4 H7 N O4'        133.103 
BRU 'DNA linking'       n "5-BROMO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" ?                                                     
'C9 H12 Br N2 O8 P' 387.078 
CYS 'L-peptide linking' y CYSTEINE                                   ?                                                     
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"       ?                                                     
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"        ?                                                     
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"       ?                                                     
'C10 H14 N5 O7 P'   347.221 
GLN 'L-peptide linking' y GLUTAMINE                                  ?                                                     
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                            ?                                                     
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                    ?                                                     
'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                                   'GLYCERIN; PROPANE-1,2,3-TRIOL'                       
'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                                  ?                                                     
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                      ?                                                     'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                 ?                                                     
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                    ?                                                     
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                     ?                                                     
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                 ?                                                     
'C5 H11 N O2 S'     149.211 
PED non-polymer         . PENTANE-3,4-DIOL-5-PHOSPHATE               
;OPEN FORM OF 1'-2'-DIDEOXYRIBOFURANOSE-5'-PHOSPHATE
;
'C5 H13 O6 P'       200.127 
PHE 'L-peptide linking' y PHENYLALANINE                              ?                                                     
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                    ?                                                     
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                     ?                                                     
'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'                              ?                                                     
'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                                  ?                                                     
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                 ?                                                     
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                   ?                                                     
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                     ?                                                     
'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                                 ?                                                     'Zn 2' 
65.409  
# 
_exptl.entry_id          1K3X 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.99 
_exptl_crystal.density_percent_sol   61.11 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            288 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'1.8M Ammonium-Sulfate, 0.1M Sodium-citrate pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 288K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 Ammonium-Sulfate ? ? ? 
1 2 1 Sodium-citrate   ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'BRANDEIS - B4' 
_diffrn_detector.pdbx_collection_date   2001-05-29 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.92 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             0.92 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1K3X 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.0 
_reflns.d_resolution_high            1.25 
_reflns.number_obs                   131559 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.06 
_reflns.pdbx_netI_over_sigmaI        9.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.5 
_reflns.R_free_details               ? 
_reflns.limit_h_min                  ? 
_reflns.observed_criterion_F_min     ? 
_reflns.limit_h_max                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.25 
_reflns_shell.d_res_low              1.27 
_reflns_shell.percent_possible_all   91.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.34 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        7.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1K3X 
_refine.ls_number_reflns_obs                     120771 
_refine.ls_number_reflns_all                     120771 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             10.00 
_refine.ls_d_res_high                            1.25 
_refine.ls_percent_reflns_obs                    97.4 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1491 
_refine.ls_R_factor_R_free                       0.1807 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.3 
_refine.ls_number_reflns_R_free                  6452 
_refine.ls_number_parameters                     26922 
_refine.ls_number_restraints                     32739 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               'FREE R' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'pdb entry 1k3w' 
_refine.pdbx_method_to_determine_struct          'AB INITIO PHASING' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1K3X 
_refine_analyze.Luzzati_coordinate_error_obs    0.06 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      8 
_refine_analyze.occupancy_sum_hydrogen          0.00 
_refine_analyze.occupancy_sum_non_hydrogen      2941.52 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2023 
_refine_hist.pdbx_number_atoms_nucleic_acid   401 
_refine_hist.pdbx_number_atoms_ligand         50 
_refine_hist.number_atoms_solvent             488 
_refine_hist.number_atoms_total               2962 
_refine_hist.d_res_high                       1.25 
_refine_hist.d_res_low                        10.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.016  ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.040  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.0271 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.100  ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.097  ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.027  ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.005  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.059  ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      0.104  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.25 
_refine_ls_shell.d_res_low                        1.27 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.1491 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.1807 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5.3 
_refine_ls_shell.number_reflns_R_free             6452 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_pdbx_refine.entry_id                                    1K3X 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      0.1491 
_pdbx_refine.free_R_factor_no_cutoff                     0.1807 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     5.3 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            6452 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.1445 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.1751 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   5.3 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          5614 
_pdbx_refine.number_reflns_obs_4sig_cutoff               105531 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1K3X 
_struct.title                     
'Crystal structure of a trapped reaction intermediate of the DNA repair enzyme Endonuclease VIII with Brominated-DNA' 
_struct.pdbx_descriptor           'ENDONUCLEASE VIII (E.C.3.2.-.-)/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1K3X 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
_struct_keywords.text            'HYDROLASE/DNA, HYDROLASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 6 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 7 ? 
O N N 7 ? 
P N N 7 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU C 2   ? LYS C 18  ? GLU A 2   LYS A 18  1 ? 17 
HELX_P HELX_P2  2  PHE C 29  ? LYS C 33  ? PHE A 29  LYS A 33  5 ? 5  
HELX_P HELX_P3  3  THR C 34  ? ILE C 40  ? THR A 34  ILE A 40  1 ? 7  
HELX_P HELX_P4  4  GLU C 114 ? HIS C 119 ? GLU A 114 HIS A 119 1 ? 6  
HELX_P HELX_P5  5  HIS C 119 ? VAL C 125 ? HIS A 119 VAL A 125 1 ? 7  
HELX_P HELX_P6  6  THR C 135 ? SER C 145 ? THR A 135 SER A 145 1 ? 11 
HELX_P HELX_P7  7  GLN C 152 ? LEU C 157 ? GLN A 152 LEU A 157 1 ? 6  
HELX_P HELX_P8  8  GLY C 167 ? GLY C 179 ? GLY A 167 GLY A 179 1 ? 13 
HELX_P HELX_P9  9  LYS C 185 ? LEU C 189 ? LYS A 185 LEU A 189 5 ? 5  
HELX_P HELX_P10 10 ASN C 190 ? ARG C 212 ? ASN A 190 ARG A 212 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B DA  6  "O3'" ? ? ? 1_555 B PED 7   P  ? ? C DA  426 C PED 427 1_555 ? ? ? ? ? ? ?            1.610 ? 
covale2  covale ? ? B PED 7  "O3'" ? ? ? 1_555 B DG  8   P  ? ? C PED 427 C DG  428 1_555 ? ? ? ? ? ? ?            1.597 ? 
covale3  covale ? ? B PED 7  "C1'" ? ? ? 1_555 C PRO 1   N  ? ? C PED 427 A PRO 1   1_555 ? ? ? ? ? ? ?            1.404 ? 
metalc1  metalc ? ? D ZN  .  ZN    ? ? ? 1_555 C CYS 237 SG ? ? A ZN  501 A CYS 237 1_555 ? ? ? ? ? ? ?            2.362 ? 
metalc2  metalc ? ? D ZN  .  ZN    ? ? ? 1_555 C CYS 240 SG ? ? A ZN  501 A CYS 240 1_555 ? ? ? ? ? ? ?            2.312 ? 
metalc3  metalc ? ? D ZN  .  ZN    ? ? ? 1_555 C CYS 257 SG ? ? A ZN  501 A CYS 257 1_555 ? ? ? ? ? ? ?            2.332 ? 
metalc4  metalc ? ? D ZN  .  ZN    ? ? ? 1_555 C CYS 260 SG ? ? A ZN  501 A CYS 260 1_555 ? ? ? ? ? ? ?            2.305 ? 
covale4  covale ? ? A DC  3  "O3'" ? ? ? 1_555 A BRU 4   P  ? ? B DC  403 B BRU 404 1_555 ? ? ? ? ? ? ?            1.632 ? 
covale5  covale ? ? A BRU 4  "O3'" ? ? ? 1_555 A BRU 5   P  ? ? B BRU 404 B BRU 405 1_555 ? ? ? ? ? ? ?            1.635 ? 
covale6  covale ? ? A BRU 5  "O3'" ? ? ? 1_555 A DC  6   P  ? ? B BRU 405 B DC  406 1_555 ? ? ? ? ? ? ?            1.588 ? 
covale7  covale ? ? A DA  7  "O3'" ? ? ? 1_555 A BRU 8   P  ? ? B DA  407 B BRU 408 1_555 ? ? ? ? ? ? ?            1.621 ? 
covale8  covale ? ? A BRU 8  "O3'" ? ? ? 1_555 A DC  9   P  ? ? B BRU 408 B DC  409 1_555 ? ? ? ? ? ? ?            1.616 ? 
covale9  covale ? ? A DC  10 "O3'" ? ? ? 1_555 A BRU 11  P  ? ? B DC  410 B BRU 411 1_555 ? ? ? ? ? ? ?            1.626 ? 
covale10 covale ? ? A BRU 11 "O3'" ? ? ? 1_555 A DG  12  P  ? ? B BRU 411 B DG  412 1_555 ? ? ? ? ? ? ?            1.635 ? 
hydrog1  hydrog ? ? A DC  3  N3    ? ? ? 1_555 B DG  11  N1 ? ? B DC  403 C DG  431 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DC  3  N4    ? ? ? 1_555 B DG  11  O6 ? ? B DC  403 C DG  431 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DC  3  O2    ? ? ? 1_555 B DG  11  N2 ? ? B DC  403 C DG  431 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A BRU 4  N3    ? ? ? 1_555 B DA  10  N1 ? ? B BRU 404 C DA  430 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A BRU 4  O4    ? ? ? 1_555 B DA  10  N6 ? ? B BRU 404 C DA  430 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A BRU 5  N3    ? ? ? 1_555 B DA  9   N1 ? ? B BRU 405 C DA  429 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A BRU 5  O4    ? ? ? 1_555 B DA  9   N6 ? ? B BRU 405 C DA  429 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DC  6  N3    ? ? ? 1_555 B DG  8   N1 ? ? B DC  406 C DG  428 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DC  6  N4    ? ? ? 1_555 B DG  8   O6 ? ? B DC  406 C DG  428 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DC  6  O2    ? ? ? 1_555 B DG  8   N2 ? ? B DC  406 C DG  428 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A BRU 8  N3    ? ? ? 1_555 B DA  6   N1 ? ? B BRU 408 C DA  426 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A BRU 8  O4    ? ? ? 1_555 B DA  6   N6 ? ? B BRU 408 C DA  426 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DC  9  N3    ? ? ? 1_555 B DG  5   N1 ? ? B DC  409 C DG  425 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DC  9  N4    ? ? ? 1_555 B DG  5   O6 ? ? B DC  409 C DG  425 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DC  9  O2    ? ? ? 1_555 B DG  5   N2 ? ? B DC  409 C DG  425 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DC  10 N3    ? ? ? 1_555 B DG  4   N1 ? ? B DC  410 C DG  424 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DC  10 N4    ? ? ? 1_555 B DG  4   O6 ? ? B DC  410 C DG  424 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DC  10 O2    ? ? ? 1_555 B DG  4   N2 ? ? B DC  410 C DG  424 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A BRU 11 N3    ? ? ? 1_555 B DA  3   N1 ? ? B BRU 411 C DA  423 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A BRU 11 O4    ? ? ? 1_555 B DA  3   N6 ? ? B BRU 411 C DA  423 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DG  12 N1    ? ? ? 1_555 B DC  2   N3 ? ? B DG  412 C DC  422 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DG  12 N2    ? ? ? 1_555 B DC  2   O2 ? ? B DG  412 C DC  422 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DG  12 O6    ? ? ? 1_555 B DC  2   N4 ? ? B DG  412 C DC  422 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASP C 24  ? PHE C 27  ? ASP A 24  PHE A 27  
A 2 LEU C 89  ? GLN C 94  ? LEU A 89  GLN A 94  
A 3 LYS C 98  ? TYR C 103 ? LYS A 98  TYR A 103 
A 4 VAL C 73  ? ASP C 78  ? VAL A 73  ASP A 78  
B 1 VAL C 44  ? ARG C 50  ? VAL A 44  ARG A 50  
B 2 ALA C 53  ? PHE C 58  ? ALA A 53  PHE A 58  
B 3 THR C 63  ? HIS C 67  ? THR A 63  HIS A 67  
B 4 ASP C 107 ? LEU C 111 ? ASP A 107 LEU A 111 
C 1 GLU C 245 ? LEU C 249 ? GLU A 245 LEU A 249 
C 2 ARG C 252 ? TRP C 256 ? ARG A 252 TRP A 256 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASP C 24  ? N ASP A 24  O GLN C 94  ? O GLN A 94  
A 2 3 N LEU C 93  ? N LEU A 93  O ILE C 100 ? O ILE A 100 
A 3 4 O TYR C 103 ? O TYR A 103 N VAL C 73  ? N VAL A 73  
B 1 2 N GLU C 48  ? N GLU A 48  O LEU C 55  ? O LEU A 55  
B 2 3 N LEU C 54  ? N LEU A 54  O SER C 66  ? O SER A 66  
B 3 4 N THR C 63  ? N THR A 63  O LEU C 111 ? O LEU A 111 
C 1 2 N GLU C 245 ? N GLU A 245 O TRP C 256 ? O TRP A 256 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 501'  
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 551' 
AC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SO4 A 552' 
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 A 553' 
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 554' 
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 555' 
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL A 511' 
AC8 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL A 512' 
AC9 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 513' 
BC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL A 514' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  CYS C 237 ? CYS A 237  . ? 1_555 ? 
2  AC1 4  CYS C 240 ? CYS A 240  . ? 1_555 ? 
3  AC1 4  CYS C 257 ? CYS A 257  . ? 1_555 ? 
4  AC1 4  CYS C 260 ? CYS A 260  . ? 1_555 ? 
5  AC2 5  ARG C 8   ? ARG A 8    . ? 1_555 ? 
6  AC2 5  ASN C 12  ? ASN A 12   . ? 1_555 ? 
7  AC2 5  HOH P .   ? HOH A 657  . ? 1_555 ? 
8  AC2 5  HOH P .   ? HOH A 1022 . ? 1_555 ? 
9  AC2 5  HOH P .   ? HOH A 1025 . ? 1_555 ? 
10 AC3 8  ARG C 112 ? ARG A 112  . ? 4_665 ? 
11 AC3 8  LYS C 140 ? LYS A 140  . ? 1_555 ? 
12 AC3 8  ALA C 191 ? ALA A 191  . ? 1_555 ? 
13 AC3 8  ASP C 195 ? ASP A 195  . ? 1_555 ? 
14 AC3 8  HOH P .   ? HOH A 665  . ? 1_555 ? 
15 AC3 8  HOH P .   ? HOH A 757  . ? 8_663 ? 
16 AC3 8  HOH P .   ? HOH A 856  . ? 1_555 ? 
17 AC3 8  HOH P .   ? HOH A 957  . ? 1_555 ? 
18 AC4 6  ASN C 190 ? ASN A 190  . ? 1_555 ? 
19 AC4 6  ALA C 191 ? ALA A 191  . ? 1_555 ? 
20 AC4 6  HOH P .   ? HOH A 630  . ? 4_665 ? 
21 AC4 6  HOH P .   ? HOH A 828  . ? 1_555 ? 
22 AC4 6  HOH P .   ? HOH A 884  . ? 4_665 ? 
23 AC4 6  HOH P .   ? HOH A 941  . ? 4_665 ? 
24 AC5 3  PRO C 1   ? PRO A 1    . ? 1_555 ? 
25 AC5 3  HOH P .   ? HOH A 681  . ? 1_555 ? 
26 AC5 3  HOH P .   ? HOH A 961  . ? 1_555 ? 
27 AC6 5  HOH P .   ? HOH A 648  . ? 1_555 ? 
28 AC6 5  HOH P .   ? HOH A 652  . ? 1_555 ? 
29 AC6 5  HOH P .   ? HOH A 734  . ? 1_555 ? 
30 AC6 5  HOH P .   ? HOH A 994  . ? 1_555 ? 
31 AC6 5  HOH P .   ? HOH A 1071 . ? 1_555 ? 
32 AC7 4  ARG C 147 ? ARG A 147  . ? 1_555 ? 
33 AC7 4  ARG C 151 ? ARG A 151  . ? 1_555 ? 
34 AC7 4  HOH P .   ? HOH A 685  . ? 1_555 ? 
35 AC7 4  HOH P .   ? HOH A 773  . ? 1_555 ? 
36 AC8 7  ASP C 195 ? ASP A 195  . ? 1_555 ? 
37 AC8 7  HIS C 199 ? HIS A 199  . ? 1_555 ? 
38 AC8 7  HOH P .   ? HOH A 684  . ? 1_555 ? 
39 AC8 7  HOH P .   ? HOH A 691  . ? 1_555 ? 
40 AC8 7  HOH P .   ? HOH A 722  . ? 4_665 ? 
41 AC8 7  HOH P .   ? HOH A 752  . ? 4_665 ? 
42 AC8 7  HOH P .   ? HOH A 932  . ? 1_555 ? 
43 AC9 10 SER C 37  ? SER A 37   . ? 6_543 ? 
44 AC9 10 GLN C 38  ? GLN A 38   . ? 6_543 ? 
45 AC9 10 GLY C 179 ? GLY A 179  . ? 8_653 ? 
46 AC9 10 LEU C 180 ? LEU A 180  . ? 8_653 ? 
47 AC9 10 HIS C 184 ? HIS A 184  . ? 8_653 ? 
48 AC9 10 GLN C 193 ? GLN A 193  . ? 8_653 ? 
49 AC9 10 HIS C 262 ? HIS A 262  . ? 8_653 ? 
50 AC9 10 HOH P .   ? HOH A 671  . ? 6_543 ? 
51 AC9 10 HOH P .   ? HOH A 689  . ? 8_653 ? 
52 AC9 10 HOH P .   ? HOH A 737  . ? 1_555 ? 
53 BC1 6  THR C 117 ? THR A 117  . ? 1_555 ? 
54 BC1 6  ARG C 142 ? ARG A 142  . ? 6_553 ? 
55 BC1 6  HOH P .   ? HOH A 655  . ? 6_553 ? 
56 BC1 6  HOH P .   ? HOH A 711  . ? 1_555 ? 
57 BC1 6  HOH P .   ? HOH A 998  . ? 6_553 ? 
58 BC1 6  HOH P .   ? HOH A 1054 . ? 6_553 ? 
# 
_database_PDB_matrix.entry_id          1K3X 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    1K3X 
_atom_sites.fract_transf_matrix[1][1]   0.013073 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013073 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006086 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
BR 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    P  P     . DC  A 1 3   ? 36.230 -3.385  -112.499 1.00 43.20  ? 403  DC  B P     1 
ATOM   2    O  OP1   . DC  A 1 3   ? 34.912 -3.120  -111.824 1.00 66.00  ? 403  DC  B OP1   1 
ATOM   3    O  OP2   . DC  A 1 3   ? 37.104 -4.230  -111.596 1.00 55.44  ? 403  DC  B OP2   1 
ATOM   4    O  "O5'" . DC  A 1 3   ? 35.861 -4.371  -113.682 1.00 49.95  ? 403  DC  B "O5'" 1 
ATOM   5    C  "C5'" . DC  A 1 3   ? 34.817 -4.025  -114.611 1.00 53.33  ? 403  DC  B "C5'" 1 
ATOM   6    C  "C4'" . DC  A 1 3   ? 34.776 -5.087  -115.717 1.00 51.05  ? 403  DC  B "C4'" 1 
ATOM   7    O  "O4'" . DC  A 1 3   ? 36.040 -5.182  -116.451 1.00 49.23  ? 403  DC  B "O4'" 1 
ATOM   8    C  "C3'" . DC  A 1 3   ? 34.527 -6.527  -115.211 1.00 56.05  ? 403  DC  B "C3'" 1 
ATOM   9    O  "O3'" . DC  A 1 3   ? 33.920 -7.303  -116.270 1.00 71.25  ? 403  DC  B "O3'" 1 
ATOM   10   C  "C2'" . DC  A 1 3   ? 35.983 -7.011  -115.089 1.00 53.68  ? 403  DC  B "C2'" 1 
ATOM   11   C  "C1'" . DC  A 1 3   ? 36.498 -6.556  -116.456 1.00 48.86  ? 403  DC  B "C1'" 1 
ATOM   12   N  N1    . DC  A 1 3   ? 37.971 -6.531  -116.565 1.00 43.54  ? 403  DC  B N1    1 
ATOM   13   C  C2    . DC  A 1 3   ? 38.583 -6.845  -117.785 1.00 39.76  ? 403  DC  B C2    1 
ATOM   14   O  O2    . DC  A 1 3   ? 37.861 -7.113  -118.750 1.00 42.16  ? 403  DC  B O2    1 
ATOM   15   N  N3    . DC  A 1 3   ? 39.922 -6.795  -117.777 1.00 36.92  ? 403  DC  B N3    1 
ATOM   16   C  C4    . DC  A 1 3   ? 40.769 -6.493  -116.772 1.00 33.52  ? 403  DC  B C4    1 
ATOM   17   N  N4    . DC  A 1 3   ? 42.119 -6.445  -116.896 1.00 34.88  ? 403  DC  B N4    1 
ATOM   18   C  C5    . DC  A 1 3   ? 40.128 -6.185  -115.530 1.00 34.13  ? 403  DC  B C5    1 
ATOM   19   C  C6    . DC  A 1 3   ? 38.790 -6.220  -115.514 1.00 38.52  ? 403  DC  B C6    1 
HETATM 20   N  N1    . BRU A 1 4   ? 36.850 -10.756 -118.051 1.00 41.68  ? 404  BRU B N1    1 
HETATM 21   C  C2    . BRU A 1 4   ? 38.078 -10.932 -118.705 1.00 38.86  ? 404  BRU B C2    1 
HETATM 22   N  N3    . BRU A 1 4   ? 39.219 -10.646 -117.900 1.00 42.20  ? 404  BRU B N3    1 
HETATM 23   C  C4    . BRU A 1 4   ? 39.188 -10.214 -116.633 1.00 48.37  ? 404  BRU B C4    1 
HETATM 24   C  C5    . BRU A 1 4   ? 37.835 -10.067 -116.040 1.00 50.20  ? 404  BRU B C5    1 
HETATM 25   C  C6    . BRU A 1 4   ? 36.725 -10.333 -116.735 1.00 47.51  ? 404  BRU B C6    1 
HETATM 26   O  O2    . BRU A 1 4   ? 38.353 -11.323 -119.823 1.00 36.72  ? 404  BRU B O2    1 
HETATM 27   O  O4    . BRU A 1 4   ? 40.175 -9.998  -115.920 1.00 56.79  ? 404  BRU B O4    1 
HETATM 28   BR BR    . BRU A 1 4   ? 38.254 -9.527  -114.264 1.00 50.00  ? 404  BRU B BR    1 
HETATM 29   C  "C1'" . BRU A 1 4   ? 35.700 -11.064 -118.921 1.00 42.61  ? 404  BRU B "C1'" 1 
HETATM 30   C  "C2'" . BRU A 1 4   ? 35.012 -12.362 -118.524 1.00 48.19  ? 404  BRU B "C2'" 1 
HETATM 31   C  "C3'" . BRU A 1 4   ? 33.535 -11.976 -118.752 1.00 56.97  ? 404  BRU B "C3'" 1 
HETATM 32   C  "C4'" . BRU A 1 4   ? 33.584 -10.512 -118.239 1.00 61.44  ? 404  BRU B "C4'" 1 
HETATM 33   O  "O3'" . BRU A 1 4   ? 33.519 -11.914 -120.224 1.00 52.88  ? 404  BRU B "O3'" 1 
HETATM 34   O  "O4'" . BRU A 1 4   ? 34.732 -10.035 -119.022 1.00 50.30  ? 404  BRU B "O4'" 1 
HETATM 35   C  "C5'" . BRU A 1 4   ? 32.328 -9.714  -118.295 1.00 77.02  ? 404  BRU B "C5'" 1 
HETATM 36   O  "O5'" . BRU A 1 4   ? 32.166 -8.564  -117.477 1.00 81.98  ? 404  BRU B "O5'" 1 
HETATM 37   P  P     . BRU A 1 4   ? 32.640 -8.267  -115.959 1.00 82.03  ? 404  BRU B P     1 
HETATM 38   O  OP1   . BRU A 1 4   ? 31.585 -7.415  -115.248 1.00 137.19 ? 404  BRU B OP1   1 
HETATM 39   O  OP2   . BRU A 1 4   ? 33.075 -9.508  -115.204 1.00 91.62  ? 404  BRU B OP2   1 
HETATM 40   N  N1    . BRU A 1 5   ? 38.793 -14.556 -119.571 1.00 23.36  ? 405  BRU B N1    1 
HETATM 41   C  C2    . BRU A 1 5   ? 40.120 -14.220 -119.298 1.00 19.73  ? 405  BRU B C2    1 
HETATM 42   N  N3    . BRU A 1 5   ? 40.393 -13.828 -117.973 1.00 23.15  ? 405  BRU B N3    1 
HETATM 43   C  C4    . BRU A 1 5   ? 39.427 -13.696 -116.990 1.00 21.34  ? 405  BRU B C4    1 
HETATM 44   C  C5    . BRU A 1 5   ? 38.125 -14.091 -117.435 1.00 23.45  ? 405  BRU B C5    1 
HETATM 45   C  C6    . BRU A 1 5   ? 37.772 -14.502 -118.682 1.00 23.22  ? 405  BRU B C6    1 
HETATM 46   O  O2    . BRU A 1 5   ? 40.986 -14.339 -120.141 1.00 28.24  ? 405  BRU B O2    1 
HETATM 47   O  O4    . BRU A 1 5   ? 39.770 -13.305 -115.844 1.00 26.99  ? 405  BRU B O4    1 
HETATM 48   BR BR    . BRU A 1 5   ? 36.765 -13.995 -116.117 1.00 65.44  ? 405  BRU B BR    1 
HETATM 49   C  "C1'" . BRU A 1 5   ? 38.472 -14.995 -120.933 1.00 21.52  ? 405  BRU B "C1'" 1 
HETATM 50   C  "C2'" . BRU A 1 5   ? 37.578 -16.219 -121.094 1.00 27.32  ? 405  BRU B "C2'" 1 
HETATM 51   C  "C3'" . BRU A 1 5   ? 36.786 -15.854 -122.357 1.00 30.36  ? 405  BRU B "C3'" 1 
HETATM 52   C  "C4'" . BRU A 1 5   ? 36.852 -14.317 -122.489 1.00 30.91  ? 405  BRU B "C4'" 1 
HETATM 53   O  "O3'" . BRU A 1 5   ? 37.417 -16.293 -123.563 1.00 32.06  ? 405  BRU B "O3'" 1 
HETATM 54   O  "O4'" . BRU A 1 5   ? 37.619 -13.873 -121.333 1.00 27.29  ? 405  BRU B "O4'" 1 
HETATM 55   C  "C5'" . BRU A 1 5   ? 35.512 -13.597 -122.428 1.00 36.18  ? 405  BRU B "C5'" 1 
HETATM 56   O  "O5'" . BRU A 1 5   ? 34.922 -13.816 -121.134 1.00 35.86  ? 405  BRU B "O5'" 1 
HETATM 57   P  P     . BRU A 1 5   ? 33.410 -13.412 -120.871 1.00 42.55  ? 405  BRU B P     1 
HETATM 58   O  OP1   . BRU A 1 5   ? 32.668 -13.354 -122.206 1.00 56.37  ? 405  BRU B OP1   1 
HETATM 59   O  OP2   . BRU A 1 5   ? 32.822 -14.347 -119.810 1.00 63.14  ? 405  BRU B OP2   1 
ATOM   60   P  P     . DC  A 1 6   ? 37.686 -17.810 -123.947 1.00 36.40  ? 406  DC  B P     1 
ATOM   61   O  OP1   . DC  A 1 6   ? 37.931 -18.129 -125.386 1.00 57.97  ? 406  DC  B OP1   1 
ATOM   62   O  OP2   . DC  A 1 6   ? 36.839 -18.834 -123.244 1.00 54.86  ? 406  DC  B OP2   1 
ATOM   63   O  "O5'" . DC  A 1 6   ? 39.113 -18.080 -123.312 1.00 34.94  ? 406  DC  B "O5'" 1 
ATOM   64   C  "C5'" . DC  A 1 6   ? 40.302 -17.757 -124.073 1.00 34.35  ? 406  DC  B "C5'" 1 
ATOM   65   C  "C4'" . DC  A 1 6   ? 41.551 -18.120 -123.251 1.00 29.15  ? 406  DC  B "C4'" 1 
ATOM   66   O  "O4'" . DC  A 1 6   ? 41.512 -17.546 -121.941 1.00 27.81  ? 406  DC  B "O4'" 1 
ATOM   67   C  "C3'" . DC  A 1 6   ? 41.720 -19.652 -123.002 1.00 27.37  ? 406  DC  B "C3'" 1 
ATOM   68   O  "O3'" . DC  A 1 6   ? 42.972 -20.101 -123.598 1.00 31.94  ? 406  DC  B "O3'" 1 
ATOM   69   C  "C2'" . DC  A 1 6   ? 41.697 -19.787 -121.478 1.00 26.86  ? 406  DC  B "C2'" 1 
ATOM   70   C  "C1'" . DC  A 1 6   ? 42.163 -18.419 -121.008 1.00 24.40  ? 406  DC  B "C1'" 1 
ATOM   71   N  N1    . DC  A 1 6   ? 41.670 -17.979 -119.681 1.00 25.32  ? 406  DC  B N1    1 
ATOM   72   C  C2    . DC  A 1 6   ? 42.631 -17.450 -118.802 1.00 25.09  ? 406  DC  B C2    1 
ATOM   73   O  O2    . DC  A 1 6   ? 43.790 -17.448 -119.198 1.00 27.03  ? 406  DC  B O2    1 
ATOM   74   N  N3    . DC  A 1 6   ? 42.219 -17.073 -117.582 1.00 23.23  ? 406  DC  B N3    1 
ATOM   75   C  C4    . DC  A 1 6   ? 40.903 -17.071 -117.194 1.00 23.02  ? 406  DC  B C4    1 
ATOM   76   N  N4    . DC  A 1 6   ? 40.582 -16.680 -115.938 1.00 23.47  ? 406  DC  B N4    1 
ATOM   77   C  C5    . DC  A 1 6   ? 39.950 -17.702 -118.080 1.00 24.22  ? 406  DC  B C5    1 
ATOM   78   C  C6    . DC  A 1 6   ? 40.349 -18.060 -119.316 1.00 22.24  ? 406  DC  B C6    1 
ATOM   79   P  P     . DA  A 1 7   ? 43.224 -21.638 -123.935 1.00 34.11  ? 407  DA  B P     1 
ATOM   80   O  OP1   . DA  A 1 7   ? 44.256 -21.967 -124.940 1.00 42.12  ? 407  DA  B OP1   1 
ATOM   81   O  OP2   . DA  A 1 7   ? 41.975 -22.461 -124.029 1.00 48.25  ? 407  DA  B OP2   1 
ATOM   82   O  "O5'" . DA  A 1 7   ? 43.859 -22.221 -122.571 1.00 26.11  ? 407  DA  B "O5'" 1 
ATOM   83   C  "C5'" . DA  A 1 7   ? 45.221 -21.819 -122.258 1.00 22.24  ? 407  DA  B "C5'" 1 
ATOM   84   C  "C4'" . DA  A 1 7   ? 45.441 -22.183 -120.806 1.00 20.28  ? 407  DA  B "C4'" 1 
ATOM   85   O  "O4'" . DA  A 1 7   ? 44.554 -21.407 -119.979 1.00 19.65  ? 407  DA  B "O4'" 1 
ATOM   86   C  "C3'" . DA  A 1 7   ? 45.146 -23.623 -120.382 1.00 17.88  ? 407  DA  B "C3'" 1 
ATOM   87   O  "O3'" . DA  A 1 7   ? 46.354 -24.402 -120.550 1.00 18.33  ? 407  DA  B "O3'" 1 
ATOM   88   C  "C2'" . DA  A 1 7   ? 44.693 -23.447 -118.935 1.00 19.58  ? 407  DA  B "C2'" 1 
ATOM   89   C  "C1'" . DA  A 1 7   ? 44.402 -21.959 -118.705 1.00 17.68  ? 407  DA  B "C1'" 1 
ATOM   90   N  N9    . DA  A 1 7   ? 43.054 -21.643 -118.175 1.00 20.35  ? 407  DA  B N9    1 
ATOM   91   C  C8    . DA  A 1 7   ? 41.796 -22.005 -118.580 1.00 25.24  ? 407  DA  B C8    1 
ATOM   92   N  N7    . DA  A 1 7   ? 40.847 -21.463 -117.821 1.00 25.86  ? 407  DA  B N7    1 
ATOM   93   C  C5    . DA  A 1 7   ? 41.482 -20.734 -116.850 1.00 25.20  ? 407  DA  B C5    1 
ATOM   94   C  C6    . DA  A 1 7   ? 41.006 -20.013 -115.734 1.00 24.54  ? 407  DA  B C6    1 
ATOM   95   N  N6    . DA  A 1 7   ? 39.759 -19.786 -115.264 1.00 26.43  ? 407  DA  B N6    1 
ATOM   96   N  N1    . DA  A 1 7   ? 41.924 -19.433 -114.915 1.00 24.49  ? 407  DA  B N1    1 
ATOM   97   C  C2    . DA  A 1 7   ? 43.189 -19.570 -115.260 1.00 21.61  ? 407  DA  B C2    1 
ATOM   98   N  N3    . DA  A 1 7   ? 43.735 -20.235 -116.271 1.00 21.77  ? 407  DA  B N3    1 
ATOM   99   C  C4    . DA  A 1 7   ? 42.846 -20.857 -117.050 1.00 20.13  ? 407  DA  B C4    1 
HETATM 100  N  N1    . BRU A 1 8   ? 44.348 -25.375 -115.057 1.00 15.54  ? 408  BRU B N1    1 
HETATM 101  C  C2    . BRU A 1 8   ? 44.183 -24.610 -113.900 1.00 15.50  ? 408  BRU B C2    1 
HETATM 102  N  N3    . BRU A 1 8   ? 43.013 -23.813 -113.773 1.00 16.12  ? 408  BRU B N3    1 
HETATM 103  C  C4    . BRU A 1 8   ? 42.026 -23.796 -114.714 1.00 18.38  ? 408  BRU B C4    1 
HETATM 104  C  C5    . BRU A 1 8   ? 42.242 -24.629 -115.905 1.00 16.58  ? 408  BRU B C5    1 
HETATM 105  C  C6    . BRU A 1 8   ? 43.377 -25.393 -115.999 1.00 17.52  ? 408  BRU B C6    1 
HETATM 106  O  O2    . BRU A 1 8   ? 44.984 -24.631 -112.987 1.00 17.94  ? 408  BRU B O2    1 
HETATM 107  O  O4    . BRU A 1 8   ? 41.024 -23.075 -114.527 1.00 20.44  ? 408  BRU B O4    1 
HETATM 108  BR BR    . BRU A 1 8   ? 40.888 -24.844 -117.147 1.00 33.44  ? 408  BRU B BR    1 
HETATM 109  C  "C1'" . BRU A 1 8   ? 45.570 -26.174 -115.234 1.00 16.26  ? 408  BRU B "C1'" 1 
HETATM 110  C  "C2'" . BRU A 1 8   ? 45.459 -27.620 -115.603 1.00 17.24  ? 408  BRU B "C2'" 1 
HETATM 111  C  "C3'" . BRU A 1 8   ? 46.667 -27.861 -116.490 1.00 17.20  ? 408  BRU B "C3'" 1 
HETATM 112  C  "C4'" . BRU A 1 8   ? 47.206 -26.447 -116.837 1.00 15.36  ? 408  BRU B "C4'" 1 
HETATM 113  O  "O3'" . BRU A 1 8   ? 47.769 -28.441 -115.784 1.00 17.55  ? 408  BRU B "O3'" 1 
HETATM 114  O  "O4'" . BRU A 1 8   ? 46.178 -25.528 -116.401 1.00 15.25  ? 408  BRU B "O4'" 1 
HETATM 115  C  "C5'" . BRU A 1 8   ? 47.521 -26.248 -118.269 1.00 17.81  ? 408  BRU B "C5'" 1 
HETATM 116  O  "O5'" . BRU A 1 8   ? 46.319 -26.416 -119.035 1.00 17.26  ? 408  BRU B "O5'" 1 
HETATM 117  P  P     . BRU A 1 8   ? 46.373 -26.022 -120.610 1.00 18.47  ? 408  BRU B P     1 
HETATM 118  O  OP1   . BRU A 1 8   ? 47.686 -26.429 -121.228 1.00 19.74  ? 408  BRU B OP1   1 
HETATM 119  O  OP2   . BRU A 1 8   ? 45.113 -26.578 -121.159 1.00 19.27  ? 408  BRU B OP2   1 
ATOM   120  P  P     . DC  A 1 9   ? 47.751 -29.932 -115.161 1.00 18.14  ? 409  DC  B P     1 
ATOM   121  O  OP1   . DC  A 1 9   ? 49.113 -30.434 -115.074 1.00 17.65  ? 409  DC  B OP1   1 
ATOM   122  O  OP2   . DC  A 1 9   ? 46.719 -30.783 -115.800 1.00 23.93  ? 409  DC  B OP2   1 
ATOM   123  O  "O5'" . DC  A 1 9   ? 47.234 -29.661 -113.686 1.00 24.03  ? 409  DC  B "O5'" 1 
ATOM   124  C  "C5'" . DC  A 1 9   ? 48.040 -28.740 -112.879 1.00 25.57  ? 409  DC  B "C5'" 1 
ATOM   125  C  "C4'" . DC  A 1 9   ? 47.284 -28.391 -111.602 1.00 26.93  ? 409  DC  B "C4'" 1 
ATOM   126  O  "O4'" . DC  A 1 9   ? 46.062 -27.702 -111.844 1.00 27.58  ? 409  DC  B "O4'" 1 
ATOM   127  C  "C3'" . DC  A 1 9   ? 46.888 -29.612 -110.768 1.00 34.84  ? 409  DC  B "C3'" 1 
ATOM   128  O  "O3'" . DC  A 1 9   ? 47.547 -29.535 -109.487 1.00 42.30  ? 409  DC  B "O3'" 1 
ATOM   129  C  "C2'" . DC  A 1 9   ? 45.375 -29.499 -110.618 1.00 33.19  ? 409  DC  B "C2'" 1 
ATOM   130  C  "C1'" . DC  A 1 9   ? 45.076 -28.045 -110.835 1.00 27.41  ? 409  DC  B "C1'" 1 
ATOM   131  N  N1    . DC  A 1 9   ? 43.837 -27.625 -111.523 1.00 29.26  ? 409  DC  B N1    1 
ATOM   132  C  C2    . DC  A 1 9   ? 43.134 -26.566 -110.934 1.00 29.32  ? 409  DC  B C2    1 
ATOM   133  O  O2    . DC  A 1 9   ? 43.685 -26.084 -109.933 1.00 28.73  ? 409  DC  B O2    1 
ATOM   134  N  N3    . DC  A 1 9   ? 42.029 -26.165 -111.584 1.00 29.21  ? 409  DC  B N3    1 
ATOM   135  C  C4    . DC  A 1 9   ? 41.494 -26.698 -112.701 1.00 26.10  ? 409  DC  B C4    1 
ATOM   136  N  N4    . DC  A 1 9   ? 40.358 -26.212 -113.254 1.00 29.13  ? 409  DC  B N4    1 
ATOM   137  C  C5    . DC  A 1 9   ? 42.215 -27.813 -113.253 1.00 28.17  ? 409  DC  B C5    1 
ATOM   138  C  C6    . DC  A 1 9   ? 43.346 -28.220 -112.653 1.00 27.60  ? 409  DC  B C6    1 
ATOM   139  P  P     . DC  A 1 10  ? 47.437 -30.753 -108.431 1.00 39.73  ? 410  DC  B P     1 
ATOM   140  O  OP1   . DC  A 1 10  ? 48.499 -30.662 -107.381 1.00 53.59  ? 410  DC  B OP1   1 
ATOM   141  O  OP2   . DC  A 1 10  ? 47.219 -32.142 -108.953 1.00 58.87  ? 410  DC  B OP2   1 
ATOM   142  O  "O5'" . DC  A 1 10  ? 46.023 -30.468 -107.749 1.00 45.84  ? 410  DC  B "O5'" 1 
ATOM   143  C  "C5'" . DC  A 1 10  ? 45.940 -29.244 -106.989 1.00 53.92  ? 410  DC  B "C5'" 1 
ATOM   144  C  "C4'" . DC  A 1 10  ? 44.566 -29.219 -106.317 1.00 51.42  ? 410  DC  B "C4'" 1 
ATOM   145  O  "O4'" . DC  A 1 10  ? 43.575 -28.737 -107.240 1.00 54.14  ? 410  DC  B "O4'" 1 
ATOM   146  C  "C3'" . DC  A 1 10  ? 44.059 -30.580 -105.824 1.00 59.93  ? 410  DC  B "C3'" 1 
ATOM   147  O  "O3'" . DC  A 1 10  ? 43.860 -30.515 -104.412 1.00 69.64  ? 410  DC  B "O3'" 1 
ATOM   148  C  "C2'" . DC  A 1 10  ? 42.807 -30.846 -106.626 1.00 52.50  ? 410  DC  B "C2'" 1 
ATOM   149  C  "C1'" . DC  A 1 10  ? 42.381 -29.473 -107.118 1.00 49.25  ? 410  DC  B "C1'" 1 
ATOM   150  N  N1    . DC  A 1 10  ? 41.659 -29.454 -108.397 1.00 47.46  ? 410  DC  B N1    1 
ATOM   151  C  C2    . DC  A 1 10  ? 40.640 -28.506 -108.571 1.00 46.06  ? 410  DC  B C2    1 
ATOM   152  O  O2    . DC  A 1 10  ? 40.374 -27.725 -107.640 1.00 43.45  ? 410  DC  B O2    1 
ATOM   153  N  N3    . DC  A 1 10  ? 40.000 -28.535 -109.761 1.00 40.15  ? 410  DC  B N3    1 
ATOM   154  C  C4    . DC  A 1 10  ? 40.257 -29.374 -110.778 1.00 45.27  ? 410  DC  B C4    1 
ATOM   155  N  N4    . DC  A 1 10  ? 39.572 -29.329 -111.956 1.00 53.02  ? 410  DC  B N4    1 
ATOM   156  C  C5    . DC  A 1 10  ? 41.316 -30.339 -110.577 1.00 42.62  ? 410  DC  B C5    1 
ATOM   157  C  C6    . DC  A 1 10  ? 41.975 -30.335 -109.408 1.00 43.53  ? 410  DC  B C6    1 
HETATM 158  N  N1    . BRU A 1 11  ? 38.483 -28.953 -104.735 1.00 57.04  ? 411  BRU B N1    1 
HETATM 159  C  C2    . BRU A 1 11  ? 37.456 -28.485 -105.542 1.00 52.50  ? 411  BRU B C2    1 
HETATM 160  N  N3    . BRU A 1 11  ? 37.172 -29.183 -106.795 1.00 53.97  ? 411  BRU B N3    1 
HETATM 161  C  C4    . BRU A 1 11  ? 37.925 -30.327 -107.160 1.00 54.07  ? 411  BRU B C4    1 
HETATM 162  C  C5    . BRU A 1 11  ? 38.975 -30.733 -106.223 1.00 57.06  ? 411  BRU B C5    1 
HETATM 163  C  C6    . BRU A 1 11  ? 39.225 -30.073 -105.078 1.00 59.75  ? 411  BRU B C6    1 
HETATM 164  O  O2    . BRU A 1 11  ? 36.747 -27.502 -105.318 1.00 62.85  ? 411  BRU B O2    1 
HETATM 165  O  O4    . BRU A 1 11  ? 37.633 -30.904 -108.229 1.00 60.04  ? 411  BRU B O4    1 
HETATM 166  BR BR    . BRU A 1 11  ? 40.050 -32.259 -106.581 1.00 131.16 ? 411  BRU B BR    1 
HETATM 167  C  "C1'" . BRU A 1 11  ? 38.968 -28.412 -103.429 1.00 62.41  ? 411  BRU B "C1'" 1 
HETATM 168  C  "C2'" . BRU A 1 11  ? 39.055 -29.509 -102.351 1.00 71.28  ? 411  BRU B "C2'" 1 
HETATM 169  C  "C3'" . BRU A 1 11  ? 40.071 -28.796 -101.435 1.00 69.33  ? 411  BRU B "C3'" 1 
HETATM 170  C  "C4'" . BRU A 1 11  ? 41.141 -28.377 -102.474 1.00 65.69  ? 411  BRU B "C4'" 1 
HETATM 171  O  "O3'" . BRU A 1 11  ? 39.441 -27.508 -101.155 1.00 67.72  ? 411  BRU B "O3'" 1 
HETATM 172  O  "O4'" . BRU A 1 11  ? 40.360 -28.014 -103.630 1.00 60.85  ? 411  BRU B "O4'" 1 
HETATM 173  C  "C5'" . BRU A 1 11  ? 42.297 -29.280 -102.683 1.00 80.03  ? 411  BRU B "C5'" 1 
HETATM 174  O  "O5'" . BRU A 1 11  ? 41.935 -30.667 -102.879 1.00 82.12  ? 411  BRU B "O5'" 1 
HETATM 175  P  P     . BRU A 1 11  ? 43.045 -31.643 -103.571 1.00 88.40  ? 411  BRU B P     1 
HETATM 176  O  OP1   . BRU A 1 11  ? 43.947 -32.230 -102.498 1.00 131.36 ? 411  BRU B OP1   1 
HETATM 177  O  OP2   . BRU A 1 11  ? 42.395 -32.638 -104.515 1.00 127.83 ? 411  BRU B OP2   1 
ATOM   178  P  P     . DG  A 1 12  ? 39.129 -27.221 -99.576  1.00 68.09  ? 412  DG  B P     1 
ATOM   179  O  OP1   . DG  A 1 12  ? 39.676 -25.858 -99.213  1.00 81.13  ? 412  DG  B OP1   1 
ATOM   180  O  OP2   . DG  A 1 12  ? 39.610 -28.421 -98.774  1.00 78.40  ? 412  DG  B OP2   1 
ATOM   181  O  "O5'" . DG  A 1 12  ? 37.514 -27.214 -99.712  1.00 60.62  ? 412  DG  B "O5'" 1 
ATOM   182  C  "C5'" . DG  A 1 12  ? 36.915 -26.929 -101.007 1.00 62.60  ? 412  DG  B "C5'" 1 
ATOM   183  C  "C4'" . DG  A 1 12  ? 35.587 -26.216 -100.700 1.00 58.37  ? 412  DG  B "C4'" 1 
ATOM   184  O  "O4'" . DG  A 1 12  ? 34.589 -26.982 -101.423 1.00 57.23  ? 412  DG  B "O4'" 1 
ATOM   185  C  "C3'" . DG  A 1 12  ? 35.207 -26.477 -99.221  1.00 56.12  ? 412  DG  B "C3'" 1 
ATOM   186  O  "O3'" . DG  A 1 12  ? 34.122 -25.651 -98.791  1.00 68.41  ? 412  DG  B "O3'" 1 
ATOM   187  C  "C2'" . DG  A 1 12  ? 34.842 -27.953 -99.291  1.00 52.28  ? 412  DG  B "C2'" 1 
ATOM   188  C  "C1'" . DG  A 1 12  ? 34.342 -28.200 -100.705 1.00 51.04  ? 412  DG  B "C1'" 1 
ATOM   189  N  N9    . DG  A 1 12  ? 34.979 -29.281 -101.471 1.00 49.65  ? 412  DG  B N9    1 
ATOM   190  C  C8    . DG  A 1 12  ? 35.987 -30.185 -101.163 1.00 51.25  ? 412  DG  B C8    1 
ATOM   191  N  N7    . DG  A 1 12  ? 36.427 -31.088 -102.010 1.00 51.16  ? 412  DG  B N7    1 
ATOM   192  C  C5    . DG  A 1 12  ? 35.558 -30.804 -103.085 1.00 41.76  ? 412  DG  B C5    1 
ATOM   193  C  C6    . DG  A 1 12  ? 35.513 -31.412 -104.423 1.00 48.50  ? 412  DG  B C6    1 
ATOM   194  O  O6    . DG  A 1 12  ? 36.255 -32.359 -104.802 1.00 63.95  ? 412  DG  B O6    1 
ATOM   195  N  N1    . DG  A 1 12  ? 34.565 -30.911 -105.350 1.00 44.84  ? 412  DG  B N1    1 
ATOM   196  C  C2    . DG  A 1 12  ? 33.808 -29.875 -104.923 1.00 45.65  ? 412  DG  B C2    1 
ATOM   197  N  N2    . DG  A 1 12  ? 32.967 -29.434 -105.830 1.00 52.20  ? 412  DG  B N2    1 
ATOM   198  N  N3    . DG  A 1 12  ? 33.825 -29.292 -103.755 1.00 43.16  ? 412  DG  B N3    1 
ATOM   199  C  C4    . DG  A 1 12  ? 34.715 -29.695 -102.782 1.00 41.37  ? 412  DG  B C4    1 
ATOM   200  P  P     . DC  B 2 2   ? 32.005 -34.820 -112.654 1.00 108.51 ? 422  DC  C P     1 
ATOM   201  O  OP1   . DC  B 2 2   ? 30.891 -35.003 -113.620 1.00 105.93 ? 422  DC  C OP1   1 
ATOM   202  O  OP2   . DC  B 2 2   ? 33.073 -33.940 -113.204 1.00 118.09 ? 422  DC  C OP2   1 
ATOM   203  O  "O5'" . DC  B 2 2   ? 31.429 -34.095 -111.353 1.00 103.92 ? 422  DC  C "O5'" 1 
ATOM   204  C  "C5'" . DC  B 2 2   ? 30.186 -33.404 -111.527 1.00 76.36  ? 422  DC  C "C5'" 1 
ATOM   205  C  "C4'" . DC  B 2 2   ? 30.172 -31.900 -111.526 1.00 68.09  ? 422  DC  C "C4'" 1 
ATOM   206  O  "O4'" . DC  B 2 2   ? 30.987 -31.305 -110.479 1.00 72.40  ? 422  DC  C "O4'" 1 
ATOM   207  C  "C3'" . DC  B 2 2   ? 30.753 -31.199 -112.777 1.00 65.32  ? 422  DC  C "C3'" 1 
ATOM   208  O  "O3'" . DC  B 2 2   ? 30.396 -29.822 -112.763 1.00 68.19  ? 422  DC  C "O3'" 1 
ATOM   209  C  "C2'" . DC  B 2 2   ? 32.233 -31.380 -112.466 1.00 58.42  ? 422  DC  C "C2'" 1 
ATOM   210  C  "C1'" . DC  B 2 2   ? 32.300 -31.143 -110.987 1.00 61.43  ? 422  DC  C "C1'" 1 
ATOM   211  N  N1    . DC  B 2 2   ? 33.317 -31.787 -110.165 1.00 53.97  ? 422  DC  C N1    1 
ATOM   212  C  C2    . DC  B 2 2   ? 33.253 -31.383 -108.811 1.00 50.22  ? 422  DC  C C2    1 
ATOM   213  O  O2    . DC  B 2 2   ? 32.377 -30.553 -108.555 1.00 56.58  ? 422  DC  C O2    1 
ATOM   214  N  N3    . DC  B 2 2   ? 34.171 -31.927 -108.001 1.00 48.78  ? 422  DC  C N3    1 
ATOM   215  C  C4    . DC  B 2 2   ? 35.142 -32.829 -108.284 1.00 47.70  ? 422  DC  C C4    1 
ATOM   216  N  N4    . DC  B 2 2   ? 35.979 -33.280 -107.314 1.00 47.09  ? 422  DC  C N4    1 
ATOM   217  C  C5    . DC  B 2 2   ? 35.188 -33.247 -109.668 1.00 49.98  ? 422  DC  C C5    1 
ATOM   218  C  C6    . DC  B 2 2   ? 34.279 -32.695 -110.503 1.00 53.07  ? 422  DC  C C6    1 
ATOM   219  P  P     . DA  B 2 3   ? 30.279 -28.843 -114.037 1.00 73.47  ? 423  DA  C P     1 
ATOM   220  O  OP1   . DA  B 2 3   ? 28.947 -28.859 -114.721 1.00 81.36  ? 423  DA  C OP1   1 
ATOM   221  O  OP2   . DA  B 2 3   ? 31.431 -28.835 -114.996 1.00 72.95  ? 423  DA  C OP2   1 
ATOM   222  O  "O5'" . DA  B 2 3   ? 30.336 -27.419 -113.296 1.00 73.15  ? 423  DA  C "O5'" 1 
ATOM   223  C  "C5'" . DA  B 2 3   ? 29.208 -27.166 -112.434 1.00 76.86  ? 423  DA  C "C5'" 1 
ATOM   224  C  "C4'" . DA  B 2 3   ? 29.404 -26.072 -111.436 1.00 73.01  ? 423  DA  C "C4'" 1 
ATOM   225  O  "O4'" . DA  B 2 3   ? 30.466 -26.267 -110.482 1.00 70.11  ? 423  DA  C "O4'" 1 
ATOM   226  C  "C3'" . DA  B 2 3   ? 29.697 -24.644 -111.935 1.00 73.84  ? 423  DA  C "C3'" 1 
ATOM   227  O  "O3'" . DA  B 2 3   ? 29.344 -23.757 -110.850 1.00 69.30  ? 423  DA  C "O3'" 1 
ATOM   228  C  "C2'" . DA  B 2 3   ? 31.222 -24.719 -112.086 1.00 71.88  ? 423  DA  C "C2'" 1 
ATOM   229  C  "C1'" . DA  B 2 3   ? 31.644 -25.526 -110.881 1.00 69.98  ? 423  DA  C "C1'" 1 
ATOM   230  N  N9    . DA  B 2 3   ? 32.695 -26.536 -111.041 1.00 63.12  ? 423  DA  C N9    1 
ATOM   231  C  C8    . DA  B 2 3   ? 33.118 -27.216 -112.158 1.00 63.12  ? 423  DA  C C8    1 
ATOM   232  N  N7    . DA  B 2 3   ? 34.094 -28.067 -111.916 1.00 61.06  ? 423  DA  C N7    1 
ATOM   233  C  C5    . DA  B 2 3   ? 34.327 -27.908 -110.561 1.00 58.46  ? 423  DA  C C5    1 
ATOM   234  C  C6    . DA  B 2 3   ? 35.267 -28.580 -109.749 1.00 55.50  ? 423  DA  C C6    1 
ATOM   235  N  N6    . DA  B 2 3   ? 36.141 -29.512 -110.215 1.00 54.19  ? 423  DA  C N6    1 
ATOM   236  N  N1    . DA  B 2 3   ? 35.246 -28.240 -108.433 1.00 52.23  ? 423  DA  C N1    1 
ATOM   237  C  C2    . DA  B 2 3   ? 34.389 -27.311 -107.990 1.00 52.34  ? 423  DA  C C2    1 
ATOM   238  N  N3    . DA  B 2 3   ? 33.471 -26.628 -108.688 1.00 53.90  ? 423  DA  C N3    1 
ATOM   239  C  C4    . DA  B 2 3   ? 33.474 -26.985 -109.995 1.00 57.83  ? 423  DA  C C4    1 
ATOM   240  P  P     . DG  B 2 4   ? 29.435 -22.150 -111.027 1.00 69.55  ? 424  DG  C P     1 
ATOM   241  O  OP1   . DG  B 2 4   ? 28.271 -21.486 -110.310 1.00 72.32  ? 424  DG  C OP1   1 
ATOM   242  O  OP2   . DG  B 2 4   ? 29.642 -21.822 -112.489 1.00 77.44  ? 424  DG  C OP2   1 
ATOM   243  O  "O5'" . DG  B 2 4   ? 30.819 -21.901 -110.207 1.00 67.78  ? 424  DG  C "O5'" 1 
ATOM   244  C  "C5'" . DG  B 2 4   ? 31.008 -22.540 -108.926 1.00 64.95  ? 424  DG  C "C5'" 1 
ATOM   245  C  "C4'" . DG  B 2 4   ? 32.368 -22.246 -108.338 1.00 58.05  ? 424  DG  C "C4'" 1 
ATOM   246  O  "O4'" . DG  B 2 4   ? 33.368 -23.213 -108.714 1.00 56.14  ? 424  DG  C "O4'" 1 
ATOM   247  C  "C3'" . DG  B 2 4   ? 32.918 -20.863 -108.698 1.00 56.42  ? 424  DG  C "C3'" 1 
ATOM   248  O  "O3'" . DG  B 2 4   ? 33.452 -20.239 -107.523 1.00 63.57  ? 424  DG  C "O3'" 1 
ATOM   249  C  "C2'" . DG  B 2 4   ? 34.002 -21.179 -109.714 1.00 58.47  ? 424  DG  C "C2'" 1 
ATOM   250  C  "C1'" . DG  B 2 4   ? 34.499 -22.552 -109.321 1.00 52.98  ? 424  DG  C "C1'" 1 
ATOM   251  N  N9    . DG  B 2 4   ? 34.945 -23.486 -110.369 1.00 47.96  ? 424  DG  C N9    1 
ATOM   252  C  C8    . DG  B 2 4   ? 34.718 -23.756 -111.706 1.00 53.08  ? 424  DG  C C8    1 
ATOM   253  N  N7    . DG  B 2 4   ? 35.329 -24.726 -112.362 1.00 52.36  ? 424  DG  C N7    1 
ATOM   254  C  C5    . DG  B 2 4   ? 36.122 -25.200 -111.307 1.00 47.96  ? 424  DG  C C5    1 
ATOM   255  C  C6    . DG  B 2 4   ? 37.107 -26.294 -111.294 1.00 43.69  ? 424  DG  C C6    1 
ATOM   256  O  O6    . DG  B 2 4   ? 37.388 -27.037 -112.268 1.00 46.27  ? 424  DG  C O6    1 
ATOM   257  N  N1    . DG  B 2 4   ? 37.744 -26.510 -110.052 1.00 38.87  ? 424  DG  C N1    1 
ATOM   258  C  C2    . DG  B 2 4   ? 37.449 -25.702 -109.011 1.00 41.27  ? 424  DG  C C2    1 
ATOM   259  N  N2    . DG  B 2 4   ? 38.102 -25.945 -107.882 1.00 37.33  ? 424  DG  C N2    1 
ATOM   260  N  N3    . DG  B 2 4   ? 36.571 -24.727 -108.946 1.00 41.82  ? 424  DG  C N3    1 
ATOM   261  C  C4    . DG  B 2 4   ? 35.908 -24.458 -110.120 1.00 44.95  ? 424  DG  C C4    1 
ATOM   262  P  P     . DG  B 2 5   ? 34.140 -18.771 -107.570 1.00 56.54  ? 425  DG  C P     1 
ATOM   263  O  OP1   . DG  B 2 5   ? 33.360 -17.732 -106.798 1.00 75.84  ? 425  DG  C OP1   1 
ATOM   264  O  OP2   . DG  B 2 5   ? 34.460 -18.389 -109.007 1.00 65.15  ? 425  DG  C OP2   1 
ATOM   265  O  "O5'" . DG  B 2 5   ? 35.516 -19.124 -106.787 1.00 47.16  ? 425  DG  C "O5'" 1 
ATOM   266  C  "C5'" . DG  B 2 5   ? 35.613 -19.980 -105.636 1.00 37.28  ? 425  DG  C "C5'" 1 
ATOM   267  C  "C4'" . DG  B 2 5   ? 37.071 -20.220 -105.288 1.00 32.99  ? 425  DG  C "C4'" 1 
ATOM   268  O  "O4'" . DG  B 2 5   ? 37.610 -21.257 -106.149 1.00 29.20  ? 425  DG  C "O4'" 1 
ATOM   269  C  "C3'" . DG  B 2 5   ? 37.943 -18.969 -105.531 1.00 28.34  ? 425  DG  C "C3'" 1 
ATOM   270  O  "O3'" . DG  B 2 5   ? 38.939 -18.980 -104.528 1.00 25.85  ? 425  DG  C "O3'" 1 
ATOM   271  C  "C2'" . DG  B 2 5   ? 38.663 -19.212 -106.841 1.00 28.46  ? 425  DG  C "C2'" 1 
ATOM   272  C  "C1'" . DG  B 2 5   ? 38.718 -20.724 -106.887 1.00 25.95  ? 425  DG  C "C1'" 1 
ATOM   273  N  N9    . DG  B 2 5   ? 38.548 -21.296 -108.227 1.00 27.87  ? 425  DG  C N9    1 
ATOM   274  C  C8    . DG  B 2 5   ? 37.679 -21.104 -109.285 1.00 30.99  ? 425  DG  C C8    1 
ATOM   275  N  N7    . DG  B 2 5   ? 37.806 -21.797 -110.386 1.00 32.32  ? 425  DG  C N7    1 
ATOM   276  C  C5    . DG  B 2 5   ? 38.904 -22.604 -110.026 1.00 24.46  ? 425  DG  C C5    1 
ATOM   277  C  C6    . DG  B 2 5   ? 39.604 -23.634 -110.814 1.00 24.35  ? 425  DG  C C6    1 
ATOM   278  O  O6    . DG  B 2 5   ? 39.291 -23.973 -112.003 1.00 24.81  ? 425  DG  C O6    1 
ATOM   279  N  N1    . DG  B 2 5   ? 40.676 -24.254 -110.118 1.00 25.31  ? 425  DG  C N1    1 
ATOM   280  C  C2    . DG  B 2 5   ? 41.033 -23.855 -108.862 1.00 25.76  ? 425  DG  C C2    1 
ATOM   281  N  N2    . DG  B 2 5   ? 42.081 -24.450 -108.330 1.00 28.07  ? 425  DG  C N2    1 
ATOM   282  N  N3    . DG  B 2 5   ? 40.444 -22.927 -108.143 1.00 25.41  ? 425  DG  C N3    1 
ATOM   283  C  C4    . DG  B 2 5   ? 39.363 -22.295 -108.739 1.00 25.50  ? 425  DG  C C4    1 
ATOM   284  P  P     . DA  B 2 6   ? 39.796 -17.658 -104.226 1.00 22.02  ? 426  DA  C P     1 
ATOM   285  O  OP1   . DA  B 2 6   ? 39.991 -17.534 -102.740 1.00 25.10  ? 426  DA  C OP1   1 
ATOM   286  O  OP2   . DA  B 2 6   ? 39.232 -16.476 -104.921 1.00 23.95  ? 426  DA  C OP2   1 
ATOM   287  O  "O5'" . DA  B 2 6   ? 41.194 -17.915 -104.887 1.00 20.89  ? 426  DA  C "O5'" 1 
ATOM   288  C  "C5'" . DA  B 2 6   ? 42.102 -18.816 -104.194 1.00 19.64  ? 426  DA  C "C5'" 1 
ATOM   289  C  "C4'" . DA  B 2 6   ? 43.331 -19.086 -105.062 1.00 17.85  ? 426  DA  C "C4'" 1 
ATOM   290  O  "O4'" . DA  B 2 6   ? 42.964 -19.983 -106.115 1.00 18.01  ? 426  DA  C "O4'" 1 
ATOM   291  C  "C3'" . DA  B 2 6   ? 43.853 -17.869 -105.835 1.00 16.55  ? 426  DA  C "C3'" 1 
ATOM   292  O  "O3'" . DA  B 2 6   ? 44.687 -17.120 -104.959 1.00 14.82  ? 426  DA  C "O3'" 1 
ATOM   293  C  "C2'" . DA  B 2 6   ? 44.520 -18.432 -107.062 1.00 16.28  ? 426  DA  C "C2'" 1 
ATOM   294  C  "C1'" . DA  B 2 6   ? 43.851 -19.780 -107.238 1.00 16.77  ? 426  DA  C "C1'" 1 
ATOM   295  N  N9    . DA  B 2 6   ? 43.000 -19.863 -108.419 1.00 16.95  ? 426  DA  C N9    1 
ATOM   296  C  C8    . DA  B 2 6   ? 41.961 -19.025 -108.752 1.00 21.16  ? 426  DA  C C8    1 
ATOM   297  N  N7    . DA  B 2 6   ? 41.372 -19.348 -109.911 1.00 20.78  ? 426  DA  C N7    1 
ATOM   298  C  C5    . DA  B 2 6   ? 42.092 -20.439 -110.344 1.00 17.61  ? 426  DA  C C5    1 
ATOM   299  C  C6    . DA  B 2 6   ? 41.897 -21.282 -111.455 1.00 17.40  ? 426  DA  C C6    1 
ATOM   300  N  N6    . DA  B 2 6   ? 40.939 -21.120 -112.410 1.00 20.80  ? 426  DA  C N6    1 
ATOM   301  N  N1    . DA  B 2 6   ? 42.826 -22.256 -111.582 1.00 17.94  ? 426  DA  C N1    1 
ATOM   302  C  C2    . DA  B 2 6   ? 43.790 -22.466 -110.678 1.00 17.29  ? 426  DA  C C2    1 
ATOM   303  N  N3    . DA  B 2 6   ? 43.939 -21.810 -109.507 1.00 17.06  ? 426  DA  C N3    1 
ATOM   304  C  C4    . DA  B 2 6   ? 43.066 -20.776 -109.436 1.00 16.00  ? 426  DA  C C4    1 
HETATM 305  P  P     . PED B 2 7   ? 45.270 -15.691 -105.416 1.00 15.24  ? 427  PED C P     1 
HETATM 306  O  O1P   . PED B 2 7   ? 45.505 -14.929 -104.155 1.00 16.40  ? 427  PED C O1P   1 
HETATM 307  O  O2P   . PED B 2 7   ? 44.443 -15.097 -106.521 1.00 15.85  ? 427  PED C O2P   1 
HETATM 308  O  "O5'" . PED B 2 7   ? 46.701 -16.052 -106.088 1.00 15.26  ? 427  PED C "O5'" 1 
HETATM 309  C  "C2'" . PED B 2 7   ? 50.063 -17.545 -107.257 1.00 14.15  ? 427  PED C "C2'" 1 
HETATM 310  C  "C5'" . PED B 2 7   ? 47.809 -16.475 -105.249 1.00 16.77  ? 427  PED C "C5'" 1 
HETATM 311  C  "C4'" . PED B 2 7   ? 48.998 -15.631 -105.815 1.00 12.72  ? 427  PED C "C4'" 1 
HETATM 312  O  "O4'" . PED B 2 7   ? 50.074 -15.796 -104.875 1.00 13.37  ? 427  PED C "O4'" 1 
HETATM 313  C  "C3'" . PED B 2 7   ? 49.427 -16.156 -107.213 1.00 12.28  ? 427  PED C "C3'" 1 
HETATM 314  C  "C1'" . PED B 2 7   ? 51.531 -17.569 -106.817 1.00 16.18  ? 427  PED C "C1'" 1 
HETATM 315  O  "O3'" . PED B 2 7   ? 50.450 -15.256 -107.731 1.00 12.22  ? 427  PED C "O3'" 1 
ATOM   316  P  P     . DG  B 2 8   ? 50.058 -14.049 -108.700 1.00 12.51  ? 428  DG  C P     1 
ATOM   317  O  OP1   . DG  B 2 8   ? 51.371 -13.381 -109.016 1.00 13.39  ? 428  DG  C OP1   1 
ATOM   318  O  OP2   . DG  B 2 8   ? 48.931 -13.223 -108.151 1.00 12.21  ? 428  DG  C OP2   1 
ATOM   319  O  "O5'" . DG  B 2 8   ? 49.483 -14.771 -110.002 1.00 13.13  ? 428  DG  C "O5'" 1 
ATOM   320  C  "C5'" . DG  B 2 8   ? 50.412 -15.585 -110.791 1.00 13.31  ? 428  DG  C "C5'" 1 
ATOM   321  C  "C4'" . DG  B 2 8   ? 50.348 -15.208 -112.237 1.00 12.09  ? 428  DG  C "C4'" 1 
ATOM   322  O  "O4'" . DG  B 2 8   ? 49.084 -15.609 -112.836 1.00 13.04  ? 428  DG  C "O4'" 1 
ATOM   323  C  "C3'" . DG  B 2 8   ? 50.429 -13.680 -112.465 1.00 11.90  ? 428  DG  C "C3'" 1 
ATOM   324  O  "O3'" . DG  B 2 8   ? 51.336 -13.477 -113.571 1.00 11.13  ? 428  DG  C "O3'" 1 
ATOM   325  C  "C2'" . DG  B 2 8   ? 49.016 -13.223 -112.818 1.00 12.70  ? 428  DG  C "C2'" 1 
ATOM   326  C  "C1'" . DG  B 2 8   ? 48.491 -14.479 -113.485 1.00 12.66  ? 428  DG  C "C1'" 1 
ATOM   327  N  N9    . DG  B 2 8   ? 47.060 -14.701 -113.388 1.00 14.39  ? 428  DG  C N9    1 
ATOM   328  C  C8    . DG  B 2 8   ? 46.175 -14.507 -112.338 1.00 14.31  ? 428  DG  C C8    1 
ATOM   329  N  N7    . DG  B 2 8   ? 44.924 -14.809 -112.501 1.00 17.09  ? 428  DG  C N7    1 
ATOM   330  C  C5    . DG  B 2 8   ? 44.965 -15.215 -113.854 1.00 16.56  ? 428  DG  C C5    1 
ATOM   331  C  C6    . DG  B 2 8   ? 43.882 -15.634 -114.735 1.00 18.98  ? 428  DG  C C6    1 
ATOM   332  O  O6    . DG  B 2 8   ? 42.717 -15.744 -114.312 1.00 20.43  ? 428  DG  C O6    1 
ATOM   333  N  N1    . DG  B 2 8   ? 44.269 -15.962 -116.068 1.00 21.30  ? 428  DG  C N1    1 
ATOM   334  C  C2    . DG  B 2 8   ? 45.554 -15.780 -116.503 1.00 22.77  ? 428  DG  C C2    1 
ATOM   335  N  N2    . DG  B 2 8   ? 45.789 -16.044 -117.789 1.00 21.39  ? 428  DG  C N2    1 
ATOM   336  N  N3    . DG  B 2 8   ? 46.568 -15.428 -115.718 1.00 20.99  ? 428  DG  C N3    1 
ATOM   337  C  C4    . DG  B 2 8   ? 46.233 -15.123 -114.424 1.00 15.98  ? 428  DG  C C4    1 
ATOM   338  P  P     . DA  B 2 9   ? 51.811 -11.997 -113.989 1.00 11.16  ? 429  DA  C P     1 
ATOM   339  O  OP1   . DA  B 2 9   ? 53.141 -12.106 -114.615 1.00 11.96  ? 429  DA  C OP1   1 
ATOM   340  O  OP2   . DA  B 2 9   ? 51.646 -11.068 -112.849 1.00 12.00  ? 429  DA  C OP2   1 
ATOM   341  O  "O5'" . DA  B 2 9   ? 50.753 -11.609 -115.114 1.00 14.63  ? 429  DA  C "O5'" 1 
ATOM   342  C  "C5'" . DA  B 2 9   ? 50.984 -12.271 -116.413 1.00 25.25  ? 429  DA  C "C5'" 1 
ATOM   343  C  "C4'" . DA  B 2 9   ? 49.790 -12.038 -117.253 1.00 28.38  ? 429  DA  C "C4'" 1 
ATOM   344  O  "O4'" . DA  B 2 9   ? 48.592 -12.376 -116.545 1.00 31.19  ? 429  DA  C "O4'" 1 
ATOM   345  C  "C3'" . DA  B 2 9   ? 49.597 -10.496 -117.489 1.00 31.11  ? 429  DA  C "C3'" 1 
ATOM   346  O  "O3'" . DA  B 2 9   ? 49.555 -10.637 -118.912 1.00 43.61  ? 429  DA  C "O3'" 1 
ATOM   347  C  "C2'" . DA  B 2 9   ? 48.108 -10.242 -117.252 1.00 31.74  ? 429  DA  C "C2'" 1 
ATOM   348  C  "C1'" . DA  B 2 9   ? 47.633 -11.714 -117.413 1.00 34.97  ? 429  DA  C "C1'" 1 
ATOM   349  N  N9    . DA  B 2 9   ? 46.376 -11.839 -116.689 1.00 32.35  ? 429  DA  C N9    1 
ATOM   350  C  C8    . DA  B 2 9   ? 46.225 -11.398 -115.376 1.00 33.26  ? 429  DA  C C8    1 
ATOM   351  N  N7    . DA  B 2 9   ? 45.001 -11.634 -115.002 1.00 30.00  ? 429  DA  C N7    1 
ATOM   352  C  C5    . DA  B 2 9   ? 44.416 -12.246 -116.082 1.00 28.07  ? 429  DA  C C5    1 
ATOM   353  C  C6    . DA  B 2 9   ? 43.105 -12.730 -116.227 1.00 27.09  ? 429  DA  C C6    1 
ATOM   354  N  N6    . DA  B 2 9   ? 42.175 -12.625 -115.259 1.00 34.11  ? 429  DA  C N6    1 
ATOM   355  N  N1    . DA  B 2 9   ? 42.931 -13.383 -117.393 1.00 29.49  ? 429  DA  C N1    1 
ATOM   356  C  C2    . DA  B 2 9   ? 43.763 -13.513 -118.416 1.00 32.41  ? 429  DA  C C2    1 
ATOM   357  N  N3    . DA  B 2 9   ? 45.006 -13.049 -118.312 1.00 36.62  ? 429  DA  C N3    1 
ATOM   358  C  C4    . DA  B 2 9   ? 45.244 -12.428 -117.137 1.00 31.63  ? 429  DA  C C4    1 
ATOM   359  P  P     . DA  B 2 10  ? 50.038 -9.536  -119.953 1.00 52.36  ? 430  DA  C P     1 
ATOM   360  O  OP1   . DA  B 2 10  ? 51.052 -10.299 -120.721 1.00 62.28  ? 430  DA  C OP1   1 
ATOM   361  O  OP2   . DA  B 2 10  ? 50.063 -8.231  -119.292 1.00 62.12  ? 430  DA  C OP2   1 
ATOM   362  O  "O5'" . DA  B 2 10  ? 48.752 -9.476  -120.952 1.00 43.70  ? 430  DA  C "O5'" 1 
ATOM   363  C  "C5'" . DA  B 2 10  ? 48.734 -10.753 -121.662 1.00 44.01  ? 430  DA  C "C5'" 1 
ATOM   364  C  "C4'" . DA  B 2 10  ? 47.480 -10.991 -122.474 1.00 40.44  ? 430  DA  C "C4'" 1 
ATOM   365  O  "O4'" . DA  B 2 10  ? 46.316 -11.205 -121.632 1.00 36.38  ? 430  DA  C "O4'" 1 
ATOM   366  C  "C3'" . DA  B 2 10  ? 47.171 -9.756  -123.332 1.00 45.99  ? 430  DA  C "C3'" 1 
ATOM   367  O  "O3'" . DA  B 2 10  ? 46.432 -10.221 -124.452 1.00 48.76  ? 430  DA  C "O3'" 1 
ATOM   368  C  "C2'" . DA  B 2 10  ? 46.300 -8.924  -122.399 1.00 41.07  ? 430  DA  C "C2'" 1 
ATOM   369  C  "C1'" . DA  B 2 10  ? 45.485 -10.041 -121.751 1.00 37.61  ? 430  DA  C "C1'" 1 
ATOM   370  N  N9    . DA  B 2 10  ? 44.951 -9.626  -120.435 1.00 36.28  ? 430  DA  C N9    1 
ATOM   371  C  C8    . DA  B 2 10  ? 45.507 -8.797  -119.496 1.00 38.69  ? 430  DA  C C8    1 
ATOM   372  N  N7    . DA  B 2 10  ? 44.747 -8.676  -118.431 1.00 39.62  ? 430  DA  C N7    1 
ATOM   373  C  C5    . DA  B 2 10  ? 43.654 -9.436  -118.772 1.00 39.92  ? 430  DA  C C5    1 
ATOM   374  C  C6    . DA  B 2 10  ? 42.501 -9.647  -118.024 1.00 41.53  ? 430  DA  C C6    1 
ATOM   375  N  N6    . DA  B 2 10  ? 42.321 -9.131  -116.804 1.00 47.52  ? 430  DA  C N6    1 
ATOM   376  N  N1    . DA  B 2 10  ? 41.700 -10.468 -118.680 1.00 40.35  ? 430  DA  C N1    1 
ATOM   377  C  C2    . DA  B 2 10  ? 41.765 -11.034 -119.856 1.00 40.64  ? 430  DA  C C2    1 
ATOM   378  N  N3    . DA  B 2 10  ? 42.849 -10.851 -120.638 1.00 44.70  ? 430  DA  C N3    1 
ATOM   379  C  C4    . DA  B 2 10  ? 43.732 -10.050 -119.988 1.00 41.54  ? 430  DA  C C4    1 
ATOM   380  P  P     . DG  B 2 11  ? 46.055 -9.182  -125.680 1.00 46.13  ? 431  DG  C P     1 
ATOM   381  O  OP1   . DG  B 2 11  ? 46.679 -9.737  -126.932 1.00 68.84  ? 431  DG  C OP1   1 
ATOM   382  O  OP2   . DG  B 2 11  ? 46.373 -7.785  -125.254 1.00 45.52  ? 431  DG  C OP2   1 
ATOM   383  O  "O5'" . DG  B 2 11  ? 44.464 -9.599  -125.677 1.00 51.94  ? 431  DG  C "O5'" 1 
ATOM   384  C  "C5'" . DG  B 2 11  ? 44.050 -10.679 -126.557 1.00 62.72  ? 431  DG  C "C5'" 1 
ATOM   385  C  "C4'" . DG  B 2 11  ? 42.560 -10.966 -126.606 1.00 62.62  ? 431  DG  C "C4'" 1 
ATOM   386  O  "O4'" . DG  B 2 11  ? 42.048 -10.862 -125.243 1.00 60.50  ? 431  DG  C "O4'" 1 
ATOM   387  C  "C3'" . DG  B 2 11  ? 41.705 -9.994  -127.436 1.00 58.60  ? 431  DG  C "C3'" 1 
ATOM   388  O  "O3'" . DG  B 2 11  ? 40.452 -10.518 -127.877 1.00 52.27  ? 431  DG  C "O3'" 1 
ATOM   389  C  "C2'" . DG  B 2 11  ? 41.564 -8.863  -126.413 1.00 61.88  ? 431  DG  C "C2'" 1 
ATOM   390  C  "C1'" . DG  B 2 11  ? 41.393 -9.610  -125.101 1.00 60.29  ? 431  DG  C "C1'" 1 
ATOM   391  N  N9    . DG  B 2 11  ? 41.780 -8.988  -123.832 1.00 61.98  ? 431  DG  C N9    1 
ATOM   392  C  C8    . DG  B 2 11  ? 43.027 -8.592  -123.373 1.00 58.25  ? 431  DG  C C8    1 
ATOM   393  N  N7    . DG  B 2 11  ? 43.243 -8.060  -122.186 1.00 54.32  ? 431  DG  C N7    1 
ATOM   394  C  C5    . DG  B 2 11  ? 41.896 -8.000  -121.772 1.00 57.30  ? 431  DG  C C5    1 
ATOM   395  C  C6    . DG  B 2 11  ? 41.355 -7.559  -120.469 1.00 54.11  ? 431  DG  C C6    1 
ATOM   396  O  O6    . DG  B 2 11  ? 41.998 -7.064  -119.504 1.00 64.36  ? 431  DG  C O6    1 
ATOM   397  N  N1    . DG  B 2 11  ? 39.960 -7.654  -120.313 1.00 54.88  ? 431  DG  C N1    1 
ATOM   398  C  C2    . DG  B 2 11  ? 39.223 -8.224  -121.287 1.00 59.60  ? 431  DG  C C2    1 
ATOM   399  N  N2    . DG  B 2 11  ? 37.952 -8.261  -120.965 1.00 64.14  ? 431  DG  C N2    1 
ATOM   400  N  N3    . DG  B 2 11  ? 39.669 -8.677  -122.433 1.00 61.87  ? 431  DG  C N3    1 
ATOM   401  C  C4    . DG  B 2 11  ? 41.024 -8.602  -122.722 1.00 60.77  ? 431  DG  C C4    1 
ATOM   402  N  N     . PRO C 3 1   ? 52.460 -18.533 -107.240 1.00 15.73  ? 1    PRO A N     1 
ATOM   403  C  CA    . PRO C 3 1   ? 53.878 -18.260 -107.267 1.00 15.37  ? 1    PRO A CA    1 
ATOM   404  C  C     . PRO C 3 1   ? 54.209 -16.912 -107.885 1.00 12.48  ? 1    PRO A C     1 
ATOM   405  O  O     . PRO C 3 1   ? 53.879 -16.656 -109.046 1.00 14.08  ? 1    PRO A O     1 
ATOM   406  C  CB    . PRO C 3 1   ? 54.449 -19.484 -107.961 1.00 21.83  ? 1    PRO A CB    1 
ATOM   407  C  CG    . PRO C 3 1   ? 53.614 -20.602 -107.279 1.00 21.82  ? 1    PRO A CG    1 
ATOM   408  C  CD    . PRO C 3 1   ? 52.274 -19.958 -106.950 1.00 18.53  ? 1    PRO A CD    1 
ATOM   409  N  N     . GLU C 3 2   ? 54.785 -16.047 -107.058 1.00 11.33  ? 2    GLU A N     1 
ATOM   410  C  CA    . GLU C 3 2   ? 55.090 -14.658 -107.439 1.00 10.94  ? 2    GLU A CA    1 
ATOM   411  C  C     . GLU C 3 2   ? 56.572 -14.505 -107.693 1.00 9.92   ? 2    GLU A C     1 
ATOM   412  O  O     . GLU C 3 2   ? 57.306 -15.499 -107.784 1.00 11.70  ? 2    GLU A O     1 
ATOM   413  C  CB    . GLU C 3 2   ? 54.578 -13.708 -106.343 1.00 11.99  ? 2    GLU A CB    1 
ATOM   414  C  CG    . GLU C 3 2   ? 53.119 -14.037 -106.041 1.00 11.97  ? 2    GLU A CG    1 
ATOM   415  C  CD    . GLU C 3 2   ? 52.334 -13.054 -105.201 1.00 11.75  ? 2    GLU A CD    1 
ATOM   416  O  OE1   . GLU C 3 2   ? 52.792 -11.945 -104.842 1.00 11.63  ? 2    GLU A OE1   1 
ATOM   417  O  OE2   . GLU C 3 2   ? 51.199 -13.494 -104.848 1.00 12.55  ? 2    GLU A OE2   1 
ATOM   418  N  N     . GLY C 3 3   ? 57.053 -13.264 -107.866 1.00 10.42  ? 3    GLY A N     1 
ATOM   419  C  CA    . GLY C 3 3   ? 58.462 -13.122 -108.234 1.00 10.74  ? 3    GLY A CA    1 
ATOM   420  C  C     . GLY C 3 3   ? 59.439 -13.845 -107.322 1.00 10.40  ? 3    GLY A C     1 
ATOM   421  O  O     . GLY C 3 3   ? 60.375 -14.498 -107.791 1.00 11.15  ? 3    GLY A O     1 
ATOM   422  N  N     . PRO C 3 4   ? 59.280 -13.761 -105.994 1.00 10.58  ? 4    PRO A N     1 
ATOM   423  C  CA    . PRO C 3 4   ? 60.222 -14.455 -105.082 1.00 10.78  ? 4    PRO A CA    1 
ATOM   424  C  C     . PRO C 3 4   ? 60.298 -15.950 -105.321 1.00 10.78  ? 4    PRO A C     1 
ATOM   425  O  O     . PRO C 3 4   ? 61.369 -16.567 -105.302 1.00 11.65  ? 4    PRO A O     1 
ATOM   426  C  CB    . PRO C 3 4   ? 59.654 -14.117 -103.674 1.00 10.56  ? 4    PRO A CB    1 
ATOM   427  C  CG    . PRO C 3 4   ? 59.053 -12.745 -103.887 1.00 11.80  ? 4    PRO A CG    1 
ATOM   428  C  CD    . PRO C 3 4   ? 58.312 -12.935 -105.209 1.00 12.08  ? 4    PRO A CD    1 
ATOM   429  N  N     . GLU C 3 5   ? 59.110 -16.555 -105.537 1.00 11.02  ? 5    GLU A N     1 
ATOM   430  C  CA    . GLU C 3 5   ? 59.059 -18.006 -105.734 1.00 10.88  ? 5    GLU A CA    1 
ATOM   431  C  C     . GLU C 3 5   ? 59.652 -18.400 -107.090 1.00 10.79  ? 5    GLU A C     1 
ATOM   432  O  O     . GLU C 3 5   ? 60.317 -19.458 -107.196 1.00 12.00  ? 5    GLU A O     1 
ATOM   433  C  CB    . GLU C 3 5   ? 57.615 -18.505 -105.648 1.00 13.07  ? 5    GLU A CB    1 
ATOM   434  C  CG    . GLU C 3 5   ? 57.017 -18.378 -104.223 1.00 13.17  ? 5    GLU A CG    1 
ATOM   435  C  CD    . GLU C 3 5   ? 56.714 -16.931 -103.833 1.00 12.33  ? 5    GLU A CD    1 
ATOM   436  O  OE1   . GLU C 3 5   ? 56.293 -16.150 -104.704 1.00 12.76  ? 5    GLU A OE1   1 
ATOM   437  O  OE2   . GLU C 3 5   ? 56.952 -16.610 -102.636 1.00 13.02  ? 5    GLU A OE2   1 
ATOM   438  N  N     . ILE C 3 6   ? 59.441 -17.561 -108.102 1.00 10.19  ? 6    ILE A N     1 
ATOM   439  C  CA    . ILE C 3 6   ? 60.001 -17.859 -109.436 1.00 10.03  ? 6    ILE A CA    1 
ATOM   440  C  C     . ILE C 3 6   ? 61.511 -17.711 -109.401 1.00 10.45  ? 6    ILE A C     1 
ATOM   441  O  O     . ILE C 3 6   ? 62.240 -18.505 -110.048 1.00 11.36  ? 6    ILE A O     1 
ATOM   442  C  CB    . ILE C 3 6   ? 59.283 -17.026 -110.515 1.00 10.84  ? 6    ILE A CB    1 
ATOM   443  C  CG1   . ILE C 3 6   ? 57.789 -17.350 -110.576 1.00 11.50  ? 6    ILE A CG1   1 
ATOM   444  C  CG2   . ILE C 3 6   ? 59.976 -17.216 -111.865 1.00 12.90  ? 6    ILE A CG2   1 
ATOM   445  C  CD1   . ILE C 3 6   ? 57.523 -18.864 -110.761 1.00 13.76  ? 6    ILE A CD1   1 
ATOM   446  N  N     . ARG C 3 7   ? 62.056 -16.719 -108.663 1.00 10.26  ? 7    ARG A N     1 
ATOM   447  C  CA    . ARG C 3 7   ? 63.499 -16.581 -108.579 1.00 9.89   ? 7    ARG A CA    1 
ATOM   448  C  C     . ARG C 3 7   ? 64.080 -17.728 -107.771 1.00 10.71  ? 7    ARG A C     1 
ATOM   449  O  O     . ARG C 3 7   ? 65.148 -18.254 -108.141 1.00 11.04  ? 7    ARG A O     1 
ATOM   450  C  CB    . ARG C 3 7   ? 63.886 -15.238 -107.986 1.00 10.38  ? 7    ARG A CB    1 
ATOM   451  C  CG    . ARG C 3 7   ? 65.403 -14.981 -107.975 1.00 10.90  ? 7    ARG A CG    1 
ATOM   452  C  CD    . ARG C 3 7   ? 66.010 -14.854 -109.378 1.00 11.78  ? 7    ARG A CD    1 
ATOM   453  N  NE    . ARG C 3 7   ? 66.858 -15.992 -109.723 1.00 12.24  ? 7    ARG A NE    1 
ATOM   454  C  CZ    . ARG C 3 7   ? 67.327 -16.271 -110.925 1.00 11.61  ? 7    ARG A CZ    1 
ATOM   455  N  NH1   . ARG C 3 7   ? 66.948 -15.575 -111.979 1.00 12.15  ? 7    ARG A NH1   1 
ATOM   456  N  NH2   . ARG C 3 7   ? 68.175 -17.291 -111.093 1.00 12.25  ? 7    ARG A NH2   1 
ATOM   457  N  N     . ARG C 3 8   ? 63.436 -18.140 -106.695 1.00 10.91  ? 8    ARG A N     1 
ATOM   458  C  CA    . ARG C 3 8   ? 63.915 -19.354 -105.980 1.00 11.64  ? 8    ARG A CA    1 
ATOM   459  C  C     . ARG C 3 8   ? 63.943 -20.540 -106.923 1.00 12.00  ? 8    ARG A C     1 
ATOM   460  O  O     . ARG C 3 8   ? 64.900 -21.346 -106.878 1.00 12.01  ? 8    ARG A O     1 
ATOM   461  C  CB    . ARG C 3 8   ? 62.996 -19.658 -104.783 1.00 13.14  ? 8    ARG A CB    1 
ATOM   462  C  CG    . ARG C 3 8   ? 63.321 -18.772 -103.571 1.00 13.38  ? 8    ARG A CG    1 
ATOM   463  C  CD    . ARG C 3 8   ? 62.146 -18.760 -102.589 1.00 14.58  ? 8    ARG A CD    1 
ATOM   464  N  NE    . ARG C 3 8   ? 61.918 -20.135 -102.104 1.00 14.42  ? 8    ARG A NE    1 
ATOM   465  C  CZ    . ARG C 3 8   ? 60.770 -20.542 -101.595 1.00 15.12  ? 8    ARG A CZ    1 
ATOM   466  N  NH1   . ARG C 3 8   ? 59.760 -19.706 -101.460 1.00 15.56  ? 8    ARG A NH1   1 
ATOM   467  N  NH2   . ARG C 3 8   ? 60.674 -21.827 -101.232 1.00 17.23  ? 8    ARG A NH2   1 
ATOM   468  N  N     . ALA C 3 9   ? 62.898 -20.721 -107.741 1.00 11.47  ? 9    ALA A N     1 
ATOM   469  C  CA    . ALA C 3 9   ? 62.885 -21.864 -108.683 1.00 10.87  ? 9    ALA A CA    1 
ATOM   470  C  C     . ALA C 3 9   ? 64.020 -21.725 -109.665 1.00 10.95  ? 9    ALA A C     1 
ATOM   471  O  O     . ALA C 3 9   ? 64.738 -22.708 -109.899 1.00 11.79  ? 9    ALA A O     1 
ATOM   472  C  CB    . ALA C 3 9   ? 61.548 -21.892 -109.398 1.00 12.26  ? 9    ALA A CB    1 
ATOM   473  N  N     . ALA C 3 10  ? 64.200 -20.536 -110.239 1.00 10.49  ? 10   ALA A N     1 
ATOM   474  C  CA    . ALA C 3 10  ? 65.286 -20.341 -111.205 1.00 10.59  ? 10   ALA A CA    1 
ATOM   475  C  C     . ALA C 3 10  ? 66.662 -20.649 -110.606 1.00 11.06  ? 10   ALA A C     1 
ATOM   476  O  O     . ALA C 3 10  ? 67.531 -21.233 -111.229 1.00 10.97  ? 10   ALA A O     1 
ATOM   477  C  CB    . ALA C 3 10  ? 65.248 -18.935 -111.723 1.00 11.11  ? 10   ALA A CB    1 
ATOM   478  N  N     . ASP C 3 11  ? 66.837 -20.263 -109.319 1.00 10.74  ? 11   ASP A N     1 
ATOM   479  C  CA    . ASP C 3 11  ? 68.115 -20.559 -108.645 1.00 10.58  ? 11   ASP A CA    1 
ATOM   480  C  C     . ASP C 3 11  ? 68.331 -22.063 -108.570 1.00 10.14  ? 11   ASP A C     1 
ATOM   481  O  O     . ASP C 3 11  ? 69.450 -22.552 -108.780 1.00 12.46  ? 11   ASP A O     1 
ATOM   482  C  CB    . ASP C 3 11  ? 68.102 -19.975 -107.258 1.00 11.51  ? 11   ASP A CB    1 
ATOM   483  C  CG    . ASP C 3 11  ? 68.142 -18.452 -107.204 1.00 12.12  ? 11   ASP A CG    1 
ATOM   484  O  OD1   . ASP C 3 11  ? 68.465 -17.814 -108.222 1.00 12.90  ? 11   ASP A OD1   1 
ATOM   485  O  OD2   . ASP C 3 11  ? 67.857 -17.937 -106.096 1.00 13.39  ? 11   ASP A OD2   1 
ATOM   486  N  N     . ASN C 3 12  ? 67.266 -22.817 -108.284 1.00 11.34  ? 12   ASN A N     1 
ATOM   487  C  CA    . ASN C 3 12  ? 67.380 -24.269 -108.225 1.00 11.86  ? 12   ASN A CA    1 
ATOM   488  C  C     . ASN C 3 12  ? 67.632 -24.857 -109.614 1.00 11.81  ? 12   ASN A C     1 
ATOM   489  O  O     . ASN C 3 12  ? 68.364 -25.840 -109.731 1.00 12.05  ? 12   ASN A O     1 
ATOM   490  C  CB    . ASN C 3 12  ? 66.141 -24.885 -107.564 1.00 14.06  ? 12   ASN A CB    1 
ATOM   491  C  CG    . ASN C 3 12  ? 66.120 -24.617 -106.030 1.00 14.54  ? 12   ASN A CG    1 
ATOM   492  O  OD1   . ASN C 3 12  ? 67.176 -24.564 -105.451 1.00 20.38  ? 12   ASN A OD1   1 
ATOM   493  N  ND2   . ASN C 3 12  ? 64.909 -24.490 -105.569 1.00 17.18  ? 12   ASN A ND2   1 
ATOM   494  N  N     . LEU C 3 13  ? 67.039 -24.281 -110.653 1.00 10.84  ? 13   LEU A N     1 
ATOM   495  C  CA    . LEU C 3 13  ? 67.319 -24.800 -112.019 1.00 10.87  ? 13   LEU A CA    1 
ATOM   496  C  C     . LEU C 3 13  ? 68.787 -24.573 -112.368 1.00 10.36  ? 13   LEU A C     1 
ATOM   497  O  O     . LEU C 3 13  ? 69.399 -25.432 -112.972 1.00 11.36  ? 13   LEU A O     1 
ATOM   498  C  CB    . LEU C 3 13  ? 66.427 -24.091 -113.049 1.00 11.82  ? 13   LEU A CB    1 
ATOM   499  C  CG    . LEU C 3 13  ? 64.922 -24.176 -112.788 1.00 11.27  ? 13   LEU A CG    1 
ATOM   500  C  CD1   . LEU C 3 13  ? 64.179 -23.528 -113.973 1.00 12.78  ? 13   LEU A CD1   1 
ATOM   501  C  CD2   . LEU C 3 13  ? 64.421 -25.590 -112.548 1.00 13.04  ? 13   LEU A CD2   1 
ATOM   502  N  N     . GLU C 3 14  ? 69.317 -23.411 -111.990 1.00 10.78  ? 14   GLU A N     1 
ATOM   503  C  CA    . GLU C 3 14  ? 70.738 -23.168 -112.254 1.00 11.30  ? 14   GLU A CA    1 
ATOM   504  C  C     . GLU C 3 14  ? 71.638 -24.126 -111.481 1.00 11.15  ? 14   GLU A C     1 
ATOM   505  O  O     . GLU C 3 14  ? 72.579 -24.692 -112.051 1.00 12.42  ? 14   GLU A O     1 
ATOM   506  C  CB    . GLU C 3 14  ? 71.158 -21.749 -111.903 1.00 11.87  ? 14   GLU A CB    1 
ATOM   507  C  CG    . GLU C 3 14  ? 70.557 -20.745 -112.887 1.00 14.16  ? 14   GLU A CG    1 
ATOM   508  C  CD    . GLU C 3 14  ? 71.009 -19.326 -112.612 1.00 15.28  ? 14   GLU A CD    1 
ATOM   509  O  OE1   . GLU C 3 14  ? 71.064 -18.956 -111.430 1.00 20.71  ? 14   GLU A OE1   1 
ATOM   510  O  OE2   . GLU C 3 14  ? 71.238 -18.587 -113.578 1.00 15.64  ? 14   GLU A OE2   1 
ATOM   511  N  N     . ALA C 3 15  ? 71.352 -24.324 -110.205 1.00 12.33  ? 15   ALA A N     1 
ATOM   512  C  CA    . ALA C 3 15  ? 72.200 -25.272 -109.430 1.00 12.81  ? 15   ALA A CA    1 
ATOM   513  C  C     . ALA C 3 15  ? 72.161 -26.647 -110.059 1.00 12.70  ? 15   ALA A C     1 
ATOM   514  O  O     . ALA C 3 15  ? 73.162 -27.386 -110.063 1.00 16.57  ? 15   ALA A O     1 
ATOM   515  C  CB    . ALA C 3 15  ? 71.716 -25.312 -107.983 1.00 14.33  ? 15   ALA A CB    1 
ATOM   516  N  N     . ALA C 3 16  ? 71.008 -27.029 -110.631 1.00 12.11  ? 16   ALA A N     1 
ATOM   517  C  CA    . ALA C 3 16  ? 70.895 -28.334 -111.227 1.00 11.80  ? 16   ALA A CA    1 
ATOM   518  C  C     . ALA C 3 16  ? 71.658 -28.455 -112.558 1.00 11.14  ? 16   ALA A C     1 
ATOM   519  O  O     . ALA C 3 16  ? 72.306 -29.499 -112.752 1.00 12.32  ? 16   ALA A O     1 
ATOM   520  C  CB    . ALA C 3 16  ? 69.415 -28.674 -111.424 1.00 12.93  ? 16   ALA A CB    1 
ATOM   521  N  N     . ILE C 3 17  ? 71.504 -27.495 -113.454 1.00 11.16  ? 17   ILE A N     1 
ATOM   522  C  CA    . ILE C 3 17  ? 71.968 -27.774 -114.815 1.00 11.34  ? 17   ILE A CA    1 
ATOM   523  C  C     . ILE C 3 17  ? 72.754 -26.628 -115.429 1.00 11.23  ? 17   ILE A C     1 
ATOM   524  O  O     . ILE C 3 17  ? 73.230 -26.817 -116.573 1.00 11.61  ? 17   ILE A O     1 
ATOM   525  C  CB    . ILE C 3 17  ? 70.880 -28.258 -115.814 1.00 13.31  ? 17   ILE A CB    1 
ATOM   526  C  CG1   . ILE C 3 17  ? 69.901 -27.132 -116.177 1.00 15.91  ? 17   ILE A CG1   1 
ATOM   527  C  CG2   . ILE C 3 17  ? 70.209 -29.527 -115.313 1.00 14.18  ? 17   ILE A CG2   1 
ATOM   528  C  CD1   . ILE C 3 17  ? 69.059 -27.524 -117.385 1.00 16.37  ? 17   ILE A CD1   1 
ATOM   529  N  N     . LYS C 3 18  ? 73.000 -25.484 -114.812 1.00 11.15  ? 18   LYS A N     1 
ATOM   530  C  CA    . LYS C 3 18  ? 73.784 -24.447 -115.461 1.00 11.59  ? 18   LYS A CA    1 
ATOM   531  C  C     . LYS C 3 18  ? 75.170 -24.986 -115.845 1.00 11.11  ? 18   LYS A C     1 
ATOM   532  O  O     . LYS C 3 18  ? 75.856 -25.619 -115.041 1.00 12.62  ? 18   LYS A O     1 
ATOM   533  C  CB    . LYS C 3 18  ? 73.858 -23.216 -114.535 1.00 12.72  ? 18   LYS A CB    1 
ATOM   534  C  CG    . LYS C 3 18  ? 74.787 -22.124 -115.035 1.00 15.08  ? 18   LYS A CG    1 
ATOM   535  C  CD    . LYS C 3 18  ? 74.801 -20.954 -114.033 1.00 16.53  ? 18   LYS A CD    1 
ATOM   536  C  CE    . LYS C 3 18  ? 75.886 -19.936 -114.439 1.00 18.87  ? 18   LYS A CE    1 
ATOM   537  N  NZ    . LYS C 3 18  ? 75.990 -18.873 -113.385 1.00 23.16  ? 18   LYS A NZ    1 
ATOM   538  N  N     . GLY C 3 19  ? 75.526 -24.711 -117.106 1.00 11.04  ? 19   GLY A N     1 
ATOM   539  C  CA    . GLY C 3 19  ? 76.849 -25.073 -117.612 1.00 12.60  ? 19   GLY A CA    1 
ATOM   540  C  C     . GLY C 3 19  ? 77.036 -26.513 -118.045 1.00 11.94  ? 19   GLY A C     1 
ATOM   541  O  O     . GLY C 3 19  ? 78.084 -26.858 -118.565 1.00 16.97  ? 19   GLY A O     1 
ATOM   542  N  N     . LYS C 3 20  ? 76.011 -27.366 -117.809 1.00 11.17  ? 20   LYS A N     1 
ATOM   543  C  CA    . LYS C 3 20  ? 76.213 -28.800 -118.107 1.00 11.81  ? 20   LYS A CA    1 
ATOM   544  C  C     . LYS C 3 20  ? 75.695 -29.165 -119.473 1.00 11.17  ? 20   LYS A C     1 
ATOM   545  O  O     . LYS C 3 20  ? 74.575 -28.783 -119.839 1.00 11.58  ? 20   LYS A O     1 
ATOM   546  C  CB    . LYS C 3 20  ? 75.435 -29.623 -117.063 1.00 12.49  ? 20   LYS A CB    1 
ATOM   547  C  CG    . LYS C 3 20  ? 75.913 -29.446 -115.608 1.00 13.96  ? 20   LYS A CG    1 
ATOM   548  C  CD    . LYS C 3 20  ? 75.072 -30.340 -114.703 1.00 15.91  ? 20   LYS A CD    1 
ATOM   549  C  CE    . LYS C 3 20  ? 75.527 -30.184 -113.255 1.00 17.15  ? 20   LYS A CE    1 
ATOM   550  N  NZ    . LYS C 3 20  ? 74.528 -30.935 -112.405 1.00 16.34  ? 20   LYS A NZ    1 
ATOM   551  N  N     . PRO C 3 21  ? 76.455 -29.892 -120.291 1.00 11.27  ? 21   PRO A N     1 
ATOM   552  C  CA    . PRO C 3 21  ? 75.912 -30.255 -121.597 1.00 11.47  ? 21   PRO A CA    1 
ATOM   553  C  C     . PRO C 3 21  ? 74.600 -31.025 -121.500 1.00 10.44  ? 21   PRO A C     1 
ATOM   554  O  O     . PRO C 3 21  ? 74.409 -31.942 -120.685 1.00 11.63  ? 21   PRO A O     1 
ATOM   555  C  CB    . PRO C 3 21  ? 77.023 -31.162 -122.192 1.00 13.42  ? 21   PRO A CB    1 
ATOM   556  C  CG    . PRO C 3 21  ? 78.277 -30.661 -121.507 1.00 14.62  ? 21   PRO A CG    1 
ATOM   557  C  CD    . PRO C 3 21  ? 77.840 -30.369 -120.094 1.00 12.21  ? 21   PRO A CD    1 
ATOM   558  N  N     . LEU C 3 22  ? 73.670 -30.665 -122.367 1.00 10.38  ? 22   LEU A N     1 
ATOM   559  C  CA    . LEU C 3 22  ? 72.359 -31.317 -122.401 1.00 10.10  ? 22   LEU A CA    1 
ATOM   560  C  C     . LEU C 3 22  ? 72.490 -32.637 -123.142 1.00 10.64  ? 22   LEU A C     1 
ATOM   561  O  O     . LEU C 3 22  ? 72.917 -32.685 -124.316 1.00 13.13  ? 22   LEU A O     1 
ATOM   562  C  CB    . LEU C 3 22  ? 71.296 -30.430 -123.080 1.00 11.05  ? 22   LEU A CB    1 
ATOM   563  C  CG    . LEU C 3 22  ? 71.011 -29.158 -122.236 1.00 12.23  ? 22   LEU A CG    1 
ATOM   564  C  CD1   . LEU C 3 22  ? 70.423 -28.074 -123.148 1.00 11.65  ? 22   LEU A CD1   1 
ATOM   565  C  CD2   . LEU C 3 22  ? 70.076 -29.488 -121.089 1.00 12.17  ? 22   LEU A CD2   1 
ATOM   566  N  N     . THR C 3 23  ? 72.129 -33.725 -122.495 1.00 10.44  ? 23   THR A N     1 
ATOM   567  C  CA    . THR C 3 23  ? 72.119 -35.043 -123.129 1.00 10.16  ? 23   THR A CA    1 
ATOM   568  C  C     . THR C 3 23  ? 70.756 -35.371 -123.682 1.00 10.22  ? 23   THR A C     1 
ATOM   569  O  O     . THR C 3 23  ? 70.655 -36.264 -124.557 1.00 11.77  ? 23   THR A O     1 
ATOM   570  C  CB    . THR C 3 23  ? 72.586 -36.144 -122.150 1.00 11.17  ? 23   THR A CB    1 
ATOM   571  O  OG1   . THR C 3 23  ? 71.733 -36.069 -121.004 1.00 11.73  ? 23   THR A OG1   1 
ATOM   572  C  CG2   . THR C 3 23  ? 74.035 -35.932 -121.717 1.00 13.39  ? 23   THR A CG2   1 
ATOM   573  N  N     . ASP C 3 24  ? 69.686 -34.733 -123.241 1.00 10.31  ? 24   ASP A N     1 
ATOM   574  C  CA    . ASP C 3 24  ? 68.395 -34.875 -123.915 1.00 11.31  ? 24   ASP A CA    1 
ATOM   575  C  C     . ASP C 3 24  ? 67.575 -33.619 -123.684 1.00 10.11  ? 24   ASP A C     1 
ATOM   576  O  O     . ASP C 3 24  ? 67.725 -32.959 -122.643 1.00 10.93  ? 24   ASP A O     1 
ATOM   577  C  CB    . ASP C 3 24  ? 67.599 -36.147 -123.498 1.00 12.46  ? 24   ASP A CB    1 
ATOM   578  C  CG    . ASP C 3 24  ? 66.476 -36.398 -124.516 1.00 12.71  ? 24   ASP A CG    1 
ATOM   579  O  OD1   . ASP C 3 24  ? 66.703 -36.140 -125.734 1.00 14.10  ? 24   ASP A OD1   1 
ATOM   580  O  OD2   . ASP C 3 24  ? 65.354 -36.822 -124.106 1.00 16.36  ? 24   ASP A OD2   1 
ATOM   581  N  N     . VAL C 3 25  ? 66.723 -33.304 -124.626 1.00 10.19  ? 25   VAL A N     1 
ATOM   582  C  CA    . VAL C 3 25  ? 65.849 -32.132 -124.602 1.00 10.41  ? 25   VAL A CA    1 
ATOM   583  C  C     . VAL C 3 25  ? 64.492 -32.587 -125.138 1.00 10.60  ? 25   VAL A C     1 
ATOM   584  O  O     . VAL C 3 25  ? 64.479 -33.171 -126.238 1.00 11.72  ? 25   VAL A O     1 
ATOM   585  C  CB    . VAL C 3 25  ? 66.419 -31.004 -125.486 1.00 10.97  ? 25   VAL A CB    1 
ATOM   586  C  CG1   . VAL C 3 25  ? 65.415 -29.850 -125.583 1.00 13.13  ? 25   VAL A CG1   1 
ATOM   587  C  CG2   . VAL C 3 25  ? 67.787 -30.580 -124.936 1.00 13.05  ? 25   VAL A CG2   1 
ATOM   588  N  N     . TRP C 3 26  ? 63.433 -32.304 -124.421 1.00 11.38  ? 26   TRP A N     1 
ATOM   589  C  CA    . TRP C 3 26  ? 62.095 -32.674 -124.864 1.00 11.62  ? 26   TRP A CA    1 
ATOM   590  C  C     . TRP C 3 26  ? 61.109 -31.571 -124.599 1.00 10.98  ? 26   TRP A C     1 
ATOM   591  O  O     . TRP C 3 26  ? 61.100 -30.974 -123.528 1.00 11.96  ? 26   TRP A O     1 
ATOM   592  C  CB    . TRP C 3 26  ? 61.648 -33.967 -124.171 1.00 12.87  ? 26   TRP A CB    1 
ATOM   593  C  CG    . TRP C 3 26  ? 60.295 -34.451 -124.565 1.00 12.77  ? 26   TRP A CG    1 
ATOM   594  C  CD1   . TRP C 3 26  ? 60.010 -35.319 -125.614 1.00 14.44  ? 26   TRP A CD1   1 
ATOM   595  C  CD2   . TRP C 3 26  ? 59.049 -34.136 -123.941 1.00 13.37  ? 26   TRP A CD2   1 
ATOM   596  N  NE1   . TRP C 3 26  ? 58.650 -35.547 -125.670 1.00 15.09  ? 26   TRP A NE1   1 
ATOM   597  C  CE2   . TRP C 3 26  ? 58.043 -34.834 -124.650 1.00 15.53  ? 26   TRP A CE2   1 
ATOM   598  C  CE3   . TRP C 3 26  ? 58.693 -33.344 -122.853 1.00 14.83  ? 26   TRP A CE3   1 
ATOM   599  C  CZ2   . TRP C 3 26  ? 56.681 -34.749 -124.295 1.00 15.97  ? 26   TRP A CZ2   1 
ATOM   600  C  CZ3   . TRP C 3 26  ? 57.347 -33.262 -122.514 1.00 17.35  ? 26   TRP A CZ3   1 
ATOM   601  C  CH2   . TRP C 3 26  ? 56.348 -33.950 -123.219 1.00 16.29  ? 26   TRP A CH2   1 
ATOM   602  N  N     . PHE C 3 27  ? 60.255 -31.326 -125.593 1.00 11.65  ? 27   PHE A N     1 
ATOM   603  C  CA    . PHE C 3 27  ? 59.145 -30.392 -125.443 1.00 11.65  ? 27   PHE A CA    1 
ATOM   604  C  C     . PHE C 3 27  ? 57.822 -31.071 -125.819 1.00 12.34  ? 27   PHE A C     1 
ATOM   605  O  O     . PHE C 3 27  ? 57.783 -31.768 -126.832 1.00 14.57  ? 27   PHE A O     1 
ATOM   606  C  CB    . PHE C 3 27  ? 59.290 -29.139 -126.309 1.00 12.52  ? 27   PHE A CB    1 
ATOM   607  C  CG    . PHE C 3 27  ? 60.580 -28.372 -126.046 1.00 11.26  ? 27   PHE A CG    1 
ATOM   608  C  CD1   . PHE C 3 27  ? 60.708 -27.579 -124.931 1.00 15.53  ? 27   PHE A CD1   1 
ATOM   609  C  CD2   . PHE C 3 27  ? 61.658 -28.480 -126.873 1.00 12.44  ? 27   PHE A CD2   1 
ATOM   610  C  CE1   . PHE C 3 27  ? 61.860 -26.897 -124.642 1.00 18.15  ? 27   PHE A CE1   1 
ATOM   611  C  CE2   . PHE C 3 27  ? 62.851 -27.804 -126.631 1.00 12.54  ? 27   PHE A CE2   1 
ATOM   612  C  CZ    . PHE C 3 27  ? 62.979 -27.019 -125.488 1.00 15.09  ? 27   PHE A CZ    1 
ATOM   613  N  N     . ALA C 3 28  ? 56.752 -30.831 -125.060 1.00 12.65  ? 28   ALA A N     1 
ATOM   614  C  CA    . ALA C 3 28  ? 55.486 -31.416 -125.458 1.00 15.12  ? 28   ALA A CA    1 
ATOM   615  C  C     . ALA C 3 28  ? 54.910 -30.724 -126.667 1.00 13.99  ? 28   ALA A C     1 
ATOM   616  O  O     . ALA C 3 28  ? 54.274 -31.383 -127.524 1.00 17.21  ? 28   ALA A O     1 
ATOM   617  C  CB    . ALA C 3 28  ? 54.486 -31.298 -124.295 1.00 15.91  ? 28   ALA A CB    1 
ATOM   618  N  N     . PHE C 3 29  ? 55.093 -29.388 -126.809 1.00 15.08  ? 29   PHE A N     1 
ATOM   619  C  CA    . PHE C 3 29  ? 54.382 -28.665 -127.886 1.00 15.39  ? 29   PHE A CA    1 
ATOM   620  C  C     . PHE C 3 29  ? 54.954 -28.924 -129.285 1.00 14.95  ? 29   PHE A C     1 
ATOM   621  O  O     . PHE C 3 29  ? 56.170 -28.850 -129.452 1.00 14.49  ? 29   PHE A O     1 
ATOM   622  C  CB    . PHE C 3 29  ? 54.479 -27.178 -127.604 1.00 15.60  ? 29   PHE A CB    1 
ATOM   623  C  CG    . PHE C 3 29  ? 53.752 -26.685 -126.373 1.00 14.75  ? 29   PHE A CG    1 
ATOM   624  C  CD1   . PHE C 3 29  ? 52.786 -27.412 -125.704 1.00 16.71  ? 29   PHE A CD1   1 
ATOM   625  C  CD2   . PHE C 3 29  ? 54.042 -25.404 -125.915 1.00 15.89  ? 29   PHE A CD2   1 
ATOM   626  C  CE1   . PHE C 3 29  ? 52.086 -26.884 -124.613 1.00 18.89  ? 29   PHE A CE1   1 
ATOM   627  C  CE2   . PHE C 3 29  ? 53.373 -24.882 -124.812 1.00 16.92  ? 29   PHE A CE2   1 
ATOM   628  C  CZ    . PHE C 3 29  ? 52.399 -25.615 -124.173 1.00 20.24  ? 29   PHE A CZ    1 
ATOM   629  N  N     . PRO C 3 30  ? 54.115 -29.235 -130.257 1.00 17.39  ? 30   PRO A N     1 
ATOM   630  C  CA    . PRO C 3 30  ? 54.600 -29.582 -131.590 1.00 16.94  ? 30   PRO A CA    1 
ATOM   631  C  C     . PRO C 3 30  ? 55.524 -28.523 -132.153 1.00 17.00  ? 30   PRO A C     1 
ATOM   632  O  O     . PRO C 3 30  ? 56.520 -28.861 -132.834 1.00 18.11  ? 30   PRO A O     1 
ATOM   633  C  CB    . PRO C 3 30  ? 53.331 -29.632 -132.432 1.00 22.90  ? 30   PRO A CB    1 
ATOM   634  C  CG    . PRO C 3 30  ? 52.183 -29.801 -131.512 1.00 26.87  ? 30   PRO A CG    1 
ATOM   635  C  CD    . PRO C 3 30  ? 52.628 -29.327 -130.149 1.00 19.86  ? 30   PRO A CD    1 
ATOM   636  N  N     . GLN C 3 31  ? 55.208 -27.251 -131.900 1.00 17.44  ? 31   GLN A N     1 
ATOM   637  C  CA    . GLN C 3 31  ? 56.023 -26.178 -132.511 1.00 18.75  ? 31   GLN A CA    1 
ATOM   638  C  C     . GLN C 3 31  ? 57.413 -26.046 -131.875 1.00 17.69  ? 31   GLN A C     1 
ATOM   639  O  O     . GLN C 3 31  ? 58.290 -25.340 -132.401 1.00 18.14  ? 31   GLN A O     1 
ATOM   640  C  CB    . GLN C 3 31  ? 55.258 -24.852 -132.437 1.00 22.26  ? 31   GLN A CB    1 
ATOM   641  C  CG    . GLN C 3 31  ? 54.945 -24.385 -131.026 1.00 23.99  ? 31   GLN A CG    1 
ATOM   642  C  CD    . GLN C 3 31  ? 53.746 -24.936 -130.274 1.00 33.60  ? 31   GLN A CD    1 
ATOM   643  O  OE1   . GLN C 3 31  ? 53.095 -25.930 -130.667 1.00 22.55  ? 31   GLN A OE1   1 
ATOM   644  N  NE2   . GLN C 3 31  ? 53.420 -24.271 -129.136 1.00 27.93  ? 31   GLN A NE2   1 
ATOM   645  N  N     . LEU C 3 32  ? 57.652 -26.709 -130.756 1.00 13.55  ? 32   LEU A N     1 
ATOM   646  C  CA    . LEU C 3 32  ? 58.960 -26.637 -130.106 1.00 12.28  ? 32   LEU A CA    1 
ATOM   647  C  C     . LEU C 3 32  ? 59.783 -27.883 -130.381 1.00 12.29  ? 32   LEU A C     1 
ATOM   648  O  O     . LEU C 3 32  ? 60.996 -27.872 -130.047 1.00 12.49  ? 32   LEU A O     1 
ATOM   649  C  CB    . LEU C 3 32  ? 58.792 -26.478 -128.583 1.00 11.96  ? 32   LEU A CB    1 
ATOM   650  C  CG    . LEU C 3 32  ? 58.093 -25.184 -128.174 1.00 12.94  ? 32   LEU A CG    1 
ATOM   651  C  CD1   . LEU C 3 32  ? 57.959 -25.172 -126.642 1.00 13.78  ? 32   LEU A CD1   1 
ATOM   652  C  CD2   . LEU C 3 32  ? 58.878 -23.992 -128.703 1.00 18.79  ? 32   LEU A CD2   1 
ATOM   653  N  N     . LYS C 3 33  ? 59.234 -28.916 -131.003 1.00 12.47  ? 33   LYS A N     1 
ATOM   654  C  CA    . LYS C 3 33  ? 59.978 -30.145 -131.204 1.00 12.91  ? 33   LYS A CA    1 
ATOM   655  C  C     . LYS C 3 33  ? 61.234 -29.926 -132.048 1.00 10.64  ? 33   LYS A C     1 
ATOM   656  O  O     . LYS C 3 33  ? 62.241 -30.637 -131.838 1.00 11.45  ? 33   LYS A O     1 
ATOM   657  C  CB    . LYS C 3 33  ? 59.110 -31.181 -131.936 1.00 17.30  ? 33   LYS A CB    1 
ATOM   658  C  CG    . LYS C 3 33  ? 57.877 -31.604 -131.123 1.00 22.85  ? 33   LYS A CG    1 
ATOM   659  C  CD    . LYS C 3 33  ? 58.278 -32.626 -130.123 1.00 26.65  ? 33   LYS A CD    1 
ATOM   660  C  CE    . LYS C 3 33  ? 57.142 -33.283 -129.301 1.00 25.73  ? 33   LYS A CE    1 
ATOM   661  N  NZ    . LYS C 3 33  ? 57.894 -34.110 -128.305 1.00 21.94  ? 33   LYS A NZ    1 
ATOM   662  N  N     . THR C 3 34  ? 61.167 -28.958 -132.966 1.00 11.53  ? 34   THR A N     1 
ATOM   663  C  CA    . THR C 3 34  ? 62.320 -28.724 -133.826 1.00 11.96  ? 34   THR A CA    1 
ATOM   664  C  C     . THR C 3 34  ? 63.552 -28.341 -133.030 1.00 12.13  ? 34   THR A C     1 
ATOM   665  O  O     . THR C 3 34  ? 64.703 -28.511 -133.501 1.00 16.35  ? 34   THR A O     1 
ATOM   666  C  CB    . THR C 3 34  ? 61.975 -27.614 -134.863 1.00 13.27  ? 34   THR A CB    1 
ATOM   667  O  OG1   . THR C 3 34  ? 63.090 -27.541 -135.750 1.00 16.33  ? 34   THR A OG1   1 
ATOM   668  C  CG2   . THR C 3 34  ? 61.755 -26.257 -134.225 1.00 14.29  ? 34   THR A CG2   1 
ATOM   669  N  N     . TYR C 3 35  ? 63.412 -27.815 -131.815 1.00 11.06  ? 35   TYR A N     1 
ATOM   670  C  CA    . TYR C 3 35  ? 64.582 -27.383 -131.047 1.00 11.51  ? 35   TYR A CA    1 
ATOM   671  C  C     . TYR C 3 35  ? 65.234 -28.493 -130.249 1.00 11.71  ? 35   TYR A C     1 
ATOM   672  O  O     . TYR C 3 35  ? 66.315 -28.286 -129.680 1.00 13.57  ? 35   TYR A O     1 
ATOM   673  C  CB    . TYR C 3 35  ? 64.145 -26.249 -130.068 1.00 12.40  ? 35   TYR A CB    1 
ATOM   674  C  CG    . TYR C 3 35  ? 63.625 -25.030 -130.813 1.00 11.77  ? 35   TYR A CG    1 
ATOM   675  C  CD1   . TYR C 3 35  ? 64.510 -24.282 -131.589 1.00 13.33  ? 35   TYR A CD1   1 
ATOM   676  C  CD2   . TYR C 3 35  ? 62.280 -24.669 -130.766 1.00 12.31  ? 35   TYR A CD2   1 
ATOM   677  C  CE1   . TYR C 3 35  ? 64.023 -23.158 -132.297 1.00 15.08  ? 35   TYR A CE1   1 
ATOM   678  C  CE2   . TYR C 3 35  ? 61.785 -23.581 -131.446 1.00 12.88  ? 35   TYR A CE2   1 
ATOM   679  C  CZ    . TYR C 3 35  ? 62.677 -22.832 -132.217 1.00 14.27  ? 35   TYR A CZ    1 
ATOM   680  O  OH    . TYR C 3 35  ? 62.252 -21.719 -132.901 1.00 18.72  ? 35   TYR A OH    1 
ATOM   681  N  N     . GLN C 3 36  ? 64.604 -29.687 -130.202 1.00 11.88  ? 36   GLN A N     1 
ATOM   682  C  CA    . GLN C 3 36  ? 65.216 -30.751 -129.401 1.00 11.84  ? 36   GLN A CA    1 
ATOM   683  C  C     . GLN C 3 36  ? 66.590 -31.149 -129.875 1.00 12.02  ? 36   GLN A C     1 
ATOM   684  O  O     . GLN C 3 36  ? 67.554 -31.118 -129.078 1.00 12.90  ? 36   GLN A O     1 
ATOM   685  C  CB    . GLN C 3 36  ? 64.280 -31.960 -129.407 1.00 11.59  ? 36   GLN A CB    1 
ATOM   686  C  CG    . GLN C 3 36  ? 62.945 -31.700 -128.737 1.00 12.87  ? 36   GLN A CG    1 
ATOM   687  C  CD    . GLN C 3 36  ? 61.897 -32.791 -128.727 1.00 12.06  ? 36   GLN A CD    1 
ATOM   688  O  OE1   . GLN C 3 36  ? 60.873 -32.700 -128.059 1.00 13.86  ? 36   GLN A OE1   1 
ATOM   689  N  NE2   . GLN C 3 36  ? 62.089 -33.845 -129.527 1.00 15.15  ? 36   GLN A NE2   1 
ATOM   690  N  N     . SER C 3 37  ? 66.722 -31.509 -131.145 1.00 12.21  ? 37   SER A N     1 
ATOM   691  C  CA    . SER C 3 37  ? 68.060 -31.963 -131.555 1.00 11.92  ? 37   SER A CA    1 
ATOM   692  C  C     . SER C 3 37  ? 69.017 -30.786 -131.509 1.00 13.51  ? 37   SER A C     1 
ATOM   693  O  O     . SER C 3 37  ? 70.206 -30.953 -131.175 1.00 16.00  ? 37   SER A O     1 
ATOM   694  C  CB    A SER C 3 37  ? 67.979 -32.624 -132.939 0.60 14.34  ? 37   SER A CB    1 
ATOM   695  C  CB    B SER C 3 37  ? 68.040 -32.465 -133.010 0.40 12.93  ? 37   SER A CB    1 
ATOM   696  O  OG    A SER C 3 37  ? 67.660 -31.609 -133.850 0.60 13.70  ? 37   SER A OG    1 
ATOM   697  O  OG    B SER C 3 37  ? 67.120 -33.508 -133.231 0.40 15.68  ? 37   SER A OG    1 
ATOM   698  N  N     . GLN C 3 38  ? 68.534 -29.574 -131.804 1.00 13.27  ? 38   GLN A N     1 
ATOM   699  C  CA    . GLN C 3 38  ? 69.363 -28.378 -131.857 1.00 13.39  ? 38   GLN A CA    1 
ATOM   700  C  C     . GLN C 3 38  ? 69.995 -28.045 -130.512 1.00 13.16  ? 38   GLN A C     1 
ATOM   701  O  O     . GLN C 3 38  ? 71.067 -27.440 -130.431 1.00 16.28  ? 38   GLN A O     1 
ATOM   702  C  CB    . GLN C 3 38  ? 68.492 -27.192 -132.303 1.00 12.63  ? 38   GLN A CB    1 
ATOM   703  C  CG    . GLN C 3 38  ? 69.233 -25.925 -132.553 1.00 13.68  ? 38   GLN A CG    1 
ATOM   704  C  CD    . GLN C 3 38  ? 68.421 -24.795 -133.130 1.00 13.97  ? 38   GLN A CD    1 
ATOM   705  O  OE1   . GLN C 3 38  ? 67.206 -24.929 -133.271 1.00 17.05  ? 38   GLN A OE1   1 
ATOM   706  N  NE2   . GLN C 3 38  ? 69.109 -23.713 -133.496 1.00 18.13  ? 38   GLN A NE2   1 
ATOM   707  N  N     . LEU C 3 39  ? 69.370 -28.447 -129.424 1.00 11.61  ? 39   LEU A N     1 
ATOM   708  C  CA    . LEU C 3 39  ? 69.885 -28.081 -128.083 1.00 10.65  ? 39   LEU A CA    1 
ATOM   709  C  C     . LEU C 3 39  ? 70.669 -29.222 -127.457 1.00 10.15  ? 39   LEU A C     1 
ATOM   710  O  O     . LEU C 3 39  ? 71.396 -28.965 -126.464 1.00 11.47  ? 39   LEU A O     1 
ATOM   711  C  CB    . LEU C 3 39  ? 68.732 -27.660 -127.188 1.00 10.76  ? 39   LEU A CB    1 
ATOM   712  C  CG    . LEU C 3 39  ? 68.214 -26.240 -127.540 1.00 11.56  ? 39   LEU A CG    1 
ATOM   713  C  CD1   . LEU C 3 39  ? 66.900 -25.954 -126.831 1.00 13.29  ? 39   LEU A CD1   1 
ATOM   714  C  CD2   . LEU C 3 39  ? 69.225 -25.168 -127.220 1.00 13.71  ? 39   LEU A CD2   1 
ATOM   715  N  N     . ILE C 3 40  ? 70.630 -30.453 -127.980 1.00 10.96  ? 40   ILE A N     1 
ATOM   716  C  CA    . ILE C 3 40  ? 71.452 -31.504 -127.405 1.00 10.82  ? 40   ILE A CA    1 
ATOM   717  C  C     . ILE C 3 40  ? 72.946 -31.166 -127.607 1.00 10.91  ? 40   ILE A C     1 
ATOM   718  O  O     . ILE C 3 40  ? 73.339 -30.820 -128.743 1.00 11.50  ? 40   ILE A O     1 
ATOM   719  C  CB    . ILE C 3 40  ? 71.074 -32.876 -127.976 1.00 11.28  ? 40   ILE A CB    1 
ATOM   720  C  CG1   . ILE C 3 40  ? 69.672 -33.250 -127.479 1.00 12.43  ? 40   ILE A CG1   1 
ATOM   721  C  CG2   . ILE C 3 40  ? 72.116 -33.916 -127.605 1.00 11.60  ? 40   ILE A CG2   1 
ATOM   722  C  CD1   . ILE C 3 40  ? 69.024 -34.464 -128.125 1.00 14.16  ? 40   ILE A CD1   1 
ATOM   723  N  N     . GLY C 3 41  ? 73.739 -31.197 -126.554 1.00 10.34  ? 41   GLY A N     1 
ATOM   724  C  CA    . GLY C 3 41  ? 75.125 -30.819 -126.563 1.00 11.08  ? 41   GLY A CA    1 
ATOM   725  C  C     . GLY C 3 41  ? 75.375 -29.346 -126.280 1.00 10.20  ? 41   GLY A C     1 
ATOM   726  O  O     . GLY C 3 41  ? 76.523 -28.958 -126.044 1.00 11.89  ? 41   GLY A O     1 
ATOM   727  N  N     . GLN C 3 42  ? 74.310 -28.502 -126.328 1.00 10.63  ? 42   GLN A N     1 
ATOM   728  C  CA    . GLN C 3 42  ? 74.409 -27.134 -125.853 1.00 9.75   ? 42   GLN A CA    1 
ATOM   729  C  C     . GLN C 3 42  ? 74.234 -27.186 -124.320 1.00 9.70   ? 42   GLN A C     1 
ATOM   730  O  O     . GLN C 3 42  ? 74.044 -28.250 -123.732 1.00 10.52  ? 42   GLN A O     1 
ATOM   731  C  CB    . GLN C 3 42  ? 73.313 -26.248 -126.500 1.00 10.94  ? 42   GLN A CB    1 
ATOM   732  C  CG    . GLN C 3 42  ? 73.446 -26.243 -128.042 1.00 11.26  ? 42   GLN A CG    1 
ATOM   733  C  CD    . GLN C 3 42  ? 74.654 -25.515 -128.560 1.00 11.22  ? 42   GLN A CD    1 
ATOM   734  O  OE1   . GLN C 3 42  ? 75.130 -24.541 -127.995 1.00 12.76  ? 42   GLN A OE1   1 
ATOM   735  N  NE2   . GLN C 3 42  ? 75.180 -26.030 -129.654 1.00 14.90  ? 42   GLN A NE2   1 
ATOM   736  N  N     . HIS C 3 43  ? 74.264 -26.020 -123.682 1.00 9.90   ? 43   HIS A N     1 
ATOM   737  C  CA    . HIS C 3 43  ? 74.032 -25.968 -122.223 1.00 10.03  ? 43   HIS A CA    1 
ATOM   738  C  C     . HIS C 3 43  ? 73.292 -24.679 -121.880 1.00 9.63   ? 43   HIS A C     1 
ATOM   739  O  O     . HIS C 3 43  ? 73.287 -23.702 -122.640 1.00 11.20  ? 43   HIS A O     1 
ATOM   740  C  CB    . HIS C 3 43  ? 75.329 -26.057 -121.416 1.00 11.42  ? 43   HIS A CB    1 
ATOM   741  C  CG    . HIS C 3 43  ? 76.327 -25.002 -121.800 1.00 11.53  ? 43   HIS A CG    1 
ATOM   742  N  ND1   . HIS C 3 43  ? 77.245 -25.156 -122.794 1.00 13.36  ? 43   HIS A ND1   1 
ATOM   743  C  CD2   . HIS C 3 43  ? 76.585 -23.749 -121.281 1.00 12.69  ? 43   HIS A CD2   1 
ATOM   744  C  CE1   . HIS C 3 43  ? 78.040 -24.062 -122.924 1.00 13.56  ? 43   HIS A CE1   1 
ATOM   745  N  NE2   . HIS C 3 43  ? 77.640 -23.194 -121.973 1.00 14.30  ? 43   HIS A NE2   1 
ATOM   746  N  N     . VAL C 3 44  ? 72.647 -24.735 -120.716 1.00 10.43  ? 44   VAL A N     1 
ATOM   747  C  CA    . VAL C 3 44  ? 72.063 -23.539 -120.144 1.00 10.14  ? 44   VAL A CA    1 
ATOM   748  C  C     . VAL C 3 44  ? 73.183 -22.649 -119.639 1.00 10.58  ? 44   VAL A C     1 
ATOM   749  O  O     . VAL C 3 44  ? 74.069 -23.134 -118.887 1.00 12.10  ? 44   VAL A O     1 
ATOM   750  C  CB    . VAL C 3 44  ? 71.115 -23.917 -118.972 1.00 10.31  ? 44   VAL A CB    1 
ATOM   751  C  CG1   . VAL C 3 44  ? 70.677 -22.684 -118.143 1.00 11.67  ? 44   VAL A CG1   1 
ATOM   752  C  CG2   . VAL C 3 44  ? 69.910 -24.702 -119.527 1.00 12.01  ? 44   VAL A CG2   1 
ATOM   753  N  N     . THR C 3 45  ? 73.177 -21.378 -120.018 1.00 10.28  ? 45   THR A N     1 
ATOM   754  C  CA    . THR C 3 45  ? 74.233 -20.461 -119.565 1.00 11.32  ? 45   THR A CA    1 
ATOM   755  C  C     . THR C 3 45  ? 73.785 -19.728 -118.306 1.00 11.63  ? 45   THR A C     1 
ATOM   756  O  O     . THR C 3 45  ? 74.597 -19.480 -117.410 1.00 14.00  ? 45   THR A O     1 
ATOM   757  C  CB    . THR C 3 45  ? 74.572 -19.449 -120.654 1.00 12.05  ? 45   THR A CB    1 
ATOM   758  O  OG1   . THR C 3 45  ? 73.365 -18.779 -121.029 1.00 14.08  ? 45   THR A OG1   1 
ATOM   759  C  CG2   . THR C 3 45  ? 75.195 -20.141 -121.864 1.00 12.70  ? 45   THR A CG2   1 
ATOM   760  N  N     . HIS C 3 46  ? 72.514 -19.408 -118.188 1.00 11.46  ? 46   HIS A N     1 
ATOM   761  C  CA    . HIS C 3 46  ? 71.935 -18.823 -116.957 1.00 13.35  ? 46   HIS A CA    1 
ATOM   762  C  C     . HIS C 3 46  ? 70.422 -18.873 -117.103 1.00 11.01  ? 46   HIS A C     1 
ATOM   763  O  O     . HIS C 3 46  ? 69.874 -18.976 -118.183 1.00 12.15  ? 46   HIS A O     1 
ATOM   764  C  CB    . HIS C 3 46  ? 72.405 -17.433 -116.636 1.00 19.33  ? 46   HIS A CB    1 
ATOM   765  C  CG    . HIS C 3 46  ? 72.215 -16.462 -117.728 1.00 20.83  ? 46   HIS A CG    1 
ATOM   766  N  ND1   . HIS C 3 46  ? 72.592 -16.530 -119.028 1.00 26.02  ? 46   HIS A ND1   1 
ATOM   767  C  CD2   . HIS C 3 46  ? 71.624 -15.237 -117.585 1.00 24.44  ? 46   HIS A CD2   1 
ATOM   768  C  CE1   . HIS C 3 46  ? 72.249 -15.408 -119.683 1.00 26.83  ? 46   HIS A CE1   1 
ATOM   769  N  NE2   . HIS C 3 46  ? 71.640 -14.589 -118.817 1.00 30.33  ? 46   HIS A NE2   1 
ATOM   770  N  N     . VAL C 3 47  ? 69.781 -18.797 -115.933 1.00 11.04  ? 47   VAL A N     1 
ATOM   771  C  CA    . VAL C 3 47  ? 68.320 -18.726 -115.914 1.00 10.66  ? 47   VAL A CA    1 
ATOM   772  C  C     . VAL C 3 47  ? 68.003 -17.337 -115.373 1.00 10.98  ? 47   VAL A C     1 
ATOM   773  O  O     . VAL C 3 47  ? 68.162 -17.063 -114.161 1.00 12.94  ? 47   VAL A O     1 
ATOM   774  C  CB    . VAL C 3 47  ? 67.651 -19.841 -115.107 1.00 10.55  ? 47   VAL A CB    1 
ATOM   775  C  CG1   . VAL C 3 47  ? 66.143 -19.631 -115.219 1.00 12.40  ? 47   VAL A CG1   1 
ATOM   776  C  CG2   . VAL C 3 47  ? 68.058 -21.210 -115.619 1.00 12.92  ? 47   VAL A CG2   1 
ATOM   777  N  N     . GLU C 3 48  ? 67.561 -16.465 -116.228 1.00 11.04  ? 48   GLU A N     1 
ATOM   778  C  CA    . GLU C 3 48  ? 67.152 -15.114 -115.895 1.00 9.58   ? 48   GLU A CA    1 
ATOM   779  C  C     . GLU C 3 48  ? 65.704 -15.103 -115.522 1.00 9.56   ? 48   GLU A C     1 
ATOM   780  O  O     . GLU C 3 48  ? 64.918 -15.914 -116.046 1.00 11.45  ? 48   GLU A O     1 
ATOM   781  C  CB    . GLU C 3 48  ? 67.489 -14.230 -117.115 1.00 11.80  ? 48   GLU A CB    1 
ATOM   782  C  CG    . GLU C 3 48  ? 67.051 -12.790 -116.929 1.00 13.41  ? 48   GLU A CG    1 
ATOM   783  C  CD    . GLU C 3 48  ? 67.189 -11.911 -118.145 1.00 13.51  ? 48   GLU A CD    1 
ATOM   784  O  OE1   . GLU C 3 48  ? 67.454 -12.404 -119.265 1.00 14.58  ? 48   GLU A OE1   1 
ATOM   785  O  OE2   . GLU C 3 48  ? 67.013 -10.675 -117.934 1.00 14.93  ? 48   GLU A OE2   1 
ATOM   786  N  N     . THR C 3 49  ? 65.300 -14.188 -114.624 1.00 10.18  ? 49   THR A N     1 
ATOM   787  C  CA    . THR C 3 49  ? 63.879 -13.971 -114.373 1.00 9.79   ? 49   THR A CA    1 
ATOM   788  C  C     . THR C 3 49  ? 63.573 -12.496 -114.543 1.00 10.50  ? 49   THR A C     1 
ATOM   789  O  O     . THR C 3 49  ? 64.416 -11.645 -114.200 1.00 11.93  ? 49   THR A O     1 
ATOM   790  C  CB    . THR C 3 49  ? 63.441 -14.453 -112.979 1.00 10.86  ? 49   THR A CB    1 
ATOM   791  O  OG1   . THR C 3 49  ? 64.387 -13.981 -112.021 1.00 12.02  ? 49   THR A OG1   1 
ATOM   792  C  CG2   . THR C 3 49  ? 63.488 -15.977 -112.928 1.00 11.55  ? 49   THR A CG2   1 
ATOM   793  N  N     . ARG C 3 50  ? 62.396 -12.180 -115.069 1.00 10.66  ? 50   ARG A N     1 
ATOM   794  C  CA    . ARG C 3 50  ? 61.869 -10.801 -115.095 1.00 10.52  ? 50   ARG A CA    1 
ATOM   795  C  C     . ARG C 3 50  ? 60.474 -10.892 -114.499 1.00 9.94   ? 50   ARG A C     1 
ATOM   796  O  O     . ARG C 3 50  ? 59.516 -11.319 -115.151 1.00 11.58  ? 50   ARG A O     1 
ATOM   797  C  CB    . ARG C 3 50  ? 61.877 -10.236 -116.531 1.00 11.62  ? 50   ARG A CB    1 
ATOM   798  C  CG    . ARG C 3 50  ? 63.260 -10.239 -117.141 1.00 11.88  ? 50   ARG A CG    1 
ATOM   799  C  CD    . ARG C 3 50  ? 63.387 -9.438  -118.436 1.00 13.58  ? 50   ARG A CD    1 
ATOM   800  N  NE    . ARG C 3 50  ? 64.575 -9.867  -119.159 1.00 14.17  ? 50   ARG A NE    1 
ATOM   801  C  CZ    . ARG C 3 50  ? 64.827 -9.761  -120.446 1.00 15.42  ? 50   ARG A CZ    1 
ATOM   802  N  NH1   . ARG C 3 50  ? 63.942 -9.138  -121.233 1.00 16.85  ? 50   ARG A NH1   1 
ATOM   803  N  NH2   . ARG C 3 50  ? 65.938 -10.249 -120.999 1.00 15.86  ? 50   ARG A NH2   1 
ATOM   804  N  N     . GLY C 3 51  ? 60.425 -10.613 -113.176 1.00 11.24  ? 51   GLY A N     1 
ATOM   805  C  CA    . GLY C 3 51  ? 59.157 -10.907 -112.483 1.00 11.26  ? 51   GLY A CA    1 
ATOM   806  C  C     . GLY C 3 51  ? 58.914 -12.411 -112.534 1.00 10.47  ? 51   GLY A C     1 
ATOM   807  O  O     . GLY C 3 51  ? 59.729 -13.262 -112.128 1.00 11.32  ? 51   GLY A O     1 
ATOM   808  N  N     . LYS C 3 52  ? 57.704 -12.771 -112.995 1.00 10.11  ? 52   LYS A N     1 
ATOM   809  C  CA    . LYS C 3 52  ? 57.282 -14.168 -113.067 1.00 10.86  ? 52   LYS A CA    1 
ATOM   810  C  C     . LYS C 3 52  ? 57.627 -14.802 -114.393 1.00 10.10  ? 52   LYS A C     1 
ATOM   811  O  O     . LYS C 3 52  ? 57.343 -16.003 -114.579 1.00 12.37  ? 52   LYS A O     1 
ATOM   812  C  CB    . LYS C 3 52  ? 55.775 -14.208 -112.753 1.00 11.36  ? 52   LYS A CB    1 
ATOM   813  C  CG    . LYS C 3 52  ? 55.503 -13.996 -111.266 1.00 12.80  ? 52   LYS A CG    1 
ATOM   814  C  CD    . LYS C 3 52  ? 54.045 -13.494 -111.014 1.00 11.54  ? 52   LYS A CD    1 
ATOM   815  C  CE    . LYS C 3 52  ? 54.117 -12.036 -110.504 1.00 11.85  ? 52   LYS A CE    1 
ATOM   816  N  NZ    . LYS C 3 52  ? 52.719 -11.469 -110.381 1.00 11.53  ? 52   LYS A NZ    1 
ATOM   817  N  N     . ALA C 3 53  ? 58.224 -14.087 -115.340 1.00 10.90  ? 53   ALA A N     1 
ATOM   818  C  CA    . ALA C 3 53  ? 58.722 -14.701 -116.591 1.00 10.52  ? 53   ALA A CA    1 
ATOM   819  C  C     . ALA C 3 53  ? 60.109 -15.300 -116.329 1.00 10.37  ? 53   ALA A C     1 
ATOM   820  O  O     . ALA C 3 53  ? 60.968 -14.661 -115.728 1.00 11.52  ? 53   ALA A O     1 
ATOM   821  C  CB    . ALA C 3 53  ? 58.804 -13.681 -117.704 1.00 11.76  ? 53   ALA A CB    1 
ATOM   822  N  N     . LEU C 3 54  ? 60.269 -16.539 -116.777 1.00 10.55  ? 54   LEU A N     1 
ATOM   823  C  CA    . LEU C 3 54  ? 61.541 -17.276 -116.560 1.00 10.47  ? 54   LEU A CA    1 
ATOM   824  C  C     . LEU C 3 54  ? 62.166 -17.501 -117.945 1.00 11.10  ? 54   LEU A C     1 
ATOM   825  O  O     . LEU C 3 54  ? 61.486 -17.946 -118.887 1.00 11.93  ? 54   LEU A O     1 
ATOM   826  C  CB    . LEU C 3 54  ? 61.222 -18.517 -115.730 1.00 12.50  ? 54   LEU A CB    1 
ATOM   827  C  CG    . LEU C 3 54  ? 62.454 -19.342 -115.244 1.00 12.67  ? 54   LEU A CG    1 
ATOM   828  C  CD1   . LEU C 3 54  ? 62.166 -20.043 -113.942 1.00 13.65  ? 54   LEU A CD1   1 
ATOM   829  C  CD2   . LEU C 3 54  ? 62.824 -20.379 -116.296 1.00 14.24  ? 54   LEU A CD2   1 
ATOM   830  N  N     . LEU C 3 55  ? 63.441 -17.124 -118.044 1.00 9.95   ? 55   LEU A N     1 
ATOM   831  C  CA    . LEU C 3 55  ? 64.167 -17.103 -119.308 1.00 9.38   ? 55   LEU A CA    1 
ATOM   832  C  C     . LEU C 3 55  ? 65.376 -18.030 -119.174 1.00 9.58   ? 55   LEU A C     1 
ATOM   833  O  O     . LEU C 3 55  ? 66.365 -17.680 -118.529 1.00 10.83  ? 55   LEU A O     1 
ATOM   834  C  CB    . LEU C 3 55  ? 64.577 -15.695 -119.660 1.00 11.10  ? 55   LEU A CB    1 
ATOM   835  C  CG    . LEU C 3 55  ? 63.439 -14.696 -119.876 1.00 14.59  ? 55   LEU A CG    1 
ATOM   836  C  CD1   . LEU C 3 55  ? 64.009 -13.283 -119.933 1.00 15.92  ? 55   LEU A CD1   1 
ATOM   837  C  CD2   . LEU C 3 55  ? 62.642 -14.967 -121.129 1.00 22.57  ? 55   LEU A CD2   1 
ATOM   838  N  N     . THR C 3 56  ? 65.279 -19.210 -119.783 1.00 10.05  ? 56   THR A N     1 
ATOM   839  C  CA    . THR C 3 56  ? 66.354 -20.216 -119.723 1.00 10.25  ? 56   THR A CA    1 
ATOM   840  C  C     . THR C 3 56  ? 67.252 -19.979 -120.932 1.00 9.29   ? 56   THR A C     1 
ATOM   841  O  O     . THR C 3 56  ? 66.866 -20.336 -122.061 1.00 10.62  ? 56   THR A O     1 
ATOM   842  C  CB    . THR C 3 56  ? 65.769 -21.648 -119.691 1.00 10.60  ? 56   THR A CB    1 
ATOM   843  O  OG1   . THR C 3 56  ? 64.900 -21.762 -118.543 1.00 11.61  ? 56   THR A OG1   1 
ATOM   844  C  CG2   . THR C 3 56  ? 66.868 -22.684 -119.572 1.00 12.25  ? 56   THR A CG2   1 
ATOM   845  N  N     . HIS C 3 57  ? 68.368 -19.318 -120.716 1.00 10.21  ? 57   HIS A N     1 
ATOM   846  C  CA    . HIS C 3 57  ? 69.261 -18.973 -121.834 1.00 9.91   ? 57   HIS A CA    1 
ATOM   847  C  C     . HIS C 3 57  ? 70.150 -20.152 -122.175 1.00 9.07   ? 57   HIS A C     1 
ATOM   848  O  O     . HIS C 3 57  ? 70.727 -20.749 -121.275 1.00 11.15  ? 57   HIS A O     1 
ATOM   849  C  CB    . HIS C 3 57  ? 70.124 -17.783 -121.424 1.00 11.40  ? 57   HIS A CB    1 
ATOM   850  C  CG    . HIS C 3 57  ? 69.362 -16.516 -121.227 1.00 10.69  ? 57   HIS A CG    1 
ATOM   851  N  ND1   . HIS C 3 57  ? 69.081 -15.659 -122.275 1.00 15.97  ? 57   HIS A ND1   1 
ATOM   852  C  CD2   . HIS C 3 57  ? 68.902 -15.882 -120.125 1.00 12.73  ? 57   HIS A CD2   1 
ATOM   853  C  CE1   . HIS C 3 57  ? 68.439 -14.582 -121.792 1.00 17.20  ? 57   HIS A CE1   1 
ATOM   854  N  NE2   . HIS C 3 57  ? 68.334 -14.702 -120.505 1.00 13.34  ? 57   HIS A NE2   1 
ATOM   855  N  N     . PHE C 3 58  ? 70.273 -20.456 -123.460 1.00 10.29  ? 58   PHE A N     1 
ATOM   856  C  CA    . PHE C 3 58  ? 71.152 -21.510 -123.922 1.00 10.36  ? 58   PHE A CA    1 
ATOM   857  C  C     . PHE C 3 58  ? 72.399 -20.930 -124.613 1.00 10.03  ? 58   PHE A C     1 
ATOM   858  O  O     . PHE C 3 58  ? 72.458 -19.756 -125.020 1.00 12.61  ? 58   PHE A O     1 
ATOM   859  C  CB    . PHE C 3 58  ? 70.405 -22.401 -124.914 1.00 10.65  ? 58   PHE A CB    1 
ATOM   860  C  CG    . PHE C 3 58  ? 69.149 -23.058 -124.323 1.00 10.34  ? 58   PHE A CG    1 
ATOM   861  C  CD1   . PHE C 3 58  ? 69.297 -24.097 -123.421 1.00 11.00  ? 58   PHE A CD1   1 
ATOM   862  C  CD2   . PHE C 3 58  ? 67.888 -22.625 -124.687 1.00 10.68  ? 58   PHE A CD2   1 
ATOM   863  C  CE1   . PHE C 3 58  ? 68.142 -24.686 -122.873 1.00 12.53  ? 58   PHE A CE1   1 
ATOM   864  C  CE2   . PHE C 3 58  ? 66.748 -23.184 -124.159 1.00 10.99  ? 58   PHE A CE2   1 
ATOM   865  C  CZ    . PHE C 3 58  ? 66.880 -24.249 -123.256 1.00 11.26  ? 58   PHE A CZ    1 
ATOM   866  N  N     . SER C 3 59  ? 73.381 -21.807 -124.770 1.00 10.42  ? 59   SER A N     1 
ATOM   867  C  CA    . SER C 3 59  ? 74.681 -21.417 -125.324 1.00 10.60  ? 59   SER A CA    1 
ATOM   868  C  C     . SER C 3 59  ? 74.643 -21.157 -126.812 1.00 11.94  ? 59   SER A C     1 
ATOM   869  O  O     . SER C 3 59  ? 75.697 -20.745 -127.340 1.00 15.10  ? 59   SER A O     1 
ATOM   870  C  CB    . SER C 3 59  ? 75.720 -22.515 -125.003 1.00 11.14  ? 59   SER A CB    1 
ATOM   871  O  OG    . SER C 3 59  ? 75.231 -23.811 -125.357 1.00 11.72  ? 59   SER A OG    1 
ATOM   872  N  N     . ASN C 3 60  ? 73.562 -21.322 -127.512 1.00 12.28  ? 60   ASN A N     1 
ATOM   873  C  CA    . ASN C 3 60  ? 73.482 -21.021 -128.958 1.00 11.44  ? 60   ASN A CA    1 
ATOM   874  C  C     . ASN C 3 60  ? 72.554 -19.842 -129.201 1.00 14.16  ? 60   ASN A C     1 
ATOM   875  O  O     . ASN C 3 60  ? 71.964 -19.732 -130.287 1.00 22.76  ? 60   ASN A O     1 
ATOM   876  C  CB    . ASN C 3 60  ? 73.026 -22.271 -129.689 1.00 11.71  ? 60   ASN A CB    1 
ATOM   877  C  CG    . ASN C 3 60  ? 71.643 -22.729 -129.314 1.00 12.84  ? 60   ASN A CG    1 
ATOM   878  O  OD1   . ASN C 3 60  ? 71.042 -22.160 -128.361 1.00 15.25  ? 60   ASN A OD1   1 
ATOM   879  N  ND2   . ASN C 3 60  ? 71.130 -23.769 -129.947 1.00 16.11  ? 60   ASN A ND2   1 
ATOM   880  N  N     . ASP C 3 61  ? 72.424 -18.945 -128.250 1.00 16.14  ? 61   ASP A N     1 
ATOM   881  C  CA    . ASP C 3 61  ? 71.678 -17.687 -128.441 1.00 22.50  ? 61   ASP A CA    1 
ATOM   882  C  C     . ASP C 3 61  ? 70.177 -17.910 -128.494 1.00 21.36  ? 61   ASP A C     1 
ATOM   883  O  O     . ASP C 3 61  ? 69.415 -16.983 -128.741 1.00 44.99  ? 61   ASP A O     1 
ATOM   884  C  CB    . ASP C 3 61  ? 72.143 -16.938 -129.701 1.00 32.79  ? 61   ASP A CB    1 
ATOM   885  C  CG    . ASP C 3 61  ? 73.411 -16.133 -129.508 1.00 46.65  ? 61   ASP A CG    1 
ATOM   886  O  OD1   . ASP C 3 61  ? 73.974 -16.133 -128.394 1.00 49.20  ? 61   ASP A OD1   1 
ATOM   887  O  OD2   . ASP C 3 61  ? 73.832 -15.498 -130.498 1.00 75.77  ? 61   ASP A OD2   1 
ATOM   888  N  N     . LEU C 3 62  ? 69.667 -19.097 -128.199 1.00 13.51  ? 62   LEU A N     1 
ATOM   889  C  CA    . LEU C 3 62  ? 68.239 -19.256 -127.963 1.00 12.37  ? 62   LEU A CA    1 
ATOM   890  C  C     . LEU C 3 62  ? 67.900 -19.122 -126.500 1.00 10.36  ? 62   LEU A C     1 
ATOM   891  O  O     . LEU C 3 62  ? 68.794 -19.366 -125.654 1.00 13.09  ? 62   LEU A O     1 
ATOM   892  C  CB    . LEU C 3 62  ? 67.803 -20.678 -128.397 1.00 14.09  ? 62   LEU A CB    1 
ATOM   893  C  CG    . LEU C 3 62  ? 67.941 -20.947 -129.907 1.00 16.51  ? 62   LEU A CG    1 
ATOM   894  C  CD1   . LEU C 3 62  ? 67.617 -22.404 -130.148 1.00 19.94  ? 62   LEU A CD1   1 
ATOM   895  C  CD2   . LEU C 3 62  ? 67.016 -19.988 -130.657 1.00 20.85  ? 62   LEU A CD2   1 
ATOM   896  N  N     . THR C 3 63  ? 66.670 -18.755 -126.205 1.00 10.61  ? 63   THR A N     1 
ATOM   897  C  CA    . THR C 3 63  ? 66.215 -18.642 -124.812 1.00 10.38  ? 63   THR A CA    1 
ATOM   898  C  C     . THR C 3 63  ? 64.818 -19.229 -124.712 1.00 10.40  ? 63   THR A C     1 
ATOM   899  O  O     . THR C 3 63  ? 63.935 -18.825 -125.445 1.00 11.65  ? 63   THR A O     1 
ATOM   900  C  CB    . THR C 3 63  ? 66.142 -17.149 -124.376 1.00 11.48  ? 63   THR A CB    1 
ATOM   901  O  OG1   . THR C 3 63  ? 67.440 -16.605 -124.529 1.00 13.25  ? 63   THR A OG1   1 
ATOM   902  C  CG2   . THR C 3 63  ? 65.678 -17.000 -122.935 1.00 13.29  ? 63   THR A CG2   1 
ATOM   903  N  N     . LEU C 3 64  ? 64.627 -20.182 -123.780 1.00 10.45  ? 64   LEU A N     1 
ATOM   904  C  CA    . LEU C 3 64  ? 63.250 -20.630 -123.549 1.00 10.22  ? 64   LEU A CA    1 
ATOM   905  C  C     . LEU C 3 64  ? 62.534 -19.663 -122.617 1.00 10.43  ? 64   LEU A C     1 
ATOM   906  O  O     . LEU C 3 64  ? 63.032 -19.393 -121.508 1.00 11.93  ? 64   LEU A O     1 
ATOM   907  C  CB    . LEU C 3 64  ? 63.285 -22.040 -122.945 1.00 11.61  ? 64   LEU A CB    1 
ATOM   908  C  CG    . LEU C 3 64  ? 61.920 -22.703 -122.779 1.00 11.85  ? 64   LEU A CG    1 
ATOM   909  C  CD1   . LEU C 3 64  ? 61.392 -23.185 -124.140 1.00 14.09  ? 64   LEU A CD1   1 
ATOM   910  C  CD2   . LEU C 3 64  ? 61.998 -23.876 -121.782 1.00 13.43  ? 64   LEU A CD2   1 
ATOM   911  N  N     . TYR C 3 65  ? 61.401 -19.165 -123.056 1.00 9.89   ? 65   TYR A N     1 
ATOM   912  C  CA    . TYR C 3 65  ? 60.530 -18.349 -122.251 1.00 10.46  ? 65   TYR A CA    1 
ATOM   913  C  C     . TYR C 3 65  ? 59.503 -19.272 -121.618 1.00 10.65  ? 65   TYR A C     1 
ATOM   914  O  O     . TYR C 3 65  ? 58.812 -20.011 -122.351 1.00 11.39  ? 65   TYR A O     1 
ATOM   915  C  CB    . TYR C 3 65  ? 59.840 -17.295 -123.144 1.00 11.66  ? 65   TYR A CB    1 
ATOM   916  C  CG    . TYR C 3 65  ? 58.749 -16.473 -122.446 1.00 11.35  ? 65   TYR A CG    1 
ATOM   917  C  CD1   . TYR C 3 65  ? 57.445 -16.887 -122.327 1.00 12.39  ? 65   TYR A CD1   1 
ATOM   918  C  CD2   . TYR C 3 65  ? 59.106 -15.243 -121.899 1.00 12.18  ? 65   TYR A CD2   1 
ATOM   919  C  CE1   . TYR C 3 65  ? 56.467 -16.147 -121.684 1.00 13.20  ? 65   TYR A CE1   1 
ATOM   920  C  CE2   . TYR C 3 65  ? 58.141 -14.490 -121.241 1.00 13.40  ? 65   TYR A CE2   1 
ATOM   921  C  CZ    . TYR C 3 65  ? 56.832 -14.925 -121.138 1.00 13.71  ? 65   TYR A CZ    1 
ATOM   922  O  OH    . TYR C 3 65  ? 55.884 -14.160 -120.493 1.00 15.59  ? 65   TYR A OH    1 
ATOM   923  N  N     . SER C 3 66  ? 59.317 -19.165 -120.301 1.00 10.44  ? 66   SER A N     1 
ATOM   924  C  CA    . SER C 3 66  ? 58.175 -19.870 -119.724 1.00 10.60  ? 66   SER A CA    1 
ATOM   925  C  C     . SER C 3 66  ? 57.568 -18.994 -118.628 1.00 10.23  ? 66   SER A C     1 
ATOM   926  O  O     . SER C 3 66  ? 58.263 -18.275 -117.912 1.00 11.79  ? 66   SER A O     1 
ATOM   927  C  CB    . SER C 3 66  ? 58.592 -21.234 -119.222 1.00 11.34  ? 66   SER A CB    1 
ATOM   928  O  OG    . SER C 3 66  ? 59.643 -21.198 -118.262 1.00 11.26  ? 66   SER A OG    1 
ATOM   929  N  N     . HIS C 3 67  ? 56.249 -19.115 -118.504 1.00 10.78  ? 67   HIS A N     1 
ATOM   930  C  CA    . HIS C 3 67  ? 55.518 -18.335 -117.502 1.00 11.16  ? 67   HIS A CA    1 
ATOM   931  C  C     . HIS C 3 67  ? 54.556 -19.323 -116.867 1.00 10.97  ? 67   HIS A C     1 
ATOM   932  O  O     . HIS C 3 67  ? 53.767 -19.958 -117.601 1.00 12.68  ? 67   HIS A O     1 
ATOM   933  C  CB    . HIS C 3 67  ? 54.846 -17.139 -118.148 1.00 11.78  ? 67   HIS A CB    1 
ATOM   934  C  CG    . HIS C 3 67  ? 54.311 -16.189 -117.135 1.00 12.31  ? 67   HIS A CG    1 
ATOM   935  N  ND1   . HIS C 3 67  ? 53.428 -16.520 -116.115 1.00 13.48  ? 67   HIS A ND1   1 
ATOM   936  C  CD2   . HIS C 3 67  ? 54.560 -14.862 -117.032 1.00 12.14  ? 67   HIS A CD2   1 
ATOM   937  C  CE1   . HIS C 3 67  ? 53.169 -15.405 -115.427 1.00 13.41  ? 67   HIS A CE1   1 
ATOM   938  N  NE2   . HIS C 3 67  ? 53.821 -14.383 -115.972 1.00 12.83  ? 67   HIS A NE2   1 
ATOM   939  N  N     . ASN C 3 68  ? 54.581 -19.474 -115.557 1.00 12.03  ? 68   ASN A N     1 
ATOM   940  C  CA    . ASN C 3 68  ? 53.792 -20.505 -114.915 1.00 11.68  ? 68   ASN A CA    1 
ATOM   941  C  C     . ASN C 3 68  ? 52.351 -20.048 -114.638 1.00 11.88  ? 68   ASN A C     1 
ATOM   942  O  O     . ASN C 3 68  ? 51.529 -20.911 -114.258 1.00 13.72  ? 68   ASN A O     1 
ATOM   943  C  CB    . ASN C 3 68  ? 54.463 -20.912 -113.577 1.00 11.55  ? 68   ASN A CB    1 
ATOM   944  C  CG    . ASN C 3 68  ? 55.786 -21.637 -113.792 1.00 12.10  ? 68   ASN A CG    1 
ATOM   945  O  OD1   . ASN C 3 68  ? 56.607 -21.685 -112.818 1.00 16.50  ? 68   ASN A OD1   1 
ATOM   946  N  ND2   . ASN C 3 68  ? 55.974 -22.169 -114.956 1.00 10.24  ? 68   ASN A ND2   1 
ATOM   947  N  N     . GLN C 3 69  ? 52.037 -18.765 -114.810 1.00 12.72  ? 69   GLN A N     1 
ATOM   948  C  CA    . GLN C 3 69  ? 50.662 -18.325 -114.507 1.00 14.05  ? 69   GLN A CA    1 
ATOM   949  C  C     . GLN C 3 69  ? 50.273 -18.773 -113.094 1.00 12.39  ? 69   GLN A C     1 
ATOM   950  O  O     . GLN C 3 69  ? 51.107 -18.591 -112.185 1.00 13.30  ? 69   GLN A O     1 
ATOM   951  C  CB    . GLN C 3 69  ? 49.678 -18.795 -115.625 1.00 16.03  ? 69   GLN A CB    1 
ATOM   952  C  CG    . GLN C 3 69  ? 48.404 -17.980 -115.675 1.00 19.08  ? 69   GLN A CG    1 
ATOM   953  C  CD    . GLN C 3 69  ? 47.105 -18.735 -115.570 1.00 17.74  ? 69   GLN A CD    1 
ATOM   954  O  OE1   . GLN C 3 69  ? 46.806 -19.282 -114.506 1.00 18.57  ? 69   GLN A OE1   1 
ATOM   955  N  NE2   . GLN C 3 69  ? 46.283 -18.821 -116.607 1.00 22.45  ? 69   GLN A NE2   1 
ATOM   956  N  N     . LEU C 3 70  ? 49.107 -19.363 -112.924 1.00 13.55  ? 70   LEU A N     1 
ATOM   957  C  CA    . LEU C 3 70  ? 48.703 -19.824 -111.579 1.00 14.82  ? 70   LEU A CA    1 
ATOM   958  C  C     . LEU C 3 70  ? 49.078 -21.263 -111.307 1.00 15.62  ? 70   LEU A C     1 
ATOM   959  O  O     . LEU C 3 70  ? 48.830 -21.709 -110.184 1.00 23.95  ? 70   LEU A O     1 
ATOM   960  C  CB    . LEU C 3 70  ? 47.196 -19.714 -111.452 1.00 15.51  ? 70   LEU A CB    1 
ATOM   961  C  CG    . LEU C 3 70  ? 46.631 -18.302 -111.353 1.00 14.21  ? 70   LEU A CG    1 
ATOM   962  C  CD1   . LEU C 3 70  ? 45.120 -18.345 -111.406 1.00 15.64  ? 70   LEU A CD1   1 
ATOM   963  C  CD2   . LEU C 3 70  ? 47.047 -17.578 -110.063 1.00 15.22  ? 70   LEU A CD2   1 
ATOM   964  N  N     . TYR C 3 71  ? 49.572 -22.011 -112.308 1.00 14.07  ? 71   TYR A N     1 
ATOM   965  C  CA    . TYR C 3 71  ? 49.606 -23.459 -112.149 1.00 13.61  ? 71   TYR A CA    1 
ATOM   966  C  C     . TYR C 3 71  ? 50.881 -24.130 -112.556 1.00 13.20  ? 71   TYR A C     1 
ATOM   967  O  O     . TYR C 3 71  ? 51.055 -25.300 -112.230 1.00 14.74  ? 71   TYR A O     1 
ATOM   968  C  CB    . TYR C 3 71  ? 48.426 -24.096 -112.924 1.00 15.68  ? 71   TYR A CB    1 
ATOM   969  C  CG    . TYR C 3 71  ? 48.244 -23.532 -114.315 1.00 14.79  ? 71   TYR A CG    1 
ATOM   970  C  CD1   . TYR C 3 71  ? 49.064 -23.849 -115.395 1.00 14.25  ? 71   TYR A CD1   1 
ATOM   971  C  CD2   . TYR C 3 71  ? 47.203 -22.648 -114.581 1.00 15.27  ? 71   TYR A CD2   1 
ATOM   972  C  CE1   . TYR C 3 71  ? 48.869 -23.294 -116.656 1.00 15.85  ? 71   TYR A CE1   1 
ATOM   973  C  CE2   . TYR C 3 71  ? 46.996 -22.090 -115.813 1.00 16.41  ? 71   TYR A CE2   1 
ATOM   974  C  CZ    . TYR C 3 71  ? 47.831 -22.429 -116.857 1.00 16.07  ? 71   TYR A CZ    1 
ATOM   975  O  OH    . TYR C 3 71  ? 47.558 -21.870 -118.053 1.00 17.19  ? 71   TYR A OH    1 
ATOM   976  N  N     . GLY C 3 72  ? 51.806 -23.517 -113.264 1.00 12.83  ? 72   GLY A N     1 
ATOM   977  C  CA    . GLY C 3 72  ? 53.008 -24.230 -113.707 1.00 13.37  ? 72   GLY A CA    1 
ATOM   978  C  C     . GLY C 3 72  ? 53.994 -24.433 -112.554 1.00 13.49  ? 72   GLY A C     1 
ATOM   979  O  O     . GLY C 3 72  ? 54.024 -23.610 -111.622 1.00 14.36  ? 72   GLY A O     1 
ATOM   980  N  N     . VAL C 3 73  ? 54.800 -25.495 -112.620 1.00 12.20  ? 73   VAL A N     1 
ATOM   981  C  CA    . VAL C 3 73  ? 55.828 -25.719 -111.618 1.00 12.38  ? 73   VAL A CA    1 
ATOM   982  C  C     . VAL C 3 73  ? 56.986 -26.500 -112.205 1.00 12.38  ? 73   VAL A C     1 
ATOM   983  O  O     . VAL C 3 73  ? 56.761 -27.481 -112.941 1.00 13.17  ? 73   VAL A O     1 
ATOM   984  C  CB    . VAL C 3 73  ? 55.248 -26.434 -110.382 1.00 14.19  ? 73   VAL A CB    1 
ATOM   985  C  CG1   . VAL C 3 73  ? 54.784 -27.844 -110.683 1.00 17.56  ? 73   VAL A CG1   1 
ATOM   986  C  CG2   . VAL C 3 73  ? 56.269 -26.443 -109.236 1.00 18.64  ? 73   VAL A CG2   1 
ATOM   987  N  N     . TRP C 3 74  ? 58.210 -26.092 -111.855 1.00 11.60  ? 74   TRP A N     1 
ATOM   988  C  CA    . TRP C 3 74  ? 59.423 -26.826 -112.202 1.00 11.22  ? 74   TRP A CA    1 
ATOM   989  C  C     . TRP C 3 74  ? 59.737 -27.827 -111.082 1.00 11.88  ? 74   TRP A C     1 
ATOM   990  O  O     . TRP C 3 74  ? 59.572 -27.533 -109.898 1.00 13.56  ? 74   TRP A O     1 
ATOM   991  C  CB    . TRP C 3 74  ? 60.635 -25.914 -112.347 1.00 12.60  ? 74   TRP A CB    1 
ATOM   992  C  CG    . TRP C 3 74  ? 60.628 -25.023 -113.548 1.00 12.37  ? 74   TRP A CG    1 
ATOM   993  C  CD1   . TRP C 3 74  ? 60.144 -23.758 -113.663 1.00 12.85  ? 74   TRP A CD1   1 
ATOM   994  C  CD2   . TRP C 3 74  ? 61.186 -25.392 -114.821 1.00 11.82  ? 74   TRP A CD2   1 
ATOM   995  N  NE1   . TRP C 3 74  ? 60.349 -23.293 -114.939 1.00 11.90  ? 74   TRP A NE1   1 
ATOM   996  C  CE2   . TRP C 3 74  ? 60.984 -24.275 -115.664 1.00 11.73  ? 74   TRP A CE2   1 
ATOM   997  C  CE3   . TRP C 3 74  ? 61.814 -26.555 -115.286 1.00 12.31  ? 74   TRP A CE3   1 
ATOM   998  C  CZ2   . TRP C 3 74  ? 61.391 -24.261 -116.994 1.00 11.83  ? 74   TRP A CZ2   1 
ATOM   999  C  CZ3   . TRP C 3 74  ? 62.233 -26.546 -116.625 1.00 11.54  ? 74   TRP A CZ3   1 
ATOM   1000 C  CH2   . TRP C 3 74  ? 62.019 -25.430 -117.413 1.00 12.66  ? 74   TRP A CH2   1 
ATOM   1001 N  N     . ARG C 3 75  ? 60.287 -28.969 -111.453 1.00 12.71  ? 75   ARG A N     1 
ATOM   1002 C  CA    . ARG C 3 75  ? 60.836 -29.949 -110.544 1.00 12.70  ? 75   ARG A CA    1 
ATOM   1003 C  C     . ARG C 3 75  ? 62.248 -30.315 -110.986 1.00 12.00  ? 75   ARG A C     1 
ATOM   1004 O  O     . ARG C 3 75  ? 62.538 -30.414 -112.186 1.00 14.11  ? 75   ARG A O     1 
ATOM   1005 C  CB    . ARG C 3 75  ? 59.964 -31.220 -110.550 1.00 15.48  ? 75   ARG A CB    1 
ATOM   1006 C  CG    . ARG C 3 75  ? 58.495 -30.971 -110.255 1.00 25.19  ? 75   ARG A CG    1 
ATOM   1007 C  CD    . ARG C 3 75  ? 58.128 -31.294 -108.848 1.00 42.53  ? 75   ARG A CD    1 
ATOM   1008 N  NE    . ARG C 3 75  ? 56.777 -31.055 -108.462 1.00 52.32  ? 75   ARG A NE    1 
ATOM   1009 C  CZ    . ARG C 3 75  ? 55.555 -31.520 -108.613 1.00 56.88  ? 75   ARG A CZ    1 
ATOM   1010 N  NH1   . ARG C 3 75  ? 55.213 -32.567 -109.364 1.00 60.92  ? 75   ARG A NH1   1 
ATOM   1011 N  NH2   . ARG C 3 75  ? 54.568 -30.889 -107.971 1.00 60.72  ? 75   ARG A NH2   1 
ATOM   1012 N  N     . VAL C 3 76  ? 63.108 -30.553 -110.011 1.00 12.64  ? 76   VAL A N     1 
ATOM   1013 C  CA    . VAL C 3 76  ? 64.484 -31.006 -110.237 1.00 12.74  ? 76   VAL A CA    1 
ATOM   1014 C  C     . VAL C 3 76  ? 64.543 -32.459 -109.856 1.00 12.21  ? 76   VAL A C     1 
ATOM   1015 O  O     . VAL C 3 76  ? 64.085 -32.799 -108.736 1.00 15.57  ? 76   VAL A O     1 
ATOM   1016 C  CB    . VAL C 3 76  ? 65.480 -30.177 -109.408 1.00 12.59  ? 76   VAL A CB    1 
ATOM   1017 C  CG1   . VAL C 3 76  ? 66.891 -30.756 -109.562 1.00 15.44  ? 76   VAL A CG1   1 
ATOM   1018 C  CG2   . VAL C 3 76  ? 65.380 -28.720 -109.787 1.00 15.60  ? 76   VAL A CG2   1 
ATOM   1019 N  N     . VAL C 3 77  ? 65.021 -33.306 -110.725 1.00 12.42  ? 77   VAL A N     1 
ATOM   1020 C  CA    . VAL C 3 77  ? 65.126 -34.754 -110.444 1.00 13.20  ? 77   VAL A CA    1 
ATOM   1021 C  C     . VAL C 3 77  ? 66.497 -35.259 -110.832 1.00 12.84  ? 77   VAL A C     1 
ATOM   1022 O  O     . VAL C 3 77  ? 67.243 -34.628 -111.610 1.00 13.63  ? 77   VAL A O     1 
ATOM   1023 C  CB    . VAL C 3 77  ? 64.058 -35.572 -111.190 1.00 14.59  ? 77   VAL A CB    1 
ATOM   1024 C  CG1   . VAL C 3 77  ? 62.675 -35.058 -110.755 1.00 17.82  ? 77   VAL A CG1   1 
ATOM   1025 C  CG2   . VAL C 3 77  ? 64.253 -35.541 -112.697 1.00 15.18  ? 77   VAL A CG2   1 
ATOM   1026 N  N     . ASP C 3 78  ? 66.873 -36.428 -110.357 1.00 13.35  ? 78   ASP A N     1 
ATOM   1027 C  CA    . ASP C 3 78  ? 68.055 -37.105 -110.905 1.00 14.56  ? 78   ASP A CA    1 
ATOM   1028 C  C     . ASP C 3 78  ? 67.715 -37.701 -112.258 1.00 12.57  ? 78   ASP A C     1 
ATOM   1029 O  O     . ASP C 3 78  ? 66.583 -38.097 -112.552 1.00 14.85  ? 78   ASP A O     1 
ATOM   1030 C  CB    . ASP C 3 78  ? 68.472 -38.228 -109.928 1.00 16.51  ? 78   ASP A CB    1 
ATOM   1031 C  CG    . ASP C 3 78  ? 69.009 -37.607 -108.633 1.00 21.45  ? 78   ASP A CG    1 
ATOM   1032 O  OD1   . ASP C 3 78  ? 69.506 -36.453 -108.590 1.00 25.11  ? 78   ASP A OD1   1 
ATOM   1033 O  OD2   . ASP C 3 78  ? 68.879 -38.315 -107.611 1.00 38.19  ? 78   ASP A OD2   1 
ATOM   1034 N  N     . THR C 3 79  ? 68.731 -37.709 -113.139 1.00 13.54  ? 79   THR A N     1 
ATOM   1035 C  CA    . THR C 3 79  ? 68.468 -38.114 -114.510 1.00 14.39  ? 79   THR A CA    1 
ATOM   1036 C  C     . THR C 3 79  ? 67.887 -39.526 -114.620 1.00 12.96  ? 79   THR A C     1 
ATOM   1037 O  O     . THR C 3 79  ? 68.351 -40.460 -114.001 1.00 14.38  ? 79   THR A O     1 
ATOM   1038 C  CB    . THR C 3 79  ? 69.807 -37.973 -115.262 1.00 14.13  ? 79   THR A CB    1 
ATOM   1039 O  OG1   . THR C 3 79  ? 69.952 -36.527 -115.355 1.00 20.19  ? 79   THR A OG1   1 
ATOM   1040 C  CG2   . THR C 3 79  ? 69.713 -38.542 -116.666 1.00 15.70  ? 79   THR A CG2   1 
ATOM   1041 N  N     . GLY C 3 80  ? 66.856 -39.639 -115.442 1.00 13.55  ? 80   GLY A N     1 
ATOM   1042 C  CA    . GLY C 3 80  ? 66.160 -40.895 -115.629 1.00 14.87  ? 80   GLY A CA    1 
ATOM   1043 C  C     . GLY C 3 80  ? 65.019 -41.086 -114.627 1.00 14.29  ? 80   GLY A C     1 
ATOM   1044 O  O     . GLY C 3 80  ? 64.215 -42.030 -114.801 1.00 14.96  ? 80   GLY A O     1 
ATOM   1045 N  N     . GLU C 3 81  ? 64.952 -40.284 -113.575 1.00 16.64  ? 81   GLU A N     1 
ATOM   1046 C  CA    . GLU C 3 81  ? 63.899 -40.421 -112.569 1.00 16.80  ? 81   GLU A CA    1 
ATOM   1047 C  C     . GLU C 3 81  ? 62.726 -39.514 -112.979 1.00 18.29  ? 81   GLU A C     1 
ATOM   1048 O  O     . GLU C 3 81  ? 62.846 -38.446 -113.569 1.00 18.80  ? 81   GLU A O     1 
ATOM   1049 C  CB    . GLU C 3 81  ? 64.442 -40.059 -111.194 1.00 19.88  ? 81   GLU A CB    1 
ATOM   1050 C  CG    . GLU C 3 81  ? 65.681 -40.820 -110.806 1.00 26.65  ? 81   GLU A CG    1 
ATOM   1051 C  CD    . GLU C 3 81  ? 65.435 -42.227 -110.329 1.00 33.86  ? 81   GLU A CD    1 
ATOM   1052 O  OE1   . GLU C 3 81  ? 64.280 -42.708 -110.357 1.00 45.97  ? 81   GLU A OE1   1 
ATOM   1053 O  OE2   . GLU C 3 81  ? 66.464 -42.817 -109.938 1.00 44.42  ? 81   GLU A OE2   1 
ATOM   1054 N  N     . GLU C 3 82  ? 61.538 -39.911 -112.641 1.00 21.16  ? 82   GLU A N     1 
ATOM   1055 C  CA    . GLU C 3 82  ? 60.329 -39.167 -112.920 1.00 25.47  ? 82   GLU A CA    1 
ATOM   1056 C  C     . GLU C 3 82  ? 59.333 -39.783 -111.943 1.00 24.03  ? 82   GLU A C     1 
ATOM   1057 O  O     . GLU C 3 82  ? 58.679 -40.769 -112.233 1.00 29.99  ? 82   GLU A O     1 
ATOM   1058 C  CB    . GLU C 3 82  ? 59.816 -39.257 -114.337 1.00 34.84  ? 82   GLU A CB    1 
ATOM   1059 N  N     . PRO C 3 83  ? 59.308 -39.102 -110.824 1.00 23.51  ? 83   PRO A N     1 
ATOM   1060 C  CA    . PRO C 3 83  ? 58.291 -39.467 -109.836 1.00 24.10  ? 83   PRO A CA    1 
ATOM   1061 C  C     . PRO C 3 83  ? 56.881 -39.354 -110.408 1.00 27.01  ? 83   PRO A C     1 
ATOM   1062 O  O     . PRO C 3 83  ? 56.570 -38.400 -111.092 1.00 22.73  ? 83   PRO A O     1 
ATOM   1063 C  CB    . PRO C 3 83  ? 58.571 -38.424 -108.733 1.00 30.90  ? 83   PRO A CB    1 
ATOM   1064 C  CG    . PRO C 3 83  ? 59.987 -37.946 -108.938 1.00 31.56  ? 83   PRO A CG    1 
ATOM   1065 C  CD    . PRO C 3 83  ? 60.161 -37.966 -110.428 1.00 30.13  ? 83   PRO A CD    1 
ATOM   1066 N  N     . GLN C 3 84  ? 56.028 -40.349 -110.120 1.00 24.96  ? 84   GLN A N     1 
ATOM   1067 C  CA    . GLN C 3 84  ? 54.644 -40.290 -110.568 1.00 28.14  ? 84   GLN A CA    1 
ATOM   1068 C  C     . GLN C 3 84  ? 53.983 -38.962 -110.182 1.00 26.13  ? 84   GLN A C     1 
ATOM   1069 O  O     . GLN C 3 84  ? 54.013 -38.402 -109.082 1.00 28.98  ? 84   GLN A O     1 
ATOM   1070 C  CB    . GLN C 3 84  ? 53.782 -41.398 -109.994 1.00 30.04  ? 84   GLN A CB    1 
ATOM   1071 N  N     . THR C 3 85  ? 53.260 -38.416 -111.162 1.00 26.15  ? 85   THR A N     1 
ATOM   1072 C  CA    . THR C 3 85  ? 52.478 -37.214 -110.889 1.00 28.04  ? 85   THR A CA    1 
ATOM   1073 C  C     . THR C 3 85  ? 51.313 -37.220 -111.870 1.00 27.71  ? 85   THR A C     1 
ATOM   1074 O  O     . THR C 3 85  ? 51.483 -37.781 -112.974 1.00 32.11  ? 85   THR A O     1 
ATOM   1075 C  CB    . THR C 3 85  ? 53.254 -35.907 -111.063 1.00 24.34  ? 85   THR A CB    1 
ATOM   1076 O  OG1   . THR C 3 85  ? 52.401 -34.749 -111.011 1.00 24.89  ? 85   THR A OG1   1 
ATOM   1077 C  CG2   . THR C 3 85  ? 53.860 -35.831 -112.457 1.00 23.76  ? 85   THR A CG2   1 
ATOM   1078 N  N     . THR C 3 86  ? 50.214 -36.593 -111.491 1.00 29.27  ? 86   THR A N     1 
ATOM   1079 C  CA    . THR C 3 86  ? 49.127 -36.395 -112.447 1.00 30.92  ? 86   THR A CA    1 
ATOM   1080 C  C     . THR C 3 86  ? 49.287 -35.193 -113.353 1.00 24.62  ? 86   THR A C     1 
ATOM   1081 O  O     . THR C 3 86  ? 48.554 -34.994 -114.330 1.00 25.61  ? 86   THR A O     1 
ATOM   1082 C  CB    . THR C 3 86  ? 47.786 -36.241 -111.669 1.00 39.91  ? 86   THR A CB    1 
ATOM   1083 O  OG1   . THR C 3 86  ? 46.729 -35.792 -112.515 1.00 64.34  ? 86   THR A OG1   1 
ATOM   1084 C  CG2   . THR C 3 86  ? 48.014 -35.223 -110.564 1.00 45.67  ? 86   THR A CG2   1 
ATOM   1085 N  N     . ARG C 3 87  ? 50.260 -34.351 -113.074 1.00 20.03  ? 87   ARG A N     1 
ATOM   1086 C  CA    . ARG C 3 87  ? 50.458 -33.128 -113.862 1.00 17.72  ? 87   ARG A CA    1 
ATOM   1087 C  C     . ARG C 3 87  ? 50.996 -33.424 -115.257 1.00 17.49  ? 87   ARG A C     1 
ATOM   1088 O  O     . ARG C 3 87  ? 51.680 -34.445 -115.473 1.00 19.80  ? 87   ARG A O     1 
ATOM   1089 C  CB    . ARG C 3 87  ? 51.504 -32.280 -113.146 1.00 17.26  ? 87   ARG A CB    1 
ATOM   1090 C  CG    . ARG C 3 87  ? 50.945 -31.594 -111.896 1.00 19.65  ? 87   ARG A CG    1 
ATOM   1091 C  CD    . ARG C 3 87  ? 52.031 -30.710 -111.330 1.00 19.15  ? 87   ARG A CD    1 
ATOM   1092 N  NE    . ARG C 3 87  ? 51.701 -29.879 -110.207 1.00 21.45  ? 87   ARG A NE    1 
ATOM   1093 C  CZ    . ARG C 3 87  ? 51.299 -28.620 -110.267 1.00 24.94  ? 87   ARG A CZ    1 
ATOM   1094 N  NH1   . ARG C 3 87  ? 51.157 -28.080 -111.466 1.00 21.39  ? 87   ARG A NH1   1 
ATOM   1095 N  NH2   . ARG C 3 87  ? 51.036 -27.928 -109.152 1.00 26.91  ? 87   ARG A NH2   1 
ATOM   1096 N  N     . VAL C 3 88  ? 50.687 -32.548 -116.186 1.00 16.64  ? 88   VAL A N     1 
ATOM   1097 C  CA    . VAL C 3 88  ? 51.173 -32.792 -117.549 1.00 16.94  ? 88   VAL A CA    1 
ATOM   1098 C  C     . VAL C 3 88  ? 52.595 -32.266 -117.750 1.00 14.93  ? 88   VAL A C     1 
ATOM   1099 O  O     . VAL C 3 88  ? 52.871 -31.073 -117.490 1.00 16.10  ? 88   VAL A O     1 
ATOM   1100 C  CB    . VAL C 3 88  ? 50.234 -32.177 -118.600 1.00 18.28  ? 88   VAL A CB    1 
ATOM   1101 C  CG1   . VAL C 3 88  ? 50.069 -30.667 -118.491 1.00 25.57  ? 88   VAL A CG1   1 
ATOM   1102 C  CG2   . VAL C 3 88  ? 50.679 -32.550 -120.015 1.00 22.59  ? 88   VAL A CG2   1 
ATOM   1103 N  N     . LEU C 3 89  ? 53.502 -33.107 -118.203 1.00 14.99  ? 89   LEU A N     1 
ATOM   1104 C  CA    . LEU C 3 89  ? 54.880 -32.685 -118.453 1.00 13.90  ? 89   LEU A CA    1 
ATOM   1105 C  C     . LEU C 3 89  ? 54.971 -31.865 -119.723 1.00 12.77  ? 89   LEU A C     1 
ATOM   1106 O  O     . LEU C 3 89  ? 54.450 -32.260 -120.773 1.00 15.35  ? 89   LEU A O     1 
ATOM   1107 C  CB    . LEU C 3 89  ? 55.783 -33.929 -118.555 1.00 15.93  ? 89   LEU A CB    1 
ATOM   1108 C  CG    . LEU C 3 89  ? 57.280 -33.584 -118.756 1.00 15.41  ? 89   LEU A CG    1 
ATOM   1109 C  CD1   . LEU C 3 89  ? 57.855 -32.825 -117.534 1.00 15.75  ? 89   LEU A CD1   1 
ATOM   1110 C  CD2   . LEU C 3 89  ? 58.076 -34.831 -119.097 1.00 17.31  ? 89   LEU A CD2   1 
ATOM   1111 N  N     . ARG C 3 90  ? 55.654 -30.724 -119.655 1.00 13.04  ? 90   ARG A N     1 
ATOM   1112 C  CA    . ARG C 3 90  ? 55.739 -29.807 -120.777 1.00 12.70  ? 90   ARG A CA    1 
ATOM   1113 C  C     . ARG C 3 90  ? 57.166 -29.618 -121.294 1.00 11.89  ? 90   ARG A C     1 
ATOM   1114 O  O     . ARG C 3 90  ? 57.299 -29.367 -122.517 1.00 12.63  ? 90   ARG A O     1 
ATOM   1115 C  CB    . ARG C 3 90  ? 55.108 -28.459 -120.367 1.00 13.32  ? 90   ARG A CB    1 
ATOM   1116 C  CG    . ARG C 3 90  ? 53.582 -28.559 -120.158 1.00 15.48  ? 90   ARG A CG    1 
ATOM   1117 C  CD    . ARG C 3 90  ? 52.883 -28.470 -121.486 1.00 15.95  ? 90   ARG A CD    1 
ATOM   1118 N  NE    . ARG C 3 90  ? 51.533 -28.994 -121.711 1.00 18.06  ? 90   ARG A NE    1 
ATOM   1119 C  CZ    . ARG C 3 90  ? 50.416 -28.313 -121.386 1.00 16.61  ? 90   ARG A CZ    1 
ATOM   1120 N  NH1   . ARG C 3 90  ? 50.472 -27.116 -120.811 1.00 17.46  ? 90   ARG A NH1   1 
ATOM   1121 N  NH2   . ARG C 3 90  ? 49.252 -28.855 -121.647 1.00 18.54  ? 90   ARG A NH2   1 
ATOM   1122 N  N     . VAL C 3 91  ? 58.178 -29.691 -120.449 1.00 11.92  ? 91   VAL A N     1 
ATOM   1123 C  CA    . VAL C 3 91  ? 59.568 -29.505 -120.881 1.00 11.44  ? 91   VAL A CA    1 
ATOM   1124 C  C     . VAL C 3 91  ? 60.465 -30.424 -120.053 1.00 11.03  ? 91   VAL A C     1 
ATOM   1125 O  O     . VAL C 3 91  ? 60.214 -30.570 -118.824 1.00 11.37  ? 91   VAL A O     1 
ATOM   1126 C  CB    . VAL C 3 91  ? 60.069 -28.049 -120.616 1.00 11.69  ? 91   VAL A CB    1 
ATOM   1127 C  CG1   . VAL C 3 91  ? 61.531 -27.858 -121.072 1.00 13.12  ? 91   VAL A CG1   1 
ATOM   1128 C  CG2   . VAL C 3 91  ? 59.183 -26.976 -121.251 1.00 12.67  ? 91   VAL A CG2   1 
ATOM   1129 N  N     . LYS C 3 92  ? 61.449 -31.062 -120.692 1.00 10.70  ? 92   LYS A N     1 
ATOM   1130 C  CA    . LYS C 3 92  ? 62.512 -31.762 -119.989 1.00 10.80  ? 92   LYS A CA    1 
ATOM   1131 C  C     . LYS C 3 92  ? 63.864 -31.251 -120.524 1.00 11.12  ? 92   LYS A C     1 
ATOM   1132 O  O     . LYS C 3 92  ? 64.076 -31.274 -121.735 1.00 11.62  ? 92   LYS A O     1 
ATOM   1133 C  CB    . LYS C 3 92  ? 62.403 -33.277 -120.191 1.00 12.01  ? 92   LYS A CB    1 
ATOM   1134 C  CG    . LYS C 3 92  ? 63.541 -34.015 -119.455 1.00 12.80  ? 92   LYS A CG    1 
ATOM   1135 C  CD    . LYS C 3 92  ? 63.644 -35.477 -119.823 1.00 13.21  ? 92   LYS A CD    1 
ATOM   1136 C  CE    . LYS C 3 92  ? 64.217 -35.634 -121.244 1.00 14.68  ? 92   LYS A CE    1 
ATOM   1137 N  NZ    . LYS C 3 92  ? 64.481 -37.096 -121.483 1.00 15.17  ? 92   LYS A NZ    1 
ATOM   1138 N  N     . LEU C 3 93  ? 64.743 -30.812 -119.641 1.00 10.80  ? 93   LEU A N     1 
ATOM   1139 C  CA    . LEU C 3 93  ? 66.136 -30.469 -119.984 1.00 10.40  ? 93   LEU A CA    1 
ATOM   1140 C  C     . LEU C 3 93  ? 67.019 -31.365 -119.125 1.00 10.31  ? 93   LEU A C     1 
ATOM   1141 O  O     . LEU C 3 93  ? 67.050 -31.241 -117.892 1.00 11.36  ? 93   LEU A O     1 
ATOM   1142 C  CB    . LEU C 3 93  ? 66.384 -28.991 -119.745 1.00 10.44  ? 93   LEU A CB    1 
ATOM   1143 C  CG    . LEU C 3 93  ? 65.534 -28.053 -120.608 1.00 10.84  ? 93   LEU A CG    1 
ATOM   1144 C  CD1   . LEU C 3 93  ? 65.683 -26.614 -120.130 1.00 12.63  ? 93   LEU A CD1   1 
ATOM   1145 C  CD2   . LEU C 3 93  ? 65.934 -28.161 -122.075 1.00 14.99  ? 93   LEU A CD2   1 
ATOM   1146 N  N     . GLN C 3 94  ? 67.679 -32.304 -119.780 1.00 10.15  ? 94   GLN A N     1 
ATOM   1147 C  CA    . GLN C 3 94  ? 68.407 -33.404 -119.108 1.00 9.99   ? 94   GLN A CA    1 
ATOM   1148 C  C     . GLN C 3 94  ? 69.901 -33.275 -119.317 1.00 9.53   ? 94   GLN A C     1 
ATOM   1149 O  O     . GLN C 3 94  ? 70.339 -33.047 -120.444 1.00 10.72  ? 94   GLN A O     1 
ATOM   1150 C  CB    . GLN C 3 94  ? 67.887 -34.733 -119.656 1.00 11.23  ? 94   GLN A CB    1 
ATOM   1151 C  CG    . GLN C 3 94  ? 68.693 -35.969 -119.264 1.00 11.47  ? 94   GLN A CG    1 
ATOM   1152 C  CD    . GLN C 3 94  ? 67.974 -37.253 -119.697 1.00 12.15  ? 94   GLN A CD    1 
ATOM   1153 O  OE1   . GLN C 3 94  ? 66.732 -37.253 -119.763 1.00 14.76  ? 94   GLN A OE1   1 
ATOM   1154 N  NE2   . GLN C 3 94  ? 68.694 -38.285 -119.977 1.00 13.81  ? 94   GLN A NE2   1 
ATOM   1155 N  N     . THR C 3 95  ? 70.639 -33.496 -118.224 1.00 10.46  ? 95   THR A N     1 
ATOM   1156 C  CA    . THR C 3 95  ? 72.094 -33.569 -118.272 1.00 10.66  ? 95   THR A CA    1 
ATOM   1157 C  C     . THR C 3 95  ? 72.553 -34.897 -117.687 1.00 10.74  ? 95   THR A C     1 
ATOM   1158 O  O     . THR C 3 95  ? 71.727 -35.747 -117.304 1.00 12.07  ? 95   THR A O     1 
ATOM   1159 C  CB    . THR C 3 95  ? 72.739 -32.406 -117.501 1.00 11.47  ? 95   THR A CB    1 
ATOM   1160 O  OG1   . THR C 3 95  ? 72.523 -32.579 -116.069 1.00 12.37  ? 95   THR A OG1   1 
ATOM   1161 C  CG2   . THR C 3 95  ? 72.159 -31.057 -117.933 1.00 11.82  ? 95   THR A CG2   1 
ATOM   1162 N  N     . ALA C 3 96  ? 73.853 -35.133 -117.585 1.00 11.12  ? 96   ALA A N     1 
ATOM   1163 C  CA    . ALA C 3 96  ? 74.354 -36.455 -117.154 1.00 11.01  ? 96   ALA A CA    1 
ATOM   1164 C  C     . ALA C 3 96  ? 73.831 -36.809 -115.778 1.00 12.54  ? 96   ALA A C     1 
ATOM   1165 O  O     . ALA C 3 96  ? 73.522 -37.957 -115.532 1.00 13.38  ? 96   ALA A O     1 
ATOM   1166 C  CB    . ALA C 3 96  ? 75.872 -36.472 -117.192 1.00 13.96  ? 96   ALA A CB    1 
ATOM   1167 N  N     . ASP C 3 97  ? 73.714 -35.854 -114.851 1.00 12.33  ? 97   ASP A N     1 
ATOM   1168 C  CA    . ASP C 3 97  ? 73.306 -36.225 -113.473 1.00 13.10  ? 97   ASP A CA    1 
ATOM   1169 C  C     . ASP C 3 97  ? 71.962 -35.641 -113.075 1.00 12.25  ? 97   ASP A C     1 
ATOM   1170 O  O     . ASP C 3 97  ? 71.232 -36.310 -112.328 1.00 15.85  ? 97   ASP A O     1 
ATOM   1171 C  CB    . ASP C 3 97  ? 74.377 -35.839 -112.455 1.00 15.88  ? 97   ASP A CB    1 
ATOM   1172 C  CG    . ASP C 3 97  ? 74.708 -34.417 -112.277 1.00 17.10  ? 97   ASP A CG    1 
ATOM   1173 O  OD1   . ASP C 3 97  ? 74.507 -33.648 -113.253 1.00 17.62  ? 97   ASP A OD1   1 
ATOM   1174 O  OD2   . ASP C 3 97  ? 75.240 -34.057 -111.221 1.00 23.11  ? 97   ASP A OD2   1 
ATOM   1175 N  N     . LYS C 3 98  ? 71.599 -34.459 -113.481 1.00 11.82  ? 98   LYS A N     1 
ATOM   1176 C  CA    . LYS C 3 98  ? 70.337 -33.821 -113.078 1.00 11.98  ? 98   LYS A CA    1 
ATOM   1177 C  C     . LYS C 3 98  ? 69.492 -33.499 -114.305 1.00 10.85  ? 98   LYS A C     1 
ATOM   1178 O  O     . LYS C 3 98  ? 70.014 -33.204 -115.397 1.00 11.64  ? 98   LYS A O     1 
ATOM   1179 C  CB    . LYS C 3 98  ? 70.545 -32.497 -112.310 1.00 14.24  ? 98   LYS A CB    1 
ATOM   1180 C  CG    . LYS C 3 98  ? 71.379 -32.682 -111.032 1.00 17.54  ? 98   LYS A CG    1 
ATOM   1181 C  CD    . LYS C 3 98  ? 70.619 -33.434 -109.957 1.00 24.14  ? 98   LYS A CD    1 
ATOM   1182 C  CE    . LYS C 3 98  ? 71.451 -33.612 -108.676 1.00 32.91  ? 98   LYS A CE    1 
ATOM   1183 N  NZ    . LYS C 3 98  ? 70.551 -34.305 -107.716 1.00 45.15  ? 98   LYS A NZ    1 
ATOM   1184 N  N     . THR C 3 99  ? 68.174 -33.503 -114.085 1.00 11.29  ? 99   THR A N     1 
ATOM   1185 C  CA    . THR C 3 99  ? 67.198 -33.119 -115.106 1.00 10.95  ? 99   THR A CA    1 
ATOM   1186 C  C     . THR C 3 99  ? 66.234 -32.086 -114.473 1.00 11.45  ? 99   THR A C     1 
ATOM   1187 O  O     . THR C 3 99  ? 65.882 -32.215 -113.288 1.00 12.57  ? 99   THR A O     1 
ATOM   1188 C  CB    . THR C 3 99  ? 66.438 -34.358 -115.554 1.00 11.46  ? 99   THR A CB    1 
ATOM   1189 O  OG1   . THR C 3 99  ? 67.352 -35.160 -116.313 1.00 12.53  ? 99   THR A OG1   1 
ATOM   1190 C  CG2   . THR C 3 99  ? 65.251 -34.025 -116.451 1.00 13.04  ? 99   THR A CG2   1 
ATOM   1191 N  N     . ILE C 3 100 ? 65.821 -31.144 -115.262 1.00 10.75  ? 100  ILE A N     1 
ATOM   1192 C  CA    . ILE C 3 100 ? 64.763 -30.234 -114.831 1.00 10.66  ? 100  ILE A CA    1 
ATOM   1193 C  C     . ILE C 3 100 ? 63.512 -30.465 -115.702 1.00 10.72  ? 100  ILE A C     1 
ATOM   1194 O  O     . ILE C 3 100 ? 63.643 -30.708 -116.925 1.00 11.11  ? 100  ILE A O     1 
ATOM   1195 C  CB    . ILE C 3 100 ? 65.181 -28.763 -114.777 1.00 11.04  ? 100  ILE A CB    1 
ATOM   1196 C  CG1   . ILE C 3 100 ? 65.612 -28.232 -116.180 1.00 12.53  ? 100  ILE A CG1   1 
ATOM   1197 C  CG2   . ILE C 3 100 ? 66.317 -28.662 -113.769 1.00 11.67  ? 100  ILE A CG2   1 
ATOM   1198 C  CD1   . ILE C 3 100 ? 65.870 -26.712 -116.122 1.00 13.50  ? 100  ILE A CD1   1 
ATOM   1199 N  N     . LEU C 3 101 ? 62.363 -30.435 -115.036 1.00 11.08  ? 101  LEU A N     1 
ATOM   1200 C  CA    . LEU C 3 101 ? 61.074 -30.765 -115.632 1.00 11.92  ? 101  LEU A CA    1 
ATOM   1201 C  C     . LEU C 3 101 ? 60.100 -29.616 -115.388 1.00 10.93  ? 101  LEU A C     1 
ATOM   1202 O  O     . LEU C 3 101 ? 59.916 -29.200 -114.230 1.00 12.31  ? 101  LEU A O     1 
ATOM   1203 C  CB    . LEU C 3 101 ? 60.507 -32.033 -114.954 1.00 13.23  ? 101  LEU A CB    1 
ATOM   1204 C  CG    . LEU C 3 101 ? 61.381 -33.273 -115.023 1.00 13.25  ? 101  LEU A CG    1 
ATOM   1205 C  CD1   . LEU C 3 101 ? 60.812 -34.399 -114.156 1.00 15.37  ? 101  LEU A CD1   1 
ATOM   1206 C  CD2   . LEU C 3 101 ? 61.514 -33.738 -116.488 1.00 14.91  ? 101  LEU A CD2   1 
ATOM   1207 N  N     . LEU C 3 102 ? 59.454 -29.120 -116.411 1.00 10.85  ? 102  LEU A N     1 
ATOM   1208 C  CA    . LEU C 3 102 ? 58.430 -28.110 -116.245 1.00 11.20  ? 102  LEU A CA    1 
ATOM   1209 C  C     . LEU C 3 102 ? 57.087 -28.773 -116.464 1.00 11.95  ? 102  LEU A C     1 
ATOM   1210 O  O     . LEU C 3 102 ? 56.843 -29.361 -117.551 1.00 12.21  ? 102  LEU A O     1 
ATOM   1211 C  CB    . LEU C 3 102 ? 58.560 -26.943 -117.244 1.00 11.56  ? 102  LEU A CB    1 
ATOM   1212 C  CG    . LEU C 3 102 ? 57.449 -25.893 -117.147 1.00 12.27  ? 102  LEU A CG    1 
ATOM   1213 C  CD1   . LEU C 3 102 ? 57.322 -25.304 -115.740 1.00 13.46  ? 102  LEU A CD1   1 
ATOM   1214 C  CD2   . LEU C 3 102 ? 57.726 -24.750 -118.163 1.00 13.53  ? 102  LEU A CD2   1 
ATOM   1215 N  N     . TYR C 3 103 ? 56.245 -28.723 -115.459 1.00 11.65  ? 103  TYR A N     1 
ATOM   1216 C  CA    . TYR C 3 103 ? 54.893 -29.256 -115.521 1.00 12.20  ? 103  TYR A CA    1 
ATOM   1217 C  C     . TYR C 3 103 ? 53.864 -28.176 -115.645 1.00 12.73  ? 103  TYR A C     1 
ATOM   1218 O  O     . TYR C 3 103 ? 54.058 -27.067 -115.066 1.00 13.79  ? 103  TYR A O     1 
ATOM   1219 C  CB    . TYR C 3 103 ? 54.566 -30.057 -114.226 1.00 14.46  ? 103  TYR A CB    1 
ATOM   1220 C  CG    . TYR C 3 103 ? 55.280 -31.379 -114.160 1.00 14.14  ? 103  TYR A CG    1 
ATOM   1221 C  CD1   . TYR C 3 103 ? 54.719 -32.498 -114.807 1.00 15.23  ? 103  TYR A CD1   1 
ATOM   1222 C  CD2   . TYR C 3 103 ? 56.493 -31.523 -113.485 1.00 15.64  ? 103  TYR A CD2   1 
ATOM   1223 C  CE1   . TYR C 3 103 ? 55.368 -33.728 -114.753 1.00 15.39  ? 103  TYR A CE1   1 
ATOM   1224 C  CE2   . TYR C 3 103 ? 57.127 -32.767 -113.461 1.00 15.27  ? 103  TYR A CE2   1 
ATOM   1225 C  CZ    . TYR C 3 103 ? 56.562 -33.855 -114.100 1.00 15.85  ? 103  TYR A CZ    1 
ATOM   1226 O  OH    . TYR C 3 103 ? 57.205 -35.072 -114.054 1.00 17.66  ? 103  TYR A OH    1 
ATOM   1227 N  N     . SER C 3 104 ? 52.812 -28.440 -116.396 1.00 13.31  ? 104  SER A N     1 
ATOM   1228 C  CA    . SER C 3 104 ? 51.538 -27.752 -116.344 1.00 13.25  ? 104  SER A CA    1 
ATOM   1229 C  C     . SER C 3 104 ? 51.521 -26.397 -117.029 1.00 12.88  ? 104  SER A C     1 
ATOM   1230 O  O     . SER C 3 104 ? 50.457 -26.040 -117.577 1.00 14.94  ? 104  SER A O     1 
ATOM   1231 C  CB    . SER C 3 104 ? 51.034 -27.615 -114.875 1.00 14.51  ? 104  SER A CB    1 
ATOM   1232 O  OG    . SER C 3 104 ? 51.098 -28.859 -114.237 1.00 15.82  ? 104  SER A OG    1 
ATOM   1233 N  N     . ALA C 3 105 ? 52.634 -25.672 -117.053 1.00 12.87  ? 105  ALA A N     1 
ATOM   1234 C  CA    . ALA C 3 105 ? 52.631 -24.347 -117.700 1.00 12.67  ? 105  ALA A CA    1 
ATOM   1235 C  C     . ALA C 3 105 ? 52.152 -24.460 -119.146 1.00 13.25  ? 105  ALA A C     1 
ATOM   1236 O  O     . ALA C 3 105 ? 52.528 -25.407 -119.848 1.00 14.30  ? 105  ALA A O     1 
ATOM   1237 C  CB    . ALA C 3 105 ? 54.049 -23.776 -117.673 1.00 12.83  ? 105  ALA A CB    1 
ATOM   1238 N  N     . SER C 3 106 ? 51.418 -23.466 -119.606 1.00 13.51  ? 106  SER A N     1 
ATOM   1239 C  CA    . SER C 3 106 ? 50.935 -23.432 -120.969 1.00 13.59  ? 106  SER A CA    1 
ATOM   1240 C  C     . SER C 3 106 ? 51.649 -22.349 -121.762 1.00 14.26  ? 106  SER A C     1 
ATOM   1241 O  O     . SER C 3 106 ? 51.595 -22.424 -122.987 1.00 18.51  ? 106  SER A O     1 
ATOM   1242 C  CB    . SER C 3 106 ? 49.427 -23.193 -120.966 1.00 15.39  ? 106  SER A CB    1 
ATOM   1243 O  OG    . SER C 3 106 ? 49.141 -22.036 -120.226 1.00 16.03  ? 106  SER A OG    1 
ATOM   1244 N  N     . ASP C 3 107 ? 52.301 -21.408 -121.122 1.00 12.93  ? 107  ASP A N     1 
ATOM   1245 C  CA    . ASP C 3 107 ? 52.941 -20.299 -121.823 1.00 12.51  ? 107  ASP A CA    1 
ATOM   1246 C  C     . ASP C 3 107 ? 54.434 -20.568 -121.935 1.00 11.54  ? 107  ASP A C     1 
ATOM   1247 O  O     . ASP C 3 107 ? 55.187 -20.263 -121.009 1.00 12.83  ? 107  ASP A O     1 
ATOM   1248 C  CB    A ASP C 3 107 ? 52.637 -18.991 -121.062 0.59 17.24  ? 107  ASP A CB    1 
ATOM   1249 C  CB    B ASP C 3 107 ? 52.680 -19.034 -120.964 0.41 17.71  ? 107  ASP A CB    1 
ATOM   1250 C  CG    A ASP C 3 107 ? 52.965 -17.716 -121.800 0.59 20.26  ? 107  ASP A CG    1 
ATOM   1251 C  CG    B ASP C 3 107 ? 51.192 -18.820 -120.790 0.41 17.23  ? 107  ASP A CG    1 
ATOM   1252 O  OD1   A ASP C 3 107 ? 53.595 -17.717 -122.885 0.59 20.31  ? 107  ASP A OD1   1 
ATOM   1253 O  OD1   B ASP C 3 107 ? 50.588 -18.719 -121.888 0.41 19.21  ? 107  ASP A OD1   1 
ATOM   1254 O  OD2   A ASP C 3 107 ? 52.549 -16.640 -121.270 0.59 29.00  ? 107  ASP A OD2   1 
ATOM   1255 O  OD2   B ASP C 3 107 ? 50.607 -18.748 -119.684 0.41 18.36  ? 107  ASP A OD2   1 
ATOM   1256 N  N     . ILE C 3 108 ? 54.801 -21.202 -123.032 1.00 12.75  ? 108  ILE A N     1 
ATOM   1257 C  CA    . ILE C 3 108 ? 56.176 -21.651 -123.247 1.00 12.01  ? 108  ILE A CA    1 
ATOM   1258 C  C     . ILE C 3 108 ? 56.532 -21.394 -124.687 1.00 12.17  ? 108  ILE A C     1 
ATOM   1259 O  O     . ILE C 3 108 ? 55.775 -21.867 -125.553 1.00 13.80  ? 108  ILE A O     1 
ATOM   1260 C  CB    . ILE C 3 108 ? 56.317 -23.155 -122.959 1.00 12.81  ? 108  ILE A CB    1 
ATOM   1261 C  CG1   . ILE C 3 108 ? 55.749 -23.565 -121.602 1.00 13.06  ? 108  ILE A CG1   1 
ATOM   1262 C  CG2   . ILE C 3 108 ? 57.786 -23.588 -123.105 1.00 13.24  ? 108  ILE A CG2   1 
ATOM   1263 C  CD1   . ILE C 3 108 ? 55.638 -25.097 -121.444 1.00 12.50  ? 108  ILE A CD1   1 
ATOM   1264 N  N     . GLU C 3 109 ? 57.628 -20.697 -124.950 1.00 12.93  ? 109  GLU A N     1 
ATOM   1265 C  CA    . GLU C 3 109 ? 58.027 -20.464 -126.349 1.00 15.07  ? 109  GLU A CA    1 
ATOM   1266 C  C     . GLU C 3 109 ? 59.547 -20.292 -126.426 1.00 12.22  ? 109  GLU A C     1 
ATOM   1267 O  O     . GLU C 3 109 ? 60.215 -20.082 -125.417 1.00 13.35  ? 109  GLU A O     1 
ATOM   1268 C  CB    . GLU C 3 109 ? 57.232 -19.365 -126.979 1.00 20.19  ? 109  GLU A CB    1 
ATOM   1269 C  CG    . GLU C 3 109 ? 57.572 -18.069 -126.321 1.00 19.85  ? 109  GLU A CG    1 
ATOM   1270 C  CD    . GLU C 3 109 ? 56.607 -16.999 -126.797 1.00 23.35  ? 109  GLU A CD    1 
ATOM   1271 O  OE1   . GLU C 3 109 ? 56.790 -16.548 -127.940 1.00 26.58  ? 109  GLU A OE1   1 
ATOM   1272 O  OE2   . GLU C 3 109 ? 55.685 -16.633 -126.027 1.00 24.56  ? 109  GLU A OE2   1 
ATOM   1273 N  N     . MET C 3 110 ? 60.070 -20.497 -127.612 1.00 11.23  ? 110  MET A N     1 
ATOM   1274 C  CA    . MET C 3 110 ? 61.490 -20.340 -127.829 1.00 10.99  ? 110  MET A CA    1 
ATOM   1275 C  C     . MET C 3 110 ? 61.789 -18.971 -128.441 1.00 12.46  ? 110  MET A C     1 
ATOM   1276 O  O     . MET C 3 110 ? 61.161 -18.658 -129.463 1.00 15.26  ? 110  MET A O     1 
ATOM   1277 C  CB    . MET C 3 110 ? 62.000 -21.461 -128.720 1.00 12.34  ? 110  MET A CB    1 
ATOM   1278 C  CG    . MET C 3 110 ? 63.523 -21.522 -128.741 1.00 11.74  ? 110  MET A CG    1 
ATOM   1279 S  SD    . MET C 3 110 ? 64.272 -22.042 -127.153 1.00 12.36  ? 110  MET A SD    1 
ATOM   1280 C  CE    . MET C 3 110 ? 63.783 -23.787 -127.172 1.00 12.63  ? 110  MET A CE    1 
ATOM   1281 N  N     . LEU C 3 111 ? 62.684 -18.214 -127.839 1.00 11.39  ? 111  LEU A N     1 
ATOM   1282 C  CA    . LEU C 3 111 ? 62.984 -16.860 -128.263 1.00 11.81  ? 111  LEU A CA    1 
ATOM   1283 C  C     . LEU C 3 111 ? 64.363 -16.742 -128.878 1.00 11.46  ? 111  LEU A C     1 
ATOM   1284 O  O     . LEU C 3 111 ? 65.355 -17.240 -128.382 1.00 13.36  ? 111  LEU A O     1 
ATOM   1285 C  CB    . LEU C 3 111 ? 62.918 -15.885 -127.061 1.00 11.88  ? 111  LEU A CB    1 
ATOM   1286 C  CG    . LEU C 3 111 ? 61.593 -15.854 -126.295 1.00 13.73  ? 111  LEU A CG    1 
ATOM   1287 C  CD1   . LEU C 3 111 ? 61.651 -14.733 -125.252 1.00 15.82  ? 111  LEU A CD1   1 
ATOM   1288 C  CD2   . LEU C 3 111 ? 60.402 -15.673 -127.224 1.00 16.63  ? 111  LEU A CD2   1 
ATOM   1289 N  N     . ARG C 3 112 ? 64.395 -16.010 -130.011 1.00 12.38  ? 112  ARG A N     1 
ATOM   1290 C  CA    . ARG C 3 112 ? 65.623 -15.535 -130.581 1.00 13.04  ? 112  ARG A CA    1 
ATOM   1291 C  C     . ARG C 3 112 ? 66.087 -14.273 -129.836 1.00 12.71  ? 112  ARG A C     1 
ATOM   1292 O  O     . ARG C 3 112 ? 65.262 -13.648 -129.146 1.00 13.19  ? 112  ARG A O     1 
ATOM   1293 C  CB    . ARG C 3 112 ? 65.345 -15.134 -132.043 1.00 15.78  ? 112  ARG A CB    1 
ATOM   1294 C  CG    . ARG C 3 112 ? 64.723 -16.247 -132.867 1.00 20.35  ? 112  ARG A CG    1 
ATOM   1295 C  CD    . ARG C 3 112 ? 65.777 -17.183 -133.456 1.00 23.68  ? 112  ARG A CD    1 
ATOM   1296 N  NE    . ARG C 3 112 ? 66.509 -16.452 -134.496 1.00 23.93  ? 112  ARG A NE    1 
ATOM   1297 C  CZ    . ARG C 3 112 ? 66.127 -16.239 -135.741 1.00 20.68  ? 112  ARG A CZ    1 
ATOM   1298 N  NH1   . ARG C 3 112 ? 64.994 -16.742 -136.206 1.00 20.45  ? 112  ARG A NH1   1 
ATOM   1299 N  NH2   . ARG C 3 112 ? 66.926 -15.517 -136.543 1.00 22.63  ? 112  ARG A NH2   1 
ATOM   1300 N  N     . PRO C 3 113 ? 67.352 -13.872 -129.928 1.00 13.48  ? 113  PRO A N     1 
ATOM   1301 C  CA    . PRO C 3 113 ? 67.811 -12.720 -129.141 1.00 14.43  ? 113  PRO A CA    1 
ATOM   1302 C  C     . PRO C 3 113 ? 66.971 -11.454 -129.328 1.00 13.19  ? 113  PRO A C     1 
ATOM   1303 O  O     . PRO C 3 113 ? 66.706 -10.743 -128.331 1.00 14.02  ? 113  PRO A O     1 
ATOM   1304 C  CB    . PRO C 3 113 ? 69.264 -12.499 -129.613 1.00 16.40  ? 113  PRO A CB    1 
ATOM   1305 C  CG    . PRO C 3 113 ? 69.711 -13.863 -130.059 1.00 16.84  ? 113  PRO A CG    1 
ATOM   1306 C  CD    . PRO C 3 113 ? 68.474 -14.524 -130.632 1.00 14.87  ? 113  PRO A CD    1 
ATOM   1307 N  N     . GLU C 3 114 ? 66.569 -11.170 -130.552 1.00 14.06  ? 114  GLU A N     1 
ATOM   1308 C  CA    . GLU C 3 114 ? 65.771 -9.942  -130.776 1.00 16.17  ? 114  GLU A CA    1 
ATOM   1309 C  C     . GLU C 3 114 ? 64.470 -9.993  -129.970 1.00 14.98  ? 114  GLU A C     1 
ATOM   1310 O  O     . GLU C 3 114 ? 63.925 -8.955  -129.575 1.00 17.10  ? 114  GLU A O     1 
ATOM   1311 C  CB    . GLU C 3 114 ? 65.548 -9.773  -132.273 1.00 19.68  ? 114  GLU A CB    1 
ATOM   1312 C  CG    . GLU C 3 114 ? 65.071 -10.833 -133.189 1.00 29.61  ? 114  GLU A CG    1 
ATOM   1313 C  CD    . GLU C 3 114 ? 65.990 -11.959 -133.655 1.00 32.38  ? 114  GLU A CD    1 
ATOM   1314 O  OE1   . GLU C 3 114 ? 67.131 -12.129 -133.124 1.00 19.65  ? 114  GLU A OE1   1 
ATOM   1315 O  OE2   . GLU C 3 114 ? 65.521 -12.721 -134.596 1.00 25.54  ? 114  GLU A OE2   1 
ATOM   1316 N  N     . GLN C 3 115 ? 63.951 -11.174 -129.745 1.00 14.23  ? 115  GLN A N     1 
ATOM   1317 C  CA    . GLN C 3 115 ? 62.660 -11.286 -129.067 1.00 13.73  ? 115  GLN A CA    1 
ATOM   1318 C  C     . GLN C 3 115 ? 62.757 -11.034 -127.584 1.00 13.22  ? 115  GLN A C     1 
ATOM   1319 O  O     . GLN C 3 115 ? 61.713 -10.818 -126.937 1.00 14.89  ? 115  GLN A O     1 
ATOM   1320 C  CB    . GLN C 3 115 ? 61.966 -12.658 -129.315 1.00 15.95  ? 115  GLN A CB    1 
ATOM   1321 C  CG    . GLN C 3 115 ? 61.536 -12.872 -130.749 1.00 18.91  ? 115  GLN A CG    1 
ATOM   1322 C  CD    . GLN C 3 115 ? 61.073 -14.322 -130.902 1.00 17.69  ? 115  GLN A CD    1 
ATOM   1323 O  OE1   . GLN C 3 115 ? 61.904 -15.153 -131.158 1.00 15.69  ? 115  GLN A OE1   1 
ATOM   1324 N  NE2   . GLN C 3 115 ? 59.797 -14.645 -130.675 1.00 21.16  ? 115  GLN A NE2   1 
ATOM   1325 N  N     . LEU C 3 116 ? 63.949 -11.042 -126.997 1.00 12.99  ? 116  LEU A N     1 
ATOM   1326 C  CA    . LEU C 3 116 ? 64.112 -10.743 -125.586 1.00 12.93  ? 116  LEU A CA    1 
ATOM   1327 C  C     . LEU C 3 116 ? 63.700 -9.324  -125.270 1.00 13.58  ? 116  LEU A C     1 
ATOM   1328 O  O     . LEU C 3 116 ? 63.450 -9.008  -124.098 1.00 16.28  ? 116  LEU A O     1 
ATOM   1329 C  CB    . LEU C 3 116 ? 65.607 -10.945 -125.175 1.00 13.69  ? 116  LEU A CB    1 
ATOM   1330 C  CG    . LEU C 3 116 ? 66.043 -12.398 -125.279 1.00 13.29  ? 116  LEU A CG    1 
ATOM   1331 C  CD1   . LEU C 3 116 ? 67.565 -12.456 -125.050 1.00 15.78  ? 116  LEU A CD1   1 
ATOM   1332 C  CD2   . LEU C 3 116 ? 65.323 -13.272 -124.263 1.00 17.37  ? 116  LEU A CD2   1 
ATOM   1333 N  N     . THR C 3 117 ? 63.619 -8.427  -126.271 1.00 13.13  ? 117  THR A N     1 
ATOM   1334 C  CA    . THR C 3 117 ? 63.095 -7.082  -125.999 1.00 13.10  ? 117  THR A CA    1 
ATOM   1335 C  C     . THR C 3 117 ? 61.755 -6.842  -126.658 1.00 12.03  ? 117  THR A C     1 
ATOM   1336 O  O     . THR C 3 117 ? 61.064 -5.899  -126.277 1.00 16.15  ? 117  THR A O     1 
ATOM   1337 C  CB    . THR C 3 117 ? 64.069 -5.957  -126.399 1.00 14.48  ? 117  THR A CB    1 
ATOM   1338 O  OG1   . THR C 3 117 ? 64.405 -6.188  -127.781 1.00 21.33  ? 117  THR A OG1   1 
ATOM   1339 C  CG2   . THR C 3 117 ? 65.349 -6.011  -125.635 1.00 20.23  ? 117  THR A CG2   1 
ATOM   1340 N  N     . THR C 3 118 ? 61.317 -7.645  -127.646 1.00 12.84  ? 118  THR A N     1 
ATOM   1341 C  CA    . THR C 3 118 ? 60.083 -7.339  -128.375 1.00 13.02  ? 118  THR A CA    1 
ATOM   1342 C  C     . THR C 3 118 ? 58.930 -8.245  -128.012 1.00 12.42  ? 118  THR A C     1 
ATOM   1343 O  O     . THR C 3 118 ? 57.772 -7.859  -128.294 1.00 12.95  ? 118  THR A O     1 
ATOM   1344 C  CB    . THR C 3 118 ? 60.284 -7.435  -129.905 1.00 12.82  ? 118  THR A CB    1 
ATOM   1345 O  OG1   . THR C 3 118 ? 60.664 -8.787  -130.226 1.00 12.60  ? 118  THR A OG1   1 
ATOM   1346 C  CG2   . THR C 3 118 ? 61.403 -6.502  -130.373 1.00 13.82  ? 118  THR A CG2   1 
ATOM   1347 N  N     . HIS C 3 119 ? 59.160 -9.389  -127.357 1.00 11.45  ? 119  HIS A N     1 
ATOM   1348 C  CA    . HIS C 3 119 ? 58.073 -10.283 -126.899 1.00 11.84  ? 119  HIS A CA    1 
ATOM   1349 C  C     . HIS C 3 119 ? 57.046 -9.510  -126.124 1.00 10.75  ? 119  HIS A C     1 
ATOM   1350 O  O     . HIS C 3 119 ? 57.450 -8.597  -125.359 1.00 13.35  ? 119  HIS A O     1 
ATOM   1351 C  CB    . HIS C 3 119 ? 58.712 -11.352 -125.989 1.00 12.81  ? 119  HIS A CB    1 
ATOM   1352 C  CG    . HIS C 3 119 ? 57.716 -12.287 -125.369 1.00 13.05  ? 119  HIS A CG    1 
ATOM   1353 N  ND1   . HIS C 3 119 ? 56.968 -12.006 -124.231 1.00 14.79  ? 119  HIS A ND1   1 
ATOM   1354 C  CD2   . HIS C 3 119 ? 57.391 -13.525 -125.774 1.00 13.72  ? 119  HIS A CD2   1 
ATOM   1355 C  CE1   . HIS C 3 119 ? 56.213 -13.063 -123.971 1.00 14.00  ? 119  HIS A CE1   1 
ATOM   1356 N  NE2   . HIS C 3 119 ? 56.459 -13.982 -124.907 1.00 13.96  ? 119  HIS A NE2   1 
ATOM   1357 N  N     . PRO C 3 120 ? 55.752 -9.722  -126.315 1.00 11.90  ? 120  PRO A N     1 
ATOM   1358 C  CA    . PRO C 3 120 ? 54.771 -8.774  -125.727 1.00 13.90  ? 120  PRO A CA    1 
ATOM   1359 C  C     . PRO C 3 120 ? 54.898 -8.599  -124.223 1.00 13.86  ? 120  PRO A C     1 
ATOM   1360 O  O     . PRO C 3 120 ? 54.784 -7.474  -123.727 1.00 17.40  ? 120  PRO A O     1 
ATOM   1361 C  CB    . PRO C 3 120 ? 53.411 -9.374  -126.136 1.00 17.13  ? 120  PRO A CB    1 
ATOM   1362 C  CG    . PRO C 3 120 ? 53.681 -10.176 -127.388 1.00 17.19  ? 120  PRO A CG    1 
ATOM   1363 C  CD    . PRO C 3 120 ? 55.088 -10.744 -127.160 1.00 14.17  ? 120  PRO A CD    1 
ATOM   1364 N  N     . PHE C 3 121 ? 55.154 -9.653  -123.475 1.00 12.79  ? 121  PHE A N     1 
ATOM   1365 C  CA    . PHE C 3 121 ? 55.265 -9.486  -122.011 1.00 12.57  ? 121  PHE A CA    1 
ATOM   1366 C  C     . PHE C 3 121 ? 56.589 -8.840  -121.672 1.00 11.40  ? 121  PHE A C     1 
ATOM   1367 O  O     . PHE C 3 121 ? 56.660 -7.912  -120.836 1.00 13.12  ? 121  PHE A O     1 
ATOM   1368 C  CB    . PHE C 3 121 ? 55.112 -10.888 -121.335 1.00 13.54  ? 121  PHE A CB    1 
ATOM   1369 C  CG    . PHE C 3 121 ? 55.136 -10.760 -119.822 1.00 14.69  ? 121  PHE A CG    1 
ATOM   1370 C  CD1   . PHE C 3 121 ? 53.996 -10.276 -119.163 1.00 18.95  ? 121  PHE A CD1   1 
ATOM   1371 C  CD2   . PHE C 3 121 ? 56.257 -11.068 -119.086 1.00 18.83  ? 121  PHE A CD2   1 
ATOM   1372 C  CE1   . PHE C 3 121 ? 54.035 -10.083 -117.788 1.00 21.99  ? 121  PHE A CE1   1 
ATOM   1373 C  CE2   . PHE C 3 121 ? 56.253 -10.941 -117.699 1.00 20.80  ? 121  PHE A CE2   1 
ATOM   1374 C  CZ    . PHE C 3 121 ? 55.128 -10.480 -117.037 1.00 21.63  ? 121  PHE A CZ    1 
ATOM   1375 N  N     . LEU C 3 122 ? 57.664 -9.305  -122.275 1.00 11.91  ? 122  LEU A N     1 
ATOM   1376 C  CA    . LEU C 3 122 ? 58.977 -8.755  -121.981 1.00 12.03  ? 122  LEU A CA    1 
ATOM   1377 C  C     . LEU C 3 122 ? 59.052 -7.303  -122.357 1.00 11.48  ? 122  LEU A C     1 
ATOM   1378 O  O     . LEU C 3 122 ? 59.759 -6.524  -121.652 1.00 14.24  ? 122  LEU A O     1 
ATOM   1379 C  CB    . LEU C 3 122 ? 60.103 -9.529  -122.656 1.00 11.54  ? 122  LEU A CB    1 
ATOM   1380 C  CG    . LEU C 3 122 ? 60.145 -11.028 -122.314 1.00 11.66  ? 122  LEU A CG    1 
ATOM   1381 C  CD1   . LEU C 3 122 ? 61.278 -11.707 -123.077 1.00 13.24  ? 122  LEU A CD1   1 
ATOM   1382 C  CD2   . LEU C 3 122 ? 60.276 -11.219 -120.804 1.00 13.35  ? 122  LEU A CD2   1 
ATOM   1383 N  N     . GLN C 3 123 ? 58.355 -6.857  -123.376 1.00 12.24  ? 123  GLN A N     1 
ATOM   1384 C  CA    . GLN C 3 123 ? 58.393 -5.445  -123.749 1.00 12.91  ? 123  GLN A CA    1 
ATOM   1385 C  C     . GLN C 3 123 ? 57.615 -4.623  -122.729 1.00 13.15  ? 123  GLN A C     1 
ATOM   1386 O  O     . GLN C 3 123 ? 57.920 -3.442  -122.601 1.00 16.78  ? 123  GLN A O     1 
ATOM   1387 C  CB    . GLN C 3 123 ? 57.831 -5.286  -125.184 1.00 13.77  ? 123  GLN A CB    1 
ATOM   1388 C  CG    . GLN C 3 123 ? 57.982 -3.898  -125.763 1.00 16.72  ? 123  GLN A CG    1 
ATOM   1389 C  CD    . GLN C 3 123 ? 56.901 -2.896  -125.388 1.00 16.66  ? 123  GLN A CD    1 
ATOM   1390 O  OE1   . GLN C 3 123 ? 57.253 -1.683  -125.411 1.00 25.24  ? 123  GLN A OE1   1 
ATOM   1391 N  NE2   . GLN C 3 123 ? 55.714 -3.291  -125.078 1.00 14.56  ? 123  GLN A NE2   1 
ATOM   1392 N  N     . ARG C 3 124 ? 56.599 -5.132  -122.095 1.00 13.47  ? 124  ARG A N     1 
ATOM   1393 C  CA    . ARG C 3 124 ? 55.734 -4.286  -121.240 1.00 14.47  ? 124  ARG A CA    1 
ATOM   1394 C  C     . ARG C 3 124 ? 56.199 -4.272  -119.800 1.00 13.60  ? 124  ARG A C     1 
ATOM   1395 O  O     . ARG C 3 124 ? 55.866 -3.355  -119.074 1.00 15.09  ? 124  ARG A O     1 
ATOM   1396 C  CB    A ARG C 3 124 ? 54.266 -4.632  -121.361 0.35 17.66  ? 124  ARG A CB    1 
ATOM   1397 C  CB    B ARG C 3 124 ? 54.351 -4.971  -121.258 0.65 16.31  ? 124  ARG A CB    1 
ATOM   1398 C  CG    A ARG C 3 124 ? 53.945 -6.037  -120.939 0.35 18.96  ? 124  ARG A CG    1 
ATOM   1399 C  CG    B ARG C 3 124 ? 53.255 -4.236  -120.546 0.65 20.45  ? 124  ARG A CG    1 
ATOM   1400 C  CD    A ARG C 3 124 ? 52.449 -6.252  -121.214 0.35 26.44  ? 124  ARG A CD    1 
ATOM   1401 C  CD    B ARG C 3 124 ? 51.857 -4.807  -120.813 0.65 27.26  ? 124  ARG A CD    1 
ATOM   1402 N  NE    A ARG C 3 124 ? 51.867 -6.692  -119.974 0.35 29.88  ? 124  ARG A NE    1 
ATOM   1403 N  NE    B ARG C 3 124 ? 50.986 -3.933  -120.021 0.65 30.43  ? 124  ARG A NE    1 
ATOM   1404 C  CZ    A ARG C 3 124 ? 51.854 -6.075  -118.808 0.35 32.84  ? 124  ARG A CZ    1 
ATOM   1405 C  CZ    B ARG C 3 124 ? 50.727 -4.184  -118.738 0.65 31.09  ? 124  ARG A CZ    1 
ATOM   1406 N  NH1   A ARG C 3 124 ? 52.414 -4.884  -118.638 0.35 36.87  ? 124  ARG A NH1   1 
ATOM   1407 N  NH1   B ARG C 3 124 ? 51.275 -5.270  -118.197 0.65 36.61  ? 124  ARG A NH1   1 
ATOM   1408 N  NH2   A ARG C 3 124 ? 51.265 -6.658  -117.777 0.35 27.53  ? 124  ARG A NH2   1 
ATOM   1409 N  NH2   B ARG C 3 124 ? 49.940 -3.368  -118.066 0.65 27.51  ? 124  ARG A NH2   1 
ATOM   1410 N  N     . VAL C 3 125 ? 56.970 -5.253  -119.335 1.00 12.72  ? 125  VAL A N     1 
ATOM   1411 C  CA    . VAL C 3 125 ? 57.257 -5.374  -117.900 1.00 13.91  ? 125  VAL A CA    1 
ATOM   1412 C  C     . VAL C 3 125 ? 58.069 -4.176  -117.424 1.00 12.90  ? 125  VAL A C     1 
ATOM   1413 O  O     . VAL C 3 125 ? 58.957 -3.644  -118.148 1.00 14.88  ? 125  VAL A O     1 
ATOM   1414 C  CB    A VAL C 3 125 ? 58.007 -6.713  -117.766 0.44 14.86  ? 125  VAL A CB    1 
ATOM   1415 C  CB    B VAL C 3 125 ? 57.967 -6.660  -117.441 0.56 14.90  ? 125  VAL A CB    1 
ATOM   1416 C  CG1   A VAL C 3 125 ? 59.474 -6.645  -118.187 0.44 13.60  ? 125  VAL A CG1   1 
ATOM   1417 C  CG1   B VAL C 3 125 ? 56.902 -7.733  -117.452 0.56 16.66  ? 125  VAL A CG1   1 
ATOM   1418 C  CG2   A VAL C 3 125 ? 58.009 -7.231  -116.354 0.44 14.29  ? 125  VAL A CG2   1 
ATOM   1419 C  CG2   B VAL C 3 125 ? 59.168 -7.059  -118.281 0.56 15.73  ? 125  VAL A CG2   1 
ATOM   1420 N  N     . GLY C 3 126 ? 57.804 -3.758  -116.197 1.00 12.38  ? 126  GLY A N     1 
ATOM   1421 C  CA    . GLY C 3 126 ? 58.634 -2.731  -115.554 1.00 11.90  ? 126  GLY A CA    1 
ATOM   1422 C  C     . GLY C 3 126 ? 59.850 -3.309  -114.831 1.00 10.75  ? 126  GLY A C     1 
ATOM   1423 O  O     . GLY C 3 126 ? 60.119 -4.505  -114.956 1.00 12.53  ? 126  GLY A O     1 
ATOM   1424 N  N     . PRO C 3 127 ? 60.529 -2.475  -114.078 1.00 10.90  ? 127  PRO A N     1 
ATOM   1425 C  CA    . PRO C 3 127 ? 61.701 -2.922  -113.308 1.00 11.48  ? 127  PRO A CA    1 
ATOM   1426 C  C     . PRO C 3 127 ? 61.279 -4.018  -112.329 1.00 10.38  ? 127  PRO A C     1 
ATOM   1427 O  O     . PRO C 3 127 ? 60.147 -4.017  -111.814 1.00 11.30  ? 127  PRO A O     1 
ATOM   1428 C  CB    . PRO C 3 127 ? 62.071 -1.619  -112.546 1.00 15.32  ? 127  PRO A CB    1 
ATOM   1429 C  CG    . PRO C 3 127 ? 61.539 -0.486  -113.336 1.00 17.07  ? 127  PRO A CG    1 
ATOM   1430 C  CD    . PRO C 3 127 ? 60.232 -1.022  -113.906 1.00 13.42  ? 127  PRO A CD    1 
ATOM   1431 N  N     . ASP C 3 128 ? 62.183 -4.932  -112.057 1.00 10.73  ? 128  ASP A N     1 
ATOM   1432 C  CA    . ASP C 3 128 ? 61.942 -6.067  -111.213 1.00 10.57  ? 128  ASP A CA    1 
ATOM   1433 C  C     . ASP C 3 128 ? 62.270 -5.755  -109.764 1.00 10.34  ? 128  ASP A C     1 
ATOM   1434 O  O     . ASP C 3 128 ? 63.363 -5.275  -109.433 1.00 11.10  ? 128  ASP A O     1 
ATOM   1435 C  CB    . ASP C 3 128 ? 62.803 -7.221  -111.750 1.00 11.79  ? 128  ASP A CB    1 
ATOM   1436 C  CG    . ASP C 3 128 ? 62.601 -8.585  -111.142 1.00 12.38  ? 128  ASP A CG    1 
ATOM   1437 O  OD1   . ASP C 3 128 ? 62.274 -8.633  -109.926 1.00 12.55  ? 128  ASP A OD1   1 
ATOM   1438 O  OD2   . ASP C 3 128 ? 62.748 -9.612  -111.858 1.00 12.42  ? 128  ASP A OD2   1 
ATOM   1439 N  N     . VAL C 3 129 ? 61.317 -6.057  -108.853 1.00 10.26  ? 129  VAL A N     1 
ATOM   1440 C  CA    . VAL C 3 129 ? 61.531 -5.740  -107.428 1.00 10.86  ? 129  VAL A CA    1 
ATOM   1441 C  C     . VAL C 3 129 ? 62.743 -6.442  -106.856 1.00 11.10  ? 129  VAL A C     1 
ATOM   1442 O  O     . VAL C 3 129 ? 63.285 -5.995  -105.838 1.00 12.64  ? 129  VAL A O     1 
ATOM   1443 C  CB    . VAL C 3 129 ? 60.251 -6.079  -106.595 1.00 11.16  ? 129  VAL A CB    1 
ATOM   1444 C  CG1   . VAL C 3 129 ? 59.143 -5.133  -107.032 1.00 12.93  ? 129  VAL A CG1   1 
ATOM   1445 C  CG2   . VAL C 3 129 ? 59.858 -7.544  -106.643 1.00 12.82  ? 129  VAL A CG2   1 
ATOM   1446 N  N     . LEU C 3 130 ? 63.146 -7.600  -107.459 1.00 11.44  ? 130  LEU A N     1 
ATOM   1447 C  CA    . LEU C 3 130 ? 64.318 -8.299  -106.952 1.00 11.59  ? 130  LEU A CA    1 
ATOM   1448 C  C     . LEU C 3 130 ? 65.602 -7.834  -107.596 1.00 12.82  ? 130  LEU A C     1 
ATOM   1449 O  O     . LEU C 3 130 ? 66.692 -8.352  -107.238 1.00 17.19  ? 130  LEU A O     1 
ATOM   1450 C  CB    . LEU C 3 130 ? 64.178 -9.805  -107.162 1.00 11.83  ? 130  LEU A CB    1 
ATOM   1451 C  CG    . LEU C 3 130 ? 62.944 -10.422 -106.463 1.00 11.59  ? 130  LEU A CG    1 
ATOM   1452 C  CD1   . LEU C 3 130 ? 62.907 -11.935 -106.673 1.00 14.57  ? 130  LEU A CD1   1 
ATOM   1453 C  CD2   . LEU C 3 130 ? 62.911 -10.149 -104.970 1.00 13.70  ? 130  LEU A CD2   1 
ATOM   1454 N  N     . ASP C 3 131 ? 65.588 -6.873  -108.511 1.00 12.70  ? 131  ASP A N     1 
ATOM   1455 C  CA    . ASP C 3 131 ? 66.820 -6.353  -109.122 1.00 13.82  ? 131  ASP A CA    1 
ATOM   1456 C  C     . ASP C 3 131 ? 67.555 -5.512  -108.127 1.00 13.50  ? 131  ASP A C     1 
ATOM   1457 O  O     . ASP C 3 131 ? 67.027 -4.477  -107.719 1.00 15.42  ? 131  ASP A O     1 
ATOM   1458 C  CB    . ASP C 3 131 ? 66.421 -5.529  -110.353 1.00 13.71  ? 131  ASP A CB    1 
ATOM   1459 C  CG    . ASP C 3 131 ? 67.567 -4.886  -111.071 1.00 15.06  ? 131  ASP A CG    1 
ATOM   1460 O  OD1   . ASP C 3 131 ? 68.721 -4.917  -110.594 1.00 15.29  ? 131  ASP A OD1   1 
ATOM   1461 O  OD2   . ASP C 3 131 ? 67.320 -4.326  -112.163 1.00 18.84  ? 131  ASP A OD2   1 
ATOM   1462 N  N     . PRO C 3 132 ? 68.743 -5.862  -107.678 1.00 15.95  ? 132  PRO A N     1 
ATOM   1463 C  CA    . PRO C 3 132 ? 69.407 -5.113  -106.612 1.00 19.45  ? 132  PRO A CA    1 
ATOM   1464 C  C     . PRO C 3 132 ? 69.756 -3.712  -107.108 1.00 19.34  ? 132  PRO A C     1 
ATOM   1465 O  O     . PRO C 3 132 ? 70.017 -2.869  -106.211 1.00 24.66  ? 132  PRO A O     1 
ATOM   1466 C  CB    . PRO C 3 132 ? 70.708 -5.893  -106.336 1.00 22.86  ? 132  PRO A CB    1 
ATOM   1467 C  CG    . PRO C 3 132 ? 70.921 -6.695  -107.562 1.00 25.17  ? 132  PRO A CG    1 
ATOM   1468 C  CD    . PRO C 3 132 ? 69.560 -7.000  -108.154 1.00 21.50  ? 132  PRO A CD    1 
ATOM   1469 N  N     . ASN C 3 133 ? 69.799 -3.467  -108.405 1.00 17.71  ? 133  ASN A N     1 
ATOM   1470 C  CA    . ASN C 3 133 ? 70.050 -2.102  -108.891 1.00 20.37  ? 133  ASN A CA    1 
ATOM   1471 C  C     . ASN C 3 133 ? 68.832 -1.168  -108.737 1.00 18.06  ? 133  ASN A C     1 
ATOM   1472 O  O     . ASN C 3 133 ? 69.010 0.046   -108.852 1.00 21.48  ? 133  ASN A O     1 
ATOM   1473 C  CB    . ASN C 3 133 ? 70.421 -2.111  -110.366 1.00 25.15  ? 133  ASN A CB    1 
ATOM   1474 C  CG    . ASN C 3 133 ? 71.809 -2.607  -110.665 1.00 34.14  ? 133  ASN A CG    1 
ATOM   1475 O  OD1   . ASN C 3 133 ? 72.656 -2.529  -109.762 1.00 40.79  ? 133  ASN A OD1   1 
ATOM   1476 N  ND2   . ASN C 3 133 ? 72.062 -3.104  -111.878 1.00 50.38  ? 133  ASN A ND2   1 
ATOM   1477 N  N     . LEU C 3 134 ? 67.622 -1.733  -108.487 1.00 16.24  ? 134  LEU A N     1 
ATOM   1478 C  CA    . LEU C 3 134 ? 66.445 -0.903  -108.292 1.00 14.61  ? 134  LEU A CA    1 
ATOM   1479 C  C     . LEU C 3 134 ? 66.397 -0.427  -106.837 1.00 12.90  ? 134  LEU A C     1 
ATOM   1480 O  O     . LEU C 3 134 ? 66.498 -1.266  -105.941 1.00 14.64  ? 134  LEU A O     1 
ATOM   1481 C  CB    . LEU C 3 134 ? 65.197 -1.725  -108.630 1.00 14.01  ? 134  LEU A CB    1 
ATOM   1482 C  CG    . LEU C 3 134 ? 63.872 -0.971  -108.428 1.00 12.59  ? 134  LEU A CG    1 
ATOM   1483 C  CD1   . LEU C 3 134 ? 63.777 0.270   -109.278 1.00 15.24  ? 134  LEU A CD1   1 
ATOM   1484 C  CD2   . LEU C 3 134 ? 62.738 -1.943  -108.707 1.00 14.02  ? 134  LEU A CD2   1 
ATOM   1485 N  N     . THR C 3 135 ? 66.307 0.902   -106.634 1.00 12.77  ? 135  THR A N     1 
ATOM   1486 C  CA    . THR C 3 135 ? 66.395 1.472   -105.301 1.00 12.98  ? 135  THR A CA    1 
ATOM   1487 C  C     . THR C 3 135 ? 65.059 2.030   -104.858 1.00 12.11  ? 135  THR A C     1 
ATOM   1488 O  O     . THR C 3 135 ? 64.179 2.355   -105.681 1.00 11.47  ? 135  THR A O     1 
ATOM   1489 C  CB    . THR C 3 135 ? 67.416 2.650   -105.247 1.00 14.52  ? 135  THR A CB    1 
ATOM   1490 O  OG1   . THR C 3 135 ? 66.895 3.665   -106.148 1.00 14.08  ? 135  THR A OG1   1 
ATOM   1491 C  CG2   . THR C 3 135 ? 68.817 2.146   -105.629 1.00 15.20  ? 135  THR A CG2   1 
ATOM   1492 N  N     . PRO C 3 136 ? 64.862 2.202   -103.544 1.00 12.66  ? 136  PRO A N     1 
ATOM   1493 C  CA    . PRO C 3 136 ? 63.642 2.863   -103.089 1.00 12.70  ? 136  PRO A CA    1 
ATOM   1494 C  C     . PRO C 3 136 ? 63.486 4.241   -103.702 1.00 11.59  ? 136  PRO A C     1 
ATOM   1495 O  O     . PRO C 3 136 ? 62.345 4.663   -103.986 1.00 12.31  ? 136  PRO A O     1 
ATOM   1496 C  CB    . PRO C 3 136 ? 63.814 2.930   -101.565 1.00 14.02  ? 136  PRO A CB    1 
ATOM   1497 C  CG    . PRO C 3 136 ? 64.751 1.820   -101.264 1.00 17.19  ? 136  PRO A CG    1 
ATOM   1498 C  CD    . PRO C 3 136 ? 65.701 1.690   -102.451 1.00 14.69  ? 136  PRO A CD    1 
ATOM   1499 N  N     . GLU C 3 137 ? 64.548 4.981   -103.937 1.00 12.32  ? 137  GLU A N     1 
ATOM   1500 C  CA    . GLU C 3 137 ? 64.426 6.350   -104.497 1.00 13.02  ? 137  GLU A CA    1 
ATOM   1501 C  C     . GLU C 3 137 ? 63.834 6.253   -105.903 1.00 12.48  ? 137  GLU A C     1 
ATOM   1502 O  O     . GLU C 3 137 ? 62.990 7.077   -106.316 1.00 12.60  ? 137  GLU A O     1 
ATOM   1503 C  CB    . GLU C 3 137 ? 65.806 7.030   -104.513 1.00 17.37  ? 137  GLU A CB    1 
ATOM   1504 C  CG    . GLU C 3 137 ? 66.313 7.325   -103.091 1.00 22.16  ? 137  GLU A CG    1 
ATOM   1505 C  CD    . GLU C 3 137 ? 67.026 6.210   -102.383 1.00 28.88  ? 137  GLU A CD    1 
ATOM   1506 O  OE1   . GLU C 3 137 ? 67.181 5.031   -102.798 1.00 25.14  ? 137  GLU A OE1   1 
ATOM   1507 O  OE2   . GLU C 3 137 ? 67.476 6.510   -101.238 1.00 40.69  ? 137  GLU A OE2   1 
ATOM   1508 N  N     . VAL C 3 138 ? 64.298 5.285   -106.712 1.00 12.08  ? 138  VAL A N     1 
ATOM   1509 C  CA    . VAL C 3 138 ? 63.752 5.134   -108.068 1.00 11.32  ? 138  VAL A CA    1 
ATOM   1510 C  C     . VAL C 3 138 ? 62.291 4.689   -108.000 1.00 10.50  ? 138  VAL A C     1 
ATOM   1511 O  O     . VAL C 3 138 ? 61.469 5.136   -108.835 1.00 11.47  ? 138  VAL A O     1 
ATOM   1512 C  CB    . VAL C 3 138 ? 64.643 4.206   -108.896 1.00 11.77  ? 138  VAL A CB    1 
ATOM   1513 C  CG1   . VAL C 3 138 ? 63.957 3.761   -110.196 1.00 12.69  ? 138  VAL A CG1   1 
ATOM   1514 C  CG2   . VAL C 3 138 ? 65.932 4.975   -109.164 1.00 15.27  ? 138  VAL A CG2   1 
ATOM   1515 N  N     . VAL C 3 139 ? 61.945 3.814   -107.040 1.00 10.71  ? 139  VAL A N     1 
ATOM   1516 C  CA    . VAL C 3 139 ? 60.532 3.425   -106.894 1.00 10.25  ? 139  VAL A CA    1 
ATOM   1517 C  C     . VAL C 3 139 ? 59.685 4.619   -106.496 1.00 10.01  ? 139  VAL A C     1 
ATOM   1518 O  O     . VAL C 3 139 ? 58.580 4.751   -107.000 1.00 10.51  ? 139  VAL A O     1 
ATOM   1519 C  CB    . VAL C 3 139 ? 60.417 2.283   -105.873 1.00 10.01  ? 139  VAL A CB    1 
ATOM   1520 C  CG1   . VAL C 3 139 ? 58.942 2.011   -105.562 1.00 10.49  ? 139  VAL A CG1   1 
ATOM   1521 C  CG2   . VAL C 3 139 ? 61.092 1.037   -106.425 1.00 11.09  ? 139  VAL A CG2   1 
ATOM   1522 N  N     . LYS C 3 140 ? 60.196 5.480   -105.599 1.00 10.99  ? 140  LYS A N     1 
ATOM   1523 C  CA    . LYS C 3 140 ? 59.426 6.683   -105.260 1.00 11.73  ? 140  LYS A CA    1 
ATOM   1524 C  C     . LYS C 3 140 ? 59.188 7.545   -106.487 1.00 11.47  ? 140  LYS A C     1 
ATOM   1525 O  O     . LYS C 3 140 ? 58.076 8.058   -106.674 1.00 11.92  ? 140  LYS A O     1 
ATOM   1526 C  CB    . LYS C 3 140 ? 60.162 7.502   -104.213 1.00 13.41  ? 140  LYS A CB    1 
ATOM   1527 C  CG    A LYS C 3 140 ? 59.369 8.631   -103.646 0.50 16.57  ? 140  LYS A CG    1 
ATOM   1528 C  CG    B LYS C 3 140 ? 60.311 6.976   -102.806 0.50 13.29  ? 140  LYS A CG    1 
ATOM   1529 C  CD    A LYS C 3 140 ? 60.132 9.297   -102.508 0.50 17.46  ? 140  LYS A CD    1 
ATOM   1530 C  CD    B LYS C 3 140 ? 61.369 7.627   -101.928 0.50 17.70  ? 140  LYS A CD    1 
ATOM   1531 C  CE    A LYS C 3 140 ? 60.382 8.326   -101.360 0.50 14.18  ? 140  LYS A CE    1 
ATOM   1532 C  CE    B LYS C 3 140 ? 60.977 8.978   -101.380 0.50 16.80  ? 140  LYS A CE    1 
ATOM   1533 N  NZ    A LYS C 3 140 ? 61.248 8.933   -100.296 0.50 15.63  ? 140  LYS A NZ    1 
ATOM   1534 N  NZ    B LYS C 3 140 ? 61.908 9.410   -100.295 0.50 17.20  ? 140  LYS A NZ    1 
ATOM   1535 N  N     . GLU C 3 141 ? 60.221 7.734   -107.318 1.00 10.91  ? 141  GLU A N     1 
ATOM   1536 C  CA    . GLU C 3 141 ? 60.057 8.502   -108.536 1.00 12.25  ? 141  GLU A CA    1 
ATOM   1537 C  C     . GLU C 3 141 ? 59.020 7.862   -109.425 1.00 11.22  ? 141  GLU A C     1 
ATOM   1538 O  O     . GLU C 3 141 ? 58.231 8.558   -110.074 1.00 11.72  ? 141  GLU A O     1 
ATOM   1539 C  CB    . GLU C 3 141 ? 61.420 8.597   -109.281 1.00 13.47  ? 141  GLU A CB    1 
ATOM   1540 C  CG    . GLU C 3 141 ? 62.373 9.500   -108.561 1.00 15.70  ? 141  GLU A CG    1 
ATOM   1541 C  CD    . GLU C 3 141 ? 63.798 9.502   -109.014 1.00 20.39  ? 141  GLU A CD    1 
ATOM   1542 O  OE1   . GLU C 3 141 ? 64.210 8.766   -109.959 1.00 22.42  ? 141  GLU A OE1   1 
ATOM   1543 O  OE2   . GLU C 3 141 ? 64.563 10.258  -108.394 1.00 28.95  ? 141  GLU A OE2   1 
ATOM   1544 N  N     . ARG C 3 142 ? 59.010 6.529   -109.493 1.00 10.83  ? 142  ARG A N     1 
ATOM   1545 C  CA    . ARG C 3 142 ? 58.087 5.822   -110.402 1.00 10.45  ? 142  ARG A CA    1 
ATOM   1546 C  C     . ARG C 3 142 ? 56.661 6.044   -109.883 1.00 10.45  ? 142  ARG A C     1 
ATOM   1547 O  O     . ARG C 3 142 ? 55.730 6.342   -110.630 1.00 10.80  ? 142  ARG A O     1 
ATOM   1548 C  CB    . ARG C 3 142 ? 58.497 4.363   -110.486 1.00 10.89  ? 142  ARG A CB    1 
ATOM   1549 C  CG    . ARG C 3 142 ? 57.817 3.591   -111.603 1.00 12.30  ? 142  ARG A CG    1 
ATOM   1550 C  CD    . ARG C 3 142 ? 58.486 2.200   -111.701 1.00 13.90  ? 142  ARG A CD    1 
ATOM   1551 N  NE    . ARG C 3 142 ? 57.919 1.495   -112.886 1.00 12.36  ? 142  ARG A NE    1 
ATOM   1552 C  CZ    . ARG C 3 142 ? 58.300 1.721   -114.148 1.00 11.06  ? 142  ARG A CZ    1 
ATOM   1553 N  NH1   . ARG C 3 142 ? 59.269 2.591   -114.449 1.00 12.23  ? 142  ARG A NH1   1 
ATOM   1554 N  NH2   . ARG C 3 142 ? 57.673 1.037   -115.121 1.00 12.21  ? 142  ARG A NH2   1 
ATOM   1555 N  N     . LEU C 3 143 ? 56.429 5.885   -108.565 1.00 10.30  ? 143  LEU A N     1 
ATOM   1556 C  CA    . LEU C 3 143 ? 55.125 6.163   -107.975 1.00 10.47  ? 143  LEU A CA    1 
ATOM   1557 C  C     . LEU C 3 143 ? 54.620 7.559   -108.289 1.00 10.57  ? 143  LEU A C     1 
ATOM   1558 O  O     . LEU C 3 143 ? 53.419 7.741   -108.555 1.00 11.54  ? 143  LEU A O     1 
ATOM   1559 C  CB    . LEU C 3 143 ? 55.205 5.976   -106.434 1.00 10.60  ? 143  LEU A CB    1 
ATOM   1560 C  CG    . LEU C 3 143 ? 55.218 4.514   -105.954 1.00 10.33  ? 143  LEU A CG    1 
ATOM   1561 C  CD1   . LEU C 3 143 ? 55.771 4.456   -104.505 1.00 12.00  ? 143  LEU A CD1   1 
ATOM   1562 C  CD2   . LEU C 3 143 ? 53.857 3.874   -106.027 1.00 11.33  ? 143  LEU A CD2   1 
ATOM   1563 N  N     . LEU C 3 144 ? 55.536 8.556   -108.206 1.00 10.89  ? 144  LEU A N     1 
ATOM   1564 C  CA    . LEU C 3 144 ? 55.130 9.972   -108.368 1.00 10.88  ? 144  LEU A CA    1 
ATOM   1565 C  C     . LEU C 3 144 ? 55.121 10.409  -109.811 1.00 11.23  ? 144  LEU A C     1 
ATOM   1566 O  O     . LEU C 3 144 ? 54.678 11.513  -110.144 1.00 13.33  ? 144  LEU A O     1 
ATOM   1567 C  CB    . LEU C 3 144 ? 56.031 10.884  -107.571 1.00 11.82  ? 144  LEU A CB    1 
ATOM   1568 C  CG    . LEU C 3 144 ? 55.843 10.769  -106.061 1.00 14.12  ? 144  LEU A CG    1 
ATOM   1569 C  CD1   . LEU C 3 144 ? 56.835 11.761  -105.458 1.00 22.04  ? 144  LEU A CD1   1 
ATOM   1570 C  CD2   . LEU C 3 144 ? 54.424 11.073  -105.602 1.00 15.98  ? 144  LEU A CD2   1 
ATOM   1571 N  N     . SER C 3 145 ? 55.597 9.556   -110.713 1.00 12.14  ? 145  SER A N     1 
ATOM   1572 C  CA    . SER C 3 145 ? 55.716 9.944   -112.124 1.00 12.53  ? 145  SER A CA    1 
ATOM   1573 C  C     . SER C 3 145 ? 54.326 10.191  -112.694 1.00 12.20  ? 145  SER A C     1 
ATOM   1574 O  O     . SER C 3 145 ? 53.318 9.613   -112.231 1.00 12.79  ? 145  SER A O     1 
ATOM   1575 C  CB    . SER C 3 145 ? 56.396 8.819   -112.894 1.00 12.64  ? 145  SER A CB    1 
ATOM   1576 O  OG    . SER C 3 145 ? 55.608 7.634   -113.001 1.00 12.61  ? 145  SER A OG    1 
ATOM   1577 N  N     . PRO C 3 146 ? 54.202 11.004  -113.705 1.00 13.90  ? 146  PRO A N     1 
ATOM   1578 C  CA    . PRO C 3 146 ? 52.869 11.215  -114.340 1.00 15.60  ? 146  PRO A CA    1 
ATOM   1579 C  C     . PRO C 3 146 ? 52.200 9.928   -114.736 1.00 14.71  ? 146  PRO A C     1 
ATOM   1580 O  O     . PRO C 3 146 ? 50.969 9.739   -114.662 1.00 16.92  ? 146  PRO A O     1 
ATOM   1581 C  CB    . PRO C 3 146 ? 53.207 12.092  -115.540 1.00 19.95  ? 146  PRO A CB    1 
ATOM   1582 C  CG    . PRO C 3 146 ? 54.343 12.921  -114.979 1.00 22.52  ? 146  PRO A CG    1 
ATOM   1583 C  CD    . PRO C 3 146 ? 55.213 11.893  -114.326 1.00 16.81  ? 146  PRO A CD    1 
ATOM   1584 N  N     . ARG C 3 147 ? 53.003 8.946   -115.196 1.00 14.35  ? 147  ARG A N     1 
ATOM   1585 C  CA    . ARG C 3 147 ? 52.409 7.722   -115.672 1.00 13.80  ? 147  ARG A CA    1 
ATOM   1586 C  C     . ARG C 3 147 ? 51.673 6.942   -114.582 1.00 14.11  ? 147  ARG A C     1 
ATOM   1587 O  O     . ARG C 3 147 ? 50.671 6.309   -114.854 1.00 16.21  ? 147  ARG A O     1 
ATOM   1588 C  CB    . ARG C 3 147 ? 53.560 6.883   -116.268 1.00 15.74  ? 147  ARG A CB    1 
ATOM   1589 C  CG    . ARG C 3 147 ? 53.035 5.532   -116.776 1.00 14.94  ? 147  ARG A CG    1 
ATOM   1590 C  CD    . ARG C 3 147 ? 54.192 4.824   -117.461 1.00 14.30  ? 147  ARG A CD    1 
ATOM   1591 N  NE    . ARG C 3 147 ? 53.817 3.536   -117.957 1.00 13.66  ? 147  ARG A NE    1 
ATOM   1592 C  CZ    . ARG C 3 147 ? 54.651 2.528   -118.184 1.00 12.89  ? 147  ARG A CZ    1 
ATOM   1593 N  NH1   . ARG C 3 147 ? 55.932 2.710   -117.964 1.00 14.24  ? 147  ARG A NH1   1 
ATOM   1594 N  NH2   . ARG C 3 147 ? 54.220 1.345   -118.638 1.00 15.26  ? 147  ARG A NH2   1 
ATOM   1595 N  N     . PHE C 3 148 ? 52.153 6.982   -113.316 1.00 12.33  ? 148  PHE A N     1 
ATOM   1596 C  CA    . PHE C 3 148 ? 51.581 6.109   -112.289 1.00 12.15  ? 148  PHE A CA    1 
ATOM   1597 C  C     . PHE C 3 148 ? 50.967 6.843   -111.112 1.00 11.93  ? 148  PHE A C     1 
ATOM   1598 O  O     . PHE C 3 148 ? 50.255 6.189   -110.334 1.00 12.64  ? 148  PHE A O     1 
ATOM   1599 C  CB    . PHE C 3 148 ? 52.641 5.113   -111.733 1.00 11.91  ? 148  PHE A CB    1 
ATOM   1600 C  CG    . PHE C 3 148 ? 53.155 4.175   -112.786 1.00 10.78  ? 148  PHE A CG    1 
ATOM   1601 C  CD1   . PHE C 3 148 ? 52.291 3.241   -113.375 1.00 11.65  ? 148  PHE A CD1   1 
ATOM   1602 C  CD2   . PHE C 3 148 ? 54.490 4.227   -113.201 1.00 11.61  ? 148  PHE A CD2   1 
ATOM   1603 C  CE1   . PHE C 3 148 ? 52.801 2.355   -114.345 1.00 11.70  ? 148  PHE A CE1   1 
ATOM   1604 C  CE2   . PHE C 3 148 ? 54.967 3.334   -114.169 1.00 11.16  ? 148  PHE A CE2   1 
ATOM   1605 C  CZ    . PHE C 3 148 ? 54.135 2.385   -114.713 1.00 11.39  ? 148  PHE A CZ    1 
ATOM   1606 N  N     . ARG C 3 149 ? 51.157 8.158   -110.965 1.00 12.37  ? 149  ARG A N     1 
ATOM   1607 C  CA    . ARG C 3 149 ? 50.748 8.841   -109.714 1.00 12.48  ? 149  ARG A CA    1 
ATOM   1608 C  C     . ARG C 3 149 ? 49.235 8.884   -109.520 1.00 12.87  ? 149  ARG A C     1 
ATOM   1609 O  O     . ARG C 3 149 ? 48.825 9.145   -108.367 1.00 13.03  ? 149  ARG A O     1 
ATOM   1610 C  CB    . ARG C 3 149 ? 51.299 10.262  -109.731 1.00 13.10  ? 149  ARG A CB    1 
ATOM   1611 C  CG    . ARG C 3 149 ? 50.671 11.170  -110.806 1.00 15.04  ? 149  ARG A CG    1 
ATOM   1612 C  CD    . ARG C 3 149 ? 51.467 12.502  -110.862 1.00 17.98  ? 149  ARG A CD    1 
ATOM   1613 N  NE    . ARG C 3 149 ? 51.096 13.387  -109.782 1.00 20.96  ? 149  ARG A NE    1 
ATOM   1614 C  CZ    . ARG C 3 149 ? 51.804 13.736  -108.707 1.00 22.39  ? 149  ARG A CZ    1 
ATOM   1615 N  NH1   . ARG C 3 149 ? 53.024 13.233  -108.491 1.00 21.34  ? 149  ARG A NH1   1 
ATOM   1616 N  NH2   . ARG C 3 149 ? 51.304 14.585  -107.795 1.00 28.35  ? 149  ARG A NH2   1 
ATOM   1617 N  N     . ASN C 3 150 ? 48.476 8.674   -110.595 1.00 13.31  ? 150  ASN A N     1 
ATOM   1618 C  CA    . ASN C 3 150 ? 46.999 8.694   -110.493 1.00 13.25  ? 150  ASN A CA    1 
ATOM   1619 C  C     . ASN C 3 150 ? 46.384 7.310   -110.503 1.00 13.41  ? 150  ASN A C     1 
ATOM   1620 O  O     . ASN C 3 150 ? 45.162 7.174   -110.633 1.00 16.12  ? 150  ASN A O     1 
ATOM   1621 C  CB    . ASN C 3 150 ? 46.456 9.570   -111.601 1.00 15.72  ? 150  ASN A CB    1 
ATOM   1622 C  CG    . ASN C 3 150 ? 44.979 9.875   -111.426 1.00 17.44  ? 150  ASN A CG    1 
ATOM   1623 O  OD1   . ASN C 3 150 ? 44.564 10.238  -110.308 1.00 25.83  ? 150  ASN A OD1   1 
ATOM   1624 N  ND2   . ASN C 3 150 ? 44.206 9.787   -112.492 1.00 22.87  ? 150  ASN A ND2   1 
ATOM   1625 N  N     . ARG C 3 151 ? 47.218 6.269   -110.390 1.00 13.21  ? 151  ARG A N     1 
ATOM   1626 C  CA    . ARG C 3 151 ? 46.706 4.892   -110.450 1.00 13.27  ? 151  ARG A CA    1 
ATOM   1627 C  C     . ARG C 3 151 ? 46.354 4.401   -109.056 1.00 13.19  ? 151  ARG A C     1 
ATOM   1628 O  O     . ARG C 3 151 ? 47.118 4.465   -108.109 1.00 13.74  ? 151  ARG A O     1 
ATOM   1629 C  CB    . ARG C 3 151 ? 47.817 3.957   -110.995 1.00 13.87  ? 151  ARG A CB    1 
ATOM   1630 C  CG    . ARG C 3 151 ? 48.107 4.176   -112.454 1.00 14.20  ? 151  ARG A CG    1 
ATOM   1631 C  CD    . ARG C 3 151 ? 47.082 3.524   -113.376 1.00 15.12  ? 151  ARG A CD    1 
ATOM   1632 N  NE    . ARG C 3 151 ? 47.015 2.075   -113.146 1.00 15.03  ? 151  ARG A NE    1 
ATOM   1633 C  CZ    . ARG C 3 151 ? 47.866 1.189   -113.720 1.00 15.21  ? 151  ARG A CZ    1 
ATOM   1634 N  NH1   . ARG C 3 151 ? 48.829 1.579   -114.561 1.00 18.98  ? 151  ARG A NH1   1 
ATOM   1635 N  NH2   . ARG C 3 151 ? 47.712 -0.087  -113.427 1.00 18.18  ? 151  ARG A NH2   1 
ATOM   1636 N  N     . GLN C 3 152 ? 45.191 3.834   -108.926 1.00 14.25  ? 152  GLN A N     1 
ATOM   1637 C  CA    . GLN C 3 152 ? 44.815 3.193   -107.659 1.00 13.74  ? 152  GLN A CA    1 
ATOM   1638 C  C     . GLN C 3 152 ? 45.689 1.979   -107.351 1.00 12.60  ? 152  GLN A C     1 
ATOM   1639 O  O     . GLN C 3 152 ? 45.991 1.148   -108.233 1.00 12.40  ? 152  GLN A O     1 
ATOM   1640 C  CB    . GLN C 3 152 ? 43.344 2.820   -107.859 1.00 20.11  ? 152  GLN A CB    1 
ATOM   1641 C  CG    . GLN C 3 152 ? 42.619 2.316   -106.691 1.00 28.04  ? 152  GLN A CG    1 
ATOM   1642 C  CD    . GLN C 3 152 ? 41.189 1.920   -106.984 1.00 34.88  ? 152  GLN A CD    1 
ATOM   1643 O  OE1   . GLN C 3 152 ? 40.832 0.980   -107.724 1.00 32.74  ? 152  GLN A OE1   1 
ATOM   1644 N  NE2   . GLN C 3 152 ? 40.291 2.638   -106.325 1.00 28.81  ? 152  GLN A NE2   1 
ATOM   1645 N  N     . PHE C 3 153 ? 46.107 1.845   -106.098 1.00 12.70  ? 153  PHE A N     1 
ATOM   1646 C  CA    . PHE C 3 153 ? 47.026 0.773   -105.718 1.00 12.97  ? 153  PHE A CA    1 
ATOM   1647 C  C     . PHE C 3 153 ? 46.463 -0.633  -105.913 1.00 12.00  ? 153  PHE A C     1 
ATOM   1648 O  O     . PHE C 3 153 ? 47.255 -1.541  -106.199 1.00 12.61  ? 153  PHE A O     1 
ATOM   1649 C  CB    . PHE C 3 153 ? 47.468 0.907   -104.246 1.00 13.45  ? 153  PHE A CB    1 
ATOM   1650 C  CG    . PHE C 3 153 ? 48.280 2.193   -104.003 1.00 12.35  ? 153  PHE A CG    1 
ATOM   1651 C  CD1   . PHE C 3 153 ? 49.006 2.813   -104.988 1.00 12.65  ? 153  PHE A CD1   1 
ATOM   1652 C  CD2   . PHE C 3 153 ? 48.291 2.715   -102.718 1.00 11.75  ? 153  PHE A CD2   1 
ATOM   1653 C  CE1   . PHE C 3 153 ? 49.751 3.938   -104.709 1.00 13.54  ? 153  PHE A CE1   1 
ATOM   1654 C  CE2   . PHE C 3 153 ? 49.005 3.865   -102.479 1.00 12.23  ? 153  PHE A CE2   1 
ATOM   1655 C  CZ    . PHE C 3 153 ? 49.729 4.528   -103.457 1.00 12.53  ? 153  PHE A CZ    1 
ATOM   1656 N  N     . ALA C 3 154 ? 45.140 -0.794  -105.734 1.00 13.08  ? 154  ALA A N     1 
ATOM   1657 C  CA    . ALA C 3 154 ? 44.522 -2.100  -105.900 1.00 12.94  ? 154  ALA A CA    1 
ATOM   1658 C  C     . ALA C 3 154 ? 44.992 -2.762  -107.178 1.00 12.71  ? 154  ALA A C     1 
ATOM   1659 O  O     . ALA C 3 154 ? 45.469 -3.893  -107.174 1.00 13.56  ? 154  ALA A O     1 
ATOM   1660 C  CB    . ALA C 3 154 ? 43.005 -1.924  -105.949 1.00 15.15  ? 154  ALA A CB    1 
ATOM   1661 N  N     . GLY C 3 155 ? 44.900 -2.051  -108.313 1.00 12.24  ? 155  GLY A N     1 
ATOM   1662 C  CA    . GLY C 3 155 ? 45.349 -2.670  -109.575 1.00 12.71  ? 155  GLY A CA    1 
ATOM   1663 C  C     . GLY C 3 155 ? 46.798 -2.389  -109.856 1.00 12.67  ? 155  GLY A C     1 
ATOM   1664 O  O     . GLY C 3 155 ? 47.462 -3.193  -110.515 1.00 12.98  ? 155  GLY A O     1 
ATOM   1665 N  N     . LEU C 3 156 ? 47.336 -1.254  -109.384 1.00 11.87  ? 156  LEU A N     1 
ATOM   1666 C  CA    . LEU C 3 156 ? 48.716 -0.931  -109.707 1.00 11.75  ? 156  LEU A CA    1 
ATOM   1667 C  C     . LEU C 3 156 ? 49.659 -2.034  -109.225 1.00 11.72  ? 156  LEU A C     1 
ATOM   1668 O  O     . LEU C 3 156 ? 50.596 -2.412  -109.948 1.00 11.82  ? 156  LEU A O     1 
ATOM   1669 C  CB    . LEU C 3 156 ? 49.103 0.409   -109.090 1.00 11.67  ? 156  LEU A CB    1 
ATOM   1670 C  CG    . LEU C 3 156 ? 50.524 0.905   -109.429 1.00 10.77  ? 156  LEU A CG    1 
ATOM   1671 C  CD1   . LEU C 3 156 ? 50.638 1.295   -110.896 1.00 13.09  ? 156  LEU A CD1   1 
ATOM   1672 C  CD2   . LEU C 3 156 ? 50.913 2.080   -108.548 1.00 13.01  ? 156  LEU A CD2   1 
ATOM   1673 N  N     . LEU C 3 157 ? 49.449 -2.545  -108.015 1.00 11.46  ? 157  LEU A N     1 
ATOM   1674 C  CA    . LEU C 3 157 ? 50.376 -3.513  -107.415 1.00 11.55  ? 157  LEU A CA    1 
ATOM   1675 C  C     . LEU C 3 157 ? 50.192 -4.918  -107.988 1.00 11.77  ? 157  LEU A C     1 
ATOM   1676 O  O     . LEU C 3 157 ? 50.949 -5.814  -107.618 1.00 14.21  ? 157  LEU A O     1 
ATOM   1677 C  CB    . LEU C 3 157 ? 50.212 -3.514  -105.901 1.00 11.67  ? 157  LEU A CB    1 
ATOM   1678 C  CG    . LEU C 3 157 ? 51.032 -2.470  -105.136 1.00 14.01  ? 157  LEU A CG    1 
ATOM   1679 C  CD1   . LEU C 3 157 ? 51.010 -1.087  -105.667 1.00 18.92  ? 157  LEU A CD1   1 
ATOM   1680 C  CD2   . LEU C 3 157 ? 50.744 -2.541  -103.621 1.00 16.35  ? 157  LEU A CD2   1 
ATOM   1681 N  N     . LEU C 3 158 ? 49.279 -5.118  -108.934 1.00 10.84  ? 158  LEU A N     1 
ATOM   1682 C  CA    . LEU C 3 158 ? 49.227 -6.345  -109.723 1.00 11.03  ? 158  LEU A CA    1 
ATOM   1683 C  C     . LEU C 3 158 ? 49.755 -6.122  -111.145 1.00 10.69  ? 158  LEU A C     1 
ATOM   1684 O  O     . LEU C 3 158 ? 49.943 -7.107  -111.888 1.00 11.97  ? 158  LEU A O     1 
ATOM   1685 C  CB    . LEU C 3 158 ? 47.791 -6.879  -109.822 1.00 13.34  ? 158  LEU A CB    1 
ATOM   1686 C  CG    . LEU C 3 158 ? 47.154 -7.196  -108.445 1.00 13.94  ? 158  LEU A CG    1 
ATOM   1687 C  CD1   . LEU C 3 158 ? 45.727 -7.696  -108.713 1.00 16.40  ? 158  LEU A CD1   1 
ATOM   1688 C  CD2   . LEU C 3 158 ? 47.954 -8.187  -107.637 1.00 15.92  ? 158  LEU A CD2   1 
ATOM   1689 N  N     . ASP C 3 159 ? 49.951 -4.859  -111.531 1.00 12.14  ? 159  ASP A N     1 
ATOM   1690 C  CA    . ASP C 3 159 ? 50.288 -4.560  -112.933 1.00 11.94  ? 159  ASP A CA    1 
ATOM   1691 C  C     . ASP C 3 159 ? 51.766 -4.701  -113.162 1.00 11.26  ? 159  ASP A C     1 
ATOM   1692 O  O     . ASP C 3 159 ? 52.579 -3.946  -112.588 1.00 11.65  ? 159  ASP A O     1 
ATOM   1693 C  CB    . ASP C 3 159 ? 49.860 -3.105  -113.232 1.00 13.54  ? 159  ASP A CB    1 
ATOM   1694 C  CG    . ASP C 3 159 ? 49.959 -2.763  -114.700 1.00 15.04  ? 159  ASP A CG    1 
ATOM   1695 O  OD1   . ASP C 3 159 ? 50.678 -3.441  -115.467 1.00 15.13  ? 159  ASP A OD1   1 
ATOM   1696 O  OD2   . ASP C 3 159 ? 49.326 -1.745  -115.115 1.00 20.04  ? 159  ASP A OD2   1 
ATOM   1697 N  N     . GLN C 3 160 ? 52.209 -5.668  -113.960 1.00 10.77  ? 160  GLN A N     1 
ATOM   1698 C  CA    . GLN C 3 160 ? 53.639 -5.939  -114.105 1.00 10.60  ? 160  GLN A CA    1 
ATOM   1699 C  C     . GLN C 3 160 ? 54.359 -4.846  -114.874 1.00 10.60  ? 160  GLN A C     1 
ATOM   1700 O  O     . GLN C 3 160 ? 55.605 -4.816  -114.841 1.00 11.94  ? 160  GLN A O     1 
ATOM   1701 C  CB    . GLN C 3 160 ? 53.841 -7.293  -114.820 1.00 11.33  ? 160  GLN A CB    1 
ATOM   1702 C  CG    . GLN C 3 160 ? 53.129 -8.441  -114.041 1.00 11.37  ? 160  GLN A CG    1 
ATOM   1703 C  CD    . GLN C 3 160 ? 53.594 -8.491  -112.606 1.00 10.93  ? 160  GLN A CD    1 
ATOM   1704 O  OE1   . GLN C 3 160 ? 54.718 -8.924  -112.334 1.00 11.88  ? 160  GLN A OE1   1 
ATOM   1705 N  NE2   . GLN C 3 160 ? 52.754 -8.038  -111.675 1.00 10.95  ? 160  GLN A NE2   1 
ATOM   1706 N  N     . ALA C 3 161 ? 53.599 -3.934  -115.531 1.00 11.56  ? 161  ALA A N     1 
ATOM   1707 C  CA    . ALA C 3 161 ? 54.259 -2.776  -116.151 1.00 11.37  ? 161  ALA A CA    1 
ATOM   1708 C  C     . ALA C 3 161 ? 54.729 -1.744  -115.133 1.00 10.10  ? 161  ALA A C     1 
ATOM   1709 O  O     . ALA C 3 161 ? 55.544 -0.867  -115.457 1.00 11.69  ? 161  ALA A O     1 
ATOM   1710 C  CB    . ALA C 3 161 ? 53.282 -2.077  -117.084 1.00 12.24  ? 161  ALA A CB    1 
ATOM   1711 N  N     . PHE C 3 162 ? 54.167 -1.802  -113.916 1.00 10.25  ? 162  PHE A N     1 
ATOM   1712 C  CA    . PHE C 3 162 ? 54.618 -0.949  -112.830 1.00 10.87  ? 162  PHE A CA    1 
ATOM   1713 C  C     . PHE C 3 162 ? 55.862 -1.558  -112.224 1.00 10.64  ? 162  PHE A C     1 
ATOM   1714 O  O     . PHE C 3 162 ? 56.979 -1.086  -112.485 1.00 11.80  ? 162  PHE A O     1 
ATOM   1715 C  CB    . PHE C 3 162 ? 53.482 -0.722  -111.810 1.00 10.66  ? 162  PHE A CB    1 
ATOM   1716 C  CG    . PHE C 3 162 ? 53.995 0.071   -110.589 1.00 10.65  ? 162  PHE A CG    1 
ATOM   1717 C  CD1   . PHE C 3 162 ? 54.576 1.314   -110.678 1.00 11.98  ? 162  PHE A CD1   1 
ATOM   1718 C  CD2   . PHE C 3 162 ? 53.881 -0.521  -109.314 1.00 10.75  ? 162  PHE A CD2   1 
ATOM   1719 C  CE1   . PHE C 3 162 ? 55.050 2.011   -109.554 1.00 11.30  ? 162  PHE A CE1   1 
ATOM   1720 C  CE2   . PHE C 3 162 ? 54.343 0.128   -108.183 1.00 11.44  ? 162  PHE A CE2   1 
ATOM   1721 C  CZ    . PHE C 3 162 ? 54.947 1.380   -108.323 1.00 11.98  ? 162  PHE A CZ    1 
ATOM   1722 N  N     . LEU C 3 163 ? 55.733 -2.618  -111.416 1.00 10.58  ? 163  LEU A N     1 
ATOM   1723 C  CA    . LEU C 3 163 ? 56.885 -3.321  -110.855 1.00 11.02  ? 163  LEU A CA    1 
ATOM   1724 C  C     . LEU C 3 163 ? 56.718 -4.812  -111.121 1.00 11.37  ? 163  LEU A C     1 
ATOM   1725 O  O     . LEU C 3 163 ? 55.708 -5.451  -110.717 1.00 13.32  ? 163  LEU A O     1 
ATOM   1726 C  CB    . LEU C 3 163 ? 57.051 -3.089  -109.340 1.00 10.91  ? 163  LEU A CB    1 
ATOM   1727 C  CG    . LEU C 3 163 ? 57.466 -1.643  -109.013 1.00 10.18  ? 163  LEU A CG    1 
ATOM   1728 C  CD1   . LEU C 3 163 ? 57.490 -1.477  -107.498 1.00 12.23  ? 163  LEU A CD1   1 
ATOM   1729 C  CD2   . LEU C 3 163 ? 58.851 -1.274  -109.527 1.00 11.76  ? 163  LEU A CD2   1 
ATOM   1730 N  N     . ALA C 3 164 ? 57.699 -5.391  -111.762 1.00 11.20  ? 164  ALA A N     1 
ATOM   1731 C  CA    . ALA C 3 164 ? 57.595 -6.822  -112.066 1.00 10.85  ? 164  ALA A CA    1 
ATOM   1732 C  C     . ALA C 3 164 ? 57.884 -7.685  -110.855 1.00 10.83  ? 164  ALA A C     1 
ATOM   1733 O  O     . ALA C 3 164 ? 58.866 -7.479  -110.145 1.00 11.41  ? 164  ALA A O     1 
ATOM   1734 C  CB    . ALA C 3 164 ? 58.622 -7.171  -113.151 1.00 12.56  ? 164  ALA A CB    1 
ATOM   1735 N  N     . GLY C 3 165 ? 57.034 -8.696  -110.665 1.00 9.68   ? 165  GLY A N     1 
ATOM   1736 C  CA    . GLY C 3 165 ? 57.214 -9.701  -109.646 1.00 10.40  ? 165  GLY A CA    1 
ATOM   1737 C  C     . GLY C 3 165 ? 56.189 -9.595  -108.521 1.00 10.23  ? 165  GLY A C     1 
ATOM   1738 O  O     . GLY C 3 165 ? 56.012 -10.574 -107.788 1.00 11.58  ? 165  GLY A O     1 
ATOM   1739 N  N     . LEU C 3 166 ? 55.541 -8.456  -108.366 1.00 10.45  ? 166  LEU A N     1 
ATOM   1740 C  CA    . LEU C 3 166 ? 54.457 -8.370  -107.357 1.00 10.17  ? 166  LEU A CA    1 
ATOM   1741 C  C     . LEU C 3 166 ? 53.283 -9.196  -107.827 1.00 9.72   ? 166  LEU A C     1 
ATOM   1742 O  O     . LEU C 3 166 ? 52.864 -9.054  -108.997 1.00 11.34  ? 166  LEU A O     1 
ATOM   1743 C  CB    . LEU C 3 166 ? 54.039 -6.905  -107.202 1.00 10.71  ? 166  LEU A CB    1 
ATOM   1744 C  CG    . LEU C 3 166 ? 55.137 -5.972  -106.734 1.00 11.01  ? 166  LEU A CG    1 
ATOM   1745 C  CD1   . LEU C 3 166 ? 54.570 -4.569  -106.525 1.00 12.85  ? 166  LEU A CD1   1 
ATOM   1746 C  CD2   . LEU C 3 166 ? 55.819 -6.446  -105.448 1.00 11.83  ? 166  LEU A CD2   1 
ATOM   1747 N  N     . GLY C 3 167 ? 52.684 -10.008 -106.960 1.00 10.53  ? 167  GLY A N     1 
ATOM   1748 C  CA    . GLY C 3 167 ? 51.372 -10.590 -107.221 1.00 11.61  ? 167  GLY A CA    1 
ATOM   1749 C  C     . GLY C 3 167 ? 50.470 -10.367 -106.018 1.00 10.84  ? 167  GLY A C     1 
ATOM   1750 O  O     . GLY C 3 167 ? 50.687 -9.435  -105.232 1.00 11.97  ? 167  GLY A O     1 
ATOM   1751 N  N     . ASN C 3 168 ? 49.438 -11.220 -105.921 1.00 11.14  ? 168  ASN A N     1 
ATOM   1752 C  CA    . ASN C 3 168 ? 48.378 -10.864 -104.939 1.00 10.67  ? 168  ASN A CA    1 
ATOM   1753 C  C     . ASN C 3 168 ? 48.861 -10.986 -103.506 1.00 10.36  ? 168  ASN A C     1 
ATOM   1754 O  O     . ASN C 3 168 ? 48.446 -10.136 -102.684 1.00 12.13  ? 168  ASN A O     1 
ATOM   1755 C  CB    . ASN C 3 168 ? 47.156 -11.728 -105.197 1.00 12.20  ? 168  ASN A CB    1 
ATOM   1756 C  CG    . ASN C 3 168 ? 45.948 -11.168 -104.487 1.00 12.10  ? 168  ASN A CG    1 
ATOM   1757 O  OD1   . ASN C 3 168 ? 45.751 -9.958  -104.503 1.00 13.09  ? 168  ASN A OD1   1 
ATOM   1758 N  ND2   . ASN C 3 168 ? 45.095 -12.039 -103.956 1.00 13.85  ? 168  ASN A ND2   1 
ATOM   1759 N  N     . TYR C 3 169 ? 49.657 -12.003 -103.153 1.00 11.50  ? 169  TYR A N     1 
ATOM   1760 C  CA    . TYR C 3 169 ? 50.034 -12.046 -101.739 1.00 11.52  ? 169  TYR A CA    1 
ATOM   1761 C  C     . TYR C 3 169 ? 50.904 -10.800 -101.471 1.00 11.42  ? 169  TYR A C     1 
ATOM   1762 O  O     . TYR C 3 169 ? 50.845 -10.237 -100.362 1.00 11.60  ? 169  TYR A O     1 
ATOM   1763 C  CB    . TYR C 3 169 ? 50.683 -13.367 -101.309 1.00 12.52  ? 169  TYR A CB    1 
ATOM   1764 C  CG    . TYR C 3 169 ? 52.180 -13.594 -101.461 1.00 12.87  ? 169  TYR A CG    1 
ATOM   1765 C  CD1   . TYR C 3 169 ? 53.137 -12.921 -100.696 1.00 11.89  ? 169  TYR A CD1   1 
ATOM   1766 C  CD2   . TYR C 3 169 ? 52.672 -14.587 -102.343 1.00 12.09  ? 169  TYR A CD2   1 
ATOM   1767 C  CE1   . TYR C 3 169 ? 54.489 -13.123 -100.787 1.00 13.16  ? 169  TYR A CE1   1 
ATOM   1768 C  CE2   . TYR C 3 169 ? 54.022 -14.815 -102.498 1.00 12.32  ? 169  TYR A CE2   1 
ATOM   1769 C  CZ    . TYR C 3 169 ? 54.912 -14.078 -101.706 1.00 12.03  ? 169  TYR A CZ    1 
ATOM   1770 O  OH    . TYR C 3 169 ? 56.302 -14.255 -101.804 1.00 12.46  ? 169  TYR A OH    1 
ATOM   1771 N  N     . LEU C 3 170 ? 51.805 -10.484 -102.372 1.00 10.74  ? 170  LEU A N     1 
ATOM   1772 C  CA    . LEU C 3 170 ? 52.681 -9.324  -102.096 1.00 10.08  ? 170  LEU A CA    1 
ATOM   1773 C  C     . LEU C 3 170 ? 51.840 -8.045  -102.019 1.00 10.24  ? 170  LEU A C     1 
ATOM   1774 O  O     . LEU C 3 170 ? 52.114 -7.182  -101.140 1.00 10.99  ? 170  LEU A O     1 
ATOM   1775 C  CB    . LEU C 3 170 ? 53.835 -9.230  -103.110 1.00 10.74  ? 170  LEU A CB    1 
ATOM   1776 C  CG    . LEU C 3 170 ? 54.880 -10.326 -102.937 1.00 11.09  ? 170  LEU A CG    1 
ATOM   1777 C  CD1   . LEU C 3 170 ? 55.776 -10.398 -104.151 1.00 11.90  ? 170  LEU A CD1   1 
ATOM   1778 C  CD2   . LEU C 3 170 ? 55.723 -10.034 -101.681 1.00 12.42  ? 170  LEU A CD2   1 
ATOM   1779 N  N     . ARG C 3 171 ? 50.847 -7.900  -102.898 1.00 10.35  ? 171  ARG A N     1 
ATOM   1780 C  CA    . ARG C 3 171 ? 49.958 -6.734  -102.795 1.00 10.99  ? 171  ARG A CA    1 
ATOM   1781 C  C     . ARG C 3 171 ? 49.367 -6.614  -101.402 1.00 10.55  ? 171  ARG A C     1 
ATOM   1782 O  O     . ARG C 3 171 ? 49.354 -5.564  -100.768 1.00 11.13  ? 171  ARG A O     1 
ATOM   1783 C  CB    . ARG C 3 171 ? 48.840 -6.892  -103.848 1.00 11.56  ? 171  ARG A CB    1 
ATOM   1784 C  CG    . ARG C 3 171 ? 47.786 -5.824  -103.716 1.00 11.71  ? 171  ARG A CG    1 
ATOM   1785 C  CD    . ARG C 3 171 ? 46.729 -5.879  -104.818 1.00 13.02  ? 171  ARG A CD    1 
ATOM   1786 N  NE    . ARG C 3 171 ? 45.800 -7.032  -104.674 1.00 11.69  ? 171  ARG A NE    1 
ATOM   1787 C  CZ    . ARG C 3 171 ? 44.540 -7.022  -105.113 1.00 12.19  ? 171  ARG A CZ    1 
ATOM   1788 N  NH1   . ARG C 3 171 ? 44.067 -5.947  -105.776 1.00 13.25  ? 171  ARG A NH1   1 
ATOM   1789 N  NH2   . ARG C 3 171 ? 43.759 -8.063  -104.905 1.00 14.21  ? 171  ARG A NH2   1 
ATOM   1790 N  N     . VAL C 3 172 ? 48.798 -7.716  -100.893 1.00 11.82  ? 172  VAL A N     1 
ATOM   1791 C  CA    . VAL C 3 172 ? 48.078 -7.698  -99.623  1.00 11.95  ? 172  VAL A CA    1 
ATOM   1792 C  C     . VAL C 3 172 ? 49.071 -7.405  -98.489  1.00 9.99   ? 172  VAL A C     1 
ATOM   1793 O  O     . VAL C 3 172 ? 48.792 -6.617  -97.567  1.00 11.07  ? 172  VAL A O     1 
ATOM   1794 C  CB    A VAL C 3 172 ? 47.166 -8.893  -99.309  0.39 13.38  ? 172  VAL A CB    1 
ATOM   1795 C  CB    B VAL C 3 172 ? 47.507 -9.138  -99.437  0.61 15.80  ? 172  VAL A CB    1 
ATOM   1796 C  CG1   A VAL C 3 172 ? 46.233 -9.188  -100.489 0.39 18.28  ? 172  VAL A CG1   1 
ATOM   1797 C  CG1   B VAL C 3 172 ? 47.285 -9.614  -98.020  0.61 14.19  ? 172  VAL A CG1   1 
ATOM   1798 C  CG2   A VAL C 3 172 ? 47.968 -10.116 -98.971  0.39 14.07  ? 172  VAL A CG2   1 
ATOM   1799 C  CG2   B VAL C 3 172 ? 46.200 -9.250  -100.230 0.61 15.54  ? 172  VAL A CG2   1 
ATOM   1800 N  N     . GLU C 3 173 ? 50.269 -7.997  -98.539  1.00 10.78  ? 173  GLU A N     1 
ATOM   1801 C  CA    . GLU C 3 173 ? 51.243 -7.849  -97.458  1.00 10.36  ? 173  GLU A CA    1 
ATOM   1802 C  C     . GLU C 3 173 ? 51.842 -6.457  -97.469  1.00 10.12  ? 173  GLU A C     1 
ATOM   1803 O  O     . GLU C 3 173 ? 52.085 -5.862  -96.407  1.00 10.74  ? 173  GLU A O     1 
ATOM   1804 C  CB    . GLU C 3 173 ? 52.332 -8.916  -97.541  1.00 10.71  ? 173  GLU A CB    1 
ATOM   1805 C  CG    . GLU C 3 173 ? 51.776 -10.324 -97.250  1.00 12.69  ? 173  GLU A CG    1 
ATOM   1806 C  CD    . GLU C 3 173 ? 51.283 -10.472 -95.828  1.00 13.67  ? 173  GLU A CD    1 
ATOM   1807 O  OE1   . GLU C 3 173 ? 52.027 -10.074 -94.887  1.00 14.19  ? 173  GLU A OE1   1 
ATOM   1808 O  OE2   . GLU C 3 173 ? 50.168 -11.010 -95.607  1.00 14.49  ? 173  GLU A OE2   1 
ATOM   1809 N  N     . ILE C 3 174 ? 52.148 -5.928  -98.657  1.00 9.92   ? 174  ILE A N     1 
ATOM   1810 C  CA    . ILE C 3 174 ? 52.733 -4.572  -98.724  1.00 9.52   ? 174  ILE A CA    1 
ATOM   1811 C  C     . ILE C 3 174 ? 51.727 -3.546  -98.255  1.00 9.63   ? 174  ILE A C     1 
ATOM   1812 O  O     . ILE C 3 174 ? 52.075 -2.654  -97.468  1.00 10.45  ? 174  ILE A O     1 
ATOM   1813 C  CB    . ILE C 3 174 ? 53.181 -4.291  -100.174 1.00 10.04  ? 174  ILE A CB    1 
ATOM   1814 C  CG1   . ILE C 3 174 ? 54.444 -5.146  -100.492 1.00 10.92  ? 174  ILE A CG1   1 
ATOM   1815 C  CG2   . ILE C 3 174 ? 53.423 -2.805  -100.419 1.00 11.51  ? 174  ILE A CG2   1 
ATOM   1816 C  CD1   . ILE C 3 174 ? 54.672 -5.287  -101.994 1.00 11.80  ? 174  ILE A CD1   1 
ATOM   1817 N  N     . LEU C 3 175 ? 50.455 -3.646  -98.671  1.00 9.89   ? 175  LEU A N     1 
ATOM   1818 C  CA    . LEU C 3 175 ? 49.467 -2.614  -98.252  1.00 10.32  ? 175  LEU A CA    1 
ATOM   1819 C  C     . LEU C 3 175 ? 49.258 -2.726  -96.745  1.00 10.67  ? 175  LEU A C     1 
ATOM   1820 O  O     . LEU C 3 175 ? 49.154 -1.692  -96.067  1.00 11.48  ? 175  LEU A O     1 
ATOM   1821 C  CB    . LEU C 3 175 ? 48.158 -2.826  -99.006  1.00 11.28  ? 175  LEU A CB    1 
ATOM   1822 C  CG    . LEU C 3 175 ? 48.267 -2.420  -100.489 1.00 12.03  ? 175  LEU A CG    1 
ATOM   1823 C  CD1   . LEU C 3 175 ? 46.979 -2.865  -101.206 1.00 13.50  ? 175  LEU A CD1   1 
ATOM   1824 C  CD2   . LEU C 3 175 ? 48.506 -0.943  -100.629 1.00 14.17  ? 175  LEU A CD2   1 
ATOM   1825 N  N     . TRP C 3 176 ? 49.239 -3.925  -96.153  1.00 10.29  ? 176  TRP A N     1 
ATOM   1826 C  CA    . TRP C 3 176 ? 49.079 -3.970  -94.691  1.00 10.81  ? 176  TRP A CA    1 
ATOM   1827 C  C     . TRP C 3 176 ? 50.289 -3.369  -94.016  1.00 10.37  ? 176  TRP A C     1 
ATOM   1828 O  O     . TRP C 3 176 ? 50.160 -2.614  -93.041  1.00 10.78  ? 176  TRP A O     1 
ATOM   1829 C  CB    . TRP C 3 176 ? 48.896 -5.426  -94.240  1.00 11.56  ? 176  TRP A CB    1 
ATOM   1830 C  CG    . TRP C 3 176 ? 48.750 -5.553  -92.727  1.00 10.81  ? 176  TRP A CG    1 
ATOM   1831 C  CD1   . TRP C 3 176 ? 47.592 -5.512  -92.013  1.00 11.57  ? 176  TRP A CD1   1 
ATOM   1832 C  CD2   . TRP C 3 176 ? 49.806 -5.745  -91.791  1.00 11.26  ? 176  TRP A CD2   1 
ATOM   1833 N  NE1   . TRP C 3 176 ? 47.857 -5.678  -90.661  1.00 12.80  ? 176  TRP A NE1   1 
ATOM   1834 C  CE2   . TRP C 3 176 ? 49.208 -5.808  -90.498  1.00 12.36  ? 176  TRP A CE2   1 
ATOM   1835 C  CE3   . TRP C 3 176 ? 51.194 -5.841  -91.891  1.00 11.87  ? 176  TRP A CE3   1 
ATOM   1836 C  CZ2   . TRP C 3 176 ? 49.969 -5.985  -89.352  1.00 13.19  ? 176  TRP A CZ2   1 
ATOM   1837 C  CZ3   . TRP C 3 176 ? 51.951 -6.022  -90.726  1.00 13.53  ? 176  TRP A CZ3   1 
ATOM   1838 C  CH2   . TRP C 3 176 ? 51.320 -6.093  -89.473  1.00 13.22  ? 176  TRP A CH2   1 
ATOM   1839 N  N     . GLN C 3 177 ? 51.515 -3.673  -94.510  1.00 11.14  ? 177  GLN A N     1 
ATOM   1840 C  CA    . GLN C 3 177 ? 52.697 -3.120  -93.827  1.00 10.96  ? 177  GLN A CA    1 
ATOM   1841 C  C     . GLN C 3 177 ? 52.641 -1.618  -93.690  1.00 11.78  ? 177  GLN A C     1 
ATOM   1842 O  O     . GLN C 3 177 ? 52.978 -1.121  -92.610  1.00 12.82  ? 177  GLN A O     1 
ATOM   1843 C  CB    . GLN C 3 177 ? 53.965 -3.588  -94.599  1.00 12.00  ? 177  GLN A CB    1 
ATOM   1844 C  CG    . GLN C 3 177 ? 55.253 -2.942  -94.115  1.00 13.92  ? 177  GLN A CG    1 
ATOM   1845 C  CD    . GLN C 3 177 ? 55.525 -3.286  -92.672  1.00 15.78  ? 177  GLN A CD    1 
ATOM   1846 O  OE1   . GLN C 3 177 ? 55.214 -4.367  -92.128  1.00 17.41  ? 177  GLN A OE1   1 
ATOM   1847 N  NE2   . GLN C 3 177 ? 56.118 -2.322  -91.974  1.00 18.18  ? 177  GLN A NE2   1 
ATOM   1848 N  N     . VAL C 3 178 ? 52.149 -0.942  -94.750  1.00 10.06  ? 178  VAL A N     1 
ATOM   1849 C  CA    . VAL C 3 178 ? 52.142 0.537   -94.728  1.00 11.53  ? 178  VAL A CA    1 
ATOM   1850 C  C     . VAL C 3 178 ? 50.799 1.124   -94.299  1.00 11.22  ? 178  VAL A C     1 
ATOM   1851 O  O     . VAL C 3 178 ? 50.611 2.329   -94.344  1.00 12.99  ? 178  VAL A O     1 
ATOM   1852 C  CB    . VAL C 3 178 ? 52.648 1.116   -96.064  1.00 12.82  ? 178  VAL A CB    1 
ATOM   1853 C  CG1   . VAL C 3 178 ? 54.056 0.589   -96.308  1.00 15.50  ? 178  VAL A CG1   1 
ATOM   1854 C  CG2   . VAL C 3 178 ? 51.645 0.793   -97.179  1.00 14.63  ? 178  VAL A CG2   1 
ATOM   1855 N  N     . GLY C 3 179 ? 49.869 0.281   -93.855  1.00 11.35  ? 179  GLY A N     1 
ATOM   1856 C  CA    . GLY C 3 179 ? 48.626 0.781   -93.256  1.00 11.77  ? 179  GLY A CA    1 
ATOM   1857 C  C     . GLY C 3 179 ? 47.623 1.295   -94.283  1.00 10.98  ? 179  GLY A C     1 
ATOM   1858 O  O     . GLY C 3 179 ? 46.742 2.119   -93.897  1.00 11.50  ? 179  GLY A O     1 
ATOM   1859 N  N     . LEU C 3 180 ? 47.669 0.830   -95.524  1.00 12.27  ? 180  LEU A N     1 
ATOM   1860 C  CA    . LEU C 3 180 ? 46.784 1.385   -96.560  1.00 12.60  ? 180  LEU A CA    1 
ATOM   1861 C  C     . LEU C 3 180 ? 45.858 0.350   -97.135  1.00 11.50  ? 180  LEU A C     1 
ATOM   1862 O  O     . LEU C 3 180 ? 46.222 -0.812  -97.229  1.00 12.47  ? 180  LEU A O     1 
ATOM   1863 C  CB    . LEU C 3 180 ? 47.650 1.921   -97.712  1.00 13.72  ? 180  LEU A CB    1 
ATOM   1864 C  CG    . LEU C 3 180 ? 48.512 3.145   -97.419  1.00 15.19  ? 180  LEU A CG    1 
ATOM   1865 C  CD1   . LEU C 3 180 ? 49.436 3.469   -98.610  1.00 18.56  ? 180  LEU A CD1   1 
ATOM   1866 C  CD2   . LEU C 3 180 ? 47.637 4.363   -97.091  1.00 18.39  ? 180  LEU A CD2   1 
ATOM   1867 N  N     . THR C 3 181 ? 44.656 0.788   -97.525  1.00 13.84  ? 181  THR A N     1 
ATOM   1868 C  CA    . THR C 3 181 ? 43.829 -0.069  -98.359  1.00 15.42  ? 181  THR A CA    1 
ATOM   1869 C  C     . THR C 3 181 ? 44.226 0.130   -99.826  1.00 14.71  ? 181  THR A C     1 
ATOM   1870 O  O     . THR C 3 181 ? 45.118 0.925   -100.117 1.00 17.08  ? 181  THR A O     1 
ATOM   1871 C  CB    . THR C 3 181 ? 42.328 0.219   -98.263  1.00 17.97  ? 181  THR A CB    1 
ATOM   1872 O  OG1   . THR C 3 181 ? 42.172 1.528   -98.818  1.00 23.68  ? 181  THR A OG1   1 
ATOM   1873 C  CG2   . THR C 3 181 ? 41.836 0.234   -96.807  1.00 18.42  ? 181  THR A CG2   1 
ATOM   1874 N  N     . GLY C 3 182 ? 43.615 -0.599  -100.746 1.00 15.23  ? 182  GLY A N     1 
ATOM   1875 C  CA    . GLY C 3 182 ? 43.918 -0.455  -102.137 1.00 13.73  ? 182  GLY A CA    1 
ATOM   1876 C  C     . GLY C 3 182 ? 43.353 0.795   -102.819 1.00 13.99  ? 182  GLY A C     1 
ATOM   1877 O  O     . GLY C 3 182 ? 43.753 1.082   -103.946 1.00 14.47  ? 182  GLY A O     1 
ATOM   1878 N  N     . ASN C 3 183 ? 42.536 1.579   -102.141 1.00 14.28  ? 183  ASN A N     1 
ATOM   1879 C  CA    . ASN C 3 183 ? 41.848 2.698   -102.745 1.00 16.95  ? 183  ASN A CA    1 
ATOM   1880 C  C     A ASN C 3 183 ? 42.546 4.020   -102.478 0.26 15.97  ? 183  ASN A C     1 
ATOM   1881 C  C     B ASN C 3 183 ? 42.565 3.986   -102.428 0.74 15.87  ? 183  ASN A C     1 
ATOM   1882 O  O     A ASN C 3 183 ? 41.985 4.991   -101.960 0.26 15.26  ? 183  ASN A O     1 
ATOM   1883 O  O     B ASN C 3 183 ? 42.065 4.926   -101.792 0.74 21.87  ? 183  ASN A O     1 
ATOM   1884 C  CB    A ASN C 3 183 ? 40.435 2.767   -102.141 0.26 20.79  ? 183  ASN A CB    1 
ATOM   1885 C  CB    B ASN C 3 183 ? 40.402 2.740   -102.203 0.74 21.46  ? 183  ASN A CB    1 
ATOM   1886 C  CG    A ASN C 3 183 ? 39.592 3.829   -102.819 0.26 20.75  ? 183  ASN A CG    1 
ATOM   1887 C  CG    B ASN C 3 183 ? 39.690 1.403   -102.228 0.74 29.00  ? 183  ASN A CG    1 
ATOM   1888 O  OD1   A ASN C 3 183 ? 39.937 4.279   -103.917 0.26 17.89  ? 183  ASN A OD1   1 
ATOM   1889 O  OD1   B ASN C 3 183 ? 39.775 0.496   -103.066 0.74 47.40  ? 183  ASN A OD1   1 
ATOM   1890 N  ND2   A ASN C 3 183 ? 38.524 4.210   -102.133 0.26 22.62  ? 183  ASN A ND2   1 
ATOM   1891 N  ND2   B ASN C 3 183 ? 38.882 1.166   -101.199 0.74 55.24  ? 183  ASN A ND2   1 
ATOM   1892 N  N     . HIS C 3 184 ? 43.817 4.054   -102.824 1.00 15.00  ? 184  HIS A N     1 
ATOM   1893 C  CA    . HIS C 3 184 ? 44.669 5.222   -102.750 1.00 13.76  ? 184  HIS A CA    1 
ATOM   1894 C  C     . HIS C 3 184 ? 45.530 5.312   -103.989 1.00 13.16  ? 184  HIS A C     1 
ATOM   1895 O  O     . HIS C 3 184 ? 45.759 4.273   -104.661 1.00 14.08  ? 184  HIS A O     1 
ATOM   1896 C  CB    . HIS C 3 184 ? 45.635 5.142   -101.544 1.00 16.70  ? 184  HIS A CB    1 
ATOM   1897 C  CG    . HIS C 3 184 ? 44.775 5.173   -100.298 1.00 20.08  ? 184  HIS A CG    1 
ATOM   1898 N  ND1   . HIS C 3 184 ? 44.457 4.069   -99.569  1.00 22.83  ? 184  HIS A ND1   1 
ATOM   1899 C  CD2   . HIS C 3 184 ? 44.107 6.237   -99.821  1.00 23.67  ? 184  HIS A CD2   1 
ATOM   1900 C  CE1   . HIS C 3 184 ? 43.644 4.467   -98.616  1.00 22.18  ? 184  HIS A CE1   1 
ATOM   1901 N  NE2   . HIS C 3 184 ? 43.439 5.761   -98.723  1.00 31.00  ? 184  HIS A NE2   1 
ATOM   1902 N  N     . LYS C 3 185 ? 45.996 6.523   -104.242 1.00 13.21  ? 185  LYS A N     1 
ATOM   1903 C  CA    . LYS C 3 185 ? 46.914 6.831   -105.357 1.00 13.44  ? 185  LYS A CA    1 
ATOM   1904 C  C     . LYS C 3 185 ? 48.143 7.470   -104.789 1.00 12.20  ? 185  LYS A C     1 
ATOM   1905 O  O     . LYS C 3 185 ? 48.080 8.177   -103.766 1.00 14.51  ? 185  LYS A O     1 
ATOM   1906 C  CB    . LYS C 3 185 ? 46.200 7.804   -106.275 1.00 15.04  ? 185  LYS A CB    1 
ATOM   1907 C  CG    . LYS C 3 185 ? 44.893 7.203   -106.821 1.00 20.26  ? 185  LYS A CG    1 
ATOM   1908 C  CD    . LYS C 3 185 ? 44.178 8.279   -107.653 1.00 21.73  ? 185  LYS A CD    1 
ATOM   1909 C  CE    . LYS C 3 185 ? 43.027 7.633   -108.479 1.00 22.87  ? 185  LYS A CE    1 
ATOM   1910 N  NZ    . LYS C 3 185 ? 42.306 8.785   -109.148 1.00 31.94  ? 185  LYS A NZ    1 
ATOM   1911 N  N     . ALA C 3 186 ? 49.290 7.341   -105.452 1.00 11.68  ? 186  ALA A N     1 
ATOM   1912 C  CA    . ALA C 3 186 ? 50.523 7.881   -104.879 1.00 12.41  ? 186  ALA A CA    1 
ATOM   1913 C  C     . ALA C 3 186 ? 50.441 9.384   -104.733 1.00 12.43  ? 186  ALA A C     1 
ATOM   1914 O  O     . ALA C 3 186 ? 51.024 9.930   -103.775 1.00 13.17  ? 186  ALA A O     1 
ATOM   1915 C  CB    . ALA C 3 186 ? 51.682 7.521   -105.778 1.00 12.31  ? 186  ALA A CB    1 
ATOM   1916 N  N     . LYS C 3 187 ? 49.776 10.101  -105.621 1.00 12.32  ? 187  LYS A N     1 
ATOM   1917 C  CA    . LYS C 3 187 ? 49.692 11.560  -105.527 1.00 15.28  ? 187  LYS A CA    1 
ATOM   1918 C  C     . LYS C 3 187 ? 49.072 12.032  -104.230 1.00 17.38  ? 187  LYS A C     1 
ATOM   1919 O  O     . LYS C 3 187 ? 49.262 13.166  -103.798 1.00 22.66  ? 187  LYS A O     1 
ATOM   1920 C  CB    . LYS C 3 187 ? 48.889 12.124  -106.728 1.00 18.18  ? 187  LYS A CB    1 
ATOM   1921 C  CG    . LYS C 3 187 ? 47.406 11.806  -106.693 1.00 22.56  ? 187  LYS A CG    1 
ATOM   1922 C  CD    . LYS C 3 187 ? 46.719 12.326  -107.963 1.00 23.21  ? 187  LYS A CD    1 
ATOM   1923 C  CE    . LYS C 3 187 ? 45.206 12.273  -107.840 1.00 27.81  ? 187  LYS A CE    1 
ATOM   1924 N  NZ    . LYS C 3 187 ? 44.590 12.946  -109.023 1.00 29.55  ? 187  LYS A NZ    1 
ATOM   1925 N  N     . ASP C 3 188 ? 48.298 11.197  -103.561 1.00 16.77  ? 188  ASP A N     1 
ATOM   1926 C  CA    . ASP C 3 188 ? 47.603 11.687  -102.386 1.00 18.89  ? 188  ASP A CA    1 
ATOM   1927 C  C     . ASP C 3 188 ? 48.329 11.300  -101.108 1.00 15.85  ? 188  ASP A C     1 
ATOM   1928 O  O     . ASP C 3 188 ? 47.905 11.717  -99.985  1.00 16.77  ? 188  ASP A O     1 
ATOM   1929 C  CB    . ASP C 3 188 ? 46.191 11.159  -102.411 1.00 22.78  ? 188  ASP A CB    1 
ATOM   1930 C  CG    . ASP C 3 188 ? 45.418 11.796  -103.561 1.00 26.96  ? 188  ASP A CG    1 
ATOM   1931 O  OD1   . ASP C 3 188 ? 45.441 13.045  -103.871 1.00 28.41  ? 188  ASP A OD1   1 
ATOM   1932 O  OD2   . ASP C 3 188 ? 44.745 10.988  -104.214 1.00 32.28  ? 188  ASP A OD2   1 
ATOM   1933 N  N     . LEU C 3 189 ? 49.417 10.531  -101.156 1.00 12.71  ? 189  LEU A N     1 
ATOM   1934 C  CA    . LEU C 3 189 ? 50.150 10.219  -99.922  1.00 13.04  ? 189  LEU A CA    1 
ATOM   1935 C  C     . LEU C 3 189 ? 51.021 11.359  -99.416  1.00 12.47  ? 189  LEU A C     1 
ATOM   1936 O  O     . LEU C 3 189 ? 51.530 12.156  -100.198 1.00 13.78  ? 189  LEU A O     1 
ATOM   1937 C  CB    . LEU C 3 189 ? 51.098 9.024   -100.191 1.00 12.29  ? 189  LEU A CB    1 
ATOM   1938 C  CG    . LEU C 3 189 ? 50.375 7.735   -100.596 1.00 13.10  ? 189  LEU A CG    1 
ATOM   1939 C  CD1   . LEU C 3 189 ? 51.363 6.567   -100.709 1.00 13.97  ? 189  LEU A CD1   1 
ATOM   1940 C  CD2   . LEU C 3 189 ? 49.265 7.369   -99.621  1.00 15.46  ? 189  LEU A CD2   1 
ATOM   1941 N  N     . ASN C 3 190 ? 51.229 11.373  -98.085  1.00 11.49  ? 190  ASN A N     1 
ATOM   1942 C  CA    . ASN C 3 190 ? 52.244 12.298  -97.572  1.00 11.15  ? 190  ASN A CA    1 
ATOM   1943 C  C     . ASN C 3 190 ? 53.618 11.685  -97.783  1.00 10.75  ? 190  ASN A C     1 
ATOM   1944 O  O     . ASN C 3 190 ? 53.767 10.520  -98.181  1.00 10.94  ? 190  ASN A O     1 
ATOM   1945 C  CB    . ASN C 3 190 ? 51.937 12.683  -96.142  1.00 13.28  ? 190  ASN A CB    1 
ATOM   1946 C  CG    . ASN C 3 190 ? 52.031 11.573  -95.118  1.00 12.95  ? 190  ASN A CG    1 
ATOM   1947 O  OD1   . ASN C 3 190 ? 52.984 10.784  -95.182  1.00 12.48  ? 190  ASN A OD1   1 
ATOM   1948 N  ND2   . ASN C 3 190 ? 51.122 11.423  -94.188  1.00 14.05  ? 190  ASN A ND2   1 
ATOM   1949 N  N     . ALA C 3 191 ? 54.665 12.503  -97.549  1.00 11.51  ? 191  ALA A N     1 
ATOM   1950 C  CA    . ALA C 3 191 ? 56.022 12.047  -97.882  1.00 11.99  ? 191  ALA A CA    1 
ATOM   1951 C  C     . ALA C 3 191 ? 56.424 10.849  -97.052  1.00 10.57  ? 191  ALA A C     1 
ATOM   1952 O  O     . ALA C 3 191 ? 57.119 9.930   -97.536  1.00 12.23  ? 191  ALA A O     1 
ATOM   1953 C  CB    . ALA C 3 191 ? 57.034 13.181  -97.724  1.00 12.81  ? 191  ALA A CB    1 
ATOM   1954 N  N     . ALA C 3 192 ? 55.990 10.757  -95.789  1.00 12.00  ? 192  ALA A N     1 
ATOM   1955 C  CA    . ALA C 3 192 ? 56.379 9.617   -94.964  1.00 11.42  ? 192  ALA A CA    1 
ATOM   1956 C  C     . ALA C 3 192 ? 55.736 8.349   -95.499  1.00 11.26  ? 192  ALA A C     1 
ATOM   1957 O  O     . ALA C 3 192 ? 56.373 7.281   -95.553  1.00 12.25  ? 192  ALA A O     1 
ATOM   1958 C  CB    . ALA C 3 192 ? 55.902 9.887   -93.481  1.00 12.05  ? 192  ALA A CB    1 
ATOM   1959 N  N     . GLN C 3 193 ? 54.435 8.421   -95.860  1.00 11.20  ? 193  GLN A N     1 
ATOM   1960 C  CA    . GLN C 3 193 ? 53.760 7.256   -96.386  1.00 12.32  ? 193  GLN A CA    1 
ATOM   1961 C  C     . GLN C 3 193 ? 54.321 6.811   -97.728  1.00 10.96  ? 193  GLN A C     1 
ATOM   1962 O  O     . GLN C 3 193 ? 54.436 5.623   -97.981  1.00 11.87  ? 193  GLN A O     1 
ATOM   1963 C  CB    . GLN C 3 193 ? 52.257 7.581   -96.637  1.00 15.34  ? 193  GLN A CB    1 
ATOM   1964 C  CG    . GLN C 3 193 ? 51.428 7.936   -95.460  1.00 16.58  ? 193  GLN A CG    1 
ATOM   1965 C  CD    . GLN C 3 193 ? 50.020 8.372   -95.903  1.00 15.00  ? 193  GLN A CD    1 
ATOM   1966 O  OE1   . GLN C 3 193 ? 49.769 9.395   -96.577  1.00 15.82  ? 193  GLN A OE1   1 
ATOM   1967 N  NE2   . GLN C 3 193 ? 49.143 7.510   -95.413  1.00 18.66  ? 193  GLN A NE2   1 
ATOM   1968 N  N     . LEU C 3 194 ? 54.621 7.789   -98.589  1.00 11.18  ? 194  LEU A N     1 
ATOM   1969 C  CA    . LEU C 3 194 ? 55.206 7.432   -99.912  1.00 11.61  ? 194  LEU A CA    1 
ATOM   1970 C  C     . LEU C 3 194 ? 56.513 6.730   -99.713  1.00 11.15  ? 194  LEU A C     1 
ATOM   1971 O  O     . LEU C 3 194 ? 56.817 5.736   -100.375 1.00 11.50  ? 194  LEU A O     1 
ATOM   1972 C  CB    . LEU C 3 194 ? 55.374 8.744   -100.696 1.00 12.75  ? 194  LEU A CB    1 
ATOM   1973 C  CG    . LEU C 3 194 ? 55.684 8.527   -102.170 1.00 16.04  ? 194  LEU A CG    1 
ATOM   1974 C  CD1   . LEU C 3 194 ? 54.468 8.015   -102.879 1.00 16.57  ? 194  LEU A CD1   1 
ATOM   1975 C  CD2   . LEU C 3 194 ? 56.185 9.845   -102.696 1.00 28.70  ? 194  LEU A CD2   1 
ATOM   1976 N  N     . ASP C 3 195 ? 57.356 7.219   -98.779  1.00 11.39  ? 195  ASP A N     1 
ATOM   1977 C  CA    . ASP C 3 195 ? 58.626 6.611   -98.521  1.00 11.56  ? 195  ASP A CA    1 
ATOM   1978 C  C     . ASP C 3 195 ? 58.447 5.199   -97.967  1.00 10.91  ? 195  ASP A C     1 
ATOM   1979 O  O     . ASP C 3 195 ? 59.167 4.226   -98.369  1.00 12.10  ? 195  ASP A O     1 
ATOM   1980 C  CB    . ASP C 3 195 ? 59.449 7.454   -97.558  1.00 13.67  ? 195  ASP A CB    1 
ATOM   1981 C  CG    . ASP C 3 195 ? 60.860 6.957   -97.428  1.00 13.70  ? 195  ASP A CG    1 
ATOM   1982 O  OD1   . ASP C 3 195 ? 61.660 7.285   -98.309  1.00 17.29  ? 195  ASP A OD1   1 
ATOM   1983 O  OD2   . ASP C 3 195 ? 61.150 6.211   -96.438  1.00 18.00  ? 195  ASP A OD2   1 
ATOM   1984 N  N     . ALA C 3 196 ? 57.500 5.023   -97.039  1.00 11.61  ? 196  ALA A N     1 
ATOM   1985 C  CA    . ALA C 3 196 ? 57.243 3.700   -96.489  1.00 12.47  ? 196  ALA A CA    1 
ATOM   1986 C  C     . ALA C 3 196 ? 56.813 2.740   -97.591  1.00 10.60  ? 196  ALA A C     1 
ATOM   1987 O  O     . ALA C 3 196 ? 57.248 1.565   -97.643  1.00 11.48  ? 196  ALA A O     1 
ATOM   1988 C  CB    . ALA C 3 196 ? 56.173 3.744   -95.368  1.00 13.73  ? 196  ALA A CB    1 
ATOM   1989 N  N     . LEU C 3 197 ? 55.923 3.210   -98.487  1.00 10.48  ? 197  LEU A N     1 
ATOM   1990 C  CA    . LEU C 3 197 ? 55.450 2.320   -99.553  1.00 10.05  ? 197  LEU A CA    1 
ATOM   1991 C  C     . LEU C 3 197 ? 56.600 1.965   -100.494 1.00 9.62   ? 197  LEU A C     1 
ATOM   1992 O  O     . LEU C 3 197 ? 56.755 0.822   -100.881 1.00 10.72  ? 197  LEU A O     1 
ATOM   1993 C  CB    . LEU C 3 197 ? 54.304 3.017   -100.282 1.00 10.75  ? 197  LEU A CB    1 
ATOM   1994 C  CG    . LEU C 3 197 ? 53.773 2.248   -101.493 1.00 10.13  ? 197  LEU A CG    1 
ATOM   1995 C  CD1   . LEU C 3 197 ? 53.217 0.874   -101.154 1.00 12.16  ? 197  LEU A CD1   1 
ATOM   1996 C  CD2   . LEU C 3 197 ? 52.701 3.108   -102.192 1.00 11.53  ? 197  LEU A CD2   1 
ATOM   1997 N  N     . ALA C 3 198 ? 57.402 2.939   -100.910 1.00 10.27  ? 198  ALA A N     1 
ATOM   1998 C  CA    . ALA C 3 198 ? 58.511 2.672   -101.786 1.00 10.37  ? 198  ALA A CA    1 
ATOM   1999 C  C     . ALA C 3 198 ? 59.465 1.597   -101.244 1.00 10.24  ? 198  ALA A C     1 
ATOM   2000 O  O     . ALA C 3 198 ? 59.924 0.690   -101.939 1.00 12.59  ? 198  ALA A O     1 
ATOM   2001 C  CB    . ALA C 3 198 ? 59.276 3.940   -102.116 1.00 12.16  ? 198  ALA A CB    1 
ATOM   2002 N  N     . HIS C 3 199 ? 59.762 1.725   -99.925  1.00 10.76  ? 199  HIS A N     1 
ATOM   2003 C  CA    . HIS C 3 199 ? 60.598 0.740   -99.291  1.00 10.96  ? 199  HIS A CA    1 
ATOM   2004 C  C     . HIS C 3 199 ? 59.932 -0.622  -99.235  1.00 10.71  ? 199  HIS A C     1 
ATOM   2005 O  O     . HIS C 3 199 ? 60.594 -1.632  -99.506  1.00 12.15  ? 199  HIS A O     1 
ATOM   2006 C  CB    . HIS C 3 199 ? 60.972 1.190   -97.844  1.00 12.68  ? 199  HIS A CB    1 
ATOM   2007 C  CG    . HIS C 3 199 ? 62.154 2.166   -97.886  1.00 12.53  ? 199  HIS A CG    1 
ATOM   2008 N  ND1   . HIS C 3 199 ? 63.464 1.749   -97.779  1.00 15.32  ? 199  HIS A ND1   1 
ATOM   2009 C  CD2   . HIS C 3 199 ? 62.185 3.519   -98.060  1.00 13.92  ? 199  HIS A CD2   1 
ATOM   2010 C  CE1   . HIS C 3 199 ? 64.273 2.809   -97.859  1.00 15.92  ? 199  HIS A CE1   1 
ATOM   2011 N  NE2   . HIS C 3 199 ? 63.523 3.877   -98.033  1.00 15.72  ? 199  HIS A NE2   1 
ATOM   2012 N  N     . ALA C 3 200 ? 58.638 -0.696  -98.861  1.00 10.32  ? 200  ALA A N     1 
ATOM   2013 C  CA    . ALA C 3 200 ? 57.993 -1.988  -98.722  1.00 10.73  ? 200  ALA A CA    1 
ATOM   2014 C  C     . ALA C 3 200 ? 57.860 -2.706  -100.060 1.00 10.40  ? 200  ALA A C     1 
ATOM   2015 O  O     . ALA C 3 200 ? 57.914 -3.945  -100.083 1.00 10.58  ? 200  ALA A O     1 
ATOM   2016 C  CB    . ALA C 3 200 ? 56.622 -1.789  -98.096  1.00 12.32  ? 200  ALA A CB    1 
ATOM   2017 N  N     . LEU C 3 201 ? 57.678 -1.950  -101.150 1.00 9.96   ? 201  LEU A N     1 
ATOM   2018 C  CA    . LEU C 3 201 ? 57.511 -2.562  -102.472 1.00 10.01  ? 201  LEU A CA    1 
ATOM   2019 C  C     . LEU C 3 201 ? 58.743 -3.388  -102.860 1.00 9.68   ? 201  LEU A C     1 
ATOM   2020 O  O     . LEU C 3 201 ? 58.611 -4.297  -103.644 1.00 11.05  ? 201  LEU A O     1 
ATOM   2021 C  CB    . LEU C 3 201 ? 57.284 -1.442  -103.507 1.00 9.34   ? 201  LEU A CB    1 
ATOM   2022 C  CG    . LEU C 3 201 ? 55.847 -0.856  -103.499 1.00 9.50   ? 201  LEU A CG    1 
ATOM   2023 C  CD1   . LEU C 3 201 ? 55.840 0.459   -104.230 1.00 10.59  ? 201  LEU A CD1   1 
ATOM   2024 C  CD2   . LEU C 3 201 ? 54.857 -1.830  -104.125 1.00 10.97  ? 201  LEU A CD2   1 
ATOM   2025 N  N     . LEU C 3 202 ? 59.897 -3.002  -102.330 1.00 9.82   ? 202  LEU A N     1 
ATOM   2026 C  CA    . LEU C 3 202 ? 61.132 -3.747  -102.578 1.00 10.52  ? 202  LEU A CA    1 
ATOM   2027 C  C     . LEU C 3 202 ? 61.427 -4.724  -101.425 1.00 10.09  ? 202  LEU A C     1 
ATOM   2028 O  O     . LEU C 3 202 ? 61.802 -5.883  -101.613 1.00 11.84  ? 202  LEU A O     1 
ATOM   2029 C  CB    . LEU C 3 202 ? 62.334 -2.810  -102.738 1.00 11.60  ? 202  LEU A CB    1 
ATOM   2030 C  CG    . LEU C 3 202 ? 62.206 -1.826  -103.901 1.00 11.37  ? 202  LEU A CG    1 
ATOM   2031 C  CD1   . LEU C 3 202 ? 63.441 -0.981  -103.994 1.00 12.00  ? 202  LEU A CD1   1 
ATOM   2032 C  CD2   . LEU C 3 202 ? 61.918 -2.581  -105.207 1.00 12.64  ? 202  LEU A CD2   1 
ATOM   2033 N  N     . GLU C 3 203 ? 61.283 -4.233  -100.189 1.00 10.67  ? 203  GLU A N     1 
ATOM   2034 C  CA    . GLU C 3 203 ? 61.808 -5.005  -99.044  1.00 11.13  ? 203  GLU A CA    1 
ATOM   2035 C  C     . GLU C 3 203 ? 60.981 -6.220  -98.736  1.00 10.55  ? 203  GLU A C     1 
ATOM   2036 O  O     . GLU C 3 203 ? 61.545 -7.265  -98.351  1.00 11.91  ? 203  GLU A O     1 
ATOM   2037 C  CB    . GLU C 3 203 ? 61.872 -4.102  -97.810  1.00 12.09  ? 203  GLU A CB    1 
ATOM   2038 C  CG    . GLU C 3 203 ? 63.050 -3.107  -98.020  1.00 15.68  ? 203  GLU A CG    1 
ATOM   2039 C  CD    . GLU C 3 203 ? 63.049 -1.891  -97.127  1.00 16.77  ? 203  GLU A CD    1 
ATOM   2040 O  OE1   . GLU C 3 203 ? 62.223 -1.792  -96.212  1.00 20.11  ? 203  GLU A OE1   1 
ATOM   2041 O  OE2   . GLU C 3 203 ? 63.900 -1.003  -97.346  1.00 20.13  ? 203  GLU A OE2   1 
ATOM   2042 N  N     . ILE C 3 204 ? 59.659 -6.178  -98.889  1.00 10.51  ? 204  ILE A N     1 
ATOM   2043 C  CA    . ILE C 3 204 ? 58.873 -7.412  -98.608  1.00 11.87  ? 204  ILE A CA    1 
ATOM   2044 C  C     . ILE C 3 204 ? 59.142 -8.456  -99.644  1.00 11.06  ? 204  ILE A C     1 
ATOM   2045 O  O     . ILE C 3 204 ? 59.430 -9.615  -99.270  1.00 11.85  ? 204  ILE A O     1 
ATOM   2046 C  CB    . ILE C 3 204 ? 57.400 -7.061  -98.411  1.00 12.01  ? 204  ILE A CB    1 
ATOM   2047 C  CG1   . ILE C 3 204 ? 57.254 -6.151  -97.137  1.00 14.53  ? 204  ILE A CG1   1 
ATOM   2048 C  CG2   . ILE C 3 204 ? 56.570 -8.311  -98.285  1.00 13.25  ? 204  ILE A CG2   1 
ATOM   2049 C  CD1   . ILE C 3 204 ? 55.855 -5.776  -96.738  1.00 16.28  ? 204  ILE A CD1   1 
ATOM   2050 N  N     . PRO C 3 205 ? 59.143 -8.201  -100.950 1.00 10.48  ? 205  PRO A N     1 
ATOM   2051 C  CA    . PRO C 3 205 ? 59.515 -9.258  -101.917 1.00 11.08  ? 205  PRO A CA    1 
ATOM   2052 C  C     . PRO C 3 205 ? 60.926 -9.755  -101.653 1.00 10.60  ? 205  PRO A C     1 
ATOM   2053 O  O     . PRO C 3 205 ? 61.139 -10.965 -101.737 1.00 11.04  ? 205  PRO A O     1 
ATOM   2054 C  CB    . PRO C 3 205 ? 59.388 -8.527  -103.275 1.00 11.42  ? 205  PRO A CB    1 
ATOM   2055 C  CG    . PRO C 3 205 ? 58.361 -7.470  -103.053 1.00 13.39  ? 205  PRO A CG    1 
ATOM   2056 C  CD    . PRO C 3 205 ? 58.669 -6.974  -101.643 1.00 11.36  ? 205  PRO A CD    1 
ATOM   2057 N  N     . ARG C 3 206 ? 61.901 -8.894  -101.358 1.00 11.04  ? 206  ARG A N     1 
ATOM   2058 C  CA    . ARG C 3 206 ? 63.279 -9.345  -101.143 1.00 11.02  ? 206  ARG A CA    1 
ATOM   2059 C  C     . ARG C 3 206 ? 63.355 -10.203 -99.888  1.00 11.81  ? 206  ARG A C     1 
ATOM   2060 O  O     . ARG C 3 206 ? 64.098 -11.191 -99.878  1.00 12.63  ? 206  ARG A O     1 
ATOM   2061 C  CB    . ARG C 3 206 ? 64.194 -8.158  -101.046 1.00 11.75  ? 206  ARG A CB    1 
ATOM   2062 C  CG    . ARG C 3 206 ? 64.320 -7.450  -102.433 1.00 11.94  ? 206  ARG A CG    1 
ATOM   2063 C  CD    . ARG C 3 206 ? 65.006 -6.086  -102.299 1.00 11.67  ? 206  ARG A CD    1 
ATOM   2064 N  NE    . ARG C 3 206 ? 65.027 -5.482  -103.636 1.00 11.92  ? 206  ARG A NE    1 
ATOM   2065 C  CZ    . ARG C 3 206 ? 65.700 -4.370  -103.940 1.00 11.82  ? 206  ARG A CZ    1 
ATOM   2066 N  NH1   . ARG C 3 206 ? 66.344 -3.702  -102.998 1.00 13.54  ? 206  ARG A NH1   1 
ATOM   2067 N  NH2   . ARG C 3 206 ? 65.663 -3.955  -105.228 1.00 13.41  ? 206  ARG A NH2   1 
ATOM   2068 N  N     . PHE C 3 207 ? 62.603 -9.904  -98.829  1.00 11.94  ? 207  PHE A N     1 
ATOM   2069 C  CA    . PHE C 3 207 ? 62.608 -10.706 -97.607  1.00 11.80  ? 207  PHE A CA    1 
ATOM   2070 C  C     . PHE C 3 207 ? 61.968 -12.063 -97.878  1.00 12.10  ? 207  PHE A C     1 
ATOM   2071 O  O     . PHE C 3 207 ? 62.472 -13.074 -97.388  1.00 12.95  ? 207  PHE A O     1 
ATOM   2072 C  CB    . PHE C 3 207 ? 61.816 -9.935  -96.546  1.00 13.46  ? 207  PHE A CB    1 
ATOM   2073 C  CG    . PHE C 3 207 ? 61.845 -10.569 -95.150  1.00 15.86  ? 207  PHE A CG    1 
ATOM   2074 C  CD1   . PHE C 3 207 ? 63.009 -11.091 -94.596  1.00 18.35  ? 207  PHE A CD1   1 
ATOM   2075 C  CD2   . PHE C 3 207 ? 60.658 -10.583 -94.423  1.00 22.32  ? 207  PHE A CD2   1 
ATOM   2076 C  CE1   . PHE C 3 207 ? 62.967 -11.583 -93.294  1.00 20.94  ? 207  PHE A CE1   1 
ATOM   2077 C  CE2   . PHE C 3 207 ? 60.618 -11.083 -93.118  1.00 25.89  ? 207  PHE A CE2   1 
ATOM   2078 C  CZ    . PHE C 3 207 ? 61.787 -11.606 -92.586  1.00 26.83  ? 207  PHE A CZ    1 
ATOM   2079 N  N     . SER C 3 208 ? 60.865 -12.093 -98.617  1.00 11.75  ? 208  SER A N     1 
ATOM   2080 C  CA    . SER C 3 208 ? 60.261 -13.371 -98.982  1.00 11.79  ? 208  SER A CA    1 
ATOM   2081 C  C     . SER C 3 208 ? 61.225 -14.217 -99.809  1.00 11.63  ? 208  SER A C     1 
ATOM   2082 O  O     . SER C 3 208 ? 61.422 -15.420 -99.586  1.00 12.76  ? 208  SER A O     1 
ATOM   2083 C  CB    . SER C 3 208 ? 58.985 -13.146 -99.804  1.00 11.94  ? 208  SER A CB    1 
ATOM   2084 O  OG    . SER C 3 208 ? 58.495 -14.390 -100.193 1.00 12.70  ? 208  SER A OG    1 
ATOM   2085 N  N     . TYR C 3 209 ? 61.870 -13.606 -100.810 1.00 12.02  ? 209  TYR A N     1 
ATOM   2086 C  CA    . TYR C 3 209 ? 62.849 -14.353 -101.605 1.00 12.00  ? 209  TYR A CA    1 
ATOM   2087 C  C     . TYR C 3 209 ? 63.948 -14.925 -100.725 1.00 13.08  ? 209  TYR A C     1 
ATOM   2088 O  O     . TYR C 3 209 ? 64.339 -16.093 -100.873 1.00 13.43  ? 209  TYR A O     1 
ATOM   2089 C  CB    . TYR C 3 209 ? 63.419 -13.431 -102.683 1.00 11.78  ? 209  TYR A CB    1 
ATOM   2090 C  CG    . TYR C 3 209 ? 64.621 -14.011 -103.374 1.00 11.96  ? 209  TYR A CG    1 
ATOM   2091 C  CD1   . TYR C 3 209 ? 64.549 -15.199 -104.102 1.00 11.72  ? 209  TYR A CD1   1 
ATOM   2092 C  CD2   . TYR C 3 209 ? 65.848 -13.416 -103.335 1.00 17.53  ? 209  TYR A CD2   1 
ATOM   2093 C  CE1   . TYR C 3 209 ? 65.670 -15.737 -104.736 1.00 12.00  ? 209  TYR A CE1   1 
ATOM   2094 C  CE2   . TYR C 3 209 ? 66.981 -13.900 -103.948 1.00 18.24  ? 209  TYR A CE2   1 
ATOM   2095 C  CZ    . TYR C 3 209 ? 66.870 -15.090 -104.674 1.00 14.84  ? 209  TYR A CZ    1 
ATOM   2096 O  OH    . TYR C 3 209 ? 68.033 -15.559 -105.263 1.00 17.52  ? 209  TYR A OH    1 
ATOM   2097 N  N     . ALA C 3 210 ? 64.443 -14.141 -99.776  1.00 12.67  ? 210  ALA A N     1 
ATOM   2098 C  CA    . ALA C 3 210 ? 65.572 -14.562 -98.951  1.00 14.22  ? 210  ALA A CA    1 
ATOM   2099 C  C     . ALA C 3 210 ? 65.177 -15.637 -97.922  1.00 14.50  ? 210  ALA A C     1 
ATOM   2100 O  O     . ALA C 3 210 ? 66.071 -16.425 -97.580  1.00 17.88  ? 210  ALA A O     1 
ATOM   2101 C  CB    . ALA C 3 210 ? 66.150 -13.358 -98.224  1.00 16.07  ? 210  ALA A CB    1 
ATOM   2102 N  N     . THR C 3 211 ? 63.931 -15.617 -97.429  1.00 15.25  ? 211  THR A N     1 
ATOM   2103 C  CA    . THR C 3 211 ? 63.694 -16.433 -96.202  1.00 15.92  ? 211  THR A CA    1 
ATOM   2104 C  C     . THR C 3 211 ? 62.446 -17.271 -96.252  1.00 16.48  ? 211  THR A C     1 
ATOM   2105 O  O     . THR C 3 211 ? 62.233 -18.059 -95.334  1.00 19.78  ? 211  THR A O     1 
ATOM   2106 C  CB    . THR C 3 211 ? 63.674 -15.543 -94.920  1.00 16.57  ? 211  THR A CB    1 
ATOM   2107 O  OG1   . THR C 3 211 ? 62.538 -14.685 -94.999  1.00 16.42  ? 211  THR A OG1   1 
ATOM   2108 C  CG2   . THR C 3 211 ? 64.914 -14.676 -94.713  1.00 18.63  ? 211  THR A CG2   1 
ATOM   2109 N  N     . ARG C 3 212 ? 61.553 -17.173 -97.272  1.00 15.64  ? 212  ARG A N     1 
ATOM   2110 C  CA    . ARG C 3 212 ? 60.368 -18.003 -97.218  1.00 17.75  ? 212  ARG A CA    1 
ATOM   2111 C  C     . ARG C 3 212 ? 60.712 -19.472 -97.407  1.00 19.99  ? 212  ARG A C     1 
ATOM   2112 O  O     . ARG C 3 212 ? 60.033 -20.331 -96.806  1.00 27.03  ? 212  ARG A O     1 
ATOM   2113 C  CB    . ARG C 3 212 ? 59.361 -17.504 -98.280  1.00 17.96  ? 212  ARG A CB    1 
ATOM   2114 C  CG    . ARG C 3 212 ? 58.051 -18.306 -98.211  1.00 17.72  ? 212  ARG A CG    1 
ATOM   2115 C  CD    . ARG C 3 212 ? 57.004 -17.688 -99.138  1.00 17.92  ? 212  ARG A CD    1 
ATOM   2116 N  NE    . ARG C 3 212 ? 55.750 -18.410 -98.970  1.00 17.25  ? 212  ARG A NE    1 
ATOM   2117 C  CZ    . ARG C 3 212 ? 54.794 -18.554 -99.883  1.00 16.35  ? 212  ARG A CZ    1 
ATOM   2118 N  NH1   . ARG C 3 212 ? 54.941 -18.002 -101.087 1.00 15.93  ? 212  ARG A NH1   1 
ATOM   2119 N  NH2   . ARG C 3 212 ? 53.707 -19.250 -99.592  1.00 18.19  ? 212  ARG A NH2   1 
ATOM   2120 N  N     . GLY C 3 213 ? 61.739 -19.776 -98.188  1.00 20.15  ? 213  GLY A N     1 
ATOM   2121 C  CA    . GLY C 3 213 ? 62.180 -21.191 -98.316  1.00 30.27  ? 213  GLY A CA    1 
ATOM   2122 C  C     . GLY C 3 213 ? 62.980 -21.665 -97.123  1.00 38.76  ? 213  GLY A C     1 
ATOM   2123 O  O     . GLY C 3 213 ? 63.222 -21.064 -96.084  1.00 45.01  ? 213  GLY A O     1 
ATOM   2124 N  N     . ALA C 3 223 ? 65.111 -14.273 -88.032  1.00 57.91  ? 223  ALA A N     1 
ATOM   2125 C  CA    . ALA C 3 223 ? 63.854 -13.629 -88.472  1.00 41.91  ? 223  ALA A CA    1 
ATOM   2126 C  C     . ALA C 3 223 ? 63.472 -13.967 -89.903  1.00 32.63  ? 223  ALA A C     1 
ATOM   2127 O  O     . ALA C 3 223 ? 64.192 -13.834 -90.911  1.00 32.71  ? 223  ALA A O     1 
ATOM   2128 C  CB    . ALA C 3 223 ? 63.959 -12.127 -88.266  1.00 54.69  ? 223  ALA A CB    1 
ATOM   2129 N  N     . LEU C 3 224 ? 62.248 -14.495 -90.039  1.00 25.82  ? 224  LEU A N     1 
ATOM   2130 C  CA    . LEU C 3 224 ? 61.866 -15.117 -91.305  1.00 23.33  ? 224  LEU A CA    1 
ATOM   2131 C  C     . LEU C 3 224 ? 60.537 -14.572 -91.826  1.00 20.66  ? 224  LEU A C     1 
ATOM   2132 O  O     . LEU C 3 224 ? 59.651 -14.214 -91.010  1.00 20.84  ? 224  LEU A O     1 
ATOM   2133 C  CB    . LEU C 3 224 ? 61.748 -16.638 -91.126  1.00 28.69  ? 224  LEU A CB    1 
ATOM   2134 C  CG    . LEU C 3 224 ? 62.971 -17.387 -90.626  1.00 33.56  ? 224  LEU A CG    1 
ATOM   2135 C  CD1   . LEU C 3 224 ? 62.707 -18.894 -90.485  1.00 39.29  ? 224  LEU A CD1   1 
ATOM   2136 C  CD2   . LEU C 3 224 ? 64.169 -17.195 -91.538  1.00 34.80  ? 224  LEU A CD2   1 
ATOM   2137 N  N     . PHE C 3 225 ? 60.433 -14.552 -93.125  1.00 17.32  ? 225  PHE A N     1 
ATOM   2138 C  CA    . PHE C 3 225 ? 59.196 -14.106 -93.723  1.00 17.03  ? 225  PHE A CA    1 
ATOM   2139 C  C     . PHE C 3 225 ? 57.990 -14.848 -93.215  1.00 17.62  ? 225  PHE A C     1 
ATOM   2140 O  O     . PHE C 3 225 ? 57.974 -16.079 -93.094  1.00 19.10  ? 225  PHE A O     1 
ATOM   2141 C  CB    . PHE C 3 225 ? 59.323 -14.298 -95.267  1.00 17.94  ? 225  PHE A CB    1 
ATOM   2142 C  CG    . PHE C 3 225 ? 58.021 -13.942 -95.981  1.00 17.01  ? 225  PHE A CG    1 
ATOM   2143 C  CD1   . PHE C 3 225 ? 57.731 -12.627 -96.279  1.00 18.42  ? 225  PHE A CD1   1 
ATOM   2144 C  CD2   . PHE C 3 225 ? 57.106 -14.904 -96.355  1.00 18.98  ? 225  PHE A CD2   1 
ATOM   2145 C  CE1   . PHE C 3 225 ? 56.542 -12.279 -96.909  1.00 17.23  ? 225  PHE A CE1   1 
ATOM   2146 C  CE2   . PHE C 3 225 ? 55.912 -14.571 -96.936  1.00 18.26  ? 225  PHE A CE2   1 
ATOM   2147 C  CZ    . PHE C 3 225 ? 55.599 -13.257 -97.220  1.00 17.35  ? 225  PHE A CZ    1 
ATOM   2148 N  N     . ARG C 3 226 ? 56.911 -14.100 -92.981  1.00 17.95  ? 226  ARG A N     1 
ATOM   2149 C  CA    . ARG C 3 226 ? 55.636 -14.765 -92.658  1.00 18.96  ? 226  ARG A CA    1 
ATOM   2150 C  C     . ARG C 3 226 ? 54.473 -13.907 -93.139  1.00 16.47  ? 226  ARG A C     1 
ATOM   2151 O  O     . ARG C 3 226 ? 54.695 -12.680 -93.264  1.00 16.99  ? 226  ARG A O     1 
ATOM   2152 C  CB    . ARG C 3 226 ? 55.484 -15.059 -91.167  1.00 21.09  ? 226  ARG A CB    1 
ATOM   2153 C  CG    . ARG C 3 226 ? 55.407 -13.838 -90.287  1.00 23.32  ? 226  ARG A CG    1 
ATOM   2154 C  CD    . ARG C 3 226 ? 54.975 -14.228 -88.864  1.00 29.65  ? 226  ARG A CD    1 
ATOM   2155 N  NE    . ARG C 3 226 ? 54.744 -12.973 -88.077  1.00 33.66  ? 226  ARG A NE    1 
ATOM   2156 C  CZ    . ARG C 3 226 ? 55.813 -12.387 -87.510  1.00 31.07  ? 226  ARG A CZ    1 
ATOM   2157 N  NH1   . ARG C 3 226 ? 57.020 -12.984 -87.696  1.00 33.87  ? 226  ARG A NH1   1 
ATOM   2158 N  NH2   . ARG C 3 226 ? 55.687 -11.280 -86.839  1.00 27.71  ? 226  ARG A NH2   1 
ATOM   2159 N  N     . PHE C 3 227 ? 53.290 -14.484 -93.407  1.00 15.89  ? 227  PHE A N     1 
ATOM   2160 C  CA    . PHE C 3 227 ? 52.165 -13.650 -93.803  1.00 14.98  ? 227  PHE A CA    1 
ATOM   2161 C  C     . PHE C 3 227 ? 51.600 -12.939 -92.581  1.00 14.57  ? 227  PHE A C     1 
ATOM   2162 O  O     . PHE C 3 227 ? 51.365 -13.608 -91.560  1.00 17.23  ? 227  PHE A O     1 
ATOM   2163 C  CB    . PHE C 3 227 ? 51.071 -14.495 -94.437  1.00 15.49  ? 227  PHE A CB    1 
ATOM   2164 C  CG    . PHE C 3 227 ? 51.501 -15.186 -95.731  1.00 16.09  ? 227  PHE A CG    1 
ATOM   2165 C  CD1   . PHE C 3 227 ? 51.926 -14.399 -96.800  1.00 14.55  ? 227  PHE A CD1   1 
ATOM   2166 C  CD2   . PHE C 3 227 ? 51.465 -16.578 -95.842  1.00 18.30  ? 227  PHE A CD2   1 
ATOM   2167 C  CE1   . PHE C 3 227 ? 52.316 -15.003 -98.003  1.00 14.71  ? 227  PHE A CE1   1 
ATOM   2168 C  CE2   . PHE C 3 227 ? 51.867 -17.154 -97.049  1.00 18.93  ? 227  PHE A CE2   1 
ATOM   2169 C  CZ    . PHE C 3 227 ? 52.280 -16.370 -98.099  1.00 16.45  ? 227  PHE A CZ    1 
ATOM   2170 N  N     . LYS C 3 228 ? 51.343 -11.641 -92.705  1.00 14.00  ? 228  LYS A N     1 
ATOM   2171 C  CA    . LYS C 3 228 ? 50.681 -10.894 -91.652  1.00 14.87  ? 228  LYS A CA    1 
ATOM   2172 C  C     . LYS C 3 228 ? 49.189 -10.912 -91.828  1.00 14.90  ? 228  LYS A C     1 
ATOM   2173 O  O     . LYS C 3 228 ? 48.423 -10.868 -90.830  1.00 17.84  ? 228  LYS A O     1 
ATOM   2174 C  CB    . LYS C 3 228 ? 51.218 -9.436  -91.701  1.00 15.42  ? 228  LYS A CB    1 
ATOM   2175 C  CG    . LYS C 3 228 ? 52.738 -9.321  -91.563  1.00 15.76  ? 228  LYS A CG    1 
ATOM   2176 C  CD    . LYS C 3 228 ? 53.228 -9.958  -90.268  1.00 19.67  ? 228  LYS A CD    1 
ATOM   2177 C  CE    . LYS C 3 228 ? 54.746 -9.857  -90.230  1.00 23.24  ? 228  LYS A CE    1 
ATOM   2178 N  NZ    . LYS C 3 228 ? 55.274 -8.481  -90.312  1.00 27.89  ? 228  LYS A NZ    1 
ATOM   2179 N  N     . VAL C 3 229 ? 48.671 -10.953 -93.052  1.00 15.59  ? 229  VAL A N     1 
ATOM   2180 C  CA    . VAL C 3 229 ? 47.207 -10.949 -93.261  1.00 15.37  ? 229  VAL A CA    1 
ATOM   2181 C  C     . VAL C 3 229 ? 46.818 -11.949 -94.344  1.00 14.68  ? 229  VAL A C     1 
ATOM   2182 O  O     . VAL C 3 229 ? 45.662 -12.429 -94.303  1.00 16.95  ? 229  VAL A O     1 
ATOM   2183 C  CB    . VAL C 3 229 ? 46.583 -9.577  -93.602  1.00 20.26  ? 229  VAL A CB    1 
ATOM   2184 C  CG1   . VAL C 3 229 ? 46.669 -8.652  -92.362  1.00 26.42  ? 229  VAL A CG1   1 
ATOM   2185 C  CG2   . VAL C 3 229 ? 47.180 -8.916  -94.814  1.00 23.34  ? 229  VAL A CG2   1 
ATOM   2186 N  N     . PHE C 3 230 ? 47.673 -12.270 -95.312  1.00 14.44  ? 230  PHE A N     1 
ATOM   2187 C  CA    . PHE C 3 230 ? 47.216 -13.165 -96.388  1.00 14.08  ? 230  PHE A CA    1 
ATOM   2188 C  C     . PHE C 3 230 ? 46.730 -14.511 -95.839  1.00 15.88  ? 230  PHE A C     1 
ATOM   2189 O  O     . PHE C 3 230 ? 47.526 -15.138 -95.100  1.00 16.67  ? 230  PHE A O     1 
ATOM   2190 C  CB    . PHE C 3 230 ? 48.393 -13.364 -97.351  1.00 14.86  ? 230  PHE A CB    1 
ATOM   2191 C  CG    . PHE C 3 230 ? 48.135 -14.158 -98.612  1.00 14.54  ? 230  PHE A CG    1 
ATOM   2192 C  CD1   . PHE C 3 230 ? 47.315 -13.637 -99.613  1.00 16.30  ? 230  PHE A CD1   1 
ATOM   2193 C  CD2   . PHE C 3 230 ? 48.726 -15.425 -98.749  1.00 16.81  ? 230  PHE A CD2   1 
ATOM   2194 C  CE1   . PHE C 3 230 ? 47.143 -14.371 -100.798 1.00 17.49  ? 230  PHE A CE1   1 
ATOM   2195 C  CE2   . PHE C 3 230 ? 48.555 -16.153 -99.942  1.00 18.43  ? 230  PHE A CE2   1 
ATOM   2196 C  CZ    . PHE C 3 230 ? 47.736 -15.609 -100.929 1.00 19.73  ? 230  PHE A CZ    1 
ATOM   2197 N  N     . HIS C 3 231 ? 45.503 -14.943 -96.173  1.00 17.07  ? 231  HIS A N     1 
ATOM   2198 C  CA    . HIS C 3 231 ? 44.906 -16.192 -95.686  1.00 18.20  ? 231  HIS A CA    1 
ATOM   2199 C  C     . HIS C 3 231 ? 44.733 -16.194 -94.162  1.00 19.89  ? 231  HIS A C     1 
ATOM   2200 O  O     . HIS C 3 231 ? 44.580 -17.273 -93.525  1.00 22.62  ? 231  HIS A O     1 
ATOM   2201 C  CB    . HIS C 3 231 ? 45.666 -17.447 -96.101  1.00 18.48  ? 231  HIS A CB    1 
ATOM   2202 C  CG    . HIS C 3 231 ? 45.576 -17.701 -97.562  1.00 23.80  ? 231  HIS A CG    1 
ATOM   2203 N  ND1   . HIS C 3 231 ? 45.904 -18.900 -98.111  1.00 32.19  ? 231  HIS A ND1   1 
ATOM   2204 C  CD2   . HIS C 3 231 ? 45.256 -16.885 -98.620  1.00 20.90  ? 231  HIS A CD2   1 
ATOM   2205 C  CE1   . HIS C 3 231 ? 45.742 -18.832 -99.434  1.00 29.38  ? 231  HIS A CE1   1 
ATOM   2206 N  NE2   . HIS C 3 231 ? 45.344 -17.619 -99.767  1.00 20.69  ? 231  HIS A NE2   1 
ATOM   2207 N  N     . ARG C 3 232 ? 44.703 -15.049 -93.515  1.00 17.79  ? 232  ARG A N     1 
ATOM   2208 C  CA    . ARG C 3 232 ? 44.502 -15.015 -92.056  1.00 18.65  ? 232  ARG A CA    1 
ATOM   2209 C  C     . ARG C 3 232 ? 43.181 -14.390 -91.662  1.00 16.69  ? 232  ARG A C     1 
ATOM   2210 O  O     . ARG C 3 232 ? 42.978 -13.886 -90.567  1.00 19.39  ? 232  ARG A O     1 
ATOM   2211 C  CB    . ARG C 3 232 ? 45.627 -14.203 -91.367  1.00 18.93  ? 232  ARG A CB    1 
ATOM   2212 C  CG    . ARG C 3 232 ? 46.934 -14.988 -91.512  1.00 22.65  ? 232  ARG A CG    1 
ATOM   2213 C  CD    . ARG C 3 232 ? 48.011 -14.318 -90.688  1.00 23.20  ? 232  ARG A CD    1 
ATOM   2214 N  NE    . ARG C 3 232 ? 47.999 -14.635 -89.275  1.00 29.03  ? 232  ARG A NE    1 
ATOM   2215 C  CZ    . ARG C 3 232 ? 49.026 -14.225 -88.529  1.00 32.77  ? 232  ARG A CZ    1 
ATOM   2216 N  NH1   . ARG C 3 232 ? 50.072 -13.531 -88.978  1.00 48.06  ? 232  ARG A NH1   1 
ATOM   2217 N  NH2   . ARG C 3 232 ? 48.991 -14.533 -87.253  1.00 49.19  ? 232  ARG A NH2   1 
ATOM   2218 N  N     . ASP C 3 233 ? 42.222 -14.390 -92.562  1.00 17.81  ? 233  ASP A N     1 
ATOM   2219 C  CA    . ASP C 3 233 ? 40.893 -13.946 -92.197  1.00 19.05  ? 233  ASP A CA    1 
ATOM   2220 C  C     . ASP C 3 233 ? 40.348 -14.730 -91.007  1.00 20.46  ? 233  ASP A C     1 
ATOM   2221 O  O     . ASP C 3 233 ? 40.468 -15.947 -90.845  1.00 21.69  ? 233  ASP A O     1 
ATOM   2222 C  CB    . ASP C 3 233 ? 39.905 -14.058 -93.355  1.00 21.27  ? 233  ASP A CB    1 
ATOM   2223 C  CG    . ASP C 3 233 ? 39.812 -15.453 -93.939  1.00 22.33  ? 233  ASP A CG    1 
ATOM   2224 O  OD1   . ASP C 3 233 ? 40.872 -15.967 -94.354  1.00 23.01  ? 233  ASP A OD1   1 
ATOM   2225 O  OD2   . ASP C 3 233 ? 38.732 -16.088 -94.047  1.00 27.10  ? 233  ASP A OD2   1 
ATOM   2226 N  N     . GLY C 3 234 ? 39.704 -13.979 -90.123  1.00 19.39  ? 234  GLY A N     1 
ATOM   2227 C  CA    . GLY C 3 234 ? 39.141 -14.524 -88.897  1.00 20.47  ? 234  GLY A CA    1 
ATOM   2228 C  C     . GLY C 3 234 ? 40.157 -14.514 -87.774  1.00 20.55  ? 234  GLY A C     1 
ATOM   2229 O  O     . GLY C 3 234 ? 39.773 -14.752 -86.605  1.00 24.69  ? 234  GLY A O     1 
ATOM   2230 N  N     . GLU C 3 235 ? 41.431 -14.263 -88.037  1.00 20.90  ? 235  GLU A N     1 
ATOM   2231 C  CA    . GLU C 3 235 ? 42.432 -14.173 -86.973  1.00 20.14  ? 235  GLU A CA    1 
ATOM   2232 C  C     . GLU C 3 235 ? 42.611 -12.725 -86.550  1.00 17.67  ? 235  GLU A C     1 
ATOM   2233 O  O     . GLU C 3 235 ? 42.430 -11.789 -87.329  1.00 17.50  ? 235  GLU A O     1 
ATOM   2234 C  CB    . GLU C 3 235 ? 43.779 -14.736 -87.470  1.00 21.38  ? 235  GLU A CB    1 
ATOM   2235 C  CG    . GLU C 3 235 ? 43.703 -16.176 -87.962  1.00 23.59  ? 235  GLU A CG    1 
ATOM   2236 C  CD    . GLU C 3 235 ? 44.964 -16.694 -88.628  1.00 31.35  ? 235  GLU A CD    1 
ATOM   2237 O  OE1   . GLU C 3 235 ? 46.102 -16.339 -88.259  1.00 37.57  ? 235  GLU A OE1   1 
ATOM   2238 O  OE2   . GLU C 3 235 ? 44.951 -17.532 -89.575  1.00 37.85  ? 235  GLU A OE2   1 
ATOM   2239 N  N     . PRO C 3 236 ? 43.042 -12.454 -85.321  1.00 19.76  ? 236  PRO A N     1 
ATOM   2240 C  CA    . PRO C 3 236 ? 43.354 -11.109 -84.907  1.00 18.77  ? 236  PRO A CA    1 
ATOM   2241 C  C     . PRO C 3 236 ? 44.631 -10.630 -85.575  1.00 20.29  ? 236  PRO A C     1 
ATOM   2242 O  O     . PRO C 3 236 ? 45.658 -11.305 -85.676  1.00 21.47  ? 236  PRO A O     1 
ATOM   2243 C  CB    . PRO C 3 236 ? 43.576 -11.174 -83.385  1.00 21.44  ? 236  PRO A CB    1 
ATOM   2244 C  CG    . PRO C 3 236 ? 43.469 -12.588 -83.035  1.00 25.79  ? 236  PRO A CG    1 
ATOM   2245 C  CD    . PRO C 3 236 ? 43.223 -13.435 -84.242  1.00 25.53  ? 236  PRO A CD    1 
ATOM   2246 N  N     . CYS C 3 237 ? 44.532 -9.383  -86.044  1.00 16.20  ? 237  CYS A N     1 
ATOM   2247 C  CA    . CYS C 3 237 ? 45.709 -8.674  -86.540  1.00 14.40  ? 237  CYS A CA    1 
ATOM   2248 C  C     . CYS C 3 237 ? 46.795 -8.587  -85.492  1.00 14.46  ? 237  CYS A C     1 
ATOM   2249 O  O     . CYS C 3 237 ? 46.545 -8.189  -84.370  1.00 17.47  ? 237  CYS A O     1 
ATOM   2250 C  CB    . CYS C 3 237 ? 45.247 -7.266  -86.926  1.00 14.41  ? 237  CYS A CB    1 
ATOM   2251 S  SG    . CYS C 3 237 ? 46.570 -6.128  -87.456  1.00 12.89  ? 237  CYS A SG    1 
ATOM   2252 N  N     . GLU C 3 238 ? 48.035 -8.886  -85.894  1.00 16.08  ? 238  GLU A N     1 
ATOM   2253 C  CA    . GLU C 3 238 ? 49.079 -8.822  -84.874  1.00 18.28  ? 238  GLU A CA    1 
ATOM   2254 C  C     . GLU C 3 238 ? 49.447 -7.392  -84.483  1.00 18.48  ? 238  GLU A C     1 
ATOM   2255 O  O     . GLU C 3 238 ? 50.108 -7.207  -83.437  1.00 19.21  ? 238  GLU A O     1 
ATOM   2256 C  CB    . GLU C 3 238 ? 50.293 -9.589  -85.342  1.00 21.57  ? 238  GLU A CB    1 
ATOM   2257 C  CG    . GLU C 3 238 ? 51.031 -8.956  -86.477  1.00 25.74  ? 238  GLU A CG    1 
ATOM   2258 C  CD    . GLU C 3 238 ? 52.198 -9.895  -86.830  1.00 31.12  ? 238  GLU A CD    1 
ATOM   2259 O  OE1   . GLU C 3 238 ? 53.347 -9.476  -86.648  1.00 38.47  ? 238  GLU A OE1   1 
ATOM   2260 O  OE2   . GLU C 3 238 ? 51.966 -11.035 -87.253  1.00 36.67  ? 238  GLU A OE2   1 
ATOM   2261 N  N     . ARG C 3 239 ? 49.014 -6.375  -85.241  1.00 14.67  ? 239  ARG A N     1 
ATOM   2262 C  CA    . ARG C 3 239 ? 49.312 -4.988  -84.918  1.00 14.14  ? 239  ARG A CA    1 
ATOM   2263 C  C     . ARG C 3 239 ? 48.250 -4.353  -84.021  1.00 13.20  ? 239  ARG A C     1 
ATOM   2264 O  O     . ARG C 3 239 ? 48.624 -3.730  -83.017  1.00 14.08  ? 239  ARG A O     1 
ATOM   2265 C  CB    . ARG C 3 239 ? 49.464 -4.161  -86.221  1.00 13.52  ? 239  ARG A CB    1 
ATOM   2266 C  CG    . ARG C 3 239 ? 49.760 -2.700  -85.967  1.00 13.38  ? 239  ARG A CG    1 
ATOM   2267 C  CD    . ARG C 3 239 ? 50.543 -2.119  -87.130  1.00 23.40  ? 239  ARG A CD    1 
ATOM   2268 N  NE    . ARG C 3 239 ? 49.832 -2.218  -88.319  1.00 20.92  ? 239  ARG A NE    1 
ATOM   2269 C  CZ    . ARG C 3 239 ? 50.165 -2.224  -89.602  1.00 14.32  ? 239  ARG A CZ    1 
ATOM   2270 N  NH1   . ARG C 3 239 ? 51.410 -2.146  -90.050  1.00 17.87  ? 239  ARG A NH1   1 
ATOM   2271 N  NH2   . ARG C 3 239 ? 49.168 -2.294  -90.459  1.00 14.69  ? 239  ARG A NH2   1 
ATOM   2272 N  N     . CYS C 3 240 ? 46.969 -4.540  -84.379  1.00 14.03  ? 240  CYS A N     1 
ATOM   2273 C  CA    . CYS C 3 240 ? 45.955 -3.801  -83.601  1.00 13.84  ? 240  CYS A CA    1 
ATOM   2274 C  C     . CYS C 3 240 ? 44.925 -4.747  -83.003  1.00 14.96  ? 240  CYS A C     1 
ATOM   2275 O  O     . CYS C 3 240 ? 44.036 -4.268  -82.278  1.00 17.11  ? 240  CYS A O     1 
ATOM   2276 C  CB    . CYS C 3 240 ? 45.246 -2.755  -84.492  1.00 13.48  ? 240  CYS A CB    1 
ATOM   2277 S  SG    . CYS C 3 240 ? 44.136 -3.522  -85.712  1.00 13.54  ? 240  CYS A SG    1 
ATOM   2278 N  N     . GLY C 3 241 ? 44.942 -6.030  -83.316  1.00 15.27  ? 241  GLY A N     1 
ATOM   2279 C  CA    . GLY C 3 241 ? 43.980 -6.944  -82.753  1.00 17.88  ? 241  GLY A CA    1 
ATOM   2280 C  C     . GLY C 3 241 ? 42.639 -7.027  -83.390  1.00 16.00  ? 241  GLY A C     1 
ATOM   2281 O  O     . GLY C 3 241 ? 41.831 -7.918  -83.047  1.00 18.51  ? 241  GLY A O     1 
ATOM   2282 N  N     . SER C 3 242 ? 42.304 -6.179  -84.364  1.00 15.59  ? 242  SER A N     1 
ATOM   2283 C  CA    . SER C 3 242 ? 41.035 -6.331  -85.073  1.00 15.67  ? 242  SER A CA    1 
ATOM   2284 C  C     . SER C 3 242 ? 41.049 -7.630  -85.877  1.00 15.50  ? 242  SER A C     1 
ATOM   2285 O  O     . SER C 3 242 ? 42.146 -8.144  -86.221  1.00 17.24  ? 242  SER A O     1 
ATOM   2286 C  CB    . SER C 3 242 ? 40.732 -5.137  -86.004  1.00 15.45  ? 242  SER A CB    1 
ATOM   2287 O  OG    . SER C 3 242 ? 40.444 -3.954  -85.256  1.00 18.46  ? 242  SER A OG    1 
ATOM   2288 N  N     . ILE C 3 243 ? 39.860 -8.135  -86.218  1.00 17.56  ? 243  ILE A N     1 
ATOM   2289 C  CA    . ILE C 3 243 ? 39.795 -9.386  -86.958  1.00 16.74  ? 243  ILE A CA    1 
ATOM   2290 C  C     . ILE C 3 243 ? 39.962 -9.140  -88.459  1.00 16.49  ? 243  ILE A C     1 
ATOM   2291 O  O     . ILE C 3 243 ? 39.289 -8.339  -89.099  1.00 16.34  ? 243  ILE A O     1 
ATOM   2292 C  CB    . ILE C 3 243 ? 38.483 -10.099 -86.650  1.00 20.20  ? 243  ILE A CB    1 
ATOM   2293 C  CG1   . ILE C 3 243 ? 38.256 -10.371 -85.148  1.00 21.57  ? 243  ILE A CG1   1 
ATOM   2294 C  CG2   . ILE C 3 243 ? 38.453 -11.408 -87.453  1.00 19.31  ? 243  ILE A CG2   1 
ATOM   2295 C  CD1   . ILE C 3 243 ? 39.321 -11.215 -84.482  1.00 28.39  ? 243  ILE A CD1   1 
ATOM   2296 N  N     . ILE C 3 244 ? 40.965 -9.857  -89.004  1.00 16.57  ? 244  ILE A N     1 
ATOM   2297 C  CA    . ILE C 3 244 ? 41.326 -9.714  -90.399  1.00 15.51  ? 244  ILE A CA    1 
ATOM   2298 C  C     . ILE C 3 244 ? 40.157 -10.179 -91.248  1.00 16.61  ? 244  ILE A C     1 
ATOM   2299 O  O     . ILE C 3 244 ? 39.520 -11.187 -90.900  1.00 17.38  ? 244  ILE A O     1 
ATOM   2300 C  CB    . ILE C 3 244 ? 42.601 -10.526 -90.682  1.00 15.82  ? 244  ILE A CB    1 
ATOM   2301 C  CG1   . ILE C 3 244 ? 43.796 -9.923  -89.930  1.00 16.43  ? 244  ILE A CG1   1 
ATOM   2302 C  CG2   . ILE C 3 244 ? 42.932 -10.635 -92.143  1.00 15.67  ? 244  ILE A CG2   1 
ATOM   2303 C  CD1   . ILE C 3 244 ? 44.919 -10.910 -89.691  1.00 19.27  ? 244  ILE A CD1   1 
ATOM   2304 N  N     . GLU C 3 245 ? 39.893 -9.440  -92.343  1.00 15.90  ? 245  GLU A N     1 
ATOM   2305 C  CA    . GLU C 3 245 ? 38.788 -9.755  -93.257  1.00 16.12  ? 245  GLU A CA    1 
ATOM   2306 C  C     . GLU C 3 245 ? 39.271 -10.227 -94.600  1.00 16.84  ? 245  GLU A C     1 
ATOM   2307 O  O     . GLU C 3 245 ? 40.379 -9.863  -95.050  1.00 17.17  ? 245  GLU A O     1 
ATOM   2308 C  CB    . GLU C 3 245 ? 37.933 -8.462  -93.406  1.00 18.14  ? 245  GLU A CB    1 
ATOM   2309 C  CG    . GLU C 3 245 ? 37.263 -8.141  -92.052  1.00 16.83  ? 245  GLU A CG    1 
ATOM   2310 C  CD    . GLU C 3 245 ? 36.354 -6.966  -92.125  1.00 20.47  ? 245  GLU A CD    1 
ATOM   2311 O  OE1   . GLU C 3 245 ? 36.054 -6.402  -93.187  1.00 21.72  ? 245  GLU A OE1   1 
ATOM   2312 O  OE2   . GLU C 3 245 ? 35.867 -6.517  -91.058  1.00 20.50  ? 245  GLU A OE2   1 
ATOM   2313 N  N     . LYS C 3 246 ? 38.445 -11.054 -95.245  1.00 17.27  ? 246  LYS A N     1 
ATOM   2314 C  CA    . LYS C 3 246 ? 38.607 -11.524 -96.603  1.00 17.44  ? 246  LYS A CA    1 
ATOM   2315 C  C     . LYS C 3 246 ? 37.476 -10.955 -97.428  1.00 16.20  ? 246  LYS A C     1 
ATOM   2316 O  O     . LYS C 3 246 ? 36.324 -11.102 -97.083  1.00 20.03  ? 246  LYS A O     1 
ATOM   2317 C  CB    . LYS C 3 246 ? 38.549 -13.042 -96.697  1.00 20.03  ? 246  LYS A CB    1 
ATOM   2318 C  CG    . LYS C 3 246 ? 38.755 -13.613 -98.108  1.00 23.84  ? 246  LYS A CG    1 
ATOM   2319 C  CD    . LYS C 3 246 ? 38.560 -15.134 -98.071  1.00 32.03  ? 246  LYS A CD    1 
ATOM   2320 C  CE    . LYS C 3 246 ? 38.614 -15.763 -99.456  1.00 40.01  ? 246  LYS A CE    1 
ATOM   2321 N  NZ    . LYS C 3 246 ? 37.259 -16.174 -99.910  1.00 61.94  ? 246  LYS A NZ    1 
ATOM   2322 N  N     . THR C 3 247 ? 37.877 -10.333 -98.518  1.00 18.07  ? 247  THR A N     1 
ATOM   2323 C  CA    . THR C 3 247 ? 36.935 -9.780  -99.519  1.00 18.19  ? 247  THR A CA    1 
ATOM   2324 C  C     . THR C 3 247 ? 37.515 -10.034 -100.910 1.00 17.18  ? 247  THR A C     1 
ATOM   2325 O  O     . THR C 3 247 ? 38.376 -10.903 -101.080 1.00 18.72  ? 247  THR A O     1 
ATOM   2326 C  CB    . THR C 3 247 ? 36.607 -8.314  -99.174  1.00 20.05  ? 247  THR A CB    1 
ATOM   2327 O  OG1   . THR C 3 247 ? 35.565 -7.799  -100.061 1.00 21.64  ? 247  THR A OG1   1 
ATOM   2328 C  CG2   . THR C 3 247 ? 37.806 -7.396  -99.299  1.00 22.28  ? 247  THR A CG2   1 
ATOM   2329 N  N     . THR C 3 248 ? 37.044 -9.321  -101.903 1.00 18.17  ? 248  THR A N     1 
ATOM   2330 C  CA    . THR C 3 248 ? 37.617 -9.315  -103.223 1.00 17.97  ? 248  THR A CA    1 
ATOM   2331 C  C     . THR C 3 248 ? 38.044 -7.883  -103.558 1.00 16.83  ? 248  THR A C     1 
ATOM   2332 O  O     . THR C 3 248 ? 37.392 -6.933  -103.117 1.00 20.60  ? 248  THR A O     1 
ATOM   2333 C  CB    . THR C 3 248 ? 36.671 -9.830  -104.314 1.00 20.17  ? 248  THR A CB    1 
ATOM   2334 O  OG1   . THR C 3 248 ? 35.578 -8.919  -104.388 1.00 26.16  ? 248  THR A OG1   1 
ATOM   2335 C  CG2   . THR C 3 248 ? 36.182 -11.226 -103.983 1.00 21.23  ? 248  THR A CG2   1 
ATOM   2336 N  N     . LEU C 3 249 ? 39.120 -7.791  -104.324 1.00 16.29  ? 249  LEU A N     1 
ATOM   2337 C  CA    . LEU C 3 249 ? 39.606 -6.502  -104.814 1.00 15.55  ? 249  LEU A CA    1 
ATOM   2338 C  C     . LEU C 3 249 ? 40.284 -6.734  -106.131 1.00 15.23  ? 249  LEU A C     1 
ATOM   2339 O  O     . LEU C 3 249 ? 41.172 -7.578  -106.251 1.00 16.78  ? 249  LEU A O     1 
ATOM   2340 C  CB    . LEU C 3 249 ? 40.565 -5.915  -103.773 1.00 17.26  ? 249  LEU A CB    1 
ATOM   2341 C  CG    . LEU C 3 249 ? 41.080 -4.502  -104.083 1.00 17.47  ? 249  LEU A CG    1 
ATOM   2342 C  CD1   . LEU C 3 249 ? 39.941 -3.519  -103.972 1.00 22.08  ? 249  LEU A CD1   1 
ATOM   2343 C  CD2   . LEU C 3 249 ? 42.230 -4.111  -103.158 1.00 19.01  ? 249  LEU A CD2   1 
ATOM   2344 N  N     . SER C 3 250 ? 39.897 -6.031  -107.194 1.00 17.74  ? 250  SER A N     1 
ATOM   2345 C  CA    . SER C 3 250 ? 40.421 -6.248  -108.542 1.00 17.42  ? 250  SER A CA    1 
ATOM   2346 C  C     . SER C 3 250 ? 40.206 -7.674  -109.010 1.00 19.06  ? 250  SER A C     1 
ATOM   2347 O  O     . SER C 3 250 ? 41.070 -8.234  -109.699 1.00 22.27  ? 250  SER A O     1 
ATOM   2348 C  CB    . SER C 3 250 ? 41.919 -5.925  -108.638 1.00 21.44  ? 250  SER A CB    1 
ATOM   2349 O  OG    . SER C 3 250 ? 42.297 -4.800  -107.853 1.00 17.44  ? 250  SER A OG    1 
ATOM   2350 N  N     . SER C 3 251 ? 39.018 -8.240  -108.664 1.00 19.45  ? 251  SER A N     1 
ATOM   2351 C  CA    . SER C 3 251 ? 38.632 -9.592  -109.115 1.00 22.31  ? 251  SER A CA    1 
ATOM   2352 C  C     . SER C 3 251 ? 39.616 -10.655 -108.589 1.00 18.61  ? 251  SER A C     1 
ATOM   2353 O  O     . SER C 3 251 ? 39.786 -11.715 -109.183 1.00 21.18  ? 251  SER A O     1 
ATOM   2354 C  CB    . SER C 3 251 ? 38.484 -9.687  -110.641 1.00 30.50  ? 251  SER A CB    1 
ATOM   2355 O  OG    . SER C 3 251 ? 37.502 -8.743  -111.032 1.00 32.20  ? 251  SER A OG    1 
ATOM   2356 N  N     . ARG C 3 252 ? 40.280 -10.402 -107.490 1.00 18.00  ? 252  ARG A N     1 
ATOM   2357 C  CA    . ARG C 3 252 ? 41.151 -11.346 -106.789 1.00 17.04  ? 252  ARG A CA    1 
ATOM   2358 C  C     . ARG C 3 252 ? 40.816 -11.300 -105.292 1.00 16.81  ? 252  ARG A C     1 
ATOM   2359 O  O     . ARG C 3 252 ? 40.243 -10.348 -104.779 1.00 17.38  ? 252  ARG A O     1 
ATOM   2360 C  CB    . ARG C 3 252 ? 42.592 -10.934 -106.995 1.00 17.00  ? 252  ARG A CB    1 
ATOM   2361 C  CG    . ARG C 3 252 ? 42.994 -10.746 -108.461 1.00 18.62  ? 252  ARG A CG    1 
ATOM   2362 C  CD    . ARG C 3 252 ? 43.069 -12.067 -109.254 1.00 18.65  ? 252  ARG A CD    1 
ATOM   2363 N  NE    . ARG C 3 252 ? 44.118 -12.917 -108.714 1.00 18.32  ? 252  ARG A NE    1 
ATOM   2364 C  CZ    . ARG C 3 252 ? 45.412 -12.780 -108.910 1.00 14.24  ? 252  ARG A CZ    1 
ATOM   2365 N  NH1   . ARG C 3 252 ? 45.873 -11.826 -109.682 1.00 18.17  ? 252  ARG A NH1   1 
ATOM   2366 N  NH2   . ARG C 3 252 ? 46.192 -13.645 -108.303 1.00 16.46  ? 252  ARG A NH2   1 
ATOM   2367 N  N     A PRO C 3 253 ? 41.119 -12.347 -104.544 0.59 17.46  ? 253  PRO A N     1 
ATOM   2368 N  N     B PRO C 3 253 ? 41.173 -12.356 -104.571 0.41 17.10  ? 253  PRO A N     1 
ATOM   2369 C  CA    A PRO C 3 253 ? 40.820 -12.269 -103.111 0.59 16.63  ? 253  PRO A CA    1 
ATOM   2370 C  CA    B PRO C 3 253 ? 41.009 -12.376 -103.121 0.41 16.25  ? 253  PRO A CA    1 
ATOM   2371 C  C     A PRO C 3 253 ? 41.670 -11.156 -102.522 0.59 14.93  ? 253  PRO A C     1 
ATOM   2372 C  C     B PRO C 3 253 ? 41.773 -11.242 -102.452 0.41 15.52  ? 253  PRO A C     1 
ATOM   2373 O  O     A PRO C 3 253 ? 42.676 -10.716 -103.062 0.59 17.52  ? 253  PRO A O     1 
ATOM   2374 O  O     B PRO C 3 253 ? 42.867 -10.871 -102.870 0.41 16.13  ? 253  PRO A O     1 
ATOM   2375 C  CB    A PRO C 3 253 ? 41.222 -13.657 -102.592 0.59 18.75  ? 253  PRO A CB    1 
ATOM   2376 C  CB    B PRO C 3 253 ? 41.639 -13.716 -102.718 0.41 17.64  ? 253  PRO A CB    1 
ATOM   2377 C  CG    A PRO C 3 253 ? 42.218 -14.141 -103.594 0.59 19.41  ? 253  PRO A CG    1 
ATOM   2378 C  CG    B PRO C 3 253 ? 41.712 -14.541 -103.943 0.41 15.27  ? 253  PRO A CG    1 
ATOM   2379 C  CD    A PRO C 3 253 ? 41.721 -13.637 -104.930 0.59 17.74  ? 253  PRO A CD    1 
ATOM   2380 C  CD    B PRO C 3 253 ? 41.733 -13.607 -105.121 0.41 17.46  ? 253  PRO A CD    1 
ATOM   2381 N  N     . PHE C 3 254 ? 41.214 -10.699 -101.366 1.00 15.25  ? 254  PHE A N     1 
ATOM   2382 C  CA    . PHE C 3 254 ? 41.934 -9.586  -100.723 1.00 15.12  ? 254  PHE A CA    1 
ATOM   2383 C  C     . PHE C 3 254 ? 41.796 -9.760  -99.224  1.00 15.47  ? 254  PHE A C     1 
ATOM   2384 O  O     . PHE C 3 254 ? 40.704 -10.040 -98.740  1.00 21.35  ? 254  PHE A O     1 
ATOM   2385 C  CB    . PHE C 3 254 ? 41.383 -8.249  -101.224 1.00 17.12  ? 254  PHE A CB    1 
ATOM   2386 C  CG    . PHE C 3 254 ? 42.230 -7.092  -100.715 1.00 15.67  ? 254  PHE A CG    1 
ATOM   2387 C  CD1   . PHE C 3 254 ? 43.525 -6.924  -101.199 1.00 18.34  ? 254  PHE A CD1   1 
ATOM   2388 C  CD2   . PHE C 3 254 ? 41.739 -6.228  -99.774  1.00 18.00  ? 254  PHE A CD2   1 
ATOM   2389 C  CE1   . PHE C 3 254 ? 44.305 -5.872  -100.726 1.00 18.72  ? 254  PHE A CE1   1 
ATOM   2390 C  CE2   . PHE C 3 254 ? 42.493 -5.140  -99.293  1.00 17.44  ? 254  PHE A CE2   1 
ATOM   2391 C  CZ    . PHE C 3 254 ? 43.784 -4.990  -99.762  1.00 19.02  ? 254  PHE A CZ    1 
ATOM   2392 N  N     . TYR C 3 255 ? 42.900 -9.600  -98.519  1.00 14.28  ? 255  TYR A N     1 
ATOM   2393 C  CA    . TYR C 3 255 ? 42.937 -9.761  -97.082  1.00 13.41  ? 255  TYR A CA    1 
ATOM   2394 C  C     . TYR C 3 255 ? 43.376 -8.449  -96.468  1.00 12.88  ? 255  TYR A C     1 
ATOM   2395 O  O     . TYR C 3 255 ? 44.344 -7.880  -97.003  1.00 14.40  ? 255  TYR A O     1 
ATOM   2396 C  CB    . TYR C 3 255 ? 43.909 -10.901 -96.659  1.00 13.96  ? 255  TYR A CB    1 
ATOM   2397 C  CG    . TYR C 3 255 ? 43.448 -12.249 -97.203  1.00 16.11  ? 255  TYR A CG    1 
ATOM   2398 C  CD1   . TYR C 3 255 ? 43.770 -12.723 -98.466  1.00 16.58  ? 255  TYR A CD1   1 
ATOM   2399 C  CD2   . TYR C 3 255 ? 42.620 -13.075 -96.420  1.00 16.92  ? 255  TYR A CD2   1 
ATOM   2400 C  CE1   . TYR C 3 255 ? 43.318 -13.941 -98.941  1.00 17.53  ? 255  TYR A CE1   1 
ATOM   2401 C  CE2   . TYR C 3 255 ? 42.177 -14.284 -96.893  1.00 18.24  ? 255  TYR A CE2   1 
ATOM   2402 C  CZ    . TYR C 3 255 ? 42.530 -14.737 -98.153  1.00 21.26  ? 255  TYR A CZ    1 
ATOM   2403 O  OH    . TYR C 3 255 ? 42.050 -15.970 -98.595  1.00 21.50  ? 255  TYR A OH    1 
ATOM   2404 N  N     . TRP C 3 256 ? 42.731 -7.968  -95.408  1.00 13.41  ? 256  TRP A N     1 
ATOM   2405 C  CA    . TRP C 3 256 ? 43.132 -6.680  -94.861  1.00 13.16  ? 256  TRP A CA    1 
ATOM   2406 C  C     . TRP C 3 256 ? 42.579 -6.579  -93.449  1.00 13.47  ? 256  TRP A C     1 
ATOM   2407 O  O     . TRP C 3 256 ? 41.690 -7.332  -93.047  1.00 14.12  ? 256  TRP A O     1 
ATOM   2408 C  CB    . TRP C 3 256 ? 42.588 -5.539  -95.747  1.00 13.59  ? 256  TRP A CB    1 
ATOM   2409 C  CG    . TRP C 3 256 ? 41.095 -5.499  -95.726  1.00 15.78  ? 256  TRP A CG    1 
ATOM   2410 C  CD1   . TRP C 3 256 ? 40.185 -6.420  -96.183  1.00 15.77  ? 256  TRP A CD1   1 
ATOM   2411 C  CD2   . TRP C 3 256 ? 40.358 -4.410  -95.179  1.00 16.23  ? 256  TRP A CD2   1 
ATOM   2412 N  NE1   . TRP C 3 256 ? 38.895 -5.976  -95.966  1.00 16.61  ? 256  TRP A NE1   1 
ATOM   2413 C  CE2   . TRP C 3 256 ? 38.974 -4.723  -95.335  1.00 16.16  ? 256  TRP A CE2   1 
ATOM   2414 C  CE3   . TRP C 3 256 ? 40.726 -3.198  -94.583  1.00 14.38  ? 256  TRP A CE3   1 
ATOM   2415 C  CZ2   . TRP C 3 256 ? 37.968 -3.865  -94.904  1.00 17.72  ? 256  TRP A CZ2   1 
ATOM   2416 C  CZ3   . TRP C 3 256 ? 39.707 -2.346  -94.153  1.00 16.27  ? 256  TRP A CZ3   1 
ATOM   2417 C  CH2   . TRP C 3 256 ? 38.360 -2.669  -94.304  1.00 17.08  ? 256  TRP A CH2   1 
ATOM   2418 N  N     . CYS C 3 257 ? 43.116 -5.632  -92.704  1.00 11.97  ? 257  CYS A N     1 
ATOM   2419 C  CA    . CYS C 3 257 ? 42.691 -5.334  -91.348  1.00 12.09  ? 257  CYS A CA    1 
ATOM   2420 C  C     . CYS C 3 257 ? 41.920 -4.022  -91.252  1.00 11.76  ? 257  CYS A C     1 
ATOM   2421 O  O     . CYS C 3 257 ? 42.477 -2.972  -91.570  1.00 12.42  ? 257  CYS A O     1 
ATOM   2422 C  CB    . CYS C 3 257 ? 43.887 -5.305  -90.398  1.00 13.09  ? 257  CYS A CB    1 
ATOM   2423 S  SG    . CYS C 3 257 ? 43.236 -4.954  -88.731  1.00 13.18  ? 257  CYS A SG    1 
ATOM   2424 N  N     . PRO C 3 258 ? 40.647 -4.078  -90.807  1.00 12.91  ? 258  PRO A N     1 
ATOM   2425 C  CA    . PRO C 3 258 ? 39.865 -2.837  -90.705  1.00 12.98  ? 258  PRO A CA    1 
ATOM   2426 C  C     . PRO C 3 258 ? 40.298 -1.916  -89.586  1.00 12.28  ? 258  PRO A C     1 
ATOM   2427 O  O     . PRO C 3 258 ? 39.853 -0.772  -89.561  1.00 14.08  ? 258  PRO A O     1 
ATOM   2428 C  CB    . PRO C 3 258 ? 38.427 -3.388  -90.486  1.00 14.35  ? 258  PRO A CB    1 
ATOM   2429 C  CG    . PRO C 3 258 ? 38.679 -4.646  -89.693  1.00 16.30  ? 258  PRO A CG    1 
ATOM   2430 C  CD    . PRO C 3 258 ? 39.860 -5.294  -90.406  1.00 14.64  ? 258  PRO A CD    1 
ATOM   2431 N  N     . GLY C 3 259 ? 41.145 -2.411  -88.680  1.00 12.21  ? 259  GLY A N     1 
ATOM   2432 C  CA    . GLY C 3 259 ? 41.541 -1.534  -87.567  1.00 12.59  ? 259  GLY A CA    1 
ATOM   2433 C  C     . GLY C 3 259 ? 42.776 -0.699  -87.896  1.00 11.71  ? 259  GLY A C     1 
ATOM   2434 O  O     . GLY C 3 259 ? 42.985 0.334   -87.244  1.00 12.97  ? 259  GLY A O     1 
ATOM   2435 N  N     . CYS C 3 260 ? 43.579 -1.128  -88.867  1.00 11.58  ? 260  CYS A N     1 
ATOM   2436 C  CA    . CYS C 3 260 ? 44.851 -0.396  -89.073  1.00 11.05  ? 260  CYS A CA    1 
ATOM   2437 C  C     . CYS C 3 260 ? 45.176 -0.170  -90.550  1.00 10.97  ? 260  CYS A C     1 
ATOM   2438 O  O     . CYS C 3 260 ? 46.255 0.337   -90.832  1.00 12.29  ? 260  CYS A O     1 
ATOM   2439 C  CB    . CYS C 3 260 ? 45.989 -1.097  -88.330  1.00 12.19  ? 260  CYS A CB    1 
ATOM   2440 S  SG    . CYS C 3 260 ? 46.369 -2.750  -88.950  1.00 12.32  ? 260  CYS A SG    1 
ATOM   2441 N  N     . GLN C 3 261 ? 44.275 -0.539  -91.465  1.00 11.11  ? 261  GLN A N     1 
ATOM   2442 C  CA    . GLN C 3 261 ? 44.454 -0.157  -92.867  1.00 11.30  ? 261  GLN A CA    1 
ATOM   2443 C  C     . GLN C 3 261 ? 43.366 0.846   -93.231  1.00 12.42  ? 261  GLN A C     1 
ATOM   2444 O  O     . GLN C 3 261 ? 42.172 0.604   -92.993  1.00 13.47  ? 261  GLN A O     1 
ATOM   2445 C  CB    . GLN C 3 261 ? 44.407 -1.379  -93.809  1.00 11.47  ? 261  GLN A CB    1 
ATOM   2446 C  CG    . GLN C 3 261 ? 45.685 -2.222  -93.664  1.00 11.48  ? 261  GLN A CG    1 
ATOM   2447 C  CD    . GLN C 3 261 ? 45.613 -3.430  -94.556  1.00 11.41  ? 261  GLN A CD    1 
ATOM   2448 O  OE1   . GLN C 3 261 ? 45.320 -4.527  -94.026  1.00 12.20  ? 261  GLN A OE1   1 
ATOM   2449 N  NE2   . GLN C 3 261 ? 45.866 -3.299  -95.872  1.00 12.82  ? 261  GLN A NE2   1 
ATOM   2450 N  N     . HIS C 3 262 ? 43.780 1.967   -93.809  1.00 12.80  ? 262  HIS A N     1 
ATOM   2451 C  CA    . HIS C 3 262 ? 42.875 3.064   -94.104  1.00 13.11  ? 262  HIS A CA    1 
ATOM   2452 C  C     . HIS C 3 262 ? 43.057 3.557   -95.525  1.00 21.32  ? 262  HIS A C     1 
ATOM   2453 O  O     . HIS C 3 262 ? 42.109 4.233   -95.942  1.00 30.52  ? 262  HIS A O     1 
ATOM   2454 C  CB    . HIS C 3 262 ? 43.133 4.258   -93.181  1.00 15.45  ? 262  HIS A CB    1 
ATOM   2455 C  CG    . HIS C 3 262 ? 43.066 3.799   -91.771  1.00 16.52  ? 262  HIS A CG    1 
ATOM   2456 N  ND1   . HIS C 3 262 ? 41.932 3.467   -91.093  1.00 18.57  ? 262  HIS A ND1   1 
ATOM   2457 C  CD2   . HIS C 3 262 ? 44.073 3.513   -90.941  1.00 20.49  ? 262  HIS A CD2   1 
ATOM   2458 C  CE1   . HIS C 3 262 ? 42.195 3.039   -89.848  1.00 18.50  ? 262  HIS A CE1   1 
ATOM   2459 N  NE2   . HIS C 3 262 ? 43.522 3.075   -89.784  1.00 20.99  ? 262  HIS A NE2   1 
ATOM   2460 O  OXT   . HIS C 3 262 ? 44.109 3.319   -96.120  1.00 25.97  ? 262  HIS A OXT   1 
HETATM 2461 ZN ZN    . ZN  D 4 .   ? 45.173 -4.233  -87.652  1.00 12.78  ? 501  ZN  A ZN    1 
HETATM 2462 S  S     . SO4 E 5 .   ? 64.001 -23.368 -101.880 0.91 19.90  ? 551  SO4 A S     1 
HETATM 2463 O  O1    . SO4 E 5 .   ? 64.082 -22.026 -102.384 0.91 23.48  ? 551  SO4 A O1    1 
HETATM 2464 O  O2    . SO4 E 5 .   ? 64.567 -24.400 -102.704 0.91 25.65  ? 551  SO4 A O2    1 
HETATM 2465 O  O3    . SO4 E 5 .   ? 64.613 -23.476 -100.567 0.91 40.05  ? 551  SO4 A O3    1 
HETATM 2466 O  O4    . SO4 E 5 .   ? 62.603 -23.780 -101.721 0.91 31.20  ? 551  SO4 A O4    1 
HETATM 2467 S  S     . SO4 F 5 .   ? 61.585 12.058  -98.392  0.65 22.93  ? 552  SO4 A S     1 
HETATM 2468 O  O1    . SO4 F 5 .   ? 61.972 10.753  -97.771  0.65 22.86  ? 552  SO4 A O1    1 
HETATM 2469 O  O2    . SO4 F 5 .   ? 62.742 12.955  -98.474  0.65 31.32  ? 552  SO4 A O2    1 
HETATM 2470 O  O3    . SO4 F 5 .   ? 61.127 11.711  -99.727  0.65 35.18  ? 552  SO4 A O3    1 
HETATM 2471 O  O4    . SO4 F 5 .   ? 60.572 12.712  -97.615  0.65 29.53  ? 552  SO4 A O4    1 
HETATM 2472 S  S     . SO4 G 5 .   ? 53.825 15.936  -96.539  0.50 28.36  ? 553  SO4 A S     1 
HETATM 2473 O  O1    . SO4 G 5 .   ? 52.658 16.276  -95.707  0.50 33.27  ? 553  SO4 A O1    1 
HETATM 2474 O  O2    . SO4 G 5 .   ? 54.745 15.050  -95.882  0.50 35.03  ? 553  SO4 A O2    1 
HETATM 2475 O  O3    . SO4 G 5 .   ? 53.357 15.302  -97.774  0.50 29.66  ? 553  SO4 A O3    1 
HETATM 2476 O  O4    . SO4 G 5 .   ? 54.488 17.186  -96.923  0.50 31.37  ? 553  SO4 A O4    1 
HETATM 2477 S  S     . SO4 H 5 .   ? 52.501 -22.111 -103.166 0.22 34.12  ? 554  SO4 A S     1 
HETATM 2478 O  O1    . SO4 H 5 .   ? 52.022 -21.784 -101.817 0.22 31.90  ? 554  SO4 A O1    1 
HETATM 2479 O  O2    . SO4 H 5 .   ? 53.657 -21.292 -103.512 0.22 26.68  ? 554  SO4 A O2    1 
HETATM 2480 O  O3    . SO4 H 5 .   ? 52.882 -23.520 -103.186 0.22 38.52  ? 554  SO4 A O3    1 
HETATM 2481 O  O4    . SO4 H 5 .   ? 51.427 -21.900 -104.136 0.22 31.04  ? 554  SO4 A O4    1 
HETATM 2482 S  S     . SO4 I 5 .   ? 42.032 0.821   -112.862 0.50 26.86  ? 555  SO4 A S     1 
HETATM 2483 O  O1    . SO4 I 5 .   ? 42.452 0.911   -114.282 0.50 34.31  ? 555  SO4 A O1    1 
HETATM 2484 O  O2    . SO4 I 5 .   ? 43.036 0.244   -112.005 0.50 29.54  ? 555  SO4 A O2    1 
HETATM 2485 O  O3    . SO4 I 5 .   ? 41.768 2.195   -112.401 0.50 37.26  ? 555  SO4 A O3    1 
HETATM 2486 O  O4    . SO4 I 5 .   ? 40.804 -0.001  -112.944 0.50 25.85  ? 555  SO4 A O4    1 
HETATM 2487 C  C1    . GOL J 6 .   ? 51.272 0.985   -118.871 1.00 26.85  ? 511  GOL A C1    1 
HETATM 2488 O  O1    . GOL J 6 .   ? 51.415 0.267   -120.090 1.00 48.10  ? 511  GOL A O1    1 
HETATM 2489 C  C2    . GOL J 6 .   ? 50.240 2.179   -118.967 1.00 19.93  ? 511  GOL A C2    1 
HETATM 2490 O  O2    . GOL J 6 .   ? 50.846 3.301   -118.304 1.00 26.06  ? 511  GOL A O2    1 
HETATM 2491 C  C3    . GOL J 6 .   ? 49.074 1.628   -118.091 1.00 36.08  ? 511  GOL A C3    1 
HETATM 2492 O  O3    . GOL J 6 .   ? 47.717 1.925   -118.110 1.00 62.79  ? 511  GOL A O3    1 
HETATM 2493 C  C1    . GOL K 6 .   ? 64.886 4.639   -94.547  0.65 45.53  ? 512  GOL A C1    1 
HETATM 2494 O  O1    . GOL K 6 .   ? 64.442 3.286   -94.642  0.65 50.72  ? 512  GOL A O1    1 
HETATM 2495 C  C2    . GOL K 6 .   ? 63.926 5.600   -95.293  0.65 42.39  ? 512  GOL A C2    1 
HETATM 2496 O  O2    . GOL K 6 .   ? 62.597 5.426   -94.835  0.65 51.21  ? 512  GOL A O2    1 
HETATM 2497 C  C3    . GOL K 6 .   ? 64.357 7.073   -95.345  0.65 44.26  ? 512  GOL A C3    1 
HETATM 2498 O  O3    . GOL K 6 .   ? 65.495 7.368   -96.126  0.65 56.12  ? 512  GOL A O3    1 
HETATM 2499 C  C1    . GOL L 6 .   ? 70.158 -44.830 -109.811 0.57 28.83  ? 513  GOL A C1    1 
HETATM 2500 O  O1    . GOL L 6 .   ? 69.133 -45.407 -108.983 0.57 48.34  ? 513  GOL A O1    1 
HETATM 2501 C  C2    . GOL L 6 .   ? 70.154 -45.698 -111.153 0.57 28.12  ? 513  GOL A C2    1 
HETATM 2502 O  O2    . GOL L 6 .   ? 69.166 -46.695 -110.945 0.57 36.08  ? 513  GOL A O2    1 
HETATM 2503 C  C3    . GOL L 6 .   ? 71.563 -46.304 -111.299 0.57 28.96  ? 513  GOL A C3    1 
HETATM 2504 O  O3    . GOL L 6 .   ? 71.843 -47.259 -112.286 0.57 22.30  ? 513  GOL A O3    1 
HETATM 2505 C  C1    . GOL M 6 .   ? 62.368 -1.930  -129.722 0.30 43.73  ? 514  GOL A C1    1 
HETATM 2506 O  O1    . GOL M 6 .   ? 61.213 -1.281  -129.203 0.30 53.58  ? 514  GOL A O1    1 
HETATM 2507 C  C2    . GOL M 6 .   ? 62.611 -3.272  -128.978 0.30 41.20  ? 514  GOL A C2    1 
HETATM 2508 O  O2    . GOL M 6 .   ? 61.728 -3.424  -127.879 0.30 37.64  ? 514  GOL A O2    1 
HETATM 2509 C  C3    . GOL M 6 .   ? 64.090 -3.468  -128.560 0.30 38.53  ? 514  GOL A C3    1 
HETATM 2510 O  O3    . GOL M 6 .   ? 64.757 -4.296  -129.509 0.30 33.20  ? 514  GOL A O3    1 
HETATM 2511 O  O     . HOH N 7 .   ? 46.387 -19.028 -119.786 1.00 27.44  ? 723  HOH B O     1 
HETATM 2512 O  O     . HOH N 7 .   ? 48.619 -25.816 -123.698 1.00 27.34  ? 745  HOH B O     1 
HETATM 2513 O  O     . HOH N 7 .   ? 38.995 -13.575 -113.299 1.00 28.14  ? 765  HOH B O     1 
HETATM 2514 O  O     . HOH N 7 .   ? 44.255 -30.942 -114.093 1.00 36.46  ? 772  HOH B O     1 
HETATM 2515 O  O     . HOH N 7 .   ? 38.331 -23.319 -114.689 1.00 33.79  ? 782  HOH B O     1 
HETATM 2516 O  O     . HOH N 7 .   ? 38.669 -2.950  -109.800 1.00 42.26  ? 845  HOH B O     1 
HETATM 2517 O  O     . HOH N 7 .   ? 42.829 -26.947 -119.685 1.00 44.07  ? 874  HOH B O     1 
HETATM 2518 O  O     . HOH N 7 .   ? 44.237 -26.342 -123.774 1.00 32.99  ? 877  HOH B O     1 
HETATM 2519 O  O     . HOH N 7 .   ? 33.501 -15.146 -124.470 1.00 45.97  ? 895  HOH B O     1 
HETATM 2520 O  O     . HOH N 7 .   ? 41.870 -8.632  -113.681 1.00 37.89  ? 903  HOH B O     1 
HETATM 2521 O  O     . HOH N 7 .   ? 37.459 -17.115 -115.552 1.00 43.01  ? 921  HOH B O     1 
HETATM 2522 O  O     . HOH N 7 .   ? 48.565 -27.859 -125.053 1.00 35.92  ? 938  HOH B O     1 
HETATM 2523 O  O     . HOH N 7 .   ? 47.193 -32.839 -111.769 1.00 46.97  ? 942  HOH B O     1 
HETATM 2524 O  O     . HOH N 7 .   ? 42.573 -28.660 -117.440 1.00 44.00  ? 971  HOH B O     1 
HETATM 2525 O  O     . HOH N 7 .   ? 43.978 -7.274  -115.454 1.00 44.55  ? 995  HOH B O     1 
HETATM 2526 O  O     . HOH N 7 .   ? 46.041 -30.911 -118.678 1.00 39.49  ? 1008 HOH B O     1 
HETATM 2527 O  O     . HOH N 7 .   ? 41.235 -24.825 -120.012 1.00 48.50  ? 1010 HOH B O     1 
HETATM 2528 O  O     . HOH N 7 .   ? 51.317 -31.464 -107.712 1.00 46.55  ? 1016 HOH B O     1 
HETATM 2529 O  O     . HOH N 7 .   ? 39.489 -27.795 -115.697 1.00 42.74  ? 1021 HOH B O     1 
HETATM 2530 O  O     . HOH N 7 .   ? 46.946 -24.951 -109.942 1.00 46.17  ? 1046 HOH B O     1 
HETATM 2531 O  O     . HOH N 7 .   ? 45.791 -24.160 -125.226 1.00 46.29  ? 1047 HOH B O     1 
HETATM 2532 O  O     . HOH N 7 .   ? 41.326 -31.444 -114.649 1.00 50.54  ? 1048 HOH B O     1 
HETATM 2533 O  O     . HOH N 7 .   ? 42.778 -14.252 -122.395 1.00 45.79  ? 1057 HOH B O     1 
HETATM 2534 O  O     . HOH N 7 .   ? 41.619 -3.106  -117.374 1.00 60.94  ? 1068 HOH B O     1 
HETATM 2535 O  O     . HOH O 7 .   ? 49.550 -9.766  -111.795 1.00 17.40  ? 638  HOH C O     1 
HETATM 2536 O  O     . HOH O 7 .   ? 50.551 -17.818 -103.190 1.00 19.58  ? 656  HOH C O     1 
HETATM 2537 O  O     . HOH O 7 .   ? 48.482 -11.039 -109.639 1.00 18.84  ? 664  HOH C O     1 
HETATM 2538 O  O     . HOH O 7 .   ? 42.474 -15.592 -108.251 1.00 20.51  ? 668  HOH C O     1 
HETATM 2539 O  O     . HOH O 7 .   ? 42.012 -16.811 -101.146 1.00 23.03  ? 696  HOH C O     1 
HETATM 2540 O  O     . HOH O 7 .   ? 42.562 -15.330 -110.989 1.00 22.33  ? 714  HOH C O     1 
HETATM 2541 O  O     . HOH O 7 .   ? 39.872 -15.704 -107.489 1.00 30.66  ? 755  HOH C O     1 
HETATM 2542 O  O     . HOH O 7 .   ? 36.996 -21.321 -112.910 1.00 43.91  ? 759  HOH C O     1 
HETATM 2543 O  O     . HOH O 7 .   ? 41.489 -17.731 -112.485 1.00 30.06  ? 764  HOH C O     1 
HETATM 2544 O  O     . HOH O 7 .   ? 37.796 -14.482 -104.180 1.00 30.90  ? 790  HOH C O     1 
HETATM 2545 O  O     . HOH O 7 .   ? 47.009 -11.954 -126.240 1.00 30.97  ? 819  HOH C O     1 
HETATM 2546 O  O     . HOH O 7 .   ? 45.926 -22.905 -108.069 1.00 33.44  ? 881  HOH C O     1 
HETATM 2547 O  O     . HOH O 7 .   ? 38.688 -19.381 -112.565 1.00 38.70  ? 885  HOH C O     1 
HETATM 2548 O  O     . HOH O 7 .   ? 38.932 -11.375 -122.681 1.00 34.59  ? 906  HOH C O     1 
HETATM 2549 O  O     . HOH O 7 .   ? 47.132 -8.433  -113.663 1.00 53.80  ? 909  HOH C O     1 
HETATM 2550 O  O     . HOH O 7 .   ? 51.963 -8.711  -122.575 1.00 36.27  ? 946  HOH C O     1 
HETATM 2551 O  O     . HOH O 7 .   ? 43.058 -11.569 -112.741 1.00 38.74  ? 965  HOH C O     1 
HETATM 2552 O  O     . HOH O 7 .   ? 50.431 -9.209  -124.805 1.00 60.85  ? 1031 HOH C O     1 
HETATM 2553 O  O     . HOH O 7 .   ? 46.163 -15.916 -120.681 1.00 40.36  ? 1036 HOH C O     1 
HETATM 2554 O  O     . HOH O 7 .   ? 40.122 -13.404 -123.923 1.00 35.66  ? 1042 HOH C O     1 
HETATM 2555 O  O     . HOH O 7 .   ? 46.018 -22.168 -105.432 1.00 56.10  ? 1063 HOH C O     1 
HETATM 2556 O  O     . HOH O 7 .   ? 40.901 -2.522  -125.479 1.00 58.68  ? 1066 HOH C O     1 
HETATM 2557 O  O     . HOH O 7 .   ? 46.432 -13.434 -120.872 1.00 43.24  ? 1072 HOH C O     1 
HETATM 2558 O  O     . HOH P 7 .   ? 72.473 -27.129 -119.245 1.00 11.05  ? 601  HOH A O     1 
HETATM 2559 O  O     . HOH P 7 .   ? 61.396 -13.164 -110.017 1.00 12.04  ? 602  HOH A O     1 
HETATM 2560 O  O     . HOH P 7 .   ? 58.337 0.370   -95.397  1.00 14.70  ? 603  HOH A O     1 
HETATM 2561 O  O     . HOH P 7 .   ? 75.770 -33.534 -119.032 1.00 12.16  ? 604  HOH A O     1 
HETATM 2562 O  O     . HOH P 7 .   ? 55.608 -11.051 -113.775 1.00 12.41  ? 605  HOH A O     1 
HETATM 2563 O  O     . HOH P 7 .   ? 49.599 5.598   -107.621 1.00 12.88  ? 606  HOH A O     1 
HETATM 2564 O  O     . HOH P 7 .   ? 60.362 -10.598 -109.164 1.00 12.48  ? 607  HOH A O     1 
HETATM 2565 O  O     . HOH P 7 .   ? 58.463 -21.207 -115.781 1.00 12.01  ? 608  HOH A O     1 
HETATM 2566 O  O     . HOH P 7 .   ? 46.138 -5.718  -97.404  1.00 13.35  ? 609  HOH A O     1 
HETATM 2567 O  O     . HOH P 7 .   ? 71.839 -37.858 -126.384 1.00 12.38  ? 610  HOH A O     1 
HETATM 2568 O  O     . HOH P 7 .   ? 53.524 -17.191 -111.833 1.00 13.42  ? 611  HOH A O     1 
HETATM 2569 O  O     . HOH P 7 .   ? 63.662 -11.792 -110.679 1.00 12.57  ? 612  HOH A O     1 
HETATM 2570 O  O     . HOH P 7 .   ? 55.620 -17.825 -113.517 1.00 12.10  ? 613  HOH A O     1 
HETATM 2571 O  O     . HOH P 7 .   ? 64.855 -4.453  -113.336 1.00 14.56  ? 614  HOH A O     1 
HETATM 2572 O  O     . HOH P 7 .   ? 52.980 -7.524  -94.351  1.00 14.63  ? 615  HOH A O     1 
HETATM 2573 O  O     . HOH P 7 .   ? 77.481 -27.691 -123.827 1.00 13.99  ? 616  HOH A O     1 
HETATM 2574 O  O     . HOH P 7 .   ? 56.234 -27.674 -124.547 1.00 14.38  ? 617  HOH A O     1 
HETATM 2575 O  O     . HOH P 7 .   ? 59.515 -16.872 -101.737 1.00 13.15  ? 618  HOH A O     1 
HETATM 2576 O  O     . HOH P 7 .   ? 57.448 5.950   -114.485 1.00 13.68  ? 619  HOH A O     1 
HETATM 2577 O  O     . HOH P 7 .   ? 62.257 -21.223 -119.493 1.00 13.14  ? 620  HOH A O     1 
HETATM 2578 O  O     . HOH P 7 .   ? 61.540 5.811   -111.565 1.00 13.47  ? 621  HOH A O     1 
HETATM 2579 O  O     . HOH P 7 .   ? 53.471 -3.915  -109.867 1.00 13.16  ? 622  HOH A O     1 
HETATM 2580 O  O     . HOH P 7 .   ? 47.675 1.990   -89.321  1.00 14.96  ? 623  HOH A O     1 
HETATM 2581 O  O     . HOH P 7 .   ? 55.969 -22.260 -109.967 1.00 16.44  ? 624  HOH A O     1 
HETATM 2582 O  O     . HOH P 7 .   ? 67.276 -19.111 -103.754 1.00 16.05  ? 625  HOH A O     1 
HETATM 2583 O  O     . HOH P 7 .   ? 58.454 -23.426 -110.617 1.00 15.01  ? 626  HOH A O     1 
HETATM 2584 O  O     . HOH P 7 .   ? 58.367 -10.480 -130.680 1.00 15.88  ? 627  HOH A O     1 
HETATM 2585 O  O     . HOH P 7 .   ? 68.712 -27.637 -107.638 1.00 16.42  ? 628  HOH A O     1 
HETATM 2586 O  O     . HOH P 7 .   ? 55.962 -9.187  -130.121 1.00 15.75  ? 629  HOH A O     1 
HETATM 2587 O  O     . HOH P 7 .   ? 63.086 -21.055 -135.437 1.00 16.33  ? 630  HOH A O     1 
HETATM 2588 O  O     . HOH P 7 .   ? 57.495 -5.208  -129.368 1.00 13.97  ? 631  HOH A O     1 
HETATM 2589 O  O     . HOH P 7 .   ? 65.827 -37.451 -116.976 1.00 15.59  ? 632  HOH A O     1 
HETATM 2590 O  O     . HOH P 7 .   ? 58.067 -18.844 -114.524 1.00 13.71  ? 633  HOH A O     1 
HETATM 2591 O  O     . HOH P 7 .   ? 64.091 -7.074  -97.278  1.00 16.78  ? 634  HOH A O     1 
HETATM 2592 O  O     . HOH P 7 .   ? 74.688 -39.988 -116.894 1.00 15.39  ? 635  HOH A O     1 
HETATM 2593 O  O     . HOH P 7 .   ? 59.542 -2.098  -95.828  1.00 17.82  ? 636  HOH A O     1 
HETATM 2594 O  O     . HOH P 7 .   ? 63.457 7.507   -112.260 1.00 17.46  ? 637  HOH A O     1 
HETATM 2595 O  O     . HOH P 7 .   ? 64.493 -31.906 -132.975 1.00 14.60  ? 639  HOH A O     1 
HETATM 2596 O  O     . HOH P 7 .   ? 51.319 -21.054 -118.079 1.00 16.44  ? 640  HOH A O     1 
HETATM 2597 O  O     . HOH P 7 .   ? 61.443 3.390   -112.833 1.00 16.52  ? 641  HOH A O     1 
HETATM 2598 O  O     . HOH P 7 .   ? 73.050 -24.706 -132.140 1.00 20.85  ? 642  HOH A O     1 
HETATM 2599 O  O     . HOH P 7 .   ? 38.025 -0.132  -91.466  1.00 15.97  ? 643  HOH A O     1 
HETATM 2600 O  O     . HOH P 7 .   ? 50.251 -7.177  -115.557 1.00 17.22  ? 644  HOH A O     1 
HETATM 2601 O  O     . HOH P 7 .   ? 66.721 -17.319 -101.637 1.00 18.87  ? 645  HOH A O     1 
HETATM 2602 O  O     . HOH P 7 .   ? 61.880 -6.518  -115.678 1.00 18.66  ? 646  HOH A O     1 
HETATM 2603 O  O     . HOH P 7 .   ? 48.753 7.962   -113.308 1.00 17.17  ? 647  HOH A O     1 
HETATM 2604 O  O     . HOH P 7 .   ? 45.391 1.084   -111.043 1.00 17.43  ? 648  HOH A O     1 
HETATM 2605 O  O     . HOH P 7 .   ? 70.006 -40.716 -111.882 1.00 19.58  ? 649  HOH A O     1 
HETATM 2606 O  O     . HOH P 7 .   ? 67.438 -12.571 -113.339 1.00 19.77  ? 650  HOH A O     1 
HETATM 2607 O  O     . HOH P 7 .   ? 39.517 1.300   -93.451  1.00 16.02  ? 651  HOH A O     1 
HETATM 2608 O  O     . HOH P 7 .   ? 42.606 -0.431  -109.370 1.00 18.84  ? 652  HOH A O     1 
HETATM 2609 O  O     . HOH P 7 .   ? 42.090 1.301   -84.689  1.00 18.97  ? 653  HOH A O     1 
HETATM 2610 O  O     . HOH P 7 .   ? 62.262 -29.834 -107.317 1.00 21.10  ? 654  HOH A O     1 
HETATM 2611 O  O     . HOH P 7 .   ? 59.403 3.158   -117.239 1.00 18.87  ? 655  HOH A O     1 
HETATM 2612 O  O     . HOH P 7 .   ? 66.080 -21.473 -104.247 1.00 16.84  ? 657  HOH A O     1 
HETATM 2613 O  O     . HOH P 7 .   ? 67.544 -15.567 -127.071 1.00 17.14  ? 658  HOH A O     1 
HETATM 2614 O  O     . HOH P 7 .   ? 66.702 -10.805 -100.953 1.00 17.56  ? 659  HOH A O     1 
HETATM 2615 O  O     . HOH P 7 .   ? 63.854 -18.463 -99.374  1.00 20.51  ? 660  HOH A O     1 
HETATM 2616 O  O     . HOH P 7 .   ? 62.117 -7.104  -120.476 1.00 16.26  ? 661  HOH A O     1 
HETATM 2617 O  O     . HOH P 7 .   ? 65.118 -9.018  -113.554 1.00 16.45  ? 662  HOH A O     1 
HETATM 2618 O  O     . HOH P 7 .   ? 58.703 -28.213 -134.253 1.00 19.58  ? 663  HOH A O     1 
HETATM 2619 O  O     . HOH P 7 .   ? 58.799 10.616  -99.643  1.00 16.84  ? 665  HOH A O     1 
HETATM 2620 O  O     . HOH P 7 .   ? 58.093 -12.869 -129.280 1.00 18.42  ? 666  HOH A O     1 
HETATM 2621 O  O     . HOH P 7 .   ? 56.799 -0.153  -117.849 1.00 20.09  ? 667  HOH A O     1 
HETATM 2622 O  O     . HOH P 7 .   ? 55.137 -6.971  -92.766  1.00 16.80  ? 669  HOH A O     1 
HETATM 2623 O  O     . HOH P 7 .   ? 36.865 -11.953 -90.905  1.00 21.91  ? 670  HOH A O     1 
HETATM 2624 O  O     . HOH P 7 .   ? 72.862 -27.233 -132.152 1.00 22.37  ? 671  HOH A O     1 
HETATM 2625 O  O     . HOH P 7 .   ? 57.908 6.273   -93.478  1.00 21.70  ? 672  HOH A O     1 
HETATM 2626 O  O     . HOH P 7 .   ? 36.062 -6.870  -95.898  1.00 20.35  ? 673  HOH A O     1 
HETATM 2627 O  O     . HOH P 7 .   ? 60.292 -4.066  -120.494 1.00 20.53  ? 674  HOH A O     1 
HETATM 2628 O  O     . HOH P 7 .   ? 36.765 -7.881  -88.787  1.00 21.97  ? 675  HOH A O     1 
HETATM 2629 O  O     . HOH P 7 .   ? 61.604 -9.099  -132.753 1.00 21.11  ? 676  HOH A O     1 
HETATM 2630 O  O     . HOH P 7 .   ? 59.827 -21.767 -105.661 1.00 19.06  ? 677  HOH A O     1 
HETATM 2631 O  O     . HOH P 7 .   ? 58.482 -20.596 -129.997 1.00 22.06  ? 678  HOH A O     1 
HETATM 2632 O  O     . HOH P 7 .   ? 36.251 -12.124 -93.592  1.00 22.27  ? 679  HOH A O     1 
HETATM 2633 O  O     . HOH P 7 .   ? 46.361 -4.755  -112.545 1.00 25.26  ? 680  HOH A O     1 
HETATM 2634 O  O     . HOH P 7 .   ? 53.401 -18.513 -103.484 1.00 19.33  ? 681  HOH A O     1 
HETATM 2635 O  O     . HOH P 7 .   ? 56.539 0.247   -93.252  1.00 24.19  ? 682  HOH A O     1 
HETATM 2636 O  O     . HOH P 7 .   ? 54.775 -10.386 -95.157  1.00 21.29  ? 683  HOH A O     1 
HETATM 2637 O  O     . HOH P 7 .   ? 59.979 4.978   -94.568  1.00 22.23  ? 684  HOH A O     1 
HETATM 2638 O  O     . HOH P 7 .   ? 49.476 4.117   -115.918 1.00 19.39  ? 685  HOH A O     1 
HETATM 2639 O  O     . HOH P 7 .   ? 44.535 -16.288 -101.973 1.00 22.19  ? 686  HOH A O     1 
HETATM 2640 O  O     . HOH P 7 .   ? 52.595 11.934  -102.696 1.00 20.06  ? 687  HOH A O     1 
HETATM 2641 O  O     . HOH P 7 .   ? 54.088 -5.363  -125.433 1.00 19.82  ? 688  HOH A O     1 
HETATM 2642 O  O     . HOH P 7 .   ? 49.523 5.179   -94.168  1.00 22.99  ? 689  HOH A O     1 
HETATM 2643 O  O     . HOH P 7 .   ? 66.335 -3.752  -100.159 1.00 24.08  ? 690  HOH A O     1 
HETATM 2644 O  O     . HOH P 7 .   ? 64.234 6.368   -98.385  1.00 25.68  ? 691  HOH A O     1 
HETATM 2645 O  O     . HOH P 7 .   ? 75.144 -26.403 -112.421 1.00 23.24  ? 692  HOH A O     1 
HETATM 2646 O  O     . HOH P 7 .   ? 61.825 -4.274  -124.257 1.00 23.30  ? 693  HOH A O     1 
HETATM 2647 O  O     . HOH P 7 .   ? 64.550 -35.676 -127.521 1.00 26.03  ? 694  HOH A O     1 
HETATM 2648 O  O     . HOH P 7 .   ? 58.694 11.209  -110.455 1.00 18.91  ? 695  HOH A O     1 
HETATM 2649 O  O     . HOH P 7 .   ? 63.035 9.619   -105.050 1.00 24.65  ? 697  HOH A O     1 
HETATM 2650 O  O     . HOH P 7 .   ? 55.804 -14.349 -128.770 1.00 26.86  ? 698  HOH A O     1 
HETATM 2651 O  O     . HOH P 7 .   ? 70.645 -17.277 -124.851 1.00 21.14  ? 699  HOH A O     1 
HETATM 2652 O  O     . HOH P 7 .   ? 38.349 -2.304  -86.735  1.00 25.54  ? 700  HOH A O     1 
HETATM 2653 O  O     . HOH P 7 .   ? 59.892 -24.980 -108.797 1.00 22.14  ? 701  HOH A O     1 
HETATM 2654 O  O     . HOH P 7 .   ? 62.309 -25.115 -107.170 1.00 25.85  ? 702  HOH A O     1 
HETATM 2655 O  O     . HOH P 7 .   ? 77.090 -33.430 -114.555 1.00 21.90  ? 703  HOH A O     1 
HETATM 2656 O  O     . HOH P 7 .   ? 44.480 8.706   -102.897 1.00 27.96  ? 704  HOH A O     1 
HETATM 2657 O  O     . HOH P 7 .   ? 51.035 -31.265 -123.231 1.00 31.00  ? 705  HOH A O     1 
HETATM 2658 O  O     . HOH P 7 .   ? 62.868 -18.310 -134.928 1.00 24.11  ? 706  HOH A O     1 
HETATM 2659 O  O     . HOH P 7 .   ? 66.760 -8.146  -127.818 1.00 23.78  ? 707  HOH A O     1 
HETATM 2660 O  O     . HOH P 7 .   ? 41.833 -3.117  -82.968  1.00 22.29  ? 708  HOH A O     1 
HETATM 2661 O  O     . HOH P 7 .   ? 63.329 -37.478 -116.154 1.00 25.53  ? 709  HOH A O     1 
HETATM 2662 O  O     . HOH P 7 .   ? 48.455 -17.467 -93.780  1.00 24.47  ? 710  HOH A O     1 
HETATM 2663 O  O     . HOH P 7 .   ? 65.309 -6.499  -130.528 1.00 33.34  ? 711  HOH A O     1 
HETATM 2664 O  O     . HOH P 7 .   ? 72.130 -38.989 -111.468 1.00 30.30  ? 712  HOH A O     1 
HETATM 2665 O  O     . HOH P 7 .   ? 57.182 -20.974 -100.859 1.00 30.16  ? 713  HOH A O     1 
HETATM 2666 O  O     . HOH P 7 .   ? 68.668 5.704   -106.671 1.00 21.34  ? 715  HOH A O     1 
HETATM 2667 O  O     . HOH P 7 .   ? 69.210 -31.949 -106.621 1.00 33.25  ? 716  HOH A O     1 
HETATM 2668 O  O     . HOH P 7 .   ? 38.032 -3.805  -107.228 1.00 36.98  ? 717  HOH A O     1 
HETATM 2669 O  O     . HOH P 7 .   ? 58.554 -17.427 -130.114 1.00 26.78  ? 718  HOH A O     1 
HETATM 2670 O  O     . HOH P 7 .   ? 44.708 -10.111 -111.648 1.00 22.51  ? 719  HOH A O     1 
HETATM 2671 O  O     . HOH P 7 .   ? 34.557 -8.980  -96.163  1.00 28.04  ? 720  HOH A O     1 
HETATM 2672 O  O     . HOH P 7 .   ? 79.888 -25.407 -120.214 1.00 26.85  ? 721  HOH A O     1 
HETATM 2673 O  O     . HOH P 7 .   ? 68.595 -14.123 -134.497 1.00 24.89  ? 722  HOH A O     1 
HETATM 2674 O  O     . HOH P 7 .   ? 59.779 -20.842 -132.488 1.00 31.92  ? 724  HOH A O     1 
HETATM 2675 O  O     . HOH P 7 .   ? 67.148 -8.592  -123.027 1.00 23.56  ? 725  HOH A O     1 
HETATM 2676 O  O     . HOH P 7 .   ? 73.628 -17.314 -113.642 1.00 30.44  ? 726  HOH A O     1 
HETATM 2677 O  O     . HOH P 7 .   ? 55.256 -22.460 -128.122 1.00 28.38  ? 727  HOH A O     1 
HETATM 2678 O  O     . HOH P 7 .   ? 52.750 -35.840 -118.941 1.00 26.04  ? 728  HOH A O     1 
HETATM 2679 O  O     . HOH P 7 .   ? 57.655 -37.756 -127.189 1.00 28.31  ? 729  HOH A O     1 
HETATM 2680 O  O     . HOH P 7 .   ? 54.977 -0.914  -120.275 1.00 24.74  ? 730  HOH A O     1 
HETATM 2681 O  O     . HOH P 7 .   ? 71.834 -20.425 -132.966 1.00 28.64  ? 731  HOH A O     1 
HETATM 2682 O  O     . HOH P 7 .   ? 52.974 -34.297 -121.793 1.00 30.85  ? 732  HOH A O     1 
HETATM 2683 O  O     . HOH P 7 .   ? 78.462 -26.818 -114.845 1.00 29.70  ? 733  HOH A O     1 
HETATM 2684 O  O     . HOH P 7 .   ? 43.380 3.670   -111.353 1.00 26.43  ? 734  HOH A O     1 
HETATM 2685 O  O     . HOH P 7 .   ? 45.884 -18.678 -102.523 1.00 26.91  ? 735  HOH A O     1 
HETATM 2686 O  O     . HOH P 7 .   ? 48.403 -9.057  -88.775  1.00 22.88  ? 736  HOH A O     1 
HETATM 2687 O  O     . HOH P 7 .   ? 68.789 -42.400 -110.023 1.00 26.36  ? 737  HOH A O     1 
HETATM 2688 O  O     . HOH P 7 .   ? 56.125 -31.311 -134.319 1.00 33.62  ? 738  HOH A O     1 
HETATM 2689 O  O     . HOH P 7 .   ? 61.427 -17.686 -132.431 1.00 26.96  ? 739  HOH A O     1 
HETATM 2690 O  O     . HOH P 7 .   ? 62.510 0.407   -94.492  1.00 29.57  ? 740  HOH A O     1 
HETATM 2691 O  O     . HOH P 7 .   ? 56.251 -41.184 -113.875 1.00 33.77  ? 741  HOH A O     1 
HETATM 2692 O  O     . HOH P 7 .   ? 41.562 -2.894  -109.586 1.00 28.52  ? 742  HOH A O     1 
HETATM 2693 O  O     . HOH P 7 .   ? 68.412 -1.812  -103.738 1.00 24.98  ? 743  HOH A O     1 
HETATM 2694 O  O     . HOH P 7 .   ? 53.501 -14.422 -121.256 1.00 34.25  ? 744  HOH A O     1 
HETATM 2695 O  O     . HOH P 7 .   ? 57.129 -11.166 -92.705  1.00 25.29  ? 746  HOH A O     1 
HETATM 2696 O  O     . HOH P 7 .   ? 53.201 0.891   -90.791  1.00 25.69  ? 747  HOH A O     1 
HETATM 2697 O  O     . HOH P 7 .   ? 71.730 -21.394 -107.737 1.00 27.09  ? 748  HOH A O     1 
HETATM 2698 O  O     . HOH P 7 .   ? 68.958 -17.204 -132.776 1.00 30.30  ? 749  HOH A O     1 
HETATM 2699 O  O     . HOH P 7 .   ? 41.013 -1.602  -100.869 1.00 26.78  ? 750  HOH A O     1 
HETATM 2700 O  O     . HOH P 7 .   ? 61.485 -42.184 -110.994 1.00 42.03  ? 751  HOH A O     1 
HETATM 2701 O  O     . HOH P 7 .   ? 66.526 -12.015 -137.050 1.00 37.04  ? 752  HOH A O     1 
HETATM 2702 O  O     . HOH P 7 .   ? 58.469 -1.281  -119.861 1.00 34.70  ? 753  HOH A O     1 
HETATM 2703 O  O     . HOH P 7 .   ? 71.700 -23.167 -133.946 1.00 27.97  ? 754  HOH A O     1 
HETATM 2704 O  O     . HOH P 7 .   ? 49.821 -23.650 -124.704 1.00 30.97  ? 756  HOH A O     1 
HETATM 2705 O  O     . HOH P 7 .   ? 64.291 11.432  -105.978 1.00 33.79  ? 757  HOH A O     1 
HETATM 2706 O  O     . HOH P 7 .   ? 55.544 -5.182  -89.643  1.00 28.77  ? 758  HOH A O     1 
HETATM 2707 O  O     . HOH P 7 .   ? 54.782 14.733  -106.677 1.00 32.13  ? 760  HOH A O     1 
HETATM 2708 O  O     . HOH P 7 .   ? 37.647 -13.791 -101.409 1.00 34.94  ? 761  HOH A O     1 
HETATM 2709 O  O     . HOH P 7 .   ? 52.071 -22.434 -109.969 1.00 25.00  ? 762  HOH A O     1 
HETATM 2710 O  O     . HOH P 7 .   ? 50.726 -4.740  -81.356  1.00 34.79  ? 763  HOH A O     1 
HETATM 2711 O  O     . HOH P 7 .   ? 60.438 -2.330  -123.165 1.00 38.16  ? 766  HOH A O     1 
HETATM 2712 O  O     . HOH P 7 .   ? 41.587 -17.682 -96.564  1.00 33.73  ? 767  HOH A O     1 
HETATM 2713 O  O     . HOH P 7 .   ? 37.356 -4.516  -101.642 1.00 28.39  ? 768  HOH A O     1 
HETATM 2714 O  O     . HOH P 7 .   ? 51.099 -19.003 -100.724 1.00 27.22  ? 769  HOH A O     1 
HETATM 2715 O  O     . HOH P 7 .   ? 48.506 -20.091 -121.973 1.00 33.74  ? 770  HOH A O     1 
HETATM 2716 O  O     . HOH P 7 .   ? 36.029 -14.671 -94.480  1.00 38.83  ? 771  HOH A O     1 
HETATM 2717 O  O     . HOH P 7 .   ? 50.559 0.031   -116.355 1.00 35.42  ? 773  HOH A O     1 
HETATM 2718 O  O     . HOH P 7 .   ? 65.436 -1.271  -99.701  1.00 26.60  ? 774  HOH A O     1 
HETATM 2719 O  O     . HOH P 7 .   ? 56.581 -36.988 -115.625 1.00 38.86  ? 775  HOH A O     1 
HETATM 2720 O  O     . HOH P 7 .   ? 35.136 -3.615  -89.866  1.00 41.17  ? 776  HOH A O     1 
HETATM 2721 O  O     . HOH P 7 .   ? 48.362 15.843  -109.792 1.00 36.09  ? 777  HOH A O     1 
HETATM 2722 O  O     . HOH P 7 .   ? 36.637 -7.053  -107.351 1.00 39.38  ? 778  HOH A O     1 
HETATM 2723 O  O     . HOH P 7 .   ? 58.145 -36.052 -111.593 1.00 31.71  ? 779  HOH A O     1 
HETATM 2724 O  O     . HOH P 7 .   ? 39.656 3.329   -91.986  1.00 26.81  ? 780  HOH A O     1 
HETATM 2725 O  O     . HOH P 7 .   ? 58.624 -12.046 -90.305  1.00 37.72  ? 781  HOH A O     1 
HETATM 2726 O  O     . HOH P 7 .   ? 58.294 -43.311 -111.293 1.00 42.46  ? 783  HOH A O     1 
HETATM 2727 O  O     . HOH P 7 .   ? 70.670 -6.336  -111.838 1.00 31.89  ? 784  HOH A O     1 
HETATM 2728 O  O     . HOH P 7 .   ? 46.793 -33.472 -115.451 1.00 31.56  ? 785  HOH A O     1 
HETATM 2729 O  O     . HOH P 7 .   ? 35.000 -5.416  -100.388 1.00 40.94  ? 786  HOH A O     1 
HETATM 2730 O  O     . HOH P 7 .   ? 67.563 2.031   -109.277 1.00 25.03  ? 787  HOH A O     1 
HETATM 2731 O  O     . HOH P 7 .   ? 53.223 -0.858  -87.730  1.00 41.56  ? 788  HOH A O     1 
HETATM 2732 O  O     . HOH P 7 .   ? 48.677 -16.934 -118.249 1.00 35.30  ? 789  HOH A O     1 
HETATM 2733 O  O     . HOH P 7 .   ? 65.419 -30.381 -135.559 1.00 34.04  ? 791  HOH A O     1 
HETATM 2734 O  O     . HOH P 7 .   ? 77.150 -35.170 -120.777 1.00 15.93  ? 792  HOH A O     1 
HETATM 2735 O  O     . HOH P 7 .   ? 59.576 7.074   -113.106 1.00 14.41  ? 793  HOH A O     1 
HETATM 2736 O  O     . HOH P 7 .   ? 64.530 -6.753  -114.851 1.00 16.54  ? 794  HOH A O     1 
HETATM 2737 O  O     . HOH P 7 .   ? 74.493 -39.498 -119.569 1.00 17.29  ? 795  HOH A O     1 
HETATM 2738 O  O     . HOH P 7 .   ? 77.548 -32.654 -117.090 1.00 18.21  ? 796  HOH A O     1 
HETATM 2739 O  O     . HOH P 7 .   ? 37.956 -0.252  -84.930  1.00 18.09  ? 797  HOH A O     1 
HETATM 2740 O  O     . HOH P 7 .   ? 70.326 -29.869 -108.126 1.00 21.26  ? 798  HOH A O     1 
HETATM 2741 O  O     . HOH P 7 .   ? 78.104 -35.714 -113.776 1.00 19.71  ? 799  HOH A O     1 
HETATM 2742 O  O     . HOH P 7 .   ? 66.750 -8.805  -111.367 1.00 19.85  ? 800  HOH A O     1 
HETATM 2743 O  O     . HOH P 7 .   ? 62.638 -5.814  -118.172 1.00 21.48  ? 801  HOH A O     1 
HETATM 2744 O  O     . HOH P 7 .   ? 57.785 12.423  -101.512 1.00 21.37  ? 802  HOH A O     1 
HETATM 2745 O  O     . HOH P 7 .   ? 68.308 -8.243  -125.561 1.00 23.65  ? 803  HOH A O     1 
HETATM 2746 O  O     . HOH P 7 .   ? 60.165 2.145   -94.404  1.00 20.83  ? 804  HOH A O     1 
HETATM 2747 O  O     . HOH P 7 .   ? 66.402 -28.317 -106.195 1.00 21.87  ? 805  HOH A O     1 
HETATM 2748 O  O     . HOH P 7 .   ? 66.393 -11.445 -110.374 1.00 29.50  ? 806  HOH A O     1 
HETATM 2749 O  O     . HOH P 7 .   ? 59.977 -40.458 -117.183 1.00 26.06  ? 807  HOH A O     1 
HETATM 2750 O  O     . HOH P 7 .   ? 60.579 11.036  -105.623 1.00 23.56  ? 808  HOH A O     1 
HETATM 2751 O  O     . HOH P 7 .   ? 59.744 12.296  -108.061 1.00 24.96  ? 809  HOH A O     1 
HETATM 2752 O  O     . HOH P 7 .   ? 38.258 1.011   -95.863  1.00 27.29  ? 810  HOH A O     1 
HETATM 2753 O  O     . HOH P 7 .   ? 63.406 -5.380  -122.236 1.00 22.41  ? 811  HOH A O     1 
HETATM 2754 O  O     . HOH P 7 .   ? 61.922 -23.332 -104.922 1.00 25.47  ? 812  HOH A O     1 
HETATM 2755 O  O     . HOH P 7 .   ? 55.812 -23.058 -107.267 1.00 26.07  ? 813  HOH A O     1 
HETATM 2756 O  O     . HOH P 7 .   ? 41.727 -0.578  -82.482  1.00 22.63  ? 814  HOH A O     1 
HETATM 2757 O  O     . HOH P 7 .   ? 36.357 -3.844  -87.428  1.00 29.37  ? 815  HOH A O     1 
HETATM 2758 O  O     . HOH P 7 .   ? 55.106 12.983  -102.003 1.00 27.77  ? 816  HOH A O     1 
HETATM 2759 O  O     . HOH P 7 .   ? 58.664 -11.841 -133.045 1.00 24.69  ? 817  HOH A O     1 
HETATM 2760 O  O     . HOH P 7 .   ? 46.554 6.842   -114.558 1.00 28.01  ? 818  HOH A O     1 
HETATM 2761 O  O     . HOH P 7 .   ? 56.951 -8.910  -94.236  1.00 29.47  ? 820  HOH A O     1 
HETATM 2762 O  O     . HOH P 7 .   ? 35.317 -10.261 -89.355  1.00 26.26  ? 821  HOH A O     1 
HETATM 2763 O  O     . HOH P 7 .   ? 65.032 -37.822 -108.547 1.00 31.28  ? 822  HOH A O     1 
HETATM 2764 O  O     . HOH P 7 .   ? 65.662 -9.430  -97.036  1.00 26.43  ? 823  HOH A O     1 
HETATM 2765 O  O     . HOH P 7 .   ? 66.175 -5.931  -98.633  1.00 26.46  ? 824  HOH A O     1 
HETATM 2766 O  O     . HOH P 7 .   ? 43.143 -7.914  -111.472 1.00 34.46  ? 825  HOH A O     1 
HETATM 2767 O  O     . HOH P 7 .   ? 57.800 -21.970 -103.652 1.00 28.95  ? 826  HOH A O     1 
HETATM 2768 O  O     . HOH P 7 .   ? 64.926 -2.264  -115.148 1.00 35.92  ? 827  HOH A O     1 
HETATM 2769 O  O     . HOH P 7 .   ? 54.059 14.969  -100.126 1.00 33.06  ? 828  HOH A O     1 
HETATM 2770 O  O     . HOH P 7 .   ? 58.636 -23.856 -107.088 1.00 27.73  ? 829  HOH A O     1 
HETATM 2771 O  O     . HOH P 7 .   ? 50.782 -24.740 -127.379 1.00 32.58  ? 830  HOH A O     1 
HETATM 2772 O  O     . HOH P 7 .   ? 77.296 -19.786 -117.666 1.00 36.30  ? 831  HOH A O     1 
HETATM 2773 O  O     . HOH P 7 .   ? 68.624 -12.735 -100.781 1.00 27.18  ? 832  HOH A O     1 
HETATM 2774 O  O     . HOH P 7 .   ? 67.669 -9.492  -98.864  1.00 33.65  ? 833  HOH A O     1 
HETATM 2775 O  O     . HOH P 7 .   ? 35.056 -4.892  -97.371  1.00 28.38  ? 834  HOH A O     1 
HETATM 2776 O  O     . HOH P 7 .   ? 58.751 -4.130  -93.957  1.00 29.41  ? 835  HOH A O     1 
HETATM 2777 O  O     . HOH P 7 .   ? 79.892 -22.997 -119.126 1.00 38.45  ? 836  HOH A O     1 
HETATM 2778 O  O     . HOH P 7 .   ? 62.114 -39.273 -118.184 1.00 33.69  ? 837  HOH A O     1 
HETATM 2779 O  O     . HOH P 7 .   ? 69.672 4.339   -108.960 1.00 34.05  ? 838  HOH A O     1 
HETATM 2780 O  O     . HOH P 7 .   ? 39.313 -3.515  -99.982  1.00 31.80  ? 839  HOH A O     1 
HETATM 2781 O  O     . HOH P 7 .   ? 69.383 -8.594  -111.856 1.00 42.80  ? 840  HOH A O     1 
HETATM 2782 O  O     . HOH P 7 .   ? 55.680 -35.535 -127.405 1.00 38.07  ? 841  HOH A O     1 
HETATM 2783 O  O     . HOH P 7 .   ? 37.212 -15.004 -85.819  1.00 32.72  ? 842  HOH A O     1 
HETATM 2784 O  O     . HOH P 7 .   ? 68.845 0.185   -102.311 1.00 31.61  ? 843  HOH A O     1 
HETATM 2785 O  O     . HOH P 7 .   ? 55.645 14.919  -104.116 1.00 35.75  ? 844  HOH A O     1 
HETATM 2786 O  O     . HOH P 7 .   ? 70.972 -15.707 -112.962 1.00 38.75  ? 846  HOH A O     1 
HETATM 2787 O  O     . HOH P 7 .   ? 65.435 5.952   -113.377 1.00 33.31  ? 847  HOH A O     1 
HETATM 2788 O  O     . HOH P 7 .   ? 55.556 13.824  -111.109 1.00 41.98  ? 848  HOH A O     1 
HETATM 2789 O  O     . HOH P 7 .   ? 63.572 2.170   -113.761 1.00 40.09  ? 849  HOH A O     1 
HETATM 2790 O  O     . HOH P 7 .   ? 54.286 -7.491  -87.610  1.00 34.00  ? 850  HOH A O     1 
HETATM 2791 O  O     . HOH P 7 .   ? 68.670 -8.890  -119.184 1.00 32.26  ? 851  HOH A O     1 
HETATM 2792 O  O     . HOH P 7 .   ? 53.411 -17.272 -92.800  1.00 33.96  ? 852  HOH A O     1 
HETATM 2793 O  O     . HOH P 7 .   ? 49.116 -19.549 -95.886  1.00 35.34  ? 853  HOH A O     1 
HETATM 2794 O  O     . HOH P 7 .   ? 67.675 -11.494 -108.173 1.00 39.42  ? 854  HOH A O     1 
HETATM 2795 O  O     . HOH P 7 .   ? 66.079 -6.176  -122.073 1.00 26.03  ? 855  HOH A O     1 
HETATM 2796 O  O     . HOH P 7 .   ? 61.851 12.753  -102.001 1.00 37.29  ? 856  HOH A O     1 
HETATM 2797 O  O     . HOH P 7 .   ? 59.797 -18.241 -93.510  1.00 38.61  ? 857  HOH A O     1 
HETATM 2798 O  O     . HOH P 7 .   ? 42.370 -3.932  -112.019 1.00 41.02  ? 858  HOH A O     1 
HETATM 2799 O  O     . HOH P 7 .   ? 45.714 9.677   -115.289 1.00 42.82  ? 859  HOH A O     1 
HETATM 2800 O  O     . HOH P 7 .   ? 51.495 5.633   -120.421 1.00 33.25  ? 860  HOH A O     1 
HETATM 2801 O  O     . HOH P 7 .   ? 55.142 2.394   -92.286  1.00 36.25  ? 861  HOH A O     1 
HETATM 2802 O  O     . HOH P 7 .   ? 66.775 4.249   -99.254  1.00 28.80  ? 862  HOH A O     1 
HETATM 2803 O  O     . HOH P 7 .   ? 47.005 5.313   -116.722 1.00 38.99  ? 863  HOH A O     1 
HETATM 2804 O  O     . HOH P 7 .   ? 59.086 -18.701 -133.422 1.00 37.44  ? 864  HOH A O     1 
HETATM 2805 O  O     . HOH P 7 .   ? 48.283 -19.482 -103.569 1.00 33.30  ? 865  HOH A O     1 
HETATM 2806 O  O     . HOH P 7 .   ? 49.414 -19.671 -98.713  1.00 41.30  ? 866  HOH A O     1 
HETATM 2807 O  O     . HOH P 7 .   ? 36.171 -14.470 -90.234  1.00 38.12  ? 867  HOH A O     1 
HETATM 2808 O  O     . HOH P 7 .   ? 38.216 -12.912 -106.519 1.00 28.80  ? 868  HOH A O     1 
HETATM 2809 O  O     . HOH P 7 .   ? 70.008 -3.804  -103.258 1.00 37.46  ? 869  HOH A O     1 
HETATM 2810 O  O     . HOH P 7 .   ? 67.148 -9.678  -115.474 1.00 30.10  ? 870  HOH A O     1 
HETATM 2811 O  O     . HOH P 7 .   ? 52.731 -20.411 -125.333 1.00 37.36  ? 871  HOH A O     1 
HETATM 2812 O  O     . HOH P 7 .   ? 58.243 14.753  -107.674 1.00 48.09  ? 872  HOH A O     1 
HETATM 2813 O  O     . HOH P 7 .   ? 67.630 -7.934  -104.663 1.00 35.42  ? 873  HOH A O     1 
HETATM 2814 O  O     . HOH P 7 .   ? 64.005 -27.654 -106.454 1.00 36.14  ? 875  HOH A O     1 
HETATM 2815 O  O     . HOH P 7 .   ? 56.996 -42.652 -108.621 1.00 38.09  ? 876  HOH A O     1 
HETATM 2816 O  O     . HOH P 7 .   ? 49.923 15.388  -98.045  1.00 39.11  ? 878  HOH A O     1 
HETATM 2817 O  O     . HOH P 7 .   ? 49.704 -17.750 -91.668  1.00 39.21  ? 879  HOH A O     1 
HETATM 2818 O  O     . HOH P 7 .   ? 66.875 8.515   -110.016 1.00 32.33  ? 880  HOH A O     1 
HETATM 2819 O  O     . HOH P 7 .   ? 73.650 -17.122 -123.189 1.00 41.45  ? 882  HOH A O     1 
HETATM 2820 O  O     . HOH P 7 .   ? 34.761 -3.829  -93.269  1.00 36.22  ? 883  HOH A O     1 
HETATM 2821 O  O     . HOH P 7 .   ? 58.707 -23.282 -134.198 1.00 41.22  ? 884  HOH A O     1 
HETATM 2822 O  O     . HOH P 7 .   ? 37.529 -6.575  -85.558  1.00 41.81  ? 886  HOH A O     1 
HETATM 2823 O  O     . HOH P 7 .   ? 62.892 -39.336 -120.797 1.00 35.79  ? 887  HOH A O     1 
HETATM 2824 O  O     . HOH P 7 .   ? 52.353 -33.465 -108.165 1.00 43.51  ? 888  HOH A O     1 
HETATM 2825 O  O     . HOH P 7 .   ? 43.948 6.049   -113.094 1.00 29.42  ? 889  HOH A O     1 
HETATM 2826 O  O     . HOH P 7 .   ? 59.082 -28.116 -107.252 1.00 36.64  ? 890  HOH A O     1 
HETATM 2827 O  O     . HOH P 7 .   ? 71.932 -19.257 -109.033 1.00 39.17  ? 891  HOH A O     1 
HETATM 2828 O  O     . HOH P 7 .   ? 35.462 -10.378 -92.323  1.00 69.83  ? 892  HOH A O     1 
HETATM 2829 O  O     . HOH P 7 .   ? 66.295 -21.845 -97.466  1.00 44.42  ? 893  HOH A O     1 
HETATM 2830 O  O     . HOH P 7 .   ? 47.198 12.254  -111.520 1.00 45.44  ? 894  HOH A O     1 
HETATM 2831 O  O     . HOH P 7 .   ? 68.522 -13.370 -107.152 1.00 38.59  ? 896  HOH A O     1 
HETATM 2832 O  O     . HOH P 7 .   ? 44.082 -21.025 -101.805 1.00 38.58  ? 897  HOH A O     1 
HETATM 2833 O  O     . HOH P 7 .   ? 39.626 2.571   -98.438  1.00 38.66  ? 898  HOH A O     1 
HETATM 2834 O  O     . HOH P 7 .   ? 69.152 -40.992 -107.892 1.00 36.68  ? 899  HOH A O     1 
HETATM 2835 O  O     . HOH P 7 .   ? 48.836 11.283  -114.222 1.00 41.84  ? 900  HOH A O     1 
HETATM 2836 O  O     . HOH P 7 .   ? 68.730 -11.378 -121.368 1.00 43.42  ? 901  HOH A O     1 
HETATM 2837 O  O     . HOH P 7 .   ? 48.962 -21.029 -107.607 1.00 41.77  ? 902  HOH A O     1 
HETATM 2838 O  O     . HOH P 7 .   ? 40.788 -12.940 -111.595 1.00 30.06  ? 904  HOH A O     1 
HETATM 2839 O  O     . HOH P 7 .   ? 66.977 1.713   -111.712 1.00 36.41  ? 905  HOH A O     1 
HETATM 2840 O  O     . HOH P 7 .   ? 66.936 -30.951 -105.550 1.00 33.37  ? 907  HOH A O     1 
HETATM 2841 O  O     . HOH P 7 .   ? 69.222 -3.439  -113.739 1.00 33.61  ? 908  HOH A O     1 
HETATM 2842 O  O     . HOH P 7 .   ? 54.013 -3.306  -88.923  1.00 43.65  ? 910  HOH A O     1 
HETATM 2843 O  O     . HOH P 7 .   ? 68.440 -12.362 -110.871 1.00 32.68  ? 911  HOH A O     1 
HETATM 2844 O  O     . HOH P 7 .   ? 67.726 0.344   -99.672  1.00 41.89  ? 912  HOH A O     1 
HETATM 2845 O  O     . HOH P 7 .   ? 49.378 -25.615 -108.972 1.00 37.68  ? 913  HOH A O     1 
HETATM 2846 O  O     . HOH P 7 .   ? 53.135 -13.840 -127.858 1.00 36.48  ? 914  HOH A O     1 
HETATM 2847 O  O     . HOH P 7 .   ? 61.108 -11.228 -134.279 1.00 30.80  ? 915  HOH A O     1 
HETATM 2848 O  O     . HOH P 7 .   ? 66.642 11.810  -104.750 1.00 33.38  ? 917  HOH A O     1 
HETATM 2849 O  O     . HOH P 7 .   ? 33.274 -9.195  -99.441  1.00 49.30  ? 918  HOH A O     1 
HETATM 2850 O  O     . HOH P 7 .   ? 42.250 -18.099 -91.596  1.00 39.48  ? 919  HOH A O     1 
HETATM 2851 O  O     . HOH P 7 .   ? 34.559 -13.347 -97.509  1.00 42.01  ? 920  HOH A O     1 
HETATM 2852 O  O     . HOH P 7 .   ? 39.626 4.179   -96.402  1.00 41.31  ? 922  HOH A O     1 
HETATM 2853 O  O     . HOH P 7 .   ? 68.735 -15.476 -101.158 1.00 31.93  ? 923  HOH A O     1 
HETATM 2854 O  O     . HOH P 7 .   ? 51.361 -15.358 -119.765 1.00 56.01  ? 924  HOH A O     1 
HETATM 2855 O  O     . HOH P 7 .   ? 54.574 -43.119 -114.020 1.00 38.55  ? 925  HOH A O     1 
HETATM 2856 O  O     . HOH P 7 .   ? 67.051 -33.872 -107.398 1.00 38.34  ? 926  HOH A O     1 
HETATM 2857 O  O     . HOH P 7 .   ? 75.068 -26.738 -108.120 1.00 40.72  ? 927  HOH A O     1 
HETATM 2858 O  O     . HOH P 7 .   ? 69.933 -15.528 -108.060 1.00 38.89  ? 928  HOH A O     1 
HETATM 2859 O  O     . HOH P 7 .   ? 66.188 -39.963 -106.894 1.00 41.32  ? 929  HOH A O     1 
HETATM 2860 O  O     . HOH P 7 .   ? 69.263 3.610   -102.298 1.00 37.61  ? 930  HOH A O     1 
HETATM 2861 O  O     . HOH P 7 .   ? 66.710 -10.055 -103.579 1.00 40.26  ? 931  HOH A O     1 
HETATM 2862 O  O     . HOH P 7 .   ? 61.530 5.683   -92.203  1.00 35.30  ? 932  HOH A O     1 
HETATM 2863 O  O     . HOH P 7 .   ? 44.058 -5.483  -112.004 1.00 35.28  ? 933  HOH A O     1 
HETATM 2864 O  O     . HOH P 7 .   ? 72.004 -24.385 -135.863 1.00 43.04  ? 934  HOH A O     1 
HETATM 2865 O  O     . HOH P 7 .   ? 75.645 -16.191 -117.264 1.00 44.44  ? 935  HOH A O     1 
HETATM 2866 O  O     . HOH P 7 .   ? 52.146 14.532  -104.565 1.00 39.81  ? 936  HOH A O     1 
HETATM 2867 O  O     . HOH P 7 .   ? 70.137 -27.150 -105.353 1.00 33.16  ? 937  HOH A O     1 
HETATM 2868 O  O     . HOH P 7 .   ? 74.273 -17.924 -126.149 1.00 38.14  ? 939  HOH A O     1 
HETATM 2869 O  O     . HOH P 7 .   ? 56.037 -21.051 -130.013 1.00 37.27  ? 940  HOH A O     1 
HETATM 2870 O  O     . HOH P 7 .   ? 58.680 -25.941 -136.082 1.00 35.68  ? 941  HOH A O     1 
HETATM 2871 O  O     . HOH P 7 .   ? 76.667 -35.600 -109.755 1.00 39.67  ? 943  HOH A O     1 
HETATM 2872 O  O     . HOH P 7 .   ? 53.324 -1.917  -124.117 1.00 41.21  ? 944  HOH A O     1 
HETATM 2873 O  O     . HOH P 7 .   ? 67.718 8.310   -107.821 1.00 34.99  ? 945  HOH A O     1 
HETATM 2874 O  O     . HOH P 7 .   ? 57.342 -2.671  -89.379  1.00 41.35  ? 947  HOH A O     1 
HETATM 2875 O  O     . HOH P 7 .   ? 35.158 -12.825 -100.467 1.00 48.29  ? 948  HOH A O     1 
HETATM 2876 O  O     . HOH P 7 .   ? 33.370 -9.585  -102.579 1.00 39.20  ? 949  HOH A O     1 
HETATM 2877 O  O     . HOH P 7 .   ? 64.495 -32.418 -106.154 1.00 54.94  ? 950  HOH A O     1 
HETATM 2878 O  O     . HOH P 7 .   ? 58.726 -22.479 -98.997  1.00 49.50  ? 951  HOH A O     1 
HETATM 2879 O  O     . HOH P 7 .   ? 42.022 7.593   -104.663 1.00 40.86  ? 952  HOH A O     1 
HETATM 2880 O  O     . HOH P 7 .   ? 77.281 -27.702 -110.964 1.00 43.12  ? 953  HOH A O     1 
HETATM 2881 O  O     . HOH P 7 .   ? 54.841 -19.785 -96.409  1.00 48.16  ? 954  HOH A O     1 
HETATM 2882 O  O     . HOH P 7 .   ? 46.304 -19.367 -92.815  1.00 39.53  ? 955  HOH A O     1 
HETATM 2883 O  O     . HOH P 7 .   ? 62.480 -34.354 -107.208 1.00 49.28  ? 956  HOH A O     1 
HETATM 2884 O  O     . HOH P 7 .   ? 59.788 15.104  -98.502  1.00 43.69  ? 957  HOH A O     1 
HETATM 2885 O  O     . HOH P 7 .   ? 59.803 12.521  -103.381 1.00 24.24  ? 958  HOH A O     1 
HETATM 2886 O  O     . HOH P 7 .   ? 78.984 -20.744 -122.161 1.00 39.15  ? 959  HOH A O     1 
HETATM 2887 O  O     . HOH P 7 .   ? 38.248 -0.793  -82.155  0.50 33.99  ? 960  HOH A O     1 
HETATM 2888 O  O     . HOH P 7 .   ? 55.720 -21.532 -105.246 1.00 37.03  ? 961  HOH A O     1 
HETATM 2889 O  O     . HOH P 7 .   ? 57.821 -14.417 -133.539 1.00 28.53  ? 962  HOH A O     1 
HETATM 2890 O  O     . HOH P 7 .   ? 52.631 -5.441  -85.734  1.00 39.52  ? 963  HOH A O     1 
HETATM 2891 O  O     . HOH P 7 .   ? 79.533 -30.943 -117.029 1.00 35.22  ? 964  HOH A O     1 
HETATM 2892 O  O     . HOH P 7 .   ? 70.568 -14.022 -126.356 1.00 39.11  ? 966  HOH A O     1 
HETATM 2893 O  O     . HOH P 7 .   ? 68.670 -6.682  -102.851 1.00 28.96  ? 967  HOH A O     1 
HETATM 2894 O  O     . HOH P 7 .   ? 58.555 14.993  -100.727 1.00 35.43  ? 968  HOH A O     1 
HETATM 2895 O  O     . HOH P 7 .   ? 57.660 0.236   -89.070  1.00 43.44  ? 969  HOH A O     1 
HETATM 2896 O  O     . HOH P 7 .   ? 34.270 -11.643 -87.217  1.00 35.41  ? 970  HOH A O     1 
HETATM 2897 O  O     . HOH P 7 .   ? 65.569 -6.274  -117.380 1.00 33.01  ? 972  HOH A O     1 
HETATM 2898 O  O     . HOH P 7 .   ? 67.204 -27.749 -103.507 1.00 45.59  ? 973  HOH A O     1 
HETATM 2899 O  O     . HOH P 7 .   ? 57.852 -25.696 -105.967 1.00 52.77  ? 974  HOH A O     1 
HETATM 2900 O  O     . HOH P 7 .   ? 57.911 -20.310 -95.286  1.00 38.62  ? 975  HOH A O     1 
HETATM 2901 O  O     . HOH P 7 .   ? 53.683 -33.881 -127.274 1.00 39.58  ? 976  HOH A O     1 
HETATM 2902 O  O     . HOH P 7 .   ? 37.045 -1.915  -102.876 1.00 45.20  ? 977  HOH A O     1 
HETATM 2903 O  O     . HOH P 7 .   ? 53.238 -2.851  -84.813  1.00 38.57  ? 978  HOH A O     1 
HETATM 2904 O  O     . HOH P 7 .   ? 67.743 -4.293  -123.178 1.00 48.79  ? 979  HOH A O     1 
HETATM 2905 O  O     . HOH P 7 .   ? 78.675 -22.506 -116.002 1.00 37.01  ? 980  HOH A O     1 
HETATM 2906 O  O     . HOH P 7 .   ? 35.153 -14.663 -87.823  1.00 47.52  ? 981  HOH A O     1 
HETATM 2907 O  O     . HOH P 7 .   ? 50.515 8.115   -118.735 1.00 43.49  ? 982  HOH A O     1 
HETATM 2908 O  O     . HOH P 7 .   ? 72.896 -28.011 -105.656 1.00 51.95  ? 983  HOH A O     1 
HETATM 2909 O  O     . HOH P 7 .   ? 47.933 -21.951 -124.511 1.00 49.88  ? 984  HOH A O     1 
HETATM 2910 O  O     . HOH P 7 .   ? 70.615 -15.256 -103.947 1.00 49.22  ? 985  HOH A O     1 
HETATM 2911 O  O     . HOH P 7 .   ? 67.780 6.932   -111.895 1.00 41.87  ? 986  HOH A O     1 
HETATM 2912 O  O     . HOH P 7 .   ? 67.690 -18.198 -99.120  1.00 42.18  ? 987  HOH A O     1 
HETATM 2913 O  O     . HOH P 7 .   ? 34.702 -3.347  -85.336  1.00 36.61  ? 988  HOH A O     1 
HETATM 2914 O  O     . HOH P 7 .   ? 70.242 -14.152 -109.990 1.00 37.44  ? 989  HOH A O     1 
HETATM 2915 O  O     . HOH P 7 .   ? 44.930 3.709   -119.356 1.00 40.58  ? 990  HOH A O     1 
HETATM 2916 O  O     . HOH P 7 .   ? 42.101 -20.467 -100.782 1.00 49.18  ? 991  HOH A O     1 
HETATM 2917 O  O     . HOH P 7 .   ? 34.556 -2.641  -95.906  1.00 43.26  ? 992  HOH A O     1 
HETATM 2918 O  O     . HOH P 7 .   ? 37.468 -6.550  -111.705 1.00 53.05  ? 993  HOH A O     1 
HETATM 2919 O  O     . HOH P 7 .   ? 44.063 -1.468  -113.142 1.00 44.53  ? 994  HOH A O     1 
HETATM 2920 O  O     . HOH P 7 .   ? 51.698 -16.310 -91.140  1.00 42.23  ? 996  HOH A O     1 
HETATM 2921 O  O     . HOH P 7 .   ? 77.834 -21.881 -118.439 1.00 37.10  ? 997  HOH A O     1 
HETATM 2922 O  O     . HOH P 7 .   ? 61.541 1.339   -119.527 1.00 86.10  ? 998  HOH A O     1 
HETATM 2923 O  O     . HOH P 7 .   ? 70.330 6.124   -104.917 1.00 34.50  ? 999  HOH A O     1 
HETATM 2924 O  O     . HOH P 7 .   ? 78.358 -18.628 -120.382 1.00 44.49  ? 1000 HOH A O     1 
HETATM 2925 O  O     . HOH P 7 .   ? 53.573 -24.605 -106.964 1.00 43.48  ? 1001 HOH A O     1 
HETATM 2926 O  O     . HOH P 7 .   ? 74.661 -29.948 -109.812 1.00 34.80  ? 1002 HOH A O     1 
HETATM 2927 O  O     . HOH P 7 .   ? 50.847 14.621  -114.147 1.00 45.81  ? 1003 HOH A O     1 
HETATM 2928 O  O     . HOH P 7 .   ? 54.562 -39.065 -113.958 1.00 50.16  ? 1004 HOH A O     1 
HETATM 2929 O  O     . HOH P 7 .   ? 66.215 -18.786 -94.826  1.00 39.74  ? 1005 HOH A O     1 
HETATM 2930 O  O     . HOH P 7 .   ? 43.090 1.786   -117.359 1.00 47.59  ? 1007 HOH A O     1 
HETATM 2931 O  O     . HOH P 7 .   ? 41.199 -6.275  -112.419 1.00 41.96  ? 1009 HOH A O     1 
HETATM 2932 O  O     . HOH P 7 .   ? 56.963 16.823  -99.497  1.00 45.61  ? 1011 HOH A O     1 
HETATM 2933 O  O     . HOH P 7 .   ? 73.282 -29.805 -107.985 1.00 47.24  ? 1012 HOH A O     1 
HETATM 2934 O  O     . HOH P 7 .   ? 35.798 -11.666 -107.797 1.00 45.17  ? 1013 HOH A O     1 
HETATM 2935 O  O     . HOH P 7 .   ? 50.586 -11.588 -128.263 1.00 47.95  ? 1014 HOH A O     1 
HETATM 2936 O  O     . HOH P 7 .   ? 50.706 -23.571 -108.183 1.00 45.88  ? 1015 HOH A O     1 
HETATM 2937 O  O     . HOH P 7 .   ? 69.254 -3.568  -100.153 1.00 37.11  ? 1017 HOH A O     1 
HETATM 2938 O  O     . HOH P 7 .   ? 68.087 -7.726  -100.270 1.00 47.00  ? 1018 HOH A O     1 
HETATM 2939 O  O     . HOH P 7 .   ? 70.506 -12.134 -102.902 1.00 46.75  ? 1019 HOH A O     1 
HETATM 2940 O  O     . HOH P 7 .   ? 47.108 -4.832  -80.296  1.00 39.35  ? 1020 HOH A O     1 
HETATM 2941 O  O     . HOH P 7 .   ? 61.221 -24.684 -99.340  1.00 47.92  ? 1022 HOH A O     1 
HETATM 2942 O  O     . HOH P 7 .   ? 48.809 7.843   -117.230 1.00 55.64  ? 1023 HOH A O     1 
HETATM 2943 O  O     . HOH P 7 .   ? 55.020 -21.183 -132.710 1.00 45.07  ? 1024 HOH A O     1 
HETATM 2944 O  O     . HOH P 7 .   ? 65.588 -20.170 -100.788 1.00 33.87  ? 1025 HOH A O     1 
HETATM 2945 O  O     . HOH P 7 .   ? 58.320 -15.410 -88.917  1.00 37.68  ? 1026 HOH A O     1 
HETATM 2946 O  O     . HOH P 7 .   ? 54.524 -44.147 -116.873 1.00 61.43  ? 1027 HOH A O     1 
HETATM 2947 O  O     . HOH P 7 .   ? 51.059 -16.889 -118.079 1.00 33.54  ? 1028 HOH A O     1 
HETATM 2948 O  O     . HOH P 7 .   ? 47.159 -8.637  -81.771  1.00 43.74  ? 1029 HOH A O     1 
HETATM 2949 O  O     . HOH P 7 .   ? 58.299 -8.517  -90.529  1.00 52.57  ? 1030 HOH A O     1 
HETATM 2950 O  O     . HOH P 7 .   ? 77.907 -28.710 -113.616 1.00 60.84  ? 1032 HOH A O     1 
HETATM 2951 O  O     . HOH P 7 .   ? 33.520 -9.503  -91.100  1.00 42.95  ? 1033 HOH A O     1 
HETATM 2952 O  O     . HOH P 7 .   ? 66.866 -7.019  -119.172 1.00 46.30  ? 1034 HOH A O     1 
HETATM 2953 O  O     . HOH P 7 .   ? 41.436 11.758  -108.065 1.00 46.37  ? 1035 HOH A O     1 
HETATM 2954 O  O     . HOH P 7 .   ? 78.320 -31.407 -113.978 1.00 73.52  ? 1037 HOH A O     1 
HETATM 2955 O  O     . HOH P 7 .   ? 68.958 -6.526  -114.554 1.00 58.22  ? 1038 HOH A O     1 
HETATM 2956 O  O     . HOH P 7 .   ? 63.791 -2.450  -125.362 1.00 50.73  ? 1039 HOH A O     1 
HETATM 2957 O  O     . HOH P 7 .   ? 59.545 -3.099  -91.407  1.00 44.51  ? 1040 HOH A O     1 
HETATM 2958 O  O     . HOH P 7 .   ? 51.938 -9.218  -82.084  1.00 55.58  ? 1041 HOH A O     1 
HETATM 2959 O  O     . HOH P 7 .   ? 78.368 -20.230 -125.217 1.00 60.64  ? 1043 HOH A O     1 
HETATM 2960 O  O     . HOH P 7 .   ? 69.422 -22.916 -105.490 1.00 43.41  ? 1044 HOH A O     1 
HETATM 2961 O  O     . HOH P 7 .   ? 40.304 -15.179 -84.013  1.00 52.51  ? 1045 HOH A O     1 
HETATM 2962 O  O     . HOH P 7 .   ? 74.534 -22.223 -110.529 1.00 48.49  ? 1049 HOH A O     1 
HETATM 2963 O  O     . HOH P 7 .   ? 52.866 -36.933 -116.151 1.00 44.53  ? 1050 HOH A O     1 
HETATM 2964 O  O     . HOH P 7 .   ? 55.850 -15.625 -131.279 1.00 51.90  ? 1051 HOH A O     1 
HETATM 2965 O  O     . HOH P 7 .   ? 77.379 -32.216 -110.884 1.00 36.97  ? 1052 HOH A O     1 
HETATM 2966 O  O     . HOH P 7 .   ? 59.029 0.644   -117.601 1.00 42.59  ? 1054 HOH A O     1 
HETATM 2967 O  O     . HOH P 7 .   ? 37.010 -3.115  -98.782  1.00 49.06  ? 1055 HOH A O     1 
HETATM 2968 O  O     . HOH P 7 .   ? 68.046 10.257  -105.692 1.00 44.23  ? 1056 HOH A O     1 
HETATM 2969 O  O     . HOH P 7 .   ? 48.610 -16.699 -122.082 1.00 47.79  ? 1058 HOH A O     1 
HETATM 2970 O  O     . HOH P 7 .   ? 69.258 -9.085  -121.560 1.00 40.92  ? 1059 HOH A O     1 
HETATM 2971 O  O     . HOH P 7 .   ? 50.316 14.691  -101.067 1.00 59.11  ? 1060 HOH A O     1 
HETATM 2972 O  O     . HOH P 7 .   ? 56.311 -0.819  -122.302 1.00 39.88  ? 1061 HOH A O     1 
HETATM 2973 O  O     . HOH P 7 .   ? 67.591 -25.618 -102.758 1.00 48.18  ? 1062 HOH A O     1 
HETATM 2974 O  O     . HOH P 7 .   ? 39.499 -18.572 -98.256  1.00 44.26  ? 1064 HOH A O     1 
HETATM 2975 O  O     . HOH P 7 .   ? 38.248 -13.697 -82.155  0.50 42.15  ? 1067 HOH A O     1 
HETATM 2976 O  O     . HOH P 7 .   ? 32.687 -4.786  -85.090  1.00 42.47  ? 1069 HOH A O     1 
HETATM 2977 O  O     . HOH P 7 .   ? 45.240 2.449   -116.192 1.00 67.68  ? 1070 HOH A O     1 
HETATM 2978 O  O     . HOH P 7 .   ? 39.590 -2.464  -114.249 1.00 56.01  ? 1071 HOH A O     1 
HETATM 2979 O  O     . HOH P 7 .   ? 45.155 -9.680  -80.150  1.00 46.90  ? 1073 HOH A O     1 
HETATM 2980 O  O     . HOH P 7 .   ? 67.585 -6.319  -130.155 1.00 50.28  ? 1074 HOH A O     1 
HETATM 2981 O  O     . HOH P 7 .   ? 48.275 13.876  -97.253  1.00 56.23  ? 1075 HOH A O     1 
HETATM 2982 O  O     . HOH P 7 .   ? 59.550 1.425   -91.420  1.00 57.49  ? 1076 HOH A O     1 
HETATM 2983 O  O     . HOH P 7 .   ? 71.616 1.268   -107.945 1.00 51.09  ? 1077 HOH A O     1 
HETATM 2984 O  O     . HOH P 7 .   ? 58.883 14.806  -104.796 1.00 35.47  ? 1078 HOH A O     1 
HETATM 2985 O  O     . HOH P 7 .   ? 66.532 -45.910 -107.321 1.00 54.82  ? 1079 HOH A O     1 
HETATM 2986 O  O     . HOH P 7 .   ? 76.249 -17.919 -124.454 1.00 50.97  ? 1080 HOH A O     1 
HETATM 2987 O  O     . HOH P 7 .   ? 38.100 -4.864  -83.291  1.00 52.23  ? 1081 HOH A O     1 
HETATM 2988 O  O     . HOH P 7 .   ? 71.541 -19.726 -105.373 1.00 46.50  ? 1082 HOH A O     1 
HETATM 2989 O  O     . HOH P 7 .   ? 40.913 -18.423 -88.581  1.00 60.27  ? 1083 HOH A O     1 
HETATM 2990 O  O     . HOH P 7 .   ? 65.311 0.204   -112.667 1.00 43.24  ? 1084 HOH A O     1 
HETATM 2991 O  O     . HOH P 7 .   ? 59.931 16.564  -102.694 0.50 59.71  ? 1085 HOH A O     1 
HETATM 2992 O  O     . HOH P 7 .   ? 32.875 -4.917  -89.459  1.00 48.89  ? 1086 HOH A O     1 
HETATM 2993 O  O     . HOH P 7 .   ? 32.999 -7.348  -85.532  1.00 46.09  ? 1087 HOH A O     1 
HETATM 2994 O  O     . HOH P 7 .   ? 60.659 -37.071 -121.262 1.00 63.78  ? 1088 HOH A O     1 
HETATM 2995 O  O     . HOH P 7 .   ? 47.885 -11.905 -83.885  1.00 41.79  ? 1089 HOH A O     1 
HETATM 2996 O  O     . HOH P 7 .   ? 43.744 -20.580 -93.974  1.00 48.95  ? 1090 HOH A O     1 
HETATM 2997 O  O     . HOH P 7 .   ? 80.032 -24.694 -114.554 1.00 50.33  ? 1091 HOH A O     1 
HETATM 2998 O  O     . HOH P 7 .   ? 51.967 -19.485 -109.704 1.00 29.56  ? 1092 HOH A O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    P  P     . DC  A 3   ? 0.5888 0.6519 0.4007 0.2265  0.0719  0.0169  403  DC  B P     
2    O  OP1   . DC  A 3   ? 0.6947 1.1104 0.7025 0.4576  0.1219  -0.2573 403  DC  B OP1   
3    O  OP2   . DC  A 3   ? 0.3743 1.0926 0.6395 0.0512  0.0041  0.3424  403  DC  B OP2   
4    O  "O5'" . DC  A 3   ? 0.6950 0.8042 0.3988 0.1544  0.1462  -0.0606 403  DC  B "O5'" 
5    C  "C5'" . DC  A 3   ? 0.7053 0.8143 0.5066 0.0771  0.0475  -0.0995 403  DC  B "C5'" 
6    C  "C4'" . DC  A 3   ? 0.5996 0.7345 0.6056 0.2888  -0.0232 -0.1176 403  DC  B "C4'" 
7    O  "O4'" . DC  A 3   ? 0.5694 0.7057 0.5955 0.2952  -0.0461 -0.0428 403  DC  B "O4'" 
8    C  "C3'" . DC  A 3   ? 0.5386 0.7635 0.8275 0.2043  0.0021  -0.0868 403  DC  B "C3'" 
9    O  "O3'" . DC  A 3   ? 0.8218 0.9221 0.9630 -0.0071 -0.0780 -0.1174 403  DC  B "O3'" 
10   C  "C2'" . DC  A 3   ? 0.5486 0.6909 0.8000 0.2399  0.1320  0.0169  403  DC  B "C2'" 
11   C  "C1'" . DC  A 3   ? 0.4663 0.7460 0.6442 0.3499  -0.1129 0.0863  403  DC  B "C1'" 
12   N  N1    . DC  A 3   ? 0.4859 0.6706 0.4978 0.2357  -0.0601 0.1840  403  DC  B N1    
13   C  C2    . DC  A 3   ? 0.4841 0.5367 0.4899 0.2121  -0.1287 0.0676  403  DC  B C2    
14   O  O2    . DC  A 3   ? 0.6332 0.3747 0.5941 0.0942  -0.2284 0.0882  403  DC  B O2    
15   N  N3    . DC  A 3   ? 0.4870 0.4578 0.4582 0.2153  -0.0872 0.0580  403  DC  B N3    
16   C  C4    . DC  A 3   ? 0.3982 0.5466 0.3289 0.1111  0.0392  0.0860  403  DC  B C4    
17   N  N4    . DC  A 3   ? 0.4155 0.4916 0.4180 0.0157  0.1251  -0.1707 403  DC  B N4    
18   C  C5    . DC  A 3   ? 0.4015 0.5320 0.3631 0.0690  0.1280  0.1665  403  DC  B C5    
19   C  C6    . DC  A 3   ? 0.4031 0.6605 0.4001 0.1325  0.0732  0.1640  403  DC  B C6    
20   N  N1    . BRU A 4   ? 0.9288 0.3755 0.2794 0.1947  -0.0663 -0.0400 404  BRU B N1    
21   C  C2    . BRU A 4   ? 0.8708 0.3008 0.3051 0.1449  -0.0822 0.0860  404  BRU B C2    
22   N  N3    . BRU A 4   ? 0.9415 0.3382 0.3236 0.1477  -0.1428 0.1060  404  BRU B N3    
23   C  C4    . BRU A 4   ? 1.0978 0.3261 0.4140 0.1361  -0.1690 -0.0282 404  BRU B C4    
24   C  C5    . BRU A 4   ? 1.1461 0.4028 0.3584 0.2200  -0.1575 -0.1266 404  BRU B C5    
25   C  C6    . BRU A 4   ? 1.0827 0.4185 0.3042 0.2498  -0.1099 -0.0837 404  BRU B C6    
26   O  O2    . BRU A 4   ? 0.7627 0.3167 0.3157 -0.1168 0.0281  0.0788  404  BRU B O2    
27   O  O4    . BRU A 4   ? 1.1501 0.4754 0.5323 0.3464  -0.2737 -0.2079 404  BRU B O4    
28   BR BR    . BRU A 4   ? 0.7623 0.6541 0.4833 0.0545  -0.0630 -0.0638 404  BRU B BR    
29   C  "C1'" . BRU A 4   ? 0.8484 0.4427 0.3278 0.2955  -0.0575 -0.1213 404  BRU B "C1'" 
30   C  "C2'" . BRU A 4   ? 0.7503 0.5433 0.5374 0.2274  -0.0916 -0.0614 404  BRU B "C2'" 
31   C  "C3'" . BRU A 4   ? 0.7791 0.6783 0.7070 0.3253  -0.0431 -0.0454 404  BRU B "C3'" 
32   C  "C4'" . BRU A 4   ? 0.9627 0.6739 0.6978 0.3570  0.1715  -0.0389 404  BRU B "C4'" 
33   O  "O3'" . BRU A 4   ? 0.6312 0.6593 0.7188 0.1748  -0.1386 -0.0212 404  BRU B "O3'" 
34   O  "O4'" . BRU A 4   ? 0.8827 0.5733 0.4552 0.3904  0.0594  -0.0865 404  BRU B "O4'" 
35   C  "C5'" . BRU A 4   ? 1.2091 0.8615 0.8558 0.6269  0.6156  0.3405  404  BRU B "C5'" 
40   N  N1    . BRU A 5   ? 0.2768 0.3287 0.2821 0.0318  -0.0166 -0.0482 405  BRU B N1    
41   C  C2    . BRU A 5   ? 0.3034 0.2332 0.2130 -0.0613 -0.0130 0.0347  405  BRU B C2    
42   N  N3    . BRU A 5   ? 0.3530 0.2821 0.2443 -0.0520 -0.0200 0.0120  405  BRU B N3    
43   C  C4    . BRU A 5   ? 0.3695 0.2122 0.2291 -0.0275 -0.0145 0.0098  405  BRU B C4    
44   C  C5    . BRU A 5   ? 0.3230 0.3076 0.2605 0.0393  -0.0153 -0.0196 405  BRU B C5    
45   C  C6    . BRU A 5   ? 0.2740 0.3046 0.3036 0.0312  -0.0142 -0.0636 405  BRU B C6    
46   O  O2    . BRU A 5   ? 0.3604 0.4009 0.3117 -0.0849 0.0799  0.0064  405  BRU B O2    
47   O  O4    . BRU A 5   ? 0.4137 0.3592 0.2525 -0.0183 -0.0342 -0.0395 405  BRU B O4    
49   C  "C1'" . BRU A 5   ? 0.2646 0.2771 0.2758 -0.0105 -0.0395 -0.0187 405  BRU B "C1'" 
50   C  "C2'" . BRU A 5   ? 0.2908 0.3842 0.3630 -0.1087 -0.0781 0.0442  405  BRU B "C2'" 
51   C  "C3'" . BRU A 5   ? 0.3874 0.4355 0.3307 -0.0132 -0.1208 -0.0873 405  BRU B "C3'" 
52   C  "C4'" . BRU A 5   ? 0.4275 0.4371 0.3100 0.0620  -0.1351 -0.0371 405  BRU B "C4'" 
53   O  "O3'" . BRU A 5   ? 0.3597 0.4804 0.3782 -0.0248 -0.1011 -0.1290 405  BRU B "O3'" 
54   O  "O4'" . BRU A 5   ? 0.3643 0.3507 0.3220 0.0897  -0.0807 -0.0970 405  BRU B "O4'" 
55   C  "C5'" . BRU A 5   ? 0.4510 0.5858 0.3381 0.1290  -0.1378 0.1120  405  BRU B "C5'" 
56   O  "O5'" . BRU A 5   ? 0.3707 0.6309 0.3609 -0.0099 -0.1110 -0.0161 405  BRU B "O5'" 
57   P  P     . BRU A 5   ? 0.3859 0.6139 0.6171 0.0153  -0.0704 0.0670  405  BRU B P     
58   O  OP1   . BRU A 5   ? 0.4992 0.8327 0.8099 0.1339  -0.2969 -0.0208 405  BRU B OP1   
59   O  OP2   . BRU A 5   ? 0.4608 0.8303 1.1078 0.1104  0.1457  0.3620  405  BRU B OP2   
60   P  P     . DC  A 6   ? 0.3899 0.5208 0.4723 0.0427  -0.1946 -0.2014 406  DC  B P     
61   O  OP1   . DC  A 6   ? 0.8127 0.9212 0.4688 0.2670  -0.4107 -0.4141 406  DC  B OP1   
62   O  OP2   . DC  A 6   ? 0.5437 0.5486 0.9922 -0.1961 -0.4037 -0.0274 406  DC  B OP2   
63   O  "O5'" . DC  A 6   ? 0.4032 0.5788 0.3457 0.0286  -0.1845 -0.1037 406  DC  B "O5'" 
64   C  "C5'" . DC  A 6   ? 0.3961 0.5252 0.3837 0.0904  -0.1832 0.0216  406  DC  B "C5'" 
65   C  "C4'" . DC  A 6   ? 0.4080 0.3318 0.3678 0.0640  -0.1946 0.0014  406  DC  B "C4'" 
66   O  "O4'" . DC  A 6   ? 0.3735 0.2793 0.4039 -0.0146 -0.1749 -0.0249 406  DC  B "O4'" 
67   C  "C3'" . DC  A 6   ? 0.4265 0.3055 0.3078 -0.0076 -0.1496 -0.0270 406  DC  B "C3'" 
68   O  "O3'" . DC  A 6   ? 0.5093 0.3965 0.3077 0.1081  -0.1470 -0.0743 406  DC  B "O3'" 
69   C  "C2'" . DC  A 6   ? 0.4369 0.2805 0.3034 0.0256  -0.1567 -0.0498 406  DC  B "C2'" 
70   C  "C1'" . DC  A 6   ? 0.3144 0.2960 0.3169 0.0122  -0.1196 -0.0518 406  DC  B "C1'" 
71   N  N1    . DC  A 6   ? 0.2995 0.3022 0.3602 -0.0155 -0.0810 -0.0896 406  DC  B N1    
72   C  C2    . DC  A 6   ? 0.2806 0.4297 0.2431 -0.0524 -0.0685 -0.0013 406  DC  B C2    
73   O  O2    . DC  A 6   ? 0.3062 0.3910 0.3299 -0.0629 -0.0326 -0.1444 406  DC  B O2    
74   N  N3    . DC  A 6   ? 0.2385 0.3092 0.3348 0.0093  -0.0629 -0.0768 406  DC  B N3    
75   C  C4    . DC  A 6   ? 0.2291 0.3466 0.2990 0.0010  -0.0847 -0.0320 406  DC  B C4    
76   N  N4    . DC  A 6   ? 0.2923 0.2890 0.3105 -0.0655 -0.0217 -0.0179 406  DC  B N4    
77   C  C5    . DC  A 6   ? 0.2576 0.3385 0.3243 -0.0015 -0.1097 -0.0130 406  DC  B C5    
78   C  C6    . DC  A 6   ? 0.2763 0.2453 0.3233 0.0184  -0.1284 -0.0186 406  DC  B C6    
79   P  P     . DA  A 7   ? 0.5639 0.4137 0.3185 0.1041  -0.2179 -0.1069 407  DA  B P     
80   O  OP1   . DA  A 7   ? 0.9147 0.4466 0.2392 0.2507  -0.0989 -0.0460 407  DA  B OP1   
81   O  OP2   . DA  A 7   ? 0.6844 0.5433 0.6056 0.0042  -0.4027 -0.2399 407  DA  B OP2   
82   O  "O5'" . DA  A 7   ? 0.3723 0.3517 0.2682 -0.0054 -0.0969 -0.0367 407  DA  B "O5'" 
83   C  "C5'" . DA  A 7   ? 0.3712 0.2624 0.2114 -0.0149 -0.0666 0.0019  407  DA  B "C5'" 
84   C  "C4'" . DA  A 7   ? 0.2816 0.2839 0.2051 -0.0277 -0.0237 0.0154  407  DA  B "C4'" 
85   O  "O4'" . DA  A 7   ? 0.2625 0.2626 0.2217 -0.0329 -0.0349 0.0217  407  DA  B "O4'" 
86   C  "C3'" . DA  A 7   ? 0.1837 0.2867 0.2090 -0.0176 -0.0248 0.0093  407  DA  B "C3'" 
87   O  "O3'" . DA  A 7   ? 0.1876 0.2826 0.2263 -0.0298 -0.0047 -0.0173 407  DA  B "O3'" 
88   C  "C2'" . DA  A 7   ? 0.2640 0.2356 0.2442 -0.0192 0.0379  0.0004  407  DA  B "C2'" 
89   C  "C1'" . DA  A 7   ? 0.2033 0.2135 0.2549 -0.0203 0.0090  0.0385  407  DA  B "C1'" 
90   N  N9    . DA  A 7   ? 0.2005 0.2669 0.3058 -0.0085 -0.0025 0.0183  407  DA  B N9    
91   C  C8    . DA  A 7   ? 0.2003 0.3484 0.4103 -0.0698 0.0332  0.0000  407  DA  B C8    
92   N  N7    . DA  A 7   ? 0.2156 0.3883 0.3789 0.0021  0.0285  0.0640  407  DA  B N7    
93   C  C5    . DA  A 7   ? 0.2463 0.3405 0.3707 0.0132  0.0676  0.0548  407  DA  B C5    
94   C  C6    . DA  A 7   ? 0.2230 0.2749 0.4345 -0.0013 0.0848  0.0447  407  DA  B C6    
95   N  N6    . DA  A 7   ? 0.2354 0.3848 0.3841 0.0420  0.0732  0.0765  407  DA  B N6    
96   N  N1    . DA  A 7   ? 0.2577 0.2992 0.3737 -0.0361 0.0920  0.0739  407  DA  B N1    
97   C  C2    . DA  A 7   ? 0.2488 0.2491 0.3229 -0.0066 0.0617  0.0176  407  DA  B C2    
98   N  N3    . DA  A 7   ? 0.2889 0.2851 0.2532 -0.0150 0.0445  0.0245  407  DA  B N3    
99   C  C4    . DA  A 7   ? 0.2351 0.2014 0.3282 -0.0030 0.0479  0.0379  407  DA  B C4    
100  N  N1    . BRU A 8   ? 0.1692 0.2160 0.2053 -0.0304 0.0011  -0.0332 408  BRU B N1    
101  C  C2    . BRU A 8   ? 0.1851 0.2065 0.1973 -0.0484 0.0208  -0.0383 408  BRU B C2    
102  N  N3    . BRU A 8   ? 0.1846 0.2302 0.1978 -0.0480 0.0163  -0.0362 408  BRU B N3    
103  C  C4    . BRU A 8   ? 0.2000 0.2205 0.2778 -0.0543 -0.0283 -0.0699 408  BRU B C4    
104  C  C5    . BRU A 8   ? 0.1663 0.2397 0.2238 -0.0577 -0.0501 -0.0465 408  BRU B C5    
105  C  C6    . BRU A 8   ? 0.1563 0.2813 0.2280 -0.0606 -0.0010 -0.0513 408  BRU B C6    
106  O  O2    . BRU A 8   ? 0.1957 0.2937 0.1923 -0.0251 0.0181  -0.0399 408  BRU B O2    
107  O  O4    . BRU A 8   ? 0.2599 0.2523 0.2644 0.0074  -0.0403 -0.0451 408  BRU B O4    
108  BR BR    . BRU A 8   ? 0.3588 0.4619 0.4497 0.0104  -0.0470 -0.0968 408  BRU B BR    
109  C  "C1'" . BRU A 8   ? 0.2063 0.2073 0.2043 -0.0075 0.0308  -0.0106 408  BRU B "C1'" 
110  C  "C2'" . BRU A 8   ? 0.1905 0.1881 0.2766 -0.0290 0.0331  0.0093  408  BRU B "C2'" 
111  C  "C3'" . BRU A 8   ? 0.1674 0.1849 0.3012 -0.0209 0.0117  -0.0457 408  BRU B "C3'" 
112  C  "C4'" . BRU A 8   ? 0.1706 0.2091 0.2039 -0.0303 0.0186  -0.0228 408  BRU B "C4'" 
113  O  "O3'" . BRU A 8   ? 0.1820 0.2180 0.2669 -0.0243 0.0047  -0.0161 408  BRU B "O3'" 
114  O  "O4'" . BRU A 8   ? 0.1878 0.1728 0.2190 -0.0353 0.0171  -0.0227 408  BRU B "O4'" 
115  C  "C5'" . BRU A 8   ? 0.1929 0.2959 0.1880 -0.0543 -0.0042 -0.0606 408  BRU B "C5'" 
116  O  "O5'" . BRU A 8   ? 0.1763 0.2652 0.2142 -0.0242 -0.0060 -0.0285 408  BRU B "O5'" 
117  P  P     . BRU A 8   ? 0.1972 0.2932 0.2114 -0.0194 -0.0116 -0.0294 408  BRU B P     
118  O  OP1   . BRU A 8   ? 0.2089 0.3260 0.2151 -0.0094 0.0033  -0.0429 408  BRU B OP1   
119  O  OP2   . BRU A 8   ? 0.2003 0.2969 0.2351 -0.0210 -0.0261 -0.0612 408  BRU B OP2   
120  P  P     . DC  A 9   ? 0.1990 0.2213 0.2688 -0.0363 0.0294  -0.0156 409  DC  B P     
121  O  OP1   . DC  A 9   ? 0.2070 0.1753 0.2884 -0.0269 0.0270  -0.0332 409  DC  B OP1   
122  O  OP2   . DC  A 9   ? 0.2490 0.2167 0.4437 -0.0302 -0.0576 -0.0147 409  DC  B OP2   
123  O  "O5'" . DC  A 9   ? 0.2180 0.4205 0.2744 -0.0167 0.0646  0.0255  409  DC  B "O5'" 
124  C  "C5'" . DC  A 9   ? 0.2465 0.5030 0.2220 0.0632  0.0017  -0.0468 409  DC  B "C5'" 
125  C  "C4'" . DC  A 9   ? 0.3754 0.3736 0.2742 0.1552  0.0929  0.0406  409  DC  B "C4'" 
126  O  "O4'" . DC  A 9   ? 0.3486 0.4254 0.2737 0.1372  0.0972  0.1030  409  DC  B "O4'" 
127  C  "C3'" . DC  A 9   ? 0.4666 0.4671 0.3901 0.1606  0.0846  0.1665  409  DC  B "C3'" 
128  O  "O3'" . DC  A 9   ? 0.5230 0.6166 0.4677 0.0906  -0.0135 0.2722  409  DC  B "O3'" 
129  C  "C2'" . DC  A 9   ? 0.4461 0.3529 0.4621 0.0491  0.0544  0.0882  409  DC  B "C2'" 
130  C  "C1'" . DC  A 9   ? 0.3343 0.3452 0.3620 0.0359  0.1053  0.0743  409  DC  B "C1'" 
131  N  N1    . DC  A 9   ? 0.3384 0.3540 0.4191 0.0312  0.0828  0.0601  409  DC  B N1    
132  C  C2    . DC  A 9   ? 0.2659 0.4963 0.3519 0.0528  0.1138  0.0232  409  DC  B C2    
133  O  O2    . DC  A 9   ? 0.2797 0.4383 0.3735 0.0083  0.1040  0.0427  409  DC  B O2    
134  N  N3    . DC  A 9   ? 0.2435 0.4802 0.3860 0.0236  0.1128  0.0452  409  DC  B N3    
135  C  C4    . DC  A 9   ? 0.2331 0.3886 0.3698 0.0020  0.1225  0.0782  409  DC  B C4    
136  N  N4    . DC  A 9   ? 0.2041 0.4028 0.4997 -0.0095 0.0778  -0.0089 409  DC  B N4    
137  C  C5    . DC  A 9   ? 0.2450 0.4059 0.4195 0.0124  0.1315  0.0680  409  DC  B C5    
138  C  C6    . DC  A 9   ? 0.2958 0.4382 0.3147 0.0630  0.1438  0.0745  409  DC  B C6    
139  P  P     . DC  A 10  ? 0.5126 0.5934 0.4036 0.1402  0.1152  0.2298  410  DC  B P     
140  O  OP1   . DC  A 10  ? 0.5384 0.9274 0.5703 0.0955  0.0042  0.4653  410  DC  B OP1   
141  O  OP2   . DC  A 10  ? 1.2564 0.5145 0.4661 0.3754  0.0441  0.2059  410  DC  B OP2   
142  O  "O5'" . DC  A 10  ? 0.5086 0.6812 0.5518 0.1777  0.1283  0.1990  410  DC  B "O5'" 
143  C  "C5'" . DC  A 10  ? 0.5592 0.7370 0.7524 0.1797  0.2089  0.0946  410  DC  B "C5'" 
144  C  "C4'" . DC  A 10  ? 0.4524 0.6377 0.8638 0.1516  0.1312  0.0554  410  DC  B "C4'" 
145  O  "O4'" . DC  A 10  ? 0.5169 0.6820 0.8582 0.0047  0.0798  0.1850  410  DC  B "O4'" 
146  C  "C3'" . DC  A 10  ? 0.6068 0.8009 0.8692 0.0581  0.0633  0.2442  410  DC  B "C3'" 
147  O  "O3'" . DC  A 10  ? 0.8544 0.9227 0.8690 -0.0241 0.0497  0.1719  410  DC  B "O3'" 
148  C  "C2'" . DC  A 10  ? 0.4759 0.7349 0.7841 0.0457  0.1910  0.2729  410  DC  B "C2'" 
149  C  "C1'" . DC  A 10  ? 0.5193 0.6196 0.7324 0.0185  0.0975  0.1019  410  DC  B "C1'" 
150  N  N1    . DC  A 10  ? 0.5561 0.5495 0.6978 0.0355  0.1215  0.1170  410  DC  B N1    
151  C  C2    . DC  A 10  ? 0.5471 0.4714 0.7317 -0.0092 0.0955  0.1108  410  DC  B C2    
152  O  O2    . DC  A 10  ? 0.4393 0.4489 0.7626 -0.0812 0.1460  0.1058  410  DC  B O2    
153  N  N3    . DC  A 10  ? 0.4084 0.4470 0.6703 -0.1254 0.1856  0.2143  410  DC  B N3    
154  C  C4    . DC  A 10  ? 0.5098 0.5408 0.6695 -0.0885 0.1331  0.1665  410  DC  B C4    
155  N  N4    . DC  A 10  ? 0.5149 0.7025 0.7974 -0.1586 0.0128  0.0938  410  DC  B N4    
156  C  C5    . DC  A 10  ? 0.6026 0.4184 0.5984 -0.0891 0.2302  0.2406  410  DC  B C5    
157  C  C6    . DC  A 10  ? 0.5991 0.5289 0.5261 0.0399  0.2953  0.2861  410  DC  B C6    
158  N  N1    . BRU A 11  ? 0.6384 0.7052 0.8239 -0.1194 0.3286  0.0884  411  BRU B N1    
159  C  C2    . BRU A 11  ? 0.6035 0.5366 0.8549 -0.2406 0.3135  0.1370  411  BRU B C2    
160  N  N3    . BRU A 11  ? 0.6144 0.5113 0.9250 -0.2609 0.2703  0.1025  411  BRU B N3    
161  C  C4    . BRU A 11  ? 0.5924 0.5061 0.9560 -0.2858 0.3155  0.0968  411  BRU B C4    
162  C  C5    . BRU A 11  ? 0.5358 0.5965 1.0358 -0.2268 0.3017  0.0241  411  BRU B C5    
163  C  C6    . BRU A 11  ? 0.5659 0.6789 1.0252 -0.1681 0.2702  0.0089  411  BRU B C6    
164  O  O2    . BRU A 11  ? 0.8616 0.5740 0.9524 -0.1034 0.1254  0.0552  411  BRU B O2    
165  O  O4    . BRU A 11  ? 0.6078 0.5111 1.1622 -0.3123 0.1974  -0.0298 411  BRU B O4    
166  BR BR    . BRU A 11  ? 2.0000 1.5917 1.3917 0.6358  -0.1166 0.3851  411  BRU B BR    
167  C  "C1'" . BRU A 11  ? 0.7096 0.8618 0.7998 -0.0355 0.3091  0.0580  411  BRU B "C1'" 
168  C  "C2'" . BRU A 11  ? 0.8431 1.0490 0.8163 0.0326  0.3845  0.1630  411  BRU B "C2'" 
169  C  "C3'" . BRU A 11  ? 0.7128 1.0907 0.8308 0.1228  0.3470  0.1882  411  BRU B "C3'" 
170  C  "C4'" . BRU A 11  ? 0.7014 1.0004 0.7939 0.1774  0.3061  0.2682  411  BRU B "C4'" 
171  O  "O3'" . BRU A 11  ? 0.6526 1.1497 0.7708 0.1511  0.2188  0.0920  411  BRU B "O3'" 
172  O  "O4'" . BRU A 11  ? 0.6653 0.8924 0.7543 -0.0122 0.2070  0.0768  411  BRU B "O4'" 
173  C  "C5'" . BRU A 11  ? 1.0489 1.1235 0.8683 0.4370  0.6267  0.6009  411  BRU B "C5'" 
178  P  P     . DG  A 12  ? 0.6819 1.1744 0.7307 0.0985  0.0831  0.0478  412  DG  B P     
179  O  OP1   . DG  A 12  ? 0.7820 1.2847 1.0160 -0.0043 0.0631  -0.0670 412  DG  B OP1   
180  O  OP2   . DG  A 12  ? 0.7617 1.3684 0.8486 0.0812  -0.0934 0.1837  412  DG  B OP2   
181  O  "O5'" . DG  A 12  ? 0.6643 1.0490 0.5900 0.0745  0.1884  0.1972  412  DG  B "O5'" 
182  C  "C5'" . DG  A 12  ? 0.7292 0.9307 0.7184 -0.1314 0.0399  0.2912  412  DG  B "C5'" 
183  C  "C4'" . DG  A 12  ? 0.7075 0.7688 0.7417 -0.1704 -0.0486 0.2368  412  DG  B "C4'" 
184  O  "O4'" . DG  A 12  ? 0.8118 0.5989 0.7636 -0.0423 -0.2024 0.2440  412  DG  B "O4'" 
185  C  "C3'" . DG  A 12  ? 0.6829 0.7263 0.7230 -0.1428 -0.0216 0.1459  412  DG  B "C3'" 
186  O  "O3'" . DG  A 12  ? 0.8666 0.6682 1.0646 -0.1701 0.0761  -0.1296 412  DG  B "O3'" 
187  C  "C2'" . DG  A 12  ? 0.6764 0.6583 0.6518 -0.0126 0.0161  0.1866  412  DG  B "C2'" 
188  C  "C1'" . DG  A 12  ? 0.6949 0.5688 0.6756 -0.0046 -0.0116 0.1675  412  DG  B "C1'" 
189  N  N9    . DG  A 12  ? 0.5278 0.5977 0.7611 -0.0798 0.0215  0.1134  412  DG  B N9    
190  C  C8    . DG  A 12  ? 0.4791 0.5939 0.8742 -0.1010 -0.0259 0.0637  412  DG  B C8    
191  N  N7    . DG  A 12  ? 0.4477 0.5873 0.9090 -0.1219 0.0105  0.0641  412  DG  B N7    
192  C  C5    . DG  A 12  ? 0.3485 0.4980 0.7402 -0.2192 0.1718  0.1890  412  DG  B C5    
193  C  C6    . DG  A 12  ? 0.4987 0.5312 0.8130 -0.1785 0.1283  0.1005  412  DG  B C6    
194  O  O6    . DG  A 12  ? 0.8981 0.6370 0.8947 0.0579  0.0754  0.0631  412  DG  B O6    
195  N  N1    . DG  A 12  ? 0.4911 0.4782 0.7346 -0.2395 0.1528  0.1046  412  DG  B N1    
196  C  C2    . DG  A 12  ? 0.4798 0.4996 0.7550 -0.2150 0.0821  0.0720  412  DG  B C2    
197  N  N2    . DG  A 12  ? 0.5278 0.6668 0.7886 -0.1389 0.0046  -0.0319 412  DG  B N2    
198  N  N3    . DG  A 12  ? 0.4791 0.4131 0.7475 -0.2025 0.0466  0.1008  412  DG  B N3    
199  C  C4    . DG  A 12  ? 0.3945 0.4708 0.7067 -0.2114 0.1364  0.1856  412  DG  B C4    
201  O  OP1   . DC  B 2   ? 1.4182 1.2847 1.3221 0.9552  0.9437  0.6951  422  DC  C OP1   
202  O  OP2   . DC  B 2   ? 1.2287 1.6700 1.5881 0.9965  0.9475  0.9383  422  DC  C OP2   
203  O  "O5'" . DC  B 2   ? 1.2237 1.3008 1.4240 0.6389  0.8411  0.7178  422  DC  C "O5'" 
204  C  "C5'" . DC  B 2   ? 0.8995 0.8046 1.1973 0.1756  0.4624  0.2468  422  DC  C "C5'" 
205  C  "C4'" . DC  B 2   ? 0.7057 0.8032 1.0782 0.0825  0.3123  0.1727  422  DC  C "C4'" 
206  O  "O4'" . DC  B 2   ? 0.7994 1.0142 0.9374 0.0245  0.2755  0.2931  422  DC  C "O4'" 
207  C  "C3'" . DC  B 2   ? 0.7879 0.7587 0.9352 -0.1397 0.1765  0.0594  422  DC  C "C3'" 
208  O  "O3'" . DC  B 2   ? 0.8295 0.7200 1.0414 -0.2097 0.0763  0.0613  422  DC  C "O3'" 
209  C  "C2'" . DC  B 2   ? 0.7905 0.6673 0.7620 -0.2642 0.1349  0.1650  422  DC  C "C2'" 
210  C  "C1'" . DC  B 2   ? 0.8573 0.7622 0.7145 -0.0904 0.2677  0.2625  422  DC  C "C1'" 
211  N  N1    . DC  B 2   ? 0.7348 0.6401 0.6757 -0.1808 0.2493  0.1532  422  DC  C N1    
212  C  C2    . DC  B 2   ? 0.6205 0.5825 0.7052 -0.1833 0.2851  0.1215  422  DC  C C2    
213  O  O2    . DC  B 2   ? 0.5525 0.7077 0.8897 -0.1674 0.2325  0.0251  422  DC  C O2    
214  N  N3    . DC  B 2   ? 0.6563 0.5286 0.6684 -0.1914 0.2665  0.0906  422  DC  C N3    
215  C  C4    . DC  B 2   ? 0.6072 0.6134 0.5917 -0.1831 0.2350  0.0523  422  DC  C C4    
216  N  N4    . DC  B 2   ? 0.7636 0.4250 0.6004 -0.1970 0.1939  0.0814  422  DC  C N4    
217  C  C5    . DC  B 2   ? 0.6343 0.6197 0.6451 -0.2350 0.1422  -0.0491 422  DC  C C5    
218  C  C6    . DC  B 2   ? 0.7469 0.6367 0.6330 -0.1905 0.1471  0.0049  422  DC  C C6    
219  P  P     . DA  B 3   ? 0.9726 0.7636 1.0553 -0.1486 -0.0204 0.0662  423  DA  C P     
220  O  OP1   . DA  B 3   ? 1.0415 0.8681 1.1817 -0.2608 -0.1165 0.1045  423  DA  C OP1   
221  O  OP2   . DA  B 3   ? 1.0684 0.7438 0.9594 -0.2767 -0.0064 0.0859  423  DA  C OP2   
222  O  "O5'" . DA  B 3   ? 0.8988 0.7271 1.1534 -0.1528 -0.0349 0.0747  423  DA  C "O5'" 
223  C  "C5'" . DA  B 3   ? 0.8459 0.8564 1.2180 -0.1226 -0.0719 -0.0512 423  DA  C "C5'" 
224  C  "C4'" . DA  B 3   ? 0.6753 0.8211 1.2775 -0.1228 -0.1141 -0.0506 423  DA  C "C4'" 
225  O  "O4'" . DA  B 3   ? 0.6475 0.8348 1.1816 -0.0077 -0.0327 -0.0485 423  DA  C "O4'" 
226  C  "C3'" . DA  B 3   ? 0.6577 0.8314 1.3165 -0.0837 -0.1424 -0.0011 423  DA  C "C3'" 
227  O  "O3'" . DA  B 3   ? 0.5269 0.7975 1.3088 -0.0487 -0.2485 -0.0027 423  DA  C "O3'" 
228  C  "C2'" . DA  B 3   ? 0.6594 0.8287 1.2431 -0.1041 -0.1258 -0.0164 423  DA  C "C2'" 
229  C  "C1'" . DA  B 3   ? 0.6540 0.8232 1.1819 -0.0652 -0.1164 -0.0736 423  DA  C "C1'" 
230  N  N9    . DA  B 3   ? 0.6138 0.7037 1.0809 -0.1551 -0.0413 -0.0578 423  DA  C N9    
231  C  C8    . DA  B 3   ? 0.6017 0.7473 1.0492 -0.2399 -0.0170 -0.0600 423  DA  C C8    
232  N  N7    . DA  B 3   ? 0.6676 0.6388 1.0138 -0.2320 0.0505  -0.0575 423  DA  C N7    
233  C  C5    . DA  B 3   ? 0.6217 0.6212 0.9784 -0.1569 0.1135  0.0055  423  DA  C C5    
234  C  C6    . DA  B 3   ? 0.6046 0.5419 0.9624 -0.1506 0.1732  0.0219  423  DA  C C6    
235  N  N6    . DA  B 3   ? 0.6067 0.4613 0.9909 -0.2125 0.2675  0.0562  423  DA  C N6    
236  N  N1    . DA  B 3   ? 0.5548 0.4982 0.9313 -0.1693 0.2112  0.0756  423  DA  C N1    
237  C  C2    . DA  B 3   ? 0.5063 0.5607 0.9218 -0.1556 0.2035  0.0739  423  DA  C C2    
238  N  N3    . DA  B 3   ? 0.5466 0.5356 0.9659 -0.1656 0.1625  0.0810  423  DA  C N3    
239  C  C4    . DA  B 3   ? 0.6021 0.5968 0.9983 -0.1426 0.0781  0.0186  423  DA  C C4    
240  P  P     . DG  B 4   ? 0.6060 0.8056 1.2309 -0.0441 -0.3378 0.0436  424  DG  C P     
241  O  OP1   . DG  B 4   ? 0.6125 0.8334 1.3018 0.0223  -0.4201 -0.0557 424  DG  C OP1   
242  O  OP2   . DG  B 4   ? 0.7968 0.9320 1.2136 -0.2702 -0.3672 0.0164  424  DG  C OP2   
243  O  "O5'" . DG  B 4   ? 0.5813 0.7668 1.2272 -0.0528 -0.3142 0.0597  424  DG  C "O5'" 
244  C  "C5'" . DG  B 4   ? 0.6091 0.7141 1.1448 -0.1586 -0.3170 -0.0224 424  DG  C "C5'" 
245  C  "C4'" . DG  B 4   ? 0.5222 0.6548 1.0284 -0.1027 -0.2053 -0.0778 424  DG  C "C4'" 
246  O  "O4'" . DG  B 4   ? 0.5774 0.5969 0.9586 -0.1632 -0.0984 -0.1152 424  DG  C "O4'" 
247  C  "C3'" . DG  B 4   ? 0.5155 0.6354 0.9927 -0.0737 -0.2271 -0.0698 424  DG  C "C3'" 
248  O  "O3'" . DG  B 4   ? 0.5621 0.7715 1.0819 -0.1494 -0.2058 -0.1855 424  DG  C "O3'" 
249  C  "C2'" . DG  B 4   ? 0.6309 0.5805 1.0103 -0.0269 -0.1553 -0.0103 424  DG  C "C2'" 
250  C  "C1'" . DG  B 4   ? 0.6028 0.5076 0.9028 -0.1272 -0.1326 -0.0263 424  DG  C "C1'" 
251  N  N9    . DG  B 4   ? 0.5130 0.4985 0.8107 -0.1408 -0.1898 0.0158  424  DG  C N9    
252  C  C8    . DG  B 4   ? 0.6339 0.6750 0.7078 -0.0397 -0.0649 0.1336  424  DG  C C8    
253  N  N7    . DG  B 4   ? 0.5196 0.8269 0.6428 -0.0362 0.0321  0.1402  424  DG  C N7    
254  C  C5    . DG  B 4   ? 0.4999 0.6747 0.6478 -0.0807 0.0377  0.1412  424  DG  C C5    
255  C  C6    . DG  B 4   ? 0.4786 0.5501 0.6314 -0.1613 0.0840  0.1671  424  DG  C C6    
256  O  O6    . DG  B 4   ? 0.5597 0.5795 0.6189 -0.1637 0.1175  0.1669  424  DG  C O6    
257  N  N1    . DG  B 4   ? 0.4209 0.4294 0.6267 -0.2091 0.1031  0.1853  424  DG  C N1    
258  C  C2    . DG  B 4   ? 0.4972 0.4146 0.6564 -0.1461 0.0529  0.1659  424  DG  C C2    
259  N  N2    . DG  B 4   ? 0.3837 0.3980 0.6368 -0.1337 0.1083  0.1554  424  DG  C N2    
260  N  N3    . DG  B 4   ? 0.4644 0.4267 0.6978 -0.1530 -0.0234 0.1269  424  DG  C N3    
261  C  C4    . DG  B 4   ? 0.4531 0.5351 0.7198 -0.1447 -0.0591 0.0893  424  DG  C C4    
262  P  P     . DG  B 5   ? 0.4892 0.6483 1.0107 -0.0049 -0.1383 -0.2019 425  DG  C P     
263  O  OP1   . DG  B 5   ? 0.5674 0.8145 1.4998 0.0952  0.0620  -0.2754 425  DG  C OP1   
264  O  OP2   . DG  B 5   ? 1.0004 0.5091 0.9659 0.0977  -0.2870 -0.1017 425  DG  C OP2   
265  O  "O5'" . DG  B 5   ? 0.4290 0.5881 0.7749 -0.0844 -0.0333 -0.1196 425  DG  C "O5'" 
266  C  "C5'" . DG  B 5   ? 0.2241 0.5193 0.6732 -0.1341 0.1560  -0.1855 425  DG  C "C5'" 
267  C  "C4'" . DG  B 5   ? 0.2452 0.4258 0.5825 -0.1229 0.1486  -0.1425 425  DG  C "C4'" 
268  O  "O4'" . DG  B 5   ? 0.2783 0.3972 0.4340 -0.1041 0.1291  -0.0673 425  DG  C "O4'" 
269  C  "C3'" . DG  B 5   ? 0.2053 0.3971 0.4744 -0.0810 0.0665  -0.0777 425  DG  C "C3'" 
270  O  "O3'" . DG  B 5   ? 0.2584 0.3426 0.3812 -0.0960 0.0913  -0.0186 425  DG  C "O3'" 
271  C  "C2'" . DG  B 5   ? 0.2980 0.3790 0.4044 -0.1053 0.0350  -0.0539 425  DG  C "C2'" 
272  C  "C1'" . DG  B 5   ? 0.2828 0.3749 0.3284 -0.1083 0.0734  -0.0297 425  DG  C "C1'" 
273  N  N9    . DG  B 5   ? 0.2982 0.4071 0.3536 -0.0523 0.0429  -0.0646 425  DG  C N9    
274  C  C8    . DG  B 5   ? 0.3367 0.4527 0.3880 0.0163  0.0036  -0.1143 425  DG  C C8    
275  N  N7    . DG  B 5   ? 0.3895 0.4142 0.4246 0.0562  -0.0526 -0.1346 425  DG  C N7    
276  C  C5    . DG  B 5   ? 0.2827 0.3266 0.3202 -0.0515 0.0430  -0.0118 425  DG  C C5    
277  C  C6    . DG  B 5   ? 0.2489 0.3270 0.3492 -0.0479 0.0155  -0.0258 425  DG  C C6    
278  O  O6    . DG  B 5   ? 0.2737 0.2975 0.3714 -0.0077 -0.0093 -0.0509 425  DG  C O6    
279  N  N1    . DG  B 5   ? 0.2634 0.3790 0.3191 -0.0373 0.0428  0.0229  425  DG  C N1    
280  C  C2    . DG  B 5   ? 0.2622 0.3971 0.3195 -0.0508 0.0374  0.0327  425  DG  C C2    
281  N  N2    . DG  B 5   ? 0.2241 0.5213 0.3213 -0.0447 0.0696  0.0947  425  DG  C N2    
282  N  N3    . DG  B 5   ? 0.3014 0.3599 0.3041 -0.0800 0.0499  0.0362  425  DG  C N3    
283  C  C4    . DG  B 5   ? 0.2518 0.3720 0.3451 -0.0762 0.0440  -0.0375 425  DG  C C4    
284  P  P     . DA  B 6   ? 0.2476 0.3029 0.2862 -0.0509 0.0865  -0.0503 426  DA  C P     
285  O  OP1   . DA  B 6   ? 0.3032 0.3766 0.2740 -0.0089 0.0978  -0.0371 426  DA  C OP1   
286  O  OP2   . DA  B 6   ? 0.2890 0.3252 0.2959 -0.0239 0.0587  -0.0450 426  DA  C OP2   
287  O  "O5'" . DA  B 6   ? 0.2326 0.3010 0.2602 -0.0650 0.0729  -0.0541 426  DA  C "O5'" 
288  C  "C5'" . DA  B 6   ? 0.2413 0.2435 0.2616 -0.0714 0.0952  -0.0588 426  DA  C "C5'" 
289  C  "C4'" . DA  B 6   ? 0.2392 0.2242 0.2149 -0.0776 0.0783  -0.0628 426  DA  C "C4'" 
290  O  "O4'" . DA  B 6   ? 0.2554 0.2090 0.2201 -0.0713 0.0544  -0.0492 426  DA  C "O4'" 
291  C  "C3'" . DA  B 6   ? 0.2267 0.2177 0.1844 -0.0591 0.0602  -0.0621 426  DA  C "C3'" 
292  O  "O3'" . DA  B 6   ? 0.2147 0.1950 0.1535 -0.0469 0.0529  -0.0246 426  DA  C "O3'" 
293  C  "C2'" . DA  B 6   ? 0.2383 0.1918 0.1883 -0.0466 0.0534  -0.0535 426  DA  C "C2'" 
294  C  "C1'" . DA  B 6   ? 0.2303 0.2081 0.1989 -0.0514 0.0389  -0.0589 426  DA  C "C1'" 
295  N  N9    . DA  B 6   ? 0.2184 0.2029 0.2229 -0.0355 0.0302  -0.0614 426  DA  C N9    
296  C  C8    . DA  B 6   ? 0.2721 0.2211 0.3108 0.0045  -0.0218 -0.1006 426  DA  C C8    
297  N  N7    . DA  B 6   ? 0.2558 0.2206 0.3131 -0.0112 -0.0321 -0.0911 426  DA  C N7    
298  C  C5    . DA  B 6   ? 0.2139 0.2058 0.2494 -0.0387 0.0065  -0.0642 426  DA  C C5    
299  C  C6    . DA  B 6   ? 0.2591 0.2032 0.1989 -0.0277 0.0124  -0.0304 426  DA  C C6    
300  N  N6    . DA  B 6   ? 0.2594 0.2763 0.2545 -0.0357 -0.0269 -0.0471 426  DA  C N6    
301  N  N1    . DA  B 6   ? 0.2419 0.2255 0.2143 -0.0223 0.0337  -0.0457 426  DA  C N1    
302  C  C2    . DA  B 6   ? 0.2145 0.2251 0.2175 -0.0200 0.0471  -0.0694 426  DA  C C2    
303  N  N3    . DA  B 6   ? 0.2176 0.2160 0.2144 -0.0255 0.0406  -0.0556 426  DA  C N3    
304  C  C4    . DA  B 6   ? 0.1862 0.2230 0.1987 -0.0378 0.0469  -0.0649 426  DA  C C4    
305  P  P     . PED B 7   ? 0.2050 0.1923 0.1817 -0.0333 0.0502  -0.0273 427  PED C P     
306  O  O1P   . PED B 7   ? 0.2658 0.1810 0.1762 -0.0396 0.0402  -0.0323 427  PED C O1P   
307  O  O2P   . PED B 7   ? 0.2090 0.2060 0.1871 -0.0198 0.0413  -0.0075 427  PED C O2P   
308  O  "O5'" . PED B 7   ? 0.1858 0.2284 0.1658 -0.0427 0.0470  -0.0140 427  PED C "O5'" 
309  C  "C2'" . PED B 7   ? 0.1981 0.1480 0.1914 0.0077  0.0239  -0.0147 427  PED C "C2'" 
310  C  "C5'" . PED B 7   ? 0.1840 0.2994 0.1539 -0.0555 0.0413  -0.0072 427  PED C "C5'" 
311  C  "C4'" . PED B 7   ? 0.1818 0.1743 0.1270 -0.0271 0.0324  -0.0258 427  PED C "C4'" 
312  O  "O4'" . PED B 7   ? 0.1904 0.1736 0.1438 -0.0300 0.0173  -0.0214 427  PED C "O4'" 
313  C  "C3'" . PED B 7   ? 0.1901 0.1366 0.1400 -0.0115 0.0447  -0.0220 427  PED C "C3'" 
314  C  "C1'" . PED B 7   ? 0.2055 0.2032 0.2061 0.0273  0.0163  -0.0494 427  PED C "C1'" 
315  O  "O3'" . PED B 7   ? 0.1679 0.1510 0.1454 -0.0138 0.0414  -0.0162 427  PED C "O3'" 
316  P  P     . DG  B 8   ? 0.2041 0.1546 0.1165 -0.0190 0.0388  -0.0236 428  DG  C P     
317  O  OP1   . DG  B 8   ? 0.2130 0.1752 0.1204 -0.0460 0.0438  -0.0230 428  DG  C OP1   
318  O  OP2   . DG  B 8   ? 0.2031 0.1557 0.1053 -0.0014 0.0278  -0.0195 428  DG  C OP2   
319  O  "O5'" . DG  B 8   ? 0.1997 0.1616 0.1375 -0.0188 0.0353  -0.0428 428  DG  C "O5'" 
320  C  "C5'" . DG  B 8   ? 0.2263 0.1664 0.1130 -0.0029 0.0529  -0.0210 428  DG  C "C5'" 
321  C  "C4'" . DG  B 8   ? 0.2010 0.1396 0.1186 -0.0337 0.0308  -0.0168 428  DG  C "C4'" 
322  O  "O4'" . DG  B 8   ? 0.2080 0.1369 0.1505 -0.0349 0.0324  -0.0252 428  DG  C "O4'" 
323  C  "C3'" . DG  B 8   ? 0.1662 0.1298 0.1563 -0.0131 0.0487  -0.0258 428  DG  C "C3'" 
324  O  "O3'" . DG  B 8   ? 0.1784 0.1354 0.1090 -0.0112 0.0261  -0.0228 428  DG  C "O3'" 
325  C  "C2'" . DG  B 8   ? 0.1682 0.1486 0.1656 -0.0214 0.0266  -0.0374 428  DG  C "C2'" 
326  C  "C1'" . DG  B 8   ? 0.1699 0.1364 0.1747 -0.0269 0.0500  -0.0218 428  DG  C "C1'" 
327  N  N9    . DG  B 8   ? 0.1812 0.1720 0.1934 -0.0456 0.0517  -0.0485 428  DG  C N9    
328  C  C8    . DG  B 8   ? 0.1614 0.2044 0.1781 -0.0010 0.0469  0.0041  428  DG  C C8    
329  N  N7    . DG  B 8   ? 0.1742 0.2556 0.2194 -0.0404 0.0426  -0.0036 428  DG  C N7    
330  C  C5    . DG  B 8   ? 0.1859 0.2057 0.2374 -0.0209 0.0236  -0.0234 428  DG  C C5    
331  C  C6    . DG  B 8   ? 0.1888 0.2247 0.3078 -0.0143 0.0023  -0.0680 428  DG  C C6    
332  O  O6    . DG  B 8   ? 0.1743 0.2703 0.3316 0.0200  -0.0076 -0.0067 428  DG  C O6    
333  N  N1    . DG  B 8   ? 0.2162 0.2824 0.3105 -0.0342 -0.0085 -0.1079 428  DG  C N1    
334  C  C2    . DG  B 8   ? 0.2257 0.3447 0.2945 -0.0507 0.0063  -0.1828 428  DG  C C2    
335  N  N2    . DG  B 8   ? 0.2795 0.2971 0.2361 0.0010  -0.0279 -0.0693 428  DG  C N2    
336  N  N3    . DG  B 8   ? 0.2104 0.3391 0.2480 -0.0550 0.0288  -0.1317 428  DG  C N3    
337  C  C4    . DG  B 8   ? 0.1997 0.1903 0.2173 -0.0537 0.0303  -0.0577 428  DG  C C4    
338  P  P     . DA  B 9   ? 0.1709 0.1446 0.1084 -0.0068 0.0095  -0.0117 429  DA  C P     
339  O  OP1   . DA  B 9   ? 0.1746 0.1654 0.1147 -0.0084 0.0298  -0.0328 429  DA  C OP1   
340  O  OP2   . DA  B 9   ? 0.1945 0.1382 0.1233 -0.0215 0.0430  -0.0312 429  DA  C OP2   
341  O  "O5'" . DA  B 9   ? 0.1938 0.1871 0.1750 -0.0175 -0.0263 0.0133  429  DA  C "O5'" 
342  C  "C5'" . DA  B 9   ? 0.3823 0.4542 0.1230 -0.1429 -0.0085 -0.0203 429  DA  C "C5'" 
343  C  "C4'" . DA  B 9   ? 0.3940 0.4120 0.2724 -0.1650 -0.0826 -0.0912 429  DA  C "C4'" 
344  O  "O4'" . DA  B 9   ? 0.3836 0.4418 0.3597 -0.1294 -0.0583 -0.0748 429  DA  C "O4'" 
345  C  "C3'" . DA  B 9   ? 0.4099 0.4184 0.3538 -0.1183 -0.0968 -0.0735 429  DA  C "C3'" 
346  O  "O3'" . DA  B 9   ? 0.5771 0.7645 0.3155 -0.0153 -0.0157 0.0671  429  DA  C "O3'" 
347  C  "C2'" . DA  B 9   ? 0.4046 0.5120 0.2894 -0.1114 -0.1015 0.0125  429  DA  C "C2'" 
348  C  "C1'" . DA  B 9   ? 0.3993 0.5488 0.3807 -0.1471 -0.1074 -0.0566 429  DA  C "C1'" 
349  N  N9    . DA  B 9   ? 0.4113 0.4421 0.3756 -0.0906 -0.0946 -0.0117 429  DA  C N9    
350  C  C8    . DA  B 9   ? 0.4889 0.4593 0.3154 -0.0981 -0.1096 0.0585  429  DA  C C8    
351  N  N7    . DA  B 9   ? 0.4975 0.2861 0.3562 -0.0417 -0.0711 0.0367  429  DA  C N7    
352  C  C5    . DA  B 9   ? 0.4528 0.2989 0.3148 -0.0746 -0.0582 0.0830  429  DA  C C5    
353  C  C6    . DA  B 9   ? 0.4448 0.2524 0.3319 -0.0654 -0.0160 0.0777  429  DA  C C6    
354  N  N6    . DA  B 9   ? 0.5223 0.3979 0.3757 -0.1336 0.0425  -0.0301 429  DA  C N6    
355  N  N1    . DA  B 9   ? 0.3506 0.3737 0.3963 -0.0878 0.0289  -0.0259 429  DA  C N1    
356  C  C2    . DA  B 9   ? 0.3249 0.4635 0.4431 -0.1559 0.0435  -0.0852 429  DA  C C2    
357  N  N3    . DA  B 9   ? 0.3664 0.5630 0.4618 -0.2209 0.0376  -0.1346 429  DA  C N3    
358  C  C4    . DA  B 9   ? 0.3949 0.4066 0.4004 -0.0932 -0.0477 -0.0393 429  DA  C C4    
359  P  P     . DA  B 10  ? 0.4208 1.0540 0.5147 -0.2272 -0.0531 0.2133  430  DA  C P     
360  O  OP1   . DA  B 10  ? 0.2855 1.7978 0.2831 -0.1152 -0.1604 0.0789  430  DA  C OP1   
361  O  OP2   . DA  B 10  ? 0.8379 0.9708 0.5515 -0.4021 -0.1570 0.2935  430  DA  C OP2   
362  O  "O5'" . DA  B 10  ? 0.3872 0.7390 0.5342 -0.1408 -0.0386 0.2531  430  DA  C "O5'" 
363  C  "C5'" . DA  B 10  ? 0.3364 0.7700 0.5658 -0.0885 -0.0581 0.2141  430  DA  C "C5'" 
364  C  "C4'" . DA  B 10  ? 0.2744 0.6476 0.6145 0.0072  -0.0387 0.1729  430  DA  C "C4'" 
365  O  "O4'" . DA  B 10  ? 0.2623 0.5558 0.5644 0.1269  -0.0416 0.1823  430  DA  C "O4'" 
366  C  "C3'" . DA  B 10  ? 0.4760 0.7683 0.5031 0.0318  -0.0240 0.2176  430  DA  C "C3'" 
367  O  "O3'" . DA  B 10  ? 0.5965 0.7670 0.4893 -0.0516 -0.0140 0.2148  430  DA  C "O3'" 
368  C  "C2'" . DA  B 10  ? 0.4725 0.6380 0.4500 0.0652  -0.0765 0.2896  430  DA  C "C2'" 
369  C  "C1'" . DA  B 10  ? 0.4620 0.4682 0.4989 0.1310  -0.0130 0.1842  430  DA  C "C1'" 
370  N  N9    . DA  B 10  ? 0.5249 0.3256 0.5279 0.0123  0.0245  0.1473  430  DA  C N9    
371  C  C8    . DA  B 10  ? 0.5225 0.3304 0.6172 0.0056  0.0028  0.1115  430  DA  C C8    
372  N  N7    . DA  B 10  ? 0.6248 0.2262 0.6542 -0.0336 0.0562  0.0399  430  DA  C N7    
373  C  C5    . DA  B 10  ? 0.5871 0.3540 0.5756 -0.0427 0.0622  0.0342  430  DA  C C5    
374  C  C6    . DA  B 10  ? 0.7403 0.3040 0.5336 -0.1550 0.1227  0.0449  430  DA  C C6    
375  N  N6    . DA  B 10  ? 0.8701 0.3902 0.5452 -0.1976 0.1528  0.0127  430  DA  C N6    
376  N  N1    . DA  B 10  ? 0.7510 0.3872 0.3947 -0.2000 0.0162  0.1930  430  DA  C N1    
377  C  C2    . DA  B 10  ? 0.7646 0.3745 0.4052 -0.2440 0.0339  0.1856  430  DA  C C2    
378  N  N3    . DA  B 10  ? 0.7597 0.4833 0.4556 -0.2371 0.0588  0.1351  430  DA  C N3    
379  C  C4    . DA  B 10  ? 0.6454 0.3984 0.5346 -0.1295 0.0946  0.0588  430  DA  C C4    
380  P  P     . DG  B 11  ? 0.5478 0.8094 0.3957 -0.0624 0.0343  0.2017  431  DG  C P     
381  O  OP1   . DG  B 11  ? 1.0278 1.0848 0.5029 -0.4132 0.3440  0.0612  431  DG  C OP1   
382  O  OP2   . DG  B 11  ? 0.4996 0.8001 0.4299 -0.0761 -0.0891 0.2567  431  DG  C OP2   
383  O  "O5'" . DG  B 11  ? 0.5729 0.8039 0.5968 -0.1135 -0.0629 0.2068  431  DG  C "O5'" 
384  C  "C5'" . DG  B 11  ? 0.7575 0.8795 0.7460 -0.2302 0.0329  0.0959  431  DG  C "C5'" 
385  C  "C4'" . DG  B 11  ? 0.7863 0.8154 0.7776 -0.3048 0.1007  -0.0046 431  DG  C "C4'" 
386  O  "O4'" . DG  B 11  ? 0.8229 0.6866 0.7891 -0.3186 0.1021  -0.1204 431  DG  C "O4'" 
387  C  "C3'" . DG  B 11  ? 0.6460 0.7656 0.8148 -0.3545 0.0281  -0.0975 431  DG  C "C3'" 
388  O  "O3'" . DG  B 11  ? 0.6343 0.7679 0.5839 -0.4632 0.2068  -0.1147 431  DG  C "O3'" 
389  C  "C2'" . DG  B 11  ? 0.7991 0.7846 0.7674 -0.3270 -0.1563 -0.1069 431  DG  C "C2'" 
390  C  "C1'" . DG  B 11  ? 0.8323 0.6654 0.7930 -0.3193 -0.0895 -0.1346 431  DG  C "C1'" 
391  N  N9    . DG  B 11  ? 0.9697 0.6414 0.7440 -0.3829 -0.0350 -0.1100 431  DG  C N9    
392  C  C8    . DG  B 11  ? 1.0042 0.6187 0.5903 -0.3881 -0.0593 -0.0688 431  DG  C C8    
393  N  N7    . DG  B 11  ? 1.0846 0.5199 0.4592 -0.4607 0.0196  0.0738  431  DG  C N7    
394  C  C5    . DG  B 11  ? 1.0740 0.5326 0.5707 -0.3136 -0.0039 0.0855  431  DG  C C5    
395  C  C6    . DG  B 11  ? 1.0883 0.3567 0.6111 -0.2466 0.0392  0.1356  431  DG  C C6    
396  O  O6    . DG  B 11  ? 1.0712 0.8620 0.5121 -0.1643 0.0258  0.0800  431  DG  C O6    
397  N  N1    . DG  B 11  ? 1.0517 0.3720 0.6617 -0.0769 -0.0247 0.1950  431  DG  C N1    
398  C  C2    . DG  B 11  ? 1.0321 0.4939 0.7386 -0.1406 -0.0132 0.1338  431  DG  C C2    
399  N  N2    . DG  B 11  ? 1.0507 0.4536 0.9329 -0.1518 0.0455  0.0129  431  DG  C N2    
400  N  N3    . DG  B 11  ? 1.0230 0.6075 0.7202 -0.2704 0.0021  0.1021  431  DG  C N3    
401  C  C4    . DG  B 11  ? 1.0322 0.5974 0.6794 -0.3581 0.0025  0.0355  431  DG  C C4    
402  N  N     . PRO C 1   ? 0.1939 0.1814 0.2226 0.0149  0.0378  0.0058  1    PRO A N     
403  C  CA    . PRO C 1   ? 0.1944 0.1435 0.2460 0.0178  0.0273  -0.0048 1    PRO A CA    
404  C  C     . PRO C 1   ? 0.1876 0.1419 0.1446 0.0104  -0.0040 -0.0269 1    PRO A C     
405  O  O     . PRO C 1   ? 0.2274 0.1728 0.1348 0.0034  -0.0175 -0.0516 1    PRO A O     
406  C  CB    . PRO C 1   ? 0.2415 0.1445 0.4434 0.0183  0.0841  -0.0539 1    PRO A CB    
407  C  CG    . PRO C 1   ? 0.2599 0.1539 0.4151 0.0002  0.0532  -0.0443 1    PRO A CG    
408  C  CD    . PRO C 1   ? 0.2462 0.1748 0.2829 -0.0126 0.0322  -0.0472 1    PRO A CD    
409  N  N     . GLU C 2   ? 0.1795 0.1509 0.1001 -0.0078 0.0137  -0.0100 2    GLU A N     
410  C  CA    . GLU C 2   ? 0.1569 0.1496 0.1092 -0.0116 0.0243  -0.0153 2    GLU A CA    
411  C  C     . GLU C 2   ? 0.1579 0.1335 0.0856 0.0043  0.0091  -0.0137 2    GLU A C     
412  O  O     . GLU C 2   ? 0.1846 0.1457 0.1141 0.0142  0.0219  -0.0185 2    GLU A O     
413  C  CB    . GLU C 2   ? 0.1701 0.1600 0.1254 -0.0151 0.0340  -0.0271 2    GLU A CB    
414  C  CG    . GLU C 2   ? 0.1637 0.1652 0.1259 0.0008  0.0266  -0.0300 2    GLU A CG    
415  C  CD    . GLU C 2   ? 0.1855 0.1370 0.1240 -0.0014 0.0411  -0.0023 2    GLU A CD    
416  O  OE1   . GLU C 2   ? 0.1823 0.1498 0.1100 0.0014  0.0243  -0.0174 2    GLU A OE1   
417  O  OE2   . GLU C 2   ? 0.1868 0.1672 0.1231 -0.0137 0.0484  -0.0246 2    GLU A OE2   
418  N  N     . GLY C 3   ? 0.1622 0.1440 0.0898 -0.0228 0.0151  -0.0087 3    GLY A N     
419  C  CA    . GLY C 3   ? 0.1527 0.1547 0.1007 0.0071  0.0125  0.0150  3    GLY A CA    
420  C  C     . GLY C 3   ? 0.1764 0.1280 0.0908 0.0154  0.0175  0.0012  3    GLY A C     
421  O  O     . GLY C 3   ? 0.1636 0.1439 0.1161 0.0162  0.0211  -0.0042 3    GLY A O     
422  N  N     . PRO C 4   ? 0.1925 0.1226 0.0870 0.0108  0.0049  -0.0078 4    PRO A N     
423  C  CA    . PRO C 4   ? 0.1842 0.1346 0.0907 0.0204  0.0084  -0.0074 4    PRO A CA    
424  C  C     . PRO C 4   ? 0.1912 0.1379 0.0807 0.0196  0.0044  -0.0176 4    PRO A C     
425  O  O     . PRO C 4   ? 0.1894 0.1395 0.1138 0.0208  0.0237  -0.0039 4    PRO A O     
426  C  CB    . PRO C 4   ? 0.1868 0.1295 0.0847 0.0188  0.0121  -0.0128 4    PRO A CB    
427  C  CG    . PRO C 4   ? 0.2163 0.1526 0.0794 0.0458  0.0049  -0.0024 4    PRO A CG    
428  C  CD    . PRO C 4   ? 0.2009 0.1668 0.0915 0.0450  0.0058  -0.0157 4    PRO A CD    
429  N  N     . GLU C 5   ? 0.1928 0.1315 0.0944 0.0069  0.0198  -0.0031 5    GLU A N     
430  C  CA    . GLU C 5   ? 0.1771 0.1294 0.1070 0.0139  0.0258  -0.0062 5    GLU A CA    
431  C  C     . GLU C 5   ? 0.1754 0.1354 0.0991 0.0001  0.0203  -0.0012 5    GLU A C     
432  O  O     . GLU C 5   ? 0.2019 0.1373 0.1166 0.0227  0.0300  -0.0022 5    GLU A O     
433  C  CB    . GLU C 5   ? 0.1999 0.1760 0.1206 -0.0298 0.0475  -0.0087 5    GLU A CB    
434  C  CG    . GLU C 5   ? 0.2175 0.1676 0.1154 0.0175  0.0475  0.0024  5    GLU A CG    
435  C  CD    . GLU C 5   ? 0.2037 0.1631 0.1018 0.0082  0.0166  0.0049  5    GLU A CD    
436  O  OE1   . GLU C 5   ? 0.2097 0.1667 0.1085 0.0184  0.0165  -0.0025 5    GLU A OE1   
437  O  OE2   . GLU C 5   ? 0.2036 0.1928 0.0984 0.0200  0.0222  0.0011  5    GLU A OE2   
438  N  N     . ILE C 6   ? 0.1645 0.1327 0.0901 0.0041  0.0092  -0.0065 6    ILE A N     
439  C  CA    . ILE C 6   ? 0.1550 0.1348 0.0912 0.0157  0.0066  -0.0050 6    ILE A CA    
440  C  C     . ILE C 6   ? 0.1504 0.1449 0.1017 0.0219  -0.0076 -0.0206 6    ILE A C     
441  O  O     . ILE C 6   ? 0.1654 0.1551 0.1113 0.0165  0.0066  -0.0235 6    ILE A O     
442  C  CB    . ILE C 6   ? 0.1343 0.1937 0.0840 0.0116  0.0009  -0.0026 6    ILE A CB    
443  C  CG1   . ILE C 6   ? 0.1462 0.1572 0.1335 0.0004  -0.0074 -0.0110 6    ILE A CG1   
444  C  CG2   . ILE C 6   ? 0.1921 0.2098 0.0884 0.0252  0.0200  -0.0031 6    ILE A CG2   
445  C  CD1   . ILE C 6   ? 0.2169 0.1638 0.1420 -0.0114 -0.0118 -0.0054 6    ILE A CD1   
446  N  N     . ARG C 7   ? 0.1632 0.1458 0.0809 -0.0098 0.0056  -0.0101 7    ARG A N     
447  C  CA    . ARG C 7   ? 0.1666 0.1194 0.0898 -0.0050 0.0105  -0.0051 7    ARG A CA    
448  C  C     . ARG C 7   ? 0.1867 0.1356 0.0844 0.0220  0.0202  -0.0011 7    ARG A C     
449  O  O     . ARG C 7   ? 0.1770 0.1347 0.1079 0.0059  0.0119  -0.0178 7    ARG A O     
450  C  CB    . ARG C 7   ? 0.1627 0.1263 0.1055 -0.0127 0.0092  -0.0282 7    ARG A CB    
451  C  CG    . ARG C 7   ? 0.1642 0.1484 0.1017 -0.0134 0.0122  -0.0072 7    ARG A CG    
452  C  CD    . ARG C 7   ? 0.1873 0.1506 0.1098 -0.0013 0.0240  -0.0221 7    ARG A CD    
453  N  NE    . ARG C 7   ? 0.1921 0.1649 0.1080 0.0154  0.0101  -0.0200 7    ARG A NE    
454  C  CZ    . ARG C 7   ? 0.2077 0.1353 0.0983 0.0264  -0.0020 -0.0113 7    ARG A CZ    
455  N  NH1   . ARG C 7   ? 0.2024 0.1548 0.1045 0.0107  0.0065  0.0029  7    ARG A NH1   
456  N  NH2   . ARG C 7   ? 0.1831 0.1374 0.1451 0.0191  0.0093  -0.0173 7    ARG A NH2   
457  N  N     . ARG C 8   ? 0.1987 0.1234 0.0922 0.0028  0.0168  0.0029  8    ARG A N     
458  C  CA    . ARG C 8   ? 0.2274 0.1367 0.0783 0.0198  0.0099  -0.0051 8    ARG A CA    
459  C  C     . ARG C 8   ? 0.2104 0.1324 0.1132 0.0252  -0.0150 -0.0131 8    ARG A C     
460  O  O     . ARG C 8   ? 0.1920 0.1394 0.1251 0.0171  0.0032  -0.0017 8    ARG A O     
461  C  CB    . ARG C 8   ? 0.2612 0.1293 0.1086 -0.0257 0.0216  0.0033  8    ARG A CB    
462  C  CG    . ARG C 8   ? 0.2739 0.1534 0.0812 0.0122  0.0330  -0.0119 8    ARG A CG    
463  C  CD    . ARG C 8   ? 0.2800 0.1532 0.1206 0.0124  0.0396  0.0138  8    ARG A CD    
464  N  NE    . ARG C 8   ? 0.2853 0.1413 0.1214 -0.0001 0.0231  0.0071  8    ARG A NE    
465  C  CZ    . ARG C 8   ? 0.2981 0.1507 0.1256 0.0197  0.0496  0.0155  8    ARG A CZ    
466  N  NH1   . ARG C 8   ? 0.2885 0.1498 0.1529 0.0201  0.0300  0.0084  8    ARG A NH1   
467  N  NH2   . ARG C 8   ? 0.3046 0.1527 0.1974 0.0171  0.0616  0.0347  8    ARG A NH2   
468  N  N     . ALA C 9   ? 0.1997 0.1335 0.1025 0.0038  -0.0017 -0.0099 9    ALA A N     
469  C  CA    . ALA C 9   ? 0.1703 0.1168 0.1260 -0.0055 0.0138  -0.0128 9    ALA A CA    
470  C  C     . ALA C 9   ? 0.1765 0.1309 0.1087 0.0143  0.0042  -0.0079 9    ALA A C     
471  O  O     . ALA C 9   ? 0.1882 0.1437 0.1159 0.0256  -0.0036 -0.0221 9    ALA A O     
472  C  CB    . ALA C 9   ? 0.1795 0.1468 0.1393 -0.0061 -0.0012 -0.0280 9    ALA A CB    
473  N  N     . ALA C 10  ? 0.1572 0.1396 0.1019 -0.0098 0.0077  -0.0019 10   ALA A N     
474  C  CA    . ALA C 10  ? 0.1567 0.1293 0.1163 0.0010  -0.0040 -0.0063 10   ALA A CA    
475  C  C     . ALA C 10  ? 0.1527 0.1769 0.0907 0.0301  0.0075  -0.0036 10   ALA A C     
476  O  O     . ALA C 10  ? 0.1737 0.1310 0.1119 0.0190  0.0122  -0.0089 10   ALA A O     
477  C  CB    . ALA C 10  ? 0.1841 0.1140 0.1242 0.0062  0.0046  0.0082  10   ALA A CB    
478  N  N     . ASP C 11  ? 0.1756 0.1314 0.1008 0.0188  -0.0098 -0.0080 11   ASP A N     
479  C  CA    . ASP C 11  ? 0.1742 0.1284 0.0994 0.0173  -0.0079 -0.0184 11   ASP A CA    
480  C  C     . ASP C 11  ? 0.1668 0.1291 0.0896 0.0158  -0.0062 -0.0127 11   ASP A C     
481  O  O     . ASP C 11  ? 0.1911 0.1645 0.1177 0.0520  -0.0025 -0.0143 11   ASP A O     
482  C  CB    . ASP C 11  ? 0.1718 0.1571 0.1083 -0.0055 0.0036  -0.0380 11   ASP A CB    
483  C  CG    . ASP C 11  ? 0.1995 0.1582 0.1027 0.0013  -0.0082 -0.0313 11   ASP A CG    
484  O  OD1   . ASP C 11  ? 0.2216 0.1563 0.1123 0.0228  0.0015  -0.0172 11   ASP A OD1   
485  O  OD2   . ASP C 11  ? 0.2444 0.1620 0.1024 0.0177  -0.0046 -0.0273 11   ASP A OD2   
486  N  N     . ASN C 12  ? 0.2024 0.1322 0.0964 -0.0049 -0.0092 0.0039  12   ASN A N     
487  C  CA    . ASN C 12  ? 0.2124 0.1344 0.1038 -0.0034 0.0026  -0.0031 12   ASN A CA    
488  C  C     . ASN C 12  ? 0.1798 0.1577 0.1113 0.0219  -0.0070 -0.0165 12   ASN A C     
489  O  O     . ASN C 12  ? 0.2053 0.1451 0.1074 0.0241  0.0123  0.0076  12   ASN A O     
490  C  CB    . ASN C 12  ? 0.2337 0.1564 0.1442 -0.0096 0.0393  0.0174  12   ASN A CB    
491  C  CG    . ASN C 12  ? 0.1833 0.2156 0.1534 0.0085  0.0292  0.0352  12   ASN A CG    
494  N  N     . LEU C 13  ? 0.1611 0.1523 0.0984 0.0011  0.0028  -0.0123 13   LEU A N     
495  C  CA    . LEU C 13  ? 0.1598 0.1519 0.1012 0.0159  0.0115  -0.0127 13   LEU A CA    
496  C  C     . LEU C 13  ? 0.1634 0.1151 0.1152 0.0190  0.0153  -0.0023 13   LEU A C     
497  O  O     . LEU C 13  ? 0.1727 0.1367 0.1223 0.0335  0.0050  -0.0101 13   LEU A O     
498  C  CB    . LEU C 13  ? 0.1786 0.1637 0.1067 0.0169  -0.0018 0.0002  13   LEU A CB    
499  C  CG    . LEU C 13  ? 0.1773 0.1180 0.1330 0.0300  -0.0086 -0.0126 13   LEU A CG    
500  C  CD1   . LEU C 13  ? 0.2084 0.1414 0.1356 0.0101  -0.0356 -0.0134 13   LEU A CD1   
501  C  CD2   . LEU C 13  ? 0.2187 0.1471 0.1298 -0.0035 -0.0001 -0.0002 13   LEU A CD2   
502  N  N     . GLU C 14  ? 0.1775 0.1281 0.1039 0.0018  -0.0009 0.0045  14   GLU A N     
503  C  CA    . GLU C 14  ? 0.1780 0.1285 0.1226 0.0015  0.0009  0.0054  14   GLU A CA    
504  C  C     . GLU C 14  ? 0.1878 0.1308 0.1049 0.0203  -0.0029 -0.0216 14   GLU A C     
505  O  O     . GLU C 14  ? 0.1788 0.1642 0.1291 0.0270  -0.0050 -0.0188 14   GLU A O     
506  C  CB    . GLU C 14  ? 0.2017 0.1277 0.1214 -0.0042 -0.0104 -0.0077 14   GLU A CB    
507  C  CG    . GLU C 14  ? 0.2557 0.1417 0.1407 0.0083  -0.0156 0.0097  14   GLU A CG    
508  C  CD    . GLU C 14  ? 0.3102 0.1352 0.1352 0.0187  -0.0122 -0.0021 14   GLU A CD    
509  O  OE1   . GLU C 14  ? 0.4436 0.2016 0.1418 -0.0284 -0.0237 -0.0190 14   GLU A OE1   
510  O  OE2   . GLU C 14  ? 0.2882 0.1633 0.1430 -0.0210 -0.0410 0.0141  14   GLU A OE2   
511  N  N     . ALA C 15  ? 0.2185 0.1537 0.0964 0.0272  -0.0164 -0.0148 15   ALA A N     
512  C  CA    . ALA C 15  ? 0.1983 0.1759 0.1125 0.0322  -0.0341 -0.0212 15   ALA A CA    
513  C  C     . ALA C 15  ? 0.1976 0.1587 0.1261 0.0236  -0.0112 -0.0004 15   ALA A C     
514  O  O     . ALA C 15  ? 0.2310 0.1920 0.2064 0.0603  -0.0234 -0.0305 15   ALA A O     
515  C  CB    . ALA C 15  ? 0.2367 0.2010 0.1070 0.0324  -0.0266 -0.0022 15   ALA A CB    
516  N  N     . ALA C 16  ? 0.2149 0.1515 0.0936 0.0108  -0.0073 -0.0020 16   ALA A N     
517  C  CA    . ALA C 16  ? 0.2133 0.1412 0.0938 0.0198  0.0071  0.0010  16   ALA A CA    
518  C  C     . ALA C 16  ? 0.1819 0.1304 0.1109 0.0116  0.0092  0.0028  16   ALA A C     
519  O  O     . ALA C 16  ? 0.1929 0.1373 0.1380 0.0226  0.0111  0.0020  16   ALA A O     
520  C  CB    . ALA C 16  ? 0.2099 0.1760 0.1055 -0.0114 0.0306  -0.0087 16   ALA A CB    
521  N  N     . ILE C 17  ? 0.1895 0.1320 0.1026 0.0136  0.0069  0.0090  17   ILE A N     
522  C  CA    . ILE C 17  ? 0.1926 0.1308 0.1074 0.0001  0.0001  -0.0001 17   ILE A CA    
523  C  C     . ILE C 17  ? 0.1968 0.1245 0.1055 0.0058  0.0048  0.0063  17   ILE A C     
524  O  O     . ILE C 17  ? 0.1849 0.1470 0.1090 0.0067  0.0003  -0.0009 17   ILE A O     
525  C  CB    . ILE C 17  ? 0.2118 0.1697 0.1240 -0.0214 -0.0127 0.0154  17   ILE A CB    
526  C  CG1   . ILE C 17  ? 0.2087 0.2206 0.1752 0.0152  -0.0455 -0.0142 17   ILE A CG1   
527  C  CG2   . ILE C 17  ? 0.1973 0.1880 0.1537 -0.0409 0.0552  -0.0102 17   ILE A CG2   
528  C  CD1   . ILE C 17  ? 0.1927 0.2994 0.1299 -0.0042 -0.0147 -0.0091 17   ILE A CD1   
529  N  N     . LYS C 18  ? 0.1775 0.1395 0.1067 -0.0041 0.0025  0.0024  18   LYS A N     
530  C  CA    . LYS C 18  ? 0.1830 0.1269 0.1305 -0.0049 0.0151  -0.0114 18   LYS A CA    
531  C  C     . LYS C 18  ? 0.1713 0.1394 0.1114 -0.0037 -0.0054 0.0060  18   LYS A C     
532  O  O     . LYS C 18  ? 0.2026 0.1679 0.1090 0.0019  -0.0170 0.0261  18   LYS A O     
533  C  CB    . LYS C 18  ? 0.2127 0.1454 0.1251 -0.0037 -0.0125 -0.0224 18   LYS A CB    
534  C  CG    . LYS C 18  ? 0.2853 0.1392 0.1485 -0.0351 -0.0192 -0.0078 18   LYS A CG    
535  C  CD    . LYS C 18  ? 0.2942 0.1744 0.1594 -0.0396 0.0008  -0.0378 18   LYS A CD    
536  C  CE    . LYS C 18  ? 0.3046 0.2050 0.2072 -0.0835 -0.0758 -0.0181 18   LYS A CE    
537  N  NZ    . LYS C 18  ? 0.3332 0.1855 0.3612 -0.0277 -0.0057 -0.0937 18   LYS A NZ    
538  N  N     . GLY C 19  ? 0.1769 0.1420 0.1005 0.0059  -0.0008 -0.0008 19   GLY A N     
539  C  CA    . GLY C 19  ? 0.1849 0.1419 0.1519 0.0023  0.0223  0.0064  19   GLY A CA    
540  C  C     . GLY C 19  ? 0.1428 0.1484 0.1623 0.0177  -0.0102 0.0080  19   GLY A C     
541  O  O     . GLY C 19  ? 0.1777 0.2006 0.2664 0.0165  0.0537  -0.0297 19   GLY A O     
542  N  N     . LYS C 20  ? 0.1669 0.1477 0.1098 -0.0031 -0.0142 0.0082  20   LYS A N     
543  C  CA    . LYS C 20  ? 0.2016 0.1493 0.0976 -0.0035 -0.0061 0.0079  20   LYS A CA    
544  C  C     . LYS C 20  ? 0.1746 0.1463 0.1036 0.0208  -0.0016 0.0016  20   LYS A C     
545  O  O     . LYS C 20  ? 0.1802 0.1486 0.1112 0.0242  -0.0075 -0.0018 20   LYS A O     
546  C  CB    . LYS C 20  ? 0.2068 0.1630 0.1047 -0.0147 -0.0123 0.0114  20   LYS A CB    
547  C  CG    . LYS C 20  ? 0.2337 0.2063 0.0904 0.0101  -0.0126 0.0092  20   LYS A CG    
548  C  CD    . LYS C 20  ? 0.2884 0.1960 0.1201 -0.0038 -0.0045 0.0195  20   LYS A CD    
549  C  CE    . LYS C 20  ? 0.3165 0.2248 0.1105 0.0164  0.0070  0.0403  20   LYS A CE    
550  N  NZ    . LYS C 20  ? 0.3060 0.1813 0.1336 0.0171  0.0176  0.0140  20   LYS A NZ    
551  N  N     . PRO C 21  ? 0.1700 0.1575 0.1007 0.0231  -0.0150 -0.0019 21   PRO A N     
552  C  CA    . PRO C 21  ? 0.1609 0.1737 0.1013 0.0021  0.0019  -0.0189 21   PRO A CA    
553  C  C     . PRO C 21  ? 0.1595 0.1384 0.0988 0.0183  -0.0063 0.0102  21   PRO A C     
554  O  O     . PRO C 21  ? 0.1976 0.1238 0.1205 0.0226  -0.0084 0.0144  21   PRO A O     
555  C  CB    . PRO C 21  ? 0.1644 0.2220 0.1234 0.0339  0.0031  -0.0239 21   PRO A CB    
556  C  CG    . PRO C 21  ? 0.1774 0.2712 0.1068 0.0156  -0.0013 -0.0114 21   PRO A CG    
557  C  CD    . PRO C 21  ? 0.1491 0.1962 0.1185 0.0181  0.0081  -0.0076 21   PRO A CD    
558  N  N     . LEU C 22  ? 0.1614 0.1501 0.0830 0.0022  -0.0066 0.0025  22   LEU A N     
559  C  CA    . LEU C 22  ? 0.1642 0.1209 0.0988 -0.0007 -0.0069 0.0135  22   LEU A CA    
560  C  C     . LEU C 22  ? 0.1872 0.1250 0.0919 0.0052  -0.0104 0.0109  22   LEU A C     
561  O  O     . LEU C 22  ? 0.2681 0.1331 0.0975 0.0178  0.0108  0.0172  22   LEU A O     
562  C  CB    . LEU C 22  ? 0.1673 0.1443 0.1084 0.0244  -0.0093 0.0074  22   LEU A CB    
563  C  CG    . LEU C 22  ? 0.2138 0.1394 0.1116 0.0285  0.0166  0.0222  22   LEU A CG    
564  C  CD1   . LEU C 22  ? 0.1716 0.1549 0.1159 0.0244  0.0024  0.0260  22   LEU A CD1   
565  C  CD2   . LEU C 22  ? 0.1907 0.1663 0.1055 0.0224  0.0105  0.0114  22   LEU A CD2   
566  N  N     . THR C 23  ? 0.1842 0.1101 0.1023 0.0136  -0.0041 0.0070  23   THR A N     
567  C  CA    . THR C 23  ? 0.1685 0.1158 0.1017 0.0332  -0.0142 -0.0012 23   THR A CA    
568  C  C     . THR C 23  ? 0.1642 0.1326 0.0916 0.0163  -0.0003 0.0020  23   THR A C     
569  O  O     . THR C 23  ? 0.2017 0.1379 0.1074 0.0054  -0.0046 -0.0137 23   THR A O     
570  C  CB    . THR C 23  ? 0.1893 0.1432 0.0918 0.0430  -0.0008 0.0189  23   THR A CB    
571  O  OG1   . THR C 23  ? 0.1968 0.1475 0.1013 0.0207  0.0100  -0.0007 23   THR A OG1   
572  C  CG2   . THR C 23  ? 0.1758 0.1895 0.1436 0.0552  -0.0133 0.0278  23   THR A CG2   
573  N  N     . ASP C 24  ? 0.1526 0.1457 0.0936 0.0156  0.0027  0.0042  24   ASP A N     
574  C  CA    . ASP C 24  ? 0.1685 0.1159 0.1452 0.0125  -0.0140 0.0050  24   ASP A CA    
575  C  C     . ASP C 24  ? 0.1516 0.1340 0.0984 0.0135  -0.0094 -0.0068 24   ASP A C     
576  O  O     . ASP C 24  ? 0.1793 0.1389 0.0973 0.0172  -0.0038 0.0014  24   ASP A O     
577  C  CB    . ASP C 24  ? 0.1948 0.1412 0.1373 -0.0156 0.0084  -0.0046 24   ASP A CB    
578  C  CG    . ASP C 24  ? 0.2044 0.1353 0.1434 -0.0117 0.0013  -0.0313 24   ASP A CG    
579  O  OD1   . ASP C 24  ? 0.2221 0.1711 0.1426 0.0058  0.0046  -0.0185 24   ASP A OD1   
580  O  OD2   . ASP C 24  ? 0.2207 0.2117 0.1891 -0.0518 0.0085  -0.0183 24   ASP A OD2   
581  N  N     . VAL C 25  ? 0.1564 0.1265 0.1044 0.0139  -0.0049 -0.0020 25   VAL A N     
582  C  CA    . VAL C 25  ? 0.1482 0.1346 0.1128 0.0180  0.0005  0.0020  25   VAL A CA    
583  C  C     . VAL C 25  ? 0.1529 0.1348 0.1149 0.0143  0.0103  -0.0125 25   VAL A C     
584  O  O     . VAL C 25  ? 0.1749 0.1671 0.1032 0.0136  0.0031  -0.0179 25   VAL A O     
585  C  CB    . VAL C 25  ? 0.1521 0.1460 0.1187 0.0160  -0.0137 0.0216  25   VAL A CB    
586  C  CG1   . VAL C 25  ? 0.2054 0.1406 0.1531 0.0342  -0.0310 0.0075  25   VAL A CG1   
587  C  CG2   . VAL C 25  ? 0.1684 0.1821 0.1454 -0.0177 -0.0239 0.0356  25   VAL A CG2   
588  N  N     . TRP C 26  ? 0.1473 0.1754 0.1096 0.0240  0.0111  -0.0025 26   TRP A N     
589  C  CA    . TRP C 26  ? 0.1486 0.1569 0.1360 0.0202  0.0044  -0.0126 26   TRP A CA    
590  C  C     . TRP C 26  ? 0.1446 0.1593 0.1133 0.0134  -0.0051 -0.0193 26   TRP A C     
591  O  O     . TRP C 26  ? 0.1798 0.1641 0.1103 0.0172  0.0023  -0.0163 26   TRP A O     
592  C  CB    . TRP C 26  ? 0.1875 0.1657 0.1359 0.0061  -0.0131 -0.0015 26   TRP A CB    
593  C  CG    . TRP C 26  ? 0.1854 0.1534 0.1464 0.0048  -0.0051 -0.0086 26   TRP A CG    
594  C  CD1   . TRP C 26  ? 0.2069 0.1538 0.1881 0.0016  -0.0156 -0.0299 26   TRP A CD1   
595  C  CD2   . TRP C 26  ? 0.1928 0.1373 0.1781 -0.0054 0.0114  -0.0035 26   TRP A CD2   
596  N  NE1   . TRP C 26  ? 0.2123 0.1526 0.2084 -0.0270 -0.0150 -0.0089 26   TRP A NE1   
597  C  CE2   . TRP C 26  ? 0.1971 0.1541 0.2388 -0.0263 0.0042  -0.0073 26   TRP A CE2   
598  C  CE3   . TRP C 26  ? 0.2078 0.1820 0.1737 0.0139  0.0294  -0.0073 26   TRP A CE3   
599  C  CZ2   . TRP C 26  ? 0.1921 0.1528 0.2618 -0.0013 -0.0138 0.0076  26   TRP A CZ2   
600  C  CZ3   . TRP C 26  ? 0.2103 0.2298 0.2190 -0.0035 0.0418  -0.0191 26   TRP A CZ3   
601  C  CH2   . TRP C 26  ? 0.2091 0.1830 0.2271 0.0122  0.0081  0.0307  26   TRP A CH2   
602  N  N     . PHE C 27  ? 0.1331 0.1844 0.1253 0.0083  -0.0068 -0.0001 27   PHE A N     
603  C  CA    . PHE C 27  ? 0.1332 0.1813 0.1282 0.0124  0.0086  0.0000  27   PHE A CA    
604  C  C     . PHE C 27  ? 0.1348 0.1781 0.1561 0.0213  -0.0084 -0.0206 27   PHE A C     
605  O  O     . PHE C 27  ? 0.2114 0.2064 0.1358 -0.0016 -0.0026 -0.0216 27   PHE A O     
606  C  CB    . PHE C 27  ? 0.1628 0.1839 0.1289 0.0149  0.0067  0.0006  27   PHE A CB    
607  C  CG    . PHE C 27  ? 0.1655 0.1492 0.1132 0.0182  0.0023  0.0014  27   PHE A CG    
608  C  CD1   . PHE C 27  ? 0.2767 0.1458 0.1677 -0.0075 0.0331  -0.0345 27   PHE A CD1   
609  C  CD2   . PHE C 27  ? 0.1745 0.1667 0.1313 -0.0017 0.0225  0.0181  27   PHE A CD2   
610  C  CE1   . PHE C 27  ? 0.3539 0.1827 0.1529 -0.0897 0.0432  -0.0449 27   PHE A CE1   
611  C  CE2   . PHE C 27  ? 0.1771 0.1545 0.1448 0.0020  0.0061  0.0215  27   PHE A CE2   
612  C  CZ    . PHE C 27  ? 0.2624 0.1525 0.1583 -0.0060 -0.0173 0.0173  27   PHE A CZ    
613  N  N     . ALA C 28  ? 0.1377 0.1815 0.1616 0.0070  0.0068  -0.0125 28   ALA A N     
614  C  CA    . ALA C 28  ? 0.1421 0.2520 0.1805 -0.0129 0.0048  -0.0034 28   ALA A CA    
615  C  C     . ALA C 28  ? 0.1553 0.2095 0.1666 0.0087  -0.0066 -0.0489 28   ALA A C     
616  O  O     . ALA C 28  ? 0.1990 0.2537 0.2011 -0.0110 -0.0296 -0.0622 28   ALA A O     
617  C  CB    . ALA C 28  ? 0.1551 0.2594 0.1900 -0.0559 0.0169  -0.0360 28   ALA A CB    
618  N  N     . PHE C 29  ? 0.1928 0.2236 0.1564 -0.0012 -0.0106 -0.0281 29   PHE A N     
619  C  CA    . PHE C 29  ? 0.2127 0.2280 0.1439 0.0043  -0.0030 -0.0304 29   PHE A CA    
620  C  C     . PHE C 29  ? 0.1754 0.2470 0.1456 0.0016  -0.0178 -0.0392 29   PHE A C     
621  O  O     . PHE C 29  ? 0.1751 0.2414 0.1342 -0.0034 -0.0176 -0.0207 29   PHE A O     
622  C  CB    . PHE C 29  ? 0.2130 0.2251 0.1547 0.0031  0.0156  -0.0270 29   PHE A CB    
623  C  CG    . PHE C 29  ? 0.1755 0.2409 0.1438 0.0152  -0.0068 -0.0321 29   PHE A CG    
624  C  CD1   . PHE C 29  ? 0.1673 0.2891 0.1786 0.0059  0.0105  -0.0368 29   PHE A CD1   
625  C  CD2   . PHE C 29  ? 0.1722 0.2505 0.1813 0.0279  -0.0463 -0.0537 29   PHE A CD2   
626  C  CE1   . PHE C 29  ? 0.2063 0.3122 0.1994 -0.0252 0.0381  -0.0637 29   PHE A CE1   
627  C  CE2   . PHE C 29  ? 0.1938 0.2548 0.1942 0.0219  -0.0318 -0.0628 29   PHE A CE2   
628  C  CZ    . PHE C 29  ? 0.2320 0.3281 0.2091 -0.0189 -0.0020 -0.0832 29   PHE A CZ    
629  N  N     . PRO C 30  ? 0.1801 0.3289 0.1517 0.0048  -0.0209 -0.0507 30   PRO A N     
630  C  CA    . PRO C 30  ? 0.1977 0.2884 0.1574 -0.0173 -0.0116 -0.0737 30   PRO A CA    
631  C  C     . PRO C 30  ? 0.2169 0.2814 0.1475 0.0058  -0.0295 -0.0191 30   PRO A C     
632  O  O     . PRO C 30  ? 0.2215 0.3015 0.1653 -0.0034 -0.0101 -0.0245 30   PRO A O     
633  C  CB    . PRO C 30  ? 0.2337 0.4661 0.1702 -0.0483 -0.0369 -0.0818 30   PRO A CB    
634  C  CG    . PRO C 30  ? 0.1981 0.5866 0.2361 -0.0172 -0.0174 -0.1785 30   PRO A CG    
635  C  CD    . PRO C 30  ? 0.1758 0.3890 0.1896 -0.0067 -0.0227 -0.0767 30   PRO A CD    
636  N  N     . GLN C 31  ? 0.2142 0.2833 0.1651 0.0200  -0.0491 -0.0001 31   GLN A N     
637  C  CA    . GLN C 31  ? 0.2575 0.2942 0.1607 0.0024  -0.0707 0.0215  31   GLN A CA    
638  C  C     . GLN C 31  ? 0.2557 0.2816 0.1351 -0.0227 -0.0552 0.0144  31   GLN A C     
639  O  O     . GLN C 31  ? 0.2367 0.2596 0.1929 0.0303  -0.0134 0.0464  31   GLN A O     
640  C  CB    . GLN C 31  ? 0.3141 0.3058 0.2258 0.0326  -0.0574 0.0625  31   GLN A CB    
641  C  CG    . GLN C 31  ? 0.3364 0.2931 0.2821 0.0330  -0.0361 -0.0004 31   GLN A CG    
642  C  CD    . GLN C 31  ? 0.5221 0.4798 0.2747 -0.1511 0.0536  -0.1062 31   GLN A CD    
643  O  OE1   . GLN C 31  ? 0.2917 0.3246 0.2405 0.0355  -0.0356 -0.0345 31   GLN A OE1   
644  N  NE2   . GLN C 31  ? 0.3424 0.4639 0.2550 -0.0499 -0.0563 -0.0950 31   GLN A NE2   
645  N  N     . LEU C 32  ? 0.1906 0.2150 0.1091 0.0281  -0.0228 -0.0248 32   LEU A N     
646  C  CA    . LEU C 32  ? 0.1692 0.1916 0.1059 0.0165  -0.0023 -0.0349 32   LEU A CA    
647  C  C     . LEU C 32  ? 0.1524 0.1993 0.1151 0.0068  0.0217  -0.0229 32   LEU A C     
648  O  O     . LEU C 32  ? 0.1591 0.1945 0.1209 0.0136  0.0031  0.0001  32   LEU A O     
649  C  CB    . LEU C 32  ? 0.1824 0.1730 0.0988 0.0153  -0.0011 -0.0145 32   LEU A CB    
650  C  CG    . LEU C 32  ? 0.2097 0.1601 0.1217 0.0034  0.0182  -0.0284 32   LEU A CG    
651  C  CD1   . LEU C 32  ? 0.2124 0.1910 0.1202 0.0384  0.0031  -0.0270 32   LEU A CD1   
652  C  CD2   . LEU C 32  ? 0.3174 0.1753 0.2213 -0.0327 0.0990  -0.0373 32   LEU A CD2   
653  N  N     . LYS C 33  ? 0.1875 0.1716 0.1146 0.0036  0.0101  -0.0073 33   LYS A N     
654  C  CA    . LYS C 33  ? 0.1935 0.1737 0.1232 0.0047  0.0097  0.0119  33   LYS A CA    
655  C  C     . LYS C 33  ? 0.1739 0.1245 0.1058 -0.0120 -0.0042 -0.0091 33   LYS A C     
656  O  O     . LYS C 33  ? 0.1749 0.1427 0.1176 -0.0093 -0.0079 -0.0125 33   LYS A O     
657  C  CB    . LYS C 33  ? 0.1997 0.1802 0.2774 -0.0475 0.0374  -0.0306 33   LYS A CB    
658  C  CG    . LYS C 33  ? 0.2403 0.2698 0.3579 -0.0438 0.0966  0.0065  33   LYS A CG    
659  C  CD    . LYS C 33  ? 0.3627 0.4886 0.1612 -0.0697 0.0512  0.0269  33   LYS A CD    
660  C  CE    . LYS C 33  ? 0.3063 0.4477 0.2238 0.0147  0.0473  0.0750  33   LYS A CE    
661  N  NZ    . LYS C 33  ? 0.3640 0.2238 0.2459 -0.0671 -0.0567 -0.0001 33   LYS A NZ    
662  N  N     . THR C 34  ? 0.1800 0.1460 0.1120 -0.0176 -0.0028 0.0021  34   THR A N     
663  C  CA    . THR C 34  ? 0.1918 0.1697 0.0927 -0.0214 -0.0121 0.0078  34   THR A CA    
664  C  C     . THR C 34  ? 0.1782 0.1678 0.1151 -0.0326 0.0067  -0.0179 34   THR A C     
665  O  O     . THR C 34  ? 0.1937 0.2205 0.2068 -0.0521 0.0507  -0.0641 34   THR A O     
666  C  CB    . THR C 34  ? 0.2427 0.1525 0.1090 -0.0245 0.0045  0.0078  34   THR A CB    
667  O  OG1   . THR C 34  ? 0.2904 0.2091 0.1208 -0.0166 0.0395  0.0245  34   THR A OG1   
668  C  CG2   . THR C 34  ? 0.2178 0.1551 0.1701 -0.0186 -0.0003 0.0015  34   THR A CG2   
669  N  N     . TYR C 35  ? 0.1749 0.1477 0.0977 -0.0072 -0.0171 -0.0002 35   TYR A N     
670  C  CA    . TYR C 35  ? 0.1780 0.1232 0.1362 0.0117  -0.0289 -0.0244 35   TYR A CA    
671  C  C     . TYR C 35  ? 0.1709 0.1380 0.1362 0.0207  -0.0187 -0.0149 35   TYR A C     
672  O  O     . TYR C 35  ? 0.1690 0.1831 0.1633 0.0231  -0.0228 -0.0281 35   TYR A O     
673  C  CB    . TYR C 35  ? 0.1875 0.1425 0.1413 0.0275  -0.0234 -0.0293 35   TYR A CB    
674  C  CG    . TYR C 35  ? 0.2037 0.1343 0.1093 0.0222  0.0019  -0.0296 35   TYR A CG    
675  C  CD1   . TYR C 35  ? 0.2226 0.1735 0.1104 0.0088  0.0113  -0.0263 35   TYR A CD1   
676  C  CD2   . TYR C 35  ? 0.1946 0.1349 0.1383 0.0234  -0.0088 -0.0245 35   TYR A CD2   
677  C  CE1   . TYR C 35  ? 0.2558 0.1899 0.1272 0.0286  0.0485  0.0041  35   TYR A CE1   
678  C  CE2   . TYR C 35  ? 0.2199 0.1678 0.1015 0.0251  -0.0029 -0.0118 35   TYR A CE2   
679  C  CZ    . TYR C 35  ? 0.2584 0.1821 0.1015 0.0381  0.0363  -0.0045 35   TYR A CZ    
680  O  OH    . TYR C 35  ? 0.3575 0.2352 0.1185 0.0998  0.0695  0.0381  35   TYR A OH    
681  N  N     . GLN C 36  ? 0.2169 0.1179 0.1167 0.0220  0.0024  -0.0225 36   GLN A N     
682  C  CA    . GLN C 36  ? 0.1879 0.1445 0.1173 0.0155  0.0012  -0.0089 36   GLN A CA    
683  C  C     . GLN C 36  ? 0.1783 0.1626 0.1157 0.0077  -0.0120 -0.0151 36   GLN A C     
684  O  O     . GLN C 36  ? 0.1861 0.1872 0.1168 0.0098  -0.0073 -0.0063 36   GLN A O     
685  C  CB    . GLN C 36  ? 0.1846 0.1424 0.1132 0.0130  0.0017  -0.0010 36   GLN A CB    
686  C  CG    . GLN C 36  ? 0.1826 0.1647 0.1417 0.0104  0.0036  0.0094  36   GLN A CG    
687  C  CD    . GLN C 36  ? 0.1923 0.1714 0.0946 -0.0029 -0.0030 -0.0054 36   GLN A CD    
688  O  OE1   . GLN C 36  ? 0.1924 0.2247 0.1097 -0.0097 0.0092  -0.0219 36   GLN A OE1   
689  N  NE2   . GLN C 36  ? 0.2478 0.1862 0.1416 0.0201  0.0020  -0.0331 36   GLN A NE2   
690  N  N     . SER C 37  ? 0.1920 0.1570 0.1151 0.0105  0.0021  -0.0172 37   SER A N     
691  C  CA    . SER C 37  ? 0.1859 0.1629 0.1040 0.0040  -0.0095 -0.0110 37   SER A CA    
692  C  C     . SER C 37  ? 0.2063 0.1674 0.1397 -0.0125 0.0132  0.0011  37   SER A C     
693  O  O     . SER C 37  ? 0.2070 0.1937 0.2072 -0.0148 -0.0134 -0.0229 37   SER A O     
694  C  CB    A SER C 37  ? 0.2367 0.1880 0.1201 0.0355  -0.0144 -0.0328 37   SER A CB    
695  C  CB    B SER C 37  ? 0.2353 0.1661 0.0899 -0.0117 0.0247  0.0096  37   SER A CB    
696  O  OG    A SER C 37  ? 0.2267 0.2046 0.0894 -0.0016 0.0049  -0.0177 37   SER A OG    
697  O  OG    B SER C 37  ? 0.2615 0.1968 0.1375 -0.0180 -0.0422 -0.0245 37   SER A OG    
698  N  N     . GLN C 38  ? 0.2401 0.1615 0.1024 -0.0207 -0.0187 -0.0067 38   GLN A N     
699  C  CA    . GLN C 38  ? 0.2307 0.1678 0.1103 -0.0173 -0.0481 0.0237  38   GLN A CA    
700  C  C     . GLN C 38  ? 0.2315 0.1613 0.1071 -0.0342 -0.0239 0.0058  38   GLN A C     
701  O  O     . GLN C 38  ? 0.2387 0.2456 0.1341 -0.0614 -0.0315 0.0181  38   GLN A O     
702  C  CB    . GLN C 38  ? 0.1971 0.1686 0.1142 -0.0044 -0.0029 0.0068  38   GLN A CB    
703  C  CG    . GLN C 38  ? 0.2428 0.1513 0.1257 -0.0033 -0.0084 -0.0022 38   GLN A CG    
704  C  CD    . GLN C 38  ? 0.2445 0.1781 0.1081 0.0304  0.0531  0.0117  38   GLN A CD    
705  O  OE1   . GLN C 38  ? 0.2417 0.2721 0.1340 0.0513  0.0350  0.0218  38   GLN A OE1   
706  N  NE2   . GLN C 38  ? 0.3488 0.1706 0.1696 0.0075  0.0576  0.0343  38   GLN A NE2   
707  N  N     . LEU C 39  ? 0.2110 0.1346 0.0954 0.0093  -0.0222 -0.0001 39   LEU A N     
708  C  CA    . LEU C 39  ? 0.1744 0.1237 0.1063 0.0067  -0.0131 0.0045  39   LEU A CA    
709  C  C     . LEU C 39  ? 0.1524 0.1264 0.1069 0.0007  -0.0033 0.0092  39   LEU A C     
710  O  O     . LEU C 39  ? 0.1803 0.1497 0.1060 0.0035  -0.0111 -0.0063 39   LEU A O     
711  C  CB    . LEU C 39  ? 0.1679 0.1290 0.1119 0.0087  -0.0156 -0.0105 39   LEU A CB    
712  C  CG    . LEU C 39  ? 0.1823 0.1271 0.1300 0.0088  -0.0076 -0.0194 39   LEU A CG    
713  C  CD1   . LEU C 39  ? 0.1717 0.1643 0.1689 0.0222  -0.0084 -0.0167 39   LEU A CD1   
714  C  CD2   . LEU C 39  ? 0.2027 0.1452 0.1728 -0.0197 0.0065  -0.0275 39   LEU A CD2   
715  N  N     . ILE C 40  ? 0.1838 0.1179 0.1146 -0.0058 -0.0086 0.0083  40   ILE A N     
716  C  CA    . ILE C 40  ? 0.1824 0.1245 0.1042 0.0082  0.0031  -0.0004 40   ILE A CA    
717  C  C     . ILE C 40  ? 0.1901 0.1436 0.0808 0.0055  0.0050  0.0074  40   ILE A C     
718  O  O     . ILE C 40  ? 0.2109 0.1384 0.0876 -0.0133 0.0038  0.0144  40   ILE A O     
719  C  CB    . ILE C 40  ? 0.1881 0.1274 0.1131 0.0181  -0.0036 -0.0067 40   ILE A CB    
720  C  CG1   . ILE C 40  ? 0.2002 0.1252 0.1471 0.0006  0.0075  -0.0226 40   ILE A CG1   
721  C  CG2   . ILE C 40  ? 0.2179 0.1268 0.0961 0.0238  -0.0195 0.0148  40   ILE A CG2   
722  C  CD1   . ILE C 40  ? 0.2210 0.1628 0.1543 -0.0122 -0.0163 -0.0357 40   ILE A CD1   
723  N  N     . GLY C 41  ? 0.1612 0.1376 0.0940 0.0344  -0.0003 0.0050  41   GLY A N     
724  C  CA    . GLY C 41  ? 0.1649 0.1348 0.1213 0.0277  0.0151  0.0181  41   GLY A CA    
725  C  C     . GLY C 41  ? 0.1829 0.1345 0.0702 0.0303  -0.0070 0.0172  41   GLY A C     
726  O  O     . GLY C 41  ? 0.1791 0.1516 0.1210 0.0172  0.0085  0.0072  41   GLY A O     
727  N  N     . GLN C 42  ? 0.1898 0.1215 0.0928 0.0238  -0.0103 0.0093  42   GLN A N     
728  C  CA    . GLN C 42  ? 0.1630 0.1257 0.0819 0.0153  0.0035  -0.0041 42   GLN A CA    
729  C  C     . GLN C 42  ? 0.1473 0.1330 0.0883 0.0136  0.0043  -0.0011 42   GLN A C     
730  O  O     . GLN C 42  ? 0.1698 0.1402 0.0897 0.0100  -0.0018 0.0114  42   GLN A O     
731  C  CB    . GLN C 42  ? 0.1935 0.1280 0.0942 0.0264  0.0089  0.0207  42   GLN A CB    
732  C  CG    . GLN C 42  ? 0.1665 0.1699 0.0916 0.0078  0.0018  0.0111  42   GLN A CG    
733  C  CD    . GLN C 42  ? 0.1559 0.1807 0.0898 0.0142  -0.0058 0.0128  42   GLN A CD    
734  O  OE1   . GLN C 42  ? 0.1921 0.1852 0.1076 -0.0074 0.0177  0.0117  42   GLN A OE1   
735  N  NE2   . GLN C 42  ? 0.2029 0.2613 0.1020 0.0191  0.0266  -0.0065 42   GLN A NE2   
736  N  N     . HIS C 43  ? 0.1518 0.1405 0.0838 0.0205  0.0022  -0.0112 43   HIS A N     
737  C  CA    . HIS C 43  ? 0.1601 0.1427 0.0781 0.0301  -0.0040 -0.0097 43   HIS A CA    
738  C  C     . HIS C 43  ? 0.1732 0.1225 0.0702 0.0076  0.0031  0.0027  43   HIS A C     
739  O  O     . HIS C 43  ? 0.2010 0.1402 0.0846 0.0134  0.0064  0.0223  43   HIS A O     
740  C  CB    . HIS C 43  ? 0.1588 0.1706 0.1046 0.0078  -0.0137 0.0120  43   HIS A CB    
741  C  CG    . HIS C 43  ? 0.1636 0.1655 0.1091 0.0170  -0.0010 0.0090  43   HIS A CG    
742  N  ND1   . HIS C 43  ? 0.1579 0.2034 0.1463 -0.0021 0.0095  0.0029  43   HIS A ND1   
743  C  CD2   . HIS C 43  ? 0.1884 0.1711 0.1228 -0.0039 -0.0199 0.0171  43   HIS A CD2   
744  C  CE1   . HIS C 43  ? 0.1501 0.2058 0.1592 -0.0078 -0.0192 0.0099  43   HIS A CE1   
745  N  NE2   . HIS C 43  ? 0.1974 0.1914 0.1546 -0.0141 -0.0165 0.0188  43   HIS A NE2   
746  N  N     . VAL C 44  ? 0.1852 0.1391 0.0719 0.0161  0.0187  -0.0053 44   VAL A N     
747  C  CA    . VAL C 44  ? 0.1650 0.1271 0.0930 0.0089  0.0016  -0.0146 44   VAL A CA    
748  C  C     . VAL C 44  ? 0.1616 0.1341 0.1060 0.0114  -0.0110 -0.0014 44   VAL A C     
749  O  O     . VAL C 44  ? 0.1716 0.1692 0.1189 0.0128  -0.0238 0.0083  44   VAL A O     
750  C  CB    . VAL C 44  ? 0.1644 0.1395 0.0877 0.0214  0.0118  -0.0067 44   VAL A CB    
751  C  CG1   . VAL C 44  ? 0.1978 0.1420 0.1037 0.0318  0.0150  -0.0109 44   VAL A CG1   
752  C  CG2   . VAL C 44  ? 0.1686 0.1617 0.1262 0.0080  -0.0020 -0.0085 44   VAL A CG2   
753  N  N     . THR C 45  ? 0.1531 0.1319 0.1057 -0.0037 0.0111  0.0003  45   THR A N     
754  C  CA    . THR C 45  ? 0.1479 0.1660 0.1164 -0.0207 0.0171  -0.0021 45   THR A CA    
755  C  C     . THR C 45  ? 0.1562 0.1595 0.1261 -0.0073 0.0037  -0.0163 45   THR A C     
756  O  O     . THR C 45  ? 0.1900 0.2013 0.1405 0.0042  -0.0187 -0.0347 45   THR A O     
757  C  CB    . THR C 45  ? 0.1532 0.1570 0.1477 0.0046  0.0371  0.0168  45   THR A CB    
758  O  OG1   . THR C 45  ? 0.1673 0.1781 0.1896 0.0057  0.0065  0.0141  45   THR A OG1   
759  C  CG2   . THR C 45  ? 0.1823 0.1903 0.1099 -0.0051 0.0061  -0.0115 45   THR A CG2   
760  N  N     . HIS C 46  ? 0.1617 0.1606 0.1132 -0.0027 0.0118  -0.0165 46   HIS A N     
761  C  CA    . HIS C 46  ? 0.1810 0.1622 0.1641 0.0162  0.0122  -0.0535 46   HIS A CA    
762  C  C     . HIS C 46  ? 0.1855 0.1437 0.0891 0.0421  0.0014  -0.0062 46   HIS A C     
763  O  O     . HIS C 46  ? 0.1856 0.1853 0.0909 0.0051  0.0130  -0.0072 46   HIS A O     
764  C  CB    . HIS C 46  ? 0.2817 0.1788 0.2738 -0.0376 0.0592  -0.0693 46   HIS A CB    
765  C  CG    . HIS C 46  ? 0.3833 0.1486 0.2597 -0.0301 0.0852  -0.0772 46   HIS A CG    
766  N  ND1   . HIS C 46  ? 0.3726 0.3743 0.2419 0.0477  0.0291  -0.0494 46   HIS A ND1   
767  C  CD2   . HIS C 46  ? 0.3945 0.2149 0.3191 0.0372  -0.0690 -0.1039 46   HIS A CD2   
768  C  CE1   . HIS C 46  ? 0.3348 0.3960 0.2888 -0.0896 -0.0825 0.0197  46   HIS A CE1   
769  N  NE2   . HIS C 46  ? 0.4276 0.3218 0.4030 0.0325  -0.1596 0.0052  46   HIS A NE2   
770  N  N     . VAL C 47  ? 0.1760 0.1499 0.0937 0.0087  0.0029  -0.0048 47   VAL A N     
771  C  CA    . VAL C 47  ? 0.1731 0.1237 0.1084 0.0110  0.0050  0.0031  47   VAL A CA    
772  C  C     . VAL C 47  ? 0.2006 0.1286 0.0879 0.0091  -0.0015 -0.0004 47   VAL A C     
773  O  O     . VAL C 47  ? 0.2306 0.1649 0.0963 0.0249  -0.0055 -0.0156 47   VAL A O     
774  C  CB    . VAL C 47  ? 0.1753 0.1270 0.0985 0.0097  0.0053  -0.0016 47   VAL A CB    
775  C  CG1   . VAL C 47  ? 0.1699 0.1923 0.1090 -0.0022 0.0009  0.0076  47   VAL A CG1   
776  C  CG2   . VAL C 47  ? 0.2501 0.1248 0.1159 0.0128  0.0239  0.0045  47   VAL A CG2   
777  N  N     . GLU C 48  ? 0.1671 0.1400 0.1125 0.0253  0.0134  0.0100  48   GLU A N     
778  C  CA    . GLU C 48  ? 0.1378 0.1327 0.0936 0.0034  0.0004  -0.0050 48   GLU A CA    
779  C  C     . GLU C 48  ? 0.1221 0.1532 0.0879 0.0064  -0.0295 -0.0207 48   GLU A C     
780  O  O     . GLU C 48  ? 0.1578 0.1759 0.1013 -0.0157 0.0033  -0.0507 48   GLU A O     
781  C  CB    . GLU C 48  ? 0.2056 0.1405 0.1024 0.0038  0.0087  0.0034  48   GLU A CB    
782  C  CG    . GLU C 48  ? 0.2330 0.1296 0.1469 -0.0220 0.0135  0.0059  48   GLU A CG    
783  C  CD    . GLU C 48  ? 0.2241 0.1447 0.1445 0.0080  0.0216  0.0132  48   GLU A CD    
784  O  OE1   . GLU C 48  ? 0.2514 0.1567 0.1461 0.0175  0.0217  0.0090  48   GLU A OE1   
785  O  OE2   . GLU C 48  ? 0.2555 0.1508 0.1609 0.0181  0.0184  0.0099  48   GLU A OE2   
786  N  N     . THR C 49  ? 0.1518 0.1335 0.1013 -0.0076 0.0045  -0.0273 49   THR A N     
787  C  CA    . THR C 49  ? 0.1506 0.1274 0.0938 0.0049  0.0020  0.0086  49   THR A CA    
788  C  C     . THR C 49  ? 0.1884 0.1225 0.0883 0.0016  -0.0187 -0.0135 49   THR A C     
789  O  O     . THR C 49  ? 0.1901 0.1370 0.1264 -0.0017 0.0044  -0.0293 49   THR A O     
790  C  CB    . THR C 49  ? 0.1727 0.1475 0.0924 0.0080  -0.0001 0.0040  49   THR A CB    
791  O  OG1   . THR C 49  ? 0.1800 0.1843 0.0924 0.0051  0.0005  -0.0123 49   THR A OG1   
792  C  CG2   . THR C 49  ? 0.2015 0.1407 0.0968 0.0014  0.0160  0.0183  49   THR A CG2   
793  N  N     . ARG C 50  ? 0.1811 0.1423 0.0816 0.0292  0.0018  -0.0048 50   ARG A N     
794  C  CA    . ARG C 50  ? 0.1761 0.1146 0.1090 -0.0038 0.0291  0.0071  50   ARG A CA    
795  C  C     . ARG C 50  ? 0.1616 0.1130 0.1030 0.0046  0.0130  -0.0049 50   ARG A C     
796  O  O     . ARG C 50  ? 0.1758 0.1521 0.1122 -0.0036 -0.0038 -0.0042 50   ARG A O     
797  C  CB    . ARG C 50  ? 0.1611 0.1682 0.1122 0.0203  0.0181  0.0237  50   ARG A CB    
798  C  CG    . ARG C 50  ? 0.1630 0.1910 0.0972 0.0161  0.0143  0.0117  50   ARG A CG    
799  C  CD    . ARG C 50  ? 0.1850 0.2270 0.1038 0.0108  0.0158  0.0300  50   ARG A CD    
800  N  NE    . ARG C 50  ? 0.2116 0.2079 0.1187 -0.0223 0.0375  0.0116  50   ARG A NE    
801  C  CZ    . ARG C 50  ? 0.2344 0.2426 0.1087 0.0007  0.0273  0.0183  50   ARG A CZ    
802  N  NH1   . ARG C 50  ? 0.2457 0.2521 0.1423 -0.0175 -0.0048 0.0303  50   ARG A NH1   
803  N  NH2   . ARG C 50  ? 0.2433 0.2210 0.1383 -0.0132 0.0411  -0.0058 50   ARG A NH2   
804  N  N     . GLY C 51  ? 0.1895 0.1381 0.0993 -0.0185 0.0263  -0.0129 51   GLY A N     
805  C  CA    . GLY C 51  ? 0.1572 0.1480 0.1225 -0.0025 0.0247  -0.0266 51   GLY A CA    
806  C  C     . GLY C 51  ? 0.1451 0.1477 0.1051 0.0005  0.0172  -0.0128 51   GLY A C     
807  O  O     . GLY C 51  ? 0.1639 0.1646 0.1017 0.0064  -0.0007 -0.0072 51   GLY A O     
808  N  N     . LYS C 52  ? 0.1514 0.1367 0.0960 -0.0087 0.0118  -0.0073 52   LYS A N     
809  C  CA    . LYS C 52  ? 0.1644 0.1441 0.1042 -0.0211 0.0428  -0.0221 52   LYS A CA    
810  C  C     . LYS C 52  ? 0.1475 0.1451 0.0913 -0.0028 0.0140  -0.0166 52   LYS A C     
811  O  O     . LYS C 52  ? 0.2003 0.1422 0.1274 -0.0050 0.0227  -0.0250 52   LYS A O     
812  C  CB    . LYS C 52  ? 0.1497 0.1860 0.0958 -0.0225 0.0311  -0.0207 52   LYS A CB    
813  C  CG    . LYS C 52  ? 0.1535 0.2338 0.0989 0.0129  0.0268  -0.0107 52   LYS A CG    
814  C  CD    . LYS C 52  ? 0.1484 0.1852 0.1050 0.0017  0.0246  -0.0293 52   LYS A CD    
815  C  CE    . LYS C 52  ? 0.1626 0.1639 0.1239 -0.0142 0.0142  0.0092  52   LYS A CE    
816  N  NZ    . LYS C 52  ? 0.1687 0.1551 0.1142 -0.0050 0.0281  -0.0116 52   LYS A NZ    
817  N  N     . ALA C 53  ? 0.1574 0.1715 0.0853 0.0094  0.0333  -0.0138 53   ALA A N     
818  C  CA    . ALA C 53  ? 0.1528 0.1601 0.0866 0.0235  0.0125  -0.0153 53   ALA A CA    
819  C  C     . ALA C 53  ? 0.1400 0.1660 0.0880 0.0134  0.0091  -0.0257 53   ALA A C     
820  O  O     . ALA C 53  ? 0.1725 0.1454 0.1197 0.0142  -0.0175 -0.0268 53   ALA A O     
821  C  CB    . ALA C 53  ? 0.1799 0.1727 0.0944 0.0050  0.0265  0.0068  53   ALA A CB    
822  N  N     . LEU C 54  ? 0.1577 0.1477 0.0955 0.0169  0.0249  -0.0154 54   LEU A N     
823  C  CA    . LEU C 54  ? 0.1626 0.1428 0.0923 0.0206  0.0227  0.0047  54   LEU A CA    
824  C  C     . LEU C 54  ? 0.1486 0.1633 0.1096 0.0089  0.0152  -0.0365 54   LEU A C     
825  O  O     . LEU C 54  ? 0.1632 0.1784 0.1119 -0.0156 0.0115  -0.0402 54   LEU A O     
826  C  CB    . LEU C 54  ? 0.1410 0.1421 0.1917 -0.0140 0.0172  0.0198  54   LEU A CB    
827  C  CG    . LEU C 54  ? 0.2078 0.1430 0.1307 0.0388  0.0078  0.0051  54   LEU A CG    
828  C  CD1   . LEU C 54  ? 0.2138 0.1873 0.1177 -0.0063 0.0088  -0.0040 54   LEU A CD1   
829  C  CD2   . LEU C 54  ? 0.2302 0.1792 0.1315 0.0246  0.0078  -0.0256 54   LEU A CD2   
830  N  N     . LEU C 55  ? 0.1480 0.1479 0.0820 0.0137  0.0099  -0.0132 55   LEU A N     
831  C  CA    . LEU C 55  ? 0.1412 0.1289 0.0863 0.0070  0.0042  0.0029  55   LEU A CA    
832  C  C     . LEU C 55  ? 0.1498 0.1426 0.0717 0.0174  0.0055  -0.0087 55   LEU A C     
833  O  O     . LEU C 55  ? 0.1488 0.1507 0.1119 0.0220  -0.0129 -0.0130 55   LEU A O     
834  C  CB    . LEU C 55  ? 0.1657 0.1318 0.1244 -0.0082 -0.0055 0.0057  55   LEU A CB    
835  C  CG    . LEU C 55  ? 0.2288 0.1341 0.1914 0.0236  -0.0196 0.0257  55   LEU A CG    
836  C  CD1   . LEU C 55  ? 0.2170 0.1481 0.2398 -0.0029 -0.0674 0.0373  55   LEU A CD1   
837  C  CD2   . LEU C 55  ? 0.2631 0.2059 0.3887 -0.0062 -0.1726 0.0129  55   LEU A CD2   
838  N  N     . THR C 56  ? 0.1572 0.1269 0.0977 0.0169  0.0200  -0.0063 56   THR A N     
839  C  CA    . THR C 56  ? 0.1578 0.1252 0.1062 0.0148  0.0300  0.0043  56   THR A CA    
840  C  C     . THR C 56  ? 0.1415 0.1303 0.0811 0.0146  0.0134  0.0001  56   THR A C     
841  O  O     . THR C 56  ? 0.1780 0.1364 0.0889 0.0083  -0.0040 -0.0049 56   THR A O     
842  C  CB    . THR C 56  ? 0.1515 0.1288 0.1225 0.0085  0.0223  0.0017  56   THR A CB    
843  O  OG1   . THR C 56  ? 0.1725 0.1574 0.1114 0.0106  0.0241  0.0247  56   THR A OG1   
844  C  CG2   . THR C 56  ? 0.1801 0.1173 0.1680 0.0218  0.0079  -0.0176 56   THR A CG2   
845  N  N     . HIS C 57  ? 0.1520 0.1369 0.0990 0.0017  0.0260  -0.0128 57   HIS A N     
846  C  CA    . HIS C 57  ? 0.1552 0.1145 0.1069 0.0036  0.0224  -0.0062 57   HIS A CA    
847  C  C     . HIS C 57  ? 0.1316 0.1253 0.0879 0.0142  0.0107  0.0052  57   HIS A C     
848  O  O     . HIS C 57  ? 0.1664 0.1521 0.1054 0.0254  -0.0093 0.0063  57   HIS A O     
849  C  CB    . HIS C 57  ? 0.1949 0.1104 0.1281 -0.0141 0.0054  -0.0024 57   HIS A CB    
850  C  CG    . HIS C 57  ? 0.1712 0.1224 0.1128 -0.0157 -0.0015 -0.0048 57   HIS A CG    
851  N  ND1   . HIS C 57  ? 0.3036 0.1736 0.1295 0.0753  -0.0086 0.0026  57   HIS A ND1   
852  C  CD2   . HIS C 57  ? 0.2096 0.1480 0.1263 0.0153  0.0261  0.0036  57   HIS A CD2   
853  C  CE1   . HIS C 57  ? 0.3571 0.1689 0.1274 0.0731  0.0142  -0.0026 57   HIS A CE1   
854  N  NE2   . HIS C 57  ? 0.2331 0.1410 0.1329 0.0136  0.0351  0.0257  57   HIS A NE2   
855  N  N     . PHE C 58  ? 0.1604 0.1459 0.0848 0.0117  0.0225  -0.0040 58   PHE A N     
856  C  CA    . PHE C 58  ? 0.1530 0.1443 0.0963 0.0077  0.0165  -0.0142 58   PHE A CA    
857  C  C     . PHE C 58  ? 0.1610 0.1424 0.0775 0.0044  0.0165  -0.0030 58   PHE A C     
858  O  O     . PHE C 58  ? 0.2034 0.1468 0.1289 0.0177  0.0179  0.0202  58   PHE A O     
859  C  CB    . PHE C 58  ? 0.1560 0.1319 0.1167 0.0025  0.0045  -0.0059 58   PHE A CB    
860  C  CG    . PHE C 58  ? 0.1606 0.1299 0.1024 0.0065  0.0045  -0.0061 58   PHE A CG    
861  C  CD1   . PHE C 58  ? 0.1831 0.1253 0.1094 -0.0014 -0.0005 0.0009  58   PHE A CD1   
862  C  CD2   . PHE C 58  ? 0.1561 0.1292 0.1205 0.0247  0.0276  -0.0118 58   PHE A CD2   
863  C  CE1   . PHE C 58  ? 0.1903 0.1376 0.1484 -0.0172 -0.0143 0.0125  58   PHE A CE1   
864  C  CE2   . PHE C 58  ? 0.1709 0.1298 0.1167 0.0063  0.0307  -0.0044 58   PHE A CE2   
865  C  CZ    . PHE C 58  ? 0.1817 0.1274 0.1186 -0.0080 0.0053  -0.0158 58   PHE A CZ    
866  N  N     . SER C 59  ? 0.1487 0.1532 0.0940 0.0061  0.0201  -0.0196 59   SER A N     
867  C  CA    . SER C 59  ? 0.1541 0.1532 0.0955 0.0102  0.0073  0.0085  59   SER A CA    
868  C  C     . SER C 59  ? 0.2056 0.1637 0.0845 -0.0299 0.0105  0.0048  59   SER A C     
869  O  O     . SER C 59  ? 0.1994 0.2447 0.1296 -0.0131 0.0240  0.0489  59   SER A O     
870  C  CB    . SER C 59  ? 0.1510 0.1390 0.1333 0.0138  0.0155  -0.0098 59   SER A CB    
871  O  OG    . SER C 59  ? 0.1786 0.1421 0.1245 -0.0006 0.0301  0.0091  59   SER A OG    
872  N  N     . ASN C 60  ? 0.2031 0.1812 0.0825 0.0023  0.0050  -0.0050 60   ASN A N     
873  C  CA    . ASN C 60  ? 0.1882 0.1596 0.0869 0.0289  0.0130  0.0025  60   ASN A CA    
874  C  C     . ASN C 60  ? 0.1811 0.2019 0.1550 0.0504  0.0291  0.0234  60   ASN A C     
875  O  O     . ASN C 60  ? 0.3341 0.3986 0.1320 0.2073  0.0429  0.0801  60   ASN A O     
876  C  CB    . ASN C 60  ? 0.1473 0.2022 0.0956 0.0131  0.0075  -0.0154 60   ASN A CB    
877  C  CG    . ASN C 60  ? 0.1355 0.2578 0.0946 0.0125  -0.0022 -0.0024 60   ASN A CG    
878  O  OD1   . ASN C 60  ? 0.1621 0.3102 0.1070 0.0201  0.0214  0.0053  60   ASN A OD1   
879  N  ND2   . ASN C 60  ? 0.1967 0.2693 0.1462 -0.0349 -0.0438 0.0080  60   ASN A ND2   
880  N  N     . ASP C 61  ? 0.2005 0.1437 0.2692 0.0053  0.0835  -0.0164 61   ASP A N     
881  C  CA    . ASP C 61  ? 0.2459 0.1811 0.4280 0.0479  0.1362  0.0326  61   ASP A CA    
882  C  C     . ASP C 61  ? 0.2421 0.2436 0.3259 0.0584  0.0593  0.1461  61   ASP A C     
883  O  O     . ASP C 61  ? 0.2832 0.3832 1.0432 0.1256  0.2180  0.4609  61   ASP A O     
884  C  CB    . ASP C 61  ? 0.3858 0.2011 0.6589 0.0457  0.2450  0.1760  61   ASP A CB    
885  C  CG    . ASP C 61  ? 0.5372 0.3618 0.8735 -0.1279 0.2266  0.1849  61   ASP A CG    
886  O  OD1   . ASP C 61  ? 0.5280 0.3783 0.9630 -0.0327 0.1407  0.0004  61   ASP A OD1   
887  O  OD2   . ASP C 61  ? 0.9960 0.8546 1.0283 -0.5225 0.3593  0.2651  61   ASP A OD2   
888  N  N     . LEU C 62  ? 0.1983 0.2196 0.0954 0.0508  0.0518  0.0330  62   LEU A N     
889  C  CA    . LEU C 62  ? 0.1885 0.1968 0.0848 0.0709  0.0292  0.0033  62   LEU A CA    
890  C  C     . LEU C 62  ? 0.1703 0.1386 0.0846 0.0474  0.0299  0.0209  62   LEU A C     
891  O  O     . LEU C 62  ? 0.1864 0.2079 0.1032 0.0389  0.0077  0.0418  62   LEU A O     
892  C  CB    . LEU C 62  ? 0.2303 0.2296 0.0754 0.0432  -0.0051 -0.0098 62   LEU A CB    
893  C  CG    . LEU C 62  ? 0.2101 0.3293 0.0878 0.0817  -0.0062 -0.0485 62   LEU A CG    
894  C  CD1   . LEU C 62  ? 0.2359 0.3569 0.1647 0.0737  0.0103  -0.1212 62   LEU A CD1   
895  C  CD2   . LEU C 62  ? 0.2849 0.4356 0.0717 0.1221  -0.0239 -0.0092 62   LEU A CD2   
896  N  N     . THR C 63  ? 0.1572 0.1537 0.0922 0.0161  0.0302  0.0028  63   THR A N     
897  C  CA    . THR C 63  ? 0.1451 0.1666 0.0825 0.0118  0.0298  -0.0059 63   THR A CA    
898  C  C     . THR C 63  ? 0.1489 0.1681 0.0783 0.0098  0.0080  -0.0051 63   THR A C     
899  O  O     . THR C 63  ? 0.1644 0.1770 0.1012 0.0192  -0.0081 0.0019  63   THR A O     
900  C  CB    . THR C 63  ? 0.1759 0.1706 0.0898 0.0003  -0.0061 -0.0130 63   THR A CB    
901  O  OG1   . THR C 63  ? 0.1923 0.2021 0.1091 -0.0193 -0.0011 -0.0067 63   THR A OG1   
902  C  CG2   . THR C 63  ? 0.2236 0.1808 0.1007 0.0229  0.0218  -0.0183 63   THR A CG2   
903  N  N     . LEU C 64  ? 0.1571 0.1616 0.0784 -0.0025 0.0150  0.0008  64   LEU A N     
904  C  CA    . LEU C 64  ? 0.1537 0.1317 0.1028 0.0091  0.0062  -0.0139 64   LEU A CA    
905  C  C     . LEU C 64  ? 0.1619 0.1581 0.0762 0.0198  0.0021  -0.0003 64   LEU A C     
906  O  O     . LEU C 64  ? 0.1710 0.1906 0.0917 0.0197  -0.0011 -0.0207 64   LEU A O     
907  C  CB    . LEU C 64  ? 0.1548 0.1529 0.1335 0.0012  -0.0002 0.0173  64   LEU A CB    
908  C  CG    . LEU C 64  ? 0.1530 0.1617 0.1356 -0.0058 0.0158  -0.0060 64   LEU A CG    
909  C  CD1   . LEU C 64  ? 0.2040 0.1614 0.1699 -0.0032 -0.0329 -0.0142 64   LEU A CD1   
910  C  CD2   . LEU C 64  ? 0.1876 0.1580 0.1648 -0.0097 0.0185  0.0092  64   LEU A CD2   
911  N  N     . TYR C 65  ? 0.1386 0.1458 0.0915 0.0070  0.0130  -0.0077 65   TYR A N     
912  C  CA    . TYR C 65  ? 0.1527 0.1637 0.0809 0.0170  0.0178  0.0048  65   TYR A CA    
913  C  C     . TYR C 65  ? 0.1347 0.1810 0.0889 -0.0042 0.0083  -0.0150 65   TYR A C     
914  O  O     . TYR C 65  ? 0.1484 0.1886 0.0956 0.0042  0.0014  -0.0253 65   TYR A O     
915  C  CB    . TYR C 65  ? 0.1733 0.1650 0.1047 0.0392  0.0053  -0.0043 65   TYR A CB    
916  C  CG    . TYR C 65  ? 0.1654 0.1742 0.0916 0.0298  0.0041  -0.0077 65   TYR A CG    
917  C  CD1   . TYR C 65  ? 0.1549 0.1803 0.1354 0.0456  -0.0147 -0.0024 65   TYR A CD1   
918  C  CD2   . TYR C 65  ? 0.1930 0.1593 0.1106 0.0372  -0.0025 -0.0062 65   TYR A CD2   
919  C  CE1   . TYR C 65  ? 0.1588 0.2021 0.1406 0.0561  -0.0130 -0.0220 65   TYR A CE1   
920  C  CE2   . TYR C 65  ? 0.1967 0.1787 0.1338 0.0511  -0.0209 -0.0196 65   TYR A CE2   
921  C  CZ    . TYR C 65  ? 0.1924 0.2137 0.1146 0.0510  -0.0088 -0.0238 65   TYR A CZ    
922  O  OH    . TYR C 65  ? 0.2397 0.2073 0.1452 0.0768  0.0202  -0.0167 65   TYR A OH    
923  N  N     . SER C 66  ? 0.1529 0.1586 0.0851 0.0027  0.0271  -0.0056 66   SER A N     
924  C  CA    . SER C 66  ? 0.1506 0.1533 0.0989 -0.0082 0.0229  -0.0269 66   SER A CA    
925  C  C     . SER C 66  ? 0.1416 0.1571 0.0899 -0.0130 0.0146  -0.0309 66   SER A C     
926  O  O     . SER C 66  ? 0.1585 0.1822 0.1073 -0.0132 0.0075  -0.0429 66   SER A O     
927  C  CB    . SER C 66  ? 0.1580 0.1444 0.1286 -0.0172 -0.0021 -0.0201 66   SER A CB    
928  O  OG    . SER C 66  ? 0.1460 0.1594 0.1223 -0.0130 0.0072  -0.0205 66   SER A OG    
929  N  N     . HIS C 67  ? 0.1447 0.1378 0.1272 -0.0042 0.0254  -0.0206 67   HIS A N     
930  C  CA    . HIS C 67  ? 0.1628 0.1444 0.1167 -0.0023 0.0274  -0.0209 67   HIS A CA    
931  C  C     . HIS C 67  ? 0.1222 0.1675 0.1269 -0.0024 0.0110  -0.0118 67   HIS A C     
932  O  O     . HIS C 67  ? 0.1681 0.1952 0.1185 -0.0298 0.0159  -0.0216 67   HIS A O     
933  C  CB    . HIS C 67  ? 0.1966 0.1318 0.1194 0.0013  0.0081  -0.0292 67   HIS A CB    
934  C  CG    . HIS C 67  ? 0.1837 0.1594 0.1245 0.0090  0.0109  -0.0346 67   HIS A CG    
935  N  ND1   . HIS C 67  ? 0.2302 0.1641 0.1178 0.0029  0.0169  -0.0166 67   HIS A ND1   
936  C  CD2   . HIS C 67  ? 0.1821 0.1505 0.1286 0.0239  0.0201  -0.0353 67   HIS A CD2   
937  C  CE1   . HIS C 67  ? 0.2071 0.1872 0.1152 -0.0099 0.0183  -0.0332 67   HIS A CE1   
938  N  NE2   . HIS C 67  ? 0.1902 0.1634 0.1338 0.0146  0.0297  -0.0319 67   HIS A NE2   
939  N  N     . ASN C 68  ? 0.1790 0.1642 0.1139 -0.0192 0.0134  -0.0156 68   ASN A N     
940  C  CA    . ASN C 68  ? 0.1784 0.1513 0.1140 -0.0078 0.0111  -0.0191 68   ASN A CA    
941  C  C     . ASN C 68  ? 0.1748 0.1572 0.1195 -0.0042 0.0045  -0.0078 68   ASN A C     
942  O  O     . ASN C 68  ? 0.1871 0.1675 0.1668 -0.0189 0.0294  -0.0367 68   ASN A O     
943  C  CB    . ASN C 68  ? 0.1700 0.1458 0.1229 0.0015  0.0146  -0.0136 68   ASN A CB    
944  C  CG    . ASN C 68  ? 0.1377 0.1734 0.1488 -0.0223 0.0125  -0.0327 68   ASN A CG    
945  O  OD1   . ASN C 68  ? 0.1930 0.2453 0.1885 -0.0217 -0.0429 -0.0096 68   ASN A OD1   
946  N  ND2   . ASN C 68  ? 0.1294 0.1210 0.1386 -0.0106 0.0143  -0.0162 68   ASN A ND2   
947  N  N     . GLN C 69  ? 0.1989 0.1637 0.1209 0.0171  0.0184  -0.0142 69   GLN A N     
948  C  CA    . GLN C 69  ? 0.2035 0.1915 0.1388 0.0235  0.0273  -0.0137 69   GLN A CA    
949  C  C     . GLN C 69  ? 0.1799 0.1572 0.1337 -0.0028 0.0127  -0.0230 69   GLN A C     
950  O  O     . GLN C 69  ? 0.1830 0.1836 0.1386 -0.0151 0.0117  -0.0410 69   GLN A O     
951  C  CB    . GLN C 69  ? 0.1952 0.2835 0.1304 0.0242  0.0225  -0.0149 69   GLN A CB    
952  C  CG    . GLN C 69  ? 0.1768 0.2971 0.2512 0.0117  0.0254  -0.0214 69   GLN A CG    
953  C  CD    . GLN C 69  ? 0.1939 0.2557 0.2246 0.0089  -0.0175 0.0112  69   GLN A CD    
954  O  OE1   . GLN C 69  ? 0.2434 0.2468 0.2153 0.0014  0.0354  -0.0306 69   GLN A OE1   
955  N  NE2   . GLN C 69  ? 0.2838 0.3223 0.2468 -0.0035 -0.0625 -0.0643 69   GLN A NE2   
956  N  N     . LEU C 70  ? 0.1922 0.1737 0.1488 -0.0216 0.0094  -0.0323 70   LEU A N     
957  C  CA    . LEU C 70  ? 0.1945 0.1965 0.1720 -0.0096 0.0549  -0.0317 70   LEU A CA    
958  C  C     . LEU C 70  ? 0.2239 0.2027 0.1670 -0.0140 0.0613  -0.0118 70   LEU A C     
959  O  O     . LEU C 70  ? 0.4801 0.2418 0.1881 0.0613  0.1585  0.0004  70   LEU A O     
960  C  CB    . LEU C 70  ? 0.1862 0.1837 0.2192 -0.0379 0.0317  -0.0578 70   LEU A CB    
961  C  CG    . LEU C 70  ? 0.1748 0.1889 0.1763 -0.0165 0.0026  -0.0293 70   LEU A CG    
962  C  CD1   . LEU C 70  ? 0.1772 0.2135 0.2034 -0.0287 0.0295  -0.0291 70   LEU A CD1   
963  C  CD2   . LEU C 70  ? 0.1818 0.2083 0.1882 -0.0272 0.0425  -0.0631 70   LEU A CD2   
964  N  N     . TYR C 71  ? 0.1592 0.2080 0.1673 0.0031  0.0473  -0.0268 71   TYR A N     
965  C  CA    . TYR C 71  ? 0.1493 0.2071 0.1608 -0.0117 0.0249  -0.0162 71   TYR A CA    
966  C  C     . TYR C 71  ? 0.1722 0.1776 0.1515 -0.0090 0.0270  -0.0058 71   TYR A C     
967  O  O     . TYR C 71  ? 0.2132 0.1827 0.1643 0.0061  0.0365  -0.0098 71   TYR A O     
968  C  CB    . TYR C 71  ? 0.1696 0.2473 0.1790 -0.0201 0.0087  -0.0269 71   TYR A CB    
969  C  CG    . TYR C 71  ? 0.1439 0.2392 0.1789 -0.0143 0.0105  -0.0430 71   TYR A CG    
970  C  CD1   . TYR C 71  ? 0.1793 0.1936 0.1685 -0.0292 0.0070  -0.0539 71   TYR A CD1   
971  C  CD2   . TYR C 71  ? 0.1863 0.2425 0.1513 -0.0028 -0.0128 -0.0541 71   TYR A CD2   
972  C  CE1   . TYR C 71  ? 0.1835 0.2400 0.1785 -0.0083 0.0068  -0.0324 71   TYR A CE1   
973  C  CE2   . TYR C 71  ? 0.2227 0.2359 0.1647 0.0039  0.0216  -0.0284 71   TYR A CE2   
974  C  CZ    . TYR C 71  ? 0.2182 0.2311 0.1611 0.0109  0.0182  -0.0357 71   TYR A CZ    
975  O  OH    . TYR C 71  ? 0.1953 0.2983 0.1595 0.0010  0.0099  -0.0168 71   TYR A OH    
976  N  N     . GLY C 72  ? 0.1524 0.1848 0.1504 -0.0140 0.0329  -0.0365 72   GLY A N     
977  C  CA    . GLY C 72  ? 0.1523 0.1808 0.1750 0.0081  0.0078  -0.0260 72   GLY A CA    
978  C  C     . GLY C 72  ? 0.1844 0.1637 0.1643 -0.0034 0.0037  -0.0168 72   GLY A C     
979  O  O     . GLY C 72  ? 0.1997 0.1830 0.1627 -0.0111 0.0220  -0.0256 72   GLY A O     
980  N  N     . VAL C 73  ? 0.1475 0.1605 0.1555 -0.0161 0.0150  -0.0020 73   VAL A N     
981  C  CA    . VAL C 73  ? 0.1418 0.1967 0.1318 -0.0125 0.0266  -0.0130 73   VAL A CA    
982  C  C     . VAL C 73  ? 0.1596 0.1733 0.1375 0.0010  0.0054  -0.0197 73   VAL A C     
983  O  O     . VAL C 73  ? 0.1965 0.1609 0.1430 -0.0194 0.0180  -0.0212 73   VAL A O     
984  C  CB    . VAL C 73  ? 0.2064 0.1886 0.1440 -0.0131 0.0320  -0.0041 73   VAL A CB    
985  C  CG1   . VAL C 73  ? 0.3309 0.1524 0.1838 0.0058  0.0715  -0.0027 73   VAL A CG1   
986  C  CG2   . VAL C 73  ? 0.2359 0.3356 0.1368 0.0311  0.0227  0.0083  73   VAL A CG2   
987  N  N     . TRP C 74  ? 0.1544 0.1571 0.1292 0.0003  0.0156  -0.0041 74   TRP A N     
988  C  CA    . TRP C 74  ? 0.1560 0.1347 0.1356 -0.0006 0.0143  0.0013  74   TRP A CA    
989  C  C     . TRP C 74  ? 0.1862 0.1431 0.1221 0.0065  0.0206  -0.0037 74   TRP A C     
990  O  O     . TRP C 74  ? 0.2269 0.1652 0.1231 0.0193  0.0253  -0.0046 74   TRP A O     
991  C  CB    . TRP C 74  ? 0.1712 0.1744 0.1330 -0.0260 0.0160  0.0031  74   TRP A CB    
992  C  CG    . TRP C 74  ? 0.1793 0.1477 0.1431 -0.0134 0.0235  -0.0041 74   TRP A CG    
993  C  CD1   . TRP C 74  ? 0.1910 0.1655 0.1317 0.0057  0.0031  -0.0072 74   TRP A CD1   
994  C  CD2   . TRP C 74  ? 0.1685 0.1515 0.1292 -0.0053 0.0064  -0.0036 74   TRP A CD2   
995  N  NE1   . TRP C 74  ? 0.1838 0.1426 0.1258 -0.0229 0.0134  -0.0158 74   TRP A NE1   
996  C  CE2   . TRP C 74  ? 0.1613 0.1446 0.1397 -0.0212 0.0120  -0.0048 74   TRP A CE2   
997  C  CE3   . TRP C 74  ? 0.1659 0.1590 0.1430 -0.0073 0.0159  -0.0102 74   TRP A CE3   
998  C  CZ2   . TRP C 74  ? 0.1557 0.1756 0.1182 -0.0012 -0.0153 -0.0157 74   TRP A CZ2   
999  C  CZ3   . TRP C 74  ? 0.1419 0.1618 0.1347 -0.0113 0.0081  -0.0075 74   TRP A CZ3   
1000 C  CH2   . TRP C 74  ? 0.1755 0.1658 0.1395 -0.0073 0.0081  -0.0073 74   TRP A CH2   
1001 N  N     . ARG C 75  ? 0.2112 0.1329 0.1388 0.0059  0.0160  -0.0008 75   ARG A N     
1002 C  CA    . ARG C 75  ? 0.2104 0.1411 0.1310 0.0076  0.0268  0.0054  75   ARG A CA    
1003 C  C     . ARG C 75  ? 0.2120 0.1453 0.0988 0.0117  0.0280  -0.0009 75   ARG A C     
1004 O  O     . ARG C 75  ? 0.2316 0.2242 0.0802 0.0330  0.0111  -0.0074 75   ARG A O     
1005 C  CB    . ARG C 75  ? 0.2370 0.1588 0.1925 -0.0217 0.0479  0.0077  75   ARG A CB    
1006 C  CG    . ARG C 75  ? 0.2280 0.2982 0.4311 -0.0200 0.0820  0.0843  75   ARG A CG    
1007 C  CD    . ARG C 75  ? 0.4633 0.5722 0.5805 0.1340  0.3439  0.2241  75   ARG A CD    
1008 N  NE    . ARG C 75  ? 0.4579 0.7874 0.7427 0.1692  0.3547  0.2926  75   ARG A NE    
1009 C  CZ    . ARG C 75  ? 0.4067 0.9643 0.7902 0.2661  0.1813  0.2604  75   ARG A CZ    
1010 N  NH1   . ARG C 75  ? 0.6655 1.1209 0.5284 0.1169  -0.0020 0.3486  75   ARG A NH1   
1011 N  NH2   . ARG C 75  ? 0.4625 1.0812 0.7633 0.3986  0.3114  0.5546  75   ARG A NH2   
1012 N  N     . VAL C 76  ? 0.2281 0.1633 0.0890 0.0164  0.0142  0.0030  76   VAL A N     
1013 C  CA    . VAL C 76  ? 0.2302 0.1417 0.1120 0.0098  0.0075  0.0053  76   VAL A CA    
1014 C  C     . VAL C 76  ? 0.2226 0.1437 0.0975 0.0087  -0.0034 0.0040  76   VAL A C     
1015 O  O     . VAL C 76  ? 0.2860 0.1791 0.1266 0.0252  0.0343  0.0359  76   VAL A O     
1016 C  CB    . VAL C 76  ? 0.2276 0.1433 0.1076 0.0016  0.0196  -0.0066 76   VAL A CB    
1017 C  CG1   . VAL C 76  ? 0.2171 0.2022 0.1672 0.0103  0.0248  0.0014  76   VAL A CG1   
1018 C  CG2   . VAL C 76  ? 0.2898 0.1399 0.1628 -0.0026 0.0063  -0.0048 76   VAL A CG2   
1019 N  N     . VAL C 77  ? 0.2050 0.1370 0.1301 0.0106  0.0027  -0.0006 77   VAL A N     
1020 C  CA    . VAL C 77  ? 0.2395 0.1314 0.1309 0.0081  0.0155  0.0167  77   VAL A CA    
1021 C  C     . VAL C 77  ? 0.2563 0.1338 0.0977 0.0233  0.0245  0.0172  77   VAL A C     
1022 O  O     . VAL C 77  ? 0.2535 0.1397 0.1248 0.0087  0.0298  0.0100  77   VAL A O     
1023 C  CB    . VAL C 77  ? 0.2620 0.1542 0.1383 -0.0140 0.0258  -0.0028 77   VAL A CB    
1024 C  CG1   . VAL C 77  ? 0.2427 0.2188 0.2157 -0.0199 0.0433  -0.0190 77   VAL A CG1   
1025 C  CG2   . VAL C 77  ? 0.2834 0.1625 0.1309 -0.0212 0.0211  0.0134  77   VAL A CG2   
1026 N  N     . ASP C 78  ? 0.2937 0.1198 0.0937 0.0364  0.0109  -0.0129 78   ASP A N     
1027 C  CA    . ASP C 78  ? 0.3061 0.1669 0.0802 0.0668  0.0029  -0.0034 78   ASP A CA    
1028 C  C     . ASP C 78  ? 0.2430 0.1296 0.1050 0.0117  0.0186  -0.0135 78   ASP A C     
1029 O  O     . ASP C 78  ? 0.2357 0.1619 0.1666 0.0086  0.0158  -0.0056 78   ASP A O     
1030 C  CB    . ASP C 78  ? 0.3406 0.1581 0.1285 0.0640  -0.0151 0.0097  78   ASP A CB    
1031 C  CG    . ASP C 78  ? 0.4918 0.1669 0.1564 0.0486  -0.1206 0.0409  78   ASP A CG    
1032 O  OD1   . ASP C 78  ? 0.5020 0.2325 0.2197 -0.0370 -0.0796 0.0060  78   ASP A OD1   
1033 O  OD2   . ASP C 78  ? 0.8809 0.3973 0.1729 -0.2037 -0.1460 0.1072  78   ASP A OD2   
1034 N  N     . THR C 79  ? 0.2606 0.1654 0.0885 0.0075  0.0254  -0.0013 79   THR A N     
1035 C  CA    . THR C 79  ? 0.2799 0.1624 0.1043 -0.0346 0.0338  -0.0247 79   THR A CA    
1036 C  C     . THR C 79  ? 0.2233 0.1529 0.1161 -0.0033 0.0098  0.0114  79   THR A C     
1037 O  O     . THR C 79  ? 0.2419 0.1634 0.1413 0.0303  0.0089  0.0058  79   THR A O     
1038 C  CB    . THR C 79  ? 0.2907 0.1475 0.0986 -0.0275 0.0531  -0.0094 79   THR A CB    
1039 O  OG1   . THR C 79  ? 0.4559 0.1682 0.1430 -0.1144 0.0763  -0.0570 79   THR A OG1   
1040 C  CG2   . THR C 79  ? 0.3327 0.1535 0.1101 -0.0535 0.0475  -0.0374 79   THR A CG2   
1041 N  N     . GLY C 80  ? 0.2548 0.1334 0.1267 -0.0058 -0.0140 -0.0073 80   GLY A N     
1042 C  CA    . GLY C 80  ? 0.2844 0.1471 0.1337 -0.0364 0.0324  -0.0269 80   GLY A CA    
1043 C  C     . GLY C 80  ? 0.2587 0.1525 0.1319 -0.0075 0.0120  -0.0061 80   GLY A C     
1044 O  O     . GLY C 80  ? 0.2254 0.1739 0.1690 -0.0087 -0.0014 -0.0027 80   GLY A O     
1045 N  N     . GLU C 81  ? 0.3048 0.1627 0.1647 -0.0172 0.0674  -0.0229 81   GLU A N     
1046 C  CA    . GLU C 81  ? 0.2698 0.1826 0.1859 -0.0313 0.0599  -0.0214 81   GLU A CA    
1047 C  C     . GLU C 81  ? 0.2614 0.1775 0.2560 -0.0411 0.0226  -0.0374 81   GLU A C     
1048 O  O     . GLU C 81  ? 0.2864 0.2005 0.2274 -0.0161 0.0378  -0.0173 81   GLU A O     
1049 C  CB    . GLU C 81  ? 0.2785 0.3102 0.1665 -0.0374 0.0640  -0.0134 81   GLU A CB    
1050 C  CG    . GLU C 81  ? 0.3199 0.4475 0.2452 0.0072  0.0331  0.0698  81   GLU A CG    
1051 C  CD    . GLU C 81  ? 0.2619 0.4816 0.5430 0.0267  0.0209  0.1743  81   GLU A CD    
1052 O  OE1   . GLU C 81  ? 0.3511 0.4434 0.9523 -0.0665 0.0547  -0.0757 81   GLU A OE1   
1053 O  OE2   . GLU C 81  ? 0.4031 0.6891 0.5956 0.1945  0.0433  0.2724  81   GLU A OE2   
1054 N  N     . GLU C 82  ? 0.2667 0.2508 0.2866 -0.0297 0.0492  -0.0158 82   GLU A N     
1055 C  CA    . GLU C 82  ? 0.2820 0.4161 0.2696 0.0377  0.0608  0.0074  82   GLU A CA    
1056 C  C     . GLU C 82  ? 0.2662 0.3580 0.2890 0.0052  0.0399  -0.0185 82   GLU A C     
1057 O  O     . GLU C 82  ? 0.4677 0.3347 0.3371 -0.0551 -0.0063 0.0025  82   GLU A O     
1058 C  CB    . GLU C 82  ? 0.3770 0.6237 0.3229 -0.1840 -0.0474 0.1430  82   GLU A CB    
1059 N  N     . PRO C 83  ? 0.2468 0.3336 0.3128 0.0205  0.0974  -0.0431 83   PRO A N     
1060 C  CA    . PRO C 83  ? 0.3009 0.2979 0.3167 0.0271  0.0911  0.0316  83   PRO A CA    
1061 C  C     . PRO C 83  ? 0.2749 0.3962 0.3552 -0.0239 0.1099  0.1648  83   PRO A C     
1062 O  O     . PRO C 83  ? 0.2816 0.2580 0.3241 -0.0568 0.0518  0.0534  83   PRO A O     
1063 C  CB    . PRO C 83  ? 0.4235 0.4251 0.3255 0.0109  0.1527  -0.0519 83   PRO A CB    
1064 C  CG    . PRO C 83  ? 0.4219 0.4056 0.3717 -0.0206 0.0614  -0.0901 83   PRO A CG    
1065 C  CD    . PRO C 83  ? 0.4022 0.3470 0.3957 -0.0642 0.1708  -0.0897 83   PRO A CD    
1066 N  N     . GLN C 84  ? 0.3300 0.3226 0.2957 -0.0241 0.1076  0.1100  84   GLN A N     
1067 C  CA    . GLN C 84  ? 0.3006 0.3077 0.4609 -0.0220 0.1184  0.0058  84   GLN A CA    
1068 C  C     . GLN C 84  ? 0.3103 0.2577 0.4248 -0.0604 0.0423  -0.0139 84   GLN A C     
1069 O  O     . GLN C 84  ? 0.4303 0.3004 0.3704 -0.0656 0.1000  0.0207  84   GLN A O     
1070 C  CB    . GLN C 84  ? 0.3574 0.2749 0.5089 -0.0588 -0.0925 0.1207  84   GLN A CB    
1071 N  N     . THR C 85  ? 0.2763 0.2834 0.4337 -0.0681 0.0405  -0.0066 85   THR A N     
1072 C  CA    . THR C 85  ? 0.2893 0.3024 0.4735 -0.0358 0.1355  0.0542  85   THR A CA    
1073 C  C     . THR C 85  ? 0.3192 0.1634 0.5701 -0.0533 0.0832  0.0598  85   THR A C     
1074 O  O     . THR C 85  ? 0.3888 0.2230 0.6083 0.0469  -0.0116 -0.0041 85   THR A O     
1075 C  CB    . THR C 85  ? 0.3332 0.2801 0.3114 -0.0377 0.0216  0.0763  85   THR A CB    
1076 O  OG1   . THR C 85  ? 0.2875 0.3018 0.3564 -0.0495 0.0871  0.0580  85   THR A OG1   
1077 C  CG2   . THR C 85  ? 0.2703 0.2854 0.3470 -0.0056 0.0499  0.0766  85   THR A CG2   
1078 N  N     . THR C 86  ? 0.2940 0.2724 0.5458 -0.0396 0.1264  0.1353  86   THR A N     
1079 C  CA    . THR C 86  ? 0.2913 0.2816 0.6018 -0.0776 0.0987  0.1225  86   THR A CA    
1080 C  C     . THR C 86  ? 0.2065 0.2445 0.4844 -0.0657 0.0836  0.0605  86   THR A C     
1081 O  O     . THR C 86  ? 0.2549 0.2321 0.4860 -0.0664 0.0418  -0.0076 86   THR A O     
1082 C  CB    . THR C 86  ? 0.2874 0.3525 0.8766 -0.0277 0.1919  0.3415  86   THR A CB    
1083 O  OG1   . THR C 86  ? 0.3662 0.8914 1.1870 0.1251  0.0645  0.3954  86   THR A OG1   
1084 C  CG2   . THR C 86  ? 0.4505 0.4044 0.8805 0.2232  0.3437  0.2255  86   THR A CG2   
1085 N  N     . ARG C 87  ? 0.2332 0.2159 0.3120 -0.0431 0.0970  0.0146  87   ARG A N     
1086 C  CA    . ARG C 87  ? 0.2321 0.2097 0.2313 -0.0768 0.0549  -0.0212 87   ARG A CA    
1087 C  C     . ARG C 87  ? 0.2345 0.2052 0.2248 -0.0515 0.0322  -0.0359 87   ARG A C     
1088 O  O     . ARG C 87  ? 0.2477 0.2212 0.2833 -0.0359 0.0497  -0.0355 87   ARG A O     
1089 C  CB    . ARG C 87  ? 0.2293 0.2066 0.2199 -0.0444 0.0302  -0.0347 87   ARG A CB    
1090 C  CG    . ARG C 87  ? 0.2933 0.2258 0.2273 -0.0520 0.0558  -0.0335 87   ARG A CG    
1091 C  CD    . ARG C 87  ? 0.3385 0.2099 0.1793 -0.0548 0.0280  -0.0193 87   ARG A CD    
1092 N  NE    . ARG C 87  ? 0.3593 0.2150 0.2406 -0.0275 0.0380  -0.0419 87   ARG A NE    
1093 C  CZ    . ARG C 87  ? 0.5426 0.1804 0.2248 -0.0503 0.0624  -0.0189 87   ARG A CZ    
1094 N  NH1   . ARG C 87  ? 0.3005 0.2741 0.2381 -0.0733 0.0164  0.0081  87   ARG A NH1   
1095 N  NH2   . ARG C 87  ? 0.5230 0.2403 0.2592 0.0050  0.0720  -0.0533 87   ARG A NH2   
1096 N  N     . VAL C 88  ? 0.1963 0.2154 0.2204 -0.0782 0.0335  -0.0294 88   VAL A N     
1097 C  CA    . VAL C 88  ? 0.1950 0.2337 0.2148 -0.0890 0.0198  -0.0469 88   VAL A CA    
1098 C  C     . VAL C 88  ? 0.1900 0.1860 0.1912 -0.0565 0.0294  -0.0324 88   VAL A C     
1099 O  O     . VAL C 88  ? 0.1765 0.2008 0.2345 -0.0614 0.0389  -0.0614 88   VAL A O     
1100 C  CB    . VAL C 88  ? 0.1863 0.2763 0.2319 -0.0801 0.0317  -0.0064 88   VAL A CB    
1101 C  CG1   . VAL C 88  ? 0.2475 0.2859 0.4382 -0.0216 0.0573  0.0108  88   VAL A CG1   
1102 C  CG2   . VAL C 88  ? 0.2184 0.4250 0.2148 -0.0434 0.0370  -0.0013 88   VAL A CG2   
1103 N  N     . LEU C 89  ? 0.2164 0.1863 0.1670 -0.0439 0.0453  -0.0184 89   LEU A N     
1104 C  CA    . LEU C 89  ? 0.1981 0.1612 0.1688 -0.0229 0.0227  -0.0137 89   LEU A CA    
1105 C  C     . LEU C 89  ? 0.1684 0.1726 0.1443 -0.0355 0.0271  -0.0254 89   LEU A C     
1106 O  O     . LEU C 89  ? 0.1997 0.2177 0.1659 -0.0347 0.0009  -0.0387 89   LEU A O     
1107 C  CB    . LEU C 89  ? 0.2423 0.1400 0.2231 -0.0225 0.0398  -0.0175 89   LEU A CB    
1108 C  CG    . LEU C 89  ? 0.2234 0.1713 0.1909 0.0158  0.0178  -0.0179 89   LEU A CG    
1109 C  CD1   . LEU C 89  ? 0.2666 0.1412 0.1904 -0.0131 0.0130  -0.0021 89   LEU A CD1   
1110 C  CD2   . LEU C 89  ? 0.2775 0.1524 0.2277 0.0252  0.0241  -0.0162 89   LEU A CD2   
1111 N  N     . ARG C 90  ? 0.1582 0.1661 0.1711 -0.0263 0.0214  -0.0149 90   ARG A N     
1112 C  CA    . ARG C 90  ? 0.1528 0.1385 0.1913 -0.0096 0.0116  -0.0116 90   ARG A CA    
1113 C  C     . ARG C 90  ? 0.1545 0.1662 0.1311 -0.0007 0.0036  -0.0189 90   ARG A C     
1114 O  O     . ARG C 90  ? 0.1680 0.1714 0.1403 -0.0047 -0.0094 -0.0009 90   ARG A O     
1115 C  CB    . ARG C 90  ? 0.1509 0.1589 0.1963 -0.0094 0.0012  -0.0528 90   ARG A CB    
1116 C  CG    . ARG C 90  ? 0.1586 0.2703 0.1593 0.0185  0.0320  -0.0051 90   ARG A CG    
1117 C  CD    . ARG C 90  ? 0.1648 0.2495 0.1916 -0.0034 -0.0095 -0.0348 90   ARG A CD    
1118 N  NE    . ARG C 90  ? 0.1721 0.2899 0.2241 -0.0107 0.0106  -0.0170 90   ARG A NE    
1119 C  CZ    . ARG C 90  ? 0.1597 0.2587 0.2126 -0.0463 0.0307  -0.0503 90   ARG A CZ    
1120 N  NH1   . ARG C 90  ? 0.2645 0.2384 0.1606 -0.0380 -0.0246 -0.0310 90   ARG A NH1   
1121 N  NH2   . ARG C 90  ? 0.1778 0.2687 0.2580 -0.0635 0.0104  -0.0278 90   ARG A NH2   
1122 N  N     . VAL C 91  ? 0.1578 0.1475 0.1475 0.0026  -0.0143 -0.0075 91   VAL A N     
1123 C  CA    . VAL C 91  ? 0.1587 0.1459 0.1303 0.0090  0.0006  -0.0089 91   VAL A CA    
1124 C  C     . VAL C 91  ? 0.1585 0.1428 0.1177 0.0079  -0.0017 -0.0273 91   VAL A C     
1125 O  O     . VAL C 91  ? 0.1717 0.1404 0.1198 -0.0068 0.0044  -0.0097 91   VAL A O     
1126 C  CB    . VAL C 91  ? 0.1453 0.1411 0.1579 0.0157  0.0143  -0.0245 91   VAL A CB    
1127 C  CG1   . VAL C 91  ? 0.1493 0.1653 0.1841 0.0197  0.0225  0.0066  91   VAL A CG1   
1128 C  CG2   . VAL C 91  ? 0.1558 0.1559 0.1697 0.0197  0.0263  0.0033  91   VAL A CG2   
1129 N  N     . LYS C 92  ? 0.1609 0.1243 0.1214 0.0074  0.0046  -0.0134 92   LYS A N     
1130 C  CA    . LYS C 92  ? 0.1739 0.1251 0.1114 0.0086  0.0051  0.0090  92   LYS A CA    
1131 C  C     . LYS C 92  ? 0.1708 0.1567 0.0949 0.0012  0.0025  -0.0229 92   LYS A C     
1132 O  O     . LYS C 92  ? 0.1815 0.1709 0.0891 -0.0017 0.0047  -0.0119 92   LYS A O     
1133 C  CB    . LYS C 92  ? 0.1972 0.1301 0.1291 0.0099  -0.0048 -0.0090 92   LYS A CB    
1134 C  CG    . LYS C 92  ? 0.2207 0.1186 0.1469 0.0243  -0.0033 0.0015  92   LYS A CG    
1135 C  CD    . LYS C 92  ? 0.2449 0.1232 0.1336 -0.0012 -0.0040 -0.0021 92   LYS A CD    
1136 C  CE    . LYS C 92  ? 0.2814 0.1438 0.1324 0.0307  -0.0040 -0.0165 92   LYS A CE    
1137 N  NZ    . LYS C 92  ? 0.2571 0.1342 0.1852 0.0133  -0.0019 -0.0199 92   LYS A NZ    
1138 N  N     . LEU C 93  ? 0.1711 0.1429 0.0964 0.0074  -0.0018 -0.0105 93   LEU A N     
1139 C  CA    . LEU C 93  ? 0.1659 0.1088 0.1204 0.0178  0.0022  0.0068  93   LEU A CA    
1140 C  C     . LEU C 93  ? 0.1787 0.1174 0.0955 0.0188  0.0172  0.0181  93   LEU A C     
1141 O  O     . LEU C 93  ? 0.1931 0.1467 0.0916 0.0045  -0.0048 0.0008  93   LEU A O     
1142 C  CB    . LEU C 93  ? 0.1985 0.1069 0.0914 0.0243  0.0085  -0.0001 93   LEU A CB    
1143 C  CG    . LEU C 93  ? 0.1839 0.1075 0.1203 0.0155  0.0037  0.0165  93   LEU A CG    
1144 C  CD1   . LEU C 93  ? 0.2336 0.1142 0.1319 0.0257  -0.0128 -0.0028 93   LEU A CD1   
1145 C  CD2   . LEU C 93  ? 0.3292 0.1539 0.0863 -0.0016 -0.0387 0.0039  93   LEU A CD2   
1146 N  N     . GLN C 94  ? 0.1471 0.1056 0.1329 0.0096  0.0031  0.0017  94   GLN A N     
1147 C  CA    . GLN C 94  ? 0.1628 0.1049 0.1117 0.0134  -0.0037 0.0035  94   GLN A CA    
1148 C  C     . GLN C 94  ? 0.1673 0.1072 0.0876 0.0297  0.0085  -0.0066 94   GLN A C     
1149 O  O     . GLN C 94  ? 0.1868 0.1346 0.0858 0.0160  0.0079  0.0069  94   GLN A O     
1150 C  CB    . GLN C 94  ? 0.1819 0.1123 0.1325 0.0174  -0.0138 -0.0024 94   GLN A CB    
1151 C  CG    . GLN C 94  ? 0.1965 0.1000 0.1394 0.0091  0.0050  0.0068  94   GLN A CG    
1152 C  CD    . GLN C 94  ? 0.2087 0.1151 0.1379 -0.0082 -0.0071 -0.0058 94   GLN A CD    
1153 O  OE1   . GLN C 94  ? 0.2077 0.1726 0.1805 -0.0097 -0.0031 -0.0178 94   GLN A OE1   
1154 N  NE2   . GLN C 94  ? 0.2536 0.1222 0.1489 0.0244  -0.0227 -0.0100 94   GLN A NE2   
1155 N  N     . THR C 95  ? 0.1772 0.1222 0.0982 0.0089  -0.0156 0.0010  95   THR A N     
1156 C  CA    . THR C 95  ? 0.1790 0.1184 0.1075 0.0147  -0.0158 0.0002  95   THR A CA    
1157 C  C     . THR C 95  ? 0.1849 0.1225 0.1007 0.0184  -0.0073 0.0022  95   THR A C     
1158 O  O     . THR C 95  ? 0.2038 0.1387 0.1161 0.0043  -0.0069 0.0193  95   THR A O     
1159 C  CB    . THR C 95  ? 0.2167 0.1184 0.1008 -0.0140 -0.0198 0.0165  95   THR A CB    
1160 O  OG1   . THR C 95  ? 0.2170 0.1565 0.0965 -0.0006 -0.0118 0.0051  95   THR A OG1   
1161 C  CG2   . THR C 95  ? 0.2127 0.1213 0.1153 0.0204  -0.0111 -0.0041 95   THR A CG2   
1162 N  N     . ALA C 96  ? 0.1865 0.1223 0.1136 0.0227  -0.0076 0.0114  96   ALA A N     
1163 C  CA    . ALA C 96  ? 0.1784 0.1226 0.1175 0.0091  -0.0134 0.0249  96   ALA A CA    
1164 C  C     . ALA C 96  ? 0.2290 0.1273 0.1203 0.0147  -0.0089 0.0191  96   ALA A C     
1165 O  O     . ALA C 96  ? 0.2322 0.1414 0.1348 -0.0006 -0.0064 0.0417  96   ALA A O     
1166 C  CB    . ALA C 96  ? 0.1742 0.1795 0.1768 0.0243  -0.0263 0.0056  96   ALA A CB    
1167 N  N     . ASP C 97  ? 0.1902 0.1652 0.1131 0.0442  -0.0192 0.0023  97   ASP A N     
1168 C  CA    . ASP C 97  ? 0.1960 0.1862 0.1157 0.0347  -0.0255 0.0188  97   ASP A CA    
1169 C  C     . ASP C 97  ? 0.2200 0.1339 0.1114 0.0235  0.0006  0.0070  97   ASP A C     
1170 O  O     . ASP C 97  ? 0.2334 0.1890 0.1798 0.0166  0.0147  0.0567  97   ASP A O     
1171 C  CB    . ASP C 97  ? 0.2271 0.2521 0.1240 -0.0036 -0.0254 0.0018  97   ASP A CB    
1172 C  CG    . ASP C 97  ? 0.2432 0.2373 0.1693 0.0092  -0.0487 -0.0032 97   ASP A CG    
1173 O  OD1   . ASP C 97  ? 0.2644 0.2408 0.1645 0.0295  -0.0153 -0.0108 97   ASP A OD1   
1174 O  OD2   . ASP C 97  ? 0.3931 0.2790 0.2058 0.0238  -0.0977 -0.0512 97   ASP A OD2   
1175 N  N     . LYS C 98  ? 0.1979 0.1356 0.1157 0.0216  -0.0211 0.0004  98   LYS A N     
1176 C  CA    . LYS C 98  ? 0.2136 0.1436 0.0981 0.0295  -0.0225 -0.0104 98   LYS A CA    
1177 C  C     . LYS C 98  ? 0.1798 0.1455 0.0869 0.0136  -0.0069 0.0029  98   LYS A C     
1178 O  O     . LYS C 98  ? 0.2054 0.1544 0.0826 0.0071  0.0035  0.0040  98   LYS A O     
1179 C  CB    . LYS C 98  ? 0.2490 0.1697 0.1223 0.0392  -0.0417 -0.0396 98   LYS A CB    
1180 C  CG    . LYS C 98  ? 0.3152 0.1954 0.1559 0.0201  -0.0883 -0.0165 98   LYS A CG    
1181 C  CD    . LYS C 98  ? 0.5063 0.2348 0.1759 -0.0453 -0.0961 0.0440  98   LYS A CD    
1182 C  CE    . LYS C 98  ? 0.6190 0.4537 0.1778 0.0042  -0.1214 0.0525  98   LYS A CE    
1183 N  NZ    . LYS C 98  ? 0.8297 0.6338 0.2521 0.1302  0.0488  0.1905  98   LYS A NZ    
1184 N  N     . THR C 99  ? 0.1835 0.1270 0.1185 0.0002  -0.0062 0.0007  99   THR A N     
1185 C  CA    . THR C 99  ? 0.1681 0.1422 0.1057 0.0159  -0.0112 -0.0174 99   THR A CA    
1186 C  C     . THR C 99  ? 0.1945 0.1367 0.1038 0.0140  0.0138  0.0019  99   THR A C     
1187 O  O     . THR C 99  ? 0.2351 0.1342 0.1081 0.0093  0.0222  0.0064  99   THR A O     
1188 C  CB    . THR C 99  ? 0.1933 0.1493 0.0929 0.0077  -0.0019 -0.0172 99   THR A CB    
1189 O  OG1   . THR C 99  ? 0.2253 0.1372 0.1136 0.0073  0.0114  -0.0104 99   THR A OG1   
1190 C  CG2   . THR C 99  ? 0.1930 0.1638 0.1384 -0.0236 -0.0245 -0.0116 99   THR A CG2   
1191 N  N     . ILE C 100 ? 0.1698 0.1131 0.1254 0.0050  0.0077  0.0078  100  ILE A N     
1192 C  CA    . ILE C 100 ? 0.1507 0.1353 0.1188 -0.0033 0.0210  -0.0050 100  ILE A CA    
1193 C  C     . ILE C 100 ? 0.1521 0.1389 0.1161 -0.0047 0.0198  0.0063  100  ILE A C     
1194 O  O     . ILE C 100 ? 0.1604 0.1460 0.1156 -0.0080 0.0164  -0.0079 100  ILE A O     
1195 C  CB    . ILE C 100 ? 0.2068 0.1186 0.0942 0.0055  -0.0158 -0.0011 100  ILE A CB    
1196 C  CG1   . ILE C 100 ? 0.2390 0.1274 0.1097 -0.0298 0.0141  -0.0102 100  ILE A CG1   
1197 C  CG2   . ILE C 100 ? 0.1606 0.1456 0.1374 0.0115  -0.0081 -0.0044 100  ILE A CG2   
1198 C  CD1   . ILE C 100 ? 0.2467 0.1188 0.1475 -0.0149 0.0046  -0.0093 100  ILE A CD1   
1199 N  N     . LEU C 101 ? 0.1506 0.1419 0.1285 0.0043  0.0253  -0.0006 101  LEU A N     
1200 C  CA    . LEU C 101 ? 0.1499 0.1598 0.1431 0.0051  0.0098  0.0213  101  LEU A CA    
1201 C  C     . LEU C 101 ? 0.1583 0.1467 0.1103 -0.0064 0.0039  -0.0035 101  LEU A C     
1202 O  O     . LEU C 101 ? 0.1850 0.1743 0.1082 -0.0053 0.0011  -0.0088 101  LEU A O     
1203 C  CB    . LEU C 101 ? 0.1981 0.1433 0.1613 -0.0100 0.0494  -0.0022 101  LEU A CB    
1204 C  CG    . LEU C 101 ? 0.1897 0.1460 0.1678 -0.0057 0.0402  0.0044  101  LEU A CG    
1205 C  CD1   . LEU C 101 ? 0.2492 0.1726 0.1623 -0.0162 0.0152  0.0343  101  LEU A CD1   
1206 C  CD2   . LEU C 101 ? 0.2492 0.1546 0.1626 0.0290  0.0451  0.0119  101  LEU A CD2   
1207 N  N     . LEU C 102 ? 0.1690 0.1324 0.1107 0.0003  -0.0003 -0.0113 102  LEU A N     
1208 C  CA    . LEU C 102 ? 0.1503 0.1409 0.1343 -0.0008 0.0217  -0.0042 102  LEU A CA    
1209 C  C     . LEU C 102 ? 0.1680 0.1571 0.1288 -0.0173 0.0218  -0.0212 102  LEU A C     
1210 O  O     . LEU C 102 ? 0.1740 0.1621 0.1277 -0.0077 0.0100  -0.0118 102  LEU A O     
1211 C  CB    . LEU C 102 ? 0.1645 0.1390 0.1356 -0.0011 0.0044  -0.0069 102  LEU A CB    
1212 C  CG    . LEU C 102 ? 0.2089 0.1155 0.1419 0.0062  -0.0058 -0.0159 102  LEU A CG    
1213 C  CD1   . LEU C 102 ? 0.2184 0.1448 0.1484 0.0239  0.0195  -0.0136 102  LEU A CD1   
1214 C  CD2   . LEU C 102 ? 0.2003 0.1556 0.1582 -0.0032 0.0015  0.0124  102  LEU A CD2   
1215 N  N     . TYR C 103 ? 0.1555 0.1377 0.1496 -0.0173 0.0284  -0.0183 103  TYR A N     
1216 C  CA    . TYR C 103 ? 0.1649 0.1540 0.1448 -0.0296 0.0091  -0.0028 103  TYR A CA    
1217 C  C     . TYR C 103 ? 0.1704 0.1785 0.1348 -0.0084 0.0118  -0.0367 103  TYR A C     
1218 O  O     . TYR C 103 ? 0.1995 0.1724 0.1522 -0.0082 0.0137  -0.0422 103  TYR A O     
1219 C  CB    . TYR C 103 ? 0.2397 0.1601 0.1497 -0.0291 0.0710  -0.0059 103  TYR A CB    
1220 C  CG    . TYR C 103 ? 0.2190 0.1563 0.1619 -0.0440 0.0400  0.0075  103  TYR A CG    
1221 C  CD1   . TYR C 103 ? 0.2180 0.1593 0.2012 -0.0391 0.0385  -0.0095 103  TYR A CD1   
1222 C  CD2   . TYR C 103 ? 0.2030 0.1837 0.2075 -0.0413 0.0461  -0.0111 103  TYR A CD2   
1223 C  CE1   . TYR C 103 ? 0.2851 0.1612 0.1385 -0.0174 0.0235  0.0025  103  TYR A CE1   
1224 C  CE2   . TYR C 103 ? 0.2090 0.1868 0.1846 -0.0286 0.0554  -0.0005 103  TYR A CE2   
1225 C  CZ    . TYR C 103 ? 0.2804 0.1729 0.1489 -0.0083 0.0263  0.0039  103  TYR A CZ    
1226 O  OH    . TYR C 103 ? 0.2653 0.1749 0.2308 -0.0038 0.0638  0.0190  103  TYR A OH    
1227 N  N     . SER C 104 ? 0.1350 0.1901 0.1805 -0.0319 0.0243  -0.0432 104  SER A N     
1228 C  CA    . SER C 104 ? 0.1548 0.1729 0.1758 -0.0225 0.0449  -0.0285 104  SER A CA    
1229 C  C     . SER C 104 ? 0.1666 0.1799 0.1427 -0.0423 0.0085  -0.0283 104  SER A C     
1230 O  O     . SER C 104 ? 0.1695 0.2222 0.1760 -0.0047 0.0038  -0.0316 104  SER A O     
1231 C  CB    . SER C 104 ? 0.1842 0.1999 0.1671 -0.0130 0.0520  -0.0175 104  SER A CB    
1232 O  OG    . SER C 104 ? 0.2179 0.2007 0.1826 -0.0341 0.0287  -0.0143 104  SER A OG    
1233 N  N     . ALA C 105 ? 0.1759 0.1746 0.1385 -0.0425 0.0214  -0.0220 105  ALA A N     
1234 C  CA    . ALA C 105 ? 0.1621 0.1899 0.1295 -0.0372 0.0039  -0.0052 105  ALA A CA    
1235 C  C     . ALA C 105 ? 0.1785 0.1835 0.1414 -0.0070 -0.0064 -0.0316 105  ALA A C     
1236 O  O     . ALA C 105 ? 0.1925 0.1962 0.1546 -0.0124 0.0011  -0.0411 105  ALA A O     
1237 C  CB    . ALA C 105 ? 0.1717 0.1628 0.1531 -0.0469 0.0216  -0.0409 105  ALA A CB    
1238 N  N     . SER C 106 ? 0.1483 0.2087 0.1562 -0.0117 -0.0065 -0.0096 106  SER A N     
1239 C  CA    . SER C 106 ? 0.1482 0.2149 0.1533 -0.0259 -0.0037 -0.0068 106  SER A CA    
1240 C  C     . SER C 106 ? 0.1805 0.2199 0.1416 -0.0433 -0.0211 -0.0147 106  SER A C     
1241 O  O     . SER C 106 ? 0.2916 0.2769 0.1348 -0.0803 -0.0341 -0.0043 106  SER A O     
1242 C  CB    . SER C 106 ? 0.1525 0.2691 0.1634 -0.0133 -0.0108 -0.0458 106  SER A CB    
1243 O  OG    . SER C 106 ? 0.1784 0.2550 0.1756 0.0127  -0.0066 -0.0271 106  SER A OG    
1244 N  N     . ASP C 107 ? 0.1256 0.2019 0.1636 -0.0232 0.0078  -0.0370 107  ASP A N     
1245 C  CA    . ASP C 107 ? 0.1532 0.1629 0.1593 0.0052  -0.0032 -0.0315 107  ASP A CA    
1246 C  C     . ASP C 107 ? 0.1446 0.1683 0.1255 -0.0228 0.0038  -0.0114 107  ASP A C     
1247 O  O     . ASP C 107 ? 0.1609 0.1981 0.1287 -0.0166 0.0005  -0.0323 107  ASP A O     
1248 C  CB    A ASP C 107 ? 0.1962 0.2023 0.2565 0.0234  -0.0493 -0.1048 107  ASP A CB    
1249 C  CB    B ASP C 107 ? 0.2825 0.1693 0.2212 0.0766  -0.0494 -0.0552 107  ASP A CB    
1250 C  CG    A ASP C 107 ? 0.2725 0.1654 0.3320 0.0136  -0.1181 -0.0987 107  ASP A CG    
1251 C  CG    B ASP C 107 ? 0.2723 0.1681 0.2144 0.0628  -0.0868 -0.1684 107  ASP A CG    
1252 O  OD1   A ASP C 107 ? 0.2127 0.1676 0.3915 -0.0048 -0.0849 -0.0130 107  ASP A OD1   
1253 O  OD1   B ASP C 107 ? 0.3026 0.2053 0.2220 0.0327  -0.0793 -0.0419 107  ASP A OD1   
1254 O  OD2   A ASP C 107 ? 0.4855 0.2134 0.4030 0.1219  -0.1771 -0.1283 107  ASP A OD2   
1255 O  OD2   B ASP C 107 ? 0.2667 0.2073 0.2236 0.0625  -0.0772 -0.1165 107  ASP A OD2   
1256 N  N     . ILE C 108 ? 0.1589 0.1706 0.1548 -0.0043 -0.0055 -0.0454 108  ILE A N     
1257 C  CA    . ILE C 108 ? 0.1586 0.1764 0.1214 -0.0039 -0.0013 -0.0218 108  ILE A CA    
1258 C  C     . ILE C 108 ? 0.1535 0.1920 0.1170 0.0098  -0.0242 -0.0144 108  ILE A C     
1259 O  O     . ILE C 108 ? 0.1787 0.2190 0.1267 -0.0049 -0.0281 -0.0249 108  ILE A O     
1260 C  CB    . ILE C 108 ? 0.1525 0.1835 0.1506 0.0018  -0.0065 -0.0090 108  ILE A CB    
1261 C  CG1   . ILE C 108 ? 0.1937 0.1574 0.1449 -0.0091 0.0216  -0.0310 108  ILE A CG1   
1262 C  CG2   . ILE C 108 ? 0.1546 0.1931 0.1555 0.0058  0.0007  -0.0236 108  ILE A CG2   
1263 C  CD1   . ILE C 108 ? 0.1687 0.1543 0.1521 0.0090  0.0045  -0.0285 108  ILE A CD1   
1264 N  N     . GLU C 109 ? 0.1602 0.2091 0.1221 -0.0022 0.0093  -0.0374 109  GLU A N     
1265 C  CA    . GLU C 109 ? 0.1514 0.3031 0.1179 0.0217  -0.0041 0.0005  109  GLU A CA    
1266 C  C     . GLU C 109 ? 0.1767 0.1863 0.1012 -0.0362 -0.0005 -0.0343 109  GLU A C     
1267 O  O     . GLU C 109 ? 0.1634 0.2292 0.1145 -0.0054 -0.0081 -0.0605 109  GLU A O     
1268 C  CB    . GLU C 109 ? 0.2498 0.2991 0.2183 0.0403  -0.0073 0.0408  109  GLU A CB    
1269 C  CG    . GLU C 109 ? 0.2734 0.2829 0.1979 -0.0402 0.0072  0.0757  109  GLU A CG    
1270 C  CD    . GLU C 109 ? 0.3585 0.2686 0.2602 -0.0174 -0.1279 -0.0171 109  GLU A CD    
1271 O  OE1   . GLU C 109 ? 0.4301 0.2314 0.3483 0.0200  -0.0727 0.0768  109  GLU A OE1   
1272 O  OE2   . GLU C 109 ? 0.2876 0.2887 0.3570 -0.0138 -0.1086 0.0402  109  GLU A OE2   
1273 N  N     . MET C 110 ? 0.1538 0.1738 0.0990 0.0284  -0.0051 -0.0024 110  MET A N     
1274 C  CA    . MET C 110 ? 0.1744 0.1469 0.0965 0.0112  0.0017  -0.0052 110  MET A CA    
1275 C  C     . MET C 110 ? 0.2106 0.1613 0.1014 -0.0030 -0.0156 0.0050  110  MET A C     
1276 O  O     . MET C 110 ? 0.2586 0.1982 0.1231 -0.0003 -0.0453 0.0238  110  MET A O     
1277 C  CB    . MET C 110 ? 0.1784 0.1858 0.1046 0.0335  0.0047  -0.0325 110  MET A CB    
1278 C  CG    . MET C 110 ? 0.1704 0.1737 0.1021 0.0077  0.0062  -0.0003 110  MET A CG    
1279 S  SD    . MET C 110 ? 0.1865 0.1659 0.1171 0.0126  0.0004  -0.0084 110  MET A SD    
1280 C  CE    . MET C 110 ? 0.1909 0.1455 0.1434 0.0212  -0.0008 -0.0075 110  MET A CE    
1281 N  N     . LEU C 111 ? 0.1642 0.1547 0.1139 0.0081  0.0043  0.0004  111  LEU A N     
1282 C  CA    . LEU C 111 ? 0.1766 0.1628 0.1094 -0.0058 0.0110  -0.0079 111  LEU A CA    
1283 C  C     . LEU C 111 ? 0.1698 0.1672 0.0984 0.0214  0.0080  0.0172  111  LEU A C     
1284 O  O     . LEU C 111 ? 0.1909 0.2000 0.1169 0.0326  -0.0068 0.0353  111  LEU A O     
1285 C  CB    . LEU C 111 ? 0.1757 0.1656 0.1101 0.0049  0.0128  -0.0109 111  LEU A CB    
1286 C  CG    . LEU C 111 ? 0.1990 0.1831 0.1398 0.0119  0.0306  -0.0225 111  LEU A CG    
1287 C  CD1   . LEU C 111 ? 0.2547 0.1835 0.1628 0.0132  0.0479  -0.0392 111  LEU A CD1   
1288 C  CD2   . LEU C 111 ? 0.1663 0.2235 0.2420 -0.0006 0.0064  -0.0302 111  LEU A CD2   
1289 N  N     . ARG C 112 ? 0.2075 0.1563 0.1065 0.0367  0.0179  0.0262  112  ARG A N     
1290 C  CA    . ARG C 112 ? 0.2169 0.1923 0.0863 0.0257  0.0297  0.0218  112  ARG A CA    
1291 C  C     . ARG C 112 ? 0.1819 0.1831 0.1180 0.0478  0.0077  0.0205  112  ARG A C     
1292 O  O     . ARG C 112 ? 0.1969 0.1771 0.1274 0.0527  0.0077  0.0185  112  ARG A O     
1293 C  CB    . ARG C 112 ? 0.2663 0.2387 0.0945 -0.0154 0.0016  0.0399  112  ARG A CB    
1294 C  CG    . ARG C 112 ? 0.3383 0.3178 0.1170 -0.0175 0.0281  -0.0470 112  ARG A CG    
1295 C  CD    . ARG C 112 ? 0.3952 0.2287 0.2759 -0.0010 0.0709  -0.0056 112  ARG A CD    
1296 N  NE    . ARG C 112 ? 0.3575 0.3170 0.2347 -0.0152 0.1002  -0.0585 112  ARG A NE    
1297 C  CZ    . ARG C 112 ? 0.3123 0.2292 0.2442 -0.0093 0.1063  -0.0526 112  ARG A CZ    
1298 N  NH1   . ARG C 112 ? 0.3239 0.2050 0.2481 -0.0209 0.0982  -0.0161 112  ARG A NH1   
1299 N  NH2   . ARG C 112 ? 0.2879 0.2954 0.2766 -0.0131 0.1361  -0.0464 112  ARG A NH2   
1300 N  N     . PRO C 113 ? 0.2022 0.1773 0.1327 0.0319  0.0366  0.0256  113  PRO A N     
1301 C  CA    . PRO C 113 ? 0.2088 0.1583 0.1813 0.0227  0.0263  0.0313  113  PRO A CA    
1302 C  C     . PRO C 113 ? 0.1954 0.1865 0.1193 0.0373  0.0116  0.0173  113  PRO A C     
1303 O  O     . PRO C 113 ? 0.2125 0.2033 0.1170 0.0414  0.0208  0.0134  113  PRO A O     
1304 C  CB    . PRO C 113 ? 0.1958 0.2152 0.2123 0.0375  0.0322  0.0050  113  PRO A CB    
1305 C  CG    . PRO C 113 ? 0.1997 0.1950 0.2450 0.0286  0.0208  0.0118  113  PRO A CG    
1306 C  CD    . PRO C 113 ? 0.1829 0.2296 0.1524 0.0459  0.0278  0.0066  113  PRO A CD    
1307 N  N     . GLU C 114 ? 0.2319 0.1869 0.1155 0.0377  0.0138  0.0221  114  GLU A N     
1308 C  CA    . GLU C 114 ? 0.2541 0.2153 0.1451 0.0579  0.0213  0.0611  114  GLU A CA    
1309 C  C     . GLU C 114 ? 0.2240 0.1704 0.1747 0.0364  0.0030  0.0098  114  GLU A C     
1310 O  O     . GLU C 114 ? 0.2441 0.1872 0.2183 0.0511  0.0153  0.0128  114  GLU A O     
1311 C  CB    . GLU C 114 ? 0.3507 0.2515 0.1454 0.0666  -0.0145 0.0574  114  GLU A CB    
1312 C  CG    . GLU C 114 ? 0.4917 0.3423 0.2909 0.1924  -0.1738 -0.0642 114  GLU A CG    
1313 C  CD    . GLU C 114 ? 0.4671 0.4145 0.3488 0.1741  -0.0987 -0.1211 114  GLU A CD    
1314 O  OE1   . GLU C 114 ? 0.3480 0.2729 0.1259 0.0742  0.0631  0.0348  114  GLU A OE1   
1315 O  OE2   . GLU C 114 ? 0.4013 0.3232 0.2459 0.0873  -0.0019 -0.0253 114  GLU A OE2   
1316 N  N     . GLN C 115 ? 0.2450 0.1873 0.1083 0.0170  -0.0108 0.0078  115  GLN A N     
1317 C  CA    . GLN C 115 ? 0.2205 0.1620 0.1390 0.0145  -0.0262 -0.0117 115  GLN A CA    
1318 C  C     . GLN C 115 ? 0.1972 0.1714 0.1336 0.0162  -0.0061 0.0013  115  GLN A C     
1319 O  O     . GLN C 115 ? 0.2049 0.1936 0.1673 0.0072  0.0088  -0.0199 115  GLN A O     
1320 C  CB    . GLN C 115 ? 0.2506 0.1786 0.1767 -0.0008 -0.0626 -0.0016 115  GLN A CB    
1321 C  CG    . GLN C 115 ? 0.2888 0.2028 0.2268 0.0501  -0.1330 -0.0451 115  GLN A CG    
1322 C  CD    . GLN C 115 ? 0.2051 0.2196 0.2473 0.0445  -0.1128 -0.0504 115  GLN A CD    
1323 O  OE1   . GLN C 115 ? 0.2421 0.1921 0.1622 0.0342  -0.0271 0.0022  115  GLN A OE1   
1324 N  NE2   . GLN C 115 ? 0.2102 0.3088 0.2850 0.0351  -0.0788 0.0195  115  GLN A NE2   
1325 N  N     . LEU C 116 ? 0.2066 0.1750 0.1119 0.0475  -0.0111 -0.0030 116  LEU A N     
1326 C  CA    . LEU C 116 ? 0.2100 0.1743 0.1070 0.0199  0.0098  -0.0043 116  LEU A CA    
1327 C  C     . LEU C 116 ? 0.2314 0.1754 0.1092 0.0219  -0.0010 -0.0069 116  LEU A C     
1328 O  O     . LEU C 116 ? 0.3080 0.1855 0.1249 0.0249  0.0030  -0.0255 116  LEU A O     
1329 C  CB    . LEU C 116 ? 0.2196 0.1570 0.1436 0.0037  -0.0216 -0.0016 116  LEU A CB    
1330 C  CG    . LEU C 116 ? 0.1922 0.1647 0.1479 0.0050  0.0211  -0.0030 116  LEU A CG    
1331 C  CD1   . LEU C 116 ? 0.2016 0.2256 0.1722 0.0095  -0.0135 0.0314  116  LEU A CD1   
1332 C  CD2   . LEU C 116 ? 0.2683 0.1734 0.2184 0.0071  0.0663  0.0288  116  LEU A CD2   
1333 N  N     . THR C 117 ? 0.1873 0.1759 0.1354 0.0125  -0.0056 0.0092  117  THR A N     
1334 C  CA    . THR C 117 ? 0.1787 0.1712 0.1478 0.0026  -0.0036 0.0019  117  THR A CA    
1335 C  C     . THR C 117 ? 0.1853 0.1549 0.1171 0.0024  0.0018  -0.0084 117  THR A C     
1336 O  O     . THR C 117 ? 0.2318 0.2303 0.1515 0.0623  -0.0123 -0.0338 117  THR A O     
1337 C  CB    . THR C 117 ? 0.1947 0.1912 0.1642 -0.0155 0.0046  0.0004  117  THR A CB    
1338 O  OG1   . THR C 117 ? 0.3603 0.2663 0.1838 -0.0398 0.0728  0.0065  117  THR A OG1   
1339 C  CG2   . THR C 117 ? 0.1901 0.2509 0.3277 -0.0140 -0.0507 0.0040  117  THR A CG2   
1340 N  N     . THR C 118 ? 0.2226 0.1636 0.1017 -0.0072 -0.0080 0.0064  118  THR A N     
1341 C  CA    . THR C 118 ? 0.2057 0.1895 0.0995 -0.0075 0.0009  0.0070  118  THR A CA    
1342 C  C     . THR C 118 ? 0.2013 0.1638 0.1068 0.0115  0.0107  0.0071  118  THR A C     
1343 O  O     . THR C 118 ? 0.2023 0.1875 0.1024 0.0082  -0.0006 -0.0147 118  THR A O     
1344 C  CB    . THR C 118 ? 0.2046 0.1780 0.1047 0.0005  0.0069  0.0040  118  THR A CB    
1345 O  OG1   . THR C 118 ? 0.1987 0.1776 0.1024 0.0180  -0.0089 0.0139  118  THR A OG1   
1346 C  CG2   . THR C 118 ? 0.2026 0.1991 0.1236 -0.0099 0.0089  0.0103  118  THR A CG2   
1347 N  N     . HIS C 119 ? 0.2093 0.1456 0.0803 0.0051  0.0268  -0.0180 119  HIS A N     
1348 C  CA    . HIS C 119 ? 0.1883 0.1612 0.1002 0.0110  0.0189  -0.0011 119  HIS A CA    
1349 C  C     . HIS C 119 ? 0.1777 0.1526 0.0782 0.0038  0.0021  -0.0037 119  HIS A C     
1350 O  O     . HIS C 119 ? 0.2142 0.1941 0.0991 -0.0034 0.0065  -0.0270 119  HIS A O     
1351 C  CB    . HIS C 119 ? 0.2007 0.1574 0.1284 0.0097  0.0150  0.0155  119  HIS A CB    
1352 C  CG    . HIS C 119 ? 0.1927 0.1590 0.1440 0.0229  0.0313  0.0083  119  HIS A CG    
1353 N  ND1   . HIS C 119 ? 0.2535 0.1960 0.1124 0.0070  0.0335  0.0004  119  HIS A ND1   
1354 C  CD2   . HIS C 119 ? 0.2065 0.1560 0.1588 0.0150  0.0432  0.0090  119  HIS A CD2   
1355 C  CE1   . HIS C 119 ? 0.2143 0.1799 0.1378 0.0193  0.0349  0.0079  119  HIS A CE1   
1356 N  NE2   . HIS C 119 ? 0.1990 0.1878 0.1434 0.0138  0.0390  0.0113  119  HIS A NE2   
1357 N  N     . PRO C 120 ? 0.1802 0.1599 0.1119 0.0186  -0.0014 0.0002  120  PRO A N     
1358 C  CA    . PRO C 120 ? 0.1780 0.2464 0.1036 0.0369  0.0149  0.0149  120  PRO A CA    
1359 C  C     . PRO C 120 ? 0.2186 0.2148 0.0931 0.0257  0.0092  0.0043  120  PRO A C     
1360 O  O     . PRO C 120 ? 0.3397 0.1993 0.1220 0.0672  0.0481  0.0198  120  PRO A O     
1361 C  CB    . PRO C 120 ? 0.1791 0.3273 0.1445 0.0317  -0.0252 -0.0070 120  PRO A CB    
1362 C  CG    . PRO C 120 ? 0.1770 0.3127 0.1635 0.0168  -0.0063 -0.0121 120  PRO A CG    
1363 C  CD    . PRO C 120 ? 0.1718 0.2311 0.1354 -0.0116 -0.0279 -0.0039 120  PRO A CD    
1364 N  N     . PHE C 121 ? 0.2116 0.1912 0.0832 0.0108  0.0240  -0.0064 121  PHE A N     
1365 C  CA    . PHE C 121 ? 0.1844 0.1999 0.0935 0.0115  0.0022  0.0225  121  PHE A CA    
1366 C  C     . PHE C 121 ? 0.1821 0.1552 0.0959 0.0251  0.0178  0.0048  121  PHE A C     
1367 O  O     . PHE C 121 ? 0.2285 0.1715 0.0987 0.0271  0.0167  -0.0092 121  PHE A O     
1368 C  CB    . PHE C 121 ? 0.2400 0.1733 0.1012 0.0020  0.0306  0.0048  121  PHE A CB    
1369 C  CG    . PHE C 121 ? 0.2865 0.1715 0.0999 -0.0027 0.0373  0.0053  121  PHE A CG    
1370 C  CD1   . PHE C 121 ? 0.2785 0.3083 0.1333 -0.0268 0.0616  -0.0359 121  PHE A CD1   
1371 C  CD2   . PHE C 121 ? 0.4008 0.1959 0.1187 0.1160  -0.0207 -0.0184 121  PHE A CD2   
1372 C  CE1   . PHE C 121 ? 0.3415 0.3622 0.1317 -0.0127 0.0746  -0.0316 121  PHE A CE1   
1373 C  CE2   . PHE C 121 ? 0.4975 0.1747 0.1181 0.1420  -0.0227 -0.0098 121  PHE A CE2   
1374 C  CZ    . PHE C 121 ? 0.4726 0.2256 0.1235 0.0524  0.0341  0.0023  121  PHE A CZ    
1375 N  N     . LEU C 122 ? 0.1714 0.1879 0.0933 0.0327  0.0016  -0.0100 122  LEU A N     
1376 C  CA    . LEU C 122 ? 0.1673 0.1734 0.1163 0.0434  0.0026  0.0169  122  LEU A CA    
1377 C  C     . LEU C 122 ? 0.1964 0.1600 0.0799 0.0430  0.0084  -0.0022 122  LEU A C     
1378 O  O     . LEU C 122 ? 0.2485 0.1842 0.1085 0.0384  -0.0316 -0.0082 122  LEU A O     
1379 C  CB    . LEU C 122 ? 0.1777 0.1505 0.1104 0.0404  -0.0034 -0.0057 122  LEU A CB    
1380 C  CG    . LEU C 122 ? 0.1855 0.1548 0.1025 0.0333  0.0000  0.0209  122  LEU A CG    
1381 C  CD1   . LEU C 122 ? 0.1958 0.1570 0.1501 0.0483  0.0114  0.0123  122  LEU A CD1   
1382 C  CD2   . LEU C 122 ? 0.2374 0.1587 0.1112 0.0307  -0.0166 0.0018  122  LEU A CD2   
1383 N  N     . GLN C 123 ? 0.2151 0.1702 0.0796 0.0232  0.0018  0.0171  123  GLN A N     
1384 C  CA    . GLN C 123 ? 0.2436 0.1667 0.0801 0.0420  0.0110  0.0076  123  GLN A CA    
1385 C  C     . GLN C 123 ? 0.2302 0.1843 0.0852 0.0249  0.0034  -0.0140 123  GLN A C     
1386 O  O     . GLN C 123 ? 0.2995 0.1784 0.1597 0.0171  0.0011  -0.0227 123  GLN A O     
1387 C  CB    . GLN C 123 ? 0.2759 0.1683 0.0789 -0.0017 -0.0142 0.0069  123  GLN A CB    
1388 C  CG    . GLN C 123 ? 0.3205 0.1843 0.1305 0.0186  -0.0078 0.0463  123  GLN A CG    
1389 C  CD    . GLN C 123 ? 0.2769 0.1712 0.1850 -0.0034 -0.0708 0.0130  123  GLN A CD    
1392 N  N     . ARG C 124 ? 0.2227 0.2078 0.0812 0.0403  0.0088  -0.0066 124  ARG A N     
1393 C  CA    . ARG C 124 ? 0.2082 0.2378 0.1036 0.0742  -0.0135 -0.0240 124  ARG A CA    
1394 C  C     . ARG C 124 ? 0.2268 0.1974 0.0926 0.0258  -0.0001 -0.0241 124  ARG A C     
1395 O  O     . ARG C 124 ? 0.2411 0.1922 0.1401 0.0311  -0.0061 -0.0445 124  ARG A O     
1396 C  CB    A ARG C 124 ? 0.2041 0.2677 0.1992 0.0993  -0.0409 -0.0499 124  ARG A CB    
1397 C  CB    B ARG C 124 ? 0.2075 0.2391 0.1732 0.0715  -0.0259 -0.0723 124  ARG A CB    
1398 C  CG    A ARG C 124 ? 0.1962 0.3386 0.1855 0.0319  -0.0465 0.0161  124  ARG A CG    
1399 C  CG    B ARG C 124 ? 0.2120 0.3205 0.2447 0.0589  0.0214  -0.0795 124  ARG A CG    
1400 C  CD    A ARG C 124 ? 0.1944 0.4902 0.3199 0.0098  -0.0431 -0.0078 124  ARG A CD    
1401 C  CD    B ARG C 124 ? 0.1998 0.5202 0.3159 0.0261  -0.0187 0.0285  124  ARG A CD    
1402 N  NE    A ARG C 124 ? 0.1701 0.6471 0.3181 -0.0006 -0.0163 -0.0283 124  ARG A NE    
1403 N  NE    B ARG C 124 ? 0.2041 0.6505 0.3015 0.0423  0.0449  0.0483  124  ARG A NE    
1404 C  CZ    A ARG C 124 ? 0.2332 0.6326 0.3818 -0.0184 0.0650  -0.0873 124  ARG A CZ    
1405 C  CZ    B ARG C 124 ? 0.2363 0.6753 0.2698 -0.0907 -0.0122 0.0120  124  ARG A CZ    
1406 N  NH1   A ARG C 124 ? 0.3706 0.5877 0.4424 -0.0209 0.1669  -0.0921 124  ARG A NH1   
1407 N  NH1   B ARG C 124 ? 0.3852 0.6924 0.3134 -0.0548 0.1277  0.1089  124  ARG A NH1   
1408 N  NH2   A ARG C 124 ? 0.2041 0.5618 0.2803 -0.0126 -0.0812 -0.0584 124  ARG A NH2   
1409 N  NH2   B ARG C 124 ? 0.3702 0.4837 0.1915 -0.2153 -0.0227 -0.0729 124  ARG A NH2   
1410 N  N     . VAL C 125 ? 0.2159 0.1861 0.0812 0.0088  -0.0069 -0.0055 125  VAL A N     
1411 C  CA    . VAL C 125 ? 0.2373 0.2108 0.0805 -0.0352 -0.0123 -0.0049 125  VAL A CA    
1412 C  C     . VAL C 125 ? 0.1858 0.2206 0.0837 -0.0263 0.0114  -0.0146 125  VAL A C     
1413 O  O     . VAL C 125 ? 0.2389 0.2316 0.0950 -0.0467 0.0247  -0.0087 125  VAL A O     
1414 C  CB    A VAL C 125 ? 0.2416 0.2043 0.1185 -0.0498 -0.0135 0.0586  125  VAL A CB    
1415 C  CB    B VAL C 125 ? 0.2428 0.2212 0.1020 -0.0644 -0.0013 0.0655  125  VAL A CB    
1416 C  CG1   A VAL C 125 ? 0.2622 0.2059 0.0485 -0.0220 0.0277  0.0113  125  VAL A CG1   
1417 C  CG1   B VAL C 125 ? 0.2506 0.2347 0.1480 -0.0786 0.0395  0.0159  125  VAL A CG1   
1418 C  CG2   A VAL C 125 ? 0.2438 0.2007 0.0985 -0.0700 0.0335  0.0310  125  VAL A CG2   
1419 C  CG2   B VAL C 125 ? 0.2128 0.1730 0.2120 -0.0589 0.0019  0.0395  125  VAL A CG2   
1420 N  N     . GLY C 126 ? 0.1829 0.2100 0.0776 -0.0269 -0.0088 -0.0115 126  GLY A N     
1421 C  CA    . GLY C 126 ? 0.1580 0.1972 0.0969 -0.0109 -0.0084 -0.0104 126  GLY A CA    
1422 C  C     . GLY C 126 ? 0.1639 0.1572 0.0875 -0.0184 0.0029  0.0029  126  GLY A C     
1423 O  O     . GLY C 126 ? 0.2064 0.1456 0.1242 -0.0227 0.0102  -0.0019 126  GLY A O     
1424 N  N     . PRO C 127 ? 0.1703 0.1621 0.0819 -0.0008 -0.0097 -0.0140 127  PRO A N     
1425 C  CA    . PRO C 127 ? 0.1777 0.1491 0.1095 -0.0117 -0.0133 0.0177  127  PRO A CA    
1426 C  C     . PRO C 127 ? 0.1648 0.1433 0.0863 -0.0029 0.0089  -0.0038 127  PRO A C     
1427 O  O     . PRO C 127 ? 0.1676 0.1570 0.1047 -0.0032 0.0087  -0.0076 127  PRO A O     
1428 C  CB    . PRO C 127 ? 0.2477 0.1800 0.1546 -0.0726 -0.0806 0.0250  127  PRO A CB    
1429 C  CG    . PRO C 127 ? 0.2353 0.1542 0.2589 0.0196  -0.0861 -0.0311 127  PRO A CG    
1430 C  CD    . PRO C 127 ? 0.2123 0.1609 0.1366 0.0219  -0.0317 -0.0268 127  PRO A CD    
1431 N  N     . ASP C 128 ? 0.1626 0.1475 0.0975 -0.0040 0.0035  0.0138  128  ASP A N     
1432 C  CA    . ASP C 128 ? 0.1812 0.1422 0.0782 0.0075  0.0185  -0.0044 128  ASP A CA    
1433 C  C     . ASP C 128 ? 0.1636 0.1404 0.0888 -0.0005 0.0112  -0.0002 128  ASP A C     
1434 O  O     . ASP C 128 ? 0.1741 0.1371 0.1107 -0.0063 0.0047  -0.0041 128  ASP A O     
1435 C  CB    . ASP C 128 ? 0.1656 0.1469 0.1355 0.0061  0.0190  -0.0203 128  ASP A CB    
1436 C  CG    . ASP C 128 ? 0.2080 0.1521 0.1104 0.0184  -0.0061 -0.0110 128  ASP A CG    
1437 O  OD1   . ASP C 128 ? 0.2018 0.1598 0.1154 -0.0041 -0.0008 -0.0272 128  ASP A OD1   
1438 O  OD2   . ASP C 128 ? 0.1799 0.1626 0.1293 -0.0008 0.0071  -0.0328 128  ASP A OD2   
1439 N  N     . VAL C 129 ? 0.1900 0.1187 0.0813 0.0046  0.0279  -0.0015 129  VAL A N     
1440 C  CA    . VAL C 129 ? 0.1620 0.1589 0.0919 0.0135  0.0199  -0.0063 129  VAL A CA    
1441 C  C     . VAL C 129 ? 0.1534 0.1473 0.1213 -0.0036 0.0043  -0.0151 129  VAL A C     
1442 O  O     . VAL C 129 ? 0.1976 0.1739 0.1087 -0.0021 -0.0085 -0.0212 129  VAL A O     
1443 C  CB    . VAL C 129 ? 0.1523 0.1719 0.0998 0.0023  0.0218  -0.0069 129  VAL A CB    
1444 C  CG1   . VAL C 129 ? 0.1619 0.2174 0.1120 0.0201  0.0094  0.0079  129  VAL A CG1   
1445 C  CG2   . VAL C 129 ? 0.2053 0.1836 0.0981 -0.0233 0.0048  -0.0074 129  VAL A CG2   
1446 N  N     . LEU C 130 ? 0.1524 0.1431 0.1393 0.0037  -0.0107 -0.0242 130  LEU A N     
1447 C  CA    . LEU C 130 ? 0.1527 0.1479 0.1398 -0.0017 -0.0076 0.0096  130  LEU A CA    
1448 C  C     . LEU C 130 ? 0.1578 0.1809 0.1485 0.0089  0.0148  0.0052  130  LEU A C     
1449 O  O     . LEU C 130 ? 0.1585 0.2604 0.2343 0.0269  0.0192  0.0533  130  LEU A O     
1450 C  CB    . LEU C 130 ? 0.1811 0.1464 0.1220 0.0127  0.0100  -0.0102 130  LEU A CB    
1451 C  CG    . LEU C 130 ? 0.2067 0.1333 0.1004 -0.0050 0.0123  -0.0108 130  LEU A CG    
1452 C  CD1   . LEU C 130 ? 0.2770 0.1434 0.1331 -0.0187 0.0216  -0.0285 130  LEU A CD1   
1453 C  CD2   . LEU C 130 ? 0.2508 0.1679 0.1019 0.0067  0.0136  -0.0257 130  LEU A CD2   
1454 N  N     . ASP C 131 ? 0.1680 0.1902 0.1244 0.0056  0.0199  0.0054  131  ASP A N     
1455 C  CA    . ASP C 131 ? 0.1685 0.2285 0.1282 -0.0163 0.0146  -0.0021 131  ASP A CA    
1456 C  C     . ASP C 131 ? 0.1394 0.2310 0.1425 0.0100  0.0145  -0.0207 131  ASP A C     
1457 O  O     . ASP C 131 ? 0.1781 0.2383 0.1693 0.0089  0.0313  -0.0309 131  ASP A O     
1458 C  CB    . ASP C 131 ? 0.1784 0.2189 0.1234 -0.0204 0.0240  -0.0010 131  ASP A CB    
1459 C  CG    . ASP C 131 ? 0.1754 0.2418 0.1549 -0.0139 0.0372  0.0095  131  ASP A CG    
1460 O  OD1   . ASP C 131 ? 0.1814 0.2017 0.1980 -0.0120 0.0178  -0.0099 131  ASP A OD1   
1461 O  OD2   . ASP C 131 ? 0.1988 0.3456 0.1713 -0.0569 0.0191  0.0520  131  ASP A OD2   
1462 N  N     . PRO C 132 ? 0.1502 0.2732 0.1825 0.0049  -0.0014 0.0082  132  PRO A N     
1463 C  CA    . PRO C 132 ? 0.1916 0.3418 0.2057 0.0208  -0.0639 0.0109  132  PRO A CA    
1464 C  C     . PRO C 132 ? 0.1982 0.3248 0.2117 -0.0252 -0.0204 -0.0552 132  PRO A C     
1465 O  O     . PRO C 132 ? 0.2414 0.4296 0.2662 -0.0642 -0.0045 -0.1348 132  PRO A O     
1466 C  CB    . PRO C 132 ? 0.1656 0.4631 0.2400 0.0421  -0.0301 0.0507  132  PRO A CB    
1467 C  CG    . PRO C 132 ? 0.1903 0.3976 0.3686 0.0665  -0.0778 -0.0301 132  PRO A CG    
1468 C  CD    . PRO C 132 ? 0.1559 0.2792 0.3817 0.0428  -0.0321 -0.0089 132  PRO A CD    
1469 N  N     . ASN C 133 ? 0.1652 0.2884 0.2194 -0.0221 0.0258  -0.0370 133  ASN A N     
1470 C  CA    . ASN C 133 ? 0.2120 0.2868 0.2753 -0.0386 0.0758  -0.0556 133  ASN A CA    
1471 C  C     . ASN C 133 ? 0.2146 0.2366 0.2350 -0.0602 0.0608  -0.0497 133  ASN A C     
1472 O  O     . ASN C 133 ? 0.2845 0.2352 0.2964 -0.0762 0.0877  -0.0566 133  ASN A O     
1473 C  CB    . ASN C 133 ? 0.3278 0.2984 0.3294 -0.0887 0.1950  -0.0461 133  ASN A CB    
1474 C  CG    . ASN C 133 ? 0.3103 0.4853 0.5014 -0.1207 0.2404  -0.1487 133  ASN A CG    
1475 O  OD1   . ASN C 133 ? 0.3052 0.5264 0.7183 -0.1065 0.1301  -0.1968 133  ASN A OD1   
1476 N  ND2   . ASN C 133 ? 0.5716 0.8459 0.4968 0.1062  0.3218  -0.1379 133  ASN A ND2   
1477 N  N     . LEU C 134 ? 0.2030 0.2354 0.1785 -0.0366 0.0858  -0.0420 134  LEU A N     
1478 C  CA    . LEU C 134 ? 0.2151 0.1927 0.1471 -0.0319 0.0399  -0.0396 134  LEU A CA    
1479 C  C     . LEU C 134 ? 0.1910 0.1644 0.1347 0.0133  0.0128  -0.0149 134  LEU A C     
1480 O  O     . LEU C 134 ? 0.2151 0.1794 0.1616 -0.0246 0.0266  0.0078  134  LEU A O     
1481 C  CB    . LEU C 134 ? 0.2078 0.1746 0.1498 -0.0163 0.0258  -0.0250 134  LEU A CB    
1482 C  CG    . LEU C 134 ? 0.2115 0.1531 0.1138 -0.0106 0.0220  0.0058  134  LEU A CG    
1483 C  CD1   . LEU C 134 ? 0.3215 0.1539 0.1036 -0.0125 -0.0023 0.0017  134  LEU A CD1   
1484 C  CD2   . LEU C 134 ? 0.2224 0.2036 0.1066 -0.0387 -0.0114 0.0115  134  LEU A CD2   
1485 N  N     . THR C 135 ? 0.1786 0.1636 0.1429 0.0041  0.0079  -0.0248 135  THR A N     
1486 C  CA    . THR C 135 ? 0.1827 0.1706 0.1398 0.0059  -0.0155 -0.0226 135  THR A CA    
1487 C  C     . THR C 135 ? 0.1768 0.1785 0.1048 -0.0059 -0.0102 -0.0186 135  THR A C     
1488 O  O     . THR C 135 ? 0.1785 0.1516 0.1057 -0.0043 -0.0045 -0.0037 135  THR A O     
1489 C  CB    . THR C 135 ? 0.1711 0.2115 0.1690 -0.0099 -0.0197 -0.0199 135  THR A CB    
1490 O  OG1   . THR C 135 ? 0.1708 0.1668 0.1975 -0.0172 -0.0111 -0.0222 135  THR A OG1   
1491 C  CG2   . THR C 135 ? 0.1841 0.2194 0.1741 0.0130  -0.0026 -0.0262 135  THR A CG2   
1492 N  N     . PRO C 136 ? 0.1715 0.2012 0.1083 -0.0155 -0.0191 -0.0099 136  PRO A N     
1493 C  CA    . PRO C 136 ? 0.2032 0.1692 0.1101 -0.0064 0.0077  -0.0080 136  PRO A CA    
1494 C  C     . PRO C 136 ? 0.1807 0.1682 0.0915 -0.0293 0.0076  -0.0197 136  PRO A C     
1495 O  O     . PRO C 136 ? 0.1815 0.1785 0.1079 -0.0173 0.0068  -0.0010 136  PRO A O     
1496 C  CB    . PRO C 136 ? 0.2120 0.2093 0.1112 -0.0123 -0.0086 -0.0003 136  PRO A CB    
1497 C  CG    . PRO C 136 ? 0.2752 0.2698 0.1082 0.0569  -0.0107 -0.0214 136  PRO A CG    
1498 C  CD    . PRO C 136 ? 0.2016 0.2455 0.1111 -0.0001 -0.0281 -0.0021 136  PRO A CD    
1499 N  N     . GLU C 137 ? 0.1844 0.1670 0.1166 -0.0252 -0.0020 -0.0140 137  GLU A N     
1500 C  CA    . GLU C 137 ? 0.2041 0.1623 0.1284 -0.0300 -0.0101 -0.0144 137  GLU A CA    
1501 C  C     . GLU C 137 ? 0.1742 0.1847 0.1153 -0.0085 0.0069  -0.0135 137  GLU A C     
1502 O  O     . GLU C 137 ? 0.1737 0.1795 0.1258 -0.0199 0.0077  0.0001  137  GLU A O     
1503 C  CB    . GLU C 137 ? 0.2371 0.2192 0.2037 -0.0871 -0.0154 -0.0341 137  GLU A CB    
1504 C  CG    . GLU C 137 ? 0.2811 0.2803 0.2804 -0.0298 -0.0914 -0.0988 137  GLU A CG    
1505 C  CD    . GLU C 137 ? 0.5466 0.2989 0.2519 -0.0307 -0.1340 -0.0348 137  GLU A CD    
1506 O  OE1   . GLU C 137 ? 0.2820 0.3020 0.3715 -0.0079 -0.1113 -0.0589 137  GLU A OE1   
1507 O  OE2   . GLU C 137 ? 0.8322 0.4103 0.3037 -0.0641 -0.2601 -0.0425 137  GLU A OE2   
1508 N  N     . VAL C 138 ? 0.1755 0.1728 0.1107 -0.0256 0.0195  -0.0063 138  VAL A N     
1509 C  CA    . VAL C 138 ? 0.1678 0.1532 0.1090 -0.0195 0.0249  -0.0024 138  VAL A CA    
1510 C  C     . VAL C 138 ? 0.1611 0.1411 0.0968 -0.0007 0.0297  -0.0041 138  VAL A C     
1511 O  O     . VAL C 138 ? 0.1758 0.1578 0.1023 -0.0044 0.0149  0.0007  138  VAL A O     
1512 C  CB    . VAL C 138 ? 0.1586 0.1662 0.1225 -0.0123 0.0255  -0.0150 138  VAL A CB    
1513 C  CG1   . VAL C 138 ? 0.1752 0.1960 0.1111 -0.0021 0.0257  -0.0145 138  VAL A CG1   
1514 C  CG2   . VAL C 138 ? 0.1431 0.2445 0.1925 -0.0168 0.0166  0.0132  138  VAL A CG2   
1515 N  N     . VAL C 139 ? 0.1665 0.1554 0.0850 -0.0253 0.0279  -0.0070 139  VAL A N     
1516 C  CA    . VAL C 139 ? 0.1601 0.1242 0.1052 -0.0141 0.0153  0.0080  139  VAL A CA    
1517 C  C     . VAL C 139 ? 0.1571 0.1283 0.0950 -0.0185 -0.0047 0.0145  139  VAL A C     
1518 O  O     . VAL C 139 ? 0.1475 0.1509 0.1011 -0.0107 0.0054  0.0113  139  VAL A O     
1519 C  CB    . VAL C 139 ? 0.1481 0.1330 0.0992 -0.0082 0.0038  0.0125  139  VAL A CB    
1520 C  CG1   . VAL C 139 ? 0.1626 0.1318 0.1040 -0.0186 0.0262  0.0114  139  VAL A CG1   
1521 C  CG2   . VAL C 139 ? 0.1630 0.1344 0.1238 0.0071  0.0020  0.0117  139  VAL A CG2   
1522 N  N     . LYS C 140 ? 0.1796 0.1538 0.0843 -0.0224 0.0261  -0.0178 140  LYS A N     
1523 C  CA    . LYS C 140 ? 0.1915 0.1515 0.1028 -0.0111 0.0227  -0.0068 140  LYS A CA    
1524 C  C     . LYS C 140 ? 0.1792 0.1568 0.0999 -0.0081 0.0218  -0.0186 140  LYS A C     
1525 O  O     . LYS C 140 ? 0.1802 0.1495 0.1230 -0.0121 0.0125  -0.0076 140  LYS A O     
1526 C  CB    . LYS C 140 ? 0.2114 0.1841 0.1141 0.0077  0.0012  -0.0375 140  LYS A CB    
1527 C  CG    A LYS C 140 ? 0.2807 0.2279 0.1211 0.0683  -0.0208 -0.0588 140  LYS A CG    
1528 C  CG    B LYS C 140 ? 0.2376 0.1426 0.1247 -0.0185 -0.0048 -0.0153 140  LYS A CG    
1529 C  CD    A LYS C 140 ? 0.3720 0.1643 0.1270 -0.0035 -0.0232 -0.0296 140  LYS A CD    
1530 C  CD    B LYS C 140 ? 0.3676 0.1946 0.1103 -0.0671 -0.0287 -0.0457 140  LYS A CD    
1531 C  CE    A LYS C 140 ? 0.3004 0.1406 0.0980 -0.0374 -0.0073 -0.0463 140  LYS A CE    
1532 C  CE    B LYS C 140 ? 0.3252 0.1896 0.1236 -0.0499 -0.0609 -0.0286 140  LYS A CE    
1533 N  NZ    A LYS C 140 ? 0.2827 0.1710 0.1403 -0.0424 -0.0276 -0.0549 140  LYS A NZ    
1534 N  NZ    B LYS C 140 ? 0.3050 0.1926 0.1558 -0.0870 -0.0485 -0.0509 140  LYS A NZ    
1535 N  N     . GLU C 141 ? 0.1837 0.1420 0.0889 -0.0056 0.0190  -0.0101 141  GLU A N     
1536 C  CA    . GLU C 141 ? 0.2095 0.1681 0.0879 -0.0158 0.0102  -0.0038 141  GLU A CA    
1537 C  C     . GLU C 141 ? 0.2019 0.1359 0.0884 -0.0030 0.0129  0.0011  141  GLU A C     
1538 O  O     . GLU C 141 ? 0.1993 0.1364 0.1096 -0.0118 0.0049  0.0027  141  GLU A O     
1539 C  CB    . GLU C 141 ? 0.2156 0.1759 0.1203 -0.0407 0.0312  0.0065  141  GLU A CB    
1540 C  CG    . GLU C 141 ? 0.2374 0.1978 0.1613 -0.0361 -0.0133 0.0194  141  GLU A CG    
1541 C  CD    . GLU C 141 ? 0.2318 0.3131 0.2298 -0.0786 -0.0090 -0.0232 141  GLU A CD    
1542 O  OE1   . GLU C 141 ? 0.2801 0.3461 0.2254 -0.0336 0.0428  0.0059  141  GLU A OE1   
1543 O  OE2   . GLU C 141 ? 0.3235 0.4752 0.3012 -0.1729 -0.0692 -0.0355 141  GLU A OE2   
1544 N  N     . ARG C 142 ? 0.1864 0.1373 0.0878 -0.0093 0.0269  -0.0037 142  ARG A N     
1545 C  CA    . ARG C 142 ? 0.1844 0.1283 0.0844 0.0031  0.0191  0.0050  142  ARG A CA    
1546 C  C     . ARG C 142 ? 0.1824 0.1418 0.0730 0.0199  0.0091  0.0046  142  ARG A C     
1547 O  O     . ARG C 142 ? 0.1894 0.1411 0.0797 0.0004  0.0069  0.0070  142  ARG A O     
1548 C  CB    . ARG C 142 ? 0.1799 0.1268 0.1072 0.0006  0.0180  -0.0035 142  ARG A CB    
1549 C  CG    . ARG C 142 ? 0.2258 0.1409 0.1007 0.0033  0.0127  -0.0054 142  ARG A CG    
1550 C  CD    . ARG C 142 ? 0.2806 0.1376 0.1101 0.0105  0.0316  -0.0184 142  ARG A CD    
1551 N  NE    . ARG C 142 ? 0.2157 0.1568 0.0973 0.0227  0.0339  -0.0027 142  ARG A NE    
1552 C  CZ    . ARG C 142 ? 0.1665 0.1559 0.0978 -0.0046 0.0188  0.0004  142  ARG A CZ    
1553 N  NH1   . ARG C 142 ? 0.1899 0.1432 0.1317 -0.0121 0.0200  -0.0011 142  ARG A NH1   
1554 N  NH2   . ARG C 142 ? 0.1914 0.1475 0.1249 0.0105  -0.0148 -0.0143 142  ARG A NH2   
1555 N  N     . LEU C 143 ? 0.1691 0.1415 0.0806 -0.0076 0.0174  0.0031  143  LEU A N     
1556 C  CA    . LEU C 143 ? 0.1699 0.1429 0.0850 0.0050  0.0145  -0.0003 143  LEU A CA    
1557 C  C     . LEU C 143 ? 0.1831 0.1350 0.0836 -0.0030 0.0054  -0.0066 143  LEU A C     
1558 O  O     . LEU C 143 ? 0.1751 0.1499 0.1134 0.0043  0.0131  0.0113  143  LEU A O     
1559 C  CB    . LEU C 143 ? 0.1941 0.1272 0.0814 0.0025  0.0267  -0.0028 143  LEU A CB    
1560 C  CG    . LEU C 143 ? 0.1453 0.1477 0.0996 -0.0032 0.0063  0.0165  143  LEU A CG    
1561 C  CD1   . LEU C 143 ? 0.2084 0.1528 0.0946 -0.0054 -0.0055 -0.0007 143  LEU A CD1   
1562 C  CD2   . LEU C 143 ? 0.1588 0.1711 0.1005 -0.0253 0.0144  -0.0061 143  LEU A CD2   
1563 N  N     . LEU C 144 ? 0.1883 0.1297 0.0959 0.0070  -0.0066 -0.0128 144  LEU A N     
1564 C  CA    . LEU C 144 ? 0.2035 0.1235 0.0863 0.0021  0.0016  -0.0083 144  LEU A CA    
1565 C  C     . LEU C 144 ? 0.1802 0.1526 0.0938 0.0102  0.0121  0.0026  144  LEU A C     
1566 O  O     . LEU C 144 ? 0.2256 0.1584 0.1225 0.0211  0.0216  0.0253  144  LEU A O     
1567 C  CB    . LEU C 144 ? 0.1916 0.1445 0.1132 -0.0208 0.0072  -0.0119 144  LEU A CB    
1568 C  CG    . LEU C 144 ? 0.2000 0.2306 0.1057 -0.0084 -0.0003 -0.0429 144  LEU A CG    
1569 C  CD1   . LEU C 144 ? 0.3274 0.3706 0.1395 -0.1566 0.0150  -0.0609 144  LEU A CD1   
1570 C  CD2   . LEU C 144 ? 0.2227 0.2432 0.1413 0.0322  0.0429  0.0086  144  LEU A CD2   
1571 N  N     . SER C 145 ? 0.2051 0.1773 0.0790 0.0059  0.0168  -0.0013 145  SER A N     
1572 C  CA    . SER C 145 ? 0.2055 0.1873 0.0833 0.0150  0.0237  0.0056  145  SER A CA    
1573 C  C     . SER C 145 ? 0.2154 0.1684 0.0796 0.0079  0.0128  0.0083  145  SER A C     
1574 O  O     . SER C 145 ? 0.2010 0.1835 0.1015 0.0137  0.0174  0.0070  145  SER A O     
1575 C  CB    . SER C 145 ? 0.2112 0.1747 0.0945 0.0042  0.0117  -0.0145 145  SER A CB    
1576 O  OG    . SER C 145 ? 0.2003 0.1818 0.0969 -0.0084 0.0148  0.0010  145  SER A OG    
1577 N  N     . PRO C 146 ? 0.2470 0.1691 0.1120 0.0372  0.0095  0.0248  146  PRO A N     
1578 C  CA    . PRO C 146 ? 0.2848 0.1853 0.1225 0.0402  -0.0239 0.0171  146  PRO A CA    
1579 C  C     . PRO C 146 ? 0.2664 0.1981 0.0945 0.0446  0.0026  -0.0090 146  PRO A C     
1580 O  O     . PRO C 146 ? 0.2581 0.2286 0.1560 0.0487  -0.0326 0.0138  146  PRO A O     
1581 C  CB    . PRO C 146 ? 0.4247 0.2046 0.1288 0.0297  -0.0598 0.0542  146  PRO A CB    
1582 C  CG    . PRO C 146 ? 0.3709 0.2442 0.2405 -0.0052 -0.0339 0.1181  146  PRO A CG    
1583 C  CD    . PRO C 146 ? 0.2957 0.2107 0.1324 0.0179  0.0378  0.0545  146  PRO A CD    
1584 N  N     . ARG C 147 ? 0.2820 0.1862 0.0769 0.0508  -0.0029 0.0052  147  ARG A N     
1585 C  CA    . ARG C 147 ? 0.2384 0.1981 0.0878 0.0565  -0.0246 -0.0023 147  ARG A CA    
1586 C  C     . ARG C 147 ? 0.2418 0.1972 0.0971 0.0423  -0.0128 -0.0144 147  ARG A C     
1587 O  O     . ARG C 147 ? 0.2189 0.2794 0.1178 0.0324  -0.0160 -0.0128 147  ARG A O     
1588 C  CB    . ARG C 147 ? 0.2609 0.1978 0.1395 0.0329  0.0177  -0.0367 147  ARG A CB    
1589 C  CG    . ARG C 147 ? 0.2435 0.1854 0.1389 0.0309  0.0119  -0.0079 147  ARG A CG    
1590 C  CD    . ARG C 147 ? 0.2346 0.1784 0.1302 0.0151  0.0047  -0.0238 147  ARG A CD    
1591 N  NE    . ARG C 147 ? 0.2440 0.1699 0.1049 0.0099  0.0169  -0.0098 147  ARG A NE    
1592 C  CZ    . ARG C 147 ? 0.2169 0.1844 0.0885 0.0082  0.0442  -0.0114 147  ARG A CZ    
1593 N  NH1   . ARG C 147 ? 0.2172 0.2216 0.1021 0.0061  0.0351  0.0341  147  ARG A NH1   
1594 N  NH2   . ARG C 147 ? 0.2984 0.1742 0.1072 0.0096  0.0135  -0.0102 147  ARG A NH2   
1595 N  N     . PHE C 148 ? 0.2121 0.1692 0.0871 0.0442  0.0058  0.0020  148  PHE A N     
1596 C  CA    . PHE C 148 ? 0.1979 0.1621 0.1017 0.0427  0.0112  -0.0010 148  PHE A CA    
1597 C  C     . PHE C 148 ? 0.1962 0.1647 0.0923 0.0427  0.0050  -0.0005 148  PHE A C     
1598 O  O     . PHE C 148 ? 0.1775 0.1903 0.1123 0.0243  0.0024  -0.0077 148  PHE A O     
1599 C  CB    . PHE C 148 ? 0.1908 0.1531 0.1088 0.0338  0.0080  -0.0009 148  PHE A CB    
1600 C  CG    . PHE C 148 ? 0.1790 0.1445 0.0860 0.0257  -0.0096 0.0103  148  PHE A CG    
1601 C  CD1   . PHE C 148 ? 0.2004 0.1562 0.0861 0.0092  -0.0056 0.0049  148  PHE A CD1   
1602 C  CD2   . PHE C 148 ? 0.1836 0.1790 0.0784 0.0222  0.0065  0.0095  148  PHE A CD2   
1603 C  CE1   . PHE C 148 ? 0.1849 0.1624 0.0971 -0.0101 0.0118  -0.0016 148  PHE A CE1   
1604 C  CE2   . PHE C 148 ? 0.1987 0.1423 0.0829 -0.0085 0.0048  0.0029  148  PHE A CE2   
1605 C  CZ    . PHE C 148 ? 0.1771 0.1575 0.0981 -0.0206 0.0052  0.0229  148  PHE A CZ    
1606 N  N     . ARG C 149 ? 0.2060 0.1667 0.0972 0.0377  -0.0136 -0.0154 149  ARG A N     
1607 C  CA    . ARG C 149 ? 0.1921 0.1685 0.1137 0.0212  0.0004  -0.0184 149  ARG A CA    
1608 C  C     . ARG C 149 ? 0.2021 0.1777 0.1091 0.0270  0.0013  -0.0004 149  ARG A C     
1609 O  O     . ARG C 149 ? 0.1964 0.1795 0.1189 0.0353  0.0005  -0.0107 149  ARG A O     
1610 C  CB    . ARG C 149 ? 0.2223 0.1522 0.1231 0.0282  0.0016  -0.0162 149  ARG A CB    
1611 C  CG    . ARG C 149 ? 0.2242 0.1821 0.1653 0.0239  -0.0204 0.0139  149  ARG A CG    
1612 C  CD    . ARG C 149 ? 0.3302 0.1650 0.1880 0.0017  0.0096  -0.0003 149  ARG A CD    
1613 N  NE    . ARG C 149 ? 0.3734 0.1929 0.2299 0.0469  -0.0090 -0.0228 149  ARG A NE    
1614 C  CZ    . ARG C 149 ? 0.3120 0.3132 0.2257 0.0592  0.0332  -0.0887 149  ARG A CZ    
1615 N  NH1   . ARG C 149 ? 0.3104 0.2615 0.2389 0.0577  0.0401  -0.0312 149  ARG A NH1   
1616 N  NH2   . ARG C 149 ? 0.3553 0.3069 0.4149 0.0330  0.0472  -0.2106 149  ARG A NH2   
1617 N  N     . ASN C 150 ? 0.1971 0.1807 0.1278 0.0074  -0.0142 0.0002  150  ASN A N     
1618 C  CA    . ASN C 150 ? 0.2040 0.1707 0.1287 0.0229  0.0034  0.0054  150  ASN A CA    
1619 C  C     . ASN C 150 ? 0.1790 0.1708 0.1595 0.0304  -0.0088 0.0035  150  ASN A C     
1620 O  O     . ASN C 150 ? 0.1939 0.1898 0.2289 0.0280  -0.0219 -0.0213 150  ASN A O     
1621 C  CB    . ASN C 150 ? 0.2301 0.2089 0.1584 0.0415  -0.0166 0.0307  150  ASN A CB    
1622 C  CG    . ASN C 150 ? 0.2259 0.2589 0.1780 0.0431  -0.0131 0.0206  150  ASN A CG    
1623 O  OD1   . ASN C 150 ? 0.3394 0.4268 0.2151 0.1827  0.0055  -0.0205 150  ASN A OD1   
1624 N  ND2   . ASN C 150 ? 0.2790 0.3405 0.2496 0.0537  -0.0844 0.0063  150  ASN A ND2   
1625 N  N     . ARG C 151 ? 0.2181 0.1633 0.1205 0.0444  -0.0208 -0.0089 151  ARG A N     
1626 C  CA    . ARG C 151 ? 0.2135 0.1687 0.1222 0.0431  -0.0170 -0.0092 151  ARG A CA    
1627 C  C     . ARG C 151 ? 0.1851 0.1847 0.1314 0.0225  -0.0058 -0.0183 151  ARG A C     
1628 O  O     . ARG C 151 ? 0.1981 0.2057 0.1182 0.0244  -0.0135 -0.0006 151  ARG A O     
1629 C  CB    . ARG C 151 ? 0.2375 0.1724 0.1173 0.0532  -0.0047 -0.0139 151  ARG A CB    
1630 C  CG    . ARG C 151 ? 0.2370 0.1939 0.1088 0.0197  -0.0181 -0.0258 151  ARG A CG    
1631 C  CD    . ARG C 151 ? 0.2317 0.1831 0.1598 0.0215  -0.0543 -0.0106 151  ARG A CD    
1632 N  NE    . ARG C 151 ? 0.2175 0.1859 0.1677 0.0350  -0.0369 -0.0239 151  ARG A NE    
1633 C  CZ    . ARG C 151 ? 0.1961 0.1956 0.1864 0.0234  -0.0376 -0.0382 151  ARG A CZ    
1634 N  NH1   . ARG C 151 ? 0.2022 0.3189 0.1999 0.0192  -0.0232 -0.0361 151  ARG A NH1   
1635 N  NH2   . ARG C 151 ? 0.2892 0.1848 0.2168 0.0437  -0.0813 -0.0420 151  ARG A NH2   
1636 N  N     . GLN C 152 ? 0.1915 0.1682 0.1818 0.0187  -0.0096 -0.0147 152  GLN A N     
1637 C  CA    . GLN C 152 ? 0.1687 0.1648 0.1888 0.0053  0.0012  -0.0289 152  GLN A CA    
1638 C  C     . GLN C 152 ? 0.1817 0.1664 0.1306 -0.0019 -0.0039 -0.0247 152  GLN A C     
1639 O  O     . GLN C 152 ? 0.1648 0.1751 0.1311 0.0113  0.0033  -0.0243 152  GLN A O     
1640 C  CB    . GLN C 152 ? 0.1609 0.1965 0.4068 -0.0175 0.0146  -0.0386 152  GLN A CB    
1641 C  CG    . GLN C 152 ? 0.2105 0.4677 0.3869 -0.0984 0.0580  -0.0916 152  GLN A CG    
1642 C  CD    . GLN C 152 ? 0.2488 0.6108 0.4658 -0.1934 0.0751  -0.1239 152  GLN A CD    
1645 N  N     . PHE C 153 ? 0.1769 0.1788 0.1269 -0.0102 0.0128  -0.0263 153  PHE A N     
1646 C  CA    . PHE C 153 ? 0.1924 0.1811 0.1193 -0.0212 -0.0173 -0.0094 153  PHE A CA    
1647 C  C     . PHE C 153 ? 0.1591 0.1830 0.1139 -0.0011 -0.0081 -0.0249 153  PHE A C     
1648 O  O     . PHE C 153 ? 0.1710 0.1878 0.1204 0.0157  0.0038  -0.0219 153  PHE A O     
1649 C  CB    . PHE C 153 ? 0.2066 0.1924 0.1122 -0.0280 -0.0059 -0.0250 153  PHE A CB    
1650 C  CG    . PHE C 153 ? 0.1532 0.2013 0.1149 -0.0061 -0.0113 -0.0168 153  PHE A CG    
1651 C  CD1   . PHE C 153 ? 0.2046 0.1567 0.1193 0.0019  0.0089  -0.0059 153  PHE A CD1   
1652 C  CD2   . PHE C 153 ? 0.1748 0.1624 0.1094 0.0043  -0.0181 -0.0125 153  PHE A CD2   
1653 C  CE1   . PHE C 153 ? 0.2146 0.1966 0.1033 -0.0177 -0.0322 0.0075  153  PHE A CE1   
1654 C  CE2   . PHE C 153 ? 0.1709 0.1589 0.1349 0.0060  0.0092  -0.0131 153  PHE A CE2   
1655 C  CZ    . PHE C 153 ? 0.1846 0.1775 0.1138 -0.0018 -0.0133 0.0026  153  PHE A CZ    
1656 N  N     . ALA C 154 ? 0.1647 0.1936 0.1388 -0.0067 0.0152  -0.0169 154  ALA A N     
1657 C  CA    . ALA C 154 ? 0.1655 0.1919 0.1343 -0.0143 0.0230  -0.0185 154  ALA A CA    
1658 C  C     . ALA C 154 ? 0.1670 0.2041 0.1118 0.0056  -0.0169 -0.0168 154  ALA A C     
1659 O  O     . ALA C 154 ? 0.1785 0.1996 0.1373 0.0124  -0.0081 -0.0233 154  ALA A O     
1660 C  CB    . ALA C 154 ? 0.1644 0.2301 0.1812 -0.0253 0.0326  0.0041  154  ALA A CB    
1661 N  N     . GLY C 155 ? 0.1492 0.2001 0.1157 -0.0102 0.0034  -0.0156 155  GLY A N     
1662 C  CA    . GLY C 155 ? 0.1548 0.2214 0.1067 0.0027  -0.0075 -0.0242 155  GLY A CA    
1663 C  C     . GLY C 155 ? 0.1559 0.2169 0.1084 0.0079  -0.0043 -0.0282 155  GLY A C     
1664 O  O     . GLY C 155 ? 0.1790 0.1913 0.1230 0.0160  0.0011  -0.0092 155  GLY A O     
1665 N  N     . LEU C 156 ? 0.1559 0.1872 0.1078 0.0074  0.0060  0.0033  156  LEU A N     
1666 C  CA    . LEU C 156 ? 0.1642 0.1550 0.1273 0.0166  0.0230  -0.0008 156  LEU A CA    
1667 C  C     . LEU C 156 ? 0.1547 0.1453 0.1454 0.0081  0.0340  0.0114  156  LEU A C     
1668 O  O     . LEU C 156 ? 0.1585 0.1487 0.1420 0.0099  0.0176  -0.0152 156  LEU A O     
1669 C  CB    . LEU C 156 ? 0.1565 0.1575 0.1292 0.0170  0.0160  -0.0129 156  LEU A CB    
1670 C  CG    . LEU C 156 ? 0.1518 0.1501 0.1073 0.0234  0.0073  -0.0032 156  LEU A CG    
1671 C  CD1   . LEU C 156 ? 0.1957 0.1822 0.1193 0.0180  0.0093  0.0318  156  LEU A CD1   
1672 C  CD2   . LEU C 156 ? 0.1862 0.1383 0.1697 0.0207  -0.0079 -0.0229 156  LEU A CD2   
1673 N  N     . LEU C 157 ? 0.1587 0.1503 0.1264 -0.0169 -0.0056 0.0031  157  LEU A N     
1674 C  CA    . LEU C 157 ? 0.1754 0.1542 0.1093 0.0074  0.0025  -0.0155 157  LEU A CA    
1675 C  C     . LEU C 157 ? 0.1644 0.1690 0.1140 0.0234  0.0116  -0.0286 157  LEU A C     
1676 O  O     . LEU C 157 ? 0.1875 0.1626 0.1899 0.0280  -0.0272 -0.0204 157  LEU A O     
1677 C  CB    . LEU C 157 ? 0.1758 0.1638 0.1038 -0.0063 0.0000  -0.0216 157  LEU A CB    
1678 C  CG    . LEU C 157 ? 0.2443 0.1643 0.1237 -0.0535 0.0204  -0.0269 157  LEU A CG    
1679 C  CD1   . LEU C 157 ? 0.3577 0.1759 0.1851 -0.0379 -0.0778 0.0019  157  LEU A CD1   
1680 C  CD2   . LEU C 157 ? 0.2675 0.2463 0.1075 -0.0360 0.0111  -0.0540 157  LEU A CD2   
1681 N  N     . LEU C 158 ? 0.1663 0.1351 0.1103 -0.0019 0.0143  -0.0123 158  LEU A N     
1682 C  CA    . LEU C 158 ? 0.1682 0.1426 0.1082 -0.0056 0.0318  -0.0219 158  LEU A CA    
1683 C  C     . LEU C 158 ? 0.1511 0.1563 0.0988 0.0061  0.0110  -0.0080 158  LEU A C     
1684 O  O     . LEU C 158 ? 0.1834 0.1578 0.1135 0.0043  0.0187  -0.0212 158  LEU A O     
1685 C  CB    . LEU C 158 ? 0.1938 0.1978 0.1151 -0.0472 0.0342  -0.0222 158  LEU A CB    
1686 C  CG    . LEU C 158 ? 0.2023 0.2025 0.1247 -0.0303 0.0460  -0.0107 158  LEU A CG    
1687 C  CD1   . LEU C 158 ? 0.2118 0.2501 0.1611 -0.0624 0.0683  -0.0347 158  LEU A CD1   
1688 C  CD2   . LEU C 158 ? 0.2518 0.1930 0.1601 -0.0260 0.0538  0.0176  158  LEU A CD2   
1689 N  N     . ASP C 159 ? 0.1855 0.1578 0.1180 -0.0176 0.0306  -0.0016 159  ASP A N     
1690 C  CA    . ASP C 159 ? 0.1809 0.1489 0.1237 0.0008  0.0296  -0.0032 159  ASP A CA    
1691 C  C     . ASP C 159 ? 0.1732 0.1656 0.0889 0.0052  0.0100  -0.0151 159  ASP A C     
1692 O  O     . ASP C 159 ? 0.1788 0.1743 0.0894 0.0049  0.0113  -0.0175 159  ASP A O     
1693 C  CB    . ASP C 159 ? 0.2006 0.1485 0.1652 0.0140  0.0425  0.0159  159  ASP A CB    
1694 C  CG    . ASP C 159 ? 0.2349 0.1784 0.1581 0.0211  0.0246  0.0167  159  ASP A CG    
1695 O  OD1   . ASP C 159 ? 0.2288 0.2014 0.1447 0.0223  0.0144  0.0178  159  ASP A OD1   
1696 O  OD2   . ASP C 159 ? 0.2970 0.2728 0.1915 0.0972  0.0044  0.0411  159  ASP A OD2   
1697 N  N     . GLN C 160 ? 0.1549 0.1795 0.0748 0.0019  0.0089  -0.0037 160  GLN A N     
1698 C  CA    . GLN C 160 ? 0.1527 0.1367 0.1132 -0.0064 0.0100  -0.0098 160  GLN A CA    
1699 C  C     . GLN C 160 ? 0.1745 0.1431 0.0851 -0.0059 0.0226  -0.0124 160  GLN A C     
1700 O  O     . GLN C 160 ? 0.1756 0.1844 0.0936 -0.0248 0.0240  -0.0037 160  GLN A O     
1701 C  CB    . GLN C 160 ? 0.1934 0.1366 0.1005 -0.0070 0.0196  -0.0106 160  GLN A CB    
1702 C  CG    . GLN C 160 ? 0.2068 0.1386 0.0866 -0.0222 0.0145  -0.0074 160  GLN A CG    
1703 C  CD    . GLN C 160 ? 0.1663 0.1516 0.0974 -0.0053 0.0041  -0.0170 160  GLN A CD    
1704 O  OE1   . GLN C 160 ? 0.1841 0.1416 0.1257 0.0123  -0.0018 -0.0352 160  GLN A OE1   
1705 N  NE2   . GLN C 160 ? 0.1650 0.1508 0.1002 -0.0287 0.0255  -0.0150 160  GLN A NE2   
1706 N  N     . ALA C 161 ? 0.2122 0.1413 0.0858 -0.0120 0.0058  -0.0051 161  ALA A N     
1707 C  CA    . ALA C 161 ? 0.1999 0.1657 0.0663 -0.0315 -0.0002 0.0017  161  ALA A CA    
1708 C  C     . ALA C 161 ? 0.1632 0.1470 0.0737 -0.0019 0.0118  -0.0042 161  ALA A C     
1709 O  O     . ALA C 161 ? 0.1919 0.1611 0.0911 -0.0227 0.0184  -0.0042 161  ALA A O     
1710 C  CB    . ALA C 161 ? 0.2087 0.1639 0.0924 -0.0221 -0.0151 0.0002  161  ALA A CB    
1711 N  N     . PHE C 162 ? 0.1633 0.1491 0.0769 -0.0012 0.0178  -0.0141 162  PHE A N     
1712 C  CA    . PHE C 162 ? 0.1802 0.1643 0.0685 0.0022  0.0014  -0.0080 162  PHE A CA    
1713 C  C     . PHE C 162 ? 0.1696 0.1413 0.0932 -0.0106 0.0100  -0.0056 162  PHE A C     
1714 O  O     . PHE C 162 ? 0.1704 0.1735 0.1045 -0.0177 0.0160  -0.0083 162  PHE A O     
1715 C  CB    . PHE C 162 ? 0.1898 0.1389 0.0764 -0.0065 0.0158  -0.0081 162  PHE A CB    
1716 C  CG    . PHE C 162 ? 0.1836 0.1348 0.0863 -0.0005 0.0139  -0.0173 162  PHE A CG    
1717 C  CD1   . PHE C 162 ? 0.1713 0.1557 0.1282 -0.0178 0.0288  -0.0276 162  PHE A CD1   
1718 C  CD2   . PHE C 162 ? 0.1566 0.1670 0.0847 0.0261  0.0127  -0.0126 162  PHE A CD2   
1719 C  CE1   . PHE C 162 ? 0.1587 0.1557 0.1148 -0.0078 0.0188  -0.0175 162  PHE A CE1   
1720 C  CE2   . PHE C 162 ? 0.1820 0.1651 0.0875 -0.0045 0.0215  -0.0123 162  PHE A CE2   
1721 C  CZ    . PHE C 162 ? 0.1623 0.1636 0.1294 0.0032  0.0235  -0.0089 162  PHE A CZ    
1722 N  N     . LEU C 163 ? 0.1659 0.1449 0.0911 0.0083  0.0036  -0.0044 163  LEU A N     
1723 C  CA    . LEU C 163 ? 0.1600 0.1347 0.1239 0.0137  0.0002  -0.0174 163  LEU A CA    
1724 C  C     . LEU C 163 ? 0.1612 0.1355 0.1353 0.0022  0.0123  -0.0148 163  LEU A C     
1725 O  O     . LEU C 163 ? 0.1742 0.1552 0.1768 -0.0072 0.0369  -0.0223 163  LEU A O     
1726 C  CB    . LEU C 163 ? 0.1573 0.1414 0.1159 -0.0126 -0.0174 0.0041  163  LEU A CB    
1727 C  CG    . LEU C 163 ? 0.1589 0.1438 0.0839 -0.0249 0.0269  0.0071  163  LEU A CG    
1728 C  CD1   . LEU C 163 ? 0.1933 0.1865 0.0849 0.0231  -0.0033 -0.0008 163  LEU A CD1   
1729 C  CD2   . LEU C 163 ? 0.1272 0.1829 0.1367 -0.0150 0.0077  -0.0102 163  LEU A CD2   
1730 N  N     . ALA C 164 ? 0.1823 0.1312 0.1119 0.0082  0.0185  -0.0153 164  ALA A N     
1731 C  CA    . ALA C 164 ? 0.1878 0.1265 0.0981 -0.0072 0.0320  -0.0052 164  ALA A CA    
1732 C  C     . ALA C 164 ? 0.1655 0.1408 0.1049 -0.0196 0.0147  -0.0015 164  ALA A C     
1733 O  O     . ALA C 164 ? 0.1629 0.1358 0.1347 -0.0189 0.0105  -0.0055 164  ALA A O     
1734 C  CB    . ALA C 164 ? 0.2056 0.1621 0.1097 0.0113  0.0416  -0.0141 164  ALA A CB    
1735 N  N     . GLY C 165 ? 0.1564 0.1209 0.0906 -0.0076 0.0216  -0.0070 165  GLY A N     
1736 C  CA    . GLY C 165 ? 0.1479 0.1444 0.1030 0.0104  0.0244  0.0071  165  GLY A CA    
1737 C  C     . GLY C 165 ? 0.1588 0.1438 0.0860 -0.0016 0.0229  -0.0152 165  GLY A C     
1738 O  O     . GLY C 165 ? 0.1775 0.1618 0.1007 -0.0047 0.0173  0.0041  165  GLY A O     
1739 N  N     . LEU C 166 ? 0.1444 0.1438 0.1090 -0.0092 0.0295  -0.0358 166  LEU A N     
1740 C  CA    . LEU C 166 ? 0.1375 0.1357 0.1133 -0.0060 0.0281  -0.0198 166  LEU A CA    
1741 C  C     . LEU C 166 ? 0.1499 0.1402 0.0792 -0.0128 0.0331  -0.0214 166  LEU A C     
1742 O  O     . LEU C 166 ? 0.1773 0.1588 0.0949 -0.0119 0.0182  -0.0144 166  LEU A O     
1743 C  CB    . LEU C 166 ? 0.1651 0.1287 0.1131 -0.0037 0.0195  -0.0276 166  LEU A CB    
1744 C  CG    . LEU C 166 ? 0.1604 0.1449 0.1131 -0.0025 0.0032  -0.0199 166  LEU A CG    
1745 C  CD1   . LEU C 166 ? 0.2167 0.1245 0.1471 -0.0064 0.0140  -0.0189 166  LEU A CD1   
1746 C  CD2   . LEU C 166 ? 0.1890 0.1591 0.1015 -0.0082 0.0049  -0.0131 166  LEU A CD2   
1747 N  N     . GLY C 167 ? 0.1629 0.1310 0.1061 -0.0194 0.0403  -0.0140 167  GLY A N     
1748 C  CA    . GLY C 167 ? 0.1541 0.1789 0.1079 -0.0200 0.0406  -0.0174 167  GLY A CA    
1749 C  C     . GLY C 167 ? 0.1530 0.1478 0.1110 -0.0119 0.0317  -0.0195 167  GLY A C     
1750 O  O     . GLY C 167 ? 0.1907 0.1580 0.1063 -0.0285 0.0318  -0.0347 167  GLY A O     
1751 N  N     . ASN C 168 ? 0.1584 0.1552 0.1097 -0.0241 0.0311  -0.0264 168  ASN A N     
1752 C  CA    . ASN C 168 ? 0.1525 0.1516 0.1015 -0.0132 0.0275  -0.0086 168  ASN A CA    
1753 C  C     . ASN C 168 ? 0.1579 0.1366 0.0993 -0.0166 0.0310  -0.0006 168  ASN A C     
1754 O  O     . ASN C 168 ? 0.1734 0.1679 0.1196 -0.0108 0.0361  -0.0317 168  ASN A O     
1755 C  CB    . ASN C 168 ? 0.1431 0.1745 0.1460 -0.0097 0.0185  -0.0212 168  ASN A CB    
1756 C  CG    . ASN C 168 ? 0.1639 0.1507 0.1451 -0.0106 0.0357  -0.0238 168  ASN A CG    
1757 O  OD1   . ASN C 168 ? 0.1813 0.1565 0.1597 -0.0101 0.0371  -0.0200 168  ASN A OD1   
1758 N  ND2   . ASN C 168 ? 0.1862 0.1854 0.1545 -0.0374 0.0415  -0.0144 168  ASN A ND2   
1759 N  N     . TYR C 169 ? 0.2142 0.1187 0.1040 -0.0189 0.0183  0.0044  169  TYR A N     
1760 C  CA    . TYR C 169 ? 0.1822 0.1418 0.1137 -0.0217 0.0035  0.0107  169  TYR A CA    
1761 C  C     . TYR C 169 ? 0.1591 0.1646 0.1102 -0.0222 0.0365  -0.0209 169  TYR A C     
1762 O  O     . TYR C 169 ? 0.1801 0.1564 0.1042 0.0090  0.0274  -0.0202 169  TYR A O     
1763 C  CB    . TYR C 169 ? 0.1920 0.1620 0.1216 0.0136  0.0333  0.0118  169  TYR A CB    
1764 C  CG    . TYR C 169 ? 0.1867 0.1755 0.1268 0.0044  0.0257  -0.0004 169  TYR A CG    
1765 C  CD1   . TYR C 169 ? 0.2030 0.1643 0.0846 -0.0016 0.0216  0.0172  169  TYR A CD1   
1766 C  CD2   . TYR C 169 ? 0.1842 0.1562 0.1192 0.0000  0.0258  0.0073  169  TYR A CD2   
1767 C  CE1   . TYR C 169 ? 0.1943 0.1971 0.1085 -0.0001 0.0294  -0.0139 169  TYR A CE1   
1768 C  CE2   . TYR C 169 ? 0.1778 0.1725 0.1180 -0.0092 0.0235  -0.0086 169  TYR A CE2   
1769 C  CZ    . TYR C 169 ? 0.1834 0.1650 0.1087 -0.0095 0.0225  -0.0032 169  TYR A CZ    
1770 O  OH    . TYR C 169 ? 0.1829 0.1550 0.1357 -0.0006 0.0126  -0.0020 169  TYR A OH    
1771 N  N     . LEU C 170 ? 0.1523 0.1455 0.1103 -0.0122 0.0311  -0.0059 170  LEU A N     
1772 C  CA    . LEU C 170 ? 0.1384 0.1426 0.1021 -0.0043 0.0190  -0.0043 170  LEU A CA    
1773 C  C     . LEU C 170 ? 0.1493 0.1491 0.0908 0.0047  0.0264  -0.0069 170  LEU A C     
1774 O  O     . LEU C 170 ? 0.1504 0.1740 0.0930 0.0082  0.0289  -0.0183 170  LEU A O     
1775 C  CB    . LEU C 170 ? 0.1481 0.1386 0.1212 0.0010  0.0329  0.0114  170  LEU A CB    
1776 C  CG    . LEU C 170 ? 0.1486 0.1859 0.0868 0.0313  0.0131  0.0012  170  LEU A CG    
1777 C  CD1   . LEU C 170 ? 0.1570 0.1905 0.1045 0.0038  0.0305  -0.0033 170  LEU A CD1   
1778 C  CD2   . LEU C 170 ? 0.1990 0.1705 0.1024 -0.0011 -0.0049 -0.0043 170  LEU A CD2   
1779 N  N     . ARG C 171 ? 0.1522 0.1383 0.1029 0.0048  0.0204  -0.0071 171  ARG A N     
1780 C  CA    . ARG C 171 ? 0.1541 0.1814 0.0821 0.0290  0.0249  -0.0175 171  ARG A CA    
1781 C  C     . ARG C 171 ? 0.1371 0.1717 0.0919 -0.0089 0.0189  -0.0279 171  ARG A C     
1782 O  O     . ARG C 171 ? 0.1606 0.1656 0.0966 0.0154  0.0101  -0.0263 171  ARG A O     
1783 C  CB    . ARG C 171 ? 0.1669 0.1792 0.0931 0.0205  0.0141  -0.0157 171  ARG A CB    
1784 C  CG    . ARG C 171 ? 0.1640 0.1866 0.0945 0.0222  0.0087  -0.0204 171  ARG A CG    
1785 C  CD    . ARG C 171 ? 0.1623 0.2155 0.1172 -0.0216 -0.0008 0.0067  171  ARG A CD    
1786 N  NE    . ARG C 171 ? 0.1462 0.1821 0.1160 0.0050  0.0274  -0.0104 171  ARG A NE    
1787 C  CZ    . ARG C 171 ? 0.1547 0.1554 0.1532 0.0027  0.0086  -0.0319 171  ARG A CZ    
1788 N  NH1   . ARG C 171 ? 0.1847 0.1733 0.1455 0.0254  -0.0097 -0.0350 171  ARG A NH1   
1789 N  NH2   . ARG C 171 ? 0.1880 0.1709 0.1811 -0.0271 0.0145  -0.0538 171  ARG A NH2   
1790 N  N     . VAL C 172 ? 0.1713 0.1814 0.0964 -0.0025 0.0245  -0.0022 172  VAL A N     
1791 C  CA    . VAL C 172 ? 0.1536 0.2141 0.0864 -0.0341 0.0178  -0.0224 172  VAL A CA    
1792 C  C     . VAL C 172 ? 0.1383 0.1398 0.1013 -0.0146 0.0128  -0.0063 172  VAL A C     
1793 O  O     . VAL C 172 ? 0.1583 0.1628 0.0997 0.0066  0.0035  -0.0119 172  VAL A O     
1794 C  CB    A VAL C 172 ? 0.1546 0.2546 0.0993 -0.0588 -0.0112 0.0107  172  VAL A CB    
1795 C  CB    B VAL C 172 ? 0.1805 0.2696 0.1502 -0.1080 0.0387  -0.0332 172  VAL A CB    
1796 C  CG1   A VAL C 172 ? 0.1973 0.3780 0.1192 -0.0911 0.0003  -0.0910 172  VAL A CG1   
1797 C  CG1   B VAL C 172 ? 0.1809 0.1785 0.1797 -0.0393 0.0183  0.0006  172  VAL A CG1   
1798 C  CG2   A VAL C 172 ? 0.2349 0.1925 0.1073 -0.0221 0.0750  -0.0601 172  VAL A CG2   
1799 C  CG2   B VAL C 172 ? 0.1703 0.2979 0.1224 -0.0857 0.0563  -0.0432 172  VAL A CG2   
1800 N  N     . GLU C 173 ? 0.1525 0.1566 0.1004 0.0019  0.0146  -0.0067 173  GLU A N     
1801 C  CA    . GLU C 173 ? 0.1409 0.1422 0.1105 -0.0084 0.0150  -0.0080 173  GLU A CA    
1802 C  C     . GLU C 173 ? 0.1538 0.1392 0.0915 -0.0017 0.0239  -0.0052 173  GLU A C     
1803 O  O     . GLU C 173 ? 0.1687 0.1500 0.0894 -0.0044 0.0190  -0.0144 173  GLU A O     
1804 C  CB    . GLU C 173 ? 0.1543 0.1417 0.1109 0.0006  0.0205  0.0093  173  GLU A CB    
1805 C  CG    . GLU C 173 ? 0.2053 0.1475 0.1292 -0.0184 0.0376  0.0103  173  GLU A CG    
1806 C  CD    . GLU C 173 ? 0.2225 0.1672 0.1295 -0.0142 0.0334  0.0203  173  GLU A CD    
1807 O  OE1   . GLU C 173 ? 0.2394 0.1726 0.1273 -0.0182 0.0333  0.0094  173  GLU A OE1   
1808 O  OE2   . GLU C 173 ? 0.2352 0.1913 0.1242 -0.0264 0.0489  0.0044  173  GLU A OE2   
1809 N  N     . ILE C 174 ? 0.1530 0.1319 0.0922 0.0092  0.0125  0.0067  174  ILE A N     
1810 C  CA    . ILE C 174 ? 0.1392 0.1297 0.0929 0.0117  0.0307  -0.0052 174  ILE A CA    
1811 C  C     . ILE C 174 ? 0.1235 0.1494 0.0932 0.0217  0.0167  -0.0208 174  ILE A C     
1812 O  O     . ILE C 174 ? 0.1612 0.1563 0.0796 0.0033  0.0175  -0.0122 174  ILE A O     
1813 C  CB    . ILE C 174 ? 0.1587 0.1300 0.0929 -0.0097 0.0408  -0.0112 174  ILE A CB    
1814 C  CG1   . ILE C 174 ? 0.1561 0.1722 0.0867 0.0072  0.0341  -0.0054 174  ILE A CG1   
1815 C  CG2   . ILE C 174 ? 0.2024 0.1364 0.0986 -0.0193 0.0027  -0.0029 174  ILE A CG2   
1816 C  CD1   . ILE C 174 ? 0.1871 0.1633 0.0981 -0.0030 0.0402  -0.0194 174  ILE A CD1   
1817 N  N     . LEU C 175 ? 0.1270 0.1511 0.0977 0.0160  0.0170  0.0047  175  LEU A N     
1818 C  CA    . LEU C 175 ? 0.1245 0.1851 0.0824 0.0369  0.0144  -0.0073 175  LEU A CA    
1819 C  C     . LEU C 175 ? 0.1668 0.1534 0.0854 -0.0086 0.0100  -0.0117 175  LEU A C     
1820 O  O     . LEU C 175 ? 0.1768 0.1672 0.0921 0.0208  0.0179  -0.0205 175  LEU A O     
1821 C  CB    . LEU C 175 ? 0.1370 0.1925 0.0989 0.0203  0.0032  -0.0010 175  LEU A CB    
1822 C  CG    . LEU C 175 ? 0.1918 0.1721 0.0934 0.0199  -0.0084 -0.0045 175  LEU A CG    
1823 C  CD1   . LEU C 175 ? 0.1948 0.2012 0.1169 0.0314  -0.0160 -0.0357 175  LEU A CD1   
1824 C  CD2   . LEU C 175 ? 0.2527 0.1810 0.1047 0.0019  -0.0135 0.0046  175  LEU A CD2   
1825 N  N     . TRP C 176 ? 0.1387 0.1661 0.0861 -0.0028 0.0258  -0.0053 176  TRP A N     
1826 C  CA    . TRP C 176 ? 0.1679 0.1566 0.0862 -0.0110 0.0115  0.0052  176  TRP A CA    
1827 C  C     . TRP C 176 ? 0.1647 0.1514 0.0778 -0.0025 0.0259  -0.0004 176  TRP A C     
1828 O  O     . TRP C 176 ? 0.1744 0.1542 0.0810 -0.0017 0.0355  -0.0151 176  TRP A O     
1829 C  CB    . TRP C 176 ? 0.1866 0.1558 0.0969 -0.0157 0.0289  -0.0020 176  TRP A CB    
1830 C  CG    . TRP C 176 ? 0.1689 0.1449 0.0967 -0.0096 0.0239  0.0015  176  TRP A CG    
1831 C  CD1   . TRP C 176 ? 0.1834 0.1485 0.1078 -0.0050 0.0364  -0.0050 176  TRP A CD1   
1832 C  CD2   . TRP C 176 ? 0.1758 0.1577 0.0944 -0.0315 0.0204  -0.0210 176  TRP A CD2   
1833 N  NE1   . TRP C 176 ? 0.1984 0.1842 0.1036 -0.0183 0.0343  -0.0153 176  TRP A NE1   
1834 C  CE2   . TRP C 176 ? 0.2005 0.1782 0.0909 -0.0201 0.0277  -0.0210 176  TRP A CE2   
1835 C  CE3   . TRP C 176 ? 0.1735 0.1684 0.1092 -0.0047 0.0091  -0.0041 176  TRP A CE3   
1836 C  CZ2   . TRP C 176 ? 0.2214 0.1717 0.1080 -0.0240 0.0146  -0.0110 176  TRP A CZ2   
1837 C  CZ3   . TRP C 176 ? 0.2082 0.1937 0.1120 0.0067  0.0026  0.0014  176  TRP A CZ3   
1838 C  CH2   . TRP C 176 ? 0.2218 0.1661 0.1143 0.0006  0.0135  -0.0093 176  TRP A CH2   
1839 N  N     . GLN C 177 ? 0.1523 0.1641 0.1071 0.0123  0.0203  -0.0042 177  GLN A N     
1840 C  CA    . GLN C 177 ? 0.1630 0.1608 0.0928 0.0139  0.0148  -0.0079 177  GLN A CA    
1841 C  C     . GLN C 177 ? 0.1878 0.1662 0.0935 0.0053  0.0145  -0.0098 177  GLN A C     
1842 O  O     . GLN C 177 ? 0.2117 0.1752 0.1000 -0.0107 -0.0109 -0.0101 177  GLN A O     
1843 C  CB    . GLN C 177 ? 0.1468 0.1929 0.1162 0.0014  0.0102  -0.0262 177  GLN A CB    
1844 C  CG    . GLN C 177 ? 0.1585 0.2387 0.1319 -0.0053 -0.0166 -0.0039 177  GLN A CG    
1845 C  CD    . GLN C 177 ? 0.1985 0.2526 0.1487 -0.0278 -0.0361 0.0118  177  GLN A CD    
1846 O  OE1   . GLN C 177 ? 0.2383 0.2530 0.1704 -0.0106 -0.0336 0.0248  177  GLN A OE1   
1847 N  NE2   . GLN C 177 ? 0.2579 0.2862 0.1469 -0.0428 -0.0591 0.0002  177  GLN A NE2   
1848 N  N     . VAL C 178 ? 0.1444 0.1547 0.0832 0.0083  0.0220  -0.0100 178  VAL A N     
1849 C  CA    . VAL C 178 ? 0.1658 0.1648 0.1074 -0.0036 0.0476  0.0002  178  VAL A CA    
1850 C  C     . VAL C 178 ? 0.1641 0.1593 0.1029 0.0062  0.0263  -0.0299 178  VAL A C     
1851 O  O     . VAL C 178 ? 0.2107 0.1624 0.1206 0.0100  0.0258  -0.0252 178  VAL A O     
1852 C  CB    . VAL C 178 ? 0.1975 0.1907 0.0988 0.0044  0.0442  0.0080  178  VAL A CB    
1853 C  CG1   . VAL C 178 ? 0.2107 0.2048 0.1733 0.0027  0.1054  0.0123  178  VAL A CG1   
1854 C  CG2   . VAL C 178 ? 0.2738 0.1761 0.1060 -0.0069 0.0198  0.0045  178  VAL A CG2   
1855 N  N     . GLY C 179 ? 0.1534 0.1811 0.0967 0.0122  0.0328  -0.0129 179  GLY A N     
1856 C  CA    . GLY C 179 ? 0.1520 0.1969 0.0983 0.0340  0.0201  -0.0068 179  GLY A CA    
1857 C  C     . GLY C 179 ? 0.1546 0.1731 0.0895 0.0122  0.0143  -0.0140 179  GLY A C     
1858 O  O     . GLY C 179 ? 0.1564 0.1666 0.1138 0.0186  0.0223  -0.0145 179  GLY A O     
1859 N  N     . LEU C 180 ? 0.1903 0.1945 0.0815 0.0162  0.0208  -0.0123 180  LEU A N     
1860 C  CA    . LEU C 180 ? 0.2155 0.1829 0.0803 -0.0008 0.0073  -0.0103 180  LEU A CA    
1861 C  C     . LEU C 180 ? 0.1576 0.1684 0.1111 0.0182  0.0203  0.0027  180  LEU A C     
1862 O  O     . LEU C 180 ? 0.1735 0.1664 0.1339 0.0122  0.0202  -0.0075 180  LEU A O     
1863 C  CB    . LEU C 180 ? 0.2346 0.1791 0.1075 -0.0358 -0.0022 0.0090  180  LEU A CB    
1864 C  CG    . LEU C 180 ? 0.2795 0.1634 0.1343 -0.0353 0.0038  -0.0191 180  LEU A CG    
1865 C  CD1   . LEU C 180 ? 0.2489 0.2852 0.1710 -0.0906 -0.0071 0.0343  180  LEU A CD1   
1866 C  CD2   . LEU C 180 ? 0.3382 0.1869 0.1735 0.0187  -0.0584 -0.0241 180  LEU A CD2   
1867 N  N     . THR C 181 ? 0.1705 0.2446 0.1106 0.0483  0.0095  -0.0041 181  THR A N     
1868 C  CA    . THR C 181 ? 0.1689 0.3110 0.1059 -0.0035 0.0104  0.0069  181  THR A CA    
1869 C  C     . THR C 181 ? 0.1959 0.2545 0.1084 -0.0194 0.0196  0.0136  181  THR A C     
1870 O  O     . THR C 181 ? 0.2363 0.2935 0.1191 -0.0578 0.0263  -0.0141 181  THR A O     
1871 C  CB    . THR C 181 ? 0.1685 0.3544 0.1600 0.0016  0.0285  0.0575  181  THR A CB    
1872 O  OG1   . THR C 181 ? 0.2001 0.3858 0.3138 0.0298  0.0418  0.1237  181  THR A OG1   
1873 C  CG2   . THR C 181 ? 0.2289 0.2922 0.1789 0.0289  0.0659  -0.0140 181  THR A CG2   
1874 N  N     . GLY C 182 ? 0.1900 0.2738 0.1149 -0.0144 0.0018  0.0090  182  GLY A N     
1875 C  CA    . GLY C 182 ? 0.1804 0.2247 0.1166 -0.0077 0.0129  0.0049  182  GLY A CA    
1876 C  C     . GLY C 182 ? 0.1680 0.2416 0.1220 0.0028  0.0018  -0.0032 182  GLY A C     
1877 O  O     . GLY C 182 ? 0.2095 0.2234 0.1168 -0.0069 0.0116  -0.0066 182  GLY A O     
1878 N  N     . ASN C 183 ? 0.1492 0.2348 0.1586 -0.0111 0.0146  -0.0134 183  ASN A N     
1879 C  CA    . ASN C 183 ? 0.1439 0.2510 0.2492 -0.0009 -0.0064 0.0014  183  ASN A CA    
1880 C  C     A ASN C 183 ? 0.1549 0.2371 0.2149 0.0107  -0.0009 -0.0035 183  ASN A C     
1881 C  C     B ASN C 183 ? 0.1581 0.2303 0.2147 0.0186  0.0167  -0.0327 183  ASN A C     
1882 O  O     A ASN C 183 ? 0.1923 0.2711 0.1164 -0.0296 0.1060  -0.0055 183  ASN A O     
1883 O  O     B ASN C 183 ? 0.2304 0.3152 0.2855 0.0684  0.0427  -0.0961 183  ASN A O     
1884 C  CB    A ASN C 183 ? 0.1265 0.3358 0.3275 -0.0020 -0.0101 -0.0360 183  ASN A CB    
1885 C  CB    B ASN C 183 ? 0.1371 0.3639 0.3144 0.0051  0.0032  -0.0089 183  ASN A CB    
1886 C  CG    A ASN C 183 ? 0.1299 0.3652 0.2934 0.0116  -0.0403 -0.0592 183  ASN A CG    
1887 C  CG    B ASN C 183 ? 0.2231 0.4911 0.3876 -0.1370 -0.0055 0.0232  183  ASN A CG    
1888 O  OD1   A ASN C 183 ? 0.1077 0.2259 0.3461 -0.0043 0.0101  -0.0698 183  ASN A OD1   
1889 O  OD1   B ASN C 183 ? 0.8391 0.3963 0.5656 -0.1780 -0.0559 -0.0198 183  ASN A OD1   
1890 N  ND2   A ASN C 183 ? 0.1545 0.4289 0.2761 0.0530  -0.0162 0.0306  183  ASN A ND2   
1891 N  ND2   B ASN C 183 ? 0.3603 0.9932 0.7453 -0.2954 0.2339  0.1074  183  ASN A ND2   
1892 N  N     . HIS C 184 ? 0.1811 0.1741 0.2146 0.0051  0.0495  -0.0048 184  HIS A N     
1893 C  CA    . HIS C 184 ? 0.1970 0.1705 0.1552 -0.0017 0.0432  -0.0150 184  HIS A CA    
1894 C  C     . HIS C 184 ? 0.1817 0.1660 0.1524 0.0056  0.0293  -0.0091 184  HIS A C     
1895 O  O     . HIS C 184 ? 0.1902 0.1880 0.1569 0.0150  0.0157  -0.0380 184  HIS A O     
1896 C  CB    . HIS C 184 ? 0.2812 0.1968 0.1566 -0.0133 0.0084  0.0087  184  HIS A CB    
1897 C  CG    . HIS C 184 ? 0.3437 0.2605 0.1587 0.0294  0.0257  0.0508  184  HIS A CG    
1898 N  ND1   . HIS C 184 ? 0.3215 0.3068 0.2391 0.0021  0.0492  0.0736  184  HIS A ND1   
1899 C  CD2   . HIS C 184 ? 0.4265 0.2684 0.2044 -0.0132 0.0912  -0.0224 184  HIS A CD2   
1900 C  CE1   . HIS C 184 ? 0.3102 0.3420 0.1905 -0.0339 0.0223  0.0321  184  HIS A CE1   
1901 N  NE2   . HIS C 184 ? 0.4709 0.3451 0.3617 -0.0177 0.2025  0.0166  184  HIS A NE2   
1902 N  N     . LYS C 185 ? 0.1938 0.1682 0.1397 0.0088  0.0230  0.0053  185  LYS A N     
1903 C  CA    . LYS C 185 ? 0.1761 0.2142 0.1204 -0.0016 0.0184  -0.0015 185  LYS A CA    
1904 C  C     . LYS C 185 ? 0.1752 0.1777 0.1105 0.0194  0.0198  -0.0227 185  LYS A C     
1905 O  O     . LYS C 185 ? 0.2073 0.2273 0.1167 0.0251  0.0382  -0.0380 185  LYS A O     
1906 C  CB    . LYS C 185 ? 0.1866 0.2450 0.1398 -0.0264 -0.0053 0.0268  185  LYS A CB    
1907 C  CG    . LYS C 185 ? 0.1683 0.3130 0.2884 0.0468  -0.0516 -0.0934 185  LYS A CG    
1908 C  CD    . LYS C 185 ? 0.1572 0.4249 0.2436 0.0343  -0.0197 -0.0072 185  LYS A CD    
1909 C  CE    . LYS C 185 ? 0.1772 0.4413 0.2506 0.0509  -0.0309 -0.0493 185  LYS A CE    
1910 N  NZ    . LYS C 185 ? 0.2615 0.5849 0.3671 0.0054  -0.1130 0.1243  185  LYS A NZ    
1911 N  N     . ALA C 186 ? 0.1633 0.1796 0.1010 0.0271  0.0141  -0.0104 186  ALA A N     
1912 C  CA    . ALA C 186 ? 0.1747 0.1765 0.1204 0.0152  0.0041  -0.0201 186  ALA A CA    
1913 C  C     . ALA C 186 ? 0.1805 0.1806 0.1114 0.0199  -0.0109 -0.0128 186  ALA A C     
1914 O  O     . ALA C 186 ? 0.1963 0.1828 0.1213 0.0124  -0.0129 -0.0172 186  ALA A O     
1915 C  CB    . ALA C 186 ? 0.1703 0.1805 0.1169 0.0122  0.0022  -0.0152 186  ALA A CB    
1916 N  N     . LYS C 187 ? 0.1871 0.1671 0.1141 0.0235  -0.0142 -0.0222 187  LYS A N     
1917 C  CA    . LYS C 187 ? 0.2639 0.1657 0.1511 0.0275  -0.0301 -0.0215 187  LYS A CA    
1918 C  C     . LYS C 187 ? 0.3061 0.1816 0.1725 0.0766  -0.0362 -0.0444 187  LYS A C     
1919 O  O     . LYS C 187 ? 0.3905 0.2044 0.2659 0.0830  -0.0720 -0.0985 187  LYS A O     
1920 C  CB    . LYS C 187 ? 0.3372 0.1809 0.1728 0.0799  -0.0363 -0.0213 187  LYS A CB    
1921 C  CG    . LYS C 187 ? 0.2918 0.3312 0.2341 0.1713  -0.0576 -0.0194 187  LYS A CG    
1922 C  CD    . LYS C 187 ? 0.3857 0.2929 0.2033 0.1403  -0.0775 -0.0412 187  LYS A CD    
1923 C  CE    . LYS C 187 ? 0.3693 0.3531 0.3344 0.1330  -0.1714 -0.0198 187  LYS A CE    
1924 N  NZ    . LYS C 187 ? 0.3779 0.5052 0.2399 0.1458  -0.0698 0.0242  187  LYS A NZ    
1925 N  N     . ASP C 188 ? 0.2470 0.2501 0.1400 0.0917  -0.0169 -0.0485 188  ASP A N     
1926 C  CA    . ASP C 188 ? 0.2361 0.3253 0.1563 0.1284  -0.0440 -0.0978 188  ASP A CA    
1927 C  C     . ASP C 188 ? 0.2360 0.2251 0.1413 0.0794  -0.0162 -0.0540 188  ASP A C     
1928 O  O     . ASP C 188 ? 0.2292 0.2656 0.1423 0.0594  -0.0024 -0.0538 188  ASP A O     
1929 C  CB    . ASP C 188 ? 0.2161 0.4030 0.2466 0.1322  -0.0227 -0.0879 188  ASP A CB    
1930 C  CG    . ASP C 188 ? 0.2709 0.3759 0.3776 0.0495  -0.1320 -0.0274 188  ASP A CG    
1931 O  OD1   . ASP C 188 ? 0.4701 0.3792 0.2301 0.0387  -0.0054 -0.0336 188  ASP A OD1   
1932 O  OD2   . ASP C 188 ? 0.3979 0.4156 0.4129 -0.0002 -0.1775 -0.0251 188  ASP A OD2   
1933 N  N     . LEU C 189 ? 0.1804 0.1539 0.1487 0.0194  -0.0105 -0.0214 189  LEU A N     
1934 C  CA    . LEU C 189 ? 0.1825 0.1785 0.1345 0.0175  -0.0075 -0.0346 189  LEU A CA    
1935 C  C     . LEU C 189 ? 0.1980 0.1565 0.1191 0.0179  -0.0012 -0.0175 189  LEU A C     
1936 O  O     . LEU C 189 ? 0.2317 0.1691 0.1229 0.0084  0.0088  -0.0140 189  LEU A O     
1937 C  CB    . LEU C 189 ? 0.1812 0.1519 0.1338 0.0089  -0.0069 -0.0173 189  LEU A CB    
1938 C  CG    . LEU C 189 ? 0.1835 0.1604 0.1539 -0.0017 0.0046  -0.0097 189  LEU A CG    
1939 C  CD1   . LEU C 189 ? 0.2007 0.1698 0.1602 0.0167  -0.0057 -0.0349 189  LEU A CD1   
1940 C  CD2   . LEU C 189 ? 0.2051 0.2049 0.1773 -0.0194 0.0350  -0.0326 189  LEU A CD2   
1941 N  N     . ASN C 190 ? 0.1691 0.1477 0.1198 0.0123  0.0041  -0.0201 190  ASN A N     
1942 C  CA    . ASN C 190 ? 0.1693 0.1455 0.1089 0.0036  0.0152  -0.0149 190  ASN A CA    
1943 C  C     . ASN C 190 ? 0.1705 0.1333 0.1047 0.0000  0.0051  -0.0155 190  ASN A C     
1944 O  O     . ASN C 190 ? 0.1801 0.1343 0.1012 0.0071  0.0038  -0.0150 190  ASN A O     
1945 C  CB    . ASN C 190 ? 0.2012 0.2032 0.1000 0.0182  0.0146  -0.0244 190  ASN A CB    
1946 C  CG    . ASN C 190 ? 0.2200 0.1769 0.0950 0.0181  0.0344  -0.0393 190  ASN A CG    
1947 O  OD1   . ASN C 190 ? 0.2051 0.1636 0.1055 -0.0024 0.0309  -0.0244 190  ASN A OD1   
1948 N  ND2   . ASN C 190 ? 0.2105 0.2283 0.0950 -0.0193 0.0308  -0.0476 190  ASN A ND2   
1949 N  N     . ALA C 191 ? 0.1744 0.1649 0.0981 -0.0160 0.0072  -0.0121 191  ALA A N     
1950 C  CA    . ALA C 191 ? 0.1755 0.1531 0.1271 -0.0164 0.0232  0.0117  191  ALA A CA    
1951 C  C     . ALA C 191 ? 0.1632 0.1528 0.0856 -0.0214 0.0071  -0.0171 191  ALA A C     
1952 O  O     . ALA C 191 ? 0.1937 0.1457 0.1251 -0.0112 0.0290  -0.0199 191  ALA A O     
1953 C  CB    . ALA C 191 ? 0.1837 0.1580 0.1452 -0.0257 0.0285  -0.0160 191  ALA A CB    
1954 N  N     . ALA C 192 ? 0.1903 0.1815 0.0841 -0.0270 0.0097  0.0029  192  ALA A N     
1955 C  CA    . ALA C 192 ? 0.1899 0.1607 0.0832 -0.0155 0.0112  -0.0122 192  ALA A CA    
1956 C  C     . ALA C 192 ? 0.1809 0.1652 0.0818 -0.0002 0.0016  -0.0178 192  ALA A C     
1957 O  O     . ALA C 192 ? 0.1984 0.1687 0.0985 0.0047  -0.0042 -0.0191 192  ALA A O     
1958 C  CB    . ALA C 192 ? 0.1947 0.1847 0.0785 -0.0088 0.0243  -0.0149 192  ALA A CB    
1959 N  N     . GLN C 193 ? 0.1684 0.1634 0.0936 -0.0175 0.0243  -0.0194 193  GLN A N     
1960 C  CA    . GLN C 193 ? 0.1889 0.1587 0.1207 -0.0149 0.0050  -0.0181 193  GLN A CA    
1961 C  C     . GLN C 193 ? 0.1627 0.1389 0.1148 -0.0305 -0.0104 -0.0162 193  GLN A C     
1962 O  O     . GLN C 193 ? 0.1738 0.1435 0.1336 -0.0049 -0.0100 -0.0168 193  GLN A O     
1963 C  CB    . GLN C 193 ? 0.1827 0.2065 0.1936 -0.0255 0.0121  -0.0673 193  GLN A CB    
1964 C  CG    . GLN C 193 ? 0.1981 0.2606 0.1715 -0.0266 0.0314  -0.0332 193  GLN A CG    
1965 C  CD    . GLN C 193 ? 0.1971 0.2077 0.1650 -0.0397 0.0308  -0.0331 193  GLN A CD    
1966 O  OE1   . GLN C 193 ? 0.2381 0.2232 0.1399 -0.0328 0.0339  -0.0236 193  GLN A OE1   
1967 N  NE2   . GLN C 193 ? 0.2339 0.3046 0.1704 -0.1320 -0.0098 -0.0035 193  GLN A NE2   
1968 N  N     . LEU C 194 ? 0.1642 0.1508 0.1099 0.0033  0.0109  -0.0092 194  LEU A N     
1969 C  CA    . LEU C 194 ? 0.1958 0.1388 0.1065 0.0244  0.0006  -0.0144 194  LEU A CA    
1970 C  C     . LEU C 194 ? 0.1803 0.1323 0.1110 0.0133  0.0058  -0.0183 194  LEU A C     
1971 O  O     . LEU C 194 ? 0.2071 0.1352 0.0947 0.0160  0.0141  -0.0074 194  LEU A O     
1972 C  CB    . LEU C 194 ? 0.2344 0.1654 0.0845 0.0162  -0.0127 0.0044  194  LEU A CB    
1973 C  CG    . LEU C 194 ? 0.2606 0.2530 0.0957 -0.0254 -0.0019 -0.0180 194  LEU A CG    
1974 C  CD1   . LEU C 194 ? 0.2801 0.2433 0.1061 0.0060  -0.0438 -0.0321 194  LEU A CD1   
1975 C  CD2   . LEU C 194 ? 0.4948 0.4288 0.1671 -0.2054 -0.0369 0.1049  194  LEU A CD2   
1976 N  N     . ASP C 195 ? 0.1621 0.1529 0.1177 -0.0059 0.0229  -0.0146 195  ASP A N     
1977 C  CA    . ASP C 195 ? 0.1642 0.1386 0.1362 -0.0126 0.0081  -0.0139 195  ASP A CA    
1978 C  C     . ASP C 195 ? 0.1704 0.1390 0.1053 -0.0117 -0.0004 -0.0307 195  ASP A C     
1979 O  O     . ASP C 195 ? 0.1929 0.1411 0.1258 0.0011  0.0117  -0.0267 195  ASP A O     
1980 C  CB    . ASP C 195 ? 0.1668 0.1498 0.2030 -0.0019 -0.0024 -0.0570 195  ASP A CB    
1981 C  CG    . ASP C 195 ? 0.1742 0.2035 0.1428 0.0176  0.0003  -0.0549 195  ASP A CG    
1982 O  OD1   . ASP C 195 ? 0.1922 0.2945 0.1702 0.0212  0.0212  -0.0296 195  ASP A OD1   
1983 O  OD2   . ASP C 195 ? 0.2798 0.2279 0.1763 0.0260  -0.0426 -0.0223 195  ASP A OD2   
1984 N  N     . ALA C 196 ? 0.1819 0.1610 0.0982 -0.0156 0.0047  -0.0154 196  ALA A N     
1985 C  CA    . ALA C 196 ? 0.2212 0.1666 0.0861 -0.0278 0.0047  -0.0231 196  ALA A CA    
1986 C  C     . ALA C 196 ? 0.1687 0.1493 0.0849 0.0025  0.0135  -0.0150 196  ALA A C     
1987 O  O     . ALA C 196 ? 0.1918 0.1533 0.0909 0.0112  0.0152  -0.0129 196  ALA A O     
1988 C  CB    . ALA C 196 ? 0.2514 0.1731 0.0971 -0.0158 0.0342  -0.0196 196  ALA A CB    
1989 N  N     . LEU C 197 ? 0.1649 0.1675 0.0660 -0.0025 0.0127  -0.0188 197  LEU A N     
1990 C  CA    . LEU C 197 ? 0.1477 0.1540 0.0801 0.0117  0.0099  -0.0116 197  LEU A CA    
1991 C  C     . LEU C 197 ? 0.1727 0.1229 0.0700 0.0128  0.0143  -0.0064 197  LEU A C     
1992 O  O     . LEU C 197 ? 0.1702 0.1449 0.0924 0.0252  0.0011  -0.0227 197  LEU A O     
1993 C  CB    . LEU C 197 ? 0.1529 0.1530 0.1026 0.0028  -0.0060 -0.0106 197  LEU A CB    
1994 C  CG    . LEU C 197 ? 0.1382 0.1307 0.1158 -0.0058 -0.0110 -0.0047 197  LEU A CG    
1995 C  CD1   . LEU C 197 ? 0.1895 0.1335 0.1392 -0.0137 0.0118  -0.0045 197  LEU A CD1   
1996 C  CD2   . LEU C 197 ? 0.1559 0.1759 0.1064 0.0266  -0.0024 -0.0045 197  LEU A CD2   
1997 N  N     . ALA C 198 ? 0.1589 0.1589 0.0724 0.0048  0.0152  -0.0012 198  ALA A N     
1998 C  CA    . ALA C 198 ? 0.1729 0.1492 0.0718 0.0031  0.0127  -0.0001 198  ALA A CA    
1999 C  C     . ALA C 198 ? 0.1559 0.1453 0.0880 0.0006  0.0044  0.0000  198  ALA A C     
2000 O  O     . ALA C 198 ? 0.1640 0.1988 0.1156 0.0196  0.0090  -0.0382 198  ALA A O     
2001 C  CB    . ALA C 198 ? 0.1855 0.1482 0.1284 -0.0102 0.0264  0.0101  198  ALA A CB    
2002 N  N     . HIS C 199 ? 0.1712 0.1419 0.0958 -0.0118 -0.0177 -0.0039 199  HIS A N     
2003 C  CA    . HIS C 199 ? 0.1773 0.1385 0.1005 -0.0205 -0.0159 0.0055  199  HIS A CA    
2004 C  C     . HIS C 199 ? 0.1666 0.1324 0.1080 -0.0045 0.0088  -0.0184 199  HIS A C     
2005 O  O     . HIS C 199 ? 0.1940 0.1381 0.1295 0.0190  -0.0012 -0.0296 199  HIS A O     
2006 C  CB    . HIS C 199 ? 0.1925 0.1868 0.1022 -0.0248 -0.0275 -0.0141 199  HIS A CB    
2007 C  CG    . HIS C 199 ? 0.1762 0.1852 0.1146 -0.0098 -0.0359 -0.0199 199  HIS A CG    
2008 N  ND1   . HIS C 199 ? 0.1799 0.2069 0.1954 -0.0129 -0.0236 -0.0185 199  HIS A ND1   
2009 C  CD2   . HIS C 199 ? 0.1965 0.1795 0.1528 -0.0193 0.0132  -0.0300 199  HIS A CD2   
2010 C  CE1   . HIS C 199 ? 0.1858 0.2266 0.1925 -0.0289 -0.0126 -0.0364 199  HIS A CE1   
2011 N  NE2   . HIS C 199 ? 0.2127 0.2119 0.1727 -0.0337 -0.0067 -0.0171 199  HIS A NE2   
2012 N  N     . ALA C 200 ? 0.1644 0.1502 0.0775 -0.0132 0.0032  0.0049  200  ALA A N     
2013 C  CA    . ALA C 200 ? 0.1680 0.1510 0.0886 -0.0129 0.0122  -0.0098 200  ALA A CA    
2014 C  C     . ALA C 200 ? 0.1652 0.1433 0.0865 0.0108  -0.0022 -0.0082 200  ALA A C     
2015 O  O     . ALA C 200 ? 0.1665 0.1436 0.0920 0.0055  0.0054  -0.0015 200  ALA A O     
2016 C  CB    . ALA C 200 ? 0.1833 0.1727 0.1120 -0.0226 0.0403  -0.0209 200  ALA A CB    
2017 N  N     . LEU C 201 ? 0.1513 0.1472 0.0801 -0.0058 -0.0046 -0.0072 201  LEU A N     
2018 C  CA    . LEU C 201 ? 0.1489 0.1496 0.0817 0.0080  0.0111  -0.0081 201  LEU A CA    
2019 C  C     . LEU C 201 ? 0.1520 0.1311 0.0846 0.0033  0.0000  -0.0033 201  LEU A C     
2020 O  O     . LEU C 201 ? 0.1737 0.1419 0.1043 0.0008  0.0126  -0.0222 201  LEU A O     
2021 C  CB    . LEU C 201 ? 0.1389 0.1311 0.0848 -0.0071 0.0145  0.0025  201  LEU A CB    
2022 C  CG    . LEU C 201 ? 0.1366 0.1203 0.1041 -0.0194 0.0020  0.0035  201  LEU A CG    
2023 C  CD1   . LEU C 201 ? 0.1500 0.1418 0.1104 -0.0062 0.0078  0.0126  201  LEU A CD1   
2024 C  CD2   . LEU C 201 ? 0.1529 0.1625 0.1014 -0.0273 -0.0160 -0.0220 201  LEU A CD2   
2025 N  N     . LEU C 202 ? 0.1413 0.1415 0.0905 -0.0043 0.0068  0.0051  202  LEU A N     
2026 C  CA    . LEU C 202 ? 0.1406 0.1613 0.0978 0.0031  0.0083  0.0113  202  LEU A CA    
2027 C  C     . LEU C 202 ? 0.1447 0.1375 0.1013 -0.0043 -0.0012 -0.0055 202  LEU A C     
2028 O  O     . LEU C 202 ? 0.1783 0.1356 0.1359 0.0024  0.0098  -0.0093 202  LEU A O     
2029 C  CB    . LEU C 202 ? 0.1531 0.1681 0.1194 -0.0026 0.0150  0.0122  202  LEU A CB    
2030 C  CG    . LEU C 202 ? 0.1761 0.1487 0.1070 -0.0244 0.0153  -0.0017 202  LEU A CG    
2031 C  CD1   . LEU C 202 ? 0.1347 0.1583 0.1629 -0.0063 0.0102  0.0086  202  LEU A CD1   
2032 C  CD2   . LEU C 202 ? 0.1989 0.1682 0.1131 -0.0177 0.0160  -0.0100 202  LEU A CD2   
2033 N  N     . GLU C 203 ? 0.1517 0.1671 0.0865 0.0119  0.0076  0.0045  203  GLU A N     
2034 C  CA    . GLU C 203 ? 0.1765 0.1483 0.0981 -0.0027 -0.0109 -0.0003 203  GLU A CA    
2035 C  C     . GLU C 203 ? 0.1605 0.1494 0.0910 0.0172  0.0247  -0.0043 203  GLU A C     
2036 O  O     . GLU C 203 ? 0.1898 0.1494 0.1133 0.0208  -0.0085 -0.0048 203  GLU A O     
2037 C  CB    . GLU C 203 ? 0.1801 0.1829 0.0964 -0.0110 -0.0117 -0.0070 203  GLU A CB    
2038 C  CG    . GLU C 203 ? 0.1918 0.1944 0.2095 -0.0320 -0.0465 -0.0171 203  GLU A CG    
2039 C  CD    . GLU C 203 ? 0.2313 0.2104 0.1953 -0.0251 -0.0741 -0.0250 203  GLU A CD    
2040 O  OE1   . GLU C 203 ? 0.3376 0.2497 0.1770 -0.0212 -0.0321 -0.0245 203  GLU A OE1   
2041 O  OE2   . GLU C 203 ? 0.2152 0.1937 0.3558 -0.0149 -0.0573 -0.0503 203  GLU A OE2   
2042 N  N     . ILE C 204 ? 0.1588 0.1515 0.0892 -0.0003 0.0128  -0.0074 204  ILE A N     
2043 C  CA    . ILE C 204 ? 0.1761 0.1609 0.1139 -0.0089 0.0212  -0.0194 204  ILE A CA    
2044 C  C     . ILE C 204 ? 0.1878 0.1523 0.0801 -0.0123 -0.0042 -0.0040 204  ILE A C     
2045 O  O     . ILE C 204 ? 0.2010 0.1593 0.0901 -0.0029 0.0006  0.0011  204  ILE A O     
2046 C  CB    . ILE C 204 ? 0.1743 0.1717 0.1103 -0.0229 0.0246  -0.0113 204  ILE A CB    
2047 C  CG1   . ILE C 204 ? 0.2310 0.1641 0.1567 -0.0043 0.0483  -0.0442 204  ILE A CG1   
2048 C  CG2   . ILE C 204 ? 0.2034 0.1575 0.1426 -0.0235 0.0354  -0.0243 204  ILE A CG2   
2049 C  CD1   . ILE C 204 ? 0.2446 0.1867 0.1874 0.0340  0.0567  -0.0063 204  ILE A CD1   
2050 N  N     . PRO C 205 ? 0.1662 0.1432 0.0889 0.0088  0.0023  -0.0069 205  PRO A N     
2051 C  CA    . PRO C 205 ? 0.1765 0.1676 0.0770 0.0291  -0.0138 -0.0151 205  PRO A CA    
2052 C  C     . PRO C 205 ? 0.1668 0.1288 0.1069 0.0036  0.0112  0.0120  205  PRO A C     
2053 O  O     . PRO C 205 ? 0.1856 0.1297 0.1042 0.0134  0.0066  0.0036  205  PRO A O     
2054 C  CB    . PRO C 205 ? 0.1910 0.1528 0.0901 0.0324  0.0076  -0.0002 205  PRO A CB    
2055 C  CG    . PRO C 205 ? 0.2593 0.1573 0.0920 0.0670  -0.0097 -0.0240 205  PRO A CG    
2056 C  CD    . PRO C 205 ? 0.1932 0.1554 0.0828 0.0206  0.0105  -0.0018 205  PRO A CD    
2057 N  N     . ARG C 206 ? 0.1667 0.1501 0.1025 0.0040  0.0003  -0.0056 206  ARG A N     
2058 C  CA    . ARG C 206 ? 0.1751 0.1500 0.0938 0.0084  -0.0124 0.0045  206  ARG A CA    
2059 C  C     . ARG C 206 ? 0.1909 0.1627 0.0950 0.0226  0.0051  0.0052  206  ARG A C     
2060 O  O     . ARG C 206 ? 0.2180 0.1536 0.1085 0.0368  -0.0074 -0.0069 206  ARG A O     
2061 C  CB    . ARG C 206 ? 0.1800 0.1610 0.1053 -0.0080 -0.0004 -0.0036 206  ARG A CB    
2062 C  CG    . ARG C 206 ? 0.2008 0.1545 0.0983 -0.0114 0.0058  -0.0078 206  ARG A CG    
2063 C  CD    . ARG C 206 ? 0.1981 0.1382 0.1070 0.0004  -0.0230 0.0012  206  ARG A CD    
2064 N  NE    . ARG C 206 ? 0.1725 0.1703 0.1100 0.0022  0.0146  0.0080  206  ARG A NE    
2065 C  CZ    . ARG C 206 ? 0.1628 0.1617 0.1247 -0.0022 0.0034  0.0081  206  ARG A CZ    
2066 N  NH1   . ARG C 206 ? 0.1624 0.2087 0.1433 -0.0107 -0.0228 0.0061  206  ARG A NH1   
2067 N  NH2   . ARG C 206 ? 0.2015 0.1857 0.1225 0.0029  0.0227  0.0109  206  ARG A NH2   
2068 N  N     . PHE C 207 ? 0.1931 0.1660 0.0946 0.0243  0.0077  0.0017  207  PHE A N     
2069 C  CA    . PHE C 207 ? 0.2023 0.1642 0.0817 0.0137  -0.0059 -0.0100 207  PHE A CA    
2070 C  C     . PHE C 207 ? 0.2146 0.1561 0.0889 0.0225  -0.0050 -0.0070 207  PHE A C     
2071 O  O     . PHE C 207 ? 0.2303 0.1717 0.0899 0.0189  0.0005  0.0082  207  PHE A O     
2072 C  CB    . PHE C 207 ? 0.2549 0.1736 0.0830 0.0390  0.0080  -0.0122 207  PHE A CB    
2073 C  CG    . PHE C 207 ? 0.3128 0.2046 0.0853 -0.0245 0.0059  -0.0011 207  PHE A CG    
2074 C  CD1   . PHE C 207 ? 0.3983 0.2053 0.0935 0.0239  -0.0444 0.0066  207  PHE A CD1   
2075 C  CD2   . PHE C 207 ? 0.3486 0.3813 0.1184 -0.0909 0.0380  -0.0025 207  PHE A CD2   
2076 C  CE1   . PHE C 207 ? 0.4893 0.2057 0.1006 0.0008  -0.0383 0.0124  207  PHE A CE1   
2077 C  CE2   . PHE C 207 ? 0.4330 0.4348 0.1161 -0.1338 0.0327  0.0143  207  PHE A CE2   
2078 C  CZ    . PHE C 207 ? 0.5262 0.3451 0.1479 -0.0839 0.0034  0.0359  207  PHE A CZ    
2079 N  N     . SER C 208 ? 0.1945 0.1686 0.0835 0.0039  0.0099  -0.0099 208  SER A N     
2080 C  CA    . SER C 208 ? 0.1864 0.1599 0.1017 0.0134  0.0168  -0.0036 208  SER A CA    
2081 C  C     . SER C 208 ? 0.2084 0.1523 0.0812 0.0191  0.0052  0.0027  208  SER A C     
2082 O  O     . SER C 208 ? 0.2350 0.1485 0.1014 0.0231  0.0001  0.0048  208  SER A O     
2083 C  CB    . SER C 208 ? 0.2087 0.1461 0.0990 0.0163  -0.0087 -0.0201 208  SER A CB    
2084 O  OG    . SER C 208 ? 0.2203 0.1482 0.1141 0.0137  0.0173  -0.0234 208  SER A OG    
2085 N  N     . TYR C 209 ? 0.1948 0.1789 0.0830 0.0164  0.0076  0.0005  209  TYR A N     
2086 C  CA    . TYR C 209 ? 0.1907 0.1751 0.0902 0.0298  0.0028  0.0097  209  TYR A CA    
2087 C  C     . TYR C 209 ? 0.2286 0.1586 0.1099 0.0412  -0.0139 -0.0079 209  TYR A C     
2088 O  O     . TYR C 209 ? 0.2234 0.1567 0.1303 0.0440  0.0162  0.0155  209  TYR A O     
2089 C  CB    . TYR C 209 ? 0.1791 0.1480 0.1205 0.0165  0.0185  0.0046  209  TYR A CB    
2090 C  CG    . TYR C 209 ? 0.1762 0.1633 0.1149 0.0218  0.0084  -0.0034 209  TYR A CG    
2091 C  CD1   . TYR C 209 ? 0.1971 0.1574 0.0910 0.0299  0.0097  0.0051  209  TYR A CD1   
2092 C  CD2   . TYR C 209 ? 0.1853 0.2683 0.2125 -0.0063 0.0328  -0.0948 209  TYR A CD2   
2093 C  CE1   . TYR C 209 ? 0.1670 0.2001 0.0889 0.0212  -0.0114 -0.0140 209  TYR A CE1   
2094 C  CE2   . TYR C 209 ? 0.1933 0.2289 0.2709 -0.0034 0.0473  -0.0948 209  TYR A CE2   
2095 C  CZ    . TYR C 209 ? 0.1713 0.1952 0.1974 0.0209  -0.0069 -0.0478 209  TYR A CZ    
2096 O  OH    . TYR C 209 ? 0.1915 0.2263 0.2478 -0.0041 0.0463  -0.0781 209  TYR A OH    
2097 N  N     . ALA C 210 ? 0.2155 0.1820 0.0839 0.0121  -0.0124 0.0151  210  ALA A N     
2098 C  CA    . ALA C 210 ? 0.2422 0.1714 0.1268 0.0403  -0.0298 0.0112  210  ALA A CA    
2099 C  C     . ALA C 210 ? 0.2645 0.1739 0.1126 0.0515  -0.0163 0.0097  210  ALA A C     
2100 O  O     . ALA C 210 ? 0.2854 0.2013 0.1925 0.0674  -0.0280 0.0418  210  ALA A O     
2101 C  CB    . ALA C 210 ? 0.2609 0.1948 0.1551 0.0189  -0.0664 0.0079  210  ALA A CB    
2102 N  N     . THR C 211 ? 0.2567 0.1837 0.1391 0.0209  -0.0153 0.0146  211  THR A N     
2103 C  CA    . THR C 211 ? 0.2598 0.2170 0.1280 0.0166  -0.0109 0.0063  211  THR A CA    
2104 C  C     . THR C 211 ? 0.2747 0.2207 0.1308 0.0042  -0.0178 0.0289  211  THR A C     
2105 O  O     . THR C 211 ? 0.3398 0.2637 0.1480 -0.0329 -0.0483 0.0635  211  THR A O     
2106 C  CB    . THR C 211 ? 0.2674 0.2150 0.1471 0.0311  -0.0114 -0.0033 211  THR A CB    
2107 O  OG1   . THR C 211 ? 0.2671 0.2099 0.1470 0.0335  0.0061  0.0181  211  THR A OG1   
2108 C  CG2   . THR C 211 ? 0.2779 0.2742 0.1559 0.0107  -0.0475 -0.0136 211  THR A CG2   
2109 N  N     . ARG C 212 ? 0.2675 0.2087 0.1179 0.0055  -0.0130 0.0131  212  ARG A N     
2110 C  CA    . ARG C 212 ? 0.2919 0.2367 0.1458 -0.0185 -0.0338 0.0230  212  ARG A CA    
2111 C  C     . ARG C 212 ? 0.3837 0.2187 0.1571 -0.0367 -0.0143 0.0631  212  ARG A C     
2112 O  O     . ARG C 212 ? 0.3835 0.3063 0.3372 -0.0782 -0.0521 0.1713  212  ARG A O     
2113 C  CB    . ARG C 212 ? 0.2726 0.2795 0.1304 -0.0285 -0.0187 0.0402  212  ARG A CB    
2114 C  CG    . ARG C 212 ? 0.2749 0.2760 0.1224 -0.0328 0.0019  0.0334  212  ARG A CG    
2115 C  CD    . ARG C 212 ? 0.2501 0.2991 0.1315 -0.0044 0.0085  0.0058  212  ARG A CD    
2116 N  NE    . ARG C 212 ? 0.2499 0.2469 0.1585 0.0203  0.0362  0.0047  212  ARG A NE    
2117 C  CZ    . ARG C 212 ? 0.2625 0.1696 0.1893 -0.0174 0.0144  0.0329  212  ARG A CZ    
2118 N  NH1   . ARG C 212 ? 0.2554 0.1857 0.1642 0.0031  0.0481  0.0195  212  ARG A NH1   
2119 N  NH2   . ARG C 212 ? 0.2915 0.1746 0.2251 -0.0354 0.0565  0.0309  212  ARG A NH2   
2120 N  N     . GLY C 213 ? 0.3935 0.1940 0.1780 -0.0074 -0.0355 0.0066  213  GLY A N     
2121 C  CA    . GLY C 213 ? 0.5366 0.2055 0.4081 0.0267  -0.0449 -0.0114 213  GLY A CA    
2122 C  C     . GLY C 213 ? 0.6747 0.1976 0.6003 0.0698  -0.1859 0.0453  213  GLY A C     
2123 O  O     . GLY C 213 ? 0.7728 0.3032 0.6343 0.0224  -0.3471 0.0506  213  GLY A O     
2124 N  N     . ALA C 223 ? 0.6586 1.2436 0.2980 0.1043  -0.3140 -0.1418 223  ALA A N     
2125 C  CA    . ALA C 223 ? 0.5032 0.8107 0.2783 0.0024  -0.1005 -0.1908 223  ALA A CA    
2126 C  C     . ALA C 223 ? 0.3384 0.6933 0.2080 0.0207  -0.0992 -0.0009 223  ALA A C     
2127 O  O     . ALA C 223 ? 0.3796 0.6150 0.2481 0.0045  -0.0668 0.0652  223  ALA A O     
2128 C  CB    . ALA C 223 ? 0.6894 0.8358 0.5527 -0.2225 -0.0340 -0.1952 223  ALA A CB    
2129 N  N     . LEU C 224 ? 0.3280 0.4563 0.1969 0.0789  -0.0970 0.0559  224  LEU A N     
2130 C  CA    . LEU C 224 ? 0.2795 0.4604 0.1464 0.0252  -0.0324 0.0845  224  LEU A CA    
2131 C  C     . LEU C 224 ? 0.2567 0.4048 0.1235 0.0197  -0.0179 0.0202  224  LEU A C     
2132 O  O     . LEU C 224 ? 0.3264 0.3322 0.1334 0.0378  0.0205  0.0347  224  LEU A O     
2133 C  CB    . LEU C 224 ? 0.4365 0.4420 0.2118 0.0719  -0.0792 0.0553  224  LEU A CB    
2134 C  CG    . LEU C 224 ? 0.4596 0.5434 0.2722 0.1054  -0.0458 0.1743  224  LEU A CG    
2135 C  CD1   . LEU C 224 ? 0.5734 0.5438 0.3756 0.1210  -0.0936 0.2269  224  LEU A CD1   
2136 C  CD2   . LEU C 224 ? 0.5104 0.5370 0.2747 0.1912  0.0120  0.1583  224  LEU A CD2   
2137 N  N     . PHE C 225 ? 0.2805 0.2612 0.1165 0.0344  -0.0195 0.0310  225  PHE A N     
2138 C  CA    . PHE C 225 ? 0.2525 0.2815 0.1129 -0.0029 -0.0088 0.0364  225  PHE A CA    
2139 C  C     . PHE C 225 ? 0.2846 0.2423 0.1425 0.0160  0.0452  0.0335  225  PHE A C     
2140 O  O     . PHE C 225 ? 0.3136 0.2312 0.1809 0.0047  0.0021  0.0184  225  PHE A O     
2141 C  CB    . PHE C 225 ? 0.2486 0.3251 0.1079 0.0093  0.0089  0.0363  225  PHE A CB    
2142 C  CG    . PHE C 225 ? 0.2604 0.2992 0.0866 0.0019  0.0070  0.0347  225  PHE A CG    
2143 C  CD1   . PHE C 225 ? 0.2942 0.3096 0.0960 -0.0038 0.0073  0.0709  225  PHE A CD1   
2144 C  CD2   . PHE C 225 ? 0.2607 0.3050 0.1553 0.0162  -0.0046 -0.0187 225  PHE A CD2   
2145 C  CE1   . PHE C 225 ? 0.2696 0.2537 0.1314 -0.0188 0.0186  0.0608  225  PHE A CE1   
2146 C  CE2   . PHE C 225 ? 0.2706 0.2370 0.1862 0.0138  -0.0110 -0.0128 225  PHE A CE2   
2147 C  CZ    . PHE C 225 ? 0.2639 0.2393 0.1562 -0.0094 0.0561  0.0252  225  PHE A CZ    
2148 N  N     . ARG C 226 ? 0.2532 0.2637 0.1649 0.0181  0.0044  0.0260  226  ARG A N     
2149 C  CA    . ARG C 226 ? 0.2643 0.2752 0.1810 0.0016  0.0018  0.0431  226  ARG A CA    
2150 C  C     . ARG C 226 ? 0.2469 0.2196 0.1594 0.0019  0.0406  0.0194  226  ARG A C     
2151 O  O     . ARG C 226 ? 0.2675 0.2300 0.1479 -0.0215 0.0082  0.0034  226  ARG A O     
2152 C  CB    . ARG C 226 ? 0.3163 0.2937 0.1914 0.0080  0.0250  0.0585  226  ARG A CB    
2153 C  CG    . ARG C 226 ? 0.4126 0.3045 0.1688 0.0485  0.0143  0.0578  226  ARG A CG    
2154 C  CD    . ARG C 226 ? 0.6027 0.3861 0.1376 0.0334  -0.0202 0.0823  226  ARG A CD    
2155 N  NE    . ARG C 226 ? 0.7210 0.4476 0.1103 -0.0161 -0.0060 0.0357  226  ARG A NE    
2156 C  CZ    . ARG C 226 ? 0.5894 0.5256 0.0655 0.0396  0.0916  -0.0381 226  ARG A CZ    
2157 N  NH1   . ARG C 226 ? 0.6532 0.3686 0.2653 0.0543  0.1899  0.0055  226  ARG A NH1   
2158 N  NH2   . ARG C 226 ? 0.3818 0.4955 0.1755 0.0438  0.0800  -0.0409 226  ARG A NH2   
2159 N  N     . PHE C 227 ? 0.2409 0.1779 0.1848 0.0199  0.0434  0.0096  227  PHE A N     
2160 C  CA    . PHE C 227 ? 0.2336 0.1683 0.1672 0.0156  0.0506  -0.0129 227  PHE A CA    
2161 C  C     . PHE C 227 ? 0.2341 0.1708 0.1486 0.0008  0.0388  -0.0059 227  PHE A C     
2162 O  O     . PHE C 227 ? 0.3046 0.1947 0.1553 -0.0060 0.0541  0.0137  227  PHE A O     
2163 C  CB    . PHE C 227 ? 0.2751 0.1799 0.1334 0.0049  0.0258  -0.0024 227  PHE A CB    
2164 C  CG    . PHE C 227 ? 0.2973 0.1741 0.1398 0.0161  0.0293  0.0023  227  PHE A CG    
2165 C  CD1   . PHE C 227 ? 0.2211 0.1882 0.1436 0.0218  0.0177  0.0174  227  PHE A CD1   
2166 C  CD2   . PHE C 227 ? 0.3290 0.1706 0.1956 0.0085  0.0904  -0.0088 227  PHE A CD2   
2167 C  CE1   . PHE C 227 ? 0.2155 0.1920 0.1514 -0.0125 0.0161  -0.0104 227  PHE A CE1   
2168 C  CE2   . PHE C 227 ? 0.3818 0.1814 0.1560 0.0399  0.0521  0.0070  227  PHE A CE2   
2169 C  CZ    . PHE C 227 ? 0.2659 0.1909 0.1681 -0.0213 0.0337  -0.0030 227  PHE A CZ    
2170 N  N     . LYS C 228 ? 0.2323 0.1612 0.1385 -0.0050 0.0512  -0.0205 228  LYS A N     
2171 C  CA    . LYS C 228 ? 0.2390 0.1739 0.1521 -0.0011 0.0464  -0.0261 228  LYS A CA    
2172 C  C     . LYS C 228 ? 0.2386 0.1693 0.1583 -0.0087 0.0636  -0.0149 228  LYS A C     
2173 O  O     . LYS C 228 ? 0.2612 0.2293 0.1871 -0.0279 0.0865  -0.0245 228  LYS A O     
2174 C  CB    . LYS C 228 ? 0.2540 0.1728 0.1592 -0.0142 0.0016  -0.0275 228  LYS A CB    
2175 C  CG    . LYS C 228 ? 0.2528 0.2139 0.1322 -0.0169 0.0057  -0.0096 228  LYS A CG    
2176 C  CD    . LYS C 228 ? 0.3033 0.2699 0.1743 -0.0021 -0.0245 0.0391  228  LYS A CD    
2177 C  CE    . LYS C 228 ? 0.3159 0.3118 0.2554 -0.0444 -0.0691 0.0775  228  LYS A CE    
2178 N  NZ    . LYS C 228 ? 0.4285 0.3580 0.2732 -0.1148 -0.1078 0.1476  228  LYS A NZ    
2179 N  N     . VAL C 229 ? 0.2386 0.1711 0.1827 -0.0398 0.0331  -0.0162 229  VAL A N     
2180 C  CA    . VAL C 229 ? 0.2253 0.1568 0.2020 -0.0219 0.0636  -0.0344 229  VAL A CA    
2181 C  C     . VAL C 229 ? 0.1856 0.1845 0.1876 -0.0032 0.0418  -0.0272 229  VAL A C     
2182 O  O     . VAL C 229 ? 0.1962 0.2303 0.2176 -0.0297 0.0534  -0.0470 229  VAL A O     
2183 C  CB    . VAL C 229 ? 0.2869 0.1751 0.3076 0.0026  0.0077  -0.0357 229  VAL A CB    
2184 C  CG1   . VAL C 229 ? 0.2773 0.2411 0.4856 -0.0031 0.1088  -0.1821 229  VAL A CG1   
2185 C  CG2   . VAL C 229 ? 0.3582 0.1436 0.3851 -0.0334 -0.0063 0.0292  229  VAL A CG2   
2186 N  N     . PHE C 230 ? 0.2125 0.1658 0.1704 0.0031  0.0544  -0.0146 230  PHE A N     
2187 C  CA    . PHE C 230 ? 0.1929 0.1744 0.1675 -0.0238 0.0504  -0.0111 230  PHE A CA    
2188 C  C     . PHE C 230 ? 0.2452 0.1809 0.1771 -0.0331 0.0656  -0.0123 230  PHE A C     
2189 O  O     . PHE C 230 ? 0.2763 0.1735 0.1836 -0.0220 0.0714  -0.0033 230  PHE A O     
2190 C  CB    . PHE C 230 ? 0.2057 0.2051 0.1539 -0.0147 0.0511  -0.0260 230  PHE A CB    
2191 C  CG    . PHE C 230 ? 0.2025 0.1959 0.1540 -0.0325 0.0413  -0.0125 230  PHE A CG    
2192 C  CD1   . PHE C 230 ? 0.1801 0.2582 0.1809 -0.0669 0.0214  0.0085  230  PHE A CD1   
2193 C  CD2   . PHE C 230 ? 0.2871 0.1691 0.1823 -0.0453 0.0726  -0.0147 230  PHE A CD2   
2194 C  CE1   . PHE C 230 ? 0.2112 0.2784 0.1750 -0.0771 0.0188  0.0099  230  PHE A CE1   
2195 C  CE2   . PHE C 230 ? 0.3049 0.2023 0.1931 -0.0462 0.0595  -0.0299 230  PHE A CE2   
2196 C  CZ    . PHE C 230 ? 0.2660 0.2835 0.1999 -0.0675 0.0596  -0.0116 230  PHE A CZ    
2197 N  N     . HIS C 231 ? 0.2510 0.1803 0.2172 -0.0533 0.0821  -0.0345 231  HIS A N     
2198 C  CA    . HIS C 231 ? 0.2727 0.1991 0.2196 -0.0582 0.0997  -0.0275 231  HIS A CA    
2199 C  C     . HIS C 231 ? 0.3205 0.2088 0.2264 -0.0642 0.1049  -0.0265 231  HIS A C     
2200 O  O     . HIS C 231 ? 0.4005 0.2200 0.2391 -0.0851 0.1148  -0.0197 231  HIS A O     
2201 C  CB    . HIS C 231 ? 0.3273 0.1761 0.1986 -0.0490 0.0589  -0.0236 231  HIS A CB    
2202 C  CG    . HIS C 231 ? 0.4943 0.2105 0.1994 -0.0316 0.0817  -0.0214 231  HIS A CG    
2203 N  ND1   . HIS C 231 ? 0.7585 0.2379 0.2269 0.0142  -0.0255 -0.0716 231  HIS A ND1   
2204 C  CD2   . HIS C 231 ? 0.3502 0.2589 0.1850 -0.0338 0.0634  -0.0313 231  HIS A CD2   
2205 C  CE1   . HIS C 231 ? 0.6721 0.2318 0.2123 -0.0354 0.0554  -0.0372 231  HIS A CE1   
2206 N  NE2   . HIS C 231 ? 0.3599 0.2244 0.2020 -0.0935 0.0891  -0.0330 231  HIS A NE2   
2207 N  N     . ARG C 232 ? 0.2562 0.2126 0.2073 -0.0230 0.0773  -0.0365 232  ARG A N     
2208 C  CA    . ARG C 232 ? 0.2477 0.2700 0.1908 0.0001  0.0470  -0.0097 232  ARG A CA    
2209 C  C     . ARG C 232 ? 0.2671 0.1851 0.1820 -0.0118 0.0639  -0.0282 232  ARG A C     
2210 O  O     . ARG C 232 ? 0.3213 0.2223 0.1930 -0.0837 0.1077  -0.0489 232  ARG A O     
2211 C  CB    . ARG C 232 ? 0.2749 0.2508 0.1936 -0.0296 0.0542  0.0021  232  ARG A CB    
2212 C  CG    . ARG C 232 ? 0.2544 0.2672 0.3390 -0.0325 0.0124  -0.0235 232  ARG A CG    
2213 C  CD    . ARG C 232 ? 0.2813 0.3114 0.2887 -0.0975 0.0307  0.0103  232  ARG A CD    
2214 N  NE    . ARG C 232 ? 0.4724 0.3426 0.2880 -0.0298 0.0090  -0.0081 232  ARG A NE    
2215 C  CZ    . ARG C 232 ? 0.5862 0.3950 0.2641 -0.1519 -0.0204 0.0515  232  ARG A CZ    
2216 N  NH1   . ARG C 232 ? 0.4786 0.6454 0.7019 -0.1439 -0.1391 0.4096  232  ARG A NH1   
2217 N  NH2   . ARG C 232 ? 0.9296 0.7181 0.2212 -0.1647 -0.0233 0.0206  232  ARG A NH2   
2218 N  N     . ASP C 233 ? 0.2390 0.2186 0.2192 -0.0120 0.0585  -0.0364 233  ASP A N     
2219 C  CA    . ASP C 233 ? 0.2475 0.2637 0.2126 -0.0172 0.0847  -0.0120 233  ASP A CA    
2220 C  C     . ASP C 233 ? 0.3241 0.2066 0.2467 -0.0772 0.1139  -0.0480 233  ASP A C     
2221 O  O     . ASP C 233 ? 0.3379 0.2176 0.2685 -0.0709 0.0978  -0.0368 233  ASP A O     
2222 C  CB    . ASP C 233 ? 0.2346 0.2937 0.2797 -0.0442 0.0478  -0.0285 233  ASP A CB    
2223 C  CG    . ASP C 233 ? 0.2933 0.2906 0.2647 -0.0748 0.0787  -0.0196 233  ASP A CG    
2224 O  OD1   . ASP C 233 ? 0.3098 0.2993 0.2651 -0.0488 0.0496  -0.0532 233  ASP A OD1   
2225 O  OD2   . ASP C 233 ? 0.3227 0.3663 0.3409 -0.1195 0.0802  -0.0661 233  ASP A OD2   
2226 N  N     . GLY C 234 ? 0.2587 0.2528 0.2253 -0.0907 0.0973  -0.0709 234  GLY A N     
2227 C  CA    . GLY C 234 ? 0.3063 0.2107 0.2606 -0.1116 0.1206  -0.0729 234  GLY A CA    
2228 C  C     . GLY C 234 ? 0.3486 0.2111 0.2210 -0.1022 0.1218  -0.0564 234  GLY A C     
2229 O  O     . GLY C 234 ? 0.4606 0.2259 0.2515 -0.0642 0.1591  0.0085  234  GLY A O     
2230 N  N     . GLU C 235 ? 0.3213 0.2100 0.2628 -0.0883 0.0922  -0.0529 235  GLU A N     
2231 C  CA    . GLU C 235 ? 0.3490 0.1827 0.2336 -0.0411 0.0866  -0.0017 235  GLU A CA    
2232 C  C     . GLU C 235 ? 0.2876 0.1908 0.1929 -0.0565 0.0890  -0.0020 235  GLU A C     
2233 O  O     . GLU C 235 ? 0.2761 0.1828 0.2062 -0.0485 0.0774  0.0026  235  GLU A O     
2234 C  CB    . GLU C 235 ? 0.3501 0.1972 0.2650 -0.0294 0.0814  -0.0060 235  GLU A CB    
2235 C  CG    . GLU C 235 ? 0.4176 0.1793 0.2993 0.0014  0.0779  0.0043  235  GLU A CG    
2236 C  CD    . GLU C 235 ? 0.4456 0.2841 0.4613 0.0915  0.0863  -0.0194 235  GLU A CD    
2237 O  OE1   . GLU C 235 ? 0.4191 0.5257 0.4828 0.0733  0.0562  0.1165  235  GLU A OE1   
2238 O  OE2   . GLU C 235 ? 0.6541 0.3114 0.4725 0.0066  0.2797  -0.0348 235  GLU A OE2   
2239 N  N     . PRO C 236 ? 0.3765 0.1759 0.1983 -0.0280 0.0681  0.0145  236  PRO A N     
2240 C  CA    . PRO C 236 ? 0.3672 0.1860 0.1601 -0.0426 0.0682  0.0131  236  PRO A CA    
2241 C  C     . PRO C 236 ? 0.3785 0.1558 0.2368 -0.0217 0.1197  -0.0165 236  PRO A C     
2242 O  O     . PRO C 236 ? 0.3480 0.1787 0.2890 -0.0327 0.0493  -0.0385 236  PRO A O     
2243 C  CB    . PRO C 236 ? 0.4101 0.2335 0.1712 -0.0605 0.0201  0.0453  236  PRO A CB    
2244 C  CG    . PRO C 236 ? 0.5132 0.2235 0.2433 0.0140  -0.0480 0.0606  236  PRO A CG    
2245 C  CD    . PRO C 236 ? 0.5332 0.2037 0.2330 -0.0306 0.0482  0.0545  236  PRO A CD    
2246 N  N     . CYS C 237 ? 0.2866 0.1828 0.1460 -0.0684 0.0117  -0.0047 237  CYS A N     
2247 C  CA    . CYS C 237 ? 0.2441 0.1682 0.1348 -0.0126 0.0199  0.0065  237  CYS A CA    
2248 C  C     . CYS C 237 ? 0.2626 0.1518 0.1351 -0.0356 0.0152  -0.0091 237  CYS A C     
2249 O  O     . CYS C 237 ? 0.3438 0.2090 0.1111 -0.0093 0.0229  0.0104  237  CYS A O     
2250 C  CB    . CYS C 237 ? 0.2313 0.1547 0.1614 -0.0093 0.0481  -0.0063 237  CYS A CB    
2251 S  SG    . CYS C 237 ? 0.1988 0.1800 0.1108 -0.0110 0.0231  -0.0038 237  CYS A SG    
2252 N  N     . GLU C 238 ? 0.2691 0.1810 0.1609 0.0261  -0.0118 0.0166  238  GLU A N     
2253 C  CA    . GLU C 238 ? 0.3011 0.1804 0.2131 0.0321  -0.0465 -0.0013 238  GLU A CA    
2254 C  C     . GLU C 238 ? 0.3923 0.1890 0.1210 -0.0238 -0.0197 0.0274  238  GLU A C     
2255 O  O     . GLU C 238 ? 0.3480 0.2310 0.1509 -0.0258 -0.0262 0.0248  238  GLU A O     
2256 C  CB    . GLU C 238 ? 0.3016 0.3005 0.2175 0.0719  -0.0461 -0.0204 238  GLU A CB    
2257 C  CG    . GLU C 238 ? 0.3242 0.4644 0.1896 0.0884  -0.0435 0.0254  238  GLU A CG    
2258 C  CD    . GLU C 238 ? 0.4386 0.5728 0.1712 0.1806  0.0174  0.0267  238  GLU A CD    
2259 O  OE1   . GLU C 238 ? 0.3855 0.8057 0.2704 0.2467  -0.0362 -0.0816 238  GLU A OE1   
2260 O  OE2   . GLU C 238 ? 0.6272 0.5228 0.2433 0.1590  0.1807  0.0511  238  GLU A OE2   
2261 N  N     . ARG C 239 ? 0.2681 0.1726 0.1167 -0.0106 0.0176  0.0015  239  ARG A N     
2262 C  CA    . ARG C 239 ? 0.2472 0.1755 0.1146 -0.0004 0.0257  0.0011  239  ARG A CA    
2263 C  C     . ARG C 239 ? 0.2430 0.1730 0.0855 -0.0072 0.0149  0.0091  239  ARG A C     
2264 O  O     . ARG C 239 ? 0.2431 0.1852 0.1069 -0.0067 0.0015  -0.0115 239  ARG A O     
2265 C  CB    . ARG C 239 ? 0.2314 0.1740 0.1082 -0.0196 0.0310  -0.0023 239  ARG A CB    
2266 C  CG    . ARG C 239 ? 0.2403 0.1719 0.0962 -0.0019 0.0131  -0.0044 239  ARG A CG    
2267 C  CD    . ARG C 239 ? 0.5294 0.2343 0.1253 -0.1205 0.0579  0.0267  239  ARG A CD    
2268 N  NE    . ARG C 239 ? 0.5116 0.1723 0.1110 0.0317  0.0759  0.0166  239  ARG A NE    
2269 C  CZ    . ARG C 239 ? 0.2995 0.1260 0.1187 -0.0395 0.0479  -0.0040 239  ARG A CZ    
2270 N  NH1   . ARG C 239 ? 0.2655 0.2891 0.1244 -0.0681 -0.0133 0.0436  239  ARG A NH1   
2271 N  NH2   . ARG C 239 ? 0.2350 0.1708 0.1524 -0.0195 0.0634  -0.0364 239  ARG A NH2   
2272 N  N     . CYS C 240 ? 0.2359 0.1919 0.1052 -0.0148 0.0227  -0.0091 240  CYS A N     
2273 C  CA    . CYS C 240 ? 0.2542 0.1696 0.1020 -0.0142 0.0425  -0.0015 240  CYS A CA    
2274 C  C     . CYS C 240 ? 0.2708 0.2080 0.0897 -0.0349 0.0321  0.0030  240  CYS A C     
2275 O  O     . CYS C 240 ? 0.2862 0.2528 0.1109 -0.0536 0.0610  -0.0157 240  CYS A O     
2276 C  CB    . CYS C 240 ? 0.2343 0.1713 0.1067 -0.0270 0.0269  -0.0098 240  CYS A CB    
2277 S  SG    . CYS C 240 ? 0.2101 0.1875 0.1169 -0.0291 0.0444  -0.0181 240  CYS A SG    
2278 N  N     . GLY C 241 ? 0.2624 0.1894 0.1285 -0.0458 0.0186  0.0284  241  GLY A N     
2279 C  CA    . GLY C 241 ? 0.2782 0.2681 0.1332 -0.0943 0.0362  0.0126  241  GLY A CA    
2280 C  C     . GLY C 241 ? 0.2533 0.2076 0.1469 -0.0472 0.0532  -0.0117 241  GLY A C     
2281 O  O     . GLY C 241 ? 0.2563 0.2505 0.1965 -0.0705 0.0245  0.0278  241  GLY A O     
2282 N  N     . SER C 242 ? 0.2501 0.2114 0.1308 -0.0428 0.0621  -0.0213 242  SER A N     
2283 C  CA    . SER C 242 ? 0.2543 0.2046 0.1365 -0.0429 0.0572  -0.0183 242  SER A CA    
2284 C  C     . SER C 242 ? 0.2470 0.1939 0.1479 -0.0490 0.0636  -0.0200 242  SER A C     
2285 O  O     . SER C 242 ? 0.2498 0.2223 0.1829 -0.0417 0.0707  -0.0329 242  SER A O     
2286 C  CB    . SER C 242 ? 0.2523 0.1859 0.1487 -0.0427 0.0588  -0.0242 242  SER A CB    
2287 O  OG    . SER C 242 ? 0.2960 0.2160 0.1894 -0.0141 0.1166  -0.0452 242  SER A OG    
2288 N  N     . ILE C 243 ? 0.2529 0.2272 0.1869 -0.0529 0.0622  -0.0467 243  ILE A N     
2289 C  CA    . ILE C 243 ? 0.2525 0.2272 0.1563 -0.0646 0.0770  -0.0468 243  ILE A CA    
2290 C  C     . ILE C 243 ? 0.2407 0.2106 0.1753 -0.0464 0.0728  -0.0334 243  ILE A C     
2291 O  O     . ILE C 243 ? 0.2498 0.2072 0.1639 -0.0495 0.0586  -0.0374 243  ILE A O     
2292 C  CB    . ILE C 243 ? 0.3042 0.2963 0.1672 -0.1211 0.0874  -0.0645 243  ILE A CB    
2293 C  CG1   . ILE C 243 ? 0.3124 0.3271 0.1803 -0.0738 0.1079  -0.0189 243  ILE A CG1   
2294 C  CG2   . ILE C 243 ? 0.2716 0.2652 0.1969 -0.1002 0.0569  -0.0443 243  ILE A CG2   
2295 C  CD1   . ILE C 243 ? 0.4287 0.3718 0.2781 0.0242  0.1514  0.0685  243  ILE A CD1   
2296 N  N     . ILE C 244 ? 0.2397 0.2141 0.1758 -0.0515 0.0845  -0.0502 244  ILE A N     
2297 C  CA    . ILE C 244 ? 0.2131 0.2005 0.1755 -0.0366 0.0610  -0.0388 244  ILE A CA    
2298 C  C     . ILE C 244 ? 0.1926 0.2661 0.1724 -0.0558 0.0839  -0.0353 244  ILE A C     
2299 O  O     . ILE C 244 ? 0.2128 0.2515 0.1963 -0.0649 0.0864  -0.0523 244  ILE A O     
2300 C  CB    . ILE C 244 ? 0.2117 0.2318 0.1573 -0.0247 0.0509  -0.0489 244  ILE A CB    
2301 C  CG1   . ILE C 244 ? 0.2317 0.2325 0.1602 -0.0140 0.0133  -0.0293 244  ILE A CG1   
2302 C  CG2   . ILE C 244 ? 0.2242 0.2167 0.1544 -0.0490 0.0540  -0.0500 244  ILE A CG2   
2303 C  CD1   . ILE C 244 ? 0.2502 0.2386 0.2436 0.0014  0.0061  -0.0244 244  ILE A CD1   
2304 N  N     . GLU C 245 ? 0.2188 0.2267 0.1588 -0.0429 0.0586  -0.0704 245  GLU A N     
2305 C  CA    . GLU C 245 ? 0.2062 0.2318 0.1744 -0.0435 0.0617  -0.0956 245  GLU A CA    
2306 C  C     . GLU C 245 ? 0.2180 0.2409 0.1811 -0.0654 0.0791  -0.0991 245  GLU A C     
2307 O  O     . GLU C 245 ? 0.2149 0.2594 0.1781 -0.0553 0.0674  -0.0698 245  GLU A O     
2308 C  CB    . GLU C 245 ? 0.2277 0.2632 0.1982 -0.0103 0.0727  -0.0689 245  GLU A CB    
2309 C  CG    . GLU C 245 ? 0.2201 0.2294 0.1899 -0.0063 0.0759  -0.0491 245  GLU A CG    
2310 C  CD    . GLU C 245 ? 0.1937 0.3552 0.2290 0.0651  -0.0062 -0.1008 245  GLU A CD    
2311 O  OE1   . GLU C 245 ? 0.2353 0.3347 0.2552 0.0789  0.0219  -0.0760 245  GLU A OE1   
2312 O  OE2   . GLU C 245 ? 0.2499 0.2715 0.2575 0.0194  0.0485  -0.0912 245  GLU A OE2   
2313 N  N     . LYS C 246 ? 0.2245 0.2626 0.1693 -0.0560 0.0324  -0.0872 246  LYS A N     
2314 C  CA    . LYS C 246 ? 0.2358 0.2614 0.1656 -0.0178 0.0217  -0.0803 246  LYS A CA    
2315 C  C     . LYS C 246 ? 0.1881 0.2623 0.1653 -0.0473 0.0492  -0.0573 246  LYS A C     
2316 O  O     . LYS C 246 ? 0.1928 0.3478 0.2203 -0.0575 0.0754  -0.0664 246  LYS A O     
2317 C  CB    . LYS C 246 ? 0.2552 0.2661 0.2397 0.0034  0.0059  -0.1124 246  LYS A CB    
2318 C  CG    . LYS C 246 ? 0.3357 0.3076 0.2626 0.0354  0.0020  -0.1461 246  LYS A CG    
2319 C  CD    . LYS C 246 ? 0.5649 0.2774 0.3748 0.1402  0.0187  -0.1602 246  LYS A CD    
2320 C  CE    . LYS C 246 ? 0.7969 0.3292 0.3943 0.0200  -0.0574 -0.2021 246  LYS A CE    
2321 N  NZ    . LYS C 246 ? 1.0707 0.3584 0.9242 -0.0630 -0.5069 -0.0909 246  LYS A NZ    
2322 N  N     . THR C 247 ? 0.1849 0.3115 0.1903 -0.0440 0.0475  -0.0253 247  THR A N     
2323 C  CA    . THR C 247 ? 0.2147 0.3063 0.1700 -0.0144 0.0415  -0.0486 247  THR A CA    
2324 C  C     . THR C 247 ? 0.1885 0.2821 0.1823 -0.0340 0.0515  -0.0467 247  THR A C     
2325 O  O     . THR C 247 ? 0.1906 0.3323 0.1884 -0.0136 0.0054  -0.0917 247  THR A O     
2326 C  CB    . THR C 247 ? 0.2124 0.3317 0.2178 0.0040  0.0146  -0.0903 247  THR A CB    
2327 O  OG1   . THR C 247 ? 0.2644 0.3299 0.2279 0.0220  0.0099  -0.0600 247  THR A OG1   
2328 C  CG2   . THR C 247 ? 0.2746 0.2955 0.2765 -0.0148 0.0061  -0.0410 247  THR A CG2   
2329 N  N     . THR C 248 ? 0.2023 0.3107 0.1776 -0.0413 0.0440  -0.0363 248  THR A N     
2330 C  CA    . THR C 248 ? 0.2179 0.2830 0.1817 -0.0630 0.0496  -0.0542 248  THR A CA    
2331 C  C     . THR C 248 ? 0.1820 0.2665 0.1909 -0.0311 0.0583  -0.0558 248  THR A C     
2332 O  O     . THR C 248 ? 0.2474 0.2867 0.2485 0.0027  0.0894  -0.0450 248  THR A O     
2333 C  CB    . THR C 248 ? 0.2988 0.2657 0.2019 -0.0591 0.0010  -0.0483 248  THR A CB    
2334 O  OG1   . THR C 248 ? 0.3369 0.3173 0.3396 -0.0195 -0.0838 -0.0370 248  THR A OG1   
2335 C  CG2   . THR C 248 ? 0.2905 0.2681 0.2482 -0.0794 0.0362  -0.0641 248  THR A CG2   
2336 N  N     . LEU C 249 ? 0.1713 0.2699 0.1779 -0.0228 0.0368  -0.0308 249  LEU A N     
2337 C  CA    . LEU C 249 ? 0.1756 0.2629 0.1524 -0.0163 0.0253  -0.0336 249  LEU A CA    
2338 C  C     . LEU C 249 ? 0.1431 0.2978 0.1377 -0.0080 0.0042  -0.0286 249  LEU A C     
2339 O  O     . LEU C 249 ? 0.1291 0.3272 0.1811 -0.0056 0.0042  -0.0510 249  LEU A O     
2340 C  CB    . LEU C 249 ? 0.2233 0.2842 0.1483 -0.0562 0.0218  -0.0350 249  LEU A CB    
2341 C  CG    . LEU C 249 ? 0.1925 0.2784 0.1929 -0.0405 0.0283  -0.0099 249  LEU A CG    
2342 C  CD1   . LEU C 249 ? 0.2346 0.2963 0.3081 -0.0150 0.0538  -0.0673 249  LEU A CD1   
2343 C  CD2   . LEU C 249 ? 0.2986 0.2348 0.1888 -0.0585 -0.0257 -0.0156 249  LEU A CD2   
2344 N  N     . SER C 250 ? 0.2281 0.3055 0.1404 -0.0017 -0.0042 -0.0305 250  SER A N     
2345 C  CA    . SER C 250 ? 0.1878 0.3307 0.1432 -0.0217 -0.0075 -0.0193 250  SER A CA    
2346 C  C     . SER C 250 ? 0.2006 0.3709 0.1526 -0.0430 -0.0140 -0.0733 250  SER A C     
2347 O  O     . SER C 250 ? 0.2835 0.3909 0.1716 -0.0548 0.0607  -0.0804 250  SER A O     
2348 C  CB    . SER C 250 ? 0.2131 0.3901 0.2115 -0.0755 0.0124  -0.0824 250  SER A CB    
2349 O  OG    . SER C 250 ? 0.1811 0.2904 0.1911 -0.0033 -0.0041 -0.0398 250  SER A OG    
2350 N  N     . SER C 251 ? 0.1935 0.3227 0.2228 -0.0253 -0.0307 -0.0343 251  SER A N     
2351 C  CA    . SER C 251 ? 0.2913 0.3217 0.2348 -0.0382 -0.0728 -0.0486 251  SER A CA    
2352 C  C     . SER C 251 ? 0.2324 0.3078 0.1669 -0.0422 -0.0027 -0.0537 251  SER A C     
2353 O  O     . SER C 251 ? 0.2772 0.3285 0.1992 -0.0397 0.0227  -0.0739 251  SER A O     
2354 C  CB    . SER C 251 ? 0.4598 0.4428 0.2560 -0.0063 -0.1722 -0.0668 251  SER A CB    
2355 O  OG    . SER C 251 ? 0.5042 0.4167 0.3025 -0.0067 -0.1905 -0.0612 251  SER A OG    
2356 N  N     . ARG C 252 ? 0.2101 0.3231 0.1507 -0.0497 0.0050  -0.0266 252  ARG A N     
2357 C  CA    . ARG C 252 ? 0.2113 0.2723 0.1636 -0.0426 0.0229  -0.0387 252  ARG A CA    
2358 C  C     . ARG C 252 ? 0.2084 0.2734 0.1570 0.0034  0.0107  -0.0416 252  ARG A C     
2359 O  O     . ARG C 252 ? 0.2264 0.2464 0.1874 -0.0225 0.0069  -0.0613 252  ARG A O     
2360 C  CB    . ARG C 252 ? 0.2043 0.2440 0.1978 -0.0239 0.0280  -0.0740 252  ARG A CB    
2361 C  CG    . ARG C 252 ? 0.2274 0.2551 0.2251 -0.0326 0.0691  -0.0572 252  ARG A CG    
2362 C  CD    . ARG C 252 ? 0.2314 0.2942 0.1829 0.0140  0.0314  -0.0654 252  ARG A CD    
2363 N  NE    . ARG C 252 ? 0.2139 0.2651 0.2171 -0.0120 0.0399  -0.0426 252  ARG A NE    
2364 C  CZ    . ARG C 252 ? 0.2140 0.1661 0.1610 -0.0144 0.0543  -0.0455 252  ARG A CZ    
2365 N  NH1   . ARG C 252 ? 0.3211 0.2167 0.1526 -0.0515 0.0292  -0.0128 252  ARG A NH1   
2366 N  NH2   . ARG C 252 ? 0.2414 0.1959 0.1880 0.0083  0.0517  -0.0196 252  ARG A NH2   
2367 N  N     A PRO C 253 ? 0.2546 0.2527 0.1559 -0.0042 0.0264  -0.0535 253  PRO A N     
2368 N  N     B PRO C 253 ? 0.2416 0.2465 0.1615 -0.0159 0.0401  -0.0470 253  PRO A N     
2369 C  CA    A PRO C 253 ? 0.2307 0.2423 0.1589 -0.0302 0.0325  -0.0420 253  PRO A CA    
2370 C  CA    B PRO C 253 ? 0.2285 0.2293 0.1595 -0.0239 0.0299  -0.0400 253  PRO A CA    
2371 C  C     A PRO C 253 ? 0.1769 0.2444 0.1461 0.0002  0.0255  -0.0386 253  PRO A C     
2372 C  C     B PRO C 253 ? 0.1923 0.2368 0.1606 -0.0189 0.0460  -0.0429 253  PRO A C     
2373 O  O     A PRO C 253 ? 0.2013 0.2655 0.1991 -0.0241 0.0561  -0.0549 253  PRO A O     
2374 O  O     B PRO C 253 ? 0.1185 0.3116 0.1827 0.0167  -0.0021 -0.0369 253  PRO A O     
2375 C  CB    A PRO C 253 ? 0.2608 0.2507 0.2009 -0.0239 0.0220  -0.0242 253  PRO A CB    
2376 C  CB    B PRO C 253 ? 0.2540 0.2387 0.1775 0.0043  -0.0043 -0.0630 253  PRO A CB    
2377 C  CG    A PRO C 253 ? 0.2815 0.2367 0.2191 -0.0085 0.0283  -0.0329 253  PRO A CG    
2378 C  CG    B PRO C 253 ? 0.1983 0.1998 0.1822 -0.0998 0.0432  -0.0567 253  PRO A CG    
2379 C  CD    A PRO C 253 ? 0.2405 0.2321 0.2013 -0.0282 0.0292  -0.0629 253  PRO A CD    
2380 C  CD    B PRO C 253 ? 0.2476 0.2292 0.1865 -0.0375 0.0732  -0.0430 253  PRO A CD    
2381 N  N     . PHE C 254 ? 0.2004 0.2303 0.1486 0.0068  0.0216  -0.0452 254  PHE A N     
2382 C  CA    . PHE C 254 ? 0.1853 0.2610 0.1283 -0.0138 0.0185  -0.0355 254  PHE A CA    
2383 C  C     . PHE C 254 ? 0.1600 0.3008 0.1268 -0.0134 0.0290  -0.0350 254  PHE A C     
2384 O  O     . PHE C 254 ? 0.1695 0.4972 0.1444 -0.0657 0.0331  -0.0472 254  PHE A O     
2385 C  CB    . PHE C 254 ? 0.2441 0.2356 0.1707 -0.0365 0.0229  -0.0210 254  PHE A CB    
2386 C  CG    . PHE C 254 ? 0.2252 0.2651 0.1051 -0.0392 0.0175  -0.0128 254  PHE A CG    
2387 C  CD1   . PHE C 254 ? 0.2071 0.3221 0.1676 -0.0369 -0.0033 0.0128  254  PHE A CD1   
2388 C  CD2   . PHE C 254 ? 0.3187 0.2495 0.1156 -0.0427 0.0254  -0.0213 254  PHE A CD2   
2389 C  CE1   . PHE C 254 ? 0.2002 0.3343 0.1769 -0.0344 -0.0162 0.0044  254  PHE A CE1   
2390 C  CE2   . PHE C 254 ? 0.2851 0.2223 0.1552 -0.0264 0.0120  -0.0016 254  PHE A CE2   
2391 C  CZ    . PHE C 254 ? 0.2906 0.3279 0.1043 -0.0437 -0.0035 0.0351  254  PHE A CZ    
2392 N  N     . TYR C 255 ? 0.1647 0.2386 0.1391 -0.0015 0.0176  -0.0637 255  TYR A N     
2393 C  CA    . TYR C 255 ? 0.1729 0.1990 0.1377 -0.0105 0.0120  -0.0590 255  TYR A CA    
2394 C  C     . TYR C 255 ? 0.1636 0.1839 0.1417 -0.0113 0.0277  -0.0528 255  TYR A C     
2395 O  O     . TYR C 255 ? 0.1629 0.2372 0.1469 -0.0278 0.0394  -0.0469 255  TYR A O     
2396 C  CB    . TYR C 255 ? 0.1732 0.1814 0.1759 -0.0082 0.0335  -0.0472 255  TYR A CB    
2397 C  CG    . TYR C 255 ? 0.2144 0.1970 0.2007 -0.0235 0.0413  -0.0561 255  TYR A CG    
2398 C  CD1   . TYR C 255 ? 0.1975 0.1914 0.2412 0.0124  0.0473  -0.0891 255  TYR A CD1   
2399 C  CD2   . TYR C 255 ? 0.2067 0.1700 0.2662 -0.0197 0.0447  -0.0473 255  TYR A CD2   
2400 C  CE1   . TYR C 255 ? 0.2149 0.2042 0.2468 -0.0192 0.0509  -0.0811 255  TYR A CE1   
2401 C  CE2   . TYR C 255 ? 0.2705 0.1883 0.2342 -0.0275 0.0395  -0.0637 255  TYR A CE2   
2402 C  CZ    . TYR C 255 ? 0.2623 0.2552 0.2902 -0.0602 0.1165  -0.1127 255  TYR A CZ    
2403 O  OH    . TYR C 255 ? 0.3281 0.2377 0.2512 -0.0696 0.0742  -0.0918 255  TYR A OH    
2404 N  N     . TRP C 256 ? 0.1705 0.1992 0.1401 -0.0179 0.0340  -0.0571 256  TRP A N     
2405 C  CA    . TRP C 256 ? 0.2182 0.1797 0.1021 -0.0083 0.0356  -0.0401 256  TRP A CA    
2406 C  C     . TRP C 256 ? 0.1791 0.2246 0.1082 -0.0263 0.0364  -0.0414 256  TRP A C     
2407 O  O     . TRP C 256 ? 0.1944 0.2039 0.1381 -0.0207 0.0529  -0.0413 256  TRP A O     
2408 C  CB    . TRP C 256 ? 0.1892 0.2140 0.1133 -0.0059 0.0355  -0.0251 256  TRP A CB    
2409 C  CG    . TRP C 256 ? 0.1952 0.2512 0.1532 0.0076  0.0275  -0.0564 256  TRP A CG    
2410 C  CD1   . TRP C 256 ? 0.1836 0.2443 0.1714 -0.0090 0.0500  -0.0401 256  TRP A CD1   
2411 C  CD2   . TRP C 256 ? 0.2078 0.2515 0.1572 0.0307  -0.0086 -0.0457 256  TRP A CD2   
2412 N  NE1   . TRP C 256 ? 0.1939 0.2527 0.1845 -0.0001 0.0572  -0.0437 256  TRP A NE1   
2413 C  CE2   . TRP C 256 ? 0.1988 0.2387 0.1765 0.0257  0.0212  -0.0230 256  TRP A CE2   
2414 C  CE3   . TRP C 256 ? 0.2188 0.2141 0.1136 0.0468  0.0004  -0.0162 256  TRP A CE3   
2415 C  CZ2   . TRP C 256 ? 0.2223 0.2527 0.1983 0.0227  0.0487  -0.0459 256  TRP A CZ2   
2416 C  CZ3   . TRP C 256 ? 0.2012 0.2620 0.1549 0.0525  0.0048  -0.0242 256  TRP A CZ3   
2417 C  CH2   . TRP C 256 ? 0.2122 0.2704 0.1664 0.0239  0.0199  -0.0508 256  TRP A CH2   
2418 N  N     . CYS C 257 ? 0.1475 0.2066 0.1007 0.0025  0.0208  -0.0401 257  CYS A N     
2419 C  CA    . CYS C 257 ? 0.1667 0.1917 0.1008 -0.0097 0.0281  -0.0288 257  CYS A CA    
2420 C  C     . CYS C 257 ? 0.1515 0.1928 0.1027 -0.0191 0.0306  -0.0414 257  CYS A C     
2421 O  O     . CYS C 257 ? 0.1578 0.1962 0.1181 -0.0192 0.0246  -0.0179 257  CYS A O     
2422 C  CB    . CYS C 257 ? 0.1881 0.2077 0.1014 -0.0046 0.0095  -0.0324 257  CYS A CB    
2423 S  SG    . CYS C 257 ? 0.1780 0.2051 0.1175 -0.0160 0.0306  -0.0268 257  CYS A SG    
2424 N  N     . PRO C 258 ? 0.1607 0.1951 0.1346 -0.0216 0.0424  -0.0303 258  PRO A N     
2425 C  CA    . PRO C 258 ? 0.1330 0.2083 0.1521 -0.0177 0.0058  -0.0286 258  PRO A CA    
2426 C  C     . PRO C 258 ? 0.1236 0.1952 0.1476 -0.0044 0.0175  -0.0314 258  PRO A C     
2427 O  O     . PRO C 258 ? 0.1717 0.2033 0.1601 0.0145  0.0174  -0.0271 258  PRO A O     
2428 C  CB    . PRO C 258 ? 0.1405 0.2106 0.1940 -0.0293 0.0168  -0.0155 258  PRO A CB    
2429 C  CG    . PRO C 258 ? 0.1570 0.2230 0.2392 -0.0011 0.0696  0.0054  258  PRO A CG    
2430 C  CD    . PRO C 258 ? 0.1589 0.2068 0.1904 -0.0299 0.0636  -0.0354 258  PRO A CD    
2431 N  N     . GLY C 259 ? 0.1402 0.1946 0.1291 -0.0207 0.0227  -0.0186 259  GLY A N     
2432 C  CA    . GLY C 259 ? 0.1554 0.1999 0.1229 -0.0199 0.0299  -0.0227 259  GLY A CA    
2433 C  C     . GLY C 259 ? 0.1593 0.1841 0.1016 -0.0138 0.0287  -0.0220 259  GLY A C     
2434 O  O     . GLY C 259 ? 0.1494 0.2095 0.1338 -0.0155 0.0413  -0.0466 259  GLY A O     
2435 N  N     . CYS C 260 ? 0.1663 0.1697 0.1042 -0.0058 0.0456  0.0007  260  CYS A N     
2436 C  CA    . CYS C 260 ? 0.1662 0.1651 0.0888 -0.0066 0.0304  -0.0135 260  CYS A CA    
2437 C  C     . CYS C 260 ? 0.1694 0.1604 0.0869 -0.0185 0.0361  -0.0098 260  CYS A C     
2438 O  O     . CYS C 260 ? 0.1636 0.1940 0.1096 -0.0235 0.0343  -0.0128 260  CYS A O     
2439 C  CB    . CYS C 260 ? 0.1873 0.1643 0.1113 -0.0025 -0.0025 -0.0203 260  CYS A CB    
2440 S  SG    . CYS C 260 ? 0.1801 0.1722 0.1159 0.0020  0.0274  -0.0073 260  CYS A SG    
2441 N  N     . GLN C 261 ? 0.1510 0.1701 0.1010 0.0143  0.0165  -0.0035 261  GLN A N     
2442 C  CA    . GLN C 261 ? 0.1439 0.1927 0.0929 0.0325  0.0138  -0.0178 261  GLN A CA    
2443 C  C     . GLN C 261 ? 0.1500 0.2048 0.1169 0.0456  0.0368  0.0125  261  GLN A C     
2444 O  O     . GLN C 261 ? 0.1509 0.2190 0.1421 0.0395  0.0364  0.0100  261  GLN A O     
2445 C  CB    . GLN C 261 ? 0.1275 0.1933 0.1151 0.0131  0.0150  -0.0240 261  GLN A CB    
2446 C  CG    . GLN C 261 ? 0.1454 0.1697 0.1210 0.0183  0.0113  -0.0264 261  GLN A CG    
2447 C  CD    . GLN C 261 ? 0.1409 0.1719 0.1206 -0.0102 0.0372  -0.0210 261  GLN A CD    
2448 O  OE1   . GLN C 261 ? 0.1617 0.1766 0.1253 -0.0161 0.0388  -0.0134 261  GLN A OE1   
2449 N  NE2   . GLN C 261 ? 0.1602 0.2254 0.1014 -0.0049 0.0311  -0.0163 261  GLN A NE2   
2450 N  N     . HIS C 262 ? 0.1663 0.2005 0.1194 0.0337  0.0244  0.0012  262  HIS A N     
2451 C  CA    . HIS C 262 ? 0.1949 0.1872 0.1162 0.0281  0.0179  0.0089  262  HIS A CA    
2452 C  C     . HIS C 262 ? 0.3749 0.2959 0.1394 0.1624  0.0910  0.0504  262  HIS A C     
2453 O  O     . HIS C 262 ? 0.4902 0.4845 0.1849 0.2591  0.0410  0.1120  262  HIS A O     
2454 C  CB    . HIS C 262 ? 0.2179 0.1852 0.1840 0.0213  -0.0212 -0.0022 262  HIS A CB    
2455 C  CG    . HIS C 262 ? 0.2387 0.2366 0.1524 0.0359  -0.0535 -0.0681 262  HIS A CG    
2456 N  ND1   . HIS C 262 ? 0.3013 0.2605 0.1440 -0.0079 -0.0447 -0.0011 262  HIS A ND1   
2457 C  CD2   . HIS C 262 ? 0.2933 0.3383 0.1468 0.1205  -0.0745 -0.1133 262  HIS A CD2   
2458 C  CE1   . HIS C 262 ? 0.3466 0.2364 0.1199 0.1004  -0.0643 -0.0532 262  HIS A CE1   
2459 N  NE2   . HIS C 262 ? 0.3503 0.2784 0.1689 0.1440  -0.0647 -0.0735 262  HIS A NE2   
2460 O  OXT   . HIS C 262 ? 0.4722 0.2831 0.2312 0.1634  0.2017  0.0567  262  HIS A OXT   
2461 ZN ZN    . ZN  D .   ? 0.1992 0.1763 0.1101 -0.0082 0.0325  -0.0122 501  ZN  A ZN    
2462 S  S     . SO4 E .   ? 0.3684 0.2273 0.1603 0.0929  0.0767  0.0526  551  SO4 A S     
2463 O  O1    . SO4 E .   ? 0.3249 0.2345 0.3327 0.0570  0.1068  0.0941  551  SO4 A O1    
2464 O  O2    . SO4 E .   ? 0.4451 0.3008 0.2288 0.1726  0.0968  0.0300  551  SO4 A O2    
2465 O  O3    . SO4 E .   ? 0.7981 0.5180 0.2057 0.2505  -0.0611 0.0237  551  SO4 A O3    
2466 O  O4    . SO4 E .   ? 0.4157 0.1593 0.6106 0.0527  0.2182  0.0119  551  SO4 A O4    
2467 S  S     . SO4 F .   ? 0.2627 0.4034 0.2051 -0.0094 0.0314  0.0110  552  SO4 A S     
2468 O  O1    . SO4 F .   ? 0.3175 0.3728 0.1783 -0.0436 -0.0340 -0.0146 552  SO4 A O1    
2469 O  O2    . SO4 F .   ? 0.3408 0.3843 0.4649 -0.0509 0.1917  -0.0332 552  SO4 A O2    
2470 O  O3    . SO4 F .   ? 0.5463 0.6113 0.1792 -0.0084 -0.0401 0.0706  552  SO4 A O3    
2471 O  O4    . SO4 F .   ? 0.2802 0.6110 0.2308 0.1143  0.1041  0.1515  552  SO4 A O4    
2472 S  S     . SO4 G .   ? 0.5443 0.3433 0.1898 -0.1038 0.0409  0.0189  553  SO4 A S     
2473 O  O1    . SO4 G .   ? 0.8050 0.2415 0.2174 0.0335  0.1777  0.0246  553  SO4 A O1    
2474 O  O2    . SO4 G .   ? 0.7312 0.2941 0.3058 0.0048  0.0352  0.0092  553  SO4 A O2    
2475 O  O3    . SO4 G .   ? 0.7373 0.1728 0.2169 -0.0391 0.0782  -0.0478 553  SO4 A O3    
2476 O  O4    . SO4 G .   ? 0.5352 0.3839 0.2728 -0.1660 -0.1676 0.1021  553  SO4 A O4    
2477 S  S     . SO4 H .   ? 0.5757 0.3172 0.4037 0.1075  0.0657  0.1648  554  SO4 A S     
2478 O  O1    . SO4 H .   ? 0.3758 0.5269 0.3092 -0.0064 0.0051  0.2509  554  SO4 A O1    
2479 O  O2    . SO4 H .   ? 0.6439 0.1539 0.2159 0.1389  0.1846  0.0212  554  SO4 A O2    
2480 O  O3    . SO4 H .   ? 0.6198 0.2447 0.5989 -0.0131 -0.2578 0.1428  554  SO4 A O3    
2481 O  O4    . SO4 H .   ? 0.6466 0.2929 0.2399 0.1334  0.1128  0.1995  554  SO4 A O4    
2482 S  S     . SO4 I .   ? 0.3179 0.5144 0.1882 -0.1179 -0.0358 0.0534  555  SO4 A S     
2483 O  O1    . SO4 I .   ? 0.3930 0.7173 0.1935 -0.0897 -0.0398 0.1456  555  SO4 A O1    
2484 O  O2    . SO4 I .   ? 0.3257 0.5885 0.2081 -0.1954 -0.0857 0.1199  555  SO4 A O2    
2485 O  O3    . SO4 I .   ? 0.5341 0.4633 0.4184 -0.1756 0.0163  0.0557  555  SO4 A O3    
2486 O  O4    . SO4 I .   ? 0.2428 0.3916 0.3478 -0.0263 -0.0517 0.0834  555  SO4 A O4    
2487 C  C1    . GOL J .   ? 0.3685 0.3173 0.3343 0.0042  -0.1153 -0.0776 511  GOL A C1    
2488 O  O1    . GOL J .   ? 0.6003 0.8789 0.3485 0.2983  -0.0157 -0.1953 511  GOL A O1    
2489 C  C2    . GOL J .   ? 0.3357 0.2612 0.1604 -0.0527 -0.1157 0.0187  511  GOL A C2    
2490 O  O2    . GOL J .   ? 0.3112 0.3346 0.3443 -0.0554 0.0072  -0.1297 511  GOL A O2    
2491 C  C3    . GOL J .   ? 0.3521 0.5388 0.4801 -0.1707 0.0460  -0.1233 511  GOL A C3    
2492 O  O3    . GOL J .   ? 0.3357 1.3771 0.6727 -0.1214 -0.0225 -0.1918 511  GOL A O3    
2493 C  C1    . GOL K .   ? 0.6693 0.8584 0.2022 0.2134  -0.0818 -0.0739 512  GOL A C1    
2494 O  O1    . GOL K .   ? 0.7990 0.8987 0.2296 0.1259  -0.0829 -0.0545 512  GOL A O1    
2495 C  C2    . GOL K .   ? 0.6057 0.9045 0.1003 0.2345  -0.0859 -0.1624 512  GOL A C2    
2496 O  O2    . GOL K .   ? 0.6948 0.9555 0.2953 0.2988  0.0673  0.0783  512  GOL A O2    
2497 C  C3    . GOL K .   ? 0.6041 0.8678 0.2098 0.3077  -0.0254 -0.1142 512  GOL A C3    
2498 O  O3    . GOL K .   ? 0.7640 1.0909 0.2773 0.2947  0.0299  0.2309  512  GOL A O3    
2499 C  C1    . GOL L .   ? 0.6125 0.1894 0.2936 -0.0044 -0.0561 0.0869  513  GOL A C1    
2500 O  O1    . GOL L .   ? 0.7226 0.6909 0.4233 -0.1432 0.1574  -0.0935 513  GOL A O1    
2501 C  C2    . GOL L .   ? 0.4816 0.3642 0.2226 0.0931  -0.1033 0.0933  513  GOL A C2    
2502 O  O2    . GOL L .   ? 0.3837 0.3758 0.6115 0.0549  -0.3542 -0.0027 513  GOL A O2    
2503 C  C3    . GOL L .   ? 0.4699 0.3556 0.2749 0.0833  -0.0905 0.1281  513  GOL A C3    
2504 O  O3    . GOL L .   ? 0.2229 0.2918 0.3326 -0.0373 -0.1345 0.0928  513  GOL A O3    
2505 C  C1    . GOL M .   ? 0.7249 0.4321 0.5047 -0.1562 -0.1982 0.0184  514  GOL A C1    
2506 O  O1    . GOL M .   ? 0.8455 0.6065 0.5839 0.0035  -0.2447 -0.0965 514  GOL A O1    
2507 C  C2    . GOL M .   ? 0.6801 0.3808 0.5045 -0.2264 -0.2318 -0.0132 514  GOL A C2    
2508 O  O2    . GOL M .   ? 0.6059 0.3385 0.4857 -0.1146 -0.2589 0.0048  514  GOL A O2    
2509 C  C3    . GOL M .   ? 0.6549 0.3610 0.4479 -0.2179 -0.1710 0.0122  514  GOL A C3    
2510 O  O3    . GOL M .   ? 0.6898 0.2741 0.2975 -0.2934 -0.0811 0.1454  514  GOL A O3    
2511 O  O     . HOH N .   ? 0.3288 0.3089 0.4051 -0.0760 0.0855  -0.1195 723  HOH B O     
2512 O  O     . HOH N .   ? 0.3354 0.4132 0.2902 -0.0048 0.0796  -0.0472 745  HOH B O     
2513 O  O     . HOH N .   ? 0.3071 0.4829 0.2792 0.0759  -0.0160 -0.0580 765  HOH B O     
2514 O  O     . HOH N .   ? 0.3450 0.3382 0.7023 -0.0777 0.1910  -0.0268 772  HOH B O     
2515 O  O     . HOH N .   ? 0.3461 0.4710 0.4669 0.0413  -0.1029 -0.1682 782  HOH B O     
2516 O  O     . HOH N .   ? 0.5368 0.5547 0.5141 -0.0886 -0.0608 -0.0948 845  HOH B O     
2517 O  O     . HOH N .   ? 0.3189 0.7622 0.5933 -0.0273 0.1338  0.0089  874  HOH B O     
2518 O  O     . HOH N .   ? 0.3953 0.5865 0.2715 -0.0452 -0.0127 -0.0982 877  HOH B O     
2519 O  O     . HOH N .   ? 0.5313 0.4141 0.8012 0.0828  -0.1511 -0.1548 895  HOH B O     
2520 O  O     . HOH N .   ? 0.4975 0.4882 0.4539 0.0643  -0.1476 -0.0256 903  HOH B O     
2521 O  O     . HOH N .   ? 0.4502 0.5010 0.6830 -0.0831 -0.0396 0.1613  921  HOH B O     
2522 O  O     . HOH N .   ? 0.4640 0.5118 0.3891 -0.1149 0.0727  -0.0374 938  HOH B O     
2523 O  O     . HOH N .   ? 0.5693 0.6351 0.5804 -0.2732 -0.0281 -0.0721 942  HOH B O     
2524 O  O     . HOH N .   ? 0.5524 0.5744 0.5448 -0.0236 -0.2546 -0.1225 971  HOH B O     
2525 O  O     . HOH N .   ? 0.4674 0.6497 0.5758 -0.1567 -0.1465 0.1591  995  HOH B O     
2526 O  O     . HOH N .   ? 0.6396 0.3818 0.4789 -0.1035 -0.2042 -0.0243 1008 HOH B O     
2527 O  O     . HOH N .   ? 0.3369 0.8290 0.6768 0.0564  0.0719  -0.1854 1010 HOH B O     
2528 O  O     . HOH N .   ? 0.6395 0.7573 0.3718 -0.1834 0.1354  0.1972  1016 HOH B O     
2529 O  O     . HOH N .   ? 0.7087 0.3067 0.6086 -0.0192 0.0244  0.0664  1021 HOH B O     
2530 O  O     . HOH N .   ? 0.6956 0.6605 0.3980 0.1236  0.1911  0.2219  1046 HOH B O     
2531 O  O     . HOH N .   ? 0.5830 0.7656 0.4101 0.0591  -0.1468 -0.1099 1047 HOH B O     
2532 O  O     . HOH N .   ? 0.7863 0.5986 0.5354 -0.0590 -0.2071 -0.1865 1048 HOH B O     
2533 O  O     . HOH N .   ? 0.5645 0.6293 0.5460 -0.2005 -0.0996 -0.0351 1057 HOH B O     
2534 O  O     . HOH N .   ? 1.0874 0.2441 0.9838 0.0664  0.1050  0.3023  1068 HOH B O     
2535 O  O     . HOH O .   ? 0.2490 0.1757 0.2365 0.0114  0.0882  -0.0118 638  HOH C O     
2536 O  O     . HOH O .   ? 0.2900 0.2544 0.1996 -0.0277 0.0043  -0.0110 656  HOH C O     
2537 O  O     . HOH O .   ? 0.2612 0.2460 0.2086 0.0056  0.0719  -0.0005 664  HOH C O     
2538 O  O     . HOH O .   ? 0.2771 0.2849 0.2173 -0.0449 0.0445  -0.0251 668  HOH C O     
2539 O  O     . HOH O .   ? 0.2990 0.2977 0.2783 -0.0520 0.0971  -0.0291 696  HOH C O     
2540 O  O     . HOH O .   ? 0.2381 0.3771 0.2331 -0.0474 0.0487  -0.0741 714  HOH C O     
2541 O  O     . HOH O .   ? 0.3513 0.5604 0.2531 -0.1861 -0.0067 -0.0229 755  HOH C O     
2542 O  O     . HOH O .   ? 0.5191 0.6862 0.4629 0.2483  -0.1568 -0.2912 759  HOH C O     
2543 O  O     . HOH O .   ? 0.4064 0.4310 0.3046 -0.1734 -0.0359 0.0327  764  HOH C O     
2544 O  O     . HOH O .   ? 0.2766 0.5844 0.3131 -0.0690 0.0399  -0.0678 790  HOH C O     
2545 O  O     . HOH O .   ? 0.3212 0.6826 0.1727 0.1211  -0.0232 0.0291  819  HOH C O     
2546 O  O     . HOH O .   ? 0.3725 0.5300 0.3679 0.0295  -0.0889 -0.0192 881  HOH C O     
2547 O  O     . HOH O .   ? 0.4574 0.5992 0.4138 -0.1450 -0.0502 -0.1288 885  HOH C O     
2548 O  O     . HOH O .   ? 0.4512 0.4518 0.4111 0.0661  -0.1944 -0.1234 906  HOH C O     
2549 O  O     . HOH O .   ? 0.5569 0.9607 0.5264 -0.0021 -0.2141 -0.3801 909  HOH C O     
2550 O  O     . HOH O .   ? 0.4088 0.5175 0.4519 -0.1589 0.1463  -0.1413 946  HOH C O     
2551 O  O     . HOH O .   ? 0.5174 0.6211 0.3335 -0.2189 0.0930  -0.1244 965  HOH C O     
2552 O  O     . HOH O .   ? 0.5500 0.9753 0.7866 -0.1477 0.2920  0.1496  1031 HOH C O     
2553 O  O     . HOH O .   ? 0.6208 0.3564 0.5563 -0.0702 0.0573  -0.0728 1036 HOH C O     
2554 O  O     . HOH O .   ? 0.4551 0.5925 0.3072 -0.1990 0.0149  -0.0522 1042 HOH C O     
2555 O  O     . HOH O .   ? 0.8273 0.7221 0.5822 -0.0026 -0.2203 0.1288  1063 HOH C O     
2556 O  O     . HOH O .   ? 1.0724 0.3235 0.8336 0.0244  0.1391  0.2639  1066 HOH C O     
2557 O  O     . HOH O .   ? 0.6072 0.3870 0.6487 -0.0003 -0.2052 -0.0780 1072 HOH C O     
2558 O  O     . HOH P .   ? 0.1751 0.1418 0.1030 0.0132  0.0014  0.0191  601  HOH A O     
2559 O  O     . HOH P .   ? 0.1687 0.1624 0.1263 0.0131  0.0165  -0.0074 602  HOH A O     
2560 O  O     . HOH P .   ? 0.2601 0.1849 0.1136 0.0297  -0.0086 -0.0019 603  HOH A O     
2561 O  O     . HOH P .   ? 0.1897 0.1621 0.1103 0.0103  -0.0045 0.0295  604  HOH A O     
2562 O  O     . HOH P .   ? 0.1882 0.1581 0.1252 0.0214  0.0060  -0.0258 605  HOH A O     
2563 O  O     . HOH P .   ? 0.2033 0.1775 0.1084 0.0141  -0.0062 -0.0226 606  HOH A O     
2564 O  O     . HOH P .   ? 0.1866 0.1711 0.1164 0.0092  0.0034  -0.0171 607  HOH A O     
2565 O  O     . HOH P .   ? 0.1864 0.1682 0.1018 0.0077  0.0295  -0.0018 608  HOH A O     
2566 O  O     . HOH P .   ? 0.1782 0.1948 0.1342 0.0022  0.0146  -0.0401 609  HOH A O     
2567 O  O     . HOH P .   ? 0.2300 0.1363 0.1039 0.0039  0.0238  0.0112  610  HOH A O     
2568 O  O     . HOH P .   ? 0.1898 0.1796 0.1406 -0.0319 0.0325  -0.0395 611  HOH A O     
2569 O  O     . HOH P .   ? 0.1690 0.1862 0.1224 -0.0126 0.0176  -0.0144 612  HOH A O     
2570 O  O     . HOH P .   ? 0.1887 0.1655 0.1057 -0.0203 -0.0004 -0.0177 613  HOH A O     
2571 O  O     . HOH P .   ? 0.1897 0.2162 0.1472 -0.0065 0.0376  0.0074  614  HOH A O     
2572 O  O     . HOH P .   ? 0.2452 0.1867 0.1240 -0.0060 0.0086  0.0030  615  HOH A O     
2573 O  O     . HOH P .   ? 0.1887 0.2375 0.1053 0.0168  0.0015  -0.0152 616  HOH A O     
2574 O  O     . HOH P .   ? 0.1869 0.1996 0.1599 -0.0024 -0.0088 -0.0423 617  HOH A O     
2575 O  O     . HOH P .   ? 0.2046 0.1633 0.1318 0.0168  0.0210  0.0100  618  HOH A O     
2576 O  O     . HOH P .   ? 0.2322 0.1570 0.1308 0.0019  0.0239  0.0115  619  HOH A O     
2577 O  O     . HOH P .   ? 0.1618 0.2263 0.1111 -0.0009 0.0093  -0.0064 620  HOH A O     
2578 O  O     . HOH P .   ? 0.2134 0.1922 0.1063 -0.0079 0.0206  0.0145  621  HOH A O     
2579 O  O     . HOH P .   ? 0.1840 0.1847 0.1311 -0.0067 0.0025  -0.0035 622  HOH A O     
2580 O  O     . HOH P .   ? 0.1932 0.2363 0.1388 -0.0362 0.0037  -0.0077 623  HOH A O     
2581 O  O     . HOH P .   ? 0.2206 0.2278 0.1763 0.0128  0.0412  -0.0133 624  HOH A O     
2582 O  O     . HOH P .   ? 0.2747 0.2029 0.1323 0.0317  0.0140  -0.0008 625  HOH A O     
2583 O  O     . HOH P .   ? 0.1883 0.1740 0.2082 -0.0085 0.0052  -0.0613 626  HOH A O     
2584 O  O     . HOH P .   ? 0.2420 0.1884 0.1732 -0.0173 -0.0263 0.0076  627  HOH A O     
2585 O  O     . HOH P .   ? 0.2798 0.2113 0.1326 0.0276  0.0103  0.0124  628  HOH A O     
2586 O  O     . HOH P .   ? 0.2835 0.1976 0.1174 -0.0166 -0.0173 0.0153  629  HOH A O     
2587 O  O     . HOH P .   ? 0.2055 0.2821 0.1329 0.0139  0.0461  0.0191  630  HOH A O     
2588 O  O     . HOH P .   ? 0.2175 0.1884 0.1247 0.0184  -0.0163 0.0008  631  HOH A O     
2589 O  O     . HOH P .   ? 0.2683 0.1657 0.1585 0.0098  0.0082  -0.0087 632  HOH A O     
2590 O  O     . HOH P .   ? 0.2110 0.1648 0.1449 -0.0213 0.0327  -0.0173 633  HOH A O     
2591 O  O     . HOH P .   ? 0.2323 0.2380 0.1674 0.0042  -0.0239 0.0307  634  HOH A O     
2592 O  O     . HOH P .   ? 0.2495 0.1697 0.1656 -0.0075 -0.0357 0.0044  635  HOH A O     
2593 O  O     . HOH P .   ? 0.3023 0.2274 0.1475 0.0831  -0.0101 -0.0111 636  HOH A O     
2594 O  O     . HOH P .   ? 0.2338 0.2321 0.1977 -0.0522 0.0099  0.0829  637  HOH A O     
2595 O  O     . HOH P .   ? 0.2099 0.2141 0.1309 0.0054  -0.0270 -0.0302 639  HOH A O     
2596 O  O     . HOH P .   ? 0.1985 0.2013 0.2248 -0.0309 0.0254  -0.0132 640  HOH A O     
2597 O  O     . HOH P .   ? 0.2505 0.2001 0.1769 -0.0342 -0.0077 -0.0287 641  HOH A O     
2598 O  O     . HOH P .   ? 0.2904 0.3214 0.1803 0.0486  0.0352  0.0047  642  HOH A O     
2599 O  O     . HOH P .   ? 0.1911 0.2393 0.1765 0.0077  0.0428  -0.0494 643  HOH A O     
2600 O  O     . HOH P .   ? 0.2144 0.2397 0.2003 -0.0049 -0.0439 -0.0446 644  HOH A O     
2601 O  O     . HOH P .   ? 0.3234 0.2414 0.1523 0.0912  -0.0024 -0.0241 645  HOH A O     
2602 O  O     . HOH P .   ? 0.2742 0.2428 0.1921 0.0297  0.0007  -0.0416 646  HOH A O     
2603 O  O     . HOH P .   ? 0.2419 0.2874 0.1229 0.0347  -0.0055 -0.0050 647  HOH A O     
2604 O  O     . HOH P .   ? 0.2432 0.2445 0.1745 -0.0222 -0.0142 -0.0105 648  HOH A O     
2605 O  O     . HOH P .   ? 0.2733 0.2661 0.2046 0.0920  -0.0190 -0.0118 649  HOH A O     
2606 O  O     . HOH P .   ? 0.2558 0.2101 0.2853 -0.0389 -0.0742 -0.0244 650  HOH A O     
2607 O  O     . HOH P .   ? 0.1638 0.2546 0.1902 0.0051  0.0269  0.0001  651  HOH A O     
2608 O  O     . HOH P .   ? 0.2433 0.2528 0.2197 0.0076  -0.0410 -0.0078 652  HOH A O     
2609 O  O     . HOH P .   ? 0.2308 0.2817 0.2085 0.0295  0.0785  0.0278  653  HOH A O     
2610 O  O     . HOH P .   ? 0.3308 0.3162 0.1547 0.0134  0.0425  -0.0212 654  HOH A O     
2611 O  O     . HOH P .   ? 0.3226 0.2655 0.1289 0.0224  0.0304  0.0050  655  HOH A O     
2612 O  O     . HOH P .   ? 0.2739 0.1921 0.1739 0.0417  -0.0125 0.0077  657  HOH A O     
2613 O  O     . HOH P .   ? 0.3220 0.1827 0.1467 0.0431  0.0152  0.0352  658  HOH A O     
2614 O  O     . HOH P .   ? 0.2470 0.2282 0.1922 0.0247  0.0118  -0.0070 659  HOH A O     
2615 O  O     . HOH P .   ? 0.4318 0.2021 0.1454 0.0461  -0.0179 0.0061  660  HOH A O     
2616 O  O     . HOH P .   ? 0.2083 0.2567 0.1527 0.0066  0.0103  0.0010  661  HOH A O     
2617 O  O     . HOH P .   ? 0.2517 0.1845 0.1887 -0.0200 0.0039  0.0048  662  HOH A O     
2618 O  O     . HOH P .   ? 0.2624 0.2667 0.2147 -0.0111 -0.0577 0.0202  663  HOH A O     
2619 O  O     . HOH P .   ? 0.2549 0.2019 0.1832 0.0218  0.0848  0.0087  665  HOH A O     
2620 O  O     . HOH P .   ? 0.3552 0.1824 0.1623 0.0214  -0.0002 -0.0035 666  HOH A O     
2621 O  O     . HOH P .   ? 0.3381 0.3105 0.1147 0.0834  0.0477  0.0444  667  HOH A O     
2622 O  O     . HOH P .   ? 0.2413 0.2427 0.1544 -0.0409 -0.0198 0.0439  669  HOH A O     
2623 O  O     . HOH P .   ? 0.2740 0.3051 0.2535 -0.1061 0.0755  -0.0445 670  HOH A O     
2624 O  O     . HOH P .   ? 0.2002 0.4052 0.2444 0.0566  -0.0117 -0.1051 671  HOH A O     
2625 O  O     . HOH P .   ? 0.3260 0.2718 0.2267 0.0087  -0.0674 -0.0118 672  HOH A O     
2626 O  O     . HOH P .   ? 0.1957 0.3116 0.2659 0.0009  0.0632  -0.0402 673  HOH A O     
2627 O  O     . HOH P .   ? 0.3682 0.2062 0.2057 -0.0208 0.0696  0.0045  674  HOH A O     
2628 O  O     . HOH P .   ? 0.2788 0.2939 0.2622 -0.0514 0.0968  -0.0935 675  HOH A O     
2629 O  O     . HOH P .   ? 0.4226 0.2397 0.1399 0.0111  0.0826  0.0102  676  HOH A O     
2630 O  O     . HOH P .   ? 0.2962 0.2071 0.2209 -0.0109 0.0179  0.0466  677  HOH A O     
2631 O  O     . HOH P .   ? 0.3081 0.3633 0.1668 0.0088  -0.0708 -0.0084 678  HOH A O     
2632 O  O     . HOH P .   ? 0.2788 0.3328 0.2346 -0.0882 0.0813  -0.0655 679  HOH A O     
2633 O  O     . HOH P .   ? 0.4255 0.3514 0.1830 -0.0958 -0.0363 -0.0576 680  HOH A O     
2634 O  O     . HOH P .   ? 0.2449 0.2956 0.1940 -0.0430 0.0254  0.0227  681  HOH A O     
2635 O  O     . HOH P .   ? 0.4249 0.2921 0.2022 -0.0735 0.1106  0.0120  682  HOH A O     
2636 O  O     . HOH P .   ? 0.2867 0.3085 0.2139 0.0491  0.0420  0.0518  683  HOH A O     
2637 O  O     . HOH P .   ? 0.3270 0.2760 0.2417 -0.0206 -0.0733 -0.0120 684  HOH A O     
2638 O  O     . HOH P .   ? 0.2447 0.3062 0.1859 -0.0079 0.0000  -0.0288 685  HOH A O     
2639 O  O     . HOH P .   ? 0.2981 0.3478 0.1971 -0.0449 0.0306  0.0368  686  HOH A O     
2640 O  O     . HOH P .   ? 0.3164 0.2718 0.1740 -0.0825 0.0552  -0.0759 687  HOH A O     
2641 O  O     . HOH P .   ? 0.2714 0.2765 0.2052 0.0289  0.0090  0.0641  688  HOH A O     
2642 O  O     . HOH P .   ? 0.2896 0.2418 0.3421 0.0164  -0.1213 -0.0107 689  HOH A O     
2643 O  O     . HOH P .   ? 0.4974 0.2771 0.1403 -0.0595 -0.0016 -0.0324 690  HOH A O     
2644 O  O     . HOH P .   ? 0.2329 0.3106 0.4323 0.0171  0.0590  -0.0082 691  HOH A O     
2645 O  O     . HOH P .   ? 0.2898 0.4049 0.1883 0.0471  -0.0247 0.0140  692  HOH A O     
2646 O  O     . HOH P .   ? 0.3640 0.2982 0.2229 0.0145  -0.0269 -0.0559 693  HOH A O     
2647 O  O     . HOH P .   ? 0.3318 0.3449 0.3121 0.0149  -0.0664 0.0360  694  HOH A O     
2648 O  O     . HOH P .   ? 0.3020 0.1687 0.2476 -0.0188 0.0383  0.0204  695  HOH A O     
2649 O  O     . HOH P .   ? 0.3335 0.2777 0.3252 -0.0301 -0.0290 -0.0106 697  HOH A O     
2650 O  O     . HOH P .   ? 0.4444 0.3327 0.2436 -0.0472 -0.0918 0.1008  698  HOH A O     
2651 O  O     . HOH P .   ? 0.2653 0.3079 0.2300 -0.0579 -0.0051 0.0833  699  HOH A O     
2652 O  O     . HOH P .   ? 0.3537 0.3191 0.2977 0.0050  0.1356  -0.0349 700  HOH A O     
2653 O  O     . HOH P .   ? 0.3155 0.2488 0.2768 0.0188  -0.0341 -0.0261 701  HOH A O     
2654 O  O     . HOH P .   ? 0.3354 0.3205 0.3262 -0.0714 -0.0352 0.0678  702  HOH A O     
2655 O  O     . HOH P .   ? 0.3078 0.2890 0.2352 0.0081  0.0171  0.0523  703  HOH A O     
2656 O  O     . HOH P .   ? 0.3695 0.2806 0.4121 0.0304  0.2128  -0.1058 704  HOH A O     
2657 O  O     . HOH P .   ? 0.3153 0.4304 0.4319 -0.0232 0.0825  -0.2107 705  HOH A O     
2658 O  O     . HOH P .   ? 0.3739 0.2891 0.2532 -0.0590 0.0926  -0.0151 706  HOH A O     
2659 O  O     . HOH P .   ? 0.3674 0.2865 0.2496 -0.0092 0.0581  0.0322  707  HOH A O     
2660 O  O     . HOH P .   ? 0.3615 0.2763 0.2090 0.0013  0.0810  -0.0477 708  HOH A O     
2661 O  O     . HOH P .   ? 0.3869 0.2938 0.2894 0.0102  0.0828  0.0141  709  HOH A O     
2662 O  O     . HOH P .   ? 0.3955 0.2554 0.2788 0.0075  0.0478  0.0544  710  HOH A O     
2663 O  O     . HOH P .   ? 0.5075 0.3304 0.4289 -0.0615 0.1940  0.0081  711  HOH A O     
2664 O  O     . HOH P .   ? 0.5118 0.2733 0.3661 0.0319  -0.1902 -0.0160 712  HOH A O     
2665 O  O     . HOH P .   ? 0.3334 0.2731 0.5396 -0.0396 0.1618  -0.0582 713  HOH A O     
2666 O  O     . HOH P .   ? 0.2518 0.2623 0.2968 -0.0893 0.0303  -0.0223 715  HOH A O     
2667 O  O     . HOH P .   ? 0.5567 0.3921 0.3146 0.0369  -0.0272 0.1532  716  HOH A O     
2668 O  O     . HOH P .   ? 0.4643 0.5288 0.4119 0.1621  -0.0257 -0.1610 717  HOH A O     
2669 O  O     . HOH P .   ? 0.4791 0.2546 0.2840 0.0054  -0.1434 0.0108  718  HOH A O     
2670 O  O     . HOH P .   ? 0.3124 0.3161 0.2268 -0.0270 0.0026  -0.0032 719  HOH A O     
2671 O  O     . HOH P .   ? 0.2701 0.4497 0.3456 -0.0631 0.0610  -0.0777 720  HOH A O     
2672 O  O     . HOH P .   ? 0.4003 0.3130 0.3068 0.0058  0.0196  0.0311  721  HOH A O     
2673 O  O     . HOH P .   ? 0.3072 0.4498 0.1886 0.0375  0.0673  0.0062  722  HOH A O     
2674 O  O     . HOH P .   ? 0.4113 0.5016 0.3000 0.2141  0.0161  0.1054  724  HOH A O     
2675 O  O     . HOH P .   ? 0.3042 0.3833 0.2078 -0.1222 -0.0024 0.0671  725  HOH A O     
2676 O  O     . HOH P .   ? 0.3346 0.4108 0.4112 -0.1159 0.0719  -0.1348 726  HOH A O     
2677 O  O     . HOH P .   ? 0.3037 0.5762 0.1982 -0.0896 -0.0593 -0.0555 727  HOH A O     
2678 O  O     . HOH P .   ? 0.4021 0.2601 0.3272 -0.1308 0.0917  -0.0991 728  HOH A O     
2679 O  O     . HOH P .   ? 0.4679 0.2463 0.3615 0.1339  0.0208  -0.0878 729  HOH A O     
2680 O  O     . HOH P .   ? 0.4219 0.2344 0.2835 0.0718  0.0477  -0.0148 730  HOH A O     
2681 O  O     . HOH P .   ? 0.5159 0.3796 0.1927 0.1894  0.1010  0.0694  731  HOH A O     
2682 O  O     . HOH P .   ? 0.3156 0.3998 0.4570 -0.1655 0.1379  -0.2198 732  HOH A O     
2683 O  O     . HOH P .   ? 0.3042 0.3587 0.4655 -0.0112 -0.1624 0.0520  733  HOH A O     
2684 O  O     . HOH P .   ? 0.4235 0.3513 0.2295 0.0799  -0.0802 0.0176  734  HOH A O     
2685 O  O     . HOH P .   ? 0.4239 0.3145 0.2839 0.0129  -0.0063 -0.0661 735  HOH A O     
2686 O  O     . HOH P .   ? 0.3795 0.2746 0.2153 -0.0184 0.0073  0.0157  736  HOH A O     
2687 O  O     . HOH P .   ? 0.4624 0.3320 0.2072 -0.0031 0.0120  -0.0062 737  HOH A O     
2688 O  O     . HOH P .   ? 0.4698 0.5052 0.3022 -0.0571 0.0070  -0.1542 738  HOH A O     
2689 O  O     . HOH P .   ? 0.3750 0.3192 0.3300 -0.0477 0.0859  -0.0682 739  HOH A O     
2690 O  O     . HOH P .   ? 0.4943 0.3881 0.2410 0.0848  -0.0247 -0.0816 740  HOH A O     
2691 O  O     . HOH P .   ? 0.2895 0.6009 0.3926 -0.0191 0.0021  -0.1183 741  HOH A O     
2692 O  O     . HOH P .   ? 0.3382 0.3331 0.4123 -0.0787 -0.1633 0.0708  742  HOH A O     
2693 O  O     . HOH P .   ? 0.3594 0.3475 0.2424 -0.1399 -0.0759 0.0670  743  HOH A O     
2694 O  O     . HOH P .   ? 0.3205 0.4649 0.5159 0.1712  -0.1062 -0.1309 744  HOH A O     
2695 O  O     . HOH P .   ? 0.4670 0.2717 0.2224 -0.0781 -0.0046 0.0028  746  HOH A O     
2696 O  O     . HOH P .   ? 0.4639 0.2608 0.2513 -0.0157 -0.0333 -0.1300 747  HOH A O     
2697 O  O     . HOH P .   ? 0.3565 0.2589 0.4138 -0.0471 -0.0663 -0.0028 748  HOH A O     
2698 O  O     . HOH P .   ? 0.4307 0.4054 0.3153 0.0955  0.1021  0.0095  749  HOH A O     
2699 O  O     . HOH P .   ? 0.2863 0.3685 0.3627 -0.0917 0.0205  -0.1088 750  HOH A O     
2700 O  O     . HOH P .   ? 0.5219 0.5857 0.4895 -0.0726 0.0194  0.2876  751  HOH A O     
2701 O  O     . HOH P .   ? 0.5379 0.5772 0.2921 0.1358  0.1237  0.1540  752  HOH A O     
2702 O  O     . HOH P .   ? 0.5437 0.2743 0.5006 0.0244  0.2564  0.0347  753  HOH A O     
2703 O  O     . HOH P .   ? 0.4590 0.3057 0.2981 -0.0319 -0.0930 0.0312  754  HOH A O     
2704 O  O     . HOH P .   ? 0.5547 0.3719 0.2502 -0.1433 -0.1064 -0.0091 756  HOH A O     
2705 O  O     . HOH P .   ? 0.6467 0.3292 0.3079 -0.0605 -0.0763 -0.0239 757  HOH A O     
2706 O  O     . HOH P .   ? 0.4121 0.4052 0.2757 -0.0732 -0.0723 0.1050  758  HOH A O     
2707 O  O     . HOH P .   ? 0.4964 0.2865 0.4379 -0.0458 -0.1146 0.0154  760  HOH A O     
2708 O  O     . HOH P .   ? 0.5351 0.3496 0.4430 -0.1119 0.0870  -0.1826 761  HOH A O     
2709 O  O     . HOH P .   ? 0.2981 0.4376 0.2142 0.0388  -0.0051 -0.0977 762  HOH A O     
2710 O  O     . HOH P .   ? 0.4440 0.5707 0.3071 0.0826  -0.1478 -0.0993 763  HOH A O     
2711 O  O     . HOH P .   ? 0.4607 0.4716 0.5177 -0.0716 0.0697  0.0626  766  HOH A O     
2712 O  O     . HOH P .   ? 0.4916 0.3300 0.4600 -0.0679 0.1571  -0.0378 767  HOH A O     
2713 O  O     . HOH P .   ? 0.4048 0.3710 0.3027 -0.0151 0.1004  -0.0607 768  HOH A O     
2714 O  O     . HOH P .   ? 0.4074 0.3578 0.2689 -0.0701 0.0309  0.0341  769  HOH A O     
2715 O  O     . HOH P .   ? 0.5687 0.3571 0.3560 0.0687  -0.1753 0.0182  770  HOH A O     
2716 O  O     . HOH P .   ? 0.4877 0.4267 0.5610 -0.1855 0.1670  -0.1738 771  HOH A O     
2717 O  O     . HOH P .   ? 0.4989 0.3051 0.5416 0.1249  0.2949  0.0241  773  HOH A O     
2718 O  O     . HOH P .   ? 0.3946 0.3055 0.3104 -0.0476 0.0431  0.0014  774  HOH A O     
2719 O  O     . HOH P .   ? 0.8802 0.2467 0.3497 0.0449  -0.0890 -0.0521 775  HOH A O     
2720 O  O     . HOH P .   ? 0.2612 0.6679 0.6350 -0.0630 -0.0160 0.2615  776  HOH A O     
2721 O  O     . HOH P .   ? 0.5194 0.2437 0.6083 0.0200  -0.0024 0.0477  777  HOH A O     
2722 O  O     . HOH P .   ? 0.2195 0.5692 0.7075 -0.0756 -0.0106 -0.1653 778  HOH A O     
2723 O  O     . HOH P .   ? 0.5794 0.3170 0.3083 -0.1599 -0.0501 0.1025  779  HOH A O     
2724 O  O     . HOH P .   ? 0.2768 0.4635 0.2783 0.0278  0.0307  -0.0813 780  HOH A O     
2725 O  O     . HOH P .   ? 0.6628 0.4909 0.2795 0.0581  0.1418  -0.0377 781  HOH A O     
2726 O  O     . HOH P .   ? 0.4535 0.5936 0.5662 -0.0157 0.1756  -0.1256 783  HOH A O     
2727 O  O     . HOH P .   ? 0.3137 0.4193 0.4786 0.0358  0.1483  -0.0694 784  HOH A O     
2728 O  O     . HOH P .   ? 0.3489 0.2918 0.5583 -0.0717 -0.0625 0.0099  785  HOH A O     
2729 O  O     . HOH P .   ? 0.3364 0.6600 0.5593 -0.0276 0.1817  -0.0087 786  HOH A O     
2730 O  O     . HOH P .   ? 0.3991 0.2694 0.2825 -0.0472 0.0470  0.0575  787  HOH A O     
2731 O  O     . HOH P .   ? 0.3275 0.4307 0.8208 0.1574  -0.2389 -0.3399 788  HOH A O     
2732 O  O     . HOH P .   ? 0.3223 0.6874 0.3313 -0.1085 -0.0045 -0.1726 789  HOH A O     
2733 O  O     . HOH P .   ? 0.4660 0.6276 0.1998 0.0692  0.0717  0.0490  791  HOH A O     
2734 O  O     . HOH P .   ? 0.2070 0.2083 0.1901 0.0018  0.0242  0.0105  792  HOH A O     
2735 O  O     . HOH P .   ? 0.1946 0.2432 0.1098 0.0074  0.0251  0.0144  793  HOH A O     
2736 O  O     . HOH P .   ? 0.2395 0.2320 0.1572 0.0161  0.0231  0.0043  794  HOH A O     
2737 O  O     . HOH P .   ? 0.2515 0.1817 0.2236 0.0004  -0.0866 0.0375  795  HOH A O     
2738 O  O     . HOH P .   ? 0.2606 0.2502 0.1809 -0.0035 -0.0486 0.0117  796  HOH A O     
2739 O  O     . HOH P .   ? 0.1902 0.2543 0.2427 0.0091  0.0223  -0.0486 797  HOH A O     
2740 O  O     . HOH P .   ? 0.3716 0.2416 0.1944 0.0658  0.0004  0.0145  798  HOH A O     
2741 O  O     . HOH P .   ? 0.2919 0.2036 0.2533 0.0217  -0.0348 0.0279  799  HOH A O     
2742 O  O     . HOH P .   ? 0.3285 0.2167 0.2089 -0.0108 -0.0307 -0.0181 800  HOH A O     
2743 O  O     . HOH P .   ? 0.3013 0.2710 0.2438 -0.0237 -0.0145 -0.0239 801  HOH A O     
2744 O  O     . HOH P .   ? 0.3240 0.3202 0.1677 0.0230  0.0618  0.0625  802  HOH A O     
2745 O  O     . HOH P .   ? 0.3181 0.3188 0.2617 -0.0210 0.0478  0.0323  803  HOH A O     
2746 O  O     . HOH P .   ? 0.2695 0.2760 0.2460 -0.0419 -0.0394 -0.0110 804  HOH A O     
2747 O  O     . HOH P .   ? 0.3884 0.2643 0.1783 -0.0493 0.0535  0.0129  805  HOH A O     
2748 O  O     . HOH P .   ? 0.1655 0.2255 0.7299 -0.0015 -0.0164 0.0380  806  HOH A O     
2749 O  O     . HOH P .   ? 0.4413 0.2745 0.2745 0.0556  -0.1058 -0.0370 807  HOH A O     
2750 O  O     . HOH P .   ? 0.3505 0.2534 0.2914 0.0018  0.0964  -0.0542 808  HOH A O     
2751 O  O     . HOH P .   ? 0.3436 0.3075 0.2974 -0.0445 0.0723  -0.0743 809  HOH A O     
2752 O  O     . HOH P .   ? 0.3103 0.4884 0.2383 0.0878  -0.0505 -0.0560 810  HOH A O     
2753 O  O     . HOH P .   ? 0.3182 0.3100 0.2232 -0.0601 0.0528  0.0163  811  HOH A O     
2754 O  O     . HOH P .   ? 0.3895 0.2633 0.3151 0.0134  -0.0375 -0.0032 812  HOH A O     
2755 O  O     . HOH P .   ? 0.3360 0.3946 0.2602 0.0663  0.0174  -0.0375 813  HOH A O     
2756 O  O     . HOH P .   ? 0.3544 0.2961 0.2093 -0.0572 0.0090  -0.0079 814  HOH A O     
2757 O  O     . HOH P .   ? 0.3871 0.3893 0.3393 -0.1057 0.1454  -0.0462 815  HOH A O     
2758 O  O     . HOH P .   ? 0.3199 0.2915 0.4437 -0.0301 0.0487  -0.1240 816  HOH A O     
2759 O  O     . HOH P .   ? 0.3899 0.3404 0.2077 0.0748  -0.0650 -0.0218 817  HOH A O     
2760 O  O     . HOH P .   ? 0.4417 0.3054 0.3171 -0.0010 -0.1253 -0.0112 818  HOH A O     
2761 O  O     . HOH P .   ? 0.4251 0.3826 0.3119 0.0184  -0.0182 0.0628  820  HOH A O     
2762 O  O     . HOH P .   ? 0.3141 0.3390 0.3445 -0.0459 0.1063  -0.0923 821  HOH A O     
2763 O  O     . HOH P .   ? 0.6390 0.2689 0.2805 0.0179  0.2312  0.0854  822  HOH A O     
2764 O  O     . HOH P .   ? 0.3362 0.2774 0.3905 -0.0257 -0.1064 -0.0221 823  HOH A O     
2765 O  O     . HOH P .   ? 0.3379 0.3910 0.2767 -0.0819 -0.0345 0.0551  824  HOH A O     
2766 O  O     . HOH P .   ? 0.4634 0.4477 0.3983 -0.0224 0.2216  -0.0811 825  HOH A O     
2767 O  O     . HOH P .   ? 0.4659 0.3000 0.3341 0.0480  0.0309  -0.0071 826  HOH A O     
2768 O  O     . HOH P .   ? 0.3654 0.4764 0.5231 0.0101  0.1314  0.2369  827  HOH A O     
2769 O  O     . HOH P .   ? 0.5477 0.4330 0.2752 0.0798  -0.0036 -0.0873 828  HOH A O     
2770 O  O     . HOH P .   ? 0.4028 0.3124 0.3383 -0.0143 -0.1225 0.0053  829  HOH A O     
2771 O  O     . HOH P .   ? 0.3982 0.5289 0.3109 0.0066  -0.0655 -0.0215 830  HOH A O     
2772 O  O     . HOH P .   ? 0.3364 0.6160 0.4268 -0.0513 -0.0846 -0.1941 831  HOH A O     
2773 O  O     . HOH P .   ? 0.3268 0.3946 0.3114 0.0571  -0.0483 -0.0460 832  HOH A O     
2774 O  O     . HOH P .   ? 0.4152 0.5073 0.3560 0.0630  -0.0853 -0.1109 833  HOH A O     
2775 O  O     . HOH P .   ? 0.3878 0.3901 0.3003 0.0530  -0.0322 -0.0314 834  HOH A O     
2776 O  O     . HOH P .   ? 0.3447 0.4145 0.3583 0.0579  -0.0446 0.0246  835  HOH A O     
2777 O  O     . HOH P .   ? 0.4515 0.3585 0.6508 0.0725  -0.2119 -0.0153 836  HOH A O     
2778 O  O     . HOH P .   ? 0.5266 0.2431 0.5103 -0.0734 -0.0388 -0.0135 837  HOH A O     
2779 O  O     . HOH P .   ? 0.5930 0.3816 0.3193 0.0645  0.1029  0.0548  838  HOH A O     
2780 O  O     . HOH P .   ? 0.3262 0.2992 0.5829 -0.0267 -0.0468 0.0275  839  HOH A O     
2781 O  O     . HOH P .   ? 0.4556 0.5966 0.5742 -0.1517 0.1942  -0.2962 840  HOH A O     
2782 O  O     . HOH P .   ? 0.4560 0.6761 0.3143 -0.2439 0.0293  -0.1290 841  HOH A O     
2783 O  O     . HOH P .   ? 0.4667 0.3603 0.4161 -0.0361 0.2258  0.0384  842  HOH A O     
2784 O  O     . HOH P .   ? 0.3483 0.4342 0.4185 0.0170  0.0051  -0.0741 843  HOH A O     
2785 O  O     . HOH P .   ? 0.6335 0.3821 0.3427 0.0018  0.0989  -0.0053 844  HOH A O     
2786 O  O     . HOH P .   ? 0.3280 0.2833 0.8609 -0.1005 0.1316  -0.1864 846  HOH A O     
2787 O  O     . HOH P .   ? 0.5057 0.4053 0.3545 0.1225  0.1271  0.1291  847  HOH A O     
2788 O  O     . HOH P .   ? 0.8418 0.3936 0.3596 -0.2487 0.2219  0.0421  848  HOH A O     
2789 O  O     . HOH P .   ? 0.3406 0.6255 0.5572 0.0485  0.1225  -0.2681 849  HOH A O     
2790 O  O     . HOH P .   ? 0.4422 0.4726 0.3769 -0.0135 -0.1586 0.0582  850  HOH A O     
2791 O  O     . HOH P .   ? 0.4169 0.4030 0.4057 -0.1128 0.0327  0.0781  851  HOH A O     
2792 O  O     . HOH P .   ? 0.4625 0.2910 0.5367 0.0165  -0.0526 0.1880  852  HOH A O     
2793 O  O     . HOH P .   ? 0.5846 0.4000 0.3581 -0.0778 0.1163  -0.0318 853  HOH A O     
2794 O  O     . HOH P .   ? 0.3880 0.6250 0.4847 -0.0212 -0.1342 -0.0461 854  HOH A O     
2795 O  O     . HOH P .   ? 0.3341 0.3513 0.3036 -0.0488 -0.0035 -0.0116 855  HOH A O     
2796 O  O     . HOH P .   ? 0.6304 0.4424 0.3440 -0.0601 -0.1066 -0.0407 856  HOH A O     
2797 O  O     . HOH P .   ? 0.6007 0.4952 0.3713 0.0269  0.0788  0.0533  857  HOH A O     
2798 O  O     . HOH P .   ? 0.6686 0.5913 0.2986 0.0507  -0.1450 -0.0183 858  HOH A O     
2799 O  O     . HOH P .   ? 0.6860 0.5365 0.4043 0.2279  -0.0752 -0.1100 859  HOH A O     
2800 O  O     . HOH P .   ? 0.3712 0.4516 0.4406 -0.0236 -0.0853 0.0834  860  HOH A O     
2801 O  O     . HOH P .   ? 0.6458 0.3698 0.3617 -0.1280 0.2412  -0.0967 861  HOH A O     
2802 O  O     . HOH P .   ? 0.3121 0.4500 0.3323 -0.0558 -0.0278 0.0256  862  HOH A O     
2803 O  O     . HOH P .   ? 0.6357 0.5511 0.2945 -0.0752 -0.0705 0.0840  863  HOH A O     
2804 O  O     . HOH P .   ? 0.6879 0.3263 0.4084 0.0134  -0.2503 0.0043  864  HOH A O     
2805 O  O     . HOH P .   ? 0.4879 0.3498 0.4275 -0.1024 -0.0435 0.0787  865  HOH A O     
2806 O  O     . HOH P .   ? 0.5711 0.5146 0.4837 -0.1537 0.1465  -0.0314 866  HOH A O     
2807 O  O     . HOH P .   ? 0.4175 0.4406 0.5903 -0.1616 0.0492  0.0571  867  HOH A O     
2808 O  O     . HOH P .   ? 0.3719 0.4175 0.3048 -0.0799 0.0087  -0.0451 868  HOH A O     
2809 O  O     . HOH P .   ? 0.4205 0.6511 0.3516 0.1164  -0.0082 -0.0134 869  HOH A O     
2810 O  O     . HOH P .   ? 0.2893 0.4940 0.3603 0.0021  0.0523  -0.2436 870  HOH A O     
2811 O  O     . HOH P .   ? 0.4481 0.7175 0.2541 0.0495  -0.0399 0.0055  871  HOH A O     
2812 O  O     . HOH P .   ? 0.8683 0.3019 0.6570 0.0227  0.2740  -0.0213 872  HOH A O     
2813 O  O     . HOH P .   ? 0.3751 0.5716 0.3991 -0.0827 -0.0536 0.1287  873  HOH A O     
2814 O  O     . HOH P .   ? 0.6665 0.3538 0.3528 -0.1817 0.1437  -0.0692 875  HOH A O     
2815 O  O     . HOH P .   ? 0.4931 0.3161 0.6380 -0.0964 -0.0001 -0.0538 876  HOH A O     
2816 O  O     . HOH P .   ? 0.6057 0.3872 0.4932 0.1162  -0.0226 0.0952  878  HOH A O     
2817 O  O     . HOH P .   ? 0.5735 0.4180 0.4985 -0.0238 -0.1621 0.0750  879  HOH A O     
2818 O  O     . HOH P .   ? 0.3935 0.4092 0.4256 0.0401  0.0474  -0.0244 880  HOH A O     
2819 O  O     . HOH P .   ? 0.6608 0.4296 0.4843 0.0873  0.1698  0.2946  882  HOH A O     
2820 O  O     . HOH P .   ? 0.3721 0.4950 0.5090 0.1118  0.1804  0.0144  883  HOH A O     
2821 O  O     . HOH P .   ? 0.6246 0.5456 0.3962 0.1454  -0.0216 0.2404  884  HOH A O     
2822 O  O     . HOH P .   ? 0.3007 0.3924 0.8956 -0.0608 0.1850  -0.2456 886  HOH A O     
2823 O  O     . HOH P .   ? 0.4343 0.4879 0.4378 -0.2626 0.0961  -0.1725 887  HOH A O     
2824 O  O     . HOH P .   ? 0.5058 0.6615 0.4859 -0.0045 -0.0481 -0.0031 888  HOH A O     
2825 O  O     . HOH P .   ? 0.4273 0.3471 0.3436 0.0317  -0.0788 0.0285  889  HOH A O     
2826 O  O     . HOH P .   ? 0.7032 0.4076 0.2814 -0.1634 -0.0081 0.0448  890  HOH A O     
2827 O  O     . HOH P .   ? 0.5766 0.5665 0.3454 0.0098  -0.1392 -0.0837 891  HOH A O     
2828 O  O     . HOH P .   ? 0.8021 0.9014 0.9497 0.0700  0.0951  -0.0075 892  HOH A O     
2829 O  O     . HOH P .   ? 0.5224 0.5258 0.6394 0.0366  0.1228  0.1173  893  HOH A O     
2830 O  O     . HOH P .   ? 0.5872 0.7700 0.3693 -0.0314 -0.0384 -0.2380 894  HOH A O     
2831 O  O     . HOH P .   ? 0.5763 0.5881 0.3020 -0.2066 -0.0357 0.0471  896  HOH A O     
2832 O  O     . HOH P .   ? 0.5555 0.3734 0.5370 -0.0221 0.0029  -0.0225 897  HOH A O     
2833 O  O     . HOH P .   ? 0.4582 0.6290 0.3817 0.2226  0.1244  0.0747  898  HOH A O     
2834 O  O     . HOH P .   ? 0.8058 0.2998 0.2882 0.0157  -0.1418 -0.0009 899  HOH A O     
2835 O  O     . HOH P .   ? 0.5435 0.5902 0.4562 0.2351  0.1152  0.1892  900  HOH A O     
2836 O  O     . HOH P .   ? 0.6941 0.4060 0.5498 0.0769  -0.0617 -0.1726 901  HOH A O     
2837 O  O     . HOH P .   ? 0.7544 0.5009 0.3319 -0.1315 0.0014  -0.0973 902  HOH A O     
2838 O  O     . HOH P .   ? 0.4154 0.3661 0.3607 0.0247  0.0205  -0.0695 904  HOH A O     
2839 O  O     . HOH P .   ? 0.5092 0.4329 0.4414 0.0509  0.0607  -0.0147 905  HOH A O     
2840 O  O     . HOH P .   ? 0.5639 0.4303 0.2736 -0.0859 0.0330  -0.0325 907  HOH A O     
2841 O  O     . HOH P .   ? 0.2764 0.5738 0.4267 -0.0485 0.0758  0.1733  908  HOH A O     
2842 O  O     . HOH P .   ? 0.4992 0.5080 0.6513 -0.1023 -0.1713 -0.1040 910  HOH A O     
2843 O  O     . HOH P .   ? 0.4476 0.4050 0.3892 -0.0036 -0.0173 0.0147  911  HOH A O     
2844 O  O     . HOH P .   ? 0.4057 0.5068 0.6790 -0.0019 -0.0368 0.2973  912  HOH A O     
2845 O  O     . HOH P .   ? 0.5700 0.2649 0.5969 0.0825  0.1336  0.0034  913  HOH A O     
2846 O  O     . HOH P .   ? 0.5429 0.4692 0.3740 -0.1202 0.0986  0.1062  914  HOH A O     
2847 O  O     . HOH P .   ? 0.5687 0.2899 0.3116 0.0504  -0.0639 -0.0236 915  HOH A O     
2848 O  O     . HOH P .   ? 0.4131 0.4203 0.4349 0.0878  0.0186  -0.0072 917  HOH A O     
2849 O  O     . HOH P .   ? 0.3527 0.8186 0.7016 -0.0300 0.0137  0.1682  918  HOH A O     
2850 O  O     . HOH P .   ? 0.4221 0.4286 0.6492 -0.1147 0.2357  -0.0384 919  HOH A O     
2851 O  O     . HOH P .   ? 0.4074 0.6026 0.5860 -0.0802 -0.0373 -0.1229 920  HOH A O     
2852 O  O     . HOH P .   ? 0.5658 0.5681 0.4357 0.1292  0.1961  0.0693  922  HOH A O     
2853 O  O     . HOH P .   ? 0.3702 0.4609 0.3820 0.0705  0.0162  0.0435  923  HOH A O     
2854 O  O     . HOH P .   ? 0.5547 0.7519 0.8214 0.0361  0.0572  0.1014  924  HOH A O     
2855 O  O     . HOH P .   ? 0.5311 0.4876 0.4462 -0.0466 0.0690  -0.0798 925  HOH A O     
2856 O  O     . HOH P .   ? 0.6507 0.3718 0.4344 -0.1691 -0.2467 0.1554  926  HOH A O     
2857 O  O     . HOH P .   ? 0.5124 0.4159 0.6188 0.1955  -0.1614 -0.0116 927  HOH A O     
2858 O  O     . HOH P .   ? 0.5062 0.5301 0.4414 -0.2279 0.1057  -0.0573 928  HOH A O     
2859 O  O     . HOH P .   ? 0.6273 0.4971 0.4457 -0.1092 0.1871  -0.1306 929  HOH A O     
2860 O  O     . HOH P .   ? 0.2636 0.6969 0.4686 0.1278  -0.0249 -0.1327 930  HOH A O     
2861 O  O     . HOH P .   ? 0.5121 0.5685 0.4490 0.1636  0.1483  0.1577  931  HOH A O     
2862 O  O     . HOH P .   ? 0.5748 0.5237 0.2427 0.0184  -0.0547 -0.0596 932  HOH A O     
2863 O  O     . HOH P .   ? 0.4763 0.4549 0.4091 -0.1448 -0.0331 0.0512  933  HOH A O     
2864 O  O     . HOH P .   ? 0.2559 0.7572 0.6224 0.0325  0.0230  0.1099  934  HOH A O     
2865 O  O     . HOH P .   ? 0.3491 0.5082 0.8311 -0.1327 0.0880  -0.0960 935  HOH A O     
2866 O  O     . HOH P .   ? 0.6312 0.4515 0.4298 -0.1121 0.1798  -0.1631 936  HOH A O     
2867 O  O     . HOH P .   ? 0.3965 0.6541 0.2093 -0.1425 -0.0388 0.0412  937  HOH A O     
2868 O  O     . HOH P .   ? 0.5891 0.3584 0.5017 0.0517  0.1628  -0.0135 939  HOH A O     
2869 O  O     . HOH P .   ? 0.5333 0.5220 0.3607 -0.0720 0.0110  -0.0524 940  HOH A O     
2870 O  O     . HOH P .   ? 0.3744 0.5549 0.4262 -0.1080 -0.1321 0.2420  941  HOH A O     
2871 O  O     . HOH P .   ? 0.5615 0.4496 0.4961 0.0638  -0.2165 -0.0845 943  HOH A O     
2872 O  O     . HOH P .   ? 0.7272 0.3241 0.5144 0.1291  0.1772  0.1136  944  HOH A O     
2873 O  O     . HOH P .   ? 0.5756 0.3927 0.3613 -0.1318 0.0462  -0.0333 945  HOH A O     
2874 O  O     . HOH P .   ? 0.7151 0.6150 0.2410 -0.1525 -0.1928 0.0674  947  HOH A O     
2875 O  O     . HOH P .   ? 0.5799 0.6238 0.6312 -0.2395 0.1493  -0.0334 948  HOH A O     
2876 O  O     . HOH P .   ? 0.3650 0.6305 0.4939 0.0533  -0.0184 -0.0617 949  HOH A O     
2877 O  O     . HOH P .   ? 0.8355 0.8588 0.3933 -0.2692 -0.0590 0.1852  950  HOH A O     
2878 O  O     . HOH P .   ? 0.6706 0.6854 0.5247 -0.0995 -0.0455 0.1482  951  HOH A O     
2879 O  O     . HOH P .   ? 0.4304 0.4560 0.6663 0.1223  -0.0220 0.0356  952  HOH A O     
2880 O  O     . HOH P .   ? 0.6898 0.5884 0.3602 0.1035  -0.0931 -0.0437 953  HOH A O     
2881 O  O     . HOH P .   ? 0.7897 0.7681 0.2720 0.2677  0.1629  0.2668  954  HOH A O     
2882 O  O     . HOH P .   ? 0.4967 0.4178 0.5875 -0.0203 0.1521  0.1435  955  HOH A O     
2883 O  O     . HOH P .   ? 0.6501 0.8978 0.3245 -0.3179 0.0907  0.0109  956  HOH A O     
2884 O  O     . HOH P .   ? 0.4779 0.4943 0.6877 -0.1988 -0.0740 0.2379  957  HOH A O     
2885 O  O     . HOH P .   ? 0.2952 0.4139 0.2118 -0.0313 0.0918  -0.0234 958  HOH A O     
2886 O  O     . HOH P .   ? 0.3212 0.3685 0.7979 -0.1120 -0.1418 -0.0343 959  HOH A O     
2887 O  O     . HOH P .   ? 0.5259 0.5135 0.2520 0.0000  -0.1156 0.0000  960  HOH A O     
2888 O  O     . HOH P .   ? 0.6740 0.3417 0.3911 -0.1580 0.1453  -0.0645 961  HOH A O     
2889 O  O     . HOH P .   ? 0.5082 0.2927 0.2829 0.0442  -0.0622 0.0245  962  HOH A O     
2890 O  O     . HOH P .   ? 0.3710 0.5694 0.5612 0.1557  -0.1121 0.1082  963  HOH A O     
2891 O  O     . HOH P .   ? 0.4415 0.5308 0.3659 -0.0645 -0.1447 0.1849  964  HOH A O     
2892 O  O     . HOH P .   ? 0.3460 0.7543 0.3857 0.1104  0.0764  0.1890  966  HOH A O     
2893 O  O     . HOH P .   ? 0.3998 0.3463 0.3541 0.0434  0.0165  0.0138  967  HOH A O     
2894 O  O     . HOH P .   ? 0.5380 0.4682 0.3399 -0.1670 -0.0442 0.0640  968  HOH A O     
2895 O  O     . HOH P .   ? 0.3876 0.5311 0.7317 -0.0246 0.0786  -0.2878 969  HOH A O     
2896 O  O     . HOH P .   ? 0.3777 0.5914 0.3761 -0.1068 0.0538  0.0810  970  HOH A O     
2897 O  O     . HOH P .   ? 0.5188 0.4113 0.3240 -0.0265 0.1508  -0.0576 972  HOH A O     
2898 O  O     . HOH P .   ? 0.8141 0.6737 0.2445 -0.0433 -0.0212 -0.0595 973  HOH A O     
2899 O  O     . HOH P .   ? 0.7282 0.7226 0.5545 0.0541  -0.1632 -0.1454 974  HOH A O     
2900 O  O     . HOH P .   ? 0.5002 0.5385 0.4286 -0.1044 -0.0367 0.1591  975  HOH A O     
2901 O  O     . HOH P .   ? 0.4459 0.5065 0.5512 -0.0766 -0.1333 -0.0707 976  HOH A O     
2902 O  O     . HOH P .   ? 0.4517 0.6281 0.6376 0.1790  0.2567  0.0548  977  HOH A O     
2903 O  O     . HOH P .   ? 0.4611 0.5812 0.4232 0.0617  -0.0510 -0.1794 978  HOH A O     
2904 O  O     . HOH P .   ? 0.5998 0.5113 0.7425 -0.2522 -0.1078 0.0120  979  HOH A O     
2905 O  O     . HOH P .   ? 0.4463 0.3434 0.6166 -0.1044 -0.0779 -0.1020 980  HOH A O     
2906 O  O     . HOH P .   ? 0.4675 0.6593 0.6786 -0.0934 0.1844  0.1884  981  HOH A O     
2907 O  O     . HOH P .   ? 0.2887 0.8954 0.4685 0.0306  -0.0551 0.3504  982  HOH A O     
2908 O  O     . HOH P .   ? 0.7185 0.4751 0.7803 0.1900  -0.2084 0.0971  983  HOH A O     
2909 O  O     . HOH P .   ? 0.3827 0.9391 0.5735 0.0212  -0.0276 0.1890  984  HOH A O     
2910 O  O     . HOH P .   ? 0.5923 0.6488 0.6292 -0.0558 -0.0472 -0.2092 985  HOH A O     
2911 O  O     . HOH P .   ? 0.4031 0.5869 0.6008 0.0329  0.2290  0.0000  986  HOH A O     
2912 O  O     . HOH P .   ? 0.3863 0.7155 0.5010 0.0288  -0.0918 0.2102  987  HOH A O     
2913 O  O     . HOH P .   ? 0.4771 0.4379 0.4760 -0.1496 0.2293  -0.1161 988  HOH A O     
2914 O  O     . HOH P .   ? 0.3449 0.4547 0.6230 0.0038  0.0075  0.0921  989  HOH A O     
2915 O  O     . HOH P .   ? 0.4593 0.5965 0.4861 -0.0174 -0.0633 0.1195  990  HOH A O     
2916 O  O     . HOH P .   ? 0.7427 0.7317 0.3941 0.0219  0.0906  0.1969  991  HOH A O     
2917 O  O     . HOH P .   ? 0.3997 0.6630 0.5812 0.1772  -0.1145 -0.0189 992  HOH A O     
2918 O  O     . HOH P .   ? 0.9115 0.3690 0.7351 0.1757  0.0135  0.0686  993  HOH A O     
2919 O  O     . HOH P .   ? 0.8208 0.5848 0.2863 -0.0001 0.0515  -0.0301 994  HOH A O     
2920 O  O     . HOH P .   ? 0.6676 0.4549 0.4818 0.0051  -0.1280 0.1554  996  HOH A O     
2921 O  O     . HOH P .   ? 0.3597 0.3813 0.6685 0.0016  0.0017  -0.1380 997  HOH A O     
2922 O  O     . HOH P .   ? 1.1010 1.0909 1.0793 0.0547  0.0511  0.0105  998  HOH A O     
2923 O  O     . HOH P .   ? 0.4570 0.5232 0.3308 -0.1090 -0.0316 -0.0481 999  HOH A O     
2924 O  O     . HOH P .   ? 0.4195 0.5610 0.7100 -0.2084 0.0571  -0.0258 1000 HOH A O     
2925 O  O     . HOH P .   ? 0.5202 0.7709 0.3609 0.0457  0.0702  0.0508  1001 HOH A O     
2926 O  O     . HOH P .   ? 0.6950 0.4127 0.2147 0.0737  0.0248  -0.0091 1002 HOH A O     
2927 O  O     . HOH P .   ? 0.6243 0.4272 0.6892 0.1825  0.1935  0.1172  1003 HOH A O     
2928 O  O     . HOH P .   ? 0.8846 0.3664 0.6549 0.1075  0.0502  -0.1768 1004 HOH A O     
2929 O  O     . HOH P .   ? 0.5521 0.4544 0.5034 0.1887  0.0480  0.0534  1005 HOH A O     
2930 O  O     . HOH P .   ? 0.4937 0.8635 0.4508 -0.1203 -0.1617 0.1602  1007 HOH A O     
2931 O  O     . HOH P .   ? 0.5875 0.5185 0.4884 0.0211  -0.1644 -0.0221 1009 HOH A O     
2932 O  O     . HOH P .   ? 0.6556 0.4525 0.6248 0.0501  0.1195  0.1408  1011 HOH A O     
2933 O  O     . HOH P .   ? 0.6298 0.5373 0.6278 -0.0220 -0.0906 0.1308  1012 HOH A O     
2934 O  O     . HOH P .   ? 0.6116 0.5890 0.5155 -0.1061 -0.0804 -0.0707 1013 HOH A O     
2935 O  O     . HOH P .   ? 0.4603 0.8386 0.5228 -0.0006 -0.0395 -0.2650 1014 HOH A O     
2936 O  O     . HOH P .   ? 0.5303 0.5674 0.6456 -0.1130 0.2705  -0.0712 1015 HOH A O     
2937 O  O     . HOH P .   ? 0.3515 0.5430 0.5157 -0.0881 0.0158  -0.0134 1017 HOH A O     
2938 O  O     . HOH P .   ? 0.4287 0.7161 0.6409 0.0353  -0.0818 0.1804  1018 HOH A O     
2939 O  O     . HOH P .   ? 0.4489 0.8835 0.4438 -0.0889 0.0787  0.1205  1019 HOH A O     
2940 O  O     . HOH P .   ? 0.5501 0.4741 0.4708 -0.0194 0.0762  0.0345  1020 HOH A O     
2941 O  O     . HOH P .   ? 0.7209 0.5061 0.5939 -0.0757 0.0212  0.1446  1022 HOH A O     
2942 O  O     . HOH P .   ? 0.6516 0.8960 0.5665 0.0338  0.2363  0.0166  1023 HOH A O     
2943 O  O     . HOH P .   ? 0.7143 0.5087 0.4895 0.0249  -0.2498 -0.0330 1024 HOH A O     
2944 O  O     . HOH P .   ? 0.6065 0.3055 0.3750 0.0764  -0.0578 0.0250  1025 HOH A O     
2945 O  O     . HOH P .   ? 0.5243 0.5860 0.3215 0.0159  -0.0114 0.0457  1026 HOH A O     
2946 O  O     . HOH P .   ? 0.8753 0.7944 0.6642 -0.0717 -0.1611 -0.2104 1027 HOH A O     
2947 O  O     . HOH P .   ? 0.3043 0.4159 0.5542 -0.0407 0.0413  -0.0151 1028 HOH A O     
2948 O  O     . HOH P .   ? 0.5655 0.7587 0.3376 0.0439  0.0555  0.0918  1029 HOH A O     
2949 O  O     . HOH P .   ? 0.5192 0.7050 0.7733 0.0295  -0.1870 -0.1784 1030 HOH A O     
2950 O  O     . HOH P .   ? 0.8246 0.7116 0.7755 -0.0547 0.1407  -0.0622 1032 HOH A O     
2951 O  O     . HOH P .   ? 0.4927 0.4839 0.6555 -0.0824 0.0238  -0.0176 1033 HOH A O     
2952 O  O     . HOH P .   ? 0.6052 0.6003 0.5536 -0.1319 -0.1898 -0.0502 1034 HOH A O     
2953 O  O     . HOH P .   ? 0.5335 0.5766 0.6517 -0.0903 0.0210  -0.1134 1035 HOH A O     
2954 O  O     . HOH P .   ? 0.8788 0.8919 1.0228 0.0585  0.0103  -0.0516 1037 HOH A O     
2955 O  O     . HOH P .   ? 0.7987 0.6913 0.7221 0.0116  0.1412  0.1472  1038 HOH A O     
2956 O  O     . HOH P .   ? 0.6146 0.6456 0.6673 -0.0399 0.1012  0.0655  1039 HOH A O     
2957 O  O     . HOH P .   ? 0.4055 0.7179 0.5676 0.0499  -0.1683 0.0018  1040 HOH A O     
2958 O  O     . HOH P .   ? 0.8504 0.8211 0.4402 -0.0506 -0.2882 0.1674  1041 HOH A O     
2959 O  O     . HOH P .   ? 0.6062 0.6871 1.0108 -0.3170 0.0734  -0.1384 1043 HOH A O     
2960 O  O     . HOH P .   ? 0.6129 0.4469 0.5894 -0.2264 -0.0859 0.0729  1044 HOH A O     
2961 O  O     . HOH P .   ? 0.7866 0.8487 0.3599 -0.0133 -0.1673 0.0739  1045 HOH A O     
2962 O  O     . HOH P .   ? 0.4710 0.6529 0.7184 -0.0396 -0.1504 0.0109  1049 HOH A O     
2963 O  O     . HOH P .   ? 0.8184 0.2873 0.5861 0.0221  -0.0970 -0.0692 1050 HOH A O     
2964 O  O     . HOH P .   ? 0.6160 0.7106 0.6453 0.1640  -0.0654 -0.0646 1051 HOH A O     
2965 O  O     . HOH P .   ? 0.6235 0.3769 0.4041 0.0894  -0.1054 -0.0159 1052 HOH A O     
2966 O  O     . HOH P .   ? 0.5797 0.5673 0.4713 -0.0709 0.1551  0.1408  1054 HOH A O     
2967 O  O     . HOH P .   ? 0.7367 0.6005 0.5268 0.1229  -0.0133 0.0910  1055 HOH A O     
2968 O  O     . HOH P .   ? 0.6927 0.6126 0.3751 -0.1181 -0.1080 0.0468  1056 HOH A O     
2969 O  O     . HOH P .   ? 0.5118 0.5727 0.7315 -0.1712 0.0519  0.0157  1058 HOH A O     
2970 O  O     . HOH P .   ? 0.4749 0.6047 0.4751 0.0195  0.1164  0.2225  1059 HOH A O     
2971 O  O     . HOH P .   ? 0.8366 0.4346 0.9747 0.0213  0.0368  0.2511  1060 HOH A O     
2972 O  O     . HOH P .   ? 0.7293 0.3322 0.4539 -0.0339 -0.0145 -0.0610 1061 HOH A O     
2973 O  O     . HOH P .   ? 0.6950 0.7600 0.3757 0.0608  -0.1734 -0.0163 1062 HOH A O     
2974 O  O     . HOH P .   ? 0.6057 0.5920 0.4841 -0.1008 0.0477  -0.0490 1064 HOH A O     
2975 O  O     . HOH P .   ? 0.7064 0.5064 0.3886 0.0000  0.1817  0.0000  1067 HOH A O     
2976 O  O     . HOH P .   ? 0.5703 0.4625 0.5809 0.0157  0.2822  -0.0699 1069 HOH A O     
2977 O  O     . HOH P .   ? 0.9848 0.9207 0.6659 0.0763  -0.2872 -0.0959 1070 HOH A O     
2978 O  O     . HOH P .   ? 0.4743 0.7715 0.8824 -0.2486 0.0231  -0.1443 1071 HOH A O     
2979 O  O     . HOH P .   ? 0.7864 0.7253 0.2703 0.0256  -0.1328 0.0600  1073 HOH A O     
2980 O  O     . HOH P .   ? 0.5250 0.6806 0.7047 -0.0611 0.1932  -0.0406 1074 HOH A O     
2981 O  O     . HOH P .   ? 0.6790 0.8430 0.6143 0.1983  -0.3462 0.0056  1075 HOH A O     
2982 O  O     . HOH P .   ? 0.7727 0.7085 0.7032 0.0022  0.0024  -0.2162 1076 HOH A O     
2983 O  O     . HOH P .   ? 0.5206 0.6826 0.7379 -0.0555 0.3463  0.0181  1077 HOH A O     
2984 O  O     . HOH P .   ? 0.5673 0.4010 0.3792 0.0177  -0.0266 0.0371  1078 HOH A O     
2985 O  O     . HOH P .   ? 0.7775 0.8041 0.5013 0.0010  -0.1060 0.2676  1079 HOH A O     
2986 O  O     . HOH P .   ? 0.7840 0.6457 0.5070 -0.2015 0.1165  0.1242  1080 HOH A O     
2987 O  O     . HOH P .   ? 0.7600 0.7615 0.4631 0.1051  0.2132  -0.0217 1081 HOH A O     
2988 O  O     . HOH P .   ? 0.6684 0.6946 0.4037 0.0572  -0.0924 0.0033  1082 HOH A O     
2989 O  O     . HOH P .   ? 0.8622 0.6132 0.8146 -0.1080 0.0924  0.0252  1083 HOH A O     
2990 O  O     . HOH P .   ? 0.6361 0.5302 0.4766 -0.1577 0.0144  -0.0628 1084 HOH A O     
2991 O  O     . HOH P .   ? 0.7934 0.7934 0.6819 -0.0316 -0.0164 -0.0164 1085 HOH A O     
2992 O  O     . HOH P .   ? 0.5300 0.5832 0.7444 -0.0658 0.0669  -0.2502 1086 HOH A O     
2993 O  O     . HOH P .   ? 0.6289 0.6754 0.4469 0.1280  -0.1499 -0.1332 1087 HOH A O     
2994 O  O     . HOH P .   ? 0.7230 0.7575 0.9430 -0.1504 -0.1676 -0.1194 1088 HOH A O     
2995 O  O     . HOH P .   ? 0.5161 0.4314 0.6402 0.0326  -0.0003 0.0517  1089 HOH A O     
2996 O  O     . HOH P .   ? 0.6514 0.4239 0.7847 -0.0577 -0.0017 0.1012  1090 HOH A O     
2997 O  O     . HOH P .   ? 0.4427 0.5717 0.8980 -0.2029 -0.0494 0.0601  1091 HOH A O     
2998 O  O     . HOH P .   ? 0.3482 0.2864 0.4885 0.0015  0.1717  0.1124  1092 HOH A O     
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   401 ?   ?   ?   B . n 
A 1 2   DG  2   402 ?   ?   ?   B . n 
A 1 3   DC  3   403 403 DC  CYT B . n 
A 1 4   BRU 4   404 404 BRU BRU B . n 
A 1 5   BRU 5   405 405 BRU BRU B . n 
A 1 6   DC  6   406 406 DC  CYT B . n 
A 1 7   DA  7   407 407 DA  ADE B . n 
A 1 8   BRU 8   408 408 BRU BRU B . n 
A 1 9   DC  9   409 409 DC  CYT B . n 
A 1 10  DC  10  410 410 DC  CYT B . n 
A 1 11  BRU 11  411 411 BRU BRU B . n 
A 1 12  DG  12  412 412 DG  GUA B . n 
A 1 13  DG  13  413 ?   ?   ?   B . n 
B 2 1   DC  1   421 ?   ?   ?   C . n 
B 2 2   DC  2   422 422 DC  CYT C . n 
B 2 3   DA  3   423 423 DA  ADE C . n 
B 2 4   DG  4   424 424 DG  GUA C . n 
B 2 5   DG  5   425 425 DG  GUA C . n 
B 2 6   DA  6   426 426 DA  ADE C . n 
B 2 7   PED 7   427 427 PED TYG C . n 
B 2 8   DG  8   428 428 DG  GUA C . n 
B 2 9   DA  9   429 429 DA  ADE C . n 
B 2 10  DA  10  430 430 DA  ADE C . n 
B 2 11  DG  11  431 431 DG  GUA C . n 
B 2 12  DC  12  432 ?   ?   ?   C . n 
B 2 13  DC  13  433 ?   ?   ?   C . n 
C 3 1   PRO 1   1   1   PRO PRO A . n 
C 3 2   GLU 2   2   2   GLU GLU A . n 
C 3 3   GLY 3   3   3   GLY GLY A . n 
C 3 4   PRO 4   4   4   PRO PRO A . n 
C 3 5   GLU 5   5   5   GLU GLU A . n 
C 3 6   ILE 6   6   6   ILE ILE A . n 
C 3 7   ARG 7   7   7   ARG ARG A . n 
C 3 8   ARG 8   8   8   ARG ARG A . n 
C 3 9   ALA 9   9   9   ALA ALA A . n 
C 3 10  ALA 10  10  10  ALA ALA A . n 
C 3 11  ASP 11  11  11  ASP ASP A . n 
C 3 12  ASN 12  12  12  ASN ASN A . n 
C 3 13  LEU 13  13  13  LEU LEU A . n 
C 3 14  GLU 14  14  14  GLU GLU A . n 
C 3 15  ALA 15  15  15  ALA ALA A . n 
C 3 16  ALA 16  16  16  ALA ALA A . n 
C 3 17  ILE 17  17  17  ILE ILE A . n 
C 3 18  LYS 18  18  18  LYS LYS A . n 
C 3 19  GLY 19  19  19  GLY GLY A . n 
C 3 20  LYS 20  20  20  LYS LYS A . n 
C 3 21  PRO 21  21  21  PRO PRO A . n 
C 3 22  LEU 22  22  22  LEU LEU A . n 
C 3 23  THR 23  23  23  THR THR A . n 
C 3 24  ASP 24  24  24  ASP ASP A . n 
C 3 25  VAL 25  25  25  VAL VAL A . n 
C 3 26  TRP 26  26  26  TRP TRP A . n 
C 3 27  PHE 27  27  27  PHE PHE A . n 
C 3 28  ALA 28  28  28  ALA ALA A . n 
C 3 29  PHE 29  29  29  PHE PHE A . n 
C 3 30  PRO 30  30  30  PRO PRO A . n 
C 3 31  GLN 31  31  31  GLN GLN A . n 
C 3 32  LEU 32  32  32  LEU LEU A . n 
C 3 33  LYS 33  33  33  LYS LYS A . n 
C 3 34  THR 34  34  34  THR THR A . n 
C 3 35  TYR 35  35  35  TYR TYR A . n 
C 3 36  GLN 36  36  36  GLN GLN A . n 
C 3 37  SER 37  37  37  SER SER A . n 
C 3 38  GLN 38  38  38  GLN GLN A . n 
C 3 39  LEU 39  39  39  LEU LEU A . n 
C 3 40  ILE 40  40  40  ILE ILE A . n 
C 3 41  GLY 41  41  41  GLY GLY A . n 
C 3 42  GLN 42  42  42  GLN GLN A . n 
C 3 43  HIS 43  43  43  HIS HIS A . n 
C 3 44  VAL 44  44  44  VAL VAL A . n 
C 3 45  THR 45  45  45  THR THR A . n 
C 3 46  HIS 46  46  46  HIS HIS A . n 
C 3 47  VAL 47  47  47  VAL VAL A . n 
C 3 48  GLU 48  48  48  GLU GLU A . n 
C 3 49  THR 49  49  49  THR THR A . n 
C 3 50  ARG 50  50  50  ARG ARG A . n 
C 3 51  GLY 51  51  51  GLY GLY A . n 
C 3 52  LYS 52  52  52  LYS LYS A . n 
C 3 53  ALA 53  53  53  ALA ALA A . n 
C 3 54  LEU 54  54  54  LEU LEU A . n 
C 3 55  LEU 55  55  55  LEU LEU A . n 
C 3 56  THR 56  56  56  THR THR A . n 
C 3 57  HIS 57  57  57  HIS HIS A . n 
C 3 58  PHE 58  58  58  PHE PHE A . n 
C 3 59  SER 59  59  59  SER SER A . n 
C 3 60  ASN 60  60  60  ASN ASN A . n 
C 3 61  ASP 61  61  61  ASP ASP A . n 
C 3 62  LEU 62  62  62  LEU LEU A . n 
C 3 63  THR 63  63  63  THR THR A . n 
C 3 64  LEU 64  64  64  LEU LEU A . n 
C 3 65  TYR 65  65  65  TYR TYR A . n 
C 3 66  SER 66  66  66  SER SER A . n 
C 3 67  HIS 67  67  67  HIS HIS A . n 
C 3 68  ASN 68  68  68  ASN ASN A . n 
C 3 69  GLN 69  69  69  GLN GLN A . n 
C 3 70  LEU 70  70  70  LEU LEU A . n 
C 3 71  TYR 71  71  71  TYR TYR A . n 
C 3 72  GLY 72  72  72  GLY GLY A . n 
C 3 73  VAL 73  73  73  VAL VAL A . n 
C 3 74  TRP 74  74  74  TRP TRP A . n 
C 3 75  ARG 75  75  75  ARG ARG A . n 
C 3 76  VAL 76  76  76  VAL VAL A . n 
C 3 77  VAL 77  77  77  VAL VAL A . n 
C 3 78  ASP 78  78  78  ASP ASP A . n 
C 3 79  THR 79  79  79  THR THR A . n 
C 3 80  GLY 80  80  80  GLY GLY A . n 
C 3 81  GLU 81  81  81  GLU GLU A . n 
C 3 82  GLU 82  82  82  GLU ALA A . n 
C 3 83  PRO 83  83  83  PRO PRO A . n 
C 3 84  GLN 84  84  84  GLN ALA A . n 
C 3 85  THR 85  85  85  THR THR A . n 
C 3 86  THR 86  86  86  THR THR A . n 
C 3 87  ARG 87  87  87  ARG ARG A . n 
C 3 88  VAL 88  88  88  VAL VAL A . n 
C 3 89  LEU 89  89  89  LEU LEU A . n 
C 3 90  ARG 90  90  90  ARG ARG A . n 
C 3 91  VAL 91  91  91  VAL VAL A . n 
C 3 92  LYS 92  92  92  LYS LYS A . n 
C 3 93  LEU 93  93  93  LEU LEU A . n 
C 3 94  GLN 94  94  94  GLN GLN A . n 
C 3 95  THR 95  95  95  THR THR A . n 
C 3 96  ALA 96  96  96  ALA ALA A . n 
C 3 97  ASP 97  97  97  ASP ASP A . n 
C 3 98  LYS 98  98  98  LYS LYS A . n 
C 3 99  THR 99  99  99  THR THR A . n 
C 3 100 ILE 100 100 100 ILE ILE A . n 
C 3 101 LEU 101 101 101 LEU LEU A . n 
C 3 102 LEU 102 102 102 LEU LEU A . n 
C 3 103 TYR 103 103 103 TYR TYR A . n 
C 3 104 SER 104 104 104 SER SER A . n 
C 3 105 ALA 105 105 105 ALA ALA A . n 
C 3 106 SER 106 106 106 SER SER A . n 
C 3 107 ASP 107 107 107 ASP ASP A . n 
C 3 108 ILE 108 108 108 ILE ILE A . n 
C 3 109 GLU 109 109 109 GLU GLU A . n 
C 3 110 MET 110 110 110 MET MET A . n 
C 3 111 LEU 111 111 111 LEU LEU A . n 
C 3 112 ARG 112 112 112 ARG ARG A . n 
C 3 113 PRO 113 113 113 PRO PRO A . n 
C 3 114 GLU 114 114 114 GLU GLU A . n 
C 3 115 GLN 115 115 115 GLN GLN A . n 
C 3 116 LEU 116 116 116 LEU LEU A . n 
C 3 117 THR 117 117 117 THR THR A . n 
C 3 118 THR 118 118 118 THR THR A . n 
C 3 119 HIS 119 119 119 HIS HIS A . n 
C 3 120 PRO 120 120 120 PRO PRO A . n 
C 3 121 PHE 121 121 121 PHE PHE A . n 
C 3 122 LEU 122 122 122 LEU LEU A . n 
C 3 123 GLN 123 123 123 GLN GLN A . n 
C 3 124 ARG 124 124 124 ARG ARG A . n 
C 3 125 VAL 125 125 125 VAL VAL A . n 
C 3 126 GLY 126 126 126 GLY GLY A . n 
C 3 127 PRO 127 127 127 PRO PRO A . n 
C 3 128 ASP 128 128 128 ASP ASP A . n 
C 3 129 VAL 129 129 129 VAL VAL A . n 
C 3 130 LEU 130 130 130 LEU LEU A . n 
C 3 131 ASP 131 131 131 ASP ASP A . n 
C 3 132 PRO 132 132 132 PRO PRO A . n 
C 3 133 ASN 133 133 133 ASN ASN A . n 
C 3 134 LEU 134 134 134 LEU LEU A . n 
C 3 135 THR 135 135 135 THR THR A . n 
C 3 136 PRO 136 136 136 PRO PRO A . n 
C 3 137 GLU 137 137 137 GLU GLU A . n 
C 3 138 VAL 138 138 138 VAL VAL A . n 
C 3 139 VAL 139 139 139 VAL VAL A . n 
C 3 140 LYS 140 140 140 LYS LYS A . n 
C 3 141 GLU 141 141 141 GLU GLU A . n 
C 3 142 ARG 142 142 142 ARG ARG A . n 
C 3 143 LEU 143 143 143 LEU LEU A . n 
C 3 144 LEU 144 144 144 LEU LEU A . n 
C 3 145 SER 145 145 145 SER SER A . n 
C 3 146 PRO 146 146 146 PRO PRO A . n 
C 3 147 ARG 147 147 147 ARG ARG A . n 
C 3 148 PHE 148 148 148 PHE PHE A . n 
C 3 149 ARG 149 149 149 ARG ARG A . n 
C 3 150 ASN 150 150 150 ASN ASN A . n 
C 3 151 ARG 151 151 151 ARG ARG A . n 
C 3 152 GLN 152 152 152 GLN GLN A . n 
C 3 153 PHE 153 153 153 PHE PHE A . n 
C 3 154 ALA 154 154 154 ALA ALA A . n 
C 3 155 GLY 155 155 155 GLY GLY A . n 
C 3 156 LEU 156 156 156 LEU LEU A . n 
C 3 157 LEU 157 157 157 LEU LEU A . n 
C 3 158 LEU 158 158 158 LEU LEU A . n 
C 3 159 ASP 159 159 159 ASP ASP A . n 
C 3 160 GLN 160 160 160 GLN GLN A . n 
C 3 161 ALA 161 161 161 ALA ALA A . n 
C 3 162 PHE 162 162 162 PHE PHE A . n 
C 3 163 LEU 163 163 163 LEU LEU A . n 
C 3 164 ALA 164 164 164 ALA ALA A . n 
C 3 165 GLY 165 165 165 GLY GLY A . n 
C 3 166 LEU 166 166 166 LEU LEU A . n 
C 3 167 GLY 167 167 167 GLY GLY A . n 
C 3 168 ASN 168 168 168 ASN ASN A . n 
C 3 169 TYR 169 169 169 TYR TYR A . n 
C 3 170 LEU 170 170 170 LEU LEU A . n 
C 3 171 ARG 171 171 171 ARG ARG A . n 
C 3 172 VAL 172 172 172 VAL VAL A . n 
C 3 173 GLU 173 173 173 GLU GLU A . n 
C 3 174 ILE 174 174 174 ILE ILE A . n 
C 3 175 LEU 175 175 175 LEU LEU A . n 
C 3 176 TRP 176 176 176 TRP TRP A . n 
C 3 177 GLN 177 177 177 GLN GLN A . n 
C 3 178 VAL 178 178 178 VAL VAL A . n 
C 3 179 GLY 179 179 179 GLY GLY A . n 
C 3 180 LEU 180 180 180 LEU LEU A . n 
C 3 181 THR 181 181 181 THR THR A . n 
C 3 182 GLY 182 182 182 GLY GLY A . n 
C 3 183 ASN 183 183 183 ASN ASN A . n 
C 3 184 HIS 184 184 184 HIS HIS A . n 
C 3 185 LYS 185 185 185 LYS LYS A . n 
C 3 186 ALA 186 186 186 ALA ALA A . n 
C 3 187 LYS 187 187 187 LYS LYS A . n 
C 3 188 ASP 188 188 188 ASP ASP A . n 
C 3 189 LEU 189 189 189 LEU LEU A . n 
C 3 190 ASN 190 190 190 ASN ASN A . n 
C 3 191 ALA 191 191 191 ALA ALA A . n 
C 3 192 ALA 192 192 192 ALA ALA A . n 
C 3 193 GLN 193 193 193 GLN GLN A . n 
C 3 194 LEU 194 194 194 LEU LEU A . n 
C 3 195 ASP 195 195 195 ASP ASP A . n 
C 3 196 ALA 196 196 196 ALA ALA A . n 
C 3 197 LEU 197 197 197 LEU LEU A . n 
C 3 198 ALA 198 198 198 ALA ALA A . n 
C 3 199 HIS 199 199 199 HIS HIS A . n 
C 3 200 ALA 200 200 200 ALA ALA A . n 
C 3 201 LEU 201 201 201 LEU LEU A . n 
C 3 202 LEU 202 202 202 LEU LEU A . n 
C 3 203 GLU 203 203 203 GLU GLU A . n 
C 3 204 ILE 204 204 204 ILE ILE A . n 
C 3 205 PRO 205 205 205 PRO PRO A . n 
C 3 206 ARG 206 206 206 ARG ARG A . n 
C 3 207 PHE 207 207 207 PHE PHE A . n 
C 3 208 SER 208 208 208 SER SER A . n 
C 3 209 TYR 209 209 209 TYR TYR A . n 
C 3 210 ALA 210 210 210 ALA ALA A . n 
C 3 211 THR 211 211 211 THR THR A . n 
C 3 212 ARG 212 212 212 ARG ARG A . n 
C 3 213 GLY 213 213 213 GLY GLY A . n 
C 3 214 GLN 214 214 ?   ?   ?   A . n 
C 3 215 VAL 215 215 ?   ?   ?   A . n 
C 3 216 ASP 216 216 ?   ?   ?   A . n 
C 3 217 GLU 217 217 ?   ?   ?   A . n 
C 3 218 ASN 218 218 ?   ?   ?   A . n 
C 3 219 LYS 219 219 ?   ?   ?   A . n 
C 3 220 HIS 220 220 ?   ?   ?   A . n 
C 3 221 HIS 221 221 ?   ?   ?   A . n 
C 3 222 GLY 222 222 ?   ?   ?   A . n 
C 3 223 ALA 223 223 223 ALA ALA A . n 
C 3 224 LEU 224 224 224 LEU LEU A . n 
C 3 225 PHE 225 225 225 PHE PHE A . n 
C 3 226 ARG 226 226 226 ARG ARG A . n 
C 3 227 PHE 227 227 227 PHE PHE A . n 
C 3 228 LYS 228 228 228 LYS LYS A . n 
C 3 229 VAL 229 229 229 VAL VAL A . n 
C 3 230 PHE 230 230 230 PHE PHE A . n 
C 3 231 HIS 231 231 231 HIS HIS A . n 
C 3 232 ARG 232 232 232 ARG ARG A . n 
C 3 233 ASP 233 233 233 ASP ASP A . n 
C 3 234 GLY 234 234 234 GLY GLY A . n 
C 3 235 GLU 235 235 235 GLU GLU A . n 
C 3 236 PRO 236 236 236 PRO PRO A . n 
C 3 237 CYS 237 237 237 CYS CYS A . n 
C 3 238 GLU 238 238 238 GLU GLU A . n 
C 3 239 ARG 239 239 239 ARG ARG A . n 
C 3 240 CYS 240 240 240 CYS CYS A . n 
C 3 241 GLY 241 241 241 GLY GLY A . n 
C 3 242 SER 242 242 242 SER SER A . n 
C 3 243 ILE 243 243 243 ILE ILE A . n 
C 3 244 ILE 244 244 244 ILE ILE A . n 
C 3 245 GLU 245 245 245 GLU GLU A . n 
C 3 246 LYS 246 246 246 LYS LYS A . n 
C 3 247 THR 247 247 247 THR THR A . n 
C 3 248 THR 248 248 248 THR THR A . n 
C 3 249 LEU 249 249 249 LEU LEU A . n 
C 3 250 SER 250 250 250 SER SER A . n 
C 3 251 SER 251 251 251 SER SER A . n 
C 3 252 ARG 252 252 252 ARG ARG A . n 
C 3 253 PRO 253 253 253 PRO PRO A . n 
C 3 254 PHE 254 254 254 PHE PHE A . n 
C 3 255 TYR 255 255 255 TYR TYR A . n 
C 3 256 TRP 256 256 256 TRP TRP A . n 
C 3 257 CYS 257 257 257 CYS CYS A . n 
C 3 258 PRO 258 258 258 PRO PRO A . n 
C 3 259 GLY 259 259 259 GLY GLY A . n 
C 3 260 CYS 260 260 260 CYS CYS A . n 
C 3 261 GLN 261 261 261 GLN GLN A . n 
C 3 262 HIS 262 262 262 HIS HIS A . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A BRU 4  B BRU 404 ? DU ? 
2 A BRU 5  B BRU 405 ? DU ? 
3 A BRU 8  B BRU 408 ? DU ? 
4 A BRU 11 B BRU 411 ? DU ? 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 960  ? P HOH . 
2 1 A HOH 1067 ? P HOH . 
3 1 A HOH 1085 ? P HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG ? C CYS 237 ? A CYS 237 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 SG ? C CYS 240 ? A CYS 240 ? 1_555 116.3 ? 
2 SG ? C CYS 237 ? A CYS 237 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 SG ? C CYS 257 ? A CYS 257 ? 1_555 106.4 ? 
3 SG ? C CYS 240 ? A CYS 240 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 SG ? C CYS 257 ? A CYS 257 ? 1_555 96.4  ? 
4 SG ? C CYS 237 ? A CYS 237 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 SG ? C CYS 260 ? A CYS 260 ? 1_555 104.8 ? 
5 SG ? C CYS 240 ? A CYS 240 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 SG ? C CYS 260 ? A CYS 260 ? 1_555 120.5 ? 
6 SG ? C CYS 257 ? A CYS 257 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 SG ? C CYS 260 ? A CYS 260 ? 1_555 111.7 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-10-04 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
SHELX     'model building' . ? 3 
SHELXL-97 refinement       . ? 4 
SHELX     phasing          . ? 5 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C4 B DG 412 ? ? C5 B DG 412 ? ? 1.426 1.379 0.047 0.007 N 
2 1 C4 C DG 431 ? ? C5 C DG 431 ? ? 1.423 1.379 0.044 0.007 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1   1 OP1   B DC  403 ? ? P     B DC  403 ? ? OP2   B DC  403 ? ? 109.66 119.60 -9.94  1.50 N 
2   1 "O4'" B DC  403 ? ? "C1'" B DC  403 ? ? "C2'" B DC  403 ? ? 99.94  105.90 -5.96  0.80 N 
3   1 C6    B DC  403 ? ? N1    B DC  403 ? ? C2    B DC  403 ? ? 117.29 120.30 -3.01  0.40 N 
4   1 C2    B DC  403 ? ? N3    B DC  403 ? ? C4    B DC  403 ? ? 129.82 119.90 9.92   0.50 N 
5   1 N3    B DC  403 ? ? C4    B DC  403 ? ? C5    B DC  403 ? ? 114.43 121.90 -7.47  0.40 N 
6   1 C5    B DC  403 ? ? C6    B DC  403 ? ? N1    B DC  403 ? ? 126.52 121.00 5.52   0.50 N 
7   1 N3    B DC  403 ? ? C2    B DC  403 ? ? O2    B DC  403 ? ? 126.66 121.90 4.76   0.70 N 
8   1 N3    B DC  403 ? ? C4    B DC  403 ? ? N4    B DC  403 ? ? 124.39 118.00 6.39   0.70 N 
9   1 "C3'" B BRU 404 ? ? "O3'" B BRU 404 ? ? P     B BRU 405 ? ? 110.94 119.70 -8.76  1.20 Y 
10  1 "O3'" B BRU 405 ? ? P     B DC  406 ? ? OP1   B DC  406 ? ? 117.69 110.50 7.19   1.10 Y 
11  1 C2    B DC  406 ? ? N3    B DC  406 ? ? C4    B DC  406 ? ? 123.51 119.90 3.61   0.50 N 
12  1 N3    B DC  406 ? ? C4    B DC  406 ? ? C5    B DC  406 ? ? 117.27 121.90 -4.63  0.40 N 
13  1 "O3'" B DC  406 ? ? P     B DA  407 ? ? OP1   B DA  407 ? ? 117.97 110.50 7.47   1.10 Y 
14  1 C2    B DA  407 ? ? N3    B DA  407 ? ? C4    B DA  407 ? ? 113.81 110.60 3.21   0.50 N 
15  1 N3    B DA  407 ? ? C4    B DA  407 ? ? C5    B DA  407 ? ? 122.02 126.80 -4.78  0.70 N 
16  1 N9    B DA  407 ? ? C4    B DA  407 ? ? C5    B DA  407 ? ? 108.37 105.80 2.57   0.40 N 
17  1 N1    B DA  407 ? ? C6    B DA  407 ? ? N6    B DA  407 ? ? 109.98 118.60 -8.62  0.60 N 
18  1 C5    B DA  407 ? ? C6    B DA  407 ? ? N6    B DA  407 ? ? 132.21 123.70 8.51   0.80 N 
19  1 "O4'" B DC  409 ? ? "C1'" B DC  409 ? ? N1    B DC  409 ? ? 100.29 108.00 -7.71  0.70 N 
20  1 C2    B DC  409 ? ? N3    B DC  409 ? ? C4    B DC  409 ? ? 127.54 119.90 7.64   0.50 N 
21  1 N3    B DC  409 ? ? C4    B DC  409 ? ? C5    B DC  409 ? ? 115.19 121.90 -6.71  0.40 N 
22  1 N1    B DC  409 ? ? C2    B DC  409 ? ? O2    B DC  409 ? ? 114.22 118.90 -4.68  0.60 N 
23  1 N3    B DC  409 ? ? C2    B DC  409 ? ? O2    B DC  409 ? ? 129.80 121.90 7.90   0.70 N 
24  1 "O3'" B DC  409 ? ? P     B DC  410 ? ? OP2   B DC  410 ? ? 118.72 110.50 8.22   1.10 Y 
25  1 C2    B DC  410 ? ? N3    B DC  410 ? ? C4    B DC  410 ? ? 126.12 119.90 6.22   0.50 N 
26  1 N3    B DC  410 ? ? C4    B DC  410 ? ? C5    B DC  410 ? ? 116.84 121.90 -5.06  0.40 N 
27  1 N3    B DC  410 ? ? C4    B DC  410 ? ? N4    B DC  410 ? ? 122.51 118.00 4.51   0.70 N 
28  1 C6    B DG  412 ? ? N1    B DG  412 ? ? C2    B DG  412 ? ? 116.02 125.10 -9.08  0.60 N 
29  1 N1    B DG  412 ? ? C2    B DG  412 ? ? N3    B DG  412 ? ? 128.12 123.90 4.22   0.60 N 
30  1 C2    B DG  412 ? ? N3    B DG  412 ? ? C4    B DG  412 ? ? 120.61 111.90 8.71   0.50 N 
31  1 N3    B DG  412 ? ? C4    B DG  412 ? ? C5    B DG  412 ? ? 117.33 128.60 -11.27 0.50 N 
32  1 C5    B DG  412 ? ? C6    B DG  412 ? ? N1    B DG  412 ? ? 118.00 111.50 6.50   0.50 N 
33  1 C5    B DG  412 ? ? N7    B DG  412 ? ? C8    B DG  412 ? ? 98.43  104.30 -5.87  0.50 N 
34  1 N7    B DG  412 ? ? C8    B DG  412 ? ? N9    B DG  412 ? ? 123.20 113.10 10.10  0.50 N 
35  1 C8    B DG  412 ? ? N9    B DG  412 ? ? C4    B DG  412 ? ? 98.75  106.40 -7.65  0.40 N 
36  1 N9    B DG  412 ? ? C4    B DG  412 ? ? C5    B DG  412 ? ? 108.52 105.40 3.12   0.40 N 
37  1 N3    B DG  412 ? ? C4    B DG  412 ? ? N9    B DG  412 ? ? 134.12 126.00 8.12   0.60 N 
38  1 C5    B DG  412 ? ? C6    B DG  412 ? ? O6    B DG  412 ? ? 124.46 128.60 -4.14  0.60 N 
39  1 "O4'" C DC  422 ? ? "C4'" C DC  422 ? ? "C3'" C DC  422 ? ? 100.74 104.50 -3.76  0.40 N 
40  1 "O4'" C DC  422 ? ? "C1'" C DC  422 ? ? N1    C DC  422 ? ? 113.19 108.30 4.89   0.30 N 
41  1 C6    C DC  422 ? ? N1    C DC  422 ? ? C2    C DC  422 ? ? 117.31 120.30 -2.99  0.40 N 
42  1 C2    C DC  422 ? ? N3    C DC  422 ? ? C4    C DC  422 ? ? 129.42 119.90 9.52   0.50 N 
43  1 N3    C DC  422 ? ? C4    C DC  422 ? ? C5    C DC  422 ? ? 114.52 121.90 -7.38  0.40 N 
44  1 C5    C DC  422 ? ? C6    C DC  422 ? ? N1    C DC  422 ? ? 126.32 121.00 5.32   0.50 N 
45  1 N1    C DC  422 ? ? C2    C DC  422 ? ? O2    C DC  422 ? ? 115.02 118.90 -3.88  0.60 N 
46  1 N3    C DC  422 ? ? C2    C DC  422 ? ? O2    C DC  422 ? ? 129.37 121.90 7.47   0.70 N 
47  1 C5    C DC  422 ? ? C4    C DC  422 ? ? N4    C DC  422 ? ? 124.59 120.20 4.39   0.70 N 
48  1 C6    C DC  422 ? ? N1    C DC  422 ? ? "C1'" C DC  422 ? ? 130.23 120.80 9.43   1.20 N 
49  1 "O4'" C DA  423 ? ? "C4'" C DA  423 ? ? "C3'" C DA  423 ? ? 101.52 104.50 -2.98  0.40 N 
50  1 C6    C DG  424 ? ? N1    C DG  424 ? ? C2    C DG  424 ? ? 119.20 125.10 -5.90  0.60 N 
51  1 N1    C DG  424 ? ? C2    C DG  424 ? ? N3    C DG  424 ? ? 128.92 123.90 5.02   0.60 N 
52  1 C2    C DG  424 ? ? N3    C DG  424 ? ? C4    C DG  424 ? ? 115.17 111.90 3.27   0.50 N 
53  1 N3    C DG  424 ? ? C4    C DG  424 ? ? C5    C DG  424 ? ? 122.71 128.60 -5.89  0.50 N 
54  1 C5    C DG  424 ? ? C6    C DG  424 ? ? N1    C DG  424 ? ? 115.03 111.50 3.53   0.50 N 
55  1 C5    C DG  424 ? ? N7    C DG  424 ? ? C8    C DG  424 ? ? 97.83  104.30 -6.47  0.50 N 
56  1 N7    C DG  424 ? ? C8    C DG  424 ? ? N9    C DG  424 ? ? 123.21 113.10 10.11  0.50 N 
57  1 C8    C DG  424 ? ? N9    C DG  424 ? ? C4    C DG  424 ? ? 98.65  106.40 -7.75  0.40 N 
58  1 N9    C DG  424 ? ? C4    C DG  424 ? ? C5    C DG  424 ? ? 108.71 105.40 3.31   0.40 N 
59  1 N3    C DG  424 ? ? C2    C DG  424 ? ? N2    C DG  424 ? ? 115.01 119.90 -4.89  0.70 N 
60  1 C8    C DG  424 ? ? N9    C DG  424 ? ? "C1'" C DG  424 ? ? 139.65 127.00 12.65  1.30 N 
61  1 "O4'" C DG  425 ? ? "C1'" C DG  425 ? ? N9    C DG  425 ? ? 103.63 108.00 -4.37  0.70 N 
62  1 C6    C DG  425 ? ? N1    C DG  425 ? ? C2    C DG  425 ? ? 121.36 125.10 -3.74  0.60 N 
63  1 C2    C DG  425 ? ? N3    C DG  425 ? ? C4    C DG  425 ? ? 115.87 111.90 3.97   0.50 N 
64  1 N3    C DG  425 ? ? C4    C DG  425 ? ? C5    C DG  425 ? ? 123.35 128.60 -5.25  0.50 N 
65  1 C5    C DG  425 ? ? N7    C DG  425 ? ? C8    C DG  425 ? ? 99.45  104.30 -4.85  0.50 N 
66  1 N7    C DG  425 ? ? C8    C DG  425 ? ? N9    C DG  425 ? ? 120.66 113.10 7.56   0.50 N 
67  1 C8    C DG  425 ? ? N9    C DG  425 ? ? C4    C DG  425 ? ? 100.77 106.40 -5.63  0.40 N 
68  1 C5    C DG  425 ? ? C6    C DG  425 ? ? O6    C DG  425 ? ? 124.59 128.60 -4.01  0.60 N 
69  1 C8    C DG  425 ? ? N9    C DG  425 ? ? "C1'" C DG  425 ? ? 135.87 127.00 8.87   1.30 N 
70  1 C6    C DA  426 ? ? N1    C DA  426 ? ? C2    C DA  426 ? ? 123.00 118.60 4.40   0.60 N 
71  1 N1    C DA  426 ? ? C2    C DA  426 ? ? N3    C DA  426 ? ? 126.09 129.30 -3.21  0.50 N 
72  1 C5    C DA  426 ? ? C6    C DA  426 ? ? N1    C DA  426 ? ? 114.22 117.70 -3.48  0.50 N 
73  1 C6    C DG  428 ? ? N1    C DG  428 ? ? C2    C DG  428 ? ? 121.41 125.10 -3.69  0.60 N 
74  1 C2    C DG  428 ? ? N3    C DG  428 ? ? C4    C DG  428 ? ? 115.45 111.90 3.55   0.50 N 
75  1 C5    C DG  428 ? ? C6    C DG  428 ? ? N1    C DG  428 ? ? 115.43 111.50 3.93   0.50 N 
76  1 C4    C DG  428 ? ? C5    C DG  428 ? ? N7    C DG  428 ? ? 113.52 110.80 2.72   0.40 N 
77  1 C5    C DG  428 ? ? N7    C DG  428 ? ? C8    C DG  428 ? ? 99.16  104.30 -5.14  0.50 N 
78  1 N7    C DG  428 ? ? C8    C DG  428 ? ? N9    C DG  428 ? ? 119.19 113.10 6.09   0.50 N 
79  1 C8    C DG  428 ? ? N9    C DG  428 ? ? C4    C DG  428 ? ? 103.11 106.40 -3.29  0.40 N 
80  1 C5    C DG  428 ? ? C6    C DG  428 ? ? O6    C DG  428 ? ? 121.04 128.60 -7.56  0.60 N 
81  1 "O4'" C DA  429 ? ? "C4'" C DA  429 ? ? "C3'" C DA  429 ? ? 101.72 104.50 -2.78  0.40 N 
82  1 "C1'" C DA  429 ? ? "O4'" C DA  429 ? ? "C4'" C DA  429 ? ? 98.58  110.10 -11.52 1.00 N 
83  1 "C4'" C DA  429 ? ? "C3'" C DA  429 ? ? "O3'" C DA  429 ? ? 93.23  109.70 -16.47 2.50 N 
84  1 "C3'" C DA  429 ? ? "C2'" C DA  429 ? ? "C1'" C DA  429 ? ? 97.13  102.40 -5.27  0.80 N 
85  1 "O4'" C DA  429 ? ? "C1'" C DA  429 ? ? "C2'" C DA  429 ? ? 99.66  105.90 -6.24  0.80 N 
86  1 "O4'" C DA  429 ? ? "C1'" C DA  429 ? ? N9    C DA  429 ? ? 103.51 108.00 -4.49  0.70 N 
87  1 C6    C DA  429 ? ? N1    C DA  429 ? ? C2    C DA  429 ? ? 129.38 118.60 10.78  0.60 N 
88  1 N1    C DA  429 ? ? C2    C DA  429 ? ? N3    C DA  429 ? ? 119.47 129.30 -9.83  0.50 N 
89  1 C5    C DA  429 ? ? C6    C DA  429 ? ? N1    C DA  429 ? ? 112.13 117.70 -5.57  0.50 N 
90  1 C4    C DA  429 ? ? C5    C DA  429 ? ? N7    C DA  429 ? ? 114.37 110.70 3.67   0.50 N 
91  1 N7    C DA  429 ? ? C8    C DA  429 ? ? N9    C DA  429 ? ? 108.38 113.80 -5.42  0.50 N 
92  1 C8    C DA  429 ? ? N9    C DA  429 ? ? C4    C DA  429 ? ? 111.06 105.80 5.26   0.40 N 
93  1 N9    C DA  429 ? ? C4    C DA  429 ? ? C5    C DA  429 ? ? 101.26 105.80 -4.54  0.40 N 
94  1 N1    C DA  429 ? ? C6    C DA  429 ? ? N6    C DA  429 ? ? 124.79 118.60 6.19   0.60 N 
95  1 OP1   C DA  430 ? ? P     C DA  430 ? ? OP2   C DA  430 ? ? 132.93 119.60 13.33  1.50 N 
96  1 P     C DA  430 ? ? "O5'" C DA  430 ? ? "C5'" C DA  430 ? ? 105.99 120.90 -14.91 1.60 N 
97  1 "O4'" C DA  430 ? ? "C1'" C DA  430 ? ? N9    C DA  430 ? ? 111.27 108.30 2.97   0.30 N 
98  1 C6    C DA  430 ? ? N1    C DA  430 ? ? C2    C DA  430 ? ? 133.30 118.60 14.70  0.60 N 
99  1 N1    C DA  430 ? ? C2    C DA  430 ? ? N3    C DA  430 ? ? 120.19 129.30 -9.11  0.50 N 
100 1 C5    C DA  430 ? ? C6    C DA  430 ? ? N1    C DA  430 ? ? 109.26 117.70 -8.44  0.50 N 
101 1 C4    C DA  430 ? ? C5    C DA  430 ? ? N7    C DA  430 ? ? 115.12 110.70 4.42   0.50 N 
102 1 C8    C DA  430 ? ? N9    C DA  430 ? ? C4    C DA  430 ? ? 109.00 105.80 3.20   0.40 N 
103 1 N9    C DA  430 ? ? C4    C DA  430 ? ? C5    C DA  430 ? ? 101.71 105.80 -4.09  0.40 N 
104 1 C6    C DA  430 ? ? C5    C DA  430 ? ? N7    C DA  430 ? ? 127.59 132.30 -4.71  0.70 N 
105 1 N1    C DA  430 ? ? C6    C DA  430 ? ? N6    C DA  430 ? ? 127.68 118.60 9.08   0.60 N 
106 1 C6    C DG  431 ? ? N1    C DG  431 ? ? C2    C DG  431 ? ? 119.38 125.10 -5.72  0.60 N 
107 1 C2    C DG  431 ? ? N3    C DG  431 ? ? C4    C DG  431 ? ? 119.72 111.90 7.82   0.50 N 
108 1 N3    C DG  431 ? ? C4    C DG  431 ? ? C5    C DG  431 ? ? 118.83 128.60 -9.77  0.50 N 
109 1 C5    C DG  431 ? ? C6    C DG  431 ? ? N1    C DG  431 ? ? 116.14 111.50 4.64   0.50 N 
110 1 C5    C DG  431 ? ? N7    C DG  431 ? ? C8    C DG  431 ? ? 97.18  104.30 -7.12  0.50 N 
111 1 N7    C DG  431 ? ? C8    C DG  431 ? ? N9    C DG  431 ? ? 124.09 113.10 10.99  0.50 N 
112 1 C8    C DG  431 ? ? N9    C DG  431 ? ? C4    C DG  431 ? ? 98.32  106.40 -8.08  0.40 N 
113 1 N9    C DG  431 ? ? C4    C DG  431 ? ? C5    C DG  431 ? ? 108.40 105.40 3.00   0.40 N 
114 1 N3    C DG  431 ? ? C4    C DG  431 ? ? N9    C DG  431 ? ? 132.76 126.00 6.76   0.60 N 
115 1 CD    A ARG 75  ? ? NE    A ARG 75  ? ? CZ    A ARG 75  ? ? 142.16 123.60 18.56  1.40 N 
116 1 NE    A ARG 75  ? ? CZ    A ARG 75  ? ? NH1   A ARG 75  ? ? 125.47 120.30 5.17   0.50 N 
117 1 CB    A ASP 107 ? B CG    A ASP 107 ? B OD1   A ASP 107 ? B 112.54 118.30 -5.76  0.90 N 
118 1 CB    A ASP 107 ? B CG    A ASP 107 ? B OD2   A ASP 107 ? B 124.65 118.30 6.35   0.90 N 
119 1 CB    A ASP 188 ? ? CG    A ASP 188 ? ? OD1   A ASP 188 ? ? 125.30 118.30 7.00   0.90 N 
120 1 NE    A ARG 206 ? ? CZ    A ARG 206 ? ? NH2   A ARG 206 ? ? 117.28 120.30 -3.02  0.50 N 
121 1 NE    A ARG 226 ? ? CZ    A ARG 226 ? ? NH1   A ARG 226 ? ? 117.18 120.30 -3.12  0.50 N 
122 1 NE    A ARG 232 ? ? CZ    A ARG 232 ? ? NH1   A ARG 232 ? ? 125.15 120.30 4.85   0.50 N 
123 1 NE    A ARG 232 ? ? CZ    A ARG 232 ? ? NH2   A ARG 232 ? ? 116.80 120.30 -3.50  0.50 N 
124 1 OE1   A GLU 235 ? ? CD    A GLU 235 ? ? OE2   A GLU 235 ? ? 114.79 123.30 -8.51  1.20 N 
125 1 CD    A ARG 239 ? ? NE    A ARG 239 ? ? CZ    A ARG 239 ? ? 134.45 123.60 10.85  1.40 N 
126 1 NE    A ARG 239 ? ? CZ    A ARG 239 ? ? NH1   A ARG 239 ? ? 124.25 120.30 3.95   0.50 N 
127 1 NE    A ARG 239 ? ? CZ    A ARG 239 ? ? NH2   A ARG 239 ? ? 116.11 120.30 -4.19  0.50 N 
128 1 NE    A ARG 252 ? ? CZ    A ARG 252 ? ? NH2   A ARG 252 ? ? 116.52 120.30 -3.78  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 69  ? ? 52.39   -132.26 
2 1 GLU A 82  ? ? -161.50 92.73   
3 1 SER A 104 ? ? 77.67   -30.99  
4 1 PHE A 162 ? ? -80.73  -76.28  
5 1 ASN A 183 ? ? -98.64  54.31   
6 1 ASN A 183 ? ? -99.75  58.80   
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    "C4'" 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    B 
_pdbx_validate_chiral.auth_comp_id    BRU 
_pdbx_validate_chiral.auth_seq_id     404 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         'WRONG HAND' 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A GLU 82 ? CG  ? C GLU 82 CG  
2 1 Y 1 A GLU 82 ? CD  ? C GLU 82 CD  
3 1 Y 1 A GLU 82 ? OE1 ? C GLU 82 OE1 
4 1 Y 1 A GLU 82 ? OE2 ? C GLU 82 OE2 
5 1 Y 1 A GLN 84 ? CG  ? C GLN 84 CG  
6 1 Y 1 A GLN 84 ? CD  ? C GLN 84 CD  
7 1 Y 1 A GLN 84 ? OE1 ? C GLN 84 OE1 
8 1 Y 1 A GLN 84 ? NE2 ? C GLN 84 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B DG  401 ? A DG  1   
2  1 Y 1 B DG  402 ? A DG  2   
3  1 Y 1 B DG  413 ? A DG  13  
4  1 Y 1 C DC  421 ? B DC  1   
5  1 Y 1 C DC  432 ? B DC  12  
6  1 Y 1 C DC  433 ? B DC  13  
7  1 Y 1 A GLN 214 ? C GLN 214 
8  1 Y 1 A VAL 215 ? C VAL 215 
9  1 Y 1 A ASP 216 ? C ASP 216 
10 1 Y 1 A GLU 217 ? C GLU 217 
11 1 Y 1 A ASN 218 ? C ASN 218 
12 1 Y 1 A LYS 219 ? C LYS 219 
13 1 Y 1 A HIS 220 ? C HIS 220 
14 1 Y 1 A HIS 221 ? C HIS 221 
15 1 Y 1 A GLY 222 ? C GLY 222 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1K3X 'double helix'         
1K3X 'b-form double helix'  
1K3X 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC  3  1_555 B DG 11 1_555 1.136  -0.741 0.050  4.300   -9.862  -0.368 1 B_DC403:DG431_C  B 403 ? C 431 ? 19 1 
1 A BRU 4  1_555 B DA 10 1_555 -0.599 -0.474 0.255  -20.735 -15.268 -9.178 2 B_BRU404:DA430_C B 404 ? C 430 ? 20 1 
1 A BRU 5  1_555 B DA 9  1_555 -0.003 -0.426 -0.198 -9.474  -3.825  -2.578 3 B_BRU405:DA429_C B 405 ? C 429 ? 20 1 
1 A DC  6  1_555 B DG 8  1_555 0.335  -0.254 0.084  4.701   3.869   -0.998 4 B_DC406:DG428_C  B 406 ? C 428 ? 19 1 
1 A BRU 8  1_555 B DA 6  1_555 -0.054 -0.194 0.140  -8.938  -10.550 3.087  5 B_BRU408:DA426_C B 408 ? C 426 ? 20 1 
1 A DC  9  1_555 B DG 5  1_555 0.316  -0.282 -0.106 2.797   -11.387 0.794  6 B_DC409:DG425_C  B 409 ? C 425 ? 19 1 
1 A DC  10 1_555 B DG 4  1_555 0.146  0.101  -0.027 -4.311  -5.420  3.379  7 B_DC410:DG424_C  B 410 ? C 424 ? 19 1 
1 A BRU 11 1_555 B DA 3  1_555 -0.043 -0.179 0.175  -10.451 -15.302 -2.713 8 B_BRU411:DA423_C B 411 ? C 423 ? 20 1 
1 A DG  12 1_555 B DC 2  1_555 0.171  -0.103 -0.348 -8.941  -5.472  -3.170 9 B_DG412:DC422_C  B 412 ? C 422 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC  3  1_555 B DG 11 1_555 A BRU 4  1_555 B DA 10 1_555 -0.009 0.171  3.581 5.462  7.749  40.225 -0.676 0.660  3.522 11.082 
-7.811 41.282 1 BB_DC403BRU404:DA430DG431_CC  B 403 ? C 431 ? B 404 ? C 430 ? 
1 A BRU 4  1_555 B DA 10 1_555 A BRU 5  1_555 B DA 9  1_555 0.101  -0.164 3.140 -0.184 -3.264 41.165 0.105  -0.163 3.143 -4.633 
0.261  41.289 2 BB_BRU404BRU405:DA429DA430_CC B 404 ? C 430 ? B 405 ? C 429 ? 
1 A BRU 5  1_555 B DA 9  1_555 A DC  6  1_555 B DG 8  1_555 -0.170 -0.418 3.156 -3.434 1.982  29.228 -1.229 -0.371 3.120 3.906  
6.765  29.490 3 BB_BRU405DC406:DG428DA429_CC  B 405 ? C 429 ? B 406 ? C 428 ? 
1 A DC  6  1_555 B DG 8  1_555 A BRU 8  1_555 B DA 6  1_555 -0.400 -0.618 7.298 6.221  45.376 49.272 -4.700 0.933  5.133 44.960 
-6.164 66.281 4 BB_DC406BRU408:DA426DG428_CC  B 406 ? C 428 ? B 408 ? C 426 ? 
1 A BRU 8  1_555 B DA 6  1_555 A DC  9  1_555 B DG 5  1_555 0.235  0.225  3.027 1.173  1.765  36.707 0.134  -0.225 3.040 2.800  
-1.860 36.766 5 BB_BRU408DC409:DG425DA426_CC  B 408 ? C 426 ? B 409 ? C 425 ? 
1 A DC  9  1_555 B DG 5  1_555 A DC  10 1_555 B DG 4  1_555 1.044  0.189  3.415 4.960  9.768  33.613 -1.245 -0.931 3.449 16.360 
-8.307 35.305 6 BB_DC409DC410:DG424DG425_CC   B 409 ? C 425 ? B 410 ? C 424 ? 
1 A DC  10 1_555 B DG 4  1_555 A BRU 11 1_555 B DA 3  1_555 -1.211 0.199  3.431 -1.901 -0.258 35.223 0.369  1.700  3.488 -0.426 
3.139  35.273 7 BB_DC410BRU411:DA423DG424_CC  B 410 ? C 424 ? B 411 ? C 423 ? 
1 A BRU 11 1_555 B DA 3  1_555 A DG  12 1_555 B DC 2  1_555 0.626  2.121  3.383 3.102  3.068  45.522 2.446  -0.519 3.544 3.954  
-3.999 45.719 8 BB_BRU411DG412:DC422DA423_CC  B 411 ? C 423 ? B 412 ? C 422 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION'    ZN  
5 'SULFATE ION' SO4 
6 GLYCEROL      GOL 
7 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 ZN  1   501  501  ZN  ZN2 A . 
E 5 SO4 1   551  551  SO4 SO4 A . 
F 5 SO4 1   552  552  SO4 SO4 A . 
G 5 SO4 1   553  553  SO4 SO4 A . 
H 5 SO4 1   554  554  SO4 SO4 A . 
I 5 SO4 1   555  555  SO4 SO4 A . 
J 6 GOL 1   511  511  GOL GOL A . 
K 6 GOL 1   512  512  GOL GOL A . 
L 6 GOL 1   513  513  GOL GOL A . 
M 6 GOL 1   514  514  GOL GOL A . 
N 7 HOH 1   723  723  HOH HOH B . 
N 7 HOH 2   745  745  HOH HOH B . 
N 7 HOH 3   765  765  HOH HOH B . 
N 7 HOH 4   772  772  HOH HOH B . 
N 7 HOH 5   782  782  HOH HOH B . 
N 7 HOH 6   845  845  HOH HOH B . 
N 7 HOH 7   874  874  HOH HOH B . 
N 7 HOH 8   877  877  HOH HOH B . 
N 7 HOH 9   895  895  HOH HOH B . 
N 7 HOH 10  903  903  HOH HOH B . 
N 7 HOH 11  921  921  HOH HOH B . 
N 7 HOH 12  938  938  HOH HOH B . 
N 7 HOH 13  942  942  HOH HOH B . 
N 7 HOH 14  971  971  HOH HOH B . 
N 7 HOH 15  995  995  HOH HOH B . 
N 7 HOH 16  1008 1008 HOH HOH B . 
N 7 HOH 17  1010 1010 HOH HOH B . 
N 7 HOH 18  1016 1016 HOH HOH B . 
N 7 HOH 19  1021 1021 HOH HOH B . 
N 7 HOH 20  1046 1046 HOH HOH B . 
N 7 HOH 21  1047 1047 HOH HOH B . 
N 7 HOH 22  1048 1048 HOH HOH B . 
N 7 HOH 23  1057 1057 HOH HOH B . 
N 7 HOH 24  1068 1068 HOH HOH B . 
O 7 HOH 1   638  638  HOH HOH C . 
O 7 HOH 2   656  656  HOH HOH C . 
O 7 HOH 3   664  664  HOH HOH C . 
O 7 HOH 4   668  668  HOH HOH C . 
O 7 HOH 5   696  696  HOH HOH C . 
O 7 HOH 6   714  714  HOH HOH C . 
O 7 HOH 7   755  755  HOH HOH C . 
O 7 HOH 8   759  759  HOH HOH C . 
O 7 HOH 9   764  764  HOH HOH C . 
O 7 HOH 10  790  790  HOH HOH C . 
O 7 HOH 11  819  819  HOH HOH C . 
O 7 HOH 12  881  881  HOH HOH C . 
O 7 HOH 13  885  885  HOH HOH C . 
O 7 HOH 14  906  906  HOH HOH C . 
O 7 HOH 15  909  909  HOH HOH C . 
O 7 HOH 16  946  946  HOH HOH C . 
O 7 HOH 17  965  965  HOH HOH C . 
O 7 HOH 18  1031 1031 HOH HOH C . 
O 7 HOH 19  1036 1036 HOH HOH C . 
O 7 HOH 20  1042 1042 HOH HOH C . 
O 7 HOH 21  1063 1063 HOH HOH C . 
O 7 HOH 22  1066 1066 HOH HOH C . 
O 7 HOH 23  1072 1072 HOH HOH C . 
P 7 HOH 1   601  601  HOH HOH A . 
P 7 HOH 2   602  602  HOH HOH A . 
P 7 HOH 3   603  603  HOH HOH A . 
P 7 HOH 4   604  604  HOH HOH A . 
P 7 HOH 5   605  605  HOH HOH A . 
P 7 HOH 6   606  606  HOH HOH A . 
P 7 HOH 7   607  607  HOH HOH A . 
P 7 HOH 8   608  608  HOH HOH A . 
P 7 HOH 9   609  609  HOH HOH A . 
P 7 HOH 10  610  610  HOH HOH A . 
P 7 HOH 11  611  611  HOH HOH A . 
P 7 HOH 12  612  612  HOH HOH A . 
P 7 HOH 13  613  613  HOH HOH A . 
P 7 HOH 14  614  614  HOH HOH A . 
P 7 HOH 15  615  615  HOH HOH A . 
P 7 HOH 16  616  616  HOH HOH A . 
P 7 HOH 17  617  617  HOH HOH A . 
P 7 HOH 18  618  618  HOH HOH A . 
P 7 HOH 19  619  619  HOH HOH A . 
P 7 HOH 20  620  620  HOH HOH A . 
P 7 HOH 21  621  621  HOH HOH A . 
P 7 HOH 22  622  622  HOH HOH A . 
P 7 HOH 23  623  623  HOH HOH A . 
P 7 HOH 24  624  624  HOH HOH A . 
P 7 HOH 25  625  625  HOH HOH A . 
P 7 HOH 26  626  626  HOH HOH A . 
P 7 HOH 27  627  627  HOH HOH A . 
P 7 HOH 28  628  628  HOH HOH A . 
P 7 HOH 29  629  629  HOH HOH A . 
P 7 HOH 30  630  630  HOH HOH A . 
P 7 HOH 31  631  631  HOH HOH A . 
P 7 HOH 32  632  632  HOH HOH A . 
P 7 HOH 33  633  633  HOH HOH A . 
P 7 HOH 34  634  634  HOH HOH A . 
P 7 HOH 35  635  635  HOH HOH A . 
P 7 HOH 36  636  636  HOH HOH A . 
P 7 HOH 37  637  637  HOH HOH A . 
P 7 HOH 38  639  639  HOH HOH A . 
P 7 HOH 39  640  640  HOH HOH A . 
P 7 HOH 40  641  641  HOH HOH A . 
P 7 HOH 41  642  642  HOH HOH A . 
P 7 HOH 42  643  643  HOH HOH A . 
P 7 HOH 43  644  644  HOH HOH A . 
P 7 HOH 44  645  645  HOH HOH A . 
P 7 HOH 45  646  646  HOH HOH A . 
P 7 HOH 46  647  647  HOH HOH A . 
P 7 HOH 47  648  648  HOH HOH A . 
P 7 HOH 48  649  649  HOH HOH A . 
P 7 HOH 49  650  650  HOH HOH A . 
P 7 HOH 50  651  651  HOH HOH A . 
P 7 HOH 51  652  652  HOH HOH A . 
P 7 HOH 52  653  653  HOH HOH A . 
P 7 HOH 53  654  654  HOH HOH A . 
P 7 HOH 54  655  655  HOH HOH A . 
P 7 HOH 55  657  657  HOH HOH A . 
P 7 HOH 56  658  658  HOH HOH A . 
P 7 HOH 57  659  659  HOH HOH A . 
P 7 HOH 58  660  660  HOH HOH A . 
P 7 HOH 59  661  661  HOH HOH A . 
P 7 HOH 60  662  662  HOH HOH A . 
P 7 HOH 61  663  663  HOH HOH A . 
P 7 HOH 62  665  665  HOH HOH A . 
P 7 HOH 63  666  666  HOH HOH A . 
P 7 HOH 64  667  667  HOH HOH A . 
P 7 HOH 65  669  669  HOH HOH A . 
P 7 HOH 66  670  670  HOH HOH A . 
P 7 HOH 67  671  671  HOH HOH A . 
P 7 HOH 68  672  672  HOH HOH A . 
P 7 HOH 69  673  673  HOH HOH A . 
P 7 HOH 70  674  674  HOH HOH A . 
P 7 HOH 71  675  675  HOH HOH A . 
P 7 HOH 72  676  676  HOH HOH A . 
P 7 HOH 73  677  677  HOH HOH A . 
P 7 HOH 74  678  678  HOH HOH A . 
P 7 HOH 75  679  679  HOH HOH A . 
P 7 HOH 76  680  680  HOH HOH A . 
P 7 HOH 77  681  681  HOH HOH A . 
P 7 HOH 78  682  682  HOH HOH A . 
P 7 HOH 79  683  683  HOH HOH A . 
P 7 HOH 80  684  684  HOH HOH A . 
P 7 HOH 81  685  685  HOH HOH A . 
P 7 HOH 82  686  686  HOH HOH A . 
P 7 HOH 83  687  687  HOH HOH A . 
P 7 HOH 84  688  688  HOH HOH A . 
P 7 HOH 85  689  689  HOH HOH A . 
P 7 HOH 86  690  690  HOH HOH A . 
P 7 HOH 87  691  691  HOH HOH A . 
P 7 HOH 88  692  692  HOH HOH A . 
P 7 HOH 89  693  693  HOH HOH A . 
P 7 HOH 90  694  694  HOH HOH A . 
P 7 HOH 91  695  695  HOH HOH A . 
P 7 HOH 92  697  697  HOH HOH A . 
P 7 HOH 93  698  698  HOH HOH A . 
P 7 HOH 94  699  699  HOH HOH A . 
P 7 HOH 95  700  700  HOH HOH A . 
P 7 HOH 96  701  701  HOH HOH A . 
P 7 HOH 97  702  702  HOH HOH A . 
P 7 HOH 98  703  703  HOH HOH A . 
P 7 HOH 99  704  704  HOH HOH A . 
P 7 HOH 100 705  705  HOH HOH A . 
P 7 HOH 101 706  706  HOH HOH A . 
P 7 HOH 102 707  707  HOH HOH A . 
P 7 HOH 103 708  708  HOH HOH A . 
P 7 HOH 104 709  709  HOH HOH A . 
P 7 HOH 105 710  710  HOH HOH A . 
P 7 HOH 106 711  711  HOH HOH A . 
P 7 HOH 107 712  712  HOH HOH A . 
P 7 HOH 108 713  713  HOH HOH A . 
P 7 HOH 109 715  715  HOH HOH A . 
P 7 HOH 110 716  716  HOH HOH A . 
P 7 HOH 111 717  717  HOH HOH A . 
P 7 HOH 112 718  718  HOH HOH A . 
P 7 HOH 113 719  719  HOH HOH A . 
P 7 HOH 114 720  720  HOH HOH A . 
P 7 HOH 115 721  721  HOH HOH A . 
P 7 HOH 116 722  722  HOH HOH A . 
P 7 HOH 117 724  724  HOH HOH A . 
P 7 HOH 118 725  725  HOH HOH A . 
P 7 HOH 119 726  726  HOH HOH A . 
P 7 HOH 120 727  727  HOH HOH A . 
P 7 HOH 121 728  728  HOH HOH A . 
P 7 HOH 122 729  729  HOH HOH A . 
P 7 HOH 123 730  730  HOH HOH A . 
P 7 HOH 124 731  731  HOH HOH A . 
P 7 HOH 125 732  732  HOH HOH A . 
P 7 HOH 126 733  733  HOH HOH A . 
P 7 HOH 127 734  734  HOH HOH A . 
P 7 HOH 128 735  735  HOH HOH A . 
P 7 HOH 129 736  736  HOH HOH A . 
P 7 HOH 130 737  737  HOH HOH A . 
P 7 HOH 131 738  738  HOH HOH A . 
P 7 HOH 132 739  739  HOH HOH A . 
P 7 HOH 133 740  740  HOH HOH A . 
P 7 HOH 134 741  741  HOH HOH A . 
P 7 HOH 135 742  742  HOH HOH A . 
P 7 HOH 136 743  743  HOH HOH A . 
P 7 HOH 137 744  744  HOH HOH A . 
P 7 HOH 138 746  746  HOH HOH A . 
P 7 HOH 139 747  747  HOH HOH A . 
P 7 HOH 140 748  748  HOH HOH A . 
P 7 HOH 141 749  749  HOH HOH A . 
P 7 HOH 142 750  750  HOH HOH A . 
P 7 HOH 143 751  751  HOH HOH A . 
P 7 HOH 144 752  752  HOH HOH A . 
P 7 HOH 145 753  753  HOH HOH A . 
P 7 HOH 146 754  754  HOH HOH A . 
P 7 HOH 147 756  756  HOH HOH A . 
P 7 HOH 148 757  757  HOH HOH A . 
P 7 HOH 149 758  758  HOH HOH A . 
P 7 HOH 150 760  760  HOH HOH A . 
P 7 HOH 151 761  761  HOH HOH A . 
P 7 HOH 152 762  762  HOH HOH A . 
P 7 HOH 153 763  763  HOH HOH A . 
P 7 HOH 154 766  766  HOH HOH A . 
P 7 HOH 155 767  767  HOH HOH A . 
P 7 HOH 156 768  768  HOH HOH A . 
P 7 HOH 157 769  769  HOH HOH A . 
P 7 HOH 158 770  770  HOH HOH A . 
P 7 HOH 159 771  771  HOH HOH A . 
P 7 HOH 160 773  773  HOH HOH A . 
P 7 HOH 161 774  774  HOH HOH A . 
P 7 HOH 162 775  775  HOH HOH A . 
P 7 HOH 163 776  776  HOH HOH A . 
P 7 HOH 164 777  777  HOH HOH A . 
P 7 HOH 165 778  778  HOH HOH A . 
P 7 HOH 166 779  779  HOH HOH A . 
P 7 HOH 167 780  780  HOH HOH A . 
P 7 HOH 168 781  781  HOH HOH A . 
P 7 HOH 169 783  783  HOH HOH A . 
P 7 HOH 170 784  784  HOH HOH A . 
P 7 HOH 171 785  785  HOH HOH A . 
P 7 HOH 172 786  786  HOH HOH A . 
P 7 HOH 173 787  787  HOH HOH A . 
P 7 HOH 174 788  788  HOH HOH A . 
P 7 HOH 175 789  789  HOH HOH A . 
P 7 HOH 176 791  791  HOH HOH A . 
P 7 HOH 177 792  792  HOH HOH A . 
P 7 HOH 178 793  793  HOH HOH A . 
P 7 HOH 179 794  794  HOH HOH A . 
P 7 HOH 180 795  795  HOH HOH A . 
P 7 HOH 181 796  796  HOH HOH A . 
P 7 HOH 182 797  797  HOH HOH A . 
P 7 HOH 183 798  798  HOH HOH A . 
P 7 HOH 184 799  799  HOH HOH A . 
P 7 HOH 185 800  800  HOH HOH A . 
P 7 HOH 186 801  801  HOH HOH A . 
P 7 HOH 187 802  802  HOH HOH A . 
P 7 HOH 188 803  803  HOH HOH A . 
P 7 HOH 189 804  804  HOH HOH A . 
P 7 HOH 190 805  805  HOH HOH A . 
P 7 HOH 191 806  806  HOH HOH A . 
P 7 HOH 192 807  807  HOH HOH A . 
P 7 HOH 193 808  808  HOH HOH A . 
P 7 HOH 194 809  809  HOH HOH A . 
P 7 HOH 195 810  810  HOH HOH A . 
P 7 HOH 196 811  811  HOH HOH A . 
P 7 HOH 197 812  812  HOH HOH A . 
P 7 HOH 198 813  813  HOH HOH A . 
P 7 HOH 199 814  814  HOH HOH A . 
P 7 HOH 200 815  815  HOH HOH A . 
P 7 HOH 201 816  816  HOH HOH A . 
P 7 HOH 202 817  817  HOH HOH A . 
P 7 HOH 203 818  818  HOH HOH A . 
P 7 HOH 204 820  820  HOH HOH A . 
P 7 HOH 205 821  821  HOH HOH A . 
P 7 HOH 206 822  822  HOH HOH A . 
P 7 HOH 207 823  823  HOH HOH A . 
P 7 HOH 208 824  824  HOH HOH A . 
P 7 HOH 209 825  825  HOH HOH A . 
P 7 HOH 210 826  826  HOH HOH A . 
P 7 HOH 211 827  827  HOH HOH A . 
P 7 HOH 212 828  828  HOH HOH A . 
P 7 HOH 213 829  829  HOH HOH A . 
P 7 HOH 214 830  830  HOH HOH A . 
P 7 HOH 215 831  831  HOH HOH A . 
P 7 HOH 216 832  832  HOH HOH A . 
P 7 HOH 217 833  833  HOH HOH A . 
P 7 HOH 218 834  834  HOH HOH A . 
P 7 HOH 219 835  835  HOH HOH A . 
P 7 HOH 220 836  836  HOH HOH A . 
P 7 HOH 221 837  837  HOH HOH A . 
P 7 HOH 222 838  838  HOH HOH A . 
P 7 HOH 223 839  839  HOH HOH A . 
P 7 HOH 224 840  840  HOH HOH A . 
P 7 HOH 225 841  841  HOH HOH A . 
P 7 HOH 226 842  842  HOH HOH A . 
P 7 HOH 227 843  843  HOH HOH A . 
P 7 HOH 228 844  844  HOH HOH A . 
P 7 HOH 229 846  846  HOH HOH A . 
P 7 HOH 230 847  847  HOH HOH A . 
P 7 HOH 231 848  848  HOH HOH A . 
P 7 HOH 232 849  849  HOH HOH A . 
P 7 HOH 233 850  850  HOH HOH A . 
P 7 HOH 234 851  851  HOH HOH A . 
P 7 HOH 235 852  852  HOH HOH A . 
P 7 HOH 236 853  853  HOH HOH A . 
P 7 HOH 237 854  854  HOH HOH A . 
P 7 HOH 238 855  855  HOH HOH A . 
P 7 HOH 239 856  856  HOH HOH A . 
P 7 HOH 240 857  857  HOH HOH A . 
P 7 HOH 241 858  858  HOH HOH A . 
P 7 HOH 242 859  859  HOH HOH A . 
P 7 HOH 243 860  860  HOH HOH A . 
P 7 HOH 244 861  861  HOH HOH A . 
P 7 HOH 245 862  862  HOH HOH A . 
P 7 HOH 246 863  863  HOH HOH A . 
P 7 HOH 247 864  864  HOH HOH A . 
P 7 HOH 248 865  865  HOH HOH A . 
P 7 HOH 249 866  866  HOH HOH A . 
P 7 HOH 250 867  867  HOH HOH A . 
P 7 HOH 251 868  868  HOH HOH A . 
P 7 HOH 252 869  869  HOH HOH A . 
P 7 HOH 253 870  870  HOH HOH A . 
P 7 HOH 254 871  871  HOH HOH A . 
P 7 HOH 255 872  872  HOH HOH A . 
P 7 HOH 256 873  873  HOH HOH A . 
P 7 HOH 257 875  875  HOH HOH A . 
P 7 HOH 258 876  876  HOH HOH A . 
P 7 HOH 259 878  878  HOH HOH A . 
P 7 HOH 260 879  879  HOH HOH A . 
P 7 HOH 261 880  880  HOH HOH A . 
P 7 HOH 262 882  882  HOH HOH A . 
P 7 HOH 263 883  883  HOH HOH A . 
P 7 HOH 264 884  884  HOH HOH A . 
P 7 HOH 265 886  886  HOH HOH A . 
P 7 HOH 266 887  887  HOH HOH A . 
P 7 HOH 267 888  888  HOH HOH A . 
P 7 HOH 268 889  889  HOH HOH A . 
P 7 HOH 269 890  890  HOH HOH A . 
P 7 HOH 270 891  891  HOH HOH A . 
P 7 HOH 271 892  892  HOH HOH A . 
P 7 HOH 272 893  893  HOH HOH A . 
P 7 HOH 273 894  894  HOH HOH A . 
P 7 HOH 274 896  896  HOH HOH A . 
P 7 HOH 275 897  897  HOH HOH A . 
P 7 HOH 276 898  898  HOH HOH A . 
P 7 HOH 277 899  899  HOH HOH A . 
P 7 HOH 278 900  900  HOH HOH A . 
P 7 HOH 279 901  901  HOH HOH A . 
P 7 HOH 280 902  902  HOH HOH A . 
P 7 HOH 281 904  904  HOH HOH A . 
P 7 HOH 282 905  905  HOH HOH A . 
P 7 HOH 283 907  907  HOH HOH A . 
P 7 HOH 284 908  908  HOH HOH A . 
P 7 HOH 285 910  910  HOH HOH A . 
P 7 HOH 286 911  911  HOH HOH A . 
P 7 HOH 287 912  912  HOH HOH A . 
P 7 HOH 288 913  913  HOH HOH A . 
P 7 HOH 289 914  914  HOH HOH A . 
P 7 HOH 290 915  915  HOH HOH A . 
P 7 HOH 291 917  917  HOH HOH A . 
P 7 HOH 292 918  918  HOH HOH A . 
P 7 HOH 293 919  919  HOH HOH A . 
P 7 HOH 294 920  920  HOH HOH A . 
P 7 HOH 295 922  922  HOH HOH A . 
P 7 HOH 296 923  923  HOH HOH A . 
P 7 HOH 297 924  924  HOH HOH A . 
P 7 HOH 298 925  925  HOH HOH A . 
P 7 HOH 299 926  926  HOH HOH A . 
P 7 HOH 300 927  927  HOH HOH A . 
P 7 HOH 301 928  928  HOH HOH A . 
P 7 HOH 302 929  929  HOH HOH A . 
P 7 HOH 303 930  930  HOH HOH A . 
P 7 HOH 304 931  931  HOH HOH A . 
P 7 HOH 305 932  932  HOH HOH A . 
P 7 HOH 306 933  933  HOH HOH A . 
P 7 HOH 307 934  934  HOH HOH A . 
P 7 HOH 308 935  935  HOH HOH A . 
P 7 HOH 309 936  936  HOH HOH A . 
P 7 HOH 310 937  937  HOH HOH A . 
P 7 HOH 311 939  939  HOH HOH A . 
P 7 HOH 312 940  940  HOH HOH A . 
P 7 HOH 313 941  941  HOH HOH A . 
P 7 HOH 314 943  943  HOH HOH A . 
P 7 HOH 315 944  944  HOH HOH A . 
P 7 HOH 316 945  945  HOH HOH A . 
P 7 HOH 317 947  947  HOH HOH A . 
P 7 HOH 318 948  948  HOH HOH A . 
P 7 HOH 319 949  949  HOH HOH A . 
P 7 HOH 320 950  950  HOH HOH A . 
P 7 HOH 321 951  951  HOH HOH A . 
P 7 HOH 322 952  952  HOH HOH A . 
P 7 HOH 323 953  953  HOH HOH A . 
P 7 HOH 324 954  954  HOH HOH A . 
P 7 HOH 325 955  955  HOH HOH A . 
P 7 HOH 326 956  956  HOH HOH A . 
P 7 HOH 327 957  957  HOH HOH A . 
P 7 HOH 328 958  958  HOH HOH A . 
P 7 HOH 329 959  959  HOH HOH A . 
P 7 HOH 330 960  960  HOH HOH A . 
P 7 HOH 331 961  961  HOH HOH A . 
P 7 HOH 332 962  962  HOH HOH A . 
P 7 HOH 333 963  963  HOH HOH A . 
P 7 HOH 334 964  964  HOH HOH A . 
P 7 HOH 335 966  966  HOH HOH A . 
P 7 HOH 336 967  967  HOH HOH A . 
P 7 HOH 337 968  968  HOH HOH A . 
P 7 HOH 338 969  969  HOH HOH A . 
P 7 HOH 339 970  970  HOH HOH A . 
P 7 HOH 340 972  972  HOH HOH A . 
P 7 HOH 341 973  973  HOH HOH A . 
P 7 HOH 342 974  974  HOH HOH A . 
P 7 HOH 343 975  975  HOH HOH A . 
P 7 HOH 344 976  976  HOH HOH A . 
P 7 HOH 345 977  977  HOH HOH A . 
P 7 HOH 346 978  978  HOH HOH A . 
P 7 HOH 347 979  979  HOH HOH A . 
P 7 HOH 348 980  980  HOH HOH A . 
P 7 HOH 349 981  981  HOH HOH A . 
P 7 HOH 350 982  982  HOH HOH A . 
P 7 HOH 351 983  983  HOH HOH A . 
P 7 HOH 352 984  984  HOH HOH A . 
P 7 HOH 353 985  985  HOH HOH A . 
P 7 HOH 354 986  986  HOH HOH A . 
P 7 HOH 355 987  987  HOH HOH A . 
P 7 HOH 356 988  988  HOH HOH A . 
P 7 HOH 357 989  989  HOH HOH A . 
P 7 HOH 358 990  990  HOH HOH A . 
P 7 HOH 359 991  991  HOH HOH A . 
P 7 HOH 360 992  992  HOH HOH A . 
P 7 HOH 361 993  993  HOH HOH A . 
P 7 HOH 362 994  994  HOH HOH A . 
P 7 HOH 363 996  996  HOH HOH A . 
P 7 HOH 364 997  997  HOH HOH A . 
P 7 HOH 365 998  998  HOH HOH A . 
P 7 HOH 366 999  999  HOH HOH A . 
P 7 HOH 367 1000 1000 HOH HOH A . 
P 7 HOH 368 1001 1001 HOH HOH A . 
P 7 HOH 369 1002 1002 HOH HOH A . 
P 7 HOH 370 1003 1003 HOH HOH A . 
P 7 HOH 371 1004 1004 HOH HOH A . 
P 7 HOH 372 1005 1005 HOH HOH A . 
P 7 HOH 373 1007 1007 HOH HOH A . 
P 7 HOH 374 1009 1009 HOH HOH A . 
P 7 HOH 375 1011 1011 HOH HOH A . 
P 7 HOH 376 1012 1012 HOH HOH A . 
P 7 HOH 377 1013 1013 HOH HOH A . 
P 7 HOH 378 1014 1014 HOH HOH A . 
P 7 HOH 379 1015 1015 HOH HOH A . 
P 7 HOH 380 1017 1017 HOH HOH A . 
P 7 HOH 381 1018 1018 HOH HOH A . 
P 7 HOH 382 1019 1019 HOH HOH A . 
P 7 HOH 383 1020 1020 HOH HOH A . 
P 7 HOH 384 1022 1022 HOH HOH A . 
P 7 HOH 385 1023 1023 HOH HOH A . 
P 7 HOH 386 1024 1024 HOH HOH A . 
P 7 HOH 387 1025 1025 HOH HOH A . 
P 7 HOH 388 1026 1026 HOH HOH A . 
P 7 HOH 389 1027 1027 HOH HOH A . 
P 7 HOH 390 1028 1028 HOH HOH A . 
P 7 HOH 391 1029 1029 HOH HOH A . 
P 7 HOH 392 1030 1030 HOH HOH A . 
P 7 HOH 393 1032 1032 HOH HOH A . 
P 7 HOH 394 1033 1033 HOH HOH A . 
P 7 HOH 395 1034 1034 HOH HOH A . 
P 7 HOH 396 1035 1035 HOH HOH A . 
P 7 HOH 397 1037 1037 HOH HOH A . 
P 7 HOH 398 1038 1038 HOH HOH A . 
P 7 HOH 399 1039 1039 HOH HOH A . 
P 7 HOH 400 1040 1040 HOH HOH A . 
P 7 HOH 401 1041 1041 HOH HOH A . 
P 7 HOH 402 1043 1043 HOH HOH A . 
P 7 HOH 403 1044 1044 HOH HOH A . 
P 7 HOH 404 1045 1045 HOH HOH A . 
P 7 HOH 405 1049 1049 HOH HOH A . 
P 7 HOH 406 1050 1050 HOH HOH A . 
P 7 HOH 407 1051 1051 HOH HOH A . 
P 7 HOH 408 1052 1052 HOH HOH A . 
P 7 HOH 409 1054 1054 HOH HOH A . 
P 7 HOH 410 1055 1055 HOH HOH A . 
P 7 HOH 411 1056 1056 HOH HOH A . 
P 7 HOH 412 1058 1058 HOH HOH A . 
P 7 HOH 413 1059 1059 HOH HOH A . 
P 7 HOH 414 1060 1060 HOH HOH A . 
P 7 HOH 415 1061 1061 HOH HOH A . 
P 7 HOH 416 1062 1062 HOH HOH A . 
P 7 HOH 417 1064 1064 HOH HOH A . 
P 7 HOH 418 1067 1067 HOH HOH A . 
P 7 HOH 419 1069 1069 HOH HOH A . 
P 7 HOH 420 1070 1070 HOH HOH A . 
P 7 HOH 421 1071 1071 HOH HOH A . 
P 7 HOH 422 1073 1073 HOH HOH A . 
P 7 HOH 423 1074 1074 HOH HOH A . 
P 7 HOH 424 1075 1075 HOH HOH A . 
P 7 HOH 425 1076 1076 HOH HOH A . 
P 7 HOH 426 1077 1077 HOH HOH A . 
P 7 HOH 427 1078 1078 HOH HOH A . 
P 7 HOH 428 1079 1079 HOH HOH A . 
P 7 HOH 429 1080 1080 HOH HOH A . 
P 7 HOH 430 1081 1081 HOH HOH A . 
P 7 HOH 431 1082 1082 HOH HOH A . 
P 7 HOH 432 1083 1083 HOH HOH A . 
P 7 HOH 433 1084 1084 HOH HOH A . 
P 7 HOH 434 1085 1085 HOH HOH A . 
P 7 HOH 435 1086 1086 HOH HOH A . 
P 7 HOH 436 1087 1087 HOH HOH A . 
P 7 HOH 437 1088 1088 HOH HOH A . 
P 7 HOH 438 1089 1089 HOH HOH A . 
P 7 HOH 439 1090 1090 HOH HOH A . 
P 7 HOH 440 1091 1091 HOH HOH A . 
P 7 HOH 441 1092 1092 HOH HOH A . 
#