data_1KA7
# 
_entry.id   1KA7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KA7         
RCSB  RCSB014753   
WWPDB D_1000014753 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1KA6 
_pdbx_database_related.details        'SAP/SH2D1A bound to peptide n-pY' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KA7 
_pdbx_database_status.recvd_initial_deposition_date   2001-10-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hwang, P.M.'    1  
'Li, C.'         2  
'Morra, M.'      3  
'Lillywhite, J.' 4  
'Gertler, F.'    5  
'Terhorst, C.'   6  
'Kay, L.E.'      7  
'Pawson, T.'     8  
'Forman-Kay, J.' 9  
'Li, S.-C.'      10 
# 
_citation.id                        primary 
_citation.title                     
;A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
;
_citation.journal_abbrev            'EMBO J.' 
_citation.journal_volume            21 
_citation.page_first                314 
_citation.page_last                 323 
_citation.year                      2002 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11823424 
_citation.pdbx_database_id_DOI      10.1093/emboj/21.3.314 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hwang, P.M.'      1  
primary 'Li, C.'           2  
primary 'Morra, M.'        3  
primary 'Lillywhite, J.'   4  
primary 'Muhandiram, D.R.' 5  
primary 'Gertler, F.'      6  
primary 'Terhorst, C.'     7  
primary 'Kay, L.E.'        8  
primary 'Pawson, T.'       9  
primary 'Forman-Kay, J.D.' 10 
primary 'Li, S.C.'         11 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'SH2 DOMAIN PROTEIN 1A' 14206.181 1 ? ?     ?                                       ? 
2 polymer syn 'peptide n-Y-c'         1437.706  1 ? K275R 'Cytoplasmic region (residues 275-286)' ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'SLAM-ASSOCIATED PROTEIN'                   
2 'SIGNALING LYMPHOCYTIC ACTIVATION MOLECULE' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKI
KNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
;
;MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKI
KNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
;
A ? 
2 'polypeptide(L)' no no RKSLTIYAQVQK RKSLTIYAQVQK B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   ALA n 
1 4   VAL n 
1 5   ALA n 
1 6   VAL n 
1 7   TYR n 
1 8   HIS n 
1 9   GLY n 
1 10  LYS n 
1 11  ILE n 
1 12  SER n 
1 13  ARG n 
1 14  GLU n 
1 15  THR n 
1 16  GLY n 
1 17  GLU n 
1 18  LYS n 
1 19  LEU n 
1 20  LEU n 
1 21  LEU n 
1 22  ALA n 
1 23  THR n 
1 24  GLY n 
1 25  LEU n 
1 26  ASP n 
1 27  GLY n 
1 28  SER n 
1 29  TYR n 
1 30  LEU n 
1 31  LEU n 
1 32  ARG n 
1 33  ASP n 
1 34  SER n 
1 35  GLU n 
1 36  SER n 
1 37  VAL n 
1 38  PRO n 
1 39  GLY n 
1 40  VAL n 
1 41  TYR n 
1 42  CYS n 
1 43  LEU n 
1 44  CYS n 
1 45  VAL n 
1 46  LEU n 
1 47  TYR n 
1 48  HIS n 
1 49  GLY n 
1 50  TYR n 
1 51  ILE n 
1 52  TYR n 
1 53  THR n 
1 54  TYR n 
1 55  ARG n 
1 56  VAL n 
1 57  SER n 
1 58  GLN n 
1 59  THR n 
1 60  GLU n 
1 61  THR n 
1 62  GLY n 
1 63  SER n 
1 64  TRP n 
1 65  SER n 
1 66  ALA n 
1 67  GLU n 
1 68  THR n 
1 69  ALA n 
1 70  PRO n 
1 71  GLY n 
1 72  VAL n 
1 73  HIS n 
1 74  LYS n 
1 75  ARG n 
1 76  TYR n 
1 77  PHE n 
1 78  ARG n 
1 79  LYS n 
1 80  ILE n 
1 81  LYS n 
1 82  ASN n 
1 83  LEU n 
1 84  ILE n 
1 85  SER n 
1 86  ALA n 
1 87  PHE n 
1 88  GLN n 
1 89  LYS n 
1 90  PRO n 
1 91  ASP n 
1 92  GLN n 
1 93  GLY n 
1 94  ILE n 
1 95  VAL n 
1 96  ILE n 
1 97  PRO n 
1 98  LEU n 
1 99  GLN n 
1 100 TYR n 
1 101 PRO n 
1 102 VAL n 
1 103 GLU n 
1 104 LYS n 
1 105 LYS n 
1 106 SER n 
1 107 SER n 
1 108 ALA n 
1 109 ARG n 
1 110 SER n 
1 111 THR n 
1 112 GLN n 
1 113 GLY n 
1 114 THR n 
1 115 THR n 
1 116 GLY n 
1 117 ILE n 
1 118 ARG n 
1 119 GLU n 
1 120 ASP n 
1 121 PRO n 
1 122 ASP n 
1 123 VAL n 
1 124 CYS n 
1 125 LEU n 
1 126 LYS n 
1 127 ALA n 
1 128 PRO n 
2 1   ARG n 
2 2   LYS n 
2 3   SER n 
2 4   LEU n 
2 5   THR n 
2 6   ILE n 
2 7   TYR n 
2 8   ALA n 
2 9   GLN n 
2 10  VAL n 
2 11  GLN n 
2 12  LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET3a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
;This peptide was chemically synthesized (solid phase synthesis). The sequence of the peptide is naturally found in Homo sapiens (human).
;
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP SH21A_HUMAN 1 
;MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKI
KNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
;
1   O60880 ? 
2 UNP SLAF1_HUMAN 2 KKSLTIYAQVQK 275 Q13291 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1KA7 A 1 ? 128 ? O60880 1   ? 128 ? 1   128 
2 2 1KA7 B 1 ? 12  ? Q13291 275 ? 286 ? 275 286 
# 
_struct_ref_seq_dif.align_id                     2 
_struct_ref_seq_dif.pdbx_pdb_id_code             1KA7 
_struct_ref_seq_dif.mon_id                       ARG 
_struct_ref_seq_dif.pdbx_pdb_strand_id           B 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q13291 
_struct_ref_seq_dif.db_mon_id                    LYS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          275 
_struct_ref_seq_dif.details                      ENGINEERED 
_struct_ref_seq_dif.pdbx_auth_seq_num            275 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 '3D_15N,13C-separated NOESY' 
2 1 1 '3D HNHB'                    
3 1 1 '3D_HN(CO)HB'                
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '120 mM' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1 mM SAP U-15N, 13C; 1mM n-pY; 20 mM phosphate buffer, 100mM NaCl' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.field_strength    600 
# 
_pdbx_nmr_refine.entry_id           1KA7 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1KA7 
_pdbx_nmr_details.text       'The structure was determined using triple-resonance NMR spectroscopy.' 
# 
_pdbx_nmr_ensemble.entry_id                             1KA7 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    1 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_pdbx_nmr_representative.entry_id             1KA7 
_pdbx_nmr_representative.conformer_id         ? 
_pdbx_nmr_representative.selection_criteria   'minimized average structure' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
ARIA    1.0 'structure solution' Nilges   1 
NMRPipe 1.8 processing           Delaglio 2 
NMRView 3.0 'data analysis'      Johnson  3 
ARIA    1.0 refinement           Nilges   4 
# 
_exptl.entry_id          1KA7 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1KA7 
_struct.title                     'SAP/SH2D1A bound to peptide n-Y-c' 
_struct.pdbx_descriptor           'SH2 DOMAIN PROTEIN 1A, peptide:n-Y-c (SIGNALING LYMPHOCYTIC ACTIVATION MOLECULE)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   'minimized average' 
# 
_struct_keywords.entry_id        1KA7 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'SH2 domain, protein-peptide complex, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 12 ? GLY A 24 ? SER A 12 GLY A 24 1 ? 13 
HELX_P HELX_P2 2 LYS A 81 ? GLN A 88 ? LYS A 81 GLN A 88 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP A 64  ? ALA A 66  ? TRP A 64  ALA A 66  
A 2 TYR A 50  ? GLN A 58  ? TYR A 50  GLN A 58  
A 3 TYR A 41  ? TYR A 47  ? TYR A 41  TYR A 47  
A 4 SER A 28  ? ASP A 33  ? SER A 28  ASP A 33  
A 5 TYR A 7   ? GLY A 9   ? TYR A 7   GLY A 9   
B 1 TRP A 64  ? ALA A 66  ? TRP A 64  ALA A 66  
B 2 TYR A 50  ? GLN A 58  ? TYR A 50  GLN A 58  
B 3 TYR A 41  ? TYR A 47  ? TYR A 41  TYR A 47  
B 4 SER A 28  ? ASP A 33  ? SER A 28  ASP A 33  
B 5 TYR A 100 ? PRO A 101 ? TYR A 100 PRO A 101 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O SER A 65 ? O SER A 65 N SER A 57  ? N SER A 57  
A 2 3 O VAL A 56 ? O VAL A 56 N TYR A 41  ? N TYR A 41  
A 3 4 O CYS A 42 ? O CYS A 42 N ARG A 32  ? N ARG A 32  
A 4 5 O ASP A 33 ? O ASP A 33 N GLY A 9   ? N GLY A 9   
B 1 2 O SER A 65 ? O SER A 65 N SER A 57  ? N SER A 57  
B 2 3 O VAL A 56 ? O VAL A 56 N TYR A 41  ? N TYR A 41  
B 3 4 O CYS A 42 ? O CYS A 42 N ARG A 32  ? N ARG A 32  
B 4 5 N TYR A 29 ? N TYR A 29 O TYR A 100 ? O TYR A 100 
# 
_database_PDB_matrix.entry_id          1KA7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KA7 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N    . MET A 1 1   ? -11.796 -16.329 -3.336  1.00 2.18 ? 1   MET A N    1 
ATOM 2    C CA   . MET A 1 1   ? -10.647 -17.118 -2.820  1.00 1.67 ? 1   MET A CA   1 
ATOM 3    C C    . MET A 1 1   ? -9.640  -16.222 -2.105  1.00 1.61 ? 1   MET A C    1 
ATOM 4    O O    . MET A 1 1   ? -8.846  -16.694 -1.292  1.00 2.26 ? 1   MET A O    1 
ATOM 5    C CB   . MET A 1 1   ? -9.977  -17.830 -3.996  1.00 2.45 ? 1   MET A CB   1 
ATOM 6    C CG   . MET A 1 1   ? -9.636  -19.285 -3.712  1.00 3.02 ? 1   MET A CG   1 
ATOM 7    S SD   . MET A 1 1   ? -9.992  -20.367 -5.110  1.00 3.69 ? 1   MET A SD   1 
ATOM 8    C CE   . MET A 1 1   ? -9.286  -21.909 -4.533  1.00 4.70 ? 1   MET A CE   1 
ATOM 9    H H1   . MET A 1 1   ? -12.603 -16.405 -2.684  1.00 2.53 ? 1   MET A H1   1 
ATOM 10   H H2   . MET A 1 1   ? -12.084 -16.685 -4.270  1.00 2.64 ? 1   MET A H2   1 
ATOM 11   H H3   . MET A 1 1   ? -11.531 -15.328 -3.427  1.00 2.62 ? 1   MET A H3   1 
ATOM 12   H HA   . MET A 1 1   ? -11.021 -17.854 -2.124  1.00 1.73 ? 1   MET A HA   1 
ATOM 13   H HB2  . MET A 1 1   ? -10.640 -17.798 -4.848  1.00 2.88 ? 1   MET A HB2  1 
ATOM 14   H HB3  . MET A 1 1   ? -9.063  -17.311 -4.243  1.00 2.89 ? 1   MET A HB3  1 
ATOM 15   H HG2  . MET A 1 1   ? -8.584  -19.355 -3.480  1.00 3.43 ? 1   MET A HG2  1 
ATOM 16   H HG3  . MET A 1 1   ? -10.213 -19.616 -2.861  1.00 3.29 ? 1   MET A HG3  1 
ATOM 17   H HE1  . MET A 1 1   ? -9.176  -22.588 -5.366  1.00 5.01 ? 1   MET A HE1  1 
ATOM 18   H HE2  . MET A 1 1   ? -9.939  -22.350 -3.794  1.00 5.05 ? 1   MET A HE2  1 
ATOM 19   H HE3  . MET A 1 1   ? -8.319  -21.720 -4.093  1.00 5.08 ? 1   MET A HE3  1 
ATOM 20   N N    . ASP A 1 2   ? -9.680  -14.928 -2.418  1.00 1.17 ? 2   ASP A N    1 
ATOM 21   C CA   . ASP A 1 2   ? -8.771  -13.961 -1.809  1.00 1.12 ? 2   ASP A CA   1 
ATOM 22   C C    . ASP A 1 2   ? -7.317  -14.368 -2.030  1.00 0.75 ? 2   ASP A C    1 
ATOM 23   O O    . ASP A 1 2   ? -6.625  -14.778 -1.098  1.00 0.95 ? 2   ASP A O    1 
ATOM 24   C CB   . ASP A 1 2   ? -9.059  -13.827 -0.312  1.00 1.41 ? 2   ASP A CB   1 
ATOM 25   C CG   . ASP A 1 2   ? -9.931  -12.628 0.005   1.00 2.16 ? 2   ASP A CG   1 
ATOM 26   O OD1  . ASP A 1 2   ? -11.012 -12.504 -0.607  1.00 2.89 ? 2   ASP A OD1  1 
ATOM 27   O OD2  . ASP A 1 2   ? -9.531  -11.813 0.862   1.00 2.74 ? 2   ASP A OD2  1 
ATOM 28   H H    . ASP A 1 2   ? -10.337 -14.617 -3.075  1.00 1.29 ? 2   ASP A H    1 
ATOM 29   H HA   . ASP A 1 2   ? -8.939  -13.006 -2.284  1.00 1.29 ? 2   ASP A HA   1 
ATOM 30   H HB2  . ASP A 1 2   ? -9.565  -14.717 0.032   1.00 1.75 ? 2   ASP A HB2  1 
ATOM 31   H HB3  . ASP A 1 2   ? -8.124  -13.721 0.221   1.00 1.71 ? 2   ASP A HB3  1 
ATOM 32   N N    . ALA A 1 3   ? -6.861  -14.254 -3.275  1.00 0.57 ? 3   ALA A N    1 
ATOM 33   C CA   . ALA A 1 3   ? -5.491  -14.611 -3.625  1.00 0.38 ? 3   ALA A CA   1 
ATOM 34   C C    . ALA A 1 3   ? -4.574  -13.393 -3.577  1.00 0.37 ? 3   ALA A C    1 
ATOM 35   O O    . ALA A 1 3   ? -4.565  -12.574 -4.497  1.00 0.57 ? 3   ALA A O    1 
ATOM 36   C CB   . ALA A 1 3   ? -5.455  -15.247 -5.008  1.00 0.74 ? 3   ALA A CB   1 
ATOM 37   H H    . ALA A 1 3   ? -7.463  -13.922 -3.974  1.00 0.86 ? 3   ALA A H    1 
ATOM 38   H HA   . ALA A 1 3   ? -5.143  -15.341 -2.910  1.00 0.42 ? 3   ALA A HA   1 
ATOM 39   H HB1  . ALA A 1 3   ? -6.242  -14.827 -5.617  1.00 1.24 ? 3   ALA A HB1  1 
ATOM 40   H HB2  . ALA A 1 3   ? -5.598  -16.313 -4.917  1.00 1.44 ? 3   ALA A HB2  1 
ATOM 41   H HB3  . ALA A 1 3   ? -4.499  -15.050 -5.469  1.00 1.25 ? 3   ALA A HB3  1 
ATOM 42   N N    . VAL A 1 4   ? -3.803  -13.281 -2.499  1.00 0.23 ? 4   VAL A N    1 
ATOM 43   C CA   . VAL A 1 4   ? -2.881  -12.164 -2.331  1.00 0.20 ? 4   VAL A CA   1 
ATOM 44   C C    . VAL A 1 4   ? -1.431  -12.636 -2.379  1.00 0.19 ? 4   VAL A C    1 
ATOM 45   O O    . VAL A 1 4   ? -0.845  -12.978 -1.351  1.00 0.21 ? 4   VAL A O    1 
ATOM 46   C CB   . VAL A 1 4   ? -3.124  -11.426 -1.000  1.00 0.20 ? 4   VAL A CB   1 
ATOM 47   C CG1  . VAL A 1 4   ? -2.250  -10.185 -0.910  1.00 0.20 ? 4   VAL A CG1  1 
ATOM 48   C CG2  . VAL A 1 4   ? -4.592  -11.065 -0.849  1.00 0.23 ? 4   VAL A CG2  1 
ATOM 49   H H    . VAL A 1 4   ? -3.855  -13.967 -1.801  1.00 0.30 ? 4   VAL A H    1 
ATOM 50   H HA   . VAL A 1 4   ? -3.049  -11.468 -3.140  1.00 0.22 ? 4   VAL A HA   1 
ATOM 51   H HB   . VAL A 1 4   ? -2.853  -12.089 -0.190  1.00 0.20 ? 4   VAL A HB   1 
ATOM 52   H HG11 . VAL A 1 4   ? -2.256  -9.813  0.105   1.00 1.01 ? 4   VAL A HG11 1 
ATOM 53   H HG12 . VAL A 1 4   ? -2.635  -9.424  -1.573  1.00 1.05 ? 4   VAL A HG12 1 
ATOM 54   H HG13 . VAL A 1 4   ? -1.239  -10.433 -1.195  1.00 1.04 ? 4   VAL A HG13 1 
ATOM 55   H HG21 . VAL A 1 4   ? -4.677  -10.078 -0.418  1.00 1.01 ? 4   VAL A HG21 1 
ATOM 56   H HG22 . VAL A 1 4   ? -5.075  -11.783 -0.202  1.00 0.99 ? 4   VAL A HG22 1 
ATOM 57   H HG23 . VAL A 1 4   ? -5.069  -11.077 -1.818  1.00 1.09 ? 4   VAL A HG23 1 
ATOM 58   N N    . ALA A 1 5   ? -0.859  -12.649 -3.578  1.00 0.20 ? 5   ALA A N    1 
ATOM 59   C CA   . ALA A 1 5   ? 0.522   -13.075 -3.761  1.00 0.21 ? 5   ALA A CA   1 
ATOM 60   C C    . ALA A 1 5   ? 1.489   -11.936 -3.458  1.00 0.20 ? 5   ALA A C    1 
ATOM 61   O O    . ALA A 1 5   ? 2.688   -12.155 -3.282  1.00 0.25 ? 5   ALA A O    1 
ATOM 62   C CB   . ALA A 1 5   ? 0.733   -13.586 -5.177  1.00 0.24 ? 5   ALA A CB   1 
ATOM 63   H H    . ALA A 1 5   ? -1.378  -12.364 -4.359  1.00 0.24 ? 5   ALA A H    1 
ATOM 64   H HA   . ALA A 1 5   ? 0.714   -13.888 -3.076  1.00 0.21 ? 5   ALA A HA   1 
ATOM 65   H HB1  . ALA A 1 5   ? 1.790   -13.714 -5.359  1.00 1.08 ? 5   ALA A HB1  1 
ATOM 66   H HB2  . ALA A 1 5   ? 0.328   -12.875 -5.881  1.00 0.96 ? 5   ALA A HB2  1 
ATOM 67   H HB3  . ALA A 1 5   ? 0.231   -14.536 -5.294  1.00 1.05 ? 5   ALA A HB3  1 
ATOM 68   N N    . VAL A 1 6   ? 0.958   -10.718 -3.397  1.00 0.17 ? 6   VAL A N    1 
ATOM 69   C CA   . VAL A 1 6   ? 1.769   -9.541  -3.113  1.00 0.18 ? 6   VAL A CA   1 
ATOM 70   C C    . VAL A 1 6   ? 2.020   -9.397  -1.616  1.00 0.16 ? 6   VAL A C    1 
ATOM 71   O O    . VAL A 1 6   ? 2.650   -8.437  -1.171  1.00 0.19 ? 6   VAL A O    1 
ATOM 72   C CB   . VAL A 1 6   ? 1.097   -8.255  -3.632  1.00 0.19 ? 6   VAL A CB   1 
ATOM 73   C CG1  . VAL A 1 6   ? 1.223   -8.159  -5.143  1.00 0.27 ? 6   VAL A CG1  1 
ATOM 74   C CG2  . VAL A 1 6   ? -0.364  -8.207  -3.207  1.00 0.16 ? 6   VAL A CG2  1 
ATOM 75   H H    . VAL A 1 6   ? -0.004  -10.610 -3.544  1.00 0.19 ? 6   VAL A H    1 
ATOM 76   H HA   . VAL A 1 6   ? 2.716   -9.657  -3.618  1.00 0.20 ? 6   VAL A HA   1 
ATOM 77   H HB   . VAL A 1 6   ? 1.603   -7.407  -3.195  1.00 0.20 ? 6   VAL A HB   1 
ATOM 78   H HG11 . VAL A 1 6   ? 1.721   -7.236  -5.404  1.00 1.02 ? 6   VAL A HG11 1 
ATOM 79   H HG12 . VAL A 1 6   ? 0.241   -8.178  -5.589  1.00 1.03 ? 6   VAL A HG12 1 
ATOM 80   H HG13 . VAL A 1 6   ? 1.802   -8.995  -5.509  1.00 1.09 ? 6   VAL A HG13 1 
ATOM 81   H HG21 . VAL A 1 6   ? -0.629  -7.195  -2.942  1.00 1.01 ? 6   VAL A HG21 1 
ATOM 82   H HG22 . VAL A 1 6   ? -0.513  -8.854  -2.355  1.00 1.01 ? 6   VAL A HG22 1 
ATOM 83   H HG23 . VAL A 1 6   ? -0.987  -8.540  -4.024  1.00 1.05 ? 6   VAL A HG23 1 
ATOM 84   N N    . TYR A 1 7   ? 1.522   -10.357 -0.847  1.00 0.15 ? 7   TYR A N    1 
ATOM 85   C CA   . TYR A 1 7   ? 1.686   -10.345 0.601   1.00 0.15 ? 7   TYR A CA   1 
ATOM 86   C C    . TYR A 1 7   ? 2.842   -11.245 1.025   1.00 0.14 ? 7   TYR A C    1 
ATOM 87   O O    . TYR A 1 7   ? 2.650   -12.435 1.279   1.00 0.19 ? 7   TYR A O    1 
ATOM 88   C CB   . TYR A 1 7   ? 0.393   -10.801 1.279   1.00 0.22 ? 7   TYR A CB   1 
ATOM 89   C CG   . TYR A 1 7   ? 0.326   -10.475 2.755   1.00 0.23 ? 7   TYR A CG   1 
ATOM 90   C CD1  . TYR A 1 7   ? 0.473   -9.170  3.206   1.00 1.24 ? 7   TYR A CD1  1 
ATOM 91   C CD2  . TYR A 1 7   ? 0.111   -11.475 3.695   1.00 1.15 ? 7   TYR A CD2  1 
ATOM 92   C CE1  . TYR A 1 7   ? 0.409   -8.871  4.554   1.00 1.27 ? 7   TYR A CE1  1 
ATOM 93   C CE2  . TYR A 1 7   ? 0.046   -11.184 5.043   1.00 1.15 ? 7   TYR A CE2  1 
ATOM 94   C CZ   . TYR A 1 7   ? 0.195   -9.881  5.468   1.00 0.33 ? 7   TYR A CZ   1 
ATOM 95   O OH   . TYR A 1 7   ? 0.128   -9.589  6.811   1.00 0.40 ? 7   TYR A OH   1 
ATOM 96   H H    . TYR A 1 7   ? 1.029   -11.096 -1.263  1.00 0.17 ? 7   TYR A H    1 
ATOM 97   H HA   . TYR A 1 7   ? 1.903   -9.331  0.902   1.00 0.20 ? 7   TYR A HA   1 
ATOM 98   H HB2  . TYR A 1 7   ? -0.445  -10.321 0.798   1.00 0.29 ? 7   TYR A HB2  1 
ATOM 99   H HB3  . TYR A 1 7   ? 0.298   -11.872 1.171   1.00 0.24 ? 7   TYR A HB3  1 
ATOM 100  H HD1  . TYR A 1 7   ? 0.641   -8.382  2.488   1.00 2.13 ? 7   TYR A HD1  1 
ATOM 101  H HD2  . TYR A 1 7   ? -0.004  -12.494 3.358   1.00 2.06 ? 7   TYR A HD2  1 
ATOM 102  H HE1  . TYR A 1 7   ? 0.526   -7.850  4.886   1.00 2.18 ? 7   TYR A HE1  1 
ATOM 103  H HE2  . TYR A 1 7   ? -0.121  -11.976 5.759   1.00 2.05 ? 7   TYR A HE2  1 
ATOM 104  H HH   . TYR A 1 7   ? -0.081  -10.386 7.302   1.00 0.96 ? 7   TYR A HH   1 
ATOM 105  N N    . HIS A 1 8   ? 4.042   -10.676 1.100   1.00 0.25 ? 8   HIS A N    1 
ATOM 106  C CA   . HIS A 1 8   ? 5.222   -11.446 1.495   1.00 0.33 ? 8   HIS A CA   1 
ATOM 107  C C    . HIS A 1 8   ? 5.139   -11.839 2.967   1.00 0.34 ? 8   HIS A C    1 
ATOM 108  O O    . HIS A 1 8   ? 5.916   -12.668 3.442   1.00 0.49 ? 8   HIS A O    1 
ATOM 109  C CB   . HIS A 1 8   ? 6.519   -10.640 1.241   1.00 0.42 ? 8   HIS A CB   1 
ATOM 110  C CG   . HIS A 1 8   ? 6.347   -9.160  1.373   1.00 0.40 ? 8   HIS A CG   1 
ATOM 111  N ND1  . HIS A 1 8   ? 6.816   -8.266  0.436   1.00 1.25 ? 8   HIS A ND1  1 
ATOM 112  C CD2  . HIS A 1 8   ? 5.762   -8.417  2.341   1.00 1.28 ? 8   HIS A CD2  1 
ATOM 113  C CE1  . HIS A 1 8   ? 6.528   -7.038  0.821   1.00 1.42 ? 8   HIS A CE1  1 
ATOM 114  N NE2  . HIS A 1 8   ? 5.888   -7.100  1.974   1.00 1.33 ? 8   HIS A NE2  1 
ATOM 115  H H    . HIS A 1 8   ? 4.137   -9.722  0.884   1.00 0.34 ? 8   HIS A H    1 
ATOM 116  H HA   . HIS A 1 8   ? 5.229   -12.354 0.896   1.00 0.33 ? 8   HIS A HA   1 
ATOM 117  H HB2  . HIS A 1 8   ? 7.278   -10.939 1.956   1.00 0.68 ? 8   HIS A HB2  1 
ATOM 118  H HB3  . HIS A 1 8   ? 6.879   -10.839 0.240   1.00 0.90 ? 8   HIS A HB3  1 
ATOM 119  H HD1  . HIS A 1 8   ? 7.291   -8.499  -0.389  1.00 2.00 ? 8   HIS A HD1  1 
ATOM 120  H HD2  . HIS A 1 8   ? 5.284   -8.790  3.237   1.00 2.18 ? 8   HIS A HD2  1 
ATOM 121  H HE1  . HIS A 1 8   ? 6.774   -6.134  0.284   1.00 2.12 ? 8   HIS A HE1  1 
ATOM 122  H HE2  . HIS A 1 8   ? 5.437   -6.347  2.407   1.00 1.83 ? 8   HIS A HE2  1 
ATOM 123  N N    . GLY A 1 9   ? 4.191   -11.243 3.682   1.00 0.25 ? 9   GLY A N    1 
ATOM 124  C CA   . GLY A 1 9   ? 4.024   -11.546 5.091   1.00 0.26 ? 9   GLY A CA   1 
ATOM 125  C C    . GLY A 1 9   ? 4.411   -10.385 5.985   1.00 0.26 ? 9   GLY A C    1 
ATOM 126  O O    . GLY A 1 9   ? 4.064   -9.236  5.706   1.00 0.38 ? 9   GLY A O    1 
ATOM 127  H H    . GLY A 1 9   ? 3.599   -10.591 3.250   1.00 0.28 ? 9   GLY A H    1 
ATOM 128  H HA2  . GLY A 1 9   ? 2.990   -11.797 5.273   1.00 0.28 ? 9   GLY A HA2  1 
ATOM 129  H HA3  . GLY A 1 9   ? 4.639   -12.397 5.341   1.00 0.28 ? 9   GLY A HA3  1 
ATOM 130  N N    . LYS A 1 10  ? 5.128   -10.683 7.064   1.00 0.16 ? 10  LYS A N    1 
ATOM 131  C CA   . LYS A 1 10  ? 5.560   -9.654  8.003   1.00 0.16 ? 10  LYS A CA   1 
ATOM 132  C C    . LYS A 1 10  ? 7.049   -9.363  7.851   1.00 0.14 ? 10  LYS A C    1 
ATOM 133  O O    . LYS A 1 10  ? 7.887   -10.252 8.014   1.00 0.19 ? 10  LYS A O    1 
ATOM 134  C CB   . LYS A 1 10  ? 5.255   -10.084 9.440   1.00 0.20 ? 10  LYS A CB   1 
ATOM 135  C CG   . LYS A 1 10  ? 5.564   -9.011  10.473  1.00 0.20 ? 10  LYS A CG   1 
ATOM 136  C CD   . LYS A 1 10  ? 4.566   -9.036  11.619  1.00 0.28 ? 10  LYS A CD   1 
ATOM 137  C CE   . LYS A 1 10  ? 5.145   -9.719  12.847  1.00 0.46 ? 10  LYS A CE   1 
ATOM 138  N NZ   . LYS A 1 10  ? 5.477   -11.146 12.584  1.00 1.25 ? 10  LYS A NZ   1 
ATOM 139  H H    . LYS A 1 10  ? 5.371   -11.617 7.233   1.00 0.16 ? 10  LYS A H    1 
ATOM 140  H HA   . LYS A 1 10  ? 5.007   -8.753  7.783   1.00 0.17 ? 10  LYS A HA   1 
ATOM 141  H HB2  . LYS A 1 10  ? 4.207   -10.335 9.515   1.00 0.26 ? 10  LYS A HB2  1 
ATOM 142  H HB3  . LYS A 1 10  ? 5.844   -10.958 9.675   1.00 0.23 ? 10  LYS A HB3  1 
ATOM 143  H HG2  . LYS A 1 10  ? 6.554   -9.181  10.868  1.00 0.26 ? 10  LYS A HG2  1 
ATOM 144  H HG3  . LYS A 1 10  ? 5.526   -8.044  9.995   1.00 0.29 ? 10  LYS A HG3  1 
ATOM 145  H HD2  . LYS A 1 10  ? 4.300   -8.021  11.876  1.00 0.39 ? 10  LYS A HD2  1 
ATOM 146  H HD3  . LYS A 1 10  ? 3.683   -9.573  11.303  1.00 0.33 ? 10  LYS A HD3  1 
ATOM 147  H HE2  . LYS A 1 10  ? 6.045   -9.198  13.142  1.00 1.01 ? 10  LYS A HE2  1 
ATOM 148  H HE3  . LYS A 1 10  ? 4.422   -9.667  13.647  1.00 1.18 ? 10  LYS A HE3  1 
ATOM 149  H HZ1  . LYS A 1 10  ? 5.688   -11.635 13.477  1.00 1.76 ? 10  LYS A HZ1  1 
ATOM 150  H HZ2  . LYS A 1 10  ? 6.308   -11.211 11.961  1.00 1.71 ? 10  LYS A HZ2  1 
ATOM 151  H HZ3  . LYS A 1 10  ? 4.675   -11.620 12.121  1.00 1.94 ? 10  LYS A HZ3  1 
ATOM 152  N N    . ILE A 1 11  ? 7.371   -8.112  7.539   1.00 0.15 ? 11  ILE A N    1 
ATOM 153  C CA   . ILE A 1 11  ? 8.756   -7.694  7.365   1.00 0.15 ? 11  ILE A CA   1 
ATOM 154  C C    . ILE A 1 11  ? 9.010   -6.349  8.041   1.00 0.15 ? 11  ILE A C    1 
ATOM 155  O O    . ILE A 1 11  ? 8.100   -5.529  8.175   1.00 0.18 ? 11  ILE A O    1 
ATOM 156  C CB   . ILE A 1 11  ? 9.129   -7.584  5.873   1.00 0.16 ? 11  ILE A CB   1 
ATOM 157  C CG1  . ILE A 1 11  ? 8.043   -6.825  5.109   1.00 0.17 ? 11  ILE A CG1  1 
ATOM 158  C CG2  . ILE A 1 11  ? 9.338   -8.968  5.276   1.00 0.19 ? 11  ILE A CG2  1 
ATOM 159  C CD1  . ILE A 1 11  ? 8.465   -6.400  3.719   1.00 0.21 ? 11  ILE A CD1  1 
ATOM 160  H H    . ILE A 1 11  ? 6.656   -7.450  7.424   1.00 0.21 ? 11  ILE A H    1 
ATOM 161  H HA   . ILE A 1 11  ? 9.391   -8.440  7.820   1.00 0.18 ? 11  ILE A HA   1 
ATOM 162  H HB   . ILE A 1 11  ? 10.060  -7.041  5.796   1.00 0.17 ? 11  ILE A HB   1 
ATOM 163  H HG12 . ILE A 1 11  ? 7.173   -7.455  5.012   1.00 0.18 ? 11  ILE A HG12 1 
ATOM 164  H HG13 . ILE A 1 11  ? 7.778   -5.936  5.662   1.00 0.18 ? 11  ILE A HG13 1 
ATOM 165  H HG21 . ILE A 1 11  ? 9.436   -9.693  6.070   1.00 1.06 ? 11  ILE A HG21 1 
ATOM 166  H HG22 . ILE A 1 11  ? 10.237  -8.968  4.675   1.00 0.97 ? 11  ILE A HG22 1 
ATOM 167  H HG23 . ILE A 1 11  ? 8.492   -9.224  4.655   1.00 1.08 ? 11  ILE A HG23 1 
ATOM 168  H HD11 . ILE A 1 11  ? 8.186   -5.369  3.558   1.00 0.96 ? 11  ILE A HD11 1 
ATOM 169  H HD12 . ILE A 1 11  ? 7.973   -7.025  2.988   1.00 1.01 ? 11  ILE A HD12 1 
ATOM 170  H HD13 . ILE A 1 11  ? 9.535   -6.504  3.621   1.00 1.06 ? 11  ILE A HD13 1 
ATOM 171  N N    . SER A 1 12  ? 10.250  -6.132  8.467   1.00 0.18 ? 12  SER A N    1 
ATOM 172  C CA   . SER A 1 12  ? 10.625  -4.889  9.131   1.00 0.20 ? 12  SER A CA   1 
ATOM 173  C C    . SER A 1 12  ? 10.555  -3.712  8.164   1.00 0.17 ? 12  SER A C    1 
ATOM 174  O O    . SER A 1 12  ? 10.471  -3.899  6.950   1.00 0.17 ? 12  SER A O    1 
ATOM 175  C CB   . SER A 1 12  ? 12.036  -5.006  9.709   1.00 0.24 ? 12  SER A CB   1 
ATOM 176  O OG   . SER A 1 12  ? 12.407  -3.825  10.398  1.00 0.52 ? 12  SER A OG   1 
ATOM 177  H H    . SER A 1 12  ? 10.929  -6.825  8.331   1.00 0.21 ? 12  SER A H    1 
ATOM 178  H HA   . SER A 1 12  ? 9.929   -4.720  9.938   1.00 0.23 ? 12  SER A HA   1 
ATOM 179  H HB2  . SER A 1 12  ? 12.073  -5.836  10.397  1.00 0.44 ? 12  SER A HB2  1 
ATOM 180  H HB3  . SER A 1 12  ? 12.739  -5.173  8.905   1.00 0.43 ? 12  SER A HB3  1 
ATOM 181  H HG   . SER A 1 12  ? 11.617  -3.362  10.689  1.00 1.11 ? 12  SER A HG   1 
ATOM 182  N N    . ARG A 1 13  ? 10.590  -2.499  8.708   1.00 0.18 ? 13  ARG A N    1 
ATOM 183  C CA   . ARG A 1 13  ? 10.530  -1.292  7.890   1.00 0.20 ? 13  ARG A CA   1 
ATOM 184  C C    . ARG A 1 13  ? 11.711  -1.235  6.926   1.00 0.18 ? 13  ARG A C    1 
ATOM 185  O O    . ARG A 1 13  ? 11.555  -0.870  5.760   1.00 0.21 ? 13  ARG A O    1 
ATOM 186  C CB   . ARG A 1 13  ? 10.519  -0.045  8.778   1.00 0.25 ? 13  ARG A CB   1 
ATOM 187  C CG   . ARG A 1 13  ? 9.789   1.135   8.158   1.00 0.43 ? 13  ARG A CG   1 
ATOM 188  C CD   . ARG A 1 13  ? 8.497   1.443   8.897   1.00 0.49 ? 13  ARG A CD   1 
ATOM 189  N NE   . ARG A 1 13  ? 8.715   2.336   10.032  1.00 1.04 ? 13  ARG A NE   1 
ATOM 190  C CZ   . ARG A 1 13  ? 8.155   2.164   11.225  1.00 1.47 ? 13  ARG A CZ   1 
ATOM 191  N NH1  . ARG A 1 13  ? 7.349   1.132   11.441  1.00 1.75 ? 13  ARG A NH1  1 
ATOM 192  N NH2  . ARG A 1 13  ? 8.401   3.022   12.204  1.00 2.12 ? 13  ARG A NH2  1 
ATOM 193  H H    . ARG A 1 13  ? 10.658  -2.414  9.682   1.00 0.21 ? 13  ARG A H    1 
ATOM 194  H HA   . ARG A 1 13  ? 9.616   -1.326  7.319   1.00 0.21 ? 13  ARG A HA   1 
ATOM 195  H HB2  . ARG A 1 13  ? 10.037  -0.288  9.713   1.00 0.43 ? 13  ARG A HB2  1 
ATOM 196  H HB3  . ARG A 1 13  ? 11.538  0.253   8.974   1.00 0.43 ? 13  ARG A HB3  1 
ATOM 197  H HG2  . ARG A 1 13  ? 10.429  2.004   8.196   1.00 0.77 ? 13  ARG A HG2  1 
ATOM 198  H HG3  . ARG A 1 13  ? 9.557   0.902   7.128   1.00 0.93 ? 13  ARG A HG3  1 
ATOM 199  H HD2  . ARG A 1 13  ? 7.806   1.909   8.212   1.00 1.07 ? 13  ARG A HD2  1 
ATOM 200  H HD3  . ARG A 1 13  ? 8.074   0.516   9.257   1.00 0.87 ? 13  ARG A HD3  1 
ATOM 201  H HE   . ARG A 1 13  ? 9.309   3.103   9.896   1.00 1.53 ? 13  ARG A HE   1 
ATOM 202  H HH11 . ARG A 1 13  ? 7.163   0.481   10.704  1.00 1.72 ? 13  ARG A HH11 1 
ATOM 203  H HH12 . ARG A 1 13  ? 6.930   1.005   12.338  1.00 2.29 ? 13  ARG A HH12 1 
ATOM 204  H HH21 . ARG A 1 13  ? 9.009   3.800   12.046  1.00 2.44 ? 13  ARG A HH21 1 
ATOM 205  H HH22 . ARG A 1 13  ? 7.979   2.893   13.101  1.00 2.50 ? 13  ARG A HH22 1 
ATOM 206  N N    . GLU A 1 14  ? 12.890  -1.601  7.419   1.00 0.17 ? 14  GLU A N    1 
ATOM 207  C CA   . GLU A 1 14  ? 14.098  -1.596  6.601   1.00 0.19 ? 14  GLU A CA   1 
ATOM 208  C C    . GLU A 1 14  ? 13.966  -2.567  5.432   1.00 0.18 ? 14  GLU A C    1 
ATOM 209  O O    . GLU A 1 14  ? 14.537  -2.349  4.364   1.00 0.22 ? 14  GLU A O    1 
ATOM 210  C CB   . GLU A 1 14  ? 15.317  -1.962  7.450   1.00 0.23 ? 14  GLU A CB   1 
ATOM 211  C CG   . GLU A 1 14  ? 16.533  -1.095  7.172   1.00 0.36 ? 14  GLU A CG   1 
ATOM 212  C CD   . GLU A 1 14  ? 17.487  -1.034  8.349   1.00 0.96 ? 14  GLU A CD   1 
ATOM 213  O OE1  . GLU A 1 14  ? 18.208  -2.027  8.581   1.00 1.43 ? 14  GLU A OE1  1 
ATOM 214  O OE2  . GLU A 1 14  ? 17.515  0.008   9.037   1.00 1.67 ? 14  GLU A OE2  1 
ATOM 215  H H    . GLU A 1 14  ? 12.950  -1.885  8.356   1.00 0.19 ? 14  GLU A H    1 
ATOM 216  H HA   . GLU A 1 14  ? 14.230  -0.598  6.211   1.00 0.23 ? 14  GLU A HA   1 
ATOM 217  H HB2  . GLU A 1 14  ? 15.059  -1.861  8.493   1.00 0.34 ? 14  GLU A HB2  1 
ATOM 218  H HB3  . GLU A 1 14  ? 15.582  -2.991  7.253   1.00 0.35 ? 14  GLU A HB3  1 
ATOM 219  H HG2  . GLU A 1 14  ? 17.061  -1.500  6.321   1.00 0.81 ? 14  GLU A HG2  1 
ATOM 220  H HG3  . GLU A 1 14  ? 16.201  -0.093  6.944   1.00 0.86 ? 14  GLU A HG3  1 
ATOM 221  N N    . THR A 1 15  ? 13.207  -3.637  5.646   1.00 0.15 ? 15  THR A N    1 
ATOM 222  C CA   . THR A 1 15  ? 12.994  -4.646  4.615   1.00 0.16 ? 15  THR A CA   1 
ATOM 223  C C    . THR A 1 15  ? 12.138  -4.098  3.478   1.00 0.15 ? 15  THR A C    1 
ATOM 224  O O    . THR A 1 15  ? 12.497  -4.214  2.307   1.00 0.17 ? 15  THR A O    1 
ATOM 225  C CB   . THR A 1 15  ? 12.312  -5.900  5.194   1.00 0.19 ? 15  THR A CB   1 
ATOM 226  O OG1  . THR A 1 15  ? 13.015  -6.347  6.359   1.00 0.23 ? 15  THR A OG1  1 
ATOM 227  C CG2  . THR A 1 15  ? 12.267  -7.019  4.164   1.00 0.22 ? 15  THR A CG2  1 
ATOM 228  H H    . THR A 1 15  ? 12.779  -3.752  6.521   1.00 0.15 ? 15  THR A H    1 
ATOM 229  H HA   . THR A 1 15  ? 13.958  -4.933  4.223   1.00 0.17 ? 15  THR A HA   1 
ATOM 230  H HB   . THR A 1 15  ? 11.298  -5.646  5.470   1.00 0.20 ? 15  THR A HB   1 
ATOM 231  H HG1  . THR A 1 15  ? 13.873  -6.693  6.102   1.00 0.92 ? 15  THR A HG1  1 
ATOM 232  H HG21 . THR A 1 15  ? 11.256  -7.392  4.082   1.00 1.07 ? 15  THR A HG21 1 
ATOM 233  H HG22 . THR A 1 15  ? 12.922  -7.820  4.474   1.00 1.00 ? 15  THR A HG22 1 
ATOM 234  H HG23 . THR A 1 15  ? 12.590  -6.640  3.206   1.00 1.02 ? 15  THR A HG23 1 
ATOM 235  N N    . GLY A 1 16  ? 11.004  -3.504  3.835   1.00 0.14 ? 16  GLY A N    1 
ATOM 236  C CA   . GLY A 1 16  ? 10.108  -2.949  2.837   1.00 0.16 ? 16  GLY A CA   1 
ATOM 237  C C    . GLY A 1 16  ? 10.744  -1.833  2.029   1.00 0.15 ? 16  GLY A C    1 
ATOM 238  O O    . GLY A 1 16  ? 10.473  -1.690  0.837   1.00 0.16 ? 16  GLY A O    1 
ATOM 239  H H    . GLY A 1 16  ? 10.770  -3.446  4.785   1.00 0.15 ? 16  GLY A H    1 
ATOM 240  H HA2  . GLY A 1 16  ? 9.803   -3.737  2.163   1.00 0.17 ? 16  GLY A HA2  1 
ATOM 241  H HA3  . GLY A 1 16  ? 9.232   -2.560  3.336   1.00 0.19 ? 16  GLY A HA3  1 
ATOM 242  N N    . GLU A 1 17  ? 11.588  -1.041  2.681   1.00 0.15 ? 17  GLU A N    1 
ATOM 243  C CA   . GLU A 1 17  ? 12.261  0.073   2.019   1.00 0.17 ? 17  GLU A CA   1 
ATOM 244  C C    . GLU A 1 17  ? 13.179  -0.421  0.904   1.00 0.16 ? 17  GLU A C    1 
ATOM 245  O O    . GLU A 1 17  ? 13.024  -0.037  -0.256  1.00 0.19 ? 17  GLU A O    1 
ATOM 246  C CB   . GLU A 1 17  ? 13.071  0.881   3.035   1.00 0.20 ? 17  GLU A CB   1 
ATOM 247  C CG   . GLU A 1 17  ? 12.250  1.922   3.778   1.00 0.25 ? 17  GLU A CG   1 
ATOM 248  C CD   . GLU A 1 17  ? 12.754  2.163   5.187   1.00 0.31 ? 17  GLU A CD   1 
ATOM 249  O OE1  . GLU A 1 17  ? 13.966  2.416   5.349   1.00 0.71 ? 17  GLU A OE1  1 
ATOM 250  O OE2  . GLU A 1 17  ? 11.937  2.098   6.130   1.00 0.62 ? 17  GLU A OE2  1 
ATOM 251  H H    . GLU A 1 17  ? 11.760  -1.205  3.632   1.00 0.16 ? 17  GLU A H    1 
ATOM 252  H HA   . GLU A 1 17  ? 11.503  0.710   1.590   1.00 0.19 ? 17  GLU A HA   1 
ATOM 253  H HB2  . GLU A 1 17  ? 13.495  0.202   3.761   1.00 0.24 ? 17  GLU A HB2  1 
ATOM 254  H HB3  . GLU A 1 17  ? 13.872  1.388   2.517   1.00 0.25 ? 17  GLU A HB3  1 
ATOM 255  H HG2  . GLU A 1 17  ? 12.295  2.853   3.233   1.00 0.34 ? 17  GLU A HG2  1 
ATOM 256  H HG3  . GLU A 1 17  ? 11.226  1.585   3.830   1.00 0.32 ? 17  GLU A HG3  1 
ATOM 257  N N    . LYS A 1 18  ? 14.139  -1.267  1.265   1.00 0.16 ? 18  LYS A N    1 
ATOM 258  C CA   . LYS A 1 18  ? 15.090  -1.808  0.300   1.00 0.18 ? 18  LYS A CA   1 
ATOM 259  C C    . LYS A 1 18  ? 14.395  -2.699  -0.727  1.00 0.16 ? 18  LYS A C    1 
ATOM 260  O O    . LYS A 1 18  ? 14.864  -2.836  -1.858  1.00 0.18 ? 18  LYS A O    1 
ATOM 261  C CB   . LYS A 1 18  ? 16.185  -2.601  1.019   1.00 0.20 ? 18  LYS A CB   1 
ATOM 262  C CG   . LYS A 1 18  ? 15.662  -3.808  1.783   1.00 0.21 ? 18  LYS A CG   1 
ATOM 263  C CD   . LYS A 1 18  ? 16.671  -4.944  1.790   1.00 0.33 ? 18  LYS A CD   1 
ATOM 264  C CE   . LYS A 1 18  ? 16.338  -5.989  0.738   1.00 0.51 ? 18  LYS A CE   1 
ATOM 265  N NZ   . LYS A 1 18  ? 16.444  -5.441  -0.642  1.00 1.37 ? 18  LYS A NZ   1 
ATOM 266  H H    . LYS A 1 18  ? 14.213  -1.529  2.207   1.00 0.17 ? 18  LYS A H    1 
ATOM 267  H HA   . LYS A 1 18  ? 15.545  -0.976  -0.215  1.00 0.20 ? 18  LYS A HA   1 
ATOM 268  H HB2  . LYS A 1 18  ? 16.900  -2.947  0.289   1.00 0.24 ? 18  LYS A HB2  1 
ATOM 269  H HB3  . LYS A 1 18  ? 16.684  -1.948  1.719   1.00 0.23 ? 18  LYS A HB3  1 
ATOM 270  H HG2  . LYS A 1 18  ? 15.459  -3.516  2.802   1.00 0.33 ? 18  LYS A HG2  1 
ATOM 271  H HG3  . LYS A 1 18  ? 14.751  -4.151  1.315   1.00 0.34 ? 18  LYS A HG3  1 
ATOM 272  H HD2  . LYS A 1 18  ? 17.653  -4.542  1.585   1.00 0.47 ? 18  LYS A HD2  1 
ATOM 273  H HD3  . LYS A 1 18  ? 16.667  -5.411  2.763   1.00 0.49 ? 18  LYS A HD3  1 
ATOM 274  H HE2  . LYS A 1 18  ? 17.024  -6.816  0.841   1.00 0.79 ? 18  LYS A HE2  1 
ATOM 275  H HE3  . LYS A 1 18  ? 15.328  -6.337  0.902   1.00 0.67 ? 18  LYS A HE3  1 
ATOM 276  H HZ1  . LYS A 1 18  ? 17.399  -5.066  -0.806  1.00 1.80 ? 18  LYS A HZ1  1 
ATOM 277  H HZ2  . LYS A 1 18  ? 15.755  -4.673  -0.776  1.00 1.90 ? 18  LYS A HZ2  1 
ATOM 278  H HZ3  . LYS A 1 18  ? 16.252  -6.188  -1.339  1.00 1.90 ? 18  LYS A HZ3  1 
ATOM 279  N N    . LEU A 1 19  ? 13.283  -3.307  -0.327  1.00 0.14 ? 19  LEU A N    1 
ATOM 280  C CA   . LEU A 1 19  ? 12.532  -4.189  -1.215  1.00 0.14 ? 19  LEU A CA   1 
ATOM 281  C C    . LEU A 1 19  ? 12.035  -3.438  -2.447  1.00 0.13 ? 19  LEU A C    1 
ATOM 282  O O    . LEU A 1 19  ? 12.196  -3.904  -3.576  1.00 0.20 ? 19  LEU A O    1 
ATOM 283  C CB   . LEU A 1 19  ? 11.351  -4.814  -0.472  1.00 0.16 ? 19  LEU A CB   1 
ATOM 284  C CG   . LEU A 1 19  ? 11.507  -6.302  -0.150  1.00 0.21 ? 19  LEU A CG   1 
ATOM 285  C CD1  . LEU A 1 19  ? 10.643  -6.688  1.040   1.00 0.23 ? 19  LEU A CD1  1 
ATOM 286  C CD2  . LEU A 1 19  ? 11.153  -7.148  -1.364  1.00 0.35 ? 19  LEU A CD2  1 
ATOM 287  H H    . LEU A 1 19  ? 12.962  -3.162  0.587   1.00 0.13 ? 19  LEU A H    1 
ATOM 288  H HA   . LEU A 1 19  ? 13.198  -4.976  -1.537  1.00 0.16 ? 19  LEU A HA   1 
ATOM 289  H HB2  . LEU A 1 19  ? 11.212  -4.278  0.457   1.00 0.16 ? 19  LEU A HB2  1 
ATOM 290  H HB3  . LEU A 1 19  ? 10.465  -4.691  -1.076  1.00 0.20 ? 19  LEU A HB3  1 
ATOM 291  H HG   . LEU A 1 19  ? 12.538  -6.500  0.108   1.00 0.28 ? 19  LEU A HG   1 
ATOM 292  H HD11 . LEU A 1 19  ? 9.633   -6.878  0.705   1.00 1.09 ? 19  LEU A HD11 1 
ATOM 293  H HD12 . LEU A 1 19  ? 10.638  -5.881  1.758   1.00 0.89 ? 19  LEU A HD12 1 
ATOM 294  H HD13 . LEU A 1 19  ? 11.043  -7.578  1.501   1.00 1.04 ? 19  LEU A HD13 1 
ATOM 295  H HD21 . LEU A 1 19  ? 10.489  -6.591  -2.009  1.00 1.08 ? 19  LEU A HD21 1 
ATOM 296  H HD22 . LEU A 1 19  ? 10.666  -8.055  -1.040  1.00 0.97 ? 19  LEU A HD22 1 
ATOM 297  H HD23 . LEU A 1 19  ? 12.055  -7.397  -1.904  1.00 1.18 ? 19  LEU A HD23 1 
ATOM 298  N N    . LEU A 1 20  ? 11.427  -2.277  -2.224  1.00 0.09 ? 20  LEU A N    1 
ATOM 299  C CA   . LEU A 1 20  ? 10.906  -1.467  -3.319  1.00 0.10 ? 20  LEU A CA   1 
ATOM 300  C C    . LEU A 1 20  ? 12.031  -0.733  -4.042  1.00 0.11 ? 20  LEU A C    1 
ATOM 301  O O    . LEU A 1 20  ? 11.930  -0.445  -5.234  1.00 0.14 ? 20  LEU A O    1 
ATOM 302  C CB   . LEU A 1 20  ? 9.878   -0.464  -2.796  1.00 0.12 ? 20  LEU A CB   1 
ATOM 303  C CG   . LEU A 1 20  ? 8.563   -1.079  -2.313  1.00 0.09 ? 20  LEU A CG   1 
ATOM 304  C CD1  . LEU A 1 20  ? 7.696   -0.031  -1.636  1.00 0.17 ? 20  LEU A CD1  1 
ATOM 305  C CD2  . LEU A 1 20  ? 7.815   -1.715  -3.475  1.00 0.20 ? 20  LEU A CD2  1 
ATOM 306  H H    . LEU A 1 20  ? 11.327  -1.958  -1.303  1.00 0.12 ? 20  LEU A H    1 
ATOM 307  H HA   . LEU A 1 20  ? 10.422  -2.131  -4.018  1.00 0.11 ? 20  LEU A HA   1 
ATOM 308  H HB2  . LEU A 1 20  ? 10.322  0.080   -1.975  1.00 0.20 ? 20  LEU A HB2  1 
ATOM 309  H HB3  . LEU A 1 20  ? 9.654   0.233   -3.589  1.00 0.17 ? 20  LEU A HB3  1 
ATOM 310  H HG   . LEU A 1 20  ? 8.779   -1.851  -1.591  1.00 0.20 ? 20  LEU A HG   1 
ATOM 311  H HD11 . LEU A 1 20  ? 7.638   0.848   -2.262  1.00 1.01 ? 20  LEU A HD11 1 
ATOM 312  H HD12 . LEU A 1 20  ? 8.129   0.233   -0.682  1.00 1.01 ? 20  LEU A HD12 1 
ATOM 313  H HD13 . LEU A 1 20  ? 6.704   -0.431  -1.483  1.00 0.95 ? 20  LEU A HD13 1 
ATOM 314  H HD21 . LEU A 1 20  ? 8.062   -2.765  -3.528  1.00 1.04 ? 20  LEU A HD21 1 
ATOM 315  H HD22 . LEU A 1 20  ? 8.100   -1.230  -4.396  1.00 1.05 ? 20  LEU A HD22 1 
ATOM 316  H HD23 . LEU A 1 20  ? 6.752   -1.604  -3.322  1.00 0.99 ? 20  LEU A HD23 1 
ATOM 317  N N    . LEU A 1 21  ? 13.104  -0.438  -3.315  1.00 0.15 ? 21  LEU A N    1 
ATOM 318  C CA   . LEU A 1 21  ? 14.247  0.259   -3.889  1.00 0.18 ? 21  LEU A CA   1 
ATOM 319  C C    . LEU A 1 21  ? 15.023  -0.658  -4.828  1.00 0.19 ? 21  LEU A C    1 
ATOM 320  O O    . LEU A 1 21  ? 15.673  -0.197  -5.766  1.00 0.22 ? 21  LEU A O    1 
ATOM 321  C CB   . LEU A 1 21  ? 15.168  0.769   -2.778  1.00 0.20 ? 21  LEU A CB   1 
ATOM 322  C CG   . LEU A 1 21  ? 14.973  2.238   -2.398  1.00 0.20 ? 21  LEU A CG   1 
ATOM 323  C CD1  . LEU A 1 21  ? 15.223  2.438   -0.911  1.00 0.30 ? 21  LEU A CD1  1 
ATOM 324  C CD2  . LEU A 1 21  ? 15.892  3.129   -3.219  1.00 0.29 ? 21  LEU A CD2  1 
ATOM 325  H H    . LEU A 1 21  ? 13.127  -0.696  -2.370  1.00 0.17 ? 21  LEU A H    1 
ATOM 326  H HA   . LEU A 1 21  ? 13.876  1.101   -4.451  1.00 0.19 ? 21  LEU A HA   1 
ATOM 327  H HB2  . LEU A 1 21  ? 15.000  0.165   -1.898  1.00 0.24 ? 21  LEU A HB2  1 
ATOM 328  H HB3  . LEU A 1 21  ? 16.189  0.634   -3.096  1.00 0.21 ? 21  LEU A HB3  1 
ATOM 329  H HG   . LEU A 1 21  ? 13.953  2.524   -2.605  1.00 0.23 ? 21  LEU A HG   1 
ATOM 330  H HD11 . LEU A 1 21  ? 16.161  1.977   -0.638  1.00 0.93 ? 21  LEU A HD11 1 
ATOM 331  H HD12 . LEU A 1 21  ? 14.421  1.985   -0.348  1.00 1.14 ? 21  LEU A HD12 1 
ATOM 332  H HD13 . LEU A 1 21  ? 15.264  3.495   -0.693  1.00 1.08 ? 21  LEU A HD13 1 
ATOM 333  H HD21 . LEU A 1 21  ? 15.479  4.126   -3.265  1.00 1.03 ? 21  LEU A HD21 1 
ATOM 334  H HD22 . LEU A 1 21  ? 15.981  2.732   -4.220  1.00 0.88 ? 21  LEU A HD22 1 
ATOM 335  H HD23 . LEU A 1 21  ? 16.868  3.165   -2.758  1.00 1.01 ? 21  LEU A HD23 1 
ATOM 336  N N    . ALA A 1 22  ? 14.951  -1.960  -4.568  1.00 0.18 ? 22  ALA A N    1 
ATOM 337  C CA   . ALA A 1 22  ? 15.648  -2.946  -5.386  1.00 0.20 ? 22  ALA A CA   1 
ATOM 338  C C    . ALA A 1 22  ? 15.081  -2.995  -6.801  1.00 0.17 ? 22  ALA A C    1 
ATOM 339  O O    . ALA A 1 22  ? 15.831  -2.990  -7.778  1.00 0.18 ? 22  ALA A O    1 
ATOM 340  C CB   . ALA A 1 22  ? 15.565  -4.319  -4.737  1.00 0.23 ? 22  ALA A CB   1 
ATOM 341  H H    . ALA A 1 22  ? 14.418  -2.264  -3.804  1.00 0.16 ? 22  ALA A H    1 
ATOM 342  H HA   . ALA A 1 22  ? 16.689  -2.660  -5.435  1.00 0.23 ? 22  ALA A HA   1 
ATOM 343  H HB1  . ALA A 1 22  ? 16.437  -4.477  -4.119  1.00 1.04 ? 22  ALA A HB1  1 
ATOM 344  H HB2  . ALA A 1 22  ? 15.526  -5.077  -5.504  1.00 0.98 ? 22  ALA A HB2  1 
ATOM 345  H HB3  . ALA A 1 22  ? 14.676  -4.375  -4.127  1.00 0.99 ? 22  ALA A HB3  1 
ATOM 346  N N    . THR A 1 23  ? 13.755  -3.048  -6.903  1.00 0.16 ? 23  THR A N    1 
ATOM 347  C CA   . THR A 1 23  ? 13.089  -3.104  -8.202  1.00 0.15 ? 23  THR A CA   1 
ATOM 348  C C    . THR A 1 23  ? 13.491  -1.924  -9.081  1.00 0.11 ? 23  THR A C    1 
ATOM 349  O O    . THR A 1 23  ? 13.543  -2.041  -10.305 1.00 0.15 ? 23  THR A O    1 
ATOM 350  C CB   . THR A 1 23  ? 11.555  -3.118  -8.050  1.00 0.17 ? 23  THR A CB   1 
ATOM 351  O OG1  . THR A 1 23  ? 11.167  -2.365  -6.895  1.00 0.23 ? 23  THR A OG1  1 
ATOM 352  C CG2  . THR A 1 23  ? 11.035  -4.543  -7.929  1.00 0.17 ? 23  THR A CG2  1 
ATOM 353  H H    . THR A 1 23  ? 13.213  -3.053  -6.088  1.00 0.18 ? 23  THR A H    1 
ATOM 354  H HA   . THR A 1 23  ? 13.389  -4.020  -8.689  1.00 0.17 ? 23  THR A HA   1 
ATOM 355  H HB   . THR A 1 23  ? 11.118  -2.666  -8.929  1.00 0.31 ? 23  THR A HB   1 
ATOM 356  H HG1  . THR A 1 23  ? 10.210  -2.369  -6.817  1.00 0.85 ? 23  THR A HG1  1 
ATOM 357  H HG21 . THR A 1 23  ? 11.862  -5.213  -7.745  1.00 1.03 ? 23  THR A HG21 1 
ATOM 358  H HG22 . THR A 1 23  ? 10.540  -4.824  -8.845  1.00 0.97 ? 23  THR A HG22 1 
ATOM 359  H HG23 . THR A 1 23  ? 10.335  -4.601  -7.109  1.00 1.05 ? 23  THR A HG23 1 
ATOM 360  N N    . GLY A 1 24  ? 13.777  -0.790  -8.448  1.00 0.11 ? 24  GLY A N    1 
ATOM 361  C CA   . GLY A 1 24  ? 14.174  0.395   -9.188  1.00 0.09 ? 24  GLY A CA   1 
ATOM 362  C C    . GLY A 1 24  ? 13.134  0.822   -10.206 1.00 0.09 ? 24  GLY A C    1 
ATOM 363  O O    . GLY A 1 24  ? 13.470  1.167   -11.338 1.00 0.10 ? 24  GLY A O    1 
ATOM 364  H H    . GLY A 1 24  ? 13.720  -0.757  -7.470  1.00 0.15 ? 24  GLY A H    1 
ATOM 365  H HA2  . GLY A 1 24  ? 14.335  1.204   -8.492  1.00 0.10 ? 24  GLY A HA2  1 
ATOM 366  H HA3  . GLY A 1 24  ? 15.100  0.188   -9.703  1.00 0.09 ? 24  GLY A HA3  1 
ATOM 367  N N    . LEU A 1 25  ? 11.866  0.797   -9.802  1.00 0.10 ? 25  LEU A N    1 
ATOM 368  C CA   . LEU A 1 25  ? 10.774  1.183   -10.689 1.00 0.10 ? 25  LEU A CA   1 
ATOM 369  C C    . LEU A 1 25  ? 9.718   1.989   -9.941  1.00 0.10 ? 25  LEU A C    1 
ATOM 370  O O    . LEU A 1 25  ? 9.064   1.478   -9.031  1.00 0.14 ? 25  LEU A O    1 
ATOM 371  C CB   . LEU A 1 25  ? 10.127  -0.058  -11.305 1.00 0.12 ? 25  LEU A CB   1 
ATOM 372  C CG   . LEU A 1 25  ? 11.009  -0.839  -12.280 1.00 0.14 ? 25  LEU A CG   1 
ATOM 373  C CD1  . LEU A 1 25  ? 10.638  -2.314  -12.272 1.00 0.16 ? 25  LEU A CD1  1 
ATOM 374  C CD2  . LEU A 1 25  ? 10.886  -0.265  -13.683 1.00 0.20 ? 25  LEU A CD2  1 
ATOM 375  H H    . LEU A 1 25  ? 11.661  0.511   -8.888  1.00 0.12 ? 25  LEU A H    1 
ATOM 376  H HA   . LEU A 1 25  ? 11.185  1.793   -11.479 1.00 0.11 ? 25  LEU A HA   1 
ATOM 377  H HB2  . LEU A 1 25  ? 9.836   -0.723  -10.504 1.00 0.12 ? 25  LEU A HB2  1 
ATOM 378  H HB3  . LEU A 1 25  ? 9.236   0.250   -11.833 1.00 0.13 ? 25  LEU A HB3  1 
ATOM 379  H HG   . LEU A 1 25  ? 12.041  -0.752  -11.970 1.00 0.17 ? 25  LEU A HG   1 
ATOM 380  H HD11 . LEU A 1 25  ? 10.379  -2.625  -13.273 1.00 1.06 ? 25  LEU A HD11 1 
ATOM 381  H HD12 . LEU A 1 25  ? 9.792   -2.469  -11.617 1.00 1.04 ? 25  LEU A HD12 1 
ATOM 382  H HD13 . LEU A 1 25  ? 11.477  -2.895  -11.919 1.00 0.99 ? 25  LEU A HD13 1 
ATOM 383  H HD21 . LEU A 1 25  ? 10.018  0.375   -13.733 1.00 1.01 ? 25  LEU A HD21 1 
ATOM 384  H HD22 . LEU A 1 25  ? 10.780  -1.072  -14.393 1.00 0.91 ? 25  LEU A HD22 1 
ATOM 385  H HD23 . LEU A 1 25  ? 11.771  0.307   -13.916 1.00 0.96 ? 25  LEU A HD23 1 
ATOM 386  N N    . ASP A 1 26  ? 9.547   3.249   -10.336 1.00 0.08 ? 26  ASP A N    1 
ATOM 387  C CA   . ASP A 1 26  ? 8.560   4.115   -9.706  1.00 0.09 ? 26  ASP A CA   1 
ATOM 388  C C    . ASP A 1 26  ? 7.163   3.540   -9.889  1.00 0.09 ? 26  ASP A C    1 
ATOM 389  O O    . ASP A 1 26  ? 6.738   3.263   -11.011 1.00 0.15 ? 26  ASP A O    1 
ATOM 390  C CB   . ASP A 1 26  ? 8.624   5.522   -10.303 1.00 0.10 ? 26  ASP A CB   1 
ATOM 391  C CG   . ASP A 1 26  ? 9.350   6.500   -9.400  1.00 0.75 ? 26  ASP A CG   1 
ATOM 392  O OD1  . ASP A 1 26  ? 9.297   6.322   -8.166  1.00 1.20 ? 26  ASP A OD1  1 
ATOM 393  O OD2  . ASP A 1 26  ? 9.971   7.447   -9.928  1.00 1.52 ? 26  ASP A OD2  1 
ATOM 394  H H    . ASP A 1 26  ? 10.091  3.598   -11.071 1.00 0.10 ? 26  ASP A H    1 
ATOM 395  H HA   . ASP A 1 26  ? 8.784   4.167   -8.651  1.00 0.09 ? 26  ASP A HA   1 
ATOM 396  H HB2  . ASP A 1 26  ? 9.143   5.483   -11.250 1.00 0.57 ? 26  ASP A HB2  1 
ATOM 397  H HB3  . ASP A 1 26  ? 7.618   5.886   -10.463 1.00 0.58 ? 26  ASP A HB3  1 
ATOM 398  N N    . GLY A 1 27  ? 6.452   3.354   -8.783  1.00 0.07 ? 27  GLY A N    1 
ATOM 399  C CA   . GLY A 1 27  ? 5.112   2.801   -8.856  1.00 0.07 ? 27  GLY A CA   1 
ATOM 400  C C    . GLY A 1 27  ? 5.051   1.388   -8.317  1.00 0.08 ? 27  GLY A C    1 
ATOM 401  O O    . GLY A 1 27  ? 3.980   0.772   -8.276  1.00 0.10 ? 27  GLY A O    1 
ATOM 402  H H    . GLY A 1 27  ? 6.842   3.586   -7.915  1.00 0.10 ? 27  GLY A H    1 
ATOM 403  H HA2  . GLY A 1 27  ? 4.444   3.425   -8.281  1.00 0.08 ? 27  GLY A HA2  1 
ATOM 404  H HA3  . GLY A 1 27  ? 4.789   2.798   -9.886  1.00 0.08 ? 27  GLY A HA3  1 
ATOM 405  N N    . SER A 1 28  ? 6.207   0.879   -7.897  1.00 0.08 ? 28  SER A N    1 
ATOM 406  C CA   . SER A 1 28  ? 6.301   -0.464  -7.342  1.00 0.09 ? 28  SER A CA   1 
ATOM 407  C C    . SER A 1 28  ? 5.713   -0.487  -5.939  1.00 0.10 ? 28  SER A C    1 
ATOM 408  O O    . SER A 1 28  ? 6.062   0.342   -5.098  1.00 0.18 ? 28  SER A O    1 
ATOM 409  C CB   . SER A 1 28  ? 7.759   -0.926  -7.309  1.00 0.12 ? 28  SER A CB   1 
ATOM 410  O OG   . SER A 1 28  ? 8.048   -1.784  -8.399  1.00 0.23 ? 28  SER A OG   1 
ATOM 411  H H    . SER A 1 28  ? 7.018   1.426   -7.958  1.00 0.07 ? 28  SER A H    1 
ATOM 412  H HA   . SER A 1 28  ? 5.732   -1.128  -7.975  1.00 0.08 ? 28  SER A HA   1 
ATOM 413  H HB2  . SER A 1 28  ? 8.409   -0.064  -7.364  1.00 0.17 ? 28  SER A HB2  1 
ATOM 414  H HB3  . SER A 1 28  ? 7.945   -1.458  -6.387  1.00 0.21 ? 28  SER A HB3  1 
ATOM 415  H HG   . SER A 1 28  ? 7.230   -2.149  -8.745  1.00 0.98 ? 28  SER A HG   1 
ATOM 416  N N    . TYR A 1 29  ? 4.808   -1.425  -5.691  1.00 0.07 ? 29  TYR A N    1 
ATOM 417  C CA   . TYR A 1 29  ? 4.166   -1.529  -4.390  1.00 0.07 ? 29  TYR A CA   1 
ATOM 418  C C    . TYR A 1 29  ? 4.259   -2.942  -3.828  1.00 0.07 ? 29  TYR A C    1 
ATOM 419  O O    . TYR A 1 29  ? 4.532   -3.896  -4.555  1.00 0.09 ? 29  TYR A O    1 
ATOM 420  C CB   . TYR A 1 29  ? 2.697   -1.119  -4.501  1.00 0.07 ? 29  TYR A CB   1 
ATOM 421  C CG   . TYR A 1 29  ? 1.799   -2.224  -5.016  1.00 0.08 ? 29  TYR A CG   1 
ATOM 422  C CD1  . TYR A 1 29  ? 1.723   -2.508  -6.374  1.00 0.11 ? 29  TYR A CD1  1 
ATOM 423  C CD2  . TYR A 1 29  ? 1.035   -2.988  -4.142  1.00 0.10 ? 29  TYR A CD2  1 
ATOM 424  C CE1  . TYR A 1 29  ? 0.910   -3.521  -6.846  1.00 0.13 ? 29  TYR A CE1  1 
ATOM 425  C CE2  . TYR A 1 29  ? 0.220   -4.002  -4.606  1.00 0.12 ? 29  TYR A CE2  1 
ATOM 426  C CZ   . TYR A 1 29  ? 0.161   -4.264  -5.958  1.00 0.13 ? 29  TYR A CZ   1 
ATOM 427  O OH   . TYR A 1 29  ? -0.649  -5.275  -6.422  1.00 0.16 ? 29  TYR A OH   1 
ATOM 428  H H    . TYR A 1 29  ? 4.558   -2.052  -6.403  1.00 0.13 ? 29  TYR A H    1 
ATOM 429  H HA   . TYR A 1 29  ? 4.668   -0.851  -3.718  1.00 0.08 ? 29  TYR A HA   1 
ATOM 430  H HB2  . TYR A 1 29  ? 2.337   -0.825  -3.526  1.00 0.08 ? 29  TYR A HB2  1 
ATOM 431  H HB3  . TYR A 1 29  ? 2.615   -0.281  -5.178  1.00 0.09 ? 29  TYR A HB3  1 
ATOM 432  H HD1  . TYR A 1 29  ? 2.310   -1.924  -7.067  1.00 0.13 ? 29  TYR A HD1  1 
ATOM 433  H HD2  . TYR A 1 29  ? 1.083   -2.779  -3.084  1.00 0.12 ? 29  TYR A HD2  1 
ATOM 434  H HE1  . TYR A 1 29  ? 0.863   -3.727  -7.905  1.00 0.16 ? 29  TYR A HE1  1 
ATOM 435  H HE2  . TYR A 1 29  ? -0.366  -4.584  -3.911  1.00 0.15 ? 29  TYR A HE2  1 
ATOM 436  H HH   . TYR A 1 29  ? -0.558  -5.347  -7.375  1.00 0.92 ? 29  TYR A HH   1 
ATOM 437  N N    . LEU A 1 30  ? 4.004   -3.066  -2.529  1.00 0.07 ? 30  LEU A N    1 
ATOM 438  C CA   . LEU A 1 30  ? 4.029   -4.364  -1.866  1.00 0.08 ? 30  LEU A CA   1 
ATOM 439  C C    . LEU A 1 30  ? 3.073   -4.388  -0.680  1.00 0.09 ? 30  LEU A C    1 
ATOM 440  O O    . LEU A 1 30  ? 2.704   -3.341  -0.144  1.00 0.14 ? 30  LEU A O    1 
ATOM 441  C CB   . LEU A 1 30  ? 5.446   -4.726  -1.410  1.00 0.10 ? 30  LEU A CB   1 
ATOM 442  C CG   . LEU A 1 30  ? 6.163   -3.676  -0.557  1.00 0.13 ? 30  LEU A CG   1 
ATOM 443  C CD1  . LEU A 1 30  ? 5.674   -3.720  0.884   1.00 0.23 ? 30  LEU A CD1  1 
ATOM 444  C CD2  . LEU A 1 30  ? 7.667   -3.897  -0.609  1.00 0.15 ? 30  LEU A CD2  1 
ATOM 445  H H    . LEU A 1 30  ? 3.776   -2.266  -2.008  1.00 0.07 ? 30  LEU A H    1 
ATOM 446  H HA   . LEU A 1 30  ? 3.700   -5.096  -2.585  1.00 0.08 ? 30  LEU A HA   1 
ATOM 447  H HB2  . LEU A 1 30  ? 5.390   -5.643  -0.840  1.00 0.13 ? 30  LEU A HB2  1 
ATOM 448  H HB3  . LEU A 1 30  ? 6.044   -4.909  -2.290  1.00 0.16 ? 30  LEU A HB3  1 
ATOM 449  H HG   . LEU A 1 30  ? 5.954   -2.693  -0.952  1.00 0.24 ? 30  LEU A HG   1 
ATOM 450  H HD11 . LEU A 1 30  ? 4.623   -3.968  0.901   1.00 1.04 ? 30  LEU A HD11 1 
ATOM 451  H HD12 . LEU A 1 30  ? 5.824   -2.756  1.345   1.00 1.07 ? 30  LEU A HD12 1 
ATOM 452  H HD13 . LEU A 1 30  ? 6.229   -4.471  1.428   1.00 0.94 ? 30  LEU A HD13 1 
ATOM 453  H HD21 . LEU A 1 30  ? 8.034   -3.649  -1.595  1.00 0.92 ? 30  LEU A HD21 1 
ATOM 454  H HD22 . LEU A 1 30  ? 7.886   -4.934  -0.394  1.00 1.02 ? 30  LEU A HD22 1 
ATOM 455  H HD23 . LEU A 1 30  ? 8.150   -3.269  0.124   1.00 0.95 ? 30  LEU A HD23 1 
ATOM 456  N N    . LEU A 1 31  ? 2.675   -5.590  -0.275  1.00 0.08 ? 31  LEU A N    1 
ATOM 457  C CA   . LEU A 1 31  ? 1.762   -5.759  0.847   1.00 0.08 ? 31  LEU A CA   1 
ATOM 458  C C    . LEU A 1 31  ? 2.483   -6.368  2.044   1.00 0.08 ? 31  LEU A C    1 
ATOM 459  O O    . LEU A 1 31  ? 2.817   -7.553  2.042   1.00 0.17 ? 31  LEU A O    1 
ATOM 460  C CB   . LEU A 1 31  ? 0.588   -6.652  0.440   1.00 0.10 ? 31  LEU A CB   1 
ATOM 461  C CG   . LEU A 1 31  ? -0.707  -5.911  0.087   1.00 0.12 ? 31  LEU A CG   1 
ATOM 462  C CD1  . LEU A 1 31  ? -1.227  -5.139  1.291   1.00 0.17 ? 31  LEU A CD1  1 
ATOM 463  C CD2  . LEU A 1 31  ? -0.483  -4.977  -1.094  1.00 0.16 ? 31  LEU A CD2  1 
ATOM 464  H H    . LEU A 1 31  ? 3.005   -6.385  -0.743  1.00 0.11 ? 31  LEU A H    1 
ATOM 465  H HA   . LEU A 1 31  ? 1.386   -4.785  1.122   1.00 0.09 ? 31  LEU A HA   1 
ATOM 466  H HB2  . LEU A 1 31  ? 0.890   -7.235  -0.418  1.00 0.10 ? 31  LEU A HB2  1 
ATOM 467  H HB3  . LEU A 1 31  ? 0.379   -7.329  1.253   1.00 0.11 ? 31  LEU A HB3  1 
ATOM 468  H HG   . LEU A 1 31  ? -1.459  -6.633  -0.194  1.00 0.14 ? 31  LEU A HG   1 
ATOM 469  H HD11 . LEU A 1 31  ? -0.630  -5.377  2.158   1.00 1.05 ? 31  LEU A HD11 1 
ATOM 470  H HD12 . LEU A 1 31  ? -2.256  -5.412  1.475   1.00 1.06 ? 31  LEU A HD12 1 
ATOM 471  H HD13 . LEU A 1 31  ? -1.166  -4.079  1.091   1.00 0.99 ? 31  LEU A HD13 1 
ATOM 472  H HD21 . LEU A 1 31  ? 0.533   -5.076  -1.443  1.00 0.98 ? 31  LEU A HD21 1 
ATOM 473  H HD22 . LEU A 1 31  ? -0.661  -3.957  -0.784  1.00 0.93 ? 31  LEU A HD22 1 
ATOM 474  H HD23 . LEU A 1 31  ? -1.166  -5.236  -1.890  1.00 1.04 ? 31  LEU A HD23 1 
ATOM 475  N N    . ARG A 1 32  ? 2.720   -5.550  3.065   1.00 0.11 ? 32  ARG A N    1 
ATOM 476  C CA   . ARG A 1 32  ? 3.402   -6.013  4.269   1.00 0.11 ? 32  ARG A CA   1 
ATOM 477  C C    . ARG A 1 32  ? 2.534   -5.796  5.503   1.00 0.13 ? 32  ARG A C    1 
ATOM 478  O O    . ARG A 1 32  ? 1.749   -4.850  5.566   1.00 0.15 ? 32  ARG A O    1 
ATOM 479  C CB   . ARG A 1 32  ? 4.738   -5.286  4.436   1.00 0.12 ? 32  ARG A CB   1 
ATOM 480  C CG   . ARG A 1 32  ? 4.601   -3.777  4.554   1.00 0.12 ? 32  ARG A CG   1 
ATOM 481  C CD   . ARG A 1 32  ? 5.849   -3.152  5.155   1.00 0.14 ? 32  ARG A CD   1 
ATOM 482  N NE   . ARG A 1 32  ? 6.489   -2.217  4.235   1.00 0.18 ? 32  ARG A NE   1 
ATOM 483  C CZ   . ARG A 1 32  ? 6.981   -1.039  4.606   1.00 0.20 ? 32  ARG A CZ   1 
ATOM 484  N NH1  . ARG A 1 32  ? 6.913   -0.659  5.875   1.00 0.29 ? 32  ARG A NH1  1 
ATOM 485  N NH2  . ARG A 1 32  ? 7.542   -0.241  3.708   1.00 0.28 ? 32  ARG A NH2  1 
ATOM 486  H H    . ARG A 1 32  ? 2.430   -4.616  3.008   1.00 0.18 ? 32  ARG A H    1 
ATOM 487  H HA   . ARG A 1 32  ? 3.590   -7.069  4.157   1.00 0.13 ? 32  ARG A HA   1 
ATOM 488  H HB2  . ARG A 1 32  ? 5.223   -5.652  5.328   1.00 0.14 ? 32  ARG A HB2  1 
ATOM 489  H HB3  . ARG A 1 32  ? 5.362   -5.503  3.583   1.00 0.14 ? 32  ARG A HB3  1 
ATOM 490  H HG2  . ARG A 1 32  ? 4.441   -3.362  3.570   1.00 0.14 ? 32  ARG A HG2  1 
ATOM 491  H HG3  . ARG A 1 32  ? 3.755   -3.551  5.186   1.00 0.13 ? 32  ARG A HG3  1 
ATOM 492  H HD2  . ARG A 1 32  ? 5.573   -2.625  6.055   1.00 0.15 ? 32  ARG A HD2  1 
ATOM 493  H HD3  . ARG A 1 32  ? 6.548   -3.939  5.400   1.00 0.21 ? 32  ARG A HD3  1 
ATOM 494  H HE   . ARG A 1 32  ? 6.553   -2.479  3.293   1.00 0.30 ? 32  ARG A HE   1 
ATOM 495  H HH11 . ARG A 1 32  ? 6.492   -1.260  6.555   1.00 0.33 ? 32  ARG A HH11 1 
ATOM 496  H HH12 . ARG A 1 32  ? 7.284   0.228   6.152   1.00 0.39 ? 32  ARG A HH12 1 
ATOM 497  H HH21 . ARG A 1 32  ? 7.596   -0.526  2.751   1.00 0.36 ? 32  ARG A HH21 1 
ATOM 498  H HH22 . ARG A 1 32  ? 7.911   0.645   3.988   1.00 0.32 ? 32  ARG A HH22 1 
ATOM 499  N N    . ASP A 1 33  ? 2.684   -6.681  6.483   1.00 0.15 ? 33  ASP A N    1 
ATOM 500  C CA   . ASP A 1 33  ? 1.918   -6.590  7.721   1.00 0.18 ? 33  ASP A CA   1 
ATOM 501  C C    . ASP A 1 33  ? 2.415   -5.435  8.582   1.00 0.20 ? 33  ASP A C    1 
ATOM 502  O O    . ASP A 1 33  ? 3.621   -5.228  8.725   1.00 0.26 ? 33  ASP A O    1 
ATOM 503  C CB   . ASP A 1 33  ? 2.015   -7.902  8.501   1.00 0.24 ? 33  ASP A CB   1 
ATOM 504  C CG   . ASP A 1 33  ? 0.871   -8.080  9.480   1.00 0.37 ? 33  ASP A CG   1 
ATOM 505  O OD1  . ASP A 1 33  ? -0.279  -7.764  9.111   1.00 0.63 ? 33  ASP A OD1  1 
ATOM 506  O OD2  . ASP A 1 33  ? 1.126   -8.533  10.615  1.00 0.78 ? 33  ASP A OD2  1 
ATOM 507  H H    . ASP A 1 33  ? 3.328   -7.412  6.373   1.00 0.16 ? 33  ASP A H    1 
ATOM 508  H HA   . ASP A 1 33  ? 0.887   -6.411  7.460   1.00 0.17 ? 33  ASP A HA   1 
ATOM 509  H HB2  . ASP A 1 33  ? 2.000   -8.729  7.806   1.00 0.29 ? 33  ASP A HB2  1 
ATOM 510  H HB3  . ASP A 1 33  ? 2.944   -7.918  9.053   1.00 0.37 ? 33  ASP A HB3  1 
ATOM 511  N N    . SER A 1 34  ? 1.479   -4.685  9.154   1.00 0.20 ? 34  SER A N    1 
ATOM 512  C CA   . SER A 1 34  ? 1.820   -3.549  10.002  1.00 0.24 ? 34  SER A CA   1 
ATOM 513  C C    . SER A 1 34  ? 2.491   -4.013  11.291  1.00 0.29 ? 34  SER A C    1 
ATOM 514  O O    . SER A 1 34  ? 1.929   -4.808  12.044  1.00 0.31 ? 34  SER A O    1 
ATOM 515  C CB   . SER A 1 34  ? 0.566   -2.740  10.334  1.00 0.26 ? 34  SER A CB   1 
ATOM 516  O OG   . SER A 1 34  ? 0.887   -1.590  11.096  1.00 0.31 ? 34  SER A OG   1 
ATOM 517  H H    . SER A 1 34  ? 0.535   -4.900  9.001   1.00 0.23 ? 34  SER A H    1 
ATOM 518  H HA   . SER A 1 34  ? 2.508   -2.921  9.457   1.00 0.25 ? 34  SER A HA   1 
ATOM 519  H HB2  . SER A 1 34  ? 0.089   -2.427  9.417   1.00 0.26 ? 34  SER A HB2  1 
ATOM 520  H HB3  . SER A 1 34  ? -0.116  -3.355  10.901  1.00 0.26 ? 34  SER A HB3  1 
ATOM 521  H HG   . SER A 1 34  ? 1.598   -1.109  10.666  1.00 0.91 ? 34  SER A HG   1 
ATOM 522  N N    . GLU A 1 35  ? 3.696   -3.507  11.537  1.00 0.33 ? 35  GLU A N    1 
ATOM 523  C CA   . GLU A 1 35  ? 4.446   -3.866  12.735  1.00 0.39 ? 35  GLU A CA   1 
ATOM 524  C C    . GLU A 1 35  ? 4.014   -3.010  13.921  1.00 0.41 ? 35  GLU A C    1 
ATOM 525  O O    . GLU A 1 35  ? 4.698   -2.955  14.943  1.00 0.45 ? 35  GLU A O    1 
ATOM 526  C CB   . GLU A 1 35  ? 5.947   -3.700  12.492  1.00 0.44 ? 35  GLU A CB   1 
ATOM 527  C CG   . GLU A 1 35  ? 6.757   -4.944  12.820  1.00 0.52 ? 35  GLU A CG   1 
ATOM 528  C CD   . GLU A 1 35  ? 7.956   -5.115  11.910  1.00 0.98 ? 35  GLU A CD   1 
ATOM 529  O OE1  . GLU A 1 35  ? 8.734   -4.148  11.763  1.00 1.41 ? 35  GLU A OE1  1 
ATOM 530  O OE2  . GLU A 1 35  ? 8.119   -6.216  11.343  1.00 1.61 ? 35  GLU A OE2  1 
ATOM 531  H H    . GLU A 1 35  ? 4.089   -2.876  10.899  1.00 0.35 ? 35  GLU A H    1 
ATOM 532  H HA   . GLU A 1 35  ? 4.238   -4.901  12.958  1.00 0.39 ? 35  GLU A HA   1 
ATOM 533  H HB2  . GLU A 1 35  ? 6.106   -3.458  11.452  1.00 0.48 ? 35  GLU A HB2  1 
ATOM 534  H HB3  . GLU A 1 35  ? 6.312   -2.888  13.102  1.00 0.49 ? 35  GLU A HB3  1 
ATOM 535  H HG2  . GLU A 1 35  ? 7.105   -4.872  13.840  1.00 0.88 ? 35  GLU A HG2  1 
ATOM 536  H HG3  . GLU A 1 35  ? 6.119   -5.809  12.718  1.00 0.80 ? 35  GLU A HG3  1 
ATOM 537  N N    . SER A 1 36  ? 2.871   -2.345  13.778  1.00 0.39 ? 36  SER A N    1 
ATOM 538  C CA   . SER A 1 36  ? 2.343   -1.492  14.836  1.00 0.43 ? 36  SER A CA   1 
ATOM 539  C C    . SER A 1 36  ? 0.867   -1.785  15.083  1.00 0.38 ? 36  SER A C    1 
ATOM 540  O O    . SER A 1 36  ? 0.380   -1.663  16.208  1.00 0.41 ? 36  SER A O    1 
ATOM 541  C CB   . SER A 1 36  ? 2.528   -0.018  14.470  1.00 0.46 ? 36  SER A CB   1 
ATOM 542  O OG   . SER A 1 36  ? 2.393   0.812   15.611  1.00 1.23 ? 36  SER A OG   1 
ATOM 543  H H    . SER A 1 36  ? 2.369   -2.431  12.940  1.00 0.39 ? 36  SER A H    1 
ATOM 544  H HA   . SER A 1 36  ? 2.897   -1.702  15.738  1.00 0.48 ? 36  SER A HA   1 
ATOM 545  H HB2  . SER A 1 36  ? 3.511   0.127   14.050  1.00 1.03 ? 36  SER A HB2  1 
ATOM 546  H HB3  . SER A 1 36  ? 1.781   0.266   13.743  1.00 0.95 ? 36  SER A HB3  1 
ATOM 547  H HG   . SER A 1 36  ? 2.842   1.646   15.455  1.00 1.64 ? 36  SER A HG   1 
ATOM 548  N N    . VAL A 1 37  ? 0.161   -2.172  14.026  1.00 0.33 ? 37  VAL A N    1 
ATOM 549  C CA   . VAL A 1 37  ? -1.260  -2.481  14.128  1.00 0.31 ? 37  VAL A CA   1 
ATOM 550  C C    . VAL A 1 37  ? -1.561  -3.867  13.561  1.00 0.29 ? 37  VAL A C    1 
ATOM 551  O O    . VAL A 1 37  ? -1.645  -4.043  12.346  1.00 0.26 ? 37  VAL A O    1 
ATOM 552  C CB   . VAL A 1 37  ? -2.121  -1.441  13.384  1.00 0.30 ? 37  VAL A CB   1 
ATOM 553  C CG1  . VAL A 1 37  ? -3.513  -1.367  13.993  1.00 0.35 ? 37  VAL A CG1  1 
ATOM 554  C CG2  . VAL A 1 37  ? -1.450  -0.075  13.402  1.00 0.40 ? 37  VAL A CG2  1 
ATOM 555  H H    . VAL A 1 37  ? 0.607   -2.250  13.156  1.00 0.33 ? 37  VAL A H    1 
ATOM 556  H HA   . VAL A 1 37  ? -1.532  -2.463  15.173  1.00 0.35 ? 37  VAL A HA   1 
ATOM 557  H HB   . VAL A 1 37  ? -2.221  -1.756  12.356  1.00 0.27 ? 37  VAL A HB   1 
ATOM 558  H HG11 . VAL A 1 37  ? -3.552  -0.553  14.702  1.00 0.95 ? 37  VAL A HG11 1 
ATOM 559  H HG12 . VAL A 1 37  ? -3.735  -2.295  14.497  1.00 1.00 ? 37  VAL A HG12 1 
ATOM 560  H HG13 . VAL A 1 37  ? -4.239  -1.198  13.211  1.00 1.05 ? 37  VAL A HG13 1 
ATOM 561  H HG21 . VAL A 1 37  ? -0.628  -0.088  14.103  1.00 0.97 ? 37  VAL A HG21 1 
ATOM 562  H HG22 . VAL A 1 37  ? -2.167  0.674   13.702  1.00 1.05 ? 37  VAL A HG22 1 
ATOM 563  H HG23 . VAL A 1 37  ? -1.077  0.156   12.415  1.00 1.18 ? 37  VAL A HG23 1 
ATOM 564  N N    . PRO A 1 38  ? -1.731  -4.876  14.438  1.00 0.34 ? 38  PRO A N    1 
ATOM 565  C CA   . PRO A 1 38  ? -2.026  -6.249  14.014  1.00 0.36 ? 38  PRO A CA   1 
ATOM 566  C C    . PRO A 1 38  ? -3.352  -6.350  13.268  1.00 0.35 ? 38  PRO A C    1 
ATOM 567  O O    . PRO A 1 38  ? -4.303  -5.631  13.573  1.00 0.40 ? 38  PRO A O    1 
ATOM 568  C CB   . PRO A 1 38  ? -2.092  -7.032  15.331  1.00 0.44 ? 38  PRO A CB   1 
ATOM 569  C CG   . PRO A 1 38  ? -2.340  -6.004  16.380  1.00 0.64 ? 38  PRO A CG   1 
ATOM 570  C CD   . PRO A 1 38  ? -1.650  -4.759  15.904  1.00 0.41 ? 38  PRO A CD   1 
ATOM 571  H HA   . PRO A 1 38  ? -1.236  -6.648  13.394  1.00 0.36 ? 38  PRO A HA   1 
ATOM 572  H HB2  . PRO A 1 38  ? -2.899  -7.750  15.284  1.00 0.53 ? 38  PRO A HB2  1 
ATOM 573  H HB3  . PRO A 1 38  ? -1.157  -7.545  15.494  1.00 0.52 ? 38  PRO A HB3  1 
ATOM 574  H HG2  . PRO A 1 38  ? -3.401  -5.831  16.482  1.00 0.94 ? 38  PRO A HG2  1 
ATOM 575  H HG3  . PRO A 1 38  ? -1.918  -6.329  17.320  1.00 0.96 ? 38  PRO A HG3  1 
ATOM 576  H HD2  . PRO A 1 38  ? -2.172  -3.881  16.253  1.00 0.46 ? 38  PRO A HD2  1 
ATOM 577  H HD3  . PRO A 1 38  ? -0.622  -4.746  16.233  1.00 0.48 ? 38  PRO A HD3  1 
ATOM 578  N N    . GLY A 1 39  ? -3.407  -7.249  12.289  1.00 0.33 ? 39  GLY A N    1 
ATOM 579  C CA   . GLY A 1 39  ? -4.621  -7.430  11.513  1.00 0.32 ? 39  GLY A CA   1 
ATOM 580  C C    . GLY A 1 39  ? -4.794  -6.362  10.450  1.00 0.30 ? 39  GLY A C    1 
ATOM 581  O O    . GLY A 1 39  ? -5.803  -6.336  9.745   1.00 0.46 ? 39  GLY A O    1 
ATOM 582  H H    . GLY A 1 39  ? -2.617  -7.794  12.092  1.00 0.35 ? 39  GLY A H    1 
ATOM 583  H HA2  . GLY A 1 39  ? -4.589  -8.396  11.035  1.00 0.34 ? 39  GLY A HA2  1 
ATOM 584  H HA3  . GLY A 1 39  ? -5.469  -7.398  12.181  1.00 0.33 ? 39  GLY A HA3  1 
ATOM 585  N N    . VAL A 1 40  ? -3.808  -5.477  10.337  1.00 0.17 ? 40  VAL A N    1 
ATOM 586  C CA   . VAL A 1 40  ? -3.853  -4.398  9.357   1.00 0.14 ? 40  VAL A CA   1 
ATOM 587  C C    . VAL A 1 40  ? -2.683  -4.494  8.379   1.00 0.14 ? 40  VAL A C    1 
ATOM 588  O O    . VAL A 1 40  ? -1.540  -4.711  8.783   1.00 0.19 ? 40  VAL A O    1 
ATOM 589  C CB   . VAL A 1 40  ? -3.830  -3.021  10.049  1.00 0.16 ? 40  VAL A CB   1 
ATOM 590  C CG1  . VAL A 1 40  ? -3.696  -1.901  9.028   1.00 0.16 ? 40  VAL A CG1  1 
ATOM 591  C CG2  . VAL A 1 40  ? -5.080  -2.831  10.894  1.00 0.18 ? 40  VAL A CG2  1 
ATOM 592  H H    . VAL A 1 40  ? -3.031  -5.552  10.931  1.00 0.23 ? 40  VAL A H    1 
ATOM 593  H HA   . VAL A 1 40  ? -4.778  -4.486  8.806   1.00 0.14 ? 40  VAL A HA   1 
ATOM 594  H HB   . VAL A 1 40  ? -2.972  -2.984  10.703  1.00 0.18 ? 40  VAL A HB   1 
ATOM 595  H HG11 . VAL A 1 40  ? -4.427  -2.036  8.246   1.00 1.07 ? 40  VAL A HG11 1 
ATOM 596  H HG12 . VAL A 1 40  ? -2.704  -1.920  8.601   1.00 0.99 ? 40  VAL A HG12 1 
ATOM 597  H HG13 . VAL A 1 40  ? -3.859  -0.950  9.515   1.00 1.02 ? 40  VAL A HG13 1 
ATOM 598  H HG21 . VAL A 1 40  ? -4.890  -3.179  11.899  1.00 1.06 ? 40  VAL A HG21 1 
ATOM 599  H HG22 . VAL A 1 40  ? -5.893  -3.396  10.465  1.00 1.04 ? 40  VAL A HG22 1 
ATOM 600  H HG23 . VAL A 1 40  ? -5.342  -1.784  10.919  1.00 0.96 ? 40  VAL A HG23 1 
ATOM 601  N N    . TYR A 1 41  ? -2.980  -4.329  7.093   1.00 0.10 ? 41  TYR A N    1 
ATOM 602  C CA   . TYR A 1 41  ? -1.957  -4.395  6.053   1.00 0.10 ? 41  TYR A CA   1 
ATOM 603  C C    . TYR A 1 41  ? -1.417  -3.005  5.741   1.00 0.07 ? 41  TYR A C    1 
ATOM 604  O O    . TYR A 1 41  ? -1.965  -1.999  6.192   1.00 0.08 ? 41  TYR A O    1 
ATOM 605  C CB   . TYR A 1 41  ? -2.522  -5.028  4.779   1.00 0.13 ? 41  TYR A CB   1 
ATOM 606  C CG   . TYR A 1 41  ? -3.406  -6.228  5.035   1.00 0.13 ? 41  TYR A CG   1 
ATOM 607  C CD1  . TYR A 1 41  ? -4.740  -6.067  5.383   1.00 0.12 ? 41  TYR A CD1  1 
ATOM 608  C CD2  . TYR A 1 41  ? -2.907  -7.520  4.926   1.00 0.21 ? 41  TYR A CD2  1 
ATOM 609  C CE1  . TYR A 1 41  ? -5.552  -7.160  5.617   1.00 0.15 ? 41  TYR A CE1  1 
ATOM 610  C CE2  . TYR A 1 41  ? -3.712  -8.618  5.158   1.00 0.24 ? 41  TYR A CE2  1 
ATOM 611  C CZ   . TYR A 1 41  ? -5.035  -8.433  5.504   1.00 0.20 ? 41  TYR A CZ   1 
ATOM 612  O OH   . TYR A 1 41  ? -5.840  -9.524  5.734   1.00 0.25 ? 41  TYR A OH   1 
ATOM 613  H H    . TYR A 1 41  ? -3.910  -4.159  6.836   1.00 0.10 ? 41  TYR A H    1 
ATOM 614  H HA   . TYR A 1 41  ? -1.148  -5.007  6.422   1.00 0.12 ? 41  TYR A HA   1 
ATOM 615  H HB2  . TYR A 1 41  ? -3.108  -4.293  4.249   1.00 0.14 ? 41  TYR A HB2  1 
ATOM 616  H HB3  . TYR A 1 41  ? -1.702  -5.348  4.152   1.00 0.18 ? 41  TYR A HB3  1 
ATOM 617  H HD1  . TYR A 1 41  ? -5.142  -5.067  5.472   1.00 0.15 ? 41  TYR A HD1  1 
ATOM 618  H HD2  . TYR A 1 41  ? -1.871  -7.661  4.657   1.00 0.27 ? 41  TYR A HD2  1 
ATOM 619  H HE1  . TYR A 1 41  ? -6.588  -7.015  5.888   1.00 0.19 ? 41  TYR A HE1  1 
ATOM 620  H HE2  . TYR A 1 41  ? -3.306  -9.615  5.069   1.00 0.32 ? 41  TYR A HE2  1 
ATOM 621  H HH   . TYR A 1 41  ? -6.291  -9.416  6.575   1.00 0.92 ? 41  TYR A HH   1 
ATOM 622  N N    . CYS A 1 42  ? -0.336  -2.953  4.969   1.00 0.07 ? 42  CYS A N    1 
ATOM 623  C CA   . CYS A 1 42  ? 0.274   -1.681  4.602   1.00 0.08 ? 42  CYS A CA   1 
ATOM 624  C C    . CYS A 1 42  ? 0.826   -1.721  3.182   1.00 0.07 ? 42  CYS A C    1 
ATOM 625  O O    . CYS A 1 42  ? 1.809   -2.409  2.907   1.00 0.07 ? 42  CYS A O    1 
ATOM 626  C CB   . CYS A 1 42  ? 1.392   -1.326  5.582   1.00 0.12 ? 42  CYS A CB   1 
ATOM 627  S SG   . CYS A 1 42  ? 0.829   -0.456  7.064   1.00 0.28 ? 42  CYS A SG   1 
ATOM 628  H H    . CYS A 1 42  ? 0.060   -3.787  4.640   1.00 0.09 ? 42  CYS A H    1 
ATOM 629  H HA   . CYS A 1 42  ? -0.492  -0.921  4.655   1.00 0.09 ? 42  CYS A HA   1 
ATOM 630  H HB2  . CYS A 1 42  ? 1.883   -2.233  5.900   1.00 0.18 ? 42  CYS A HB2  1 
ATOM 631  H HB3  . CYS A 1 42  ? 2.110   -0.693  5.081   1.00 0.16 ? 42  CYS A HB3  1 
ATOM 632  H HG   . CYS A 1 42  ? -0.287  -1.038  7.479   1.00 1.26 ? 42  CYS A HG   1 
ATOM 633  N N    . LEU A 1 43  ? 0.196   -0.968  2.285   1.00 0.08 ? 43  LEU A N    1 
ATOM 634  C CA   . LEU A 1 43  ? 0.633   -0.904  0.897   1.00 0.07 ? 43  LEU A CA   1 
ATOM 635  C C    . LEU A 1 43  ? 1.600   0.261   0.713   1.00 0.07 ? 43  LEU A C    1 
ATOM 636  O O    . LEU A 1 43  ? 1.253   1.409   0.990   1.00 0.08 ? 43  LEU A O    1 
ATOM 637  C CB   . LEU A 1 43  ? -0.571  -0.742  -0.035  1.00 0.10 ? 43  LEU A CB   1 
ATOM 638  C CG   . LEU A 1 43  ? -0.233  -0.622  -1.524  1.00 0.08 ? 43  LEU A CG   1 
ATOM 639  C CD1  . LEU A 1 43  ? -1.320  -1.261  -2.370  1.00 0.10 ? 43  LEU A CD1  1 
ATOM 640  C CD2  . LEU A 1 43  ? -0.045  0.836   -1.915  1.00 0.08 ? 43  LEU A CD2  1 
ATOM 641  H H    . LEU A 1 43  ? -0.576  -0.434  2.569   1.00 0.09 ? 43  LEU A H    1 
ATOM 642  H HA   . LEU A 1 43  ? 1.143   -1.826  0.665   1.00 0.07 ? 43  LEU A HA   1 
ATOM 643  H HB2  . LEU A 1 43  ? -1.218  -1.598  0.097   1.00 0.12 ? 43  LEU A HB2  1 
ATOM 644  H HB3  . LEU A 1 43  ? -1.111  0.144   0.261   1.00 0.12 ? 43  LEU A HB3  1 
ATOM 645  H HG   . LEU A 1 43  ? 0.691   -1.145  -1.721  1.00 0.07 ? 43  LEU A HG   1 
ATOM 646  H HD11 . LEU A 1 43  ? -1.936  -0.489  -2.806  1.00 0.99 ? 43  LEU A HD11 1 
ATOM 647  H HD12 . LEU A 1 43  ? -1.929  -1.902  -1.750  1.00 0.99 ? 43  LEU A HD12 1 
ATOM 648  H HD13 . LEU A 1 43  ? -0.865  -1.846  -3.156  1.00 1.07 ? 43  LEU A HD13 1 
ATOM 649  H HD21 . LEU A 1 43  ? 0.844   0.934   -2.519  1.00 1.02 ? 43  LEU A HD21 1 
ATOM 650  H HD22 . LEU A 1 43  ? 0.057   1.437   -1.023  1.00 1.00 ? 43  LEU A HD22 1 
ATOM 651  H HD23 . LEU A 1 43  ? -0.903  1.170   -2.479  1.00 1.02 ? 43  LEU A HD23 1 
ATOM 652  N N    . CYS A 1 44  ? 2.817   -0.036  0.267   1.00 0.06 ? 44  CYS A N    1 
ATOM 653  C CA   . CYS A 1 44  ? 3.821   1.006   0.080   1.00 0.07 ? 44  CYS A CA   1 
ATOM 654  C C    . CYS A 1 44  ? 4.280   1.113   -1.372  1.00 0.07 ? 44  CYS A C    1 
ATOM 655  O O    . CYS A 1 44  ? 4.625   0.116   -2.004  1.00 0.10 ? 44  CYS A O    1 
ATOM 656  C CB   . CYS A 1 44  ? 5.024   0.742   0.985   1.00 0.09 ? 44  CYS A CB   1 
ATOM 657  S SG   . CYS A 1 44  ? 4.797   -0.638  2.131   1.00 0.18 ? 44  CYS A SG   1 
ATOM 658  H H    . CYS A 1 44  ? 3.050   -0.970  0.076   1.00 0.06 ? 44  CYS A H    1 
ATOM 659  H HA   . CYS A 1 44  ? 3.374   1.944   0.367   1.00 0.09 ? 44  CYS A HA   1 
ATOM 660  H HB2  . CYS A 1 44  ? 5.886   0.521   0.373   1.00 0.09 ? 44  CYS A HB2  1 
ATOM 661  H HB3  . CYS A 1 44  ? 5.222   1.626   1.571   1.00 0.12 ? 44  CYS A HB3  1 
ATOM 662  H HG   . CYS A 1 44  ? 3.554   -1.077  2.002   1.00 1.16 ? 44  CYS A HG   1 
ATOM 663  N N    . VAL A 1 45  ? 4.301   2.346   -1.876  1.00 0.06 ? 45  VAL A N    1 
ATOM 664  C CA   . VAL A 1 45  ? 4.737   2.634   -3.241  1.00 0.06 ? 45  VAL A CA   1 
ATOM 665  C C    . VAL A 1 45  ? 6.005   3.483   -3.205  1.00 0.06 ? 45  VAL A C    1 
ATOM 666  O O    . VAL A 1 45  ? 6.047   4.515   -2.536  1.00 0.07 ? 45  VAL A O    1 
ATOM 667  C CB   . VAL A 1 45  ? 3.650   3.381   -4.041  1.00 0.07 ? 45  VAL A CB   1 
ATOM 668  C CG1  . VAL A 1 45  ? 3.459   2.738   -5.406  1.00 0.08 ? 45  VAL A CG1  1 
ATOM 669  C CG2  . VAL A 1 45  ? 2.335   3.410   -3.277  1.00 0.07 ? 45  VAL A CG2  1 
ATOM 670  H H    . VAL A 1 45  ? 4.027   3.092   -1.302  1.00 0.09 ? 45  VAL A H    1 
ATOM 671  H HA   . VAL A 1 45  ? 4.949   1.701   -3.743  1.00 0.06 ? 45  VAL A HA   1 
ATOM 672  H HB   . VAL A 1 45  ? 3.979   4.399   -4.189  1.00 0.08 ? 45  VAL A HB   1 
ATOM 673  H HG11 . VAL A 1 45  ? 3.573   3.486   -6.177  1.00 1.01 ? 45  VAL A HG11 1 
ATOM 674  H HG12 . VAL A 1 45  ? 2.469   2.309   -5.466  1.00 1.01 ? 45  VAL A HG12 1 
ATOM 675  H HG13 . VAL A 1 45  ? 4.196   1.962   -5.546  1.00 1.01 ? 45  VAL A HG13 1 
ATOM 676  H HG21 . VAL A 1 45  ? 2.448   4.012   -2.387  1.00 0.98 ? 45  VAL A HG21 1 
ATOM 677  H HG22 . VAL A 1 45  ? 2.060   2.403   -2.999  1.00 1.01 ? 45  VAL A HG22 1 
ATOM 678  H HG23 . VAL A 1 45  ? 1.566   3.833   -3.904  1.00 1.01 ? 45  VAL A HG23 1 
ATOM 679  N N    . LEU A 1 46  ? 7.042   3.040   -3.910  1.00 0.06 ? 46  LEU A N    1 
ATOM 680  C CA   . LEU A 1 46  ? 8.311   3.764   -3.928  1.00 0.06 ? 46  LEU A CA   1 
ATOM 681  C C    . LEU A 1 46  ? 8.280   4.914   -4.927  1.00 0.06 ? 46  LEU A C    1 
ATOM 682  O O    . LEU A 1 46  ? 8.120   4.700   -6.133  1.00 0.07 ? 46  LEU A O    1 
ATOM 683  C CB   . LEU A 1 46  ? 9.466   2.817   -4.262  1.00 0.07 ? 46  LEU A CB   1 
ATOM 684  C CG   . LEU A 1 46  ? 10.797  3.509   -4.572  1.00 0.09 ? 46  LEU A CG   1 
ATOM 685  C CD1  . LEU A 1 46  ? 11.454  4.001   -3.292  1.00 0.17 ? 46  LEU A CD1  1 
ATOM 686  C CD2  . LEU A 1 46  ? 11.724  2.570   -5.323  1.00 0.12 ? 46  LEU A CD2  1 
ATOM 687  H H    . LEU A 1 46  ? 6.960   2.203   -4.414  1.00 0.06 ? 46  LEU A H    1 
ATOM 688  H HA   . LEU A 1 46  ? 8.470   4.170   -2.941  1.00 0.07 ? 46  LEU A HA   1 
ATOM 689  H HB2  . LEU A 1 46  ? 9.614   2.153   -3.423  1.00 0.09 ? 46  LEU A HB2  1 
ATOM 690  H HB3  . LEU A 1 46  ? 9.185   2.228   -5.121  1.00 0.08 ? 46  LEU A HB3  1 
ATOM 691  H HG   . LEU A 1 46  ? 10.608  4.368   -5.200  1.00 0.14 ? 46  LEU A HG   1 
ATOM 692  H HD11 . LEU A 1 46  ? 12.433  3.555   -3.195  1.00 1.06 ? 46  LEU A HD11 1 
ATOM 693  H HD12 . LEU A 1 46  ? 10.846  3.722   -2.444  1.00 1.02 ? 46  LEU A HD12 1 
ATOM 694  H HD13 . LEU A 1 46  ? 11.550  5.077   -3.328  1.00 1.02 ? 46  LEU A HD13 1 
ATOM 695  H HD21 . LEU A 1 46  ? 11.744  1.611   -4.828  1.00 1.04 ? 46  LEU A HD21 1 
ATOM 696  H HD22 . LEU A 1 46  ? 12.721  2.987   -5.341  1.00 0.99 ? 46  LEU A HD22 1 
ATOM 697  H HD23 . LEU A 1 46  ? 11.368  2.447   -6.335  1.00 1.03 ? 46  LEU A HD23 1 
ATOM 698  N N    . TYR A 1 47  ? 8.441   6.134   -4.410  1.00 0.07 ? 47  TYR A N    1 
ATOM 699  C CA   . TYR A 1 47  ? 8.441   7.332   -5.242  1.00 0.08 ? 47  TYR A CA   1 
ATOM 700  C C    . TYR A 1 47  ? 9.348   8.411   -4.658  1.00 0.10 ? 47  TYR A C    1 
ATOM 701  O O    . TYR A 1 47  ? 9.284   8.713   -3.467  1.00 0.11 ? 47  TYR A O    1 
ATOM 702  C CB   . TYR A 1 47  ? 7.019   7.874   -5.400  1.00 0.08 ? 47  TYR A CB   1 
ATOM 703  C CG   . TYR A 1 47  ? 6.477   7.691   -6.793  1.00 0.08 ? 47  TYR A CG   1 
ATOM 704  C CD1  . TYR A 1 47  ? 6.130   6.432   -7.250  1.00 0.08 ? 47  TYR A CD1  1 
ATOM 705  C CD2  . TYR A 1 47  ? 6.326   8.769   -7.654  1.00 0.10 ? 47  TYR A CD2  1 
ATOM 706  C CE1  . TYR A 1 47  ? 5.647   6.241   -8.524  1.00 0.09 ? 47  TYR A CE1  1 
ATOM 707  C CE2  . TYR A 1 47  ? 5.840   8.592   -8.934  1.00 0.11 ? 47  TYR A CE2  1 
ATOM 708  C CZ   . TYR A 1 47  ? 5.503   7.326   -9.366  1.00 0.10 ? 47  TYR A CZ   1 
ATOM 709  O OH   . TYR A 1 47  ? 5.029   7.146   -10.645 1.00 0.11 ? 47  TYR A OH   1 
ATOM 710  H H    . TYR A 1 47  ? 8.568   6.227   -3.443  1.00 0.08 ? 47  TYR A H    1 
ATOM 711  H HA   . TYR A 1 47  ? 8.818   7.055   -6.215  1.00 0.09 ? 47  TYR A HA   1 
ATOM 712  H HB2  . TYR A 1 47  ? 6.362   7.356   -4.716  1.00 0.08 ? 47  TYR A HB2  1 
ATOM 713  H HB3  . TYR A 1 47  ? 7.010   8.928   -5.173  1.00 0.10 ? 47  TYR A HB3  1 
ATOM 714  H HD1  . TYR A 1 47  ? 6.245   5.585   -6.590  1.00 0.08 ? 47  TYR A HD1  1 
ATOM 715  H HD2  . TYR A 1 47  ? 6.593   9.757   -7.312  1.00 0.12 ? 47  TYR A HD2  1 
ATOM 716  H HE1  . TYR A 1 47  ? 5.379   5.246   -8.851  1.00 0.09 ? 47  TYR A HE1  1 
ATOM 717  H HE2  . TYR A 1 47  ? 5.727   9.441   -9.591  1.00 0.13 ? 47  TYR A HE2  1 
ATOM 718  H HH   . TYR A 1 47  ? 5.660   7.502   -11.274 1.00 0.90 ? 47  TYR A HH   1 
ATOM 719  N N    . HIS A 1 48  ? 10.190  8.989   -5.512  1.00 0.17 ? 48  HIS A N    1 
ATOM 720  C CA   . HIS A 1 48  ? 11.116  10.041  -5.097  1.00 0.21 ? 48  HIS A CA   1 
ATOM 721  C C    . HIS A 1 48  ? 12.060  9.543   -4.007  1.00 0.17 ? 48  HIS A C    1 
ATOM 722  O O    . HIS A 1 48  ? 12.478  10.308  -3.137  1.00 0.18 ? 48  HIS A O    1 
ATOM 723  C CB   . HIS A 1 48  ? 10.345  11.267  -4.603  1.00 0.24 ? 48  HIS A CB   1 
ATOM 724  C CG   . HIS A 1 48  ? 9.888   12.170  -5.706  1.00 0.56 ? 48  HIS A CG   1 
ATOM 725  N ND1  . HIS A 1 48  ? 10.751  12.944  -6.453  1.00 1.19 ? 48  HIS A ND1  1 
ATOM 726  C CD2  . HIS A 1 48  ? 8.647   12.420  -6.190  1.00 1.46 ? 48  HIS A CD2  1 
ATOM 727  C CE1  . HIS A 1 48  ? 10.062  13.632  -7.346  1.00 1.22 ? 48  HIS A CE1  1 
ATOM 728  N NE2  . HIS A 1 48  ? 8.784   13.331  -7.208  1.00 1.42 ? 48  HIS A NE2  1 
ATOM 729  H H    . HIS A 1 48  ? 10.189  8.701   -6.449  1.00 0.21 ? 48  HIS A H    1 
ATOM 730  H HA   . HIS A 1 48  ? 11.702  10.322  -5.960  1.00 0.27 ? 48  HIS A HA   1 
ATOM 731  H HB2  . HIS A 1 48  ? 9.472   10.940  -4.058  1.00 0.43 ? 48  HIS A HB2  1 
ATOM 732  H HB3  . HIS A 1 48  ? 10.980  11.841  -3.944  1.00 0.41 ? 48  HIS A HB3  1 
ATOM 733  H HD1  . HIS A 1 48  ? 11.724  12.985  -6.343  1.00 1.97 ? 48  HIS A HD1  1 
ATOM 734  H HD2  . HIS A 1 48  ? 7.722   11.983  -5.840  1.00 2.34 ? 48  HIS A HD2  1 
ATOM 735  H HE1  . HIS A 1 48  ? 10.474  14.320  -8.070  1.00 1.73 ? 48  HIS A HE1  1 
ATOM 736  H HE2  . HIS A 1 48  ? 8.059   13.665  -7.776  1.00 1.99 ? 48  HIS A HE2  1 
ATOM 737  N N    . GLY A 1 49  ? 12.393  8.256   -4.062  1.00 0.18 ? 49  GLY A N    1 
ATOM 738  C CA   . GLY A 1 49  ? 13.287  7.677   -3.076  1.00 0.20 ? 49  GLY A CA   1 
ATOM 739  C C    . GLY A 1 49  ? 12.614  7.460   -1.735  1.00 0.20 ? 49  GLY A C    1 
ATOM 740  O O    . GLY A 1 49  ? 13.160  6.786   -0.862  1.00 0.27 ? 49  GLY A O    1 
ATOM 741  H H    . GLY A 1 49  ? 12.029  7.697   -4.780  1.00 0.19 ? 49  GLY A H    1 
ATOM 742  H HA2  . GLY A 1 49  ? 13.645  6.728   -3.444  1.00 0.26 ? 49  GLY A HA2  1 
ATOM 743  H HA3  . GLY A 1 49  ? 14.130  8.339   -2.940  1.00 0.22 ? 49  GLY A HA3  1 
ATOM 744  N N    . TYR A 1 50  ? 11.425  8.032   -1.569  1.00 0.17 ? 50  TYR A N    1 
ATOM 745  C CA   . TYR A 1 50  ? 10.680  7.899   -0.324  1.00 0.23 ? 50  TYR A CA   1 
ATOM 746  C C    . TYR A 1 50  ? 9.563   6.871   -0.464  1.00 0.26 ? 50  TYR A C    1 
ATOM 747  O O    . TYR A 1 50  ? 8.732   6.962   -1.369  1.00 0.50 ? 50  TYR A O    1 
ATOM 748  C CB   . TYR A 1 50  ? 10.098  9.252   0.091   1.00 0.26 ? 50  TYR A CB   1 
ATOM 749  C CG   . TYR A 1 50  ? 11.142  10.234  0.571   1.00 0.23 ? 50  TYR A CG   1 
ATOM 750  C CD1  . TYR A 1 50  ? 11.662  10.151  1.857   1.00 0.56 ? 50  TYR A CD1  1 
ATOM 751  C CD2  . TYR A 1 50  ? 11.608  11.244  -0.261  1.00 0.35 ? 50  TYR A CD2  1 
ATOM 752  C CE1  . TYR A 1 50  ? 12.615  11.049  2.300   1.00 0.64 ? 50  TYR A CE1  1 
ATOM 753  C CE2  . TYR A 1 50  ? 12.561  12.144  0.175   1.00 0.41 ? 50  TYR A CE2  1 
ATOM 754  C CZ   . TYR A 1 50  ? 13.064  12.040  1.453   1.00 0.45 ? 50  TYR A CZ   1 
ATOM 755  O OH   . TYR A 1 50  ? 14.010  12.938  1.893   1.00 0.60 ? 50  TYR A OH   1 
ATOM 756  H H    . TYR A 1 50  ? 11.041  8.558   -2.301  1.00 0.15 ? 50  TYR A H    1 
ATOM 757  H HA   . TYR A 1 50  ? 11.367  7.563   0.439   1.00 0.27 ? 50  TYR A HA   1 
ATOM 758  H HB2  . TYR A 1 50  ? 9.592   9.693   -0.754  1.00 0.32 ? 50  TYR A HB2  1 
ATOM 759  H HB3  . TYR A 1 50  ? 9.389   9.101   0.892   1.00 0.40 ? 50  TYR A HB3  1 
ATOM 760  H HD1  . TYR A 1 50  ? 11.310  9.371   2.516   1.00 0.82 ? 50  TYR A HD1  1 
ATOM 761  H HD2  . TYR A 1 50  ? 11.214  11.321  -1.264  1.00 0.60 ? 50  TYR A HD2  1 
ATOM 762  H HE1  . TYR A 1 50  ? 13.006  10.968  3.303   1.00 0.94 ? 50  TYR A HE1  1 
ATOM 763  H HE2  . TYR A 1 50  ? 12.909  12.924  -0.487  1.00 0.65 ? 50  TYR A HE2  1 
ATOM 764  H HH   . TYR A 1 50  ? 14.302  13.481  1.157   1.00 1.08 ? 50  TYR A HH   1 
ATOM 765  N N    . ILE A 1 51  ? 9.549   5.895   0.437   1.00 0.09 ? 51  ILE A N    1 
ATOM 766  C CA   . ILE A 1 51  ? 8.533   4.848   0.414   1.00 0.09 ? 51  ILE A CA   1 
ATOM 767  C C    . ILE A 1 51  ? 7.258   5.313   1.116   1.00 0.10 ? 51  ILE A C    1 
ATOM 768  O O    . ILE A 1 51  ? 7.217   5.424   2.342   1.00 0.16 ? 51  ILE A O    1 
ATOM 769  C CB   . ILE A 1 51  ? 9.045   3.552   1.084   1.00 0.11 ? 51  ILE A CB   1 
ATOM 770  C CG1  . ILE A 1 51  ? 10.085  2.861   0.198   1.00 0.11 ? 51  ILE A CG1  1 
ATOM 771  C CG2  . ILE A 1 51  ? 7.891   2.603   1.376   1.00 0.14 ? 51  ILE A CG2  1 
ATOM 772  C CD1  . ILE A 1 51  ? 11.472  3.457   0.316   1.00 0.14 ? 51  ILE A CD1  1 
ATOM 773  H H    . ILE A 1 51  ? 10.239  5.878   1.134   1.00 0.22 ? 51  ILE A H    1 
ATOM 774  H HA   . ILE A 1 51  ? 8.304   4.629   -0.618  1.00 0.08 ? 51  ILE A HA   1 
ATOM 775  H HB   . ILE A 1 51  ? 9.504   3.817   2.024   1.00 0.12 ? 51  ILE A HB   1 
ATOM 776  H HG12 . ILE A 1 51  ? 10.150  1.820   0.476   1.00 0.15 ? 51  ILE A HG12 1 
ATOM 777  H HG13 . ILE A 1 51  ? 9.778   2.933   -0.836  1.00 0.13 ? 51  ILE A HG13 1 
ATOM 778  H HG21 . ILE A 1 51  ? 7.455   2.851   2.332   1.00 1.04 ? 51  ILE A HG21 1 
ATOM 779  H HG22 . ILE A 1 51  ? 8.257   1.587   1.399   1.00 0.99 ? 51  ILE A HG22 1 
ATOM 780  H HG23 . ILE A 1 51  ? 7.143   2.698   0.603   1.00 1.05 ? 51  ILE A HG23 1 
ATOM 781  H HD11 . ILE A 1 51  ? 11.541  4.031   1.228   1.00 1.01 ? 51  ILE A HD11 1 
ATOM 782  H HD12 . ILE A 1 51  ? 11.660  4.100   -0.530  1.00 1.01 ? 51  ILE A HD12 1 
ATOM 783  H HD13 . ILE A 1 51  ? 12.204  2.663   0.334   1.00 1.03 ? 51  ILE A HD13 1 
ATOM 784  N N    . TYR A 1 52  ? 6.221   5.583   0.328   1.00 0.09 ? 52  TYR A N    1 
ATOM 785  C CA   . TYR A 1 52  ? 4.943   6.036   0.871   1.00 0.10 ? 52  TYR A CA   1 
ATOM 786  C C    . TYR A 1 52  ? 4.129   4.857   1.396   1.00 0.11 ? 52  TYR A C    1 
ATOM 787  O O    . TYR A 1 52  ? 3.694   4.001   0.626   1.00 0.19 ? 52  TYR A O    1 
ATOM 788  C CB   . TYR A 1 52  ? 4.145   6.781   -0.202  1.00 0.12 ? 52  TYR A CB   1 
ATOM 789  C CG   . TYR A 1 52  ? 4.582   8.215   -0.402  1.00 0.16 ? 52  TYR A CG   1 
ATOM 790  C CD1  . TYR A 1 52  ? 4.080   9.232   0.399   1.00 0.48 ? 52  TYR A CD1  1 
ATOM 791  C CD2  . TYR A 1 52  ? 5.497   8.550   -1.392  1.00 0.52 ? 52  TYR A CD2  1 
ATOM 792  C CE1  . TYR A 1 52  ? 4.476   10.544  0.218   1.00 0.52 ? 52  TYR A CE1  1 
ATOM 793  C CE2  . TYR A 1 52  ? 5.899   9.859   -1.578  1.00 0.56 ? 52  TYR A CE2  1 
ATOM 794  C CZ   . TYR A 1 52  ? 5.386   10.852  -0.772  1.00 0.33 ? 52  TYR A CZ   1 
ATOM 795  O OH   . TYR A 1 52  ? 5.782   12.157  -0.954  1.00 0.42 ? 52  TYR A OH   1 
ATOM 796  H H    . TYR A 1 52  ? 6.316   5.475   -0.641  1.00 0.12 ? 52  TYR A H    1 
ATOM 797  H HA   . TYR A 1 52  ? 5.149   6.709   1.688   1.00 0.12 ? 52  TYR A HA   1 
ATOM 798  H HB2  . TYR A 1 52  ? 4.256   6.266   -1.145  1.00 0.15 ? 52  TYR A HB2  1 
ATOM 799  H HB3  . TYR A 1 52  ? 3.101   6.788   0.077   1.00 0.15 ? 52  TYR A HB3  1 
ATOM 800  H HD1  . TYR A 1 52  ? 3.368   8.988   1.174   1.00 0.82 ? 52  TYR A HD1  1 
ATOM 801  H HD2  . TYR A 1 52  ? 5.898   7.770   -2.023  1.00 0.85 ? 52  TYR A HD2  1 
ATOM 802  H HE1  . TYR A 1 52  ? 4.073   11.321  0.851   1.00 0.85 ? 52  TYR A HE1  1 
ATOM 803  H HE2  . TYR A 1 52  ? 6.611   10.100  -2.354  1.00 0.90 ? 52  TYR A HE2  1 
ATOM 804  H HH   . TYR A 1 52  ? 5.169   12.599  -1.545  1.00 1.07 ? 52  TYR A HH   1 
ATOM 805  N N    . THR A 1 53  ? 3.931   4.818   2.709   1.00 0.11 ? 53  THR A N    1 
ATOM 806  C CA   . THR A 1 53  ? 3.173   3.742   3.338   1.00 0.12 ? 53  THR A CA   1 
ATOM 807  C C    . THR A 1 53  ? 1.715   4.137   3.554   1.00 0.11 ? 53  THR A C    1 
ATOM 808  O O    . THR A 1 53  ? 1.419   5.246   4.001   1.00 0.12 ? 53  THR A O    1 
ATOM 809  C CB   . THR A 1 53  ? 3.789   3.343   4.692   1.00 0.16 ? 53  THR A CB   1 
ATOM 810  O OG1  . THR A 1 53  ? 5.197   3.120   4.542   1.00 0.20 ? 53  THR A OG1  1 
ATOM 811  C CG2  . THR A 1 53  ? 3.131   2.086   5.240   1.00 0.19 ? 53  THR A CG2  1 
ATOM 812  H H    . THR A 1 53  ? 4.305   5.529   3.270   1.00 0.16 ? 53  THR A H    1 
ATOM 813  H HA   . THR A 1 53  ? 3.209   2.883   2.684   1.00 0.12 ? 53  THR A HA   1 
ATOM 814  H HB   . THR A 1 53  ? 3.634   4.149   5.394   1.00 0.19 ? 53  THR A HB   1 
ATOM 815  H HG1  . THR A 1 53  ? 5.668   3.948   4.661   1.00 0.95 ? 53  THR A HG1  1 
ATOM 816  H HG21 . THR A 1 53  ? 2.314   2.362   5.892   1.00 0.97 ? 53  THR A HG21 1 
ATOM 817  H HG22 . THR A 1 53  ? 3.857   1.512   5.797   1.00 1.00 ? 53  THR A HG22 1 
ATOM 818  H HG23 . THR A 1 53  ? 2.753   1.491   4.423   1.00 0.93 ? 53  THR A HG23 1 
ATOM 819  N N    . TYR A 1 54  ? 0.808   3.217   3.235   1.00 0.10 ? 54  TYR A N    1 
ATOM 820  C CA   . TYR A 1 54  ? -0.623  3.455   3.395   1.00 0.11 ? 54  TYR A CA   1 
ATOM 821  C C    . TYR A 1 54  ? -1.276  2.304   4.156   1.00 0.12 ? 54  TYR A C    1 
ATOM 822  O O    . TYR A 1 54  ? -1.109  1.139   3.797   1.00 0.19 ? 54  TYR A O    1 
ATOM 823  C CB   . TYR A 1 54  ? -1.291  3.628   2.028   1.00 0.13 ? 54  TYR A CB   1 
ATOM 824  C CG   . TYR A 1 54  ? -0.699  4.747   1.199   1.00 0.13 ? 54  TYR A CG   1 
ATOM 825  C CD1  . TYR A 1 54  ? -1.006  6.075   1.469   1.00 0.18 ? 54  TYR A CD1  1 
ATOM 826  C CD2  . TYR A 1 54  ? 0.167   4.476   0.147   1.00 0.17 ? 54  TYR A CD2  1 
ATOM 827  C CE1  . TYR A 1 54  ? -0.468  7.100   0.713   1.00 0.22 ? 54  TYR A CE1  1 
ATOM 828  C CE2  . TYR A 1 54  ? 0.708   5.494   -0.613  1.00 0.20 ? 54  TYR A CE2  1 
ATOM 829  C CZ   . TYR A 1 54  ? 0.388   6.804   -0.325  1.00 0.21 ? 54  TYR A CZ   1 
ATOM 830  O OH   . TYR A 1 54  ? 0.927   7.822   -1.080  1.00 0.26 ? 54  TYR A OH   1 
ATOM 831  H H    . TYR A 1 54  ? 1.110   2.352   2.888   1.00 0.11 ? 54  TYR A H    1 
ATOM 832  H HA   . TYR A 1 54  ? -0.746  4.365   3.966   1.00 0.11 ? 54  TYR A HA   1 
ATOM 833  H HB2  . TYR A 1 54  ? -1.188  2.712   1.468   1.00 0.16 ? 54  TYR A HB2  1 
ATOM 834  H HB3  . TYR A 1 54  ? -2.340  3.840   2.173   1.00 0.15 ? 54  TYR A HB3  1 
ATOM 835  H HD1  . TYR A 1 54  ? -1.677  6.303   2.284   1.00 0.23 ? 54  TYR A HD1  1 
ATOM 836  H HD2  . TYR A 1 54  ? 0.415   3.448   -0.077  1.00 0.22 ? 54  TYR A HD2  1 
ATOM 837  H HE1  . TYR A 1 54  ? -0.718  8.126   0.939   1.00 0.29 ? 54  TYR A HE1  1 
ATOM 838  H HE2  . TYR A 1 54  ? 1.380   5.262   -1.428  1.00 0.25 ? 54  TYR A HE2  1 
ATOM 839  H HH   . TYR A 1 54  ? 1.865   7.900   -0.890  1.00 0.91 ? 54  TYR A HH   1 
ATOM 840  N N    . ARG A 1 55  ? -2.008  2.638   5.214   1.00 0.11 ? 55  ARG A N    1 
ATOM 841  C CA   . ARG A 1 55  ? -2.677  1.629   6.032   1.00 0.12 ? 55  ARG A CA   1 
ATOM 842  C C    . ARG A 1 55  ? -3.983  1.171   5.394   1.00 0.12 ? 55  ARG A C    1 
ATOM 843  O O    . ARG A 1 55  ? -4.826  1.988   5.022   1.00 0.20 ? 55  ARG A O    1 
ATOM 844  C CB   . ARG A 1 55  ? -2.955  2.183   7.430   1.00 0.15 ? 55  ARG A CB   1 
ATOM 845  C CG   . ARG A 1 55  ? -1.697  2.515   8.215   1.00 0.25 ? 55  ARG A CG   1 
ATOM 846  C CD   . ARG A 1 55  ? -2.029  3.125   9.567   1.00 0.39 ? 55  ARG A CD   1 
ATOM 847  N NE   . ARG A 1 55  ? -2.391  4.536   9.458   1.00 0.68 ? 55  ARG A NE   1 
ATOM 848  C CZ   . ARG A 1 55  ? -1.680  5.526   9.993   1.00 1.08 ? 55  ARG A CZ   1 
ATOM 849  N NH1  . ARG A 1 55  ? -0.573  5.262   10.674  1.00 1.62 ? 55  ARG A NH1  1 
ATOM 850  N NH2  . ARG A 1 55  ? -2.079  6.782   9.848   1.00 1.38 ? 55  ARG A NH2  1 
ATOM 851  H H    . ARG A 1 55  ? -2.098  3.583   5.455   1.00 0.14 ? 55  ARG A H    1 
ATOM 852  H HA   . ARG A 1 55  ? -2.015  0.781   6.118   1.00 0.13 ? 55  ARG A HA   1 
ATOM 853  H HB2  . ARG A 1 55  ? -3.544  3.083   7.338   1.00 0.19 ? 55  ARG A HB2  1 
ATOM 854  H HB3  . ARG A 1 55  ? -3.519  1.451   7.989   1.00 0.18 ? 55  ARG A HB3  1 
ATOM 855  H HG2  . ARG A 1 55  ? -1.131  1.608   8.370   1.00 0.39 ? 55  ARG A HG2  1 
ATOM 856  H HG3  . ARG A 1 55  ? -1.106  3.218   7.647   1.00 0.39 ? 55  ARG A HG3  1 
ATOM 857  H HD2  . ARG A 1 55  ? -2.858  2.584   9.998   1.00 0.53 ? 55  ARG A HD2  1 
ATOM 858  H HD3  . ARG A 1 55  ? -1.166  3.033   10.210  1.00 0.53 ? 55  ARG A HD3  1 
ATOM 859  H HE   . ARG A 1 55  ? -3.205  4.758   8.959   1.00 1.05 ? 55  ARG A HE   1 
ATOM 860  H HH11 . ARG A 1 55  ? -0.267  4.316   10.785  1.00 1.63 ? 55  ARG A HH11 1 
ATOM 861  H HH12 . ARG A 1 55  ? -0.042  6.009   11.075  1.00 2.15 ? 55  ARG A HH12 1 
ATOM 862  H HH21 . ARG A 1 55  ? -2.912  6.987   9.336   1.00 1.44 ? 55  ARG A HH21 1 
ATOM 863  H HH22 . ARG A 1 55  ? -1.544  7.525   10.252  1.00 1.77 ? 55  ARG A HH22 1 
ATOM 864  N N    . VAL A 1 56  ? -4.149  -0.146  5.280   1.00 0.10 ? 56  VAL A N    1 
ATOM 865  C CA   . VAL A 1 56  ? -5.357  -0.716  4.699   1.00 0.10 ? 56  VAL A CA   1 
ATOM 866  C C    . VAL A 1 56  ? -6.040  -1.651  5.692   1.00 0.11 ? 56  VAL A C    1 
ATOM 867  O O    . VAL A 1 56  ? -5.493  -2.691  6.057   1.00 0.15 ? 56  VAL A O    1 
ATOM 868  C CB   . VAL A 1 56  ? -5.053  -1.496  3.406   1.00 0.13 ? 56  VAL A CB   1 
ATOM 869  C CG1  . VAL A 1 56  ? -6.323  -1.695  2.592   1.00 0.18 ? 56  VAL A CG1  1 
ATOM 870  C CG2  . VAL A 1 56  ? -3.990  -0.780  2.586   1.00 0.14 ? 56  VAL A CG2  1 
ATOM 871  H H    . VAL A 1 56  ? -3.446  -0.747  5.603   1.00 0.17 ? 56  VAL A H    1 
ATOM 872  H HA   . VAL A 1 56  ? -6.030  0.095   4.460   1.00 0.09 ? 56  VAL A HA   1 
ATOM 873  H HB   . VAL A 1 56  ? -4.672  -2.469  3.678   1.00 0.17 ? 56  VAL A HB   1 
ATOM 874  H HG11 . VAL A 1 56  ? -6.726  -0.732  2.314   1.00 0.90 ? 56  VAL A HG11 1 
ATOM 875  H HG12 . VAL A 1 56  ? -7.049  -2.233  3.183   1.00 0.89 ? 56  VAL A HG12 1 
ATOM 876  H HG13 . VAL A 1 56  ? -6.094  -2.260  1.701   1.00 0.87 ? 56  VAL A HG13 1 
ATOM 877  H HG21 . VAL A 1 56  ? -3.308  -0.269  3.249   1.00 1.00 ? 56  VAL A HG21 1 
ATOM 878  H HG22 . VAL A 1 56  ? -4.463  -0.062  1.932   1.00 0.99 ? 56  VAL A HG22 1 
ATOM 879  H HG23 . VAL A 1 56  ? -3.446  -1.502  1.995   1.00 0.97 ? 56  VAL A HG23 1 
ATOM 880  N N    . SER A 1 57  ? -7.237  -1.272  6.124   1.00 0.11 ? 57  SER A N    1 
ATOM 881  C CA   . SER A 1 57  ? -7.993  -2.076  7.077   1.00 0.15 ? 57  SER A CA   1 
ATOM 882  C C    . SER A 1 57  ? -9.464  -2.144  6.684   1.00 0.13 ? 57  SER A C    1 
ATOM 883  O O    . SER A 1 57  ? -10.010 -1.196  6.119   1.00 0.16 ? 57  SER A O    1 
ATOM 884  C CB   . SER A 1 57  ? -7.854  -1.497  8.486   1.00 0.19 ? 57  SER A CB   1 
ATOM 885  O OG   . SER A 1 57  ? -6.988  -0.376  8.493   1.00 0.66 ? 57  SER A OG   1 
ATOM 886  H H    . SER A 1 57  ? -7.621  -0.432  5.797   1.00 0.11 ? 57  SER A H    1 
ATOM 887  H HA   . SER A 1 57  ? -7.583  -3.076  7.066   1.00 0.17 ? 57  SER A HA   1 
ATOM 888  H HB2  . SER A 1 57  ? -8.825  -1.189  8.844   1.00 0.48 ? 57  SER A HB2  1 
ATOM 889  H HB3  . SER A 1 57  ? -7.450  -2.253  9.145   1.00 0.53 ? 57  SER A HB3  1 
ATOM 890  H HG   . SER A 1 57  ? -7.419  0.358   8.938   1.00 1.17 ? 57  SER A HG   1 
ATOM 891  N N    . GLN A 1 58  ? -10.101 -3.272  6.984   1.00 0.13 ? 58  GLN A N    1 
ATOM 892  C CA   . GLN A 1 58  ? -11.508 -3.465  6.660   1.00 0.13 ? 58  GLN A CA   1 
ATOM 893  C C    . GLN A 1 58  ? -12.404 -2.821  7.713   1.00 0.15 ? 58  GLN A C    1 
ATOM 894  O O    . GLN A 1 58  ? -12.158 -2.948  8.913   1.00 0.21 ? 58  GLN A O    1 
ATOM 895  C CB   . GLN A 1 58  ? -11.825 -4.955  6.545   1.00 0.15 ? 58  GLN A CB   1 
ATOM 896  C CG   . GLN A 1 58  ? -12.965 -5.261  5.588   1.00 0.15 ? 58  GLN A CG   1 
ATOM 897  C CD   . GLN A 1 58  ? -13.524 -6.659  5.772   1.00 0.18 ? 58  GLN A CD   1 
ATOM 898  O OE1  . GLN A 1 58  ? -13.827 -7.351  4.800   1.00 0.20 ? 58  GLN A OE1  1 
ATOM 899  N NE2  . GLN A 1 58  ? -13.662 -7.082  7.022   1.00 0.21 ? 58  GLN A NE2  1 
ATOM 900  H H    . GLN A 1 58  ? -9.611  -3.992  7.434   1.00 0.16 ? 58  GLN A H    1 
ATOM 901  H HA   . GLN A 1 58  ? -11.696 -2.992  5.707   1.00 0.12 ? 58  GLN A HA   1 
ATOM 902  H HB2  . GLN A 1 58  ? -10.944 -5.473  6.199   1.00 0.17 ? 58  GLN A HB2  1 
ATOM 903  H HB3  . GLN A 1 58  ? -12.092 -5.330  7.522   1.00 0.17 ? 58  GLN A HB3  1 
ATOM 904  H HG2  . GLN A 1 58  ? -13.759 -4.548  5.754   1.00 0.15 ? 58  GLN A HG2  1 
ATOM 905  H HG3  . GLN A 1 58  ? -12.600 -5.165  4.575   1.00 0.15 ? 58  GLN A HG3  1 
ATOM 906  H HE21 . GLN A 1 58  ? -13.401 -6.477  7.748   1.00 0.20 ? 58  GLN A HE21 1 
ATOM 907  H HE22 . GLN A 1 58  ? -14.020 -7.983  7.170   1.00 0.23 ? 58  GLN A HE22 1 
ATOM 908  N N    . THR A 1 59  ? -13.443 -2.132  7.255   1.00 0.17 ? 59  THR A N    1 
ATOM 909  C CA   . THR A 1 59  ? -14.379 -1.467  8.153   1.00 0.20 ? 59  THR A CA   1 
ATOM 910  C C    . THR A 1 59  ? -15.285 -2.476  8.848   1.00 0.24 ? 59  THR A C    1 
ATOM 911  O O    . THR A 1 59  ? -15.331 -3.647  8.472   1.00 0.27 ? 59  THR A O    1 
ATOM 912  C CB   . THR A 1 59  ? -15.251 -0.447  7.400   1.00 0.23 ? 59  THR A CB   1 
ATOM 913  O OG1  . THR A 1 59  ? -16.227 -1.129  6.603   1.00 0.31 ? 59  THR A OG1  1 
ATOM 914  C CG2  . THR A 1 59  ? -14.397 0.444   6.511   1.00 0.21 ? 59  THR A CG2  1 
ATOM 915  H H    . THR A 1 59  ? -13.584 -2.069  6.288   1.00 0.19 ? 59  THR A H    1 
ATOM 916  H HA   . THR A 1 59  ? -13.805 -0.938  8.900   1.00 0.21 ? 59  THR A HA   1 
ATOM 917  H HB   . THR A 1 59  ? -15.760 0.173   8.124   1.00 0.29 ? 59  THR A HB   1 
ATOM 918  H HG1  . THR A 1 59  ? -16.357 -0.653  5.779   1.00 0.95 ? 59  THR A HG1  1 
ATOM 919  H HG21 . THR A 1 59  ? -14.055 -0.122  5.657   1.00 1.03 ? 59  THR A HG21 1 
ATOM 920  H HG22 . THR A 1 59  ? -13.546 0.801   7.070   1.00 1.07 ? 59  THR A HG22 1 
ATOM 921  H HG23 . THR A 1 59  ? -14.985 1.285   6.174   1.00 1.02 ? 59  THR A HG23 1 
ATOM 922  N N    . GLU A 1 60  ? -16.006 -2.014  9.866   1.00 0.30 ? 60  GLU A N    1 
ATOM 923  C CA   . GLU A 1 60  ? -16.912 -2.877  10.616  1.00 0.35 ? 60  GLU A CA   1 
ATOM 924  C C    . GLU A 1 60  ? -18.097 -3.304  9.754   1.00 0.38 ? 60  GLU A C    1 
ATOM 925  O O    . GLU A 1 60  ? -18.809 -4.250  10.087  1.00 0.44 ? 60  GLU A O    1 
ATOM 926  C CB   . GLU A 1 60  ? -17.407 -2.163  11.876  1.00 0.40 ? 60  GLU A CB   1 
ATOM 927  C CG   . GLU A 1 60  ? -18.346 -1.000  11.596  1.00 0.49 ? 60  GLU A CG   1 
ATOM 928  C CD   . GLU A 1 60  ? -17.607 0.288   11.290  1.00 1.54 ? 60  GLU A CD   1 
ATOM 929  O OE1  . GLU A 1 60  ? -16.447 0.425   11.731  1.00 1.93 ? 60  GLU A OE1  1 
ATOM 930  O OE2  . GLU A 1 60  ? -18.187 1.159   10.608  1.00 2.48 ? 60  GLU A OE2  1 
ATOM 931  H H    . GLU A 1 60  ? -15.926 -1.071  10.119  1.00 0.34 ? 60  GLU A H    1 
ATOM 932  H HA   . GLU A 1 60  ? -16.361 -3.760  10.907  1.00 0.35 ? 60  GLU A HA   1 
ATOM 933  H HB2  . GLU A 1 60  ? -17.929 -2.877  12.497  1.00 0.52 ? 60  GLU A HB2  1 
ATOM 934  H HB3  . GLU A 1 60  ? -16.554 -1.785  12.419  1.00 0.39 ? 60  GLU A HB3  1 
ATOM 935  H HG2  . GLU A 1 60  ? -18.966 -1.251  10.749  1.00 0.82 ? 60  GLU A HG2  1 
ATOM 936  H HG3  . GLU A 1 60  ? -18.971 -0.843  12.463  1.00 1.01 ? 60  GLU A HG3  1 
ATOM 937  N N    . THR A 1 61  ? -18.303 -2.597  8.646   1.00 0.38 ? 61  THR A N    1 
ATOM 938  C CA   . THR A 1 61  ? -19.403 -2.902  7.739   1.00 0.44 ? 61  THR A CA   1 
ATOM 939  C C    . THR A 1 61  ? -19.056 -4.068  6.818   1.00 0.48 ? 61  THR A C    1 
ATOM 940  O O    . THR A 1 61  ? -19.914 -4.573  6.092   1.00 0.86 ? 61  THR A O    1 
ATOM 941  C CB   . THR A 1 61  ? -19.777 -1.678  6.883   1.00 0.42 ? 61  THR A CB   1 
ATOM 942  O OG1  . THR A 1 61  ? -18.969 -0.555  7.252   1.00 0.50 ? 61  THR A OG1  1 
ATOM 943  C CG2  . THR A 1 61  ? -21.248 -1.329  7.058   1.00 0.55 ? 61  THR A CG2  1 
ATOM 944  H H    . THR A 1 61  ? -17.701 -1.852  8.435   1.00 0.37 ? 61  THR A H    1 
ATOM 945  H HA   . THR A 1 61  ? -20.261 -3.173  8.337   1.00 0.51 ? 61  THR A HA   1 
ATOM 946  H HB   . THR A 1 61  ? -19.601 -1.915  5.844   1.00 0.45 ? 61  THR A HB   1 
ATOM 947  H HG1  . THR A 1 61  ? -19.534 0.197   7.445   1.00 0.86 ? 61  THR A HG1  1 
ATOM 948  H HG21 . THR A 1 61  ? -21.654 -1.887  7.889   1.00 1.19 ? 61  THR A HG21 1 
ATOM 949  H HG22 . THR A 1 61  ? -21.787 -1.581  6.156   1.00 1.06 ? 61  THR A HG22 1 
ATOM 950  H HG23 . THR A 1 61  ? -21.346 -0.272  7.253   1.00 1.16 ? 61  THR A HG23 1 
ATOM 951  N N    . GLY A 1 62  ? -17.796 -4.493  6.851   1.00 0.29 ? 62  GLY A N    1 
ATOM 952  C CA   . GLY A 1 62  ? -17.363 -5.598  6.015   1.00 0.29 ? 62  GLY A CA   1 
ATOM 953  C C    . GLY A 1 62  ? -16.749 -5.134  4.708   1.00 0.26 ? 62  GLY A C    1 
ATOM 954  O O    . GLY A 1 62  ? -16.256 -5.946  3.924   1.00 0.36 ? 62  GLY A O    1 
ATOM 955  H H    . GLY A 1 62  ? -17.157 -4.056  7.450   1.00 0.47 ? 62  GLY A H    1 
ATOM 956  H HA2  . GLY A 1 62  ? -16.631 -6.179  6.557   1.00 0.31 ? 62  GLY A HA2  1 
ATOM 957  H HA3  . GLY A 1 62  ? -18.215 -6.225  5.797   1.00 0.35 ? 62  GLY A HA3  1 
ATOM 958  N N    . SER A 1 63  ? -16.778 -3.825  4.472   1.00 0.18 ? 63  SER A N    1 
ATOM 959  C CA   . SER A 1 63  ? -16.220 -3.255  3.250   1.00 0.19 ? 63  SER A CA   1 
ATOM 960  C C    . SER A 1 63  ? -14.734 -2.954  3.419   1.00 0.19 ? 63  SER A C    1 
ATOM 961  O O    . SER A 1 63  ? -14.299 -2.509  4.481   1.00 0.33 ? 63  SER A O    1 
ATOM 962  C CB   . SER A 1 63  ? -16.973 -1.978  2.867   1.00 0.25 ? 63  SER A CB   1 
ATOM 963  O OG   . SER A 1 63  ? -16.594 -0.893  3.697   1.00 1.04 ? 63  SER A OG   1 
ATOM 964  H H    . SER A 1 63  ? -17.184 -3.229  5.135   1.00 0.22 ? 63  SER A H    1 
ATOM 965  H HA   . SER A 1 63  ? -16.339 -3.983  2.460   1.00 0.22 ? 63  SER A HA   1 
ATOM 966  H HB2  . SER A 1 63  ? -16.749 -1.726  1.841   1.00 0.80 ? 63  SER A HB2  1 
ATOM 967  H HB3  . SER A 1 63  ? -18.035 -2.144  2.974   1.00 0.76 ? 63  SER A HB3  1 
ATOM 968  H HG   . SER A 1 63  ? -17.138 -0.129  3.493   1.00 1.58 ? 63  SER A HG   1 
ATOM 969  N N    . TRP A 1 64  ? -13.961 -3.201  2.366   1.00 0.12 ? 64  TRP A N    1 
ATOM 970  C CA   . TRP A 1 64  ? -12.523 -2.960  2.397   1.00 0.10 ? 64  TRP A CA   1 
ATOM 971  C C    . TRP A 1 64  ? -12.193 -1.550  1.916   1.00 0.12 ? 64  TRP A C    1 
ATOM 972  O O    . TRP A 1 64  ? -12.700 -1.098  0.890   1.00 0.15 ? 64  TRP A O    1 
ATOM 973  C CB   . TRP A 1 64  ? -11.797 -3.990  1.530   1.00 0.11 ? 64  TRP A CB   1 
ATOM 974  C CG   . TRP A 1 64  ? -11.577 -5.300  2.224   1.00 0.13 ? 64  TRP A CG   1 
ATOM 975  C CD1  . TRP A 1 64  ? -12.297 -6.447  2.055   1.00 0.14 ? 64  TRP A CD1  1 
ATOM 976  C CD2  . TRP A 1 64  ? -10.571 -5.596  3.201   1.00 0.15 ? 64  TRP A CD2  1 
ATOM 977  N NE1  . TRP A 1 64  ? -11.800 -7.439  2.865   1.00 0.17 ? 64  TRP A NE1  1 
ATOM 978  C CE2  . TRP A 1 64  ? -10.741 -6.942  3.578   1.00 0.17 ? 64  TRP A CE2  1 
ATOM 979  C CE3  . TRP A 1 64  ? -9.544  -4.855  3.791   1.00 0.16 ? 64  TRP A CE3  1 
ATOM 980  C CZ2  . TRP A 1 64  ? -9.923  -7.560  4.520   1.00 0.20 ? 64  TRP A CZ2  1 
ATOM 981  C CZ3  . TRP A 1 64  ? -8.733  -5.470  4.726   1.00 0.19 ? 64  TRP A CZ3  1 
ATOM 982  C CH2  . TRP A 1 64  ? -8.925  -6.810  5.082   1.00 0.21 ? 64  TRP A CH2  1 
ATOM 983  H H    . TRP A 1 64  ? -14.369 -3.555  1.549   1.00 0.17 ? 64  TRP A H    1 
ATOM 984  H HA   . TRP A 1 64  ? -12.192 -3.065  3.419   1.00 0.10 ? 64  TRP A HA   1 
ATOM 985  H HB2  . TRP A 1 64  ? -12.381 -4.178  0.641   1.00 0.12 ? 64  TRP A HB2  1 
ATOM 986  H HB3  . TRP A 1 64  ? -10.833 -3.597  1.244   1.00 0.13 ? 64  TRP A HB3  1 
ATOM 987  H HD1  . TRP A 1 64  ? -13.132 -6.547  1.377   1.00 0.14 ? 64  TRP A HD1  1 
ATOM 988  H HE1  . TRP A 1 64  ? -12.148 -8.354  2.923   1.00 0.19 ? 64  TRP A HE1  1 
ATOM 989  H HE3  . TRP A 1 64  ? -9.381  -3.820  3.529   1.00 0.15 ? 64  TRP A HE3  1 
ATOM 990  H HZ2  . TRP A 1 64  ? -10.057 -8.593  4.806   1.00 0.23 ? 64  TRP A HZ2  1 
ATOM 991  H HZ3  . TRP A 1 64  ? -7.934  -4.913  5.194   1.00 0.21 ? 64  TRP A HZ3  1 
ATOM 992  H HH2  . TRP A 1 64  ? -8.267  -7.250  5.817   1.00 0.24 ? 64  TRP A HH2  1 
ATOM 993  N N    . SER A 1 65  ? -11.337 -0.860  2.665   1.00 0.11 ? 65  SER A N    1 
ATOM 994  C CA   . SER A 1 65  ? -10.935 0.499   2.315   1.00 0.13 ? 65  SER A CA   1 
ATOM 995  C C    . SER A 1 65  ? -9.646  0.887   3.033   1.00 0.13 ? 65  SER A C    1 
ATOM 996  O O    . SER A 1 65  ? -9.182  0.176   3.926   1.00 0.17 ? 65  SER A O    1 
ATOM 997  C CB   . SER A 1 65  ? -12.048 1.487   2.666   1.00 0.15 ? 65  SER A CB   1 
ATOM 998  O OG   . SER A 1 65  ? -12.655 1.157   3.903   1.00 1.27 ? 65  SER A OG   1 
ATOM 999  H H    . SER A 1 65  ? -10.964 -1.275  3.471   1.00 0.11 ? 65  SER A H    1 
ATOM 1000 H HA   . SER A 1 65  ? -10.761 0.529   1.250   1.00 0.15 ? 65  SER A HA   1 
ATOM 1001 H HB2  . SER A 1 65  ? -11.633 2.482   2.737   1.00 1.00 ? 65  SER A HB2  1 
ATOM 1002 H HB3  . SER A 1 65  ? -12.802 1.466   1.893   1.00 0.96 ? 65  SER A HB3  1 
ATOM 1003 H HG   . SER A 1 65  ? -13.573 1.433   3.894   1.00 1.71 ? 65  SER A HG   1 
ATOM 1004 N N    . ALA A 1 66  ? -9.073  2.019   2.638   1.00 0.13 ? 66  ALA A N    1 
ATOM 1005 C CA   . ALA A 1 66  ? -7.837  2.502   3.242   1.00 0.14 ? 66  ALA A CA   1 
ATOM 1006 C C    . ALA A 1 66  ? -8.074  3.785   4.031   1.00 0.13 ? 66  ALA A C    1 
ATOM 1007 O O    . ALA A 1 66  ? -9.148  4.383   3.956   1.00 0.18 ? 66  ALA A O    1 
ATOM 1008 C CB   . ALA A 1 66  ? -6.781  2.730   2.171   1.00 0.16 ? 66  ALA A CB   1 
ATOM 1009 H H    . ALA A 1 66  ? -9.490  2.542   1.922   1.00 0.15 ? 66  ALA A H    1 
ATOM 1010 H HA   . ALA A 1 66  ? -7.475  1.740   3.916   1.00 0.15 ? 66  ALA A HA   1 
ATOM 1011 H HB1  . ALA A 1 66  ? -5.799  2.582   2.596   1.00 1.06 ? 66  ALA A HB1  1 
ATOM 1012 H HB2  . ALA A 1 66  ? -6.861  3.740   1.795   1.00 0.99 ? 66  ALA A HB2  1 
ATOM 1013 H HB3  . ALA A 1 66  ? -6.931  2.031   1.362   1.00 1.03 ? 66  ALA A HB3  1 
ATOM 1014 N N    . GLU A 1 67  ? -7.063  4.203   4.787   1.00 0.13 ? 67  GLU A N    1 
ATOM 1015 C CA   . GLU A 1 67  ? -7.159  5.417   5.590   1.00 0.15 ? 67  GLU A CA   1 
ATOM 1016 C C    . GLU A 1 67  ? -7.254  6.652   4.698   1.00 0.16 ? 67  GLU A C    1 
ATOM 1017 O O    . GLU A 1 67  ? -6.688  6.684   3.604   1.00 0.24 ? 67  GLU A O    1 
ATOM 1018 C CB   . GLU A 1 67  ? -5.950  5.536   6.520   1.00 0.18 ? 67  GLU A CB   1 
ATOM 1019 C CG   . GLU A 1 67  ? -6.234  6.325   7.788   1.00 0.23 ? 67  GLU A CG   1 
ATOM 1020 C CD   . GLU A 1 67  ? -7.384  5.745   8.590   1.00 0.51 ? 67  GLU A CD   1 
ATOM 1021 O OE1  . GLU A 1 67  ? -7.220  4.640   9.149   1.00 0.73 ? 67  GLU A OE1  1 
ATOM 1022 O OE2  . GLU A 1 67  ? -8.447  6.396   8.659   1.00 0.76 ? 67  GLU A OE2  1 
ATOM 1023 H H    . GLU A 1 67  ? -6.232  3.683   4.804   1.00 0.14 ? 67  GLU A H    1 
ATOM 1024 H HA   . GLU A 1 67  ? -8.055  5.349   6.187   1.00 0.16 ? 67  GLU A HA   1 
ATOM 1025 H HB2  . GLU A 1 67  ? -5.630  4.544   6.803   1.00 0.23 ? 67  GLU A HB2  1 
ATOM 1026 H HB3  . GLU A 1 67  ? -5.148  6.025   5.988   1.00 0.25 ? 67  GLU A HB3  1 
ATOM 1027 H HG2  . GLU A 1 67  ? -5.348  6.322   8.405   1.00 0.31 ? 67  GLU A HG2  1 
ATOM 1028 H HG3  . GLU A 1 67  ? -6.480  7.340   7.517   1.00 0.39 ? 67  GLU A HG3  1 
ATOM 1029 N N    . THR A 1 68  ? -7.974  7.663   5.171   1.00 0.16 ? 68  THR A N    1 
ATOM 1030 C CA   . THR A 1 68  ? -8.146  8.899   4.414   1.00 0.19 ? 68  THR A CA   1 
ATOM 1031 C C    . THR A 1 68  ? -7.794  10.120  5.258   1.00 0.23 ? 68  THR A C    1 
ATOM 1032 O O    . THR A 1 68  ? -8.094  10.171  6.450   1.00 0.28 ? 68  THR A O    1 
ATOM 1033 C CB   . THR A 1 68  ? -9.591  9.048   3.904   1.00 0.21 ? 68  THR A CB   1 
ATOM 1034 O OG1  . THR A 1 68  ? -10.265 7.785   3.963   1.00 0.19 ? 68  THR A OG1  1 
ATOM 1035 C CG2  . THR A 1 68  ? -9.607  9.571   2.475   1.00 0.25 ? 68  THR A CG2  1 
ATOM 1036 H H    . THR A 1 68  ? -8.402  7.577   6.049   1.00 0.21 ? 68  THR A H    1 
ATOM 1037 H HA   . THR A 1 68  ? -7.486  8.861   3.559   1.00 0.20 ? 68  THR A HA   1 
ATOM 1038 H HB   . THR A 1 68  ? -10.109 9.754   4.536   1.00 0.28 ? 68  THR A HB   1 
ATOM 1039 H HG1  . THR A 1 68  ? -11.186 7.901   3.719   1.00 0.68 ? 68  THR A HG1  1 
ATOM 1040 H HG21 . THR A 1 68  ? -9.581  8.740   1.787   1.00 1.02 ? 68  THR A HG21 1 
ATOM 1041 H HG22 . THR A 1 68  ? -8.745  10.201  2.312   1.00 1.03 ? 68  THR A HG22 1 
ATOM 1042 H HG23 . THR A 1 68  ? -10.508 10.145  2.312   1.00 1.05 ? 68  THR A HG23 1 
ATOM 1043 N N    . ALA A 1 69  ? -7.160  11.103  4.625   1.00 0.23 ? 69  ALA A N    1 
ATOM 1044 C CA   . ALA A 1 69  ? -6.770  12.328  5.311   1.00 0.27 ? 69  ALA A CA   1 
ATOM 1045 C C    . ALA A 1 69  ? -8.000  13.137  5.716   1.00 0.29 ? 69  ALA A C    1 
ATOM 1046 O O    . ALA A 1 69  ? -9.057  13.018  5.098   1.00 0.29 ? 69  ALA A O    1 
ATOM 1047 C CB   . ALA A 1 69  ? -5.853  13.158  4.425   1.00 0.31 ? 69  ALA A CB   1 
ATOM 1048 H H    . ALA A 1 69  ? -6.952  11.001  3.674   1.00 0.23 ? 69  ALA A H    1 
ATOM 1049 H HA   . ALA A 1 69  ? -6.223  12.052  6.202   1.00 0.30 ? 69  ALA A HA   1 
ATOM 1050 H HB1  . ALA A 1 69  ? -5.974  12.852  3.397   1.00 1.08 ? 69  ALA A HB1  1 
ATOM 1051 H HB2  . ALA A 1 69  ? -4.827  13.006  4.728   1.00 1.04 ? 69  ALA A HB2  1 
ATOM 1052 H HB3  . ALA A 1 69  ? -6.106  14.203  4.524   1.00 1.04 ? 69  ALA A HB3  1 
ATOM 1053 N N    . PRO A 1 70  ? -7.881  13.973  6.763   1.00 0.34 ? 70  PRO A N    1 
ATOM 1054 C CA   . PRO A 1 70  ? -8.995  14.799  7.241   1.00 0.38 ? 70  PRO A CA   1 
ATOM 1055 C C    . PRO A 1 70  ? -9.451  15.817  6.200   1.00 0.39 ? 70  PRO A C    1 
ATOM 1056 O O    . PRO A 1 70  ? -8.930  16.931  6.137   1.00 0.43 ? 70  PRO A O    1 
ATOM 1057 C CB   . PRO A 1 70  ? -8.421  15.512  8.471   1.00 0.44 ? 70  PRO A CB   1 
ATOM 1058 C CG   . PRO A 1 70  ? -6.943  15.465  8.288   1.00 0.72 ? 70  PRO A CG   1 
ATOM 1059 C CD   . PRO A 1 70  ? -6.660  14.181  7.562   1.00 0.39 ? 70  PRO A CD   1 
ATOM 1060 H HA   . PRO A 1 70  ? -9.837  14.191  7.537   1.00 0.39 ? 70  PRO A HA   1 
ATOM 1061 H HB2  . PRO A 1 70  ? -8.783  16.530  8.502   1.00 0.50 ? 70  PRO A HB2  1 
ATOM 1062 H HB3  . PRO A 1 70  ? -8.722  14.990  9.366   1.00 0.63 ? 70  PRO A HB3  1 
ATOM 1063 H HG2  . PRO A 1 70  ? -6.618  16.309  7.697   1.00 1.11 ? 70  PRO A HG2  1 
ATOM 1064 H HG3  . PRO A 1 70  ? -6.453  15.468  9.250   1.00 1.15 ? 70  PRO A HG3  1 
ATOM 1065 H HD2  . PRO A 1 70  ? -5.795  14.290  6.925   1.00 0.50 ? 70  PRO A HD2  1 
ATOM 1066 H HD3  . PRO A 1 70  ? -6.518  13.374  8.265   1.00 0.40 ? 70  PRO A HD3  1 
ATOM 1067 N N    . GLY A 1 71  ? -10.427 15.426  5.385   1.00 0.39 ? 71  GLY A N    1 
ATOM 1068 C CA   . GLY A 1 71  ? -10.939 16.314  4.358   1.00 0.42 ? 71  GLY A CA   1 
ATOM 1069 C C    . GLY A 1 71  ? -11.039 15.645  3.002   1.00 0.38 ? 71  GLY A C    1 
ATOM 1070 O O    . GLY A 1 71  ? -11.481 16.260  2.032   1.00 0.43 ? 71  GLY A O    1 
ATOM 1071 H H    . GLY A 1 71  ? -10.804 14.526  5.483   1.00 0.39 ? 71  GLY A H    1 
ATOM 1072 H HA2  . GLY A 1 71  ? -11.921 16.656  4.651   1.00 0.45 ? 71  GLY A HA2  1 
ATOM 1073 H HA3  . GLY A 1 71  ? -10.282 17.168  4.279   1.00 0.44 ? 71  GLY A HA3  1 
ATOM 1074 N N    . VAL A 1 72  ? -10.628 14.383  2.932   1.00 0.33 ? 72  VAL A N    1 
ATOM 1075 C CA   . VAL A 1 72  ? -10.673 13.632  1.682   1.00 0.30 ? 72  VAL A CA   1 
ATOM 1076 C C    . VAL A 1 72  ? -11.731 12.536  1.733   1.00 0.28 ? 72  VAL A C    1 
ATOM 1077 O O    . VAL A 1 72  ? -11.947 11.916  2.776   1.00 0.28 ? 72  VAL A O    1 
ATOM 1078 C CB   . VAL A 1 72  ? -9.309  12.994  1.355   1.00 0.29 ? 72  VAL A CB   1 
ATOM 1079 C CG1  . VAL A 1 72  ? -9.280  12.499  -0.082  1.00 0.31 ? 72  VAL A CG1  1 
ATOM 1080 C CG2  . VAL A 1 72  ? -8.179  13.982  1.609   1.00 0.38 ? 72  VAL A CG2  1 
ATOM 1081 H H    . VAL A 1 72  ? -10.285 13.947  3.740   1.00 0.35 ? 72  VAL A H    1 
ATOM 1082 H HA   . VAL A 1 72  ? -10.922 14.322  0.888   1.00 0.33 ? 72  VAL A HA   1 
ATOM 1083 H HB   . VAL A 1 72  ? -9.167  12.144  2.007   1.00 0.28 ? 72  VAL A HB   1 
ATOM 1084 H HG11 . VAL A 1 72  ? -8.311  12.073  -0.298  1.00 0.87 ? 72  VAL A HG11 1 
ATOM 1085 H HG12 . VAL A 1 72  ? -9.466  13.326  -0.752  1.00 0.97 ? 72  VAL A HG12 1 
ATOM 1086 H HG13 . VAL A 1 72  ? -10.043 11.746  -0.220  1.00 1.07 ? 72  VAL A HG13 1 
ATOM 1087 H HG21 . VAL A 1 72  ? -8.212  14.764  0.864   1.00 1.08 ? 72  VAL A HG21 1 
ATOM 1088 H HG22 . VAL A 1 72  ? -7.231  13.468  1.549   1.00 1.07 ? 72  VAL A HG22 1 
ATOM 1089 H HG23 . VAL A 1 72  ? -8.294  14.415  2.591   1.00 1.12 ? 72  VAL A HG23 1 
ATOM 1090 N N    . HIS A 1 73  ? -12.383 12.299  0.600   1.00 0.28 ? 73  HIS A N    1 
ATOM 1091 C CA   . HIS A 1 73  ? -13.416 11.275  0.511   1.00 0.27 ? 73  HIS A CA   1 
ATOM 1092 C C    . HIS A 1 73  ? -12.833 9.968   -0.017  1.00 0.27 ? 73  HIS A C    1 
ATOM 1093 O O    . HIS A 1 73  ? -12.148 9.951   -1.040  1.00 0.44 ? 73  HIS A O    1 
ATOM 1094 C CB   . HIS A 1 73  ? -14.554 11.746  -0.396  1.00 0.30 ? 73  HIS A CB   1 
ATOM 1095 C CG   . HIS A 1 73  ? -15.288 12.937  0.137   1.00 0.70 ? 73  HIS A CG   1 
ATOM 1096 N ND1  . HIS A 1 73  ? -14.842 13.676  1.212   1.00 1.26 ? 73  HIS A ND1  1 
ATOM 1097 C CD2  . HIS A 1 73  ? -16.442 13.520  -0.266  1.00 1.12 ? 73  HIS A CD2  1 
ATOM 1098 C CE1  . HIS A 1 73  ? -15.692 14.660  1.449   1.00 1.63 ? 73  HIS A CE1  1 
ATOM 1099 N NE2  . HIS A 1 73  ? -16.669 14.589  0.565   1.00 1.50 ? 73  HIS A NE2  1 
ATOM 1100 H H    . HIS A 1 73  ? -12.162 12.826  -0.196  1.00 0.31 ? 73  HIS A H    1 
ATOM 1101 H HA   . HIS A 1 73  ? -13.804 11.107  1.504   1.00 0.27 ? 73  HIS A HA   1 
ATOM 1102 H HB2  . HIS A 1 73  ? -14.150 12.010  -1.362  1.00 0.47 ? 73  HIS A HB2  1 
ATOM 1103 H HB3  . HIS A 1 73  ? -15.266 10.941  -0.515  1.00 0.56 ? 73  HIS A HB3  1 
ATOM 1104 H HD1  . HIS A 1 73  ? -14.027 13.505  1.727   1.00 1.57 ? 73  HIS A HD1  1 
ATOM 1105 H HD2  . HIS A 1 73  ? -17.066 13.203  -1.089  1.00 1.45 ? 73  HIS A HD2  1 
ATOM 1106 H HE1  . HIS A 1 73  ? -15.600 15.400  2.231   1.00 2.14 ? 73  HIS A HE1  1 
ATOM 1107 H HE2  . HIS A 1 73  ? -17.381 15.254  0.455   1.00 1.85 ? 73  HIS A HE2  1 
ATOM 1108 N N    . LYS A 1 74  ? -13.105 8.876   0.690   1.00 0.20 ? 74  LYS A N    1 
ATOM 1109 C CA   . LYS A 1 74  ? -12.602 7.565   0.295   1.00 0.19 ? 74  LYS A CA   1 
ATOM 1110 C C    . LYS A 1 74  ? -13.741 6.635   -0.108  1.00 0.21 ? 74  LYS A C    1 
ATOM 1111 O O    . LYS A 1 74  ? -14.754 6.541   0.586   1.00 0.30 ? 74  LYS A O    1 
ATOM 1112 C CB   . LYS A 1 74  ? -11.809 6.935   1.442   1.00 0.21 ? 74  LYS A CB   1 
ATOM 1113 C CG   . LYS A 1 74  ? -10.424 6.457   1.035   1.00 0.24 ? 74  LYS A CG   1 
ATOM 1114 C CD   . LYS A 1 74  ? -10.496 5.204   0.178   1.00 0.29 ? 74  LYS A CD   1 
ATOM 1115 C CE   . LYS A 1 74  ? -9.320  5.117   -0.782  1.00 0.36 ? 74  LYS A CE   1 
ATOM 1116 N NZ   . LYS A 1 74  ? -9.667  5.633   -2.135  1.00 1.24 ? 74  LYS A NZ   1 
ATOM 1117 H H    . LYS A 1 74  ? -13.653 8.954   1.499   1.00 0.28 ? 74  LYS A H    1 
ATOM 1118 H HA   . LYS A 1 74  ? -11.946 7.701   -0.551  1.00 0.20 ? 74  LYS A HA   1 
ATOM 1119 H HB2  . LYS A 1 74  ? -11.698 7.665   2.231   1.00 0.24 ? 74  LYS A HB2  1 
ATOM 1120 H HB3  . LYS A 1 74  ? -12.360 6.089   1.823   1.00 0.24 ? 74  LYS A HB3  1 
ATOM 1121 H HG2  . LYS A 1 74  ? -9.935  7.239   0.474   1.00 0.26 ? 74  LYS A HG2  1 
ATOM 1122 H HG3  . LYS A 1 74  ? -9.854  6.241   1.926   1.00 0.28 ? 74  LYS A HG3  1 
ATOM 1123 H HD2  . LYS A 1 74  ? -10.487 4.338   0.822   1.00 0.43 ? 74  LYS A HD2  1 
ATOM 1124 H HD3  . LYS A 1 74  ? -11.414 5.222   -0.392  1.00 0.35 ? 74  LYS A HD3  1 
ATOM 1125 H HE2  . LYS A 1 74  ? -8.503  5.701   -0.383  1.00 1.10 ? 74  LYS A HE2  1 
ATOM 1126 H HE3  . LYS A 1 74  ? -9.017  4.085   -0.866  1.00 1.01 ? 74  LYS A HE3  1 
ATOM 1127 H HZ1  . LYS A 1 74  ? -10.069 6.590   -2.061  1.00 1.89 ? 74  LYS A HZ1  1 
ATOM 1128 H HZ2  . LYS A 1 74  ? -10.366 5.010   -2.588  1.00 1.76 ? 74  LYS A HZ2  1 
ATOM 1129 H HZ3  . LYS A 1 74  ? -8.815  5.672   -2.731  1.00 1.76 ? 74  LYS A HZ3  1 
ATOM 1130 N N    . ARG A 1 75  ? -13.561 5.939   -1.226  1.00 0.23 ? 75  ARG A N    1 
ATOM 1131 C CA   . ARG A 1 75  ? -14.567 5.005   -1.712  1.00 0.26 ? 75  ARG A CA   1 
ATOM 1132 C C    . ARG A 1 75  ? -14.376 3.640   -1.059  1.00 0.21 ? 75  ARG A C    1 
ATOM 1133 O O    . ARG A 1 75  ? -13.257 3.263   -0.710  1.00 0.25 ? 75  ARG A O    1 
ATOM 1134 C CB   . ARG A 1 75  ? -14.492 4.881   -3.238  1.00 0.35 ? 75  ARG A CB   1 
ATOM 1135 C CG   . ARG A 1 75  ? -13.160 4.353   -3.742  1.00 0.64 ? 75  ARG A CG   1 
ATOM 1136 C CD   . ARG A 1 75  ? -13.154 4.213   -5.255  1.00 0.85 ? 75  ARG A CD   1 
ATOM 1137 N NE   . ARG A 1 75  ? -13.555 5.449   -5.922  1.00 0.66 ? 75  ARG A NE   1 
ATOM 1138 C CZ   . ARG A 1 75  ? -12.903 5.975   -6.954  1.00 0.88 ? 75  ARG A CZ   1 
ATOM 1139 N NH1  . ARG A 1 75  ? -11.828 5.371   -7.444  1.00 1.83 ? 75  ARG A NH1  1 
ATOM 1140 N NH2  . ARG A 1 75  ? -13.328 7.106   -7.501  1.00 0.95 ? 75  ARG A NH2  1 
ATOM 1141 H H    . ARG A 1 75  ? -12.728 6.050   -1.730  1.00 0.28 ? 75  ARG A H    1 
ATOM 1142 H HA   . ARG A 1 75  ? -15.538 5.389   -1.434  1.00 0.31 ? 75  ARG A HA   1 
ATOM 1143 H HB2  . ARG A 1 75  ? -15.269 4.211   -3.572  1.00 0.72 ? 75  ARG A HB2  1 
ATOM 1144 H HB3  . ARG A 1 75  ? -14.655 5.856   -3.677  1.00 0.91 ? 75  ARG A HB3  1 
ATOM 1145 H HG2  . ARG A 1 75  ? -12.378 5.039   -3.451  1.00 1.08 ? 75  ARG A HG2  1 
ATOM 1146 H HG3  . ARG A 1 75  ? -12.976 3.386   -3.298  1.00 0.85 ? 75  ARG A HG3  1 
ATOM 1147 H HD2  . ARG A 1 75  ? -12.158 3.949   -5.576  1.00 1.43 ? 75  ARG A HD2  1 
ATOM 1148 H HD3  . ARG A 1 75  ? -13.841 3.426   -5.533  1.00 1.08 ? 75  ARG A HD3  1 
ATOM 1149 H HE   . ARG A 1 75  ? -14.347 5.912   -5.580  1.00 1.20 ? 75  ARG A HE   1 
ATOM 1150 H HH11 . ARG A 1 75  ? -11.506 4.516   -7.035  1.00 2.16 ? 75  ARG A HH11 1 
ATOM 1151 H HH12 . ARG A 1 75  ? -11.340 5.769   -8.219  1.00 2.37 ? 75  ARG A HH12 1 
ATOM 1152 H HH21 . ARG A 1 75  ? -14.139 7.563   -7.137  1.00 1.27 ? 75  ARG A HH21 1 
ATOM 1153 H HH22 . ARG A 1 75  ? -12.836 7.502   -8.276  1.00 1.29 ? 75  ARG A HH22 1 
ATOM 1154 N N    . TYR A 1 76  ? -15.471 2.908   -0.884  1.00 0.18 ? 76  TYR A N    1 
ATOM 1155 C CA   . TYR A 1 76  ? -15.413 1.593   -0.255  1.00 0.19 ? 76  TYR A CA   1 
ATOM 1156 C C    . TYR A 1 76  ? -15.432 0.473   -1.292  1.00 0.18 ? 76  TYR A C    1 
ATOM 1157 O O    . TYR A 1 76  ? -16.010 0.616   -2.369  1.00 0.34 ? 76  TYR A O    1 
ATOM 1158 C CB   . TYR A 1 76  ? -16.578 1.425   0.721   1.00 0.28 ? 76  TYR A CB   1 
ATOM 1159 C CG   . TYR A 1 76  ? -16.633 2.503   1.781   1.00 0.31 ? 76  TYR A CG   1 
ATOM 1160 C CD1  . TYR A 1 76  ? -15.814 2.444   2.901   1.00 0.41 ? 76  TYR A CD1  1 
ATOM 1161 C CD2  . TYR A 1 76  ? -17.501 3.580   1.658   1.00 0.40 ? 76  TYR A CD2  1 
ATOM 1162 C CE1  . TYR A 1 76  ? -15.858 3.430   3.870   1.00 0.47 ? 76  TYR A CE1  1 
ATOM 1163 C CE2  . TYR A 1 76  ? -17.553 4.568   2.623   1.00 0.45 ? 76  TYR A CE2  1 
ATOM 1164 C CZ   . TYR A 1 76  ? -16.729 4.489   3.727   1.00 0.43 ? 76  TYR A CZ   1 
ATOM 1165 O OH   . TYR A 1 76  ? -16.777 5.471   4.689   1.00 0.51 ? 76  TYR A OH   1 
ATOM 1166 H H    . TYR A 1 76  ? -16.337 3.265   -1.173  1.00 0.21 ? 76  TYR A H    1 
ATOM 1167 H HA   . TYR A 1 76  ? -14.488 1.535   0.297   1.00 0.21 ? 76  TYR A HA   1 
ATOM 1168 H HB2  . TYR A 1 76  ? -17.508 1.452   0.171   1.00 0.32 ? 76  TYR A HB2  1 
ATOM 1169 H HB3  . TYR A 1 76  ? -16.487 0.472   1.220   1.00 0.34 ? 76  TYR A HB3  1 
ATOM 1170 H HD1  . TYR A 1 76  ? -15.133 1.613   3.011   1.00 0.53 ? 76  TYR A HD1  1 
ATOM 1171 H HD2  . TYR A 1 76  ? -18.145 3.639   0.793   1.00 0.50 ? 76  TYR A HD2  1 
ATOM 1172 H HE1  . TYR A 1 76  ? -15.214 3.368   4.733   1.00 0.60 ? 76  TYR A HE1  1 
ATOM 1173 H HE2  . TYR A 1 76  ? -18.234 5.398   2.510   1.00 0.59 ? 76  TYR A HE2  1 
ATOM 1174 H HH   . TYR A 1 76  ? -17.470 6.098   4.473   1.00 0.99 ? 76  TYR A HH   1 
ATOM 1175 N N    . PHE A 1 77  ? -14.795 -0.644  -0.949  1.00 0.14 ? 77  PHE A N    1 
ATOM 1176 C CA   . PHE A 1 77  ? -14.729 -1.803  -1.834  1.00 0.14 ? 77  PHE A CA   1 
ATOM 1177 C C    . PHE A 1 77  ? -15.277 -3.044  -1.138  1.00 0.14 ? 77  PHE A C    1 
ATOM 1178 O O    . PHE A 1 77  ? -15.754 -2.971  -0.005  1.00 0.16 ? 77  PHE A O    1 
ATOM 1179 C CB   . PHE A 1 77  ? -13.286 -2.059  -2.277  1.00 0.16 ? 77  PHE A CB   1 
ATOM 1180 C CG   . PHE A 1 77  ? -12.543 -0.817  -2.675  1.00 0.17 ? 77  PHE A CG   1 
ATOM 1181 C CD1  . PHE A 1 77  ? -12.910 -0.106  -3.807  1.00 0.18 ? 77  PHE A CD1  1 
ATOM 1182 C CD2  . PHE A 1 77  ? -11.473 -0.363  -1.921  1.00 0.23 ? 77  PHE A CD2  1 
ATOM 1183 C CE1  . PHE A 1 77  ? -12.223 1.035   -4.177  1.00 0.20 ? 77  PHE A CE1  1 
ATOM 1184 C CE2  . PHE A 1 77  ? -10.783 0.777   -2.286  1.00 0.26 ? 77  PHE A CE2  1 
ATOM 1185 C CZ   . PHE A 1 77  ? -11.159 1.477   -3.416  1.00 0.23 ? 77  PHE A CZ   1 
ATOM 1186 H H    . PHE A 1 77  ? -14.358 -0.690  -0.074  1.00 0.25 ? 77  PHE A H    1 
ATOM 1187 H HA   . PHE A 1 77  ? -15.334 -1.594  -2.705  1.00 0.16 ? 77  PHE A HA   1 
ATOM 1188 H HB2  . PHE A 1 77  ? -12.746 -2.522  -1.465  1.00 0.18 ? 77  PHE A HB2  1 
ATOM 1189 H HB3  . PHE A 1 77  ? -13.293 -2.730  -3.125  1.00 0.19 ? 77  PHE A HB3  1 
ATOM 1190 H HD1  . PHE A 1 77  ? -13.743 -0.450  -4.402  1.00 0.21 ? 77  PHE A HD1  1 
ATOM 1191 H HD2  . PHE A 1 77  ? -11.179 -0.910  -1.037  1.00 0.29 ? 77  PHE A HD2  1 
ATOM 1192 H HE1  . PHE A 1 77  ? -12.519 1.579   -5.061  1.00 0.25 ? 77  PHE A HE1  1 
ATOM 1193 H HE2  . PHE A 1 77  ? -9.951  1.120   -1.689  1.00 0.33 ? 77  PHE A HE2  1 
ATOM 1194 H HZ   . PHE A 1 77  ? -10.621 2.368   -3.703  1.00 0.26 ? 77  PHE A HZ   1 
ATOM 1195 N N    . ARG A 1 78  ? -15.205 -4.183  -1.820  1.00 0.14 ? 78  ARG A N    1 
ATOM 1196 C CA   . ARG A 1 78  ? -15.693 -5.438  -1.263  1.00 0.15 ? 78  ARG A CA   1 
ATOM 1197 C C    . ARG A 1 78  ? -14.639 -6.537  -1.384  1.00 0.14 ? 78  ARG A C    1 
ATOM 1198 O O    . ARG A 1 78  ? -14.970 -7.712  -1.546  1.00 0.16 ? 78  ARG A O    1 
ATOM 1199 C CB   . ARG A 1 78  ? -16.980 -5.869  -1.969  1.00 0.18 ? 78  ARG A CB   1 
ATOM 1200 C CG   . ARG A 1 78  ? -18.029 -6.434  -1.024  1.00 0.21 ? 78  ARG A CG   1 
ATOM 1201 C CD   . ARG A 1 78  ? -19.359 -6.640  -1.730  1.00 0.49 ? 78  ARG A CD   1 
ATOM 1202 N NE   . ARG A 1 78  ? -20.402 -7.088  -0.811  1.00 1.29 ? 78  ARG A NE   1 
ATOM 1203 C CZ   . ARG A 1 78  ? -21.697 -6.840  -0.984  1.00 1.78 ? 78  ARG A CZ   1 
ATOM 1204 N NH1  . ARG A 1 78  ? -22.108 -6.149  -2.039  1.00 1.84 ? 78  ARG A NH1  1 
ATOM 1205 N NH2  . ARG A 1 78  ? -22.581 -7.284  -0.103  1.00 2.81 ? 78  ARG A NH2  1 
ATOM 1206 H H    . ARG A 1 78  ? -14.813 -4.178  -2.719  1.00 0.14 ? 78  ARG A H    1 
ATOM 1207 H HA   . ARG A 1 78  ? -15.904 -5.276  -0.218  1.00 0.16 ? 78  ARG A HA   1 
ATOM 1208 H HB2  . ARG A 1 78  ? -17.404 -5.015  -2.474  1.00 0.26 ? 78  ARG A HB2  1 
ATOM 1209 H HB3  . ARG A 1 78  ? -16.739 -6.628  -2.700  1.00 0.23 ? 78  ARG A HB3  1 
ATOM 1210 H HG2  . ARG A 1 78  ? -17.683 -7.384  -0.644  1.00 0.37 ? 78  ARG A HG2  1 
ATOM 1211 H HG3  . ARG A 1 78  ? -18.168 -5.744  -0.204  1.00 0.41 ? 78  ARG A HG3  1 
ATOM 1212 H HD2  . ARG A 1 78  ? -19.665 -5.706  -2.176  1.00 1.18 ? 78  ARG A HD2  1 
ATOM 1213 H HD3  . ARG A 1 78  ? -19.230 -7.383  -2.503  1.00 1.22 ? 78  ARG A HD3  1 
ATOM 1214 H HE   . ARG A 1 78  ? -20.122 -7.601  -0.023  1.00 1.96 ? 78  ARG A HE   1 
ATOM 1215 H HH11 . ARG A 1 78  ? -21.444 -5.814  -2.707  1.00 1.80 ? 78  ARG A HH11 1 
ATOM 1216 H HH12 . ARG A 1 78  ? -23.082 -5.964  -2.166  1.00 2.41 ? 78  ARG A HH12 1 
ATOM 1217 H HH21 . ARG A 1 78  ? -22.275 -7.806  0.693   1.00 3.35 ? 78  ARG A HH21 1 
ATOM 1218 H HH22 . ARG A 1 78  ? -23.554 -7.095  -0.234  1.00 3.21 ? 78  ARG A HH22 1 
ATOM 1219 N N    . LYS A 1 79  ? -13.368 -6.147  -1.301  1.00 0.12 ? 79  LYS A N    1 
ATOM 1220 C CA   . LYS A 1 79  ? -12.266 -7.098  -1.397  1.00 0.12 ? 79  LYS A CA   1 
ATOM 1221 C C    . LYS A 1 79  ? -10.933 -6.418  -1.105  1.00 0.11 ? 79  LYS A C    1 
ATOM 1222 O O    . LYS A 1 79  ? -10.785 -5.212  -1.306  1.00 0.14 ? 79  LYS A O    1 
ATOM 1223 C CB   . LYS A 1 79  ? -12.231 -7.733  -2.789  1.00 0.13 ? 79  LYS A CB   1 
ATOM 1224 C CG   . LYS A 1 79  ? -11.909 -9.218  -2.772  1.00 0.19 ? 79  LYS A CG   1 
ATOM 1225 C CD   . LYS A 1 79  ? -11.702 -9.757  -4.178  1.00 0.23 ? 79  LYS A CD   1 
ATOM 1226 C CE   . LYS A 1 79  ? -12.881 -10.602 -4.628  1.00 0.38 ? 79  LYS A CE   1 
ATOM 1227 N NZ   . LYS A 1 79  ? -12.442 -11.870 -5.273  1.00 1.27 ? 79  LYS A NZ   1 
ATOM 1228 H H    . LYS A 1 79  ? -13.168 -5.196  -1.168  1.00 0.12 ? 79  LYS A H    1 
ATOM 1229 H HA   . LYS A 1 79  ? -12.431 -7.873  -0.663  1.00 0.13 ? 79  LYS A HA   1 
ATOM 1230 H HB2  . LYS A 1 79  ? -13.195 -7.601  -3.257  1.00 0.13 ? 79  LYS A HB2  1 
ATOM 1231 H HB3  . LYS A 1 79  ? -11.480 -7.231  -3.382  1.00 0.15 ? 79  LYS A HB3  1 
ATOM 1232 H HG2  . LYS A 1 79  ? -11.007 -9.374  -2.199  1.00 0.30 ? 79  LYS A HG2  1 
ATOM 1233 H HG3  . LYS A 1 79  ? -12.729 -9.748  -2.309  1.00 0.25 ? 79  LYS A HG3  1 
ATOM 1234 H HD2  . LYS A 1 79  ? -11.585 -8.927  -4.858  1.00 0.33 ? 79  LYS A HD2  1 
ATOM 1235 H HD3  . LYS A 1 79  ? -10.809 -10.364 -4.192  1.00 0.34 ? 79  LYS A HD3  1 
ATOM 1236 H HE2  . LYS A 1 79  ? -13.490 -10.838 -3.768  1.00 1.02 ? 79  LYS A HE2  1 
ATOM 1237 H HE3  . LYS A 1 79  ? -13.467 -10.033 -5.335  1.00 1.06 ? 79  LYS A HE3  1 
ATOM 1238 H HZ1  . LYS A 1 79  ? -12.607 -11.826 -6.299  1.00 1.90 ? 79  LYS A HZ1  1 
ATOM 1239 H HZ2  . LYS A 1 79  ? -12.975 -12.673 -4.883  1.00 1.81 ? 79  LYS A HZ2  1 
ATOM 1240 H HZ3  . LYS A 1 79  ? -11.429 -12.026 -5.101  1.00 1.78 ? 79  LYS A HZ3  1 
ATOM 1241 N N    . ILE A 1 80  ? -9.967  -7.198  -0.629  1.00 0.11 ? 80  ILE A N    1 
ATOM 1242 C CA   . ILE A 1 80  ? -8.648  -6.667  -0.308  1.00 0.11 ? 80  ILE A CA   1 
ATOM 1243 C C    . ILE A 1 80  ? -7.827  -6.430  -1.573  1.00 0.10 ? 80  ILE A C    1 
ATOM 1244 O O    . ILE A 1 80  ? -7.187  -5.389  -1.723  1.00 0.10 ? 80  ILE A O    1 
ATOM 1245 C CB   . ILE A 1 80  ? -7.875  -7.612  0.640   1.00 0.12 ? 80  ILE A CB   1 
ATOM 1246 C CG1  . ILE A 1 80  ? -6.532  -6.994  1.037   1.00 0.12 ? 80  ILE A CG1  1 
ATOM 1247 C CG2  . ILE A 1 80  ? -7.666  -8.974  -0.007  1.00 0.14 ? 80  ILE A CG2  1 
ATOM 1248 C CD1  . ILE A 1 80  ? -6.669  -5.764  1.908   1.00 0.15 ? 80  ILE A CD1  1 
ATOM 1249 H H    . ILE A 1 80  ? -10.147 -8.151  -0.489  1.00 0.14 ? 80  ILE A H    1 
ATOM 1250 H HA   . ILE A 1 80  ? -8.787  -5.722  0.199   1.00 0.11 ? 80  ILE A HA   1 
ATOM 1251 H HB   . ILE A 1 80  ? -8.471  -7.756  1.528   1.00 0.14 ? 80  ILE A HB   1 
ATOM 1252 H HG12 . ILE A 1 80  ? -5.956  -7.724  1.586   1.00 0.17 ? 80  ILE A HG12 1 
ATOM 1253 H HG13 . ILE A 1 80  ? -5.992  -6.712  0.145   1.00 0.14 ? 80  ILE A HG13 1 
ATOM 1254 H HG21 . ILE A 1 80  ? -8.073  -9.743  0.632   1.00 0.98 ? 80  ILE A HG21 1 
ATOM 1255 H HG22 . ILE A 1 80  ? -6.609  -9.146  -0.151  1.00 0.96 ? 80  ILE A HG22 1 
ATOM 1256 H HG23 . ILE A 1 80  ? -8.166  -8.997  -0.964  1.00 1.04 ? 80  ILE A HG23 1 
ATOM 1257 H HD11 . ILE A 1 80  ? -7.712  -5.597  2.133   1.00 0.98 ? 80  ILE A HD11 1 
ATOM 1258 H HD12 . ILE A 1 80  ? -6.270  -4.907  1.386   1.00 1.06 ? 80  ILE A HD12 1 
ATOM 1259 H HD13 . ILE A 1 80  ? -6.122  -5.912  2.828   1.00 1.03 ? 80  ILE A HD13 1 
ATOM 1260 N N    . LYS A 1 81  ? -7.851  -7.401  -2.482  1.00 0.11 ? 81  LYS A N    1 
ATOM 1261 C CA   . LYS A 1 81  ? -7.110  -7.298  -3.735  1.00 0.13 ? 81  LYS A CA   1 
ATOM 1262 C C    . LYS A 1 81  ? -7.769  -6.296  -4.678  1.00 0.13 ? 81  LYS A C    1 
ATOM 1263 O O    . LYS A 1 81  ? -7.097  -5.660  -5.491  1.00 0.14 ? 81  LYS A O    1 
ATOM 1264 C CB   . LYS A 1 81  ? -7.012  -8.670  -4.408  1.00 0.15 ? 81  LYS A CB   1 
ATOM 1265 C CG   . LYS A 1 81  ? -8.338  -9.187  -4.939  1.00 0.15 ? 81  LYS A CG   1 
ATOM 1266 C CD   . LYS A 1 81  ? -8.206  -9.690  -6.368  1.00 0.45 ? 81  LYS A CD   1 
ATOM 1267 C CE   . LYS A 1 81  ? -8.163  -11.209 -6.424  1.00 1.02 ? 81  LYS A CE   1 
ATOM 1268 N NZ   . LYS A 1 81  ? -6.942  -11.754 -5.770  1.00 1.78 ? 81  LYS A NZ   1 
ATOM 1269 H H    . LYS A 1 81  ? -8.381  -8.207  -2.305  1.00 0.12 ? 81  LYS A H    1 
ATOM 1270 H HA   . LYS A 1 81  ? -6.116  -6.951  -3.501  1.00 0.14 ? 81  LYS A HA   1 
ATOM 1271 H HB2  . LYS A 1 81  ? -6.320  -8.602  -5.233  1.00 0.17 ? 81  LYS A HB2  1 
ATOM 1272 H HB3  . LYS A 1 81  ? -6.633  -9.382  -3.690  1.00 0.19 ? 81  LYS A HB3  1 
ATOM 1273 H HG2  . LYS A 1 81  ? -8.674  -10.000 -4.314  1.00 0.44 ? 81  LYS A HG2  1 
ATOM 1274 H HG3  . LYS A 1 81  ? -9.064  -8.387  -4.915  1.00 0.41 ? 81  LYS A HG3  1 
ATOM 1275 H HD2  . LYS A 1 81  ? -9.052  -9.343  -6.942  1.00 1.32 ? 81  LYS A HD2  1 
ATOM 1276 H HD3  . LYS A 1 81  ? -7.294  -9.296  -6.795  1.00 1.31 ? 81  LYS A HD3  1 
ATOM 1277 H HE2  . LYS A 1 81  ? -9.035  -11.599 -5.921  1.00 1.80 ? 81  LYS A HE2  1 
ATOM 1278 H HE3  . LYS A 1 81  ? -8.176  -11.519 -7.458  1.00 1.39 ? 81  LYS A HE3  1 
ATOM 1279 H HZ1  . LYS A 1 81  ? -6.702  -12.682 -6.177  1.00 2.22 ? 81  LYS A HZ1  1 
ATOM 1280 H HZ2  . LYS A 1 81  ? -7.105  -11.870 -4.749  1.00 2.34 ? 81  LYS A HZ2  1 
ATOM 1281 H HZ3  . LYS A 1 81  ? -6.141  -11.107 -5.911  1.00 2.15 ? 81  LYS A HZ3  1 
ATOM 1282 N N    . ASN A 1 82  ? -9.088  -6.162  -4.564  1.00 0.12 ? 82  ASN A N    1 
ATOM 1283 C CA   . ASN A 1 82  ? -9.841  -5.239  -5.407  1.00 0.12 ? 82  ASN A CA   1 
ATOM 1284 C C    . ASN A 1 82  ? -9.339  -3.809  -5.232  1.00 0.12 ? 82  ASN A C    1 
ATOM 1285 O O    . ASN A 1 82  ? -9.465  -2.982  -6.134  1.00 0.15 ? 82  ASN A O    1 
ATOM 1286 C CB   . ASN A 1 82  ? -11.335 -5.313  -5.078  1.00 0.14 ? 82  ASN A CB   1 
ATOM 1287 C CG   . ASN A 1 82  ? -12.209 -4.965  -6.267  1.00 0.18 ? 82  ASN A CG   1 
ATOM 1288 O OD1  . ASN A 1 82  ? -11.892 -4.063  -7.042  1.00 0.25 ? 82  ASN A OD1  1 
ATOM 1289 N ND2  . ASN A 1 82  ? -13.319 -5.680  -6.417  1.00 0.23 ? 82  ASN A ND2  1 
ATOM 1290 H H    . ASN A 1 82  ? -9.564  -6.697  -3.898  1.00 0.11 ? 82  ASN A H    1 
ATOM 1291 H HA   . ASN A 1 82  ? -9.695  -5.534  -6.435  1.00 0.13 ? 82  ASN A HA   1 
ATOM 1292 H HB2  . ASN A 1 82  ? -11.576 -6.315  -4.758  1.00 0.14 ? 82  ASN A HB2  1 
ATOM 1293 H HB3  . ASN A 1 82  ? -11.555 -4.622  -4.277  1.00 0.14 ? 82  ASN A HB3  1 
ATOM 1294 H HD21 . ASN A 1 82  ? -13.511 -6.383  -5.761  1.00 0.30 ? 82  ASN A HD21 1 
ATOM 1295 H HD22 . ASN A 1 82  ? -13.902 -5.476  -7.177  1.00 0.25 ? 82  ASN A HD22 1 
ATOM 1296 N N    . LEU A 1 83  ? -8.767  -3.530  -4.064  1.00 0.11 ? 83  LEU A N    1 
ATOM 1297 C CA   . LEU A 1 83  ? -8.240  -2.203  -3.770  1.00 0.11 ? 83  LEU A CA   1 
ATOM 1298 C C    . LEU A 1 83  ? -7.134  -1.836  -4.753  1.00 0.12 ? 83  LEU A C    1 
ATOM 1299 O O    . LEU A 1 83  ? -6.960  -0.669  -5.103  1.00 0.14 ? 83  LEU A O    1 
ATOM 1300 C CB   . LEU A 1 83  ? -7.699  -2.153  -2.338  1.00 0.12 ? 83  LEU A CB   1 
ATOM 1301 C CG   . LEU A 1 83  ? -6.997  -0.850  -1.954  1.00 0.14 ? 83  LEU A CG   1 
ATOM 1302 C CD1  . LEU A 1 83  ? -7.500  -0.348  -0.609  1.00 0.16 ? 83  LEU A CD1  1 
ATOM 1303 C CD2  . LEU A 1 83  ? -5.489  -1.047  -1.921  1.00 0.17 ? 83  LEU A CD2  1 
ATOM 1304 H H    . LEU A 1 83  ? -8.694  -4.234  -3.386  1.00 0.12 ? 83  LEU A H    1 
ATOM 1305 H HA   . LEU A 1 83  ? -9.047  -1.493  -3.868  1.00 0.12 ? 83  LEU A HA   1 
ATOM 1306 H HB2  . LEU A 1 83  ? -8.525  -2.308  -1.658  1.00 0.12 ? 83  LEU A HB2  1 
ATOM 1307 H HB3  . LEU A 1 83  ? -6.996  -2.964  -2.214  1.00 0.12 ? 83  LEU A HB3  1 
ATOM 1308 H HG   . LEU A 1 83  ? -7.221  -0.097  -2.696  1.00 0.15 ? 83  LEU A HG   1 
ATOM 1309 H HD11 . LEU A 1 83  ? -8.552  -0.568  -0.513  1.00 0.93 ? 83  LEU A HD11 1 
ATOM 1310 H HD12 . LEU A 1 83  ? -7.347  0.719   -0.543  1.00 0.94 ? 83  LEU A HD12 1 
ATOM 1311 H HD13 . LEU A 1 83  ? -6.956  -0.838  0.185   1.00 0.99 ? 83  LEU A HD13 1 
ATOM 1312 H HD21 . LEU A 1 83  ? -5.074  -0.804  -2.889  1.00 0.97 ? 83  LEU A HD21 1 
ATOM 1313 H HD22 . LEU A 1 83  ? -5.266  -2.076  -1.683  1.00 1.07 ? 83  LEU A HD22 1 
ATOM 1314 H HD23 . LEU A 1 83  ? -5.058  -0.400  -1.173  1.00 0.95 ? 83  LEU A HD23 1 
ATOM 1315 N N    . ILE A 1 84  ? -6.388  -2.845  -5.191  1.00 0.11 ? 84  ILE A N    1 
ATOM 1316 C CA   . ILE A 1 84  ? -5.293  -2.641  -6.130  1.00 0.11 ? 84  ILE A CA   1 
ATOM 1317 C C    . ILE A 1 84  ? -5.808  -2.221  -7.504  1.00 0.12 ? 84  ILE A C    1 
ATOM 1318 O O    . ILE A 1 84  ? -5.309  -1.267  -8.099  1.00 0.18 ? 84  ILE A O    1 
ATOM 1319 C CB   . ILE A 1 84  ? -4.446  -3.920  -6.276  1.00 0.12 ? 84  ILE A CB   1 
ATOM 1320 C CG1  . ILE A 1 84  ? -3.976  -4.398  -4.900  1.00 0.13 ? 84  ILE A CG1  1 
ATOM 1321 C CG2  . ILE A 1 84  ? -3.258  -3.676  -7.196  1.00 0.13 ? 84  ILE A CG2  1 
ATOM 1322 C CD1  . ILE A 1 84  ? -3.710  -5.885  -4.835  1.00 0.15 ? 84  ILE A CD1  1 
ATOM 1323 H H    . ILE A 1 84  ? -6.579  -3.751  -4.870  1.00 0.10 ? 84  ILE A H    1 
ATOM 1324 H HA   . ILE A 1 84  ? -4.661  -1.859  -5.739  1.00 0.12 ? 84  ILE A HA   1 
ATOM 1325 H HB   . ILE A 1 84  ? -5.063  -4.684  -6.722  1.00 0.13 ? 84  ILE A HB   1 
ATOM 1326 H HG12 . ILE A 1 84  ? -3.061  -3.886  -4.641  1.00 0.13 ? 84  ILE A HG12 1 
ATOM 1327 H HG13 . ILE A 1 84  ? -4.735  -4.162  -4.168  1.00 0.15 ? 84  ILE A HG13 1 
ATOM 1328 H HG21 . ILE A 1 84  ? -2.883  -4.622  -7.559  1.00 0.99 ? 84  ILE A HG21 1 
ATOM 1329 H HG22 . ILE A 1 84  ? -2.477  -3.166  -6.651  1.00 1.00 ? 84  ILE A HG22 1 
ATOM 1330 H HG23 . ILE A 1 84  ? -3.568  -3.067  -8.033  1.00 0.96 ? 84  ILE A HG23 1 
ATOM 1331 H HD11 . ILE A 1 84  ? -2.954  -6.149  -5.560  1.00 0.99 ? 84  ILE A HD11 1 
ATOM 1332 H HD12 . ILE A 1 84  ? -4.620  -6.425  -5.052  1.00 1.01 ? 84  ILE A HD12 1 
ATOM 1333 H HD13 . ILE A 1 84  ? -3.364  -6.146  -3.845  1.00 0.96 ? 84  ILE A HD13 1 
ATOM 1334 N N    . SER A 1 85  ? -6.807  -2.944  -8.001  1.00 0.17 ? 85  SER A N    1 
ATOM 1335 C CA   . SER A 1 85  ? -7.387  -2.650  -9.307  1.00 0.19 ? 85  SER A CA   1 
ATOM 1336 C C    . SER A 1 85  ? -8.047  -1.274  -9.321  1.00 0.15 ? 85  SER A C    1 
ATOM 1337 O O    . SER A 1 85  ? -8.029  -0.578  -10.336 1.00 0.14 ? 85  SER A O    1 
ATOM 1338 C CB   . SER A 1 85  ? -8.410  -3.722  -9.685  1.00 0.25 ? 85  SER A CB   1 
ATOM 1339 O OG   . SER A 1 85  ? -7.939  -4.523  -10.755 1.00 0.62 ? 85  SER A OG   1 
ATOM 1340 H H    . SER A 1 85  ? -7.159  -3.694  -7.480  1.00 0.23 ? 85  SER A H    1 
ATOM 1341 H HA   . SER A 1 85  ? -6.588  -2.658  -10.032 1.00 0.20 ? 85  SER A HA   1 
ATOM 1342 H HB2  . SER A 1 85  ? -8.595  -4.357  -8.831  1.00 0.49 ? 85  SER A HB2  1 
ATOM 1343 H HB3  . SER A 1 85  ? -9.332  -3.246  -9.986  1.00 0.49 ? 85  SER A HB3  1 
ATOM 1344 H HG   . SER A 1 85  ? -8.683  -4.954  -11.183 1.00 1.13 ? 85  SER A HG   1 
ATOM 1345 N N    . ALA A 1 86  ? -8.633  -0.891  -8.192  1.00 0.17 ? 86  ALA A N    1 
ATOM 1346 C CA   . ALA A 1 86  ? -9.304  0.400   -8.079  1.00 0.17 ? 86  ALA A CA   1 
ATOM 1347 C C    . ALA A 1 86  ? -8.306  1.534   -7.864  1.00 0.15 ? 86  ALA A C    1 
ATOM 1348 O O    . ALA A 1 86  ? -8.572  2.682   -8.223  1.00 0.18 ? 86  ALA A O    1 
ATOM 1349 C CB   . ALA A 1 86  ? -10.317 0.367   -6.946  1.00 0.22 ? 86  ALA A CB   1 
ATOM 1350 H H    . ALA A 1 86  ? -8.618  -1.490  -7.417  1.00 0.19 ? 86  ALA A H    1 
ATOM 1351 H HA   . ALA A 1 86  ? -9.839  0.577   -9.000  1.00 0.18 ? 86  ALA A HA   1 
ATOM 1352 H HB1  . ALA A 1 86  ? -9.847  0.704   -6.034  1.00 1.01 ? 86  ALA A HB1  1 
ATOM 1353 H HB2  . ALA A 1 86  ? -10.677 -0.643  -6.814  1.00 1.05 ? 86  ALA A HB2  1 
ATOM 1354 H HB3  . ALA A 1 86  ? -11.147 1.016   -7.185  1.00 1.06 ? 86  ALA A HB3  1 
ATOM 1355 N N    . PHE A 1 87  ? -7.159  1.210   -7.272  1.00 0.12 ? 87  PHE A N    1 
ATOM 1356 C CA   . PHE A 1 87  ? -6.128  2.208   -7.006  1.00 0.10 ? 87  PHE A CA   1 
ATOM 1357 C C    . PHE A 1 87  ? -5.257  2.445   -8.236  1.00 0.10 ? 87  PHE A C    1 
ATOM 1358 O O    . PHE A 1 87  ? -4.420  3.346   -8.247  1.00 0.13 ? 87  PHE A O    1 
ATOM 1359 C CB   . PHE A 1 87  ? -5.256  1.769   -5.826  1.00 0.09 ? 87  PHE A CB   1 
ATOM 1360 C CG   . PHE A 1 87  ? -5.793  2.180   -4.479  1.00 0.10 ? 87  PHE A CG   1 
ATOM 1361 C CD1  . PHE A 1 87  ? -7.156  2.335   -4.271  1.00 0.14 ? 87  PHE A CD1  1 
ATOM 1362 C CD2  . PHE A 1 87  ? -4.929  2.406   -3.420  1.00 0.15 ? 87  PHE A CD2  1 
ATOM 1363 C CE1  . PHE A 1 87  ? -7.644  2.708   -3.032  1.00 0.17 ? 87  PHE A CE1  1 
ATOM 1364 C CE2  . PHE A 1 87  ? -5.412  2.779   -2.179  1.00 0.20 ? 87  PHE A CE2  1 
ATOM 1365 C CZ   . PHE A 1 87  ? -6.771  2.930   -1.986  1.00 0.18 ? 87  PHE A CZ   1 
ATOM 1366 H H    . PHE A 1 87  ? -7.006  0.280   -7.004  1.00 0.13 ? 87  PHE A H    1 
ATOM 1367 H HA   . PHE A 1 87  ? -6.623  3.133   -6.749  1.00 0.12 ? 87  PHE A HA   1 
ATOM 1368 H HB2  . PHE A 1 87  ? -5.171  0.693   -5.832  1.00 0.11 ? 87  PHE A HB2  1 
ATOM 1369 H HB3  . PHE A 1 87  ? -4.272  2.202   -5.937  1.00 0.09 ? 87  PHE A HB3  1 
ATOM 1370 H HD1  . PHE A 1 87  ? -7.839  2.162   -5.088  1.00 0.18 ? 87  PHE A HD1  1 
ATOM 1371 H HD2  . PHE A 1 87  ? -3.865  2.288   -3.568  1.00 0.20 ? 87  PHE A HD2  1 
ATOM 1372 H HE1  . PHE A 1 87  ? -8.708  2.825   -2.885  1.00 0.21 ? 87  PHE A HE1  1 
ATOM 1373 H HE2  . PHE A 1 87  ? -4.727  2.952   -1.362  1.00 0.27 ? 87  PHE A HE2  1 
ATOM 1374 H HZ   . PHE A 1 87  ? -7.150  3.222   -1.018  1.00 0.23 ? 87  PHE A HZ   1 
ATOM 1375 N N    . GLN A 1 88  ? -5.459  1.632   -9.269  1.00 0.10 ? 88  GLN A N    1 
ATOM 1376 C CA   . GLN A 1 88  ? -4.688  1.759   -10.502 1.00 0.11 ? 88  GLN A CA   1 
ATOM 1377 C C    . GLN A 1 88  ? -5.209  2.906   -11.365 1.00 0.13 ? 88  GLN A C    1 
ATOM 1378 O O    . GLN A 1 88  ? -4.940  2.962   -12.565 1.00 0.20 ? 88  GLN A O    1 
ATOM 1379 C CB   . GLN A 1 88  ? -4.737  0.455   -11.296 1.00 0.11 ? 88  GLN A CB   1 
ATOM 1380 C CG   . GLN A 1 88  ? -3.828  -0.630  -10.747 1.00 0.14 ? 88  GLN A CG   1 
ATOM 1381 C CD   . GLN A 1 88  ? -4.164  -2.002  -11.296 1.00 0.18 ? 88  GLN A CD   1 
ATOM 1382 O OE1  . GLN A 1 88  ? -5.320  -2.293  -11.603 1.00 0.25 ? 88  GLN A OE1  1 
ATOM 1383 N NE2  . GLN A 1 88  ? -3.154  -2.852  -11.429 1.00 0.19 ? 88  GLN A NE2  1 
ATOM 1384 H H    . GLN A 1 88  ? -6.140  0.930   -9.202  1.00 0.11 ? 88  GLN A H    1 
ATOM 1385 H HA   . GLN A 1 88  ? -3.663  1.965   -10.231 1.00 0.11 ? 88  GLN A HA   1 
ATOM 1386 H HB2  . GLN A 1 88  ? -5.751  0.081   -11.291 1.00 0.13 ? 88  GLN A HB2  1 
ATOM 1387 H HB3  . GLN A 1 88  ? -4.444  0.658   -12.316 1.00 0.13 ? 88  GLN A HB3  1 
ATOM 1388 H HG2  . GLN A 1 88  ? -2.807  -0.394  -11.009 1.00 0.15 ? 88  GLN A HG2  1 
ATOM 1389 H HG3  . GLN A 1 88  ? -3.926  -0.653  -9.672  1.00 0.19 ? 88  GLN A HG3  1 
ATOM 1390 H HE21 . GLN A 1 88  ? -2.257  -2.552  -11.170 1.00 0.21 ? 88  GLN A HE21 1 
ATOM 1391 H HE22 . GLN A 1 88  ? -3.346  -3.747  -11.779 1.00 0.22 ? 88  GLN A HE22 1 
ATOM 1392 N N    . LYS A 1 89  ? -5.949  3.821   -10.747 1.00 0.14 ? 89  LYS A N    1 
ATOM 1393 C CA   . LYS A 1 89  ? -6.503  4.967   -11.461 1.00 0.17 ? 89  LYS A CA   1 
ATOM 1394 C C    . LYS A 1 89  ? -5.670  6.224   -11.202 1.00 0.15 ? 89  LYS A C    1 
ATOM 1395 O O    . LYS A 1 89  ? -5.658  6.750   -10.089 1.00 0.17 ? 89  LYS A O    1 
ATOM 1396 C CB   . LYS A 1 89  ? -7.954  5.209   -11.041 1.00 0.21 ? 89  LYS A CB   1 
ATOM 1397 C CG   . LYS A 1 89  ? -8.842  3.983   -11.184 1.00 0.25 ? 89  LYS A CG   1 
ATOM 1398 C CD   . LYS A 1 89  ? -10.316 4.355   -11.137 1.00 0.39 ? 89  LYS A CD   1 
ATOM 1399 C CE   . LYS A 1 89  ? -11.197 3.201   -11.585 1.00 0.54 ? 89  LYS A CE   1 
ATOM 1400 N NZ   . LYS A 1 89  ? -12.589 3.643   -11.878 1.00 1.49 ? 89  LYS A NZ   1 
ATOM 1401 H H    . LYS A 1 89  ? -6.127  3.724   -9.789  1.00 0.18 ? 89  LYS A H    1 
ATOM 1402 H HA   . LYS A 1 89  ? -6.476  4.742   -12.517 1.00 0.20 ? 89  LYS A HA   1 
ATOM 1403 H HB2  . LYS A 1 89  ? -7.972  5.521   -10.007 1.00 0.22 ? 89  LYS A HB2  1 
ATOM 1404 H HB3  . LYS A 1 89  ? -8.366  5.998   -11.653 1.00 0.28 ? 89  LYS A HB3  1 
ATOM 1405 H HG2  . LYS A 1 89  ? -8.631  3.505   -12.130 1.00 0.39 ? 89  LYS A HG2  1 
ATOM 1406 H HG3  . LYS A 1 89  ? -8.627  3.298   -10.376 1.00 0.43 ? 89  LYS A HG3  1 
ATOM 1407 H HD2  . LYS A 1 89  ? -10.578 4.622   -10.125 1.00 0.71 ? 89  LYS A HD2  1 
ATOM 1408 H HD3  . LYS A 1 89  ? -10.484 5.200   -11.790 1.00 0.79 ? 89  LYS A HD3  1 
ATOM 1409 H HE2  . LYS A 1 89  ? -10.773 2.766   -12.479 1.00 0.95 ? 89  LYS A HE2  1 
ATOM 1410 H HE3  . LYS A 1 89  ? -11.222 2.458   -10.801 1.00 0.89 ? 89  LYS A HE3  1 
ATOM 1411 H HZ1  . LYS A 1 89  ? -12.700 4.651   -11.645 1.00 2.02 ? 89  LYS A HZ1  1 
ATOM 1412 H HZ2  . LYS A 1 89  ? -13.266 3.092   -11.313 1.00 2.00 ? 89  LYS A HZ2  1 
ATOM 1413 H HZ3  . LYS A 1 89  ? -12.803 3.505   -12.887 1.00 2.01 ? 89  LYS A HZ3  1 
ATOM 1414 N N    . PRO A 1 90  ? -4.955  6.721   -12.231 1.00 0.17 ? 90  PRO A N    1 
ATOM 1415 C CA   . PRO A 1 90  ? -4.113  7.919   -12.106 1.00 0.20 ? 90  PRO A CA   1 
ATOM 1416 C C    . PRO A 1 90  ? -4.895  9.137   -11.624 1.00 0.16 ? 90  PRO A C    1 
ATOM 1417 O O    . PRO A 1 90  ? -6.001  9.403   -12.096 1.00 0.16 ? 90  PRO A O    1 
ATOM 1418 C CB   . PRO A 1 90  ? -3.600  8.150   -13.531 1.00 0.31 ? 90  PRO A CB   1 
ATOM 1419 C CG   . PRO A 1 90  ? -3.706  6.823   -14.197 1.00 0.33 ? 90  PRO A CG   1 
ATOM 1420 C CD   . PRO A 1 90  ? -4.906  6.154   -13.592 1.00 0.22 ? 90  PRO A CD   1 
ATOM 1421 H HA   . PRO A 1 90  ? -3.277  7.746   -11.445 1.00 0.24 ? 90  PRO A HA   1 
ATOM 1422 H HB2  . PRO A 1 90  ? -4.216  8.890   -14.021 1.00 0.62 ? 90  PRO A HB2  1 
ATOM 1423 H HB3  . PRO A 1 90  ? -2.576  8.493   -13.497 1.00 0.51 ? 90  PRO A HB3  1 
ATOM 1424 H HG2  . PRO A 1 90  ? -3.847  6.956   -15.261 1.00 0.78 ? 90  PRO A HG2  1 
ATOM 1425 H HG3  . PRO A 1 90  ? -2.815  6.244   -14.005 1.00 0.67 ? 90  PRO A HG3  1 
ATOM 1426 H HD2  . PRO A 1 90  ? -5.799  6.402   -14.146 1.00 0.36 ? 90  PRO A HD2  1 
ATOM 1427 H HD3  . PRO A 1 90  ? -4.765  5.084   -13.558 1.00 0.45 ? 90  PRO A HD3  1 
ATOM 1428 N N    . ASP A 1 91  ? -4.306  9.874   -10.685 1.00 0.17 ? 91  ASP A N    1 
ATOM 1429 C CA   . ASP A 1 91  ? -4.935  11.072  -10.132 1.00 0.21 ? 91  ASP A CA   1 
ATOM 1430 C C    . ASP A 1 91  ? -6.325  10.765  -9.582  1.00 0.22 ? 91  ASP A C    1 
ATOM 1431 O O    . ASP A 1 91  ? -7.165  11.656  -9.463  1.00 0.27 ? 91  ASP A O    1 
ATOM 1432 C CB   . ASP A 1 91  ? -5.027  12.166  -11.199 1.00 0.24 ? 91  ASP A CB   1 
ATOM 1433 C CG   . ASP A 1 91  ? -4.201  13.387  -10.850 1.00 0.45 ? 91  ASP A CG   1 
ATOM 1434 O OD1  . ASP A 1 91  ? -4.351  13.902  -9.721  1.00 0.83 ? 91  ASP A OD1  1 
ATOM 1435 O OD2  . ASP A 1 91  ? -3.405  13.830  -11.704 1.00 0.74 ? 91  ASP A OD2  1 
ATOM 1436 H H    . ASP A 1 91  ? -3.422  9.607   -10.356 1.00 0.19 ? 91  ASP A H    1 
ATOM 1437 H HA   . ASP A 1 91  ? -4.314  11.427  -9.323  1.00 0.25 ? 91  ASP A HA   1 
ATOM 1438 H HB2  . ASP A 1 91  ? -4.674  11.772  -12.140 1.00 0.32 ? 91  ASP A HB2  1 
ATOM 1439 H HB3  . ASP A 1 91  ? -6.058  12.468  -11.307 1.00 0.35 ? 91  ASP A HB3  1 
ATOM 1440 N N    . GLN A 1 92  ? -6.559  9.500   -9.247  1.00 0.20 ? 92  GLN A N    1 
ATOM 1441 C CA   . GLN A 1 92  ? -7.848  9.079   -8.709  1.00 0.22 ? 92  GLN A CA   1 
ATOM 1442 C C    . GLN A 1 92  ? -7.677  7.911   -7.744  1.00 0.22 ? 92  GLN A C    1 
ATOM 1443 O O    . GLN A 1 92  ? -8.623  7.172   -7.473  1.00 0.27 ? 92  GLN A O    1 
ATOM 1444 C CB   . GLN A 1 92  ? -8.794  8.684   -9.845  1.00 0.23 ? 92  GLN A CB   1 
ATOM 1445 C CG   . GLN A 1 92  ? -9.466  9.871   -10.515 1.00 0.33 ? 92  GLN A CG   1 
ATOM 1446 C CD   . GLN A 1 92  ? -10.504 9.452   -11.538 1.00 0.36 ? 92  GLN A CD   1 
ATOM 1447 O OE1  . GLN A 1 92  ? -11.707 9.554   -11.298 1.00 0.53 ? 92  GLN A OE1  1 
ATOM 1448 N NE2  . GLN A 1 92  ? -10.041 8.977   -12.689 1.00 0.40 ? 92  GLN A NE2  1 
ATOM 1449 H H    . GLN A 1 92  ? -5.850  8.834   -9.365  1.00 0.18 ? 92  GLN A H    1 
ATOM 1450 H HA   . GLN A 1 92  ? -8.272  9.914   -8.173  1.00 0.26 ? 92  GLN A HA   1 
ATOM 1451 H HB2  . GLN A 1 92  ? -8.234  8.145   -10.594 1.00 0.21 ? 92  GLN A HB2  1 
ATOM 1452 H HB3  . GLN A 1 92  ? -9.564  8.039   -9.450  1.00 0.30 ? 92  GLN A HB3  1 
ATOM 1453 H HG2  . GLN A 1 92  ? -9.951  10.469  -9.759  1.00 0.48 ? 92  GLN A HG2  1 
ATOM 1454 H HG3  . GLN A 1 92  ? -8.711  10.463  -11.012 1.00 0.42 ? 92  GLN A HG3  1 
ATOM 1455 H HE21 . GLN A 1 92  ? -9.070  8.923   -12.810 1.00 0.43 ? 92  GLN A HE21 1 
ATOM 1456 H HE22 . GLN A 1 92  ? -10.690 8.697   -13.369 1.00 0.52 ? 92  GLN A HE22 1 
ATOM 1457 N N    . GLY A 1 93  ? -6.461  7.754   -7.227  1.00 0.18 ? 93  GLY A N    1 
ATOM 1458 C CA   . GLY A 1 93  ? -6.183  6.676   -6.296  1.00 0.19 ? 93  GLY A CA   1 
ATOM 1459 C C    . GLY A 1 93  ? -5.214  7.088   -5.206  1.00 0.19 ? 93  GLY A C    1 
ATOM 1460 O O    . GLY A 1 93  ? -5.627  7.509   -4.125  1.00 0.28 ? 93  GLY A O    1 
ATOM 1461 H H    . GLY A 1 93  ? -5.748  8.376   -7.481  1.00 0.18 ? 93  GLY A H    1 
ATOM 1462 H HA2  . GLY A 1 93  ? -7.110  6.360   -5.841  1.00 0.21 ? 93  GLY A HA2  1 
ATOM 1463 H HA3  . GLY A 1 93  ? -5.761  5.846   -6.842  1.00 0.18 ? 93  GLY A HA3  1 
ATOM 1464 N N    . ILE A 1 94  ? -3.922  6.964   -5.490  1.00 0.10 ? 94  ILE A N    1 
ATOM 1465 C CA   . ILE A 1 94  ? -2.885  7.323   -4.526  1.00 0.09 ? 94  ILE A CA   1 
ATOM 1466 C C    . ILE A 1 94  ? -1.799  8.168   -5.187  1.00 0.09 ? 94  ILE A C    1 
ATOM 1467 O O    . ILE A 1 94  ? -1.987  8.670   -6.295  1.00 0.09 ? 94  ILE A O    1 
ATOM 1468 C CB   . ILE A 1 94  ? -2.242  6.066   -3.904  1.00 0.10 ? 94  ILE A CB   1 
ATOM 1469 C CG1  . ILE A 1 94  ? -2.472  4.849   -4.805  1.00 0.19 ? 94  ILE A CG1  1 
ATOM 1470 C CG2  . ILE A 1 94  ? -2.806  5.816   -2.514  1.00 0.19 ? 94  ILE A CG2  1 
ATOM 1471 C CD1  . ILE A 1 94  ? -1.553  3.686   -4.505  1.00 0.16 ? 94  ILE A CD1  1 
ATOM 1472 H H    . ILE A 1 94  ? -3.657  6.619   -6.371  1.00 0.09 ? 94  ILE A H    1 
ATOM 1473 H HA   . ILE A 1 94  ? -3.346  7.898   -3.736  1.00 0.11 ? 94  ILE A HA   1 
ATOM 1474 H HB   . ILE A 1 94  ? -1.180  6.239   -3.809  1.00 0.12 ? 94  ILE A HB   1 
ATOM 1475 H HG12 . ILE A 1 94  ? -3.489  4.506   -4.683  1.00 0.32 ? 94  ILE A HG12 1 
ATOM 1476 H HG13 . ILE A 1 94  ? -2.318  5.138   -5.834  1.00 0.32 ? 94  ILE A HG13 1 
ATOM 1477 H HG21 . ILE A 1 94  ? -2.556  6.645   -1.868  1.00 0.97 ? 94  ILE A HG21 1 
ATOM 1478 H HG22 . ILE A 1 94  ? -2.384  4.907   -2.112  1.00 0.94 ? 94  ILE A HG22 1 
ATOM 1479 H HG23 . ILE A 1 94  ? -3.881  5.718   -2.574  1.00 1.05 ? 94  ILE A HG23 1 
ATOM 1480 H HD11 . ILE A 1 94  ? -2.085  2.759   -4.657  1.00 1.03 ? 94  ILE A HD11 1 
ATOM 1481 H HD12 . ILE A 1 94  ? -1.220  3.745   -3.480  1.00 1.04 ? 94  ILE A HD12 1 
ATOM 1482 H HD13 . ILE A 1 94  ? -0.699  3.724   -5.164  1.00 1.00 ? 94  ILE A HD13 1 
ATOM 1483 N N    . VAL A 1 95  ? -0.659  8.316   -4.510  1.00 0.09 ? 95  VAL A N    1 
ATOM 1484 C CA   . VAL A 1 95  ? 0.452   9.094   -5.053  1.00 0.10 ? 95  VAL A CA   1 
ATOM 1485 C C    . VAL A 1 95  ? 0.850   8.556   -6.423  1.00 0.09 ? 95  VAL A C    1 
ATOM 1486 O O    . VAL A 1 95  ? 1.476   9.248   -7.226  1.00 0.10 ? 95  VAL A O    1 
ATOM 1487 C CB   . VAL A 1 95  ? 1.678   9.069   -4.113  1.00 0.10 ? 95  VAL A CB   1 
ATOM 1488 C CG1  . VAL A 1 95  ? 2.229   7.658   -3.978  1.00 0.08 ? 95  VAL A CG1  1 
ATOM 1489 C CG2  . VAL A 1 95  ? 2.758   10.021  -4.607  1.00 0.12 ? 95  VAL A CG2  1 
ATOM 1490 H H    . VAL A 1 95  ? -0.562  7.887   -3.634  1.00 0.10 ? 95  VAL A H    1 
ATOM 1491 H HA   . VAL A 1 95  ? 0.123   10.119  -5.159  1.00 0.11 ? 95  VAL A HA   1 
ATOM 1492 H HB   . VAL A 1 95  ? 1.360   9.399   -3.135  1.00 0.12 ? 95  VAL A HB   1 
ATOM 1493 H HG11 . VAL A 1 95  ? 3.310   7.690   -3.995  1.00 1.01 ? 95  VAL A HG11 1 
ATOM 1494 H HG12 . VAL A 1 95  ? 1.874   7.054   -4.800  1.00 1.01 ? 95  VAL A HG12 1 
ATOM 1495 H HG13 . VAL A 1 95  ? 1.897   7.228   -3.045  1.00 0.99 ? 95  VAL A HG13 1 
ATOM 1496 H HG21 . VAL A 1 95  ? 2.317   10.980  -4.833  1.00 0.99 ? 95  VAL A HG21 1 
ATOM 1497 H HG22 . VAL A 1 95  ? 3.216   9.615   -5.497  1.00 1.01 ? 95  VAL A HG22 1 
ATOM 1498 H HG23 . VAL A 1 95  ? 3.509   10.142  -3.840  1.00 1.07 ? 95  VAL A HG23 1 
ATOM 1499 N N    . ILE A 1 96  ? 0.461   7.312   -6.678  1.00 0.07 ? 96  ILE A N    1 
ATOM 1500 C CA   . ILE A 1 96  ? 0.745   6.650   -7.942  1.00 0.07 ? 96  ILE A CA   1 
ATOM 1501 C C    . ILE A 1 96  ? -0.077  5.373   -8.067  1.00 0.06 ? 96  ILE A C    1 
ATOM 1502 O O    . ILE A 1 96  ? -0.058  4.528   -7.171  1.00 0.06 ? 96  ILE A O    1 
ATOM 1503 C CB   . ILE A 1 96  ? 2.239   6.294   -8.082  1.00 0.06 ? 96  ILE A CB   1 
ATOM 1504 C CG1  . ILE A 1 96  ? 2.441   5.223   -9.162  1.00 0.07 ? 96  ILE A CG1  1 
ATOM 1505 C CG2  . ILE A 1 96  ? 2.794   5.814   -6.751  1.00 0.07 ? 96  ILE A CG2  1 
ATOM 1506 C CD1  . ILE A 1 96  ? 2.515   5.781   -10.566 1.00 0.09 ? 96  ILE A CD1  1 
ATOM 1507 H H    . ILE A 1 96  ? -0.044  6.825   -5.994  1.00 0.08 ? 96  ILE A H    1 
ATOM 1508 H HA   . ILE A 1 96  ? 0.477   7.324   -8.743  1.00 0.07 ? 96  ILE A HA   1 
ATOM 1509 H HB   . ILE A 1 96  ? 2.775   7.188   -8.366  1.00 0.07 ? 96  ILE A HB   1 
ATOM 1510 H HG12 . ILE A 1 96  ? 3.361   4.695   -8.966  1.00 0.08 ? 96  ILE A HG12 1 
ATOM 1511 H HG13 . ILE A 1 96  ? 1.616   4.526   -9.125  1.00 0.08 ? 96  ILE A HG13 1 
ATOM 1512 H HG21 . ILE A 1 96  ? 3.492   5.008   -6.921  1.00 0.96 ? 96  ILE A HG21 1 
ATOM 1513 H HG22 . ILE A 1 96  ? 1.982   5.461   -6.130  1.00 0.95 ? 96  ILE A HG22 1 
ATOM 1514 H HG23 . ILE A 1 96  ? 3.299   6.630   -6.255  1.00 0.96 ? 96  ILE A HG23 1 
ATOM 1515 H HD11 . ILE A 1 96  ? 1.923   5.168   -11.229 1.00 1.01 ? 96  ILE A HD11 1 
ATOM 1516 H HD12 . ILE A 1 96  ? 3.544   5.780   -10.898 1.00 1.00 ? 96  ILE A HD12 1 
ATOM 1517 H HD13 . ILE A 1 96  ? 2.134   6.792   -10.573 1.00 1.00 ? 96  ILE A HD13 1 
ATOM 1518 N N    . PRO A 1 97  ? -0.800  5.201   -9.183  1.00 0.06 ? 97  PRO A N    1 
ATOM 1519 C CA   . PRO A 1 97  ? -1.608  4.004   -9.404  1.00 0.06 ? 97  PRO A CA   1 
ATOM 1520 C C    . PRO A 1 97  ? -0.739  2.757   -9.504  1.00 0.06 ? 97  PRO A C    1 
ATOM 1521 O O    . PRO A 1 97  ? 0.052   2.619   -10.439 1.00 0.07 ? 97  PRO A O    1 
ATOM 1522 C CB   . PRO A 1 97  ? -2.316  4.285   -10.733 1.00 0.08 ? 97  PRO A CB   1 
ATOM 1523 C CG   . PRO A 1 97  ? -1.463  5.299   -11.414 1.00 0.08 ? 97  PRO A CG   1 
ATOM 1524 C CD   . PRO A 1 97  ? -0.878  6.141   -10.316 1.00 0.08 ? 97  PRO A CD   1 
ATOM 1525 H HA   . PRO A 1 97  ? -2.338  3.871   -8.621  1.00 0.07 ? 97  PRO A HA   1 
ATOM 1526 H HB2  . PRO A 1 97  ? -2.381  3.373   -11.306 1.00 0.08 ? 97  PRO A HB2  1 
ATOM 1527 H HB3  . PRO A 1 97  ? -3.306  4.668   -10.542 1.00 0.09 ? 97  PRO A HB3  1 
ATOM 1528 H HG2  . PRO A 1 97  ? -0.677  4.807   -11.968 1.00 0.08 ? 97  PRO A HG2  1 
ATOM 1529 H HG3  . PRO A 1 97  ? -2.065  5.905   -12.072 1.00 0.09 ? 97  PRO A HG3  1 
ATOM 1530 H HD2  . PRO A 1 97  ? 0.103   6.497   -10.593 1.00 0.09 ? 97  PRO A HD2  1 
ATOM 1531 H HD3  . PRO A 1 97  ? -1.532  6.969   -10.086 1.00 0.09 ? 97  PRO A HD3  1 
ATOM 1532 N N    . LEU A 1 98  ? -0.884  1.864   -8.523  1.00 0.05 ? 98  LEU A N    1 
ATOM 1533 C CA   . LEU A 1 98  ? -0.112  0.622   -8.473  1.00 0.05 ? 98  LEU A CA   1 
ATOM 1534 C C    . LEU A 1 98  ? 0.127   0.067   -9.871  1.00 0.06 ? 98  LEU A C    1 
ATOM 1535 O O    . LEU A 1 98  ? -0.786  0.025   -10.695 1.00 0.08 ? 98  LEU A O    1 
ATOM 1536 C CB   . LEU A 1 98  ? -0.838  -0.405  -7.603  1.00 0.06 ? 98  LEU A CB   1 
ATOM 1537 C CG   . LEU A 1 98  ? -1.382  0.152   -6.284  1.00 0.06 ? 98  LEU A CG   1 
ATOM 1538 C CD1  . LEU A 1 98  ? -2.301  -0.853  -5.612  1.00 0.09 ? 98  LEU A CD1  1 
ATOM 1539 C CD2  . LEU A 1 98  ? -0.238  0.534   -5.356  1.00 0.07 ? 98  LEU A CD2  1 
ATOM 1540 H H    . LEU A 1 98  ? -1.526  2.050   -7.807  1.00 0.06 ? 98  LEU A H    1 
ATOM 1541 H HA   . LEU A 1 98  ? 0.844   0.847   -8.023  1.00 0.05 ? 98  LEU A HA   1 
ATOM 1542 H HB2  . LEU A 1 98  ? -1.664  -0.809  -8.171  1.00 0.08 ? 98  LEU A HB2  1 
ATOM 1543 H HB3  . LEU A 1 98  ? -0.151  -1.206  -7.375  1.00 0.08 ? 98  LEU A HB3  1 
ATOM 1544 H HG   . LEU A 1 98  ? -1.958  1.043   -6.489  1.00 0.09 ? 98  LEU A HG   1 
ATOM 1545 H HD11 . LEU A 1 98  ? -1.719  -1.505  -4.977  1.00 0.97 ? 98  LEU A HD11 1 
ATOM 1546 H HD12 . LEU A 1 98  ? -2.804  -1.440  -6.365  1.00 0.98 ? 98  LEU A HD12 1 
ATOM 1547 H HD13 . LEU A 1 98  ? -3.034  -0.329  -5.017  1.00 1.00 ? 98  LEU A HD13 1 
ATOM 1548 H HD21 . LEU A 1 98  ? -0.629  1.071   -4.505  1.00 0.92 ? 98  LEU A HD21 1 
ATOM 1549 H HD22 . LEU A 1 98  ? 0.463   1.160   -5.889  1.00 0.95 ? 98  LEU A HD22 1 
ATOM 1550 H HD23 . LEU A 1 98  ? 0.263   -0.360  -5.017  1.00 0.94 ? 98  LEU A HD23 1 
ATOM 1551 N N    . GLN A 1 99  ? 1.367   -0.332  -10.146 1.00 0.07 ? 99  GLN A N    1 
ATOM 1552 C CA   . GLN A 1 99  ? 1.711   -0.851  -11.470 1.00 0.09 ? 99  GLN A CA   1 
ATOM 1553 C C    . GLN A 1 99  ? 2.626   -2.075  -11.414 1.00 0.11 ? 99  GLN A C    1 
ATOM 1554 O O    . GLN A 1 99  ? 2.378   -3.067  -12.100 1.00 0.23 ? 99  GLN A O    1 
ATOM 1555 C CB   . GLN A 1 99  ? 2.375   0.247   -12.303 1.00 0.11 ? 99  GLN A CB   1 
ATOM 1556 C CG   . GLN A 1 99  ? 1.778   0.405   -13.691 1.00 0.18 ? 99  GLN A CG   1 
ATOM 1557 C CD   . GLN A 1 99  ? 0.357   0.934   -13.659 1.00 0.26 ? 99  GLN A CD   1 
ATOM 1558 O OE1  . GLN A 1 99  ? 0.133   2.139   -13.550 1.00 0.44 ? 99  GLN A OE1  1 
ATOM 1559 N NE2  . GLN A 1 99  ? -0.613  0.032   -13.755 1.00 0.49 ? 99  GLN A NE2  1 
ATOM 1560 H H    . GLN A 1 99  ? 2.058   -0.257  -9.456  1.00 0.08 ? 99  GLN A H    1 
ATOM 1561 H HA   . GLN A 1 99  ? 0.790   -1.137  -11.955 1.00 0.11 ? 99  GLN A HA   1 
ATOM 1562 H HB2  . GLN A 1 99  ? 2.273   1.187   -11.781 1.00 0.15 ? 99  GLN A HB2  1 
ATOM 1563 H HB3  . GLN A 1 99  ? 3.425   0.015   -12.410 1.00 0.11 ? 99  GLN A HB3  1 
ATOM 1564 H HG2  . GLN A 1 99  ? 2.389   1.093   -14.255 1.00 0.27 ? 99  GLN A HG2  1 
ATOM 1565 H HG3  . GLN A 1 99  ? 1.776   -0.558  -14.180 1.00 0.25 ? 99  GLN A HG3  1 
ATOM 1566 H HE21 . GLN A 1 99  ? -0.361  -0.912  -13.840 1.00 0.64 ? 99  GLN A HE21 1 
ATOM 1567 H HE22 . GLN A 1 99  ? -1.541  0.346   -13.737 1.00 0.58 ? 99  GLN A HE22 1 
ATOM 1568 N N    . TYR A 1 100 ? 3.689   -2.005  -10.617 1.00 0.13 ? 100 TYR A N    1 
ATOM 1569 C CA   . TYR A 1 100 ? 4.627   -3.125  -10.517 1.00 0.13 ? 100 TYR A CA   1 
ATOM 1570 C C    . TYR A 1 100 ? 4.627   -3.730  -9.115  1.00 0.15 ? 100 TYR A C    1 
ATOM 1571 O O    . TYR A 1 100 ? 5.195   -3.161  -8.183  1.00 0.17 ? 100 TYR A O    1 
ATOM 1572 C CB   . TYR A 1 100 ? 6.053   -2.696  -10.904 1.00 0.10 ? 100 TYR A CB   1 
ATOM 1573 C CG   . TYR A 1 100 ? 6.676   -3.569  -11.969 1.00 0.46 ? 100 TYR A CG   1 
ATOM 1574 C CD1  . TYR A 1 100 ? 6.890   -4.926  -11.756 1.00 0.89 ? 100 TYR A CD1  1 
ATOM 1575 C CD2  . TYR A 1 100 ? 7.047   -3.030  -13.194 1.00 0.64 ? 100 TYR A CD2  1 
ATOM 1576 C CE1  . TYR A 1 100 ? 7.456   -5.719  -12.736 1.00 1.28 ? 100 TYR A CE1  1 
ATOM 1577 C CE2  . TYR A 1 100 ? 7.612   -3.817  -14.178 1.00 1.03 ? 100 TYR A CE2  1 
ATOM 1578 C CZ   . TYR A 1 100 ? 7.815   -5.161  -13.944 1.00 1.31 ? 100 TYR A CZ   1 
ATOM 1579 O OH   . TYR A 1 100 ? 8.379   -5.948  -14.922 1.00 1.73 ? 100 TYR A OH   1 
ATOM 1580 H H    . TYR A 1 100 ? 3.845   -1.190  -10.093 1.00 0.23 ? 100 TYR A H    1 
ATOM 1581 H HA   . TYR A 1 100 ? 4.301   -3.884  -11.210 1.00 0.14 ? 100 TYR A HA   1 
ATOM 1582 H HB2  . TYR A 1 100 ? 6.043   -1.687  -11.286 1.00 0.31 ? 100 TYR A HB2  1 
ATOM 1583 H HB3  . TYR A 1 100 ? 6.682   -2.738  -10.030 1.00 0.41 ? 100 TYR A HB3  1 
ATOM 1584 H HD1  . TYR A 1 100 ? 6.606   -5.359  -10.808 1.00 1.00 ? 100 TYR A HD1  1 
ATOM 1585 H HD2  . TYR A 1 100 ? 6.888   -1.977  -13.373 1.00 0.66 ? 100 TYR A HD2  1 
ATOM 1586 H HE1  . TYR A 1 100 ? 7.613   -6.772  -12.553 1.00 1.62 ? 100 TYR A HE1  1 
ATOM 1587 H HE2  . TYR A 1 100 ? 7.893   -3.378  -15.123 1.00 1.22 ? 100 TYR A HE2  1 
ATOM 1588 H HH   . TYR A 1 100 ? 9.122   -5.485  -15.318 1.00 2.19 ? 100 TYR A HH   1 
ATOM 1589 N N    . PRO A 1 101 ? 3.988   -4.906  -8.948  1.00 0.18 ? 101 PRO A N    1 
ATOM 1590 C CA   . PRO A 1 101 ? 3.918   -5.594  -7.655  1.00 0.20 ? 101 PRO A CA   1 
ATOM 1591 C C    . PRO A 1 101 ? 5.249   -6.233  -7.272  1.00 0.17 ? 101 PRO A C    1 
ATOM 1592 O O    . PRO A 1 101 ? 5.915   -6.850  -8.104  1.00 0.19 ? 101 PRO A O    1 
ATOM 1593 C CB   . PRO A 1 101 ? 2.854   -6.667  -7.887  1.00 0.24 ? 101 PRO A CB   1 
ATOM 1594 C CG   . PRO A 1 101 ? 2.926   -6.957  -9.345  1.00 0.25 ? 101 PRO A CG   1 
ATOM 1595 C CD   . PRO A 1 101 ? 3.286   -5.658  -10.010 1.00 0.22 ? 101 PRO A CD   1 
ATOM 1596 H HA   . PRO A 1 101 ? 3.599   -4.927  -6.868  1.00 0.21 ? 101 PRO A HA   1 
ATOM 1597 H HB2  . PRO A 1 101 ? 3.085   -7.543  -7.297  1.00 0.25 ? 101 PRO A HB2  1 
ATOM 1598 H HB3  . PRO A 1 101 ? 1.884   -6.284  -7.609  1.00 0.27 ? 101 PRO A HB3  1 
ATOM 1599 H HG2  . PRO A 1 101 ? 3.688   -7.699  -9.534  1.00 0.25 ? 101 PRO A HG2  1 
ATOM 1600 H HG3  . PRO A 1 101 ? 1.967   -7.306  -9.697  1.00 0.29 ? 101 PRO A HG3  1 
ATOM 1601 H HD2  . PRO A 1 101 ? 3.939   -5.833  -10.852 1.00 0.24 ? 101 PRO A HD2  1 
ATOM 1602 H HD3  . PRO A 1 101 ? 2.394   -5.135  -10.324 1.00 0.26 ? 101 PRO A HD3  1 
ATOM 1603 N N    . VAL A 1 102 ? 5.632   -6.081  -6.008  1.00 0.17 ? 102 VAL A N    1 
ATOM 1604 C CA   . VAL A 1 102 ? 6.885   -6.641  -5.515  1.00 0.17 ? 102 VAL A CA   1 
ATOM 1605 C C    . VAL A 1 102 ? 6.627   -7.786  -4.541  1.00 0.20 ? 102 VAL A C    1 
ATOM 1606 O O    . VAL A 1 102 ? 6.684   -7.607  -3.324  1.00 0.24 ? 102 VAL A O    1 
ATOM 1607 C CB   . VAL A 1 102 ? 7.742   -5.566  -4.821  1.00 0.20 ? 102 VAL A CB   1 
ATOM 1608 C CG1  . VAL A 1 102 ? 9.134   -6.099  -4.517  1.00 0.24 ? 102 VAL A CG1  1 
ATOM 1609 C CG2  . VAL A 1 102 ? 7.820   -4.312  -5.679  1.00 0.20 ? 102 VAL A CG2  1 
ATOM 1610 H H    . VAL A 1 102 ? 5.061   -5.578  -5.392  1.00 0.20 ? 102 VAL A H    1 
ATOM 1611 H HA   . VAL A 1 102 ? 7.437   -7.021  -6.364  1.00 0.16 ? 102 VAL A HA   1 
ATOM 1612 H HB   . VAL A 1 102 ? 7.269   -5.306  -3.885  1.00 0.23 ? 102 VAL A HB   1 
ATOM 1613 H HG11 . VAL A 1 102 ? 9.779   -5.280  -4.233  1.00 1.08 ? 102 VAL A HG11 1 
ATOM 1614 H HG12 . VAL A 1 102 ? 9.534   -6.584  -5.395  1.00 1.04 ? 102 VAL A HG12 1 
ATOM 1615 H HG13 . VAL A 1 102 ? 9.078   -6.811  -3.706  1.00 1.02 ? 102 VAL A HG13 1 
ATOM 1616 H HG21 . VAL A 1 102 ? 7.774   -4.587  -6.722  1.00 1.00 ? 102 VAL A HG21 1 
ATOM 1617 H HG22 . VAL A 1 102 ? 8.749   -3.798  -5.483  1.00 1.01 ? 102 VAL A HG22 1 
ATOM 1618 H HG23 . VAL A 1 102 ? 6.991   -3.662  -5.441  1.00 1.02 ? 102 VAL A HG23 1 
ATOM 1619 N N    . GLU A 1 103 ? 6.344   -8.965  -5.087  1.00 0.22 ? 103 GLU A N    1 
ATOM 1620 C CA   . GLU A 1 103 ? 6.076   -10.143 -4.269  1.00 0.25 ? 103 GLU A CA   1 
ATOM 1621 C C    . GLU A 1 103 ? 7.364   -10.908 -3.978  1.00 0.27 ? 103 GLU A C    1 
ATOM 1622 O O    . GLU A 1 103 ? 8.323   -10.839 -4.746  1.00 0.34 ? 103 GLU A O    1 
ATOM 1623 C CB   . GLU A 1 103 ? 5.073   -11.060 -4.971  1.00 0.31 ? 103 GLU A CB   1 
ATOM 1624 C CG   . GLU A 1 103 ? 5.506   -11.483 -6.365  1.00 0.49 ? 103 GLU A CG   1 
ATOM 1625 C CD   . GLU A 1 103 ? 5.054   -12.887 -6.717  1.00 0.83 ? 103 GLU A CD   1 
ATOM 1626 O OE1  . GLU A 1 103 ? 3.841   -13.164 -6.608  1.00 1.35 ? 103 GLU A OE1  1 
ATOM 1627 O OE2  . GLU A 1 103 ? 5.912   -13.708 -7.102  1.00 1.22 ? 103 GLU A OE2  1 
ATOM 1628 H H    . GLU A 1 103 ? 6.313   -9.045  -6.063  1.00 0.24 ? 103 GLU A H    1 
ATOM 1629 H HA   . GLU A 1 103 ? 5.652   -9.809  -3.335  1.00 0.27 ? 103 GLU A HA   1 
ATOM 1630 H HB2  . GLU A 1 103 ? 4.936   -11.949 -4.375  1.00 0.54 ? 103 GLU A HB2  1 
ATOM 1631 H HB3  . GLU A 1 103 ? 4.127   -10.543 -5.053  1.00 0.50 ? 103 GLU A HB3  1 
ATOM 1632 H HG2  . GLU A 1 103 ? 5.086   -10.795 -7.084  1.00 0.70 ? 103 GLU A HG2  1 
ATOM 1633 H HG3  . GLU A 1 103 ? 6.585   -11.443 -6.420  1.00 0.81 ? 103 GLU A HG3  1 
ATOM 1634 N N    . LYS A 1 104 ? 7.376   -11.638 -2.867  1.00 0.30 ? 104 LYS A N    1 
ATOM 1635 C CA   . LYS A 1 104 ? 8.546   -12.416 -2.477  1.00 0.33 ? 104 LYS A CA   1 
ATOM 1636 C C    . LYS A 1 104 ? 8.395   -13.876 -2.895  1.00 0.48 ? 104 LYS A C    1 
ATOM 1637 O O    . LYS A 1 104 ? 8.013   -14.726 -2.090  1.00 0.63 ? 104 LYS A O    1 
ATOM 1638 C CB   . LYS A 1 104 ? 8.768   -12.324 -0.966  1.00 0.43 ? 104 LYS A CB   1 
ATOM 1639 C CG   . LYS A 1 104 ? 10.093  -12.910 -0.509  1.00 0.47 ? 104 LYS A CG   1 
ATOM 1640 C CD   . LYS A 1 104 ? 9.887   -14.126 0.381   1.00 0.67 ? 104 LYS A CD   1 
ATOM 1641 C CE   . LYS A 1 104 ? 10.998  -15.147 0.195   1.00 0.86 ? 104 LYS A CE   1 
ATOM 1642 N NZ   . LYS A 1 104 ? 10.474  -16.541 0.190   1.00 1.32 ? 104 LYS A NZ   1 
ATOM 1643 H H    . LYS A 1 104 ? 6.579   -11.652 -2.296  1.00 0.37 ? 104 LYS A H    1 
ATOM 1644 H HA   . LYS A 1 104 ? 9.404   -11.997 -2.983  1.00 0.38 ? 104 LYS A HA   1 
ATOM 1645 H HB2  . LYS A 1 104 ? 8.738   -11.285 -0.671  1.00 0.52 ? 104 LYS A HB2  1 
ATOM 1646 H HB3  . LYS A 1 104 ? 7.973   -12.854 -0.464  1.00 0.55 ? 104 LYS A HB3  1 
ATOM 1647 H HG2  . LYS A 1 104 ? 10.664  -13.206 -1.377  1.00 0.41 ? 104 LYS A HG2  1 
ATOM 1648 H HG3  . LYS A 1 104 ? 10.637  -12.158 0.044   1.00 0.59 ? 104 LYS A HG3  1 
ATOM 1649 H HD2  . LYS A 1 104 ? 9.875   -13.807 1.413   1.00 0.80 ? 104 LYS A HD2  1 
ATOM 1650 H HD3  . LYS A 1 104 ? 8.943   -14.585 0.132   1.00 0.71 ? 104 LYS A HD3  1 
ATOM 1651 H HE2  . LYS A 1 104 ? 11.494  -14.954 -0.745  1.00 1.29 ? 104 LYS A HE2  1 
ATOM 1652 H HE3  . LYS A 1 104 ? 11.706  -15.040 1.004   1.00 1.44 ? 104 LYS A HE3  1 
ATOM 1653 H HZ1  . LYS A 1 104 ? 9.498   -16.557 0.547   1.00 1.77 ? 104 LYS A HZ1  1 
ATOM 1654 H HZ2  . LYS A 1 104 ? 11.064  -17.147 0.795   1.00 1.81 ? 104 LYS A HZ2  1 
ATOM 1655 H HZ3  . LYS A 1 104 ? 10.485  -16.922 -0.778  1.00 1.89 ? 104 LYS A HZ3  1 
ATOM 1656 N N    . LYS A 1 105 ? 8.698   -14.159 -4.158  1.00 0.63 ? 105 LYS A N    1 
ATOM 1657 C CA   . LYS A 1 105 ? 8.598   -15.516 -4.684  1.00 0.87 ? 105 LYS A CA   1 
ATOM 1658 C C    . LYS A 1 105 ? 9.298   -15.628 -6.036  1.00 1.07 ? 105 LYS A C    1 
ATOM 1659 O O    . LYS A 1 105 ? 10.370  -16.222 -6.143  1.00 1.29 ? 105 LYS A O    1 
ATOM 1660 C CB   . LYS A 1 105 ? 7.132   -15.931 -4.818  1.00 1.02 ? 105 LYS A CB   1 
ATOM 1661 C CG   . LYS A 1 105 ? 6.814   -17.259 -4.148  1.00 1.31 ? 105 LYS A CG   1 
ATOM 1662 C CD   . LYS A 1 105 ? 6.984   -18.424 -5.110  1.00 1.65 ? 105 LYS A CD   1 
ATOM 1663 C CE   . LYS A 1 105 ? 5.937   -19.501 -4.870  1.00 1.76 ? 105 LYS A CE   1 
ATOM 1664 N NZ   . LYS A 1 105 ? 6.466   -20.618 -4.038  1.00 2.15 ? 105 LYS A NZ   1 
ATOM 1665 H H    . LYS A 1 105 ? 8.998   -13.437 -4.750  1.00 0.65 ? 105 LYS A H    1 
ATOM 1666 H HA   . LYS A 1 105 ? 9.088   -16.177 -3.986  1.00 0.87 ? 105 LYS A HA   1 
ATOM 1667 H HB2  . LYS A 1 105 ? 6.512   -15.169 -4.370  1.00 0.94 ? 105 LYS A HB2  1 
ATOM 1668 H HB3  . LYS A 1 105 ? 6.886   -16.013 -5.866  1.00 1.13 ? 105 LYS A HB3  1 
ATOM 1669 H HG2  . LYS A 1 105 ? 7.482   -17.398 -3.311  1.00 1.58 ? 105 LYS A HG2  1 
ATOM 1670 H HG3  . LYS A 1 105 ? 5.793   -17.238 -3.797  1.00 1.55 ? 105 LYS A HG3  1 
ATOM 1671 H HD2  . LYS A 1 105 ? 6.885   -18.061 -6.122  1.00 2.10 ? 105 LYS A HD2  1 
ATOM 1672 H HD3  . LYS A 1 105 ? 7.965   -18.852 -4.973  1.00 2.14 ? 105 LYS A HD3  1 
ATOM 1673 H HE2  . LYS A 1 105 ? 5.092   -19.058 -4.365  1.00 2.05 ? 105 LYS A HE2  1 
ATOM 1674 H HE3  . LYS A 1 105 ? 5.618   -19.894 -5.824  1.00 2.26 ? 105 LYS A HE3  1 
ATOM 1675 H HZ1  . LYS A 1 105 ? 6.370   -20.388 -3.028  1.00 2.25 ? 105 LYS A HZ1  1 
ATOM 1676 H HZ2  . LYS A 1 105 ? 7.472   -20.777 -4.251  1.00 2.65 ? 105 LYS A HZ2  1 
ATOM 1677 H HZ3  . LYS A 1 105 ? 5.939   -21.492 -4.236  1.00 2.64 ? 105 LYS A HZ3  1 
ATOM 1678 N N    . SER A 1 106 ? 8.683   -15.052 -7.065  1.00 1.21 ? 106 SER A N    1 
ATOM 1679 C CA   . SER A 1 106 ? 9.249   -15.086 -8.409  1.00 1.50 ? 106 SER A CA   1 
ATOM 1680 C C    . SER A 1 106 ? 9.423   -13.675 -8.961  1.00 1.81 ? 106 SER A C    1 
ATOM 1681 O O    . SER A 1 106 ? 8.605   -12.792 -8.706  1.00 2.50 ? 106 SER A O    1 
ATOM 1682 C CB   . SER A 1 106 ? 8.355   -15.904 -9.344  1.00 2.13 ? 106 SER A CB   1 
ATOM 1683 O OG   . SER A 1 106 ? 7.009   -15.898 -8.899  1.00 2.80 ? 106 SER A OG   1 
ATOM 1684 H H    . SER A 1 106 ? 7.830   -14.591 -6.916  1.00 1.24 ? 106 SER A H    1 
ATOM 1685 H HA   . SER A 1 106 ? 10.217  -15.558 -8.348  1.00 1.91 ? 106 SER A HA   1 
ATOM 1686 H HB2  . SER A 1 106 ? 8.395   -15.482 -10.337 1.00 2.42 ? 106 SER A HB2  1 
ATOM 1687 H HB3  . SER A 1 106 ? 8.708   -16.925 -9.372  1.00 2.61 ? 106 SER A HB3  1 
ATOM 1688 H HG   . SER A 1 106 ? 6.976   -16.144 -7.973  1.00 3.07 ? 106 SER A HG   1 
ATOM 1689 N N    . SER A 1 107 ? 10.497  -13.471 -9.719  1.00 2.29 ? 107 SER A N    1 
ATOM 1690 C CA   . SER A 1 107 ? 10.780  -12.168 -10.309 1.00 3.24 ? 107 SER A CA   1 
ATOM 1691 C C    . SER A 1 107 ? 9.986   -11.966 -11.595 1.00 3.86 ? 107 SER A C    1 
ATOM 1692 O O    . SER A 1 107 ? 9.242   -10.966 -11.679 1.00 4.40 ? 107 SER A O    1 
ATOM 1693 C CB   . SER A 1 107 ? 12.277  -12.031 -10.595 1.00 4.08 ? 107 SER A CB   1 
ATOM 1694 O OG   . SER A 1 107 ? 13.047  -12.364 -9.453  1.00 4.57 ? 107 SER A OG   1 
ATOM 1695 H H    . SER A 1 107 ? 11.111  -14.216 -9.886  1.00 2.48 ? 107 SER A H    1 
ATOM 1696 H HA   . SER A 1 107 ? 10.490  -11.412 -9.597  1.00 3.49 ? 107 SER A HA   1 
ATOM 1697 H HB2  . SER A 1 107 ? 12.549  -12.695 -11.402 1.00 4.38 ? 107 SER A HB2  1 
ATOM 1698 H HB3  . SER A 1 107 ? 12.496  -11.013 -10.877 1.00 4.54 ? 107 SER A HB3  1 
ATOM 1699 H HG   . SER A 1 107 ? 13.453  -13.225 -9.580  1.00 5.07 ? 107 SER A HG   1 
ATOM 1700 N N    . ARG B 2 1   ? 16.740  12.416  5.449   1.00 4.31 ? 275 ARG B N    1 
ATOM 1701 C CA   . ARG B 2 1   ? 17.887  11.476  5.530   1.00 3.90 ? 275 ARG B CA   1 
ATOM 1702 C C    . ARG B 2 1   ? 17.677  10.443  6.633   1.00 3.13 ? 275 ARG B C    1 
ATOM 1703 O O    . ARG B 2 1   ? 17.027  10.723  7.641   1.00 3.15 ? 275 ARG B O    1 
ATOM 1704 C CB   . ARG B 2 1   ? 19.160  12.283  5.796   1.00 4.46 ? 275 ARG B CB   1 
ATOM 1705 C CG   . ARG B 2 1   ? 19.491  13.273  4.692   1.00 5.38 ? 275 ARG B CG   1 
ATOM 1706 C CD   . ARG B 2 1   ? 20.732  14.083  5.026   1.00 6.09 ? 275 ARG B CD   1 
ATOM 1707 N NE   . ARG B 2 1   ? 21.960  13.355  4.718   1.00 6.62 ? 275 ARG B NE   1 
ATOM 1708 C CZ   . ARG B 2 1   ? 22.607  13.455  3.560   1.00 7.45 ? 275 ARG B CZ   1 
ATOM 1709 N NH1  . ARG B 2 1   ? 22.146  14.251  2.604   1.00 7.86 ? 275 ARG B NH1  1 
ATOM 1710 N NH2  . ARG B 2 1   ? 23.717  12.759  3.358   1.00 8.12 ? 275 ARG B NH2  1 
ATOM 1711 H H1   . ARG B 2 1   ? 16.399  12.480  4.469   1.00 4.56 ? 275 ARG B H1   1 
ATOM 1712 H H2   . ARG B 2 1   ? 17.031  13.363  5.766   1.00 4.47 ? 275 ARG B H2   1 
ATOM 1713 H H3   . ARG B 2 1   ? 15.963  12.084  6.056   1.00 4.69 ? 275 ARG B H3   1 
ATOM 1714 H HA   . ARG B 2 1   ? 17.982  10.966  4.583   1.00 4.34 ? 275 ARG B HA   1 
ATOM 1715 H HB2  . ARG B 2 1   ? 19.038  12.832  6.719   1.00 4.62 ? 275 ARG B HB2  1 
ATOM 1716 H HB3  . ARG B 2 1   ? 19.990  11.600  5.901   1.00 4.48 ? 275 ARG B HB3  1 
ATOM 1717 H HG2  . ARG B 2 1   ? 19.664  12.730  3.775   1.00 5.67 ? 275 ARG B HG2  1 
ATOM 1718 H HG3  . ARG B 2 1   ? 18.656  13.946  4.563   1.00 5.62 ? 275 ARG B HG3  1 
ATOM 1719 H HD2  . ARG B 2 1   ? 20.715  14.999  4.453   1.00 6.25 ? 275 ARG B HD2  1 
ATOM 1720 H HD3  . ARG B 2 1   ? 20.720  14.319  6.079   1.00 6.41 ? 275 ARG B HD3  1 
ATOM 1721 H HE   . ARG B 2 1   ? 22.321  12.762  5.409   1.00 6.56 ? 275 ARG B HE   1 
ATOM 1722 H HH11 . ARG B 2 1   ? 21.308  14.776  2.751   1.00 7.57 ? 275 ARG B HH11 1 
ATOM 1723 H HH12 . ARG B 2 1   ? 22.635  14.324  1.735   1.00 8.61 ? 275 ARG B HH12 1 
ATOM 1724 H HH21 . ARG B 2 1   ? 24.068  12.158  4.077   1.00 8.05 ? 275 ARG B HH21 1 
ATOM 1725 H HH22 . ARG B 2 1   ? 24.204  12.835  2.488   1.00 8.84 ? 275 ARG B HH22 1 
ATOM 1726 N N    . LYS B 2 2   ? 18.230  9.249   6.433   1.00 3.05 ? 276 LYS B N    1 
ATOM 1727 C CA   . LYS B 2 2   ? 18.105  8.169   7.406   1.00 2.91 ? 276 LYS B CA   1 
ATOM 1728 C C    . LYS B 2 2   ? 16.639  7.851   7.685   1.00 2.03 ? 276 LYS B C    1 
ATOM 1729 O O    . LYS B 2 2   ? 16.296  7.343   8.754   1.00 2.53 ? 276 LYS B O    1 
ATOM 1730 C CB   . LYS B 2 2   ? 18.817  8.542   8.709   1.00 3.78 ? 276 LYS B CB   1 
ATOM 1731 C CG   . LYS B 2 2   ? 20.297  8.196   8.715   1.00 4.76 ? 276 LYS B CG   1 
ATOM 1732 C CD   . LYS B 2 2   ? 21.161  9.447   8.669   1.00 5.68 ? 276 LYS B CD   1 
ATOM 1733 C CE   . LYS B 2 2   ? 22.377  9.319   9.573   1.00 6.65 ? 276 LYS B CE   1 
ATOM 1734 N NZ   . LYS B 2 2   ? 22.364  10.328  10.667  1.00 7.37 ? 276 LYS B NZ   1 
ATOM 1735 H H    . LYS B 2 2   ? 18.735  9.091   5.607   1.00 3.51 ? 276 LYS B H    1 
ATOM 1736 H HA   . LYS B 2 2   ? 18.577  7.293   6.988   1.00 3.42 ? 276 LYS B HA   1 
ATOM 1737 H HB2  . LYS B 2 2   ? 18.718  9.605   8.868   1.00 4.01 ? 276 LYS B HB2  1 
ATOM 1738 H HB3  . LYS B 2 2   ? 18.344  8.019   9.526   1.00 4.03 ? 276 LYS B HB3  1 
ATOM 1739 H HG2  . LYS B 2 2   ? 20.524  7.647   9.617   1.00 4.98 ? 276 LYS B HG2  1 
ATOM 1740 H HG3  . LYS B 2 2   ? 20.518  7.583   7.854   1.00 5.00 ? 276 LYS B HG3  1 
ATOM 1741 H HD2  . LYS B 2 2   ? 21.494  9.604   7.654   1.00 5.84 ? 276 LYS B HD2  1 
ATOM 1742 H HD3  . LYS B 2 2   ? 20.571  10.291  8.991   1.00 5.83 ? 276 LYS B HD3  1 
ATOM 1743 H HE2  . LYS B 2 2   ? 22.385  8.331   10.007  1.00 6.93 ? 276 LYS B HE2  1 
ATOM 1744 H HE3  . LYS B 2 2   ? 23.267  9.458   8.977   1.00 6.85 ? 276 LYS B HE3  1 
ATOM 1745 H HZ1  . LYS B 2 2   ? 22.337  11.288  10.269  1.00 7.38 ? 276 LYS B HZ1  1 
ATOM 1746 H HZ2  . LYS B 2 2   ? 23.219  10.232  11.253  1.00 7.89 ? 276 LYS B HZ2  1 
ATOM 1747 H HZ3  . LYS B 2 2   ? 21.528  10.191  11.271  1.00 7.62 ? 276 LYS B HZ3  1 
ATOM 1748 N N    . SER B 2 3   ? 15.778  8.152   6.717   1.00 1.28 ? 277 SER B N    1 
ATOM 1749 C CA   . SER B 2 3   ? 14.349  7.898   6.855   1.00 0.57 ? 277 SER B CA   1 
ATOM 1750 C C    . SER B 2 3   ? 13.664  7.902   5.493   1.00 0.50 ? 277 SER B C    1 
ATOM 1751 O O    . SER B 2 3   ? 13.391  8.961   4.927   1.00 0.76 ? 277 SER B O    1 
ATOM 1752 C CB   . SER B 2 3   ? 13.706  8.947   7.764   1.00 1.10 ? 277 SER B CB   1 
ATOM 1753 O OG   . SER B 2 3   ? 14.176  10.248  7.455   1.00 1.86 ? 277 SER B OG   1 
ATOM 1754 H H    . SER B 2 3   ? 16.113  8.553   5.889   1.00 1.80 ? 277 SER B H    1 
ATOM 1755 H HA   . SER B 2 3   ? 14.226  6.923   7.303   1.00 1.03 ? 277 SER B HA   1 
ATOM 1756 H HB2  . SER B 2 3   ? 12.634  8.926   7.633   1.00 1.61 ? 277 SER B HB2  1 
ATOM 1757 H HB3  . SER B 2 3   ? 13.947  8.725   8.793   1.00 1.67 ? 277 SER B HB3  1 
ATOM 1758 H HG   . SER B 2 3   ? 13.649  10.899  7.923   1.00 2.11 ? 277 SER B HG   1 
ATOM 1759 N N    . LEU B 2 4   ? 13.388  6.711   4.971   1.00 0.30 ? 278 LEU B N    1 
ATOM 1760 C CA   . LEU B 2 4   ? 12.736  6.577   3.674   1.00 0.23 ? 278 LEU B CA   1 
ATOM 1761 C C    . LEU B 2 4   ? 11.286  6.131   3.839   1.00 0.20 ? 278 LEU B C    1 
ATOM 1762 O O    . LEU B 2 4   ? 10.850  5.154   3.229   1.00 0.23 ? 278 LEU B O    1 
ATOM 1763 C CB   . LEU B 2 4   ? 13.496  5.580   2.793   1.00 0.24 ? 278 LEU B CB   1 
ATOM 1764 C CG   . LEU B 2 4   ? 14.816  5.067   3.374   1.00 0.29 ? 278 LEU B CG   1 
ATOM 1765 C CD1  . LEU B 2 4   ? 15.204  3.745   2.729   1.00 0.39 ? 278 LEU B CD1  1 
ATOM 1766 C CD2  . LEU B 2 4   ? 15.919  6.098   3.185   1.00 0.34 ? 278 LEU B CD2  1 
ATOM 1767 H H    . LEU B 2 4   ? 13.631  5.903   5.471   1.00 0.41 ? 278 LEU B H    1 
ATOM 1768 H HA   . LEU B 2 4   ? 12.748  7.546   3.198   1.00 0.27 ? 278 LEU B HA   1 
ATOM 1769 H HB2  . LEU B 2 4   ? 12.854  4.731   2.611   1.00 0.37 ? 278 LEU B HB2  1 
ATOM 1770 H HB3  . LEU B 2 4   ? 13.708  6.057   1.849   1.00 0.28 ? 278 LEU B HB3  1 
ATOM 1771 H HG   . LEU B 2 4   ? 14.693  4.896   4.435   1.00 0.36 ? 278 LEU B HG   1 
ATOM 1772 H HD11 . LEU B 2 4   ? 16.273  3.609   2.802   1.00 1.15 ? 278 LEU B HD11 1 
ATOM 1773 H HD12 . LEU B 2 4   ? 14.912  3.753   1.689   1.00 1.08 ? 278 LEU B HD12 1 
ATOM 1774 H HD13 . LEU B 2 4   ? 14.702  2.935   3.236   1.00 1.05 ? 278 LEU B HD13 1 
ATOM 1775 H HD21 . LEU B 2 4   ? 15.625  6.801   2.419   1.00 1.04 ? 278 LEU B HD21 1 
ATOM 1776 H HD22 . LEU B 2 4   ? 16.830  5.601   2.886   1.00 1.09 ? 278 LEU B HD22 1 
ATOM 1777 H HD23 . LEU B 2 4   ? 16.084  6.625   4.114   1.00 1.10 ? 278 LEU B HD23 1 
ATOM 1778 N N    . THR B 2 5   ? 10.542  6.856   4.672   1.00 0.22 ? 279 THR B N    1 
ATOM 1779 C CA   . THR B 2 5   ? 9.140   6.538   4.921   1.00 0.27 ? 279 THR B CA   1 
ATOM 1780 C C    . THR B 2 5   ? 8.357   7.786   5.322   1.00 0.31 ? 279 THR B C    1 
ATOM 1781 O O    . THR B 2 5   ? 8.827   8.594   6.123   1.00 0.64 ? 279 THR B O    1 
ATOM 1782 C CB   . THR B 2 5   ? 8.992   5.478   6.027   1.00 0.32 ? 279 THR B CB   1 
ATOM 1783 O OG1  . THR B 2 5   ? 10.093  4.563   5.982   1.00 0.45 ? 279 THR B OG1  1 
ATOM 1784 C CG2  . THR B 2 5   ? 7.686   4.712   5.872   1.00 0.54 ? 279 THR B CG2  1 
ATOM 1785 H H    . THR B 2 5   ? 10.946  7.622   5.129   1.00 0.26 ? 279 THR B H    1 
ATOM 1786 H HA   . THR B 2 5   ? 8.721   6.140   4.010   1.00 0.30 ? 279 THR B HA   1 
ATOM 1787 H HB   . THR B 2 5   ? 8.986   5.977   6.986   1.00 0.38 ? 279 THR B HB   1 
ATOM 1788 H HG1  . THR B 2 5   ? 10.087  4.013   6.768   1.00 0.94 ? 279 THR B HG1  1 
ATOM 1789 H HG21 . THR B 2 5   ? 7.380   4.324   6.832   1.00 1.20 ? 279 THR B HG21 1 
ATOM 1790 H HG22 . THR B 2 5   ? 7.828   3.894   5.182   1.00 1.12 ? 279 THR B HG22 1 
ATOM 1791 H HG23 . THR B 2 5   ? 6.923   5.376   5.493   1.00 1.18 ? 279 THR B HG23 1 
ATOM 1792 N N    . ILE B 2 6   ? 7.162   7.937   4.758   1.00 0.19 ? 280 ILE B N    1 
ATOM 1793 C CA   . ILE B 2 6   ? 6.315   9.087   5.056   1.00 0.21 ? 280 ILE B CA   1 
ATOM 1794 C C    . ILE B 2 6   ? 5.128   8.689   5.927   1.00 0.33 ? 280 ILE B C    1 
ATOM 1795 O O    . ILE B 2 6   ? 4.709   9.447   6.801   1.00 0.85 ? 280 ILE B O    1 
ATOM 1796 C CB   . ILE B 2 6   ? 5.792   9.750   3.764   1.00 0.24 ? 280 ILE B CB   1 
ATOM 1797 C CG1  . ILE B 2 6   ? 6.957   10.106  2.833   1.00 0.33 ? 280 ILE B CG1  1 
ATOM 1798 C CG2  . ILE B 2 6   ? 4.970   10.989  4.096   1.00 0.31 ? 280 ILE B CG2  1 
ATOM 1799 C CD1  . ILE B 2 6   ? 7.923   11.115  3.418   1.00 0.60 ? 280 ILE B CD1  1 
ATOM 1800 H H    . ILE B 2 6   ? 6.843   7.258   4.126   1.00 0.39 ? 280 ILE B H    1 
ATOM 1801 H HA   . ILE B 2 6   ? 6.914   9.811   5.589   1.00 0.29 ? 280 ILE B HA   1 
ATOM 1802 H HB   . ILE B 2 6   ? 5.146   9.044   3.264   1.00 0.30 ? 280 ILE B HB   1 
ATOM 1803 H HG12 . ILE B 2 6   ? 7.514   9.209   2.608   1.00 0.78 ? 280 ILE B HG12 1 
ATOM 1804 H HG13 . ILE B 2 6   ? 6.561   10.517  1.915   1.00 0.78 ? 280 ILE B HG13 1 
ATOM 1805 H HG21 . ILE B 2 6   ? 5.076   11.714  3.303   1.00 1.11 ? 280 ILE B HG21 1 
ATOM 1806 H HG22 . ILE B 2 6   ? 5.319   11.414  5.024   1.00 0.93 ? 280 ILE B HG22 1 
ATOM 1807 H HG23 . ILE B 2 6   ? 3.930   10.713  4.194   1.00 1.04 ? 280 ILE B HG23 1 
ATOM 1808 H HD11 . ILE B 2 6   ? 7.423   12.065  3.537   1.00 1.30 ? 280 ILE B HD11 1 
ATOM 1809 H HD12 . ILE B 2 6   ? 8.766   11.233  2.754   1.00 1.25 ? 280 ILE B HD12 1 
ATOM 1810 H HD13 . ILE B 2 6   ? 8.268   10.767  4.380   1.00 1.25 ? 280 ILE B HD13 1 
ATOM 1811 N N    . TYR B 2 7   ? 4.591   7.497   5.679   1.00 0.27 ? 281 TYR B N    1 
ATOM 1812 C CA   . TYR B 2 7   ? 3.449   6.994   6.439   1.00 0.23 ? 281 TYR B CA   1 
ATOM 1813 C C    . TYR B 2 7   ? 2.257   7.940   6.324   1.00 0.26 ? 281 TYR B C    1 
ATOM 1814 O O    . TYR B 2 7   ? 1.409   7.999   7.216   1.00 0.47 ? 281 TYR B O    1 
ATOM 1815 C CB   . TYR B 2 7   ? 3.826   6.810   7.910   1.00 0.28 ? 281 TYR B CB   1 
ATOM 1816 C CG   . TYR B 2 7   ? 3.875   5.363   8.348   1.00 0.26 ? 281 TYR B CG   1 
ATOM 1817 C CD1  . TYR B 2 7   ? 5.043   4.622   8.232   1.00 1.14 ? 281 TYR B CD1  1 
ATOM 1818 C CD2  . TYR B 2 7   ? 2.752   4.740   8.881   1.00 1.18 ? 281 TYR B CD2  1 
ATOM 1819 C CE1  . TYR B 2 7   ? 5.093   3.301   8.633   1.00 1.16 ? 281 TYR B CE1  1 
ATOM 1820 C CE2  . TYR B 2 7   ? 2.795   3.420   9.285   1.00 1.19 ? 281 TYR B CE2  1 
ATOM 1821 C CZ   . TYR B 2 7   ? 3.966   2.704   9.159   1.00 0.34 ? 281 TYR B CZ   1 
ATOM 1822 O OH   . TYR B 2 7   ? 4.011   1.389   9.560   1.00 0.42 ? 281 TYR B OH   1 
ATOM 1823 H H    . TYR B 2 7   ? 4.971   6.941   4.968   1.00 0.66 ? 281 TYR B H    1 
ATOM 1824 H HA   . TYR B 2 7   ? 3.174   6.036   6.024   1.00 0.22 ? 281 TYR B HA   1 
ATOM 1825 H HB2  . TYR B 2 7   ? 4.802   7.239   8.081   1.00 0.35 ? 281 TYR B HB2  1 
ATOM 1826 H HB3  . TYR B 2 7   ? 3.100   7.320   8.526   1.00 0.35 ? 281 TYR B HB3  1 
ATOM 1827 H HD1  . TYR B 2 7   ? 5.924   5.091   7.820   1.00 2.01 ? 281 TYR B HD1  1 
ATOM 1828 H HD2  . TYR B 2 7   ? 1.835   5.303   8.978   1.00 2.06 ? 281 TYR B HD2  1 
ATOM 1829 H HE1  . TYR B 2 7   ? 6.011   2.741   8.534   1.00 2.03 ? 281 TYR B HE1  1 
ATOM 1830 H HE2  . TYR B 2 7   ? 1.913   2.953   9.697   1.00 2.07 ? 281 TYR B HE2  1 
ATOM 1831 H HH   . TYR B 2 7   ? 3.180   1.155   9.980   1.00 0.99 ? 281 TYR B HH   1 
ATOM 1832 N N    . ALA B 2 8   ? 2.198   8.677   5.220   1.00 0.24 ? 282 ALA B N    1 
ATOM 1833 C CA   . ALA B 2 8   ? 1.111   9.620   4.987   1.00 0.27 ? 282 ALA B CA   1 
ATOM 1834 C C    . ALA B 2 8   ? -0.192  8.892   4.675   1.00 0.32 ? 282 ALA B C    1 
ATOM 1835 O O    . ALA B 2 8   ? -0.281  7.671   4.812   1.00 0.73 ? 282 ALA B O    1 
ATOM 1836 C CB   . ALA B 2 8   ? 1.468   10.565  3.851   1.00 0.33 ? 282 ALA B CB   1 
ATOM 1837 H H    . ALA B 2 8   ? 2.903   8.585   4.546   1.00 0.36 ? 282 ALA B H    1 
ATOM 1838 H HA   . ALA B 2 8   ? 0.979   10.207  5.885   1.00 0.28 ? 282 ALA B HA   1 
ATOM 1839 H HB1  . ALA B 2 8   ? 0.600   10.724  3.228   1.00 1.00 ? 282 ALA B HB1  1 
ATOM 1840 H HB2  . ALA B 2 8   ? 2.261   10.133  3.258   1.00 1.07 ? 282 ALA B HB2  1 
ATOM 1841 H HB3  . ALA B 2 8   ? 1.797   11.510  4.258   1.00 1.09 ? 282 ALA B HB3  1 
ATOM 1842 N N    . GLN B 2 9   ? -1.198  9.650   4.252   1.00 0.26 ? 283 GLN B N    1 
ATOM 1843 C CA   . GLN B 2 9   ? -2.497  9.081   3.916   1.00 0.23 ? 283 GLN B CA   1 
ATOM 1844 C C    . GLN B 2 9   ? -2.873  9.403   2.474   1.00 0.23 ? 283 GLN B C    1 
ATOM 1845 O O    . GLN B 2 9   ? -2.166  10.139  1.786   1.00 0.30 ? 283 GLN B O    1 
ATOM 1846 C CB   . GLN B 2 9   ? -3.571  9.609   4.868   1.00 0.28 ? 283 GLN B CB   1 
ATOM 1847 C CG   . GLN B 2 9   ? -3.779  8.733   6.093   1.00 0.31 ? 283 GLN B CG   1 
ATOM 1848 C CD   . GLN B 2 9   ? -4.088  9.538   7.341   1.00 0.67 ? 283 GLN B CD   1 
ATOM 1849 O OE1  . GLN B 2 9   ? -3.182  9.973   8.054   1.00 1.14 ? 283 GLN B OE1  1 
ATOM 1850 N NE2  . GLN B 2 9   ? -5.372  9.738   7.615   1.00 1.47 ? 283 GLN B NE2  1 
ATOM 1851 H H    . GLN B 2 9   ? -1.062  10.616  4.161   1.00 0.56 ? 283 GLN B H    1 
ATOM 1852 H HA   . GLN B 2 9   ? -2.426  8.010   4.026   1.00 0.24 ? 283 GLN B HA   1 
ATOM 1853 H HB2  . GLN B 2 9   ? -3.287  10.596  5.202   1.00 0.32 ? 283 GLN B HB2  1 
ATOM 1854 H HB3  . GLN B 2 9   ? -4.507  9.675   4.336   1.00 0.38 ? 283 GLN B HB3  1 
ATOM 1855 H HG2  . GLN B 2 9   ? -4.604  8.063   5.903   1.00 0.48 ? 283 GLN B HG2  1 
ATOM 1856 H HG3  . GLN B 2 9   ? -2.881  8.158   6.265   1.00 0.43 ? 283 GLN B HG3  1 
ATOM 1857 H HE21 . GLN B 2 9   ? -6.040  9.361   7.003   1.00 2.01 ? 283 GLN B HE21 1 
ATOM 1858 H HE22 . GLN B 2 9   ? -5.600  10.254  8.415   1.00 1.72 ? 283 GLN B HE22 1 
ATOM 1859 N N    . VAL B 2 10  ? -3.993  8.846   2.023   1.00 0.20 ? 284 VAL B N    1 
ATOM 1860 C CA   . VAL B 2 10  ? -4.469  9.071   0.664   1.00 0.22 ? 284 VAL B CA   1 
ATOM 1861 C C    . VAL B 2 10  ? -5.039  10.479  0.510   1.00 0.24 ? 284 VAL B C    1 
ATOM 1862 O O    . VAL B 2 10  ? -6.030  10.831  1.149   1.00 0.34 ? 284 VAL B O    1 
ATOM 1863 C CB   . VAL B 2 10  ? -5.548  8.041   0.274   1.00 0.23 ? 284 VAL B CB   1 
ATOM 1864 C CG1  . VAL B 2 10  ? -6.001  8.251   -1.163  1.00 0.32 ? 284 VAL B CG1  1 
ATOM 1865 C CG2  . VAL B 2 10  ? -5.031  6.624   0.474   1.00 0.27 ? 284 VAL B CG2  1 
ATOM 1866 H H    . VAL B 2 10  ? -4.513  8.270   2.621   1.00 0.21 ? 284 VAL B H    1 
ATOM 1867 H HA   . VAL B 2 10  ? -3.631  8.955   -0.008  1.00 0.26 ? 284 VAL B HA   1 
ATOM 1868 H HB   . VAL B 2 10  ? -6.403  8.181   0.920   1.00 0.20 ? 284 VAL B HB   1 
ATOM 1869 H HG11 . VAL B 2 10  ? -6.720  7.489   -1.428  1.00 1.12 ? 284 VAL B HG11 1 
ATOM 1870 H HG12 . VAL B 2 10  ? -5.149  8.187   -1.822  1.00 0.98 ? 284 VAL B HG12 1 
ATOM 1871 H HG13 . VAL B 2 10  ? -6.458  9.224   -1.258  1.00 1.05 ? 284 VAL B HG13 1 
ATOM 1872 H HG21 . VAL B 2 10  ? -5.865  5.939   0.523   1.00 1.00 ? 284 VAL B HG21 1 
ATOM 1873 H HG22 . VAL B 2 10  ? -4.469  6.573   1.396   1.00 0.90 ? 284 VAL B HG22 1 
ATOM 1874 H HG23 . VAL B 2 10  ? -4.390  6.354   -0.353  1.00 0.97 ? 284 VAL B HG23 1 
ATOM 1875 N N    . GLN B 2 11  ? -4.402  11.281  -0.341  1.00 0.33 ? 285 GLN B N    1 
ATOM 1876 C CA   . GLN B 2 11  ? -4.842  12.653  -0.576  1.00 0.36 ? 285 GLN B CA   1 
ATOM 1877 C C    . GLN B 2 11  ? -5.764  12.736  -1.791  1.00 0.40 ? 285 GLN B C    1 
ATOM 1878 O O    . GLN B 2 11  ? -5.953  13.810  -2.363  1.00 0.54 ? 285 GLN B O    1 
ATOM 1879 C CB   . GLN B 2 11  ? -3.634  13.571  -0.779  1.00 0.44 ? 285 GLN B CB   1 
ATOM 1880 C CG   . GLN B 2 11  ? -2.561  13.414  0.286   1.00 0.45 ? 285 GLN B CG   1 
ATOM 1881 C CD   . GLN B 2 11  ? -1.162  13.370  -0.298  1.00 0.68 ? 285 GLN B CD   1 
ATOM 1882 O OE1  . GLN B 2 11  ? -0.973  13.534  -1.504  1.00 1.31 ? 285 GLN B OE1  1 
ATOM 1883 N NE2  . GLN B 2 11  ? -0.172  13.147  0.558   1.00 0.88 ? 285 GLN B NE2  1 
ATOM 1884 H H    . GLN B 2 11  ? -3.616  10.944  -0.818  1.00 0.45 ? 285 GLN B H    1 
ATOM 1885 H HA   . GLN B 2 11  ? -5.388  12.979  0.297   1.00 0.34 ? 285 GLN B HA   1 
ATOM 1886 H HB2  . GLN B 2 11  ? -3.191  13.355  -1.740  1.00 0.50 ? 285 GLN B HB2  1 
ATOM 1887 H HB3  . GLN B 2 11  ? -3.972  14.598  -0.771  1.00 0.49 ? 285 GLN B HB3  1 
ATOM 1888 H HG2  . GLN B 2 11  ? -2.623  14.249  0.967   1.00 0.56 ? 285 GLN B HG2  1 
ATOM 1889 H HG3  . GLN B 2 11  ? -2.739  12.496  0.826   1.00 0.45 ? 285 GLN B HG3  1 
ATOM 1890 H HE21 . GLN B 2 11  ? -0.397  13.026  1.504   1.00 1.29 ? 285 GLN B HE21 1 
ATOM 1891 H HE22 . GLN B 2 11  ? 0.743   13.112  0.208   1.00 1.00 ? 285 GLN B HE22 1 
ATOM 1892 N N    . LYS B 2 12  ? -6.334  11.600  -2.179  1.00 0.45 ? 286 LYS B N    1 
ATOM 1893 C CA   . LYS B 2 12  ? -7.235  11.552  -3.326  1.00 0.51 ? 286 LYS B CA   1 
ATOM 1894 C C    . LYS B 2 12  ? -8.519  10.804  -2.982  1.00 0.55 ? 286 LYS B C    1 
ATOM 1895 O O    . LYS B 2 12  ? -9.606  11.301  -3.343  1.00 1.18 ? 286 LYS B O    1 
ATOM 1896 C CB   . LYS B 2 12  ? -6.544  10.885  -4.517  1.00 0.57 ? 286 LYS B CB   1 
ATOM 1897 C CG   . LYS B 2 12  ? -6.295  11.829  -5.683  1.00 0.97 ? 286 LYS B CG   1 
ATOM 1898 C CD   . LYS B 2 12  ? -4.817  11.903  -6.033  1.00 1.04 ? 286 LYS B CD   1 
ATOM 1899 C CE   . LYS B 2 12  ? -4.282  13.319  -5.893  1.00 1.52 ? 286 LYS B CE   1 
ATOM 1900 N NZ   . LYS B 2 12  ? -4.818  14.222  -6.948  1.00 2.05 ? 286 LYS B NZ   1 
ATOM 1901 O OXT  . LYS B 2 12  ? -8.426  9.728   -2.357  1.00 1.30 ? 286 LYS B OXT  1 
ATOM 1902 H H    . LYS B 2 12  ? -6.146  10.776  -1.684  1.00 0.54 ? 286 LYS B H    1 
ATOM 1903 H HA   . LYS B 2 12  ? -7.485  12.569  -3.591  1.00 0.53 ? 286 LYS B HA   1 
ATOM 1904 H HB2  . LYS B 2 12  ? -5.592  10.490  -4.191  1.00 0.98 ? 286 LYS B HB2  1 
ATOM 1905 H HB3  . LYS B 2 12  ? -7.162  10.070  -4.866  1.00 0.81 ? 286 LYS B HB3  1 
ATOM 1906 H HG2  . LYS B 2 12  ? -6.841  11.474  -6.545  1.00 1.54 ? 286 LYS B HG2  1 
ATOM 1907 H HG3  . LYS B 2 12  ? -6.643  12.816  -5.415  1.00 1.54 ? 286 LYS B HG3  1 
ATOM 1908 H HD2  . LYS B 2 12  ? -4.267  11.254  -5.369  1.00 1.17 ? 286 LYS B HD2  1 
ATOM 1909 H HD3  . LYS B 2 12  ? -4.682  11.577  -7.054  1.00 1.30 ? 286 LYS B HD3  1 
ATOM 1910 H HE2  . LYS B 2 12  ? -4.566  13.704  -4.924  1.00 1.83 ? 286 LYS B HE2  1 
ATOM 1911 H HE3  . LYS B 2 12  ? -3.204  13.291  -5.966  1.00 1.89 ? 286 LYS B HE3  1 
ATOM 1912 H HZ1  . LYS B 2 12  ? -5.504  14.885  -6.538  1.00 2.47 ? 286 LYS B HZ1  1 
ATOM 1913 H HZ2  . LYS B 2 12  ? -5.291  13.665  -7.688  1.00 2.46 ? 286 LYS B HZ2  1 
ATOM 1914 H HZ3  . LYS B 2 12  ? -4.043  14.763  -7.382  1.00 2.37 ? 286 LYS B HZ3  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ASP 2   2   2   ASP ASP A . n 
A 1 3   ALA 3   3   3   ALA ALA A . n 
A 1 4   VAL 4   4   4   VAL VAL A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   HIS 8   8   8   HIS HIS A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  ILE 11  11  11  ILE ILE A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  THR 15  15  15  THR THR A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  ALA 22  22  22  ALA ALA A . n 
A 1 23  THR 23  23  23  THR THR A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  ASP 26  26  26  ASP ASP A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  TYR 29  29  29  TYR TYR A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  ARG 32  32  32  ARG ARG A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  VAL 37  37  37  VAL VAL A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  GLY 39  39  39  GLY GLY A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  TYR 41  41  41  TYR TYR A . n 
A 1 42  CYS 42  42  42  CYS CYS A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  CYS 44  44  44  CYS CYS A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  TYR 47  47  47  TYR TYR A . n 
A 1 48  HIS 48  48  48  HIS HIS A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  TYR 50  50  50  TYR TYR A . n 
A 1 51  ILE 51  51  51  ILE ILE A . n 
A 1 52  TYR 52  52  52  TYR TYR A . n 
A 1 53  THR 53  53  53  THR THR A . n 
A 1 54  TYR 54  54  54  TYR TYR A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLN 58  58  58  GLN GLN A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  GLU 60  60  60  GLU GLU A . n 
A 1 61  THR 61  61  61  THR THR A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  TRP 64  64  64  TRP TRP A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  ALA 66  66  66  ALA ALA A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  PRO 70  70  70  PRO PRO A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  HIS 73  73  73  HIS HIS A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  ARG 75  75  75  ARG ARG A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  ILE 80  80  80  ILE ILE A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  ASN 82  82  82  ASN ASN A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  GLN 88  88  88  GLN GLN A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  PRO 90  90  90  PRO PRO A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  GLN 92  92  92  GLN GLN A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  PRO 97  97  97  PRO PRO A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  GLN 99  99  99  GLN GLN A . n 
A 1 100 TYR 100 100 100 TYR TYR A . n 
A 1 101 PRO 101 101 101 PRO PRO A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 LYS 105 105 105 LYS LYS A . n 
A 1 106 SER 106 106 106 SER SER A . n 
A 1 107 SER 107 107 107 SER SER A . n 
A 1 108 ALA 108 108 ?   ?   ?   A . n 
A 1 109 ARG 109 109 ?   ?   ?   A . n 
A 1 110 SER 110 110 ?   ?   ?   A . n 
A 1 111 THR 111 111 ?   ?   ?   A . n 
A 1 112 GLN 112 112 ?   ?   ?   A . n 
A 1 113 GLY 113 113 ?   ?   ?   A . n 
A 1 114 THR 114 114 ?   ?   ?   A . n 
A 1 115 THR 115 115 ?   ?   ?   A . n 
A 1 116 GLY 116 116 ?   ?   ?   A . n 
A 1 117 ILE 117 117 ?   ?   ?   A . n 
A 1 118 ARG 118 118 ?   ?   ?   A . n 
A 1 119 GLU 119 119 ?   ?   ?   A . n 
A 1 120 ASP 120 120 ?   ?   ?   A . n 
A 1 121 PRO 121 121 ?   ?   ?   A . n 
A 1 122 ASP 122 122 ?   ?   ?   A . n 
A 1 123 VAL 123 123 ?   ?   ?   A . n 
A 1 124 CYS 124 124 ?   ?   ?   A . n 
A 1 125 LEU 125 125 ?   ?   ?   A . n 
A 1 126 LYS 126 126 ?   ?   ?   A . n 
A 1 127 ALA 127 127 ?   ?   ?   A . n 
A 1 128 PRO 128 128 ?   ?   ?   A . n 
B 2 1   ARG 1   275 275 ARG ARG B . n 
B 2 2   LYS 2   276 276 LYS LYS B . n 
B 2 3   SER 3   277 277 SER SER B . n 
B 2 4   LEU 4   278 278 LEU LEU B . n 
B 2 5   THR 5   279 279 THR THR B . n 
B 2 6   ILE 6   280 280 ILE ILE B . n 
B 2 7   TYR 7   281 281 TYR TYR B . n 
B 2 8   ALA 8   282 282 ALA ALA B . n 
B 2 9   GLN 9   283 283 GLN GLN B . n 
B 2 10  VAL 10  284 284 VAL VAL B . n 
B 2 11  GLN 11  285 285 GLN GLN B . n 
B 2 12  LYS 12  286 286 LYS LYS B . n 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-11-07 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 2   ? ? 56.25   70.77  
2 1 SER A 36  ? ? -131.94 -31.87 
3 1 PRO A 70  ? ? -63.61  91.67  
4 1 GLN A 92  ? ? -149.00 20.63  
5 1 LEU A 98  ? ? -35.48  133.81 
6 1 GLN A 99  ? ? -138.19 -47.55 
7 1 LYS A 105 ? ? -166.91 -72.70 
8 1 SER B 277 ? ? -161.70 101.38 
9 1 LEU B 278 ? ? -106.81 52.34  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 108 ? A ALA 108 
2  1 Y 1 A ARG 109 ? A ARG 109 
3  1 Y 1 A SER 110 ? A SER 110 
4  1 Y 1 A THR 111 ? A THR 111 
5  1 Y 1 A GLN 112 ? A GLN 112 
6  1 Y 1 A GLY 113 ? A GLY 113 
7  1 Y 1 A THR 114 ? A THR 114 
8  1 Y 1 A THR 115 ? A THR 115 
9  1 Y 1 A GLY 116 ? A GLY 116 
10 1 Y 1 A ILE 117 ? A ILE 117 
11 1 Y 1 A ARG 118 ? A ARG 118 
12 1 Y 1 A GLU 119 ? A GLU 119 
13 1 Y 1 A ASP 120 ? A ASP 120 
14 1 Y 1 A PRO 121 ? A PRO 121 
15 1 Y 1 A ASP 122 ? A ASP 122 
16 1 Y 1 A VAL 123 ? A VAL 123 
17 1 Y 1 A CYS 124 ? A CYS 124 
18 1 Y 1 A LEU 125 ? A LEU 125 
19 1 Y 1 A LYS 126 ? A LYS 126 
20 1 Y 1 A ALA 127 ? A ALA 127 
21 1 Y 1 A PRO 128 ? A PRO 128 
#