data_1KZK
# 
_entry.id   1KZK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KZK         
RCSB  RCSB015507   
WWPDB D_1000015507 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1hpx 
_pdbx_database_related.details        'The Inhibitor Kni-272 is a closely related compound.' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KZK 
_pdbx_database_status.recvd_initial_deposition_date   2002-02-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Reiling, K.K.' 1 
'Endres, N.F.'  2 
'Dauber, D.S.'  3 
'Craik, C.S.'   4 
'Stroud, R.M.'  5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Anisotropic Dynamics of the JE-2147-HIV Protease Complex:  
Drug Resistance and Thermodynamic Binding Mode Examined in a 1.09 A Structure
;
Biochemistry 41 4582 4594 2002 BICHAW US 0006-2960 0033 ? 11926820 10.1021/bi011781z 
1       
;Structure-Activity Relationship of Small-Sized HIV Protease Inhibitors  
Containing Allophenylnorstatine
;
J.Med.Chem.  42 1789 1802 1999 JMCMAR US 0022-2623 0151 ? ?        10.1021/jm980637h 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Reiling, K.K.' 1  
primary 'Endres, N.F.'  2  
primary 'Dauber, D.S.'  3  
primary 'Craik, C.S.'   4  
primary 'Stroud, R.M.'  5  
1       'Mimoto, T.'    6  
1       'Kato, R.'      7  
1       'Takaku, H.'    8  
1       'Nojima, S.'    9  
1       'Terashima, K.' 10 
1       'Misawa, S.'    11 
1       'Fukazawa, T.'  12 
1       'Ueno, T.'      13 
1       'Sato, H.'      14 
1       'Shintani, M.'  15 
1       'Kiso, Y.'      16 
1       'Hayashi, H.'   17 
# 
_cell.entry_id           1KZK 
_cell.length_a           51.203 
_cell.length_b           58.409 
_cell.length_c           62.858 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1KZK 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Protease 10801.763 2   3.4.23.16 'Q7K, K14R, S37N, R41K, L63P, I64V' ? ? 
2 non-polymer syn 
;(4R)-3-{(2S,3S)-2-hydroxy-3-[(3-hydroxy-2-methylbenzoyl)amino]-4-phenylbutanoyl}-5,5-dimethyl-N-(2-methylbenzyl)-1,3-thiazolidine-4-carboxamide
;
575.718   1   ?         ?                                   ? ? 
3 non-polymer syn 'CHLORIDE ION' 35.453    5   ?         ?                                   ? ? 
4 non-polymer syn 1,2-ETHANEDIOL 62.068    5   ?         ?                                   ? ? 
5 water       nat water 18.015    223 ?         ?                                   ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Retropepsin 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPT
PVNIIGRNLLTQIGCTLNF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPT
PVNIIGRNLLTQIGCTLNF
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PRO n 
1 2  GLN n 
1 3  ILE n 
1 4  THR n 
1 5  LEU n 
1 6  TRP n 
1 7  LYS n 
1 8  ARG n 
1 9  PRO n 
1 10 LEU n 
1 11 VAL n 
1 12 THR n 
1 13 ILE n 
1 14 ARG n 
1 15 ILE n 
1 16 GLY n 
1 17 GLY n 
1 18 GLN n 
1 19 LEU n 
1 20 LYS n 
1 21 GLU n 
1 22 ALA n 
1 23 LEU n 
1 24 LEU n 
1 25 ASP n 
1 26 THR n 
1 27 GLY n 
1 28 ALA n 
1 29 ASP n 
1 30 ASP n 
1 31 THR n 
1 32 VAL n 
1 33 LEU n 
1 34 GLU n 
1 35 GLU n 
1 36 MET n 
1 37 ASN n 
1 38 LEU n 
1 39 PRO n 
1 40 GLY n 
1 41 LYS n 
1 42 TRP n 
1 43 LYS n 
1 44 PRO n 
1 45 LYS n 
1 46 MET n 
1 47 ILE n 
1 48 GLY n 
1 49 GLY n 
1 50 ILE n 
1 51 GLY n 
1 52 GLY n 
1 53 PHE n 
1 54 ILE n 
1 55 LYS n 
1 56 VAL n 
1 57 ARG n 
1 58 GLN n 
1 59 TYR n 
1 60 ASP n 
1 61 GLN n 
1 62 ILE n 
1 63 PRO n 
1 64 VAL n 
1 65 GLU n 
1 66 ILE n 
1 67 CYS n 
1 68 GLY n 
1 69 HIS n 
1 70 LYS n 
1 71 ALA n 
1 72 ILE n 
1 73 GLY n 
1 74 THR n 
1 75 VAL n 
1 76 LEU n 
1 77 VAL n 
1 78 GLY n 
1 79 PRO n 
1 80 THR n 
1 81 PRO n 
1 82 VAL n 
1 83 ASN n 
1 84 ILE n 
1 85 ILE n 
1 86 GLY n 
1 87 ARG n 
1 88 ASN n 
1 89 LEU n 
1 90 LEU n 
1 91 THR n 
1 92 GLN n 
1 93 ILE n 
1 94 GLY n 
1 95 CYS n 
1 96 THR n 
1 97 LEU n 
1 98 ASN n 
1 99 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Lentivirus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Human immunodeficiency virus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     12721 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTacTac 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    POL_HV1A2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPT
PVNIIGRNLLTQIGCTLNF
;
_struct_ref.pdbx_align_begin           57 
_struct_ref.pdbx_db_accession          P03369 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1KZK A 1 ? 99 ? P03369 57 ? 155 ? 1 99 
2 1 1KZK B 1 ? 99 ? P03369 57 ? 155 ? 1 99 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1KZK LYS A 7 ? UNP P03369 GLN 63 ENGINEERED 7 1 
2 1KZK LYS B 7 ? UNP P03369 GLN 63 ENGINEERED 7 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                          'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ?                          'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                          'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                          'C4 H7 N O4'      133.103 
CL  non-polymer         . 'CHLORIDE ION' ?                          'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE ?                          'C3 H7 N O2 S'    121.158 
EDO non-polymer         . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL'          'C2 H6 O2'        62.068  
GLN 'L-peptide linking' y GLUTAMINE ?                          'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                          'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ?                          'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ?                          'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ?                          'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                          'C6 H13 N O2'     131.173 
JE2 peptide-like        . 
;(4R)-3-{(2S,3S)-2-hydroxy-3-[(3-hydroxy-2-methylbenzoyl)amino]-4-phenylbutanoyl}-5,5-dimethyl-N-(2-methylbenzyl)-1,3-thiazolidine-4-carboxamide
;
'JE-2147, AG1776, KNI-764' 'C32 H37 N3 O5 S' 575.718 
LEU 'L-peptide linking' y LEUCINE ?                          'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ?                          'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ?                          'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?                          'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ?                          'C5 H9 N O2'      115.130 
THR 'L-peptide linking' y THREONINE ?                          'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                          'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ?                          'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ?                          'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1KZK 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.18 
_exptl_crystal.density_percent_sol   43.46 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'NaAc, NaCl, EDTA, DTT, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-03-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'single crystal Si(311)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.98 
# 
_reflns.entry_id                     1KZK 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   -3 
_reflns.d_resolution_low             42.64 
_reflns.d_resolution_high            1.09 
_reflns.number_obs                   79223 
_reflns.number_all                   79223 
_reflns.percent_possible_obs         93.3 
_reflns.pdbx_Rmerge_I_obs            0.102 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.5 
_reflns.B_iso_Wilson_estimate        6.4 
_reflns.pdbx_redundancy              5.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.09 
_reflns_shell.d_res_low              1.11 
_reflns_shell.percent_possible_all   61.8 
_reflns_shell.Rmerge_I_obs           0.717 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.1 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1KZK 
_refine.ls_number_reflns_obs                     73360 
_refine.ls_number_reflns_all                     73360 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             6.00 
_refine.ls_d_res_high                            1.09 
_refine.ls_percent_reflns_obs                    93.3 
_refine.ls_R_factor_obs                          0.152 
_refine.ls_R_factor_all                          0.152 
_refine.ls_R_factor_R_work                       0.1506 
_refine.ls_R_factor_R_free                       0.1885 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 3.1 
_refine.ls_number_reflns_R_free                  2251 
_refine.ls_number_parameters                     16580 
_refine.ls_number_restraints                     21599 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               12.9 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               Free-R 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'Poly Serine PDB ENTRY 1HPX' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1KZK 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      12 
_refine_analyze.occupancy_sum_hydrogen          1506.94 
_refine_analyze.occupancy_sum_non_hydrogen      1771.55 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1508 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         66 
_refine_hist.number_atoms_solvent             223 
_refine_hist.number_atoms_total               1797 
_refine_hist.d_res_high                       1.09 
_refine_hist.d_res_low                        6.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.016  ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.035  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.0301 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.079  ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.084  ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.047  ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.006  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.075  ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      0.113  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_all 
. 1.09 1.15 . 0.27 68.91 . . . . 7942  . . 'X-RAY DIFFRACTION' . 
. 1.15 1.23 . 0.27 88.44 . . . . 10790 . . 'X-RAY DIFFRACTION' . 
. 1.23 1.33 . 0.27 98.18 . . . . 11222 . . 'X-RAY DIFFRACTION' . 
. 1.33 1.48 . 0.27 99.89 . . . . 11878 . . 'X-RAY DIFFRACTION' . 
. 1.48 1.73 . 0.27 100   . . . . 11827 . . 'X-RAY DIFFRACTION' . 
. 1.73 6    . 0.27 99.88 . . . . 19702 . . 'X-RAY DIFFRACTION' . 
# 
_pdbx_refine.entry_id                                    1KZK 
_pdbx_refine.R_factor_all_no_cutoff                      0.152 
_pdbx_refine.R_factor_obs_no_cutoff                      0.1506 
_pdbx_refine.free_R_factor_no_cutoff                     0.1885 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     3.1 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            2251 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.1232 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.1218 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.1568 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   3.0 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          1280 
_pdbx_refine.number_reflns_obs_4sig_cutoff               42827 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1KZK 
_struct.title                     'JE-2147-HIV Protease Complex' 
_struct.pdbx_descriptor           'Protease (E.C.3.4.23.16)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KZK 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            
'HIV Protease Complex, Anisotropic Displacement Parameters, Viral protein, hydrolase, HYDROLASE-HYDROLASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 4 ? 
N N N 5 ? 
O N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The Protease is active as a Dimer' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 86 ? THR A 91 ? GLY A 86 THR A 91 1 ? 6 
HELX_P HELX_P2 2 GLY B 86 ? THR B 91 ? GLY B 86 THR B 91 1 ? 6 
HELX_P HELX_P3 3 GLN B 92 ? GLY B 94 ? GLN B 92 GLY B 94 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 7 ? 
C ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
C 5 6 ? parallel      
C 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 2  ? ILE A 3  ? GLN A 2  ILE A 3  
A 2 THR B 96 ? ASN B 98 ? THR B 96 ASN B 98 
A 3 THR A 96 ? ASN A 98 ? THR A 96 ASN A 98 
A 4 GLN B 2  ? ILE B 3  ? GLN B 2  ILE B 3  
B 1 LYS A 43 ? GLY A 49 ? LYS A 43 GLY A 49 
B 2 GLY A 52 ? ILE A 66 ? GLY A 52 ILE A 66 
B 3 HIS A 69 ? VAL A 77 ? HIS A 69 VAL A 77 
B 4 VAL A 32 ? LEU A 33 ? VAL A 32 LEU A 33 
B 5 ILE A 84 ? ILE A 85 ? ILE A 84 ILE A 85 
B 6 GLN A 18 ? LEU A 24 ? GLN A 18 LEU A 24 
B 7 LEU A 10 ? ILE A 15 ? LEU A 10 ILE A 15 
C 1 LYS B 43 ? GLY B 49 ? LYS B 43 GLY B 49 
C 2 GLY B 52 ? ILE B 66 ? GLY B 52 ILE B 66 
C 3 HIS B 69 ? GLY B 78 ? HIS B 69 GLY B 78 
C 4 VAL B 32 ? GLU B 34 ? VAL B 32 GLU B 34 
C 5 ILE B 84 ? ILE B 85 ? ILE B 84 ILE B 85 
C 6 GLN B 18 ? LEU B 24 ? GLN B 18 LEU B 24 
C 7 LEU B 10 ? ILE B 15 ? LEU B 10 ILE B 15 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 3  ? N ILE A 3  O LEU B 97 ? O LEU B 97 
A 2 3 N ASN B 98 ? N ASN B 98 O THR A 96 ? O THR A 96 
A 3 4 O LEU A 97 ? O LEU A 97 N ILE B 3  ? N ILE B 3  
B 1 2 N GLY A 49 ? N GLY A 49 O GLY A 52 ? O GLY A 52 
B 2 3 N ILE A 66 ? N ILE A 66 O HIS A 69 ? O HIS A 69 
B 3 4 O LEU A 76 ? O LEU A 76 N LEU A 33 ? N LEU A 33 
B 4 5 O VAL A 32 ? O VAL A 32 N ILE A 84 ? N ILE A 84 
B 5 6 N ILE A 85 ? N ILE A 85 O LEU A 23 ? O LEU A 23 
B 6 7 N ALA A 22 ? N ALA A 22 O VAL A 11 ? O VAL A 11 
C 1 2 O GLY B 49 ? O GLY B 49 N GLY B 52 ? N GLY B 52 
C 2 3 N ILE B 66 ? N ILE B 66 O HIS B 69 ? O HIS B 69 
C 3 4 O LEU B 76 ? O LEU B 76 N LEU B 33 ? N LEU B 33 
C 4 5 O VAL B 32 ? O VAL B 32 N ILE B 84 ? N ILE B 84 
C 5 6 N ILE B 85 ? N ILE B 85 O LEU B 23 ? O LEU B 23 
C 6 7 O ALA B 22 ? O ALA B 22 N VAL B 11 ? N VAL B 11 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE JE2 A 701' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL B 901'  
AC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL A 902'  
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CL B 903'  
AC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL B 904'  
AC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL A 905'  
AC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO A 801' 
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO B 802' 
AC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO A 803' 
BC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO A 804' 
BC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE EDO A 805' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 22 LEU A 23 ? LEU A 23   . ? 1_555 ? 
2  AC1 22 ASP A 25 ? ASP A 25   . ? 1_555 ? 
3  AC1 22 GLY A 27 ? GLY A 27   . ? 1_555 ? 
4  AC1 22 ALA A 28 ? ALA A 28   . ? 1_555 ? 
5  AC1 22 ASP A 29 ? ASP A 29   . ? 1_555 ? 
6  AC1 22 ASP A 30 ? ASP A 30   . ? 1_555 ? 
7  AC1 22 ILE A 47 ? ILE A 47   . ? 1_555 ? 
8  AC1 22 GLY A 48 ? GLY A 48   . ? 1_555 ? 
9  AC1 22 GLY A 49 ? GLY A 49   . ? 1_555 ? 
10 AC1 22 ILE A 50 ? ILE A 50   . ? 1_555 ? 
11 AC1 22 PRO A 81 ? PRO A 81   . ? 1_555 ? 
12 AC1 22 HOH N .  ? HOH A 1037 . ? 1_555 ? 
13 AC1 22 HOH N .  ? HOH A 1040 . ? 1_555 ? 
14 AC1 22 ASP B 25 ? ASP B 25   . ? 1_555 ? 
15 AC1 22 GLY B 27 ? GLY B 27   . ? 1_555 ? 
16 AC1 22 ALA B 28 ? ALA B 28   . ? 1_555 ? 
17 AC1 22 ASP B 30 ? ASP B 30   . ? 1_555 ? 
18 AC1 22 ILE B 47 ? ILE B 47   . ? 1_555 ? 
19 AC1 22 GLY B 48 ? GLY B 48   . ? 1_555 ? 
20 AC1 22 GLY B 49 ? GLY B 49   . ? 1_555 ? 
21 AC1 22 ILE B 50 ? ILE B 50   . ? 1_555 ? 
22 AC1 22 VAL B 82 ? VAL B 82   . ? 1_555 ? 
23 AC2 3  HOH N .  ? HOH A 932  . ? 2_554 ? 
24 AC2 3  HOH O .  ? HOH B 938  . ? 2_554 ? 
25 AC2 3  HOH O .  ? HOH B 991  . ? 1_555 ? 
26 AC3 1  GLU A 21 ? GLU A 21   . ? 1_555 ? 
27 AC4 5  PRO A 39 ? PRO A 39   . ? 1_455 ? 
28 AC4 5  GLY A 40 ? GLY A 40   . ? 1_455 ? 
29 AC4 5  MET B 36 ? MET B 36   . ? 1_555 ? 
30 AC4 5  ASN B 37 ? ASN B 37   . ? 1_555 ? 
31 AC4 5  HOH O .  ? HOH B 954  . ? 1_555 ? 
32 AC5 2  THR B 74 ? THR B 74   . ? 1_555 ? 
33 AC5 2  ASN B 88 ? ASN B 88   . ? 1_555 ? 
34 AC6 3  THR A 74 ? THR A 74   . ? 1_555 ? 
35 AC6 3  ASN A 88 ? ASN A 88   . ? 1_555 ? 
36 AC6 3  HOH N .  ? HOH A 967  . ? 1_555 ? 
37 AC7 6  GLU A 21 ? GLU A 21   . ? 1_555 ? 
38 AC7 6  GLU A 34 ? GLU A 34   . ? 1_555 ? 
39 AC7 6  VAL A 82 ? VAL A 82   . ? 1_555 ? 
40 AC7 6  ASN A 83 ? ASN A 83   . ? 1_555 ? 
41 AC7 6  HOH N .  ? HOH A 999  . ? 1_555 ? 
42 AC7 6  LYS B 7  ? LYS B 7    . ? 3_645 ? 
43 AC8 5  GLN A 2  ? GLN A 2    . ? 2_555 ? 
44 AC8 5  HOH N .  ? HOH A 910  . ? 2_555 ? 
45 AC8 5  GLU B 35 ? GLU B 35   . ? 1_555 ? 
46 AC8 5  LYS B 55 ? LYS B 55   . ? 1_555 ? 
47 AC8 5  ARG B 57 ? ARG B 57   . ? 1_555 ? 
48 AC9 6  THR A 12 ? THR A 12   . ? 2_655 ? 
49 AC9 6  LYS A 41 ? LYS A 41   . ? 1_555 ? 
50 AC9 6  TRP A 42 ? TRP A 42   . ? 1_555 ? 
51 AC9 6  HOH N .  ? HOH A 924  . ? 2_655 ? 
52 AC9 6  HOH N .  ? HOH A 983  . ? 1_555 ? 
53 AC9 6  HOH N .  ? HOH A 1007 . ? 1_555 ? 
54 BC1 4  ARG A 14 ? ARG A 14   . ? 1_555 ? 
55 BC1 4  GLY A 16 ? GLY A 16   . ? 1_555 ? 
56 BC1 4  GLY A 17 ? GLY A 17   . ? 1_555 ? 
57 BC1 4  HOH N .  ? HOH A 977  . ? 1_555 ? 
58 BC2 10 ASN A 98 ? ASN A 98   . ? 1_555 ? 
59 BC2 10 PHE A 99 ? PHE A 99   . ? 1_555 ? 
60 BC2 10 HOH N .  ? HOH A 909  . ? 1_555 ? 
61 BC2 10 HOH N .  ? HOH A 911  . ? 1_555 ? 
62 BC2 10 PRO B 79 ? PRO B 79   . ? 2_554 ? 
63 BC2 10 GLY B 94 ? GLY B 94   . ? 1_555 ? 
64 BC2 10 THR B 96 ? THR B 96   . ? 1_555 ? 
65 BC2 10 HOH O .  ? HOH B 942  . ? 2_554 ? 
66 BC2 10 HOH O .  ? HOH B 943  . ? 2_554 ? 
67 BC2 10 HOH O .  ? HOH B 976  . ? 2_554 ? 
# 
_database_PDB_matrix.entry_id          1KZK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    1KZK 
_atom_sites.fract_transf_matrix[1][1]   0.019530 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017121 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015909 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . PRO A 1 1  ? 29.282 7.112   -2.873 1.00 17.30  ? 1    PRO A N    1 
ATOM   2    C  CA   . PRO A 1 1  ? 28.291 6.156   -3.421 1.00 18.35  ? 1    PRO A CA   1 
ATOM   3    C  C    . PRO A 1 1  ? 26.885 6.495   -2.988 1.00 17.35  ? 1    PRO A C    1 
ATOM   4    O  O    . PRO A 1 1  ? 26.653 7.310   -2.080 1.00 14.84  ? 1    PRO A O    1 
ATOM   5    C  CB   . PRO A 1 1  ? 28.746 4.856   -2.792 1.00 28.75  ? 1    PRO A CB   1 
ATOM   6    C  CG   . PRO A 1 1  ? 29.363 5.293   -1.505 1.00 28.14  ? 1    PRO A CG   1 
ATOM   7    C  CD   . PRO A 1 1  ? 30.192 6.475   -1.888 1.00 26.14  ? 1    PRO A CD   1 
ATOM   8    H  HA   . PRO A 1 1  ? 28.355 6.110   -4.418 1.00 22.02  ? 1    PRO A HA   1 
ATOM   9    H  HB2  . PRO A 1 1  ? 27.980 4.250   -2.633 1.00 34.49  ? 1    PRO A HB2  1 
ATOM   10   H  HB3  . PRO A 1 1  ? 29.408 4.395   -3.366 1.00 34.49  ? 1    PRO A HB3  1 
ATOM   11   H  HG2  . PRO A 1 1  ? 28.668 5.545   -0.846 1.00 33.77  ? 1    PRO A HG2  1 
ATOM   12   H  HG3  . PRO A 1 1  ? 29.926 4.575   -1.120 1.00 33.77  ? 1    PRO A HG3  1 
ATOM   13   H  HD2  . PRO A 1 1  ? 30.368 7.067   -1.114 1.00 31.37  ? 1    PRO A HD2  1 
ATOM   14   H  HD3  . PRO A 1 1  ? 31.050 6.205   -2.301 1.00 31.37  ? 1    PRO A HD3  1 
ATOM   15   N  N    . GLN A 1 2  ? 25.918 5.906   -3.658 1.00 17.33  ? 2    GLN A N    1 
ATOM   16   C  CA   . GLN A 1 2  ? 24.524 5.884   -3.257 1.00 16.82  ? 2    GLN A CA   1 
ATOM   17   C  C    . GLN A 1 2  ? 24.161 4.435   -3.041 1.00 16.46  ? 2    GLN A C    1 
ATOM   18   O  O    . GLN A 1 2  ? 24.108 3.733   -4.026 1.00 24.02  ? 2    GLN A O    1 
ATOM   19   C  CB   A GLN A 1 2  ? 23.655 6.463   -4.352 0.60 19.97  ? 2    GLN A CB   1 
ATOM   20   C  CB   B GLN A 1 2  ? 23.613 6.507   -4.318 0.40 24.07  ? 2    GLN A CB   1 
ATOM   21   C  CG   A GLN A 1 2  ? 22.178 6.403   -3.958 0.60 27.77  ? 2    GLN A CG   1 
ATOM   22   C  CG   B GLN A 1 2  ? 23.920 7.986   -4.559 0.40 17.15  ? 2    GLN A CG   1 
ATOM   23   C  CD   A GLN A 1 2  ? 21.493 7.430   -4.799 0.60 27.76  ? 2    GLN A CD   1 
ATOM   24   C  CD   B GLN A 1 2  ? 22.987 8.607   -5.584 0.40 17.78  ? 2    GLN A CD   1 
ATOM   25   O  OE1  A GLN A 1 2  ? 21.438 8.635   -4.549 0.60 29.25  ? 2    GLN A OE1  1 
ATOM   26   O  OE1  B GLN A 1 2  ? 23.373 8.918   -6.715 0.40 15.64  ? 2    GLN A OE1  1 
ATOM   27   N  NE2  A GLN A 1 2  ? 20.912 6.969   -5.900 0.60 28.67  ? 2    GLN A NE2  1 
ATOM   28   N  NE2  B GLN A 1 2  ? 21.716 8.740   -5.183 0.40 13.51  ? 2    GLN A NE2  1 
ATOM   29   H  H    . GLN A 1 2  ? 26.133 5.494   -4.405 1.00 20.80  ? 2    GLN A H    1 
ATOM   30   H  HA   . GLN A 1 2  ? 24.402 6.400   -2.410 1.00 20.18  ? 2    GLN A HA   1 
ATOM   31   H  HG2  A GLN A 1 2  ? 21.807 5.503   -4.135 0.60 33.33  ? 2    GLN A HG2  1 
ATOM   32   H  HG2  B GLN A 1 2  ? 23.838 8.478   -3.705 0.40 20.58  ? 2    GLN A HG2  1 
ATOM   33   H  HG3  A GLN A 1 2  ? 22.066 6.610   -2.996 0.60 33.33  ? 2    GLN A HG3  1 
ATOM   34   H  HG3  B GLN A 1 2  ? 24.854 8.077   -4.874 0.40 20.58  ? 2    GLN A HG3  1 
ATOM   35   H  HE21 A GLN A 1 2  ? 20.494 7.522   -6.442 0.60 34.40  ? 2    GLN A HE21 1 
ATOM   36   H  HE21 B GLN A 1 2  ? 21.111 9.062   -5.735 0.40 16.22  ? 2    GLN A HE21 1 
ATOM   37   H  HE22 A GLN A 1 2  ? 20.945 6.110   -6.088 0.60 34.40  ? 2    GLN A HE22 1 
ATOM   38   H  HE22 B GLN A 1 2  ? 21.486 8.505   -4.366 0.40 16.22  ? 2    GLN A HE22 1 
ATOM   39   N  N    . ILE A 1 3  ? 23.967 4.070   -1.783 1.00 18.10  ? 3    ILE A N    1 
ATOM   40   C  CA   . ILE A 1 3  ? 23.787 2.709   -1.331 1.00 18.01  ? 3    ILE A CA   1 
ATOM   41   C  C    . ILE A 1 3  ? 22.302 2.384   -1.132 1.00 22.63  ? 3    ILE A C    1 
ATOM   42   O  O    . ILE A 1 3  ? 21.650 3.039   -0.355 1.00 17.11  ? 3    ILE A O    1 
ATOM   43   C  CB   . ILE A 1 3  ? 24.666 2.427   -0.080 1.00 20.85  ? 3    ILE A CB   1 
ATOM   44   C  CG1  . ILE A 1 3  ? 26.159 2.751   -0.320 1.00 19.55  ? 3    ILE A CG1  1 
ATOM   45   C  CG2  . ILE A 1 3  ? 24.491 1.003   0.443  1.00 20.43  ? 3    ILE A CG2  1 
ATOM   46   C  CD1  . ILE A 1 3  ? 26.999 2.592   0.924  1.00 25.28  ? 3    ILE A CD1  1 
ATOM   47   H  H    . ILE A 1 3  ? 23.947 4.706   -1.175 1.00 21.73  ? 3    ILE A H    1 
ATOM   48   H  HA   . ILE A 1 3  ? 24.120 2.113   -2.061 1.00 21.61  ? 3    ILE A HA   1 
ATOM   49   H  HB   . ILE A 1 3  ? 24.349 3.042   0.642  1.00 25.02  ? 3    ILE A HB   1 
ATOM   50   H  HG12 . ILE A 1 3  ? 26.510 2.151   -1.025 1.00 23.46  ? 3    ILE A HG12 1 
ATOM   51   H  HG13 . ILE A 1 3  ? 26.239 3.682   -0.647 1.00 23.46  ? 3    ILE A HG13 1 
ATOM   52   H  HG21 . ILE A 1 3  ? 23.539 0.821   0.586  1.00 30.65  ? 3    ILE A HG21 1 
ATOM   53   H  HG22 . ILE A 1 3  ? 24.973 0.905   1.291  1.00 30.65  ? 3    ILE A HG22 1 
ATOM   54   H  HG23 . ILE A 1 3  ? 24.850 0.368   -0.211 1.00 30.65  ? 3    ILE A HG23 1 
ATOM   55   H  HD11 . ILE A 1 3  ? 27.927 2.836   0.725  1.00 37.92  ? 3    ILE A HD11 1 
ATOM   56   H  HD12 . ILE A 1 3  ? 26.964 1.660   1.226  1.00 37.92  ? 3    ILE A HD12 1 
ATOM   57   H  HD13 . ILE A 1 3  ? 26.652 3.177   1.630  1.00 37.92  ? 3    ILE A HD13 1 
ATOM   58   N  N    A THR A 1 4  ? 21.726 1.461   -1.934 0.56 25.57  ? 4    THR A N    1 
ATOM   59   N  N    B THR A 1 4  ? 21.962 1.261   -1.802 0.44 23.55  ? 4    THR A N    1 
ATOM   60   C  CA   A THR A 1 4  ? 20.273 1.145   -1.780 0.56 21.43  ? 4    THR A CA   1 
ATOM   61   C  CA   B THR A 1 4  ? 20.662 0.618   -1.718 0.44 12.89  ? 4    THR A CA   1 
ATOM   62   C  C    A THR A 1 4  ? 20.269 0.118   -0.651 0.56 19.24  ? 4    THR A C    1 
ATOM   63   C  C    B THR A 1 4  ? 20.486 -0.244  -0.477 0.44 16.89  ? 4    THR A C    1 
ATOM   64   O  O    A THR A 1 4  ? 21.422 -0.149  -0.267 0.56 23.31  ? 4    THR A O    1 
ATOM   65   O  O    B THR A 1 4  ? 21.409 -0.758  0.161  0.44 13.63  ? 4    THR A O    1 
ATOM   66   C  CB   A THR A 1 4  ? 19.622 0.687   -3.087 0.56 24.78  ? 4    THR A CB   1 
ATOM   67   C  CB   B THR A 1 4  ? 20.324 -0.263  -2.942 0.44 7.37   ? 4    THR A CB   1 
ATOM   68   O  OG1  A THR A 1 4  ? 20.531 -0.141  -3.801 0.56 26.23  ? 4    THR A OG1  1 
ATOM   69   O  OG1  B THR A 1 4  ? 21.328 -1.294  -3.095 0.44 7.83   ? 4    THR A OG1  1 
ATOM   70   C  CG2  A THR A 1 4  ? 19.368 1.806   -4.097 0.56 20.07  ? 4    THR A CG2  1 
ATOM   71   C  CG2  B THR A 1 4  ? 20.309 0.591   -4.183 0.44 10.53  ? 4    THR A CG2  1 
ATOM   72   N  N    . LEU A 1 5  ? 19.184 -0.416  -0.130 1.00 18.96  ? 5    LEU A N    1 
ATOM   73   C  CA   . LEU A 1 5  ? 18.953 -1.200  1.087  1.00 15.83  ? 5    LEU A CA   1 
ATOM   74   C  C    . LEU A 1 5  ? 18.270 -2.542  0.921  1.00 15.86  ? 5    LEU A C    1 
ATOM   75   O  O    . LEU A 1 5  ? 17.663 -3.066  1.886  1.00 12.59  ? 5    LEU A O    1 
ATOM   76   C  CB   . LEU A 1 5  ? 18.193 -0.248  2.089  1.00 12.12  ? 5    LEU A CB   1 
ATOM   77   C  CG   . LEU A 1 5  ? 18.990 1.030   2.458  1.00 10.49  ? 5    LEU A CG   1 
ATOM   78   C  CD1  . LEU A 1 5  ? 18.130 1.987   3.242  1.00 10.75  ? 5    LEU A CD1  1 
ATOM   79   C  CD2  . LEU A 1 5  ? 20.210 0.662   3.256  1.00 11.79  ? 5    LEU A CD2  1 
ATOM   80   H  H    . LEU A 1 5  ? 18.456 -0.276  -0.605 1.00 22.75  ? 5    LEU A H    1 
ATOM   81   H  HA   . LEU A 1 5  ? 19.851 -1.381  1.487  1.00 18.99  ? 5    LEU A HA   1 
ATOM   82   H  HB2  . LEU A 1 5  ? 17.330 0.019   1.684  1.00 14.54  ? 5    LEU A HB2  1 
ATOM   83   H  HB3  . LEU A 1 5  ? 17.993 -0.751  2.918  1.00 14.54  ? 5    LEU A HB3  1 
ATOM   84   H  HG   . LEU A 1 5  ? 19.283 1.480   1.615  1.00 12.59  ? 5    LEU A HG   1 
ATOM   85   H  HD11 . LEU A 1 5  ? 17.346 2.234   2.708  1.00 16.12  ? 5    LEU A HD11 1 
ATOM   86   H  HD12 . LEU A 1 5  ? 18.647 2.792   3.455  1.00 16.12  ? 5    LEU A HD12 1 
ATOM   87   H  HD13 . LEU A 1 5  ? 17.837 1.557   4.073  1.00 16.12  ? 5    LEU A HD13 1 
ATOM   88   H  HD21 . LEU A 1 5  ? 20.753 0.024   2.746  1.00 17.69  ? 5    LEU A HD21 1 
ATOM   89   H  HD22 . LEU A 1 5  ? 19.935 0.252   4.103  1.00 17.69  ? 5    LEU A HD22 1 
ATOM   90   H  HD23 . LEU A 1 5  ? 20.737 1.467   3.438  1.00 17.69  ? 5    LEU A HD23 1 
ATOM   91   N  N    . TRP A 1 6  ? 18.356 -3.223  -0.253 1.00 16.28  ? 6    TRP A N    1 
ATOM   92   C  CA   . TRP A 1 6  ? 17.778 -4.574  -0.406 1.00 14.38  ? 6    TRP A CA   1 
ATOM   93   C  C    . TRP A 1 6  ? 18.553 -5.604  0.396  1.00 15.26  ? 6    TRP A C    1 
ATOM   94   O  O    . TRP A 1 6  ? 17.904 -6.573  0.763  1.00 18.04  ? 6    TRP A O    1 
ATOM   95   C  CB   . TRP A 1 6  ? 17.828 -5.077  -1.846 1.00 18.88  ? 6    TRP A CB   1 
ATOM   96   C  CG   . TRP A 1 6  ? 17.336 -3.998  -2.736 1.00 18.50  ? 6    TRP A CG   1 
ATOM   97   C  CD1  . TRP A 1 6  ? 18.120 -3.175  -3.515 1.00 23.08  ? 6    TRP A CD1  1 
ATOM   98   C  CD2  . TRP A 1 6  ? 15.969 -3.609  -2.937 1.00 18.05  ? 6    TRP A CD2  1 
ATOM   99   N  NE1  . TRP A 1 6  ? 17.292 -2.292  -4.190 1.00 29.19  ? 6    TRP A NE1  1 
ATOM   100  C  CE2  . TRP A 1 6  ? 15.978 -2.554  -3.850 1.00 27.45  ? 6    TRP A CE2  1 
ATOM   101  C  CE3  . TRP A 1 6  ? 14.762 -4.073  -2.439 1.00 17.06  ? 6    TRP A CE3  1 
ATOM   102  C  CZ2  . TRP A 1 6  ? 14.805 -1.926  -4.284 1.00 30.87  ? 6    TRP A CZ2  1 
ATOM   103  C  CZ3  . TRP A 1 6  ? 13.596 -3.469  -2.850 1.00 23.09  ? 6    TRP A CZ3  1 
ATOM   104  C  CH2  . TRP A 1 6  ? 13.651 -2.410  -3.766 1.00 24.84  ? 6    TRP A CH2  1 
ATOM   105  H  H    . TRP A 1 6  ? 18.766 -2.850  -0.937 1.00 19.53  ? 6    TRP A H    1 
ATOM   106  H  HA   . TRP A 1 6  ? 16.827 -4.562  -0.095 1.00 17.26  ? 6    TRP A HA   1 
ATOM   107  H  HB2  . TRP A 1 6  ? 18.757 -5.319  -2.087 1.00 22.65  ? 6    TRP A HB2  1 
ATOM   108  H  HB3  . TRP A 1 6  ? 17.260 -5.882  -1.943 1.00 22.65  ? 6    TRP A HB3  1 
ATOM   109  H  HD1  . TRP A 1 6  ? 19.068 -3.207  -3.579 1.00 27.70  ? 6    TRP A HD1  1 
ATOM   110  H  HE1  . TRP A 1 6  ? 17.559 -1.664  -4.746 1.00 35.03  ? 6    TRP A HE1  1 
ATOM   111  H  HE3  . TRP A 1 6  ? 14.740 -4.797  -1.824 1.00 20.47  ? 6    TRP A HE3  1 
ATOM   112  H  HZ2  . TRP A 1 6  ? 14.817 -1.205  -4.903 1.00 37.04  ? 6    TRP A HZ2  1 
ATOM   113  H  HZ3  . TRP A 1 6  ? 12.759 -3.768  -2.515 1.00 27.70  ? 6    TRP A HZ3  1 
ATOM   114  H  HH2  . TRP A 1 6  ? 12.833 -2.009  -4.038 1.00 29.81  ? 6    TRP A HH2  1 
ATOM   115  N  N    . LYS A 1 7  ? 19.861 -5.357  0.580  1.00 18.54  ? 7    LYS A N    1 
ATOM   116  C  CA   . LYS A 1 7  ? 20.731 -6.187  1.406  1.00 21.60  ? 7    LYS A CA   1 
ATOM   117  C  C    . LYS A 1 7  ? 21.318 -5.309  2.516  1.00 17.32  ? 7    LYS A C    1 
ATOM   118  O  O    . LYS A 1 7  ? 21.266 -4.074  2.384  1.00 16.86  ? 7    LYS A O    1 
ATOM   119  C  CB   . LYS A 1 7  ? 21.894 -6.830  0.654  1.00 39.77  ? 7    LYS A CB   1 
ATOM   120  H  H    . LYS A 1 7  ? 20.212 -4.657  0.179  1.00 22.24  ? 7    LYS A H    1 
ATOM   121  H  HA   . LYS A 1 7  ? 20.181 -6.909  1.825  1.00 25.92  ? 7    LYS A HA   1 
ATOM   122  N  N    . ARG A 1 8  ? 21.888 -5.927  3.553  1.00 18.76  ? 8    ARG A N    1 
ATOM   123  C  CA   . ARG A 1 8  ? 22.597 -5.158  4.577  1.00 15.12  ? 8    ARG A CA   1 
ATOM   124  C  C    . ARG A 1 8  ? 23.679 -4.265  3.946  1.00 16.07  ? 8    ARG A C    1 
ATOM   125  O  O    . ARG A 1 8  ? 24.440 -4.746  3.084  1.00 17.23  ? 8    ARG A O    1 
ATOM   126  C  CB   . ARG A 1 8  ? 23.204 -6.097  5.623  1.00 16.86  ? 8    ARG A CB   1 
ATOM   127  C  CG   . ARG A 1 8  ? 22.229 -6.895  6.503  1.00 20.38  ? 8    ARG A CG   1 
ATOM   128  C  CD   . ARG A 1 8  ? 22.841 -7.423  7.793  0.50 28.78  ? 8    ARG A CD   1 
ATOM   129  N  NE   . ARG A 1 8  ? 21.911 -7.908  8.806  0.50 17.76  ? 8    ARG A NE   1 
ATOM   130  C  CZ   . ARG A 1 8  ? 22.119 -8.287  10.054 0.50 31.70  ? 8    ARG A CZ   1 
ATOM   131  N  NH1  . ARG A 1 8  ? 23.364 -8.237  10.509 0.50 35.22  ? 8    ARG A NH1  1 
ATOM   132  N  NH2  . ARG A 1 8  ? 21.158 -8.717  10.877 0.50 25.06  ? 8    ARG A NH2  1 
ATOM   133  H  H    . ARG A 1 8  ? 21.838 -6.803  3.621  1.00 22.52  ? 8    ARG A H    1 
ATOM   134  H  HA   . ARG A 1 8  ? 21.934 -4.567  5.037  1.00 18.14  ? 8    ARG A HA   1 
ATOM   135  H  HB2  . ARG A 1 8  ? 23.788 -6.742  5.152  1.00 20.23  ? 8    ARG A HB2  1 
ATOM   136  H  HB3  . ARG A 1 8  ? 23.782 -5.558  6.219  1.00 20.23  ? 8    ARG A HB3  1 
ATOM   137  H  HG2  . ARG A 1 8  ? 21.460 -6.316  6.731  1.00 24.45  ? 8    ARG A HG2  1 
ATOM   138  H  HG3  . ARG A 1 8  ? 21.883 -7.661  5.979  1.00 24.45  ? 8    ARG A HG3  1 
ATOM   139  N  N    . PRO A 1 9  ? 23.759 -2.979  4.306  1.00 13.50  ? 9    PRO A N    1 
ATOM   140  C  CA   . PRO A 1 9  ? 24.798 -2.094  3.765  1.00 11.80  ? 9    PRO A CA   1 
ATOM   141  C  C    . PRO A 1 9  ? 26.163 -2.251  4.400  1.00 10.17  ? 9    PRO A C    1 
ATOM   142  O  O    . PRO A 1 9  ? 26.622 -1.460  5.218  1.00 10.80  ? 9    PRO A O    1 
ATOM   143  C  CB   . PRO A 1 9  ? 24.233 -0.684  4.061  1.00 11.76  ? 9    PRO A CB   1 
ATOM   144  C  CG   . PRO A 1 9  ? 23.400 -0.869  5.277  1.00 10.66  ? 9    PRO A CG   1 
ATOM   145  C  CD   . PRO A 1 9  ? 22.745 -2.246  5.166  1.00 11.98  ? 9    PRO A CD   1 
ATOM   146  H  HA   . PRO A 1 9  ? 24.870 -2.226  2.776  1.00 14.15  ? 9    PRO A HA   1 
ATOM   147  H  HB2  . PRO A 1 9  ? 24.964 -0.039  4.230  1.00 14.11  ? 9    PRO A HB2  1 
ATOM   148  H  HB3  . PRO A 1 9  ? 23.685 -0.357  3.304  1.00 14.11  ? 9    PRO A HB3  1 
ATOM   149  H  HG2  . PRO A 1 9  ? 23.962 -0.821  6.090  1.00 12.79  ? 9    PRO A HG2  1 
ATOM   150  H  HG3  . PRO A 1 9  ? 22.708 -0.163  5.330  1.00 12.79  ? 9    PRO A HG3  1 
ATOM   151  H  HD2  . PRO A 1 9  ? 22.644 -2.673  6.053  1.00 14.37  ? 9    PRO A HD2  1 
ATOM   152  H  HD3  . PRO A 1 9  ? 21.862 -2.194  4.723  1.00 14.37  ? 9    PRO A HD3  1 
ATOM   153  N  N    . LEU A 1 10 ? 26.844 -3.334  3.994  1.00 12.68  ? 10   LEU A N    1 
ATOM   154  C  CA   . LEU A 1 10 ? 28.187 -3.682  4.429  1.00 11.19  ? 10   LEU A CA   1 
ATOM   155  C  C    . LEU A 1 10 ? 29.258 -3.093  3.513  1.00 10.50  ? 10   LEU A C    1 
ATOM   156  O  O    . LEU A 1 10 ? 29.114 -3.109  2.274  1.00 12.89  ? 10   LEU A O    1 
ATOM   157  C  CB   . LEU A 1 10 ? 28.307 -5.217  4.447  1.00 14.72  ? 10   LEU A CB   1 
ATOM   158  C  CG   . LEU A 1 10 ? 27.482 -6.012  5.442  1.00 15.86  ? 10   LEU A CG   1 
ATOM   159  C  CD1  . LEU A 1 10 ? 27.616 -7.545  5.144  1.00 28.15  ? 10   LEU A CD1  1 
ATOM   160  C  CD2  . LEU A 1 10 ? 27.819 -5.770  6.886  1.00 17.34  ? 10   LEU A CD2  1 
ATOM   161  H  H    . LEU A 1 10 ? 26.448 -3.873  3.421  1.00 15.22  ? 10   LEU A H    1 
ATOM   162  H  HA   . LEU A 1 10 ? 28.328 -3.335  5.357  1.00 13.43  ? 10   LEU A HA   1 
ATOM   163  H  HB2  . LEU A 1 10 ? 28.079 -5.545  3.541  1.00 17.66  ? 10   LEU A HB2  1 
ATOM   164  H  HB3  . LEU A 1 10 ? 29.259 -5.440  4.604  1.00 17.66  ? 10   LEU A HB3  1 
ATOM   165  H  HG   . LEU A 1 10 ? 26.523 -5.760  5.309  1.00 19.03  ? 10   LEU A HG   1 
ATOM   166  H  HD11 . LEU A 1 10 ? 27.384 -7.717  4.207  1.00 42.23  ? 10   LEU A HD11 1 
ATOM   167  H  HD12 . LEU A 1 10 ? 27.009 -8.045  5.728  1.00 42.23  ? 10   LEU A HD12 1 
ATOM   168  H  HD13 . LEU A 1 10 ? 28.539 -7.830  5.309  1.00 42.23  ? 10   LEU A HD13 1 
ATOM   169  H  HD21 . LEU A 1 10 ? 27.231 -6.311  7.454  1.00 26.00  ? 10   LEU A HD21 1 
ATOM   170  H  HD22 . LEU A 1 10 ? 27.695 -4.821  7.096  1.00 26.00  ? 10   LEU A HD22 1 
ATOM   171  H  HD23 . LEU A 1 10 ? 28.752 -6.022  7.050  1.00 26.00  ? 10   LEU A HD23 1 
ATOM   172  N  N    . VAL A 1 11 ? 30.323 -2.566  4.136  1.00 8.89   ? 11   VAL A N    1 
ATOM   173  C  CA   . VAL A 1 11 ? 31.471 -2.016  3.390  1.00 9.14   ? 11   VAL A CA   1 
ATOM   174  C  C    . VAL A 1 11 ? 32.759 -2.448  4.064  1.00 8.35   ? 11   VAL A C    1 
ATOM   175  O  O    . VAL A 1 11 ? 32.786 -2.874  5.222  1.00 9.43   ? 11   VAL A O    1 
ATOM   176  C  CB   . VAL A 1 11 ? 31.416 -0.503  3.273  1.00 9.04   ? 11   VAL A CB   1 
ATOM   177  C  CG1  . VAL A 1 11 ? 30.118 -0.037  2.559  1.00 11.59  ? 11   VAL A CG1  1 
ATOM   178  C  CG2  . VAL A 1 11 ? 31.583 0.155   4.638  1.00 9.40   ? 11   VAL A CG2  1 
ATOM   179  H  H    . VAL A 1 11 ? 30.337 -2.547  5.016  1.00 10.67  ? 11   VAL A H    1 
ATOM   180  H  HA   . VAL A 1 11 ? 31.457 -2.401  2.467  1.00 10.96  ? 11   VAL A HA   1 
ATOM   181  H  HB   . VAL A 1 11 ? 32.189 -0.218  2.706  1.00 10.84  ? 11   VAL A HB   1 
ATOM   182  H  HG11 . VAL A 1 11 ? 30.055 -0.469  1.682  1.00 17.39  ? 11   VAL A HG11 1 
ATOM   183  H  HG12 . VAL A 1 11 ? 30.140 0.936   2.443  1.00 17.39  ? 11   VAL A HG12 1 
ATOM   184  H  HG13 . VAL A 1 11 ? 29.340 -0.284  3.102  1.00 17.39  ? 11   VAL A HG13 1 
ATOM   185  H  HG21 . VAL A 1 11 ? 31.557 1.129   4.536  1.00 14.09  ? 11   VAL A HG21 1 
ATOM   186  H  HG22 . VAL A 1 11 ? 32.442 -0.111  5.026  1.00 14.09  ? 11   VAL A HG22 1 
ATOM   187  H  HG23 . VAL A 1 11 ? 30.855 -0.131  5.229  1.00 14.09  ? 11   VAL A HG23 1 
ATOM   188  N  N    . THR A 1 12 ? 33.866 -2.335  3.301  1.00 8.93   ? 12   THR A N    1 
ATOM   189  C  CA   . THR A 1 12 ? 35.196 -2.577  3.826  1.00 8.04   ? 12   THR A CA   1 
ATOM   190  C  C    . THR A 1 12 ? 35.692 -1.303  4.530  1.00 7.66   ? 12   THR A C    1 
ATOM   191  O  O    . THR A 1 12 ? 35.561 -0.185  3.979  1.00 9.44   ? 12   THR A O    1 
ATOM   192  C  CB   . THR A 1 12 ? 36.205 -3.006  2.736  1.00 8.59   ? 12   THR A CB   1 
ATOM   193  O  OG1  . THR A 1 12 ? 35.633 -4.122  1.990  1.00 10.09  ? 12   THR A OG1  1 
ATOM   194  C  CG2  . THR A 1 12 ? 37.516 -3.441  3.309  1.00 10.42  ? 12   THR A CG2  1 
ATOM   195  H  H    . THR A 1 12 ? 33.778 -2.107  2.455  1.00 10.72  ? 12   THR A H    1 
ATOM   196  H  HA   . THR A 1 12 ? 35.137 -3.309  4.505  1.00 9.65   ? 12   THR A HA   1 
ATOM   197  H  HB   . THR A 1 12 ? 36.358 -2.240  2.112  1.00 10.31  ? 12   THR A HB   1 
ATOM   198  H  HG1  . THR A 1 12 ? 34.887 -3.896  1.677  1.00 15.14  ? 12   THR A HG1  1 
ATOM   199  H  HG21 . THR A 1 12 ? 38.121 -3.698  2.583  1.00 15.63  ? 12   THR A HG21 1 
ATOM   200  H  HG22 . THR A 1 12 ? 37.375 -4.207  3.903  1.00 15.63  ? 12   THR A HG22 1 
ATOM   201  H  HG23 . THR A 1 12 ? 37.911 -2.702  3.818  1.00 15.63  ? 12   THR A HG23 1 
ATOM   202  N  N    . ILE A 1 13 ? 36.249 -1.512  5.744  1.00 7.69   ? 13   ILE A N    1 
ATOM   203  C  CA   . ILE A 1 13 ? 36.946 -0.463  6.522  1.00 7.74   ? 13   ILE A CA   1 
ATOM   204  C  C    . ILE A 1 13 ? 38.391 -0.869  6.772  1.00 8.46   ? 13   ILE A C    1 
ATOM   205  O  O    . ILE A 1 13 ? 38.768 -2.046  6.703  1.00 8.84   ? 13   ILE A O    1 
ATOM   206  C  CB   . ILE A 1 13 ? 36.225 -0.190  7.854  1.00 8.24   ? 13   ILE A CB   1 
ATOM   207  C  CG1  . ILE A 1 13 ? 36.379 -1.339  8.876  1.00 9.57   ? 13   ILE A CG1  1 
ATOM   208  C  CG2  . ILE A 1 13 ? 34.752 0.151   7.643  1.00 8.32   ? 13   ILE A CG2  1 
ATOM   209  C  CD1  . ILE A 1 13 ? 35.918 -1.016  10.302 1.00 9.09   ? 13   ILE A CD1  1 
ATOM   210  H  H    . ILE A 1 13 ? 36.194 -2.318  6.092  1.00 9.22   ? 13   ILE A H    1 
ATOM   211  H  HA   . ILE A 1 13 ? 36.945 0.381   5.985  1.00 9.29   ? 13   ILE A HA   1 
ATOM   212  H  HB   . ILE A 1 13 ? 36.656 0.617   8.258  1.00 9.88   ? 13   ILE A HB   1 
ATOM   213  H  HG12 . ILE A 1 13 ? 35.865 -2.119  8.550  1.00 11.48  ? 13   ILE A HG12 1 
ATOM   214  H  HG13 . ILE A 1 13 ? 37.333 -1.604  8.908  1.00 11.48  ? 13   ILE A HG13 1 
ATOM   215  H  HG21 . ILE A 1 13 ? 34.677 0.898   7.013  1.00 12.47  ? 13   ILE A HG21 1 
ATOM   216  H  HG22 . ILE A 1 13 ? 34.349 0.405   8.500  1.00 12.47  ? 13   ILE A HG22 1 
ATOM   217  H  HG23 . ILE A 1 13 ? 34.284 -0.630  7.280  1.00 12.47  ? 13   ILE A HG23 1 
ATOM   218  H  HD11 . ILE A 1 13 ? 36.051 -1.801  10.874 1.00 13.64  ? 13   ILE A HD11 1 
ATOM   219  H  HD12 . ILE A 1 13 ? 34.967 -0.777  10.292 1.00 13.64  ? 13   ILE A HD12 1 
ATOM   220  H  HD13 . ILE A 1 13 ? 36.440 -0.264  10.652 1.00 13.64  ? 13   ILE A HD13 1 
ATOM   221  N  N    . ARG A 1 14 ? 39.262 0.112   7.070  1.00 8.38   ? 14   ARG A N    1 
ATOM   222  C  CA   . ARG A 1 14 ? 40.613 -0.124  7.595  1.00 8.68   ? 14   ARG A CA   1 
ATOM   223  C  C    . ARG A 1 14 ? 40.706 0.581   8.974  1.00 7.83   ? 14   ARG A C    1 
ATOM   224  O  O    . ARG A 1 14 ? 40.363 1.765   9.083  1.00 8.69   ? 14   ARG A O    1 
ATOM   225  C  CB   . ARG A 1 14 ? 41.735 0.342   6.678  1.00 10.13  ? 14   ARG A CB   1 
ATOM   226  C  CG   . ARG A 1 14 ? 43.100 -0.202  7.090  1.00 13.56  ? 14   ARG A CG   1 
ATOM   227  C  CD   . ARG A 1 14 ? 44.273 0.280   6.277  1.00 14.03  ? 14   ARG A CD   1 
ATOM   228  N  NE   . ARG A 1 14 ? 44.427 -0.197  4.905  1.00 13.73  ? 14   ARG A NE   1 
ATOM   229  C  CZ   . ARG A 1 14 ? 44.967 -1.307  4.440  1.00 14.09  ? 14   ARG A CZ   1 
ATOM   230  N  NH1  . ARG A 1 14 ? 45.469 -2.285  5.191  1.00 15.10  ? 14   ARG A NH1  1 
ATOM   231  N  NH2  . ARG A 1 14 ? 45.002 -1.452  3.119  1.00 16.57  ? 14   ARG A NH2  1 
ATOM   232  H  H    . ARG A 1 14 ? 39.007 0.944   6.943  1.00 10.05  ? 14   ARG A H    1 
ATOM   233  H  HA   . ARG A 1 14 ? 40.721 -1.107  7.742  1.00 10.42  ? 14   ARG A HA   1 
ATOM   234  H  HB2  . ARG A 1 14 ? 41.537 0.050   5.753  1.00 12.16  ? 14   ARG A HB2  1 
ATOM   235  H  HB3  . ARG A 1 14 ? 41.766 1.331   6.684  1.00 12.16  ? 14   ARG A HB3  1 
ATOM   236  H  HG2  . ARG A 1 14 ? 43.258 0.040   8.037  1.00 16.27  ? 14   ARG A HG2  1 
ATOM   237  H  HG3  . ARG A 1 14 ? 43.070 -1.190  7.037  1.00 16.27  ? 14   ARG A HG3  1 
ATOM   238  H  HD2  . ARG A 1 14 ? 44.230 1.269   6.247  1.00 16.83  ? 14   ARG A HD2  1 
ATOM   239  H  HD3  . ARG A 1 14 ? 45.097 0.041   6.771  1.00 16.83  ? 14   ARG A HD3  1 
ATOM   240  H  HE   . ARG A 1 14 ? 44.106 0.343   4.289  1.00 16.47  ? 14   ARG A HE   1 
ATOM   241  H  HH11 . ARG A 1 14 ? 45.455 -2.217  6.069  1.00 18.11  ? 14   ARG A HH11 1 
ATOM   242  H  HH12 . ARG A 1 14 ? 45.815 -2.999  4.811  1.00 18.11  ? 14   ARG A HH12 1 
ATOM   243  H  HH21 . ARG A 1 14 ? 44.673 -0.823  2.598  1.00 19.88  ? 14   ARG A HH21 1 
ATOM   244  H  HH22 . ARG A 1 14 ? 45.354 -2.177  2.765  1.00 19.88  ? 14   ARG A HH22 1 
ATOM   245  N  N    . ILE A 1 15 ? 41.162 -0.152  9.991  1.00 8.26   ? 15   ILE A N    1 
ATOM   246  C  CA   . ILE A 1 15 ? 41.334 0.331   11.339 1.00 7.87   ? 15   ILE A CA   1 
ATOM   247  C  C    . ILE A 1 15 ? 42.582 -0.319  11.939 1.00 8.90   ? 15   ILE A C    1 
ATOM   248  O  O    . ILE A 1 15 ? 42.769 -1.533  11.837 1.00 8.99   ? 15   ILE A O    1 
ATOM   249  C  CB   . ILE A 1 15 ? 40.090 0.075   12.206 1.00 7.96   ? 15   ILE A CB   1 
ATOM   250  C  CG1  . ILE A 1 15 ? 40.283 0.708   13.633 1.00 9.15   ? 15   ILE A CG1  1 
ATOM   251  C  CG2  . ILE A 1 15 ? 39.604 -1.348  12.226 1.00 10.27  ? 15   ILE A CG2  1 
ATOM   252  C  CD1  . ILE A 1 15 ? 39.041 0.638   14.472 1.00 10.78  ? 15   ILE A CD1  1 
ATOM   253  H  H    . ILE A 1 15 ? 41.374 -0.990  9.828  1.00 9.91   ? 15   ILE A H    1 
ATOM   254  H  HA   . ILE A 1 15 ? 41.487 1.318   11.298 1.00 9.45   ? 15   ILE A HA   1 
ATOM   255  H  HB   . ILE A 1 15 ? 39.355 0.601   11.779 1.00 9.56   ? 15   ILE A HB   1 
ATOM   256  H  HG12 . ILE A 1 15 ? 41.015 0.234   14.100 1.00 10.98  ? 15   ILE A HG12 1 
ATOM   257  H  HG13 . ILE A 1 15 ? 40.551 1.656   13.532 1.00 10.98  ? 15   ILE A HG13 1 
ATOM   258  H  HG21 . ILE A 1 15 ? 38.812 -1.414  12.799 1.00 15.40  ? 15   ILE A HG21 1 
ATOM   259  H  HG22 . ILE A 1 15 ? 40.311 -1.929  12.576 1.00 15.40  ? 15   ILE A HG22 1 
ATOM   260  H  HG23 . ILE A 1 15 ? 39.372 -1.626  11.315 1.00 15.40  ? 15   ILE A HG23 1 
ATOM   261  H  HD11 . ILE A 1 15 ? 39.225 1.013   15.359 1.00 16.17  ? 15   ILE A HD11 1 
ATOM   262  H  HD12 . ILE A 1 15 ? 38.761 -0.296  14.564 1.00 16.17  ? 15   ILE A HD12 1 
ATOM   263  H  HD13 . ILE A 1 15 ? 38.327 1.153   14.042 1.00 16.17  ? 15   ILE A HD13 1 
ATOM   264  N  N    . GLY A 1 16 ? 43.483 0.499   12.536 1.00 8.92   ? 16   GLY A N    1 
ATOM   265  C  CA   . GLY A 1 16 ? 44.697 -0.053  13.123 1.00 10.57  ? 16   GLY A CA   1 
ATOM   266  C  C    . GLY A 1 16 ? 45.558 -0.782  12.094 1.00 9.41   ? 16   GLY A C    1 
ATOM   267  O  O    . GLY A 1 16 ? 46.358 -1.669  12.488 1.00 10.20  ? 16   GLY A O    1 
ATOM   268  H  H    . GLY A 1 16 ? 43.335 1.366   12.569 1.00 10.70  ? 16   GLY A H    1 
ATOM   269  H  HA2  . GLY A 1 16 ? 45.225 0.681   13.526 1.00 12.68  ? 16   GLY A HA2  1 
ATOM   270  H  HA3  . GLY A 1 16 ? 44.451 -0.683  13.845 1.00 12.68  ? 16   GLY A HA3  1 
ATOM   271  N  N    . GLY A 1 17 ? 45.484 -0.466  10.814 1.00 9.33   ? 17   GLY A N    1 
ATOM   272  C  CA   . GLY A 1 17 ? 46.155 -1.189  9.728  1.00 9.94   ? 17   GLY A CA   1 
ATOM   273  C  C    . GLY A 1 17 ? 45.433 -2.395  9.137  1.00 10.12  ? 17   GLY A C    1 
ATOM   274  O  O    . GLY A 1 17 ? 45.886 -2.870  8.062  1.00 11.96  ? 17   GLY A O    1 
ATOM   275  H  H    . GLY A 1 17 ? 44.994 0.232   10.595 1.00 11.20  ? 17   GLY A H    1 
ATOM   276  H  HA2  . GLY A 1 17 ? 46.327 -0.547  8.995  1.00 11.93  ? 17   GLY A HA2  1 
ATOM   277  H  HA3  . GLY A 1 17 ? 47.035 -1.494  10.064 1.00 11.93  ? 17   GLY A HA3  1 
ATOM   278  N  N    . GLN A 1 18 ? 44.354 -2.887  9.772  1.00 8.39   ? 18   GLN A N    1 
ATOM   279  C  CA   . GLN A 1 18 ? 43.668 -4.103  9.377  1.00 8.63   ? 18   GLN A CA   1 
ATOM   280  C  C    . GLN A 1 18 ? 42.381 -3.821  8.621  1.00 9.40   ? 18   GLN A C    1 
ATOM   281  O  O    . GLN A 1 18 ? 41.593 -2.937  8.951  1.00 9.98   ? 18   GLN A O    1 
ATOM   282  C  CB   . GLN A 1 18 ? 43.316 -4.963  10.605 1.00 11.18  ? 18   GLN A CB   1 
ATOM   283  C  CG   . GLN A 1 18 ? 44.488 -5.501  11.370 1.00 12.11  ? 18   GLN A CG   1 
ATOM   284  C  CD   . GLN A 1 18 ? 45.276 -6.470  10.553 1.00 13.03  ? 18   GLN A CD   1 
ATOM   285  O  OE1  . GLN A 1 18 ? 44.650 -7.483  10.175 1.00 18.90  ? 18   GLN A OE1  1 
ATOM   286  N  NE2  . GLN A 1 18 ? 46.552 -6.207  10.309 1.00 14.25  ? 18   GLN A NE2  1 
ATOM   287  H  H    . GLN A 1 18 ? 44.047 -2.446  10.469 1.00 10.07  ? 18   GLN A H    1 
ATOM   288  H  HA   . GLN A 1 18 ? 44.275 -4.632  8.783  1.00 10.35  ? 18   GLN A HA   1 
ATOM   289  H  HB2  . GLN A 1 18 ? 42.764 -4.418  11.221 1.00 13.42  ? 18   GLN A HB2  1 
ATOM   290  H  HB3  . GLN A 1 18 ? 42.761 -5.725  10.305 1.00 13.42  ? 18   GLN A HB3  1 
ATOM   291  H  HG2  . GLN A 1 18 ? 45.073 -4.751  11.643 1.00 14.53  ? 18   GLN A HG2  1 
ATOM   292  H  HG3  . GLN A 1 18 ? 44.165 -5.951  12.190 1.00 14.53  ? 18   GLN A HG3  1 
ATOM   293  H  HE21 . GLN A 1 18 ? 47.036 -6.773  9.841  1.00 17.10  ? 18   GLN A HE21 1 
ATOM   294  H  HE22 . GLN A 1 18 ? 46.914 -5.466  10.615 1.00 17.10  ? 18   GLN A HE22 1 
ATOM   295  N  N    . LEU A 1 19 ? 42.082 -4.638  7.622  1.00 9.61   ? 19   LEU A N    1 
ATOM   296  C  CA   . LEU A 1 19 ? 40.842 -4.533  6.869  1.00 8.96   ? 19   LEU A CA   1 
ATOM   297  C  C    . LEU A 1 19 ? 39.774 -5.428  7.505  1.00 9.03   ? 19   LEU A C    1 
ATOM   298  O  O    . LEU A 1 19 ? 40.019 -6.601  7.955  1.00 12.32  ? 19   LEU A O    1 
ATOM   299  C  CB   . LEU A 1 19 ? 41.017 -4.962  5.389  1.00 10.38  ? 19   LEU A CB   1 
ATOM   300  C  CG   . LEU A 1 19 ? 41.991 -4.186  4.539  1.00 12.13  ? 19   LEU A CG   1 
ATOM   301  C  CD1  . LEU A 1 19 ? 42.155 -4.820  3.126  1.00 19.99  ? 19   LEU A CD1  1 
ATOM   302  C  CD2  . LEU A 1 19 ? 41.531 -2.743  4.383  1.00 11.34  ? 19   LEU A CD2  1 
ATOM   303  H  H    . LEU A 1 19 ? 42.657 -5.268  7.405  1.00 11.53  ? 19   LEU A H    1 
ATOM   304  H  HA   . LEU A 1 19 ? 40.527 -3.585  6.895  1.00 10.75  ? 19   LEU A HA   1 
ATOM   305  H  HB2  . LEU A 1 19 ? 41.297 -5.912  5.380  1.00 12.46  ? 19   LEU A HB2  1 
ATOM   306  H  HB3  . LEU A 1 19 ? 40.130 -4.916  4.953  1.00 12.46  ? 19   LEU A HB3  1 
ATOM   307  H  HG   . LEU A 1 19 ? 42.882 -4.188  4.994  1.00 14.56  ? 19   LEU A HG   1 
ATOM   308  H  HD11 . LEU A 1 19 ? 42.469 -5.744  3.218  1.00 29.99  ? 19   LEU A HD11 1 
ATOM   309  H  HD12 . LEU A 1 19 ? 42.808 -4.303  2.610  1.00 29.99  ? 19   LEU A HD12 1 
ATOM   310  H  HD13 . LEU A 1 19 ? 41.292 -4.813  2.663  1.00 29.99  ? 19   LEU A HD13 1 
ATOM   311  H  HD21 . LEU A 1 19 ? 42.164 -2.258  3.812  1.00 17.02  ? 19   LEU A HD21 1 
ATOM   312  H  HD22 . LEU A 1 19 ? 41.492 -2.315  5.263  1.00 17.02  ? 19   LEU A HD22 1 
ATOM   313  H  HD23 . LEU A 1 19 ? 40.642 -2.726  3.971  1.00 17.02  ? 19   LEU A HD23 1 
ATOM   314  N  N    . LYS A 1 20 ? 38.554 -4.865  7.601  1.00 9.08   ? 20   LYS A N    1 
ATOM   315  C  CA   . LYS A 1 20 ? 37.412 -5.539  8.170  1.00 8.51   ? 20   LYS A CA   1 
ATOM   316  C  C    . LYS A 1 20 ? 36.160 -5.231  7.357  1.00 8.77   ? 20   LYS A C    1 
ATOM   317  O  O    . LYS A 1 20 ? 36.181 -4.194  6.658  1.00 9.89   ? 20   LYS A O    1 
ATOM   318  C  CB   . LYS A 1 20 ? 37.134 -5.138  9.623  1.00 9.89   ? 20   LYS A CB   1 
ATOM   319  C  CG   . LYS A 1 20 ? 38.256 -5.465  10.583 1.00 9.95   ? 20   LYS A CG   1 
ATOM   320  C  CD   . LYS A 1 20 ? 37.975 -4.921  11.953 1.00 11.41  ? 20   LYS A CD   1 
ATOM   321  C  CE   . LYS A 1 20 ? 39.022 -5.274  12.972 1.00 13.36  ? 20   LYS A CE   1 
ATOM   322  N  NZ   . LYS A 1 20 ? 38.771 -6.642  13.484 1.00 13.56  ? 20   LYS A NZ   1 
ATOM   323  H  H    . LYS A 1 20 ? 38.448 -4.045  7.302  1.00 10.90  ? 20   LYS A H    1 
ATOM   324  H  HA   . LYS A 1 20 ? 37.577 -6.525  8.139  1.00 10.22  ? 20   LYS A HA   1 
ATOM   325  H  HB2  . LYS A 1 20 ? 36.961 -4.164  9.656  1.00 11.87  ? 20   LYS A HB2  1 
ATOM   326  H  HB3  . LYS A 1 20 ? 36.312 -5.598  9.927  1.00 11.87  ? 20   LYS A HB3  1 
ATOM   327  H  HG2  . LYS A 1 20 ? 38.368 -6.447  10.636 1.00 11.94  ? 20   LYS A HG2  1 
ATOM   328  H  HG3  . LYS A 1 20 ? 39.102 -5.078  10.243 1.00 11.94  ? 20   LYS A HG3  1 
ATOM   329  H  HD2  . LYS A 1 20 ? 37.904 -3.935  11.897 1.00 13.69  ? 20   LYS A HD2  1 
ATOM   330  H  HD3  . LYS A 1 20 ? 37.100 -5.268  12.260 1.00 13.69  ? 20   LYS A HD3  1 
ATOM   331  H  HE2  . LYS A 1 20 ? 39.920 -5.231  12.558 1.00 16.03  ? 20   LYS A HE2  1 
ATOM   332  H  HE3  . LYS A 1 20 ? 38.993 -4.626  13.720 1.00 16.03  ? 20   LYS A HE3  1 
ATOM   333  H  HZ1  . LYS A 1 20 ? 39.415 -6.864  14.087 1.00 20.33  ? 20   LYS A HZ1  1 
ATOM   334  H  HZ2  . LYS A 1 20 ? 38.787 -7.233  12.792 1.00 20.33  ? 20   LYS A HZ2  1 
ATOM   335  H  HZ3  . LYS A 1 20 ? 37.956 -6.671  13.887 1.00 20.33  ? 20   LYS A HZ3  1 
ATOM   336  N  N    . GLU A 1 21 ? 35.098 -6.028  7.436  1.00 8.33   ? 21   GLU A N    1 
ATOM   337  C  CA   . GLU A 1 21 ? 33.752 -5.715  6.935  1.00 8.67   ? 21   GLU A CA   1 
ATOM   338  C  C    . GLU A 1 21 ? 32.901 -5.069  8.031  1.00 9.34   ? 21   GLU A C    1 
ATOM   339  O  O    . GLU A 1 21 ? 32.976 -5.535  9.209  1.00 9.70   ? 21   GLU A O    1 
ATOM   340  C  CB   . GLU A 1 21 ? 33.070 -6.927  6.373  1.00 10.40  ? 21   GLU A CB   1 
ATOM   341  C  CG   . GLU A 1 21 ? 33.777 -7.537  5.164  1.00 13.65  ? 21   GLU A CG   1 
ATOM   342  C  CD   . GLU A 1 21 ? 33.917 -6.580  3.985  1.00 11.74  ? 21   GLU A CD   1 
ATOM   343  O  OE1  . GLU A 1 21 ? 32.850 -6.172  3.468  1.00 16.96  ? 21   GLU A OE1  1 
ATOM   344  O  OE2  . GLU A 1 21 ? 35.070 -6.266  3.574  1.00 13.54  ? 21   GLU A OE2  1 
ATOM   345  H  H    . GLU A 1 21 ? 35.211 -6.811  7.822  1.00 10.00  ? 21   GLU A H    1 
ATOM   346  H  HA   . GLU A 1 21 ? 33.850 -5.050  6.195  1.00 10.41  ? 21   GLU A HA   1 
ATOM   347  H  HB2  . GLU A 1 21 ? 33.006 -7.613  7.084  1.00 12.48  ? 21   GLU A HB2  1 
ATOM   348  H  HB3  . GLU A 1 21 ? 32.148 -6.680  6.111  1.00 12.48  ? 21   GLU A HB3  1 
ATOM   349  H  HG2  . GLU A 1 21 ? 34.679 -7.838  5.440  1.00 16.38  ? 21   GLU A HG2  1 
ATOM   350  H  HG3  . GLU A 1 21 ? 33.271 -8.335  4.869  1.00 16.38  ? 21   GLU A HG3  1 
ATOM   351  N  N    . ALA A 1 22 ? 32.111 -4.040  7.739  1.00 7.47   ? 22   ALA A N    1 
ATOM   352  C  CA   . ALA A 1 22 ? 31.297 -3.380  8.777  1.00 7.37   ? 22   ALA A CA   1 
ATOM   353  C  C    . ALA A 1 22 ? 29.993 -2.874  8.193  1.00 7.87   ? 22   ALA A C    1 
ATOM   354  O  O    . ALA A 1 22 ? 29.893 -2.536  7.003  1.00 9.83   ? 22   ALA A O    1 
ATOM   355  C  CB   . ALA A 1 22 ? 32.046 -2.238  9.507  1.00 8.68   ? 22   ALA A CB   1 
ATOM   356  H  H    . ALA A 1 22 ? 32.074 -3.746  6.910  1.00 8.96   ? 22   ALA A H    1 
ATOM   357  H  HA   . ALA A 1 22 ? 31.068 -4.072  9.462  1.00 8.84   ? 22   ALA A HA   1 
ATOM   358  H  HB1  . ALA A 1 22 ? 32.887 -2.582  9.875  1.00 13.03  ? 22   ALA A HB1  1 
ATOM   359  H  HB2  . ALA A 1 22 ? 31.488 -1.894  10.236 1.00 13.03  ? 22   ALA A HB2  1 
ATOM   360  H  HB3  . ALA A 1 22 ? 32.238 -1.516  8.874  1.00 13.03  ? 22   ALA A HB3  1 
ATOM   361  N  N    . LEU A 1 23 ? 28.967 -2.762  9.040  1.00 8.20   ? 23   LEU A N    1 
ATOM   362  C  CA   . LEU A 1 23 ? 27.599 -2.319  8.719  1.00 7.86   ? 23   LEU A CA   1 
ATOM   363  C  C    . LEU A 1 23 ? 27.367 -0.825  8.923  1.00 7.84   ? 23   LEU A C    1 
ATOM   364  O  O    . LEU A 1 23 ? 27.663 -0.335  10.031 1.00 7.90   ? 23   LEU A O    1 
ATOM   365  C  CB   . LEU A 1 23 ? 26.630 -3.113  9.595  1.00 8.86   ? 23   LEU A CB   1 
ATOM   366  C  CG   . LEU A 1 23 ? 25.124 -2.852  9.389  1.00 10.18  ? 23   LEU A CG   1 
ATOM   367  C  CD1  . LEU A 1 23 ? 24.673 -3.286  8.008  1.00 12.96  ? 23   LEU A CD1  1 
ATOM   368  C  CD2  . LEU A 1 23 ? 24.275 -3.542  10.459 1.00 13.01  ? 23   LEU A CD2  1 
ATOM   369  H  H    . LEU A 1 23 ? 29.125 -2.975  9.879  1.00 9.84   ? 23   LEU A H    1 
ATOM   370  H  HA   . LEU A 1 23 ? 27.412 -2.540  7.762  1.00 9.44   ? 23   LEU A HA   1 
ATOM   371  H  HB2  . LEU A 1 23 ? 26.797 -4.077  9.441  1.00 10.63  ? 23   LEU A HB2  1 
ATOM   372  H  HB3  . LEU A 1 23 ? 26.847 -2.925  10.542 1.00 10.63  ? 23   LEU A HB3  1 
ATOM   373  H  HG   . LEU A 1 23 ? 24.971 -1.866  9.466  1.00 12.22  ? 23   LEU A HG   1 
ATOM   374  H  HD11 . LEU A 1 23 ? 25.221 -2.839  7.330  1.00 19.44  ? 23   LEU A HD11 1 
ATOM   375  H  HD12 . LEU A 1 23 ? 23.732 -3.043  7.880  1.00 19.44  ? 23   LEU A HD12 1 
ATOM   376  H  HD13 . LEU A 1 23 ? 24.774 -4.257  7.922  1.00 19.44  ? 23   LEU A HD13 1 
ATOM   377  H  HD21 . LEU A 1 23 ? 24.569 -3.252  11.348 1.00 19.52  ? 23   LEU A HD21 1 
ATOM   378  H  HD22 . LEU A 1 23 ? 24.379 -4.514  10.382 1.00 19.52  ? 23   LEU A HD22 1 
ATOM   379  H  HD23 . LEU A 1 23 ? 23.333 -3.304  10.333 1.00 19.52  ? 23   LEU A HD23 1 
ATOM   380  N  N    . LEU A 1 24 ? 26.896 -0.098  7.888  1.00 7.59   ? 24   LEU A N    1 
ATOM   381  C  CA   . LEU A 1 24 ? 26.578 1.315   8.021  1.00 7.45   ? 24   LEU A CA   1 
ATOM   382  C  C    . LEU A 1 24 ? 25.177 1.430   8.641  1.00 8.19   ? 24   LEU A C    1 
ATOM   383  O  O    . LEU A 1 24 ? 24.160 1.093   8.015  1.00 8.70   ? 24   LEU A O    1 
ATOM   384  C  CB   . LEU A 1 24 ? 26.681 1.987   6.669  1.00 9.03   ? 24   LEU A CB   1 
ATOM   385  C  CG   . LEU A 1 24 ? 27.983 1.921   5.881  1.00 11.45  ? 24   LEU A CG   1 
ATOM   386  C  CD1  . LEU A 1 24 ? 27.843 2.715   4.558  1.00 15.73  ? 24   LEU A CD1  1 
ATOM   387  C  CD2  . LEU A 1 24 ? 29.167 2.441   6.665  1.00 16.47  ? 24   LEU A CD2  1 
ATOM   388  H  H    . LEU A 1 24 ? 26.778 -0.490  7.109  1.00 9.11   ? 24   LEU A H    1 
ATOM   389  H  HA   . LEU A 1 24 ? 27.240 1.736   8.641  1.00 8.95   ? 24   LEU A HA   1 
ATOM   390  H  HB2  . LEU A 1 24 ? 25.970 1.605   6.095  1.00 10.84  ? 24   LEU A HB2  1 
ATOM   391  H  HB3  . LEU A 1 24 ? 26.463 2.944   6.798  1.00 10.84  ? 24   LEU A HB3  1 
ATOM   392  H  HG   . LEU A 1 24 ? 28.159 0.964   5.651  1.00 13.73  ? 24   LEU A HG   1 
ATOM   393  H  HD11 . LEU A 1 24 ? 28.683 2.665   4.056  1.00 23.60  ? 24   LEU A HD11 1 
ATOM   394  H  HD12 . LEU A 1 24 ? 27.638 3.652   4.760  1.00 23.60  ? 24   LEU A HD12 1 
ATOM   395  H  HD13 . LEU A 1 24 ? 27.118 2.331   4.021  1.00 23.60  ? 24   LEU A HD13 1 
ATOM   396  H  HD21 . LEU A 1 24 ? 29.978 2.367   6.120  1.00 24.70  ? 24   LEU A HD21 1 
ATOM   397  H  HD22 . LEU A 1 24 ? 29.274 1.912   7.483  1.00 24.70  ? 24   LEU A HD22 1 
ATOM   398  H  HD23 . LEU A 1 24 ? 29.015 3.380   6.900  1.00 24.70  ? 24   LEU A HD23 1 
ATOM   399  N  N    . ASP A 1 25 ? 25.147 1.823   9.933  1.00 7.25   ? 25   ASP A N    1 
ATOM   400  C  CA   . ASP A 1 25 ? 23.973 1.716   10.791 1.00 6.76   ? 25   ASP A CA   1 
ATOM   401  C  C    . ASP A 1 25 ? 23.515 3.077   11.342 1.00 6.41   ? 25   ASP A C    1 
ATOM   402  O  O    . ASP A 1 25 ? 23.983 3.622   12.342 1.00 6.34   ? 25   ASP A O    1 
ATOM   403  C  CB   . ASP A 1 25 ? 24.304 0.756   11.942 1.00 7.12   ? 25   ASP A CB   1 
ATOM   404  C  CG   . ASP A 1 25 ? 23.133 0.327   12.767 1.00 9.14   ? 25   ASP A CG   1 
ATOM   405  O  OD1  . ASP A 1 25 ? 22.069 1.064   12.693 1.00 8.30   ? 25   ASP A OD1  1 
ATOM   406  O  OD2  . ASP A 1 25 ? 23.269 -0.669  13.530 1.00 9.55   ? 25   ASP A OD2  1 
ATOM   407  H  H    . ASP A 1 25 ? 25.881 2.164   10.278 1.00 8.71   ? 25   ASP A H    1 
ATOM   408  H  HA   . ASP A 1 25 ? 23.225 1.323   10.256 1.00 8.11   ? 25   ASP A HA   1 
ATOM   409  H  HB2  . ASP A 1 25 ? 24.734 -0.051  11.564 1.00 8.54   ? 25   ASP A HB2  1 
ATOM   410  H  HB3  . ASP A 1 25 ? 24.963 1.195   12.537 1.00 8.54   ? 25   ASP A HB3  1 
ATOM   411  N  N    . THR A 1 26 ? 22.518 3.703   10.757 1.00 6.64   ? 26   THR A N    1 
ATOM   412  C  CA   . THR A 1 26 ? 21.953 4.992   11.109 1.00 6.52   ? 26   THR A CA   1 
ATOM   413  C  C    . THR A 1 26 ? 21.162 4.909   12.412 1.00 6.06   ? 26   THR A C    1 
ATOM   414  O  O    . THR A 1 26 ? 20.925 5.964   12.989 1.00 7.03   ? 26   THR A O    1 
ATOM   415  C  CB   . THR A 1 26 ? 21.052 5.602   10.003 1.00 6.52   ? 26   THR A CB   1 
ATOM   416  O  OG1  . THR A 1 26 ? 19.934 4.745   9.680  1.00 6.89   ? 26   THR A OG1  1 
ATOM   417  C  CG2  . THR A 1 26 ? 21.829 5.811   8.698  1.00 7.88   ? 26   THR A CG2  1 
ATOM   418  H  H    . THR A 1 26 ? 22.151 3.292   10.071 1.00 7.97   ? 26   THR A H    1 
ATOM   419  H  HA   . THR A 1 26 ? 22.714 5.623   11.259 1.00 7.83   ? 26   THR A HA   1 
ATOM   420  H  HB   . THR A 1 26 ? 20.704 6.485   10.318 1.00 7.83   ? 26   THR A HB   1 
ATOM   421  H  HG1  . THR A 1 26 ? 19.495 4.584   10.377 1.00 10.34  ? 26   THR A HG1  1 
ATOM   422  H  HG21 . THR A 1 26 ? 21.239 6.215   8.028  1.00 11.82  ? 26   THR A HG21 1 
ATOM   423  H  HG22 . THR A 1 26 ? 22.154 4.947   8.369  1.00 11.82  ? 26   THR A HG22 1 
ATOM   424  H  HG23 . THR A 1 26 ? 22.591 6.405   8.863  1.00 11.82  ? 26   THR A HG23 1 
ATOM   425  N  N    . GLY A 1 27 ? 20.782 3.713   12.893 1.00 6.13   ? 27   GLY A N    1 
ATOM   426  C  CA   . GLY A 1 27 ? 20.114 3.590   14.179 1.00 6.00   ? 27   GLY A CA   1 
ATOM   427  C  C    . GLY A 1 27 ? 21.052 3.471   15.369 1.00 6.25   ? 27   GLY A C    1 
ATOM   428  O  O    . GLY A 1 27 ? 20.590 3.393   16.504 1.00 7.00   ? 27   GLY A O    1 
ATOM   429  H  H    . GLY A 1 27 ? 20.941 2.988   12.419 1.00 7.36   ? 27   GLY A H    1 
ATOM   430  H  HA2  . GLY A 1 27 ? 19.535 4.382   14.311 1.00 7.21   ? 27   GLY A HA2  1 
ATOM   431  H  HA3  . GLY A 1 27 ? 19.529 2.792   14.156 1.00 7.21   ? 27   GLY A HA3  1 
ATOM   432  N  N    . ALA A 1 28 ? 22.362 3.427   15.152 1.00 6.07   ? 28   ALA A N    1 
ATOM   433  C  CA   . ALA A 1 28 ? 23.385 3.333   16.215 1.00 6.67   ? 28   ALA A CA   1 
ATOM   434  C  C    . ALA A 1 28 ? 24.010 4.670   16.526 1.00 7.00   ? 28   ALA A C    1 
ATOM   435  O  O    . ALA A 1 28 ? 24.527 5.333   15.608 1.00 7.32   ? 28   ALA A O    1 
ATOM   436  C  CB   . ALA A 1 28 ? 24.481 2.351   15.756 1.00 6.68   ? 28   ALA A CB   1 
ATOM   437  H  H    . ALA A 1 28 ? 22.641 3.455   14.318 1.00 7.28   ? 28   ALA A H    1 
ATOM   438  H  HA   . ALA A 1 28 ? 22.957 2.976   17.045 1.00 8.00   ? 28   ALA A HA   1 
ATOM   439  H  HB1  . ALA A 1 28 ? 24.077 1.482   15.554 1.00 10.03  ? 28   ALA A HB1  1 
ATOM   440  H  HB2  . ALA A 1 28 ? 25.144 2.245   16.470 1.00 10.03  ? 28   ALA A HB2  1 
ATOM   441  H  HB3  . ALA A 1 28 ? 24.920 2.702   14.953 1.00 10.03  ? 28   ALA A HB3  1 
ATOM   442  N  N    . ASP A 1 29 ? 23.985 5.091   17.794 1.00 6.99   ? 29   ASP A N    1 
ATOM   443  C  CA   . ASP A 1 29 ? 24.610 6.365   18.157 1.00 7.30   ? 29   ASP A CA   1 
ATOM   444  C  C    . ASP A 1 29 ? 26.148 6.304   17.993 1.00 6.97   ? 29   ASP A C    1 
ATOM   445  O  O    . ASP A 1 29 ? 26.783 7.303   17.645 1.00 8.48   ? 29   ASP A O    1 
ATOM   446  C  CB   . ASP A 1 29 ? 24.237 6.811   19.569 1.00 7.82   ? 29   ASP A CB   1 
ATOM   447  C  CG   . ASP A 1 29 ? 22.757 6.980   19.875 1.00 9.25   ? 29   ASP A CG   1 
ATOM   448  O  OD1  . ASP A 1 29 ? 21.944 7.179   18.932 1.00 8.31   ? 29   ASP A OD1  1 
ATOM   449  O  OD2  . ASP A 1 29 ? 22.397 6.926   21.081 1.00 10.64  ? 29   ASP A OD2  1 
ATOM   450  H  H    . ASP A 1 29 ? 23.591 4.603   18.411 1.00 8.38   ? 29   ASP A H    1 
ATOM   451  H  HA   . ASP A 1 29 ? 24.268 7.058   17.523 1.00 8.76   ? 29   ASP A HA   1 
ATOM   452  H  HB2  . ASP A 1 29 ? 24.608 6.150   20.207 1.00 9.38   ? 29   ASP A HB2  1 
ATOM   453  H  HB3  . ASP A 1 29 ? 24.687 7.675   19.746 1.00 9.38   ? 29   ASP A HB3  1 
ATOM   454  N  N    . ASP A 1 30 ? 26.680 5.149   18.320 1.00 7.43   ? 30   ASP A N    1 
ATOM   455  C  CA   . ASP A 1 30 ? 28.106 4.902   18.443 1.00 7.02   ? 30   ASP A CA   1 
ATOM   456  C  C    . ASP A 1 30 ? 28.604 3.843   17.428 1.00 7.06   ? 30   ASP A C    1 
ATOM   457  O  O    . ASP A 1 30 ? 27.783 3.084   16.884 1.00 8.34   ? 30   ASP A O    1 
ATOM   458  C  CB   . ASP A 1 30 ? 28.408 4.386   19.869 1.00 8.51   ? 30   ASP A CB   1 
ATOM   459  C  CG   . ASP A 1 30 ? 27.773 5.197   20.955 1.00 8.06   ? 30   ASP A CG   1 
ATOM   460  O  OD1  . ASP A 1 30 ? 28.161 6.376   21.106 1.00 12.40  ? 30   ASP A OD1  1 
ATOM   461  O  OD2  . ASP A 1 30 ? 26.825 4.702   21.631 1.00 9.55   ? 30   ASP A OD2  1 
ATOM   462  H  H    . ASP A 1 30 ? 26.134 4.477   18.475 1.00 8.91   ? 30   ASP A H    1 
ATOM   463  H  HA   . ASP A 1 30 ? 28.601 5.758   18.293 1.00 8.43   ? 30   ASP A HA   1 
ATOM   464  H  HB2  . ASP A 1 30 ? 28.092 3.451   19.943 1.00 10.21  ? 30   ASP A HB2  1 
ATOM   465  H  HB3  . ASP A 1 30 ? 29.389 4.384   20.006 1.00 10.21  ? 30   ASP A HB3  1 
ATOM   466  N  N    . THR A 1 31 ? 29.875 3.780   17.168 1.00 8.20   ? 31   THR A N    1 
ATOM   467  C  CA   . THR A 1 31 ? 30.588 2.758   16.437 1.00 7.08   ? 31   THR A CA   1 
ATOM   468  C  C    . THR A 1 31 ? 31.060 1.658   17.409 1.00 7.43   ? 31   THR A C    1 
ATOM   469  O  O    . THR A 1 31 ? 31.742 1.956   18.399 1.00 8.61   ? 31   THR A O    1 
ATOM   470  C  CB   . THR A 1 31 ? 31.755 3.417   15.709 1.00 7.33   ? 31   THR A CB   1 
ATOM   471  O  OG1  . THR A 1 31 ? 31.209 4.325   14.693 1.00 8.09   ? 31   THR A OG1  1 
ATOM   472  C  CG2  . THR A 1 31 ? 32.699 2.423   15.021 1.00 8.25   ? 31   THR A CG2  1 
ATOM   473  H  H    . THR A 1 31 ? 30.364 4.445   17.475 1.00 9.84   ? 31   THR A H    1 
ATOM   474  H  HA   . THR A 1 31 ? 29.972 2.352   15.762 1.00 8.49   ? 31   THR A HA   1 
ATOM   475  H  HB   . THR A 1 31 ? 32.281 3.954   16.368 1.00 8.80   ? 31   THR A HB   1 
ATOM   476  H  HG1  . THR A 1 31 ? 30.695 4.880   15.059 1.00 12.14  ? 31   THR A HG1  1 
ATOM   477  H  HG21 . THR A 1 31 ? 33.419 2.914   14.572 1.00 12.38  ? 31   THR A HG21 1 
ATOM   478  H  HG22 . THR A 1 31 ? 32.198 1.900   14.360 1.00 12.38  ? 31   THR A HG22 1 
ATOM   479  H  HG23 . THR A 1 31 ? 33.084 1.820   15.691 1.00 12.38  ? 31   THR A HG23 1 
ATOM   480  N  N    . VAL A 1 32 ? 30.714 0.403   17.143 1.00 7.25   ? 32   VAL A N    1 
ATOM   481  C  CA   . VAL A 1 32 ? 30.941 -0.714  18.036 1.00 7.29   ? 32   VAL A CA   1 
ATOM   482  C  C    . VAL A 1 32 ? 31.523 -1.876  17.202 1.00 8.14   ? 32   VAL A C    1 
ATOM   483  O  O    . VAL A 1 32 ? 30.840 -2.348  16.265 1.00 8.90   ? 32   VAL A O    1 
ATOM   484  C  CB   . VAL A 1 32 ? 29.658 -1.171  18.815 1.00 10.02  ? 32   VAL A CB   1 
ATOM   485  C  CG1  . VAL A 1 32 ? 30.127 -2.068  19.959 1.00 10.15  ? 32   VAL A CG1  1 
ATOM   486  C  CG2  . VAL A 1 32 ? 28.790 0.009   19.256 1.00 15.37  ? 32   VAL A CG2  1 
ATOM   487  H  H    . VAL A 1 32 ? 30.321 0.240   16.373 1.00 8.69   ? 32   VAL A H    1 
ATOM   488  H  HA   . VAL A 1 32 ? 31.629 -0.439  18.707 1.00 8.75   ? 32   VAL A HA   1 
ATOM   489  H  HB   . VAL A 1 32 ? 29.111 -1.734  18.194 1.00 12.02  ? 32   VAL A HB   1 
ATOM   490  H  HG11 . VAL A 1 32 ? 30.675 -2.797  19.599 1.00 15.23  ? 32   VAL A HG11 1 
ATOM   491  H  HG12 . VAL A 1 32 ? 29.349 -2.443  20.421 1.00 15.23  ? 32   VAL A HG12 1 
ATOM   492  H  HG13 . VAL A 1 32 ? 30.660 -1.541  20.591 1.00 15.23  ? 32   VAL A HG13 1 
ATOM   493  H  HG21 . VAL A 1 32 ? 28.544 0.544   18.473 1.00 23.06  ? 32   VAL A HG21 1 
ATOM   494  H  HG22 . VAL A 1 32 ? 29.292 0.565   19.887 1.00 23.06  ? 32   VAL A HG22 1 
ATOM   495  H  HG23 . VAL A 1 32 ? 27.979 -0.327  19.691 1.00 23.06  ? 32   VAL A HG23 1 
ATOM   496  N  N    . LEU A 1 33 ? 32.715 -2.338  17.550 1.00 7.50   ? 33   LEU A N    1 
ATOM   497  C  CA   . LEU A 1 33 ? 33.386 -3.418  16.824 1.00 6.98   ? 33   LEU A CA   1 
ATOM   498  C  C    . LEU A 1 33 ? 33.506 -4.666  17.689 1.00 7.83   ? 33   LEU A C    1 
ATOM   499  O  O    . LEU A 1 33 ? 33.629 -4.566  18.921 1.00 7.93   ? 33   LEU A O    1 
ATOM   500  C  CB   . LEU A 1 33 ? 34.757 -2.914  16.331 1.00 9.34   ? 33   LEU A CB   1 
ATOM   501  C  CG   . LEU A 1 33 ? 34.767 -1.688  15.406 1.00 11.61  ? 33   LEU A CG   1 
ATOM   502  C  CD1  . LEU A 1 33 ? 36.158 -1.425  14.869 1.00 12.80  ? 33   LEU A CD1  1 
ATOM   503  C  CD2  . LEU A 1 33 ? 33.847 -1.753  14.198 1.00 15.31  ? 33   LEU A CD2  1 
ATOM   504  H  H    . LEU A 1 33 ? 33.119 -1.982  18.245 1.00 9.00   ? 33   LEU A H    1 
ATOM   505  H  HA   . LEU A 1 33 ? 32.832 -3.646  16.024 1.00 8.38   ? 33   LEU A HA   1 
ATOM   506  H  HB2  . LEU A 1 33 ? 35.308 -2.702  17.125 1.00 11.21  ? 33   LEU A HB2  1 
ATOM   507  H  HB3  . LEU A 1 33 ? 35.202 -3.659  15.855 1.00 11.21  ? 33   LEU A HB3  1 
ATOM   508  H  HG   . LEU A 1 33 ? 34.497 -0.894  15.951 1.00 13.94  ? 33   LEU A HG   1 
ATOM   509  H  HD11 . LEU A 1 33 ? 36.789 -1.359  15.615 1.00 19.20  ? 33   LEU A HD11 1 
ATOM   510  H  HD12 . LEU A 1 33 ? 36.160 -0.586  14.363 1.00 19.20  ? 33   LEU A HD12 1 
ATOM   511  H  HD13 . LEU A 1 33 ? 36.425 -2.161  14.280 1.00 19.20  ? 33   LEU A HD13 1 
ATOM   512  H  HD21 . LEU A 1 33 ? 32.928 -1.918  14.496 1.00 22.96  ? 33   LEU A HD21 1 
ATOM   513  H  HD22 . LEU A 1 33 ? 34.134 -2.480  13.607 1.00 22.96  ? 33   LEU A HD22 1 
ATOM   514  H  HD23 . LEU A 1 33 ? 33.885 -0.903  13.712 1.00 22.96  ? 33   LEU A HD23 1 
ATOM   515  N  N    . GLU A 1 34 ? 33.516 -5.841  17.034 1.00 7.26   ? 34   GLU A N    1 
ATOM   516  C  CA   . GLU A 1 34 ? 33.801 -7.096  17.670 1.00 7.81   ? 34   GLU A CA   1 
ATOM   517  C  C    . GLU A 1 34 ? 35.198 -7.050  18.301 1.00 8.05   ? 34   GLU A C    1 
ATOM   518  O  O    . GLU A 1 34 ? 36.087 -6.317  17.895 1.00 8.89   ? 34   GLU A O    1 
ATOM   519  C  CB   . GLU A 1 34 ? 33.689 -8.234  16.650 1.00 8.83   ? 34   GLU A CB   1 
ATOM   520  C  CG   . GLU A 1 34 ? 32.332 -8.374  15.934 1.00 10.27  ? 34   GLU A CG   1 
ATOM   521  C  CD   . GLU A 1 34 ? 32.350 -9.361  14.773 1.00 14.28  ? 34   GLU A CD   1 
ATOM   522  O  OE1  . GLU A 1 34 ? 33.329 -9.980  14.406 1.00 35.36  ? 34   GLU A OE1  1 
ATOM   523  O  OE2  . GLU A 1 34 ? 31.333 -9.607  14.117 1.00 20.36  ? 34   GLU A OE2  1 
ATOM   524  H  H    . GLU A 1 34 ? 33.338 -5.841  16.172 1.00 8.72   ? 34   GLU A H    1 
ATOM   525  H  HA   . GLU A 1 34 ? 33.128 -7.247  18.394 1.00 9.37   ? 34   GLU A HA   1 
ATOM   526  H  HB2  . GLU A 1 34 ? 34.390 -8.105  15.963 1.00 10.59  ? 34   GLU A HB2  1 
ATOM   527  H  HB3  . GLU A 1 34 ? 33.883 -9.087  17.115 1.00 10.59  ? 34   GLU A HB3  1 
ATOM   528  H  HG2  . GLU A 1 34 ? 31.652 -8.666  16.591 1.00 12.33  ? 34   GLU A HG2  1 
ATOM   529  H  HG3  . GLU A 1 34 ? 32.058 -7.485  15.593 1.00 12.33  ? 34   GLU A HG3  1 
ATOM   530  N  N    . GLU A 1 35 ? 35.423 -7.944  19.305 1.00 9.14   ? 35   GLU A N    1 
ATOM   531  C  CA   . GLU A 1 35 ? 36.697 -8.039  20.047 1.00 9.43   ? 35   GLU A CA   1 
ATOM   532  C  C    . GLU A 1 35 ? 37.923 -7.968  19.129 1.00 8.86   ? 35   GLU A C    1 
ATOM   533  O  O    . GLU A 1 35 ? 38.004 -8.712  18.142 1.00 9.78   ? 35   GLU A O    1 
ATOM   534  C  CB   . GLU A 1 35 ? 36.766 -9.315  20.886 1.00 9.83   ? 35   GLU A CB   1 
ATOM   535  C  CG   . GLU A 1 35 ? 38.030 -9.514  21.707 1.00 16.07  ? 35   GLU A CG   1 
ATOM   536  C  CD   . GLU A 1 35 ? 38.344 -8.343  22.619 1.00 18.30  ? 35   GLU A CD   1 
ATOM   537  O  OE1  . GLU A 1 35 ? 37.359 -7.830  23.208 1.00 21.52  ? 35   GLU A OE1  1 
ATOM   538  O  OE2  . GLU A 1 35 ? 39.527 -7.957  22.725 1.00 27.89  ? 35   GLU A OE2  1 
ATOM   539  H  H    . GLU A 1 35 ? 34.773 -8.495  19.524 1.00 10.97  ? 35   GLU A H    1 
ATOM   540  H  HA   . GLU A 1 35 ? 36.743 -7.261  20.674 1.00 11.32  ? 35   GLU A HA   1 
ATOM   541  H  HB2  . GLU A 1 35 ? 35.992 -9.321  21.504 1.00 11.80  ? 35   GLU A HB2  1 
ATOM   542  H  HB3  . GLU A 1 35 ? 36.665 -10.090 20.279 1.00 11.80  ? 35   GLU A HB3  1 
ATOM   543  H  HG2  . GLU A 1 35 ? 37.930 -10.332 22.256 1.00 19.29  ? 35   GLU A HG2  1 
ATOM   544  H  HG3  . GLU A 1 35 ? 38.792 -9.656  21.092 1.00 19.29  ? 35   GLU A HG3  1 
ATOM   545  N  N    . MET A 1 36 ? 38.841 -7.058  19.456 1.00 9.70   ? 36   MET A N    1 
ATOM   546  C  CA   . MET A 1 36 ? 40.071 -6.775  18.767 1.00 9.79   ? 36   MET A CA   1 
ATOM   547  C  C    . MET A 1 36 ? 40.978 -5.983  19.703 1.00 10.27  ? 36   MET A C    1 
ATOM   548  O  O    . MET A 1 36 ? 40.533 -5.414  20.733 1.00 12.85  ? 36   MET A O    1 
ATOM   549  C  CB   . MET A 1 36 ? 39.802 -5.928  17.517 1.00 9.11   ? 36   MET A CB   1 
ATOM   550  C  CG   . MET A 1 36 ? 39.333 -4.497  17.751 1.00 11.30  ? 36   MET A CG   1 
ATOM   551  S  SD   . MET A 1 36 ? 39.096 -3.489  16.280 1.00 10.94  ? 36   MET A SD   1 
ATOM   552  C  CE   . MET A 1 36 ? 40.775 -3.389  15.656 1.00 12.14  ? 36   MET A CE   1 
ATOM   553  H  H    . MET A 1 36 ? 38.676 -6.577  20.174 1.00 11.64  ? 36   MET A H    1 
ATOM   554  H  HA   . MET A 1 36 ? 40.518 -7.631  18.506 1.00 11.75  ? 36   MET A HA   1 
ATOM   555  H  HB2  . MET A 1 36 ? 40.633 -5.896  16.981 1.00 10.93  ? 36   MET A HB2  1 
ATOM   556  H  HB3  . MET A 1 36 ? 39.117 -6.391  16.972 1.00 10.93  ? 36   MET A HB3  1 
ATOM   557  H  HG2  . MET A 1 36 ? 38.476 -4.528  18.247 1.00 13.56  ? 36   MET A HG2  1 
ATOM   558  H  HG3  . MET A 1 36 ? 39.995 -4.045  18.333 1.00 13.56  ? 36   MET A HG3  1 
ATOM   559  H  HE1  . MET A 1 36 ? 40.789 -2.842  14.843 1.00 18.21  ? 36   MET A HE1  1 
ATOM   560  H  HE2  . MET A 1 36 ? 41.102 -4.289  15.450 1.00 18.21  ? 36   MET A HE2  1 
ATOM   561  H  HE3  . MET A 1 36 ? 41.352 -2.979  16.334 1.00 18.21  ? 36   MET A HE3  1 
ATOM   562  N  N    . ASN A 1 37 ? 42.248 -5.909  19.322 1.00 10.28  ? 37   ASN A N    1 
ATOM   563  C  CA   . ASN A 1 37 ? 43.262 -5.059  19.951 1.00 11.70  ? 37   ASN A CA   1 
ATOM   564  C  C    . ASN A 1 37 ? 43.294 -3.667  19.325 1.00 10.99  ? 37   ASN A C    1 
ATOM   565  O  O    . ASN A 1 37 ? 43.336 -3.561  18.087 1.00 11.64  ? 37   ASN A O    1 
ATOM   566  C  CB   . ASN A 1 37 ? 44.639 -5.795  19.854 1.00 13.49  ? 37   ASN A CB   1 
ATOM   567  C  CG   . ASN A 1 37 ? 44.735 -7.135  20.527 1.00 15.16  ? 37   ASN A CG   1 
ATOM   568  O  OD1  . ASN A 1 37 ? 45.384 -8.111  20.060 1.00 23.44  ? 37   ASN A OD1  1 
ATOM   569  N  ND2  . ASN A 1 37 ? 44.121 -7.282  21.672 1.00 20.01  ? 37   ASN A ND2  1 
ATOM   570  H  H    . ASN A 1 37 ? 42.499 -6.408  18.642 1.00 12.33  ? 37   ASN A H    1 
ATOM   571  H  HA   . ASN A 1 37 ? 43.029 -4.960  20.918 1.00 14.04  ? 37   ASN A HA   1 
ATOM   572  H  HB2  . ASN A 1 37 ? 44.857 -5.915  18.895 1.00 16.19  ? 37   ASN A HB2  1 
ATOM   573  H  HB3  . ASN A 1 37 ? 45.332 -5.205  20.242 1.00 16.19  ? 37   ASN A HB3  1 
ATOM   574  H  HD21 . ASN A 1 37 ? 44.165 -8.050  22.100 1.00 24.02  ? 37   ASN A HD21 1 
ATOM   575  H  HD22 . ASN A 1 37 ? 43.663 -6.613  22.015 1.00 24.02  ? 37   ASN A HD22 1 
ATOM   576  N  N    . LEU A 1 38 ? 43.292 -2.608  20.123 1.00 9.63   ? 38   LEU A N    1 
ATOM   577  C  CA   . LEU A 1 38 ? 43.569 -1.246  19.618 1.00 10.28  ? 38   LEU A CA   1 
ATOM   578  C  C    . LEU A 1 38 ? 44.613 -0.556  20.496 1.00 10.91  ? 38   LEU A C    1 
ATOM   579  O  O    . LEU A 1 38 ? 44.656 -0.807  21.728 1.00 10.58  ? 38   LEU A O    1 
ATOM   580  C  CB   . LEU A 1 38 ? 42.292 -0.412  19.593 1.00 11.24  ? 38   LEU A CB   1 
ATOM   581  C  CG   . LEU A 1 38 ? 41.298 -0.646  18.480 1.00 10.34  ? 38   LEU A CG   1 
ATOM   582  C  CD1  . LEU A 1 38 ? 40.025 0.175   18.688 1.00 10.67  ? 38   LEU A CD1  1 
ATOM   583  C  CD2  . LEU A 1 38 ? 41.894 -0.361  17.075 1.00 12.16  ? 38   LEU A CD2  1 
ATOM   584  H  H    . LEU A 1 38 ? 43.120 -2.718  20.979 1.00 11.56  ? 38   LEU A H    1 
ATOM   585  H  HA   . LEU A 1 38 ? 43.927 -1.315  18.687 1.00 12.34  ? 38   LEU A HA   1 
ATOM   586  H  HB2  . LEU A 1 38 ? 41.821 -0.558  20.452 1.00 13.49  ? 38   LEU A HB2  1 
ATOM   587  H  HB3  . LEU A 1 38 ? 42.556 0.542   19.565 1.00 13.49  ? 38   LEU A HB3  1 
ATOM   588  H  HG   . LEU A 1 38 ? 41.040 -1.612  18.506 1.00 12.40  ? 38   LEU A HG   1 
ATOM   589  H  HD11 . LEU A 1 38 ? 39.398 -0.004  17.957 1.00 16.00  ? 38   LEU A HD11 1 
ATOM   590  H  HD12 . LEU A 1 38 ? 40.250 1.129   18.701 1.00 16.00  ? 38   LEU A HD12 1 
ATOM   591  H  HD13 . LEU A 1 38 ? 39.612 -0.074  19.541 1.00 16.00  ? 38   LEU A HD13 1 
ATOM   592  H  HD21 . LEU A 1 38 ? 41.211 -0.526  16.392 1.00 18.25  ? 38   LEU A HD21 1 
ATOM   593  H  HD22 . LEU A 1 38 ? 42.661 -0.951  16.920 1.00 18.25  ? 38   LEU A HD22 1 
ATOM   594  H  HD23 . LEU A 1 38 ? 42.185 0.574   17.027 1.00 18.25  ? 38   LEU A HD23 1 
ATOM   595  N  N    . PRO A 1 39 ? 45.452 0.314   19.937 1.00 10.28  ? 39   PRO A N    1 
ATOM   596  C  CA   . PRO A 1 39 ? 46.486 0.974   20.752 1.00 11.57  ? 39   PRO A CA   1 
ATOM   597  C  C    . PRO A 1 39 ? 45.928 2.139   21.550 1.00 13.20  ? 39   PRO A C    1 
ATOM   598  O  O    . PRO A 1 39 ? 44.893 2.758   21.241 1.00 12.67  ? 39   PRO A O    1 
ATOM   599  C  CB   . PRO A 1 39 ? 47.484 1.440   19.702 1.00 14.08  ? 39   PRO A CB   1 
ATOM   600  C  CG   . PRO A 1 39 ? 46.669 1.680   18.490 1.00 20.29  ? 39   PRO A CG   1 
ATOM   601  C  CD   . PRO A 1 39 ? 45.503 0.671   18.500 1.00 11.25  ? 39   PRO A CD   1 
ATOM   602  H  HA   . PRO A 1 39 ? 46.917 0.311   21.365 1.00 13.88  ? 39   PRO A HA   1 
ATOM   603  H  HB2  . PRO A 1 39 ? 47.937 2.271   19.991 1.00 16.90  ? 39   PRO A HB2  1 
ATOM   604  H  HB3  . PRO A 1 39 ? 48.167 0.744   19.533 1.00 16.90  ? 39   PRO A HB3  1 
ATOM   605  H  HG2  . PRO A 1 39 ? 46.319 2.606   18.493 1.00 24.35  ? 39   PRO A HG2  1 
ATOM   606  H  HG3  . PRO A 1 39 ? 47.221 1.556   17.678 1.00 24.35  ? 39   PRO A HG3  1 
ATOM   607  H  HD2  . PRO A 1 39 ? 44.658 1.089   18.198 1.00 13.50  ? 39   PRO A HD2  1 
ATOM   608  H  HD3  . PRO A 1 39 ? 45.700 -0.118  17.935 1.00 13.50  ? 39   PRO A HD3  1 
ATOM   609  N  N    . GLY A 1 40 ? 46.632 2.464   22.630 1.00 11.92  ? 40   GLY A N    1 
ATOM   610  C  CA   . GLY A 1 40 ? 46.370 3.628   23.450 1.00 11.81  ? 40   GLY A CA   1 
ATOM   611  C  C    . GLY A 1 40 ? 45.445 3.422   24.618 1.00 11.27  ? 40   GLY A C    1 
ATOM   612  O  O    . GLY A 1 40 ? 45.155 2.267   25.001 1.00 12.87  ? 40   GLY A O    1 
ATOM   613  H  H    . GLY A 1 40 ? 47.300 1.939   22.861 1.00 14.30  ? 40   GLY A H    1 
ATOM   614  H  HA2  . GLY A 1 40 ? 47.235 3.965   23.795 1.00 14.17  ? 40   GLY A HA2  1 
ATOM   615  H  HA3  . GLY A 1 40 ? 45.987 4.335   22.872 1.00 14.17  ? 40   GLY A HA3  1 
ATOM   616  N  N    . LYS A 1 41 ? 44.967 4.504   25.234 1.00 10.44  ? 41   LYS A N    1 
ATOM   617  C  CA   . LYS A 1 41 ? 44.195 4.478   26.456 1.00 9.80   ? 41   LYS A CA   1 
ATOM   618  C  C    . LYS A 1 41 ? 42.741 4.080   26.166 1.00 10.22  ? 41   LYS A C    1 
ATOM   619  O  O    . LYS A 1 41 ? 42.215 4.325   25.075 1.00 9.84   ? 41   LYS A O    1 
ATOM   620  C  CB   . LYS A 1 41 ? 44.215 5.859   27.102 1.00 16.19  ? 41   LYS A CB   1 
ATOM   621  C  CG   . LYS A 1 41 ? 45.559 6.380   27.626 1.00 18.88  ? 41   LYS A CG   1 
ATOM   622  C  CD   . LYS A 1 41 ? 45.467 7.806   28.186 0.50 19.67  ? 41   LYS A CD   1 
ATOM   623  C  CE   . LYS A 1 41 ? 46.641 8.018   29.147 0.50 34.86  ? 41   LYS A CE   1 
ATOM   624  N  NZ   . LYS A 1 41 ? 47.053 9.424   29.372 0.50 50.34  ? 41   LYS A NZ   1 
ATOM   625  H  H    . LYS A 1 41 ? 45.134 5.289   24.872 1.00 12.53  ? 41   LYS A H    1 
ATOM   626  H  HA   . LYS A 1 41 ? 44.598 3.815   27.086 1.00 11.75  ? 41   LYS A HA   1 
ATOM   627  H  HB2  . LYS A 1 41 ? 43.874 6.510   26.439 1.00 19.43  ? 41   LYS A HB2  1 
ATOM   628  H  HB3  . LYS A 1 41 ? 43.576 5.851   27.858 1.00 19.43  ? 41   LYS A HB3  1 
ATOM   629  H  HG2  . LYS A 1 41 ? 45.885 5.774   28.338 1.00 22.66  ? 41   LYS A HG2  1 
ATOM   630  H  HG3  . LYS A 1 41 ? 46.221 6.365   26.890 1.00 22.66  ? 41   LYS A HG3  1 
ATOM   631  N  N    . TRP A 1 42 ? 42.059 3.486   27.127 1.00 9.57   ? 42   TRP A N    1 
ATOM   632  C  CA   . TRP A 1 42 ? 40.635 3.137   27.084 1.00 9.42   ? 42   TRP A CA   1 
ATOM   633  C  C    . TRP A 1 42 ? 40.022 3.224   28.491 1.00 11.54  ? 42   TRP A C    1 
ATOM   634  O  O    . TRP A 1 42 ? 40.756 3.186   29.493 1.00 11.23  ? 42   TRP A O    1 
ATOM   635  C  CB   . TRP A 1 42 ? 40.360 1.756   26.420 1.00 9.70   ? 42   TRP A CB   1 
ATOM   636  C  CG   . TRP A 1 42 ? 40.873 0.560   27.169 1.00 9.81   ? 42   TRP A CG   1 
ATOM   637  C  CD1  . TRP A 1 42 ? 42.097 0.001   27.059 1.00 11.72  ? 42   TRP A CD1  1 
ATOM   638  C  CD2  . TRP A 1 42 ? 40.160 -0.209  28.130 1.00 9.83   ? 42   TRP A CD2  1 
ATOM   639  N  NE1  . TRP A 1 42 ? 42.200 -1.053  27.895 1.00 12.46  ? 42   TRP A NE1  1 
ATOM   640  C  CE2  . TRP A 1 42 ? 41.028 -1.228  28.574 1.00 11.85  ? 42   TRP A CE2  1 
ATOM   641  C  CE3  . TRP A 1 42 ? 38.870 -0.118  28.641 1.00 9.95   ? 42   TRP A CE3  1 
ATOM   642  C  CZ2  . TRP A 1 42 ? 40.640 -2.153  29.522 1.00 15.40  ? 42   TRP A CZ2  1 
ATOM   643  C  CZ3  . TRP A 1 42 ? 38.484 -1.045  29.592 1.00 12.41  ? 42   TRP A CZ3  1 
ATOM   644  C  CH2  . TRP A 1 42 ? 39.353 -2.080  30.041 1.00 12.82  ? 42   TRP A CH2  1 
ATOM   645  H  H    . TRP A 1 42 ? 42.499 3.280   27.861 1.00 11.49  ? 42   TRP A H    1 
ATOM   646  H  HA   . TRP A 1 42 ? 40.181 3.829   26.523 1.00 11.30  ? 42   TRP A HA   1 
ATOM   647  H  HB2  . TRP A 1 42 ? 39.382 1.655   26.303 1.00 11.64  ? 42   TRP A HB2  1 
ATOM   648  H  HB3  . TRP A 1 42 ? 40.767 1.757   25.517 1.00 11.64  ? 42   TRP A HB3  1 
ATOM   649  H  HD1  . TRP A 1 42 ? 42.785 0.304   26.478 1.00 14.07  ? 42   TRP A HD1  1 
ATOM   650  H  HE1  . TRP A 1 42 ? 42.917 -1.554  27.990 1.00 14.96  ? 42   TRP A HE1  1 
ATOM   651  H  HE3  . TRP A 1 42 ? 38.273 0.560   28.347 1.00 11.94  ? 42   TRP A HE3  1 
ATOM   652  H  HZ2  . TRP A 1 42 ? 41.242 -2.827  29.814 1.00 18.47  ? 42   TRP A HZ2  1 
ATOM   653  H  HZ3  . TRP A 1 42 ? 37.609 -0.990  29.958 1.00 14.89  ? 42   TRP A HZ3  1 
ATOM   654  H  HH2  . TRP A 1 42 ? 39.057 -2.712  30.687 1.00 15.39  ? 42   TRP A HH2  1 
ATOM   655  N  N    . LYS A 1 43 ? 38.692 3.351   28.562 1.00 12.46  ? 43   LYS A N    1 
ATOM   656  C  CA   . LYS A 1 43 ? 37.953 3.275   29.813 1.00 11.64  ? 43   LYS A CA   1 
ATOM   657  C  C    . LYS A 1 43 ? 36.694 2.458   29.614 1.00 12.87  ? 43   LYS A C    1 
ATOM   658  O  O    . LYS A 1 43 ? 36.152 2.382   28.463 1.00 12.48  ? 43   LYS A O    1 
ATOM   659  C  CB   A LYS A 1 43 ? 37.565 4.632   30.385 0.53 13.76  ? 43   LYS A CB   1 
ATOM   660  C  CB   B LYS A 1 43 ? 37.597 4.677   30.301 0.47 21.14  ? 43   LYS A CB   1 
ATOM   661  C  CG   A LYS A 1 43 ? 36.706 5.464   29.454 0.53 11.72  ? 43   LYS A CG   1 
ATOM   662  C  CG   B LYS A 1 43 ? 38.747 5.394   31.017 0.47 27.84  ? 43   LYS A CG   1 
ATOM   663  C  CD   A LYS A 1 43 ? 36.646 6.918   29.967 0.53 45.07  ? 43   LYS A CD   1 
ATOM   664  C  CD   B LYS A 1 43 ? 38.191 6.564   31.803 0.47 22.69  ? 43   LYS A CD   1 
ATOM   665  C  CE   A LYS A 1 43 ? 35.968 7.832   28.934 0.53 28.06  ? 43   LYS A CE   1 
ATOM   666  C  CE   B LYS A 1 43 ? 39.332 7.485   32.250 0.47 14.38  ? 43   LYS A CE   1 
ATOM   667  N  NZ   A LYS A 1 43 ? 34.808 8.492   29.558 0.53 38.60  ? 43   LYS A NZ   1 
ATOM   668  N  NZ   B LYS A 1 43 ? 38.762 8.836   32.550 0.47 22.19  ? 43   LYS A NZ   1 
ATOM   669  H  H    . LYS A 1 43 ? 38.244 3.487   27.817 1.00 14.95  ? 43   LYS A H    1 
ATOM   670  H  HA   . LYS A 1 43 ? 38.526 2.805   30.485 1.00 13.96  ? 43   LYS A HA   1 
ATOM   671  N  N    . PRO A 1 44 ? 36.201 1.843   30.693 1.00 14.04  ? 44   PRO A N    1 
ATOM   672  C  CA   . PRO A 1 44 ? 34.941 1.089   30.563 1.00 16.03  ? 44   PRO A CA   1 
ATOM   673  C  C    . PRO A 1 44 ? 33.738 1.980   30.291 1.00 13.37  ? 44   PRO A C    1 
ATOM   674  O  O    . PRO A 1 44 ? 33.697 3.111   30.761 1.00 20.21  ? 44   PRO A O    1 
ATOM   675  C  CB   . PRO A 1 44 ? 34.789 0.408   31.929 1.00 18.11  ? 44   PRO A CB   1 
ATOM   676  C  CG   . PRO A 1 44 ? 36.000 0.621   32.732 1.00 20.25  ? 44   PRO A CG   1 
ATOM   677  C  CD   . PRO A 1 44 ? 36.717 1.751   32.083 1.00 14.16  ? 44   PRO A CD   1 
ATOM   678  H  HA   . PRO A 1 44 ? 35.026 0.400   29.844 1.00 19.23  ? 44   PRO A HA   1 
ATOM   679  H  HB2  . PRO A 1 44 ? 34.005 0.782   32.403 1.00 21.73  ? 44   PRO A HB2  1 
ATOM   680  H  HB3  . PRO A 1 44 ? 34.640 -0.563  31.803 1.00 21.73  ? 44   PRO A HB3  1 
ATOM   681  H  HG2  . PRO A 1 44 ? 35.763 0.849   33.666 1.00 24.30  ? 44   PRO A HG2  1 
ATOM   682  H  HG3  . PRO A 1 44 ? 36.563 -0.193  32.736 1.00 24.30  ? 44   PRO A HG3  1 
ATOM   683  H  HD2  . PRO A 1 44 ? 36.545 2.594   32.571 1.00 16.99  ? 44   PRO A HD2  1 
ATOM   684  H  HD3  . PRO A 1 44 ? 37.693 1.582   32.078 1.00 16.99  ? 44   PRO A HD3  1 
ATOM   685  N  N    . LYS A 1 45 ? 32.720 1.561   29.582 1.00 13.79  ? 45   LYS A N    1 
ATOM   686  C  CA   . LYS A 1 45 ? 31.485 2.193   29.195 1.00 14.38  ? 45   LYS A CA   1 
ATOM   687  C  C    . LYS A 1 45 ? 30.356 1.172   29.019 1.00 11.73  ? 45   LYS A C    1 
ATOM   688  O  O    . LYS A 1 45 ? 30.634 -0.012  28.801 1.00 12.41  ? 45   LYS A O    1 
ATOM   689  C  CB   . LYS A 1 45 ? 31.666 3.013   27.886 1.00 20.50  ? 45   LYS A CB   1 
ATOM   690  C  CG   . LYS A 1 45 ? 30.485 3.774   27.341 1.00 22.20  ? 45   LYS A CG   1 
ATOM   691  C  CD   . LYS A 1 45 ? 30.633 4.533   26.067 0.50 20.17  ? 45   LYS A CD   1 
ATOM   692  C  CE   . LYS A 1 45 ? 29.307 5.183   25.673 0.50 28.80  ? 45   LYS A CE   1 
ATOM   693  N  NZ   . LYS A 1 45 ? 29.219 6.623   26.001 0.50 55.18  ? 45   LYS A NZ   1 
ATOM   694  H  H    . LYS A 1 45 ? 32.806 0.736   29.286 1.00 16.54  ? 45   LYS A H    1 
ATOM   695  H  HA   . LYS A 1 45 ? 31.220 2.826   29.923 1.00 17.25  ? 45   LYS A HA   1 
ATOM   696  H  HB2  . LYS A 1 45 ? 32.398 3.662   28.037 1.00 24.61  ? 45   LYS A HB2  1 
ATOM   697  H  HB3  . LYS A 1 45 ? 31.972 2.389   27.181 1.00 24.61  ? 45   LYS A HB3  1 
ATOM   698  H  HG2  . LYS A 1 45 ? 29.745 3.127   27.218 1.00 26.64  ? 45   LYS A HG2  1 
ATOM   699  H  HG3  . LYS A 1 45 ? 30.197 4.415   28.038 1.00 26.64  ? 45   LYS A HG3  1 
ATOM   700  H  HD2  . LYS A 1 45 ? 31.325 5.233   26.176 0.50 24.20  ? 45   LYS A HD2  1 
ATOM   701  H  HD3  . LYS A 1 45 ? 30.928 3.919   25.348 0.50 24.20  ? 45   LYS A HD3  1 
ATOM   702  H  HE2  . LYS A 1 45 ? 29.175 5.070   24.698 0.50 34.56  ? 45   LYS A HE2  1 
ATOM   703  H  HE3  . LYS A 1 45 ? 28.571 4.707   26.133 0.50 34.56  ? 45   LYS A HE3  1 
ATOM   704  H  HZ1  . LYS A 1 45 ? 28.361 6.832   26.219 0.50 82.77  ? 45   LYS A HZ1  1 
ATOM   705  H  HZ2  . LYS A 1 45 ? 29.477 7.114   25.279 0.50 82.77  ? 45   LYS A HZ2  1 
ATOM   706  H  HZ3  . LYS A 1 45 ? 29.766 6.807   26.705 0.50 82.77  ? 45   LYS A HZ3  1 
ATOM   707  N  N    . MET A 1 46 ? 29.103 1.608   29.137 1.00 11.92  ? 46   MET A N    1 
ATOM   708  C  CA   . MET A 1 46 ? 27.933 0.762   28.934 1.00 11.06  ? 46   MET A CA   1 
ATOM   709  C  C    . MET A 1 46 ? 27.059 1.406   27.856 1.00 10.81  ? 46   MET A C    1 
ATOM   710  O  O    . MET A 1 46 ? 26.905 2.608   27.855 1.00 13.63  ? 46   MET A O    1 
ATOM   711  C  CB   . MET A 1 46 ? 27.111 0.523   30.224 1.00 12.72  ? 46   MET A CB   1 
ATOM   712  C  CG   . MET A 1 46 ? 27.896 -0.411  31.202 1.00 15.32  ? 46   MET A CG   1 
ATOM   713  S  SD   . MET A 1 46 ? 26.943 -0.600  32.772 1.00 16.02  ? 46   MET A SD   1 
ATOM   714  C  CE   . MET A 1 46 ? 25.568 -1.492  32.112 1.00 25.16  ? 46   MET A CE   1 
ATOM   715  H  H    . MET A 1 46 ? 28.974 2.453   29.347 1.00 14.30  ? 46   MET A H    1 
ATOM   716  H  HB2  . MET A 1 46 ? 26.928 1.390   30.667 1.00 15.27  ? 46   MET A HB2  1 
ATOM   717  H  HB3  . MET A 1 46 ? 26.243 0.107   29.992 1.00 15.27  ? 46   MET A HB3  1 
ATOM   718  H  HG2  . MET A 1 46 ? 28.029 -1.298  30.783 1.00 18.39  ? 46   MET A HG2  1 
ATOM   719  H  HG3  . MET A 1 46 ? 28.785 -0.022  31.395 1.00 18.39  ? 46   MET A HG3  1 
ATOM   720  H  HE1  . MET A 1 46 ? 24.927 -1.681  32.829 1.00 37.73  ? 46   MET A HE1  1 
ATOM   721  H  HE2  . MET A 1 46 ? 25.881 -2.335  31.724 1.00 37.73  ? 46   MET A HE2  1 
ATOM   722  H  HE3  . MET A 1 46 ? 25.133 -0.955  31.418 1.00 37.73  ? 46   MET A HE3  1 
ATOM   723  N  N    . ILE A 1 47 ? 26.512 0.596   26.939 1.00 10.08  ? 47   ILE A N    1 
ATOM   724  C  CA   . ILE A 1 47 ? 25.610 1.023   25.864 1.00 9.65   ? 47   ILE A CA   1 
ATOM   725  C  C    . ILE A 1 47 ? 24.395 0.095   25.829 1.00 9.90   ? 47   ILE A C    1 
ATOM   726  O  O    . ILE A 1 47 ? 24.461 -1.062  26.246 1.00 10.97  ? 47   ILE A O    1 
ATOM   727  C  CB   . ILE A 1 47 ? 26.238 1.085   24.451 1.00 10.26  ? 47   ILE A CB   1 
ATOM   728  C  CG1  . ILE A 1 47 ? 26.725 -0.257  23.954 1.00 9.49   ? 47   ILE A CG1  1 
ATOM   729  C  CG2  . ILE A 1 47 ? 27.372 2.121   24.434 1.00 11.69  ? 47   ILE A CG2  1 
ATOM   730  C  CD1  . ILE A 1 47 ? 27.327 -0.259  22.528 1.00 13.41  ? 47   ILE A CD1  1 
ATOM   731  H  H    . ILE A 1 47 ? 26.710 -0.261  26.986 1.00 12.10  ? 47   ILE A H    1 
ATOM   732  H  HA   . ILE A 1 47 ? 25.283 1.941   26.090 1.00 11.58  ? 47   ILE A HA   1 
ATOM   733  H  HB   . ILE A 1 47 ? 25.531 1.402   23.820 1.00 12.31  ? 47   ILE A HB   1 
ATOM   734  H  HG12 . ILE A 1 47 ? 27.410 -0.594  24.584 1.00 11.38  ? 47   ILE A HG12 1 
ATOM   735  H  HG13 . ILE A 1 47 ? 25.965 -0.892  23.974 1.00 11.38  ? 47   ILE A HG13 1 
ATOM   736  H  HG21 . ILE A 1 47 ? 27.030 2.985   24.746 1.00 17.53  ? 47   ILE A HG21 1 
ATOM   737  H  HG22 . ILE A 1 47 ? 27.715 2.216   23.521 1.00 17.53  ? 47   ILE A HG22 1 
ATOM   738  H  HG23 . ILE A 1 47 ? 28.095 1.823   25.025 1.00 17.53  ? 47   ILE A HG23 1 
ATOM   739  H  HD11 . ILE A 1 47 ? 27.631 -1.164  22.304 1.00 20.12  ? 47   ILE A HD11 1 
ATOM   740  H  HD12 . ILE A 1 47 ? 28.087 0.359   22.494 1.00 20.12  ? 47   ILE A HD12 1 
ATOM   741  H  HD13 . ILE A 1 47 ? 26.645 0.025   21.885 1.00 20.12  ? 47   ILE A HD13 1 
ATOM   742  N  N    . GLY A 1 48 ? 23.265 0.619   25.298 1.00 9.67   ? 48   GLY A N    1 
ATOM   743  C  CA   . GLY A 1 48 ? 22.043 -0.199  25.200 1.00 10.16  ? 48   GLY A CA   1 
ATOM   744  C  C    . GLY A 1 48 ? 21.468 -0.198  23.797 1.00 8.55   ? 48   GLY A C    1 
ATOM   745  O  O    . GLY A 1 48 ? 21.430 0.795   23.052 1.00 11.17  ? 48   GLY A O    1 
ATOM   746  H  H    . GLY A 1 48 ? 23.260 1.451   25.010 1.00 11.60  ? 48   GLY A H    1 
ATOM   747  H  HA2  . GLY A 1 48 ? 22.251 -1.130  25.466 1.00 12.19  ? 48   GLY A HA2  1 
ATOM   748  H  HA3  . GLY A 1 48 ? 21.364 0.152   25.829 1.00 12.19  ? 48   GLY A HA3  1 
ATOM   749  N  N    . GLY A 1 49 ? 21.019 -1.384  23.413 1.00 8.61   ? 49   GLY A N    1 
ATOM   750  C  CA   . GLY A 1 49 ? 20.383 -1.623  22.105 1.00 8.55   ? 49   GLY A CA   1 
ATOM   751  C  C    . GLY A 1 49 ? 19.062 -2.371  22.246 1.00 9.24   ? 49   GLY A C    1 
ATOM   752  O  O    . GLY A 1 49 ? 18.376 -2.277  23.273 1.00 8.92   ? 49   GLY A O    1 
ATOM   753  H  H    . GLY A 1 49 ? 21.105 -2.063  23.967 1.00 10.34  ? 49   GLY A H    1 
ATOM   754  H  HA2  . GLY A 1 49 ? 20.221 -0.755  21.658 1.00 10.26  ? 49   GLY A HA2  1 
ATOM   755  H  HA3  . GLY A 1 49 ? 20.998 -2.150  21.535 1.00 10.26  ? 49   GLY A HA3  1 
ATOM   756  N  N    . ILE A 1 50 ? 18.687 -3.173  21.213 1.00 7.95   ? 50   ILE A N    1 
ATOM   757  C  CA   . ILE A 1 50 ? 17.350 -3.757  21.148 1.00 7.75   ? 50   ILE A CA   1 
ATOM   758  C  C    . ILE A 1 50 ? 17.079 -4.715  22.303 1.00 9.07   ? 50   ILE A C    1 
ATOM   759  O  O    . ILE A 1 50 ? 15.930 -4.821  22.724 1.00 10.28  ? 50   ILE A O    1 
ATOM   760  C  CB   . ILE A 1 50 ? 17.148 -4.474  19.794 1.00 8.33   ? 50   ILE A CB   1 
ATOM   761  C  CG1  . ILE A 1 50 ? 15.683 -4.824  19.501 1.00 9.62   ? 50   ILE A CG1  1 
ATOM   762  C  CG2  . ILE A 1 50 ? 17.960 -5.748  19.639 1.00 8.82   ? 50   ILE A CG2  1 
ATOM   763  C  CD1  . ILE A 1 50 ? 14.757 -3.661  19.387 1.00 10.36  ? 50   ILE A CD1  1 
ATOM   764  H  H    . ILE A 1 50 ? 19.263 -3.343  20.570 1.00 9.54   ? 50   ILE A H    1 
ATOM   765  H  HA   . ILE A 1 50 ? 16.686 -3.012  21.203 1.00 9.30   ? 50   ILE A HA   1 
ATOM   766  H  HB   . ILE A 1 50 ? 17.449 -3.843  19.079 1.00 10.00  ? 50   ILE A HB   1 
ATOM   767  H  HG12 . ILE A 1 50 ? 15.647 -5.336  18.655 1.00 11.54  ? 50   ILE A HG12 1 
ATOM   768  H  HG13 . ILE A 1 50 ? 15.352 -5.417  20.222 1.00 11.54  ? 50   ILE A HG13 1 
ATOM   769  H  HG21 . ILE A 1 50 ? 18.904 -5.558  19.822 1.00 13.22  ? 50   ILE A HG21 1 
ATOM   770  H  HG22 . ILE A 1 50 ? 17.866 -6.085  18.724 1.00 13.22  ? 50   ILE A HG22 1 
ATOM   771  H  HG23 . ILE A 1 50 ? 17.634 -6.422  20.271 1.00 13.22  ? 50   ILE A HG23 1 
ATOM   772  H  HD11 . ILE A 1 50 ? 13.852 -3.981  19.193 1.00 15.54  ? 50   ILE A HD11 1 
ATOM   773  H  HD12 . ILE A 1 50 ? 15.058 -3.073  18.663 1.00 15.54  ? 50   ILE A HD12 1 
ATOM   774  H  HD13 . ILE A 1 50 ? 14.753 -3.162  20.231 1.00 15.54  ? 50   ILE A HD13 1 
ATOM   775  N  N    . GLY A 1 51 ? 18.110 -5.398  22.805 1.00 7.77   ? 51   GLY A N    1 
ATOM   776  C  CA   . GLY A 1 51 ? 17.977 -6.415  23.816 1.00 8.86   ? 51   GLY A CA   1 
ATOM   777  C  C    . GLY A 1 51 ? 18.321 -5.973  25.225 1.00 10.85  ? 51   GLY A C    1 
ATOM   778  O  O    . GLY A 1 51 ? 18.079 -6.704  26.161 1.00 17.91  ? 51   GLY A O    1 
ATOM   779  H  H    . GLY A 1 51 ? 18.916 -5.217  22.501 1.00 9.33   ? 51   GLY A H    1 
ATOM   780  H  HA2  . GLY A 1 51 ? 17.043 -6.744  23.809 1.00 10.64  ? 51   GLY A HA2  1 
ATOM   781  H  HA3  . GLY A 1 51 ? 18.562 -7.176  23.574 1.00 10.64  ? 51   GLY A HA3  1 
ATOM   782  N  N    . GLY A 1 52 ? 18.832 -4.769  25.425 1.00 9.65   ? 52   GLY A N    1 
ATOM   783  C  CA   . GLY A 1 52 ? 19.328 -4.364  26.697 1.00 9.57   ? 52   GLY A CA   1 
ATOM   784  C  C    . GLY A 1 52 ? 20.747 -3.820  26.652 1.00 7.89   ? 52   GLY A C    1 
ATOM   785  O  O    . GLY A 1 52 ? 21.240 -3.450  25.577 1.00 9.61   ? 52   GLY A O    1 
ATOM   786  H  H    . GLY A 1 52 ? 18.867 -4.203  24.752 1.00 11.57  ? 52   GLY A H    1 
ATOM   787  H  HA2  . GLY A 1 52 ? 18.730 -3.666  27.066 1.00 11.49  ? 52   GLY A HA2  1 
ATOM   788  H  HA3  . GLY A 1 52 ? 19.302 -5.139  27.313 1.00 11.49  ? 52   GLY A HA3  1 
ATOM   789  N  N    . PHE A 1 53 ? 21.392 -3.712  27.830 1.00 10.37  ? 53   PHE A N    1 
ATOM   790  C  CA   . PHE A 1 53 ? 22.720 -3.096  28.005 1.00 9.20   ? 53   PHE A CA   1 
ATOM   791  C  C    . PHE A 1 53 ? 23.874 -4.098  28.010 1.00 10.07  ? 53   PHE A C    1 
ATOM   792  O  O    . PHE A 1 53 ? 23.697 -5.242  28.468 1.00 10.41  ? 53   PHE A O    1 
ATOM   793  C  CB   . PHE A 1 53 ? 22.713 -2.236  29.290 1.00 9.92   ? 53   PHE A CB   1 
ATOM   794  C  CG   . PHE A 1 53 ? 21.961 -0.933  29.093 1.00 11.54  ? 53   PHE A CG   1 
ATOM   795  C  CD1  . PHE A 1 53 ? 20.570 -0.857  29.152 1.00 15.02  ? 53   PHE A CD1  1 
ATOM   796  C  CD2  . PHE A 1 53 ? 22.654 0.240   28.810 1.00 15.35  ? 53   PHE A CD2  1 
ATOM   797  C  CE1  . PHE A 1 53 ? 19.880 0.332   28.939 1.00 21.50  ? 53   PHE A CE1  1 
ATOM   798  C  CE2  . PHE A 1 53 ? 21.977 1.431   28.633 1.00 20.31  ? 53   PHE A CE2  1 
ATOM   799  C  CZ   . PHE A 1 53 ? 20.592 1.479   28.681 1.00 21.83  ? 53   PHE A CZ   1 
ATOM   800  H  H    . PHE A 1 53 ? 20.993 -4.033  28.545 1.00 12.45  ? 53   PHE A H    1 
ATOM   801  H  HA   . PHE A 1 53 ? 22.866 -2.477  27.233 1.00 11.04  ? 53   PHE A HA   1 
ATOM   802  H  HB2  . PHE A 1 53 ? 22.290 -2.749  30.023 1.00 11.91  ? 53   PHE A HB2  1 
ATOM   803  H  HB3  . PHE A 1 53 ? 23.646 -2.038  29.555 1.00 11.91  ? 53   PHE A HB3  1 
ATOM   804  H  HD1  . PHE A 1 53 ? 20.076 -1.645  29.345 1.00 18.02  ? 53   PHE A HD1  1 
ATOM   805  H  HD2  . PHE A 1 53 ? 23.601 0.222   28.739 1.00 18.42  ? 53   PHE A HD2  1 
ATOM   806  H  HE1  . PHE A 1 53 ? 18.931 0.351   28.972 1.00 25.80  ? 53   PHE A HE1  1 
ATOM   807  H  HE2  . PHE A 1 53 ? 22.467 2.229   28.475 1.00 24.37  ? 53   PHE A HE2  1 
ATOM   808  H  HZ   . PHE A 1 53 ? 20.137 2.300   28.537 1.00 26.20  ? 53   PHE A HZ   1 
ATOM   809  N  N    . ILE A 1 54 ? 25.027 -3.696  27.475 1.00 9.54   ? 54   ILE A N    1 
ATOM   810  C  CA   . ILE A 1 54 ? 26.279 -4.426  27.479 1.00 9.34   ? 54   ILE A CA   1 
ATOM   811  C  C    . ILE A 1 54 ? 27.431 -3.515  27.965 1.00 8.79   ? 54   ILE A C    1 
ATOM   812  O  O    . ILE A 1 54 ? 27.335 -2.289  27.893 1.00 10.64  ? 54   ILE A O    1 
ATOM   813  C  CB   . ILE A 1 54 ? 26.607 -4.993  26.090 1.00 8.81   ? 54   ILE A CB   1 
ATOM   814  C  CG1  . ILE A 1 54 ? 26.847 -3.949  25.006 1.00 8.57   ? 54   ILE A CG1  1 
ATOM   815  C  CG2  . ILE A 1 54 ? 25.550 -6.019  25.610 1.00 10.56  ? 54   ILE A CG2  1 
ATOM   816  C  CD1  . ILE A 1 54 ? 27.499 -4.450  23.730 1.00 9.62   ? 54   ILE A CD1  1 
ATOM   817  H  H    . ILE A 1 54 ? 25.029 -2.910  27.080 1.00 11.45  ? 54   ILE A H    1 
ATOM   818  H  HA   . ILE A 1 54 ? 26.194 -5.191  28.118 1.00 11.21  ? 54   ILE A HA   1 
ATOM   819  H  HB   . ILE A 1 54 ? 27.465 -5.498  26.188 1.00 10.57  ? 54   ILE A HB   1 
ATOM   820  H  HG12 . ILE A 1 54 ? 25.977 -3.540  24.771 1.00 10.29  ? 54   ILE A HG12 1 
ATOM   821  H  HG13 . ILE A 1 54 ? 27.417 -3.234  25.385 1.00 10.29  ? 54   ILE A HG13 1 
ATOM   822  H  HG21 . ILE A 1 54 ? 25.817 -6.380  24.739 1.00 15.83  ? 54   ILE A HG21 1 
ATOM   823  H  HG22 . ILE A 1 54 ? 24.679 -5.577  25.527 1.00 15.83  ? 54   ILE A HG22 1 
ATOM   824  H  HG23 . ILE A 1 54 ? 25.486 -6.750  26.260 1.00 15.83  ? 54   ILE A HG23 1 
ATOM   825  H  HD11 . ILE A 1 54 ? 27.618 -3.702  23.109 1.00 14.43  ? 54   ILE A HD11 1 
ATOM   826  H  HD12 . ILE A 1 54 ? 26.927 -5.130  23.317 1.00 14.43  ? 54   ILE A HD12 1 
ATOM   827  H  HD13 . ILE A 1 54 ? 28.372 -4.842  23.941 1.00 14.43  ? 54   ILE A HD13 1 
ATOM   828  N  N    . LYS A 1 55 ? 28.503 -4.120  28.392 1.00 9.92   ? 55   LYS A N    1 
ATOM   829  C  CA   . LYS A 1 55 ? 29.783 -3.538  28.747 1.00 10.60  ? 55   LYS A CA   1 
ATOM   830  C  C    . LYS A 1 55 ? 30.722 -3.498  27.514 1.00 9.18   ? 55   LYS A C    1 
ATOM   831  O  O    . LYS A 1 55 ? 30.825 -4.505  26.813 1.00 10.23  ? 55   LYS A O    1 
ATOM   832  C  CB   . LYS A 1 55 ? 30.493 -4.266  29.899 1.00 11.07  ? 55   LYS A CB   1 
ATOM   833  C  CG   . LYS A 1 55 ? 29.754 -4.251  31.239 1.00 13.45  ? 55   LYS A CG   1 
ATOM   834  C  CD   . LYS A 1 55 ? 30.319 -5.164  32.319 1.00 24.27  ? 55   LYS A CD   1 
ATOM   835  C  CE   . LYS A 1 55 ? 31.661 -4.631  32.795 1.00 40.66  ? 55   LYS A CE   1 
ATOM   836  N  NZ   . LYS A 1 55 ? 32.250 -5.590  33.774 0.75 31.63  ? 55   LYS A NZ   1 
ATOM   837  H  H    . LYS A 1 55 ? 28.443 -4.994  28.476 1.00 11.90  ? 55   LYS A H    1 
ATOM   838  H  HA   . LYS A 1 55 ? 29.620 -2.595  29.036 1.00 12.72  ? 55   LYS A HA   1 
ATOM   839  H  HB2  . LYS A 1 55 ? 30.639 -5.208  29.632 1.00 13.28  ? 55   LYS A HB2  1 
ATOM   840  H  HB3  . LYS A 1 55 ? 31.384 -3.853  30.029 1.00 13.28  ? 55   LYS A HB3  1 
ATOM   841  H  HG2  . LYS A 1 55 ? 29.754 -3.323  31.584 1.00 16.13  ? 55   LYS A HG2  1 
ATOM   842  H  HG3  . LYS A 1 55 ? 28.811 -4.507  31.077 1.00 16.13  ? 55   LYS A HG3  1 
ATOM   843  H  HD2  . LYS A 1 55 ? 29.689 -5.210  33.081 1.00 29.13  ? 55   LYS A HD2  1 
ATOM   844  H  HD3  . LYS A 1 55 ? 30.433 -6.078  31.957 1.00 29.13  ? 55   LYS A HD3  1 
ATOM   845  H  HE2  . LYS A 1 55 ? 32.272 -4.521  32.024 1.00 48.80  ? 55   LYS A HE2  1 
ATOM   846  H  HE3  . LYS A 1 55 ? 31.539 -3.747  33.223 1.00 48.80  ? 55   LYS A HE3  1 
ATOM   847  H  HZ1  . LYS A 1 55 ? 33.000 -5.227  34.142 0.75 47.45  ? 55   LYS A HZ1  1 
ATOM   848  H  HZ2  . LYS A 1 55 ? 32.466 -6.365  33.348 0.75 47.45  ? 55   LYS A HZ2  1 
ATOM   849  H  HZ3  . LYS A 1 55 ? 31.644 -5.764  34.431 0.75 47.45  ? 55   LYS A HZ3  1 
ATOM   850  N  N    . VAL A 1 56 ? 31.353 -2.361  27.278 1.00 8.64   ? 56   VAL A N    1 
ATOM   851  C  CA   . VAL A 1 56 ? 32.281 -2.146  26.165 1.00 8.33   ? 56   VAL A CA   1 
ATOM   852  C  C    . VAL A 1 56 ? 33.523 -1.386  26.645 1.00 8.96   ? 56   VAL A C    1 
ATOM   853  O  O    . VAL A 1 56 ? 33.538 -0.823  27.732 1.00 11.14  ? 56   VAL A O    1 
ATOM   854  C  CB   . VAL A 1 56 ? 31.665 -1.420  24.939 1.00 9.53   ? 56   VAL A CB   1 
ATOM   855  C  CG1  . VAL A 1 56 ? 30.469 -2.185  24.346 1.00 10.40  ? 56   VAL A CG1  1 
ATOM   856  C  CG2  . VAL A 1 56 ? 31.211 -0.005  25.282 1.00 12.50  ? 56   VAL A CG2  1 
ATOM   857  H  H    . VAL A 1 56 ? 31.206 -1.688  27.826 1.00 10.37  ? 56   VAL A H    1 
ATOM   858  H  HA   . VAL A 1 56 ? 32.586 -3.046  25.854 1.00 10.00  ? 56   VAL A HA   1 
ATOM   859  H  HB   . VAL A 1 56 ? 32.370 -1.355  24.233 1.00 11.44  ? 56   VAL A HB   1 
ATOM   860  H  HG11 . VAL A 1 56 ? 30.753 -3.086  24.086 1.00 15.60  ? 56   VAL A HG11 1 
ATOM   861  H  HG12 . VAL A 1 56 ? 30.134 -1.708  23.558 1.00 15.60  ? 56   VAL A HG12 1 
ATOM   862  H  HG13 . VAL A 1 56 ? 29.757 -2.248  25.016 1.00 15.60  ? 56   VAL A HG13 1 
ATOM   863  H  HG21 . VAL A 1 56 ? 31.960 0.493   25.671 1.00 18.75  ? 56   VAL A HG21 1 
ATOM   864  H  HG22 . VAL A 1 56 ? 30.475 -0.045  25.928 1.00 18.75  ? 56   VAL A HG22 1 
ATOM   865  H  HG23 . VAL A 1 56 ? 30.907 0.447   24.467 1.00 18.75  ? 56   VAL A HG23 1 
ATOM   866  N  N    . ARG A 1 57 ? 34.594 -1.411  25.843 1.00 8.14   ? 57   ARG A N    1 
ATOM   867  C  CA   . ARG A 1 57 ? 35.782 -0.606  26.053 1.00 8.06   ? 57   ARG A CA   1 
ATOM   868  C  C    . ARG A 1 57 ? 35.731 0.592   25.111 1.00 8.52   ? 57   ARG A C    1 
ATOM   869  O  O    . ARG A 1 57 ? 35.525 0.404   23.903 1.00 9.28   ? 57   ARG A O    1 
ATOM   870  C  CB   . ARG A 1 57 ? 37.070 -1.414  25.818 1.00 9.65   ? 57   ARG A CB   1 
ATOM   871  C  CG   . ARG A 1 57 ? 37.144 -2.739  26.643 1.00 10.42  ? 57   ARG A CG   1 
ATOM   872  C  CD   . ARG A 1 57 ? 38.534 -3.361  26.630 1.00 11.08  ? 57   ARG A CD   1 
ATOM   873  N  NE   . ARG A 1 57 ? 39.164 -3.566  25.351 1.00 10.66  ? 57   ARG A NE   1 
ATOM   874  C  CZ   . ARG A 1 57 ? 38.953 -4.635  24.589 1.00 11.34  ? 57   ARG A CZ   1 
ATOM   875  N  NH1  . ARG A 1 57 ? 38.126 -5.593  24.923 1.00 16.08  ? 57   ARG A NH1  1 
ATOM   876  N  NH2  . ARG A 1 57 ? 39.616 -4.670  23.422 1.00 15.83  ? 57   ARG A NH2  1 
ATOM   877  H  H    . ARG A 1 57 ? 34.576 -1.947  25.145 1.00 9.77   ? 57   ARG A H    1 
ATOM   878  H  HA   . ARG A 1 57 ? 35.780 -0.273  26.996 1.00 9.67   ? 57   ARG A HA   1 
ATOM   879  H  HB2  . ARG A 1 57 ? 37.137 -1.633  24.855 1.00 11.58  ? 57   ARG A HB2  1 
ATOM   880  H  HB3  . ARG A 1 57 ? 37.848 -0.848  26.052 1.00 11.58  ? 57   ARG A HB3  1 
ATOM   881  H  HG2  . ARG A 1 57 ? 36.882 -2.552  27.580 1.00 12.50  ? 57   ARG A HG2  1 
ATOM   882  H  HG3  . ARG A 1 57 ? 36.495 -3.388  26.272 1.00 12.50  ? 57   ARG A HG3  1 
ATOM   883  H  HD2  . ARG A 1 57 ? 39.130 -2.787  27.173 1.00 13.29  ? 57   ARG A HD2  1 
ATOM   884  H  HD3  . ARG A 1 57 ? 38.479 -4.239  27.085 1.00 13.29  ? 57   ARG A HD3  1 
ATOM   885  H  HE   . ARG A 1 57 ? 39.720 -2.950  25.058 1.00 12.80  ? 57   ARG A HE   1 
ATOM   886  H  HH11 . ARG A 1 57 ? 37.681 -5.546  25.681 1.00 19.29  ? 57   ARG A HH11 1 
ATOM   887  H  HH12 . ARG A 1 57 ? 38.014 -6.284  24.390 1.00 19.29  ? 57   ARG A HH12 1 
ATOM   888  H  HH21 . ARG A 1 57 ? 39.497 -5.344  22.869 1.00 19.00  ? 57   ARG A HH21 1 
ATOM   889  H  HH22 . ARG A 1 57 ? 40.169 -4.019  23.210 1.00 19.00  ? 57   ARG A HH22 1 
ATOM   890  N  N    . GLN A 1 58 ? 35.940 1.791   25.599 1.00 8.56   ? 58   GLN A N    1 
ATOM   891  C  CA   . GLN A 1 58 ? 35.915 3.036   24.845 1.00 7.73   ? 58   GLN A CA   1 
ATOM   892  C  C    . GLN A 1 58 ? 37.331 3.554   24.544 1.00 8.69   ? 58   GLN A C    1 
ATOM   893  O  O    . GLN A 1 58 ? 38.061 3.950   25.451 1.00 8.54   ? 58   GLN A O    1 
ATOM   894  C  CB   . GLN A 1 58 ? 35.144 4.136   25.587 1.00 10.25  ? 58   GLN A CB   1 
ATOM   895  C  CG   . GLN A 1 58 ? 35.052 5.453   24.831 1.00 10.94  ? 58   GLN A CG   1 
ATOM   896  C  CD   . GLN A 1 58 ? 34.315 6.553   25.562 1.00 11.67  ? 58   GLN A CD   1 
ATOM   897  O  OE1  . GLN A 1 58 ? 33.459 6.305   26.399 1.00 16.52  ? 58   GLN A OE1  1 
ATOM   898  N  NE2  . GLN A 1 58 ? 34.616 7.810   25.239 1.00 13.22  ? 58   GLN A NE2  1 
ATOM   899  H  H    . GLN A 1 58 ? 36.110 1.848   26.461 1.00 10.27  ? 58   GLN A H    1 
ATOM   900  H  HA   . GLN A 1 58 ? 35.454 2.864   23.974 1.00 9.27   ? 58   GLN A HA   1 
ATOM   901  H  HB2  . GLN A 1 58 ? 34.227 3.811   25.771 1.00 12.30  ? 58   GLN A HB2  1 
ATOM   902  H  HB3  . GLN A 1 58 ? 35.585 4.300   26.458 1.00 12.30  ? 58   GLN A HB3  1 
ATOM   903  H  HG2  . GLN A 1 58 ? 35.970 5.767   24.632 1.00 13.12  ? 58   GLN A HG2  1 
ATOM   904  H  HG3  . GLN A 1 58 ? 34.599 5.290   23.967 1.00 13.12  ? 58   GLN A HG3  1 
ATOM   905  H  HE21 . GLN A 1 58 ? 34.197 8.477   25.631 1.00 15.86  ? 58   GLN A HE21 1 
ATOM   906  H  HE22 . GLN A 1 58 ? 35.235 7.972   24.635 1.00 15.86  ? 58   GLN A HE22 1 
ATOM   907  N  N    . TYR A 1 59 ? 37.653 3.613   23.238 1.00 8.33   ? 59   TYR A N    1 
ATOM   908  C  CA   . TYR A 1 59 ? 38.916 4.153   22.688 1.00 8.16   ? 59   TYR A CA   1 
ATOM   909  C  C    . TYR A 1 59 ? 38.616 5.453   21.942 1.00 7.99   ? 59   TYR A C    1 
ATOM   910  O  O    . TYR A 1 59 ? 37.739 5.444   21.062 1.00 9.82   ? 59   TYR A O    1 
ATOM   911  C  CB   . TYR A 1 59 ? 39.600 3.146   21.731 1.00 9.21   ? 59   TYR A CB   1 
ATOM   912  C  CG   . TYR A 1 59 ? 40.026 1.851   22.322 1.00 7.75   ? 59   TYR A CG   1 
ATOM   913  C  CD1  . TYR A 1 59 ? 39.103 0.789   22.481 1.00 8.92   ? 59   TYR A CD1  1 
ATOM   914  C  CD2  . TYR A 1 59 ? 41.342 1.625   22.737 1.00 8.06   ? 59   TYR A CD2  1 
ATOM   915  C  CE1  . TYR A 1 59 ? 39.476 -0.429  23.026 1.00 9.61   ? 59   TYR A CE1  1 
ATOM   916  C  CE2  . TYR A 1 59 ? 41.703 0.396   23.279 1.00 10.05  ? 59   TYR A CE2  1 
ATOM   917  C  CZ   . TYR A 1 59 ? 40.766 -0.632  23.419 1.00 11.46  ? 59   TYR A CZ   1 
ATOM   918  O  OH   . TYR A 1 59 ? 41.136 -1.852  23.980 1.00 13.24  ? 59   TYR A OH   1 
ATOM   919  H  H    . TYR A 1 59 ? 37.062 3.306   22.663 1.00 10.00  ? 59   TYR A H    1 
ATOM   920  H  HA   . TYR A 1 59 ? 39.538 4.352   23.445 1.00 9.80   ? 59   TYR A HA   1 
ATOM   921  H  HB2  . TYR A 1 59 ? 38.975 2.955   20.987 1.00 11.05  ? 59   TYR A HB2  1 
ATOM   922  H  HB3  . TYR A 1 59 ? 40.397 3.585   21.341 1.00 11.05  ? 59   TYR A HB3  1 
ATOM   923  H  HD1  . TYR A 1 59 ? 38.203 0.915   22.207 1.00 10.71  ? 59   TYR A HD1  1 
ATOM   924  H  HD2  . TYR A 1 59 ? 41.991 2.313   22.649 1.00 9.67   ? 59   TYR A HD2  1 
ATOM   925  H  HE1  . TYR A 1 59 ? 38.834 -1.122  23.125 1.00 11.53  ? 59   TYR A HE1  1 
ATOM   926  H  HE2  . TYR A 1 59 ? 42.599 0.253   23.558 1.00 12.06  ? 59   TYR A HE2  1 
ATOM   927  H  HH   . TYR A 1 59 ? 41.952 -1.832  24.179 1.00 19.86  ? 59   TYR A HH   1 
ATOM   928  N  N    . ASP A 1 60 ? 39.258 6.562   22.297 1.00 8.61   ? 60   ASP A N    1 
ATOM   929  C  CA   . ASP A 1 60 ? 39.026 7.846   21.686 1.00 8.76   ? 60   ASP A CA   1 
ATOM   930  C  C    . ASP A 1 60 ? 40.064 8.195   20.603 1.00 9.04   ? 60   ASP A C    1 
ATOM   931  O  O    . ASP A 1 60 ? 41.198 7.738   20.637 1.00 9.68   ? 60   ASP A O    1 
ATOM   932  C  CB   . ASP A 1 60 ? 38.957 8.960   22.758 1.00 11.76  ? 60   ASP A CB   1 
ATOM   933  C  CG   . ASP A 1 60 ? 37.759 8.767   23.668 1.00 12.47  ? 60   ASP A CG   1 
ATOM   934  O  OD1  . ASP A 1 60 ? 36.656 8.374   23.231 1.00 13.34  ? 60   ASP A OD1  1 
ATOM   935  O  OD2  . ASP A 1 60 ? 37.930 9.064   24.874 1.00 18.57  ? 60   ASP A OD2  1 
ATOM   936  H  H    . ASP A 1 60 ? 39.857 6.509   22.939 1.00 10.34  ? 60   ASP A H    1 
ATOM   937  H  HA   . ASP A 1 60 ? 38.132 7.806   21.240 1.00 10.52  ? 60   ASP A HA   1 
ATOM   938  H  HB2  . ASP A 1 60 ? 39.786 8.949   23.298 1.00 14.12  ? 60   ASP A HB2  1 
ATOM   939  H  HB3  . ASP A 1 60 ? 38.894 9.842   22.313 1.00 14.12  ? 60   ASP A HB3  1 
ATOM   940  N  N    . GLN A 1 61 ? 39.665 9.006   19.625 1.00 9.63   ? 61   GLN A N    1 
ATOM   941  C  CA   . GLN A 1 61 ? 40.558 9.604   18.647 1.00 8.60   ? 61   GLN A CA   1 
ATOM   942  C  C    . GLN A 1 61 ? 41.289 8.537   17.810 1.00 10.63  ? 61   GLN A C    1 
ATOM   943  O  O    . GLN A 1 61 ? 42.514 8.632   17.595 1.00 11.65  ? 61   GLN A O    1 
ATOM   944  C  CB   . GLN A 1 61 ? 41.511 10.611  19.264 1.00 11.60  ? 61   GLN A CB   1 
ATOM   945  C  CG   . GLN A 1 61 ? 41.710 11.869  18.388 1.00 27.96  ? 61   GLN A CG   1 
ATOM   946  C  CD   . GLN A 1 61 ? 42.574 12.914  19.056 1.00 24.33  ? 61   GLN A CD   1 
ATOM   947  O  OE1  . GLN A 1 61 ? 43.442 13.599  18.371 1.00 17.53  ? 61   GLN A OE1  1 
ATOM   948  N  NE2  . GLN A 1 61 ? 42.340 13.154  20.347 1.00 28.53  ? 61   GLN A NE2  1 
ATOM   949  H  H    . GLN A 1 61 ? 38.806 9.191   19.567 1.00 11.56  ? 61   GLN A H    1 
ATOM   950  H  HA   . GLN A 1 61 ? 39.980 10.115  18.011 1.00 10.32  ? 61   GLN A HA   1 
ATOM   951  H  HB2  . GLN A 1 61 ? 41.161 10.886  20.148 1.00 13.92  ? 61   GLN A HB2  1 
ATOM   952  H  HB3  . GLN A 1 61 ? 42.389 10.177  19.408 1.00 13.92  ? 61   GLN A HB3  1 
ATOM   953  H  HG2  . GLN A 1 61 ? 42.128 11.604  17.531 1.00 33.56  ? 61   GLN A HG2  1 
ATOM   954  H  HG3  . GLN A 1 61 ? 40.825 12.264  18.184 1.00 33.56  ? 61   GLN A HG3  1 
ATOM   955  H  HE21 . GLN A 1 61 ? 42.779 13.793  20.763 1.00 34.23  ? 61   GLN A HE21 1 
ATOM   956  H  HE22 . GLN A 1 61 ? 41.746 12.672  20.783 1.00 34.23  ? 61   GLN A HE22 1 
ATOM   957  N  N    . ILE A 1 62 ? 40.543 7.557   17.304 1.00 7.87   ? 62   ILE A N    1 
ATOM   958  C  CA   . ILE A 1 62 ? 41.028 6.412   16.480 1.00 8.02   ? 62   ILE A CA   1 
ATOM   959  C  C    . ILE A 1 62 ? 40.767 6.683   14.988 1.00 8.95   ? 62   ILE A C    1 
ATOM   960  O  O    . ILE A 1 62 ? 39.575 6.872   14.637 1.00 8.09   ? 62   ILE A O    1 
ATOM   961  C  CB   . ILE A 1 62 ? 40.346 5.111   16.922 1.00 7.94   ? 62   ILE A CB   1 
ATOM   962  C  CG1  . ILE A 1 62 ? 40.547 4.765   18.408 1.00 9.10   ? 62   ILE A CG1  1 
ATOM   963  C  CG2  . ILE A 1 62 ? 40.791 3.926   16.030 1.00 8.76   ? 62   ILE A CG2  1 
ATOM   964  C  CD1  . ILE A 1 62 ? 41.977 4.568   18.835 1.00 10.36  ? 62   ILE A CD1  1 
ATOM   965  H  H    . ILE A 1 62 ? 39.680 7.587   17.472 1.00 9.44   ? 62   ILE A H    1 
ATOM   966  H  HA   . ILE A 1 62 ? 42.013 6.317   16.618 1.00 9.62   ? 62   ILE A HA   1 
ATOM   967  H  HB   . ILE A 1 62 ? 39.364 5.232   16.780 1.00 9.52   ? 62   ILE A HB   1 
ATOM   968  H  HG12 . ILE A 1 62 ? 40.154 5.490   18.955 1.00 10.91  ? 62   ILE A HG12 1 
ATOM   969  H  HG13 . ILE A 1 62 ? 40.044 3.936   18.607 1.00 10.91  ? 62   ILE A HG13 1 
ATOM   970  H  HG21 . ILE A 1 62 ? 40.345 3.106   16.329 1.00 13.14  ? 62   ILE A HG21 1 
ATOM   971  H  HG22 . ILE A 1 62 ? 41.762 3.812   16.098 1.00 13.14  ? 62   ILE A HG22 1 
ATOM   972  H  HG23 . ILE A 1 62 ? 40.548 4.109   15.098 1.00 13.14  ? 62   ILE A HG23 1 
ATOM   973  H  HD11 . ILE A 1 62 ? 42.005 4.353   19.791 1.00 15.53  ? 62   ILE A HD11 1 
ATOM   974  H  HD12 . ILE A 1 62 ? 42.483 5.391   18.671 1.00 15.53  ? 62   ILE A HD12 1 
ATOM   975  H  HD13 . ILE A 1 62 ? 42.373 3.832   18.323 1.00 15.53  ? 62   ILE A HD13 1 
ATOM   976  N  N    . PRO A 1 63 ? 41.770 6.710   14.103 1.00 7.91   ? 63   PRO A N    1 
ATOM   977  C  CA   . PRO A 1 63 ? 41.523 6.776   12.673 1.00 7.98   ? 63   PRO A CA   1 
ATOM   978  C  C    . PRO A 1 63 ? 40.836 5.539   12.103 1.00 8.12   ? 63   PRO A C    1 
ATOM   979  O  O    . PRO A 1 63 ? 41.205 4.391   12.436 1.00 8.69   ? 63   PRO A O    1 
ATOM   980  C  CB   . PRO A 1 63 ? 42.941 6.962   12.072 1.00 9.19   ? 63   PRO A CB   1 
ATOM   981  C  CG   . PRO A 1 63 ? 43.743 7.551   13.152 1.00 8.48   ? 63   PRO A CG   1 
ATOM   982  C  CD   . PRO A 1 63 ? 43.233 6.850   14.374 1.00 8.30   ? 63   PRO A CD   1 
ATOM   983  H  HA   . PRO A 1 63 ? 40.969 7.584   12.470 1.00 9.57   ? 63   PRO A HA   1 
ATOM   984  H  HB2  . PRO A 1 63 ? 43.319 6.091   11.791 1.00 11.03  ? 63   PRO A HB2  1 
ATOM   985  H  HB3  . PRO A 1 63 ? 42.913 7.565   11.288 1.00 11.03  ? 63   PRO A HB3  1 
ATOM   986  H  HG2  . PRO A 1 63 ? 44.708 7.376   13.016 1.00 10.17  ? 63   PRO A HG2  1 
ATOM   987  H  HG3  . PRO A 1 63 ? 43.596 8.528   13.213 1.00 10.17  ? 63   PRO A HG3  1 
ATOM   988  H  HD2  . PRO A 1 63 ? 43.662 5.965   14.482 1.00 9.96   ? 63   PRO A HD2  1 
ATOM   989  H  HD3  . PRO A 1 63 ? 43.395 7.390   15.188 1.00 9.96   ? 63   PRO A HD3  1 
ATOM   990  N  N    . VAL A 1 64 ? 39.840 5.745   11.224 1.00 7.86   ? 64   VAL A N    1 
ATOM   991  C  CA   . VAL A 1 64 ? 39.104 4.660   10.551 1.00 7.97   ? 64   VAL A CA   1 
ATOM   992  C  C    . VAL A 1 64 ? 38.866 5.095   9.116  1.00 8.08   ? 64   VAL A C    1 
ATOM   993  O  O    . VAL A 1 64 ? 38.311 6.169   8.942  1.00 10.84  ? 64   VAL A O    1 
ATOM   994  C  CB   . VAL A 1 64 ? 37.743 4.292   11.206 1.00 8.90   ? 64   VAL A CB   1 
ATOM   995  C  CG1  . VAL A 1 64 ? 37.097 3.101   10.524 1.00 10.60  ? 64   VAL A CG1  1 
ATOM   996  C  CG2  . VAL A 1 64 ? 37.867 4.060   12.737 1.00 10.09  ? 64   VAL A CG2  1 
ATOM   997  H  H    . VAL A 1 64 ? 39.614 6.575   11.039 1.00 9.43   ? 64   VAL A H    1 
ATOM   998  H  HA   . VAL A 1 64 ? 39.682 3.844   10.542 1.00 9.57   ? 64   VAL A HA   1 
ATOM   999  H  HB   . VAL A 1 64 ? 37.132 5.073   11.075 1.00 10.68  ? 64   VAL A HB   1 
ATOM   1000 H  HG11 . VAL A 1 64 ? 36.239 2.903   10.955 1.00 15.89  ? 64   VAL A HG11 1 
ATOM   1001 H  HG12 . VAL A 1 64 ? 37.687 2.322   10.599 1.00 15.89  ? 64   VAL A HG12 1 
ATOM   1002 H  HG13 . VAL A 1 64 ? 36.947 3.308   9.578  1.00 15.89  ? 64   VAL A HG13 1 
ATOM   1003 H  HG21 . VAL A 1 64 ? 38.302 4.834   13.151 1.00 15.13  ? 64   VAL A HG21 1 
ATOM   1004 H  HG22 . VAL A 1 64 ? 38.403 3.256   12.903 1.00 15.13  ? 64   VAL A HG22 1 
ATOM   1005 H  HG23 . VAL A 1 64 ? 36.973 3.942   13.123 1.00 15.13  ? 64   VAL A HG23 1 
ATOM   1006 N  N    . GLU A 1 65 ? 39.235 4.326   8.111  1.00 8.55   ? 65   GLU A N    1 
ATOM   1007 C  CA   . GLU A 1 65 ? 38.918 4.602   6.725  1.00 8.92   ? 65   GLU A CA   1 
ATOM   1008 C  C    . GLU A 1 65 ? 37.703 3.762   6.343  1.00 10.00  ? 65   GLU A C    1 
ATOM   1009 O  O    . GLU A 1 65 ? 37.670 2.554   6.550  1.00 12.18  ? 65   GLU A O    1 
ATOM   1010 C  CB   . GLU A 1 65 ? 40.155 4.356   5.806  1.00 14.09  ? 65   GLU A CB   1 
ATOM   1011 C  CG   . GLU A 1 65 ? 39.812 4.844   4.379  1.00 33.20  ? 65   GLU A CG   1 
ATOM   1012 C  CD   . GLU A 1 65 ? 40.875 4.405   3.392  1.00 68.69  ? 65   GLU A CD   1 
ATOM   1013 O  OE1  . GLU A 1 65 ? 41.871 5.168   3.280  1.00 93.81  ? 65   GLU A OE1  1 
ATOM   1014 O  OE2  . GLU A 1 65 ? 40.761 3.346   2.723  1.00 67.39  ? 65   GLU A OE2  1 
ATOM   1015 H  H    . GLU A 1 65 ? 39.701 3.602   8.293  1.00 10.26  ? 65   GLU A H    1 
ATOM   1016 H  HA   . GLU A 1 65 ? 38.663 5.567   6.652  1.00 10.70  ? 65   GLU A HA   1 
ATOM   1017 N  N    . ILE A 1 66 ? 36.654 4.423   5.836  1.00 9.32   ? 66   ILE A N    1 
ATOM   1018 C  CA   . ILE A 1 66 ? 35.339 3.800   5.574  1.00 8.93   ? 66   ILE A CA   1 
ATOM   1019 C  C    . ILE A 1 66 ? 34.984 3.989   4.119  1.00 9.69   ? 66   ILE A C    1 
ATOM   1020 O  O    . ILE A 1 66 ? 34.713 5.106   3.713  1.00 10.79  ? 66   ILE A O    1 
ATOM   1021 C  CB   . ILE A 1 66 ? 34.224 4.435   6.493  1.00 9.49   ? 66   ILE A CB   1 
ATOM   1022 C  CG1  . ILE A 1 66 ? 34.581 4.343   7.983  1.00 11.49  ? 66   ILE A CG1  1 
ATOM   1023 C  CG2  . ILE A 1 66 ? 32.871 3.873   6.116  1.00 11.70  ? 66   ILE A CG2  1 
ATOM   1024 C  CD1  . ILE A 1 66 ? 33.852 5.364   8.866  1.00 11.89  ? 66   ILE A CD1  1 
ATOM   1025 H  H    . ILE A 1 66 ? 36.753 5.277   5.649  1.00 11.18  ? 66   ILE A H    1 
ATOM   1026 H  HA   . ILE A 1 66 ? 35.400 2.821   5.768  1.00 10.72  ? 66   ILE A HA   1 
ATOM   1027 H  HB   . ILE A 1 66 ? 34.196 5.409   6.270  1.00 11.39  ? 66   ILE A HB   1 
ATOM   1028 H  HG12 . ILE A 1 66 ? 34.366 3.432   8.306  1.00 13.79  ? 66   ILE A HG12 1 
ATOM   1029 H  HG13 . ILE A 1 66 ? 35.557 4.474   8.084  1.00 13.79  ? 66   ILE A HG13 1 
ATOM   1030 H  HG21 . ILE A 1 66 ? 32.730 3.980   5.152  1.00 17.54  ? 66   ILE A HG21 1 
ATOM   1031 H  HG22 . ILE A 1 66 ? 32.170 4.353   6.604  1.00 17.54  ? 66   ILE A HG22 1 
ATOM   1032 H  HG23 . ILE A 1 66 ? 32.837 2.921   6.347  1.00 17.54  ? 66   ILE A HG23 1 
ATOM   1033 H  HD11 . ILE A 1 66 ? 34.105 5.225   9.802  1.00 17.84  ? 66   ILE A HD11 1 
ATOM   1034 H  HD12 . ILE A 1 66 ? 32.884 5.248   8.768  1.00 17.84  ? 66   ILE A HD12 1 
ATOM   1035 H  HD13 . ILE A 1 66 ? 34.102 6.271   8.591  1.00 17.84  ? 66   ILE A HD13 1 
ATOM   1036 N  N    . CYS A 1 67 ? 35.017 2.905   3.325  1.00 12.35  ? 67   CYS A N    1 
ATOM   1037 C  CA   . CYS A 1 67 ? 34.665 2.950   1.896  1.00 15.63  ? 67   CYS A CA   1 
ATOM   1038 C  C    . CYS A 1 67 ? 35.479 4.070   1.253  1.00 15.93  ? 67   CYS A C    1 
ATOM   1039 O  O    . CYS A 1 67 ? 34.981 4.860   0.479  1.00 20.60  ? 67   CYS A O    1 
ATOM   1040 C  CB   . CYS A 1 67 ? 33.093 3.017   1.777  1.00 15.84  ? 67   CYS A CB   1 
ATOM   1041 S  SG   . CYS A 1 67 ? 32.434 2.732   0.162  1.00 20.52  ? 67   CYS A SG   1 
ATOM   1042 H  H    . CYS A 1 67 ? 35.259 2.134   3.674  1.00 14.82  ? 67   CYS A H    1 
ATOM   1043 H  HA   . CYS A 1 67 ? 34.961 2.088   1.485  1.00 18.75  ? 67   CYS A HA   1 
ATOM   1044 N  N    . GLY A 1 68 ? 36.769 4.244   1.612  1.00 15.28  ? 68   GLY A N    1 
ATOM   1045 C  CA   . GLY A 1 68 ? 37.618 5.265   1.042  1.00 17.35  ? 68   GLY A CA   1 
ATOM   1046 C  C    . GLY A 1 68 ? 37.652 6.632   1.693  1.00 16.47  ? 68   GLY A C    1 
ATOM   1047 O  O    . GLY A 1 68 ? 38.432 7.521   1.262  1.00 23.06  ? 68   GLY A O    1 
ATOM   1048 H  H    . GLY A 1 68 ? 37.109 3.711   2.223  1.00 18.34  ? 68   GLY A H    1 
ATOM   1049 H  HA2  . GLY A 1 68 ? 38.544 4.914   1.033  1.00 20.82  ? 68   GLY A HA2  1 
ATOM   1050 H  HA3  . GLY A 1 68 ? 37.346 5.389   0.098  1.00 20.82  ? 68   GLY A HA3  1 
ATOM   1051 N  N    . HIS A 1 69 ? 36.853 6.928   2.695  1.00 12.47  ? 69   HIS A N    1 
ATOM   1052 C  CA   . HIS A 1 69 ? 36.702 8.232   3.348  1.00 11.49  ? 69   HIS A CA   1 
ATOM   1053 C  C    . HIS A 1 69 ? 37.281 8.160   4.748  1.00 12.06  ? 69   HIS A C    1 
ATOM   1054 O  O    . HIS A 1 69 ? 36.993 7.232   5.492  1.00 13.87  ? 69   HIS A O    1 
ATOM   1055 C  CB   . HIS A 1 69 ? 35.214 8.685   3.420  1.00 11.66  ? 69   HIS A CB   1 
ATOM   1056 C  CG   . HIS A 1 69 ? 34.593 8.889   2.065  1.00 13.38  ? 69   HIS A CG   1 
ATOM   1057 N  ND1  . HIS A 1 69 ? 34.284 10.142  1.629  1.00 18.79  ? 69   HIS A ND1  1 
ATOM   1058 C  CD2  . HIS A 1 69 ? 34.262 8.079   1.026  1.00 16.39  ? 69   HIS A CD2  1 
ATOM   1059 C  CE1  . HIS A 1 69 ? 33.779 10.118  0.405  1.00 24.60  ? 69   HIS A CE1  1 
ATOM   1060 N  NE2  . HIS A 1 69 ? 33.745 8.839   0.013  1.00 19.15  ? 69   HIS A NE2  1 
ATOM   1061 H  H    . HIS A 1 69 ? 36.355 6.273   3.008  1.00 14.96  ? 69   HIS A H    1 
ATOM   1062 H  HA   . HIS A 1 69 ? 37.217 8.911   2.825  1.00 13.79  ? 69   HIS A HA   1 
ATOM   1063 H  HB2  . HIS A 1 69 ? 34.693 8.003   3.913  1.00 13.99  ? 69   HIS A HB2  1 
ATOM   1064 H  HB3  . HIS A 1 69 ? 35.160 9.533   3.929  1.00 13.99  ? 69   HIS A HB3  1 
ATOM   1065 H  HD1  . HIS A 1 69 ? 34.404 10.875  2.101  1.00 22.54  ? 69   HIS A HD1  1 
ATOM   1066 H  HD2  . HIS A 1 69 ? 34.373 7.136   1.006  1.00 19.67  ? 69   HIS A HD2  1 
ATOM   1067 H  HE1  . HIS A 1 69 ? 33.494 10.870  -0.101 1.00 29.52  ? 69   HIS A HE1  1 
ATOM   1068 N  N    . LYS A 1 70 ? 38.058 9.167   5.139  1.00 12.39  ? 70   LYS A N    1 
ATOM   1069 C  CA   . LYS A 1 70 ? 38.687 9.236   6.438  1.00 11.76  ? 70   LYS A CA   1 
ATOM   1070 C  C    . LYS A 1 70 ? 37.825 9.778   7.548  1.00 11.09  ? 70   LYS A C    1 
ATOM   1071 O  O    . LYS A 1 70 ? 37.156 10.833  7.420  1.00 14.02  ? 70   LYS A O    1 
ATOM   1072 C  CB   . LYS A 1 70 ? 39.932 10.146  6.329  1.00 20.88  ? 70   LYS A CB   1 
ATOM   1073 H  H    . LYS A 1 70 ? 38.196 9.828   4.575  1.00 14.86  ? 70   LYS A H    1 
ATOM   1074 H  HA   . LYS A 1 70 ? 38.989 8.317   6.693  1.00 14.11  ? 70   LYS A HA   1 
ATOM   1075 H  HB2  . LYS A 1 70 ? 40.506 9.828   5.601  1.00 31.32  ? 70   LYS A HB2  1 
ATOM   1076 H  HB3  . LYS A 1 70 ? 40.431 10.120  7.172  1.00 31.32  ? 70   LYS A HB3  1 
ATOM   1077 N  N    . ALA A 1 71 ? 37.870 9.089   8.679  1.00 9.46   ? 71   ALA A N    1 
ATOM   1078 C  CA   . ALA A 1 71 ? 37.280 9.578   9.928  1.00 8.73   ? 71   ALA A CA   1 
ATOM   1079 C  C    . ALA A 1 71 ? 38.279 9.379   11.064 1.00 9.45   ? 71   ALA A C    1 
ATOM   1080 O  O    . ALA A 1 71 ? 39.224 8.546   10.969 1.00 9.50   ? 71   ALA A O    1 
ATOM   1081 C  CB   . ALA A 1 71 ? 35.997 8.781   10.225 1.00 9.02   ? 71   ALA A CB   1 
ATOM   1082 H  H    . ALA A 1 71 ? 38.271 8.306   8.680  1.00 11.35  ? 71   ALA A H    1 
ATOM   1083 H  HA   . ALA A 1 71 ? 37.061 10.550  9.839  1.00 10.48  ? 71   ALA A HA   1 
ATOM   1084 H  HB1  . ALA A 1 71 ? 35.356 8.909   9.495  1.00 13.53  ? 71   ALA A HB1  1 
ATOM   1085 H  HB2  . ALA A 1 71 ? 35.603 9.098   11.065 1.00 13.53  ? 71   ALA A HB2  1 
ATOM   1086 H  HB3  . ALA A 1 71 ? 36.215 7.829   10.305 1.00 13.53  ? 71   ALA A HB3  1 
ATOM   1087 N  N    . ILE A 1 72 ? 38.148 10.128  12.172 1.00 7.95   ? 72   ILE A N    1 
ATOM   1088 C  CA   . ILE A 1 72 ? 38.965 9.956   13.378 1.00 7.52   ? 72   ILE A CA   1 
ATOM   1089 C  C    . ILE A 1 72 ? 38.029 10.230  14.544 1.00 8.05   ? 72   ILE A C    1 
ATOM   1090 O  O    . ILE A 1 72 ? 37.514 11.348  14.706 1.00 8.83   ? 72   ILE A O    1 
ATOM   1091 C  CB   . ILE A 1 72 ? 40.192 10.897  13.417 1.00 7.79   ? 72   ILE A CB   1 
ATOM   1092 C  CG1  . ILE A 1 72 ? 41.080 10.888  12.199 1.00 8.25   ? 72   ILE A CG1  1 
ATOM   1093 C  CG2  . ILE A 1 72 ? 40.996 10.595  14.687 1.00 9.37   ? 72   ILE A CG2  1 
ATOM   1094 C  CD1  . ILE A 1 72 ? 42.257 11.869  12.168 1.00 9.38   ? 72   ILE A CD1  1 
ATOM   1095 H  H    . ILE A 1 72 ? 37.535 10.760  12.174 1.00 9.54   ? 72   ILE A H    1 
ATOM   1096 H  HA   . ILE A 1 72 ? 39.280 9.008   13.428 1.00 9.03   ? 72   ILE A HA   1 
ATOM   1097 H  HB   . ILE A 1 72 ? 39.840 11.829  13.512 1.00 9.35   ? 72   ILE A HB   1 
ATOM   1098 H  HG12 . ILE A 1 72 ? 41.444 9.973   12.095 1.00 9.91   ? 72   ILE A HG12 1 
ATOM   1099 H  HG13 . ILE A 1 72 ? 40.513 11.068  11.408 1.00 9.91   ? 72   ILE A HG13 1 
ATOM   1100 H  HG21 . ILE A 1 72 ? 40.401 10.626  15.465 1.00 14.06  ? 72   ILE A HG21 1 
ATOM   1101 H  HG22 . ILE A 1 72 ? 41.705 11.264  14.792 1.00 14.06  ? 72   ILE A HG22 1 
ATOM   1102 H  HG23 . ILE A 1 72 ? 41.396 9.703   14.616 1.00 14.06  ? 72   ILE A HG23 1 
ATOM   1103 H  HD11 . ILE A 1 72 ? 42.746 11.766  11.325 1.00 14.07  ? 72   ILE A HD11 1 
ATOM   1104 H  HD12 . ILE A 1 72 ? 42.858 11.683  12.919 1.00 14.07  ? 72   ILE A HD12 1 
ATOM   1105 H  HD13 . ILE A 1 72 ? 41.920 12.787  12.239 1.00 14.07  ? 72   ILE A HD13 1 
ATOM   1106 N  N    . GLY A 1 73 ? 37.747 9.209   15.344 1.00 7.48   ? 73   GLY A N    1 
ATOM   1107 C  CA   . GLY A 1 73 ? 36.817 9.390   16.490 1.00 8.59   ? 73   GLY A CA   1 
ATOM   1108 C  C    . GLY A 1 73 ? 36.756 8.166   17.400 1.00 7.58   ? 73   GLY A C    1 
ATOM   1109 O  O    . GLY A 1 73 ? 37.634 7.295   17.406 1.00 7.97   ? 73   GLY A O    1 
ATOM   1110 H  H    . GLY A 1 73 ? 38.112 8.422   15.196 1.00 8.98   ? 73   GLY A H    1 
ATOM   1111 H  HA2  . GLY A 1 73 ? 37.107 10.173  17.021 1.00 10.31  ? 73   GLY A HA2  1 
ATOM   1112 H  HA3  . GLY A 1 73 ? 35.910 9.579   16.142 1.00 10.31  ? 73   GLY A HA3  1 
ATOM   1113 N  N    . THR A 1 74 ? 35.694 8.142   18.205 1.00 7.79   ? 74   THR A N    1 
ATOM   1114 C  CA   . THR A 1 74 ? 35.553 7.161   19.267 1.00 7.81   ? 74   THR A CA   1 
ATOM   1115 C  C    . THR A 1 74 ? 35.098 5.810   18.653 1.00 8.21   ? 74   THR A C    1 
ATOM   1116 O  O    . THR A 1 74 ? 34.157 5.771   17.832 1.00 7.97   ? 74   THR A O    1 
ATOM   1117 C  CB   . THR A 1 74 ? 34.575 7.632   20.348 1.00 8.43   ? 74   THR A CB   1 
ATOM   1118 O  OG1  . THR A 1 74 ? 35.127 8.816   20.980 1.00 11.66  ? 74   THR A OG1  1 
ATOM   1119 C  CG2  . THR A 1 74 ? 34.307 6.566   21.375 1.00 8.92   ? 74   THR A CG2  1 
ATOM   1120 H  H    . THR A 1 74 ? 35.058 8.740   18.089 1.00 9.35   ? 74   THR A H    1 
ATOM   1121 H  HA   . THR A 1 74 ? 36.449 7.027   19.691 1.00 9.37   ? 74   THR A HA   1 
ATOM   1122 H  HB   . THR A 1 74 ? 33.710 7.878   19.910 1.00 10.12  ? 74   THR A HB   1 
ATOM   1123 H  HG1  . THR A 1 74 ? 35.219 8.677   21.803 1.00 17.49  ? 74   THR A HG1  1 
ATOM   1124 H  HG21 . THR A 1 74 ? 33.672 6.905   22.039 1.00 13.37  ? 74   THR A HG21 1 
ATOM   1125 H  HG22 . THR A 1 74 ? 35.146 6.323   21.819 1.00 13.37  ? 74   THR A HG22 1 
ATOM   1126 H  HG23 . THR A 1 74 ? 33.930 5.776   20.935 1.00 13.37  ? 74   THR A HG23 1 
ATOM   1127 N  N    . VAL A 1 75 ? 35.785 4.759   19.080 1.00 7.72   ? 75   VAL A N    1 
ATOM   1128 C  CA   . VAL A 1 75 ? 35.464 3.346   18.728 1.00 7.84   ? 75   VAL A CA   1 
ATOM   1129 C  C    . VAL A 1 75 ? 35.280 2.561   20.011 1.00 7.31   ? 75   VAL A C    1 
ATOM   1130 O  O    . VAL A 1 75 ? 36.149 2.573   20.891 1.00 8.56   ? 75   VAL A O    1 
ATOM   1131 C  CB   . VAL A 1 75 ? 36.585 2.785   17.806 1.00 8.24   ? 75   VAL A CB   1 
ATOM   1132 C  CG1  . VAL A 1 75 ? 36.347 1.295   17.588 1.00 9.04   ? 75   VAL A CG1  1 
ATOM   1133 C  CG2  . VAL A 1 75 ? 36.696 3.580   16.510 1.00 9.88   ? 75   VAL A CG2  1 
ATOM   1134 H  H    . VAL A 1 75 ? 36.476 4.906   19.605 1.00 9.26   ? 75   VAL A H    1 
ATOM   1135 H  HA   . VAL A 1 75 ? 34.602 3.334   18.222 1.00 9.41   ? 75   VAL A HA   1 
ATOM   1136 H  HB   . VAL A 1 75 ? 37.453 2.883   18.293 1.00 9.89   ? 75   VAL A HB   1 
ATOM   1137 H  HG11 . VAL A 1 75 ? 36.276 0.846   18.456 1.00 13.56  ? 75   VAL A HG11 1 
ATOM   1138 H  HG12 . VAL A 1 75 ? 37.095 0.915   17.083 1.00 13.56  ? 75   VAL A HG12 1 
ATOM   1139 H  HG13 . VAL A 1 75 ? 35.515 1.168   17.086 1.00 13.56  ? 75   VAL A HG13 1 
ATOM   1140 H  HG21 . VAL A 1 75 ? 36.848 4.525   16.719 1.00 14.82  ? 75   VAL A HG21 1 
ATOM   1141 H  HG22 . VAL A 1 75 ? 35.866 3.487   15.998 1.00 14.82  ? 75   VAL A HG22 1 
ATOM   1142 H  HG23 . VAL A 1 75 ? 37.447 3.238   15.981 1.00 14.82  ? 75   VAL A HG23 1 
ATOM   1143 N  N    . LEU A 1 76 ? 34.119 1.889   20.138 1.00 7.08   ? 76   LEU A N    1 
ATOM   1144 C  CA   . LEU A 1 76 ? 33.805 0.968   21.236 1.00 8.00   ? 76   LEU A CA   1 
ATOM   1145 C  C    . LEU A 1 76 ? 34.097 -0.458  20.811 1.00 8.04   ? 76   LEU A C    1 
ATOM   1146 O  O    . LEU A 1 76 ? 33.880 -0.780  19.641 1.00 9.56   ? 76   LEU A O    1 
ATOM   1147 C  CB   . LEU A 1 76 ? 32.333 1.157   21.677 1.00 7.97   ? 76   LEU A CB   1 
ATOM   1148 C  CG   . LEU A 1 76 ? 31.855 2.594   21.905 1.00 7.50   ? 76   LEU A CG   1 
ATOM   1149 C  CD1  . LEU A 1 76 ? 30.399 2.601   22.347 1.00 9.02   ? 76   LEU A CD1  1 
ATOM   1150 C  CD2  . LEU A 1 76 ? 32.724 3.303   22.931 1.00 8.99   ? 76   LEU A CD2  1 
ATOM   1151 H  H    . LEU A 1 76 ? 33.506 2.012   19.519 1.00 8.50   ? 76   LEU A H    1 
ATOM   1152 H  HA   . LEU A 1 76 ? 34.395 1.192   22.011 1.00 9.60   ? 76   LEU A HA   1 
ATOM   1153 H  HB2  . LEU A 1 76 ? 31.751 0.746   20.989 1.00 9.56   ? 76   LEU A HB2  1 
ATOM   1154 H  HB3  . LEU A 1 76 ? 32.197 0.652   22.517 1.00 9.56   ? 76   LEU A HB3  1 
ATOM   1155 H  HG   . LEU A 1 76 ? 31.923 3.090   21.039 1.00 9.00   ? 76   LEU A HG   1 
ATOM   1156 H  HD11 . LEU A 1 76 ? 29.857 2.110   21.695 1.00 13.53  ? 76   LEU A HD11 1 
ATOM   1157 H  HD12 . LEU A 1 76 ? 30.079 3.525   22.407 1.00 13.53  ? 76   LEU A HD12 1 
ATOM   1158 H  HD13 . LEU A 1 76 ? 30.322 2.171   23.225 1.00 13.53  ? 76   LEU A HD13 1 
ATOM   1159 H  HD21 . LEU A 1 76 ? 33.657 3.291   22.633 1.00 13.48  ? 76   LEU A HD21 1 
ATOM   1160 H  HD22 . LEU A 1 76 ? 32.650 2.843   23.794 1.00 13.48  ? 76   LEU A HD22 1 
ATOM   1161 H  HD23 . LEU A 1 76 ? 32.423 4.230   23.029 1.00 13.48  ? 76   LEU A HD23 1 
ATOM   1162 N  N    . VAL A 1 77 ? 34.601 -1.282  21.684 1.00 7.57   ? 77   VAL A N    1 
ATOM   1163 C  CA   . VAL A 1 77 ? 34.888 -2.707  21.441 1.00 7.61   ? 77   VAL A CA   1 
ATOM   1164 C  C    . VAL A 1 77 ? 34.164 -3.574  22.467 1.00 7.71   ? 77   VAL A C    1 
ATOM   1165 O  O    . VAL A 1 77 ? 34.263 -3.329  23.683 1.00 8.53   ? 77   VAL A O    1 
ATOM   1166 C  CB   . VAL A 1 77 ? 36.410 -2.956  21.443 1.00 9.00   ? 77   VAL A CB   1 
ATOM   1167 C  CG1  . VAL A 1 77 ? 36.740 -4.431  21.197 1.00 9.24   ? 77   VAL A CG1  1 
ATOM   1168 C  CG2  . VAL A 1 77 ? 37.117 -2.091  20.393 1.00 9.65   ? 77   VAL A CG2  1 
ATOM   1169 H  H    . VAL A 1 77 ? 34.786 -0.962  22.483 1.00 9.08   ? 77   VAL A H    1 
ATOM   1170 H  HA   . VAL A 1 77 ? 34.537 -2.943  20.535 1.00 9.13   ? 77   VAL A HA   1 
ATOM   1171 H  HB   . VAL A 1 77 ? 36.765 -2.704  22.344 1.00 10.80  ? 77   VAL A HB   1 
ATOM   1172 H  HG11 . VAL A 1 77 ? 36.278 -4.985  21.860 1.00 13.85  ? 77   VAL A HG11 1 
ATOM   1173 H  HG12 . VAL A 1 77 ? 37.707 -4.567  21.275 1.00 13.85  ? 77   VAL A HG12 1 
ATOM   1174 H  HG13 . VAL A 1 77 ? 36.446 -4.686  20.297 1.00 13.85  ? 77   VAL A HG13 1 
ATOM   1175 H  HG21 . VAL A 1 77 ? 36.919 -1.146  20.561 1.00 14.48  ? 77   VAL A HG21 1 
ATOM   1176 H  HG22 . VAL A 1 77 ? 36.800 -2.338  19.499 1.00 14.48  ? 77   VAL A HG22 1 
ATOM   1177 H  HG23 . VAL A 1 77 ? 38.085 -2.237  20.448 1.00 14.48  ? 77   VAL A HG23 1 
ATOM   1178 N  N    . GLY A 1 78 ? 33.431 -4.591  22.000 1.00 8.34   ? 78   GLY A N    1 
ATOM   1179 C  CA   . GLY A 1 78 ? 32.784 -5.514  22.940 1.00 9.29   ? 78   GLY A CA   1 
ATOM   1180 C  C    . GLY A 1 78 ? 31.852 -6.462  22.221 1.00 8.60   ? 78   GLY A C    1 
ATOM   1181 O  O    . GLY A 1 78 ? 32.004 -6.707  21.009 1.00 8.78   ? 78   GLY A O    1 
ATOM   1182 H  H    . GLY A 1 78 ? 33.336 -4.706  21.132 1.00 10.01  ? 78   GLY A H    1 
ATOM   1183 H  HA2  . GLY A 1 78 ? 33.477 -6.034  23.419 1.00 11.15  ? 78   GLY A HA2  1 
ATOM   1184 H  HA3  . GLY A 1 78 ? 32.272 -4.996  23.610 1.00 11.15  ? 78   GLY A HA3  1 
ATOM   1185 N  N    . PRO A 1 79 ? 30.928 -7.101  22.935 1.00 9.36   ? 79   PRO A N    1 
ATOM   1186 C  CA   . PRO A 1 79 ? 30.135 -8.238  22.405 1.00 9.81   ? 79   PRO A CA   1 
ATOM   1187 C  C    . PRO A 1 79 ? 28.968 -7.833  21.491 1.00 9.33   ? 79   PRO A C    1 
ATOM   1188 O  O    . PRO A 1 79 ? 27.799 -8.254  21.636 1.00 11.68  ? 79   PRO A O    1 
ATOM   1189 C  CB   . PRO A 1 79 ? 29.637 -8.929  23.672 1.00 11.34  ? 79   PRO A CB   1 
ATOM   1190 C  CG   . PRO A 1 79 ? 29.539 -7.800  24.673 1.00 11.66  ? 79   PRO A CG   1 
ATOM   1191 C  CD   . PRO A 1 79 ? 30.660 -6.850  24.370 1.00 10.00  ? 79   PRO A CD   1 
ATOM   1192 H  HA   . PRO A 1 79 ? 30.742 -8.859  21.909 1.00 11.78  ? 79   PRO A HA   1 
ATOM   1193 H  HB2  . PRO A 1 79 ? 28.754 -9.350  23.523 1.00 13.61  ? 79   PRO A HB2  1 
ATOM   1194 H  HB3  . PRO A 1 79 ? 30.277 -9.620  23.976 1.00 13.61  ? 79   PRO A HB3  1 
ATOM   1195 H  HG2  . PRO A 1 79 ? 28.666 -7.341  24.589 1.00 14.00  ? 79   PRO A HG2  1 
ATOM   1196 H  HG3  . PRO A 1 79 ? 29.624 -8.150  25.595 1.00 14.00  ? 79   PRO A HG3  1 
ATOM   1197 H  HD2  . PRO A 1 79 ? 30.385 -5.912  24.524 1.00 12.00  ? 79   PRO A HD2  1 
ATOM   1198 H  HD3  . PRO A 1 79 ? 31.457 -7.050  24.922 1.00 12.00  ? 79   PRO A HD3  1 
ATOM   1199 N  N    . THR A 1 80 ? 29.287 -7.071  20.457 1.00 9.55   ? 80   THR A N    1 
ATOM   1200 C  CA   . THR A 1 80 ? 28.340 -6.746  19.392 1.00 9.51   ? 80   THR A CA   1 
ATOM   1201 C  C    . THR A 1 80 ? 28.073 -7.876  18.408 1.00 8.74   ? 80   THR A C    1 
ATOM   1202 O  O    . THR A 1 80 ? 29.020 -8.643  18.147 1.00 10.06  ? 80   THR A O    1 
ATOM   1203 C  CB   . THR A 1 80 ? 28.802 -5.487  18.648 1.00 8.87   ? 80   THR A CB   1 
ATOM   1204 O  OG1  . THR A 1 80 ? 27.841 -5.177  17.621 1.00 10.04  ? 80   THR A OG1  1 
ATOM   1205 C  CG2  . THR A 1 80 ? 30.195 -5.635  18.010 1.00 10.72  ? 80   THR A CG2  1 
ATOM   1206 H  H    . THR A 1 80 ? 30.104 -6.747  20.409 1.00 11.46  ? 80   THR A H    1 
ATOM   1207 H  HA   . THR A 1 80 ? 27.469 -6.525  19.830 1.00 11.41  ? 80   THR A HA   1 
ATOM   1208 H  HB   . THR A 1 80 ? 28.829 -4.727  19.297 1.00 10.65  ? 80   THR A HB   1 
ATOM   1209 H  HG1  . THR A 1 80 ? 28.231 -5.126  16.879 1.00 15.05  ? 80   THR A HG1  1 
ATOM   1210 H  HG21 . THR A 1 80 ? 30.440 -4.798  17.563 1.00 16.07  ? 80   THR A HG21 1 
ATOM   1211 H  HG22 . THR A 1 80 ? 30.178 -6.363  17.354 1.00 16.07  ? 80   THR A HG22 1 
ATOM   1212 H  HG23 . THR A 1 80 ? 30.853 -5.839  18.706 1.00 16.07  ? 80   THR A HG23 1 
ATOM   1213 N  N    . PRO A 1 81 ? 26.872 -8.067  17.853 1.00 9.05   ? 81   PRO A N    1 
ATOM   1214 C  CA   . PRO A 1 81 ? 26.630 -9.121  16.863 1.00 9.97   ? 81   PRO A CA   1 
ATOM   1215 C  C    . PRO A 1 81 ? 27.388 -8.982  15.530 1.00 9.83   ? 81   PRO A C    1 
ATOM   1216 O  O    . PRO A 1 81 ? 27.622 -10.025 14.861 1.00 11.70  ? 81   PRO A O    1 
ATOM   1217 C  CB   . PRO A 1 81 ? 25.100 -9.096  16.629 1.00 13.46  ? 81   PRO A CB   1 
ATOM   1218 C  CG   . PRO A 1 81 ? 24.690 -7.727  17.064 1.00 23.34  ? 81   PRO A CG   1 
ATOM   1219 C  CD   . PRO A 1 81 ? 25.615 -7.375  18.197 1.00 12.10  ? 81   PRO A CD   1 
ATOM   1220 H  HA   . PRO A 1 81 ? 26.872 -10.000 17.273 1.00 11.96  ? 81   PRO A HA   1 
ATOM   1221 H  HB2  . PRO A 1 81 ? 24.886 -9.242  15.673 1.00 16.16  ? 81   PRO A HB2  1 
ATOM   1222 H  HB3  . PRO A 1 81 ? 24.647 -9.790  17.170 1.00 16.16  ? 81   PRO A HB3  1 
ATOM   1223 H  HG2  . PRO A 1 81 ? 24.787 -7.081  16.321 1.00 28.00  ? 81   PRO A HG2  1 
ATOM   1224 H  HG3  . PRO A 1 81 ? 23.748 -7.725  17.369 1.00 28.00  ? 81   PRO A HG3  1 
ATOM   1225 H  HD2  . PRO A 1 81 ? 25.753 -6.396  18.253 1.00 14.52  ? 81   PRO A HD2  1 
ATOM   1226 H  HD3  . PRO A 1 81 ? 25.257 -7.700  19.062 1.00 14.52  ? 81   PRO A HD3  1 
ATOM   1227 N  N    . VAL A 1 82 ? 27.717 -7.728  15.167 1.00 8.81   ? 82   VAL A N    1 
ATOM   1228 C  CA   . VAL A 1 82 ? 28.409 -7.408  13.931 1.00 9.97   ? 82   VAL A CA   1 
ATOM   1229 C  C    . VAL A 1 82 ? 29.230 -6.156  14.156 1.00 8.81   ? 82   VAL A C    1 
ATOM   1230 O  O    . VAL A 1 82 ? 28.911 -5.351  15.043 1.00 11.45  ? 82   VAL A O    1 
ATOM   1231 C  CB   . VAL A 1 82 ? 27.469 -7.161  12.737 1.00 12.44  ? 82   VAL A CB   1 
ATOM   1232 C  CG1  . VAL A 1 82 ? 26.570 -8.343  12.415 1.00 20.95  ? 82   VAL A CG1  1 
ATOM   1233 C  CG2  . VAL A 1 82 ? 26.585 -5.959  12.980 1.00 14.84  ? 82   VAL A CG2  1 
ATOM   1234 H  H    . VAL A 1 82 ? 27.502 -7.067  15.707 1.00 10.58  ? 82   VAL A H    1 
ATOM   1235 H  HA   . VAL A 1 82 ? 29.027 -8.161  13.704 1.00 11.96  ? 82   VAL A HA   1 
ATOM   1236 H  HB   . VAL A 1 82 ? 28.033 -6.973  11.933 1.00 14.93  ? 82   VAL A HB   1 
ATOM   1237 H  HG11 . VAL A 1 82 ? 27.119 -9.143  12.275 1.00 31.43  ? 82   VAL A HG11 1 
ATOM   1238 H  HG12 . VAL A 1 82 ? 26.059 -8.152  11.601 1.00 31.43  ? 82   VAL A HG12 1 
ATOM   1239 H  HG13 . VAL A 1 82 ? 25.952 -8.496  13.160 1.00 31.43  ? 82   VAL A HG13 1 
ATOM   1240 H  HG21 . VAL A 1 82 ? 27.144 -5.175  13.165 1.00 22.26  ? 82   VAL A HG21 1 
ATOM   1241 H  HG22 . VAL A 1 82 ? 26.002 -6.133  13.748 1.00 22.26  ? 82   VAL A HG22 1 
ATOM   1242 H  HG23 . VAL A 1 82 ? 26.038 -5.790  12.185 1.00 22.26  ? 82   VAL A HG23 1 
ATOM   1243 N  N    . ASN A 1 83 ? 30.258 -5.925  13.331 1.00 8.08   ? 83   ASN A N    1 
ATOM   1244 C  CA   . ASN A 1 83 ? 30.927 -4.603  13.315 1.00 7.73   ? 83   ASN A CA   1 
ATOM   1245 C  C    . ASN A 1 83 ? 29.956 -3.523  12.836 1.00 7.94   ? 83   ASN A C    1 
ATOM   1246 O  O    . ASN A 1 83 ? 29.413 -3.687  11.721 1.00 9.20   ? 83   ASN A O    1 
ATOM   1247 C  CB   . ASN A 1 83 ? 32.171 -4.607  12.414 1.00 8.39   ? 83   ASN A CB   1 
ATOM   1248 C  CG   . ASN A 1 83 ? 33.298 -5.534  12.848 1.00 9.00   ? 83   ASN A CG   1 
ATOM   1249 O  OD1  . ASN A 1 83 ? 33.603 -5.664  14.068 1.00 9.59   ? 83   ASN A OD1  1 
ATOM   1250 N  ND2  . ASN A 1 83 ? 33.982 -6.181  11.909 1.00 9.05   ? 83   ASN A ND2  1 
ATOM   1251 H  H    . ASN A 1 83 ? 30.539 -6.563  12.794 1.00 9.69   ? 83   ASN A H    1 
ATOM   1252 H  HA   . ASN A 1 83 ? 31.213 -4.382  14.247 1.00 9.27   ? 83   ASN A HA   1 
ATOM   1253 H  HB2  . ASN A 1 83 ? 31.892 -4.861  11.498 1.00 10.07  ? 83   ASN A HB2  1 
ATOM   1254 H  HB3  . ASN A 1 83 ? 32.526 -3.684  12.369 1.00 10.07  ? 83   ASN A HB3  1 
ATOM   1255 H  HD21 . ASN A 1 83 ? 34.652 -6.704  12.135 1.00 10.86  ? 83   ASN A HD21 1 
ATOM   1256 H  HD22 . ASN A 1 83 ? 33.764 -6.087  11.062 1.00 10.86  ? 83   ASN A HD22 1 
ATOM   1257 N  N    . ILE A 1 84 ? 29.748 -2.489  13.638 1.00 8.24   ? 84   ILE A N    1 
ATOM   1258 C  CA   . ILE A 1 84 ? 28.793 -1.395  13.394 1.00 8.96   ? 84   ILE A CA   1 
ATOM   1259 C  C    . ILE A 1 84 ? 29.500 -0.043  13.281 1.00 7.30   ? 84   ILE A C    1 
ATOM   1260 O  O    . ILE A 1 84 ? 30.231 0.356   14.193 1.00 8.18   ? 84   ILE A O    1 
ATOM   1261 C  CB   . ILE A 1 84 ? 27.796 -1.281  14.593 1.00 11.46  ? 84   ILE A CB   1 
ATOM   1262 C  CG1  . ILE A 1 84 ? 26.904 -2.528  14.713 1.00 14.68  ? 84   ILE A CG1  1 
ATOM   1263 C  CG2  . ILE A 1 84 ? 27.002 0.016   14.530 1.00 10.91  ? 84   ILE A CG2  1 
ATOM   1264 C  CD1  . ILE A 1 84 ? 26.102 -2.543  15.991 1.00 19.36  ? 84   ILE A CD1  1 
ATOM   1265 H  H    . ILE A 1 84 ? 30.221 -2.453  14.379 1.00 9.88   ? 84   ILE A H    1 
ATOM   1266 H  HA   . ILE A 1 84 ? 28.284 -1.577  12.553 1.00 10.75  ? 84   ILE A HA   1 
ATOM   1267 H  HB   . ILE A 1 84 ? 28.349 -1.240  15.425 1.00 13.75  ? 84   ILE A HB   1 
ATOM   1268 H  HG12 . ILE A 1 84 ? 26.285 -2.559  13.942 1.00 17.62  ? 84   ILE A HG12 1 
ATOM   1269 H  HG13 . ILE A 1 84 ? 27.473 -3.337  14.678 1.00 17.62  ? 84   ILE A HG13 1 
ATOM   1270 H  HG21 . ILE A 1 84 ? 27.621 0.776   14.503 1.00 16.36  ? 84   ILE A HG21 1 
ATOM   1271 H  HG22 . ILE A 1 84 ? 26.430 0.088   15.322 1.00 16.36  ? 84   ILE A HG22 1 
ATOM   1272 H  HG23 . ILE A 1 84 ? 26.445 0.019   13.723 1.00 16.36  ? 84   ILE A HG23 1 
ATOM   1273 H  HD11 . ILE A 1 84 ? 25.527 -3.337  16.006 1.00 29.05  ? 84   ILE A HD11 1 
ATOM   1274 H  HD12 . ILE A 1 84 ? 25.548 -1.737  16.039 1.00 29.05  ? 84   ILE A HD12 1 
ATOM   1275 H  HD13 . ILE A 1 84 ? 26.711 -2.567  16.759 1.00 29.05  ? 84   ILE A HD13 1 
ATOM   1276 N  N    . ILE A 1 85 ? 29.298 0.685   12.141 1.00 7.62   ? 85   ILE A N    1 
ATOM   1277 C  CA   . ILE A 1 85 ? 29.673 2.107   11.981 1.00 7.41   ? 85   ILE A CA   1 
ATOM   1278 C  C    . ILE A 1 85 ? 28.417 2.922   12.291 1.00 6.80   ? 85   ILE A C    1 
ATOM   1279 O  O    . ILE A 1 85 ? 27.425 2.860   11.581 1.00 8.43   ? 85   ILE A O    1 
ATOM   1280 C  CB   . ILE A 1 85 ? 30.201 2.397   10.581 1.00 8.42   ? 85   ILE A CB   1 
ATOM   1281 C  CG1  . ILE A 1 85 ? 31.348 1.442   10.121 1.00 9.84   ? 85   ILE A CG1  1 
ATOM   1282 C  CG2  . ILE A 1 85 ? 30.596 3.856   10.447 1.00 9.01   ? 85   ILE A CG2  1 
ATOM   1283 C  CD1  . ILE A 1 85 ? 32.550 1.415   11.029 1.00 11.14  ? 85   ILE A CD1  1 
ATOM   1284 H  H    . ILE A 1 85 ? 28.919 0.281   11.457 1.00 9.15   ? 85   ILE A H    1 
ATOM   1285 H  HA   . ILE A 1 85 ? 30.381 2.334   12.649 1.00 8.89   ? 85   ILE A HA   1 
ATOM   1286 H  HB   . ILE A 1 85 ? 29.438 2.249   9.952  1.00 10.11  ? 85   ILE A HB   1 
ATOM   1287 H  HG12 . ILE A 1 85 ? 30.985 0.524   10.050 1.00 11.80  ? 85   ILE A HG12 1 
ATOM   1288 H  HG13 . ILE A 1 85 ? 31.643 1.717   9.216  1.00 11.80  ? 85   ILE A HG13 1 
ATOM   1289 H  HG21 . ILE A 1 85 ? 30.913 4.026   9.535  1.00 13.52  ? 85   ILE A HG21 1 
ATOM   1290 H  HG22 . ILE A 1 85 ? 31.312 4.061   11.085 1.00 13.52  ? 85   ILE A HG22 1 
ATOM   1291 H  HG23 . ILE A 1 85 ? 29.820 4.424   10.634 1.00 13.52  ? 85   ILE A HG23 1 
ATOM   1292 H  HD11 . ILE A 1 85 ? 33.208 0.778   10.682 1.00 16.71  ? 85   ILE A HD11 1 
ATOM   1293 H  HD12 . ILE A 1 85 ? 32.273 1.142   11.929 1.00 16.71  ? 85   ILE A HD12 1 
ATOM   1294 H  HD13 . ILE A 1 85 ? 32.950 2.309   11.068 1.00 16.71  ? 85   ILE A HD13 1 
ATOM   1295 N  N    . GLY A 1 86 ? 28.473 3.666   13.402 1.00 6.67   ? 86   GLY A N    1 
ATOM   1296 C  CA   . GLY A 1 86 ? 27.351 4.477   13.850 1.00 6.40   ? 86   GLY A CA   1 
ATOM   1297 C  C    . GLY A 1 86 ? 27.484 5.948   13.493 1.00 6.31   ? 86   GLY A C    1 
ATOM   1298 O  O    . GLY A 1 86 ? 28.432 6.397   12.815 1.00 6.15   ? 86   GLY A O    1 
ATOM   1299 H  H    . GLY A 1 86 ? 29.213 3.666   13.877 1.00 8.00   ? 86   GLY A H    1 
ATOM   1300 H  HA2  . GLY A 1 86 ? 26.520 4.123   13.445 1.00 7.68   ? 86   GLY A HA2  1 
ATOM   1301 H  HA3  . GLY A 1 86 ? 27.268 4.392   14.832 1.00 7.68   ? 86   GLY A HA3  1 
ATOM   1302 N  N    . ARG A 1 87 ? 26.501 6.741   13.964 1.00 6.59   ? 87   ARG A N    1 
ATOM   1303 C  CA   . ARG A 1 87 ? 26.374 8.129   13.551 1.00 6.26   ? 87   ARG A CA   1 
ATOM   1304 C  C    . ARG A 1 87 ? 27.595 8.994   13.857 1.00 5.93   ? 87   ARG A C    1 
ATOM   1305 O  O    . ARG A 1 87 ? 27.856 9.952   13.090 1.00 7.40   ? 87   ARG A O    1 
ATOM   1306 C  CB   . ARG A 1 87 ? 25.109 8.777   14.130 1.00 7.11   ? 87   ARG A CB   1 
ATOM   1307 C  CG   . ARG A 1 87 ? 23.772 8.148   13.693 1.00 6.00   ? 87   ARG A CG   1 
ATOM   1308 C  CD   . ARG A 1 87 ? 22.559 8.973   14.074 1.00 7.81   ? 87   ARG A CD   1 
ATOM   1309 N  NE   . ARG A 1 87 ? 22.409 8.981   15.527 1.00 7.87   ? 87   ARG A NE   1 
ATOM   1310 C  CZ   . ARG A 1 87 ? 22.778 9.926   16.386 1.00 8.29   ? 87   ARG A CZ   1 
ATOM   1311 N  NH1  . ARG A 1 87 ? 23.327 11.092  15.976 1.00 8.37   ? 87   ARG A NH1  1 
ATOM   1312 N  NH2  . ARG A 1 87 ? 22.618 9.776   17.710 1.00 9.06   ? 87   ARG A NH2  1 
ATOM   1313 H  H    . ARG A 1 87 ? 25.922 6.410   14.537 1.00 7.91   ? 87   ARG A H    1 
ATOM   1314 H  HA   . ARG A 1 87 ? 26.265 8.124   12.557 1.00 7.51   ? 87   ARG A HA   1 
ATOM   1315 H  HB2  . ARG A 1 87 ? 25.164 8.739   15.118 1.00 8.53   ? 87   ARG A HB2  1 
ATOM   1316 H  HB3  . ARG A 1 87 ? 25.103 9.733   13.870 1.00 8.53   ? 87   ARG A HB3  1 
ATOM   1317 H  HG2  . ARG A 1 87 ? 23.781 8.027   12.711 1.00 7.21   ? 87   ARG A HG2  1 
ATOM   1318 H  HG3  . ARG A 1 87 ? 23.691 7.252   14.106 1.00 7.21   ? 87   ARG A HG3  1 
ATOM   1319 H  HD2  . ARG A 1 87 ? 22.667 9.900   13.743 1.00 9.38   ? 87   ARG A HD2  1 
ATOM   1320 H  HD3  . ARG A 1 87 ? 21.748 8.589   13.656 1.00 9.38   ? 87   ARG A HD3  1 
ATOM   1321 H  HE   . ARG A 1 87 ? 22.025 8.271   15.877 1.00 9.45   ? 87   ARG A HE   1 
ATOM   1322 H  HH11 . ARG A 1 87 ? 23.449 11.242  15.117 1.00 10.05  ? 87   ARG A HH11 1 
ATOM   1323 H  HH12 . ARG A 1 87 ? 23.563 11.700  16.567 1.00 10.05  ? 87   ARG A HH12 1 
ATOM   1324 H  HH21 . ARG A 1 87 ? 22.261 9.037   18.029 1.00 10.87  ? 87   ARG A HH21 1 
ATOM   1325 H  HH22 . ARG A 1 87 ? 22.870 10.415  18.259 1.00 10.87  ? 87   ARG A HH22 1 
ATOM   1326 N  N    . ASN A 1 88 ? 28.320 8.707   14.924 1.00 6.71   ? 88   ASN A N    1 
ATOM   1327 C  CA   . ASN A 1 88 ? 29.518 9.520   15.250 1.00 6.85   ? 88   ASN A CA   1 
ATOM   1328 C  C    . ASN A 1 88 ? 30.526 9.554   14.093 1.00 6.44   ? 88   ASN A C    1 
ATOM   1329 O  O    . ASN A 1 88 ? 31.153 10.591  13.872 1.00 9.44   ? 88   ASN A O    1 
ATOM   1330 C  CB   . ASN A 1 88 ? 30.171 9.039   16.546 1.00 7.07   ? 88   ASN A CB   1 
ATOM   1331 C  CG   . ASN A 1 88 ? 30.929 7.723   16.438 1.00 7.19   ? 88   ASN A CG   1 
ATOM   1332 O  OD1  . ASN A 1 88 ? 30.347 6.715   15.963 1.00 8.16   ? 88   ASN A OD1  1 
ATOM   1333 N  ND2  . ASN A 1 88 ? 32.187 7.736   16.893 1.00 8.02   ? 88   ASN A ND2  1 
ATOM   1334 H  H    . ASN A 1 88 ? 28.093 8.033   15.442 1.00 8.06   ? 88   ASN A H    1 
ATOM   1335 H  HA   . ASN A 1 88 ? 29.209 10.458  15.403 1.00 8.22   ? 88   ASN A HA   1 
ATOM   1336 H  HB2  . ASN A 1 88 ? 30.799 9.738   16.860 1.00 8.48   ? 88   ASN A HB2  1 
ATOM   1337 H  HB3  . ASN A 1 88 ? 29.467 8.941   17.235 1.00 8.48   ? 88   ASN A HB3  1 
ATOM   1338 H  HD21 . ASN A 1 88 ? 32.670 7.000   16.873 1.00 9.62   ? 88   ASN A HD21 1 
ATOM   1339 H  HD22 . ASN A 1 88 ? 32.532 8.480   17.213 1.00 9.62   ? 88   ASN A HD22 1 
ATOM   1340 N  N    . LEU A 1 89 ? 30.709 8.451   13.368 1.00 6.40   ? 89   LEU A N    1 
ATOM   1341 C  CA   . LEU A 1 89 ? 31.610 8.393   12.210 1.00 6.91   ? 89   LEU A CA   1 
ATOM   1342 C  C    . LEU A 1 89 ? 30.885 8.575   10.877 1.00 6.68   ? 89   LEU A C    1 
ATOM   1343 O  O    . LEU A 1 89 ? 31.450 9.131   9.937  1.00 7.76   ? 89   LEU A O    1 
ATOM   1344 C  CB   . LEU A 1 89 ? 32.466 7.104   12.182 1.00 7.71   ? 89   LEU A CB   1 
ATOM   1345 C  CG   . LEU A 1 89 ? 33.332 6.873   13.425 1.00 7.47   ? 89   LEU A CG   1 
ATOM   1346 C  CD1  . LEU A 1 89 ? 34.266 5.663   13.225 1.00 8.79   ? 89   LEU A CD1  1 
ATOM   1347 C  CD2  . LEU A 1 89 ? 34.184 8.059   13.832 1.00 7.83   ? 89   LEU A CD2  1 
ATOM   1348 H  H    . LEU A 1 89 ? 30.269 7.723   13.594 1.00 7.68   ? 89   LEU A H    1 
ATOM   1349 H  HA   . LEU A 1 89 ? 32.245 9.160   12.300 1.00 8.29   ? 89   LEU A HA   1 
ATOM   1350 H  HB2  . LEU A 1 89 ? 31.861 6.328   12.072 1.00 9.25   ? 89   LEU A HB2  1 
ATOM   1351 H  HB3  . LEU A 1 89 ? 33.057 7.136   11.388 1.00 9.25   ? 89   LEU A HB3  1 
ATOM   1352 H  HG   . LEU A 1 89 ? 32.720 6.662   14.188 1.00 8.96   ? 89   LEU A HG   1 
ATOM   1353 H  HD11 . LEU A 1 89 ? 33.736 4.881   12.964 1.00 13.18  ? 89   LEU A HD11 1 
ATOM   1354 H  HD12 . LEU A 1 89 ? 34.739 5.473   14.062 1.00 13.18  ? 89   LEU A HD12 1 
ATOM   1355 H  HD13 . LEU A 1 89 ? 34.917 5.866   12.521 1.00 13.18  ? 89   LEU A HD13 1 
ATOM   1356 H  HD21 . LEU A 1 89 ? 34.692 7.835   14.639 1.00 11.74  ? 89   LEU A HD21 1 
ATOM   1357 H  HD22 . LEU A 1 89 ? 33.606 8.829   14.013 1.00 11.74  ? 89   LEU A HD22 1 
ATOM   1358 H  HD23 . LEU A 1 89 ? 34.804 8.280   13.106 1.00 11.74  ? 89   LEU A HD23 1 
ATOM   1359 N  N    . LEU A 1 90 ? 29.603 8.179   10.765 1.00 7.17   ? 90   LEU A N    1 
ATOM   1360 C  CA   . LEU A 1 90 ? 28.867 8.431   9.501  1.00 6.87   ? 90   LEU A CA   1 
ATOM   1361 C  C    . LEU A 1 90 ? 28.792 9.940   9.184  1.00 7.78   ? 90   LEU A C    1 
ATOM   1362 O  O    . LEU A 1 90 ? 28.868 10.398  8.020  1.00 8.33   ? 90   LEU A O    1 
ATOM   1363 C  CB   . LEU A 1 90 ? 27.461 7.816   9.564  1.00 7.96   ? 90   LEU A CB   1 
ATOM   1364 C  CG   . LEU A 1 90 ? 27.325 6.303   9.686  1.00 8.23   ? 90   LEU A CG   1 
ATOM   1365 C  CD1  . LEU A 1 90 ? 25.870 5.883   9.972  1.00 10.38  ? 90   LEU A CD1  1 
ATOM   1366 C  CD2  . LEU A 1 90 ? 27.829 5.658   8.399  1.00 11.41  ? 90   LEU A CD2  1 
ATOM   1367 H  H    . LEU A 1 90 ? 29.205 7.773   11.436 1.00 8.60   ? 90   LEU A H    1 
ATOM   1368 H  HA   . LEU A 1 90 ? 29.366 7.985   8.759  1.00 8.24   ? 90   LEU A HA   1 
ATOM   1369 H  HB2  . LEU A 1 90 ? 26.991 8.222   10.334 1.00 9.55   ? 90   LEU A HB2  1 
ATOM   1370 H  HB3  . LEU A 1 90 ? 26.976 8.095   8.747  1.00 9.55   ? 90   LEU A HB3  1 
ATOM   1371 H  HG   . LEU A 1 90 ? 27.900 5.992   10.443 1.00 9.88   ? 90   LEU A HG   1 
ATOM   1372 H  HD11 . LEU A 1 90 ? 25.549 6.342   10.776 1.00 15.58  ? 90   LEU A HD11 1 
ATOM   1373 H  HD12 . LEU A 1 90 ? 25.831 4.914   10.112 1.00 15.58  ? 90   LEU A HD12 1 
ATOM   1374 H  HD13 . LEU A 1 90 ? 25.304 6.125   9.210  1.00 15.58  ? 90   LEU A HD13 1 
ATOM   1375 H  HD21 . LEU A 1 90 ? 27.781 4.683   8.482  1.00 17.12  ? 90   LEU A HD21 1 
ATOM   1376 H  HD22 . LEU A 1 90 ? 28.757 5.928   8.240  1.00 17.12  ? 90   LEU A HD22 1 
ATOM   1377 H  HD23 . LEU A 1 90 ? 27.271 5.949   7.648  1.00 17.12  ? 90   LEU A HD23 1 
ATOM   1378 N  N    . THR A 1 91 ? 28.602 10.786  10.230 1.00 7.55   ? 91   THR A N    1 
ATOM   1379 C  CA   . THR A 1 91 ? 28.548 12.220  10.039 1.00 7.96   ? 91   THR A CA   1 
ATOM   1380 C  C    . THR A 1 91 ? 29.905 12.734  9.521  1.00 7.52   ? 91   THR A C    1 
ATOM   1381 O  O    . THR A 1 91 ? 29.928 13.643  8.662  1.00 9.15   ? 91   THR A O    1 
ATOM   1382 C  CB   A THR A 1 91 ? 28.259 13.074  11.303 0.65 9.31   ? 91   THR A CB   1 
ATOM   1383 C  CB   B THR A 1 91 ? 28.040 12.911  11.316 0.35 6.82   ? 91   THR A CB   1 
ATOM   1384 O  OG1  A THR A 1 91 ? 29.171 12.687  12.343 0.65 8.09   ? 91   THR A OG1  1 
ATOM   1385 O  OG1  B THR A 1 91 ? 26.776 12.319  11.723 0.35 6.29   ? 91   THR A OG1  1 
ATOM   1386 C  CG2  A THR A 1 91 ? 26.815 12.900  11.774 0.65 11.00  ? 91   THR A CG2  1 
ATOM   1387 C  CG2  B THR A 1 91 ? 27.710 14.367  11.063 0.35 8.47   ? 91   THR A CG2  1 
ATOM   1388 H  H    . THR A 1 91 ? 28.510 10.456  11.041 1.00 9.06   ? 91   THR A H    1 
ATOM   1389 H  HA   . THR A 1 91 ? 27.849 12.422  9.353  1.00 9.55   ? 91   THR A HA   1 
ATOM   1390 H  HB   A THR A 1 91 ? 28.412 14.037  11.082 0.65 11.17  ? 91   THR A HB   1 
ATOM   1391 H  HB   B THR A 1 91 ? 28.715 12.829  12.049 0.35 8.18   ? 91   THR A HB   1 
ATOM   1392 H  HG1  A THR A 1 91 ? 28.737 12.443  13.020 0.65 12.13  ? 91   THR A HG1  1 
ATOM   1393 H  HG1  B THR A 1 91 ? 26.888 11.502  11.883 0.35 9.43   ? 91   THR A HG1  1 
ATOM   1394 H  HG21 A THR A 1 91 ? 26.665 13.445  12.574 0.65 16.49  ? 91   THR A HG21 1 
ATOM   1395 H  HG21 B THR A 1 91 ? 27.380 14.776  11.890 0.35 12.71  ? 91   THR A HG21 1 
ATOM   1396 H  HG22 A THR A 1 91 ? 26.652 11.957  11.985 0.65 16.49  ? 91   THR A HG22 1 
ATOM   1397 H  HG22 B THR A 1 91 ? 27.020 14.430  10.370 0.35 12.71  ? 91   THR A HG22 1 
ATOM   1398 H  HG23 A THR A 1 91 ? 26.203 13.186  11.064 0.65 16.49  ? 91   THR A HG23 1 
ATOM   1399 H  HG23 B THR A 1 91 ? 28.516 14.838  10.765 0.35 12.71  ? 91   THR A HG23 1 
ATOM   1400 N  N    . GLN A 1 92 ? 31.027 12.187  9.980  1.00 7.44   ? 92   GLN A N    1 
ATOM   1401 C  CA   . GLN A 1 92 ? 32.354 12.648  9.569  1.00 7.86   ? 92   GLN A CA   1 
ATOM   1402 C  C    . GLN A 1 92 ? 32.575 12.406  8.091  1.00 8.51   ? 92   GLN A C    1 
ATOM   1403 O  O    . GLN A 1 92 ? 33.298 13.214  7.462  1.00 11.40  ? 92   GLN A O    1 
ATOM   1404 C  CB   . GLN A 1 92 ? 33.458 12.019  10.364 1.00 7.49   ? 92   GLN A CB   1 
ATOM   1405 C  CG   . GLN A 1 92 ? 33.451 12.364  11.858 1.00 7.25   ? 92   GLN A CG   1 
ATOM   1406 C  CD   . GLN A 1 92 ? 34.783 12.055  12.546 1.00 7.65   ? 92   GLN A CD   1 
ATOM   1407 O  OE1  . GLN A 1 92 ? 35.816 11.774  11.881 1.00 9.02   ? 92   GLN A OE1  1 
ATOM   1408 N  NE2  . GLN A 1 92 ? 34.857 12.133  13.865 1.00 9.30   ? 92   GLN A NE2  1 
ATOM   1409 H  H    . GLN A 1 92 ? 30.970 11.522  10.553 1.00 8.93   ? 92   GLN A H    1 
ATOM   1410 H  HA   . GLN A 1 92 ? 32.393 13.635  9.724  1.00 9.44   ? 92   GLN A HA   1 
ATOM   1411 H  HB2  . GLN A 1 92 ? 33.395 11.036  10.267 1.00 8.98   ? 92   GLN A HB2  1 
ATOM   1412 H  HB3  . GLN A 1 92 ? 34.325 12.302  9.979  1.00 8.98   ? 92   GLN A HB3  1 
ATOM   1413 H  HG2  . GLN A 1 92 ? 33.248 13.326  11.966 1.00 8.70   ? 92   GLN A HG2  1 
ATOM   1414 H  HG3  . GLN A 1 92 ? 32.731 11.851  12.304 1.00 8.70   ? 92   GLN A HG3  1 
ATOM   1415 H  HE21 . GLN A 1 92 ? 35.624 11.990  14.272 1.00 11.16  ? 92   GLN A HE21 1 
ATOM   1416 H  HE22 . GLN A 1 92 ? 34.139 12.329  14.335 1.00 11.16  ? 92   GLN A HE22 1 
ATOM   1417 N  N    . ILE A 1 93 ? 32.040 11.366  7.479  1.00 8.74   ? 93   ILE A N    1 
ATOM   1418 C  CA   . ILE A 1 93 ? 32.254 11.063  6.059  1.00 9.48   ? 93   ILE A CA   1 
ATOM   1419 C  C    . ILE A 1 93 ? 31.170 11.690  5.189  1.00 9.97   ? 93   ILE A C    1 
ATOM   1420 O  O    . ILE A 1 93 ? 31.138 11.507  3.958  1.00 12.28  ? 93   ILE A O    1 
ATOM   1421 C  CB   . ILE A 1 93 ? 32.387 9.510   5.815  1.00 9.75   ? 93   ILE A CB   1 
ATOM   1422 C  CG1  . ILE A 1 93 ? 31.122 8.679   6.034  1.00 9.85   ? 93   ILE A CG1  1 
ATOM   1423 C  CG2  . ILE A 1 93 ? 33.582 8.960   6.628  1.00 11.02  ? 93   ILE A CG2  1 
ATOM   1424 C  CD1  . ILE A 1 93 ? 31.243 7.192   5.781  1.00 13.85  ? 93   ILE A CD1  1 
ATOM   1425 H  H    . ILE A 1 93 ? 31.528 10.825  7.948  1.00 10.49  ? 93   ILE A H    1 
ATOM   1426 H  HA   . ILE A 1 93 ? 33.124 11.480  5.795  1.00 11.37  ? 93   ILE A HA   1 
ATOM   1427 H  HB   . ILE A 1 93 ? 32.630 9.399   4.852  1.00 11.70  ? 93   ILE A HB   1 
ATOM   1428 H  HG12 . ILE A 1 93 ? 30.823 8.811   6.969  1.00 11.81  ? 93   ILE A HG12 1 
ATOM   1429 H  HG13 . ILE A 1 93 ? 30.412 9.037   5.444  1.00 11.81  ? 93   ILE A HG13 1 
ATOM   1430 H  HG21 . ILE A 1 93 ? 34.376 9.506   6.451  1.00 16.54  ? 93   ILE A HG21 1 
ATOM   1431 H  HG22 . ILE A 1 93 ? 33.757 8.032   6.364  1.00 16.54  ? 93   ILE A HG22 1 
ATOM   1432 H  HG23 . ILE A 1 93 ? 33.369 8.992   7.584  1.00 16.54  ? 93   ILE A HG23 1 
ATOM   1433 H  HD11 . ILE A 1 93 ? 30.380 6.760   5.951  1.00 20.78  ? 93   ILE A HD11 1 
ATOM   1434 H  HD12 . ILE A 1 93 ? 31.922 6.813   6.378  1.00 20.78  ? 93   ILE A HD12 1 
ATOM   1435 H  HD13 . ILE A 1 93 ? 31.506 7.039   4.849  1.00 20.78  ? 93   ILE A HD13 1 
ATOM   1436 N  N    . GLY A 1 94 ? 30.238 12.419  5.755  1.00 10.08  ? 94   GLY A N    1 
ATOM   1437 C  CA   . GLY A 1 94 ? 29.210 13.172  4.983  1.00 11.77  ? 94   GLY A CA   1 
ATOM   1438 C  C    . GLY A 1 94 ? 27.979 12.356  4.631  1.00 10.49  ? 94   GLY A C    1 
ATOM   1439 O  O    . GLY A 1 94 ? 27.298 12.697  3.648  1.00 12.28  ? 94   GLY A O    1 
ATOM   1440 H  H    . GLY A 1 94 ? 30.220 12.467  6.634  1.00 12.10  ? 94   GLY A H    1 
ATOM   1441 H  HA2  . GLY A 1 94 ? 28.928 13.960  5.512  1.00 14.13  ? 94   GLY A HA2  1 
ATOM   1442 H  HA3  . GLY A 1 94 ? 29.621 13.504  4.146  1.00 14.13  ? 94   GLY A HA3  1 
ATOM   1443 N  N    . CYS A 1 95 ? 27.668 11.287  5.381  1.00 9.42   ? 95   CYS A N    1 
ATOM   1444 C  CA   . CYS A 1 95 ? 26.522 10.426  5.057  1.00 10.49  ? 95   CYS A CA   1 
ATOM   1445 C  C    . CYS A 1 95 ? 25.169 11.063  5.416  1.00 11.59  ? 95   CYS A C    1 
ATOM   1446 O  O    . CYS A 1 95 ? 24.994 11.540  6.526  1.00 13.33  ? 95   CYS A O    1 
ATOM   1447 C  CB   A CYS A 1 95 ? 26.432 9.178   5.928  0.39 19.81  ? 95   CYS A CB   1 
ATOM   1448 C  CB   B CYS A 1 95 ? 26.812 9.063   5.670  0.61 12.55  ? 95   CYS A CB   1 
ATOM   1449 S  SG   A CYS A 1 95 ? 27.577 7.897   5.543  0.39 12.23  ? 95   CYS A SG   1 
ATOM   1450 S  SG   B CYS A 1 95 ? 25.782 7.693   5.184  0.61 11.29  ? 95   CYS A SG   1 
ATOM   1451 H  H    . CYS A 1 95 ? 28.162 11.098  6.084  1.00 11.31  ? 95   CYS A H    1 
ATOM   1452 H  HA   . CYS A 1 95 ? 26.541 10.173  4.090  1.00 12.59  ? 95   CYS A HA   1 
ATOM   1453 N  N    . THR A 1 96 ? 24.214 11.002  4.479  1.00 12.08  ? 96   THR A N    1 
ATOM   1454 C  CA   . THR A 1 96 ? 22.830 11.369  4.695  1.00 10.50  ? 96   THR A CA   1 
ATOM   1455 C  C    . THR A 1 96 ? 21.889 10.283  4.181  1.00 8.79   ? 96   THR A C    1 
ATOM   1456 O  O    . THR A 1 96 ? 22.234 9.453   3.327  1.00 10.98  ? 96   THR A O    1 
ATOM   1457 C  CB   . THR A 1 96 ? 22.501 12.697  3.990  1.00 13.15  ? 96   THR A CB   1 
ATOM   1458 O  OG1  . THR A 1 96 ? 22.725 12.533  2.575  1.00 15.26  ? 96   THR A OG1  1 
ATOM   1459 C  CG2  . THR A 1 96 ? 23.397 13.826  4.492  1.00 15.18  ? 96   THR A CG2  1 
ATOM   1460 H  H    . THR A 1 96 ? 24.443 10.719  3.677  1.00 14.49  ? 96   THR A H    1 
ATOM   1461 H  HA   . THR A 1 96 ? 22.680 11.484  5.677  1.00 12.60  ? 96   THR A HA   1 
ATOM   1462 H  HB   . THR A 1 96 ? 21.543 12.933  4.152  1.00 15.78  ? 96   THR A HB   1 
ATOM   1463 H  HG1  . THR A 1 96 ? 22.547 13.251  2.178  1.00 22.88  ? 96   THR A HG1  1 
ATOM   1464 H  HG21 . THR A 1 96 ? 23.169 14.657  4.025  1.00 22.77  ? 96   THR A HG21 1 
ATOM   1465 H  HG22 . THR A 1 96 ? 24.335 13.601  4.318  1.00 22.77  ? 96   THR A HG22 1 
ATOM   1466 H  HG23 . THR A 1 96 ? 23.263 13.946  5.456  1.00 22.77  ? 96   THR A HG23 1 
ATOM   1467 N  N    . LEU A 1 97 ? 20.674 10.303  4.723  1.00 9.78   ? 97   LEU A N    1 
ATOM   1468 C  CA   . LEU A 1 97 ? 19.566 9.522   4.176  1.00 8.77   ? 97   LEU A CA   1 
ATOM   1469 C  C    . LEU A 1 97 ? 18.784 10.320  3.159  1.00 11.70  ? 97   LEU A C    1 
ATOM   1470 O  O    . LEU A 1 97 ? 18.603 11.548  3.393  1.00 14.26  ? 97   LEU A O    1 
ATOM   1471 C  CB   . LEU A 1 97 ? 18.621 9.096   5.334  1.00 9.66   ? 97   LEU A CB   1 
ATOM   1472 C  CG   . LEU A 1 97 ? 19.211 8.030   6.278  1.00 10.04  ? 97   LEU A CG   1 
ATOM   1473 C  CD1  . LEU A 1 97 ? 18.420 7.988   7.580  1.00 14.38  ? 97   LEU A CD1  1 
ATOM   1474 C  CD2  . LEU A 1 97 ? 19.217 6.642   5.621  1.00 14.42  ? 97   LEU A CD2  1 
ATOM   1475 H  H    . LEU A 1 97 ? 20.534 10.802  5.433  1.00 11.73  ? 97   LEU A H    1 
ATOM   1476 H  HA   . LEU A 1 97 ? 19.931 8.702   3.735  1.00 10.52  ? 97   LEU A HA   1 
ATOM   1477 H  HB2  . LEU A 1 97 ? 18.391 9.898   5.867  1.00 11.59  ? 97   LEU A HB2  1 
ATOM   1478 H  HB3  . LEU A 1 97 ? 17.782 8.744   4.945  1.00 11.59  ? 97   LEU A HB3  1 
ATOM   1479 H  HG   . LEU A 1 97 ? 20.155 8.283   6.490  1.00 12.04  ? 97   LEU A HG   1 
ATOM   1480 H  HD11 . LEU A 1 97 ? 18.435 8.873   8.000  1.00 21.57  ? 97   LEU A HD11 1 
ATOM   1481 H  HD12 . LEU A 1 97 ? 18.823 7.332   8.186  1.00 21.57  ? 97   LEU A HD12 1 
ATOM   1482 H  HD13 . LEU A 1 97 ? 17.493 7.732   7.391  1.00 21.57  ? 97   LEU A HD13 1 
ATOM   1483 H  HD21 . LEU A 1 97 ? 19.739 6.676   4.792  1.00 21.63  ? 97   LEU A HD21 1 
ATOM   1484 H  HD22 . LEU A 1 97 ? 18.297 6.374   5.416  1.00 21.63  ? 97   LEU A HD22 1 
ATOM   1485 H  HD23 . LEU A 1 97 ? 19.619 5.992   6.234  1.00 21.63  ? 97   LEU A HD23 1 
ATOM   1486 N  N    . ASN A 1 98 ? 18.332 9.670   2.083  1.00 12.37  ? 98   ASN A N    1 
ATOM   1487 C  CA   . ASN A 1 98 ? 17.716 10.387  0.956  1.00 14.54  ? 98   ASN A CA   1 
ATOM   1488 C  C    . ASN A 1 98 ? 16.524 9.619   0.365  1.00 13.45  ? 98   ASN A C    1 
ATOM   1489 O  O    . ASN A 1 98 ? 16.706 8.416   0.109  1.00 15.02  ? 98   ASN A O    1 
ATOM   1490 C  CB   . ASN A 1 98 ? 18.755 10.640  -0.166 1.00 18.45  ? 98   ASN A CB   1 
ATOM   1491 C  CG   . ASN A 1 98 ? 19.775 11.665  0.286  1.00 18.82  ? 98   ASN A CG   1 
ATOM   1492 O  OD1  . ASN A 1 98 ? 19.673 12.891  0.123  1.00 26.88  ? 98   ASN A OD1  1 
ATOM   1493 N  ND2  . ASN A 1 98 ? 20.828 11.172  0.920  1.00 18.78  ? 98   ASN A ND2  1 
ATOM   1494 H  H    . ASN A 1 98 ? 18.404 8.793   2.048  1.00 14.84  ? 98   ASN A H    1 
ATOM   1495 H  HA   . ASN A 1 98 ? 17.388 11.271  1.287  1.00 17.44  ? 98   ASN A HA   1 
ATOM   1496 H  HB2  . ASN A 1 98 ? 19.214 9.792   -0.391 1.00 22.14  ? 98   ASN A HB2  1 
ATOM   1497 H  HB3  . ASN A 1 98 ? 18.294 10.966  -0.979 1.00 22.14  ? 98   ASN A HB3  1 
ATOM   1498 H  HD21 . ASN A 1 98 ? 21.452 11.713  1.223  1.00 22.54  ? 98   ASN A HD21 1 
ATOM   1499 H  HD22 . ASN A 1 98 ? 20.903 10.304  1.037  1.00 22.54  ? 98   ASN A HD22 1 
ATOM   1500 N  N    . PHE A 1 99 ? 15.400 10.300  0.157  1.00 13.63  ? 99   PHE A N    1 
ATOM   1501 C  CA   . PHE A 1 99 ? 14.234 9.667   -0.464 1.00 14.14  ? 99   PHE A CA   1 
ATOM   1502 C  C    . PHE A 1 99 ? 13.271 10.751  -0.940 1.00 15.16  ? 99   PHE A C    1 
ATOM   1503 O  O    . PHE A 1 99 ? 13.517 11.922  -0.659 1.00 25.77  ? 99   PHE A O    1 
ATOM   1504 C  CB   . PHE A 1 99 ? 13.505 8.680   0.434  1.00 16.44  ? 99   PHE A CB   1 
ATOM   1505 C  CG   . PHE A 1 99 ? 12.993 9.157   1.779  1.00 15.03  ? 99   PHE A CG   1 
ATOM   1506 C  CD1  . PHE A 1 99 ? 13.800 9.179   2.910  1.00 18.85  ? 99   PHE A CD1  1 
ATOM   1507 C  CD2  . PHE A 1 99 ? 11.689 9.615   1.937  1.00 20.69  ? 99   PHE A CD2  1 
ATOM   1508 C  CE1  . PHE A 1 99 ? 13.284 9.612   4.119  1.00 21.26  ? 99   PHE A CE1  1 
ATOM   1509 C  CE2  . PHE A 1 99 ? 11.165 10.041  3.147  1.00 24.76  ? 99   PHE A CE2  1 
ATOM   1510 C  CZ   . PHE A 1 99 ? 11.985 10.058  4.258  1.00 21.39  ? 99   PHE A CZ   1 
ATOM   1511 O  OXT  . PHE A 1 99 ? 12.237 10.461  -1.590 1.00 18.62  ? 99   PHE A OXT  1 
ATOM   1512 H  H    . PHE A 1 99 ? 15.356 11.145  0.397  1.00 16.35  ? 99   PHE A H    1 
ATOM   1513 H  HA   . PHE A 1 99 ? 14.552 9.168   -1.270 1.00 16.97  ? 99   PHE A HA   1 
ATOM   1514 H  HB2  . PHE A 1 99 ? 12.731 8.328   -0.073 1.00 19.73  ? 99   PHE A HB2  1 
ATOM   1515 H  HB3  . PHE A 1 99 ? 14.114 7.918   0.599  1.00 19.73  ? 99   PHE A HB3  1 
ATOM   1516 H  HD1  . PHE A 1 99 ? 14.706 8.898   2.853  1.00 22.62  ? 99   PHE A HD1  1 
ATOM   1517 H  HD2  . PHE A 1 99 ? 11.126 9.636   1.172  1.00 24.83  ? 99   PHE A HD2  1 
ATOM   1518 H  HE1  . PHE A 1 99 ? 13.846 9.603   4.885  1.00 25.51  ? 99   PHE A HE1  1 
ATOM   1519 H  HE2  . PHE A 1 99 ? 10.258 10.317  3.211  1.00 29.71  ? 99   PHE A HE2  1 
ATOM   1520 H  HZ   . PHE A 1 99 ? 11.664 10.368  5.096  1.00 25.66  ? 99   PHE A HZ   1 
ATOM   1521 N  N    . PRO B 1 1  ? 13.099 13.957  1.069  1.00 25.23  ? 1    PRO B N    1 
ATOM   1522 C  CA   . PRO B 1 1  ? 13.934 14.703  1.958  1.00 20.14  ? 1    PRO B CA   1 
ATOM   1523 C  C    . PRO B 1 1  ? 15.383 14.210  2.002  1.00 16.03  ? 1    PRO B C    1 
ATOM   1524 O  O    . PRO B 1 1  ? 15.561 13.056  1.629  1.00 20.50  ? 1    PRO B O    1 
ATOM   1525 C  CB   . PRO B 1 1  ? 13.339 14.418  3.350  1.00 31.21  ? 1    PRO B CB   1 
ATOM   1526 C  CG   . PRO B 1 1  ? 12.252 13.417  3.172  1.00 34.60  ? 1    PRO B CG   1 
ATOM   1527 C  CD   . PRO B 1 1  ? 11.843 13.520  1.734  1.00 38.69  ? 1    PRO B CD   1 
ATOM   1528 H  HA   . PRO B 1 1  ? 13.896 15.680  1.748  1.00 24.17  ? 1    PRO B HA   1 
ATOM   1529 H  HB2  . PRO B 1 1  ? 14.037 14.061  3.955  1.00 37.45  ? 1    PRO B HB2  1 
ATOM   1530 H  HB3  . PRO B 1 1  ? 12.976 15.250  3.745  1.00 37.45  ? 1    PRO B HB3  1 
ATOM   1531 H  HG2  . PRO B 1 1  ? 12.581 12.506  3.376  1.00 41.52  ? 1    PRO B HG2  1 
ATOM   1532 H  HG3  . PRO B 1 1  ? 11.489 13.622  3.767  1.00 41.52  ? 1    PRO B HG3  1 
ATOM   1533 H  HD2  . PRO B 1 1  ? 11.537 12.646  1.384  1.00 46.43  ? 1    PRO B HD2  1 
ATOM   1534 H  HD3  . PRO B 1 1  ? 11.123 14.188  1.613  1.00 46.43  ? 1    PRO B HD3  1 
ATOM   1535 N  N    . GLN B 1 2  ? 16.301 15.065  2.429  1.00 17.64  ? 2    GLN B N    1 
ATOM   1536 C  CA   . GLN B 1 2  ? 17.652 14.679  2.807  1.00 16.78  ? 2    GLN B CA   1 
ATOM   1537 C  C    . GLN B 1 2  ? 17.716 14.865  4.342  1.00 15.72  ? 2    GLN B C    1 
ATOM   1538 O  O    . GLN B 1 2  ? 17.410 15.937  4.886  1.00 20.36  ? 2    GLN B O    1 
ATOM   1539 C  CB   . GLN B 1 2  ? 18.730 15.459  2.098  1.00 20.97  ? 2    GLN B CB   1 
ATOM   1540 C  CG   . GLN B 1 2  ? 20.164 15.043  2.500  1.00 22.74  ? 2    GLN B CG   1 
ATOM   1541 C  CD   . GLN B 1 2  ? 21.196 15.727  1.608  1.00 22.32  ? 2    GLN B CD   1 
ATOM   1542 O  OE1  . GLN B 1 2  ? 21.734 16.786  2.024  1.00 28.38  ? 2    GLN B OE1  1 
ATOM   1543 N  NE2  . GLN B 1 2  ? 21.466 15.143  0.443  1.00 27.69  ? 2    GLN B NE2  1 
ATOM   1544 H  H    . GLN B 1 2  ? 16.080 15.915  2.488  1.00 21.16  ? 2    GLN B H    1 
ATOM   1545 H  HA   . GLN B 1 2  ? 17.774 13.709  2.599  1.00 20.14  ? 2    GLN B HA   1 
ATOM   1546 H  HB2  . GLN B 1 2  ? 18.623 15.337  1.121  1.00 25.17  ? 2    GLN B HB2  1 
ATOM   1547 H  HB3  . GLN B 1 2  ? 18.610 16.422  2.295  1.00 25.17  ? 2    GLN B HB3  1 
ATOM   1548 H  HG2  . GLN B 1 2  ? 20.327 15.290  3.444  1.00 27.29  ? 2    GLN B HG2  1 
ATOM   1549 H  HG3  . GLN B 1 2  ? 20.257 14.060  2.419  1.00 27.29  ? 2    GLN B HG3  1 
ATOM   1550 H  HE21 . GLN B 1 2  ? 22.060 15.497  -0.100 1.00 33.22  ? 2    GLN B HE21 1 
ATOM   1551 H  HE22 . GLN B 1 2  ? 21.050 14.401  0.215  1.00 33.22  ? 2    GLN B HE22 1 
ATOM   1552 N  N    . ILE B 1 3  ? 18.112 13.791  5.012  1.00 12.93  ? 3    ILE B N    1 
ATOM   1553 C  CA   . ILE B 1 3  ? 18.217 13.785  6.473  1.00 13.29  ? 3    ILE B CA   1 
ATOM   1554 C  C    . ILE B 1 3  ? 19.657 13.549  6.920  1.00 14.29  ? 3    ILE B C    1 
ATOM   1555 O  O    . ILE B 1 3  ? 20.265 12.513  6.613  1.00 11.79  ? 3    ILE B O    1 
ATOM   1556 C  CB   . ILE B 1 3  ? 17.255 12.748  7.086  1.00 14.81  ? 3    ILE B CB   1 
ATOM   1557 C  CG1  . ILE B 1 3  ? 15.817 13.106  6.674  1.00 17.03  ? 3    ILE B CG1  1 
ATOM   1558 C  CG2  . ILE B 1 3  ? 17.303 12.614  8.610  1.00 15.53  ? 3    ILE B CG2  1 
ATOM   1559 C  CD1  . ILE B 1 3  ? 14.867 11.975  6.893  1.00 22.75  ? 3    ILE B CD1  1 
ATOM   1560 H  H    . ILE B 1 3  ? 18.318 13.061  4.566  1.00 15.51  ? 3    ILE B H    1 
ATOM   1561 H  HA   . ILE B 1 3  ? 17.941 14.688  6.802  1.00 15.95  ? 3    ILE B HA   1 
ATOM   1562 H  HB   . ILE B 1 3  ? 17.474 11.856  6.692  1.00 17.77  ? 3    ILE B HB   1 
ATOM   1563 H  HG12 . ILE B 1 3  ? 15.514 13.890  7.198  1.00 20.44  ? 3    ILE B HG12 1 
ATOM   1564 H  HG13 . ILE B 1 3  ? 15.806 13.358  5.717  1.00 20.44  ? 3    ILE B HG13 1 
ATOM   1565 H  HG21 . ILE B 1 3  ? 18.216 12.394  8.890  1.00 23.30  ? 3    ILE B HG21 1 
ATOM   1566 H  HG22 . ILE B 1 3  ? 16.694 11.901  8.894  1.00 23.30  ? 3    ILE B HG22 1 
ATOM   1567 H  HG23 . ILE B 1 3  ? 17.030 13.460  9.021  1.00 23.30  ? 3    ILE B HG23 1 
ATOM   1568 H  HD11 . ILE B 1 3  ? 13.959 12.263  6.666  1.00 34.12  ? 3    ILE B HD11 1 
ATOM   1569 H  HD12 . ILE B 1 3  ? 14.898 11.701  7.834  1.00 34.12  ? 3    ILE B HD12 1 
ATOM   1570 H  HD13 . ILE B 1 3  ? 15.123 11.219  6.324  1.00 34.12  ? 3    ILE B HD13 1 
ATOM   1571 N  N    . THR B 1 4  ? 20.199 14.507  7.673  1.00 14.64  ? 4    THR B N    1 
ATOM   1572 C  CA   . THR B 1 4  ? 21.502 14.405  8.271  1.00 12.04  ? 4    THR B CA   1 
ATOM   1573 C  C    . THR B 1 4  ? 21.533 13.542  9.547  1.00 11.99  ? 4    THR B C    1 
ATOM   1574 O  O    . THR B 1 4  ? 20.490 13.126  10.068 1.00 12.12  ? 4    THR B O    1 
ATOM   1575 C  CB   . THR B 1 4  ? 22.111 15.782  8.546  1.00 15.37  ? 4    THR B CB   1 
ATOM   1576 O  OG1  . THR B 1 4  ? 21.298 16.556  9.409  1.00 23.62  ? 4    THR B OG1  1 
ATOM   1577 C  CG2  . THR B 1 4  ? 22.196 16.631  7.257  1.00 21.67  ? 4    THR B CG2  1 
ATOM   1578 H  H    . THR B 1 4  ? 19.734 15.241  7.812  1.00 17.56  ? 4    THR B H    1 
ATOM   1579 H  HA   . THR B 1 4  ? 22.093 13.955  7.602  1.00 14.44  ? 4    THR B HA   1 
ATOM   1580 H  HB   . THR B 1 4  ? 23.023 15.677  8.943  1.00 18.44  ? 4    THR B HB   1 
ATOM   1581 H  HG1  . THR B 1 4  ? 21.228 16.168  10.151 1.00 35.43  ? 4    THR B HG1  1 
ATOM   1582 H  HG21 . THR B 1 4  ? 22.552 17.518  7.473  1.00 32.50  ? 4    THR B HG21 1 
ATOM   1583 H  HG22 . THR B 1 4  ? 21.302 16.723  6.867  1.00 32.50  ? 4    THR B HG22 1 
ATOM   1584 H  HG23 . THR B 1 4  ? 22.790 16.189  6.614  1.00 32.50  ? 4    THR B HG23 1 
ATOM   1585 N  N    . LEU B 1 5  ? 22.715 13.244  10.068 1.00 9.74   ? 5    LEU B N    1 
ATOM   1586 C  CA   . LEU B 1 5  ? 22.844 12.246  11.161 1.00 8.35   ? 5    LEU B CA   1 
ATOM   1587 C  C    . LEU B 1 5  ? 23.473 12.824  12.412 1.00 8.05   ? 5    LEU B C    1 
ATOM   1588 O  O    . LEU B 1 5  ? 23.963 12.077  13.294 1.00 7.88   ? 5    LEU B O    1 
ATOM   1589 C  CB   . LEU B 1 5  ? 23.594 11.022  10.625 1.00 8.18   ? 5    LEU B CB   1 
ATOM   1590 C  CG   . LEU B 1 5  ? 22.914 10.274  9.450  1.00 9.12   ? 5    LEU B CG   1 
ATOM   1591 C  CD1  . LEU B 1 5  ? 23.828 9.181   8.859  1.00 10.97  ? 5    LEU B CD1  1 
ATOM   1592 C  CD2  . LEU B 1 5  ? 21.591 9.672   9.913  1.00 9.80   ? 5    LEU B CD2  1 
ATOM   1593 H  H    . LEU B 1 5  ? 23.436 13.645  9.761  1.00 11.69  ? 5    LEU B H    1 
ATOM   1594 H  HA   . LEU B 1 5  ? 21.920 11.948  11.402 1.00 10.02  ? 5    LEU B HA   1 
ATOM   1595 H  HB2  . LEU B 1 5  ? 24.493 11.313  10.330 1.00 9.81   ? 5    LEU B HB2  1 
ATOM   1596 H  HB3  . LEU B 1 5  ? 23.718 10.383  11.371 1.00 9.81   ? 5    LEU B HB3  1 
ATOM   1597 H  HG   . LEU B 1 5  ? 22.718 10.939  8.730  1.00 10.94  ? 5    LEU B HG   1 
ATOM   1598 H  HD11 . LEU B 1 5  ? 24.677 9.582   8.576  1.00 16.45  ? 5    LEU B HD11 1 
ATOM   1599 H  HD12 . LEU B 1 5  ? 23.388 8.770   8.086  1.00 16.45  ? 5    LEU B HD12 1 
ATOM   1600 H  HD13 . LEU B 1 5  ? 24.001 8.496   9.539  1.00 16.45  ? 5    LEU B HD13 1 
ATOM   1601 H  HD21 . LEU B 1 5  ? 21.028 10.376  10.298 1.00 14.69  ? 5    LEU B HD21 1 
ATOM   1602 H  HD22 . LEU B 1 5  ? 21.764 8.985   10.591 1.00 14.69  ? 5    LEU B HD22 1 
ATOM   1603 H  HD23 . LEU B 1 5  ? 21.131 9.267   9.148  1.00 14.69  ? 5    LEU B HD23 1 
ATOM   1604 N  N    . TRP B 1 6  ? 23.489 14.148  12.583 1.00 8.46   ? 6    TRP B N    1 
ATOM   1605 C  CA   . TRP B 1 6  ? 23.941 14.834  13.768 1.00 8.46   ? 6    TRP B CA   1 
ATOM   1606 C  C    . TRP B 1 6  ? 23.192 14.359  15.015 1.00 8.25   ? 6    TRP B C    1 
ATOM   1607 O  O    . TRP B 1 6  ? 23.795 14.222  16.088 1.00 9.42   ? 6    TRP B O    1 
ATOM   1608 C  CB   . TRP B 1 6  ? 23.770 16.346  13.590 1.00 9.73   ? 6    TRP B CB   1 
ATOM   1609 C  CG   . TRP B 1 6  ? 24.530 17.071  12.571 1.00 9.40   ? 6    TRP B CG   1 
ATOM   1610 C  CD1  . TRP B 1 6  ? 24.021 17.738  11.479 1.00 14.50  ? 6    TRP B CD1  1 
ATOM   1611 C  CD2  . TRP B 1 6  ? 25.965 17.259  12.525 1.00 9.31   ? 6    TRP B CD2  1 
ATOM   1612 N  NE1  . TRP B 1 6  ? 25.064 18.313  10.782 1.00 14.99  ? 6    TRP B NE1  1 
ATOM   1613 C  CE2  . TRP B 1 6  ? 26.243 18.040  11.392 1.00 13.83  ? 6    TRP B CE2  1 
ATOM   1614 C  CE3  . TRP B 1 6  ? 27.000 16.852  13.342 1.00 11.49  ? 6    TRP B CE3  1 
ATOM   1615 C  CZ2  . TRP B 1 6  ? 27.574 18.393  11.082 1.00 13.97  ? 6    TRP B CZ2  1 
ATOM   1616 C  CZ3  . TRP B 1 6  ? 28.317 17.197  13.037 1.00 15.72  ? 6    TRP B CZ3  1 
ATOM   1617 C  CH2  . TRP B 1 6  ? 28.592 17.962  11.908 1.00 15.04  ? 6    TRP B CH2  1 
ATOM   1618 H  H    . TRP B 1 6  ? 23.199 14.644  11.916 1.00 10.15  ? 6    TRP B H    1 
ATOM   1619 H  HA   . TRP B 1 6  ? 24.914 14.640  13.893 1.00 10.15  ? 6    TRP B HA   1 
ATOM   1620 H  HB2  . TRP B 1 6  ? 22.810 16.511  13.410 1.00 11.68  ? 6    TRP B HB2  1 
ATOM   1621 H  HB3  . TRP B 1 6  ? 23.974 16.767  14.462 1.00 11.68  ? 6    TRP B HB3  1 
ATOM   1622 H  HD1  . TRP B 1 6  ? 23.102 17.794  11.244 1.00 17.41  ? 6    TRP B HD1  1 
ATOM   1623 H  HE1  . TRP B 1 6  ? 24.976 18.789  10.048 1.00 17.98  ? 6    TRP B HE1  1 
ATOM   1624 H  HE3  . TRP B 1 6  ? 26.815 16.334  14.117 1.00 13.79  ? 6    TRP B HE3  1 
ATOM   1625 H  HZ2  . TRP B 1 6  ? 27.766 18.920  10.316 1.00 16.76  ? 6    TRP B HZ2  1 
ATOM   1626 H  HZ3  . TRP B 1 6  ? 29.026 16.910  13.600 1.00 18.87  ? 6    TRP B HZ3  1 
ATOM   1627 H  HH2  . TRP B 1 6  ? 29.491 18.190  11.702 1.00 18.05  ? 6    TRP B HH2  1 
ATOM   1628 N  N    . LYS B 1 7  ? 21.882 14.158  14.856 1.00 8.38   ? 7    LYS B N    1 
ATOM   1629 C  CA   . LYS B 1 7  ? 20.974 13.661  15.889 1.00 9.51   ? 7    LYS B CA   1 
ATOM   1630 C  C    . LYS B 1 7  ? 20.300 12.400  15.349 1.00 9.04   ? 7    LYS B C    1 
ATOM   1631 O  O    . LYS B 1 7  ? 20.391 12.069  14.143 1.00 9.30   ? 7    LYS B O    1 
ATOM   1632 C  CB   . LYS B 1 7  ? 19.951 14.720  16.337 1.00 12.99  ? 7    LYS B CB   1 
ATOM   1633 C  CG   . LYS B 1 7  ? 20.626 16.086  16.722 1.00 16.73  ? 7    LYS B CG   1 
ATOM   1634 C  CD   . LYS B 1 7  ? 21.324 16.018  18.073 1.00 20.34  ? 7    LYS B CD   1 
ATOM   1635 C  CE   . LYS B 1 7  ? 21.958 17.243  18.709 1.00 27.76  ? 7    LYS B CE   1 
ATOM   1636 N  NZ   . LYS B 1 7  ? 20.895 18.136  19.235 1.00 23.08  ? 7    LYS B NZ   1 
ATOM   1637 H  H    . LYS B 1 7  ? 21.538 14.340  14.067 1.00 10.05  ? 7    LYS B H    1 
ATOM   1638 H  HA   . LYS B 1 7  ? 21.522 13.402  16.684 1.00 11.41  ? 7    LYS B HA   1 
ATOM   1639 H  HB2  . LYS B 1 7  ? 19.303 14.875  15.605 1.00 15.59  ? 7    LYS B HB2  1 
ATOM   1640 H  HB3  . LYS B 1 7  ? 19.449 14.376  17.118 1.00 15.59  ? 7    LYS B HB3  1 
ATOM   1641 H  HG2  . LYS B 1 7  ? 21.286 16.330  16.026 1.00 20.08  ? 7    LYS B HG2  1 
ATOM   1642 H  HG3  . LYS B 1 7  ? 19.935 16.794  16.748 1.00 20.08  ? 7    LYS B HG3  1 
ATOM   1643 H  HD2  . LYS B 1 7  ? 20.663 15.668  18.721 1.00 24.40  ? 7    LYS B HD2  1 
ATOM   1644 H  HD3  . LYS B 1 7  ? 22.036 15.335  17.994 1.00 24.40  ? 7    LYS B HD3  1 
ATOM   1645 H  HE2  . LYS B 1 7  ? 22.557 16.965  19.446 1.00 33.31  ? 7    LYS B HE2  1 
ATOM   1646 H  HE3  . LYS B 1 7  ? 22.499 17.728  18.036 1.00 33.31  ? 7    LYS B HE3  1 
ATOM   1647 H  HZ1  . LYS B 1 7  ? 21.274 18.883  19.589 1.00 34.62  ? 7    LYS B HZ1  1 
ATOM   1648 H  HZ2  . LYS B 1 7  ? 20.425 17.700  19.881 1.00 34.62  ? 7    LYS B HZ2  1 
ATOM   1649 H  HZ3  . LYS B 1 7  ? 20.334 18.372  18.559 1.00 34.62  ? 7    LYS B HZ3  1 
ATOM   1650 N  N    . ARG B 1 8  ? 19.615 11.660  16.229 1.00 9.48   ? 8    ARG B N    1 
ATOM   1651 C  CA   . ARG B 1 8  ? 18.891 10.449  15.733 1.00 8.92   ? 8    ARG B CA   1 
ATOM   1652 C  C    . ARG B 1 8  ? 17.877 10.820  14.639 1.00 9.56   ? 8    ARG B C    1 
ATOM   1653 O  O    . ARG B 1 8  ? 17.139 11.819  14.802 1.00 10.26  ? 8    ARG B O    1 
ATOM   1654 C  CB   . ARG B 1 8  ? 18.123 9.776   16.862 1.00 9.83   ? 8    ARG B CB   1 
ATOM   1655 C  CG   . ARG B 1 8  ? 18.985 9.204   18.005 1.00 10.62  ? 8    ARG B CG   1 
ATOM   1656 C  CD   . ARG B 1 8  ? 18.180 8.315   18.992 1.00 11.16  ? 8    ARG B CD   1 
ATOM   1657 N  NE   . ARG B 1 8  ? 19.091 7.596   19.930 1.00 15.96  ? 8    ARG B NE   1 
ATOM   1658 C  CZ   . ARG B 1 8  ? 18.756 6.702   20.853 1.00 24.77  ? 8    ARG B CZ   1 
ATOM   1659 N  NH1  . ARG B 1 8  ? 17.471 6.409   20.956 1.00 23.65  ? 8    ARG B NH1  1 
ATOM   1660 N  NH2  . ARG B 1 8  ? 19.647 6.105   21.647 1.00 22.25  ? 8    ARG B NH2  1 
ATOM   1661 H  H    . ARG B 1 8  ? 19.591 11.880  17.081 1.00 11.38  ? 8    ARG B H    1 
ATOM   1662 H  HA   . ARG B 1 8  ? 19.555 9.802   15.358 1.00 10.70  ? 8    ARG B HA   1 
ATOM   1663 H  HB2  . ARG B 1 8  ? 17.493 10.435  17.247 1.00 11.80  ? 8    ARG B HB2  1 
ATOM   1664 H  HB3  . ARG B 1 8  ? 17.585 9.040   16.478 1.00 11.80  ? 8    ARG B HB3  1 
ATOM   1665 H  HG2  . ARG B 1 8  ? 19.720 8.667   17.616 1.00 12.75  ? 8    ARG B HG2  1 
ATOM   1666 H  HG3  . ARG B 1 8  ? 19.392 9.954   18.507 1.00 12.75  ? 8    ARG B HG3  1 
ATOM   1667 H  HD2  . ARG B 1 8  ? 17.554 8.880   19.510 1.00 13.39  ? 8    ARG B HD2  1 
ATOM   1668 H  HD3  . ARG B 1 8  ? 17.646 7.655   18.481 1.00 13.39  ? 8    ARG B HD3  1 
ATOM   1669 H  HE   . ARG B 1 8  ? 19.948 7.786   19.864 1.00 19.15  ? 8    ARG B HE   1 
ATOM   1670 H  HH11 . ARG B 1 8  ? 16.886 6.801   20.428 1.00 28.38  ? 8    ARG B HH11 1 
ATOM   1671 H  HH12 . ARG B 1 8  ? 17.200 5.822   21.554 1.00 28.38  ? 8    ARG B HH12 1 
ATOM   1672 H  HH21 . ARG B 1 8  ? 19.380 5.515   22.242 1.00 26.70  ? 8    ARG B HH21 1 
ATOM   1673 H  HH22 . ARG B 1 8  ? 20.502 6.302   21.575 1.00 26.70  ? 8    ARG B HH22 1 
ATOM   1674 N  N    . PRO B 1 9  ? 17.856 10.128  13.501 1.00 9.09   ? 9    PRO B N    1 
ATOM   1675 C  CA   . PRO B 1 9  ? 16.941 10.445  12.390 1.00 9.03   ? 9    PRO B CA   1 
ATOM   1676 C  C    . PRO B 1 9  ? 15.492 9.984   12.661 1.00 8.61   ? 9    PRO B C    1 
ATOM   1677 O  O    . PRO B 1 9  ? 15.015 8.964   12.157 1.00 9.65   ? 9    PRO B O    1 
ATOM   1678 C  CB   . PRO B 1 9  ? 17.576 9.776   11.206 1.00 9.97   ? 9    PRO B CB   1 
ATOM   1679 C  CG   . PRO B 1 9  ? 18.312 8.598   11.796 1.00 9.81   ? 9    PRO B CG   1 
ATOM   1680 C  CD   . PRO B 1 9  ? 18.830 9.085   13.132 1.00 9.44   ? 9    PRO B CD   1 
ATOM   1681 H  HA   . PRO B 1 9  ? 16.943 11.434  12.241 1.00 10.83  ? 9    PRO B HA   1 
ATOM   1682 H  HB2  . PRO B 1 9  ? 16.889 9.476   10.560 1.00 11.97  ? 9    PRO B HB2  1 
ATOM   1683 H  HB3  . PRO B 1 9  ? 18.202 10.390  10.747 1.00 11.97  ? 9    PRO B HB3  1 
ATOM   1684 H  HG2  . PRO B 1 9  ? 17.702 7.828   11.917 1.00 11.78  ? 9    PRO B HG2  1 
ATOM   1685 H  HG3  . PRO B 1 9  ? 19.061 8.323   11.209 1.00 11.78  ? 9    PRO B HG3  1 
ATOM   1686 H  HD2  . PRO B 1 9  ? 18.842 8.353   13.799 1.00 11.32  ? 9    PRO B HD2  1 
ATOM   1687 H  HD3  . PRO B 1 9  ? 19.742 9.460   13.047 1.00 11.32  ? 9    PRO B HD3  1 
ATOM   1688 N  N    . LEU B 1 10 ? 14.833 10.763  13.470 1.00 11.62  ? 10   LEU B N    1 
ATOM   1689 C  CA   . LEU B 1 10 ? 13.420 10.568  13.852 1.00 11.01  ? 10   LEU B CA   1 
ATOM   1690 C  C    . LEU B 1 10 ? 12.474 11.311  12.950 1.00 12.10  ? 10   LEU B C    1 
ATOM   1691 O  O    . LEU B 1 10 ? 12.639 12.511  12.734 1.00 15.77  ? 10   LEU B O    1 
ATOM   1692 C  CB   . LEU B 1 10 ? 13.134 11.024  15.308 1.00 15.21  ? 10   LEU B CB   1 
ATOM   1693 C  CG   . LEU B 1 10 ? 14.012 10.334  16.370 1.00 17.31  ? 10   LEU B CG   1 
ATOM   1694 C  CD1  . LEU B 1 10 ? 14.010 11.061  17.706 1.00 26.15  ? 10   LEU B CD1  1 
ATOM   1695 C  CD2  . LEU B 1 10 ? 13.588 8.853   16.514 1.00 18.95  ? 10   LEU B CD2  1 
ATOM   1696 H  H    . LEU B 1 10 ? 15.258 11.452  13.813 1.00 13.95  ? 10   LEU B H    1 
ATOM   1697 H  HA   . LEU B 1 10 ? 13.211 9.592   13.785 1.00 13.21  ? 10   LEU B HA   1 
ATOM   1698 H  HB2  . LEU B 1 10 ? 13.274 12.002  15.367 1.00 18.25  ? 10   LEU B HB2  1 
ATOM   1699 H  HB3  . LEU B 1 10 ? 12.183 10.844  15.516 1.00 18.25  ? 10   LEU B HB3  1 
ATOM   1700 H  HG   . LEU B 1 10 ? 14.952 10.341  16.029 1.00 20.77  ? 10   LEU B HG   1 
ATOM   1701 H  HD11 . LEU B 1 10 ? 14.589 10.585  18.337 1.00 39.23  ? 10   LEU B HD11 1 
ATOM   1702 H  HD12 . LEU B 1 10 ? 13.097 11.093  18.059 1.00 39.23  ? 10   LEU B HD12 1 
ATOM   1703 H  HD13 . LEU B 1 10 ? 14.345 11.974  17.581 1.00 39.23  ? 10   LEU B HD13 1 
ATOM   1704 H  HD21 . LEU B 1 10 ? 13.594 8.424   15.633 1.00 28.43  ? 10   LEU B HD21 1 
ATOM   1705 H  HD22 . LEU B 1 10 ? 12.686 8.806   16.894 1.00 28.43  ? 10   LEU B HD22 1 
ATOM   1706 H  HD23 . LEU B 1 10 ? 14.216 8.389   17.107 1.00 28.43  ? 10   LEU B HD23 1 
ATOM   1707 N  N    . VAL B 1 11 ? 11.475 10.593  12.418 1.00 9.61   ? 11   VAL B N    1 
ATOM   1708 C  CA   . VAL B 1 11 ? 10.448 11.171  11.549 1.00 9.70   ? 11   VAL B CA   1 
ATOM   1709 C  C    . VAL B 1 11 ? 9.047  10.773  12.026 1.00 9.95   ? 11   VAL B C    1 
ATOM   1710 O  O    . VAL B 1 11 ? 8.883  9.825   12.809 1.00 9.61   ? 11   VAL B O    1 
ATOM   1711 C  CB   . VAL B 1 11 ? 10.618 10.811  10.064 1.00 10.57  ? 11   VAL B CB   1 
ATOM   1712 C  CG1  . VAL B 1 11 ? 12.001 11.308  9.567  1.00 14.07  ? 11   VAL B CG1  1 
ATOM   1713 C  CG2  . VAL B 1 11 ? 10.347 9.338   9.801  1.00 11.69  ? 11   VAL B CG2  1 
ATOM   1714 H  H    . VAL B 1 11 ? 11.434 9.733   12.599 1.00 11.53  ? 11   VAL B H    1 
ATOM   1715 H  HA   . VAL B 1 11 ? 10.518 12.166  11.625 1.00 11.64  ? 11   VAL B HA   1 
ATOM   1716 H  HB   . VAL B 1 11 ? 9.926  11.328  9.560  1.00 12.68  ? 11   VAL B HB   1 
ATOM   1717 H  HG11 . VAL B 1 11 ? 12.088 12.267  9.747  1.00 21.10  ? 11   VAL B HG11 1 
ATOM   1718 H  HG12 . VAL B 1 11 ? 12.079 11.148  8.603  1.00 21.10  ? 11   VAL B HG12 1 
ATOM   1719 H  HG13 . VAL B 1 11 ? 12.711 10.822  10.037 1.00 21.10  ? 11   VAL B HG13 1 
ATOM   1720 H  HG21 . VAL B 1 11 ? 9.453  9.106   10.129 1.00 17.54  ? 11   VAL B HG21 1 
ATOM   1721 H  HG22 . VAL B 1 11 ? 11.017 8.795   10.266 1.00 17.54  ? 11   VAL B HG22 1 
ATOM   1722 H  HG23 . VAL B 1 11 ? 10.397 9.164   8.838  1.00 17.54  ? 11   VAL B HG23 1 
ATOM   1723 N  N    . THR B 1 12 ? 8.022  11.462  11.520 1.00 9.07   ? 12   THR B N    1 
ATOM   1724 C  CA   . THR B 1 12 ? 6.618  11.083  11.818 1.00 9.21   ? 12   THR B CA   1 
ATOM   1725 C  C    . THR B 1 12 ? 6.158  9.985   10.897 1.00 9.57   ? 12   THR B C    1 
ATOM   1726 O  O    . THR B 1 12 ? 6.335  10.055  9.670  1.00 10.15  ? 12   THR B O    1 
ATOM   1727 C  CB   . THR B 1 12 ? 5.716  12.321  11.657 1.00 12.64  ? 12   THR B CB   1 
ATOM   1728 O  OG1  . THR B 1 12 ? 6.190  13.344  12.565 1.00 13.27  ? 12   THR B OG1  1 
ATOM   1729 C  CG2  . THR B 1 12 ? 4.275  11.991  11.982 1.00 14.56  ? 12   THR B CG2  1 
ATOM   1730 H  H    . THR B 1 12 ? 8.181  12.154  11.000 1.00 10.88  ? 12   THR B H    1 
ATOM   1731 H  HA   . THR B 1 12 ? 6.562  10.759  12.763 1.00 11.05  ? 12   THR B HA   1 
ATOM   1732 H  HB   . THR B 1 12 ? 5.777  12.657  10.717 1.00 15.16  ? 12   THR B HB   1 
ATOM   1733 H  HG1  . THR B 1 12 ? 6.992  13.521  12.393 1.00 19.90  ? 12   THR B HG1  1 
ATOM   1734 H  HG21 . THR B 1 12 ? 3.723  12.793  11.870 1.00 21.84  ? 12   THR B HG21 1 
ATOM   1735 H  HG22 . THR B 1 12 ? 4.212  11.677  12.908 1.00 21.84  ? 12   THR B HG22 1 
ATOM   1736 H  HG23 . THR B 1 12 ? 3.957  11.288  11.377 1.00 21.84  ? 12   THR B HG23 1 
ATOM   1737 N  N    . ILE B 1 13 ? 5.520  8.942   11.471 1.00 8.75   ? 13   ILE B N    1 
ATOM   1738 C  CA   . ILE B 1 13 ? 4.866  7.852   10.737 1.00 8.08   ? 13   ILE B CA   1 
ATOM   1739 C  C    . ILE B 1 13 ? 3.421  7.731   11.173 1.00 9.37   ? 13   ILE B C    1 
ATOM   1740 O  O    . ILE B 1 13 ? 2.999  8.255   12.224 1.00 10.11  ? 13   ILE B O    1 
ATOM   1741 C  CB   . ILE B 1 13 ? 5.573  6.503   10.974 1.00 8.21   ? 13   ILE B CB   1 
ATOM   1742 C  CG1  . ILE B 1 13 ? 5.398  5.960   12.367 1.00 9.14   ? 13   ILE B CG1  1 
ATOM   1743 C  CG2  . ILE B 1 13 ? 7.061  6.633   10.624 1.00 8.87   ? 13   ILE B CG2  1 
ATOM   1744 C  CD1  . ILE B 1 13 ? 5.772  4.468   12.609 1.00 9.68   ? 13   ILE B CD1  1 
ATOM   1745 H  H    . ILE B 1 13 ? 5.494  8.914   12.351 1.00 10.49  ? 13   ILE B H    1 
ATOM   1746 H  HA   . ILE B 1 13 ? 4.891  8.062   9.759  1.00 9.70   ? 13   ILE B HA   1 
ATOM   1747 H  HB   . ILE B 1 13 ? 5.173  5.840   10.342 1.00 9.86   ? 13   ILE B HB   1 
ATOM   1748 H  HG12 . ILE B 1 13 ? 5.943  6.514   12.980 1.00 10.96  ? 13   ILE B HG12 1 
ATOM   1749 H  HG13 . ILE B 1 13 ? 4.450  6.082   12.625 1.00 10.96  ? 13   ILE B HG13 1 
ATOM   1750 H  HG21 . ILE B 1 13 ? 7.154  6.965   9.707  1.00 13.31  ? 13   ILE B HG21 1 
ATOM   1751 H  HG22 . ILE B 1 13 ? 7.492  5.756   10.700 1.00 13.31  ? 13   ILE B HG22 1 
ATOM   1752 H  HG23 . ILE B 1 13 ? 7.489  7.262   11.243 1.00 13.31  ? 13   ILE B HG23 1 
ATOM   1753 H  HD11 . ILE B 1 13 ? 5.611  4.240   13.548 1.00 14.51  ? 13   ILE B HD11 1 
ATOM   1754 H  HD12 . ILE B 1 13 ? 6.719  4.330   12.397 1.00 14.51  ? 13   ILE B HD12 1 
ATOM   1755 H  HD13 . ILE B 1 13 ? 5.222  3.896   12.035 1.00 14.51  ? 13   ILE B HD13 1 
ATOM   1756 N  N    . ARG B 1 14 ? 2.614  7.086   10.339 1.00 9.01   ? 14   ARG B N    1 
ATOM   1757 C  CA   . ARG B 1 14 ? 1.202  6.790   10.567 1.00 9.70   ? 14   ARG B CA   1 
ATOM   1758 C  C    . ARG B 1 14 ? 0.996  5.304   10.414 1.00 8.55   ? 14   ARG B C    1 
ATOM   1759 O  O    . ARG B 1 14 ? 1.349  4.741   9.325  1.00 9.59   ? 14   ARG B O    1 
ATOM   1760 C  CB   . ARG B 1 14 ? 0.296  7.565   9.570  1.00 11.88  ? 14   ARG B CB   1 
ATOM   1761 C  CG   . ARG B 1 14 ? -1.190 7.521   9.874  1.00 15.93  ? 14   ARG B CG   1 
ATOM   1762 C  CD   . ARG B 1 14 ? -2.053 8.287   8.876  1.00 37.94  ? 14   ARG B CD   1 
ATOM   1763 N  NE   . ARG B 1 14 ? -1.655 9.614   8.476  1.00 43.51  ? 14   ARG B NE   1 
ATOM   1764 C  CZ   . ARG B 1 14 ? -2.033 10.848  8.793  1.00 45.71  ? 14   ARG B CZ   1 
ATOM   1765 N  NH1  . ARG B 1 14 ? -2.957 11.252  9.684  1.00 33.58  ? 14   ARG B NH1  1 
ATOM   1766 N  NH2  . ARG B 1 14 ? -1.408 11.870  8.178  1.00 43.82  ? 14   ARG B NH2  1 
ATOM   1767 H  H    . ARG B 1 14 ? 2.962  6.811   9.579  1.00 10.81  ? 14   ARG B H    1 
ATOM   1768 H  HA   . ARG B 1 14 ? 0.961  7.057   11.500 1.00 11.64  ? 14   ARG B HA   1 
ATOM   1769 H  HB2  . ARG B 1 14 ? 0.585  8.512   9.555  1.00 14.26  ? 14   ARG B HB2  1 
ATOM   1770 H  HB3  . ARG B 1 14 ? 0.441  7.196   8.663  1.00 14.26  ? 14   ARG B HB3  1 
ATOM   1771 H  HG2  . ARG B 1 14 ? -1.484 6.576   9.889  1.00 19.12  ? 14   ARG B HG2  1 
ATOM   1772 H  HG3  . ARG B 1 14 ? -1.340 7.897   10.778 1.00 19.12  ? 14   ARG B HG3  1 
ATOM   1773 H  HD2  . ARG B 1 14 ? -2.120 7.736   8.057  1.00 45.53  ? 14   ARG B HD2  1 
ATOM   1774 H  HD3  . ARG B 1 14 ? -2.964 8.351   9.258  1.00 45.53  ? 14   ARG B HD3  1 
ATOM   1775 H  HE   . ARG B 1 14 ? -1.009 9.605   7.879  1.00 52.21  ? 14   ARG B HE   1 
ATOM   1776 H  HH11 . ARG B 1 14 ? -3.406 10.657  10.152 1.00 40.30  ? 14   ARG B HH11 1 
ATOM   1777 H  HH12 . ARG B 1 14 ? -3.113 12.110  9.799  1.00 40.30  ? 14   ARG B HH12 1 
ATOM   1778 H  HH21 . ARG B 1 14 ? -0.773 11.707  7.590  1.00 52.59  ? 14   ARG B HH21 1 
ATOM   1779 H  HH22 . ARG B 1 14 ? -1.633 12.700  8.364  1.00 52.59  ? 14   ARG B HH22 1 
ATOM   1780 N  N    . ILE B 1 15 ? 0.429  4.626   11.431 1.00 8.63   ? 15   ILE B N    1 
ATOM   1781 C  CA   . ILE B 1 15 ? 0.248  3.153   11.422 1.00 10.01  ? 15   ILE B CA   1 
ATOM   1782 C  C    . ILE B 1 15 ? -0.865 2.807   12.393 1.00 12.24  ? 15   ILE B C    1 
ATOM   1783 O  O    . ILE B 1 15 ? -0.893 3.348   13.520 1.00 11.22  ? 15   ILE B O    1 
ATOM   1784 C  CB   . ILE B 1 15 ? 1.558  2.436   11.786 1.00 10.33  ? 15   ILE B CB   1 
ATOM   1785 C  CG1  . ILE B 1 15 ? 1.446  0.877   11.739 1.00 11.21  ? 15   ILE B CG1  1 
ATOM   1786 C  CG2  . ILE B 1 15 ? 2.204  2.922   13.072 1.00 13.53  ? 15   ILE B CG2  1 
ATOM   1787 C  CD1  . ILE B 1 15 ? 1.019  0.146   12.948 1.00 13.37  ? 15   ILE B CD1  1 
ATOM   1788 H  H    . ILE B 1 15 ? 0.153  5.078   12.134 1.00 10.35  ? 15   ILE B H    1 
ATOM   1789 H  HA   . ILE B 1 15 ? -0.028 2.870   10.503 1.00 12.01  ? 15   ILE B HA   1 
ATOM   1790 H  HB   . ILE B 1 15 ? 2.202  2.677   11.060 1.00 12.40  ? 15   ILE B HB   1 
ATOM   1791 H  HG12 . ILE B 1 15 ? 0.813  0.646   11.013 1.00 13.45  ? 15   ILE B HG12 1 
ATOM   1792 H  HG13 . ILE B 1 15 ? 2.331  0.523   11.474 1.00 13.45  ? 15   ILE B HG13 1 
ATOM   1793 H  HG21 . ILE B 1 15 ? 3.032  2.423   13.230 1.00 20.29  ? 15   ILE B HG21 1 
ATOM   1794 H  HG22 . ILE B 1 15 ? 1.588  2.780   13.821 1.00 20.29  ? 15   ILE B HG22 1 
ATOM   1795 H  HG23 . ILE B 1 15 ? 2.409  3.877   12.994 1.00 20.29  ? 15   ILE B HG23 1 
ATOM   1796 H  HD11 . ILE B 1 15 ? 0.980  -0.814  12.753 1.00 20.05  ? 15   ILE B HD11 1 
ATOM   1797 H  HD12 . ILE B 1 15 ? 0.132  0.459   13.223 1.00 20.05  ? 15   ILE B HD12 1 
ATOM   1798 H  HD13 . ILE B 1 15 ? 1.661  0.307   13.671 1.00 20.05  ? 15   ILE B HD13 1 
ATOM   1799 N  N    . GLY B 1 16 ? -1.811 1.940   11.980 1.00 11.41  ? 16   GLY B N    1 
ATOM   1800 C  CA   . GLY B 1 16 ? -2.797 1.442   12.970 1.00 11.71  ? 16   GLY B CA   1 
ATOM   1801 C  C    . GLY B 1 16 ? -3.692 2.512   13.503 1.00 13.20  ? 16   GLY B C    1 
ATOM   1802 O  O    . GLY B 1 16 ? -4.219 2.402   14.630 1.00 13.14  ? 16   GLY B O    1 
ATOM   1803 H  H    . GLY B 1 16 ? -1.843 1.676   11.141 1.00 13.69  ? 16   GLY B H    1 
ATOM   1804 H  HA2  . GLY B 1 16 ? -3.352 0.741   12.544 1.00 14.06  ? 16   GLY B HA2  1 
ATOM   1805 H  HA3  . GLY B 1 16 ? -2.310 1.024   13.724 1.00 14.06  ? 16   GLY B HA3  1 
ATOM   1806 N  N    . GLY B 1 17 ? -3.847 3.602   12.727 1.00 12.35  ? 17   GLY B N    1 
ATOM   1807 C  CA   . GLY B 1 17 ? -4.701 4.697   13.224 1.00 13.77  ? 17   GLY B CA   1 
ATOM   1808 C  C    . GLY B 1 17 ? -3.953 5.685   14.134 1.00 16.48  ? 17   GLY B C    1 
ATOM   1809 O  O    . GLY B 1 17 ? -4.619 6.606   14.629 1.00 23.37  ? 17   GLY B O    1 
ATOM   1810 H  H    . GLY B 1 17 ? -3.449 3.660   11.945 1.00 14.82  ? 17   GLY B H    1 
ATOM   1811 H  HA2  . GLY B 1 17 ? -5.072 5.192   12.450 1.00 16.52  ? 17   GLY B HA2  1 
ATOM   1812 H  HA3  . GLY B 1 17 ? -5.460 4.310   13.727 1.00 16.52  ? 17   GLY B HA3  1 
ATOM   1813 N  N    . GLN B 1 18 ? -2.640 5.542   14.391 1.00 11.47  ? 18   GLN B N    1 
ATOM   1814 C  CA   . GLN B 1 18 ? -1.874 6.444   15.276 1.00 12.34  ? 18   GLN B CA   1 
ATOM   1815 C  C    . GLN B 1 18 ? -0.743 7.167   14.522 1.00 12.07  ? 18   GLN B C    1 
ATOM   1816 O  O    . GLN B 1 18 ? -0.114 6.614   13.588 1.00 12.97  ? 18   GLN B O    1 
ATOM   1817 C  CB   . GLN B 1 18 ? -1.284 5.633   16.426 1.00 13.35  ? 18   GLN B CB   1 
ATOM   1818 C  CG   . GLN B 1 18 ? -2.241 5.005   17.418 1.00 17.53  ? 18   GLN B CG   1 
ATOM   1819 C  CD   . GLN B 1 18 ? -1.562 4.397   18.602 1.00 18.66  ? 18   GLN B CD   1 
ATOM   1820 O  OE1  . GLN B 1 18 ? -0.769 3.485   18.402 1.00 22.00  ? 18   GLN B OE1  1 
ATOM   1821 N  NE2  . GLN B 1 18 ? -1.872 4.916   19.765 1.00 25.20  ? 18   GLN B NE2  1 
ATOM   1822 H  H    . GLN B 1 18 ? -2.213 4.874   14.010 1.00 13.76  ? 18   GLN B H    1 
ATOM   1823 H  HA   . GLN B 1 18 ? -2.497 7.129   15.653 1.00 14.81  ? 18   GLN B HA   1 
ATOM   1824 H  HB2  . GLN B 1 18 ? -0.735 4.908   16.035 1.00 16.02  ? 18   GLN B HB2  1 
ATOM   1825 H  HB3  . GLN B 1 18 ? -0.671 6.224   16.930 1.00 16.02  ? 18   GLN B HB3  1 
ATOM   1826 H  HG2  . GLN B 1 18 ? -2.874 5.698   17.733 1.00 21.04  ? 18   GLN B HG2  1 
ATOM   1827 H  HG3  . GLN B 1 18 ? -2.766 4.305   16.956 1.00 21.04  ? 18   GLN B HG3  1 
ATOM   1828 H  HE21 . GLN B 1 18 ? -1.496 4.609   20.499 1.00 30.24  ? 18   GLN B HE21 1 
ATOM   1829 H  HE22 . GLN B 1 18 ? -2.457 5.572   19.812 1.00 30.24  ? 18   GLN B HE22 1 
ATOM   1830 N  N    . LEU B 1 19 ? -0.472 8.416   14.875 1.00 12.86  ? 19   LEU B N    1 
ATOM   1831 C  CA   . LEU B 1 19 ? 0.746  9.155   14.498 1.00 10.13  ? 19   LEU B CA   1 
ATOM   1832 C  C    . LEU B 1 19 ? 1.803  8.897   15.546 1.00 9.78   ? 19   LEU B C    1 
ATOM   1833 O  O    . LEU B 1 19 ? 1.498  9.008   16.715 1.00 13.99  ? 19   LEU B O    1 
ATOM   1834 C  CB   . LEU B 1 19 ? 0.519  10.666  14.425 1.00 16.73  ? 19   LEU B CB   1 
ATOM   1835 C  CG   . LEU B 1 19 ? -0.189 11.228  13.186 1.00 16.89  ? 19   LEU B CG   1 
ATOM   1836 C  CD1  . LEU B 1 19 ? -0.153 12.751  13.289 1.00 22.56  ? 19   LEU B CD1  1 
ATOM   1837 C  CD2  . LEU B 1 19 ? 0.404  10.867  11.849 1.00 30.34  ? 19   LEU B CD2  1 
ATOM   1838 H  H    . LEU B 1 19 ? -1.065 8.835   15.372 1.00 15.43  ? 19   LEU B H    1 
ATOM   1839 H  HA   . LEU B 1 19 ? 1.071  8.826   13.611 1.00 12.16  ? 19   LEU B HA   1 
ATOM   1840 H  HB2  . LEU B 1 19 ? -0.006 10.932  15.220 1.00 20.07  ? 19   LEU B HB2  1 
ATOM   1841 H  HB3  . LEU B 1 19 ? 1.402  11.109  14.496 1.00 20.07  ? 19   LEU B HB3  1 
ATOM   1842 H  HG   . LEU B 1 19 ? -1.143 10.930  13.202 1.00 20.27  ? 19   LEU B HG   1 
ATOM   1843 H  HD11 . LEU B 1 19 ? -0.578 13.032  14.126 1.00 33.84  ? 19   LEU B HD11 1 
ATOM   1844 H  HD12 . LEU B 1 19 ? -0.636 13.141  12.531 1.00 33.84  ? 19   LEU B HD12 1 
ATOM   1845 H  HD13 . LEU B 1 19 ? 0.778  13.058  13.276 1.00 33.84  ? 19   LEU B HD13 1 
ATOM   1846 H  HD21 . LEU B 1 19 ? -0.114 11.295  11.136 1.00 45.52  ? 19   LEU B HD21 1 
ATOM   1847 H  HD22 . LEU B 1 19 ? 0.378  9.894   11.733 1.00 45.52  ? 19   LEU B HD22 1 
ATOM   1848 H  HD23 . LEU B 1 19 ? 1.333  11.176  11.810 1.00 45.52  ? 19   LEU B HD23 1 
ATOM   1849 N  N    . LYS B 1 20 ? 3.017  8.539   15.129 1.00 9.93   ? 20   LYS B N    1 
ATOM   1850 C  CA   . LYS B 1 20 ? 4.141  8.218   16.033 1.00 9.70   ? 20   LYS B CA   1 
ATOM   1851 C  C    . LYS B 1 20 ? 5.432  8.841   15.489 1.00 8.52   ? 20   LYS B C    1 
ATOM   1852 O  O    . LYS B 1 20 ? 5.521  9.138   14.301 1.00 11.37  ? 20   LYS B O    1 
ATOM   1853 C  CB   . LYS B 1 20 ? 4.297  6.687   16.112 1.00 10.49  ? 20   LYS B CB   1 
ATOM   1854 C  CG   . LYS B 1 20 ? 3.080  5.878   16.523 1.00 11.29  ? 20   LYS B CG   1 
ATOM   1855 C  CD   . LYS B 1 20 ? 3.386  4.381   16.436 1.00 12.86  ? 20   LYS B CD   1 
ATOM   1856 C  CE   . LYS B 1 20 ? 2.158  3.592   16.815 1.00 12.95  ? 20   LYS B CE   1 
ATOM   1857 N  NZ   . LYS B 1 20 ? 2.027  3.480   18.307 1.00 11.75  ? 20   LYS B NZ   1 
ATOM   1858 H  H    . LYS B 1 20 ? 3.158  8.490   14.261 1.00 11.92  ? 20   LYS B H    1 
ATOM   1859 H  HA   . LYS B 1 20 ? 3.951  8.583   16.945 1.00 11.64  ? 20   LYS B HA   1 
ATOM   1860 H  HB2  . LYS B 1 20 ? 4.592  6.365   15.224 1.00 12.59  ? 20   LYS B HB2  1 
ATOM   1861 H  HB3  . LYS B 1 20 ? 5.025  6.489   16.753 1.00 12.59  ? 20   LYS B HB3  1 
ATOM   1862 H  HG2  . LYS B 1 20 ? 2.822  6.111   17.450 1.00 13.55  ? 20   LYS B HG2  1 
ATOM   1863 H  HG3  . LYS B 1 20 ? 2.320  6.096   15.927 1.00 13.55  ? 20   LYS B HG3  1 
ATOM   1864 H  HD2  . LYS B 1 20 ? 3.662  4.148   15.514 1.00 15.43  ? 20   LYS B HD2  1 
ATOM   1865 H  HD3  . LYS B 1 20 ? 4.131  4.156   17.048 1.00 15.43  ? 20   LYS B HD3  1 
ATOM   1866 H  HE2  . LYS B 1 20 ? 1.354  4.037   16.447 1.00 15.54  ? 20   LYS B HE2  1 
ATOM   1867 H  HE3  . LYS B 1 20 ? 2.214  2.685   16.421 1.00 15.54  ? 20   LYS B HE3  1 
ATOM   1868 H  HZ1  . LYS B 1 20 ? 1.260  3.036   18.512 1.00 17.63  ? 20   LYS B HZ1  1 
ATOM   1869 H  HZ2  . LYS B 1 20 ? 2.003  4.313   18.673 1.00 17.63  ? 20   LYS B HZ2  1 
ATOM   1870 H  HZ3  . LYS B 1 20 ? 2.740  3.023   18.641 1.00 17.63  ? 20   LYS B HZ3  1 
ATOM   1871 N  N    . GLU B 1 21 ? 6.429  8.975   16.328 1.00 8.65   ? 21   GLU B N    1 
ATOM   1872 C  CA   . GLU B 1 21 ? 7.809  9.261   15.985 1.00 8.55   ? 21   GLU B CA   1 
ATOM   1873 C  C    . GLU B 1 21 ? 8.585  7.966   15.846 1.00 8.76   ? 21   GLU B C    1 
ATOM   1874 O  O    . GLU B 1 21 ? 8.439  7.100   16.697 1.00 10.08  ? 21   GLU B O    1 
ATOM   1875 C  CB   A GLU B 1 21 ? 8.552  10.171  17.001 0.44 9.08   ? 21   GLU B CB   1 
ATOM   1876 C  CB   B GLU B 1 21 ? 8.403  10.200  17.063 0.56 21.35  ? 21   GLU B CB   1 
ATOM   1877 C  CG   A GLU B 1 21 ? 7.898  11.543  17.050 0.44 10.17  ? 21   GLU B CG   1 
ATOM   1878 C  CG   B GLU B 1 21 ? 9.813  10.686  16.915 0.56 24.76  ? 21   GLU B CG   1 
ATOM   1879 C  CD   A GLU B 1 21 ? 7.929  12.282  15.733 0.44 11.32  ? 21   GLU B CD   1 
ATOM   1880 C  CD   B GLU B 1 21 ? 10.267 11.600  18.043 0.56 40.06  ? 21   GLU B CD   1 
ATOM   1881 O  OE1  A GLU B 1 21 ? 9.082  12.585  15.322 0.44 19.18  ? 21   GLU B OE1  1 
ATOM   1882 O  OE1  B GLU B 1 21 ? 10.375 11.144  19.201 0.56 36.75  ? 21   GLU B OE1  1 
ATOM   1883 O  OE2  A GLU B 1 21 ? 6.861  12.622  15.145 0.44 11.58  ? 21   GLU B OE2  1 
ATOM   1884 O  OE2  B GLU B 1 21 ? 10.516 12.794  17.754 0.56 29.09  ? 21   GLU B OE2  1 
ATOM   1885 H  H    . GLU B 1 21 ? 6.243  8.882   17.184 1.00 10.38  ? 21   GLU B H    1 
ATOM   1886 H  HA   . GLU B 1 21 ? 7.816  9.721   15.098 1.00 10.25  ? 21   GLU B HA   1 
ATOM   1887 H  HB2  A GLU B 1 21 ? 8.525  9.757   17.900 0.44 10.90  ? 21   GLU B HB2  1 
ATOM   1888 H  HB2  B GLU B 1 21 ? 7.818  10.997  17.120 0.56 25.62  ? 21   GLU B HB2  1 
ATOM   1889 H  HB3  A GLU B 1 21 ? 9.500  10.264  16.732 0.44 10.90  ? 21   GLU B HB3  1 
ATOM   1890 H  HB3  B GLU B 1 21 ? 8.339  9.732   17.934 0.56 25.62  ? 21   GLU B HB3  1 
ATOM   1891 H  HG2  A GLU B 1 21 ? 6.956  11.437  17.335 0.44 12.20  ? 21   GLU B HG2  1 
ATOM   1892 H  HG2  B GLU B 1 21 ? 10.418 9.903   16.875 0.56 29.71  ? 21   GLU B HG2  1 
ATOM   1893 H  HG3  A GLU B 1 21 ? 8.359  12.091  17.734 0.44 12.20  ? 21   GLU B HG3  1 
ATOM   1894 H  HG3  B GLU B 1 21 ? 9.895  11.172  16.057 0.56 29.71  ? 21   GLU B HG3  1 
ATOM   1895 N  N    . ALA B 1 22 ? 9.404  7.780   14.811 1.00 7.50   ? 22   ALA B N    1 
ATOM   1896 C  CA   . ALA B 1 22 ? 10.134 6.534   14.574 1.00 7.15   ? 22   ALA B CA   1 
ATOM   1897 C  C    . ALA B 1 22 ? 11.480 6.814   13.944 1.00 7.00   ? 22   ALA B C    1 
ATOM   1898 O  O    . ALA B 1 22 ? 11.675 7.809   13.216 1.00 8.32   ? 22   ALA B O    1 
ATOM   1899 C  CB   . ALA B 1 22 ? 9.345  5.608   13.682 1.00 8.45   ? 22   ALA B CB   1 
ATOM   1900 H  H    . ALA B 1 22 ? 9.511  8.442   14.241 1.00 9.00   ? 22   ALA B H    1 
ATOM   1901 H  HA   . ALA B 1 22 ? 10.282 6.080   15.453 1.00 8.58   ? 22   ALA B HA   1 
ATOM   1902 H  HB1  . ALA B 1 22 ? 8.470  5.432   14.086 1.00 12.67  ? 22   ALA B HB1  1 
ATOM   1903 H  HB2  . ALA B 1 22 ? 9.832  4.764   13.576 1.00 12.67  ? 22   ALA B HB2  1 
ATOM   1904 H  HB3  . ALA B 1 22 ? 9.221  6.026   12.805 1.00 12.67  ? 22   ALA B HB3  1 
ATOM   1905 N  N    . LEU B 1 23 ? 12.439 5.946   14.214 1.00 7.28   ? 23   LEU B N    1 
ATOM   1906 C  CA   . LEU B 1 23 ? 13.836 5.983   13.844 1.00 7.36   ? 23   LEU B CA   1 
ATOM   1907 C  C    . LEU B 1 23 ? 14.097 5.347   12.483 1.00 7.51   ? 23   LEU B C    1 
ATOM   1908 O  O    . LEU B 1 23 ? 13.761 4.168   12.292 1.00 8.63   ? 23   LEU B O    1 
ATOM   1909 C  CB   . LEU B 1 23 ? 14.659 5.312   14.971 1.00 8.89   ? 23   LEU B CB   1 
ATOM   1910 C  CG   . LEU B 1 23 ? 16.172 5.328   14.830 1.00 9.91   ? 23   LEU B CG   1 
ATOM   1911 C  CD1  . LEU B 1 23 ? 16.734 6.697   15.006 1.00 13.52  ? 23   LEU B CD1  1 
ATOM   1912 C  CD2  . LEU B 1 23 ? 16.804 4.392   15.879 1.00 13.35  ? 23   LEU B CD2  1 
ATOM   1913 H  H    . LEU B 1 23 ? 12.192 5.246   14.685 1.00 8.74   ? 23   LEU B H    1 
ATOM   1914 H  HA   . LEU B 1 23 ? 14.114 6.943   13.792 1.00 8.83   ? 23   LEU B HA   1 
ATOM   1915 H  HB2  . LEU B 1 23 ? 14.426 5.755   15.825 1.00 10.67  ? 23   LEU B HB2  1 
ATOM   1916 H  HB3  . LEU B 1 23 ? 14.368 4.368   15.041 1.00 10.67  ? 23   LEU B HB3  1 
ATOM   1917 H  HG   . LEU B 1 23 ? 16.413 4.996   13.918 1.00 11.89  ? 23   LEU B HG   1 
ATOM   1918 H  HD11 . LEU B 1 23 ? 17.710 6.662   14.926 1.00 20.28  ? 23   LEU B HD11 1 
ATOM   1919 H  HD12 . LEU B 1 23 ? 16.490 7.039   15.891 1.00 20.28  ? 23   LEU B HD12 1 
ATOM   1920 H  HD13 . LEU B 1 23 ? 16.371 7.290   14.315 1.00 20.28  ? 23   LEU B HD13 1 
ATOM   1921 H  HD21 . LEU B 1 23 ? 17.780 4.409   15.786 1.00 20.03  ? 23   LEU B HD21 1 
ATOM   1922 H  HD22 . LEU B 1 23 ? 16.479 3.478   15.740 1.00 20.03  ? 23   LEU B HD22 1 
ATOM   1923 H  HD23 . LEU B 1 23 ? 16.557 4.694   16.778 1.00 20.03  ? 23   LEU B HD23 1 
ATOM   1924 N  N    . LEU B 1 24 ? 14.667 6.100   11.542 1.00 6.20   ? 24   LEU B N    1 
ATOM   1925 C  CA   . LEU B 1 24 ? 15.038 5.499   10.233 1.00 6.69   ? 24   LEU B CA   1 
ATOM   1926 C  C    . LEU B 1 24 ? 16.347 4.735   10.406 1.00 6.05   ? 24   LEU B C    1 
ATOM   1927 O  O    . LEU B 1 24 ? 17.394 5.364   10.609 1.00 7.73   ? 24   LEU B O    1 
ATOM   1928 C  CB   . LEU B 1 24 ? 15.147 6.539   9.144  1.00 7.37   ? 24   LEU B CB   1 
ATOM   1929 C  CG   . LEU B 1 24 ? 13.873 7.338   8.864  1.00 8.01   ? 24   LEU B CG   1 
ATOM   1930 C  CD1  . LEU B 1 24 ? 14.148 8.286   7.661  1.00 17.98  ? 24   LEU B CD1  1 
ATOM   1931 C  CD2  . LEU B 1 24 ? 12.653 6.499   8.610  1.00 11.10  ? 24   LEU B CD2  1 
ATOM   1932 H  H    . LEU B 1 24 ? 14.825 6.952   11.695 1.00 7.44   ? 24   LEU B H    1 
ATOM   1933 H  HA   . LEU B 1 24 ? 14.326 4.846   9.974  1.00 8.03   ? 24   LEU B HA   1 
ATOM   1934 H  HB2  . LEU B 1 24 ? 15.866 7.173   9.389  1.00 8.84   ? 24   LEU B HB2  1 
ATOM   1935 H  HB3  . LEU B 1 24 ? 15.422 6.087   8.307  1.00 8.84   ? 24   LEU B HB3  1 
ATOM   1936 H  HG   . LEU B 1 24 ? 13.689 7.908   9.664  1.00 9.61   ? 24   LEU B HG   1 
ATOM   1937 H  HD11 . LEU B 1 24 ? 14.917 8.858   7.865  1.00 26.97  ? 24   LEU B HD11 1 
ATOM   1938 H  HD12 . LEU B 1 24 ? 13.359 8.845   7.499  1.00 26.97  ? 24   LEU B HD12 1 
ATOM   1939 H  HD13 . LEU B 1 24 ? 14.340 7.753   6.862  1.00 26.97  ? 24   LEU B HD13 1 
ATOM   1940 H  HD21 . LEU B 1 24 ? 11.888 7.082   8.426  1.00 16.64  ? 24   LEU B HD21 1 
ATOM   1941 H  HD22 . LEU B 1 24 ? 12.464 5.951   9.400  1.00 16.64  ? 24   LEU B HD22 1 
ATOM   1942 H  HD23 . LEU B 1 24 ? 12.812 5.916   7.838  1.00 16.64  ? 24   LEU B HD23 1 
ATOM   1943 N  N    . ASP B 1 25 ? 16.308 3.400   10.354 1.00 6.47   ? 25   ASP B N    1 
ATOM   1944 C  CA   . ASP B 1 25 ? 17.421 2.551   10.802 1.00 6.15   ? 25   ASP B CA   1 
ATOM   1945 C  C    . ASP B 1 25 ? 17.906 1.586   9.746  1.00 7.22   ? 25   ASP B C    1 
ATOM   1946 O  O    . ASP B 1 25 ? 17.323 0.508   9.520  1.00 7.32   ? 25   ASP B O    1 
ATOM   1947 C  CB   . ASP B 1 25 ? 16.984 1.755   12.034 1.00 7.20   ? 25   ASP B CB   1 
ATOM   1948 C  CG   . ASP B 1 25 ? 18.026 0.872   12.650 1.00 7.39   ? 25   ASP B CG   1 
ATOM   1949 O  OD1  . ASP B 1 25 ? 19.153 0.872   12.142 1.00 7.86   ? 25   ASP B OD1  1 
ATOM   1950 O  OD2  . ASP B 1 25 ? 17.684 0.168   13.671 1.00 9.21   ? 25   ASP B OD2  1 
ATOM   1951 H  H    . ASP B 1 25 ? 15.584 3.013   10.038 1.00 7.77   ? 25   ASP B H    1 
ATOM   1952 H  HA   . ASP B 1 25 ? 18.184 3.143   11.063 1.00 7.38   ? 25   ASP B HA   1 
ATOM   1953 H  HB2  . ASP B 1 25 ? 16.673 2.395   12.723 1.00 8.64   ? 25   ASP B HB2  1 
ATOM   1954 H  HB3  . ASP B 1 25 ? 16.209 1.193   11.782 1.00 8.64   ? 25   ASP B HB3  1 
ATOM   1955 N  N    . THR B 1 26 ? 19.031 1.935   9.074  1.00 7.05   ? 26   THR B N    1 
ATOM   1956 C  CA   . THR B 1 26 ? 19.612 1.065   8.039  1.00 7.18   ? 26   THR B CA   1 
ATOM   1957 C  C    . THR B 1 26 ? 20.241 -0.196  8.578  1.00 8.34   ? 26   THR B C    1 
ATOM   1958 O  O    . THR B 1 26 ? 20.490 -1.132  7.807  1.00 7.99   ? 26   THR B O    1 
ATOM   1959 C  CB   . THR B 1 26 ? 20.693 1.801   7.212  1.00 8.16   ? 26   THR B CB   1 
ATOM   1960 O  OG1  . THR B 1 26 ? 21.734 2.272   8.010  1.00 7.91   ? 26   THR B OG1  1 
ATOM   1961 C  CG2  . THR B 1 26 ? 20.078 3.021   6.506  1.00 9.30   ? 26   THR B CG2  1 
ATOM   1962 H  H    . THR B 1 26 ? 19.424 2.700   9.261  1.00 8.46   ? 26   THR B H    1 
ATOM   1963 H  HA   . THR B 1 26 ? 18.877 0.798   7.416  1.00 8.61   ? 26   THR B HA   1 
ATOM   1964 H  HB   . THR B 1 26 ? 21.063 1.176   6.525  1.00 9.79   ? 26   THR B HB   1 
ATOM   1965 H  HG1  . THR B 1 26 ? 21.590 2.061   8.811  1.00 11.86  ? 26   THR B HG1  1 
ATOM   1966 H  HG21 . THR B 1 26 ? 20.776 3.497   6.009  1.00 13.95  ? 26   THR B HG21 1 
ATOM   1967 H  HG22 . THR B 1 26 ? 19.687 3.622   7.174  1.00 13.95  ? 26   THR B HG22 1 
ATOM   1968 H  HG23 . THR B 1 26 ? 19.381 2.723   5.886  1.00 13.95  ? 26   THR B HG23 1 
ATOM   1969 N  N    . GLY B 1 27 ? 20.477 -0.264  9.900  1.00 7.41   ? 27   GLY B N    1 
ATOM   1970 C  CA   . GLY B 1 27 ? 20.980 -1.489  10.559 1.00 7.98   ? 27   GLY B CA   1 
ATOM   1971 C  C    . GLY B 1 27 ? 19.924 -2.534  10.835 1.00 7.74   ? 27   GLY B C    1 
ATOM   1972 O  O    . GLY B 1 27 ? 20.291 -3.690  11.116 1.00 8.99   ? 27   GLY B O    1 
ATOM   1973 H  H    . GLY B 1 27 ? 20.325 0.448   10.393 1.00 8.89   ? 27   GLY B H    1 
ATOM   1974 H  HA2  . GLY B 1 27 ? 21.680 -1.892  9.985  1.00 9.57   ? 27   GLY B HA2  1 
ATOM   1975 H  HA3  . GLY B 1 27 ? 21.405 -1.235  11.416 1.00 9.57   ? 27   GLY B HA3  1 
ATOM   1976 N  N    . ALA B 1 28 ? 18.635 -2.178  10.750 1.00 7.18   ? 28   ALA B N    1 
ATOM   1977 C  CA   . ALA B 1 28 ? 17.545 -3.107  11.079 1.00 7.55   ? 28   ALA B CA   1 
ATOM   1978 C  C    . ALA B 1 28 ? 17.030 -3.795  9.831  1.00 8.45   ? 28   ALA B C    1 
ATOM   1979 O  O    . ALA B 1 28 ? 16.651 -3.104  8.854  1.00 7.73   ? 28   ALA B O    1 
ATOM   1980 C  CB   . ALA B 1 28 ? 16.415 -2.333  11.756 1.00 9.26   ? 28   ALA B CB   1 
ATOM   1981 H  H    . ALA B 1 28 ? 18.435 -1.362  10.489 1.00 8.61   ? 28   ALA B H    1 
ATOM   1982 H  HA   . ALA B 1 28 ? 17.889 -3.800  11.712 1.00 9.06   ? 28   ALA B HA   1 
ATOM   1983 H  HB1  . ALA B 1 28 ? 16.762 -1.879  12.552 1.00 13.89  ? 28   ALA B HB1  1 
ATOM   1984 H  HB2  . ALA B 1 28 ? 15.704 -2.955  12.018 1.00 13.89  ? 28   ALA B HB2  1 
ATOM   1985 H  HB3  . ALA B 1 28 ? 16.054 -1.669  11.132 1.00 13.89  ? 28   ALA B HB3  1 
ATOM   1986 N  N    . ASP B 1 29 ? 16.935 -5.115  9.800  1.00 8.42   ? 29   ASP B N    1 
ATOM   1987 C  CA   . ASP B 1 29 ? 16.412 -5.805  8.628  1.00 9.71   ? 29   ASP B CA   1 
ATOM   1988 C  C    . ASP B 1 29 ? 14.920 -5.555  8.476  1.00 9.10   ? 29   ASP B C    1 
ATOM   1989 O  O    . ASP B 1 29 ? 14.401 -5.536  7.330  1.00 10.64  ? 29   ASP B O    1 
ATOM   1990 C  CB   . ASP B 1 29 ? 16.633 -7.327  8.764  1.00 11.19  ? 29   ASP B CB   1 
ATOM   1991 C  CG   . ASP B 1 29 ? 18.107 -7.731  8.823  1.00 17.71  ? 29   ASP B CG   1 
ATOM   1992 O  OD1  . ASP B 1 29 ? 19.034 -7.056  8.368  1.00 13.58  ? 29   ASP B OD1  1 
ATOM   1993 O  OD2  . ASP B 1 29 ? 18.346 -8.830  9.388  1.00 30.86  ? 29   ASP B OD2  1 
ATOM   1994 H  H    . ASP B 1 29 ? 17.193 -5.584  10.499 1.00 10.10  ? 29   ASP B H    1 
ATOM   1995 H  HA   . ASP B 1 29 ? 16.886 -5.474  7.812  1.00 11.65  ? 29   ASP B HA   1 
ATOM   1996 H  HB2  . ASP B 1 29 ? 16.182 -7.643  9.587  1.00 13.43  ? 29   ASP B HB2  1 
ATOM   1997 H  HB3  . ASP B 1 29 ? 16.208 -7.782  7.994  1.00 13.43  ? 29   ASP B HB3  1 
ATOM   1998 N  N    . ASP B 1 30 ? 14.211 -5.399  9.602  1.00 7.89   ? 30   ASP B N    1 
ATOM   1999 C  CA   . ASP B 1 30 ? 12.733 -5.356  9.661  1.00 7.95   ? 30   ASP B CA   1 
ATOM   2000 C  C    . ASP B 1 30 ? 12.316 -4.146  10.527 1.00 7.65   ? 30   ASP B C    1 
ATOM   2001 O  O    . ASP B 1 30 ? 13.179 -3.393  10.983 1.00 8.04   ? 30   ASP B O    1 
ATOM   2002 C  CB   . ASP B 1 30 ? 12.152 -6.693  10.128 1.00 9.63   ? 30   ASP B CB   1 
ATOM   2003 C  CG   . ASP B 1 30 ? 11.958 -7.652  8.940  1.00 14.35  ? 30   ASP B CG   1 
ATOM   2004 O  OD1  . ASP B 1 30 ? 11.134 -7.302  8.012  1.00 14.75  ? 30   ASP B OD1  1 
ATOM   2005 O  OD2  . ASP B 1 30 ? 12.620 -8.699  8.918  1.00 19.95  ? 30   ASP B OD2  1 
ATOM   2006 H  H    . ASP B 1 30 ? 14.654 -5.317  10.358 1.00 9.47   ? 30   ASP B H    1 
ATOM   2007 H  HA   . ASP B 1 30 ? 12.399 -5.191  8.733  1.00 9.54   ? 30   ASP B HA   1 
ATOM   2008 H  HB2  . ASP B 1 30 ? 12.763 -7.106  10.788 1.00 11.55  ? 30   ASP B HB2  1 
ATOM   2009 H  HB3  . ASP B 1 30 ? 11.281 -6.537  10.572 1.00 11.55  ? 30   ASP B HB3  1 
ATOM   2010 N  N    . THR B 1 31 ? 11.024 -3.969  10.744 1.00 7.91   ? 31   THR B N    1 
ATOM   2011 C  CA   . THR B 1 31 ? 10.409 -2.806  11.421 1.00 7.00   ? 31   THR B CA   1 
ATOM   2012 C  C    . THR B 1 31 ? 9.819  -3.272  12.744 1.00 6.93   ? 31   THR B C    1 
ATOM   2013 O  O    . THR B 1 31 ? 9.025  -4.250  12.760 1.00 7.90   ? 31   THR B O    1 
ATOM   2014 C  CB   . THR B 1 31 ? 9.370  -2.202  10.471 1.00 7.04   ? 31   THR B CB   1 
ATOM   2015 O  OG1  . THR B 1 31 ? 10.047 -1.575  9.340  1.00 7.59   ? 31   THR B OG1  1 
ATOM   2016 C  CG2  . THR B 1 31 ? 8.475  -1.155  11.108 1.00 8.04   ? 31   THR B CG2  1 
ATOM   2017 H  H    . THR B 1 31 ? 10.481 -4.601  10.461 1.00 9.49   ? 31   THR B H    1 
ATOM   2018 H  HA   . THR B 1 31 ? 11.117 -2.124  11.604 1.00 8.40   ? 31   THR B HA   1 
ATOM   2019 H  HB   . THR B 1 31 ? 8.793  -2.941  10.123 1.00 8.45   ? 31   THR B HB   1 
ATOM   2020 H  HG1  . THR B 1 31 ? 10.547 -2.137  8.967  1.00 11.38  ? 31   THR B HG1  1 
ATOM   2021 H  HG21 . THR B 1 31 ? 7.833  -0.825  10.444 1.00 12.06  ? 31   THR B HG21 1 
ATOM   2022 H  HG22 . THR B 1 31 ? 9.023  -0.409  11.431 1.00 12.06  ? 31   THR B HG22 1 
ATOM   2023 H  HG23 . THR B 1 31 ? 7.990  -1.554  11.861 1.00 12.06  ? 31   THR B HG23 1 
ATOM   2024 N  N    . VAL B 1 32 ? 10.173 -2.609  13.868 1.00 6.85   ? 32   VAL B N    1 
ATOM   2025 C  CA   . VAL B 1 32 ? 9.615  -2.992  15.176 1.00 7.22   ? 32   VAL B CA   1 
ATOM   2026 C  C    . VAL B 1 32 ? 9.090  -1.768  15.906 1.00 6.97   ? 32   VAL B C    1 
ATOM   2027 O  O    . VAL B 1 32 ? 9.818  -0.761  16.001 1.00 7.58   ? 32   VAL B O    1 
ATOM   2028 C  CB   . VAL B 1 32 ? 10.605 -3.795  16.055 1.00 8.26   ? 32   VAL B CB   1 
ATOM   2029 C  CG1  . VAL B 1 32 ? 11.868 -2.995  16.386 1.00 8.81   ? 32   VAL B CG1  1 
ATOM   2030 C  CG2  . VAL B 1 32 ? 9.933  -4.287  17.346 1.00 9.70   ? 32   VAL B CG2  1 
ATOM   2031 H  H    . VAL B 1 32 ? 10.743 -1.941  13.818 1.00 8.22   ? 32   VAL B H    1 
ATOM   2032 H  HA   . VAL B 1 32 ? 8.831  -3.587  14.998 1.00 8.66   ? 32   VAL B HA   1 
ATOM   2033 H  HB   . VAL B 1 32 ? 10.886 -4.601  15.534 1.00 9.91   ? 32   VAL B HB   1 
ATOM   2034 H  HG11 . VAL B 1 32 ? 12.282 -2.680  15.556 1.00 13.22  ? 32   VAL B HG11 1 
ATOM   2035 H  HG12 . VAL B 1 32 ? 12.499 -3.567  16.870 1.00 13.22  ? 32   VAL B HG12 1 
ATOM   2036 H  HG13 . VAL B 1 32 ? 11.630 -2.225  16.945 1.00 13.22  ? 32   VAL B HG13 1 
ATOM   2037 H  HG21 . VAL B 1 32 ? 9.129  -4.800  17.121 1.00 14.55  ? 32   VAL B HG21 1 
ATOM   2038 H  HG22 . VAL B 1 32 ? 9.684  -3.516  17.899 1.00 14.55  ? 32   VAL B HG22 1 
ATOM   2039 H  HG23 . VAL B 1 32 ? 10.556 -4.857  17.843 1.00 14.55  ? 32   VAL B HG23 1 
ATOM   2040 N  N    . LEU B 1 33 ? 7.842  -1.828  16.379 1.00 6.92   ? 33   LEU B N    1 
ATOM   2041 C  CA   . LEU B 1 33 ? 7.152  -0.773  17.043 1.00 6.89   ? 33   LEU B CA   1 
ATOM   2042 C  C    . LEU B 1 33 ? 7.018  -1.050  18.535 1.00 6.90   ? 33   LEU B C    1 
ATOM   2043 O  O    . LEU B 1 33 ? 6.821  -2.204  18.938 1.00 7.58   ? 33   LEU B O    1 
ATOM   2044 C  CB   . LEU B 1 33 ? 5.771  -0.569  16.409 1.00 9.39   ? 33   LEU B CB   1 
ATOM   2045 C  CG   . LEU B 1 33 ? 5.728  -0.256  14.907 1.00 11.71  ? 33   LEU B CG   1 
ATOM   2046 C  CD1  . LEU B 1 33 ? 4.268  -0.069  14.522 1.00 16.22  ? 33   LEU B CD1  1 
ATOM   2047 C  CD2  . LEU B 1 33 ? 6.573  0.972   14.526 1.00 14.10  ? 33   LEU B CD2  1 
ATOM   2048 H  H    . LEU B 1 33 ? 7.409  -2.586  16.272 1.00 8.31   ? 33   LEU B H    1 
ATOM   2049 H  HA   . LEU B 1 33 ? 7.678  0.070   16.926 1.00 8.27   ? 33   LEU B HA   1 
ATOM   2050 H  HB2  . LEU B 1 33 ? 5.239  -1.389  16.566 1.00 11.27  ? 33   LEU B HB2  1 
ATOM   2051 H  HB3  . LEU B 1 33 ? 5.320  0.170   16.889 1.00 11.27  ? 33   LEU B HB3  1 
ATOM   2052 H  HG   . LEU B 1 33 ? 6.084  -1.048  14.411 1.00 14.06  ? 33   LEU B HG   1 
ATOM   2053 H  HD11 . LEU B 1 33 ? 4.202  0.093   13.557 1.00 24.32  ? 33   LEU B HD11 1 
ATOM   2054 H  HD12 . LEU B 1 33 ? 3.898  0.698   15.007 1.00 24.32  ? 33   LEU B HD12 1 
ATOM   2055 H  HD13 . LEU B 1 33 ? 3.763  -0.876  14.753 1.00 24.32  ? 33   LEU B HD13 1 
ATOM   2056 H  HD21 . LEU B 1 33 ? 7.507  0.818   14.781 1.00 21.14  ? 33   LEU B HD21 1 
ATOM   2057 H  HD22 . LEU B 1 33 ? 6.233  1.762   14.996 1.00 21.14  ? 33   LEU B HD22 1 
ATOM   2058 H  HD23 . LEU B 1 33 ? 6.519  1.120   13.559 1.00 21.14  ? 33   LEU B HD23 1 
ATOM   2059 N  N    . GLU B 1 34 ? 7.074  0.006   19.335 1.00 7.45   ? 34   GLU B N    1 
ATOM   2060 C  CA   . GLU B 1 34 ? 6.809  -0.018  20.773 1.00 7.44   ? 34   GLU B CA   1 
ATOM   2061 C  C    . GLU B 1 34 ? 5.450  -0.687  21.025 1.00 7.67   ? 34   GLU B C    1 
ATOM   2062 O  O    . GLU B 1 34 ? 4.513  -0.585  20.218 1.00 8.71   ? 34   GLU B O    1 
ATOM   2063 C  CB   . GLU B 1 34 ? 6.779  1.390   21.359 1.00 8.45   ? 34   GLU B CB   1 
ATOM   2064 C  CG   . GLU B 1 34 ? 8.156  2.068   21.326 1.00 10.30  ? 34   GLU B CG   1 
ATOM   2065 C  CD   . GLU B 1 34 ? 8.133  3.500   21.783 1.00 18.76  ? 34   GLU B CD   1 
ATOM   2066 O  OE1  . GLU B 1 34 ? 7.481  3.732   22.839 1.00 37.49  ? 34   GLU B OE1  1 
ATOM   2067 O  OE2  . GLU B 1 34 ? 8.704  4.415   21.175 1.00 19.04  ? 34   GLU B OE2  1 
ATOM   2068 H  H    . GLU B 1 34 ? 7.287  0.779   18.974 1.00 8.94   ? 34   GLU B H    1 
ATOM   2069 H  HA   . GLU B 1 34 ? 7.524  -0.547  21.229 1.00 8.93   ? 34   GLU B HA   1 
ATOM   2070 H  HB2  . GLU B 1 34 ? 6.134  1.940   20.847 1.00 10.14  ? 34   GLU B HB2  1 
ATOM   2071 H  HB3  . GLU B 1 34 ? 6.462  1.345   22.295 1.00 10.14  ? 34   GLU B HB3  1 
ATOM   2072 H  HG2  . GLU B 1 34 ? 8.777  1.558   21.904 1.00 12.36  ? 34   GLU B HG2  1 
ATOM   2073 H  HG3  . GLU B 1 34 ? 8.507  2.034   20.401 1.00 12.36  ? 34   GLU B HG3  1 
ATOM   2074 N  N    . GLU B 1 35 ? 5.324  -1.370  22.136 1.00 8.81   ? 35   GLU B N    1 
ATOM   2075 C  CA   . GLU B 1 35 ? 4.116  -2.154  22.487 1.00 8.28   ? 35   GLU B CA   1 
ATOM   2076 C  C    . GLU B 1 35 ? 2.844  -1.328  22.273 1.00 9.92   ? 35   GLU B C    1 
ATOM   2077 O  O    . GLU B 1 35 ? 2.741  -0.196  22.704 1.00 10.50  ? 35   GLU B O    1 
ATOM   2078 C  CB   . GLU B 1 35 ? 4.238  -2.619  23.930 1.00 10.92  ? 35   GLU B CB   1 
ATOM   2079 C  CG   . GLU B 1 35 ? 3.208  -3.637  24.389 1.00 12.65  ? 35   GLU B CG   1 
ATOM   2080 C  CD   . GLU B 1 35 ? 3.176  -4.915  23.588 1.00 13.22  ? 35   GLU B CD   1 
ATOM   2081 O  OE1  . GLU B 1 35 ? 4.265  -5.551  23.526 1.00 14.56  ? 35   GLU B OE1  1 
ATOM   2082 O  OE2  . GLU B 1 35 ? 2.089  -5.212  23.074 1.00 19.11  ? 35   GLU B OE2  1 
ATOM   2083 H  H    . GLU B 1 35 ? 5.995  -1.363  22.706 1.00 10.57  ? 35   GLU B H    1 
ATOM   2084 H  HA   . GLU B 1 35 ? 4.076  -2.960  21.895 1.00 9.93   ? 35   GLU B HA   1 
ATOM   2085 H  HB2  . GLU B 1 35 ? 5.139  -3.010  24.056 1.00 13.10  ? 35   GLU B HB2  1 
ATOM   2086 H  HB3  . GLU B 1 35 ? 4.175  -1.826  24.519 1.00 13.10  ? 35   GLU B HB3  1 
ATOM   2087 H  HG2  . GLU B 1 35 ? 3.389  -3.863  25.336 1.00 15.18  ? 35   GLU B HG2  1 
ATOM   2088 H  HG3  . GLU B 1 35 ? 2.312  -3.218  24.349 1.00 15.18  ? 35   GLU B HG3  1 
ATOM   2089 N  N    . MET B 1 36 ? 1.879  -1.881  21.525 1.00 9.29   ? 36   MET B N    1 
ATOM   2090 C  CA   . MET B 1 36 ? 0.602  -1.217  21.207 1.00 9.97   ? 36   MET B CA   1 
ATOM   2091 C  C    . MET B 1 36 ? -0.392 -2.347  20.902 1.00 10.45  ? 36   MET B C    1 
ATOM   2092 O  O    . MET B 1 36 ? -0.052 -3.467  20.467 1.00 11.55  ? 36   MET B O    1 
ATOM   2093 C  CB   . MET B 1 36 ? 0.703  -0.238  20.056 1.00 13.36  ? 36   MET B CB   1 
ATOM   2094 C  CG   . MET B 1 36 ? 1.068  -0.907  18.775 1.00 16.47  ? 36   MET B CG   1 
ATOM   2095 S  SD   . MET B 1 36 ? 0.945  0.157   17.283 1.00 17.08  ? 36   MET B SD   1 
ATOM   2096 C  CE   . MET B 1 36 ? -0.805 0.367   17.111 1.00 38.23  ? 36   MET B CE   1 
ATOM   2097 H  H    . MET B 1 36 ? 2.017  -2.689  21.204 1.00 11.14  ? 36   MET B H    1 
ATOM   2098 H  HA   . MET B 1 36 ? 0.287  -0.725  22.019 1.00 11.96  ? 36   MET B HA   1 
ATOM   2099 H  HB2  . MET B 1 36 ? -0.165 0.224   19.945 1.00 16.03  ? 36   MET B HB2  1 
ATOM   2100 H  HB3  . MET B 1 36 ? 1.386  0.446   20.271 1.00 16.03  ? 36   MET B HB3  1 
ATOM   2101 H  HG2  . MET B 1 36 ? 1.997  -1.242  18.848 1.00 19.76  ? 36   MET B HG2  1 
ATOM   2102 H  HG3  . MET B 1 36 ? 0.477  -1.692  18.651 1.00 19.76  ? 36   MET B HG3  1 
ATOM   2103 H  HE1  . MET B 1 36 ? -0.991 0.927   16.329 1.00 57.35  ? 36   MET B HE1  1 
ATOM   2104 H  HE2  . MET B 1 36 ? -1.162 0.798   17.915 1.00 57.35  ? 36   MET B HE2  1 
ATOM   2105 H  HE3  . MET B 1 36 ? -1.229 -0.509  16.994 1.00 57.35  ? 36   MET B HE3  1 
ATOM   2106 N  N    . ASN B 1 37 ? -1.680 -2.089  21.204 1.00 10.74  ? 37   ASN B N    1 
ATOM   2107 C  CA   . ASN B 1 37 ? -2.718 -3.106  21.039 1.00 10.30  ? 37   ASN B CA   1 
ATOM   2108 C  C    . ASN B 1 37 ? -3.322 -3.043  19.646 1.00 10.35  ? 37   ASN B C    1 
ATOM   2109 O  O    . ASN B 1 37 ? -4.476 -2.698  19.449 1.00 12.43  ? 37   ASN B O    1 
ATOM   2110 C  CB   . ASN B 1 37 ? -3.786 -3.005  22.140 1.00 13.56  ? 37   ASN B CB   1 
ATOM   2111 C  CG   . ASN B 1 37 ? -4.559 -4.246  22.346 1.00 23.27  ? 37   ASN B CG   1 
ATOM   2112 O  OD1  . ASN B 1 37 ? -4.097 -5.330  22.022 1.00 16.67  ? 37   ASN B OD1  1 
ATOM   2113 N  ND2  . ASN B 1 37 ? -5.787 -4.099  22.849 1.00 36.39  ? 37   ASN B ND2  1 
ATOM   2114 H  H    . ASN B 1 37 ? -1.900 -1.293  21.506 1.00 12.89  ? 37   ASN B H    1 
ATOM   2115 H  HA   . ASN B 1 37 ? -2.277 -3.998  21.132 1.00 12.35  ? 37   ASN B HA   1 
ATOM   2116 H  HB2  . ASN B 1 37 ? -3.343 -2.762  22.991 1.00 16.28  ? 37   ASN B HB2  1 
ATOM   2117 H  HB3  . ASN B 1 37 ? -4.413 -2.275  21.909 1.00 16.28  ? 37   ASN B HB3  1 
ATOM   2118 H  HD21 . ASN B 1 37 ? -6.304 -4.802  22.961 1.00 43.67  ? 37   ASN B HD21 1 
ATOM   2119 H  HD22 . ASN B 1 37 ? -6.079 -3.298  23.069 1.00 43.67  ? 37   ASN B HD22 1 
ATOM   2120 N  N    . LEU B 1 38 ? -2.521 -3.418  18.680 1.00 10.17  ? 38   LEU B N    1 
ATOM   2121 C  CA   . LEU B 1 38 ? -2.870 -3.432  17.258 1.00 10.40  ? 38   LEU B CA   1 
ATOM   2122 C  C    . LEU B 1 38 ? -3.800 -4.574  16.928 1.00 10.10  ? 38   LEU B C    1 
ATOM   2123 O  O    . LEU B 1 38 ? -3.523 -5.733  17.387 1.00 11.89  ? 38   LEU B O    1 
ATOM   2124 C  CB   . LEU B 1 38 ? -1.549 -3.553  16.464 1.00 10.29  ? 38   LEU B CB   1 
ATOM   2125 C  CG   . LEU B 1 38 ? -1.641 -3.417  14.970 1.00 11.28  ? 38   LEU B CG   1 
ATOM   2126 C  CD1  . LEU B 1 38 ? -1.873 -1.944  14.552 1.00 11.75  ? 38   LEU B CD1  1 
ATOM   2127 C  CD2  . LEU B 1 38 ? -0.413 -3.964  14.250 1.00 12.80  ? 38   LEU B CD2  1 
ATOM   2128 H  H    . LEU B 1 38 ? -1.711 -3.681  18.902 1.00 12.20  ? 38   LEU B H    1 
ATOM   2129 H  HA   . LEU B 1 38 ? -3.316 -2.569  17.021 1.00 12.49  ? 38   LEU B HA   1 
ATOM   2130 H  HB2  . LEU B 1 38 ? -0.925 -2.861  16.797 1.00 12.35  ? 38   LEU B HB2  1 
ATOM   2131 H  HB3  . LEU B 1 38 ? -1.147 -4.435  16.668 1.00 12.35  ? 38   LEU B HB3  1 
ATOM   2132 H  HG   . LEU B 1 38 ? -2.432 -3.947  14.665 1.00 13.53  ? 38   LEU B HG   1 
ATOM   2133 H  HD11 . LEU B 1 38 ? -1.932 -1.888  13.575 1.00 17.62  ? 38   LEU B HD11 1 
ATOM   2134 H  HD12 . LEU B 1 38 ? -1.125 -1.394  14.866 1.00 17.62  ? 38   LEU B HD12 1 
ATOM   2135 H  HD13 . LEU B 1 38 ? -2.708 -1.619  14.949 1.00 17.62  ? 38   LEU B HD13 1 
ATOM   2136 H  HD21 . LEU B 1 38 ? -0.525 -3.854  13.283 1.00 19.19  ? 38   LEU B HD21 1 
ATOM   2137 H  HD22 . LEU B 1 38 ? -0.307 -4.915  14.461 1.00 19.19  ? 38   LEU B HD22 1 
ATOM   2138 H  HD23 . LEU B 1 38 ? 0.383  -3.474  14.544 1.00 19.19  ? 38   LEU B HD23 1 
ATOM   2139 N  N    . PRO B 1 39 ? -4.892 -4.431  16.208 1.00 9.16   ? 39   PRO B N    1 
ATOM   2140 C  CA   . PRO B 1 39 ? -5.733 -5.576  15.854 1.00 9.97   ? 39   PRO B CA   1 
ATOM   2141 C  C    . PRO B 1 39 ? -5.142 -6.445  14.773 1.00 9.94   ? 39   PRO B C    1 
ATOM   2142 O  O    . PRO B 1 39 ? -4.215 -6.066  14.039 1.00 10.98  ? 39   PRO B O    1 
ATOM   2143 C  CB   . PRO B 1 39 ? -7.022 -4.894  15.292 1.00 11.34  ? 39   PRO B CB   1 
ATOM   2144 C  CG   . PRO B 1 39 ? -6.585 -3.532  14.827 1.00 10.52  ? 39   PRO B CG   1 
ATOM   2145 C  CD   . PRO B 1 39 ? -5.462 -3.128  15.758 1.00 10.21  ? 39   PRO B CD   1 
ATOM   2146 H  HA   . PRO B 1 39 ? -5.947 -6.120  16.665 1.00 11.96  ? 39   PRO B HA   1 
ATOM   2147 H  HB2  . PRO B 1 39 ? -7.394 -5.417  14.538 1.00 13.61  ? 39   PRO B HB2  1 
ATOM   2148 H  HB3  . PRO B 1 39 ? -7.712 -4.817  15.997 1.00 13.61  ? 39   PRO B HB3  1 
ATOM   2149 H  HG2  . PRO B 1 39 ? -6.265 -3.569  13.890 1.00 12.63  ? 39   PRO B HG2  1 
ATOM   2150 H  HG3  . PRO B 1 39 ? -7.334 -2.887  14.883 1.00 12.63  ? 39   PRO B HG3  1 
ATOM   2151 H  HD2  . PRO B 1 39 ? -4.782 -2.589  15.281 1.00 12.25  ? 39   PRO B HD2  1 
ATOM   2152 H  HD3  . PRO B 1 39 ? -5.807 -2.607  16.525 1.00 12.25  ? 39   PRO B HD3  1 
ATOM   2153 N  N    . GLY B 1 40 ? -5.616 -7.663  14.649 1.00 11.24  ? 40   GLY B N    1 
ATOM   2154 C  CA   . GLY B 1 40 ? -5.231 -8.568  13.573 1.00 11.36  ? 40   GLY B CA   1 
ATOM   2155 C  C    . GLY B 1 40 ? -4.612 -9.889  14.045 1.00 10.86  ? 40   GLY B C    1 
ATOM   2156 O  O    . GLY B 1 40 ? -4.223 -10.061 15.238 1.00 12.37  ? 40   GLY B O    1 
ATOM   2157 H  H    . GLY B 1 40 ? -6.195 -7.948  15.246 1.00 13.49  ? 40   GLY B H    1 
ATOM   2158 H  HA2  . GLY B 1 40 ? -6.032 -8.771  13.028 1.00 13.63  ? 40   GLY B HA2  1 
ATOM   2159 H  HA3  . GLY B 1 40 ? -4.580 -8.105  12.987 1.00 13.63  ? 40   GLY B HA3  1 
ATOM   2160 N  N    . LYS B 1 41 ? -4.460 -10.807 13.095 1.00 12.91  ? 41   LYS B N    1 
ATOM   2161 C  CA   . LYS B 1 41 ? -3.745 -12.065 13.367 1.00 13.03  ? 41   LYS B CA   1 
ATOM   2162 C  C    . LYS B 1 41 ? -2.238 -11.842 13.442 1.00 12.70  ? 41   LYS B C    1 
ATOM   2163 O  O    . LYS B 1 41 ? -1.727 -10.985 12.739 1.00 13.45  ? 41   LYS B O    1 
ATOM   2164 C  CB   . LYS B 1 41 ? -4.093 -13.037 12.207 1.00 17.76  ? 41   LYS B CB   1 
ATOM   2165 C  CG   . LYS B 1 41 ? -5.579 -13.409 12.210 1.00 37.90  ? 41   LYS B CG   1 
ATOM   2166 C  CD   . LYS B 1 41 ? -5.781 -14.664 11.354 1.00 50.84  ? 41   LYS B CD   1 
ATOM   2167 C  CE   . LYS B 1 41 ? -7.193 -14.922 10.886 1.00 50.02  ? 41   LYS B CE   1 
ATOM   2168 N  NZ   . LYS B 1 41 ? -7.226 -16.005 9.868  1.00 59.90  ? 41   LYS B NZ   1 
ATOM   2169 N  N    . TRP B 1 42 ? -1.518 -12.630 14.218 1.00 10.33  ? 42   TRP B N    1 
ATOM   2170 C  CA   . TRP B 1 42 ? -0.071 -12.467 14.382 1.00 8.57   ? 42   TRP B CA   1 
ATOM   2171 C  C    . TRP B 1 42 ? 0.583  -13.820 14.654 1.00 9.70   ? 42   TRP B C    1 
ATOM   2172 O  O    . TRP B 1 42 ? -0.106 -14.825 14.972 1.00 12.46  ? 42   TRP B O    1 
ATOM   2173 C  CB   . TRP B 1 42 ? 0.236  -11.458 15.482 1.00 11.36  ? 42   TRP B CB   1 
ATOM   2174 C  CG   . TRP B 1 42 ? -0.363 -11.846 16.824 1.00 11.85  ? 42   TRP B CG   1 
ATOM   2175 C  CD1  . TRP B 1 42 ? -1.620 -11.592 17.276 1.00 21.19  ? 42   TRP B CD1  1 
ATOM   2176 C  CD2  . TRP B 1 42 ? 0.328  -12.554 17.845 1.00 15.89  ? 42   TRP B CD2  1 
ATOM   2177 N  NE1  . TRP B 1 42 ? -1.769 -12.103 18.527 1.00 20.69  ? 42   TRP B NE1  1 
ATOM   2178 C  CE2  . TRP B 1 42 ? -0.590 -12.707 18.914 1.00 19.91  ? 42   TRP B CE2  1 
ATOM   2179 C  CE3  . TRP B 1 42 ? 1.581  -13.102 18.028 1.00 17.87  ? 42   TRP B CE3  1 
ATOM   2180 C  CZ2  . TRP B 1 42 ? -0.304 -13.349 20.106 1.00 25.86  ? 42   TRP B CZ2  1 
ATOM   2181 C  CZ3  . TRP B 1 42 ? 1.879  -13.753 19.226 1.00 23.07  ? 42   TRP B CZ3  1 
ATOM   2182 C  CH2  . TRP B 1 42 ? 0.949  -13.883 20.265 1.00 30.72  ? 42   TRP B CH2  1 
ATOM   2183 H  H    . TRP B 1 42 ? -1.923 -13.280 14.653 1.00 12.40  ? 42   TRP B H    1 
ATOM   2184 H  HA   . TRP B 1 42 ? 0.300  -12.111 13.524 1.00 10.29  ? 42   TRP B HA   1 
ATOM   2185 H  HB2  . TRP B 1 42 ? 1.218  -11.375 15.579 1.00 13.64  ? 42   TRP B HB2  1 
ATOM   2186 H  HB3  . TRP B 1 42 ? -0.117 -10.573 15.215 1.00 13.64  ? 42   TRP B HB3  1 
ATOM   2187 H  HD1  . TRP B 1 42 ? -2.292 -11.127 16.792 1.00 25.43  ? 42   TRP B HD1  1 
ATOM   2188 H  HE1  . TRP B 1 42 ? -2.501 -12.056 19.013 1.00 24.82  ? 42   TRP B HE1  1 
ATOM   2189 H  HE3  . TRP B 1 42 ? 2.236  -13.038 17.343 1.00 21.45  ? 42   TRP B HE3  1 
ATOM   2190 H  HZ2  . TRP B 1 42 ? -0.956 -13.418 20.793 1.00 31.03  ? 42   TRP B HZ2  1 
ATOM   2191 H  HZ3  . TRP B 1 42 ? 2.747  -14.123 19.342 1.00 27.68  ? 42   TRP B HZ3  1 
ATOM   2192 H  HH2  . TRP B 1 42 ? 1.182  -14.334 21.068 1.00 36.86  ? 42   TRP B HH2  1 
ATOM   2193 N  N    . LYS B 1 43 ? 1.916  -13.845 14.525 1.00 9.06   ? 43   LYS B N    1 
ATOM   2194 C  CA   . LYS B 1 43 ? 2.708  -14.994 14.881 1.00 12.96  ? 43   LYS B CA   1 
ATOM   2195 C  C    . LYS B 1 43 ? 3.937  -14.590 15.700 1.00 10.14  ? 43   LYS B C    1 
ATOM   2196 O  O    . LYS B 1 43 ? 4.484  -13.489 15.470 1.00 9.96   ? 43   LYS B O    1 
ATOM   2197 C  CB   . LYS B 1 43 ? 3.153  -15.747 13.677 1.00 21.03  ? 43   LYS B CB   1 
ATOM   2198 C  CG   . LYS B 1 43 ? 4.194  -15.515 12.721 1.00 28.44  ? 43   LYS B CG   1 
ATOM   2199 C  CD   . LYS B 1 43 ? 4.236  -16.357 11.468 1.00 31.45  ? 43   LYS B CD   1 
ATOM   2200 C  CE   . LYS B 1 43 ? 4.446  -15.517 10.193 0.50 47.60  ? 43   LYS B CE   1 
ATOM   2201 N  NZ   . LYS B 1 43 ? 5.855  -15.575 9.727  0.10 69.93  ? 43   LYS B NZ   1 
ATOM   2202 H  H    . LYS B 1 43 ? 2.324  -13.131 14.209 1.00 10.88  ? 43   LYS B H    1 
ATOM   2203 H  HA   . LYS B 1 43 ? 2.145  -15.602 15.441 1.00 15.55  ? 43   LYS B HA   1 
ATOM   2204 H  HB2  . LYS B 1 43 ? 3.335  -16.659 14.016 1.00 25.24  ? 43   LYS B HB2  1 
ATOM   2205 H  HB3  . LYS B 1 43 ? 2.334  -15.828 13.127 1.00 25.24  ? 43   LYS B HB3  1 
ATOM   2206 H  HG2  . LYS B 1 43 ? 4.139  -14.567 12.442 1.00 34.13  ? 43   LYS B HG2  1 
ATOM   2207 H  HG3  . LYS B 1 43 ? 5.060  -15.630 13.187 1.00 34.13  ? 43   LYS B HG3  1 
ATOM   2208 H  HD2  . LYS B 1 43 ? 4.971  -17.015 11.546 1.00 37.74  ? 43   LYS B HD2  1 
ATOM   2209 H  HD3  . LYS B 1 43 ? 3.387  -16.860 11.388 1.00 37.74  ? 43   LYS B HD3  1 
ATOM   2210 H  HE2  . LYS B 1 43 ? 3.850  -15.853 9.477  0.50 57.12  ? 43   LYS B HE2  1 
ATOM   2211 H  HE3  . LYS B 1 43 ? 4.200  -14.575 10.377 0.50 57.12  ? 43   LYS B HE3  1 
ATOM   2212 H  HZ1  . LYS B 1 43 ? 5.936  -15.115 8.946  0.10 104.90 ? 43   LYS B HZ1  1 
ATOM   2213 H  HZ2  . LYS B 1 43 ? 6.095  -16.443 9.594  0.10 104.90 ? 43   LYS B HZ2  1 
ATOM   2214 H  HZ3  . LYS B 1 43 ? 6.398  -15.203 10.355 0.10 104.90 ? 43   LYS B HZ3  1 
ATOM   2215 N  N    . PRO B 1 44 ? 4.372  -15.416 16.657 1.00 11.40  ? 44   PRO B N    1 
ATOM   2216 C  CA   . PRO B 1 44 ? 5.517  -15.038 17.468 1.00 11.60  ? 44   PRO B CA   1 
ATOM   2217 C  C    . PRO B 1 44 ? 6.855  -15.154 16.748 1.00 10.51  ? 44   PRO B C    1 
ATOM   2218 O  O    . PRO B 1 44 ? 7.043  -15.998 15.867 1.00 10.27  ? 44   PRO B O    1 
ATOM   2219 C  CB   . PRO B 1 44 ? 5.515  -16.036 18.636 1.00 15.53  ? 44   PRO B CB   1 
ATOM   2220 C  CG   . PRO B 1 44 ? 4.769  -17.217 18.132 1.00 21.20  ? 44   PRO B CG   1 
ATOM   2221 C  CD   . PRO B 1 44 ? 3.770  -16.711 17.105 1.00 16.83  ? 44   PRO B CD   1 
ATOM   2222 H  HA   . PRO B 1 44 ? 5.396  -14.107 17.815 1.00 13.91  ? 44   PRO B HA   1 
ATOM   2223 H  HB2  . PRO B 1 44 ? 6.440  -16.285 18.885 1.00 18.63  ? 44   PRO B HB2  1 
ATOM   2224 H  HB3  . PRO B 1 44 ? 5.065  -15.648 19.428 1.00 18.63  ? 44   PRO B HB3  1 
ATOM   2225 H  HG2  . PRO B 1 44 ? 5.391  -17.864 17.716 1.00 25.44  ? 44   PRO B HG2  1 
ATOM   2226 H  HG3  . PRO B 1 44 ? 4.297  -17.668 18.877 1.00 25.44  ? 44   PRO B HG3  1 
ATOM   2227 H  HD2  . PRO B 1 44 ? 3.682  -17.345 16.349 1.00 20.20  ? 44   PRO B HD2  1 
ATOM   2228 H  HD3  . PRO B 1 44 ? 2.879  -16.569 17.513 1.00 20.20  ? 44   PRO B HD3  1 
ATOM   2229 N  N    . LYS B 1 45 ? 7.787  -14.280 17.133 1.00 9.58   ? 45   LYS B N    1 
ATOM   2230 C  CA   . LYS B 1 45 ? 9.116  -14.164 16.532 1.00 8.65   ? 45   LYS B CA   1 
ATOM   2231 C  C    . LYS B 1 45 ? 10.113 -13.706 17.598 1.00 9.20   ? 45   LYS B C    1 
ATOM   2232 O  O    . LYS B 1 45 ? 9.709  -12.943 18.525 1.00 10.84  ? 45   LYS B O    1 
ATOM   2233 C  CB   . LYS B 1 45 ? 9.010  -13.122 15.361 1.00 11.45  ? 45   LYS B CB   1 
ATOM   2234 C  CG   . LYS B 1 45 ? 10.238 -12.925 14.518 1.00 14.06  ? 45   LYS B CG   1 
ATOM   2235 C  CD   . LYS B 1 45 ? 10.019 -12.046 13.294 1.00 14.94  ? 45   LYS B CD   1 
ATOM   2236 C  CE   . LYS B 1 45 ? 11.301 -11.705 12.577 1.00 20.26  ? 45   LYS B CE   1 
ATOM   2237 N  NZ   . LYS B 1 45 ? 11.771 -12.698 11.629 1.00 26.81  ? 45   LYS B NZ   1 
ATOM   2238 H  H    . LYS B 1 45 ? 7.588  -13.735 17.795 1.00 11.49  ? 45   LYS B H    1 
ATOM   2239 H  HA   . LYS B 1 45 ? 9.398  -15.052 16.167 1.00 10.38  ? 45   LYS B HA   1 
ATOM   2240 H  HB2  . LYS B 1 45 ? 8.270  -13.402 14.766 1.00 13.74  ? 45   LYS B HB2  1 
ATOM   2241 H  HB3  . LYS B 1 45 ? 8.760  -12.247 15.749 1.00 13.74  ? 45   LYS B HB3  1 
ATOM   2242 H  HG2  . LYS B 1 45 ? 10.946 -12.519 15.078 1.00 16.87  ? 45   LYS B HG2  1 
ATOM   2243 H  HG3  . LYS B 1 45 ? 10.564 -13.811 14.219 1.00 16.87  ? 45   LYS B HG3  1 
ATOM   2244 H  HD2  . LYS B 1 45 ? 9.413  -12.514 12.666 1.00 17.93  ? 45   LYS B HD2  1 
ATOM   2245 H  HD3  . LYS B 1 45 ? 9.573  -11.208 13.575 1.00 17.93  ? 45   LYS B HD3  1 
ATOM   2246 H  HE2  . LYS B 1 45 ? 11.172 -10.849 12.096 1.00 24.32  ? 45   LYS B HE2  1 
ATOM   2247 H  HE3  . LYS B 1 45 ? 12.008 -11.560 13.255 1.00 24.32  ? 45   LYS B HE3  1 
ATOM   2248 H  HZ1  . LYS B 1 45 ? 12.512 -12.384 11.203 1.00 40.21  ? 45   LYS B HZ1  1 
ATOM   2249 H  HZ2  . LYS B 1 45 ? 11.119 -12.866 11.017 1.00 40.21  ? 45   LYS B HZ2  1 
ATOM   2250 H  HZ3  . LYS B 1 45 ? 11.978 -13.466 12.071 1.00 40.21  ? 45   LYS B HZ3  1 
ATOM   2251 N  N    . MET B 1 46 ? 11.383 -14.104 17.470 1.00 9.00   ? 46   MET B N    1 
ATOM   2252 C  CA   . MET B 1 46 ? 12.450 -13.491 18.279 1.00 9.14   ? 46   MET B CA   1 
ATOM   2253 C  C    . MET B 1 46 ? 13.380 -12.680 17.377 1.00 8.91   ? 46   MET B C    1 
ATOM   2254 O  O    . MET B 1 46 ? 13.756 -13.134 16.302 1.00 10.96  ? 46   MET B O    1 
ATOM   2255 C  CB   A MET B 1 46 ? 13.286 -14.589 18.943 0.75 9.47   ? 46   MET B CB   1 
ATOM   2256 C  CB   B MET B 1 46 ? 13.060 -14.550 19.207 0.25 11.70  ? 46   MET B CB   1 
ATOM   2257 C  CG   A MET B 1 46 ? 12.562 -15.446 19.989 0.75 9.13   ? 46   MET B CG   1 
ATOM   2258 C  CG   B MET B 1 46 ? 12.115 -14.810 20.397 0.25 8.94   ? 46   MET B CG   1 
ATOM   2259 S  SD   A MET B 1 46 ? 12.460 -14.519 21.523 0.75 14.89  ? 46   MET B SD   1 
ATOM   2260 S  SD   B MET B 1 46 ? 12.608 -16.078 21.554 0.25 9.37   ? 46   MET B SD   1 
ATOM   2261 C  CE   A MET B 1 46 ? 14.025 -15.072 22.284 0.75 16.19  ? 46   MET B CE   1 
ATOM   2262 C  CE   B MET B 1 46 ? 11.145 -16.327 22.544 0.25 11.56  ? 46   MET B CE   1 
ATOM   2263 H  H    . MET B 1 46 ? 11.583 -14.740 16.896 1.00 10.81  ? 46   MET B H    1 
ATOM   2264 H  HA   . MET B 1 46 ? 12.050 -12.898 18.978 1.00 10.97  ? 46   MET B HA   1 
ATOM   2265 H  HB2  A MET B 1 46 ? 13.630 -15.189 18.234 0.75 11.36  ? 46   MET B HB2  1 
ATOM   2266 H  HB2  B MET B 1 46 ? 13.203 -15.391 18.705 0.25 14.04  ? 46   MET B HB2  1 
ATOM   2267 H  HB3  A MET B 1 46 ? 14.069 -14.165 19.376 0.75 11.36  ? 46   MET B HB3  1 
ATOM   2268 H  HB3  B MET B 1 46 ? 13.938 -14.236 19.541 0.25 14.04  ? 46   MET B HB3  1 
ATOM   2269 H  HG2  A MET B 1 46 ? 11.653 -15.673 19.670 0.75 10.95  ? 46   MET B HG2  1 
ATOM   2270 H  HG2  B MET B 1 46 ? 12.009 -13.963 20.897 0.25 10.73  ? 46   MET B HG2  1 
ATOM   2271 H  HG3  A MET B 1 46 ? 13.059 -16.290 20.137 0.75 10.95  ? 46   MET B HG3  1 
ATOM   2272 H  HG3  B MET B 1 46 ? 11.225 -15.052 20.036 0.25 10.73  ? 46   MET B HG3  1 
ATOM   2273 H  HE1  A MET B 1 46 ? 14.110 -14.681 23.178 0.75 24.28  ? 46   MET B HE1  1 
ATOM   2274 H  HE1  B MET B 1 46 ? 11.388 -16.783 23.377 0.25 17.34  ? 46   MET B HE1  1 
ATOM   2275 H  HE2  A MET B 1 46 ? 14.779 -14.782 21.728 0.75 24.28  ? 46   MET B HE2  1 
ATOM   2276 H  HE2  B MET B 1 46 ? 10.503 -16.875 22.047 0.25 17.34  ? 46   MET B HE2  1 
ATOM   2277 H  HE3  A MET B 1 46 ? 14.027 -16.050 22.353 0.75 24.28  ? 46   MET B HE3  1 
ATOM   2278 H  HE3  B MET B 1 46 ? 10.741 -15.459 22.753 0.25 17.34  ? 46   MET B HE3  1 
ATOM   2279 N  N    . ILE B 1 47 ? 13.771 -11.464 17.806 1.00 8.18   ? 47   ILE B N    1 
ATOM   2280 C  CA   . ILE B 1 47 ? 14.751 -10.596 17.100 1.00 8.12   ? 47   ILE B CA   1 
ATOM   2281 C  C    . ILE B 1 47 ? 15.893 -10.239 18.065 1.00 7.66   ? 47   ILE B C    1 
ATOM   2282 O  O    . ILE B 1 47 ? 15.697 -10.048 19.269 1.00 8.14   ? 47   ILE B O    1 
ATOM   2283 C  CB   . ILE B 1 47 ? 14.074 -9.354  16.515 1.00 8.33   ? 47   ILE B CB   1 
ATOM   2284 C  CG1  . ILE B 1 47 ? 13.439 -8.415  17.503 1.00 8.91   ? 47   ILE B CG1  1 
ATOM   2285 C  CG2  . ILE B 1 47 ? 13.072 -9.776  15.439 1.00 9.12   ? 47   ILE B CG2  1 
ATOM   2286 C  CD1  . ILE B 1 47 ? 12.994 -7.051  17.003 1.00 10.62  ? 47   ILE B CD1  1 
ATOM   2287 H  H    . ILE B 1 47 ? 13.422 -11.162 18.555 1.00 9.82   ? 47   ILE B H    1 
ATOM   2288 H  HA   . ILE B 1 47 ? 15.139 -11.121 16.343 1.00 9.75   ? 47   ILE B HA   1 
ATOM   2289 H  HB   . ILE B 1 47 ? 14.789 -8.834  16.049 1.00 10.00  ? 47   ILE B HB   1 
ATOM   2290 H  HG12 . ILE B 1 47 ? 12.648 -8.869  17.887 1.00 10.69  ? 47   ILE B HG12 1 
ATOM   2291 H  HG13 . ILE B 1 47 ? 14.082 -8.272  18.242 1.00 10.69  ? 47   ILE B HG13 1 
ATOM   2292 H  HG21 . ILE B 1 47 ? 13.516 -10.361 14.791 1.00 13.69  ? 47   ILE B HG21 1 
ATOM   2293 H  HG22 . ILE B 1 47 ? 12.731 -8.980  14.980 1.00 13.69  ? 47   ILE B HG22 1 
ATOM   2294 H  HG23 . ILE B 1 47 ? 12.327 -10.256 15.856 1.00 13.69  ? 47   ILE B HG23 1 
ATOM   2295 H  HD11 . ILE B 1 47 ? 12.597 -6.546  17.743 1.00 15.93  ? 47   ILE B HD11 1 
ATOM   2296 H  HD12 . ILE B 1 47 ? 12.330 -7.164  16.291 1.00 15.93  ? 47   ILE B HD12 1 
ATOM   2297 H  HD13 . ILE B 1 47 ? 13.768 -6.563  16.654 1.00 15.93  ? 47   ILE B HD13 1 
ATOM   2298 N  N    . GLY B 1 48 ? 17.102 -10.132 17.508 1.00 8.75   ? 48   GLY B N    1 
ATOM   2299 C  CA   . GLY B 1 48 ? 18.288 -9.944  18.313 1.00 10.19  ? 48   GLY B CA   1 
ATOM   2300 C  C    . GLY B 1 48 ? 19.270 -8.893  17.810 1.00 7.87   ? 48   GLY B C    1 
ATOM   2301 O  O    . GLY B 1 48 ? 19.425 -8.619  16.619 1.00 8.36   ? 48   GLY B O    1 
ATOM   2302 H  H    . GLY B 1 48 ? 17.178 -10.178 16.632 1.00 10.50  ? 48   GLY B H    1 
ATOM   2303 H  HA2  . GLY B 1 48 ? 18.006 -9.693  19.229 1.00 12.22  ? 48   GLY B HA2  1 
ATOM   2304 H  HA3  . GLY B 1 48 ? 18.763 -10.810 18.376 1.00 12.22  ? 48   GLY B HA3  1 
ATOM   2305 N  N    . GLY B 1 49 ? 19.932 -8.296  18.797 1.00 7.91   ? 49   GLY B N    1 
ATOM   2306 C  CA   . GLY B 1 49 ? 20.968 -7.294  18.529 1.00 9.13   ? 49   GLY B CA   1 
ATOM   2307 C  C    . GLY B 1 49 ? 21.772 -7.013  19.806 1.00 8.06   ? 49   GLY B C    1 
ATOM   2308 O  O    . GLY B 1 49 ? 22.039 -7.928  20.602 1.00 8.61   ? 49   GLY B O    1 
ATOM   2309 H  H    . GLY B 1 49 ? 19.744 -8.507  19.630 1.00 9.49   ? 49   GLY B H    1 
ATOM   2310 H  HA2  . GLY B 1 49 ? 21.574 -7.624  17.820 1.00 10.95  ? 49   GLY B HA2  1 
ATOM   2311 H  HA3  . GLY B 1 49 ? 20.546 -6.457  18.210 1.00 10.95  ? 49   GLY B HA3  1 
ATOM   2312 N  N    . ILE B 1 50 ? 22.211 -5.755  19.925 1.00 8.32   ? 50   ILE B N    1 
ATOM   2313 C  CA   . ILE B 1 50 ? 23.030 -5.392  21.110 1.00 8.45   ? 50   ILE B CA   1 
ATOM   2314 C  C    . ILE B 1 50 ? 22.194 -5.710  22.363 1.00 9.21   ? 50   ILE B C    1 
ATOM   2315 O  O    . ILE B 1 50 ? 21.035 -5.253  22.452 1.00 10.49  ? 50   ILE B O    1 
ATOM   2316 C  CB   . ILE B 1 50 ? 23.385 -3.898  21.033 1.00 11.00  ? 50   ILE B CB   1 
ATOM   2317 C  CG1  . ILE B 1 50 ? 24.309 -3.613  19.870 1.00 10.95  ? 50   ILE B CG1  1 
ATOM   2318 C  CG2  . ILE B 1 50 ? 23.911 -3.415  22.378 1.00 11.55  ? 50   ILE B CG2  1 
ATOM   2319 C  CD1  . ILE B 1 50 ? 25.766 -3.918  20.047 1.00 13.86  ? 50   ILE B CD1  1 
ATOM   2320 H  H    . ILE B 1 50 ? 22.018 -5.153  19.312 1.00 9.99   ? 50   ILE B H    1 
ATOM   2321 H  HA   . ILE B 1 50 ? 23.869 -5.937  21.119 1.00 10.14  ? 50   ILE B HA   1 
ATOM   2322 H  HB   . ILE B 1 50 ? 22.534 -3.403  20.858 1.00 13.20  ? 50   ILE B HB   1 
ATOM   2323 H  HG12 . ILE B 1 50 ? 23.983 -4.128  19.090 1.00 13.14  ? 50   ILE B HG12 1 
ATOM   2324 H  HG13 . ILE B 1 50 ? 24.224 -2.653  19.643 1.00 13.14  ? 50   ILE B HG13 1 
ATOM   2325 H  HG21 . ILE B 1 50 ? 23.264 -3.636  23.080 1.00 17.32  ? 50   ILE B HG21 1 
ATOM   2326 H  HG22 . ILE B 1 50 ? 24.042 -2.445  22.348 1.00 17.32  ? 50   ILE B HG22 1 
ATOM   2327 H  HG23 . ILE B 1 50 ? 24.766 -3.855  22.571 1.00 17.32  ? 50   ILE B HG23 1 
ATOM   2328 H  HD11 . ILE B 1 50 ? 26.248 -3.702  19.221 1.00 20.79  ? 50   ILE B HD11 1 
ATOM   2329 H  HD12 . ILE B 1 50 ? 25.879 -4.869  20.252 1.00 20.79  ? 50   ILE B HD12 1 
ATOM   2330 H  HD13 . ILE B 1 50 ? 26.125 -3.380  20.784 1.00 20.79  ? 50   ILE B HD13 1 
ATOM   2331 N  N    . GLY B 1 51 ? 22.777 -6.474  23.269 1.00 9.94   ? 51   GLY B N    1 
ATOM   2332 C  CA   . GLY B 1 51 ? 22.079 -6.885  24.487 1.00 11.08  ? 51   GLY B CA   1 
ATOM   2333 C  C    . GLY B 1 51 ? 21.334 -8.198  24.433 1.00 9.99   ? 51   GLY B C    1 
ATOM   2334 O  O    . GLY B 1 51 ? 20.835 -8.701  25.468 1.00 20.18  ? 51   GLY B O    1 
ATOM   2335 H  H    . GLY B 1 51 ? 23.605 -6.741  23.138 1.00 11.92  ? 51   GLY B H    1 
ATOM   2336 H  HA2  . GLY B 1 51 ? 22.743 -6.938  25.220 1.00 13.30  ? 51   GLY B HA2  1 
ATOM   2337 H  HA3  . GLY B 1 51 ? 21.433 -6.174  24.727 1.00 13.30  ? 51   GLY B HA3  1 
ATOM   2338 N  N    . GLY B 1 52 ? 21.170 -8.815  23.254 1.00 8.20   ? 52   GLY B N    1 
ATOM   2339 C  CA   . GLY B 1 52 ? 20.425 -10.090 23.144 1.00 8.47   ? 52   GLY B CA   1 
ATOM   2340 C  C    . GLY B 1 52 ? 19.129 -9.963  22.356 1.00 8.22   ? 52   GLY B C    1 
ATOM   2341 O  O    . GLY B 1 52 ? 18.958 -9.073  21.514 1.00 8.33   ? 52   GLY B O    1 
ATOM   2342 H  H    . GLY B 1 52 ? 21.512 -8.453  22.528 1.00 9.83   ? 52   GLY B H    1 
ATOM   2343 H  HA2  . GLY B 1 52 ? 21.004 -10.762 22.704 1.00 10.17  ? 52   GLY B HA2  1 
ATOM   2344 H  HA3  . GLY B 1 52 ? 20.217 -10.420 24.054 1.00 10.17  ? 52   GLY B HA3  1 
ATOM   2345 N  N    . PHE B 1 53 ? 18.244 -10.898 22.638 1.00 8.82   ? 53   PHE B N    1 
ATOM   2346 C  CA   . PHE B 1 53 ? 16.975 -11.075 21.918 1.00 9.01   ? 53   PHE B CA   1 
ATOM   2347 C  C    . PHE B 1 53 ? 15.749 -10.647 22.741 1.00 8.98   ? 53   PHE B C    1 
ATOM   2348 O  O    . PHE B 1 53 ? 15.710 -10.741 23.970 1.00 12.15  ? 53   PHE B O    1 
ATOM   2349 C  CB   . PHE B 1 53 ? 16.795 -12.541 21.459 1.00 10.00  ? 53   PHE B CB   1 
ATOM   2350 C  CG   . PHE B 1 53 ? 17.686 -12.966 20.301 1.00 9.14   ? 53   PHE B CG   1 
ATOM   2351 C  CD1  . PHE B 1 53 ? 19.062 -13.190 20.508 1.00 10.02  ? 53   PHE B CD1  1 
ATOM   2352 C  CD2  . PHE B 1 53 ? 17.151 -13.155 19.034 1.00 8.92   ? 53   PHE B CD2  1 
ATOM   2353 C  CE1  . PHE B 1 53 ? 19.829 -13.577 19.452 1.00 13.47  ? 53   PHE B CE1  1 
ATOM   2354 C  CE2  . PHE B 1 53 ? 17.976 -13.559 17.967 1.00 11.34  ? 53   PHE B CE2  1 
ATOM   2355 C  CZ   . PHE B 1 53 ? 19.340 -13.765 18.184 1.00 11.81  ? 53   PHE B CZ   1 
ATOM   2356 H  H    . PHE B 1 53 ? 18.424 -11.450 23.299 1.00 10.58  ? 53   PHE B H    1 
ATOM   2357 H  HA   . PHE B 1 53 ? 17.006 -10.502 21.099 1.00 10.81  ? 53   PHE B HA   1 
ATOM   2358 H  HB2  . PHE B 1 53 ? 16.975 -13.136 22.229 1.00 12.00  ? 53   PHE B HB2  1 
ATOM   2359 H  HB3  . PHE B 1 53 ? 15.851 -12.674 21.194 1.00 12.00  ? 53   PHE B HB3  1 
ATOM   2360 H  HD1  . PHE B 1 53 ? 19.448 -13.073 21.368 1.00 12.03  ? 53   PHE B HD1  1 
ATOM   2361 H  HD2  . PHE B 1 53 ? 16.224 -13.012 18.886 1.00 10.70  ? 53   PHE B HD2  1 
ATOM   2362 H  HE1  . PHE B 1 53 ? 20.755 -13.726 19.602 1.00 16.17  ? 53   PHE B HE1  1 
ATOM   2363 H  HE2  . PHE B 1 53 ? 17.606 -13.690 17.102 1.00 13.61  ? 53   PHE B HE2  1 
ATOM   2364 H  HZ   . PHE B 1 53 ? 19.913 -14.028 17.473 1.00 14.17  ? 53   PHE B HZ   1 
ATOM   2365 N  N    . ILE B 1 54 ? 14.715 -10.197 22.040 1.00 9.20   ? 54   ILE B N    1 
ATOM   2366 C  CA   . ILE B 1 54 ? 13.369 -9.963  22.579 1.00 9.51   ? 54   ILE B CA   1 
ATOM   2367 C  C    . ILE B 1 54 ? 12.330 -10.712 21.728 1.00 8.40   ? 54   ILE B C    1 
ATOM   2368 O  O    . ILE B 1 54 ? 12.505 -10.963 20.517 1.00 9.09   ? 54   ILE B O    1 
ATOM   2369 C  CB   . ILE B 1 54 ? 13.016 -8.443  22.655 1.00 10.58  ? 54   ILE B CB   1 
ATOM   2370 C  CG1  . ILE B 1 54 ? 13.035 -7.780  21.293 1.00 10.61  ? 54   ILE B CG1  1 
ATOM   2371 C  CG2  . ILE B 1 54 ? 13.895 -7.683  23.642 1.00 11.16  ? 54   ILE B CG2  1 
ATOM   2372 C  CD1  . ILE B 1 54 ? 12.470 -6.390  21.251 1.00 12.14  ? 54   ILE B CD1  1 
ATOM   2373 H  H    . ILE B 1 54 ? 14.846 -10.026 21.187 1.00 11.04  ? 54   ILE B H    1 
ATOM   2374 H  HA   . ILE B 1 54 ? 13.337 -10.336 23.507 1.00 11.41  ? 54   ILE B HA   1 
ATOM   2375 H  HB   . ILE B 1 54 ? 12.078 -8.380  22.995 1.00 12.69  ? 54   ILE B HB   1 
ATOM   2376 H  HG12 . ILE B 1 54 ? 13.971 -7.748  20.973 1.00 12.74  ? 54   ILE B HG12 1 
ATOM   2377 H  HG13 . ILE B 1 54 ? 12.524 -8.346  20.662 1.00 12.74  ? 54   ILE B HG13 1 
ATOM   2378 H  HG21 . ILE B 1 54 ? 13.862 -8.126  24.516 1.00 16.74  ? 54   ILE B HG21 1 
ATOM   2379 H  HG22 . ILE B 1 54 ? 13.569 -6.763  23.729 1.00 16.74  ? 54   ILE B HG22 1 
ATOM   2380 H  HG23 . ILE B 1 54 ? 14.819 -7.673  23.317 1.00 16.74  ? 54   ILE B HG23 1 
ATOM   2381 H  HD11 . ILE B 1 54 ? 12.516 -6.047  20.335 1.00 18.21  ? 54   ILE B HD11 1 
ATOM   2382 H  HD12 . ILE B 1 54 ? 12.990 -5.809  21.844 1.00 18.21  ? 54   ILE B HD12 1 
ATOM   2383 H  HD13 . ILE B 1 54 ? 11.536 -6.408  21.547 1.00 18.21  ? 54   ILE B HD13 1 
ATOM   2384 N  N    . LYS B 1 55 ? 11.214 -11.050 22.392 1.00 9.50   ? 55   LYS B N    1 
ATOM   2385 C  CA   . LYS B 1 55 ? 10.044 -11.665 21.745 1.00 9.31   ? 55   LYS B CA   1 
ATOM   2386 C  C    . LYS B 1 55 ? 9.094  -10.565 21.262 1.00 8.43   ? 55   LYS B C    1 
ATOM   2387 O  O    . LYS B 1 55 ? 8.779  -9.620  22.007 1.00 9.33   ? 55   LYS B O    1 
ATOM   2388 C  CB   . LYS B 1 55 ? 9.333  -12.643 22.698 1.00 13.50  ? 55   LYS B CB   1 
ATOM   2389 C  CG   . LYS B 1 55 ? 8.151  -13.374 22.007 1.00 17.71  ? 55   LYS B CG   1 
ATOM   2390 C  CD   . LYS B 1 55 ? 7.428  -14.313 23.004 1.00 26.96  ? 55   LYS B CD   1 
ATOM   2391 C  CE   . LYS B 1 55 ? 6.557  -15.300 22.239 1.00 53.13  ? 55   LYS B CE   1 
ATOM   2392 N  NZ   . LYS B 1 55 ? 5.940  -16.400 23.001 0.20 42.80  ? 55   LYS B NZ   1 
ATOM   2393 H  H    . LYS B 1 55 ? 11.180 -10.895 23.257 1.00 11.40  ? 55   LYS B H    1 
ATOM   2394 H  HA   . LYS B 1 55 ? 10.361 -12.178 20.948 1.00 11.17  ? 55   LYS B HA   1 
ATOM   2395 N  N    . VAL B 1 56 ? 8.653  -10.706 20.016 1.00 8.46   ? 56   VAL B N    1 
ATOM   2396 C  CA   . VAL B 1 56 ? 7.725  -9.761  19.373 1.00 7.78   ? 56   VAL B CA   1 
ATOM   2397 C  C    . VAL B 1 56 ? 6.610  -10.519 18.680 1.00 8.64   ? 56   VAL B C    1 
ATOM   2398 O  O    . VAL B 1 56 ? 6.667  -11.731 18.412 1.00 10.34  ? 56   VAL B O    1 
ATOM   2399 C  CB   . VAL B 1 56 ? 8.503  -8.854  18.381 1.00 8.50   ? 56   VAL B CB   1 
ATOM   2400 C  CG1  . VAL B 1 56 ? 9.591  -8.032  19.067 1.00 10.35  ? 56   VAL B CG1  1 
ATOM   2401 C  CG2  . VAL B 1 56 ? 9.088  -9.659  17.226 1.00 9.59   ? 56   VAL B CG2  1 
ATOM   2402 H  H    . VAL B 1 56 ? 8.929  -11.401 19.551 1.00 10.15  ? 56   VAL B H    1 
ATOM   2403 H  HA   . VAL B 1 56 ? 7.321  -9.182  20.081 1.00 9.34   ? 56   VAL B HA   1 
ATOM   2404 H  HB   . VAL B 1 56 ? 7.846  -8.210  17.990 1.00 10.20  ? 56   VAL B HB   1 
ATOM   2405 H  HG11 . VAL B 1 56 ? 9.194  -7.504  19.790 1.00 15.52  ? 56   VAL B HG11 1 
ATOM   2406 H  HG12 . VAL B 1 56 ? 10.006 -7.431  18.413 1.00 15.52  ? 56   VAL B HG12 1 
ATOM   2407 H  HG13 . VAL B 1 56 ? 10.271 -8.633  19.436 1.00 15.52  ? 56   VAL B HG13 1 
ATOM   2408 H  HG21 . VAL B 1 56 ? 8.379  -10.189 16.805 1.00 14.39  ? 56   VAL B HG21 1 
ATOM   2409 H  HG22 . VAL B 1 56 ? 9.785  -10.258 17.566 1.00 14.39  ? 56   VAL B HG22 1 
ATOM   2410 H  HG23 . VAL B 1 56 ? 9.475  -9.048  16.565 1.00 14.39  ? 56   VAL B HG23 1 
ATOM   2411 N  N    . ARG B 1 57 ? 5.555  -9.754  18.299 1.00 8.61   ? 57   ARG B N    1 
ATOM   2412 C  CA   . ARG B 1 57 ? 4.421  -10.244 17.500 1.00 8.52   ? 57   ARG B CA   1 
ATOM   2413 C  C    . ARG B 1 57 ? 4.557  -9.809  16.038 1.00 8.40   ? 57   ARG B C    1 
ATOM   2414 O  O    . ARG B 1 57 ? 4.747  -8.586  15.855 1.00 8.96   ? 57   ARG B O    1 
ATOM   2415 C  CB   . ARG B 1 57 ? 3.091  -9.755  18.094 1.00 9.35   ? 57   ARG B CB   1 
ATOM   2416 C  CG   . ARG B 1 57 ? 2.860  -10.143 19.565 1.00 9.81   ? 57   ARG B CG   1 
ATOM   2417 C  CD   . ARG B 1 57 ? 1.432  -9.873  19.997 1.00 12.02  ? 57   ARG B CD   1 
ATOM   2418 N  NE   . ARG B 1 57 ? 0.928  -8.542  19.875 1.00 10.55  ? 57   ARG B NE   1 
ATOM   2419 C  CZ   . ARG B 1 57 ? 1.274  -7.530  20.653 1.00 11.68  ? 57   ARG B CZ   1 
ATOM   2420 N  NH1  . ARG B 1 57 ? 2.163  -7.682  21.599 1.00 13.95  ? 57   ARG B NH1  1 
ATOM   2421 N  NH2  . ARG B 1 57 ? 0.747  -6.317  20.514 1.00 15.95  ? 57   ARG B NH2  1 
ATOM   2422 H  H    . ARG B 1 57 ? 5.549  -8.910  18.547 1.00 10.33  ? 57   ARG B H    1 
ATOM   2423 H  HA   . ARG B 1 57 ? 4.427  -11.244 17.530 1.00 10.22  ? 57   ARG B HA   1 
ATOM   2424 H  HB2  . ARG B 1 57 ? 3.056  -8.768  18.019 1.00 11.22  ? 57   ARG B HB2  1 
ATOM   2425 H  HB3  . ARG B 1 57 ? 2.349  -10.122 17.551 1.00 11.22  ? 57   ARG B HB3  1 
ATOM   2426 H  HG2  . ARG B 1 57 ? 3.061  -11.105 19.685 1.00 11.77  ? 57   ARG B HG2  1 
ATOM   2427 H  HG3  . ARG B 1 57 ? 3.479  -9.628  20.141 1.00 11.77  ? 57   ARG B HG3  1 
ATOM   2428 H  HD2  . ARG B 1 57 ? 0.840  -10.469 19.472 1.00 14.42  ? 57   ARG B HD2  1 
ATOM   2429 H  HD3  . ARG B 1 57 ? 1.348  -10.142 20.946 1.00 14.42  ? 57   ARG B HD3  1 
ATOM   2430 H  HE   . ARG B 1 57 ? 0.345  -8.384  19.235 1.00 12.66  ? 57   ARG B HE   1 
ATOM   2431 H  HH11 . ARG B 1 57 ? 2.541  -8.467  21.726 1.00 16.74  ? 57   ARG B HH11 1 
ATOM   2432 H  HH12 . ARG B 1 57 ? 2.383  -7.000  22.110 1.00 16.74  ? 57   ARG B HH12 1 
ATOM   2433 H  HH21 . ARG B 1 57 ? 1.000  -5.664  21.046 1.00 19.14  ? 57   ARG B HH21 1 
ATOM   2434 H  HH22 . ARG B 1 57 ? 0.144  -6.168  19.890 1.00 19.14  ? 57   ARG B HH22 1 
ATOM   2435 N  N    . GLN B 1 58 ? 4.479  -10.727 15.085 1.00 8.46   ? 58   GLN B N    1 
ATOM   2436 C  CA   . GLN B 1 58 ? 4.615  -10.423 13.674 1.00 8.56   ? 58   GLN B CA   1 
ATOM   2437 C  C    . GLN B 1 58 ? 3.251  -10.288 12.993 1.00 8.17   ? 58   GLN B C    1 
ATOM   2438 O  O    . GLN B 1 58 ? 2.462  -11.229 12.983 1.00 9.89   ? 58   GLN B O    1 
ATOM   2439 C  CB   . GLN B 1 58 ? 5.412  -11.518 12.940 1.00 9.68   ? 58   GLN B CB   1 
ATOM   2440 C  CG   . GLN B 1 58 ? 5.521  -11.304 11.462 1.00 9.98   ? 58   GLN B CG   1 
ATOM   2441 C  CD   . GLN B 1 58 ? 6.277  -12.363 10.711 1.00 13.72  ? 58   GLN B CD   1 
ATOM   2442 O  OE1  . GLN B 1 58 ? 7.149  -12.995 11.321 1.00 13.51  ? 58   GLN B OE1  1 
ATOM   2443 N  NE2  . GLN B 1 58 ? 5.924  -12.480 9.444  1.00 18.36  ? 58   GLN B NE2  1 
ATOM   2444 H  H    . GLN B 1 58 ? 4.338  -11.563 15.321 1.00 10.16  ? 58   GLN B H    1 
ATOM   2445 H  HA   . GLN B 1 58 ? 5.105  -9.556  13.580 1.00 10.27  ? 58   GLN B HA   1 
ATOM   2446 H  HB2  . GLN B 1 58 ? 6.324  -11.559 13.323 1.00 11.62  ? 58   GLN B HB2  1 
ATOM   2447 H  HB3  . GLN B 1 58 ? 4.977  -12.392 13.104 1.00 11.62  ? 58   GLN B HB3  1 
ATOM   2448 H  HG2  . GLN B 1 58 ? 4.607  -11.247 11.086 1.00 11.98  ? 58   GLN B HG2  1 
ATOM   2449 H  HG3  . GLN B 1 58 ? 5.962  -10.433 11.303 1.00 11.98  ? 58   GLN B HG3  1 
ATOM   2450 H  HE21 . GLN B 1 58 ? 6.329  -13.065 8.926  1.00 22.03  ? 58   GLN B HE21 1 
ATOM   2451 H  HE22 . GLN B 1 58 ? 5.284  -11.972 9.117  1.00 22.03  ? 58   GLN B HE22 1 
ATOM   2452 N  N    . TYR B 1 59 ? 2.968  -9.089  12.401 1.00 7.49   ? 59   TYR B N    1 
ATOM   2453 C  CA   . TYR B 1 59 ? 1.738  -8.758  11.678 1.00 8.00   ? 59   TYR B CA   1 
ATOM   2454 C  C    . TYR B 1 59 ? 2.069  -8.566  10.186 1.00 8.27   ? 59   TYR B C    1 
ATOM   2455 O  O    . TYR B 1 59 ? 3.079  -7.901  9.890  1.00 11.10  ? 59   TYR B O    1 
ATOM   2456 C  CB   . TYR B 1 59 ? 1.050  -7.454  12.183 1.00 7.82   ? 59   TYR B CB   1 
ATOM   2457 C  CG   . TYR B 1 59 ? 0.558  -7.564  13.607 1.00 7.78   ? 59   TYR B CG   1 
ATOM   2458 C  CD1  . TYR B 1 59 ? 1.389  -7.367  14.698 1.00 8.43   ? 59   TYR B CD1  1 
ATOM   2459 C  CD2  . TYR B 1 59 ? -0.771 -7.876  13.866 1.00 8.30   ? 59   TYR B CD2  1 
ATOM   2460 C  CE1  . TYR B 1 59 ? 0.913  -7.472  16.015 1.00 8.88   ? 59   TYR B CE1  1 
ATOM   2461 C  CE2  . TYR B 1 59 ? -1.276 -7.996  15.154 1.00 9.95   ? 59   TYR B CE2  1 
ATOM   2462 C  CZ   . TYR B 1 59 ? -0.432 -7.790  16.224 1.00 9.62   ? 59   TYR B CZ   1 
ATOM   2463 O  OH   . TYR B 1 59 ? -0.896 -7.929  17.527 1.00 11.77  ? 59   TYR B OH   1 
ATOM   2464 H  H    . TYR B 1 59 ? 3.579  -8.459  12.460 1.00 8.99   ? 59   TYR B H    1 
ATOM   2465 H  HA   . TYR B 1 59 ? 1.095  -9.519  11.770 1.00 9.60   ? 59   TYR B HA   1 
ATOM   2466 H  HB2  . TYR B 1 59 ? 1.694  -6.705  12.122 1.00 9.39   ? 59   TYR B HB2  1 
ATOM   2467 H  HB3  . TYR B 1 59 ? 0.284  -7.243  11.592 1.00 9.39   ? 59   TYR B HB3  1 
ATOM   2468 H  HD1  . TYR B 1 59 ? 2.303  -7.154  14.551 1.00 10.12  ? 59   TYR B HD1  1 
ATOM   2469 H  HD2  . TYR B 1 59 ? -1.358 -8.012  13.132 1.00 9.96   ? 59   TYR B HD2  1 
ATOM   2470 H  HE1  . TYR B 1 59 ? 1.496  -7.330  16.752 1.00 10.66  ? 59   TYR B HE1  1 
ATOM   2471 H  HE2  . TYR B 1 59 ? -2.189 -8.218  15.296 1.00 11.94  ? 59   TYR B HE2  1 
ATOM   2472 H  HH   . TYR B 1 59 ? -1.715 -8.115  17.515 1.00 17.66  ? 59   TYR B HH   1 
ATOM   2473 N  N    . ASP B 1 60 ? 1.250  -9.092  9.274  1.00 10.12  ? 60   ASP B N    1 
ATOM   2474 C  CA   . ASP B 1 60 ? 1.588  -8.953  7.852  1.00 11.41  ? 60   ASP B CA   1 
ATOM   2475 C  C    . ASP B 1 60 ? 0.615  -8.008  7.126  1.00 9.49   ? 60   ASP B C    1 
ATOM   2476 O  O    . ASP B 1 60 ? -0.511 -7.773  7.550  1.00 10.79  ? 60   ASP B O    1 
ATOM   2477 C  CB   . ASP B 1 60 ? 1.625  -10.325 7.171  1.00 14.91  ? 60   ASP B CB   1 
ATOM   2478 C  CG   . ASP B 1 60 ? 2.695  -11.224 7.724  1.00 22.87  ? 60   ASP B CG   1 
ATOM   2479 O  OD1  . ASP B 1 60 ? 3.809  -10.770 8.051  1.00 16.81  ? 60   ASP B OD1  1 
ATOM   2480 O  OD2  . ASP B 1 60 ? 2.387  -12.418 7.806  1.00 26.04  ? 60   ASP B OD2  1 
ATOM   2481 H  H    . ASP B 1 60 ? 0.519  -9.515  9.520  1.00 12.15  ? 60   ASP B H    1 
ATOM   2482 H  HA   . ASP B 1 60 ? 2.504  -8.556  7.792  1.00 13.69  ? 60   ASP B HA   1 
ATOM   2483 H  HB2  . ASP B 1 60 ? 0.745  -10.765 7.283  1.00 17.89  ? 60   ASP B HB2  1 
ATOM   2484 H  HB3  . ASP B 1 60 ? 1.779  -10.200 6.201  1.00 17.89  ? 60   ASP B HB3  1 
ATOM   2485 N  N    . GLN B 1 61 ? 1.036  -7.424  6.016  1.00 9.58   ? 61   GLN B N    1 
ATOM   2486 C  CA   . GLN B 1 61 ? 0.318  -6.541  5.116  1.00 11.84  ? 61   GLN B CA   1 
ATOM   2487 C  C    . GLN B 1 61 ? -0.338 -5.373  5.833  1.00 10.22  ? 61   GLN B C    1 
ATOM   2488 O  O    . GLN B 1 61 ? -1.518 -5.050  5.598  1.00 11.47  ? 61   GLN B O    1 
ATOM   2489 C  CB   . GLN B 1 61 ? -0.683 -7.416  4.341  1.00 16.37  ? 61   GLN B CB   1 
ATOM   2490 C  CG   . GLN B 1 61 ? -0.024 -8.405  3.419  1.00 21.04  ? 61   GLN B CG   1 
ATOM   2491 C  CD   . GLN B 1 61 ? 0.666  -7.748  2.227  1.00 29.54  ? 61   GLN B CD   1 
ATOM   2492 O  OE1  . GLN B 1 61 ? 1.802  -8.048  1.880  1.00 81.36  ? 61   GLN B OE1  1 
ATOM   2493 N  NE2  . GLN B 1 61 ? 0.033  -6.822  1.551  1.00 44.18  ? 61   GLN B NE2  1 
ATOM   2494 H  H    . GLN B 1 61 ? 1.870  -7.595  5.791  1.00 11.50  ? 61   GLN B H    1 
ATOM   2495 H  HA   . GLN B 1 61 ? 0.975  -6.170  4.459  1.00 14.21  ? 61   GLN B HA   1 
ATOM   2496 H  HB2  . GLN B 1 61 ? -1.247 -7.908  4.988  1.00 19.64  ? 61   GLN B HB2  1 
ATOM   2497 H  HB3  . GLN B 1 61 ? -1.277 -6.829  3.809  1.00 19.64  ? 61   GLN B HB3  1 
ATOM   2498 H  HG2  . GLN B 1 61 ? 0.644  -8.926  3.930  1.00 25.25  ? 61   GLN B HG2  1 
ATOM   2499 H  HG3  . GLN B 1 61 ? -0.709 -9.038  3.085  1.00 25.25  ? 61   GLN B HG3  1 
ATOM   2500 H  HE21 . GLN B 1 61 ? 0.424  -6.432  0.866  1.00 53.02  ? 61   GLN B HE21 1 
ATOM   2501 H  HE22 . GLN B 1 61 ? -0.784 -6.590  1.781  1.00 53.02  ? 61   GLN B HE22 1 
ATOM   2502 N  N    . ILE B 1 62 ? 0.434  -4.706  6.687  1.00 8.44   ? 62   ILE B N    1 
ATOM   2503 C  CA   . ILE B 1 62 ? 0.013  -3.524  7.446  1.00 8.25   ? 62   ILE B CA   1 
ATOM   2504 C  C    . ILE B 1 62 ? 0.390  -2.242  6.722  1.00 7.88   ? 62   ILE B C    1 
ATOM   2505 O  O    . ILE B 1 62 ? 1.558  -2.034  6.367  1.00 8.03   ? 62   ILE B O    1 
ATOM   2506 C  CB   . ILE B 1 62 ? 0.667  -3.534  8.857  1.00 8.38   ? 62   ILE B CB   1 
ATOM   2507 C  CG1  . ILE B 1 62 ? 0.362  -4.842  9.613  1.00 7.66   ? 62   ILE B CG1  1 
ATOM   2508 C  CG2  . ILE B 1 62 ? 0.244  -2.294  9.633  1.00 9.28   ? 62   ILE B CG2  1 
ATOM   2509 C  CD1  . ILE B 1 62 ? -1.121 -5.184  9.717  1.00 10.96  ? 62   ILE B CD1  1 
ATOM   2510 H  H    . ILE B 1 62 ? 1.257  -4.995  6.804  1.00 10.13  ? 62   ILE B H    1 
ATOM   2511 H  HA   . ILE B 1 62 ? -0.981 -3.550  7.554  1.00 9.90   ? 62   ILE B HA   1 
ATOM   2512 H  HB   . ILE B 1 62 ? 1.658  -3.485  8.729  1.00 10.06  ? 62   ILE B HB   1 
ATOM   2513 H  HG12 . ILE B 1 62 ? 0.827  -5.587  9.155  1.00 9.19   ? 62   ILE B HG12 1 
ATOM   2514 H  HG13 . ILE B 1 62 ? 0.736  -4.774  10.527 1.00 9.19   ? 62   ILE B HG13 1 
ATOM   2515 H  HG21 . ILE B 1 62 ? 0.463  -1.493  9.114  1.00 13.92  ? 62   ILE B HG21 1 
ATOM   2516 H  HG22 . ILE B 1 62 ? 0.718  -2.268  10.490 1.00 13.92  ? 62   ILE B HG22 1 
ATOM   2517 H  HG23 . ILE B 1 62 ? -0.722 -2.324  9.795  1.00 13.92  ? 62   ILE B HG23 1 
ATOM   2518 H  HD11 . ILE B 1 62 ? -1.229 -6.026  10.207 1.00 16.44  ? 62   ILE B HD11 1 
ATOM   2519 H  HD12 . ILE B 1 62 ? -1.499 -5.279  8.818  1.00 16.44  ? 62   ILE B HD12 1 
ATOM   2520 H  HD13 . ILE B 1 62 ? -1.589 -4.467  10.194 1.00 16.44  ? 62   ILE B HD13 1 
ATOM   2521 N  N    . PRO B 1 63 ? -0.538 -1.347  6.390  1.00 8.90   ? 63   PRO B N    1 
ATOM   2522 C  CA   . PRO B 1 63 ? -0.175 -0.045  5.778  1.00 8.59   ? 63   PRO B CA   1 
ATOM   2523 C  C    . PRO B 1 63 ? 0.608  0.830   6.756  1.00 9.31   ? 63   PRO B C    1 
ATOM   2524 O  O    . PRO B 1 63 ? 0.257  0.939   7.945  1.00 8.91   ? 63   PRO B O    1 
ATOM   2525 C  CB   . PRO B 1 63 ? -1.510 0.593   5.406  1.00 9.01   ? 63   PRO B CB   1 
ATOM   2526 C  CG   . PRO B 1 63 ? -2.480 -0.535  5.410  1.00 10.12  ? 63   PRO B CG   1 
ATOM   2527 C  CD   . PRO B 1 63 ? -2.015 -1.523  6.468  1.00 8.15   ? 63   PRO B CD   1 
ATOM   2528 H  HA   . PRO B 1 63 ? 0.368  -0.199  4.952  1.00 10.31  ? 63   PRO B HA   1 
ATOM   2529 H  HB2  . PRO B 1 63 ? -1.768 1.281   6.069  1.00 10.81  ? 63   PRO B HB2  1 
ATOM   2530 H  HB3  . PRO B 1 63 ? -1.463 1.012   4.510  1.00 10.81  ? 63   PRO B HB3  1 
ATOM   2531 H  HG2  . PRO B 1 63 ? -3.389 -0.206  5.624  1.00 12.14  ? 63   PRO B HG2  1 
ATOM   2532 H  HG3  . PRO B 1 63 ? -2.504 -0.971  4.521  1.00 12.14  ? 63   PRO B HG3  1 
ATOM   2533 H  HD2  . PRO B 1 63 ? -2.363 -1.287  7.364  1.00 9.79   ? 63   PRO B HD2  1 
ATOM   2534 H  HD3  . PRO B 1 63 ? -2.284 -2.449  6.245  1.00 9.79   ? 63   PRO B HD3  1 
ATOM   2535 N  N    . VAL B 1 64 ? 1.673  1.506   6.284  1.00 9.18   ? 64   VAL B N    1 
ATOM   2536 C  CA   . VAL B 1 64 ? 2.487  2.433   7.066  1.00 9.16   ? 64   VAL B CA   1 
ATOM   2537 C  C    . VAL B 1 64 ? 2.765  3.652   6.178  1.00 10.17  ? 64   VAL B C    1 
ATOM   2538 O  O    . VAL B 1 64 ? 3.184  3.489   5.039  1.00 20.30  ? 64   VAL B O    1 
ATOM   2539 C  CB   . VAL B 1 64 ? 3.806  1.808   7.602  1.00 10.51  ? 64   VAL B CB   1 
ATOM   2540 C  CG1  . VAL B 1 64 ? 4.588  2.760   8.536  1.00 11.69  ? 64   VAL B CG1  1 
ATOM   2541 C  CG2  . VAL B 1 64 ? 3.582  0.520   8.366  1.00 9.71   ? 64   VAL B CG2  1 
ATOM   2542 H  H    . VAL B 1 64 ? 1.895  1.379   5.442  1.00 11.01  ? 64   VAL B H    1 
ATOM   2543 H  HB   . VAL B 1 64 ? 4.389  1.602   6.817  1.00 12.61  ? 64   VAL B HB   1 
ATOM   2544 H  HG11 . VAL B 1 64 ? 4.743  3.613   8.078  1.00 17.53  ? 64   VAL B HG11 1 
ATOM   2545 H  HG12 . VAL B 1 64 ? 5.448  2.354   8.771  1.00 17.53  ? 64   VAL B HG12 1 
ATOM   2546 H  HG13 . VAL B 1 64 ? 4.068  2.917   9.352  1.00 17.53  ? 64   VAL B HG13 1 
ATOM   2547 N  N    . GLU B 1 65 ? 2.571  4.869   6.680  1.00 9.75   ? 65   GLU B N    1 
ATOM   2548 C  CA   . GLU B 1 65 ? 3.038  6.053   5.919  1.00 9.63   ? 65   GLU B CA   1 
ATOM   2549 C  C    . GLU B 1 65 ? 4.256  6.635   6.668  1.00 9.69   ? 65   GLU B C    1 
ATOM   2550 O  O    . GLU B 1 65 ? 4.174  6.776   7.884  1.00 11.85  ? 65   GLU B O    1 
ATOM   2551 C  CB   . GLU B 1 65 ? 1.914  7.032   5.752  1.00 15.77  ? 65   GLU B CB   1 
ATOM   2552 C  CG   . GLU B 1 65 ? 2.179  8.078   4.610  1.00 23.88  ? 65   GLU B CG   1 
ATOM   2553 C  CD   . GLU B 1 65 ? 0.953  8.983   4.534  1.00 36.07  ? 65   GLU B CD   1 
ATOM   2554 O  OE1  . GLU B 1 65 ? 0.980  9.949   5.317  1.00 53.91  ? 65   GLU B OE1  1 
ATOM   2555 O  OE2  . GLU B 1 65 ? 0.005  8.722   3.768  1.00 41.75  ? 65   GLU B OE2  1 
ATOM   2556 H  H    . GLU B 1 65 ? 2.170  4.971   7.456  1.00 11.70  ? 65   GLU B H    1 
ATOM   2557 H  HA   . GLU B 1 65 ? 3.336  5.752   5.013  1.00 11.56  ? 65   GLU B HA   1 
ATOM   2558 H  HB2  . GLU B 1 65 ? 1.082  6.536   5.547  1.00 18.92  ? 65   GLU B HB2  1 
ATOM   2559 H  HB3  . GLU B 1 65 ? 1.776  7.515   6.605  1.00 18.92  ? 65   GLU B HB3  1 
ATOM   2560 H  HG2  . GLU B 1 65 ? 2.987  8.612   4.814  1.00 28.66  ? 65   GLU B HG2  1 
ATOM   2561 H  HG3  . GLU B 1 65 ? 2.317  7.615   3.746  1.00 28.66  ? 65   GLU B HG3  1 
ATOM   2562 N  N    . ILE B 1 66 ? 5.329  6.918   5.919  1.00 9.22   ? 66   ILE B N    1 
ATOM   2563 C  CA   . ILE B 1 66 ? 6.607  7.431   6.465  1.00 10.44  ? 66   ILE B CA   1 
ATOM   2564 C  C    . ILE B 1 66 ? 6.908  8.798   5.843  1.00 10.17  ? 66   ILE B C    1 
ATOM   2565 O  O    . ILE B 1 66 ? 7.224  8.872   4.641  1.00 12.41  ? 66   ILE B O    1 
ATOM   2566 C  CB   . ILE B 1 66 ? 7.759  6.442   6.224  1.00 10.54  ? 66   ILE B CB   1 
ATOM   2567 C  CG1  . ILE B 1 66 ? 7.469  5.031   6.765  1.00 11.11  ? 66   ILE B CG1  1 
ATOM   2568 C  CG2  . ILE B 1 66 ? 9.084  6.986   6.739  1.00 13.18  ? 66   ILE B CG2  1 
ATOM   2569 C  CD1  . ILE B 1 66 ? 7.982  3.930   5.902  1.00 17.92  ? 66   ILE B CD1  1 
ATOM   2570 H  H    . ILE B 1 66 ? 5.271  6.791   5.050  1.00 11.06  ? 66   ILE B H    1 
ATOM   2571 H  HA   . ILE B 1 66 ? 6.499  7.552   7.452  1.00 12.52  ? 66   ILE B HA   1 
ATOM   2572 H  HB   . ILE B 1 66 ? 7.855  6.352   5.233  1.00 12.65  ? 66   ILE B HB   1 
ATOM   2573 H  HG12 . ILE B 1 66 ? 7.874  4.946   7.664  1.00 13.33  ? 66   ILE B HG12 1 
ATOM   2574 H  HG13 . ILE B 1 66 ? 6.489  4.925   6.867  1.00 13.33  ? 66   ILE B HG13 1 
ATOM   2575 H  HG21 . ILE B 1 66 ? 9.257  7.862   6.336  1.00 19.77  ? 66   ILE B HG21 1 
ATOM   2576 H  HG22 . ILE B 1 66 ? 9.806  6.368   6.499  1.00 19.77  ? 66   ILE B HG22 1 
ATOM   2577 H  HG23 . ILE B 1 66 ? 9.043  7.077   7.714  1.00 19.77  ? 66   ILE B HG23 1 
ATOM   2578 H  HD11 . ILE B 1 66 ? 7.751  3.066   6.302  1.00 26.88  ? 66   ILE B HD11 1 
ATOM   2579 H  HD12 . ILE B 1 66 ? 8.956  4.004   5.823  1.00 26.88  ? 66   ILE B HD12 1 
ATOM   2580 H  HD13 . ILE B 1 66 ? 7.576  3.997   5.012  1.00 26.88  ? 66   ILE B HD13 1 
ATOM   2581 N  N    . CYS B 1 67 ? 6.811  9.877   6.648  1.00 12.84  ? 67   CYS B N    1 
ATOM   2582 C  CA   . CYS B 1 67 ? 7.046  11.211  6.114  1.00 16.91  ? 67   CYS B CA   1 
ATOM   2583 C  C    . CYS B 1 67 ? 6.226  11.451  4.853  1.00 17.75  ? 67   CYS B C    1 
ATOM   2584 O  O    . CYS B 1 67 ? 6.833  11.988  3.908  1.00 23.03  ? 67   CYS B O    1 
ATOM   2585 C  CB   A CYS B 1 67 ? 8.555  11.346  5.911  0.44 18.82  ? 67   CYS B CB   1 
ATOM   2586 C  CB   B CYS B 1 67 ? 8.455  11.459  5.569  0.56 25.28  ? 67   CYS B CB   1 
ATOM   2587 S  SG   A CYS B 1 67 ? 9.433  12.893  5.978  0.44 22.74  ? 67   CYS B SG   1 
ATOM   2588 S  SG   B CYS B 1 67 ? 9.537  11.459  6.953  0.56 23.73  ? 67   CYS B SG   1 
ATOM   2589 H  H    . CYS B 1 67 ? 6.606  9.774   7.498  1.00 15.40  ? 67   CYS B H    1 
ATOM   2590 H  HA   . CYS B 1 67 ? 6.763  11.878  6.804  1.00 20.30  ? 67   CYS B HA   1 
ATOM   2591 H  HB2  A CYS B 1 67 ? 8.980  10.755  6.582  0.44 22.59  ? 67   CYS B HB2  1 
ATOM   2592 H  HB2  B CYS B 1 67 ? 8.710  10.745  4.932  0.56 30.33  ? 67   CYS B HB2  1 
ATOM   2593 H  HB3  A CYS B 1 67 ? 8.753  10.952  5.025  0.44 22.59  ? 67   CYS B HB3  1 
ATOM   2594 H  HB3  B CYS B 1 67 ? 8.495  12.330  5.100  0.56 30.33  ? 67   CYS B HB3  1 
ATOM   2595 N  N    . GLY B 1 68 ? 4.970  11.065  4.725  1.00 17.53  ? 68   GLY B N    1 
ATOM   2596 C  CA   . GLY B 1 68 ? 4.238  11.344  3.469  1.00 21.40  ? 68   GLY B CA   1 
ATOM   2597 C  C    . GLY B 1 68 ? 4.390  10.249  2.429  1.00 17.78  ? 68   GLY B C    1 
ATOM   2598 O  O    . GLY B 1 68 ? 3.733  10.254  1.361  1.00 27.08  ? 68   GLY B O    1 
ATOM   2599 H  H    . GLY B 1 68 ? 4.570  10.642  5.384  1.00 21.03  ? 68   GLY B H    1 
ATOM   2600 H  HA2  . GLY B 1 68 ? 3.277  11.458  3.677  1.00 25.68  ? 68   GLY B HA2  1 
ATOM   2601 H  HA3  . GLY B 1 68 ? 4.568  12.196  3.088  1.00 25.68  ? 68   GLY B HA3  1 
ATOM   2602 N  N    . HIS B 1 69 ? 5.217  9.262   2.570  1.00 13.54  ? 69   HIS B N    1 
ATOM   2603 C  CA   . HIS B 1 69 ? 5.435  8.242   1.569  1.00 12.54  ? 69   HIS B CA   1 
ATOM   2604 C  C    . HIS B 1 69 ? 4.784  6.942   2.056  1.00 12.83  ? 69   HIS B C    1 
ATOM   2605 O  O    . HIS B 1 69 ? 5.021  6.468   3.165  1.00 13.44  ? 69   HIS B O    1 
ATOM   2606 C  CB   . HIS B 1 69 ? 6.925  8.005   1.362  1.00 13.13  ? 69   HIS B CB   1 
ATOM   2607 C  CG   . HIS B 1 69 ? 7.663  9.154   0.755  1.00 14.93  ? 69   HIS B CG   1 
ATOM   2608 N  ND1  . HIS B 1 69 ? 8.159  9.051   -0.545 1.00 16.04  ? 69   HIS B ND1  1 
ATOM   2609 C  CD2  . HIS B 1 69 ? 7.977  10.381  1.178  1.00 16.00  ? 69   HIS B CD2  1 
ATOM   2610 C  CE1  . HIS B 1 69 ? 8.754  10.176  -0.851 1.00 17.85  ? 69   HIS B CE1  1 
ATOM   2611 N  NE2  . HIS B 1 69 ? 8.668  11.029  0.152  1.00 18.70  ? 69   HIS B NE2  1 
ATOM   2612 H  H    . HIS B 1 69 ? 5.674  9.209   3.320  1.00 16.25  ? 69   HIS B H    1 
ATOM   2613 H  HA   . HIS B 1 69 ? 5.016  8.524   0.706  1.00 15.05  ? 69   HIS B HA   1 
ATOM   2614 H  HB2  . HIS B 1 69 ? 7.336  7.794   2.238  1.00 15.76  ? 69   HIS B HB2  1 
ATOM   2615 H  HB3  . HIS B 1 69 ? 7.041  7.213   0.779  1.00 15.76  ? 69   HIS B HB3  1 
ATOM   2616 H  HD1  . HIS B 1 69 ? 8.085  8.349   -1.070 1.00 19.25  ? 69   HIS B HD1  1 
ATOM   2617 H  HD2  . HIS B 1 69 ? 7.768  10.748  2.029  1.00 19.20  ? 69   HIS B HD2  1 
ATOM   2618 H  HE1  . HIS B 1 69 ? 9.186  10.354  -1.678 1.00 21.42  ? 69   HIS B HE1  1 
ATOM   2619 N  N    . LYS B 1 70 ? 3.955  6.308   1.223  1.00 13.13  ? 70   LYS B N    1 
ATOM   2620 C  CA   . LYS B 1 70 ? 3.186  5.120   1.568  1.00 10.80  ? 70   LYS B CA   1 
ATOM   2621 C  C    . LYS B 1 70 ? 3.975  3.826   1.415  1.00 11.46  ? 70   LYS B C    1 
ATOM   2622 O  O    . LYS B 1 70 ? 4.792  3.677   0.503  1.00 13.06  ? 70   LYS B O    1 
ATOM   2623 C  CB   . LYS B 1 70 ? 1.870  5.015   0.736  1.00 11.34  ? 70   LYS B CB   1 
ATOM   2624 C  CG   . LYS B 1 70 ? 0.935  6.177   1.048  1.00 12.98  ? 70   LYS B CG   1 
ATOM   2625 C  CD   . LYS B 1 70 ? -0.387 6.086   0.322  1.00 16.19  ? 70   LYS B CD   1 
ATOM   2626 C  CE   A LYS B 1 70 ? -1.413 7.077   0.846  0.47 23.87  ? 70   LYS B CE   1 
ATOM   2627 C  CE   B LYS B 1 70 ? -1.312 7.274   0.560  0.52 31.60  ? 70   LYS B CE   1 
ATOM   2628 N  NZ   A LYS B 1 70 ? -1.829 6.781   2.242  0.47 28.56  ? 70   LYS B NZ   1 
ATOM   2629 N  NZ   B LYS B 1 70 ? -0.959 8.439   -0.297 0.52 17.77  ? 70   LYS B NZ   1 
ATOM   2630 H  H    . LYS B 1 70 ? 3.868  6.631   0.409  1.00 15.76  ? 70   LYS B H    1 
ATOM   2631 H  HA   . LYS B 1 70 ? 2.927  5.200   2.530  1.00 12.96  ? 70   LYS B HA   1 
ATOM   2632 H  HB2  . LYS B 1 70 ? 2.089  5.018   -0.229 1.00 13.60  ? 70   LYS B HB2  1 
ATOM   2633 H  HB3  . LYS B 1 70 ? 1.415  4.161   0.945  1.00 13.60  ? 70   LYS B HB3  1 
ATOM   2634 H  HG2  . LYS B 1 70 ? 0.765  6.200   2.023  1.00 15.57  ? 70   LYS B HG2  1 
ATOM   2635 H  HG3  . LYS B 1 70 ? 1.381  7.025   0.798  1.00 15.57  ? 70   LYS B HG3  1 
ATOM   2636 H  HD2  . LYS B 1 70 ? -0.239 6.254   -0.642 1.00 19.43  ? 70   LYS B HD2  1 
ATOM   2637 H  HD3  . LYS B 1 70 ? -0.746 5.168   0.418  1.00 19.43  ? 70   LYS B HD3  1 
ATOM   2638 H  HE2  A LYS B 1 70 ? -1.031 7.989   0.808  0.47 28.65  ? 70   LYS B HE2  1 
ATOM   2639 H  HE3  A LYS B 1 70 ? -2.211 7.057   0.259  0.47 28.65  ? 70   LYS B HE3  1 
ATOM   2640 H  HZ1  A LYS B 1 70 ? -2.412 7.419   2.527  0.47 42.84  ? 70   LYS B HZ1  1 
ATOM   2641 H  HZ2  A LYS B 1 70 ? -1.097 6.775   2.782  0.47 42.84  ? 70   LYS B HZ2  1 
ATOM   2642 H  HZ3  A LYS B 1 70 ? -2.234 5.966   2.271  0.47 42.84  ? 70   LYS B HZ3  1 
ATOM   2643 N  N    . ALA B 1 71 ? 3.738  2.885   2.321  1.00 10.92  ? 71   ALA B N    1 
ATOM   2644 C  CA   . ALA B 1 71 ? 4.325  1.567   2.291  1.00 9.90   ? 71   ALA B CA   1 
ATOM   2645 C  C    . ALA B 1 71 ? 3.313  0.564   2.827  1.00 9.23   ? 71   ALA B C    1 
ATOM   2646 O  O    . ALA B 1 71 ? 2.288  0.933   3.456  1.00 9.87   ? 71   ALA B O    1 
ATOM   2647 C  CB   . ALA B 1 71 ? 5.618  1.607   3.099  1.00 11.79  ? 71   ALA B CB   1 
ATOM   2648 H  H    . ALA B 1 71 ? 3.188  3.077   2.981  1.00 13.10  ? 71   ALA B H    1 
ATOM   2649 H  HA   . ALA B 1 71 ? 4.543  1.332   1.344  1.00 11.88  ? 71   ALA B HA   1 
ATOM   2650 H  HB1  . ALA B 1 71 ? 6.221  2.278   2.717  1.00 17.69  ? 71   ALA B HB1  1 
ATOM   2651 H  HB2  . ALA B 1 71 ? 6.048  0.727   3.070  1.00 17.69  ? 71   ALA B HB2  1 
ATOM   2652 H  HB3  . ALA B 1 71 ? 5.415  1.841   4.029  1.00 17.69  ? 71   ALA B HB3  1 
ATOM   2653 N  N    . ILE B 1 72 ? 3.586  -0.714  2.632  1.00 10.20  ? 72   ILE B N    1 
ATOM   2654 C  CA   . ILE B 1 72 ? 2.726  -1.757  3.196  1.00 9.96   ? 72   ILE B CA   1 
ATOM   2655 C  C    . ILE B 1 72 ? 3.561  -3.027  3.329  1.00 10.56  ? 72   ILE B C    1 
ATOM   2656 O  O    . ILE B 1 72 ? 4.277  -3.477  2.413  1.00 10.60  ? 72   ILE B O    1 
ATOM   2657 C  CB   . ILE B 1 72 ? 1.468  -2.011  2.333  1.00 11.27  ? 72   ILE B CB   1 
ATOM   2658 C  CG1  . ILE B 1 72 ? 0.632  -3.201  2.932  1.00 11.08  ? 72   ILE B CG1  1 
ATOM   2659 C  CG2  . ILE B 1 72 ? 1.821  -2.174  0.861  1.00 13.77  ? 72   ILE B CG2  1 
ATOM   2660 C  CD1  . ILE B 1 72 ? -0.686 -3.379  2.200  1.00 19.73  ? 72   ILE B CD1  1 
ATOM   2661 H  H    . ILE B 1 72 ? 4.292  -0.942  2.158  1.00 12.24  ? 72   ILE B H    1 
ATOM   2662 H  HA   . ILE B 1 72 ? 2.434  -1.470  4.109  1.00 11.95  ? 72   ILE B HA   1 
ATOM   2663 H  HB   . ILE B 1 72 ? 0.897  -1.193  2.405  1.00 13.52  ? 72   ILE B HB   1 
ATOM   2664 H  HG12 . ILE B 1 72 ? 1.159  -4.037  2.865  1.00 13.30  ? 72   ILE B HG12 1 
ATOM   2665 H  HG13 . ILE B 1 72 ? 0.454  -3.028  3.890  1.00 13.30  ? 72   ILE B HG13 1 
ATOM   2666 H  HG21 . ILE B 1 72 ? 1.002  -2.322  0.343  1.00 20.66  ? 72   ILE B HG21 1 
ATOM   2667 H  HG22 . ILE B 1 72 ? 2.420  -2.942  0.752  1.00 20.66  ? 72   ILE B HG22 1 
ATOM   2668 H  HG23 . ILE B 1 72 ? 2.268  -1.363  0.541  1.00 20.66  ? 72   ILE B HG23 1 
ATOM   2669 H  HD11 . ILE B 1 72 ? -1.181 -4.127  2.596  1.00 29.59  ? 72   ILE B HD11 1 
ATOM   2670 H  HD12 . ILE B 1 72 ? -0.512 -3.566  1.254  1.00 29.59  ? 72   ILE B HD12 1 
ATOM   2671 H  HD13 . ILE B 1 72 ? -1.216 -2.559  2.279  1.00 29.59  ? 72   ILE B HD13 1 
ATOM   2672 N  N    . GLY B 1 73 ? 3.532  -3.658  4.485  1.00 9.29   ? 73   GLY B N    1 
ATOM   2673 C  CA   . GLY B 1 73 ? 4.353  -4.836  4.725  1.00 9.96   ? 73   GLY B CA   1 
ATOM   2674 C  C    . GLY B 1 73 ? 4.298  -5.332  6.149  1.00 8.90   ? 73   GLY B C    1 
ATOM   2675 O  O    . GLY B 1 73 ? 3.342  -5.060  6.877  1.00 10.26  ? 73   GLY B O    1 
ATOM   2676 H  H    . GLY B 1 73 ? 3.007  -3.361  5.125  1.00 11.15  ? 73   GLY B H    1 
ATOM   2677 H  HA2  . GLY B 1 73 ? 4.054  -5.562  4.122  1.00 11.96  ? 73   GLY B HA2  1 
ATOM   2678 H  HA3  . GLY B 1 73 ? 5.293  -4.623  4.497  1.00 11.96  ? 73   GLY B HA3  1 
ATOM   2679 N  N    . THR B 1 74 ? 5.331  -6.094  6.530  1.00 7.86   ? 74   THR B N    1 
ATOM   2680 C  CA   . THR B 1 74 ? 5.370  -6.743  7.834  1.00 7.63   ? 74   THR B CA   1 
ATOM   2681 C  C    . THR B 1 74 ? 5.784  -5.717  8.894  1.00 8.36   ? 74   THR B C    1 
ATOM   2682 O  O    . THR B 1 74 ? 6.756  -4.938  8.682  1.00 8.10   ? 74   THR B O    1 
ATOM   2683 C  CB   . THR B 1 74 ? 6.376  -7.905  7.802  1.00 9.40   ? 74   THR B CB   1 
ATOM   2684 O  OG1  . THR B 1 74 ? 5.850  -8.892  6.904  1.00 14.30  ? 74   THR B OG1  1 
ATOM   2685 C  CG2  . THR B 1 74 ? 6.537  -8.530  9.176  1.00 11.35  ? 74   THR B CG2  1 
ATOM   2686 H  H    . THR B 1 74 ? 6.005  -6.207  5.976  1.00 9.44   ? 74   THR B H    1 
ATOM   2687 H  HA   . THR B 1 74 ? 4.462  -7.098  8.055  1.00 9.16   ? 74   THR B HA   1 
ATOM   2688 H  HB   . THR B 1 74 ? 7.262  -7.581  7.470  1.00 11.27  ? 74   THR B HB   1 
ATOM   2689 H  HG1  . THR B 1 74 ? 5.725  -8.546  6.149  1.00 21.45  ? 74   THR B HG1  1 
ATOM   2690 H  HG21 . THR B 1 74 ? 7.186  -9.263  9.127  1.00 17.02  ? 74   THR B HG21 1 
ATOM   2691 H  HG22 . THR B 1 74 ? 5.672  -8.879  9.479  1.00 17.02  ? 74   THR B HG22 1 
ATOM   2692 H  HG23 . THR B 1 74 ? 6.856  -7.853  9.807  1.00 17.02  ? 74   THR B HG23 1 
ATOM   2693 N  N    . VAL B 1 75 ? 5.083  -5.707  10.014 1.00 7.58   ? 75   VAL B N    1 
ATOM   2694 C  CA   . VAL B 1 75 ? 5.367  -4.889  11.189 1.00 7.59   ? 75   VAL B CA   1 
ATOM   2695 C  C    . VAL B 1 75 ? 5.413  -5.769  12.426 1.00 8.14   ? 75   VAL B C    1 
ATOM   2696 O  O    . VAL B 1 75 ? 4.543  -6.615  12.651 1.00 9.59   ? 75   VAL B O    1 
ATOM   2697 C  CB   . VAL B 1 75 ? 4.287  -3.797  11.342 1.00 12.32  ? 75   VAL B CB   1 
ATOM   2698 C  CG1  . VAL B 1 75 ? 4.376  -3.104  12.659 1.00 15.56  ? 75   VAL B CG1  1 
ATOM   2699 C  CG2  . VAL B 1 75 ? 4.380  -2.785  10.174 1.00 10.95  ? 75   VAL B CG2  1 
ATOM   2700 H  H    . VAL B 1 75 ? 4.385  -6.240  10.055 1.00 9.10   ? 75   VAL B H    1 
ATOM   2701 H  HA   . VAL B 1 75 ? 6.257  -4.450  11.071 1.00 9.11   ? 75   VAL B HA   1 
ATOM   2702 H  HB   . VAL B 1 75 ? 3.393  -4.242  11.291 1.00 14.79  ? 75   VAL B HB   1 
ATOM   2703 H  HG11 . VAL B 1 75 ? 3.679  -2.418  12.714 1.00 23.34  ? 75   VAL B HG11 1 
ATOM   2704 H  HG12 . VAL B 1 75 ? 5.257  -2.683  12.747 1.00 23.34  ? 75   VAL B HG12 1 
ATOM   2705 H  HG13 . VAL B 1 75 ? 4.251  -3.756  13.380 1.00 23.34  ? 75   VAL B HG13 1 
ATOM   2706 H  HG21 . VAL B 1 75 ? 4.287  -3.260  9.322  1.00 16.42  ? 75   VAL B HG21 1 
ATOM   2707 H  HG22 . VAL B 1 75 ? 5.248  -2.332  10.203 1.00 16.42  ? 75   VAL B HG22 1 
ATOM   2708 H  HG23 . VAL B 1 75 ? 3.663  -2.122  10.259 1.00 16.42  ? 75   VAL B HG23 1 
ATOM   2709 N  N    . LEU B 1 76 ? 6.484  -5.626  13.227 1.00 6.98   ? 76   LEU B N    1 
ATOM   2710 C  CA   . LEU B 1 76 ? 6.678  -6.370  14.462 1.00 6.85   ? 76   LEU B CA   1 
ATOM   2711 C  C    . LEU B 1 76 ? 6.307  -5.449  15.645 1.00 6.88   ? 76   LEU B C    1 
ATOM   2712 O  O    . LEU B 1 76 ? 6.552  -4.215  15.538 1.00 7.81   ? 76   LEU B O    1 
ATOM   2713 C  CB   . LEU B 1 76 ? 8.140  -6.829  14.620 1.00 7.14   ? 76   LEU B CB   1 
ATOM   2714 C  CG   . LEU B 1 76 ? 8.764  -7.520  13.406 1.00 7.69   ? 76   LEU B CG   1 
ATOM   2715 C  CD1  . LEU B 1 76 ? 10.221 -7.902  13.637 1.00 8.07   ? 76   LEU B CD1  1 
ATOM   2716 C  CD2  . LEU B 1 76 ? 7.993  -8.745  12.984 1.00 8.37   ? 76   LEU B CD2  1 
ATOM   2717 H  H    . LEU B 1 76 ? 7.104  -5.049  12.990 1.00 8.38   ? 76   LEU B H    1 
ATOM   2718 H  HA   . LEU B 1 76 ? 6.077  -7.170  14.464 1.00 8.23   ? 76   LEU B HA   1 
ATOM   2719 H  HB2  . LEU B 1 76 ? 8.690  -6.037  14.844 1.00 8.57   ? 76   LEU B HB2  1 
ATOM   2720 H  HB3  . LEU B 1 76 ? 8.188  -7.450  15.390 1.00 8.57   ? 76   LEU B HB3  1 
ATOM   2721 H  HG   . LEU B 1 76 ? 8.739  -6.871  12.645 1.00 9.23   ? 76   LEU B HG   1 
ATOM   2722 H  HD11 . LEU B 1 76 ? 10.730 -7.106  13.898 1.00 12.11  ? 76   LEU B HD11 1 
ATOM   2723 H  HD12 . LEU B 1 76 ? 10.596 -8.273  12.812 1.00 12.11  ? 76   LEU B HD12 1 
ATOM   2724 H  HD13 . LEU B 1 76 ? 10.273 -8.572  14.350 1.00 12.11  ? 76   LEU B HD13 1 
ATOM   2725 H  HD21 . LEU B 1 76 ? 7.052  -8.508  12.847 1.00 12.55  ? 76   LEU B HD21 1 
ATOM   2726 H  HD22 . LEU B 1 76 ? 8.059  -9.429  13.683 1.00 12.55  ? 76   LEU B HD22 1 
ATOM   2727 H  HD23 . LEU B 1 76 ? 8.367  -9.094  12.148 1.00 12.55  ? 76   LEU B HD23 1 
ATOM   2728 N  N    . VAL B 1 77 ? 5.723  -5.987  16.711 1.00 7.05   ? 77   VAL B N    1 
ATOM   2729 C  CA   . VAL B 1 77 ? 5.303  -5.214  17.918 1.00 7.08   ? 77   VAL B CA   1 
ATOM   2730 C  C    . VAL B 1 77 ? 5.852  -5.887  19.162 1.00 7.35   ? 77   VAL B C    1 
ATOM   2731 O  O    . VAL B 1 77 ? 5.681  -7.092  19.329 1.00 8.20   ? 77   VAL B O    1 
ATOM   2732 C  CB   . VAL B 1 77 ? 3.779  -5.060  17.975 1.00 7.77   ? 77   VAL B CB   1 
ATOM   2733 C  CG1  . VAL B 1 77 ? 3.393  -4.261  19.214 1.00 9.89   ? 77   VAL B CG1  1 
ATOM   2734 C  CG2  . VAL B 1 77 ? 3.225  -4.376  16.745 1.00 9.18   ? 77   VAL B CG2  1 
ATOM   2735 H  H    . VAL B 1 77 ? 5.574  -6.854  16.705 1.00 8.46   ? 77   VAL B H    1 
ATOM   2736 H  HA   . VAL B 1 77 ? 5.705  -4.300  17.857 1.00 8.49   ? 77   VAL B HA   1 
ATOM   2737 H  HB   . VAL B 1 77 ? 3.370  -5.970  18.044 1.00 9.32   ? 77   VAL B HB   1 
ATOM   2738 H  HG11 . VAL B 1 77 ? 3.772  -4.689  20.010 1.00 14.83  ? 77   VAL B HG11 1 
ATOM   2739 H  HG12 . VAL B 1 77 ? 2.417  -4.232  19.293 1.00 14.83  ? 77   VAL B HG12 1 
ATOM   2740 H  HG13 . VAL B 1 77 ? 3.742  -3.348  19.136 1.00 14.83  ? 77   VAL B HG13 1 
ATOM   2741 H  HG21 . VAL B 1 77 ? 2.251  -4.300  16.824 1.00 13.77  ? 77   VAL B HG21 1 
ATOM   2742 H  HG22 . VAL B 1 77 ? 3.448  -4.904  15.950 1.00 13.77  ? 77   VAL B HG22 1 
ATOM   2743 H  HG23 . VAL B 1 77 ? 3.617  -3.482  16.664 1.00 13.77  ? 77   VAL B HG23 1 
ATOM   2744 N  N    . GLY B 1 78 ? 6.551  -5.110  20.030 1.00 7.36   ? 78   GLY B N    1 
ATOM   2745 C  CA   . GLY B 1 78 ? 7.042  -5.708  21.291 1.00 9.08   ? 78   GLY B CA   1 
ATOM   2746 C  C    . GLY B 1 78 ? 7.878  -4.700  22.079 1.00 9.01   ? 78   GLY B C    1 
ATOM   2747 O  O    . GLY B 1 78 ? 7.792  -3.480  21.811 1.00 9.86   ? 78   GLY B O    1 
ATOM   2748 H  H    . GLY B 1 78 ? 6.709  -4.264  19.845 1.00 8.84   ? 78   GLY B H    1 
ATOM   2749 H  HA2  . GLY B 1 78 ? 6.272  -5.999  21.840 1.00 10.90  ? 78   GLY B HA2  1 
ATOM   2750 H  HA3  . GLY B 1 78 ? 7.592  -6.505  21.086 1.00 10.90  ? 78   GLY B HA3  1 
ATOM   2751 N  N    . PRO B 1 79 ? 8.646  -5.196  23.063 1.00 10.21  ? 79   PRO B N    1 
ATOM   2752 C  CA   . PRO B 1 79 ? 9.348  -4.338  24.033 1.00 11.83  ? 79   PRO B CA   1 
ATOM   2753 C  C    . PRO B 1 79 ? 10.606 -3.639  23.544 1.00 12.57  ? 79   PRO B C    1 
ATOM   2754 O  O    . PRO B 1 79 ? 11.636 -3.597  24.236 1.00 13.90  ? 79   PRO B O    1 
ATOM   2755 C  CB   . PRO B 1 79 ? 9.665  -5.335  25.205 1.00 15.34  ? 79   PRO B CB   1 
ATOM   2756 C  CG   . PRO B 1 79 ? 9.780  -6.636  24.535 1.00 14.37  ? 79   PRO B CG   1 
ATOM   2757 C  CD   . PRO B 1 79 ? 8.712  -6.604  23.456 1.00 12.30  ? 79   PRO B CD   1 
ATOM   2758 H  HA   . PRO B 1 79 ? 8.708  -3.646  24.367 1.00 14.20  ? 79   PRO B HA   1 
ATOM   2759 H  HB2  . PRO B 1 79 ? 10.511 -5.093  25.658 1.00 18.41  ? 79   PRO B HB2  1 
ATOM   2760 H  HB3  . PRO B 1 79 ? 8.933  -5.343  25.872 1.00 18.41  ? 79   PRO B HB3  1 
ATOM   2761 H  HG2  . PRO B 1 79 ? 10.679 -6.750  24.138 1.00 17.24  ? 79   PRO B HG2  1 
ATOM   2762 H  HG3  . PRO B 1 79 ? 9.615  -7.376  25.172 1.00 17.24  ? 79   PRO B HG3  1 
ATOM   2763 H  HD2  . PRO B 1 79 ? 8.967  -7.174  22.688 1.00 14.76  ? 79   PRO B HD2  1 
ATOM   2764 H  HD3  . PRO B 1 79 ? 7.841  -6.913  23.811 1.00 14.76  ? 79   PRO B HD3  1 
ATOM   2765 N  N    . THR B 1 80 ? 10.564 -3.041  22.375 1.00 12.02  ? 80   THR B N    1 
ATOM   2766 C  CA   . THR B 1 80 ? 11.597 -2.172  21.897 1.00 9.76   ? 80   THR B CA   1 
ATOM   2767 C  C    . THR B 1 80 ? 11.526 -0.833  22.628 1.00 10.05  ? 80   THR B C    1 
ATOM   2768 O  O    . THR B 1 80 ? 10.411 -0.342  22.869 1.00 10.03  ? 80   THR B O    1 
ATOM   2769 C  CB   . THR B 1 80 ? 11.498 -1.932  20.364 1.00 8.93   ? 80   THR B CB   1 
ATOM   2770 O  OG1  . THR B 1 80 ? 12.616 -1.015  20.054 1.00 9.69   ? 80   THR B OG1  1 
ATOM   2771 C  CG2  . THR B 1 80 ? 10.198 -1.345  19.858 1.00 7.72   ? 80   THR B CG2  1 
ATOM   2772 H  H    . THR B 1 80 ? 9.866  -3.183  21.859 1.00 14.42  ? 80   THR B H    1 
ATOM   2773 H  HA   . THR B 1 80 ? 12.481 -2.593  22.094 1.00 11.71  ? 80   THR B HA   1 
ATOM   2774 H  HB   . THR B 1 80 ? 11.660 -2.801  19.895 1.00 10.72  ? 80   THR B HB   1 
ATOM   2775 H  HG1  . THR B 1 80 ? 12.320 -0.340  19.652 1.00 14.54  ? 80   THR B HG1  1 
ATOM   2776 H  HG21 . THR B 1 80 ? 10.242 -1.246  18.884 1.00 11.59  ? 80   THR B HG21 1 
ATOM   2777 H  HG22 . THR B 1 80 ? 10.054 -0.468  20.270 1.00 11.59  ? 80   THR B HG22 1 
ATOM   2778 H  HG23 . THR B 1 80 ? 9.457  -1.942  20.093 1.00 11.59  ? 80   THR B HG23 1 
ATOM   2779 N  N    . PRO B 1 81 ? 12.628 -0.154  22.978 1.00 11.30  ? 81   PRO B N    1 
ATOM   2780 C  CA   . PRO B 1 81 ? 12.545 1.174   23.611 1.00 13.06  ? 81   PRO B CA   1 
ATOM   2781 C  C    . PRO B 1 81 ? 12.188 2.288   22.649 1.00 11.83  ? 81   PRO B C    1 
ATOM   2782 O  O    . PRO B 1 81 ? 11.886 3.377   23.160 1.00 14.73  ? 81   PRO B O    1 
ATOM   2783 C  CB   . PRO B 1 81 ? 13.965 1.396   24.171 1.00 16.77  ? 81   PRO B CB   1 
ATOM   2784 C  CG   . PRO B 1 81 ? 14.855 0.484   23.424 1.00 18.76  ? 81   PRO B CG   1 
ATOM   2785 C  CD   . PRO B 1 81 ? 14.022 -0.601  22.858 1.00 12.73  ? 81   PRO B CD   1 
ATOM   2786 H  HA   . PRO B 1 81 ? 11.885 1.150   24.362 1.00 15.67  ? 81   PRO B HA   1 
ATOM   2787 H  HB2  . PRO B 1 81 ? 14.245 2.337   24.041 1.00 20.12  ? 81   PRO B HB2  1 
ATOM   2788 H  HB3  . PRO B 1 81 ? 13.992 1.189   25.139 1.00 20.12  ? 81   PRO B HB3  1 
ATOM   2789 H  HG2  . PRO B 1 81 ? 15.314 0.976   22.698 1.00 22.51  ? 81   PRO B HG2  1 
ATOM   2790 H  HG3  . PRO B 1 81 ? 15.541 0.107   24.030 1.00 22.51  ? 81   PRO B HG3  1 
ATOM   2791 H  HD2  . PRO B 1 81 ? 14.255 -0.757  21.908 1.00 15.27  ? 81   PRO B HD2  1 
ATOM   2792 H  HD3  . PRO B 1 81 ? 14.161 -1.443  23.360 1.00 15.27  ? 81   PRO B HD3  1 
ATOM   2793 N  N    . VAL B 1 82 ? 12.230 2.092   21.340 1.00 8.02   ? 82   VAL B N    1 
ATOM   2794 C  CA   . VAL B 1 82 ? 12.021 3.109   20.304 1.00 10.20  ? 82   VAL B CA   1 
ATOM   2795 C  C    . VAL B 1 82 ? 11.326 2.466   19.113 1.00 7.80   ? 82   VAL B C    1 
ATOM   2796 O  O    . VAL B 1 82 ? 11.667 1.326   18.745 1.00 9.14   ? 82   VAL B O    1 
ATOM   2797 C  CB   A VAL B 1 82 ? 13.273 3.912   19.900 0.43 14.02  ? 82   VAL B CB   1 
ATOM   2798 C  CB   B VAL B 1 82 ? 13.423 3.627   19.884 0.57 12.27  ? 82   VAL B CB   1 
ATOM   2799 C  CG1  A VAL B 1 82 ? 14.111 4.428   21.071 0.43 17.52  ? 82   VAL B CG1  1 
ATOM   2800 C  CG1  B VAL B 1 82 ? 14.309 2.428   19.608 0.57 52.66  ? 82   VAL B CG1  1 
ATOM   2801 C  CG2  A VAL B 1 82 ? 14.210 3.108   19.043 0.43 13.90  ? 82   VAL B CG2  1 
ATOM   2802 C  CG2  B VAL B 1 82 ? 13.389 4.562   18.687 0.57 16.21  ? 82   VAL B CG2  1 
ATOM   2803 H  H    . VAL B 1 82 ? 12.399 1.274   21.065 1.00 9.62   ? 82   VAL B H    1 
ATOM   2804 H  HA   . VAL B 1 82 ? 11.374 3.769   20.684 1.00 12.24  ? 82   VAL B HA   1 
ATOM   2805 H  HB   A VAL B 1 82 ? 12.972 4.703   19.367 0.43 16.83  ? 82   VAL B HB   1 
ATOM   2806 H  HB   B VAL B 1 82 ? 13.812 4.128   20.657 0.57 14.72  ? 82   VAL B HB   1 
ATOM   2807 H  HG11 A VAL B 1 82 ? 13.542 4.948   21.676 0.43 26.28  ? 82   VAL B HG11 1 
ATOM   2808 H  HG11 B VAL B 1 82 ? 14.342 1.857   20.404 0.57 78.99  ? 82   VAL B HG11 1 
ATOM   2809 H  HG12 A VAL B 1 82 ? 14.833 4.997   20.731 0.43 26.28  ? 82   VAL B HG12 1 
ATOM   2810 H  HG12 B VAL B 1 82 ? 15.213 2.734   19.388 0.57 78.99  ? 82   VAL B HG12 1 
ATOM   2811 H  HG13 A VAL B 1 82 ? 14.495 3.668   21.557 0.43 26.28  ? 82   VAL B HG13 1 
ATOM   2812 H  HG13 B VAL B 1 82 ? 13.943 1.918   18.855 0.57 78.99  ? 82   VAL B HG13 1 
ATOM   2813 H  HG21 A VAL B 1 82 ? 13.725 2.763   18.264 0.43 20.85  ? 82   VAL B HG21 1 
ATOM   2814 H  HG21 B VAL B 1 82 ? 12.768 5.299   18.865 0.57 24.31  ? 82   VAL B HG21 1 
ATOM   2815 H  HG22 A VAL B 1 82 ? 14.566 2.358   19.563 0.43 20.85  ? 82   VAL B HG22 1 
ATOM   2816 H  HG22 B VAL B 1 82 ? 13.091 4.068   17.895 0.57 24.31  ? 82   VAL B HG22 1 
ATOM   2817 H  HG23 A VAL B 1 82 ? 14.948 3.677   18.742 0.43 20.85  ? 82   VAL B HG23 1 
ATOM   2818 H  HG23 B VAL B 1 82 ? 14.286 4.923   18.528 0.57 24.31  ? 82   VAL B HG23 1 
ATOM   2819 N  N    . ASN B 1 83 ? 10.385 3.203   18.499 1.00 7.65   ? 83   ASN B N    1 
ATOM   2820 C  CA   . ASN B 1 83 ? 9.841  2.754   17.217 1.00 6.86   ? 83   ASN B CA   1 
ATOM   2821 C  C    . ASN B 1 83 ? 10.911 2.788   16.123 1.00 7.27   ? 83   ASN B C    1 
ATOM   2822 O  O    . ASN B 1 83 ? 11.582 3.848   15.983 1.00 7.81   ? 83   ASN B O    1 
ATOM   2823 C  CB   . ASN B 1 83 ? 8.652  3.635   16.771 1.00 7.97   ? 83   ASN B CB   1 
ATOM   2824 C  CG   . ASN B 1 83 ? 7.442  3.625   17.681 1.00 7.00   ? 83   ASN B CG   1 
ATOM   2825 O  OD1  . ASN B 1 83 ? 6.941  2.575   18.050 1.00 9.44   ? 83   ASN B OD1  1 
ATOM   2826 N  ND2  . ASN B 1 83 ? 6.992  4.822   18.071 1.00 9.16   ? 83   ASN B ND2  1 
ATOM   2827 H  H    . ASN B 1 83 ? 10.099 3.951   18.865 1.00 9.19   ? 83   ASN B H    1 
ATOM   2828 H  HA   . ASN B 1 83 ? 9.520  1.812   17.319 1.00 8.23   ? 83   ASN B HA   1 
ATOM   2829 H  HB2  . ASN B 1 83 ? 8.971  4.568   16.688 1.00 9.56   ? 83   ASN B HB2  1 
ATOM   2830 H  HB3  . ASN B 1 83 ? 8.367  3.339   15.870 1.00 9.56   ? 83   ASN B HB3  1 
ATOM   2831 H  HD21 . ASN B 1 83 ? 6.305  4.877   18.619 1.00 10.99  ? 83   ASN B HD21 1 
ATOM   2832 H  HD22 . ASN B 1 83 ? 7.382  5.555   17.781 1.00 10.99  ? 83   ASN B HD22 1 
ATOM   2833 N  N    . ILE B 1 84 ? 11.091 1.698   15.356 1.00 5.94   ? 84   ILE B N    1 
ATOM   2834 C  CA   . ILE B 1 84 ? 12.165 1.541   14.385 1.00 6.44   ? 84   ILE B CA   1 
ATOM   2835 C  C    . ILE B 1 84 ? 11.638 1.116   13.001 1.00 6.74   ? 84   ILE B C    1 
ATOM   2836 O  O    . ILE B 1 84 ? 10.989 0.095   12.905 1.00 7.55   ? 84   ILE B O    1 
ATOM   2837 C  CB   . ILE B 1 84 ? 13.216 0.505   14.897 1.00 7.55   ? 84   ILE B CB   1 
ATOM   2838 C  CG1  . ILE B 1 84 ? 13.933 1.023   16.128 1.00 9.10   ? 84   ILE B CG1  1 
ATOM   2839 C  CG2  . ILE B 1 84 ? 14.184 0.102   13.808 1.00 9.56   ? 84   ILE B CG2  1 
ATOM   2840 C  CD1  . ILE B 1 84 ? 14.695 0.001   16.938 1.00 9.68   ? 84   ILE B CD1  1 
ATOM   2841 H  H    . ILE B 1 84 ? 10.522 1.033   15.448 1.00 7.12   ? 84   ILE B H    1 
ATOM   2842 H  HA   . ILE B 1 84 ? 12.623 2.425   14.285 1.00 7.72   ? 84   ILE B HA   1 
ATOM   2843 H  HB   . ILE B 1 84 ? 12.715 -0.316  15.169 1.00 9.06   ? 84   ILE B HB   1 
ATOM   2844 H  HG12 . ILE B 1 84 ? 14.568 1.727   15.843 1.00 10.92  ? 84   ILE B HG12 1 
ATOM   2845 H  HG13 . ILE B 1 84 ? 13.264 1.450   16.720 1.00 10.92  ? 84   ILE B HG13 1 
ATOM   2846 H  HG21 . ILE B 1 84 ? 13.684 -0.229  13.033 1.00 14.34  ? 84   ILE B HG21 1 
ATOM   2847 H  HG22 . ILE B 1 84 ? 14.774 -0.606  14.142 1.00 14.34  ? 84   ILE B HG22 1 
ATOM   2848 H  HG23 . ILE B 1 84 ? 14.721 0.878   13.544 1.00 14.34  ? 84   ILE B HG23 1 
ATOM   2849 H  HD11 . ILE B 1 84 ? 15.112 0.440   17.709 1.00 14.52  ? 84   ILE B HD11 1 
ATOM   2850 H  HD12 . ILE B 1 84 ? 15.390 -0.406  16.379 1.00 14.52  ? 84   ILE B HD12 1 
ATOM   2851 H  HD13 . ILE B 1 84 ? 14.079 -0.693  17.251 1.00 14.52  ? 84   ILE B HD13 1 
ATOM   2852 N  N    . ILE B 1 85 ? 11.938 1.975   11.998 1.00 6.52   ? 85   ILE B N    1 
ATOM   2853 C  CA   . ILE B 1 85 ? 11.678 1.611   10.598 1.00 6.40   ? 85   ILE B CA   1 
ATOM   2854 C  C    . ILE B 1 85 ? 12.934 1.003   9.992  1.00 6.52   ? 85   ILE B C    1 
ATOM   2855 O  O    . ILE B 1 85 ? 13.981 1.658   9.920  1.00 7.44   ? 85   ILE B O    1 
ATOM   2856 C  CB   . ILE B 1 85 ? 11.263 2.857   9.787  1.00 7.27   ? 85   ILE B CB   1 
ATOM   2857 C  CG1  . ILE B 1 85 ? 10.066 3.580   10.335 1.00 8.24   ? 85   ILE B CG1  1 
ATOM   2858 C  CG2  . ILE B 1 85 ? 11.043 2.447   8.351  1.00 8.36   ? 85   ILE B CG2  1 
ATOM   2859 C  CD1  . ILE B 1 85 ? 8.819  2.743   10.417 1.00 15.39  ? 85   ILE B CD1  1 
ATOM   2860 H  H    . ILE B 1 85 ? 12.292 2.759   12.187 1.00 7.82   ? 85   ILE B H    1 
ATOM   2861 H  HA   . ILE B 1 85 ? 10.939 0.938   10.566 1.00 7.69   ? 85   ILE B HA   1 
ATOM   2862 H  HB   . ILE B 1 85 ? 12.032 3.496   9.803  1.00 8.72   ? 85   ILE B HB   1 
ATOM   2863 H  HG12 . ILE B 1 85 ? 10.285 3.913   11.242 1.00 9.88   ? 85   ILE B HG12 1 
ATOM   2864 H  HG13 . ILE B 1 85 ? 9.882  4.367   9.764  1.00 9.88   ? 85   ILE B HG13 1 
ATOM   2865 H  HG21 . ILE B 1 85 ? 11.836 1.976   8.020  1.00 12.54  ? 85   ILE B HG21 1 
ATOM   2866 H  HG22 . ILE B 1 85 ? 10.885 3.245   7.804  1.00 12.54  ? 85   ILE B HG22 1 
ATOM   2867 H  HG23 . ILE B 1 85 ? 10.264 1.855   8.296  1.00 12.54  ? 85   ILE B HG23 1 
ATOM   2868 H  HD11 . ILE B 1 85 ? 8.088  3.281   10.788 1.00 23.09  ? 85   ILE B HD11 1 
ATOM   2869 H  HD12 . ILE B 1 85 ? 8.982  1.970   10.996 1.00 23.09  ? 85   ILE B HD12 1 
ATOM   2870 H  HD13 . ILE B 1 85 ? 8.574  2.433   9.520  1.00 23.09  ? 85   ILE B HD13 1 
ATOM   2871 N  N    . GLY B 1 86 ? 12.836 -0.258  9.578  1.00 6.60   ? 86   GLY B N    1 
ATOM   2872 C  CA   . GLY B 1 86 ? 13.966 -0.971  8.992  1.00 6.58   ? 86   GLY B CA   1 
ATOM   2873 C  C    . GLY B 1 86 ? 13.865 -1.132  7.486  1.00 7.04   ? 86   GLY B C    1 
ATOM   2874 O  O    . GLY B 1 86 ? 13.005 -0.554  6.797  1.00 7.05   ? 86   GLY B O    1 
ATOM   2875 H  H    . GLY B 1 86 ? 12.065 -0.675  9.660  1.00 7.92   ? 86   GLY B H    1 
ATOM   2876 H  HA2  . GLY B 1 86 ? 14.799 -0.481  9.207  1.00 7.90   ? 86   GLY B HA2  1 
ATOM   2877 H  HA3  . GLY B 1 86 ? 14.028 -1.867  9.407  1.00 7.90   ? 86   GLY B HA3  1 
ATOM   2878 N  N    . ARG B 1 87 ? 14.793 -1.925  6.913  1.00 7.56   ? 87   ARG B N    1 
ATOM   2879 C  CA   . ARG B 1 87 ? 15.061 -1.968  5.482  1.00 8.18   ? 87   ARG B CA   1 
ATOM   2880 C  C    . ARG B 1 87 ? 13.853 -2.458  4.699  1.00 7.80   ? 87   ARG B C    1 
ATOM   2881 O  O    . ARG B 1 87 ? 13.647 -2.062  3.541  1.00 9.95   ? 87   ARG B O    1 
ATOM   2882 C  CB   . ARG B 1 87 ? 16.297 -2.826  5.170  1.00 8.89   ? 87   ARG B CB   1 
ATOM   2883 C  CG   . ARG B 1 87 ? 17.607 -2.163  5.677  1.00 10.47  ? 87   ARG B CG   1 
ATOM   2884 C  CD   . ARG B 1 87 ? 18.886 -2.910  5.176  1.00 11.59  ? 87   ARG B CD   1 
ATOM   2885 N  NE   . ARG B 1 87 ? 18.899 -4.322  5.573  1.00 12.00  ? 87   ARG B NE   1 
ATOM   2886 C  CZ   . ARG B 1 87 ? 18.545 -5.405  4.916  1.00 12.69  ? 87   ARG B CZ   1 
ATOM   2887 N  NH1  . ARG B 1 87 ? 18.123 -5.290  3.659  1.00 12.29  ? 87   ARG B NH1  1 
ATOM   2888 N  NH2  . ARG B 1 87 ? 18.656 -6.581  5.559  1.00 13.85  ? 87   ARG B NH2  1 
ATOM   2889 H  H    . ARG B 1 87 ? 15.267 -2.450  7.437  1.00 9.07   ? 87   ARG B H    1 
ATOM   2890 H  HA   . ARG B 1 87 ? 15.257 -1.034  5.182  1.00 9.81   ? 87   ARG B HA   1 
ATOM   2891 H  HB2  . ARG B 1 87 ? 16.195 -3.713  5.598  1.00 10.67  ? 87   ARG B HB2  1 
ATOM   2892 H  HB3  . ARG B 1 87 ? 16.360 -2.965  4.192  1.00 10.67  ? 87   ARG B HB3  1 
ATOM   2893 H  HG2  . ARG B 1 87 ? 17.636 -1.224  5.365  1.00 12.56  ? 87   ARG B HG2  1 
ATOM   2894 H  HG3  . ARG B 1 87 ? 17.604 -2.155  6.667  1.00 12.56  ? 87   ARG B HG3  1 
ATOM   2895 H  HD2  . ARG B 1 87 ? 18.931 -2.850  4.188  1.00 13.91  ? 87   ARG B HD2  1 
ATOM   2896 H  HD3  . ARG B 1 87 ? 19.689 -2.462  5.544  1.00 13.91  ? 87   ARG B HD3  1 
ATOM   2897 H  HE   . ARG B 1 87 ? 19.193 -4.469  6.390  1.00 14.40  ? 87   ARG B HE   1 
ATOM   2898 H  HH11 . ARG B 1 87 ? 18.084 -4.497  3.279  1.00 14.75  ? 87   ARG B HH11 1 
ATOM   2899 H  HH12 . ARG B 1 87 ? 17.884 -6.006  3.207  1.00 14.75  ? 87   ARG B HH12 1 
ATOM   2900 H  HH21 . ARG B 1 87 ? 18.956 -6.603  6.386  1.00 16.62  ? 87   ARG B HH21 1 
ATOM   2901 H  HH22 . ARG B 1 87 ? 18.430 -7.328  5.152  1.00 16.62  ? 87   ARG B HH22 1 
ATOM   2902 N  N    . ASN B 1 88 ? 13.013 -3.337  5.253  1.00 7.83   ? 88   ASN B N    1 
ATOM   2903 C  CA   . ASN B 1 88 ? 11.820 -3.870  4.598  1.00 8.96   ? 88   ASN B CA   1 
ATOM   2904 C  C    . ASN B 1 88 ? 10.901 -2.765  4.128  1.00 9.68   ? 88   ASN B C    1 
ATOM   2905 O  O    . ASN B 1 88 ? 10.285 -2.878  3.062  1.00 11.12  ? 88   ASN B O    1 
ATOM   2906 C  CB   . ASN B 1 88 ? 11.046 -4.877  5.441  1.00 9.38   ? 88   ASN B CB   1 
ATOM   2907 C  CG   . ASN B 1 88 ? 10.281 -4.256  6.602  1.00 7.78   ? 88   ASN B CG   1 
ATOM   2908 O  OD1  . ASN B 1 88 ? 10.886 -3.528  7.423  1.00 8.82   ? 88   ASN B OD1  1 
ATOM   2909 N  ND2  . ASN B 1 88 ? 8.976  -4.556  6.702  1.00 8.81   ? 88   ASN B ND2  1 
ATOM   2910 H  H    . ASN B 1 88 ? 13.191 -3.615  6.068  1.00 9.40   ? 88   ASN B H    1 
ATOM   2911 H  HA   . ASN B 1 88 ? 12.131 -4.355  3.781  1.00 10.75  ? 88   ASN B HA   1 
ATOM   2912 H  HB2  . ASN B 1 88 ? 10.405 -5.355  4.857  1.00 11.25  ? 88   ASN B HB2  1 
ATOM   2913 H  HB3  . ASN B 1 88 ? 11.681 -5.547  5.800  1.00 11.25  ? 88   ASN B HB3  1 
ATOM   2914 N  N    . LEU B 1 89 ? 10.756 -1.665  4.869  1.00 8.04   ? 89   LEU B N    1 
ATOM   2915 C  CA   . LEU B 1 89 ? 9.935  -0.520  4.477  1.00 8.33   ? 89   LEU B CA   1 
ATOM   2916 C  C    . LEU B 1 89 ? 10.816 0.598   3.888  1.00 8.86   ? 89   LEU B C    1 
ATOM   2917 O  O    . LEU B 1 89 ? 10.306 1.330   2.989  1.00 9.53   ? 89   LEU B O    1 
ATOM   2918 C  CB   . LEU B 1 89 ? 9.083  0.019   5.639  1.00 8.83   ? 89   LEU B CB   1 
ATOM   2919 C  CG   . LEU B 1 89 ? 8.150  -1.018  6.271  1.00 8.20   ? 89   LEU B CG   1 
ATOM   2920 C  CD1  . LEU B 1 89 ? 7.346  -0.330  7.417  1.00 9.71   ? 89   LEU B CD1  1 
ATOM   2921 C  CD2  . LEU B 1 89 ? 7.213  -1.698  5.290  1.00 11.00  ? 89   LEU B CD2  1 
ATOM   2922 H  H    . LEU B 1 89 ? 11.179 -1.626  5.640  1.00 9.65   ? 89   LEU B H    1 
ATOM   2923 H  HA   . LEU B 1 89 ? 9.310  -0.826  3.758  1.00 10.00  ? 89   LEU B HA   1 
ATOM   2924 H  HB2  . LEU B 1 89 ? 9.689  0.369   6.340  1.00 10.60  ? 89   LEU B HB2  1 
ATOM   2925 H  HB3  . LEU B 1 89 ? 8.539  0.777   5.308  1.00 10.60  ? 89   LEU B HB3  1 
ATOM   2926 H  HG   . LEU B 1 89 ? 8.721  -1.726  6.685  1.00 9.84   ? 89   LEU B HG   1 
ATOM   2927 H  HD11 . LEU B 1 89 ? 7.969  0.091   8.046  1.00 14.57  ? 89   LEU B HD11 1 
ATOM   2928 H  HD12 . LEU B 1 89 ? 6.810  -1.001  7.889  1.00 14.57  ? 89   LEU B HD12 1 
ATOM   2929 H  HD13 . LEU B 1 89 ? 6.754  0.353   7.037  1.00 14.57  ? 89   LEU B HD13 1 
ATOM   2930 H  HD21 . LEU B 1 89 ? 6.652  -2.344  5.769  1.00 16.50  ? 89   LEU B HD21 1 
ATOM   2931 H  HD22 . LEU B 1 89 ? 7.739  -2.165  4.607  1.00 16.50  ? 89   LEU B HD22 1 
ATOM   2932 H  HD23 . LEU B 1 89 ? 6.644  -1.026  4.862  1.00 16.50  ? 89   LEU B HD23 1 
ATOM   2933 N  N    . LEU B 1 90 ? 12.058 0.800   4.295  1.00 8.28   ? 90   LEU B N    1 
ATOM   2934 C  CA   . LEU B 1 90 ? 12.918 1.844   3.719  1.00 8.36   ? 90   LEU B CA   1 
ATOM   2935 C  C    . LEU B 1 90 ? 13.057 1.609   2.202  1.00 8.27   ? 90   LEU B C    1 
ATOM   2936 O  O    . LEU B 1 90 ? 13.082 2.594   1.430  1.00 9.38   ? 90   LEU B O    1 
ATOM   2937 C  CB   . LEU B 1 90 ? 14.299 1.930   4.381  1.00 8.86   ? 90   LEU B CB   1 
ATOM   2938 C  CG   . LEU B 1 90 ? 14.332 2.352   5.865  1.00 7.33   ? 90   LEU B CG   1 
ATOM   2939 C  CD1  . LEU B 1 90 ? 15.720 2.145   6.473  1.00 8.76   ? 90   LEU B CD1  1 
ATOM   2940 C  CD2  . LEU B 1 90 ? 13.933 3.798   6.002  1.00 9.79   ? 90   LEU B CD2  1 
ATOM   2941 H  H    . LEU B 1 90 ? 12.382 0.291   4.936  1.00 9.94   ? 90   LEU B H    1 
ATOM   2942 H  HA   . LEU B 1 90 ? 12.461 2.723   3.851  1.00 10.04  ? 90   LEU B HA   1 
ATOM   2943 H  HB2  . LEU B 1 90 ? 14.734 1.044   4.303  1.00 10.64  ? 90   LEU B HB2  1 
ATOM   2944 H  HB3  . LEU B 1 90 ? 14.848 2.574   3.866  1.00 10.64  ? 90   LEU B HB3  1 
ATOM   2945 H  HG   . LEU B 1 90 ? 13.676 1.791   6.370  1.00 8.79   ? 90   LEU B HG   1 
ATOM   2946 H  HD11 . LEU B 1 90 ? 15.988 1.209   6.364  1.00 13.15  ? 90   LEU B HD11 1 
ATOM   2947 H  HD12 . LEU B 1 90 ? 15.695 2.369   7.427  1.00 13.15  ? 90   LEU B HD12 1 
ATOM   2948 H  HD13 . LEU B 1 90 ? 16.366 2.725   6.018  1.00 13.15  ? 90   LEU B HD13 1 
ATOM   2949 H  HD21 . LEU B 1 90 ? 13.044 3.930   5.613  1.00 14.68  ? 90   LEU B HD21 1 
ATOM   2950 H  HD22 . LEU B 1 90 ? 14.583 4.362   5.532  1.00 14.68  ? 90   LEU B HD22 1 
ATOM   2951 H  HD23 . LEU B 1 90 ? 13.914 4.043   6.951  1.00 14.68  ? 90   LEU B HD23 1 
ATOM   2952 N  N    . THR B 1 91 ? 13.189 0.391   1.736  1.00 10.22  ? 91   THR B N    1 
ATOM   2953 C  CA   . THR B 1 91 ? 13.306 0.141   0.292  1.00 10.64  ? 91   THR B CA   1 
ATOM   2954 C  C    . THR B 1 91 ? 12.049 0.516   -0.427 1.00 10.64  ? 91   THR B C    1 
ATOM   2955 O  O    . THR B 1 91 ? 12.138 1.019   -1.574 1.00 14.83  ? 91   THR B O    1 
ATOM   2956 C  CB   . THR B 1 91 ? 13.650 -1.330  -0.027 1.00 11.48  ? 91   THR B CB   1 
ATOM   2957 O  OG1  . THR B 1 91 ? 12.643 -2.193  0.589  1.00 14.26  ? 91   THR B OG1  1 
ATOM   2958 C  CG2  . THR B 1 91 ? 15.042 -1.714  0.501  1.00 13.07  ? 91   THR B CG2  1 
ATOM   2959 H  H    . THR B 1 91 ? 13.208 -0.288  2.296  1.00 12.26  ? 91   THR B H    1 
ATOM   2960 H  HA   . THR B 1 91 ? 14.045 0.714   -0.061 1.00 12.77  ? 91   THR B HA   1 
ATOM   2961 H  HB   . THR B 1 91 ? 13.630 -1.462  -1.018 1.00 13.77  ? 91   THR B HB   1 
ATOM   2962 H  HG1  . THR B 1 91 ? 11.882 -1.986  0.301  1.00 21.39  ? 91   THR B HG1  1 
ATOM   2963 H  HG21 . THR B 1 91 ? 15.227 -2.651  0.282  1.00 19.60  ? 91   THR B HG21 1 
ATOM   2964 H  HG22 . THR B 1 91 ? 15.067 -1.595  1.473  1.00 19.60  ? 91   THR B HG22 1 
ATOM   2965 H  HG23 . THR B 1 91 ? 15.719 -1.141  0.084  1.00 19.60  ? 91   THR B HG23 1 
ATOM   2966 N  N    . GLN B 1 92 ? 10.872 0.400   0.176  1.00 10.31  ? 92   GLN B N    1 
ATOM   2967 C  CA   . GLN B 1 92 ? 9.596  0.691   -0.469 1.00 11.36  ? 92   GLN B CA   1 
ATOM   2968 C  C    . GLN B 1 92 ? 9.391  2.185   -0.740 1.00 10.67  ? 92   GLN B C    1 
ATOM   2969 O  O    . GLN B 1 92 ? 8.638  2.532   -1.623 1.00 15.90  ? 92   GLN B O    1 
ATOM   2970 C  CB   . GLN B 1 92 ? 8.393  0.238   0.365  1.00 11.68  ? 92   GLN B CB   1 
ATOM   2971 C  CG   . GLN B 1 92 ? 8.277  -1.266  0.415  1.00 12.35  ? 92   GLN B CG   1 
ATOM   2972 C  CD   . GLN B 1 92 ? 7.000  -1.723  1.088  1.00 11.99  ? 92   GLN B CD   1 
ATOM   2973 O  OE1  . GLN B 1 92 ? 6.018  -0.998  1.099  1.00 15.72  ? 92   GLN B OE1  1 
ATOM   2974 N  NE2  . GLN B 1 92 ? 7.036  -2.885  1.680  1.00 17.74  ? 92   GLN B NE2  1 
ATOM   2975 H  H    . GLN B 1 92 ? 10.861 0.132   1.014  1.00 12.38  ? 92   GLN B H    1 
ATOM   2976 H  HA   . GLN B 1 92 ? 9.570  0.208   -1.344 1.00 13.63  ? 92   GLN B HA   1 
ATOM   2977 H  HB2  . GLN B 1 92 ? 8.484  0.588   1.287  1.00 14.01  ? 92   GLN B HB2  1 
ATOM   2978 H  HB3  . GLN B 1 92 ? 7.565  0.616   -0.024 1.00 14.01  ? 92   GLN B HB3  1 
ATOM   2979 H  HG2  . GLN B 1 92 ? 8.303  -1.624  -0.508 1.00 14.82  ? 92   GLN B HG2  1 
ATOM   2980 H  HG3  . GLN B 1 92 ? 9.053  -1.635  0.906  1.00 14.82  ? 92   GLN B HG3  1 
ATOM   2981 H  HE21 . GLN B 1 92 ? 6.330  -3.181  2.114  1.00 21.28  ? 92   GLN B HE21 1 
ATOM   2982 H  HE22 . GLN B 1 92 ? 7.767  -3.374  1.645  1.00 21.28  ? 92   GLN B HE22 1 
ATOM   2983 N  N    . ILE B 1 93 ? 10.082 3.019   0.044  1.00 12.60  ? 93   ILE B N    1 
ATOM   2984 C  CA   . ILE B 1 93 ? 10.046 4.472   -0.119 1.00 11.56  ? 93   ILE B CA   1 
ATOM   2985 C  C    . ILE B 1 93 ? 11.245 5.013   -0.897 1.00 12.09  ? 93   ILE B C    1 
ATOM   2986 O  O    . ILE B 1 93 ? 11.386 6.177   -1.112 1.00 15.19  ? 93   ILE B O    1 
ATOM   2987 C  CB   . ILE B 1 93 ? 9.823  5.210   1.211  1.00 12.15  ? 93   ILE B CB   1 
ATOM   2988 C  CG1  . ILE B 1 93 ? 11.023 5.174   2.137  1.00 12.06  ? 93   ILE B CG1  1 
ATOM   2989 C  CG2  . ILE B 1 93 ? 8.581  4.666   1.939  1.00 16.79  ? 93   ILE B CG2  1 
ATOM   2990 C  CD1  . ILE B 1 93 ? 10.795 5.872   3.453  1.00 11.96  ? 93   ILE B CD1  1 
ATOM   2991 H  H    . ILE B 1 93 ? 10.579 2.679   0.685  1.00 15.12  ? 93   ILE B H    1 
ATOM   2992 H  HA   . ILE B 1 93 ? 9.242  4.666   -0.681 1.00 13.87  ? 93   ILE B HA   1 
ATOM   2993 H  HB   . ILE B 1 93 ? 9.644  6.170   0.993  1.00 14.58  ? 93   ILE B HB   1 
ATOM   2994 H  HG12 . ILE B 1 93 ? 11.261 4.230   2.314  1.00 14.48  ? 93   ILE B HG12 1 
ATOM   2995 H  HG13 . ILE B 1 93 ? 11.791 5.599   1.680  1.00 14.48  ? 93   ILE B HG13 1 
ATOM   2996 H  HG21 . ILE B 1 93 ? 7.813  4.681   1.330  1.00 25.19  ? 93   ILE B HG21 1 
ATOM   2997 H  HG22 . ILE B 1 93 ? 8.389  5.225   2.720  1.00 25.19  ? 93   ILE B HG22 1 
ATOM   2998 H  HG23 . ILE B 1 93 ? 8.749  3.745   2.229  1.00 25.19  ? 93   ILE B HG23 1 
ATOM   2999 H  HD11 . ILE B 1 93 ? 11.615 5.834   3.989  1.00 17.94  ? 93   ILE B HD11 1 
ATOM   3000 H  HD12 . ILE B 1 93 ? 10.068 5.428   3.937  1.00 17.94  ? 93   ILE B HD12 1 
ATOM   3001 H  HD13 . ILE B 1 93 ? 10.555 6.808   3.290  1.00 17.94  ? 93   ILE B HD13 1 
ATOM   3002 N  N    . GLY B 1 94 ? 12.139 4.157   -1.422 1.00 13.65  ? 94   GLY B N    1 
ATOM   3003 C  CA   . GLY B 1 94 ? 13.249 4.660   -2.271 1.00 16.91  ? 94   GLY B CA   1 
ATOM   3004 C  C    . GLY B 1 94 ? 14.401 5.201   -1.448 1.00 15.64  ? 94   GLY B C    1 
ATOM   3005 O  O    . GLY B 1 94 ? 15.195 5.984   -1.993 1.00 22.16  ? 94   GLY B O    1 
ATOM   3006 H  H    . GLY B 1 94 ? 12.065 3.295   -1.262 1.00 16.38  ? 94   GLY B H    1 
ATOM   3007 H  HA2  . GLY B 1 94 ? 13.577 3.923   -2.845 1.00 20.29  ? 94   GLY B HA2  1 
ATOM   3008 H  HA3  . GLY B 1 94 ? 12.907 5.376   -2.862 1.00 20.29  ? 94   GLY B HA3  1 
ATOM   3009 N  N    . CYS B 1 95 ? 14.539 4.809   -0.171 1.00 15.74  ? 95   CYS B N    1 
ATOM   3010 C  CA   . CYS B 1 95 ? 15.598 5.463   0.627  1.00 15.61  ? 95   CYS B CA   1 
ATOM   3011 C  C    . CYS B 1 95 ? 16.989 4.915   0.335  1.00 14.82  ? 95   CYS B C    1 
ATOM   3012 O  O    . CYS B 1 95 ? 17.117 3.650   0.296  1.00 18.11  ? 95   CYS B O    1 
ATOM   3013 C  CB   . CYS B 1 95 ? 15.257 5.247   2.119  1.00 15.57  ? 95   CYS B CB   1 
ATOM   3014 S  SG   . CYS B 1 95 ? 16.302 6.034   3.327  1.00 15.57  ? 95   CYS B SG   1 
ATOM   3015 H  H    . CYS B 1 95 ? 14.020 4.189   0.177  1.00 18.88  ? 95   CYS B H    1 
ATOM   3016 H  HA   . CYS B 1 95 ? 15.589 6.444   0.433  1.00 18.73  ? 95   CYS B HA   1 
ATOM   3017 H  HB2  . CYS B 1 95 ? 14.330 5.561   2.267  1.00 18.68  ? 95   CYS B HB2  1 
ATOM   3018 H  HB3  . CYS B 1 95 ? 15.268 4.273   2.295  1.00 18.68  ? 95   CYS B HB3  1 
ATOM   3019 N  N    . THR B 1 96 ? 17.953 5.829   0.200  1.00 13.30  ? 96   THR B N    1 
ATOM   3020 C  CA   . THR B 1 96 ? 19.344 5.444   0.009  1.00 13.52  ? 96   THR B CA   1 
ATOM   3021 C  C    . THR B 1 96 ? 20.222 6.149   1.044  1.00 10.69  ? 96   THR B C    1 
ATOM   3022 O  O    . THR B 1 96 ? 19.853 7.168   1.663  1.00 11.05  ? 96   THR B O    1 
ATOM   3023 C  CB   . THR B 1 96 ? 19.891 5.705   -1.402 1.00 18.41  ? 96   THR B CB   1 
ATOM   3024 O  OG1  . THR B 1 96 ? 19.716 7.069   -1.719 1.00 18.88  ? 96   THR B OG1  1 
ATOM   3025 C  CG2  . THR B 1 96 ? 19.122 4.958   -2.473 1.00 22.62  ? 96   THR B CG2  1 
ATOM   3026 H  H    . THR B 1 96 ? 17.743 6.683   0.228  1.00 15.96  ? 96   THR B H    1 
ATOM   3027 H  HA   . THR B 1 96 ? 19.409 4.461   0.179  1.00 16.23  ? 96   THR B HA   1 
ATOM   3028 H  HB   . THR B 1 96 ? 20.861 5.465   -1.444 1.00 22.09  ? 96   THR B HB   1 
ATOM   3029 H  HG1  . THR B 1 96 ? 19.251 7.136   -2.416 1.00 28.32  ? 96   THR B HG1  1 
ATOM   3030 H  HG21 . THR B 1 96 ? 19.515 5.149   -3.351 1.00 33.93  ? 96   THR B HG21 1 
ATOM   3031 H  HG22 . THR B 1 96 ? 18.186 5.247   -2.465 1.00 33.93  ? 96   THR B HG22 1 
ATOM   3032 H  HG23 . THR B 1 96 ? 19.168 3.995   -2.297 1.00 33.93  ? 96   THR B HG23 1 
ATOM   3033 N  N    . LEU B 1 97 ? 21.409 5.605   1.284  1.00 10.48  ? 97   LEU B N    1 
ATOM   3034 C  CA   . LEU B 1 97 ? 22.515 6.218   2.030  1.00 10.59  ? 97   LEU B CA   1 
ATOM   3035 C  C    . LEU B 1 97 ? 23.481 6.855   1.022  1.00 12.43  ? 97   LEU B C    1 
ATOM   3036 O  O    . LEU B 1 97 ? 23.879 6.214   0.042  1.00 29.70  ? 97   LEU B O    1 
ATOM   3037 C  CB   A LEU B 1 97 ? 23.380 5.259   2.820  0.50 16.96  ? 97   LEU B CB   1 
ATOM   3038 C  CB   B LEU B 1 97 ? 23.099 5.110   2.890  0.50 13.42  ? 97   LEU B CB   1 
ATOM   3039 C  CG   A LEU B 1 97 ? 22.713 4.620   4.010  0.50 8.17   ? 97   LEU B CG   1 
ATOM   3040 C  CG   B LEU B 1 97 ? 23.754 5.386   4.206  0.50 13.07  ? 97   LEU B CG   1 
ATOM   3041 C  CD1  A LEU B 1 97 ? 23.457 3.353   4.352  0.50 12.46  ? 97   LEU B CD1  1 
ATOM   3042 C  CD1  B LEU B 1 97 ? 22.846 6.204   5.144  0.50 20.58  ? 97   LEU B CD1  1 
ATOM   3043 C  CD2  A LEU B 1 97 ? 22.714 5.585   5.206  0.50 12.18  ? 97   LEU B CD2  1 
ATOM   3044 C  CD2  B LEU B 1 97 ? 24.223 4.135   4.946  0.50 23.99  ? 97   LEU B CD2  1 
ATOM   3045 H  H    . LEU B 1 97 ? 21.547 4.797   0.963  1.00 12.58  ? 97   LEU B H    1 
ATOM   3046 H  HA   . LEU B 1 97 ? 22.156 6.924   2.640  1.00 12.71  ? 97   LEU B HA   1 
ATOM   3047 H  HB2  A LEU B 1 97 ? 23.689 4.542   2.211  0.50 20.35  ? 97   LEU B HB2  1 
ATOM   3048 H  HB2  B LEU B 1 97 ? 22.367 4.467   3.064  0.50 16.10  ? 97   LEU B HB2  1 
ATOM   3049 H  HB3  A LEU B 1 97 ? 24.182 5.747   3.135  0.50 20.35  ? 97   LEU B HB3  1 
ATOM   3050 H  HB3  B LEU B 1 97 ? 23.766 4.636   2.332  0.50 16.10  ? 97   LEU B HB3  1 
ATOM   3051 H  HG   A LEU B 1 97 ? 21.768 4.392   3.773  0.50 9.80   ? 97   LEU B HG   1 
ATOM   3052 H  HD11 A LEU B 1 97 ? 23.039 2.929   5.131  0.50 18.69  ? 97   LEU B HD11 1 
ATOM   3053 H  HD12 A LEU B 1 97 ? 24.390 3.568   4.559  0.50 18.69  ? 97   LEU B HD12 1 
ATOM   3054 H  HD13 A LEU B 1 97 ? 23.424 2.739   3.589  0.50 18.69  ? 97   LEU B HD13 1 
ATOM   3055 H  HD21 A LEU B 1 97 ? 22.279 5.156   5.973  0.50 18.27  ? 97   LEU B HD21 1 
ATOM   3056 H  HD22 A LEU B 1 97 ? 22.226 6.401   4.969  0.50 18.27  ? 97   LEU B HD22 1 
ATOM   3057 H  HD23 A LEU B 1 97 ? 23.637 5.813   5.441  0.50 18.27  ? 97   LEU B HD23 1 
ATOM   3058 N  N    . ASN B 1 98 ? 23.840 8.105   1.169  1.00 10.30  ? 98   ASN B N    1 
ATOM   3059 C  CA   . ASN B 1 98 ? 24.654 8.797   0.204  1.00 12.20  ? 98   ASN B CA   1 
ATOM   3060 C  C    . ASN B 1 98 ? 25.833 9.511   0.881  1.00 11.79  ? 98   ASN B C    1 
ATOM   3061 O  O    . ASN B 1 98 ? 25.615 10.132  1.899  1.00 12.79  ? 98   ASN B O    1 
ATOM   3062 C  CB   A ASN B 1 98 ? 23.831 9.887   -0.491 0.61 14.67  ? 98   ASN B CB   1 
ATOM   3063 C  CB   B ASN B 1 98 ? 23.826 9.788   -0.608 0.39 10.17  ? 98   ASN B CB   1 
ATOM   3064 C  CG   A ASN B 1 98 ? 22.574 9.475   -1.217 0.61 11.92  ? 98   ASN B CG   1 
ATOM   3065 C  CG   B ASN B 1 98 ? 22.701 9.134   -1.388 0.39 10.59  ? 98   ASN B CG   1 
ATOM   3066 O  OD1  A ASN B 1 98 ? 21.543 9.083   -0.636 0.61 18.02  ? 98   ASN B OD1  1 
ATOM   3067 O  OD1  B ASN B 1 98 ? 22.397 7.936   -1.316 0.39 9.37   ? 98   ASN B OD1  1 
ATOM   3068 N  ND2  A ASN B 1 98 ? 22.631 9.578   -2.536 0.61 20.41  ? 98   ASN B ND2  1 
ATOM   3069 N  ND2  B ASN B 1 98 ? 22.014 9.957   -2.166 0.39 10.54  ? 98   ASN B ND2  1 
ATOM   3070 H  H    . ASN B 1 98 ? 23.573 8.540   1.886  1.00 12.36  ? 98   ASN B H    1 
ATOM   3071 H  HA   . ASN B 1 98 ? 24.998 8.148   -0.475 1.00 14.65  ? 98   ASN B HA   1 
ATOM   3072 H  HB2  A ASN B 1 98 ? 23.579 10.558  0.192  0.61 17.61  ? 98   ASN B HB2  1 
ATOM   3073 H  HB2  B ASN B 1 98 ? 23.441 10.463  0.006  0.39 12.20  ? 98   ASN B HB2  1 
ATOM   3074 H  HB3  A ASN B 1 98 ? 24.421 10.342  -1.143 0.61 17.61  ? 98   ASN B HB3  1 
ATOM   3075 H  HB3  B ASN B 1 98 ? 24.422 10.262  -1.241 0.39 12.20  ? 98   ASN B HB3  1 
ATOM   3076 H  HD21 A ASN B 1 98 ? 21.930 9.367   -3.024 0.61 24.50  ? 98   ASN B HD21 1 
ATOM   3077 H  HD21 B ASN B 1 98 ? 21.335 9.653   -2.636 0.39 12.65  ? 98   ASN B HD21 1 
ATOM   3078 H  HD22 A ASN B 1 98 ? 23.370 9.857   -2.925 0.61 24.50  ? 98   ASN B HD22 1 
ATOM   3079 H  HD22 B ASN B 1 98 ? 22.236 10.807  -2.212 0.39 12.65  ? 98   ASN B HD22 1 
ATOM   3080 N  N    . PHE B 1 99 ? 27.024 9.419   0.289  1.00 12.63  ? 99   PHE B N    1 
ATOM   3081 C  CA   . PHE B 1 99 ? 28.188 10.209  0.689  1.00 12.89  ? 99   PHE B CA   1 
ATOM   3082 C  C    . PHE B 1 99 ? 29.204 10.292  -0.464 1.00 14.32  ? 99   PHE B C    1 
ATOM   3083 O  O    . PHE B 1 99 ? 30.283 10.890  -0.371 1.00 18.32  ? 99   PHE B O    1 
ATOM   3084 C  CB   . PHE B 1 99 ? 28.827 9.677   1.989  1.00 12.04  ? 99   PHE B CB   1 
ATOM   3085 C  CG   . PHE B 1 99 ? 29.286 8.234   1.967  1.00 11.85  ? 99   PHE B CG   1 
ATOM   3086 C  CD1  . PHE B 1 99 ? 30.621 7.893   1.744  1.00 18.37  ? 99   PHE B CD1  1 
ATOM   3087 C  CD2  . PHE B 1 99 ? 28.387 7.196   2.154  1.00 13.07  ? 99   PHE B CD2  1 
ATOM   3088 C  CE1  . PHE B 1 99 ? 31.003 6.550   1.711  1.00 19.60  ? 99   PHE B CE1  1 
ATOM   3089 C  CE2  . PHE B 1 99 ? 28.763 5.855   2.106  1.00 15.66  ? 99   PHE B CE2  1 
ATOM   3090 C  CZ   . PHE B 1 99 ? 30.077 5.537   1.871  1.00 20.18  ? 99   PHE B CZ   1 
ATOM   3091 O  OXT  . PHE B 1 99 ? 28.920 9.705   -1.505 1.00 18.39  ? 99   PHE B OXT  1 
ATOM   3092 H  H    . PHE B 1 99 ? 27.115 8.853   -0.378 1.00 15.15  ? 99   PHE B H    1 
ATOM   3093 H  HA   . PHE B 1 99 ? 27.868 11.139  0.872  1.00 15.47  ? 99   PHE B HA   1 
ATOM   3094 H  HB2  . PHE B 1 99 ? 29.607 10.247  2.206  1.00 14.44  ? 99   PHE B HB2  1 
ATOM   3095 H  HB3  . PHE B 1 99 ? 28.171 9.782   2.723  1.00 14.44  ? 99   PHE B HB3  1 
ATOM   3096 H  HD1  . PHE B 1 99 ? 31.271 8.575   1.615  1.00 22.04  ? 99   PHE B HD1  1 
ATOM   3097 H  HD2  . PHE B 1 99 ? 27.476 7.407   2.321  1.00 15.69  ? 99   PHE B HD2  1 
ATOM   3098 H  HE1  . PHE B 1 99 ? 31.917 6.328   1.577  1.00 23.52  ? 99   PHE B HE1  1 
ATOM   3099 H  HE2  . PHE B 1 99 ? 28.118 5.169   2.235  1.00 18.79  ? 99   PHE B HE2  1 
ATOM   3100 H  HZ   . PHE B 1 99 ? 30.348 4.628   1.817  1.00 24.22  ? 99   PHE B HZ   1 
HETATM 3101 C  C3   . JE2 C 2 .  ? 23.687 3.448   20.947 1.00 10.07  ? 701  JE2 A C3   1 
HETATM 3102 C  C4   . JE2 C 2 .  ? 22.339 3.432   20.726 1.00 10.16  ? 701  JE2 A C4   1 
HETATM 3103 C  C5   . JE2 C 2 .  ? 21.727 2.354   20.024 1.00 9.16   ? 701  JE2 A C5   1 
HETATM 3104 C  C6   . JE2 C 2 .  ? 22.533 1.347   19.433 1.00 7.34   ? 701  JE2 A C6   1 
HETATM 3105 C  C7   . JE2 C 2 .  ? 23.950 1.358   19.605 1.00 8.69   ? 701  JE2 A C7   1 
HETATM 3106 C  C1   . JE2 C 2 .  ? 24.500 2.399   20.424 1.00 10.50  ? 701  JE2 A C1   1 
HETATM 3107 C  C8   . JE2 C 2 .  ? 24.899 0.374   18.930 1.00 10.05  ? 701  JE2 A C8   1 
HETATM 3108 C  C9   . JE2 C 2 .  ? 21.848 0.267   18.666 1.00 7.14   ? 701  JE2 A C9   1 
HETATM 3109 O  O2   . JE2 C 2 .  ? 25.856 2.446   20.562 1.00 11.52  ? 701  JE2 A O2   1 
HETATM 3110 O  O10  . JE2 C 2 .  ? 22.069 -0.990  18.943 1.00 8.61   ? 701  JE2 A O10  1 
HETATM 3111 C  C22  . JE2 C 2 .  ? 20.360 -1.785  14.942 1.00 6.91   ? 701  JE2 A C22  1 
HETATM 3112 N  N11  . JE2 C 2 .  ? 20.970 0.659   17.757 1.00 6.96   ? 701  JE2 A N11  1 
HETATM 3113 O  O23  . JE2 C 2 .  ? 19.299 -1.864  14.288 1.00 7.89   ? 701  JE2 A O23  1 
HETATM 3114 C  C20  . JE2 C 2 .  ? 20.868 -0.504  15.603 1.00 7.23   ? 701  JE2 A C20  1 
HETATM 3115 C  C14  . JE2 C 2 .  ? 18.148 0.637   18.212 1.00 7.95   ? 701  JE2 A C14  1 
HETATM 3116 C  C13  . JE2 C 2 .  ? 18.686 0.194   16.874 1.00 7.99   ? 701  JE2 A C13  1 
HETATM 3117 C  C17  . JE2 C 2 .  ? 17.324 1.460   20.812 1.00 11.80  ? 701  JE2 A C17  1 
HETATM 3118 C  C12  . JE2 C 2 .  ? 20.173 -0.362  16.980 1.00 7.60   ? 701  JE2 A C12  1 
HETATM 3119 O  O21  . JE2 C 2 .  ? 20.521 0.582   14.746 1.00 8.55   ? 701  JE2 A O21  1 
HETATM 3120 C  C15  . JE2 C 2 .  ? 18.094 2.032   18.521 1.00 9.73   ? 701  JE2 A C15  1 
HETATM 3121 C  C19  . JE2 C 2 .  ? 17.797 -0.295  19.213 1.00 8.23   ? 701  JE2 A C19  1 
HETATM 3122 C  C16  . JE2 C 2 .  ? 17.677 2.408   19.838 1.00 10.79  ? 701  JE2 A C16  1 
HETATM 3123 C  C18  . JE2 C 2 .  ? 17.375 0.104   20.472 1.00 10.74  ? 701  JE2 A C18  1 
HETATM 3124 C  C31  . JE2 C 2 .  ? 19.474 -4.746  15.483 1.00 7.69   ? 701  JE2 A C31  1 
HETATM 3125 N  N24  . JE2 C 2 .  ? 21.105 -2.923  15.130 1.00 7.10   ? 701  JE2 A N24  1 
HETATM 3126 O  O32  . JE2 C 2 .  ? 19.360 -4.502  16.721 1.00 7.69   ? 701  JE2 A O32  1 
HETATM 3127 C  C30  . JE2 C 2 .  ? 20.635 -4.226  14.610 1.00 7.10   ? 701  JE2 A C30  1 
HETATM 3128 C  C27  . JE2 C 2 .  ? 21.898 -5.137  14.596 1.00 7.36   ? 701  JE2 A C27  1 
HETATM 3129 C  C25  . JE2 C 2 .  ? 22.390 -2.947  15.922 1.00 7.75   ? 701  JE2 A C25  1 
HETATM 3130 C  C28  . JE2 C 2 .  ? 22.745 -4.760  13.379 1.00 8.27   ? 701  JE2 A C28  1 
HETATM 3131 C  C29  . JE2 C 2 .  ? 21.562 -6.638  14.515 1.00 8.63   ? 701  JE2 A C29  1 
HETATM 3132 S  S26  . JE2 C 2 .  ? 22.775 -4.705  16.144 1.00 8.35   ? 701  JE2 A S26  1 
HETATM 3133 N  N33  . JE2 C 2 .  ? 18.568 -5.561  14.791 1.00 7.08   ? 701  JE2 A N33  1 
HETATM 3134 C  C34  . JE2 C 2 .  ? 17.426 -6.206  15.483 1.00 8.87   ? 701  JE2 A C34  1 
HETATM 3135 C  C35  . JE2 C 2 .  ? 16.136 -5.981  14.682 1.00 8.36   ? 701  JE2 A C35  1 
HETATM 3136 C  C36  . JE2 C 2 .  ? 15.480 -4.731  14.667 1.00 7.40   ? 701  JE2 A C36  1 
HETATM 3137 C  C37  . JE2 C 2 .  ? 14.267 -4.624  13.979 1.00 10.31  ? 701  JE2 A C37  1 
HETATM 3138 C  C38  . JE2 C 2 .  ? 13.736 -5.747  13.296 1.00 9.56   ? 701  JE2 A C38  1 
HETATM 3139 C  C39  . JE2 C 2 .  ? 14.365 -6.959  13.309 1.00 9.43   ? 701  JE2 A C39  1 
HETATM 3140 C  C40  . JE2 C 2 .  ? 15.577 -7.073  14.028 1.00 8.29   ? 701  JE2 A C40  1 
HETATM 3141 C  C41  . JE2 C 2 .  ? 16.013 -3.575  15.420 1.00 11.47  ? 701  JE2 A C41  1 
HETATM 3142 CL CL   . CL  D 3 .  ? 35.611 -8.712  9.170  1.00 18.82  ? 902  CL  A CL   1 
HETATM 3143 CL CL   . CL  E 3 .  ? 33.493 10.561  17.890 1.00 10.38  ? 905  CL  A CL   1 
HETATM 3144 C  C1   . EDO F 4 .  ? 30.707 -7.589  9.617  1.00 50.54  ? 801  EDO A C1   1 
HETATM 3145 O  O1   . EDO F 4 .  ? 30.701 -7.742  11.033 1.00 36.59  ? 801  EDO A O1   1 
HETATM 3146 C  C2   . EDO F 4 .  ? 29.609 -8.485  9.027  1.00 35.73  ? 801  EDO A C2   1 
HETATM 3147 O  O2   . EDO F 4 .  ? 28.865 -9.088  10.095 1.00 76.59  ? 801  EDO A O2   1 
HETATM 3148 C  C1   . EDO G 4 .  ? 43.881 0.996   31.097 1.00 19.24  ? 803  EDO A C1   1 
HETATM 3149 O  O1   . EDO G 4 .  ? 42.801 1.514   31.884 1.00 16.04  ? 803  EDO A O1   1 
HETATM 3150 C  C2   . EDO G 4 .  ? 43.798 1.443   29.645 1.00 15.90  ? 803  EDO A C2   1 
HETATM 3151 O  O2   . EDO G 4 .  ? 43.997 2.884   29.539 1.00 14.19  ? 803  EDO A O2   1 
HETATM 3152 C  C1   . EDO H 4 .  ? 43.769 3.159   9.934  1.00 19.49  ? 804  EDO A C1   1 
HETATM 3153 O  O1   . EDO H 4 .  ? 44.459 1.968   9.524  1.00 12.93  ? 804  EDO A O1   1 
HETATM 3154 C  C2   . EDO H 4 .  ? 43.080 3.954   8.851  1.00 18.03  ? 804  EDO A C2   1 
HETATM 3155 O  O2   . EDO H 4 .  ? 44.030 4.644   8.001  1.00 22.69  ? 804  EDO A O2   1 
HETATM 3156 C  C1   . EDO I 4 .  ? 16.914 8.650   -2.758 1.00 22.15  ? 805  EDO A C1   1 
HETATM 3157 O  O1   . EDO I 4 .  ? 16.002 7.827   -3.468 1.00 22.44  ? 805  EDO A O1   1 
HETATM 3158 C  C2   . EDO I 4 .  ? 16.527 10.126  -3.037 1.00 24.04  ? 805  EDO A C2   1 
HETATM 3159 O  O2   . EDO I 4 .  ? 16.933 10.386  -4.384 1.00 48.43  ? 805  EDO A O2   1 
HETATM 3160 CL CL   . CL  J 3 .  ? 0.000  10.386  -4.384 1.00 48.43  ? 901  CL  B CL   1 
HETATM 3161 CL CL   . CL  K 3 .  ? -1.901 0.620   23.007 1.00 17.52  ? 903  CL  B CL   1 
HETATM 3162 CL CL   . CL  L 3 .  ? 7.716  -6.446  4.350  1.00 15.85  ? 904  CL  B CL   1 
HETATM 3163 C  C1   . EDO M 4 .  ? 5.130  -10.413 22.587 1.00 18.32  ? 802  EDO B C1   1 
HETATM 3164 O  O1   . EDO M 4 .  ? 3.685  -10.217 22.597 1.00 16.89  ? 802  EDO B O1   1 
HETATM 3165 C  C2   . EDO M 4 .  ? 5.723  -9.015  22.512 1.00 30.41  ? 802  EDO B C2   1 
HETATM 3166 O  O2   . EDO M 4 .  ? 5.157  -8.363  23.612 1.00 29.28  ? 802  EDO B O2   1 
HETATM 3167 O  O    . HOH N 5 .  ? 21.075 -5.675  9.501  1.00 24.10  ? 906  HOH A O    1 
HETATM 3168 O  O    . HOH N 5 .  ? 21.689 -9.165  3.598  1.00 28.19  ? 907  HOH A O    1 
HETATM 3169 O  O    . HOH N 5 .  ? 17.748 14.335  -1.294 1.00 34.05  ? 908  HOH A O    1 
HETATM 3170 O  O    . HOH N 5 .  ? 19.406 10.745  -3.614 0.50 19.63  ? 909  HOH A O    1 
HETATM 3171 O  O    . HOH N 5 .  ? 19.602 9.183   -5.750 0.50 5.33   ? 910  HOH A O    1 
HETATM 3172 O  O    . HOH N 5 .  ? 18.718 7.465   -4.524 1.00 24.79  ? 911  HOH A O    1 
HETATM 3173 O  O    . HOH N 5 .  ? 19.198 5.210   -6.013 1.00 19.78  ? 912  HOH A O    1 
HETATM 3174 O  O    . HOH N 5 .  ? 18.051 2.701   -5.389 0.50 7.75   ? 913  HOH A O    1 
HETATM 3175 O  O    . HOH N 5 .  ? 18.871 -1.352  -6.501 1.00 17.27  ? 914  HOH A O    1 
HETATM 3176 O  O    . HOH N 5 .  ? 21.530 -1.385  -6.947 1.00 20.07  ? 915  HOH A O    1 
HETATM 3177 O  O    . HOH N 5 .  ? 23.087 -1.281  -5.015 1.00 19.96  ? 916  HOH A O    1 
HETATM 3178 O  O    . HOH N 5 .  ? 23.737 0.883   -4.876 1.00 26.22  ? 917  HOH A O    1 
HETATM 3179 O  O    . HOH N 5 .  ? 20.639 -2.718  -2.430 0.50 16.81  ? 918  HOH A O    1 
HETATM 3180 O  O    . HOH N 5 .  ? 21.325 -3.677  -1.418 0.50 10.35  ? 919  HOH A O    1 
HETATM 3181 O  O    . HOH N 5 .  ? 23.028 -2.612  0.835  1.00 30.84  ? 920  HOH A O    1 
HETATM 3182 O  O    . HOH N 5 .  ? 25.482 -2.979  -0.139 1.00 32.74  ? 921  HOH A O    1 
HETATM 3183 O  O    . HOH N 5 .  ? 27.331 -1.381  0.651  1.00 30.56  ? 922  HOH A O    1 
HETATM 3184 O  O    . HOH N 5 .  ? 30.009 -4.704  0.268  0.50 17.51  ? 923  HOH A O    1 
HETATM 3185 O  O    . HOH N 5 .  ? 30.118 -3.435  -1.927 1.00 27.35  ? 924  HOH A O    1 
HETATM 3186 O  O    . HOH N 5 .  ? 32.655 -4.797  1.024  1.00 16.75  ? 925  HOH A O    1 
HETATM 3187 O  O    . HOH N 5 .  ? 30.832 -7.879  3.456  1.00 25.98  ? 926  HOH A O    1 
HETATM 3188 O  O    . HOH N 5 .  ? 30.614 -9.616  5.759  1.00 38.76  ? 927  HOH A O    1 
HETATM 3189 O  O    . HOH N 5 .  ? 25.402 -10.220 6.755  1.00 42.14  ? 928  HOH A O    1 
HETATM 3190 O  O    . HOH N 5 .  ? 25.958 -8.876  8.896  1.00 15.01  ? 929  HOH A O    1 
HETATM 3191 O  O    . HOH N 5 .  ? 23.241 -9.937  13.403 1.00 27.37  ? 930  HOH A O    1 
HETATM 3192 O  O    . HOH N 5 .  ? 25.159 -8.011  22.590 1.00 14.86  ? 931  HOH A O    1 
HETATM 3193 O  O    . HOH N 5 .  ? 25.767 -9.961  24.424 1.00 28.11  ? 932  HOH A O    1 
HETATM 3194 O  O    . HOH N 5 .  ? 24.824 -7.860  28.752 1.00 28.47  ? 933  HOH A O    1 
HETATM 3195 O  O    . HOH N 5 .  ? 22.024 -7.011  29.802 0.50 11.19  ? 934  HOH A O    1 
HETATM 3196 O  O    . HOH N 5 .  ? 18.128 2.412   24.824 1.00 34.54  ? 935  HOH A O    1 
HETATM 3197 O  O    . HOH N 5 .  ? 20.412 3.450   23.718 1.00 23.67  ? 936  HOH A O    1 
HETATM 3198 O  O    . HOH N 5 .  ? 23.335 3.555   24.810 1.00 19.91  ? 937  HOH A O    1 
HETATM 3199 O  O    . HOH N 5 .  ? 25.371 5.232   23.980 1.00 13.25  ? 938  HOH A O    1 
HETATM 3200 O  O    . HOH N 5 .  ? 26.248 5.239   26.431 0.50 15.95  ? 939  HOH A O    1 
HETATM 3201 O  O    . HOH N 5 .  ? 24.964 4.599   28.378 0.50 34.81  ? 940  HOH A O    1 
HETATM 3202 O  O    . HOH N 5 .  ? 28.690 4.392   30.679 1.00 16.78  ? 941  HOH A O    1 
HETATM 3203 O  O    . HOH N 5 .  ? 32.425 5.328   31.622 1.00 58.24  ? 942  HOH A O    1 
HETATM 3204 O  O    . HOH N 5 .  ? 33.093 10.206  26.942 1.00 37.59  ? 943  HOH A O    1 
HETATM 3205 O  O    . HOH N 5 .  ? 36.198 10.905  25.948 1.00 38.21  ? 944  HOH A O    1 
HETATM 3206 O  O    . HOH N 5 .  ? 39.930 10.660  25.757 1.00 25.22  ? 945  HOH A O    1 
HETATM 3207 O  O    . HOH N 5 .  ? 41.831 8.802   26.236 1.00 21.70  ? 946  HOH A O    1 
HETATM 3208 O  O    . HOH N 5 .  ? 40.637 7.214   28.050 1.00 21.93  ? 947  HOH A O    1 
HETATM 3209 O  O    . HOH N 5 .  ? 38.495 6.656   26.491 1.00 27.12  ? 948  HOH A O    1 
HETATM 3210 O  O    . HOH N 5 .  ? 41.520 6.904   24.151 1.00 11.73  ? 949  HOH A O    1 
HETATM 3211 O  O    . HOH N 5 .  ? 43.030 7.155   22.108 1.00 7.02   ? 950  HOH A O    1 
HETATM 3212 O  O    . HOH N 5 .  ? 43.110 4.799   22.400 1.00 11.81  ? 951  HOH A O    1 
HETATM 3213 O  O    . HOH N 5 .  ? 45.293 7.233   23.584 1.00 16.29  ? 952  HOH A O    1 
HETATM 3214 O  O    . HOH N 5 .  ? 44.834 9.632   25.479 1.00 24.09  ? 953  HOH A O    1 
HETATM 3215 O  O    . HOH N 5 .  ? 43.173 9.668   22.798 1.00 21.04  ? 954  HOH A O    1 
HETATM 3216 O  O    . HOH N 5 .  ? 41.182 11.825  23.161 1.00 39.32  ? 955  HOH A O    1 
HETATM 3217 O  O    . HOH N 5 .  ? 38.420 12.583  21.905 1.00 31.87  ? 956  HOH A O    1 
HETATM 3218 O  O    . HOH N 5 .  ? 37.170 10.558  19.859 1.00 12.73  ? 957  HOH A O    1 
HETATM 3219 O  O    . HOH N 5 .  ? 33.418 10.683  22.177 0.50 25.07  ? 958  HOH A O    1 
HETATM 3220 O  O    . HOH N 5 .  ? 30.942 10.043  20.128 1.00 30.84  ? 959  HOH A O    1 
HETATM 3221 O  O    . HOH N 5 .  ? 30.242 7.572   19.841 1.00 18.60  ? 960  HOH A O    1 
HETATM 3222 O  O    . HOH N 5 .  ? 31.658 5.230   19.121 1.00 10.00  ? 961  HOH A O    1 
HETATM 3223 O  O    . HOH N 5 .  ? 26.762 8.348   22.271 1.00 31.16  ? 962  HOH A O    1 
HETATM 3224 O  O    . HOH N 5 .  ? 25.476 10.393  20.831 1.00 37.51  ? 963  HOH A O    1 
HETATM 3225 O  O    . HOH N 5 .  ? 26.536 9.975   18.378 1.00 21.96  ? 964  HOH A O    1 
HETATM 3226 O  O    . HOH N 5 .  ? 22.960 12.270  19.236 1.00 25.41  ? 965  HOH A O    1 
HETATM 3227 O  O    . HOH N 5 .  ? 30.974 14.223  16.885 1.00 26.54  ? 966  HOH A O    1 
HETATM 3228 O  O    . HOH N 5 .  ? 32.348 12.342  15.628 1.00 11.02  ? 967  HOH A O    1 
HETATM 3229 O  O    . HOH N 5 .  ? 39.186 13.266  16.007 1.00 11.44  ? 968  HOH A O    1 
HETATM 3230 O  O    . HOH N 5 .  ? 44.477 10.358  16.214 1.00 17.08  ? 969  HOH A O    1 
HETATM 3231 O  O    . HOH N 5 .  ? 46.631 8.883   15.799 1.00 35.97  ? 970  HOH A O    1 
HETATM 3232 O  O    . HOH N 5 .  ? 48.997 8.619   19.865 1.00 28.51  ? 971  HOH A O    1 
HETATM 3233 O  O    . HOH N 5 .  ? 47.698 7.079   21.661 1.00 28.37  ? 972  HOH A O    1 
HETATM 3234 O  O    . HOH N 5 .  ? 45.489 5.384   19.606 0.50 17.24  ? 973  HOH A O    1 
HETATM 3235 O  O    . HOH N 5 .  ? 44.232 7.539   20.110 1.00 20.53  ? 974  HOH A O    1 
HETATM 3236 O  O    . HOH N 5 .  ? 43.423 3.190   13.406 1.00 9.22   ? 975  HOH A O    1 
HETATM 3237 O  O    . HOH N 5 .  ? 45.838 6.618   9.775  1.00 14.66  ? 976  HOH A O    1 
HETATM 3238 O  O    . HOH N 5 .  ? 46.915 2.148   7.880  1.00 9.83   ? 977  HOH A O    1 
HETATM 3239 O  O    . HOH N 5 .  ? 46.649 2.936   5.060  0.50 14.49  ? 978  HOH A O    1 
HETATM 3240 O  O    . HOH N 5 .  ? 47.257 1.915   2.710  0.50 18.02  ? 979  HOH A O    1 
HETATM 3241 O  O    . HOH N 5 .  ? 45.169 0.864   1.192  1.00 22.74  ? 980  HOH A O    1 
HETATM 3242 O  O    . HOH N 5 .  ? 43.138 1.905   3.322  0.50 11.16  ? 981  HOH A O    1 
HETATM 3243 O  O    . HOH N 5 .  ? 38.335 1.969   2.993  1.00 36.03  ? 982  HOH A O    1 
HETATM 3244 O  O    . HOH N 5 .  ? 40.321 0.397   31.925 1.00 34.11  ? 983  HOH A O    1 
HETATM 3245 O  O    . HOH N 5 .  ? 37.411 -7.669  4.568  1.00 30.43  ? 984  HOH A O    1 
HETATM 3246 O  O    . HOH N 5 .  ? 38.952 -8.962  9.173  1.00 33.63  ? 985  HOH A O    1 
HETATM 3247 O  O    . HOH N 5 .  ? 39.465 -8.905  11.605 1.00 23.89  ? 986  HOH A O    1 
HETATM 3248 O  O    . HOH N 5 .  ? 42.607 -8.423  11.806 1.00 23.02  ? 987  HOH A O    1 
HETATM 3249 O  O    . HOH N 5 .  ? 41.592 -7.112  14.156 1.00 21.00  ? 988  HOH A O    1 
HETATM 3250 O  O    . HOH N 5 .  ? 43.069 -8.061  16.867 1.00 3.66   ? 989  HOH A O    1 
HETATM 3251 O  O    . HOH N 5 .  ? 41.915 -10.151 19.331 1.00 41.48  ? 990  HOH A O    1 
HETATM 3252 O  O    . HOH N 5 .  ? 41.478 -8.608  21.642 1.00 23.40  ? 991  HOH A O    1 
HETATM 3253 O  O    . HOH N 5 .  ? 45.033 -10.631 21.481 1.00 50.33  ? 992  HOH A O    1 
HETATM 3254 O  O    . HOH N 5 .  ? 38.252 -12.933 16.695 1.00 62.32  ? 993  HOH A O    1 
HETATM 3255 O  O    . HOH N 5 .  ? 36.958 -11.060 17.380 1.00 23.23  ? 994  HOH A O    1 
HETATM 3256 O  O    . HOH N 5 .  ? 38.623 -8.937  15.383 1.00 33.37  ? 995  HOH A O    1 
HETATM 3257 O  O    . HOH N 5 .  ? 36.215 -9.949  14.159 0.50 17.96  ? 996  HOH A O    1 
HETATM 3258 O  O    . HOH N 5 .  ? 36.258 -8.099  12.153 1.00 17.33  ? 997  HOH A O    1 
HETATM 3259 O  O    . HOH N 5 .  ? 36.395 -6.161  15.106 1.00 11.53  ? 998  HOH A O    1 
HETATM 3260 O  O    . HOH N 5 .  ? 32.783 -9.142  10.650 1.00 36.78  ? 999  HOH A O    1 
HETATM 3261 O  O    . HOH N 5 .  ? 30.951 -10.434 19.123 0.50 13.97  ? 1000 HOH A O    1 
HETATM 3262 O  O    . HOH N 5 .  ? 33.233 -9.744  20.218 1.00 17.96  ? 1001 HOH A O    1 
HETATM 3263 O  O    . HOH N 5 .  ? 34.739 -8.223  23.806 1.00 35.59  ? 1002 HOH A O    1 
HETATM 3264 O  O    . HOH N 5 .  ? 31.277 -7.106  27.951 1.00 41.11  ? 1003 HOH A O    1 
HETATM 3265 O  O    . HOH N 5 .  ? 32.999 -1.990  30.425 1.00 20.86  ? 1004 HOH A O    1 
HETATM 3266 O  O    . HOH N 5 .  ? 35.903 -3.293  31.104 1.00 21.79  ? 1005 HOH A O    1 
HETATM 3267 O  O    . HOH N 5 .  ? 30.521 -6.409  35.747 1.00 42.45  ? 1006 HOH A O    1 
HETATM 3268 O  O    . HOH N 5 .  ? 42.355 3.928   31.208 1.00 7.72   ? 1007 HOH A O    1 
HETATM 3269 O  O    . HOH N 5 .  ? 42.067 5.997   30.291 1.00 22.83  ? 1008 HOH A O    1 
HETATM 3270 O  O    . HOH N 5 .  ? 45.435 -0.314  24.238 1.00 14.29  ? 1009 HOH A O    1 
HETATM 3271 O  O    . HOH N 5 .  ? 43.724 -2.219  24.890 1.00 16.89  ? 1010 HOH A O    1 
HETATM 3272 O  O    . HOH N 5 .  ? 44.536 -3.311  27.841 1.00 17.28  ? 1011 HOH A O    1 
HETATM 3273 O  O    . HOH N 5 .  ? 47.600 -4.118  11.931 1.00 11.58  ? 1012 HOH A O    1 
HETATM 3274 O  O    . HOH N 5 .  ? 46.714 -5.163  6.843  1.00 25.55  ? 1013 HOH A O    1 
HETATM 3275 O  O    . HOH N 5 .  ? 44.032 -6.710  6.808  1.00 22.44  ? 1014 HOH A O    1 
HETATM 3276 O  O    . HOH N 5 .  ? 42.618 -8.089  8.374  1.00 48.19  ? 1015 HOH A O    1 
HETATM 3277 O  O    . HOH N 5 .  ? 45.638 -10.151 10.397 1.00 21.24  ? 1016 HOH A O    1 
HETATM 3278 O  O    . HOH N 5 .  ? 46.880 -3.386  1.447  1.00 34.39  ? 1017 HOH A O    1 
HETATM 3279 O  O    . HOH N 5 .  ? 40.585 7.752   0.493  1.00 91.87  ? 1018 HOH A O    1 
HETATM 3280 O  O    . HOH N 5 .  ? 38.667 11.440  3.055  1.00 29.05  ? 1019 HOH A O    1 
HETATM 3281 O  O    . HOH N 5 .  ? 34.962 12.527  3.477  1.00 34.99  ? 1020 HOH A O    1 
HETATM 3282 O  O    . HOH N 5 .  ? 35.725 12.517  5.749  1.00 31.38  ? 1021 HOH A O    1 
HETATM 3283 O  O    . HOH N 5 .  ? 28.576 14.207  1.609  1.00 34.80  ? 1022 HOH A O    1 
HETATM 3284 O  O    . HOH N 5 .  ? 25.250 13.204  1.689  1.00 14.63  ? 1023 HOH A O    1 
HETATM 3285 O  O    . HOH N 5 .  ? 25.887 12.954  -0.938 1.00 34.03  ? 1024 HOH A O    1 
HETATM 3286 O  O    . HOH N 5 .  ? 33.393 7.998   -2.472 0.50 29.42  ? 1025 HOH A O    1 
HETATM 3287 O  O    . HOH N 5 .  ? 41.448 8.707   8.707  1.00 33.07  ? 1026 HOH A O    1 
HETATM 3288 O  O    . HOH N 5 .  ? 24.911 13.595  8.354  1.00 15.59  ? 1027 HOH A O    1 
HETATM 3289 O  O    . HOH N 5 .  ? 23.967 7.436   23.208 1.00 19.61  ? 1028 HOH A O    1 
HETATM 3290 O  O    . HOH N 5 .  ? 18.322 -0.404  25.360 1.00 19.03  ? 1029 HOH A O    1 
HETATM 3291 O  O    . HOH N 5 .  ? 45.503 10.085  20.812 1.00 25.50  ? 1030 HOH A O    1 
HETATM 3292 O  O    . HOH N 5 .  ? 11.454 8.370   -2.829 1.00 15.29  ? 1031 HOH A O    1 
HETATM 3293 O  O    . HOH N 5 .  ? 9.420  9.108   -4.445 0.50 17.47  ? 1032 HOH A O    1 
HETATM 3294 O  O    . HOH N 5 .  ? 17.741 -9.689  25.961 0.50 22.54  ? 1033 HOH A O    1 
HETATM 3295 O  O    . HOH N 5 .  ? 10.496 12.345  -2.834 1.00 41.06  ? 1034 HOH A O    1 
HETATM 3296 O  O    . HOH N 5 .  ? 25.337 -7.123  2.011  1.00 31.24  ? 1035 HOH A O    1 
HETATM 3297 O  O    . HOH N 5 .  ? 36.796 -14.959 17.449 0.50 21.20  ? 1036 HOH A O    1 
HETATM 3298 O  O    . HOH N 5 .  ? 20.598 -3.420  18.914 1.00 7.93   ? 1037 HOH A O    1 
HETATM 3299 O  O    . HOH N 5 .  ? 20.442 6.935   15.578 1.00 8.91   ? 1038 HOH A O    1 
HETATM 3300 O  O    . HOH N 5 .  ? 19.783 5.583   17.975 1.00 11.74  ? 1039 HOH A O    1 
HETATM 3301 O  O    . HOH N 5 .  ? 18.687 -6.486  11.893 1.00 12.26  ? 1040 HOH A O    1 
HETATM 3302 O  O    . HOH O 5 .  ? 9.610  -13.286 9.846  1.00 32.64  ? 905  HOH B O    1 
HETATM 3303 O  O    . HOH O 5 .  ? 13.832 -10.025 10.970 1.00 29.49  ? 906  HOH B O    1 
HETATM 3304 O  O    . HOH O 5 .  ? 16.406 -10.341 11.106 0.50 22.84  ? 907  HOH B O    1 
HETATM 3305 O  O    . HOH O 5 .  ? 17.048 -11.009 14.419 1.00 11.63  ? 908  HOH B O    1 
HETATM 3306 O  O    . HOH O 5 .  ? 18.905 -8.997  13.676 1.00 20.98  ? 909  HOH B O    1 
HETATM 3307 O  O    . HOH O 5 .  ? 17.760 -8.665  3.721  1.00 43.29  ? 910  HOH B O    1 
HETATM 3308 O  O    . HOH O 5 .  ? 14.554 -7.253  5.266  1.00 26.80  ? 911  HOH B O    1 
HETATM 3309 O  O    . HOH O 5 .  ? 13.569 -9.586  6.479  1.00 37.40  ? 912  HOH B O    1 
HETATM 3310 O  O    . HOH O 5 .  ? 10.040 -8.475  5.807  1.00 27.41  ? 913  HOH B O    1 
HETATM 3311 O  O    . HOH O 5 .  ? 9.133  -6.023  9.685  1.00 11.01  ? 914  HOH B O    1 
HETATM 3312 O  O    . HOH O 5 .  ? 3.709  -8.446  4.991  1.00 15.50  ? 915  HOH B O    1 
HETATM 3313 O  O    . HOH O 5 .  ? 3.224  -10.988 3.476  0.50 22.01  ? 916  HOH B O    1 
HETATM 3314 O  O    . HOH O 5 .  ? 1.809  -12.958 10.745 1.00 35.53  ? 917  HOH B O    1 
HETATM 3315 O  O    . HOH O 5 .  ? -1.241 -10.343 10.141 1.00 22.68  ? 918  HOH B O    1 
HETATM 3316 O  O    . HOH O 5 .  ? -2.901 -8.304  9.048  0.50 20.55  ? 919  HOH B O    1 
HETATM 3317 O  O    . HOH O 5 .  ? -3.978 -4.556  4.289  1.00 24.59  ? 920  HOH B O    1 
HETATM 3318 O  O    . HOH O 5 .  ? -2.094 0.738   9.423  1.00 9.61   ? 921  HOH B O    1 
HETATM 3319 O  O    . HOH O 5 .  ? -3.278 4.274   9.855  1.00 15.26  ? 922  HOH B O    1 
HETATM 3320 O  O    . HOH O 5 .  ? -4.385 8.789   11.560 1.00 37.70  ? 923  HOH B O    1 
HETATM 3321 O  O    . HOH O 5 .  ? -6.120 10.191  10.259 1.00 43.03  ? 924  HOH B O    1 
HETATM 3322 O  O    . HOH O 5 .  ? -3.765 13.741  9.224  1.00 22.98  ? 925  HOH B O    1 
HETATM 3323 O  O    . HOH O 5 .  ? 3.706  15.173  10.152 1.00 38.72  ? 926  HOH B O    1 
HETATM 3324 O  O    . HOH O 5 .  ? 5.963  14.298  8.261  1.00 41.65  ? 927  HOH B O    1 
HETATM 3325 O  O    . HOH O 5 .  ? 8.540  13.910  9.613  1.00 17.47  ? 928  HOH B O    1 
HETATM 3326 O  O    . HOH O 5 .  ? 8.408  14.946  12.386 1.00 37.63  ? 929  HOH B O    1 
HETATM 3327 O  O    . HOH O 5 .  ? 16.553 14.889  12.550 1.00 36.52  ? 930  HOH B O    1 
HETATM 3328 O  O    . HOH O 5 .  ? 18.834 13.410  12.101 1.00 15.08  ? 931  HOH B O    1 
HETATM 3329 O  O    . HOH O 5 .  ? 20.705 15.864  12.086 1.00 16.72  ? 932  HOH B O    1 
HETATM 3330 O  O    . HOH O 5 .  ? 19.219 17.163  8.132  1.00 25.01  ? 933  HOH B O    1 
HETATM 3331 O  O    . HOH O 5 .  ? 19.020 18.099  5.656  1.00 32.05  ? 934  HOH B O    1 
HETATM 3332 O  O    . HOH O 5 .  ? 21.087 18.213  4.158  1.00 33.64  ? 935  HOH B O    1 
HETATM 3333 O  O    . HOH O 5 .  ? 15.264 17.790  2.963  1.00 46.57  ? 936  HOH B O    1 
HETATM 3334 O  O    . HOH O 5 .  ? 25.403 17.464  20.431 1.00 44.07  ? 937  HOH B O    1 
HETATM 3335 O  O    . HOH O 5 .  ? 23.723 -9.427  27.081 1.00 31.15  ? 938  HOH B O    1 
HETATM 3336 O  O    . HOH O 5 .  ? 20.102 -8.266  28.036 0.50 11.43  ? 939  HOH B O    1 
HETATM 3337 O  O    . HOH O 5 .  ? 18.940 -13.231 24.324 1.00 29.72  ? 940  HOH B O    1 
HETATM 3338 O  O    . HOH O 5 .  ? 13.928 -11.701 26.068 0.50 24.57  ? 941  HOH B O    1 
HETATM 3339 O  O    . HOH O 5 .  ? 11.146 -10.309 25.482 1.00 15.36  ? 942  HOH B O    1 
HETATM 3340 O  O    . HOH O 5 .  ? 11.925 -7.845  27.050 1.00 20.35  ? 943  HOH B O    1 
HETATM 3341 O  O    . HOH O 5 .  ? 12.934 -5.463  26.082 1.00 53.40  ? 944  HOH B O    1 
HETATM 3342 O  O    . HOH O 5 .  ? 11.872 -1.453  26.288 1.00 32.57  ? 945  HOH B O    1 
HETATM 3343 O  O    . HOH O 5 .  ? 7.745  -0.896  23.921 1.00 10.91  ? 946  HOH B O    1 
HETATM 3344 O  O    . HOH O 5 .  ? 4.631  4.305   22.585 1.00 28.01  ? 947  HOH B O    1 
HETATM 3345 O  O    . HOH O 5 .  ? 4.698  5.291   19.935 1.00 21.94  ? 948  HOH B O    1 
HETATM 3346 O  O    . HOH O 5 .  ? 1.843  5.867   19.988 0.50 15.11  ? 949  HOH B O    1 
HETATM 3347 O  O    . HOH O 5 .  ? 0.757  7.609   19.220 0.50 32.49  ? 950  HOH B O    1 
HETATM 3348 O  O    . HOH O 5 .  ? -2.236 9.632   16.863 1.00 19.00  ? 951  HOH B O    1 
HETATM 3349 O  O    . HOH O 5 .  ? -6.098 5.640   17.207 0.50 11.64  ? 952  HOH B O    1 
HETATM 3350 O  O    . HOH O 5 .  ? -6.603 3.006   15.940 1.00 16.17  ? 953  HOH B O    1 
HETATM 3351 O  O    . HOH O 5 .  ? -0.286 2.953   21.804 1.00 41.90  ? 954  HOH B O    1 
HETATM 3352 O  O    . HOH O 5 .  ? 1.286  4.933   22.769 1.00 64.67  ? 955  HOH B O    1 
HETATM 3353 O  O    . HOH O 5 .  ? 2.642  2.450   21.688 1.00 32.92  ? 956  HOH B O    1 
HETATM 3354 O  O    . HOH O 5 .  ? 4.237  1.815   18.774 1.00 11.74  ? 957  HOH B O    1 
HETATM 3355 O  O    . HOH O 5 .  ? 5.690  8.213   19.388 1.00 10.52  ? 958  HOH B O    1 
HETATM 3356 O  O    . HOH O 5 .  ? 8.497  6.795   20.686 1.00 46.31  ? 959  HOH B O    1 
HETATM 3357 O  O    . HOH O 5 .  ? 10.144 5.919   19.308 1.00 25.89  ? 960  HOH B O    1 
HETATM 3358 O  O    . HOH O 5 .  ? 11.957 7.839   19.909 1.00 37.83  ? 961  HOH B O    1 
HETATM 3359 O  O    . HOH O 5 .  ? 15.004 8.147   20.483 1.00 22.28  ? 962  HOH B O    1 
HETATM 3360 O  O    . HOH O 5 .  ? 11.143 6.176   22.516 1.00 28.68  ? 963  HOH B O    1 
HETATM 3361 O  O    . HOH O 5 .  ? 8.941  5.601   24.744 0.50 28.77  ? 964  HOH B O    1 
HETATM 3362 O  O    . HOH O 5 .  ? 17.043 4.583   23.396 1.00 27.55  ? 965  HOH B O    1 
HETATM 3363 O  O    . HOH O 5 .  ? 24.219 14.197  19.265 1.00 57.25  ? 966  HOH B O    1 
HETATM 3364 O  O    . HOH O 5 .  ? 25.644 14.898  17.375 1.00 16.08  ? 967  HOH B O    1 
HETATM 3365 O  O    . HOH O 5 .  ? 25.557 17.450  17.603 1.00 22.22  ? 968  HOH B O    1 
HETATM 3366 O  O    . HOH O 5 .  ? 30.963 12.747  1.494  1.00 20.69  ? 969  HOH B O    1 
HETATM 3367 O  O    . HOH O 5 .  ? 31.768 11.218  -2.377 0.50 23.41  ? 970  HOH B O    1 
HETATM 3368 O  O    . HOH O 5 .  ? 16.831 17.059  14.272 1.00 34.85  ? 971  HOH B O    1 
HETATM 3369 O  O    . HOH O 5 .  ? 16.196 14.012  16.208 0.50 20.66  ? 972  HOH B O    1 
HETATM 3370 O  O    . HOH O 5 .  ? 16.289 13.170  17.194 0.50 14.37  ? 973  HOH B O    1 
HETATM 3371 O  O    . HOH O 5 .  ? 19.649 12.563  19.277 1.00 21.36  ? 974  HOH B O    1 
HETATM 3372 O  O    . HOH O 5 .  ? 19.687 16.805  21.810 1.00 58.37  ? 975  HOH B O    1 
HETATM 3373 O  O    . HOH O 5 .  ? 7.984  -9.740  24.689 1.00 23.27  ? 976  HOH B O    1 
HETATM 3374 O  O    . HOH O 5 .  ? -0.812 -8.197  24.183 1.00 26.43  ? 977  HOH B O    1 
HETATM 3375 O  O    . HOH O 5 .  ? -0.382 -5.160  24.262 1.00 39.18  ? 978  HOH B O    1 
HETATM 3376 O  O    . HOH O 5 .  ? -2.331 -6.463  19.958 1.00 15.82  ? 979  HOH B O    1 
HETATM 3377 O  O    . HOH O 5 .  ? -3.832 -8.440  17.517 1.00 13.52  ? 980  HOH B O    1 
HETATM 3378 O  O    . HOH O 5 .  ? -3.130 -14.705 15.940 1.00 25.86  ? 981  HOH B O    1 
HETATM 3379 O  O    . HOH O 5 .  ? -4.174 -17.012 14.970 1.00 26.66  ? 982  HOH B O    1 
HETATM 3380 O  O    . HOH O 5 .  ? 9.512  -5.118  1.694  1.00 30.09  ? 983  HOH B O    1 
HETATM 3381 O  O    . HOH O 5 .  ? 4.707  -4.261  -0.255 0.50 27.47  ? 984  HOH B O    1 
HETATM 3382 O  O    . HOH O 5 .  ? 6.371  4.546   -1.502 1.00 16.40  ? 985  HOH B O    1 
HETATM 3383 O  O    . HOH O 5 .  ? 7.715  6.735   -2.135 1.00 17.98  ? 986  HOH B O    1 
HETATM 3384 O  O    . HOH O 5 .  ? 9.578  6.145   -3.493 1.00 37.10  ? 987  HOH B O    1 
HETATM 3385 O  O    . HOH O 5 .  ? 16.909 1.192   -0.943 1.00 19.28  ? 988  HOH B O    1 
HETATM 3386 O  O    . HOH O 5 .  ? 3.232  10.600  7.494  1.00 34.19  ? 989  HOH B O    1 
HETATM 3387 O  O    . HOH O 5 .  ? -2.470 7.419   -2.667 1.00 9.18   ? 990  HOH B O    1 
HETATM 3388 O  O    . HOH O 5 .  ? -1.854 9.819   -4.712 1.00 21.81  ? 991  HOH B O    1 
HETATM 3389 O  O    . HOH O 5 .  ? 20.642 -3.925  7.882  1.00 12.69  ? 992  HOH B O    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . PRO A 1  ? 0.1443 0.3220 0.1911 -0.0491 0.0071  -0.0750 1    PRO A N   
2    C  CA  . PRO A 1  ? 0.1411 0.2425 0.3137 -0.0498 0.0247  -0.0688 1    PRO A CA  
3    C  C   . PRO A 1  ? 0.1425 0.3208 0.1957 -0.0638 0.0220  -0.0673 1    PRO A C   
4    O  O   . PRO A 1  ? 0.1269 0.2921 0.1447 -0.0802 0.0168  -0.0235 1    PRO A O   
5    C  CB  . PRO A 1  ? 0.3201 0.2832 0.4890 0.0180  0.0332  -0.0101 1    PRO A CB  
6    C  CG  . PRO A 1  ? 0.2976 0.4236 0.3482 0.1198  0.0961  0.0488  1    PRO A CG  
7    C  CD  . PRO A 1  ? 0.2738 0.5427 0.1767 -0.0155 -0.0280 -0.0085 1    PRO A CD  
15   N  N   . GLN A 2  ? 0.1401 0.3476 0.1708 -0.0757 0.0459  -0.0820 2    GLN A N   
16   C  CA  . GLN A 2  ? 0.1307 0.2971 0.2112 -0.0446 0.0368  -0.0555 2    GLN A CA  
17   C  C   . GLN A 2  ? 0.1311 0.2891 0.2052 -0.0639 0.0195  -0.0989 2    GLN A C   
18   O  O   . GLN A 2  ? 0.3944 0.3145 0.2037 0.0659  -0.0984 -0.1084 2    GLN A O   
19   C  CB  A GLN A 2  ? 0.2143 0.3225 0.2222 0.0261  0.0031  -0.1004 2    GLN A CB  
20   C  CB  B GLN A 2  ? 0.1847 0.3596 0.3703 -0.1339 -0.0931 0.0122  2    GLN A CB  
21   C  CG  A GLN A 2  ? 0.1866 0.3890 0.4796 -0.0833 -0.0668 0.1874  2    GLN A CG  
22   C  CG  B GLN A 2  ? 0.1952 0.3208 0.1359 -0.0214 0.1580  -0.0314 2    GLN A CG  
23   C  CD  A GLN A 2  ? 0.4297 0.3984 0.2265 0.2377  -0.1023 -0.1410 2    GLN A CD  
24   C  CD  B GLN A 2  ? 0.2879 0.2369 0.1507 -0.1534 -0.0085 -0.1124 2    GLN A CD  
25   O  OE1 A GLN A 2  ? 0.7586 0.2788 0.0741 -0.0845 -0.0340 0.0703  2    GLN A OE1 
26   O  OE1 B GLN A 2  ? 0.1442 0.2910 0.1592 -0.0669 -0.0018 -0.0963 2    GLN A OE1 
27   N  NE2 A GLN A 2  ? 0.4099 0.3690 0.3104 -0.0922 -0.1153 -0.0323 2    GLN A NE2 
28   N  NE2 B GLN A 2  ? 0.3361 0.1773 0.0000 -0.0089 0.0060  0.0721  2    GLN A NE2 
39   N  N   . ILE A 3  ? 0.1941 0.2650 0.2287 -0.1158 0.1034  -0.1178 3    ILE A N   
40   C  CA  . ILE A 3  ? 0.1985 0.2578 0.2279 -0.1479 0.1018  -0.1342 3    ILE A CA  
41   C  C   . ILE A 3  ? 0.2293 0.4269 0.2034 -0.2342 0.1436  -0.2018 3    ILE A C   
42   O  O   . ILE A 3  ? 0.1718 0.3289 0.1494 -0.1332 0.0527  -0.1120 3    ILE A O   
43   C  CB  . ILE A 3  ? 0.2668 0.3102 0.2152 -0.2042 0.0935  -0.0667 3    ILE A CB  
44   C  CG1 . ILE A 3  ? 0.2176 0.2479 0.2772 -0.1002 0.0615  -0.0490 3    ILE A CG1 
45   C  CG2 . ILE A 3  ? 0.2456 0.2437 0.2870 -0.1322 0.0886  -0.1116 3    ILE A CG2 
46   C  CD1 . ILE A 3  ? 0.3210 0.4003 0.2393 -0.2096 0.0257  -0.1019 3    ILE A CD1 
58   N  N   A THR A 4  ? 0.2981 0.4848 0.1887 -0.2983 0.1575  -0.2107 4    THR A N   
59   N  N   B THR A 4  ? 0.2089 0.3851 0.3007 -0.2071 0.1577  -0.2107 4    THR A N   
60   C  CA  A THR A 4  ? 0.2718 0.4255 0.1172 -0.2498 0.0771  -0.1460 4    THR A CA  
61   C  CA  B THR A 4  ? 0.1137 0.2376 0.1385 -0.0774 0.0522  -0.1213 4    THR A CA  
62   C  C   A THR A 4  ? 0.2193 0.3370 0.1748 -0.2121 0.0726  -0.1538 4    THR A C   
63   C  C   B THR A 4  ? 0.1929 0.3477 0.1012 -0.0673 0.1122  -0.1278 4    THR A C   
64   O  O   A THR A 4  ? 0.1922 0.3365 0.3569 -0.0984 0.1782  -0.1009 4    THR A O   
65   O  O   B THR A 4  ? 0.1979 0.1579 0.1623 -0.1357 0.1145  -0.0670 4    THR A O   
66   C  CB  A THR A 4  ? 0.3575 0.4016 0.1825 -0.1315 0.0002  -0.2078 4    THR A CB  
67   C  CB  B THR A 4  ? 0.1164 0.0615 0.1021 -0.0091 0.0925  -0.0633 4    THR A CB  
68   O  OG1 A THR A 4  ? 0.4279 0.5200 0.0488 0.0174  -0.0274 -0.1119 4    THR A OG1 
69   O  OG1 B THR A 4  ? 0.0764 0.1673 0.0538 0.0351  0.0113  -0.0067 4    THR A OG1 
70   C  CG2 A THR A 4  ? 0.1236 0.4525 0.1866 -0.1027 0.0235  -0.1884 4    THR A CG2 
71   C  CG2 B THR A 4  ? 0.0347 0.2185 0.1469 0.0549  -0.0049 0.0219  4    THR A CG2 
72   N  N   . LEU A 5  ? 0.1924 0.3571 0.1709 -0.1579 0.0881  -0.1199 5    LEU A N   
73   C  CA  . LEU A 5  ? 0.1470 0.2901 0.1643 -0.1088 0.0826  -0.1384 5    LEU A CA  
74   C  C   . LEU A 5  ? 0.1407 0.2828 0.1791 -0.0989 0.0677  -0.1411 5    LEU A C   
75   O  O   . LEU A 5  ? 0.1005 0.2319 0.1461 -0.0504 0.0233  -0.1194 5    LEU A O   
76   C  CB  . LEU A 5  ? 0.0931 0.2127 0.1546 -0.0636 0.0426  -0.0698 5    LEU A CB  
77   C  CG  . LEU A 5  ? 0.0894 0.1931 0.1160 -0.0502 0.0314  -0.0523 5    LEU A CG  
78   C  CD1 . LEU A 5  ? 0.1221 0.1555 0.1307 -0.0095 0.0108  -0.0103 5    LEU A CD1 
79   C  CD2 . LEU A 5  ? 0.1063 0.1576 0.1840 -0.0280 0.0008  -0.0680 5    LEU A CD2 
91   N  N   . TRP A 6  ? 0.1843 0.2674 0.1667 -0.1301 0.0821  -0.1219 6    TRP A N   
92   C  CA  . TRP A 6  ? 0.1051 0.2380 0.2033 -0.0838 0.0262  -0.1108 6    TRP A CA  
93   C  C   . TRP A 6  ? 0.0842 0.2778 0.2177 -0.0187 0.0311  -0.1377 6    TRP A C   
94   O  O   . TRP A 6  ? 0.1186 0.2533 0.3135 -0.0247 -0.0410 -0.0851 6    TRP A O   
95   C  CB  . TRP A 6  ? 0.3194 0.1835 0.2144 -0.0555 0.0102  -0.0981 6    TRP A CB  
96   C  CG  . TRP A 6  ? 0.2769 0.1965 0.2293 -0.1040 0.0191  -0.0610 6    TRP A CG  
98   C  CD2 . TRP A 6  ? 0.3156 0.1944 0.1758 -0.0232 0.0621  -0.0850 6    TRP A CD2 
99   N  NE1 . TRP A 6  ? 0.4273 0.5321 0.1497 -0.2798 -0.1612 0.0967  6    TRP A NE1 
100  C  CE2 . TRP A 6  ? 0.3788 0.2309 0.4332 -0.2000 -0.1535 0.0514  6    TRP A CE2 
101  C  CE3 . TRP A 6  ? 0.2611 0.2966 0.0905 0.0716  0.0350  -0.0173 6    TRP A CE3 
102  C  CZ2 . TRP A 6  ? 0.5164 0.4926 0.1639 0.0199  -0.0998 0.0034  6    TRP A CZ2 
103  C  CZ3 . TRP A 6  ? 0.3301 0.4578 0.0893 0.1393  -0.0504 -0.0429 6    TRP A CZ3 
104  C  CH2 . TRP A 6  ? 0.4254 0.3506 0.1679 0.1622  -0.0750 -0.0655 6    TRP A CH2 
109  H  HD1 . TRP A 6  ? 0.3311 0.4067 0.1391 -0.2054 -0.0406 -0.0185 6    TRP A HD1 
115  N  N   . LYS A 7  ? 0.0853 0.3342 0.2848 -0.0291 0.0306  -0.2201 7    LYS A N   
116  C  CA  . LYS A 7  ? 0.0604 0.3285 0.4319 -0.0108 -0.0379 -0.2689 7    LYS A CA  
117  C  C   . LYS A 7  ? 0.0754 0.2728 0.3098 -0.0717 0.0206  -0.1977 7    LYS A C   
118  O  O   . LYS A 7  ? 0.0936 0.2774 0.2698 -0.0598 0.0592  -0.1684 7    LYS A O   
119  C  CB  . LYS A 7  ? 0.1130 0.7660 0.6322 0.1508  -0.1474 -0.5966 7    LYS A CB  
122  N  N   . ARG A 8  ? 0.0878 0.2320 0.3932 -0.0029 -0.0154 -0.2173 8    ARG A N   
123  C  CA  . ARG A 8  ? 0.0656 0.1997 0.3091 -0.0288 0.0101  -0.1539 8    ARG A CA  
124  C  C   . ARG A 8  ? 0.0687 0.2060 0.3358 -0.0077 0.0483  -0.1569 8    ARG A C   
125  O  O   . ARG A 8  ? 0.0711 0.2482 0.3353 -0.0347 0.0341  -0.2066 8    ARG A O   
126  C  CB  . ARG A 8  ? 0.0582 0.1983 0.3840 -0.0004 0.0161  -0.1259 8    ARG A CB  
127  C  CG  . ARG A 8  ? 0.1097 0.3012 0.3632 -0.0018 0.0293  -0.0735 8    ARG A CG  
128  C  CD  . ARG A 8  ? 0.3729 0.1077 0.6130 -0.1414 -0.1912 0.0757  8    ARG A CD  
129  N  NE  . ARG A 8  ? 0.2749 0.0641 0.3359 0.0476  -0.2384 -0.0582 8    ARG A NE  
130  C  CZ  . ARG A 8  ? 0.4651 0.4751 0.2643 0.2306  -0.2256 -0.1429 8    ARG A CZ  
131  N  NH1 . ARG A 8  ? 0.4890 0.6740 0.1750 0.3317  -0.2535 -0.2846 8    ARG A NH1 
132  N  NH2 . ARG A 8  ? 0.6492 0.0606 0.2424 0.0153  -0.3355 -0.0363 8    ARG A NH2 
139  N  N   . PRO A 9  ? 0.0695 0.2085 0.2348 -0.0288 0.0351  -0.1458 9    PRO A N   
140  C  CA  . PRO A 9  ? 0.0863 0.2103 0.1516 -0.0022 0.0027  -0.0736 9    PRO A CA  
141  C  C   . PRO A 9  ? 0.0736 0.1730 0.1397 -0.0239 0.0154  -0.0687 9    PRO A C   
142  O  O   . PRO A 9  ? 0.0604 0.1773 0.1726 -0.0202 0.0170  -0.0822 9    PRO A O   
143  C  CB  . PRO A 9  ? 0.0533 0.2164 0.1770 -0.0191 -0.0030 -0.1037 9    PRO A CB  
144  C  CG  . PRO A 9  ? 0.0761 0.1600 0.1690 0.0038  -0.0018 -0.0734 9    PRO A CG  
145  C  CD  . PRO A 9  ? 0.0694 0.1738 0.2118 -0.0052 0.0101  -0.1112 9    PRO A CD  
153  N  N   . LEU A 10 ? 0.0678 0.2227 0.1915 -0.0077 0.0228  -0.1075 10   LEU A N   
154  C  CA  . LEU A 10 ? 0.0814 0.1587 0.1851 -0.0192 0.0131  -0.0598 10   LEU A CA  
155  C  C   . LEU A 10 ? 0.0681 0.1735 0.1572 -0.0103 -0.0004 -0.0557 10   LEU A C   
156  O  O   . LEU A 10 ? 0.0684 0.2663 0.1549 -0.0325 0.0021  -0.0810 10   LEU A O   
157  C  CB  . LEU A 10 ? 0.1131 0.1510 0.2951 -0.0303 0.0588  -0.0810 10   LEU A CB  
158  C  CG  . LEU A 10 ? 0.1161 0.1639 0.3225 -0.0489 0.0503  -0.0629 10   LEU A CG  
159  C  CD1 . LEU A 10 ? 0.4383 0.1721 0.4593 -0.1628 0.2113  -0.1523 10   LEU A CD1 
160  C  CD2 . LEU A 10 ? 0.2189 0.1302 0.3096 -0.0404 0.0628  -0.0562 10   LEU A CD2 
172  N  N   . VAL A 11 ? 0.0722 0.1402 0.1255 -0.0095 -0.0027 -0.0297 11   VAL A N   
173  C  CA  . VAL A 11 ? 0.0709 0.1428 0.1334 -0.0032 -0.0028 -0.0343 11   VAL A CA  
174  C  C   . VAL A 11 ? 0.0731 0.1395 0.1047 0.0107  0.0179  -0.0194 11   VAL A C   
175  O  O   . VAL A 11 ? 0.0748 0.1740 0.1094 0.0005  0.0171  -0.0135 11   VAL A O   
176  C  CB  . VAL A 11 ? 0.0771 0.1496 0.1166 0.0058  0.0103  -0.0021 11   VAL A CB  
177  C  CG1 . VAL A 11 ? 0.0866 0.2090 0.1450 0.0224  -0.0079 0.0054  11   VAL A CG1 
178  C  CG2 . VAL A 11 ? 0.0970 0.1189 0.1412 0.0075  -0.0087 -0.0149 11   VAL A CG2 
188  N  N   . THR A 12 ? 0.0756 0.1575 0.1061 -0.0168 0.0180  -0.0292 12   THR A N   
189  C  CA  . THR A 12 ? 0.0693 0.1243 0.1120 -0.0166 0.0191  -0.0153 12   THR A CA  
190  C  C   . THR A 12 ? 0.0786 0.1081 0.1044 0.0015  0.0087  -0.0122 12   THR A C   
191  O  O   . THR A 12 ? 0.1137 0.1135 0.1313 0.0046  0.0009  0.0054  12   THR A O   
192  C  CB  . THR A 12 ? 0.0672 0.1581 0.1011 -0.0114 -0.0010 -0.0398 12   THR A CB  
193  O  OG1 . THR A 12 ? 0.0699 0.1647 0.1488 -0.0166 0.0071  -0.0623 12   THR A OG1 
194  C  CG2 . THR A 12 ? 0.0704 0.1505 0.1749 0.0011  -0.0137 -0.0512 12   THR A CG2 
202  N  N   . ILE A 13 ? 0.0710 0.1090 0.1121 -0.0150 0.0034  0.0051  13   ILE A N   
203  C  CA  . ILE A 13 ? 0.0678 0.0998 0.1265 -0.0036 -0.0012 -0.0108 13   ILE A CA  
204  C  C   . ILE A 13 ? 0.0712 0.0919 0.1585 0.0043  -0.0116 -0.0344 13   ILE A C   
205  O  O   . ILE A 13 ? 0.0800 0.0975 0.1583 0.0085  0.0118  -0.0129 13   ILE A O   
206  C  CB  . ILE A 13 ? 0.0655 0.1161 0.1314 -0.0042 -0.0066 -0.0109 13   ILE A CB  
207  C  CG1 . ILE A 13 ? 0.0999 0.1342 0.1296 0.0173  0.0044  0.0008  13   ILE A CG1 
208  C  CG2 . ILE A 13 ? 0.0634 0.1090 0.1436 -0.0025 0.0013  -0.0103 13   ILE A CG2 
209  C  CD1 . ILE A 13 ? 0.0959 0.1106 0.1391 -0.0058 0.0097  0.0008  13   ILE A CD1 
221  N  N   . ARG A 14 ? 0.0748 0.1024 0.1411 0.0000  -0.0231 -0.0111 14   ARG A N   
222  C  CA  . ARG A 14 ? 0.0572 0.1417 0.1311 0.0088  0.0013  -0.0295 14   ARG A CA  
223  C  C   . ARG A 14 ? 0.0611 0.1025 0.1339 -0.0077 -0.0087 -0.0196 14   ARG A C   
224  O  O   . ARG A 14 ? 0.0907 0.1028 0.1368 -0.0082 0.0109  -0.0112 14   ARG A O   
225  C  CB  . ARG A 14 ? 0.0829 0.1501 0.1520 -0.0077 0.0167  -0.0249 14   ARG A CB  
226  C  CG  . ARG A 14 ? 0.0587 0.2713 0.1852 -0.0144 0.0147  -0.0205 14   ARG A CG  
227  C  CD  . ARG A 14 ? 0.0783 0.2848 0.1699 -0.0343 0.0129  -0.0247 14   ARG A CD  
228  N  NE  . ARG A 14 ? 0.1341 0.2243 0.1633 -0.0086 0.0080  -0.0067 14   ARG A NE  
229  C  CZ  . ARG A 14 ? 0.1707 0.1835 0.1811 -0.0222 -0.0285 -0.0147 14   ARG A CZ  
230  N  NH1 . ARG A 14 ? 0.1390 0.2087 0.2259 -0.0427 -0.0585 0.0089  14   ARG A NH1 
231  N  NH2 . ARG A 14 ? 0.1995 0.2445 0.1855 0.0291  -0.0366 -0.0352 14   ARG A NH2 
245  N  N   . ILE A 15 ? 0.0695 0.1075 0.1367 0.0109  -0.0039 -0.0239 15   ILE A N   
246  C  CA  . ILE A 15 ? 0.0625 0.1120 0.1246 0.0116  0.0069  -0.0098 15   ILE A CA  
247  C  C   . ILE A 15 ? 0.0672 0.1081 0.1629 0.0090  -0.0198 -0.0360 15   ILE A C   
248  O  O   . ILE A 15 ? 0.0613 0.1058 0.1745 0.0056  -0.0054 -0.0196 15   ILE A O   
249  C  CB  . ILE A 15 ? 0.0767 0.0895 0.1364 0.0148  0.0074  -0.0062 15   ILE A CB  
250  C  CG1 . ILE A 15 ? 0.0894 0.1407 0.1174 -0.0040 0.0194  -0.0045 15   ILE A CG1 
251  C  CG2 . ILE A 15 ? 0.0780 0.1113 0.2008 -0.0099 0.0350  -0.0209 15   ILE A CG2 
252  C  CD1 . ILE A 15 ? 0.0937 0.1508 0.1651 0.0056  0.0450  -0.0105 15   ILE A CD1 
264  N  N   . GLY A 16 ? 0.0692 0.1118 0.1579 -0.0004 -0.0088 -0.0263 16   GLY A N   
265  C  CA  . GLY A 16 ? 0.0598 0.1694 0.1724 0.0125  -0.0123 -0.0520 16   GLY A CA  
266  C  C   . GLY A 16 ? 0.0805 0.1009 0.1761 -0.0096 0.0110  -0.0383 16   GLY A C   
267  O  O   . GLY A 16 ? 0.0774 0.1410 0.1692 0.0017  0.0010  -0.0300 16   GLY A O   
271  N  N   . GLY A 17 ? 0.0524 0.1249 0.1772 -0.0062 0.0040  -0.0259 17   GLY A N   
272  C  CA  . GLY A 17 ? 0.0650 0.1315 0.1812 -0.0127 0.0241  -0.0249 17   GLY A CA  
273  C  C   . GLY A 17 ? 0.1080 0.1398 0.1367 -0.0337 0.0225  -0.0111 17   GLY A C   
274  O  O   . GLY A 17 ? 0.1017 0.1699 0.1828 -0.0327 0.0311  -0.0433 17   GLY A O   
278  N  N   . GLN A 18 ? 0.0720 0.0994 0.1472 -0.0062 0.0052  -0.0169 18   GLN A N   
279  C  CA  . GLN A 18 ? 0.0558 0.1129 0.1591 -0.0047 0.0153  -0.0415 18   GLN A CA  
280  C  C   . GLN A 18 ? 0.0700 0.1173 0.1698 0.0083  0.0060  -0.0517 18   GLN A C   
281  O  O   . GLN A 18 ? 0.0995 0.1148 0.1648 0.0242  -0.0020 -0.0368 18   GLN A O   
282  C  CB  . GLN A 18 ? 0.0675 0.1262 0.2312 -0.0245 -0.0017 0.0153  18   GLN A CB  
283  C  CG  . GLN A 18 ? 0.1242 0.1121 0.2237 0.0114  -0.0069 0.0062  18   GLN A CG  
284  C  CD  . GLN A 18 ? 0.1192 0.1295 0.2465 0.0086  -0.0369 -0.0407 18   GLN A CD  
285  O  OE1 . GLN A 18 ? 0.1440 0.1646 0.4095 0.0226  -0.1072 -0.1069 18   GLN A OE1 
286  N  NE2 . GLN A 18 ? 0.1217 0.1424 0.2773 0.0186  -0.0262 -0.0624 18   GLN A NE2 
295  N  N   . LEU A 19 ? 0.0569 0.1607 0.1476 0.0025  0.0194  -0.0597 19   LEU A N   
296  C  CA  . LEU A 19 ? 0.0589 0.1259 0.1557 0.0009  0.0156  -0.0399 19   LEU A CA  
297  C  C   . LEU A 19 ? 0.0726 0.1298 0.1410 -0.0064 0.0193  -0.0335 19   LEU A C   
298  O  O   . LEU A 19 ? 0.0832 0.1211 0.2638 0.0084  0.0169  -0.0168 19   LEU A O   
299  C  CB  . LEU A 19 ? 0.1120 0.1527 0.1298 -0.0074 0.0138  -0.0133 19   LEU A CB  
300  C  CG  . LEU A 19 ? 0.1298 0.1733 0.1579 0.0134  0.0227  0.0144  19   LEU A CG  
301  C  CD1 . LEU A 19 ? 0.3435 0.2076 0.2086 0.0018  0.1625  -0.0255 19   LEU A CD1 
302  C  CD2 . LEU A 19 ? 0.1171 0.1549 0.1590 -0.0069 0.0027  0.0042  19   LEU A CD2 
314  N  N   . LYS A 20 ? 0.0726 0.1087 0.1639 -0.0039 0.0195  -0.0048 20   LYS A N   
315  C  CA  . LYS A 20 ? 0.0693 0.0907 0.1634 -0.0065 0.0216  -0.0347 20   LYS A CA  
316  C  C   . LYS A 20 ? 0.0761 0.0946 0.1626 -0.0051 0.0161  -0.0102 20   LYS A C   
317  O  O   . LYS A 20 ? 0.1147 0.1176 0.1435 -0.0235 0.0005  -0.0116 20   LYS A O   
318  C  CB  . LYS A 20 ? 0.1169 0.1152 0.1437 -0.0034 0.0241  0.0030  20   LYS A CB  
319  C  CG  . LYS A 20 ? 0.1043 0.1121 0.1618 -0.0207 0.0209  -0.0110 20   LYS A CG  
320  C  CD  . LYS A 20 ? 0.1383 0.1392 0.1560 -0.0120 0.0106  -0.0194 20   LYS A CD  
321  C  CE  . LYS A 20 ? 0.1458 0.1820 0.1799 0.0067  -0.0095 -0.0434 20   LYS A CE  
322  N  NZ  . LYS A 20 ? 0.1252 0.1925 0.1974 0.0294  -0.0478 -0.0129 20   LYS A NZ  
336  N  N   . GLU A 21 ? 0.0808 0.0992 0.1365 -0.0019 0.0064  -0.0113 21   GLU A N   
337  C  CA  . GLU A 21 ? 0.0749 0.1355 0.1191 -0.0117 0.0112  -0.0237 21   GLU A CA  
338  C  C   . GLU A 21 ? 0.1060 0.1209 0.1280 0.0107  0.0298  -0.0129 21   GLU A C   
339  O  O   . GLU A 21 ? 0.1055 0.1301 0.1328 0.0081  0.0280  -0.0005 21   GLU A O   
340  C  CB  . GLU A 21 ? 0.1003 0.1211 0.1737 -0.0222 0.0215  -0.0367 21   GLU A CB  
341  C  CG  . GLU A 21 ? 0.2064 0.1402 0.1720 0.0107  0.0430  -0.0380 21   GLU A CG  
342  C  CD  . GLU A 21 ? 0.1488 0.1438 0.1535 0.0160  0.0147  -0.0385 21   GLU A CD  
343  O  OE1 . GLU A 21 ? 0.1680 0.2573 0.2190 0.0457  -0.0061 -0.0260 21   GLU A OE1 
344  O  OE2 . GLU A 21 ? 0.1584 0.1878 0.1681 -0.0233 -0.0038 -0.0260 21   GLU A OE2 
351  N  N   . ALA A 22 ? 0.0687 0.1053 0.1097 -0.0180 0.0197  -0.0077 22   ALA A N   
352  C  CA  . ALA A 22 ? 0.0713 0.1036 0.1050 -0.0068 0.0089  -0.0131 22   ALA A CA  
353  C  C   . ALA A 22 ? 0.0596 0.1043 0.1353 -0.0225 0.0035  0.0014  22   ALA A C   
354  O  O   . ALA A 22 ? 0.0589 0.1633 0.1514 0.0111  0.0029  0.0129  22   ALA A O   
355  C  CB  . ALA A 22 ? 0.0752 0.1308 0.1240 -0.0260 0.0103  -0.0256 22   ALA A CB  
361  N  N   . LEU A 23 ? 0.0597 0.1037 0.1483 -0.0105 0.0011  0.0035  23   LEU A N   
362  C  CA  . LEU A 23 ? 0.0583 0.1074 0.1330 -0.0204 -0.0002 -0.0249 23   LEU A CA  
363  C  C   . LEU A 23 ? 0.0583 0.1087 0.1309 -0.0097 -0.0016 -0.0213 23   LEU A C   
364  O  O   . LEU A 23 ? 0.0834 0.1068 0.1101 -0.0006 0.0138  -0.0160 23   LEU A O   
365  C  CB  . LEU A 23 ? 0.0783 0.1261 0.1323 -0.0049 0.0252  -0.0056 23   LEU A CB  
366  C  CG  . LEU A 23 ? 0.0669 0.1439 0.1761 -0.0411 0.0087  0.0014  23   LEU A CG  
367  C  CD1 . LEU A 23 ? 0.0699 0.2093 0.2132 -0.0417 0.0185  -0.0832 23   LEU A CD1 
368  C  CD2 . LEU A 23 ? 0.1021 0.1448 0.2475 -0.0031 0.0712  0.0263  23   LEU A CD2 
380  N  N   . LEU A 24 ? 0.0719 0.1113 0.1051 0.0001  0.0095  -0.0396 24   LEU A N   
381  C  CA  . LEU A 24 ? 0.0792 0.0941 0.1099 -0.0061 0.0125  -0.0340 24   LEU A CA  
382  C  C   . LEU A 24 ? 0.0621 0.1330 0.1160 0.0059  0.0045  -0.0272 24   LEU A C   
383  O  O   . LEU A 24 ? 0.0819 0.1515 0.0971 -0.0068 0.0089  -0.0257 24   LEU A O   
384  C  CB  . LEU A 24 ? 0.1012 0.1213 0.1206 -0.0147 0.0211  -0.0235 24   LEU A CB  
385  C  CG  . LEU A 24 ? 0.1443 0.1515 0.1391 -0.0338 0.0562  -0.0535 24   LEU A CG  
386  C  CD1 . LEU A 24 ? 0.2787 0.1341 0.1851 -0.0064 0.1289  -0.0060 24   LEU A CD1 
387  C  CD2 . LEU A 24 ? 0.1214 0.2671 0.2372 -0.1167 0.1014  -0.1016 24   LEU A CD2 
399  N  N   . ASP A 25 ? 0.0632 0.0974 0.1150 -0.0158 0.0106  -0.0186 25   ASP A N   
400  C  CA  . ASP A 25 ? 0.0577 0.0843 0.1149 -0.0096 0.0070  -0.0225 25   ASP A CA  
401  C  C   . ASP A 25 ? 0.0557 0.0738 0.1139 -0.0093 -0.0004 -0.0105 25   ASP A C   
402  O  O   . ASP A 25 ? 0.0559 0.0830 0.1018 -0.0081 0.0060  -0.0187 25   ASP A O   
403  C  CB  . ASP A 25 ? 0.0924 0.0606 0.1175 -0.0021 0.0111  -0.0251 25   ASP A CB  
404  C  CG  . ASP A 25 ? 0.0980 0.0934 0.1560 -0.0024 0.0140  0.0075  25   ASP A CG  
405  O  OD1 . ASP A 25 ? 0.0834 0.1119 0.1202 0.0030  -0.0012 -0.0258 25   ASP A OD1 
406  O  OD2 . ASP A 25 ? 0.1290 0.1003 0.1337 0.0086  0.0326  0.0056  25   ASP A OD2 
411  N  N   . THR A 26 ? 0.0683 0.0885 0.0955 -0.0042 0.0056  -0.0137 26   THR A N   
412  C  CA  . THR A 26 ? 0.0795 0.0701 0.0982 -0.0033 0.0043  -0.0040 26   THR A CA  
413  C  C   . THR A 26 ? 0.0438 0.0814 0.1051 -0.0125 0.0045  -0.0110 26   THR A C   
414  O  O   . THR A 26 ? 0.0736 0.0828 0.1105 -0.0042 -0.0005 -0.0203 26   THR A O   
415  C  CB  . THR A 26 ? 0.0676 0.0773 0.1030 -0.0262 -0.0066 0.0038  26   THR A CB  
416  O  OG1 . THR A 26 ? 0.0670 0.0744 0.1204 -0.0205 0.0110  -0.0163 26   THR A OG1 
417  C  CG2 . THR A 26 ? 0.1027 0.0910 0.1058 -0.0291 0.0219  -0.0029 26   THR A CG2 
425  N  N   . GLY A 27 ? 0.0630 0.0801 0.0900 -0.0144 -0.0066 -0.0013 27   GLY A N   
426  C  CA  . GLY A 27 ? 0.0611 0.0701 0.0970 -0.0033 -0.0031 -0.0059 27   GLY A CA  
427  C  C   . GLY A 27 ? 0.0520 0.0945 0.0908 -0.0118 0.0045  0.0049  27   GLY A C   
428  O  O   . GLY A 27 ? 0.0666 0.1068 0.0928 0.0010  0.0091  0.0023  27   GLY A O   
432  N  N   . ALA A 28 ? 0.0514 0.0770 0.1022 -0.0178 -0.0058 -0.0031 28   ALA A N   
433  C  CA  . ALA A 28 ? 0.0423 0.1118 0.0992 -0.0223 -0.0041 -0.0004 28   ALA A CA  
434  C  C   . ALA A 28 ? 0.0390 0.1094 0.1178 -0.0146 0.0097  -0.0150 28   ALA A C   
435  O  O   . ALA A 28 ? 0.0614 0.0959 0.1208 -0.0227 0.0042  -0.0060 28   ALA A O   
436  C  CB  . ALA A 28 ? 0.0665 0.0995 0.0880 -0.0058 -0.0106 0.0006  28   ALA A CB  
442  N  N   . ASP A 29 ? 0.0611 0.0943 0.1101 -0.0131 0.0093  -0.0074 29   ASP A N   
443  C  CA  . ASP A 29 ? 0.0586 0.0971 0.1217 0.0054  -0.0048 -0.0164 29   ASP A CA  
444  C  C   . ASP A 29 ? 0.0606 0.0965 0.1077 -0.0101 -0.0137 -0.0295 29   ASP A C   
445  O  O   . ASP A 29 ? 0.0677 0.0844 0.1701 -0.0006 0.0156  -0.0251 29   ASP A O   
446  C  CB  . ASP A 29 ? 0.0725 0.1036 0.1210 0.0123  -0.0046 -0.0171 29   ASP A CB  
447  C  CG  . ASP A 29 ? 0.0760 0.1499 0.1254 -0.0115 0.0053  -0.0501 29   ASP A CG  
448  O  OD1 . ASP A 29 ? 0.0635 0.1196 0.1327 0.0077  0.0128  -0.0229 29   ASP A OD1 
449  O  OD2 . ASP A 29 ? 0.1103 0.1634 0.1307 0.0310  0.0167  -0.0283 29   ASP A OD2 
454  N  N   . ASP A 30 ? 0.0513 0.0957 0.1351 -0.0076 -0.0101 -0.0101 30   ASP A N   
455  C  CA  . ASP A 30 ? 0.0486 0.1041 0.1141 -0.0119 -0.0116 -0.0265 30   ASP A CA  
456  C  C   . ASP A 30 ? 0.0585 0.0866 0.1233 -0.0093 -0.0139 -0.0191 30   ASP A C   
457  O  O   . ASP A 30 ? 0.0601 0.1112 0.1454 0.0016  -0.0006 -0.0503 30   ASP A O   
458  C  CB  . ASP A 30 ? 0.0617 0.1397 0.1219 0.0166  -0.0180 -0.0339 30   ASP A CB  
459  C  CG  . ASP A 30 ? 0.0747 0.1157 0.1160 -0.0115 -0.0063 -0.0275 30   ASP A CG  
460  O  OD1 . ASP A 30 ? 0.1235 0.1482 0.1995 -0.0510 0.0258  -0.0755 30   ASP A OD1 
461  O  OD2 . ASP A 30 ? 0.0920 0.1468 0.1239 -0.0178 0.0082  -0.0261 30   ASP A OD2 
466  N  N   . THR A 31 ? 0.0724 0.0745 0.1646 -0.0201 0.0284  -0.0285 31   THR A N   
467  C  CA  . THR A 31 ? 0.0748 0.0748 0.1192 -0.0182 0.0068  -0.0200 31   THR A CA  
468  C  C   . THR A 31 ? 0.0711 0.0890 0.1222 -0.0178 0.0021  -0.0141 31   THR A C   
469  O  O   . THR A 31 ? 0.0813 0.0957 0.1501 -0.0122 -0.0227 -0.0210 31   THR A O   
470  C  CB  . THR A 31 ? 0.0782 0.0978 0.1025 -0.0017 0.0123  -0.0105 31   THR A CB  
471  O  OG1 . THR A 31 ? 0.0703 0.0886 0.1486 -0.0105 0.0072  0.0089  31   THR A OG1 
472  C  CG2 . THR A 31 ? 0.0565 0.0910 0.1660 -0.0004 -0.0028 -0.0298 31   THR A CG2 
480  N  N   . VAL A 32 ? 0.0583 0.0813 0.1357 -0.0044 -0.0029 -0.0095 32   VAL A N   
481  C  CA  . VAL A 32 ? 0.0610 0.0965 0.1197 0.0027  -0.0046 -0.0062 32   VAL A CA  
482  C  C   . VAL A 32 ? 0.0608 0.0786 0.1700 -0.0120 -0.0039 -0.0223 32   VAL A C   
483  O  O   . VAL A 32 ? 0.0663 0.1060 0.1659 -0.0063 -0.0017 -0.0389 32   VAL A O   
484  C  CB  . VAL A 32 ? 0.1152 0.0889 0.1765 0.0000  0.0398  0.0085  32   VAL A CB  
485  C  CG1 . VAL A 32 ? 0.1385 0.1080 0.1391 -0.0244 0.0214  -0.0082 32   VAL A CG1 
486  C  CG2 . VAL A 32 ? 0.1254 0.2767 0.1821 0.1104  0.0181  -0.0202 32   VAL A CG2 
496  N  N   . LEU A 33 ? 0.0616 0.0928 0.1305 -0.0078 0.0081  -0.0307 33   LEU A N   
497  C  CA  . LEU A 33 ? 0.0576 0.0795 0.1281 -0.0024 -0.0056 -0.0178 33   LEU A CA  
498  C  C   . LEU A 33 ? 0.0657 0.0935 0.1382 -0.0072 -0.0060 -0.0089 33   LEU A C   
499  O  O   . LEU A 33 ? 0.0659 0.0992 0.1363 -0.0037 0.0074  -0.0073 33   LEU A O   
500  C  CB  . LEU A 33 ? 0.0715 0.0890 0.1943 0.0150  0.0254  0.0044  33   LEU A CB  
501  C  CG  . LEU A 33 ? 0.0760 0.1382 0.2270 -0.0403 -0.0040 0.0402  33   LEU A CG  
502  C  CD1 . LEU A 33 ? 0.0878 0.1986 0.1999 -0.0060 0.0350  0.0438  33   LEU A CD1 
503  C  CD2 . LEU A 33 ? 0.1450 0.1969 0.2396 -0.0907 -0.0364 0.0871  33   LEU A CD2 
515  N  N   . GLU A 34 ? 0.0754 0.0841 0.1166 -0.0192 -0.0005 0.0049  34   GLU A N   
516  C  CA  . GLU A 34 ? 0.0676 0.0815 0.1476 -0.0009 0.0051  -0.0022 34   GLU A CA  
517  C  C   . GLU A 34 ? 0.0775 0.0851 0.1432 -0.0102 -0.0047 -0.0001 34   GLU A C   
518  O  O   . GLU A 34 ? 0.0778 0.0988 0.1610 -0.0069 0.0038  0.0065  34   GLU A O   
519  C  CB  . GLU A 34 ? 0.1147 0.0898 0.1309 -0.0028 -0.0156 -0.0002 34   GLU A CB  
520  C  CG  . GLU A 34 ? 0.1019 0.1070 0.1814 -0.0176 -0.0099 -0.0159 34   GLU A CG  
521  C  CD  . GLU A 34 ? 0.1491 0.1466 0.2469 -0.0017 -0.0500 -0.0745 34   GLU A CD  
522  O  OE1 . GLU A 34 ? 0.2088 0.4253 0.7095 0.0398  -0.0333 -0.4452 34   GLU A OE1 
523  O  OE2 . GLU A 34 ? 0.2443 0.2208 0.3083 -0.0337 -0.1353 -0.0582 34   GLU A OE2 
530  N  N   . GLU A 35 ? 0.0884 0.1158 0.1433 -0.0075 -0.0036 0.0102  35   GLU A N   
531  C  CA  . GLU A 35 ? 0.0806 0.1225 0.1553 -0.0163 -0.0105 0.0154  35   GLU A CA  
532  C  C   . GLU A 35 ? 0.0822 0.0818 0.1725 0.0038  -0.0013 0.0013  35   GLU A C   
533  O  O   . GLU A 35 ? 0.0885 0.1104 0.1725 0.0129  -0.0182 -0.0090 35   GLU A O   
534  C  CB  . GLU A 35 ? 0.1216 0.1194 0.1326 0.0120  -0.0054 0.0092  35   GLU A CB  
535  C  CG  . GLU A 35 ? 0.1886 0.2028 0.2193 0.0304  -0.0761 0.0195  35   GLU A CG  
536  C  CD  . GLU A 35 ? 0.1854 0.2884 0.2216 0.0081  -0.0798 -0.0303 35   GLU A CD  
537  O  OE1 . GLU A 35 ? 0.2808 0.2873 0.2494 0.0827  -0.0465 -0.0183 35   GLU A OE1 
538  O  OE2 . GLU A 35 ? 0.2632 0.4430 0.3534 -0.1495 -0.0129 -0.0502 35   GLU A OE2 
545  N  N   . MET A 36 ? 0.0786 0.0996 0.1903 0.0009  0.0114  -0.0077 36   MET A N   
546  C  CA  . MET A 36 ? 0.0762 0.1123 0.1835 -0.0086 -0.0036 0.0046  36   MET A CA  
547  C  C   . MET A 36 ? 0.0813 0.1297 0.1793 -0.0003 -0.0146 0.0117  36   MET A C   
548  O  O   . MET A 36 ? 0.0840 0.2166 0.1878 -0.0082 -0.0275 -0.0264 36   MET A O   
549  C  CB  . MET A 36 ? 0.0712 0.1084 0.1665 0.0049  0.0034  -0.0194 36   MET A CB  
550  C  CG  . MET A 36 ? 0.1404 0.1023 0.1865 0.0199  0.0098  -0.0047 36   MET A CG  
551  S  SD  . MET A 36 ? 0.0881 0.1420 0.1855 0.0204  -0.0136 -0.0033 36   MET A SD  
552  C  CE  . MET A 36 ? 0.0824 0.1722 0.2065 0.0129  -0.0039 0.0136  36   MET A CE  
562  N  N   . ASN A 37 ? 0.0710 0.1322 0.1873 0.0119  -0.0334 0.0029  37   ASN A N   
563  C  CA  . ASN A 37 ? 0.0899 0.1636 0.1911 -0.0161 -0.0238 0.0134  37   ASN A CA  
564  C  C   . ASN A 37 ? 0.0966 0.1518 0.1691 -0.0179 0.0170  -0.0014 37   ASN A C   
565  O  O   . ASN A 37 ? 0.1325 0.1514 0.1585 0.0191  -0.0220 -0.0144 37   ASN A O   
566  C  CB  . ASN A 37 ? 0.0620 0.2071 0.2435 -0.0253 -0.0122 0.0883  37   ASN A CB  
567  C  CG  . ASN A 37 ? 0.1071 0.2129 0.2559 0.0044  -0.0207 0.0863  37   ASN A CG  
568  O  OD1 . ASN A 37 ? 0.2522 0.2433 0.3950 0.0687  -0.0023 0.0546  37   ASN A OD1 
569  N  ND2 . ASN A 37 ? 0.1053 0.3264 0.3288 0.0320  0.0279  0.2017  37   ASN A ND2 
576  N  N   . LEU A 38 ? 0.0785 0.1587 0.1288 -0.0082 0.0012  0.0129  38   LEU A N   
577  C  CA  . LEU A 38 ? 0.0681 0.1478 0.1747 -0.0033 0.0008  0.0111  38   LEU A CA  
578  C  C   . LEU A 38 ? 0.0677 0.1712 0.1757 -0.0089 0.0058  -0.0024 38   LEU A C   
579  O  O   . LEU A 38 ? 0.0802 0.1546 0.1670 0.0103  0.0041  -0.0065 38   LEU A O   
580  C  CB  . LEU A 38 ? 0.0811 0.1611 0.1849 0.0076  -0.0122 -0.0183 38   LEU A CB  
581  C  CG  . LEU A 38 ? 0.0832 0.1552 0.1543 0.0150  -0.0014 -0.0301 38   LEU A CG  
582  C  CD1 . LEU A 38 ? 0.0673 0.1819 0.1562 0.0071  0.0141  -0.0061 38   LEU A CD1 
583  C  CD2 . LEU A 38 ? 0.0937 0.1923 0.1762 0.0365  0.0286  -0.0036 38   LEU A CD2 
595  N  N   . PRO A 39 ? 0.0672 0.1602 0.1631 -0.0013 0.0106  -0.0108 39   PRO A N   
596  C  CA  . PRO A 39 ? 0.0939 0.1563 0.1894 -0.0189 0.0069  -0.0368 39   PRO A CA  
597  C  C   . PRO A 39 ? 0.0860 0.2216 0.1941 0.0106  0.0162  -0.0651 39   PRO A C   
598  O  O   . PRO A 39 ? 0.1009 0.1856 0.1950 -0.0059 0.0007  -0.0700 39   PRO A O   
599  C  CB  . PRO A 39 ? 0.0802 0.2375 0.2172 -0.0304 0.0362  -0.0821 39   PRO A CB  
600  C  CG  . PRO A 39 ? 0.1291 0.3964 0.2454 -0.1203 0.0179  0.0737  39   PRO A CG  
601  C  CD  . PRO A 39 ? 0.1174 0.1375 0.1726 -0.0130 -0.0011 -0.0009 39   PRO A CD  
609  N  N   . GLY A 40 ? 0.1064 0.1616 0.1847 -0.0043 0.0118  -0.0327 40   GLY A N   
610  C  CA  . GLY A 40 ? 0.0907 0.1757 0.1823 -0.0099 0.0278  -0.0358 40   GLY A CA  
611  C  C   . GLY A 40 ? 0.0952 0.1682 0.1648 -0.0019 0.0151  -0.0077 40   GLY A C   
612  O  O   . GLY A 40 ? 0.1261 0.1690 0.1939 -0.0062 0.0158  -0.0038 40   GLY A O   
616  N  N   . LYS A 41 ? 0.0934 0.1602 0.1431 -0.0291 0.0201  -0.0153 41   LYS A N   
617  C  CA  . LYS A 41 ? 0.0724 0.1628 0.1370 0.0075  -0.0030 0.0062  41   LYS A CA  
618  C  C   . LYS A 41 ? 0.0809 0.1889 0.1185 -0.0136 0.0122  -0.0543 41   LYS A C   
619  O  O   . LYS A 41 ? 0.0953 0.1678 0.1107 -0.0306 0.0002  -0.0480 41   LYS A O   
620  C  CB  . LYS A 41 ? 0.1244 0.2616 0.2292 -0.0609 0.0302  -0.1229 41   LYS A CB  
621  C  CG  . LYS A 41 ? 0.1053 0.2889 0.3231 -0.0746 0.0305  -0.0913 41   LYS A CG  
622  C  CD  . LYS A 41 ? 0.3051 0.1751 0.2674 -0.0990 -0.1542 0.0414  41   LYS A CD  
623  C  CE  . LYS A 41 ? 0.6865 0.3497 0.2884 -0.3228 -0.3778 0.2081  41   LYS A CE  
624  N  NZ  . LYS A 41 ? 0.8216 0.3418 0.7491 -0.2817 -0.6835 0.1816  41   LYS A NZ  
631  N  N   . TRP A 42 ? 0.0685 0.1874 0.1079 0.0043  -0.0065 -0.0283 42   TRP A N   
632  C  CA  . TRP A 42 ? 0.0724 0.1600 0.1253 0.0026  -0.0071 -0.0046 42   TRP A CA  
633  C  C   . TRP A 42 ? 0.0831 0.2249 0.1303 -0.0288 0.0049  -0.0024 42   TRP A C   
634  O  O   . TRP A 42 ? 0.1036 0.1891 0.1340 -0.0160 -0.0047 -0.0291 42   TRP A O   
635  C  CB  . TRP A 42 ? 0.0693 0.1606 0.1387 -0.0024 -0.0039 0.0075  42   TRP A CB  
636  C  CG  . TRP A 42 ? 0.0905 0.1526 0.1298 -0.0066 -0.0346 -0.0021 42   TRP A CG  
637  C  CD1 . TRP A 42 ? 0.1212 0.1531 0.1711 0.0142  -0.0115 -0.0135 42   TRP A CD1 
638  C  CD2 . TRP A 42 ? 0.1090 0.1208 0.1439 0.0074  -0.0269 -0.0044 42   TRP A CD2 
639  N  NE1 . TRP A 42 ? 0.1177 0.2050 0.1508 0.0428  -0.0391 0.0018  42   TRP A NE1 
640  C  CE2 . TRP A 42 ? 0.1216 0.1649 0.1638 0.0263  -0.0318 0.0153  42   TRP A CE2 
641  C  CE3 . TRP A 42 ? 0.1164 0.1367 0.1251 0.0162  -0.0199 0.0026  42   TRP A CE3 
642  C  CZ2 . TRP A 42 ? 0.1958 0.1963 0.1928 0.0310  -0.0383 0.0597  42   TRP A CZ2 
643  C  CZ3 . TRP A 42 ? 0.1496 0.1801 0.1419 -0.0252 -0.0222 0.0122  42   TRP A CZ3 
644  C  CH2 . TRP A 42 ? 0.1959 0.1614 0.1299 -0.0301 -0.0434 0.0313  42   TRP A CH2 
655  N  N   . LYS A 43 ? 0.0796 0.2344 0.1594 -0.0385 0.0120  -0.0256 43   LYS A N   
656  C  CA  . LYS A 43 ? 0.0972 0.1924 0.1525 -0.0158 0.0231  -0.0278 43   LYS A CA  
657  C  C   . LYS A 43 ? 0.0818 0.2615 0.1457 -0.0336 0.0232  -0.0441 43   LYS A C   
658  O  O   . LYS A 43 ? 0.0987 0.2299 0.1457 -0.0220 0.0347  -0.0405 43   LYS A O   
659  C  CB  A LYS A 43 ? 0.2532 0.1573 0.1124 0.0079  0.0125  0.0223  43   LYS A CB  
660  C  CB  B LYS A 43 ? 0.2772 0.2217 0.3042 -0.0180 0.0709  -0.1019 43   LYS A CB  
661  C  CG  A LYS A 43 ? 0.1801 0.1716 0.0937 -0.0236 0.0095  0.0137  43   LYS A CG  
662  C  CG  B LYS A 43 ? 0.3509 0.3211 0.3860 -0.2347 0.2156  -0.1645 43   LYS A CG  
663  C  CD  A LYS A 43 ? 0.8677 0.3157 0.5293 0.3724  -0.4900 -0.2377 43   LYS A CD  
664  C  CD  B LYS A 43 ? 0.2555 0.2289 0.3779 0.0590  -0.2020 -0.0781 43   LYS A CD  
665  C  CE  A LYS A 43 ? 0.4403 0.2541 0.3716 0.2848  -0.2739 -0.2352 43   LYS A CE  
666  C  CE  B LYS A 43 ? 0.2458 0.1435 0.1570 -0.0207 0.0242  0.0092  43   LYS A CE  
667  N  NZ  A LYS A 43 ? 0.1912 0.3216 0.9539 0.0877  0.0086  -0.0484 43   LYS A NZ  
668  N  NZ  B LYS A 43 ? 0.1877 0.2516 0.4040 0.0545  -0.0693 -0.1326 43   LYS A NZ  
671  N  N   . PRO A 44 ? 0.1215 0.2719 0.1403 -0.0687 0.0370  -0.0616 44   PRO A N   
672  C  CA  . PRO A 44 ? 0.1037 0.2804 0.2248 -0.0636 0.0333  -0.0484 44   PRO A CA  
673  C  C   . PRO A 44 ? 0.1234 0.1992 0.1853 -0.0711 0.0460  -0.0692 44   PRO A C   
674  O  O   . PRO A 44 ? 0.1194 0.2908 0.3577 -0.0799 0.0721  -0.2023 44   PRO A O   
675  C  CB  . PRO A 44 ? 0.1034 0.2917 0.2929 -0.0479 0.0553  0.0170  44   PRO A CB  
676  C  CG  . PRO A 44 ? 0.2339 0.4108 0.1248 -0.2002 0.0649  -0.0505 44   PRO A CG  
677  C  CD  . PRO A 44 ? 0.1584 0.2389 0.1406 -0.0637 0.0444  -0.0501 44   PRO A CD  
685  N  N   . LYS A 45 ? 0.0957 0.1850 0.2431 -0.0367 0.0421  -0.1028 45   LYS A N   
686  C  CA  . LYS A 45 ? 0.1002 0.1557 0.2904 -0.0276 0.0526  -0.0864 45   LYS A CA  
687  C  C   . LYS A 45 ? 0.0949 0.1589 0.1920 -0.0299 0.0406  -0.0548 45   LYS A C   
688  O  O   . LYS A 45 ? 0.0963 0.1688 0.2064 -0.0265 0.0311  -0.0743 45   LYS A O   
689  C  CB  . LYS A 45 ? 0.1506 0.2145 0.4140 -0.0782 0.0332  0.0303  45   LYS A CB  
690  C  CG  . LYS A 45 ? 0.1783 0.2899 0.3752 -0.0942 -0.0525 0.0002  45   LYS A CG  
691  C  CD  . LYS A 45 ? 0.1194 0.1046 0.5423 -0.0572 0.0506  0.0605  45   LYS A CD  
692  C  CE  . LYS A 45 ? 0.2177 0.2652 0.6112 -0.0481 -0.2011 -0.0187 45   LYS A CE  
693  N  NZ  . LYS A 45 ? 0.2372 0.0747 1.7848 -0.0565 -0.5201 0.1985  45   LYS A NZ  
707  N  N   . MET A 46 ? 0.0994 0.1538 0.1995 -0.0311 0.0214  -0.0826 46   MET A N   
708  C  CA  . MET A 46 ? 0.0933 0.1438 0.1830 -0.0272 0.0269  -0.0527 46   MET A CA  
709  C  C   . MET A 46 ? 0.0708 0.1372 0.2029 -0.0213 0.0337  -0.0423 46   MET A C   
710  O  O   . MET A 46 ? 0.1420 0.1316 0.2441 -0.0086 0.0233  -0.0613 46   MET A O   
711  C  CB  . MET A 46 ? 0.0976 0.2087 0.1770 -0.0339 0.0179  -0.0580 46   MET A CB  
712  C  CG  . MET A 46 ? 0.0971 0.3584 0.1267 0.0165  0.0043  -0.0575 46   MET A CG  
713  S  SD  . MET A 46 ? 0.1590 0.2761 0.1736 -0.0319 0.0396  -0.0558 46   MET A SD  
714  C  CE  . MET A 46 ? 0.3371 0.3743 0.2444 -0.2176 0.0828  -0.1157 46   MET A CE  
723  N  N   . ILE A 47 ? 0.0924 0.1218 0.1689 -0.0293 0.0329  -0.0234 47   ILE A N   
724  C  CA  . ILE A 47 ? 0.0744 0.1038 0.1884 -0.0074 0.0362  -0.0350 47   ILE A CA  
725  C  C   . ILE A 47 ? 0.0971 0.1002 0.1788 -0.0211 0.0229  -0.0475 47   ILE A C   
726  O  O   . ILE A 47 ? 0.0896 0.1200 0.2073 -0.0312 0.0158  -0.0169 47   ILE A O   
727  C  CB  . ILE A 47 ? 0.0832 0.1261 0.1807 0.0165  0.0350  -0.0131 47   ILE A CB  
728  C  CG1 . ILE A 47 ? 0.0970 0.1296 0.1338 0.0082  0.0122  -0.0224 47   ILE A CG1 
729  C  CG2 . ILE A 47 ? 0.1006 0.1292 0.2144 0.0014  0.0633  -0.0299 47   ILE A CG2 
730  C  CD1 . ILE A 47 ? 0.1617 0.2076 0.1403 -0.0151 0.0290  -0.0586 47   ILE A CD1 
742  N  N   . GLY A 48 ? 0.0810 0.1403 0.1460 -0.0341 0.0343  -0.0140 48   GLY A N   
743  C  CA  . GLY A 48 ? 0.1095 0.1481 0.1285 -0.0523 0.0091  -0.0005 48   GLY A CA  
744  C  C   . GLY A 48 ? 0.1228 0.1066 0.0956 -0.0363 0.0377  -0.0145 48   GLY A C   
745  O  O   . GLY A 48 ? 0.1641 0.1172 0.1433 -0.0263 0.0157  0.0108  48   GLY A O   
749  N  N   . GLY A 49 ? 0.0799 0.1128 0.1346 -0.0275 0.0074  -0.0025 49   GLY A N   
750  C  CA  . GLY A 49 ? 0.0956 0.0992 0.1299 -0.0227 0.0038  -0.0051 49   GLY A CA  
751  C  C   . GLY A 49 ? 0.0700 0.1359 0.1453 -0.0109 -0.0079 -0.0074 49   GLY A C   
752  O  O   . GLY A 49 ? 0.0817 0.1186 0.1387 -0.0008 0.0017  -0.0005 49   GLY A O   
756  N  N   . ILE A 50 ? 0.0574 0.0942 0.1504 0.0003  0.0022  -0.0091 50   ILE A N   
757  C  CA  . ILE A 50 ? 0.0591 0.0986 0.1369 -0.0008 -0.0026 0.0033  50   ILE A CA  
758  C  C   . ILE A 50 ? 0.0660 0.1320 0.1467 -0.0100 0.0077  0.0184  50   ILE A C   
759  O  O   . ILE A 50 ? 0.0714 0.1522 0.1669 -0.0161 0.0252  -0.0143 50   ILE A O   
760  C  CB  . ILE A 50 ? 0.0630 0.1170 0.1365 -0.0010 -0.0076 -0.0068 50   ILE A CB  
761  C  CG1 . ILE A 50 ? 0.0793 0.1219 0.1643 -0.0199 -0.0245 0.0167  50   ILE A CG1 
762  C  CG2 . ILE A 50 ? 0.1191 0.1086 0.1073 0.0148  -0.0092 0.0062  50   ILE A CG2 
763  C  CD1 . ILE A 50 ? 0.0706 0.1530 0.1700 0.0024  -0.0035 0.0420  50   ILE A CD1 
775  N  N   . GLY A 51 ? 0.0695 0.0950 0.1308 -0.0183 -0.0018 0.0083  51   GLY A N   
776  C  CA  . GLY A 51 ? 0.0833 0.1159 0.1377 -0.0181 0.0093  0.0072  51   GLY A CA  
777  C  C   . GLY A 51 ? 0.1331 0.1560 0.1233 -0.0113 0.0018  0.0120  51   GLY A C   
778  O  O   . GLY A 51 ? 0.3513 0.1693 0.1598 -0.0423 -0.0413 0.0454  51   GLY A O   
782  N  N   . GLY A 52 ? 0.0903 0.1887 0.0876 -0.0339 0.0031  0.0123  52   GLY A N   
783  C  CA  . GLY A 52 ? 0.0763 0.1888 0.0987 0.0021  0.0069  -0.0041 52   GLY A CA  
784  C  C   . GLY A 52 ? 0.0870 0.1131 0.0998 -0.0065 0.0096  -0.0002 52   GLY A C   
785  O  O   . GLY A 52 ? 0.1173 0.1423 0.1054 -0.0374 0.0101  -0.0019 52   GLY A O   
789  N  N   . PHE A 53 ? 0.1022 0.1907 0.1012 -0.0573 0.0166  -0.0186 53   PHE A N   
790  C  CA  . PHE A 53 ? 0.1045 0.1378 0.1072 -0.0450 0.0168  -0.0266 53   PHE A CA  
791  C  C   . PHE A 53 ? 0.1020 0.1333 0.1475 -0.0473 0.0125  -0.0431 53   PHE A C   
792  O  O   . PHE A 53 ? 0.0927 0.1413 0.1615 -0.0368 0.0117  -0.0328 53   PHE A O   
793  C  CB  . PHE A 53 ? 0.1400 0.1355 0.1014 -0.0311 0.0152  -0.0236 53   PHE A CB  
794  C  CG  . PHE A 53 ? 0.1766 0.1316 0.1301 -0.0194 0.0120  -0.0248 53   PHE A CG  
795  C  CD1 . PHE A 53 ? 0.1854 0.2124 0.1728 0.0304  0.0630  0.0018  53   PHE A CD1 
796  C  CD2 . PHE A 53 ? 0.2540 0.1352 0.1939 -0.0419 0.0020  -0.0226 53   PHE A CD2 
797  C  CE1 . PHE A 53 ? 0.2995 0.3210 0.1964 0.1470  0.1193  0.0598  53   PHE A CE1 
798  C  CE2 . PHE A 53 ? 0.4376 0.1263 0.2078 -0.0045 -0.0738 -0.0393 53   PHE A CE2 
799  C  CZ  . PHE A 53 ? 0.4538 0.2173 0.1584 0.1483  0.0268  0.0190  53   PHE A CZ  
809  N  N   . ILE A 54 ? 0.0954 0.1368 0.1301 -0.0380 -0.0018 -0.0310 54   ILE A N   
810  C  CA  . ILE A 54 ? 0.0921 0.1357 0.1272 -0.0432 -0.0039 -0.0152 54   ILE A CA  
811  C  C   . ILE A 54 ? 0.0894 0.1156 0.1288 -0.0416 0.0036  -0.0170 54   ILE A C   
812  O  O   . ILE A 54 ? 0.1207 0.1259 0.1577 -0.0341 0.0123  -0.0249 54   ILE A O   
813  C  CB  . ILE A 54 ? 0.0940 0.1131 0.1276 -0.0204 -0.0156 -0.0128 54   ILE A CB  
814  C  CG1 . ILE A 54 ? 0.0773 0.1076 0.1408 -0.0030 0.0139  -0.0083 54   ILE A CG1 
815  C  CG2 . ILE A 54 ? 0.1352 0.1338 0.1321 -0.0502 -0.0208 -0.0065 54   ILE A CG2 
816  C  CD1 . ILE A 54 ? 0.1039 0.1351 0.1266 -0.0291 0.0006  -0.0252 54   ILE A CD1 
828  N  N   . LYS A 55 ? 0.0911 0.1424 0.1433 -0.0407 0.0004  -0.0107 55   LYS A N   
829  C  CA  . LYS A 55 ? 0.0834 0.2143 0.1051 -0.0460 0.0206  -0.0350 55   LYS A CA  
830  C  C   . LYS A 55 ? 0.0979 0.1627 0.0883 -0.0402 0.0103  -0.0398 55   LYS A C   
831  O  O   . LYS A 55 ? 0.1266 0.1429 0.1191 -0.0291 0.0263  -0.0372 55   LYS A O   
832  C  CB  . LYS A 55 ? 0.1020 0.2219 0.0966 -0.0428 0.0114  -0.0329 55   LYS A CB  
833  C  CG  . LYS A 55 ? 0.1685 0.2348 0.1076 -0.0523 0.0391  -0.0236 55   LYS A CG  
834  C  CD  . LYS A 55 ? 0.3237 0.4222 0.1764 -0.1905 -0.0882 0.1114  55   LYS A CD  
835  C  CE  . LYS A 55 ? 0.5392 0.7093 0.2966 -0.4204 -0.3012 0.3202  55   LYS A CE  
836  N  NZ  . LYS A 55 ? 0.3258 0.4642 0.4120 -0.2260 -0.1752 0.1856  55   LYS A NZ  
850  N  N   . VAL A 56 ? 0.0865 0.1369 0.1048 -0.0096 0.0242  -0.0312 56   VAL A N   
851  C  CA  . VAL A 56 ? 0.0665 0.1336 0.1166 0.0060  0.0128  -0.0046 56   VAL A CA  
852  C  C   . VAL A 56 ? 0.1075 0.1063 0.1266 -0.0226 0.0157  -0.0109 56   VAL A C   
853  O  O   . VAL A 56 ? 0.0834 0.1947 0.1450 0.0015  0.0063  -0.0569 56   VAL A O   
854  C  CB  . VAL A 56 ? 0.0899 0.1393 0.1331 0.0232  0.0153  0.0084  56   VAL A CB  
855  C  CG1 . VAL A 56 ? 0.0893 0.1809 0.1250 0.0103  -0.0006 0.0299  56   VAL A CG1 
856  C  CG2 . VAL A 56 ? 0.1356 0.1327 0.2065 0.0240  0.0513  0.0297  56   VAL A CG2 
866  N  N   . ARG A 57 ? 0.0869 0.1217 0.1008 -0.0220 -0.0010 -0.0054 57   ARG A N   
867  C  CA  . ARG A 57 ? 0.0848 0.1016 0.1197 -0.0181 -0.0037 -0.0247 57   ARG A CA  
868  C  C   . ARG A 57 ? 0.0725 0.1173 0.1337 -0.0160 -0.0276 -0.0130 57   ARG A C   
869  O  O   . ARG A 57 ? 0.1236 0.0975 0.1315 -0.0058 -0.0082 -0.0265 57   ARG A O   
870  C  CB  . ARG A 57 ? 0.0959 0.1549 0.1159 0.0087  0.0138  0.0141  57   ARG A CB  
871  C  CG  . ARG A 57 ? 0.1026 0.1558 0.1374 0.0060  -0.0092 0.0229  57   ARG A CG  
872  C  CD  . ARG A 57 ? 0.1266 0.1460 0.1483 0.0220  -0.0081 -0.0079 57   ARG A CD  
873  N  NE  . ARG A 57 ? 0.1112 0.1475 0.1465 0.0124  -0.0114 -0.0159 57   ARG A NE  
874  C  CZ  . ARG A 57 ? 0.1819 0.1187 0.1302 0.0299  -0.0052 0.0118  57   ARG A CZ  
875  N  NH1 . ARG A 57 ? 0.1928 0.1743 0.2439 -0.0396 -0.0682 0.0035  57   ARG A NH1 
876  N  NH2 . ARG A 57 ? 0.1965 0.2875 0.1177 0.0670  -0.0179 -0.0339 57   ARG A NH2 
890  N  N   . GLN A 58 ? 0.0808 0.1161 0.1281 -0.0164 -0.0092 -0.0200 58   GLN A N   
891  C  CA  . GLN A 58 ? 0.0465 0.1208 0.1264 -0.0015 0.0001  -0.0131 58   GLN A CA  
892  C  C   . GLN A 58 ? 0.0406 0.1498 0.1399 -0.0028 -0.0091 -0.0107 58   GLN A C   
893  O  O   . GLN A 58 ? 0.0571 0.1265 0.1408 -0.0139 -0.0105 -0.0182 58   GLN A O   
894  C  CB  . GLN A 58 ? 0.0620 0.1282 0.1991 -0.0148 0.0107  -0.0566 58   GLN A CB  
895  C  CG  . GLN A 58 ? 0.0654 0.1152 0.2348 -0.0136 0.0065  -0.0583 58   GLN A CG  
896  C  CD  . GLN A 58 ? 0.0613 0.1408 0.2414 -0.0063 0.0462  -0.0469 58   GLN A CD  
897  O  OE1 . GLN A 58 ? 0.1315 0.1679 0.3282 -0.0275 0.1065  -0.0690 58   GLN A OE1 
898  N  NE2 . GLN A 58 ? 0.1666 0.1287 0.2069 0.0177  0.0398  -0.0404 58   GLN A NE2 
907  N  N   . TYR A 59 ? 0.0557 0.1224 0.1384 -0.0207 -0.0065 -0.0072 59   TYR A N   
908  C  CA  . TYR A 59 ? 0.0536 0.1028 0.1539 -0.0154 -0.0017 -0.0237 59   TYR A CA  
909  C  C   . TYR A 59 ? 0.0728 0.1114 0.1196 -0.0188 -0.0009 -0.0237 59   TYR A C   
910  O  O   . TYR A 59 ? 0.0911 0.1134 0.1688 -0.0241 -0.0303 -0.0167 59   TYR A O   
911  C  CB  . TYR A 59 ? 0.0687 0.1240 0.1572 -0.0020 0.0023  -0.0240 59   TYR A CB  
912  C  CG  . TYR A 59 ? 0.0692 0.1106 0.1145 -0.0070 0.0190  -0.0357 59   TYR A CG  
913  C  CD1 . TYR A 59 ? 0.0591 0.1347 0.1452 -0.0058 0.0124  -0.0037 59   TYR A CD1 
914  C  CD2 . TYR A 59 ? 0.0709 0.1251 0.1103 -0.0077 0.0051  -0.0250 59   TYR A CD2 
915  C  CE1 . TYR A 59 ? 0.0930 0.1159 0.1563 -0.0025 0.0048  -0.0160 59   TYR A CE1 
916  C  CE2 . TYR A 59 ? 0.0835 0.1467 0.1517 0.0077  0.0363  0.0011  59   TYR A CE2 
917  C  CZ  . TYR A 59 ? 0.1065 0.1256 0.2035 0.0108  -0.0047 0.0138  59   TYR A CZ  
918  O  OH  . TYR A 59 ? 0.1441 0.1356 0.2235 0.0286  -0.0024 0.0227  59   TYR A OH  
928  N  N   . ASP A 60 ? 0.0666 0.1114 0.1494 -0.0195 -0.0253 -0.0078 60   ASP A N   
929  C  CA  . ASP A 60 ? 0.0867 0.1084 0.1379 0.0007  -0.0060 -0.0215 60   ASP A CA  
930  C  C   . ASP A 60 ? 0.0748 0.1148 0.1540 -0.0175 -0.0093 -0.0117 60   ASP A C   
931  O  O   . ASP A 60 ? 0.0686 0.1442 0.1549 -0.0130 -0.0241 -0.0244 60   ASP A O   
932  C  CB  . ASP A 60 ? 0.1027 0.1350 0.2092 -0.0439 0.0106  -0.0783 60   ASP A CB  
933  C  CG  . ASP A 60 ? 0.1141 0.1796 0.1800 -0.0371 0.0149  -0.0875 60   ASP A CG  
934  O  OD1 . ASP A 60 ? 0.0997 0.1871 0.2200 -0.0301 0.0213  -0.0983 60   ASP A OD1 
935  O  OD2 . ASP A 60 ? 0.1515 0.3584 0.1955 -0.0495 0.0039  -0.1229 60   ASP A OD2 
940  N  N   . GLN A 61 ? 0.0884 0.1267 0.1508 -0.0223 -0.0262 -0.0046 61   GLN A N   
941  C  CA  . GLN A 61 ? 0.0820 0.0950 0.1496 -0.0196 -0.0304 -0.0104 61   GLN A CA  
942  C  C   . GLN A 61 ? 0.0766 0.1110 0.2163 -0.0167 -0.0083 -0.0227 61   GLN A C   
943  O  O   . GLN A 61 ? 0.0794 0.1537 0.2095 -0.0353 0.0044  -0.0192 61   GLN A O   
944  C  CB  . GLN A 61 ? 0.1061 0.1822 0.1526 -0.0569 -0.0208 -0.0334 61   GLN A CB  
945  C  CG  . GLN A 61 ? 0.6160 0.1845 0.2620 -0.2398 0.1242  -0.0588 61   GLN A CG  
946  C  CD  . GLN A 61 ? 0.3670 0.2447 0.3126 -0.1728 0.0356  -0.0058 61   GLN A CD  
947  O  OE1 . GLN A 61 ? 0.1310 0.1921 0.3430 0.0007  -0.0083 0.0628  61   GLN A OE1 
948  N  NE2 . GLN A 61 ? 0.4359 0.4086 0.2394 -0.3366 -0.0660 0.0313  61   GLN A NE2 
957  N  N   . ILE A 62 ? 0.0671 0.0923 0.1396 -0.0117 0.0011  -0.0062 62   ILE A N   
958  C  CA  . ILE A 62 ? 0.0519 0.1131 0.1396 -0.0113 0.0155  -0.0147 62   ILE A CA  
959  C  C   . ILE A 62 ? 0.0574 0.1413 0.1413 -0.0115 -0.0028 -0.0209 62   ILE A C   
960  O  O   . ILE A 62 ? 0.0532 0.1067 0.1474 0.0081  0.0166  -0.0266 62   ILE A O   
961  C  CB  . ILE A 62 ? 0.0502 0.1039 0.1475 -0.0067 -0.0102 -0.0277 62   ILE A CB  
962  C  CG1 . ILE A 62 ? 0.0719 0.1279 0.1458 -0.0129 0.0039  0.0008  62   ILE A CG1 
963  C  CG2 . ILE A 62 ? 0.0709 0.1008 0.1610 0.0150  0.0122  -0.0094 62   ILE A CG2 
964  C  CD1 . ILE A 62 ? 0.0906 0.1633 0.1397 -0.0041 -0.0137 -0.0112 62   ILE A CD1 
976  N  N   . PRO A 63 ? 0.0518 0.1126 0.1360 -0.0105 -0.0046 -0.0196 63   PRO A N   
977  C  CA  . PRO A 63 ? 0.0677 0.0992 0.1362 -0.0081 0.0011  -0.0170 63   PRO A CA  
978  C  C   . PRO A 63 ? 0.0652 0.0971 0.1461 0.0056  -0.0141 -0.0220 63   PRO A C   
979  O  O   . PRO A 63 ? 0.0803 0.0968 0.1530 -0.0015 -0.0089 -0.0081 63   PRO A O   
980  C  CB  . PRO A 63 ? 0.0562 0.1437 0.1494 -0.0019 -0.0009 0.0063  63   PRO A CB  
981  C  CG  . PRO A 63 ? 0.0507 0.1102 0.1612 0.0059  0.0054  -0.0091 63   PRO A CG  
982  C  CD  . PRO A 63 ? 0.0540 0.1180 0.1434 0.0131  0.0038  -0.0239 63   PRO A CD  
990  N  N   . VAL A 64 ? 0.0861 0.0872 0.1253 0.0026  -0.0132 -0.0198 64   VAL A N   
991  C  CA  . VAL A 64 ? 0.0745 0.1075 0.1208 0.0001  -0.0097 -0.0175 64   VAL A CA  
992  C  C   . VAL A 64 ? 0.0995 0.0787 0.1288 -0.0082 -0.0204 -0.0196 64   VAL A C   
993  O  O   . VAL A 64 ? 0.1634 0.1003 0.1483 0.0317  -0.0383 -0.0265 64   VAL A O   
994  C  CB  . VAL A 64 ? 0.0793 0.1327 0.1262 -0.0076 -0.0077 -0.0340 64   VAL A CB  
995  C  CG1 . VAL A 64 ? 0.0976 0.1330 0.1720 -0.0281 -0.0013 -0.0404 64   VAL A CG1 
996  C  CG2 . VAL A 64 ? 0.1126 0.1392 0.1316 -0.0122 -0.0045 0.0069  64   VAL A CG2 
1006 N  N   . GLU A 65 ? 0.0820 0.1213 0.1215 0.0109  -0.0145 -0.0254 65   GLU A N   
1007 C  CA  . GLU A 65 ? 0.0858 0.1286 0.1243 -0.0025 -0.0044 -0.0047 65   GLU A CA  
1008 C  C   . GLU A 65 ? 0.1129 0.1163 0.1509 0.0073  -0.0389 -0.0416 65   GLU A C   
1009 O  O   . GLU A 65 ? 0.1144 0.1090 0.2394 0.0072  -0.0338 -0.0418 65   GLU A O   
1010 C  CB  . GLU A 65 ? 0.1460 0.2282 0.1611 0.0333  0.0462  -0.0241 65   GLU A CB  
1011 C  CG  . GLU A 65 ? 0.2576 0.7934 0.2107 -0.0151 0.0858  0.1890  65   GLU A CG  
1012 C  CD  . GLU A 65 ? 0.7149 1.5553 0.3397 0.0265  0.4114  0.1082  65   GLU A CD  
1013 O  OE1 . GLU A 65 ? 0.5298 2.0000 1.0345 -0.1471 0.6089  -0.1296 65   GLU A OE1 
1014 O  OE2 . GLU A 65 ? 0.9103 1.2992 0.3509 0.5341  0.3121  0.2315  65   GLU A OE2 
1017 N  N   . ILE A 66 ? 0.0781 0.1075 0.1685 -0.0040 -0.0025 -0.0272 66   ILE A N   
1018 C  CA  . ILE A 66 ? 0.0822 0.1020 0.1552 0.0000  -0.0092 -0.0130 66   ILE A CA  
1019 C  C   . ILE A 66 ? 0.0737 0.1387 0.1559 0.0234  -0.0046 -0.0248 66   ILE A C   
1020 O  O   . ILE A 66 ? 0.1297 0.1470 0.1335 0.0196  -0.0161 -0.0181 66   ILE A O   
1021 C  CB  . ILE A 66 ? 0.0804 0.1203 0.1599 -0.0061 0.0043  -0.0120 66   ILE A CB  
1022 C  CG1 . ILE A 66 ? 0.0996 0.1766 0.1604 -0.0251 0.0278  -0.0165 66   ILE A CG1 
1023 C  CG2 . ILE A 66 ? 0.0801 0.1500 0.2143 -0.0122 0.0054  -0.0059 66   ILE A CG2 
1024 C  CD1 . ILE A 66 ? 0.0955 0.1771 0.1792 -0.0311 0.0437  -0.0225 66   ILE A CD1 
1036 N  N   . CYS A 67 ? 0.1484 0.1550 0.1658 0.0429  -0.0145 -0.0375 67   CYS A N   
1037 C  CA  . CYS A 67 ? 0.1672 0.2722 0.1543 0.0004  0.0183  -0.0567 67   CYS A CA  
1038 C  C   . CYS A 67 ? 0.2223 0.2271 0.1558 0.0179  -0.0356 -0.0177 67   CYS A C   
1039 O  O   . CYS A 67 ? 0.4131 0.2511 0.1186 0.0882  -0.0639 -0.0492 67   CYS A O   
1040 C  CB  . CYS A 67 ? 0.1720 0.3203 0.1094 0.0992  0.0045  0.0842  67   CYS A CB  
1041 S  SG  . CYS A 67 ? 0.2213 0.3055 0.2530 -0.0114 -0.0448 -0.0839 67   CYS A SG  
1044 N  N   . GLY A 68 ? 0.1771 0.2330 0.1706 0.0112  0.0615  -0.0574 68   GLY A N   
1045 C  CA  . GLY A 68 ? 0.2447 0.2495 0.1648 0.0215  0.0963  -0.0118 68   GLY A CA  
1046 C  C   . GLY A 68 ? 0.1511 0.2352 0.2396 0.0107  0.0916  -0.0123 68   GLY A C   
1047 O  O   . GLY A 68 ? 0.2620 0.3074 0.3067 -0.0569 0.1836  -0.0402 68   GLY A O   
1051 N  N   . HIS A 69 ? 0.1064 0.1984 0.1688 0.0059  0.0338  -0.0107 69   HIS A N   
1052 C  CA  . HIS A 69 ? 0.1077 0.1683 0.1607 -0.0336 0.0404  0.0114  69   HIS A CA  
1053 C  C   . HIS A 69 ? 0.1550 0.1234 0.1797 0.0016  0.0065  0.0051  69   HIS A C   
1054 O  O   . HIS A 69 ? 0.2090 0.1219 0.1960 -0.0229 -0.0207 0.0148  69   HIS A O   
1055 C  CB  . HIS A 69 ? 0.1409 0.1710 0.1310 0.0155  0.0397  0.0203  69   HIS A CB  
1056 C  CG  . HIS A 69 ? 0.1472 0.2214 0.1398 0.0020  0.0303  0.0336  69   HIS A CG  
1057 N  ND1 . HIS A 69 ? 0.2413 0.2544 0.2181 0.0019  -0.0537 0.0714  69   HIS A ND1 
1058 C  CD2 . HIS A 69 ? 0.1647 0.2883 0.1698 -0.0457 -0.0126 0.0243  69   HIS A CD2 
1059 C  CE1 . HIS A 69 ? 0.3313 0.3686 0.2348 0.0819  -0.0969 0.0595  69   HIS A CE1 
1060 N  NE2 . HIS A 69 ? 0.1732 0.3788 0.1756 -0.0504 -0.0186 0.0580  69   HIS A NE2 
1068 N  N   . LYS A 70 ? 0.1855 0.1325 0.1527 -0.0221 0.0206  0.0082  70   LYS A N   
1069 C  CA  . LYS A 70 ? 0.0988 0.1670 0.1811 -0.0286 0.0141  0.0216  70   LYS A CA  
1070 C  C   . LYS A 70 ? 0.1315 0.1345 0.1551 -0.0246 -0.0049 0.0038  70   LYS A C   
1071 O  O   . LYS A 70 ? 0.2153 0.1316 0.1857 0.0080  -0.0097 0.0042  70   LYS A O   
1072 C  CB  . LYS A 70 ? 0.2115 0.3239 0.2579 -0.1545 0.0690  -0.0457 70   LYS A CB  
1077 N  N   . ALA A 71 ? 0.1068 0.0977 0.1548 -0.0117 -0.0053 -0.0153 71   ALA A N   
1078 C  CA  . ALA A 71 ? 0.0905 0.0953 0.1459 -0.0089 -0.0124 -0.0030 71   ALA A CA  
1079 C  C   . ALA A 71 ? 0.0894 0.0967 0.1729 -0.0028 -0.0365 -0.0396 71   ALA A C   
1080 O  O   . ALA A 71 ? 0.0831 0.0952 0.1828 -0.0114 -0.0206 -0.0162 71   ALA A O   
1081 C  CB  . ALA A 71 ? 0.0774 0.1063 0.1589 -0.0063 -0.0305 0.0049  71   ALA A CB  
1087 N  N   . ILE A 72 ? 0.0560 0.0940 0.1521 -0.0208 -0.0133 -0.0100 72   ILE A N   
1088 C  CA  . ILE A 72 ? 0.0616 0.0837 0.1405 -0.0145 -0.0078 -0.0106 72   ILE A CA  
1089 C  C   . ILE A 72 ? 0.0698 0.0842 0.1516 -0.0045 -0.0027 -0.0159 72   ILE A C   
1090 O  O   . ILE A 72 ? 0.0606 0.0849 0.1901 -0.0094 -0.0106 -0.0303 72   ILE A O   
1091 C  CB  . ILE A 72 ? 0.0628 0.0912 0.1420 -0.0245 -0.0128 -0.0159 72   ILE A CB  
1092 C  CG1 . ILE A 72 ? 0.0749 0.0915 0.1472 -0.0128 -0.0035 -0.0119 72   ILE A CG1 
1093 C  CG2 . ILE A 72 ? 0.0764 0.1411 0.1386 -0.0164 -0.0141 -0.0322 72   ILE A CG2 
1094 C  CD1 . ILE A 72 ? 0.0627 0.1013 0.1925 -0.0038 0.0172  0.0079  72   ILE A CD1 
1106 N  N   . GLY A 73 ? 0.0561 0.0955 0.1327 -0.0144 -0.0161 -0.0132 73   GLY A N   
1107 C  CA  . GLY A 73 ? 0.0789 0.1265 0.1211 0.0144  -0.0187 -0.0093 73   GLY A CA  
1108 C  C   . GLY A 73 ? 0.0897 0.0641 0.1342 -0.0080 0.0175  -0.0450 73   GLY A C   
1109 O  O   . GLY A 73 ? 0.0569 0.0993 0.1465 -0.0022 0.0023  -0.0112 73   GLY A O   
1113 N  N   . THR A 74 ? 0.0573 0.0875 0.1512 -0.0094 0.0015  -0.0309 74   THR A N   
1114 C  CA  . THR A 74 ? 0.0541 0.0992 0.1434 0.0026  -0.0098 -0.0184 74   THR A CA  
1115 C  C   . THR A 74 ? 0.0620 0.0920 0.1579 -0.0104 -0.0110 -0.0111 74   THR A C   
1116 O  O   . THR A 74 ? 0.0674 0.0905 0.1450 0.0011  -0.0093 -0.0215 74   THR A O   
1117 C  CB  . THR A 74 ? 0.0604 0.1179 0.1421 -0.0135 0.0002  -0.0230 74   THR A CB  
1118 O  OG1 . THR A 74 ? 0.1113 0.1499 0.1819 -0.0271 0.0279  -0.0623 74   THR A OG1 
1119 C  CG2 . THR A 74 ? 0.0859 0.1280 0.1248 0.0073  -0.0020 -0.0252 74   THR A CG2 
1127 N  N   . VAL A 75 ? 0.0398 0.0891 0.1643 -0.0128 0.0089  -0.0094 75   VAL A N   
1128 C  CA  . VAL A 75 ? 0.0480 0.0895 0.1604 -0.0123 0.0104  -0.0151 75   VAL A CA  
1129 C  C   . VAL A 75 ? 0.0565 0.0798 0.1415 -0.0170 0.0048  -0.0227 75   VAL A C   
1130 O  O   . VAL A 75 ? 0.0725 0.1026 0.1502 -0.0228 -0.0074 -0.0325 75   VAL A O   
1131 C  CB  . VAL A 75 ? 0.0675 0.1081 0.1377 -0.0086 0.0086  -0.0227 75   VAL A CB  
1132 C  CG1 . VAL A 75 ? 0.0748 0.1102 0.1585 -0.0082 0.0408  -0.0313 75   VAL A CG1 
1133 C  CG2 . VAL A 75 ? 0.0684 0.1523 0.1547 0.0278  0.0022  0.0158  75   VAL A CG2 
1143 N  N   . LEU A 76 ? 0.0453 0.1015 0.1223 0.0009  -0.0008 -0.0036 76   LEU A N   
1144 C  CA  . LEU A 76 ? 0.0702 0.1160 0.1176 -0.0048 0.0180  -0.0047 76   LEU A CA  
1145 C  C   . LEU A 76 ? 0.0681 0.0986 0.1390 -0.0150 -0.0177 -0.0080 76   LEU A C   
1146 O  O   . LEU A 76 ? 0.1103 0.1082 0.1445 0.0033  -0.0404 -0.0126 76   LEU A O   
1147 C  CB  . LEU A 76 ? 0.0633 0.1078 0.1317 -0.0203 0.0077  -0.0186 76   LEU A CB  
1148 C  CG  . LEU A 76 ? 0.0634 0.0889 0.1327 -0.0243 0.0040  -0.0170 76   LEU A CG  
1149 C  CD1 . LEU A 76 ? 0.0698 0.0959 0.1770 -0.0196 0.0164  -0.0091 76   LEU A CD1 
1150 C  CD2 . LEU A 76 ? 0.0882 0.0965 0.1568 -0.0202 -0.0184 -0.0174 76   LEU A CD2 
1162 N  N   . VAL A 77 ? 0.0807 0.1035 0.1032 -0.0094 0.0035  -0.0294 77   VAL A N   
1163 C  CA  . VAL A 77 ? 0.0678 0.1011 0.1201 0.0063  -0.0014 -0.0061 77   VAL A CA  
1164 C  C   . VAL A 77 ? 0.0589 0.1138 0.1204 0.0068  -0.0051 -0.0040 77   VAL A C   
1165 O  O   . VAL A 77 ? 0.0870 0.1196 0.1175 0.0035  -0.0026 -0.0037 77   VAL A O   
1166 C  CB  . VAL A 77 ? 0.0603 0.1260 0.1557 -0.0093 0.0070  -0.0120 77   VAL A CB  
1167 C  CG1 . VAL A 77 ? 0.0650 0.1403 0.1456 0.0178  -0.0002 -0.0181 77   VAL A CG1 
1168 C  CG2 . VAL A 77 ? 0.0757 0.1400 0.1511 -0.0006 0.0200  -0.0131 77   VAL A CG2 
1178 N  N   . GLY A 78 ? 0.0866 0.1137 0.1167 -0.0078 0.0094  -0.0010 78   GLY A N   
1179 C  CA  . GLY A 78 ? 0.1057 0.1385 0.1088 -0.0145 0.0091  0.0068  78   GLY A CA  
1180 C  C   . GLY A 78 ? 0.0882 0.0937 0.1449 0.0088  0.0121  -0.0017 78   GLY A C   
1181 O  O   . GLY A 78 ? 0.0817 0.1152 0.1367 -0.0139 0.0086  -0.0067 78   GLY A O   
1185 N  N   . PRO A 79 ? 0.1127 0.1079 0.1352 -0.0086 0.0168  -0.0073 79   PRO A N   
1186 C  CA  . PRO A 79 ? 0.1166 0.1033 0.1530 -0.0085 -0.0035 0.0044  79   PRO A CA  
1187 C  C   . PRO A 79 ? 0.0809 0.1313 0.1422 0.0110  0.0224  -0.0068 79   PRO A C   
1188 O  O   . PRO A 79 ? 0.1090 0.1797 0.1549 -0.0320 0.0241  -0.0058 79   PRO A O   
1189 C  CB  . PRO A 79 ? 0.1498 0.1039 0.1771 -0.0028 0.0098  0.0247  79   PRO A CB  
1190 C  CG  . PRO A 79 ? 0.1540 0.1384 0.1508 -0.0289 0.0168  0.0203  79   PRO A CG  
1191 C  CD  . PRO A 79 ? 0.0906 0.1529 0.1366 -0.0060 0.0049  -0.0012 79   PRO A CD  
1199 N  N   . THR A 80 ? 0.0690 0.1355 0.1582 -0.0039 0.0115  0.0109  80   THR A N   
1200 C  CA  . THR A 80 ? 0.0660 0.1291 0.1662 -0.0077 0.0133  0.0145  80   THR A CA  
1201 C  C   . THR A 80 ? 0.0772 0.0913 0.1634 0.0124  -0.0034 0.0273  80   THR A C   
1202 O  O   . THR A 80 ? 0.0903 0.1166 0.1755 0.0127  -0.0013 0.0297  80   THR A O   
1203 C  CB  . THR A 80 ? 0.0901 0.1167 0.1304 -0.0129 0.0207  -0.0115 80   THR A CB  
1204 O  OG1 . THR A 80 ? 0.0622 0.1541 0.1651 -0.0027 0.0230  0.0269  80   THR A OG1 
1205 C  CG2 . THR A 80 ? 0.0702 0.1682 0.1688 0.0000  0.0182  0.0378  80   THR A CG2 
1213 N  N   . PRO A 81 ? 0.0816 0.0888 0.1735 0.0009  0.0045  0.0248  81   PRO A N   
1214 C  CA  . PRO A 81 ? 0.0808 0.1102 0.1878 -0.0007 -0.0176 0.0206  81   PRO A CA  
1215 C  C   . PRO A 81 ? 0.0743 0.0998 0.1993 -0.0193 -0.0100 -0.0183 81   PRO A C   
1216 O  O   . PRO A 81 ? 0.0966 0.0918 0.2563 -0.0115 0.0134  -0.0229 81   PRO A O   
1217 C  CB  . PRO A 81 ? 0.0745 0.1694 0.2677 -0.0382 0.0079  -0.0001 81   PRO A CB  
1218 C  CG  . PRO A 81 ? 0.0848 0.2998 0.5020 0.0539  -0.0769 -0.1807 81   PRO A CG  
1219 C  CD  . PRO A 81 ? 0.0686 0.1096 0.2817 -0.0003 0.0128  0.0083  81   PRO A CD  
1227 N  N   . VAL A 82 ? 0.0560 0.0922 0.1867 -0.0157 -0.0025 -0.0139 82   VAL A N   
1228 C  CA  . VAL A 82 ? 0.0824 0.1054 0.1909 -0.0094 0.0051  -0.0247 82   VAL A CA  
1229 C  C   . VAL A 82 ? 0.0653 0.0664 0.2030 0.0162  0.0284  -0.0120 82   VAL A C   
1230 O  O   . VAL A 82 ? 0.1515 0.0666 0.2169 -0.0131 0.1020  -0.0138 82   VAL A O   
1231 C  CB  . VAL A 82 ? 0.1104 0.1555 0.2066 -0.0098 -0.0109 0.0175  82   VAL A CB  
1232 C  CG1 . VAL A 82 ? 0.2900 0.2273 0.2787 -0.0969 -0.1733 0.0694  82   VAL A CG1 
1233 C  CG2 . VAL A 82 ? 0.0817 0.2434 0.2388 0.0352  0.0054  0.0235  82   VAL A CG2 
1243 N  N   . ASN A 83 ? 0.0830 0.0857 0.1381 -0.0037 0.0131  -0.0425 83   ASN A N   
1244 C  CA  . ASN A 83 ? 0.0699 0.0917 0.1320 -0.0073 0.0036  -0.0222 83   ASN A CA  
1245 C  C   . ASN A 83 ? 0.0763 0.0966 0.1287 -0.0007 0.0236  -0.0067 83   ASN A C   
1246 O  O   . ASN A 83 ? 0.1046 0.1327 0.1124 0.0249  0.0231  0.0063  83   ASN A O   
1247 C  CB  . ASN A 83 ? 0.0801 0.0982 0.1406 0.0027  0.0152  -0.0121 83   ASN A CB  
1248 C  CG  . ASN A 83 ? 0.0770 0.1237 0.1412 0.0044  -0.0021 -0.0249 83   ASN A CG  
1249 O  OD1 . ASN A 83 ? 0.1052 0.1186 0.1406 0.0016  0.0063  -0.0119 83   ASN A OD1 
1250 N  ND2 . ASN A 83 ? 0.0950 0.1186 0.1301 0.0258  0.0134  0.0066  83   ASN A ND2 
1257 N  N   . ILE A 84 ? 0.0587 0.0817 0.1726 -0.0120 0.0014  -0.0146 84   ILE A N   
1258 C  CA  . ILE A 84 ? 0.0655 0.0841 0.1908 -0.0122 -0.0015 -0.0190 84   ILE A CA  
1259 C  C   . ILE A 84 ? 0.0744 0.0707 0.1322 -0.0132 0.0120  -0.0407 84   ILE A C   
1260 O  O   . ILE A 84 ? 0.0780 0.0829 0.1500 -0.0172 -0.0001 -0.0253 84   ILE A O   
1261 C  CB  . ILE A 84 ? 0.0679 0.0782 0.2892 -0.0087 0.0534  -0.0215 84   ILE A CB  
1262 C  CG1 . ILE A 84 ? 0.0812 0.1010 0.3758 -0.0234 0.0892  -0.0559 84   ILE A CG1 
1263 C  CG2 . ILE A 84 ? 0.1225 0.1001 0.1918 0.0121  0.0204  -0.0286 84   ILE A CG2 
1264 C  CD1 . ILE A 84 ? 0.0643 0.3982 0.2733 -0.0791 -0.0057 0.0971  84   ILE A CD1 
1276 N  N   . ILE A 85 ? 0.0541 0.0837 0.1518 -0.0127 0.0023  -0.0337 85   ILE A N   
1277 C  CA  . ILE A 85 ? 0.0586 0.0848 0.1380 -0.0108 0.0112  -0.0201 85   ILE A CA  
1278 C  C   . ILE A 85 ? 0.0563 0.0747 0.1276 -0.0180 0.0070  -0.0210 85   ILE A C   
1279 O  O   . ILE A 85 ? 0.0704 0.1116 0.1384 0.0043  -0.0045 -0.0433 85   ILE A O   
1280 C  CB  . ILE A 85 ? 0.0748 0.1000 0.1451 -0.0038 0.0241  -0.0308 85   ILE A CB  
1281 C  CG1 . ILE A 85 ? 0.0999 0.1379 0.1358 0.0401  0.0180  -0.0109 85   ILE A CG1 
1282 C  CG2 . ILE A 85 ? 0.0909 0.1137 0.1379 -0.0024 0.0299  0.0020  85   ILE A CG2 
1283 C  CD1 . ILE A 85 ? 0.1003 0.1748 0.1482 0.0351  0.0091  -0.0590 85   ILE A CD1 
1295 N  N   . GLY A 86 ? 0.0507 0.0883 0.1145 -0.0040 0.0055  -0.0083 86   GLY A N   
1296 C  CA  . GLY A 86 ? 0.0518 0.1047 0.0865 0.0014  0.0184  0.0149  86   GLY A CA  
1297 C  C   . GLY A 86 ? 0.0494 0.0846 0.1059 -0.0048 0.0014  -0.0083 86   GLY A C   
1298 O  O   . GLY A 86 ? 0.0481 0.0740 0.1116 -0.0054 0.0037  -0.0085 86   GLY A O   
1302 N  N   . ARG A 87 ? 0.0522 0.0899 0.1083 -0.0070 0.0041  -0.0161 87   ARG A N   
1303 C  CA  . ARG A 87 ? 0.0501 0.0845 0.1030 -0.0032 0.0045  -0.0274 87   ARG A CA  
1304 C  C   . ARG A 87 ? 0.0297 0.0790 0.1166 0.0111  0.0125  -0.0173 87   ARG A C   
1305 O  O   . ARG A 87 ? 0.0545 0.0866 0.1402 -0.0023 0.0043  0.0001  87   ARG A O   
1306 C  CB  . ARG A 87 ? 0.0385 0.1058 0.1258 0.0001  0.0014  -0.0389 87   ARG A CB  
1307 C  CG  . ARG A 87 ? 0.0400 0.0882 0.0999 0.0003  0.0016  -0.0189 87   ARG A CG  
1308 C  CD  . ARG A 87 ? 0.0450 0.1235 0.1285 0.0195  -0.0098 -0.0216 87   ARG A CD  
1309 N  NE  . ARG A 87 ? 0.0658 0.1014 0.1320 -0.0008 0.0294  -0.0276 87   ARG A NE  
1310 C  CZ  . ARG A 87 ? 0.0670 0.1011 0.1469 0.0140  0.0183  -0.0376 87   ARG A CZ  
1311 N  NH1 . ARG A 87 ? 0.0979 0.0881 0.1321 0.0084  -0.0167 -0.0335 87   ARG A NH1 
1312 N  NH2 . ARG A 87 ? 0.0914 0.1043 0.1484 -0.0061 0.0202  -0.0360 87   ARG A NH2 
1326 N  N   . ASN A 88 ? 0.0509 0.0768 0.1273 -0.0087 -0.0043 -0.0074 88   ASN A N   
1327 C  CA  . ASN A 88 ? 0.0447 0.0760 0.1397 0.0002  -0.0031 -0.0211 88   ASN A CA  
1328 C  C   . ASN A 88 ? 0.0489 0.0670 0.1290 -0.0044 -0.0065 -0.0119 88   ASN A C   
1329 O  O   . ASN A 88 ? 0.0703 0.0809 0.2074 -0.0139 0.0354  -0.0194 88   ASN A O   
1330 C  CB  . ASN A 88 ? 0.0588 0.0946 0.1153 -0.0060 0.0009  -0.0366 88   ASN A CB  
1331 C  CG  . ASN A 88 ? 0.0518 0.0908 0.1306 -0.0028 0.0067  -0.0085 88   ASN A CG  
1332 O  OD1 . ASN A 88 ? 0.0744 0.0844 0.1512 -0.0014 -0.0094 -0.0137 88   ASN A OD1 
1333 N  ND2 . ASN A 88 ? 0.0576 0.1030 0.1440 -0.0055 -0.0040 -0.0163 88   ASN A ND2 
1340 N  N   . LEU A 89 ? 0.0506 0.0641 0.1284 -0.0020 0.0035  -0.0069 89   LEU A N   
1341 C  CA  . LEU A 89 ? 0.0322 0.0891 0.1411 0.0081  -0.0010 -0.0178 89   LEU A CA  
1342 C  C   . LEU A 89 ? 0.0522 0.0827 0.1191 0.0136  0.0031  -0.0227 89   LEU A C   
1343 O  O   . LEU A 89 ? 0.0567 0.0907 0.1475 0.0022  0.0137  -0.0083 89   LEU A O   
1344 C  CB  . LEU A 89 ? 0.0767 0.0857 0.1304 0.0268  -0.0078 -0.0133 89   LEU A CB  
1345 C  CG  . LEU A 89 ? 0.0566 0.0966 0.1306 0.0013  -0.0048 -0.0055 89   LEU A CG  
1346 C  CD1 . LEU A 89 ? 0.1049 0.0993 0.1298 0.0317  0.0027  0.0345  89   LEU A CD1 
1347 C  CD2 . LEU A 89 ? 0.0679 0.1112 0.1184 -0.0239 0.0050  0.0112  89   LEU A CD2 
1359 N  N   . LEU A 90 ? 0.0598 0.0937 0.1188 -0.0068 -0.0071 -0.0010 90   LEU A N   
1360 C  CA  . LEU A 90 ? 0.0543 0.0869 0.1197 0.0029  0.0004  -0.0034 90   LEU A CA  
1361 C  C   . LEU A 90 ? 0.0753 0.0876 0.1329 -0.0152 0.0006  0.0017  90   LEU A C   
1362 O  O   . LEU A 90 ? 0.0955 0.0918 0.1293 -0.0252 -0.0156 0.0042  90   LEU A O   
1363 C  CB  . LEU A 90 ? 0.0741 0.0927 0.1356 -0.0266 -0.0129 -0.0115 90   LEU A CB  
1364 C  CG  . LEU A 90 ? 0.0467 0.0866 0.1795 -0.0066 0.0030  -0.0427 90   LEU A CG  
1365 C  CD1 . LEU A 90 ? 0.0709 0.1236 0.2001 -0.0383 -0.0076 0.0546  90   LEU A CD1 
1366 C  CD2 . LEU A 90 ? 0.1622 0.1033 0.1681 -0.0302 0.0259  -0.0350 90   LEU A CD2 
1378 N  N   . THR A 91 ? 0.0730 0.0887 0.1253 -0.0005 -0.0036 -0.0026 91   THR A N   
1379 C  CA  . THR A 91 ? 0.0758 0.0938 0.1328 0.0177  0.0067  0.0013  91   THR A CA  
1380 C  C   . THR A 91 ? 0.0748 0.0975 0.1135 -0.0008 0.0018  -0.0028 91   THR A C   
1381 O  O   . THR A 91 ? 0.0925 0.0965 0.1588 0.0062  0.0001  0.0170  91   THR A O   
1382 C  CB  A THR A 91 ? 0.0930 0.1160 0.1449 0.0610  0.0139  -0.0123 91   THR A CB  
1383 C  CB  B THR A 91 ? 0.0687 0.0814 0.1089 -0.0100 0.0010  0.0095  91   THR A CB  
1384 O  OG1 A THR A 91 ? 0.0796 0.0880 0.1397 -0.0004 0.0055  -0.0087 91   THR A OG1 
1385 O  OG1 B THR A 91 ? 0.0456 0.0783 0.1152 -0.0114 -0.0210 -0.0229 91   THR A OG1 
1386 C  CG2 A THR A 91 ? 0.0830 0.1658 0.1690 0.0473  0.0011  -0.0587 91   THR A CG2 
1387 C  CG2 B THR A 91 ? 0.0650 0.0653 0.1916 -0.0210 -0.0188 -0.0264 91   THR A CG2 
1400 N  N   . GLN A 92 ? 0.0705 0.0686 0.1436 -0.0178 -0.0194 -0.0051 92   GLN A N   
1401 C  CA  . GLN A 92 ? 0.0735 0.0714 0.1540 -0.0158 -0.0125 0.0175  92   GLN A CA  
1402 C  C   . GLN A 92 ? 0.0744 0.1044 0.1448 -0.0163 -0.0222 0.0270  92   GLN A C   
1403 O  O   . GLN A 92 ? 0.1362 0.1484 0.1486 -0.0705 0.0025  -0.0119 92   GLN A O   
1404 C  CB  . GLN A 92 ? 0.0754 0.0762 0.1328 -0.0191 -0.0137 0.0132  92   GLN A CB  
1405 C  CG  . GLN A 92 ? 0.0728 0.0689 0.1338 -0.0124 0.0079  -0.0084 92   GLN A CG  
1406 C  CD  . GLN A 92 ? 0.0745 0.0742 0.1418 -0.0138 -0.0070 -0.0131 92   GLN A CD  
1407 O  OE1 . GLN A 92 ? 0.0763 0.1171 0.1492 -0.0022 -0.0117 -0.0064 92   GLN A OE1 
1408 N  NE2 . GLN A 92 ? 0.0845 0.1194 0.1494 -0.0007 -0.0084 -0.0223 92   GLN A NE2 
1417 N  N   . ILE A 93 ? 0.0601 0.1369 0.1352 -0.0288 0.0087  0.0020  93   ILE A N   
1418 C  CA  . ILE A 93 ? 0.0890 0.1397 0.1314 -0.0116 0.0245  0.0091  93   ILE A CA  
1419 C  C   . ILE A 93 ? 0.1021 0.1349 0.1417 -0.0280 0.0039  0.0195  93   ILE A C   
1420 O  O   . ILE A 93 ? 0.1312 0.1894 0.1458 -0.0541 -0.0031 0.0003  93   ILE A O   
1421 C  CB  . ILE A 93 ? 0.1115 0.1346 0.1244 -0.0271 -0.0060 0.0005  93   ILE A CB  
1422 C  CG1 . ILE A 93 ? 0.1015 0.1445 0.1281 -0.0130 0.0158  -0.0201 93   ILE A CG1 
1423 C  CG2 . ILE A 93 ? 0.1245 0.1245 0.1699 -0.0146 -0.0218 -0.0032 93   ILE A CG2 
1424 C  CD1 . ILE A 93 ? 0.1347 0.1488 0.2429 -0.0567 0.0204  -0.0552 93   ILE A CD1 
1436 N  N   . GLY A 94 ? 0.0876 0.1337 0.1618 -0.0284 -0.0246 -0.0018 94   GLY A N   
1437 C  CA  . GLY A 94 ? 0.1244 0.1159 0.2070 -0.0240 -0.0360 0.0258  94   GLY A CA  
1438 C  C   . GLY A 94 ? 0.0809 0.1406 0.1769 0.0012  -0.0271 0.0375  94   GLY A C   
1439 O  O   . GLY A 94 ? 0.1272 0.1646 0.1748 0.0067  -0.0426 0.0394  94   GLY A O   
1443 N  N   . CYS A 95 ? 0.0851 0.1607 0.1122 -0.0297 -0.0277 0.0122  95   CYS A N   
1444 C  CA  . CYS A 95 ? 0.1022 0.1798 0.1165 -0.0415 -0.0292 0.0129  95   CYS A CA  
1445 C  C   . CYS A 95 ? 0.0887 0.2021 0.1496 -0.0640 -0.0181 -0.0174 95   CYS A C   
1446 O  O   . CYS A 95 ? 0.0970 0.2565 0.1528 -0.0471 -0.0157 -0.0347 95   CYS A O   
1447 C  CB  A CYS A 95 ? 0.3967 0.0532 0.3029 -0.0261 0.0781  -0.0202 95   CYS A CB  
1448 C  CB  B CYS A 95 ? 0.1664 0.1740 0.1365 -0.0653 -0.1063 0.0148  95   CYS A CB  
1449 S  SG  A CYS A 95 ? 0.1510 0.1652 0.1487 -0.0424 0.0142  0.0114  95   CYS A SG  
1450 S  SG  B CYS A 95 ? 0.1087 0.1898 0.1303 -0.0634 -0.0126 -0.0171 95   CYS A SG  
1453 N  N   . THR A 96 ? 0.0856 0.2357 0.1376 -0.0303 -0.0132 0.0116  96   THR A N   
1454 C  CA  . THR A 96 ? 0.0940 0.1686 0.1365 -0.0275 -0.0090 0.0039  96   THR A CA  
1455 C  C   . THR A 96 ? 0.0765 0.1653 0.0923 -0.0148 -0.0065 0.0111  96   THR A C   
1456 O  O   . THR A 96 ? 0.0939 0.1583 0.1648 -0.0291 0.0225  -0.0086 96   THR A O   
1457 C  CB  . THR A 96 ? 0.1122 0.1925 0.1949 -0.0478 -0.0209 0.0451  96   THR A CB  
1458 O  OG1 . THR A 96 ? 0.1430 0.2629 0.1737 -0.0923 -0.0536 0.0671  96   THR A OG1 
1459 C  CG2 . THR A 96 ? 0.1859 0.1957 0.1951 -0.0946 0.0218  0.0280  96   THR A CG2 
1467 N  N   . LEU A 97 ? 0.0819 0.1776 0.1120 -0.0084 -0.0042 0.0097  97   LEU A N   
1468 C  CA  . LEU A 97 ? 0.0689 0.1501 0.1142 -0.0014 0.0013  0.0018  97   LEU A CA  
1469 C  C   . LEU A 97 ? 0.1275 0.2009 0.1162 -0.0117 -0.0241 0.0253  97   LEU A C   
1470 O  O   . LEU A 97 ? 0.1776 0.1958 0.1683 0.0184  -0.0476 0.0366  97   LEU A O   
1471 C  CB  . LEU A 97 ? 0.0870 0.1875 0.0925 0.0070  0.0047  0.0020  97   LEU A CB  
1472 C  CG  . LEU A 97 ? 0.0886 0.1446 0.1482 -0.0160 0.0067  0.0209  97   LEU A CG  
1473 C  CD1 . LEU A 97 ? 0.1679 0.2183 0.1602 -0.0263 0.0331  0.0628  97   LEU A CD1 
1474 C  CD2 . LEU A 97 ? 0.2039 0.1563 0.1877 -0.0424 -0.0535 -0.0006 97   LEU A CD2 
1486 N  N   . ASN A 98 ? 0.1037 0.2285 0.1378 -0.0636 -0.0382 0.0310  98   ASN A N   
1487 C  CA  . ASN A 98 ? 0.1271 0.2857 0.1395 -0.0916 -0.0400 0.0666  98   ASN A CA  
1488 C  C   . ASN A 98 ? 0.1289 0.2314 0.1508 -0.0745 -0.0607 0.0815  98   ASN A C   
1489 O  O   . ASN A 98 ? 0.1020 0.2402 0.2284 -0.0691 -0.0156 0.0707  98   ASN A O   
1490 C  CB  . ASN A 98 ? 0.1711 0.3870 0.1429 -0.1460 -0.0191 0.0420  98   ASN A CB  
1491 C  CG  . ASN A 98 ? 0.1596 0.4052 0.1503 -0.1467 0.0129  0.0056  98   ASN A CG  
1492 O  OD1 . ASN A 98 ? 0.3255 0.4355 0.2604 -0.2631 -0.1621 0.1796  98   ASN A OD1 
1493 N  ND2 . ASN A 98 ? 0.1705 0.3947 0.1485 -0.1668 -0.0071 0.0078  98   ASN A ND2 
1500 N  N   . PHE A 99 ? 0.1241 0.2514 0.1423 -0.0545 -0.0407 0.0160  99   PHE A N   
1501 C  CA  . PHE A 99 ? 0.0881 0.2274 0.2218 -0.0571 -0.0220 0.0375  99   PHE A CA  
1502 C  C   . PHE A 99 ? 0.1055 0.2667 0.2040 0.0054  -0.0129 -0.0151 99   PHE A C   
1503 O  O   . PHE A 99 ? 0.3026 0.2545 0.4222 0.0089  -0.2279 0.0171  99   PHE A O   
1504 C  CB  . PHE A 99 ? 0.1019 0.3823 0.1406 -0.0925 -0.0404 0.0631  99   PHE A CB  
1505 C  CG  . PHE A 99 ? 0.1442 0.2583 0.1686 -0.0518 -0.0488 0.0527  99   PHE A CG  
1506 C  CD1 . PHE A 99 ? 0.1581 0.4273 0.1309 -0.0135 -0.0210 0.0447  99   PHE A CD1 
1507 C  CD2 . PHE A 99 ? 0.2059 0.3744 0.2059 0.0524  -0.0663 0.0094  99   PHE A CD2 
1508 C  CE1 . PHE A 99 ? 0.1916 0.4723 0.1439 0.0328  0.0083  0.0549  99   PHE A CE1 
1509 C  CE2 . PHE A 99 ? 0.2191 0.4976 0.2241 0.0594  -0.0460 -0.0117 99   PHE A CE2 
1510 C  CZ  . PHE A 99 ? 0.1518 0.4798 0.1810 -0.0264 0.0043  0.0308  99   PHE A CZ  
1511 O  OXT . PHE A 99 ? 0.1308 0.2715 0.3053 -0.0452 -0.0608 0.0762  99   PHE A OXT 
1521 N  N   . PRO B 1  ? 0.2395 0.3514 0.3676 -0.0952 -0.1846 0.1309  1    PRO B N   
1522 C  CA  . PRO B 1  ? 0.1932 0.3172 0.2550 0.0143  -0.0918 0.0335  1    PRO B CA  
1523 C  C   . PRO B 1  ? 0.1711 0.2102 0.2277 -0.0272 -0.0911 0.0696  1    PRO B C   
1524 O  O   . PRO B 1  ? 0.2011 0.2259 0.3518 -0.0292 -0.0877 0.0316  1    PRO B O   
1525 C  CB  . PRO B 1  ? 0.2496 0.5966 0.3394 -0.0254 0.0091  0.0666  1    PRO B CB  
1526 C  CG  . PRO B 1  ? 0.3139 0.4675 0.5333 -0.0147 0.1205  0.0418  1    PRO B CG  
1527 C  CD  . PRO B 1  ? 0.3791 0.5147 0.5763 -0.2148 0.0103  -0.0426 1    PRO B CD  
1535 N  N   . GLN B 2  ? 0.2204 0.2376 0.2121 -0.0559 -0.1111 0.0817  2    GLN B N   
1536 C  CA  . GLN B 2  ? 0.2023 0.2222 0.2131 -0.0956 -0.1170 0.1104  2    GLN B CA  
1537 C  C   . GLN B 2  ? 0.1726 0.1844 0.2404 -0.0053 -0.1114 0.0420  2    GLN B C   
1538 O  O   . GLN B 2  ? 0.2979 0.1576 0.3181 0.0154  -0.1173 0.0534  2    GLN B O   
1539 C  CB  . GLN B 2  ? 0.2409 0.2479 0.3080 -0.1299 -0.1149 0.1435  2    GLN B CB  
1540 C  CG  . GLN B 2  ? 0.2189 0.3251 0.3201 -0.1271 -0.0800 0.1697  2    GLN B CG  
1541 C  CD  . GLN B 2  ? 0.2655 0.2455 0.3372 -0.1189 -0.0475 0.1441  2    GLN B CD  
1542 O  OE1 . GLN B 2  ? 0.3908 0.3425 0.3449 -0.2310 -0.0601 0.1262  2    GLN B OE1 
1543 N  NE2 . GLN B 2  ? 0.4190 0.3478 0.2852 -0.1992 -0.0448 0.1415  2    GLN B NE2 
1552 N  N   . ILE B 3  ? 0.1923 0.1521 0.1468 0.0004  -0.0440 0.0210  3    ILE B N   
1553 C  CA  . ILE B 3  ? 0.1550 0.1999 0.1500 0.0090  -0.0257 -0.0136 3    ILE B CA  
1554 C  C   . ILE B 3  ? 0.1772 0.1249 0.2408 -0.0076 -0.0886 0.0178  3    ILE B C   
1555 O  O   . ILE B 3  ? 0.1533 0.1634 0.1314 -0.0106 -0.0250 0.0136  3    ILE B O   
1556 C  CB  . ILE B 3  ? 0.1770 0.2491 0.1365 -0.0131 -0.0237 0.0111  3    ILE B CB  
1557 C  CG1 . ILE B 3  ? 0.1759 0.2905 0.1806 -0.0473 -0.0449 0.0652  3    ILE B CG1 
1558 C  CG2 . ILE B 3  ? 0.2118 0.2438 0.1347 0.0714  -0.0166 -0.0039 3    ILE B CG2 
1559 C  CD1 . ILE B 3  ? 0.2721 0.4082 0.1841 -0.1709 -0.0933 0.0565  3    ILE B CD1 
1571 N  N   . THR B 4  ? 0.2071 0.1024 0.2466 0.0102  -0.1010 0.0290  4    THR B N   
1572 C  CA  . THR B 4  ? 0.1906 0.1145 0.1522 0.0212  -0.0610 -0.0231 4    THR B CA  
1573 C  C   . THR B 4  ? 0.1552 0.1502 0.1502 -0.0131 -0.0657 -0.0081 4    THR B C   
1574 O  O   . THR B 4  ? 0.1149 0.1553 0.1904 0.0348  -0.0548 -0.0057 4    THR B O   
1575 C  CB  . THR B 4  ? 0.2080 0.1234 0.2524 0.0037  -0.0891 0.0075  4    THR B CB  
1576 O  OG1 . THR B 4  ? 0.4063 0.1443 0.3468 0.0332  -0.0668 -0.1080 4    THR B OG1 
1577 C  CG2 . THR B 4  ? 0.4273 0.1313 0.2646 -0.0698 -0.1768 0.0267  4    THR B CG2 
1585 N  N   . LEU B 5  ? 0.1155 0.0929 0.1618 -0.0064 -0.0287 -0.0109 5    LEU B N   
1586 C  CA  . LEU B 5  ? 0.0814 0.0779 0.1579 -0.0066 -0.0183 -0.0144 5    LEU B CA  
1587 C  C   . LEU B 5  ? 0.0723 0.0832 0.1503 0.0098  -0.0051 -0.0242 5    LEU B C   
1588 O  O   . LEU B 5  ? 0.0541 0.0880 0.1573 -0.0025 -0.0124 -0.0206 5    LEU B O   
1589 C  CB  . LEU B 5  ? 0.0859 0.0928 0.1320 -0.0124 0.0068  -0.0167 5    LEU B CB  
1590 C  CG  . LEU B 5  ? 0.0870 0.1059 0.1536 -0.0183 0.0093  -0.0343 5    LEU B CG  
1591 C  CD1 . LEU B 5  ? 0.1171 0.1162 0.1833 -0.0131 0.0242  -0.0525 5    LEU B CD1 
1592 C  CD2 . LEU B 5  ? 0.0900 0.1234 0.1589 -0.0258 0.0020  -0.0130 5    LEU B CD2 
1604 N  N   . TRP B 6  ? 0.1009 0.0828 0.1378 0.0026  -0.0163 -0.0114 6    TRP B N   
1605 C  CA  . TRP B 6  ? 0.0975 0.0782 0.1457 -0.0049 -0.0137 -0.0094 6    TRP B CA  
1606 C  C   . TRP B 6  ? 0.0923 0.0818 0.1393 -0.0136 -0.0078 -0.0350 6    TRP B C   
1607 O  O   . TRP B 6  ? 0.0886 0.1344 0.1348 -0.0164 -0.0059 -0.0150 6    TRP B O   
1608 C  CB  . TRP B 6  ? 0.0915 0.0754 0.2030 -0.0135 -0.0308 -0.0132 6    TRP B CB  
1609 C  CG  . TRP B 6  ? 0.1103 0.0612 0.1856 0.0098  -0.0314 0.0046  6    TRP B CG  
1610 C  CD1 . TRP B 6  ? 0.1297 0.1631 0.2584 -0.0128 -0.0715 0.0676  6    TRP B CD1 
1611 C  CD2 . TRP B 6  ? 0.0944 0.1080 0.1514 0.0427  0.0111  0.0034  6    TRP B CD2 
1612 N  NE1 . TRP B 6  ? 0.1720 0.1303 0.2672 -0.0234 -0.0645 0.0929  6    TRP B NE1 
1613 C  CE2 . TRP B 6  ? 0.1330 0.1528 0.2395 -0.0131 -0.0331 0.0761  6    TRP B CE2 
1614 C  CE3 . TRP B 6  ? 0.0940 0.1403 0.2021 0.0236  0.0050  0.0464  6    TRP B CE3 
1615 C  CZ2 . TRP B 6  ? 0.1664 0.1574 0.2071 -0.0495 -0.0180 0.0657  6    TRP B CZ2 
1616 C  CZ3 . TRP B 6  ? 0.0973 0.1383 0.3618 -0.0048 -0.0250 0.1514  6    TRP B CZ3 
1617 C  CH2 . TRP B 6  ? 0.1110 0.1833 0.2771 -0.0194 0.0049  0.0846  6    TRP B CH2 
1628 N  N   . LYS B 7  ? 0.0913 0.1025 0.1246 0.0016  -0.0103 -0.0262 7    LYS B N   
1629 C  CA  . LYS B 7  ? 0.0842 0.1176 0.1594 0.0095  0.0212  -0.0279 7    LYS B CA  
1630 C  C   . LYS B 7  ? 0.0585 0.1071 0.1780 0.0179  0.0192  -0.0268 7    LYS B C   
1631 O  O   . LYS B 7  ? 0.0780 0.1057 0.1698 -0.0112 0.0141  -0.0141 7    LYS B O   
1632 C  CB  . LYS B 7  ? 0.1071 0.1540 0.2325 0.0326  0.0002  -0.1016 7    LYS B CB  
1633 C  CG  . LYS B 7  ? 0.2302 0.1519 0.2537 0.0051  -0.0096 -0.0881 7    LYS B CG  
1634 C  CD  . LYS B 7  ? 0.2418 0.1653 0.3656 -0.0691 -0.1202 -0.0485 7    LYS B CD  
1635 C  CE  . LYS B 7  ? 0.2305 0.2084 0.6159 0.0342  -0.1969 -0.2151 7    LYS B CE  
1636 N  NZ  . LYS B 7  ? 0.3792 0.2136 0.2841 0.0923  -0.0759 -0.0165 7    LYS B NZ  
1650 N  N   . ARG B 8  ? 0.0650 0.1417 0.1537 -0.0218 0.0213  -0.0639 8    ARG B N   
1651 C  CA  . ARG B 8  ? 0.0747 0.1143 0.1499 -0.0023 0.0066  -0.0373 8    ARG B CA  
1652 C  C   . ARG B 8  ? 0.0572 0.1463 0.1598 0.0131  -0.0021 -0.0425 8    ARG B C   
1653 O  O   . ARG B 8  ? 0.0757 0.1230 0.1913 0.0007  -0.0220 -0.0628 8    ARG B O   
1654 C  CB  . ARG B 8  ? 0.0635 0.1332 0.1769 -0.0036 0.0173  -0.0197 8    ARG B CB  
1655 C  CG  . ARG B 8  ? 0.0732 0.1365 0.1939 0.0271  0.0212  -0.0005 8    ARG B CG  
1656 C  CD  . ARG B 8  ? 0.0739 0.2036 0.1465 -0.0021 0.0038  -0.0126 8    ARG B CD  
1657 N  NE  . ARG B 8  ? 0.1345 0.2624 0.2095 0.0104  -0.0063 0.0557  8    ARG B NE  
1658 C  CZ  . ARG B 8  ? 0.2490 0.4346 0.2573 -0.1519 -0.1272 0.1597  8    ARG B CZ  
1659 N  NH1 . ARG B 8  ? 0.2477 0.2786 0.3722 -0.1245 -0.0727 0.1476  8    ARG B NH1 
1660 N  NH2 . ARG B 8  ? 0.2266 0.4191 0.1996 0.0791  0.0699  0.1258  8    ARG B NH2 
1674 N  N   . PRO B 9  ? 0.0635 0.1016 0.1801 0.0131  -0.0215 -0.0338 9    PRO B N   
1675 C  CA  . PRO B 9  ? 0.0556 0.1162 0.1712 0.0025  -0.0140 -0.0310 9    PRO B CA  
1676 C  C   . PRO B 9  ? 0.0552 0.1106 0.1614 0.0033  -0.0227 -0.0272 9    PRO B C   
1677 O  O   . PRO B 9  ? 0.0826 0.0914 0.1926 -0.0087 -0.0120 -0.0232 9    PRO B O   
1678 C  CB  . PRO B 9  ? 0.0784 0.1265 0.1740 -0.0051 -0.0050 -0.0367 9    PRO B CB  
1679 C  CG  . PRO B 9  ? 0.0738 0.1210 0.1781 0.0012  0.0103  -0.0329 9    PRO B CG  
1680 C  CD  . PRO B 9  ? 0.0686 0.0988 0.1912 0.0105  -0.0070 -0.0324 9    PRO B CD  
1688 N  N   . LEU B 10 ? 0.0492 0.1311 0.2613 -0.0020 -0.0022 -0.0767 10   LEU B N   
1689 C  CA  . LEU B 10 ? 0.0504 0.1052 0.2627 -0.0080 -0.0076 -0.0532 10   LEU B CA  
1690 C  C   . LEU B 10 ? 0.0441 0.0797 0.3360 0.0041  0.0033  -0.0287 10   LEU B C   
1691 O  O   . LEU B 10 ? 0.0801 0.0954 0.4238 -0.0088 -0.0506 -0.0130 10   LEU B O   
1692 C  CB  . LEU B 10 ? 0.0932 0.1832 0.3014 0.0083  0.0372  -0.1030 10   LEU B CB  
1693 C  CG  . LEU B 10 ? 0.1597 0.2685 0.2293 0.0773  0.0206  -0.1670 10   LEU B CG  
1694 C  CD1 . LEU B 10 ? 0.5445 0.2539 0.1952 -0.0231 0.1031  -0.1210 10   LEU B CD1 
1695 C  CD2 . LEU B 10 ? 0.2992 0.2618 0.1591 0.0933  -0.0482 -0.1146 10   LEU B CD2 
1707 N  N   . VAL B 11 ? 0.0593 0.0902 0.2155 -0.0036 0.0041  0.0101  11   VAL B N   
1708 C  CA  . VAL B 11 ? 0.0666 0.1014 0.2004 -0.0014 0.0180  0.0227  11   VAL B CA  
1709 C  C   . VAL B 11 ? 0.0624 0.1339 0.1818 0.0204  0.0169  0.0502  11   VAL B C   
1710 O  O   . VAL B 11 ? 0.0668 0.1138 0.1847 -0.0009 -0.0011 0.0456  11   VAL B O   
1711 C  CB  . VAL B 11 ? 0.0795 0.1266 0.1955 0.0087  0.0312  0.0322  11   VAL B CB  
1712 C  CG1 . VAL B 11 ? 0.0904 0.1980 0.2462 -0.0381 0.0509  -0.0317 11   VAL B CG1 
1713 C  CG2 . VAL B 11 ? 0.1002 0.1426 0.2014 0.0020  0.0175  -0.0008 11   VAL B CG2 
1723 N  N   . THR B 12 ? 0.0687 0.0844 0.1915 0.0163  0.0092  0.0179  12   THR B N   
1724 C  CA  . THR B 12 ? 0.0644 0.1068 0.1788 0.0111  0.0130  0.0003  12   THR B CA  
1725 C  C   . THR B 12 ? 0.0799 0.1126 0.1710 0.0064  0.0114  0.0008  12   THR B C   
1726 O  O   . THR B 12 ? 0.0975 0.1130 0.1752 -0.0194 -0.0121 0.0090  12   THR B O   
1727 C  CB  . THR B 12 ? 0.0739 0.0980 0.3082 0.0140  -0.0197 -0.0160 12   THR B CB  
1728 O  OG1 . THR B 12 ? 0.1133 0.1175 0.2733 0.0136  -0.0056 -0.0260 12   THR B OG1 
1729 C  CG2 . THR B 12 ? 0.0695 0.1498 0.3339 0.0339  -0.0084 -0.0304 12   THR B CG2 
1737 N  N   . ILE B 13 ? 0.0856 0.1098 0.1370 0.0004  -0.0273 -0.0062 13   ILE B N   
1738 C  CA  . ILE B 13 ? 0.0811 0.1144 0.1116 0.0036  -0.0429 -0.0094 13   ILE B CA  
1739 C  C   . ILE B 13 ? 0.0842 0.0985 0.1732 0.0101  -0.0267 -0.0039 13   ILE B C   
1740 O  O   . ILE B 13 ? 0.0596 0.1155 0.2091 -0.0146 -0.0165 -0.0348 13   ILE B O   
1741 C  CB  . ILE B 13 ? 0.0693 0.1029 0.1399 -0.0009 -0.0078 0.0103  13   ILE B CB  
1742 C  CG1 . ILE B 13 ? 0.0757 0.1092 0.1622 -0.0048 0.0126  0.0200  13   ILE B CG1 
1743 C  CG2 . ILE B 13 ? 0.0731 0.1132 0.1508 -0.0131 0.0100  -0.0042 13   ILE B CG2 
1744 C  CD1 . ILE B 13 ? 0.0991 0.1094 0.1591 0.0055  0.0052  0.0206  13   ILE B CD1 
1756 N  N   . ARG B 14 ? 0.0776 0.1278 0.1368 -0.0211 0.0119  0.0080  14   ARG B N   
1757 C  CA  . ARG B 14 ? 0.0631 0.0935 0.2119 0.0098  -0.0008 -0.0056 14   ARG B CA  
1758 C  C   . ARG B 14 ? 0.0515 0.1047 0.1685 0.0006  -0.0162 -0.0102 14   ARG B C   
1759 O  O   . ARG B 14 ? 0.1073 0.1058 0.1511 -0.0167 -0.0015 -0.0018 14   ARG B O   
1760 C  CB  . ARG B 14 ? 0.0874 0.1130 0.2511 -0.0086 -0.0210 0.0317  14   ARG B CB  
1761 C  CG  . ARG B 14 ? 0.0766 0.2013 0.3274 0.0385  -0.0460 -0.0484 14   ARG B CG  
1762 C  CD  . ARG B 14 ? 0.0898 0.6957 0.6560 0.0278  -0.0563 0.3675  14   ARG B CD  
1763 N  NE  . ARG B 14 ? 0.1885 0.6649 0.7997 0.1759  0.1193  0.4477  14   ARG B NE  
1764 C  CZ  . ARG B 14 ? 0.2324 0.7072 0.7972 0.3056  0.2346  0.5359  14   ARG B CZ  
1765 N  NH1 . ARG B 14 ? 0.1171 0.8717 0.2871 -0.1138 -0.0636 0.0772  14   ARG B NH1 
1766 N  NH2 . ARG B 14 ? 0.6463 0.6367 0.3820 -0.0121 0.2379  0.1594  14   ARG B NH2 
1780 N  N   . ILE B 15 ? 0.0672 0.0983 0.1622 0.0023  0.0105  -0.0258 15   ILE B N   
1781 C  CA  . ILE B 15 ? 0.0924 0.0929 0.1950 -0.0135 0.0296  -0.0460 15   ILE B CA  
1782 C  C   . ILE B 15 ? 0.1271 0.1601 0.1778 -0.0622 0.0207  -0.0296 15   ILE B C   
1783 O  O   . ILE B 15 ? 0.1103 0.1443 0.1715 -0.0310 0.0180  -0.0157 15   ILE B O   
1784 C  CB  . ILE B 15 ? 0.1329 0.0986 0.1612 -0.0059 -0.0039 -0.0010 15   ILE B CB  
1785 C  CG1 . ILE B 15 ? 0.1402 0.1014 0.1842 -0.0227 -0.0250 0.0040  15   ILE B CG1 
1786 C  CG2 . ILE B 15 ? 0.1095 0.1873 0.2172 0.0066  0.0034  -0.0962 15   ILE B CG2 
1787 C  CD1 . ILE B 15 ? 0.1204 0.1360 0.2515 -0.0310 0.0071  0.0457  15   ILE B CD1 
1799 N  N   . GLY B 16 ? 0.0862 0.1341 0.2132 -0.0271 0.0234  -0.0385 16   GLY B N   
1800 C  CA  . GLY B 16 ? 0.0646 0.1333 0.2471 -0.0144 0.0181  -0.0139 16   GLY B CA  
1801 C  C   . GLY B 16 ? 0.1067 0.1093 0.2857 -0.0295 0.0673  -0.0150 16   GLY B C   
1802 O  O   . GLY B 16 ? 0.0900 0.1928 0.2166 -0.0088 -0.0007 -0.0352 16   GLY B O   
1806 N  N   . GLY B 17 ? 0.0739 0.1324 0.2630 -0.0059 0.0151  -0.0193 17   GLY B N   
1807 C  CA  . GLY B 17 ? 0.0956 0.1703 0.2573 0.0281  -0.0132 -0.0457 17   GLY B CA  
1808 C  C   . GLY B 17 ? 0.0957 0.2121 0.3181 0.0628  -0.0503 -0.0979 17   GLY B C   
1809 O  O   . GLY B 17 ? 0.1017 0.2092 0.5771 0.0692  -0.0801 -0.1877 17   GLY B O   
1813 N  N   . GLN B 18 ? 0.0630 0.1422 0.2306 0.0009  0.0291  -0.0341 18   GLN B N   
1814 C  CA  . GLN B 18 ? 0.0917 0.1487 0.2285 -0.0013 0.0066  -0.0322 18   GLN B CA  
1815 C  C   . GLN B 18 ? 0.0825 0.1262 0.2498 0.0002  0.0233  -0.0597 18   GLN B C   
1816 O  O   . GLN B 18 ? 0.0947 0.1285 0.2694 -0.0148 0.0333  -0.0750 18   GLN B O   
1817 C  CB  . GLN B 18 ? 0.0788 0.1410 0.2874 -0.0066 -0.0159 -0.0122 18   GLN B CB  
1818 C  CG  . GLN B 18 ? 0.1452 0.2334 0.2876 0.0058  0.0127  0.0420  18   GLN B CG  
1819 C  CD  . GLN B 18 ? 0.2803 0.1207 0.3079 0.0356  -0.0309 0.0111  18   GLN B CD  
1820 O  OE1 . GLN B 18 ? 0.1409 0.2236 0.4712 0.0332  -0.0015 0.0432  18   GLN B OE1 
1821 N  NE2 . GLN B 18 ? 0.4183 0.2274 0.3120 0.0070  -0.1145 -0.0820 18   GLN B NE2 
1830 N  N   . LEU B 19 ? 0.0568 0.1465 0.2852 -0.0032 0.0112  -0.0891 19   LEU B N   
1831 C  CA  . LEU B 19 ? 0.0757 0.1148 0.1944 0.0116  0.0123  -0.0289 19   LEU B CA  
1832 C  C   . LEU B 19 ? 0.0696 0.1173 0.1845 -0.0164 0.0099  -0.0344 19   LEU B C   
1833 O  O   . LEU B 19 ? 0.0863 0.2508 0.1943 -0.0112 0.0174  -0.0379 19   LEU B O   
1834 C  CB  . LEU B 19 ? 0.2322 0.1070 0.2963 0.0051  -0.1113 -0.0475 19   LEU B CB  
1835 C  CG  . LEU B 19 ? 0.2571 0.1675 0.2173 0.0798  -0.0060 -0.0146 19   LEU B CG  
1836 C  CD1 . LEU B 19 ? 0.2123 0.1527 0.4921 0.0562  0.0511  0.0671  19   LEU B CD1 
1837 C  CD2 . LEU B 19 ? 0.4886 0.3752 0.2892 0.1663  0.1634  0.0596  19   LEU B CD2 
1849 N  N   . LYS B 20 ? 0.0659 0.1250 0.1865 -0.0033 0.0058  -0.0018 20   LYS B N   
1850 C  CA  . LYS B 20 ? 0.0724 0.1471 0.1491 -0.0108 -0.0004 -0.0245 20   LYS B CA  
1851 C  C   . LYS B 20 ? 0.0815 0.1123 0.1298 -0.0158 0.0049  -0.0444 20   LYS B C   
1852 O  O   . LYS B 20 ? 0.1225 0.1660 0.1434 -0.0477 -0.0067 -0.0201 20   LYS B O   
1853 C  CB  . LYS B 20 ? 0.0773 0.1523 0.1691 -0.0239 -0.0342 0.0181  20   LYS B CB  
1854 C  CG  . LYS B 20 ? 0.0833 0.1573 0.1884 0.0065  0.0028  0.0530  20   LYS B CG  
1855 C  CD  . LYS B 20 ? 0.1605 0.1462 0.1819 -0.0138 0.0064  0.0464  20   LYS B CD  
1856 C  CE  . LYS B 20 ? 0.1585 0.1644 0.1690 -0.0361 -0.0072 -0.0067 20   LYS B CE  
1857 N  NZ  . LYS B 20 ? 0.0813 0.1955 0.1697 0.0034  0.0060  0.0138  20   LYS B NZ  
1871 N  N   . GLU B 21 ? 0.0704 0.1284 0.1298 -0.0130 0.0121  -0.0198 21   GLU B N   
1872 C  CA  . GLU B 21 ? 0.0682 0.0921 0.1643 -0.0002 0.0158  -0.0101 21   GLU B CA  
1873 C  C   . GLU B 21 ? 0.0994 0.0766 0.1570 -0.0078 0.0323  0.0002  21   GLU B C   
1874 O  O   . GLU B 21 ? 0.1096 0.1031 0.1704 0.0056  0.0457  0.0148  21   GLU B O   
1875 C  CB  A GLU B 21 ? 0.0409 0.0999 0.2042 0.0372  -0.0159 -0.0310 21   GLU B CB  
1876 C  CB  B GLU B 21 ? 0.1458 0.2036 0.4619 -0.0586 0.0134  -0.2090 21   GLU B CB  
1877 C  CG  A GLU B 21 ? 0.0672 0.0833 0.2358 0.0236  -0.0365 -0.0251 21   GLU B CG  
1878 C  CG  B GLU B 21 ? 0.0855 0.2610 0.5944 0.0052  -0.0328 -0.2407 21   GLU B CG  
1879 C  CD  A GLU B 21 ? 0.0860 0.1018 0.2424 0.0733  0.0210  -0.0196 21   GLU B CD  
1880 C  CD  B GLU B 21 ? 0.4492 0.4849 0.5880 -0.3402 -0.0535 -0.2188 21   GLU B CD  
1881 O  OE1 A GLU B 21 ? 0.1124 0.2468 0.3696 -0.0051 0.0171  0.0733  21   GLU B OE1 
1882 O  OE1 B GLU B 21 ? 0.3892 0.4175 0.5897 -0.1816 -0.0337 -0.2412 21   GLU B OE1 
1883 O  OE2 A GLU B 21 ? 0.1148 0.1223 0.2028 0.0871  0.0075  -0.0185 21   GLU B OE2 
1884 O  OE2 B GLU B 21 ? 0.2314 0.2863 0.5873 0.0489  -0.1572 -0.2786 21   GLU B OE2 
1895 N  N   . ALA B 22 ? 0.0564 0.1121 0.1163 0.0022  -0.0058 -0.0096 22   ALA B N   
1896 C  CA  . ALA B 22 ? 0.0438 0.0854 0.1424 -0.0146 -0.0028 -0.0080 22   ALA B CA  
1897 C  C   . ALA B 22 ? 0.0644 0.0908 0.1106 -0.0063 0.0098  0.0055  22   ALA B C   
1898 O  O   . ALA B 22 ? 0.0736 0.1163 0.1264 -0.0030 0.0000  0.0285  22   ALA B O   
1899 C  CB  . ALA B 22 ? 0.0679 0.1312 0.1218 -0.0145 0.0017  -0.0253 22   ALA B CB  
1905 N  N   . LEU B 23 ? 0.0444 0.0895 0.1428 -0.0105 0.0144  0.0055  23   LEU B N   
1906 C  CA  . LEU B 23 ? 0.0481 0.1083 0.1231 -0.0111 0.0155  0.0109  23   LEU B CA  
1907 C  C   . LEU B 23 ? 0.0638 0.0768 0.1448 -0.0120 0.0273  -0.0018 23   LEU B C   
1908 O  O   . LEU B 23 ? 0.0833 0.0902 0.1543 -0.0337 0.0185  -0.0004 23   LEU B O   
1909 C  CB  . LEU B 23 ? 0.0672 0.0946 0.1760 0.0146  -0.0103 0.0151  23   LEU B CB  
1910 C  CG  . LEU B 23 ? 0.0698 0.1228 0.1839 -0.0007 -0.0112 0.0174  23   LEU B CG  
1911 C  CD1 . LEU B 23 ? 0.0906 0.1372 0.2861 -0.0238 -0.0686 0.0071  23   LEU B CD1 
1912 C  CD2 . LEU B 23 ? 0.0659 0.1898 0.2516 0.0071  -0.0376 0.0660  23   LEU B CD2 
1924 N  N   . LEU B 24 ? 0.0536 0.0666 0.1153 0.0051  -0.0032 0.0037  24   LEU B N   
1925 C  CA  . LEU B 24 ? 0.0569 0.0778 0.1197 -0.0075 0.0051  0.0005  24   LEU B CA  
1926 C  C   . LEU B 24 ? 0.0567 0.0776 0.0957 -0.0071 -0.0019 -0.0190 24   LEU B C   
1927 O  O   . LEU B 24 ? 0.0564 0.0808 0.1565 -0.0160 0.0086  -0.0171 24   LEU B O   
1928 C  CB  . LEU B 24 ? 0.0847 0.0713 0.1239 -0.0102 0.0052  0.0011  24   LEU B CB  
1929 C  CG  . LEU B 24 ? 0.1019 0.0929 0.1094 0.0013  -0.0250 -0.0049 24   LEU B CG  
1930 C  CD1 . LEU B 24 ? 0.2558 0.2087 0.2186 0.0622  0.0406  0.1142  24   LEU B CD1 
1931 C  CD2 . LEU B 24 ? 0.1083 0.1246 0.1887 0.0134  -0.0564 -0.0620 24   LEU B CD2 
1943 N  N   . ASP B 25 ? 0.0436 0.0799 0.1225 -0.0147 -0.0020 0.0002  25   ASP B N   
1944 C  CA  . ASP B 25 ? 0.0403 0.0702 0.1231 -0.0109 0.0057  -0.0035 25   ASP B CA  
1945 C  C   . ASP B 25 ? 0.0426 0.0950 0.1367 -0.0074 -0.0035 -0.0175 25   ASP B C   
1946 O  O   . ASP B 25 ? 0.0521 0.0946 0.1313 -0.0186 0.0140  -0.0257 25   ASP B O   
1947 C  CB  . ASP B 25 ? 0.0694 0.0858 0.1183 0.0008  -0.0060 -0.0005 25   ASP B CB  
1948 C  CG  . ASP B 25 ? 0.0639 0.1112 0.1058 0.0298  0.0016  -0.0159 25   ASP B CG  
1949 O  OD1 . ASP B 25 ? 0.0686 0.1040 0.1259 0.0080  -0.0010 -0.0346 25   ASP B OD1 
1950 O  OD2 . ASP B 25 ? 0.1012 0.1348 0.1138 0.0340  0.0040  0.0016  25   ASP B OD2 
1955 N  N   . THR B 26 ? 0.0544 0.0808 0.1326 -0.0139 0.0107  -0.0210 26   THR B N   
1956 C  CA  . THR B 26 ? 0.0499 0.1021 0.1206 -0.0168 -0.0132 -0.0341 26   THR B CA  
1957 C  C   . THR B 26 ? 0.0817 0.0994 0.1357 0.0036  -0.0178 -0.0379 26   THR B C   
1958 O  O   . THR B 26 ? 0.0765 0.0992 0.1279 -0.0067 0.0128  -0.0168 26   THR B O   
1959 C  CB  . THR B 26 ? 0.0570 0.1441 0.1088 -0.0178 -0.0001 -0.0282 26   THR B CB  
1960 O  OG1 . THR B 26 ? 0.0812 0.1149 0.1044 -0.0347 0.0125  -0.0233 26   THR B OG1 
1961 C  CG2 . THR B 26 ? 0.0991 0.1145 0.1399 -0.0156 0.0067  -0.0266 26   THR B CG2 
1969 N  N   . GLY B 27 ? 0.0579 0.0821 0.1416 -0.0183 -0.0090 -0.0203 27   GLY B N   
1970 C  CA  . GLY B 27 ? 0.0559 0.0897 0.1575 0.0075  -0.0068 -0.0197 27   GLY B CA  
1971 C  C   . GLY B 27 ? 0.0651 0.1067 0.1222 -0.0022 -0.0055 0.0102  27   GLY B C   
1972 O  O   . GLY B 27 ? 0.0877 0.1043 0.1494 0.0087  0.0010  0.0049  27   GLY B O   
1976 N  N   . ALA B 28 ? 0.0649 0.0862 0.1216 -0.0131 -0.0113 -0.0041 28   ALA B N   
1977 C  CA  . ALA B 28 ? 0.0769 0.0843 0.1257 -0.0240 -0.0220 0.0153  28   ALA B CA  
1978 C  C   . ALA B 28 ? 0.0735 0.0878 0.1598 -0.0003 -0.0287 -0.0144 28   ALA B C   
1979 O  O   . ALA B 28 ? 0.0790 0.0881 0.1266 -0.0112 -0.0198 -0.0251 28   ALA B O   
1980 C  CB  . ALA B 28 ? 0.0829 0.1262 0.1427 -0.0431 0.0088  -0.0164 28   ALA B CB  
1986 N  N   . ASP B 29 ? 0.0614 0.0877 0.1708 -0.0018 -0.0203 -0.0188 29   ASP B N   
1987 C  CA  . ASP B 29 ? 0.0759 0.1184 0.1746 -0.0089 0.0052  -0.0454 29   ASP B CA  
1988 C  C   . ASP B 29 ? 0.0760 0.1353 0.1344 -0.0042 -0.0060 -0.0541 29   ASP B C   
1989 O  O   . ASP B 29 ? 0.1055 0.1750 0.1237 -0.0022 0.0036  -0.0686 29   ASP B O   
1990 C  CB  . ASP B 29 ? 0.0958 0.1120 0.2174 -0.0033 0.0189  -0.0665 29   ASP B CB  
1991 C  CG  . ASP B 29 ? 0.1034 0.1101 0.4594 -0.0024 -0.0174 0.0108  29   ASP B CG  
1992 O  OD1 . ASP B 29 ? 0.0748 0.1448 0.2964 0.0103  -0.0042 -0.0602 29   ASP B OD1 
1993 O  OD2 . ASP B 29 ? 0.2281 0.1157 0.8289 0.0706  0.0548  0.0990  29   ASP B OD2 
1998 N  N   . ASP B 30 ? 0.0603 0.1294 0.1101 -0.0016 -0.0175 -0.0058 30   ASP B N   
1999 C  CA  . ASP B 30 ? 0.0646 0.1001 0.1373 -0.0150 -0.0014 -0.0121 30   ASP B CA  
2000 C  C   . ASP B 30 ? 0.0709 0.1035 0.1164 -0.0117 -0.0081 -0.0093 30   ASP B C   
2001 O  O   . ASP B 30 ? 0.0784 0.0882 0.1390 -0.0090 -0.0185 -0.0033 30   ASP B O   
2002 C  CB  . ASP B 30 ? 0.0671 0.0934 0.2053 -0.0002 -0.0100 0.0136  30   ASP B CB  
2003 C  CG  . ASP B 30 ? 0.1788 0.0963 0.2701 -0.0207 -0.0466 -0.0205 30   ASP B CG  
2004 O  OD1 . ASP B 30 ? 0.1772 0.1467 0.2368 -0.0269 -0.0332 -0.0248 30   ASP B OD1 
2005 O  OD2 . ASP B 30 ? 0.2516 0.1223 0.3842 0.0214  -0.0747 -0.0668 30   ASP B OD2 
2010 N  N   . THR B 31 ? 0.0687 0.1038 0.1280 -0.0156 -0.0116 -0.0237 31   THR B N   
2011 C  CA  . THR B 31 ? 0.0689 0.0892 0.1079 -0.0135 -0.0087 -0.0045 31   THR B CA  
2012 C  C   . THR B 31 ? 0.0642 0.0834 0.1157 -0.0072 -0.0129 0.0118  31   THR B C   
2013 O  O   . THR B 31 ? 0.0803 0.0998 0.1201 -0.0192 0.0079  -0.0075 31   THR B O   
2014 C  CB  . THR B 31 ? 0.0793 0.1093 0.0790 -0.0065 0.0027  -0.0163 31   THR B CB  
2015 O  OG1 . THR B 31 ? 0.0713 0.1072 0.1098 -0.0157 0.0074  0.0096  31   THR B OG1 
2016 C  CG2 . THR B 31 ? 0.0731 0.1198 0.1126 0.0087  -0.0087 -0.0225 31   THR B CG2 
2024 N  N   . VAL B 32 ? 0.0589 0.0815 0.1199 -0.0184 0.0106  -0.0020 32   VAL B N   
2025 C  CA  . VAL B 32 ? 0.0642 0.0934 0.1166 -0.0100 -0.0005 0.0087  32   VAL B CA  
2026 C  C   . VAL B 32 ? 0.0641 0.0939 0.1068 -0.0079 -0.0085 0.0064  32   VAL B C   
2027 O  O   . VAL B 32 ? 0.0766 0.1073 0.1040 -0.0136 0.0101  -0.0090 32   VAL B O   
2028 C  CB  . VAL B 32 ? 0.0523 0.1205 0.1410 0.0095  0.0004  0.0107  32   VAL B CB  
2029 C  CG1 . VAL B 32 ? 0.0686 0.0998 0.1665 0.0084  -0.0155 0.0031  32   VAL B CG1 
2030 C  CG2 . VAL B 32 ? 0.1143 0.1286 0.1256 -0.0268 -0.0336 0.0349  32   VAL B CG2 
2040 N  N   . LEU B 33 ? 0.0686 0.0783 0.1161 -0.0068 0.0010  -0.0104 33   LEU B N   
2041 C  CA  . LEU B 33 ? 0.0680 0.0879 0.1060 -0.0142 0.0020  -0.0031 33   LEU B CA  
2042 C  C   . LEU B 33 ? 0.0533 0.0923 0.1166 -0.0304 0.0092  -0.0022 33   LEU B C   
2043 O  O   . LEU B 33 ? 0.0642 0.0988 0.1251 -0.0145 -0.0078 0.0219  33   LEU B O   
2044 C  CB  . LEU B 33 ? 0.0882 0.1542 0.1144 0.0351  0.0088  -0.0137 33   LEU B CB  
2045 C  CG  . LEU B 33 ? 0.1442 0.1777 0.1231 0.0180  -0.0434 0.0012  33   LEU B CG  
2046 C  CD1 . LEU B 33 ? 0.1623 0.2595 0.1943 0.0897  -0.0694 -0.0403 33   LEU B CD1 
2047 C  CD2 . LEU B 33 ? 0.2572 0.1421 0.1363 0.0116  -0.0428 0.0193  33   LEU B CD2 
2059 N  N   . GLU B 34 ? 0.0764 0.0976 0.1090 -0.0038 0.0060  -0.0055 34   GLU B N   
2060 C  CA  . GLU B 34 ? 0.0675 0.1128 0.1025 -0.0057 -0.0062 0.0104  34   GLU B CA  
2061 C  C   . GLU B 34 ? 0.0608 0.1154 0.1151 -0.0044 0.0009  0.0063  34   GLU B C   
2062 O  O   . GLU B 34 ? 0.0716 0.1249 0.1343 -0.0182 -0.0040 0.0169  34   GLU B O   
2063 C  CB  . GLU B 34 ? 0.0924 0.1342 0.0946 -0.0230 0.0011  -0.0119 34   GLU B CB  
2064 C  CG  . GLU B 34 ? 0.1013 0.1500 0.1402 -0.0316 0.0214  -0.0283 34   GLU B CG  
2065 C  CD  . GLU B 34 ? 0.1695 0.1736 0.3698 -0.0785 0.0960  -0.1018 34   GLU B CD  
2066 O  OE1 . GLU B 34 ? 0.5691 0.2979 0.5576 -0.2327 0.3450  -0.3025 34   GLU B OE1 
2067 O  OE2 . GLU B 34 ? 0.2507 0.1673 0.3054 -0.0746 -0.0819 0.0251  34   GLU B OE2 
2074 N  N   . GLU B 35 ? 0.0676 0.1405 0.1265 -0.0247 -0.0111 0.0169  35   GLU B N   
2075 C  CA  . GLU B 35 ? 0.0578 0.1710 0.0858 -0.0221 0.0056  -0.0015 35   GLU B CA  
2076 C  C   . GLU B 35 ? 0.0727 0.1536 0.1508 -0.0226 0.0054  -0.0189 35   GLU B C   
2077 O  O   . GLU B 35 ? 0.0931 0.1548 0.1509 -0.0171 0.0164  -0.0276 35   GLU B O   
2078 C  CB  . GLU B 35 ? 0.0979 0.2269 0.0901 -0.0652 -0.0055 0.0053  35   GLU B CB  
2079 C  CG  . GLU B 35 ? 0.1496 0.1930 0.1380 -0.0623 0.0381  0.0126  35   GLU B CG  
2080 C  CD  . GLU B 35 ? 0.1289 0.2133 0.1602 -0.0678 0.0357  -0.0086 35   GLU B CD  
2081 O  OE1 . GLU B 35 ? 0.1770 0.2213 0.1549 -0.0235 -0.0003 -0.0079 35   GLU B OE1 
2082 O  OE2 . GLU B 35 ? 0.1614 0.2755 0.2892 -0.0477 -0.0297 -0.0543 35   GLU B OE2 
2089 N  N   . MET B 36 ? 0.0675 0.1498 0.1356 -0.0143 -0.0071 -0.0045 36   MET B N   
2090 C  CA  . MET B 36 ? 0.0719 0.1542 0.1526 -0.0002 0.0082  0.0008  36   MET B CA  
2091 C  C   . MET B 36 ? 0.0661 0.1402 0.1906 0.0197  -0.0209 -0.0066 36   MET B C   
2092 O  O   . MET B 36 ? 0.0613 0.1575 0.2198 0.0037  -0.0152 -0.0321 36   MET B O   
2093 C  CB  . MET B 36 ? 0.1467 0.1676 0.1933 0.0047  -0.0025 0.0338  36   MET B CB  
2094 C  CG  . MET B 36 ? 0.2099 0.2351 0.1807 -0.0681 0.0465  0.0238  36   MET B CG  
2095 S  SD  . MET B 36 ? 0.2643 0.2098 0.1750 -0.0869 0.0069  0.0042  36   MET B SD  
2096 C  CE  . MET B 36 ? 0.3624 0.4269 0.6634 0.0982  -0.3400 -0.2209 36   MET B CE  
2106 N  N   . ASN B 37 ? 0.0690 0.1563 0.1830 0.0098  -0.0122 -0.0242 37   ASN B N   
2107 C  CA  . ASN B 37 ? 0.0840 0.1470 0.1602 0.0052  -0.0066 -0.0335 37   ASN B CA  
2108 C  C   . ASN B 37 ? 0.0916 0.1209 0.1806 0.0082  -0.0211 -0.0169 37   ASN B C   
2109 O  O   . ASN B 37 ? 0.0836 0.1898 0.1989 0.0101  -0.0257 -0.0277 37   ASN B O   
2110 C  CB  . ASN B 37 ? 0.0969 0.2120 0.2065 0.0151  0.0290  -0.0072 37   ASN B CB  
2111 C  CG  . ASN B 37 ? 0.2007 0.2721 0.4114 -0.0708 0.1577  -0.0851 37   ASN B CG  
2112 O  OD1 . ASN B 37 ? 0.1328 0.2328 0.2679 -0.0161 0.0081  0.0390  37   ASN B OD1 
2113 N  ND2 . ASN B 37 ? 0.2354 0.3332 0.8142 -0.1022 0.2799  -0.1685 37   ASN B ND2 
2120 N  N   . LEU B 38 ? 0.0708 0.1610 0.1545 0.0047  -0.0221 0.0032  38   LEU B N   
2121 C  CA  . LEU B 38 ? 0.0702 0.1653 0.1598 -0.0012 -0.0215 0.0338  38   LEU B CA  
2122 C  C   . LEU B 38 ? 0.0868 0.1473 0.1499 0.0222  -0.0163 -0.0117 38   LEU B C   
2123 O  O   . LEU B 38 ? 0.1087 0.1566 0.1863 0.0189  -0.0405 0.0078  38   LEU B O   
2124 C  CB  . LEU B 38 ? 0.0868 0.1489 0.1552 0.0334  -0.0106 0.0280  38   LEU B CB  
2125 C  CG  . LEU B 38 ? 0.1057 0.1568 0.1659 0.0205  -0.0096 0.0525  38   LEU B CG  
2126 C  CD1 . LEU B 38 ? 0.1697 0.1347 0.1419 -0.0125 -0.0030 0.0278  38   LEU B CD1 
2127 C  CD2 . LEU B 38 ? 0.1345 0.1484 0.2034 -0.0342 0.0518  0.0007  38   LEU B CD2 
2139 N  N   . PRO B 39 ? 0.0704 0.1193 0.1583 0.0080  -0.0044 0.0141  39   PRO B N   
2140 C  CA  . PRO B 39 ? 0.0862 0.1274 0.1651 0.0120  -0.0183 -0.0054 39   PRO B CA  
2141 C  C   . PRO B 39 ? 0.0851 0.1092 0.1834 0.0432  -0.0191 0.0104  39   PRO B C   
2142 O  O   . PRO B 39 ? 0.1016 0.1535 0.1620 0.0250  -0.0190 -0.0143 39   PRO B O   
2143 C  CB  . PRO B 39 ? 0.0800 0.1243 0.2266 0.0263  -0.0199 -0.0370 39   PRO B CB  
2144 C  CG  . PRO B 39 ? 0.0563 0.1562 0.1874 0.0280  -0.0131 0.0096  39   PRO B CG  
2145 C  CD  . PRO B 39 ? 0.0814 0.1304 0.1761 0.0052  -0.0091 0.0213  39   PRO B CD  
2153 N  N   . GLY B 40 ? 0.1089 0.1243 0.1939 0.0309  -0.0249 -0.0066 40   GLY B N   
2154 C  CA  . GLY B 40 ? 0.1162 0.1135 0.2019 0.0306  0.0124  0.0040  40   GLY B CA  
2155 C  C   . GLY B 40 ? 0.0866 0.1135 0.2127 0.0134  -0.0077 0.0061  40   GLY B C   
2156 O  O   . GLY B 40 ? 0.1137 0.1391 0.2170 -0.0147 -0.0015 0.0403  40   GLY B O   
2160 N  N   . LYS B 41 ? 0.0942 0.1112 0.2852 0.0163  -0.0475 -0.0461 41   LYS B N   
2161 C  CA  . LYS B 41 ? 0.0654 0.1055 0.3242 -0.0043 -0.0338 -0.0298 41   LYS B CA  
2162 C  C   . LYS B 41 ? 0.0736 0.1378 0.2710 -0.0087 -0.0279 0.0565  41   LYS B C   
2163 O  O   . LYS B 41 ? 0.0828 0.1348 0.2933 -0.0086 -0.0617 0.0808  41   LYS B O   
2164 C  CB  . LYS B 41 ? 0.1451 0.1479 0.3820 0.0568  -0.0791 -0.0967 41   LYS B CB  
2165 C  CG  . LYS B 41 ? 0.1491 0.2601 1.0309 0.0371  -0.2875 -0.2253 41   LYS B CG  
2166 C  CD  . LYS B 41 ? 0.3986 0.6244 0.9088 -0.2396 -0.0057 -0.4308 41   LYS B CD  
2167 C  CE  . LYS B 41 ? 0.5140 0.8124 0.5741 -0.5097 -0.0324 -0.1793 41   LYS B CE  
2168 N  NZ  . LYS B 41 ? 0.5130 0.7471 1.0157 -0.2539 -0.2203 -0.3552 41   LYS B NZ  
2169 N  N   . TRP B 42 ? 0.0570 0.1272 0.2085 -0.0028 0.0106  0.0477  42   TRP B N   
2170 C  CA  . TRP B 42 ? 0.0665 0.0972 0.1622 -0.0022 -0.0029 0.0120  42   TRP B CA  
2171 C  C   . TRP B 42 ? 0.0667 0.1003 0.2014 -0.0126 -0.0305 0.0202  42   TRP B C   
2172 O  O   . TRP B 42 ? 0.0932 0.1278 0.2522 -0.0177 -0.0118 0.0765  42   TRP B O   
2173 C  CB  . TRP B 42 ? 0.1112 0.1435 0.1771 0.0070  0.0062  -0.0200 42   TRP B CB  
2174 C  CG  . TRP B 42 ? 0.1266 0.1462 0.1775 0.0212  0.0104  -0.0174 42   TRP B CG  
2175 C  CD1 . TRP B 42 ? 0.1543 0.3500 0.3010 0.0697  0.0843  0.1213  42   TRP B CD1 
2176 C  CD2 . TRP B 42 ? 0.1139 0.2174 0.2724 -0.0507 -0.0072 0.0971  42   TRP B CD2 
2177 N  NE1 . TRP B 42 ? 0.2262 0.2881 0.2718 0.0350  0.0990  0.0603  42   TRP B NE1 
2178 C  CE2 . TRP B 42 ? 0.2551 0.2075 0.2940 0.0070  0.0740  0.1232  42   TRP B CE2 
2179 C  CE3 . TRP B 42 ? 0.1444 0.2032 0.3315 -0.0291 -0.0482 0.1083  42   TRP B CE3 
2180 C  CZ2 . TRP B 42 ? 0.4631 0.2667 0.2527 0.1034  0.0750  0.0842  42   TRP B CZ2 
2181 C  CZ3 . TRP B 42 ? 0.3248 0.2629 0.2887 0.0513  -0.0724 0.0696  42   TRP B CZ3 
2182 C  CH2 . TRP B 42 ? 0.4603 0.3749 0.3320 0.0961  0.0027  0.1736  42   TRP B CH2 
2193 N  N   . LYS B 43 ? 0.0747 0.1027 0.1669 -0.0013 -0.0129 0.0511  43   LYS B N   
2194 C  CA  . LYS B 43 ? 0.0984 0.0813 0.3126 0.0034  -0.0723 0.0351  43   LYS B CA  
2195 C  C   . LYS B 43 ? 0.0625 0.0953 0.2274 0.0022  -0.0133 0.0431  43   LYS B C   
2196 O  O   . LYS B 43 ? 0.0752 0.1058 0.1973 -0.0103 -0.0167 0.0435  43   LYS B O   
2197 C  CB  . LYS B 43 ? 0.1255 0.1939 0.4796 0.0363  -0.1246 -0.1486 43   LYS B CB  
2198 C  CG  . LYS B 43 ? 0.3423 0.4412 0.2971 0.0680  -0.0713 -0.1540 43   LYS B CG  
2199 C  CD  . LYS B 43 ? 0.5540 0.2663 0.3747 0.0094  -0.1185 -0.1538 43   LYS B CD  
2200 C  CE  . LYS B 43 ? 0.7782 0.6788 0.3517 -0.5855 0.1970  -0.2304 43   LYS B CE  
2201 N  NZ  . LYS B 43 ? 0.8187 0.2335 1.6049 -0.4983 0.4224  -0.2628 43   LYS B NZ  
2215 N  N   . PRO B 44 ? 0.0797 0.1262 0.2273 -0.0225 -0.0128 0.0695  44   PRO B N   
2216 C  CA  . PRO B 44 ? 0.0762 0.1719 0.1924 -0.0045 -0.0059 0.0269  44   PRO B CA  
2217 C  C   . PRO B 44 ? 0.0715 0.1148 0.2131 -0.0060 -0.0117 0.0249  44   PRO B C   
2218 O  O   . PRO B 44 ? 0.0773 0.1174 0.1954 -0.0128 -0.0148 0.0243  44   PRO B O   
2219 C  CB  . PRO B 44 ? 0.1589 0.2587 0.1723 0.0278  0.0115  0.0479  44   PRO B CB  
2220 C  CG  . PRO B 44 ? 0.2976 0.1851 0.3226 -0.0050 -0.0980 0.1388  44   PRO B CG  
2221 C  CD  . PRO B 44 ? 0.1169 0.1438 0.3789 -0.0284 -0.0514 0.1350  44   PRO B CD  
2229 N  N   . LYS B 45 ? 0.0630 0.1102 0.1907 0.0100  -0.0188 0.0143  45   LYS B N   
2230 C  CA  . LYS B 45 ? 0.0629 0.1053 0.1603 0.0028  -0.0252 0.0295  45   LYS B CA  
2231 C  C   . LYS B 45 ? 0.0723 0.0995 0.1778 -0.0017 -0.0247 0.0196  45   LYS B C   
2232 O  O   . LYS B 45 ? 0.0949 0.1331 0.1840 0.0278  -0.0433 -0.0041 45   LYS B O   
2233 C  CB  . LYS B 45 ? 0.1326 0.1416 0.1608 0.0086  -0.0233 0.0362  45   LYS B CB  
2234 C  CG  . LYS B 45 ? 0.1432 0.1803 0.2107 -0.0371 -0.0187 0.0804  45   LYS B CG  
2235 C  CD  . LYS B 45 ? 0.2266 0.1277 0.2133 -0.0036 0.0143  0.0681  45   LYS B CD  
2236 C  CE  . LYS B 45 ? 0.2530 0.2916 0.2253 -0.1231 -0.0072 0.0848  45   LYS B CE  
2237 N  NZ  . LYS B 45 ? 0.1702 0.3794 0.4690 0.0417  0.1066  0.0625  45   LYS B NZ  
2251 N  N   . MET B 46 ? 0.0601 0.1148 0.1672 0.0009  -0.0212 0.0349  46   MET B N   
2252 C  CA  . MET B 46 ? 0.0697 0.0941 0.1836 -0.0012 -0.0233 0.0269  46   MET B CA  
2253 C  C   . MET B 46 ? 0.0874 0.0837 0.1673 -0.0056 -0.0133 0.0138  46   MET B C   
2254 O  O   . MET B 46 ? 0.0954 0.1196 0.2014 -0.0260 0.0078  -0.0179 46   MET B O   
2255 C  CB  A MET B 46 ? 0.0786 0.1045 0.1765 0.0125  -0.0250 0.0277  46   MET B CB  
2256 C  CB  B MET B 46 ? 0.1609 0.0937 0.1901 -0.0479 -0.0910 0.0383  46   MET B CB  
2257 C  CG  A MET B 46 ? 0.0915 0.0545 0.2007 -0.0136 -0.0331 0.0101  46   MET B CG  
2258 C  CG  B MET B 46 ? 0.1763 0.0000 0.1634 -0.0386 -0.0908 -0.0088 46   MET B CG  
2259 S  SD  A MET B 46 ? 0.2729 0.1228 0.1702 0.0627  -0.0013 0.0227  46   MET B SD  
2260 S  SD  B MET B 46 ? 0.1183 0.0845 0.1531 0.0032  -0.0778 0.0129  46   MET B SD  
2261 C  CE  A MET B 46 ? 0.2948 0.1137 0.2065 -0.0487 -0.1043 0.0386  46   MET B CE  
2262 C  CE  B MET B 46 ? 0.1410 0.0854 0.2129 0.0935  -0.0319 0.0720  46   MET B CE  
2279 N  N   . ILE B 47 ? 0.0708 0.0822 0.1577 -0.0001 -0.0206 0.0221  47   ILE B N   
2280 C  CA  . ILE B 47 ? 0.0688 0.0883 0.1515 -0.0087 -0.0271 0.0241  47   ILE B CA  
2281 C  C   . ILE B 47 ? 0.0682 0.0763 0.1464 0.0124  -0.0228 0.0243  47   ILE B C   
2282 O  O   . ILE B 47 ? 0.0836 0.0858 0.1401 0.0083  -0.0235 0.0219  47   ILE B O   
2283 C  CB  . ILE B 47 ? 0.0542 0.1132 0.1493 0.0077  -0.0134 0.0383  47   ILE B CB  
2284 C  CG1 . ILE B 47 ? 0.0886 0.1049 0.1450 0.0138  -0.0122 0.0422  47   ILE B CG1 
2285 C  CG2 . ILE B 47 ? 0.0610 0.1068 0.1789 -0.0001 -0.0255 0.0267  47   ILE B CG2 
2286 C  CD1 . ILE B 47 ? 0.0664 0.1141 0.2231 0.0266  0.0117  0.0702  47   ILE B CD1 
2298 N  N   . GLY B 48 ? 0.0679 0.1067 0.1579 -0.0162 -0.0229 0.0141  48   GLY B N   
2299 C  CA  . GLY B 48 ? 0.0801 0.0984 0.2085 -0.0286 -0.0544 0.0558  48   GLY B CA  
2300 C  C   . GLY B 48 ? 0.0653 0.0905 0.1432 -0.0098 0.0087  -0.0037 48   GLY B C   
2301 O  O   . GLY B 48 ? 0.0783 0.0934 0.1459 -0.0133 -0.0159 0.0005  48   GLY B O   
2305 N  N   . GLY B 49 ? 0.0918 0.0744 0.1343 -0.0167 0.0030  0.0056  49   GLY B N   
2306 C  CA  . GLY B 49 ? 0.0701 0.1288 0.1478 -0.0292 -0.0118 0.0159  49   GLY B CA  
2307 C  C   . GLY B 49 ? 0.0718 0.0971 0.1373 -0.0120 0.0079  -0.0042 49   GLY B C   
2308 O  O   . GLY B 49 ? 0.0974 0.0921 0.1377 0.0010  -0.0086 -0.0058 49   GLY B O   
2312 N  N   . ILE B 50 ? 0.0888 0.0939 0.1335 -0.0065 -0.0144 0.0060  50   ILE B N   
2313 C  CA  . ILE B 50 ? 0.0579 0.1185 0.1446 -0.0074 -0.0118 0.0003  50   ILE B CA  
2314 C  C   . ILE B 50 ? 0.0769 0.1357 0.1374 -0.0234 0.0025  -0.0270 50   ILE B C   
2315 O  O   . ILE B 50 ? 0.0719 0.1493 0.1775 -0.0248 0.0210  -0.0206 50   ILE B O   
2316 C  CB  . ILE B 50 ? 0.0956 0.1252 0.1971 -0.0346 -0.0176 -0.0088 50   ILE B CB  
2317 C  CG1 . ILE B 50 ? 0.1166 0.1249 0.1746 -0.0294 -0.0395 0.0292  50   ILE B CG1 
2318 C  CG2 . ILE B 50 ? 0.1036 0.1404 0.1948 -0.0538 -0.0059 -0.0131 50   ILE B CG2 
2319 C  CD1 . ILE B 50 ? 0.1170 0.2389 0.1708 0.0148  0.0055  -0.0147 50   ILE B CD1 
2331 N  N   . GLY B 51 ? 0.1095 0.1262 0.1419 -0.0427 -0.0166 -0.0088 51   GLY B N   
2332 C  CA  . GLY B 51 ? 0.1152 0.1663 0.1395 -0.0553 -0.0162 -0.0130 51   GLY B CA  
2333 C  C   . GLY B 51 ? 0.1279 0.1208 0.1309 -0.0248 0.0090  -0.0115 51   GLY B C   
2334 O  O   . GLY B 51 ? 0.3939 0.2199 0.1529 -0.1685 0.0784  -0.0455 51   GLY B O   
2338 N  N   . GLY B 52 ? 0.0515 0.1260 0.1339 -0.0027 -0.0121 -0.0074 52   GLY B N   
2339 C  CA  . GLY B 52 ? 0.0826 0.1052 0.1341 0.0053  -0.0223 -0.0124 52   GLY B CA  
2340 C  C   . GLY B 52 ? 0.0697 0.0997 0.1428 -0.0067 -0.0138 0.0006  52   GLY B C   
2341 O  O   . GLY B 52 ? 0.0746 0.1031 0.1388 -0.0280 -0.0247 0.0110  52   GLY B O   
2345 N  N   . PHE B 53 ? 0.0894 0.0882 0.1575 -0.0077 -0.0343 0.0347  53   PHE B N   
2346 C  CA  . PHE B 53 ? 0.0666 0.0996 0.1760 -0.0122 -0.0231 0.0367  53   PHE B CA  
2347 C  C   . PHE B 53 ? 0.0919 0.1067 0.1427 -0.0246 -0.0288 0.0012  53   PHE B C   
2348 O  O   . PHE B 53 ? 0.1058 0.2074 0.1483 -0.0154 -0.0300 0.0352  53   PHE B O   
2349 C  CB  . PHE B 53 ? 0.0898 0.1026 0.1875 -0.0101 -0.0175 0.0187  53   PHE B CB  
2350 C  CG  . PHE B 53 ? 0.0634 0.0997 0.1843 -0.0298 -0.0192 0.0240  53   PHE B CG  
2351 C  CD1 . PHE B 53 ? 0.0766 0.0896 0.2146 0.0008  -0.0396 0.0286  53   PHE B CD1 
2352 C  CD2 . PHE B 53 ? 0.0877 0.0688 0.1824 0.0118  -0.0309 0.0273  53   PHE B CD2 
2353 C  CE1 . PHE B 53 ? 0.0600 0.1558 0.2960 -0.0192 -0.0086 -0.0158 53   PHE B CE1 
2354 C  CE2 . PHE B 53 ? 0.1292 0.1035 0.1982 0.0061  -0.0104 0.0103  53   PHE B CE2 
2355 C  CZ  . PHE B 53 ? 0.1146 0.0959 0.2382 0.0055  0.0332  0.0194  53   PHE B CZ  
2365 N  N   . ILE B 54 ? 0.0593 0.1519 0.1384 -0.0168 0.0010  0.0242  54   ILE B N   
2366 C  CA  . ILE B 54 ? 0.0842 0.1284 0.1487 -0.0274 0.0308  0.0125  54   ILE B CA  
2367 C  C   . ILE B 54 ? 0.0546 0.1025 0.1622 0.0068  0.0033  0.0470  54   ILE B C   
2368 O  O   . ILE B 54 ? 0.0678 0.1186 0.1590 -0.0056 -0.0019 0.0344  54   ILE B O   
2369 C  CB  . ILE B 54 ? 0.0707 0.1374 0.1938 -0.0186 -0.0109 0.0269  54   ILE B CB  
2370 C  CG1 . ILE B 54 ? 0.0993 0.1193 0.1847 -0.0189 0.0013  0.0150  54   ILE B CG1 
2371 C  CG2 . ILE B 54 ? 0.1167 0.1324 0.1748 -0.0355 0.0028  0.0108  54   ILE B CG2 
2372 C  CD1 . ILE B 54 ? 0.1160 0.1259 0.2194 -0.0006 0.0367  0.0348  54   ILE B CD1 
2384 N  N   . LYS B 55 ? 0.0802 0.1324 0.1484 -0.0294 -0.0059 0.0521  55   LYS B N   
2385 C  CA  . LYS B 55 ? 0.0656 0.1364 0.1517 -0.0075 -0.0117 0.0395  55   LYS B CA  
2386 C  C   . LYS B 55 ? 0.0677 0.1326 0.1200 -0.0039 0.0205  0.0395  55   LYS B C   
2387 O  O   . LYS B 55 ? 0.0611 0.1418 0.1514 -0.0011 0.0007  0.0108  55   LYS B O   
2388 C  CB  . LYS B 55 ? 0.1020 0.1502 0.2609 -0.0382 -0.0099 0.0952  55   LYS B CB  
2389 C  CG  . LYS B 55 ? 0.0998 0.2144 0.3588 -0.0512 -0.0542 0.1199  55   LYS B CG  
2390 C  CD  . LYS B 55 ? 0.2636 0.3504 0.4104 -0.2210 -0.0013 0.0940  55   LYS B CD  
2391 C  CE  . LYS B 55 ? 0.7063 0.8067 0.5056 -0.6541 0.2024  -0.1482 55   LYS B CE  
2392 N  NZ  . LYS B 55 ? 0.6243 0.8802 0.1219 -0.7143 -0.0316 -0.1629 55   LYS B NZ  
2395 N  N   . VAL B 56 ? 0.0760 0.0925 0.1528 -0.0088 -0.0178 0.0216  56   VAL B N   
2396 C  CA  . VAL B 56 ? 0.0658 0.0967 0.1332 0.0024  0.0028  0.0223  56   VAL B CA  
2397 C  C   . VAL B 56 ? 0.0572 0.1055 0.1658 -0.0034 -0.0065 0.0203  56   VAL B C   
2398 O  O   . VAL B 56 ? 0.0717 0.0987 0.2225 -0.0011 -0.0395 0.0236  56   VAL B O   
2399 C  CB  . VAL B 56 ? 0.0597 0.1107 0.1527 -0.0071 0.0028  0.0287  56   VAL B CB  
2400 C  CG1 . VAL B 56 ? 0.0641 0.1378 0.1913 -0.0123 -0.0029 -0.0011 56   VAL B CG1 
2401 C  CG2 . VAL B 56 ? 0.1101 0.1293 0.1250 -0.0164 0.0127  0.0408  56   VAL B CG2 
2411 N  N   . ARG B 57 ? 0.0771 0.0900 0.1600 -0.0052 -0.0226 0.0010  57   ARG B N   
2412 C  CA  . ARG B 57 ? 0.0475 0.1046 0.1715 -0.0091 -0.0088 0.0418  57   ARG B CA  
2413 C  C   . ARG B 57 ? 0.0584 0.0983 0.1625 -0.0238 -0.0183 0.0389  57   ARG B C   
2414 O  O   . ARG B 57 ? 0.0897 0.0916 0.1592 -0.0210 -0.0133 0.0224  57   ARG B O   
2415 C  CB  . ARG B 57 ? 0.0720 0.1226 0.1608 0.0026  -0.0058 0.0041  57   ARG B CB  
2416 C  CG  . ARG B 57 ? 0.0613 0.1440 0.1672 -0.0061 -0.0102 0.0302  57   ARG B CG  
2417 C  CD  . ARG B 57 ? 0.0828 0.1320 0.2418 -0.0147 0.0389  0.0643  57   ARG B CD  
2418 N  NE  . ARG B 57 ? 0.0783 0.1596 0.1628 0.0117  0.0075  0.0414  57   ARG B NE  
2419 C  CZ  . ARG B 57 ? 0.0571 0.1443 0.2422 -0.0014 0.0106  0.0340  57   ARG B CZ  
2420 N  NH1 . ARG B 57 ? 0.0723 0.2639 0.1938 0.0258  0.0158  -0.0399 57   ARG B NH1 
2421 N  NH2 . ARG B 57 ? 0.1462 0.1329 0.3269 0.0152  0.1036  0.0746  57   ARG B NH2 
2435 N  N   . GLN B 58 ? 0.0622 0.0852 0.1742 -0.0158 -0.0181 0.0314  58   GLN B N   
2436 C  CA  . GLN B 58 ? 0.0731 0.0814 0.1708 -0.0136 -0.0112 0.0273  58   GLN B CA  
2437 C  C   . GLN B 58 ? 0.0620 0.1002 0.1480 -0.0181 -0.0007 0.0197  58   GLN B C   
2438 O  O   . GLN B 58 ? 0.0750 0.1059 0.1949 -0.0245 -0.0309 0.0512  58   GLN B O   
2439 C  CB  . GLN B 58 ? 0.1021 0.0896 0.1763 0.0133  -0.0123 0.0425  58   GLN B CB  
2440 C  CG  . GLN B 58 ? 0.1022 0.1049 0.1721 -0.0186 0.0000  0.0190  58   GLN B CG  
2441 C  CD  . GLN B 58 ? 0.2123 0.1180 0.1907 0.0408  0.0016  0.0279  58   GLN B CD  
2442 O  OE1 . GLN B 58 ? 0.1643 0.1118 0.2372 0.0196  -0.0095 0.0242  58   GLN B OE1 
2443 N  NE2 . GLN B 58 ? 0.2133 0.2687 0.2154 0.1316  -0.0218 -0.0504 58   GLN B NE2 
2452 N  N   . TYR B 59 ? 0.0501 0.0993 0.1353 -0.0189 -0.0042 0.0090  59   TYR B N   
2453 C  CA  . TYR B 59 ? 0.0724 0.0978 0.1340 -0.0168 -0.0070 0.0168  59   TYR B CA  
2454 C  C   . TYR B 59 ? 0.0749 0.1035 0.1360 -0.0058 0.0001  0.0222  59   TYR B C   
2455 O  O   . TYR B 59 ? 0.1084 0.1671 0.1463 -0.0468 0.0039  0.0276  59   TYR B O   
2456 C  CB  . TYR B 59 ? 0.0577 0.1031 0.1365 -0.0128 -0.0166 0.0056  59   TYR B CB  
2457 C  CG  . TYR B 59 ? 0.0666 0.0976 0.1315 -0.0075 -0.0147 0.0154  59   TYR B CG  
2458 C  CD1 . TYR B 59 ? 0.0820 0.0993 0.1390 -0.0142 -0.0232 0.0251  59   TYR B CD1 
2459 C  CD2 . TYR B 59 ? 0.0656 0.1125 0.1372 -0.0004 -0.0087 0.0299  59   TYR B CD2 
2460 C  CE1 . TYR B 59 ? 0.0953 0.1072 0.1349 -0.0227 -0.0229 0.0088  59   TYR B CE1 
2461 C  CE2 . TYR B 59 ? 0.0825 0.1654 0.1300 -0.0207 -0.0093 0.0133  59   TYR B CE2 
2462 C  CZ  . TYR B 59 ? 0.0903 0.1389 0.1361 -0.0185 -0.0116 -0.0078 59   TYR B CZ  
2463 O  OH  . TYR B 59 ? 0.0866 0.2249 0.1357 -0.0043 -0.0188 0.0027  59   TYR B OH  
2473 N  N   . ASP B 60 ? 0.1028 0.1420 0.1397 -0.0209 -0.0117 0.0097  60   ASP B N   
2474 C  CA  . ASP B 60 ? 0.1628 0.1331 0.1376 0.0249  0.0166  -0.0180 60   ASP B CA  
2475 C  C   . ASP B 60 ? 0.1044 0.1358 0.1205 -0.0276 -0.0083 -0.0182 60   ASP B C   
2476 O  O   . ASP B 60 ? 0.1145 0.1243 0.1714 -0.0182 0.0030  -0.0043 60   ASP B O   
2477 C  CB  . ASP B 60 ? 0.2225 0.1355 0.2085 0.0004  0.0021  -0.0371 60   ASP B CB  
2478 C  CG  . ASP B 60 ? 0.2258 0.1205 0.5227 0.0245  -0.0547 -0.0616 60   ASP B CG  
2479 O  OD1 . ASP B 60 ? 0.2557 0.1634 0.2198 -0.0200 -0.0406 0.0424  60   ASP B OD1 
2480 O  OD2 . ASP B 60 ? 0.3690 0.1603 0.4600 -0.0416 -0.1841 0.0323  60   ASP B OD2 
2485 N  N   . GLN B 61 ? 0.1250 0.1187 0.1203 -0.0187 -0.0124 -0.0288 61   GLN B N   
2486 C  CA  . GLN B 61 ? 0.1702 0.1700 0.1096 0.0012  -0.0229 -0.0184 61   GLN B CA  
2487 C  C   . GLN B 61 ? 0.1120 0.1472 0.1292 -0.0096 -0.0188 -0.0041 61   GLN B C   
2488 O  O   . GLN B 61 ? 0.1211 0.1483 0.1663 -0.0196 -0.0540 0.0198  61   GLN B O   
2489 C  CB  . GLN B 61 ? 0.2865 0.1742 0.1612 -0.0015 -0.1143 -0.0177 61   GLN B CB  
2490 C  CG  . GLN B 61 ? 0.4024 0.1646 0.2326 0.0731  -0.1803 -0.0611 61   GLN B CG  
2491 C  CD  . GLN B 61 ? 0.5350 0.2911 0.2964 0.1196  0.0321  -0.1300 61   GLN B CD  
2492 O  OE1 . GLN B 61 ? 0.7095 2.0000 0.3819 0.4999  0.2106  -0.1016 61   GLN B OE1 
2493 N  NE2 . GLN B 61 ? 1.0923 0.1806 0.4058 -0.0227 -0.1020 0.0469  61   GLN B NE2 
2502 N  N   . ILE B 62 ? 0.0809 0.1136 0.1262 0.0002  -0.0081 0.0095  62   ILE B N   
2503 C  CA  . ILE B 62 ? 0.0865 0.1169 0.1102 0.0072  0.0098  0.0114  62   ILE B CA  
2504 C  C   . ILE B 62 ? 0.0603 0.1167 0.1223 -0.0090 -0.0187 0.0137  62   ILE B C   
2505 O  O   . ILE B 62 ? 0.0740 0.1133 0.1180 -0.0033 -0.0109 0.0092  62   ILE B O   
2506 C  CB  . ILE B 62 ? 0.0829 0.1145 0.1211 -0.0044 0.0064  0.0127  62   ILE B CB  
2507 C  CG1 . ILE B 62 ? 0.0653 0.1081 0.1177 0.0105  -0.0330 0.0175  62   ILE B CG1 
2508 C  CG2 . ILE B 62 ? 0.1220 0.1013 0.1294 -0.0215 -0.0160 0.0048  62   ILE B CG2 
2509 C  CD1 . ILE B 62 ? 0.0821 0.1842 0.1502 -0.0156 -0.0010 0.0530  62   ILE B CD1 
2521 N  N   . PRO B 63 ? 0.0643 0.1242 0.1496 -0.0119 -0.0075 0.0312  63   PRO B N   
2522 C  CA  . PRO B 63 ? 0.0842 0.1095 0.1327 0.0093  0.0092  0.0185  63   PRO B CA  
2523 C  C   . PRO B 63 ? 0.1170 0.1104 0.1262 -0.0096 -0.0049 0.0365  63   PRO B C   
2524 O  O   . PRO B 63 ? 0.0841 0.1220 0.1325 0.0037  -0.0013 0.0257  63   PRO B O   
2525 C  CB  . PRO B 63 ? 0.0765 0.1263 0.1396 0.0073  0.0202  0.0199  63   PRO B CB  
2526 C  CG  . PRO B 63 ? 0.1008 0.1072 0.1765 0.0044  -0.0371 0.0247  63   PRO B CG  
2527 C  CD  . PRO B 63 ? 0.0638 0.1167 0.1293 0.0069  -0.0062 0.0089  63   PRO B CD  
2535 N  N   . VAL B 64 ? 0.1034 0.1121 0.1331 -0.0065 0.0040  0.0110  64   VAL B N   
2536 C  CA  . VAL B 64 ? 0.1154 0.1030 0.1297 -0.0144 0.0191  0.0082  64   VAL B CA  
2537 C  C   . VAL B 64 ? 0.1525 0.1182 0.1160 -0.0278 0.0219  0.0107  64   VAL B C   
2538 O  O   . VAL B 64 ? 0.4360 0.1649 0.1704 -0.1325 0.1435  -0.0385 64   VAL B O   
2539 C  CB  . VAL B 64 ? 0.1047 0.1301 0.1643 -0.0134 0.0009  0.0042  64   VAL B CB  
2540 C  CG1 . VAL B 64 ? 0.1302 0.1491 0.1648 -0.0499 -0.0016 0.0311  64   VAL B CG1 
2541 C  CG2 . VAL B 64 ? 0.0756 0.1381 0.1550 -0.0133 -0.0102 0.0118  64   VAL B CG2 
2547 N  N   . GLU B 65 ? 0.0920 0.1047 0.1739 -0.0112 0.0225  0.0142  65   GLU B N   
2548 C  CA  . GLU B 65 ? 0.0957 0.1205 0.1498 -0.0178 -0.0044 0.0235  65   GLU B CA  
2549 C  C   . GLU B 65 ? 0.1136 0.1432 0.1112 -0.0479 -0.0001 0.0286  65   GLU B C   
2550 O  O   . GLU B 65 ? 0.1538 0.1716 0.1249 -0.0481 0.0265  -0.0080 65   GLU B O   
2551 C  CB  . GLU B 65 ? 0.1054 0.1496 0.3440 -0.0081 -0.0114 0.0886  65   GLU B CB  
2552 C  CG  . GLU B 65 ? 0.1927 0.2629 0.4518 0.0396  -0.0011 0.2110  65   GLU B CG  
2553 C  CD  . GLU B 65 ? 0.3090 0.1382 0.9233 0.0524  -0.2320 0.1385  65   GLU B CD  
2554 O  OE1 . GLU B 65 ? 0.4277 0.2383 1.3823 0.1677  -0.4357 -0.1031 65   GLU B OE1 
2555 O  OE2 . GLU B 65 ? 0.3583 0.6293 0.5988 0.2487  -0.1865 -0.0210 65   GLU B OE2 
2562 N  N   . ILE B 66 ? 0.1142 0.1327 0.1033 -0.0455 -0.0057 0.0122  66   ILE B N   
2563 C  CA  . ILE B 66 ? 0.1035 0.1474 0.1456 -0.0365 -0.0160 0.0343  66   ILE B CA  
2564 C  C   . ILE B 66 ? 0.1069 0.1457 0.1338 -0.0474 -0.0269 0.0275  66   ILE B C   
2565 O  O   . ILE B 66 ? 0.1542 0.1864 0.1309 -0.0813 -0.0346 0.0423  66   ILE B O   
2566 C  CB  . ILE B 66 ? 0.1284 0.1461 0.1259 -0.0235 -0.0440 -0.0205 66   ILE B CB  
2567 C  CG1 . ILE B 66 ? 0.1226 0.1752 0.1243 -0.0019 -0.0378 0.0339  66   ILE B CG1 
2568 C  CG2 . ILE B 66 ? 0.1082 0.2349 0.1577 -0.0240 -0.0416 -0.0351 66   ILE B CG2 
2569 C  CD1 . ILE B 66 ? 0.2886 0.1304 0.2619 0.0253  0.0460  0.0452  66   ILE B CD1 
2581 N  N   . CYS B 67 ? 0.1524 0.1470 0.1884 -0.0433 -0.0048 0.0161  67   CYS B N   
2582 C  CA  . CYS B 67 ? 0.2442 0.1459 0.2525 -0.0742 -0.0196 0.0168  67   CYS B CA  
2583 C  C   . CYS B 67 ? 0.2833 0.1587 0.2324 -0.0672 -0.0135 0.0545  67   CYS B C   
2584 O  O   . CYS B 67 ? 0.4477 0.1940 0.2333 -0.1263 0.0514  0.0108  67   CYS B O   
2585 C  CB  A CYS B 67 ? 0.2688 0.2591 0.1871 -0.1941 -0.0093 -0.0651 67   CYS B CB  
2586 C  CB  B CYS B 67 ? 0.2773 0.3183 0.3647 -0.2204 -0.0221 0.0489  67   CYS B CB  
2587 S  SG  A CYS B 67 ? 0.3928 0.2299 0.2412 -0.2042 0.0173  -0.0015 67   CYS B SG  
2588 S  SG  B CYS B 67 ? 0.2285 0.2588 0.4145 -0.0624 -0.0336 0.1375  67   CYS B SG  
2595 N  N   . GLY B 68 ? 0.2602 0.1381 0.2676 -0.0174 -0.0349 0.0084  68   GLY B N   
2596 C  CA  . GLY B 68 ? 0.3047 0.2007 0.3078 0.0647  -0.0691 0.0086  68   GLY B CA  
2597 C  C   . GLY B 68 ? 0.2159 0.1960 0.2635 0.0113  -0.0756 0.0290  68   GLY B C   
2598 O  O   . GLY B 68 ? 0.3672 0.3225 0.3393 0.0983  -0.1850 -0.0070 68   GLY B O   
2602 N  N   . HIS B 69 ? 0.1737 0.1563 0.1845 -0.0273 -0.0394 0.0287  69   HIS B N   
2603 C  CA  . HIS B 69 ? 0.1531 0.1729 0.1504 -0.0510 -0.0488 0.0335  69   HIS B CA  
2604 C  C   . HIS B 69 ? 0.1897 0.1809 0.1170 -0.0695 -0.0309 0.0267  69   HIS B C   
2605 O  O   . HIS B 69 ? 0.2195 0.1742 0.1170 -0.0934 -0.0611 0.0186  69   HIS B O   
2606 C  CB  . HIS B 69 ? 0.1647 0.1581 0.1763 -0.0252 -0.0189 0.0676  69   HIS B CB  
2607 C  CG  . HIS B 69 ? 0.1835 0.1772 0.2066 -0.0502 -0.0114 0.0564  69   HIS B CG  
2608 N  ND1 . HIS B 69 ? 0.2168 0.2108 0.1817 -0.0578 -0.0189 0.0931  69   HIS B ND1 
2609 C  CD2 . HIS B 69 ? 0.2067 0.1451 0.2561 -0.0255 -0.0212 0.0739  69   HIS B CD2 
2610 C  CE1 . HIS B 69 ? 0.1833 0.2114 0.2837 -0.0473 0.0198  0.0902  69   HIS B CE1 
2611 N  NE2 . HIS B 69 ? 0.2515 0.2154 0.2434 -0.0894 -0.0520 0.0989  69   HIS B NE2 
2619 N  N   . LYS B 70 ? 0.1741 0.1968 0.1281 -0.0773 -0.0638 0.0662  70   LYS B N   
2620 C  CA  . LYS B 70 ? 0.1190 0.1812 0.1102 -0.0444 -0.0212 0.0536  70   LYS B CA  
2621 C  C   . LYS B 70 ? 0.1057 0.1912 0.1387 -0.0399 -0.0179 0.0351  70   LYS B C   
2622 O  O   . LYS B 70 ? 0.1508 0.1974 0.1482 -0.0349 0.0103  0.0483  70   LYS B O   
2623 C  CB  . LYS B 70 ? 0.1263 0.1844 0.1200 -0.0304 -0.0315 0.0466  70   LYS B CB  
2624 C  CG  . LYS B 70 ? 0.1503 0.1526 0.1902 -0.0291 -0.0533 0.0538  70   LYS B CG  
2625 C  CD  . LYS B 70 ? 0.1339 0.2532 0.2280 0.0007  -0.0477 -0.0264 70   LYS B CD  
2626 C  CE  A LYS B 70 ? 0.1188 0.1557 0.6326 -0.0376 0.0372  -0.0144 70   LYS B CE  
2627 C  CE  B LYS B 70 ? 0.3614 0.6219 0.2176 0.3592  0.1853  0.2781  70   LYS B CE  
2628 N  NZ  A LYS B 70 ? 0.1168 0.4909 0.4775 0.1231  -0.0146 -0.2271 70   LYS B NZ  
2629 N  NZ  B LYS B 70 ? 0.1867 0.2931 0.1952 0.0682  -0.0498 -0.0098 70   LYS B NZ  
2643 N  N   . ALA B 71 ? 0.1198 0.1712 0.1238 -0.0328 -0.0020 0.0206  71   ALA B N   
2644 C  CA  . ALA B 71 ? 0.0912 0.1791 0.1060 -0.0363 -0.0165 0.0165  71   ALA B CA  
2645 C  C   . ALA B 71 ? 0.0722 0.1672 0.1112 -0.0338 -0.0215 0.0067  71   ALA B C   
2646 O  O   . ALA B 71 ? 0.0783 0.1790 0.1179 -0.0076 -0.0228 0.0324  71   ALA B O   
2647 C  CB  . ALA B 71 ? 0.0943 0.2134 0.1404 -0.0581 -0.0368 0.0133  71   ALA B CB  
2653 N  N   . ILE B 72 ? 0.0865 0.1765 0.1245 -0.0149 0.0096  0.0314  72   ILE B N   
2654 C  CA  . ILE B 72 ? 0.0762 0.1635 0.1386 -0.0076 0.0008  0.0371  72   ILE B CA  
2655 C  C   . ILE B 72 ? 0.0859 0.1781 0.1371 -0.0042 0.0152  0.0356  72   ILE B C   
2656 O  O   . ILE B 72 ? 0.0836 0.1826 0.1365 0.0015  0.0046  0.0262  72   ILE B O   
2657 C  CB  . ILE B 72 ? 0.1167 0.1574 0.1541 -0.0237 -0.0273 0.0282  72   ILE B CB  
2658 C  CG1 . ILE B 72 ? 0.0732 0.1608 0.1871 -0.0038 -0.0060 0.0276  72   ILE B CG1 
2659 C  CG2 . ILE B 72 ? 0.1144 0.2619 0.1470 -0.0043 -0.0272 0.0483  72   ILE B CG2 
2660 C  CD1 . ILE B 72 ? 0.1522 0.2405 0.3568 -0.0810 -0.1252 0.1479  72   ILE B CD1 
2672 N  N   . GLY B 73 ? 0.0793 0.1449 0.1288 -0.0054 -0.0035 0.0194  73   GLY B N   
2673 C  CA  . GLY B 73 ? 0.1440 0.1538 0.0808 0.0340  -0.0379 -0.0388 73   GLY B CA  
2674 C  C   . GLY B 73 ? 0.0723 0.1564 0.1096 0.0123  -0.0254 -0.0038 73   GLY B C   
2675 O  O   . GLY B 73 ? 0.0965 0.1657 0.1278 0.0370  -0.0071 0.0151  73   GLY B O   
2679 N  N   . THR B 74 ? 0.0639 0.1272 0.1077 0.0027  -0.0071 0.0038  74   THR B N   
2680 C  CA  . THR B 74 ? 0.0625 0.1146 0.1129 -0.0029 0.0091  0.0114  74   THR B CA  
2681 C  C   . THR B 74 ? 0.0952 0.1028 0.1196 -0.0092 -0.0065 0.0099  74   THR B C   
2682 O  O   . THR B 74 ? 0.0835 0.1102 0.1141 -0.0060 -0.0029 0.0153  74   THR B O   
2683 C  CB  . THR B 74 ? 0.1036 0.1189 0.1345 0.0178  -0.0270 -0.0115 74   THR B CB  
2684 O  OG1 . THR B 74 ? 0.2276 0.1294 0.1863 0.0086  -0.0606 -0.0345 74   THR B OG1 
2685 C  CG2 . THR B 74 ? 0.1528 0.1033 0.1752 0.0112  -0.0548 0.0040  74   THR B CG2 
2693 N  N   . VAL B 75 ? 0.0471 0.1083 0.1326 0.0063  -0.0110 -0.0029 75   VAL B N   
2694 C  CA  . VAL B 75 ? 0.0582 0.1141 0.1161 -0.0199 -0.0088 0.0148  75   VAL B CA  
2695 C  C   . VAL B 75 ? 0.0811 0.0840 0.1443 -0.0089 -0.0273 0.0291  75   VAL B C   
2696 O  O   . VAL B 75 ? 0.0823 0.1145 0.1677 -0.0295 -0.0565 0.0374  75   VAL B O   
2697 C  CB  . VAL B 75 ? 0.2332 0.0802 0.1547 0.0518  -0.0013 0.0247  75   VAL B CB  
2698 C  CG1 . VAL B 75 ? 0.2557 0.1684 0.1672 0.0497  0.0060  -0.0079 75   VAL B CG1 
2699 C  CG2 . VAL B 75 ? 0.1316 0.1190 0.1654 0.0012  0.0003  0.0343  75   VAL B CG2 
2709 N  N   . LEU B 76 ? 0.0652 0.0968 0.1033 -0.0296 -0.0002 0.0250  76   LEU B N   
2710 C  CA  . LEU B 76 ? 0.0685 0.0879 0.1041 -0.0170 0.0006  0.0173  76   LEU B CA  
2711 C  C   . LEU B 76 ? 0.0606 0.0948 0.1060 -0.0181 -0.0002 0.0077  76   LEU B C   
2712 O  O   . LEU B 76 ? 0.0839 0.0970 0.1158 -0.0237 0.0137  0.0110  76   LEU B O   
2713 C  CB  . LEU B 76 ? 0.0782 0.0674 0.1257 -0.0078 -0.0090 0.0087  76   LEU B CB  
2714 C  CG  . LEU B 76 ? 0.0690 0.0902 0.1330 -0.0074 -0.0136 -0.0025 76   LEU B CG  
2715 C  CD1 . LEU B 76 ? 0.0692 0.1154 0.1221 0.0012  0.0011  0.0234  76   LEU B CD1 
2716 C  CD2 . LEU B 76 ? 0.0906 0.0746 0.1527 -0.0123 -0.0082 0.0012  76   LEU B CD2 
2728 N  N   . VAL B 77 ? 0.0705 0.0803 0.1173 -0.0182 0.0085  0.0049  77   VAL B N   
2729 C  CA  . VAL B 77 ? 0.0532 0.1020 0.1137 -0.0151 0.0103  0.0089  77   VAL B CA  
2730 C  C   . VAL B 77 ? 0.0657 0.0995 0.1142 -0.0214 0.0055  0.0173  77   VAL B C   
2731 O  O   . VAL B 77 ? 0.0770 0.0990 0.1355 -0.0141 -0.0017 0.0108  77   VAL B O   
2732 C  CB  . VAL B 77 ? 0.0612 0.0907 0.1432 -0.0123 0.0107  0.0144  77   VAL B CB  
2733 C  CG1 . VAL B 77 ? 0.0699 0.1610 0.1448 0.0254  0.0085  -0.0098 77   VAL B CG1 
2734 C  CG2 . VAL B 77 ? 0.0765 0.1290 0.1433 -0.0037 -0.0121 0.0146  77   VAL B CG2 
2744 N  N   . GLY B 78 ? 0.0734 0.0953 0.1111 -0.0088 0.0031  0.0245  78   GLY B N   
2745 C  CA  . GLY B 78 ? 0.0906 0.1228 0.1318 -0.0218 -0.0250 0.0395  78   GLY B CA  
2746 C  C   . GLY B 78 ? 0.0893 0.1192 0.1340 -0.0194 -0.0198 0.0261  78   GLY B C   
2747 O  O   . GLY B 78 ? 0.0886 0.1242 0.1618 -0.0221 0.0033  0.0307  78   GLY B O   
2751 N  N   . PRO B 79 ? 0.1366 0.1244 0.1270 -0.0440 -0.0375 0.0332  79   PRO B N   
2752 C  CA  . PRO B 79 ? 0.1682 0.1651 0.1164 -0.0767 -0.0299 0.0371  79   PRO B CA  
2753 C  C   . PRO B 79 ? 0.1323 0.1899 0.1555 -0.0714 -0.0534 0.0725  79   PRO B C   
2754 O  O   . PRO B 79 ? 0.1641 0.1869 0.1773 -0.0537 -0.0768 0.0759  79   PRO B O   
2755 C  CB  . PRO B 79 ? 0.2398 0.1862 0.1570 -0.1434 -0.0876 0.0748  79   PRO B CB  
2756 C  CG  . PRO B 79 ? 0.1880 0.1878 0.1701 -0.0673 -0.0782 0.0888  79   PRO B CG  
2757 C  CD  . PRO B 79 ? 0.1856 0.1455 0.1362 -0.0544 -0.0654 0.0600  79   PRO B CD  
2765 N  N   . THR B 80 ? 0.1156 0.1970 0.1441 -0.0815 -0.0504 0.0576  80   THR B N   
2766 C  CA  . THR B 80 ? 0.0836 0.1495 0.1378 -0.0281 -0.0133 0.0335  80   THR B CA  
2767 C  C   . THR B 80 ? 0.0940 0.1760 0.1120 -0.0391 -0.0436 0.0124  80   THR B C   
2768 O  O   . THR B 80 ? 0.1201 0.1669 0.0943 -0.0417 0.0031  0.0072  80   THR B O   
2769 C  CB  . THR B 80 ? 0.0767 0.1349 0.1277 -0.0001 0.0078  0.0172  80   THR B CB  
2770 O  OG1 . THR B 80 ? 0.0631 0.1473 0.1579 -0.0094 -0.0152 0.0440  80   THR B OG1 
2771 C  CG2 . THR B 80 ? 0.0642 0.1131 0.1162 -0.0209 0.0049  0.0070  80   THR B CG2 
2779 N  N   . PRO B 81 ? 0.1221 0.2083 0.0988 -0.0713 -0.0133 0.0102  81   PRO B N   
2780 C  CA  . PRO B 81 ? 0.1962 0.2151 0.0849 -0.1189 0.0022  0.0008  81   PRO B CA  
2781 C  C   . PRO B 81 ? 0.1432 0.1983 0.1080 -0.0557 0.0280  -0.0176 81   PRO B C   
2782 O  O   . PRO B 81 ? 0.2078 0.2393 0.1126 -0.0375 0.0438  -0.0518 81   PRO B O   
2783 C  CB  . PRO B 81 ? 0.2309 0.2979 0.1084 -0.1278 -0.0601 0.0195  81   PRO B CB  
2784 C  CG  . PRO B 81 ? 0.1506 0.4408 0.1214 -0.1745 0.0023  -0.0318 81   PRO B CG  
2785 C  CD  . PRO B 81 ? 0.1026 0.2517 0.1293 -0.0692 -0.0550 0.0573  81   PRO B CD  
2793 N  N   . VAL B 82 ? 0.0762 0.1215 0.1069 -0.0200 0.0085  -0.0091 82   VAL B N   
2794 C  CA  . VAL B 82 ? 0.1332 0.1195 0.1348 -0.0626 -0.0357 0.0001  82   VAL B CA  
2795 C  C   . VAL B 82 ? 0.0643 0.1152 0.1170 -0.0201 0.0011  -0.0149 82   VAL B C   
2796 O  O   . VAL B 82 ? 0.1241 0.1098 0.1132 -0.0002 -0.0076 -0.0086 82   VAL B O   
2797 C  CB  A VAL B 82 ? 0.2070 0.2617 0.0642 -0.1561 -0.0244 0.0056  82   VAL B CB  
2798 C  CB  B VAL B 82 ? 0.1765 0.1800 0.1096 -0.1208 -0.0329 0.0062  82   VAL B CB  
2799 C  CG1 A VAL B 82 ? 0.3147 0.2885 0.0625 -0.2735 -0.0850 0.1163  82   VAL B CG1 
2800 C  CG1 B VAL B 82 ? 0.6315 0.8447 0.5247 0.5377  0.5008  0.4941  82   VAL B CG1 
2801 C  CG2 A VAL B 82 ? 0.1791 0.2484 0.1006 -0.0655 -0.0092 0.1220  82   VAL B CG2 
2802 C  CG2 B VAL B 82 ? 0.2171 0.2176 0.1811 -0.1808 -0.0958 0.0666  82   VAL B CG2 
2819 N  N   . ASN B 83 ? 0.0636 0.1038 0.1235 -0.0162 0.0020  -0.0157 83   ASN B N   
2820 C  CA  . ASN B 83 ? 0.0595 0.0729 0.1282 -0.0103 -0.0022 -0.0110 83   ASN B CA  
2821 C  C   . ASN B 83 ? 0.0659 0.0858 0.1245 -0.0069 0.0039  -0.0079 83   ASN B C   
2822 O  O   . ASN B 83 ? 0.0741 0.0889 0.1337 -0.0102 0.0159  -0.0098 83   ASN B O   
2823 C  CB  . ASN B 83 ? 0.0816 0.1058 0.1153 0.0157  0.0181  0.0116  83   ASN B CB  
2824 C  CG  . ASN B 83 ? 0.0641 0.0888 0.1131 0.0022  0.0042  -0.0068 83   ASN B CG  
2825 O  OD1 . ASN B 83 ? 0.0947 0.1055 0.1587 -0.0144 0.0324  0.0070  83   ASN B OD1 
2826 N  ND2 . ASN B 83 ? 0.0815 0.1013 0.1654 0.0019  0.0341  -0.0177 83   ASN B ND2 
2833 N  N   . ILE B 84 ? 0.0379 0.0821 0.1056 -0.0180 -0.0039 0.0044  84   ILE B N   
2834 C  CA  . ILE B 84 ? 0.0578 0.0778 0.1089 -0.0118 -0.0027 -0.0043 84   ILE B CA  
2835 C  C   . ILE B 84 ? 0.0796 0.0705 0.1059 0.0018  -0.0095 -0.0062 84   ILE B C   
2836 O  O   . ILE B 84 ? 0.0884 0.0807 0.1176 -0.0162 -0.0139 0.0042  84   ILE B O   
2837 C  CB  . ILE B 84 ? 0.0486 0.1086 0.1298 0.0029  -0.0053 -0.0020 84   ILE B CB  
2838 C  CG1 . ILE B 84 ? 0.0682 0.1240 0.1534 -0.0077 -0.0247 -0.0037 84   ILE B CG1 
2839 C  CG2 . ILE B 84 ? 0.0674 0.1574 0.1384 0.0234  0.0060  0.0154  84   ILE B CG2 
2840 C  CD1 . ILE B 84 ? 0.0708 0.1378 0.1590 0.0095  -0.0096 0.0191  84   ILE B CD1 
2852 N  N   . ILE B 85 ? 0.0668 0.0744 0.1064 -0.0079 0.0043  -0.0125 85   ILE B N   
2853 C  CA  . ILE B 85 ? 0.0551 0.0829 0.1053 -0.0182 -0.0009 0.0039  85   ILE B CA  
2854 C  C   . ILE B 85 ? 0.0611 0.0877 0.0990 -0.0215 -0.0019 -0.0150 85   ILE B C   
2855 O  O   . ILE B 85 ? 0.0620 0.1020 0.1186 -0.0247 0.0062  -0.0232 85   ILE B O   
2856 C  CB  . ILE B 85 ? 0.0730 0.0962 0.1070 -0.0103 0.0010  0.0156  85   ILE B CB  
2857 C  CG1 . ILE B 85 ? 0.0995 0.1186 0.0948 0.0101  0.0076  0.0263  85   ILE B CG1 
2858 C  CG2 . ILE B 85 ? 0.0760 0.1277 0.1138 0.0078  -0.0104 0.0043  85   ILE B CG2 
2859 C  CD1 . ILE B 85 ? 0.0953 0.1097 0.3799 0.0208  0.0816  0.0026  85   ILE B CD1 
2871 N  N   . GLY B 86 ? 0.0648 0.0824 0.1035 -0.0169 0.0080  -0.0055 86   GLY B N   
2872 C  CA  . GLY B 86 ? 0.0520 0.0939 0.1042 0.0029  -0.0061 0.0016  86   GLY B CA  
2873 C  C   . GLY B 86 ? 0.0520 0.1076 0.1080 -0.0151 -0.0028 -0.0175 86   GLY B C   
2874 O  O   . GLY B 86 ? 0.0556 0.1254 0.0869 -0.0123 0.0006  -0.0055 86   GLY B O   
2878 N  N   . ARG B 87 ? 0.0729 0.1034 0.1108 -0.0083 0.0026  -0.0146 87   ARG B N   
2879 C  CA  . ARG B 87 ? 0.0544 0.1514 0.1049 -0.0214 0.0065  -0.0323 87   ARG B CA  
2880 C  C   . ARG B 87 ? 0.0688 0.1105 0.1172 -0.0012 -0.0060 -0.0106 87   ARG B C   
2881 O  O   . ARG B 87 ? 0.0587 0.2072 0.1120 -0.0216 -0.0077 0.0003  87   ARG B O   
2882 C  CB  . ARG B 87 ? 0.0587 0.1674 0.1118 -0.0245 0.0054  -0.0396 87   ARG B CB  
2883 C  CG  . ARG B 87 ? 0.0486 0.1980 0.1511 -0.0067 0.0098  -0.0796 87   ARG B CG  
2884 C  CD  . ARG B 87 ? 0.0608 0.1837 0.1960 -0.0086 0.0161  -0.1055 87   ARG B CD  
2885 N  NE  . ARG B 87 ? 0.0790 0.1881 0.1888 -0.0056 0.0123  -0.1060 87   ARG B NE  
2886 C  CZ  . ARG B 87 ? 0.0940 0.1665 0.2217 0.0226  -0.0192 -0.1036 87   ARG B CZ  
2887 N  NH1 . ARG B 87 ? 0.0904 0.1798 0.1967 0.0004  0.0090  -0.0959 87   ARG B NH1 
2888 N  NH2 . ARG B 87 ? 0.1218 0.1899 0.2146 0.0198  -0.0049 -0.0878 87   ARG B NH2 
2902 N  N   . ASN B 88 ? 0.0797 0.1025 0.1153 -0.0158 -0.0084 -0.0288 88   ASN B N   
2903 C  CA  . ASN B 88 ? 0.0712 0.1625 0.1068 -0.0166 -0.0008 -0.0505 88   ASN B CA  
2904 C  C   . ASN B 88 ? 0.0793 0.1707 0.1178 -0.0233 -0.0186 -0.0407 88   ASN B C   
2905 O  O   . ASN B 88 ? 0.1009 0.2048 0.1169 -0.0300 -0.0264 -0.0300 88   ASN B O   
2906 C  CB  . ASN B 88 ? 0.0624 0.1388 0.1552 -0.0136 0.0104  -0.0554 88   ASN B CB  
2907 C  CG  . ASN B 88 ? 0.0559 0.1121 0.1275 0.0050  0.0007  -0.0215 88   ASN B CG  
2908 O  OD1 . ASN B 88 ? 0.0792 0.1275 0.1284 0.0045  -0.0145 -0.0290 88   ASN B OD1 
2909 N  ND2 . ASN B 88 ? 0.0633 0.1347 0.1368 -0.0217 0.0016  0.0045  88   ASN B ND2 
2914 N  N   . LEU B 89 ? 0.0545 0.1456 0.1054 -0.0248 -0.0205 -0.0118 89   LEU B N   
2915 C  CA  . LEU B 89 ? 0.0644 0.1588 0.0933 -0.0206 -0.0120 0.0101  89   LEU B CA  
2916 C  C   . LEU B 89 ? 0.0836 0.1703 0.0827 -0.0375 -0.0197 0.0111  89   LEU B C   
2917 O  O   . LEU B 89 ? 0.0764 0.1798 0.1057 -0.0181 -0.0027 0.0267  89   LEU B O   
2918 C  CB  . LEU B 89 ? 0.0701 0.1399 0.1256 -0.0214 0.0056  0.0064  89   LEU B CB  
2919 C  CG  . LEU B 89 ? 0.0745 0.1219 0.1153 -0.0133 0.0042  0.0023  89   LEU B CG  
2920 C  CD1 . LEU B 89 ? 0.1007 0.1326 0.1359 0.0168  0.0348  0.0294  89   LEU B CD1 
2921 C  CD2 . LEU B 89 ? 0.1031 0.1823 0.1325 -0.0584 -0.0267 0.0269  89   LEU B CD2 
2933 N  N   . LEU B 90 ? 0.0692 0.1595 0.0859 -0.0328 -0.0059 0.0103  90   LEU B N   
2934 C  CA  . LEU B 90 ? 0.0697 0.1520 0.0961 -0.0245 0.0024  0.0071  90   LEU B CA  
2935 C  C   . LEU B 90 ? 0.0580 0.1634 0.0929 -0.0186 -0.0043 0.0122  90   LEU B C   
2936 O  O   . LEU B 90 ? 0.0702 0.1762 0.1098 -0.0353 -0.0254 0.0213  90   LEU B O   
2937 C  CB  . LEU B 90 ? 0.0972 0.1521 0.0876 -0.0637 -0.0119 -0.0015 90   LEU B CB  
2938 C  CG  . LEU B 90 ? 0.0775 0.1109 0.0899 -0.0253 0.0037  0.0028  90   LEU B CG  
2939 C  CD1 . LEU B 90 ? 0.0901 0.1399 0.1030 -0.0126 -0.0197 -0.0341 90   LEU B CD1 
2940 C  CD2 . LEU B 90 ? 0.0998 0.1345 0.1377 0.0000  -0.0095 -0.0104 90   LEU B CD2 
2952 N  N   . THR B 91 ? 0.1172 0.1651 0.1059 -0.0579 0.0102  -0.0080 91   THR B N   
2953 C  CA  . THR B 91 ? 0.0857 0.2148 0.1038 -0.0196 0.0238  -0.0049 91   THR B CA  
2954 C  C   . THR B 91 ? 0.0977 0.1935 0.1129 -0.0337 0.0111  -0.0005 91   THR B C   
2955 O  O   . THR B 91 ? 0.1399 0.3219 0.1017 -0.0771 -0.0124 0.0228  91   THR B O   
2956 C  CB  . THR B 91 ? 0.0860 0.2355 0.1145 -0.0020 0.0313  -0.0272 91   THR B CB  
2957 O  OG1 . THR B 91 ? 0.1171 0.2393 0.1853 -0.0701 0.0140  -0.0437 91   THR B OG1 
2958 C  CG2 . THR B 91 ? 0.0940 0.1813 0.2213 -0.0333 -0.0088 -0.0303 91   THR B CG2 
2966 N  N   . GLN B 92 ? 0.0819 0.1964 0.1136 -0.0367 -0.0020 -0.0220 92   GLN B N   
2967 C  CA  . GLN B 92 ? 0.0962 0.2070 0.1284 -0.0380 -0.0115 -0.0282 92   GLN B CA  
2968 C  C   . GLN B 92 ? 0.0915 0.2218 0.0922 -0.0159 -0.0284 -0.0221 92   GLN B C   
2969 O  O   . GLN B 92 ? 0.1408 0.3131 0.1503 -0.0398 -0.0805 0.0380  92   GLN B O   
2970 C  CB  . GLN B 92 ? 0.0791 0.2503 0.1143 -0.0534 -0.0304 -0.0312 92   GLN B CB  
2971 C  CG  . GLN B 92 ? 0.0967 0.2504 0.1220 -0.0567 0.0139  -0.0343 92   GLN B CG  
2972 C  CD  . GLN B 92 ? 0.0733 0.2522 0.1301 -0.0270 -0.0062 0.0134  92   GLN B CD  
2973 O  OE1 . GLN B 92 ? 0.0896 0.2652 0.2426 -0.0104 0.0292  0.0850  92   GLN B OE1 
2974 N  NE2 . GLN B 92 ? 0.1231 0.2530 0.2979 0.0089  0.0655  0.0688  92   GLN B NE2 
2983 N  N   . ILE B 93 ? 0.1641 0.1909 0.1236 -0.0669 -0.0566 0.0238  93   ILE B N   
2984 C  CA  . ILE B 93 ? 0.1057 0.1977 0.1359 -0.0256 -0.0624 0.0343  93   ILE B CA  
2985 C  C   . ILE B 93 ? 0.1447 0.1903 0.1244 -0.0565 -0.0553 0.0263  93   ILE B C   
2986 O  O   . ILE B 93 ? 0.2090 0.2000 0.1680 -0.0640 -0.0742 0.0582  93   ILE B O   
2987 C  CB  . ILE B 93 ? 0.1088 0.1950 0.1579 -0.0532 -0.0460 0.0172  93   ILE B CB  
2988 C  CG1 . ILE B 93 ? 0.1200 0.1955 0.1428 -0.0044 -0.0434 -0.0152 93   ILE B CG1 
2989 C  CG2 . ILE B 93 ? 0.1378 0.3382 0.1621 -0.0731 -0.0250 0.0194  93   ILE B CG2 
2990 C  CD1 . ILE B 93 ? 0.1153 0.1845 0.1545 -0.0530 -0.0061 -0.0282 93   ILE B CD1 
3002 N  N   . GLY B 94 ? 0.1350 0.2392 0.1443 -0.0498 -0.0248 0.0399  94   GLY B N   
3003 C  CA  . GLY B 94 ? 0.1570 0.3726 0.1129 -0.1013 -0.0335 0.0369  94   GLY B CA  
3004 C  C   . GLY B 94 ? 0.1470 0.3274 0.1197 -0.0951 -0.0244 0.0424  94   GLY B C   
3005 O  O   . GLY B 94 ? 0.2133 0.4902 0.1386 -0.1862 -0.0397 0.1173  94   GLY B O   
3009 N  N   . CYS B 95 ? 0.1515 0.3319 0.1146 -0.1350 -0.0316 0.0571  95   CYS B N   
3010 C  CA  . CYS B 95 ? 0.1665 0.2960 0.1305 -0.1429 -0.0310 0.0520  95   CYS B CA  
3011 C  C   . CYS B 95 ? 0.1661 0.2803 0.1168 -0.1383 -0.0399 0.0418  95   CYS B C   
3012 O  O   . CYS B 95 ? 0.1785 0.2655 0.2441 -0.1601 -0.0180 0.0453  95   CYS B O   
3013 C  CB  . CYS B 95 ? 0.1627 0.3057 0.1230 -0.1273 -0.0405 0.0400  95   CYS B CB  
3014 S  SG  . CYS B 95 ? 0.1845 0.2652 0.1419 -0.1190 -0.0392 0.0430  95   CYS B SG  
3019 N  N   . THR B 96 ? 0.1570 0.2240 0.1243 -0.1115 -0.0487 0.0397  96   THR B N   
3020 C  CA  . THR B 96 ? 0.1662 0.2446 0.1029 -0.1269 -0.0068 -0.0037 96   THR B CA  
3021 C  C   . THR B 96 ? 0.1397 0.1714 0.0950 -0.0858 -0.0198 0.0214  96   THR B C   
3022 O  O   . THR B 96 ? 0.1188 0.1695 0.1316 -0.0587 -0.0373 0.0161  96   THR B O   
3023 C  CB  . THR B 96 ? 0.2869 0.3132 0.0992 -0.1960 0.0201  -0.0354 96   THR B CB  
3024 O  OG1 . THR B 96 ? 0.1818 0.3849 0.1505 -0.1819 -0.0797 0.0924  96   THR B OG1 
3025 C  CG2 . THR B 96 ? 0.2564 0.4807 0.1224 -0.1896 -0.0238 -0.0617 96   THR B CG2 
3033 N  N   . LEU B 97 ? 0.1404 0.1527 0.1053 -0.0727 0.0052  -0.0062 97   LEU B N   
3034 C  CA  . LEU B 97 ? 0.1203 0.1396 0.1426 -0.0405 -0.0047 -0.0284 97   LEU B CA  
3035 C  C   . LEU B 97 ? 0.1175 0.1877 0.1671 -0.0603 0.0228  -0.0508 97   LEU B C   
3036 O  O   . LEU B 97 ? 0.3833 0.3568 0.3882 -0.2743 0.2699  -0.2463 97   LEU B O   
3037 C  CB  A LEU B 97 ? 0.1456 0.4231 0.0757 0.0876  0.0450  0.0254  97   LEU B CB  
3038 C  CB  B LEU B 97 ? 0.2157 0.0968 0.1973 -0.0222 -0.0676 -0.0531 97   LEU B CB  
3039 C  CG  A LEU B 97 ? 0.0577 0.1288 0.1239 -0.0579 0.0030  -0.0531 97   LEU B CG  
3040 C  CG  B LEU B 97 ? 0.2482 0.1934 0.0550 0.0242  0.0509  -0.0258 97   LEU B CG  
3041 C  CD1 A LEU B 97 ? 0.0557 0.1338 0.2841 -0.0360 0.0222  -0.0583 97   LEU B CD1 
3042 C  CD1 B LEU B 97 ? 0.4627 0.1695 0.1496 0.1969  0.0985  0.0367  97   LEU B CD1 
3043 C  CD2 A LEU B 97 ? 0.2434 0.1671 0.0524 0.0526  -0.0088 -0.0227 97   LEU B CD2 
3044 C  CD2 B LEU B 97 ? 0.4363 0.2240 0.2512 0.2297  -0.1447 -0.1253 97   LEU B CD2 
3058 N  N   . ASN B 98 ? 0.1103 0.1641 0.1169 -0.0385 -0.0302 0.0036  98   ASN B N   
3059 C  CA  . ASN B 98 ? 0.1085 0.2210 0.1342 -0.0488 -0.0186 0.0195  98   ASN B CA  
3060 C  C   . ASN B 98 ? 0.1005 0.2222 0.1254 -0.0419 -0.0096 0.0115  98   ASN B C   
3061 O  O   . ASN B 98 ? 0.1039 0.2379 0.1442 -0.0396 -0.0111 -0.0077 98   ASN B O   
3062 C  CB  A ASN B 98 ? 0.1436 0.2443 0.1697 -0.0857 -0.0657 0.0715  98   ASN B CB  
3063 C  CB  B ASN B 98 ? 0.0889 0.2079 0.0895 -0.0498 0.0119  0.0113  98   ASN B CB  
3064 C  CG  A ASN B 98 ? 0.1083 0.1890 0.1557 -0.0111 -0.0275 -0.0525 98   ASN B CG  
3065 C  CG  B ASN B 98 ? 0.1386 0.1279 0.1360 0.0081  -0.0365 -0.0409 98   ASN B CG  
3066 O  OD1 A ASN B 98 ? 0.1255 0.2808 0.2785 -0.0716 -0.0561 0.0711  98   ASN B OD1 
3067 O  OD1 B ASN B 98 ? 0.1293 0.1020 0.1246 0.0584  -0.0722 -0.0478 98   ASN B OD1 
3068 N  ND2 A ASN B 98 ? 0.3346 0.2760 0.1650 -0.1220 -0.1104 0.0728  98   ASN B ND2 
3069 N  ND2 B ASN B 98 ? 0.1737 0.1029 0.1239 -0.0559 -0.0453 0.0064  98   ASN B ND2 
3080 N  N   . PHE B 99 ? 0.1056 0.2048 0.1695 -0.0547 0.0064  -0.0075 99   PHE B N   
3081 C  CA  . PHE B 99 ? 0.0831 0.2391 0.1675 -0.0288 -0.0327 0.0034  99   PHE B CA  
3082 C  C   . PHE B 99 ? 0.1211 0.2720 0.1509 -0.0874 -0.0330 0.0373  99   PHE B C   
3083 O  O   . PHE B 99 ? 0.1589 0.3406 0.1967 -0.1362 -0.0105 0.0160  99   PHE B O   
3084 C  CB  . PHE B 99 ? 0.0823 0.2107 0.1642 -0.0150 0.0066  0.0353  99   PHE B CB  
3085 C  CG  . PHE B 99 ? 0.0980 0.2039 0.1485 -0.0193 0.0061  -0.0167 99   PHE B CG  
3086 C  CD1 . PHE B 99 ? 0.0988 0.2099 0.3891 -0.0041 0.0196  0.0420  99   PHE B CD1 
3087 C  CD2 . PHE B 99 ? 0.1004 0.2018 0.1946 -0.0204 0.0092  -0.0365 99   PHE B CD2 
3088 C  CE1 . PHE B 99 ? 0.1492 0.2166 0.3789 0.0177  0.0217  -0.0095 99   PHE B CE1 
3089 C  CE2 . PHE B 99 ? 0.1640 0.1984 0.2326 -0.0073 -0.0110 0.0292  99   PHE B CE2 
3090 C  CZ  . PHE B 99 ? 0.1866 0.1841 0.3961 0.0099  0.0186  -0.0717 99   PHE B CZ  
3091 O  OXT . PHE B 99 ? 0.1794 0.3581 0.1611 -0.1507 0.0060  -0.0025 99   PHE B OXT 
3101 C  C3  . JE2 C .  ? 0.0884 0.1614 0.1330 -0.0126 -0.0078 -0.0011 701  JE2 A C3  
3102 C  C4  . JE2 C .  ? 0.0913 0.1647 0.1298 -0.0229 -0.0246 -0.0374 701  JE2 A C4  
3103 C  C5  . JE2 C .  ? 0.0875 0.1222 0.1383 -0.0133 0.0058  -0.0139 701  JE2 A C5  
3104 C  C6  . JE2 C .  ? 0.0703 0.1079 0.1007 -0.0195 0.0018  0.0115  701  JE2 A C6  
3105 C  C7  . JE2 C .  ? 0.0687 0.1393 0.1221 -0.0205 -0.0117 0.0048  701  JE2 A C7  
3106 C  C1  . JE2 C .  ? 0.0947 0.1296 0.1746 -0.0071 -0.0547 0.0027  701  JE2 A C1  
3107 C  C8  . JE2 C .  ? 0.0864 0.1557 0.1397 0.0147  0.0030  0.0239  701  JE2 A C8  
3108 C  C9  . JE2 C .  ? 0.0706 0.1115 0.0891 -0.0108 -0.0146 0.0118  701  JE2 A C9  
3109 O  O2  . JE2 C .  ? 0.0892 0.1481 0.2003 -0.0103 -0.0363 -0.0376 701  JE2 A O2  
3110 O  O10 . JE2 C .  ? 0.0872 0.1112 0.1287 -0.0044 -0.0225 0.0093  701  JE2 A O10 
3111 C  C22 . JE2 C .  ? 0.0425 0.0957 0.1242 0.0013  0.0050  -0.0228 701  JE2 A C22 
3112 N  N11 . JE2 C .  ? 0.0716 0.1140 0.0789 -0.0089 -0.0063 0.0092  701  JE2 A N11 
3113 O  O23 . JE2 C .  ? 0.0649 0.1068 0.1281 0.0016  -0.0105 0.0088  701  JE2 A O23 
3114 C  C20 . JE2 C .  ? 0.0890 0.0819 0.1040 -0.0105 0.0062  0.0000  701  JE2 A C20 
3115 C  C14 . JE2 C .  ? 0.0530 0.0987 0.1502 -0.0160 0.0213  0.0090  701  JE2 A C14 
3116 C  C13 . JE2 C .  ? 0.0622 0.1205 0.1211 0.0029  -0.0091 0.0048  701  JE2 A C13 
3117 C  C17 . JE2 C .  ? 0.1376 0.1580 0.1526 0.0142  0.0337  -0.0075 701  JE2 A C17 
3118 C  C12 . JE2 C .  ? 0.0551 0.1316 0.1020 -0.0001 -0.0137 -0.0214 701  JE2 A C12 
3119 O  O21 . JE2 C .  ? 0.0804 0.1020 0.1422 0.0029  -0.0099 0.0104  701  JE2 A O21 
3120 C  C15 . JE2 C .  ? 0.0924 0.1101 0.1673 0.0022  0.0301  -0.0062 701  JE2 A C15 
3121 C  C19 . JE2 C .  ? 0.0672 0.1185 0.1270 0.0022  0.0049  0.0145  701  JE2 A C19 
3122 C  C16 . JE2 C .  ? 0.0985 0.1486 0.1628 0.0172  0.0324  -0.0022 701  JE2 A C16 
3123 C  C18 . JE2 C .  ? 0.1074 0.1520 0.1487 0.0248  0.0362  0.0101  701  JE2 A C18 
3124 C  C31 . JE2 C .  ? 0.0493 0.1196 0.1235 -0.0025 0.0062  -0.0005 701  JE2 A C31 
3125 N  N24 . JE2 C .  ? 0.0659 0.0937 0.1102 -0.0007 -0.0152 -0.0130 701  JE2 A N24 
3126 O  O32 . JE2 C .  ? 0.0741 0.1021 0.1160 -0.0086 0.0031  0.0034  701  JE2 A O32 
3127 C  C30 . JE2 C .  ? 0.0458 0.0927 0.1312 0.0036  0.0168  -0.0281 701  JE2 A C30 
3128 C  C27 . JE2 C .  ? 0.0495 0.1013 0.1291 0.0065  0.0015  -0.0087 701  JE2 A C27 
3129 C  C25 . JE2 C .  ? 0.0558 0.0973 0.1412 0.0049  -0.0126 -0.0100 701  JE2 A C25 
3130 C  C28 . JE2 C .  ? 0.0524 0.1385 0.1233 0.0099  0.0193  -0.0333 701  JE2 A C28 
3131 C  C29 . JE2 C .  ? 0.0636 0.0982 0.1662 0.0181  -0.0044 -0.0286 701  JE2 A C29 
3132 S  S26 . JE2 C .  ? 0.0751 0.1048 0.1375 0.0026  -0.0073 -0.0060 701  JE2 A S26 
3133 N  N33 . JE2 C .  ? 0.0571 0.0919 0.1199 0.0012  -0.0046 0.0094  701  JE2 A N33 
3134 C  C34 . JE2 C .  ? 0.0610 0.1222 0.1537 -0.0278 -0.0177 0.0197  701  JE2 A C34 
3135 C  C35 . JE2 C .  ? 0.0694 0.0879 0.1605 -0.0108 -0.0177 0.0189  701  JE2 A C35 
3136 C  C36 . JE2 C .  ? 0.0707 0.0937 0.1167 -0.0073 0.0280  0.0328  701  JE2 A C36 
3137 C  C37 . JE2 C .  ? 0.0670 0.1204 0.2044 -0.0129 -0.0017 0.0455  701  JE2 A C37 
3138 C  C38 . JE2 C .  ? 0.0945 0.1581 0.1106 0.0124  -0.0015 0.0207  701  JE2 A C38 
3139 C  C39 . JE2 C .  ? 0.0776 0.1180 0.1627 -0.0325 -0.0228 0.0552  701  JE2 A C39 
3140 C  C40 . JE2 C .  ? 0.0575 0.1107 0.1466 -0.0262 -0.0061 0.0074  701  JE2 A C40 
3141 C  C41 . JE2 C .  ? 0.1047 0.1274 0.2036 0.0117  0.0061  -0.0327 701  JE2 A C41 
3142 CL CL  . CL  D .  ? 0.2286 0.1577 0.3289 -0.0102 -0.0300 0.0349  902  CL  A CL  
3144 C  C1  . EDO F .  ? 0.6204 0.2926 1.0072 -0.0471 0.2472  0.2520  801  EDO A C1  
3145 O  O1  . EDO F .  ? 0.2275 0.3023 0.8605 -0.1352 0.2966  -0.3899 801  EDO A O1  
3146 C  C2  . EDO F .  ? 0.4380 0.4784 0.4413 0.2384  0.1223  0.1135  801  EDO A C2  
3147 O  O2  . EDO F .  ? 0.9332 1.5263 0.4507 -0.8589 -0.4475 0.5766  801  EDO A O2  
3148 C  C1  . EDO G .  ? 0.2840 0.2778 0.1692 0.1280  0.0461  0.0604  803  EDO A C1  
3149 O  O1  . EDO G .  ? 0.2086 0.2603 0.1404 0.0915  -0.0241 -0.0028 803  EDO A O1  
3150 C  C2  . EDO G .  ? 0.2406 0.2012 0.1623 -0.0280 0.0147  0.0439  803  EDO A C2  
3151 O  O2  . EDO G .  ? 0.1640 0.2030 0.1723 -0.0322 0.0215  0.0094  803  EDO A O2  
3152 C  C1  . EDO H .  ? 0.2690 0.1503 0.3213 0.0722  0.0831  0.0469  804  EDO A C1  
3153 O  O1  . EDO H .  ? 0.1720 0.1133 0.2061 0.0034  -0.0228 -0.0255 804  EDO A O1  
3154 C  C2  . EDO H .  ? 0.1172 0.1763 0.3914 0.0171  0.0634  0.0833  804  EDO A C2  
3155 O  O2  . EDO H .  ? 0.1896 0.2949 0.3777 -0.0527 0.0470  0.1243  804  EDO A O2  
3161 CL CL  . CL  K .  ? 0.1262 0.2516 0.2879 0.0287  -0.0280 -0.0921 903  CL  B CL  
3162 CL CL  . CL  L .  ? 0.1102 0.2555 0.2366 -0.0434 0.0050  -0.0658 904  CL  B CL  
3163 C  C1  . EDO M .  ? 0.1233 0.2285 0.3442 -0.0526 -0.0052 -0.0699 802  EDO B C1  
3164 O  O1  . EDO M .  ? 0.1382 0.2877 0.2160 -0.0197 -0.0194 0.0975  802  EDO B O1  
3165 C  C2  . EDO M .  ? 0.2859 0.2682 0.6014 -0.1352 0.2776  -0.2126 802  EDO B C2  
3166 O  O2  . EDO M .  ? 0.5743 0.2758 0.2624 -0.0101 0.0726  -0.0982 802  EDO B O2  
3167 O  O   . HOH N .  ? 0.2072 0.3317 0.3766 -0.0279 0.0213  -0.0478 906  HOH A O   
3168 O  O   . HOH N .  ? 0.3363 0.1796 0.5554 -0.0272 -0.0364 -0.2074 907  HOH A O   
3169 O  O   . HOH N .  ? 0.4594 0.5917 0.2428 -0.1069 -0.0291 0.0835  908  HOH A O   
3170 O  O   . HOH N .  ? 0.1993 0.2547 0.2918 0.0754  -0.0306 0.0113  909  HOH A O   
3171 O  O   . HOH N .  ? 0.0615 0.0920 0.0490 0.0003  -0.0178 0.0190  910  HOH A O   
3172 O  O   . HOH N .  ? 0.2164 0.3403 0.3852 -0.0068 -0.0138 -0.0550 911  HOH A O   
3173 O  O   . HOH N .  ? 0.2299 0.2544 0.2675 -0.0297 0.0017  -0.0347 912  HOH A O   
3174 O  O   . HOH N .  ? 0.0750 0.1100 0.1096 -0.0007 -0.0073 -0.0035 913  HOH A O   
3175 O  O   . HOH N .  ? 0.2823 0.1792 0.1949 0.0425  0.0755  0.0291  914  HOH A O   
3176 O  O   . HOH N .  ? 0.2280 0.2305 0.3043 -0.0214 0.0035  0.0689  915  HOH A O   
3177 O  O   . HOH N .  ? 0.2024 0.3103 0.2455 0.0363  0.0094  0.0656  916  HOH A O   
3178 O  O   . HOH N .  ? 0.2538 0.3352 0.4072 0.0190  -0.0621 -0.1447 917  HOH A O   
3179 O  O   . HOH N .  ? 0.2950 0.1834 0.1603 -0.0093 0.0490  -0.0442 918  HOH A O   
3180 O  O   . HOH N .  ? 0.0888 0.1450 0.1596 -0.0064 0.0058  0.0047  919  HOH A O   
3181 O  O   . HOH N .  ? 0.1357 0.7944 0.2417 -0.0822 -0.0233 -0.0420 920  HOH A O   
3182 O  O   . HOH N .  ? 0.3706 0.5675 0.3059 -0.1653 0.1243  -0.1789 921  HOH A O   
3183 O  O   . HOH N .  ? 0.2532 0.5886 0.3191 0.0341  -0.0058 -0.0820 922  HOH A O   
3184 O  O   . HOH N .  ? 0.2463 0.2152 0.2038 0.0348  0.0560  -0.1001 923  HOH A O   
3185 O  O   . HOH N .  ? 0.2303 0.3821 0.4267 -0.0909 0.0447  -0.0755 924  HOH A O   
3186 O  O   . HOH N .  ? 0.1541 0.2705 0.2119 -0.0492 -0.0137 -0.0009 925  HOH A O   
3187 O  O   . HOH N .  ? 0.3318 0.2923 0.3628 0.0325  -0.0349 0.0067  926  HOH A O   
3188 O  O   . HOH N .  ? 0.5653 0.4387 0.4687 -0.2111 -0.1084 0.1203  927  HOH A O   
3189 O  O   . HOH N .  ? 0.3699 0.3529 0.8783 -0.1416 0.2172  -0.1685 928  HOH A O   
3190 O  O   . HOH N .  ? 0.1374 0.2264 0.2065 -0.0051 -0.0232 0.0042  929  HOH A O   
3191 O  O   . HOH N .  ? 0.3029 0.3783 0.3588 0.1269  -0.1182 -0.2062 930  HOH A O   
3192 O  O   . HOH N .  ? 0.1327 0.2418 0.1903 0.0067  0.0295  -0.0356 931  HOH A O   
3193 O  O   . HOH N .  ? 0.3825 0.2010 0.4845 0.0076  -0.1017 -0.0188 932  HOH A O   
3194 O  O   . HOH N .  ? 0.3303 0.4385 0.3129 -0.1311 0.0542  0.1035  933  HOH A O   
3195 O  O   . HOH N .  ? 0.1531 0.1919 0.0801 -0.0766 0.0202  -0.0647 934  HOH A O   
3196 O  O   . HOH N .  ? 0.3764 0.2561 0.6801 -0.0262 0.0269  -0.1110 935  HOH A O   
3197 O  O   . HOH N .  ? 0.3427 0.1958 0.3610 0.0483  0.1070  0.0714  936  HOH A O   
3198 O  O   . HOH N .  ? 0.1921 0.2516 0.3130 -0.0068 0.0761  0.0581  937  HOH A O   
3199 O  O   . HOH N .  ? 0.1514 0.1851 0.1669 0.0083  0.0037  -0.0345 938  HOH A O   
3200 O  O   . HOH N .  ? 0.1223 0.3607 0.1230 -0.0117 -0.0202 -0.0101 939  HOH A O   
3201 O  O   . HOH N .  ? 0.1791 0.2907 0.8529 0.0530  -0.1022 0.1560  940  HOH A O   
3202 O  O   . HOH N .  ? 0.1979 0.2227 0.2170 -0.0382 0.1126  -0.0886 941  HOH A O   
3203 O  O   . HOH N .  ? 0.9036 0.6536 0.6556 0.1512  -0.4353 0.0993  942  HOH A O   
3204 O  O   . HOH N .  ? 0.6455 0.2107 0.5721 0.1112  0.2121  -0.0824 943  HOH A O   
3205 O  O   . HOH N .  ? 0.4571 0.4483 0.5466 -0.0857 0.1796  -0.2697 944  HOH A O   
3206 O  O   . HOH N .  ? 0.3463 0.2970 0.3151 0.0661  -0.0523 -0.0662 945  HOH A O   
3207 O  O   . HOH N .  ? 0.3067 0.2189 0.2989 -0.0072 -0.0210 -0.0283 946  HOH A O   
3208 O  O   . HOH N .  ? 0.2209 0.3240 0.2883 0.0373  -0.0494 -0.0043 947  HOH A O   
3209 O  O   . HOH N .  ? 0.3698 0.3834 0.2771 -0.0784 -0.1703 0.0165  948  HOH A O   
3210 O  O   . HOH N .  ? 0.1370 0.1560 0.1527 -0.0206 -0.0324 -0.0157 949  HOH A O   
3211 O  O   . HOH N .  ? 0.0426 0.0997 0.1246 -0.0156 0.0023  -0.0038 950  HOH A O   
3212 O  O   . HOH N .  ? 0.1168 0.1335 0.1984 -0.0347 -0.0156 -0.0132 951  HOH A O   
3213 O  O   . HOH N .  ? 0.2187 0.1876 0.2128 0.0206  -0.0384 -0.0307 952  HOH A O   
3214 O  O   . HOH N .  ? 0.3531 0.2771 0.2852 -0.1497 -0.0682 -0.0429 953  HOH A O   
3215 O  O   . HOH N .  ? 0.2403 0.2788 0.2806 -0.0957 -0.0309 -0.0218 954  HOH A O   
3216 O  O   . HOH N .  ? 0.5022 0.3107 0.6811 -0.1404 0.0584  -0.1125 955  HOH A O   
3217 O  O   . HOH N .  ? 0.4450 0.2423 0.5238 0.0313  0.1947  -0.0962 956  HOH A O   
3218 O  O   . HOH N .  ? 0.0930 0.1719 0.2189 0.0052  -0.0119 -0.0231 957  HOH A O   
3219 O  O   . HOH N .  ? 0.2516 0.3009 0.4002 0.1685  0.0887  -0.1423 958  HOH A O   
3220 O  O   . HOH N .  ? 0.5156 0.3300 0.3261 -0.0798 0.0023  -0.0518 959  HOH A O   
3221 O  O   . HOH N .  ? 0.1718 0.2059 0.3290 -0.0463 0.0993  -0.0328 960  HOH A O   
3222 O  O   . HOH N .  ? 0.0708 0.1502 0.1591 -0.0388 -0.0368 0.0036  961  HOH A O   
3223 O  O   . HOH N .  ? 0.4425 0.3214 0.4201 0.0930  0.0807  -0.1776 962  HOH A O   
3224 O  O   . HOH N .  ? 0.7338 0.3380 0.3532 0.1617  0.0010  -0.1097 963  HOH A O   
3225 O  O   . HOH N .  ? 0.2621 0.1468 0.4253 -0.0047 0.0627  -0.0398 964  HOH A O   
3226 O  O   . HOH N .  ? 0.4789 0.2480 0.2386 -0.0107 -0.0743 -0.0776 965  HOH A O   
3227 O  O   . HOH N .  ? 0.4184 0.2329 0.3571 0.1222  0.0032  0.0190  966  HOH A O   
3228 O  O   . HOH N .  ? 0.1088 0.1268 0.1831 -0.0278 0.0107  -0.0098 967  HOH A O   
3229 O  O   . HOH N .  ? 0.1338 0.1212 0.1796 -0.0191 -0.0280 -0.0194 968  HOH A O   
3230 O  O   . HOH N .  ? 0.1863 0.1862 0.2764 0.0413  0.0155  0.0012  969  HOH A O   
3231 O  O   . HOH N .  ? 0.1940 0.3442 0.8284 0.1549  -0.1190 -0.2178 970  HOH A O   
3232 O  O   . HOH N .  ? 0.3519 0.4108 0.3206 0.1537  0.1001  0.0250  971  HOH A O   
3233 O  O   . HOH N .  ? 0.2193 0.2612 0.5973 -0.0047 0.0168  0.0959  972  HOH A O   
3234 O  O   . HOH N .  ? 0.1395 0.2042 0.3112 0.0400  0.0216  -0.0166 973  HOH A O   
3235 O  O   . HOH N .  ? 0.1904 0.3191 0.2707 -0.0928 -0.0561 -0.0086 974  HOH A O   
3236 O  O   . HOH N .  ? 0.0814 0.1060 0.1627 0.0076  0.0118  -0.0215 975  HOH A O   
3237 O  O   . HOH N .  ? 0.1052 0.1376 0.3142 -0.0210 0.0416  0.0016  976  HOH A O   
3238 O  O   . HOH N .  ? 0.0776 0.1164 0.1794 0.0224  -0.0070 0.0286  977  HOH A O   
3239 O  O   . HOH N .  ? 0.1605 0.1422 0.2477 0.0963  0.0665  -0.0158 978  HOH A O   
3240 O  O   . HOH N .  ? 0.1358 0.4507 0.0982 -0.0262 -0.0903 0.0185  979  HOH A O   
3241 O  O   . HOH N .  ? 0.2158 0.3040 0.3443 -0.0945 -0.0227 -0.0363 980  HOH A O   
3242 O  O   . HOH N .  ? 0.1538 0.1751 0.0951 -0.0019 0.0046  0.0135  981  HOH A O   
3243 O  O   . HOH N .  ? 0.3715 0.6489 0.3484 0.0694  0.1958  0.0301  982  HOH A O   
3244 O  O   . HOH N .  ? 0.1993 0.5883 0.5083 0.0819  0.1249  0.3602  983  HOH A O   
3245 O  O   . HOH N .  ? 0.4018 0.3330 0.4215 0.0990  0.2165  0.1108  984  HOH A O   
3246 O  O   . HOH N .  ? 0.4709 0.4117 0.3951 0.0580  0.0244  -0.1689 985  HOH A O   
3247 O  O   . HOH N .  ? 0.3339 0.2245 0.3491 0.1008  0.0023  -0.0277 986  HOH A O   
3248 O  O   . HOH N .  ? 0.1952 0.2405 0.4388 0.0193  -0.0712 0.0162  987  HOH A O   
3249 O  O   . HOH N .  ? 0.1578 0.2363 0.4040 0.0135  -0.0856 -0.1000 988  HOH A O   
3250 O  O   . HOH N .  ? 0.0095 0.0348 0.0948 0.0037  0.0147  -0.0089 989  HOH A O   
3251 O  O   . HOH N .  ? 0.3827 0.3461 0.8473 -0.0114 -0.1709 0.1758  990  HOH A O   
3252 O  O   . HOH N .  ? 0.3442 0.2530 0.2918 0.0126  -0.0301 0.0262  991  HOH A O   
3253 O  O   . HOH N .  ? 0.8087 0.5081 0.5956 -0.0159 0.0433  0.3274  992  HOH A O   
3254 O  O   . HOH N .  ? 0.4445 0.6218 1.3015 0.2991  0.3662  0.2952  993  HOH A O   
3255 O  O   . HOH N .  ? 0.2732 0.2497 0.3595 -0.0685 0.0759  -0.1169 994  HOH A O   
3256 O  O   . HOH N .  ? 0.7062 0.2933 0.2684 -0.0910 0.0938  -0.0593 995  HOH A O   
3257 O  O   . HOH N .  ? 0.3009 0.1627 0.2189 -0.0009 -0.0385 -0.0357 996  HOH A O   
3258 O  O   . HOH N .  ? 0.1549 0.1583 0.3451 0.0349  -0.0019 -0.0370 997  HOH A O   
3259 O  O   . HOH N .  ? 0.0922 0.1800 0.1657 -0.0016 0.0196  0.0009  998  HOH A O   
3260 O  O   . HOH N .  ? 0.4301 0.2099 0.7573 -0.0591 0.0183  -0.1205 999  HOH A O   
3261 O  O   . HOH N .  ? 0.0247 0.2163 0.2897 0.0240  -0.0254 0.1474  1000 HOH A O   
3262 O  O   . HOH N .  ? 0.2174 0.1939 0.2711 -0.0351 0.0570  0.0679  1001 HOH A O   
3263 O  O   . HOH N .  ? 0.5791 0.4090 0.3640 0.2917  0.0719  0.0504  1002 HOH A O   
3264 O  O   . HOH N .  ? 0.6455 0.5347 0.3818 0.2700  -0.1775 -0.2147 1003 HOH A O   
3265 O  O   . HOH N .  ? 0.2588 0.3249 0.2089 -0.1261 0.0077  -0.0257 1004 HOH A O   
3266 O  O   . HOH N .  ? 0.1638 0.3199 0.3444 -0.0525 -0.0282 0.1465  1005 HOH A O   
3267 O  O   . HOH N .  ? 0.5177 0.5106 0.5845 0.0875  0.1329  0.2165  1006 HOH A O   
3268 O  O   . HOH N .  ? 0.0590 0.1339 0.1005 0.0048  -0.0219 0.0208  1007 HOH A O   
3269 O  O   . HOH N .  ? 0.3263 0.2230 0.3182 -0.0751 -0.1227 0.0099  1008 HOH A O   
3270 O  O   . HOH N .  ? 0.1549 0.1868 0.2014 0.0140  0.0103  -0.0012 1009 HOH A O   
3271 O  O   . HOH N .  ? 0.1369 0.2592 0.2455 0.0415  -0.0265 0.0491  1010 HOH A O   
3272 O  O   . HOH N .  ? 0.1811 0.2745 0.2009 0.1364  0.0236  0.0323  1011 HOH A O   
3273 O  O   . HOH N .  ? 0.1199 0.1530 0.1669 -0.0065 0.0246  -0.0303 1012 HOH A O   
3274 O  O   . HOH N .  ? 0.3031 0.3176 0.3503 0.0618  0.0786  -0.0839 1013 HOH A O   
3275 O  O   . HOH N .  ? 0.1848 0.2900 0.3777 0.1077  0.0162  -0.0963 1014 HOH A O   
3276 O  O   . HOH N .  ? 0.8470 0.3359 0.6481 -0.0969 -0.4443 0.1409  1015 HOH A O   
3277 O  O   . HOH N .  ? 0.2737 0.1917 0.3415 0.0587  -0.0658 -0.0773 1016 HOH A O   
3278 O  O   . HOH N .  ? 0.2072 0.5828 0.5167 0.1915  -0.1240 -0.1376 1017 HOH A O   
3279 O  O   . HOH N .  ? 1.1292 1.5122 0.8492 -0.7764 0.0647  0.3976  1018 HOH A O   
3280 O  O   . HOH N .  ? 0.5570 0.2625 0.2844 -0.0554 0.1483  0.0987  1019 HOH A O   
3281 O  O   . HOH N .  ? 0.5884 0.3148 0.4261 0.0655  -0.1190 -0.0293 1020 HOH A O   
3282 O  O   . HOH N .  ? 0.4900 0.4307 0.2718 0.0243  -0.0324 0.0230  1021 HOH A O   
3283 O  O   . HOH N .  ? 0.4944 0.3584 0.4694 -0.0127 -0.0513 0.1431  1022 HOH A O   
3284 O  O   . HOH N .  ? 0.1209 0.2138 0.2213 -0.0387 -0.0298 0.0434  1023 HOH A O   
3285 O  O   . HOH N .  ? 0.5593 0.5148 0.2188 -0.2740 -0.0665 0.0626  1024 HOH A O   
3286 O  O   . HOH N .  ? 0.4178 0.4689 0.2310 -0.2945 -0.0907 0.0557  1025 HOH A O   
3287 O  O   . HOH N .  ? 0.2706 0.5920 0.3937 -0.1055 0.0240  -0.1604 1026 HOH A O   
3288 O  O   . HOH N .  ? 0.2396 0.1902 0.1625 -0.0532 -0.0430 0.0053  1027 HOH A O   
3289 O  O   . HOH N .  ? 0.2822 0.2273 0.2358 0.0672  -0.1011 -0.0893 1028 HOH A O   
3290 O  O   . HOH N .  ? 0.1608 0.2792 0.2832 -0.0095 -0.0037 -0.0781 1029 HOH A O   
3291 O  O   . HOH N .  ? 0.2737 0.2345 0.4605 0.0396  -0.1319 0.0238  1030 HOH A O   
3292 O  O   . HOH N .  ? 0.1809 0.2345 0.1654 -0.0185 -0.0017 -0.0140 1031 HOH A O   
3293 O  O   . HOH N .  ? 0.2120 0.2337 0.2182 0.0166  0.0615  -0.0475 1032 HOH A O   
3294 O  O   . HOH N .  ? 0.4094 0.2243 0.2228 -0.1559 -0.0905 0.0420  1033 HOH A O   
3295 O  O   . HOH N .  ? 0.6736 0.4412 0.4453 0.1432  -0.0159 0.1149  1034 HOH A O   
3296 O  O   . HOH N .  ? 0.2683 0.3272 0.5916 0.0644  -0.0565 -0.2798 1035 HOH A O   
3297 O  O   . HOH N .  ? 0.2001 0.1254 0.4802 0.0533  0.0102  0.1460  1036 HOH A O   
3298 O  O   . HOH N .  ? 0.0836 0.0921 0.1256 -0.0017 -0.0064 0.0068  1037 HOH A O   
3299 O  O   . HOH N .  ? 0.0916 0.1338 0.1132 -0.0194 0.0149  -0.0213 1038 HOH A O   
3300 O  O   . HOH N .  ? 0.1243 0.1432 0.1785 0.0003  0.0134  0.0209  1039 HOH A O   
3301 O  O   . HOH N .  ? 0.0862 0.2495 0.1300 0.0435  0.0136  0.0564  1040 HOH A O   
3302 O  O   . HOH O .  ? 0.2775 0.5947 0.3681 -0.0119 0.0108  -0.0903 905  HOH B O   
3303 O  O   . HOH O .  ? 0.5128 0.2423 0.3655 -0.1091 -0.0425 0.0702  906  HOH B O   
3304 O  O   . HOH O .  ? 0.2840 0.2364 0.3474 -0.0652 -0.1874 0.1528  907  HOH B O   
3305 O  O   . HOH O .  ? 0.1251 0.1523 0.1646 -0.0463 -0.0061 -0.0283 908  HOH B O   
3306 O  O   . HOH O .  ? 0.2005 0.3280 0.2687 0.0895  -0.0276 -0.0741 909  HOH B O   
3307 O  O   . HOH O .  ? 0.6863 0.4567 0.5018 -0.2259 -0.0790 -0.2192 910  HOH B O   
3308 O  O   . HOH O .  ? 0.2895 0.4280 0.3007 0.0255  -0.0249 -0.2014 911  HOH B O   
3309 O  O   . HOH O .  ? 0.4009 0.5351 0.4851 -0.1260 0.2312  -0.2478 912  HOH B O   
3310 O  O   . HOH O .  ? 0.5127 0.2628 0.2660 -0.0573 0.0482  -0.0648 913  HOH B O   
3311 O  O   . HOH O .  ? 0.1160 0.1335 0.1691 -0.0413 -0.0395 0.0217  914  HOH B O   
3312 O  O   . HOH O .  ? 0.2056 0.1732 0.2100 -0.0103 0.0408  -0.0444 915  HOH B O   
3313 O  O   . HOH O .  ? 0.3577 0.2084 0.2701 0.0395  -0.0532 -0.2184 916  HOH B O   
3314 O  O   . HOH O .  ? 0.7494 0.2302 0.3702 0.0479  0.0355  0.1241  917  HOH B O   
3315 O  O   . HOH O .  ? 0.2201 0.3950 0.2466 -0.1465 -0.0087 0.0323  918  HOH B O   
3316 O  O   . HOH O .  ? 0.1169 0.1631 0.5006 -0.0396 0.0914  -0.1912 919  HOH B O   
3317 O  O   . HOH O .  ? 0.2326 0.3375 0.3640 0.0165  -0.1260 -0.0170 920  HOH B O   
3318 O  O   . HOH O .  ? 0.0792 0.1156 0.1705 0.0027  0.0013  -0.0090 921  HOH B O   
3319 O  O   . HOH O .  ? 0.1544 0.1957 0.2296 0.0057  0.0190  0.0498  922  HOH B O   
3320 O  O   . HOH O .  ? 0.3844 0.5046 0.5436 -0.0368 0.1746  -0.0409 923  HOH B O   
3321 O  O   . HOH O .  ? 0.4647 0.6342 0.5361 -0.0599 0.1166  -0.1057 924  HOH B O   
3322 O  O   . HOH O .  ? 0.3235 0.2365 0.3131 0.0152  -0.0739 -0.0166 925  HOH B O   
3323 O  O   . HOH O .  ? 0.3327 0.3077 0.8308 0.0774  0.1326  0.1434  926  HOH B O   
3324 O  O   . HOH O .  ? 0.3765 0.2742 0.9318 0.0195  0.0679  0.2392  927  HOH B O   
3325 O  O   . HOH O .  ? 0.2317 0.1295 0.3026 0.0515  0.0871  0.1018  928  HOH B O   
3326 O  O   . HOH O .  ? 0.3100 0.2660 0.8536 -0.0991 0.0738  -0.1927 929  HOH B O   
3327 O  O   . HOH O .  ? 0.2801 0.2446 0.8628 0.0041  -0.0906 -0.1749 930  HOH B O   
3328 O  O   . HOH O .  ? 0.1466 0.1893 0.2372 0.0194  0.0201  0.0689  931  HOH B O   
3329 O  O   . HOH O .  ? 0.1535 0.1900 0.2919 0.0469  -0.0582 -0.0571 932  HOH B O   
3330 O  O   . HOH O .  ? 0.3761 0.2516 0.3228 0.0152  -0.1048 -0.0666 933  HOH B O   
3331 O  O   . HOH O .  ? 0.4246 0.2810 0.5121 -0.1280 -0.0696 -0.0455 934  HOH B O   
3332 O  O   . HOH O .  ? 0.4615 0.3674 0.4492 -0.1398 0.0375  0.0534  935  HOH B O   
3333 O  O   . HOH O .  ? 0.6157 0.3304 0.8231 0.0538  -0.2952 -0.0619 936  HOH B O   
3334 O  O   . HOH O .  ? 0.6365 0.5191 0.5188 0.1376  -0.0277 0.1494  937  HOH B O   
3335 O  O   . HOH O .  ? 0.3344 0.3377 0.5116 -0.0004 -0.0445 -0.0602 938  HOH B O   
3336 O  O   . HOH O .  ? 0.1262 0.1664 0.1415 -0.0373 0.0417  0.0384  939  HOH B O   
3337 O  O   . HOH O .  ? 0.5306 0.1943 0.4043 0.0482  -0.1364 0.0746  940  HOH B O   
3338 O  O   . HOH O .  ? 0.4257 0.2999 0.2079 0.1713  0.0430  0.1076  941  HOH B O   
3339 O  O   . HOH O .  ? 0.2020 0.2598 0.1218 -0.0415 -0.0258 -0.0234 942  HOH B O   
3340 O  O   . HOH O .  ? 0.1572 0.3338 0.2822 -0.0322 -0.0556 0.0081  943  HOH B O   
3341 O  O   . HOH O .  ? 1.3111 0.3702 0.3475 -0.2881 0.1150  -0.1877 944  HOH B O   
3342 O  O   . HOH O .  ? 0.4549 0.4440 0.3386 -0.1949 0.0009  -0.1188 945  HOH B O   
3343 O  O   . HOH O .  ? 0.1404 0.1399 0.1342 -0.0115 -0.0147 0.0185  946  HOH B O   
3344 O  O   . HOH O .  ? 0.3779 0.2942 0.3922 0.0541  0.1372  0.0035  947  HOH B O   
3345 O  O   . HOH O .  ? 0.1919 0.3740 0.2678 -0.0451 0.0904  -0.0784 948  HOH B O   
3346 O  O   . HOH O .  ? 0.2659 0.1456 0.1627 -0.1108 0.0952  -0.0475 949  HOH B O   
3347 O  O   . HOH O .  ? 0.3938 0.4723 0.3682 0.0013  0.2744  -0.1257 950  HOH B O   
3348 O  O   . HOH O .  ? 0.1692 0.2270 0.3255 0.0356  0.0369  -0.1193 951  HOH B O   
3349 O  O   . HOH O .  ? 0.0728 0.2019 0.1675 0.0583  0.0280  0.0269  952  HOH B O   
3350 O  O   . HOH O .  ? 0.1000 0.3368 0.1777 0.0378  0.0091  0.0100  953  HOH B O   
3351 O  O   . HOH O .  ? 0.5192 0.4328 0.6401 -0.2152 -0.2945 0.2857  954  HOH B O   
3352 O  O   . HOH O .  ? 1.0873 0.9668 0.4032 -0.4646 0.1416  -0.3007 955  HOH B O   
3353 O  O   . HOH O .  ? 0.5609 0.3610 0.3290 -0.0928 -0.1487 0.0227  956  HOH B O   
3354 O  O   . HOH O .  ? 0.0829 0.1408 0.2224 0.0120  0.0136  0.0385  957  HOH B O   
3355 O  O   . HOH O .  ? 0.1246 0.1691 0.1059 -0.0006 0.0228  -0.0103 958  HOH B O   
3356 O  O   . HOH O .  ? 0.8778 0.4454 0.4365 0.0613  -0.0758 -0.1987 959  HOH B O   
3357 O  O   . HOH O .  ? 0.2854 0.2876 0.4106 0.0924  -0.0828 -0.1534 960  HOH B O   
3358 O  O   . HOH O .  ? 0.4743 0.4044 0.5588 -0.0560 0.1771  -0.0100 961  HOH B O   
3359 O  O   . HOH O .  ? 0.1811 0.3091 0.3562 -0.0257 -0.0253 0.0265  962  HOH B O   
3360 O  O   . HOH O .  ? 0.4054 0.3073 0.3771 -0.0481 0.0697  -0.0966 963  HOH B O   
3361 O  O   . HOH O .  ? 0.3599 0.2914 0.4416 -0.2190 0.2331  -0.2622 964  HOH B O   
3362 O  O   . HOH O .  ? 0.4091 0.4301 0.2074 -0.0151 -0.0880 0.0489  965  HOH B O   
3363 O  O   . HOH O .  ? 0.5486 1.1841 0.4425 -0.2880 0.1476  0.1713  966  HOH B O   
3364 O  O   . HOH O .  ? 0.1955 0.1829 0.2326 0.1084  -0.0805 -0.0722 967  HOH B O   
3365 O  O   . HOH O .  ? 0.1567 0.3030 0.3846 0.0632  0.0144  0.1392  968  HOH B O   
3366 O  O   . HOH O .  ? 0.3277 0.2244 0.2342 -0.1036 -0.0625 0.0482  969  HOH B O   
3367 O  O   . HOH O .  ? 0.2152 0.4172 0.2572 -0.0089 0.1108  0.1448  970  HOH B O   
3368 O  O   . HOH O .  ? 0.2372 0.2646 0.8224 -0.0644 0.0934  -0.2094 971  HOH B O   
3369 O  O   . HOH O .  ? 0.2606 0.1739 0.3503 0.0808  0.0406  -0.1394 972  HOH B O   
3370 O  O   . HOH O .  ? 0.1508 0.2291 0.1660 0.0624  -0.0349 -0.0882 973  HOH B O   
3371 O  O   . HOH O .  ? 0.5773 0.1185 0.1158 -0.0837 0.0507  -0.0556 974  HOH B O   
3372 O  O   . HOH O .  ? 1.1737 0.7265 0.3176 -0.2531 0.2326  0.0628  975  HOH B O   
3373 O  O   . HOH O .  ? 0.3718 0.2924 0.2200 0.0135  0.0768  0.0130  976  HOH B O   
3374 O  O   . HOH O .  ? 0.2158 0.5309 0.2576 -0.0161 -0.0536 -0.0156 977  HOH B O   
3375 O  O   . HOH O .  ? 0.3287 0.7366 0.4233 -0.0480 0.0287  -0.1452 978  HOH B O   
3376 O  O   . HOH O .  ? 0.2341 0.1680 0.1988 0.0009  -0.0400 0.0411  979  HOH B O   
3377 O  O   . HOH O .  ? 0.1643 0.1818 0.1677 0.0245  0.0110  0.0421  980  HOH B O   
3378 O  O   . HOH O .  ? 0.2633 0.2725 0.4467 -0.1160 0.0890  -0.0020 981  HOH B O   
3379 O  O   . HOH O .  ? 0.3116 0.2837 0.4176 -0.0782 -0.0551 0.0152  982  HOH B O   
3380 O  O   . HOH O .  ? 0.4517 0.3662 0.3255 0.0931  -0.0954 -0.1700 983  HOH B O   
3381 O  O   . HOH O .  ? 0.2333 0.5667 0.2437 0.1818  -0.1043 -0.1706 984  HOH B O   
3382 O  O   . HOH O .  ? 0.1824 0.3058 0.1348 -0.1291 -0.0220 0.0311  985  HOH B O   
3383 O  O   . HOH O .  ? 0.2518 0.2412 0.1901 -0.0648 -0.0360 0.0007  986  HOH B O   
3384 O  O   . HOH O .  ? 0.3130 0.7489 0.3479 0.0268  -0.1812 -0.0283 987  HOH B O   
3385 O  O   . HOH O .  ? 0.1840 0.3453 0.2032 -0.1373 0.0172  -0.0022 988  HOH B O   
3386 O  O   . HOH O .  ? 0.1851 0.2516 0.8622 0.0023  -0.0970 -0.0241 989  HOH B O   
3387 O  O   . HOH O .  ? 0.1016 0.1073 0.1399 0.0132  0.0037  -0.0090 990  HOH B O   
3388 O  O   . HOH O .  ? 0.2856 0.2652 0.2778 -0.0522 -0.0332 -0.0576 991  HOH B O   
3389 O  O   . HOH O .  ? 0.1340 0.1132 0.2349 0.0118  -0.0528 -0.0440 992  HOH B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  PRO 1  1  1  PRO PRO A . n 
A 1 2  GLN 2  2  2  GLN GLN A . n 
A 1 3  ILE 3  3  3  ILE ILE A . n 
A 1 4  THR 4  4  4  THR THR A . n 
A 1 5  LEU 5  5  5  LEU LEU A . n 
A 1 6  TRP 6  6  6  TRP TRP A . n 
A 1 7  LYS 7  7  7  LYS ALA A . n 
A 1 8  ARG 8  8  8  ARG ARG A . n 
A 1 9  PRO 9  9  9  PRO PRO A . n 
A 1 10 LEU 10 10 10 LEU LEU A . n 
A 1 11 VAL 11 11 11 VAL VAL A . n 
A 1 12 THR 12 12 12 THR THR A . n 
A 1 13 ILE 13 13 13 ILE ILE A . n 
A 1 14 ARG 14 14 14 ARG ARG A . n 
A 1 15 ILE 15 15 15 ILE ILE A . n 
A 1 16 GLY 16 16 16 GLY GLY A . n 
A 1 17 GLY 17 17 17 GLY GLY A . n 
A 1 18 GLN 18 18 18 GLN GLN A . n 
A 1 19 LEU 19 19 19 LEU LEU A . n 
A 1 20 LYS 20 20 20 LYS LYS A . n 
A 1 21 GLU 21 21 21 GLU GLU A . n 
A 1 22 ALA 22 22 22 ALA ALA A . n 
A 1 23 LEU 23 23 23 LEU LEU A . n 
A 1 24 LEU 24 24 24 LEU LEU A . n 
A 1 25 ASP 25 25 25 ASP ASP A . n 
A 1 26 THR 26 26 26 THR THR A . n 
A 1 27 GLY 27 27 27 GLY GLY A . n 
A 1 28 ALA 28 28 28 ALA ALA A . n 
A 1 29 ASP 29 29 29 ASP ASP A . n 
A 1 30 ASP 30 30 30 ASP ASP A . n 
A 1 31 THR 31 31 31 THR THR A . n 
A 1 32 VAL 32 32 32 VAL VAL A . n 
A 1 33 LEU 33 33 33 LEU LEU A . n 
A 1 34 GLU 34 34 34 GLU GLU A . n 
A 1 35 GLU 35 35 35 GLU GLU A . n 
A 1 36 MET 36 36 36 MET MET A . n 
A 1 37 ASN 37 37 37 ASN ASN A . n 
A 1 38 LEU 38 38 38 LEU LEU A . n 
A 1 39 PRO 39 39 39 PRO PRO A . n 
A 1 40 GLY 40 40 40 GLY GLY A . n 
A 1 41 LYS 41 41 41 LYS LYS A . n 
A 1 42 TRP 42 42 42 TRP TRP A . n 
A 1 43 LYS 43 43 43 LYS LYS A . n 
A 1 44 PRO 44 44 44 PRO PRO A . n 
A 1 45 LYS 45 45 45 LYS LYS A . n 
A 1 46 MET 46 46 46 MET MET A . n 
A 1 47 ILE 47 47 47 ILE ILE A . n 
A 1 48 GLY 48 48 48 GLY GLY A . n 
A 1 49 GLY 49 49 49 GLY GLY A . n 
A 1 50 ILE 50 50 50 ILE ILE A . n 
A 1 51 GLY 51 51 51 GLY GLY A . n 
A 1 52 GLY 52 52 52 GLY GLY A . n 
A 1 53 PHE 53 53 53 PHE PHE A . n 
A 1 54 ILE 54 54 54 ILE ILE A . n 
A 1 55 LYS 55 55 55 LYS LYS A . n 
A 1 56 VAL 56 56 56 VAL VAL A . n 
A 1 57 ARG 57 57 57 ARG ARG A . n 
A 1 58 GLN 58 58 58 GLN GLN A . n 
A 1 59 TYR 59 59 59 TYR TYR A . n 
A 1 60 ASP 60 60 60 ASP ASP A . n 
A 1 61 GLN 61 61 61 GLN GLN A . n 
A 1 62 ILE 62 62 62 ILE ILE A . n 
A 1 63 PRO 63 63 63 PRO PRO A . n 
A 1 64 VAL 64 64 64 VAL VAL A . n 
A 1 65 GLU 65 65 65 GLU GLU A . n 
A 1 66 ILE 66 66 66 ILE ILE A . n 
A 1 67 CYS 67 67 67 CYS CYS A . n 
A 1 68 GLY 68 68 68 GLY GLY A . n 
A 1 69 HIS 69 69 69 HIS HIS A . n 
A 1 70 LYS 70 70 70 LYS ALA A . n 
A 1 71 ALA 71 71 71 ALA ALA A . n 
A 1 72 ILE 72 72 72 ILE ILE A . n 
A 1 73 GLY 73 73 73 GLY GLY A . n 
A 1 74 THR 74 74 74 THR THR A . n 
A 1 75 VAL 75 75 75 VAL VAL A . n 
A 1 76 LEU 76 76 76 LEU LEU A . n 
A 1 77 VAL 77 77 77 VAL VAL A . n 
A 1 78 GLY 78 78 78 GLY GLY A . n 
A 1 79 PRO 79 79 79 PRO PRO A . n 
A 1 80 THR 80 80 80 THR THR A . n 
A 1 81 PRO 81 81 81 PRO PRO A . n 
A 1 82 VAL 82 82 82 VAL VAL A . n 
A 1 83 ASN 83 83 83 ASN ASN A . n 
A 1 84 ILE 84 84 84 ILE ILE A . n 
A 1 85 ILE 85 85 85 ILE ILE A . n 
A 1 86 GLY 86 86 86 GLY GLY A . n 
A 1 87 ARG 87 87 87 ARG ARG A . n 
A 1 88 ASN 88 88 88 ASN ASN A . n 
A 1 89 LEU 89 89 89 LEU LEU A . n 
A 1 90 LEU 90 90 90 LEU LEU A . n 
A 1 91 THR 91 91 91 THR THR A . n 
A 1 92 GLN 92 92 92 GLN GLN A . n 
A 1 93 ILE 93 93 93 ILE ILE A . n 
A 1 94 GLY 94 94 94 GLY GLY A . n 
A 1 95 CYS 95 95 95 CYS CYS A . n 
A 1 96 THR 96 96 96 THR THR A . n 
A 1 97 LEU 97 97 97 LEU LEU A . n 
A 1 98 ASN 98 98 98 ASN ASN A . n 
A 1 99 PHE 99 99 99 PHE PHE A . n 
B 1 1  PRO 1  1  1  PRO PRO B . n 
B 1 2  GLN 2  2  2  GLN GLN B . n 
B 1 3  ILE 3  3  3  ILE ILE B . n 
B 1 4  THR 4  4  4  THR THR B . n 
B 1 5  LEU 5  5  5  LEU LEU B . n 
B 1 6  TRP 6  6  6  TRP TRP B . n 
B 1 7  LYS 7  7  7  LYS LYS B . n 
B 1 8  ARG 8  8  8  ARG ARG B . n 
B 1 9  PRO 9  9  9  PRO PRO B . n 
B 1 10 LEU 10 10 10 LEU LEU B . n 
B 1 11 VAL 11 11 11 VAL VAL B . n 
B 1 12 THR 12 12 12 THR THR B . n 
B 1 13 ILE 13 13 13 ILE ILE B . n 
B 1 14 ARG 14 14 14 ARG ARG B . n 
B 1 15 ILE 15 15 15 ILE ILE B . n 
B 1 16 GLY 16 16 16 GLY GLY B . n 
B 1 17 GLY 17 17 17 GLY GLY B . n 
B 1 18 GLN 18 18 18 GLN GLN B . n 
B 1 19 LEU 19 19 19 LEU LEU B . n 
B 1 20 LYS 20 20 20 LYS LYS B . n 
B 1 21 GLU 21 21 21 GLU GLU B . n 
B 1 22 ALA 22 22 22 ALA ALA B . n 
B 1 23 LEU 23 23 23 LEU LEU B . n 
B 1 24 LEU 24 24 24 LEU LEU B . n 
B 1 25 ASP 25 25 25 ASP ASP B . n 
B 1 26 THR 26 26 26 THR THR B . n 
B 1 27 GLY 27 27 27 GLY GLY B . n 
B 1 28 ALA 28 28 28 ALA ALA B . n 
B 1 29 ASP 29 29 29 ASP ASP B . n 
B 1 30 ASP 30 30 30 ASP ASP B . n 
B 1 31 THR 31 31 31 THR THR B . n 
B 1 32 VAL 32 32 32 VAL VAL B . n 
B 1 33 LEU 33 33 33 LEU LEU B . n 
B 1 34 GLU 34 34 34 GLU GLU B . n 
B 1 35 GLU 35 35 35 GLU GLU B . n 
B 1 36 MET 36 36 36 MET MET B . n 
B 1 37 ASN 37 37 37 ASN ASN B . n 
B 1 38 LEU 38 38 38 LEU LEU B . n 
B 1 39 PRO 39 39 39 PRO PRO B . n 
B 1 40 GLY 40 40 40 GLY GLY B . n 
B 1 41 LYS 41 41 41 LYS LYS B . n 
B 1 42 TRP 42 42 42 TRP TRP B . n 
B 1 43 LYS 43 43 43 LYS LYS B . n 
B 1 44 PRO 44 44 44 PRO PRO B . n 
B 1 45 LYS 45 45 45 LYS LYS B . n 
B 1 46 MET 46 46 46 MET MET B . n 
B 1 47 ILE 47 47 47 ILE ILE B . n 
B 1 48 GLY 48 48 48 GLY GLY B . n 
B 1 49 GLY 49 49 49 GLY GLY B . n 
B 1 50 ILE 50 50 50 ILE ILE B . n 
B 1 51 GLY 51 51 51 GLY GLY B . n 
B 1 52 GLY 52 52 52 GLY GLY B . n 
B 1 53 PHE 53 53 53 PHE PHE B . n 
B 1 54 ILE 54 54 54 ILE ILE B . n 
B 1 55 LYS 55 55 55 LYS LYS B . n 
B 1 56 VAL 56 56 56 VAL VAL B . n 
B 1 57 ARG 57 57 57 ARG ARG B . n 
B 1 58 GLN 58 58 58 GLN GLN B . n 
B 1 59 TYR 59 59 59 TYR TYR B . n 
B 1 60 ASP 60 60 60 ASP ASP B . n 
B 1 61 GLN 61 61 61 GLN GLN B . n 
B 1 62 ILE 62 62 62 ILE ILE B . n 
B 1 63 PRO 63 63 63 PRO PRO B . n 
B 1 64 VAL 64 64 64 VAL VAL B . n 
B 1 65 GLU 65 65 65 GLU GLU B . n 
B 1 66 ILE 66 66 66 ILE ILE B . n 
B 1 67 CYS 67 67 67 CYS CYS B . n 
B 1 68 GLY 68 68 68 GLY GLY B . n 
B 1 69 HIS 69 69 69 HIS HIS B . n 
B 1 70 LYS 70 70 70 LYS LYS B . n 
B 1 71 ALA 71 71 71 ALA ALA B . n 
B 1 72 ILE 72 72 72 ILE ILE B . n 
B 1 73 GLY 73 73 73 GLY GLY B . n 
B 1 74 THR 74 74 74 THR THR B . n 
B 1 75 VAL 75 75 75 VAL VAL B . n 
B 1 76 LEU 76 76 76 LEU LEU B . n 
B 1 77 VAL 77 77 77 VAL VAL B . n 
B 1 78 GLY 78 78 78 GLY GLY B . n 
B 1 79 PRO 79 79 79 PRO PRO B . n 
B 1 80 THR 80 80 80 THR THR B . n 
B 1 81 PRO 81 81 81 PRO PRO B . n 
B 1 82 VAL 82 82 82 VAL VAL B . n 
B 1 83 ASN 83 83 83 ASN ASN B . n 
B 1 84 ILE 84 84 84 ILE ILE B . n 
B 1 85 ILE 85 85 85 ILE ILE B . n 
B 1 86 GLY 86 86 86 GLY GLY B . n 
B 1 87 ARG 87 87 87 ARG ARG B . n 
B 1 88 ASN 88 88 88 ASN ASN B . n 
B 1 89 LEU 89 89 89 LEU LEU B . n 
B 1 90 LEU 90 90 90 LEU LEU B . n 
B 1 91 THR 91 91 91 THR THR B . n 
B 1 92 GLN 92 92 92 GLN GLN B . n 
B 1 93 ILE 93 93 93 ILE ILE B . n 
B 1 94 GLY 94 94 94 GLY GLY B . n 
B 1 95 CYS 95 95 95 CYS CYS B . n 
B 1 96 THR 96 96 96 THR THR B . n 
B 1 97 LEU 97 97 97 LEU LEU B . n 
B 1 98 ASN 98 98 98 ASN ASN B . n 
B 1 99 PHE 99 99 99 PHE PHE B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 JE2 1   701  1   JE2 JE2 A . 
D 3 CL  1   902  1   CL  CL  A . 
E 3 CL  1   905  4   CL  CL  A . 
F 4 EDO 1   801  1   EDO EDO A . 
G 4 EDO 1   803  3   EDO EDO A . 
H 4 EDO 1   804  4   EDO EDO A . 
I 4 EDO 1   805  5   EDO EDO A . 
J 3 CL  1   901  32  CL  CL  B . 
K 3 CL  1   903  2   CL  CL  B . 
L 3 CL  1   904  3   CL  CL  B . 
M 4 EDO 1   802  2   EDO EDO B . 
N 5 HOH 1   906  7   HOH HOH A . 
N 5 HOH 2   907  9   HOH HOH A . 
N 5 HOH 3   908  37  HOH HOH A . 
N 5 HOH 4   909  38  HOH HOH A . 
N 5 HOH 5   910  39  HOH HOH A . 
N 5 HOH 6   911  40  HOH HOH A . 
N 5 HOH 7   912  41  HOH HOH A . 
N 5 HOH 8   913  42  HOH HOH A . 
N 5 HOH 9   914  43  HOH HOH A . 
N 5 HOH 10  915  44  HOH HOH A . 
N 5 HOH 11  916  45  HOH HOH A . 
N 5 HOH 12  917  46  HOH HOH A . 
N 5 HOH 13  918  47  HOH HOH A . 
N 5 HOH 14  919  48  HOH HOH A . 
N 5 HOH 15  920  49  HOH HOH A . 
N 5 HOH 16  921  50  HOH HOH A . 
N 5 HOH 17  922  51  HOH HOH A . 
N 5 HOH 18  923  52  HOH HOH A . 
N 5 HOH 19  924  53  HOH HOH A . 
N 5 HOH 20  925  54  HOH HOH A . 
N 5 HOH 21  926  55  HOH HOH A . 
N 5 HOH 22  927  56  HOH HOH A . 
N 5 HOH 23  928  57  HOH HOH A . 
N 5 HOH 24  929  58  HOH HOH A . 
N 5 HOH 25  930  60  HOH HOH A . 
N 5 HOH 26  931  62  HOH HOH A . 
N 5 HOH 27  932  63  HOH HOH A . 
N 5 HOH 28  933  65  HOH HOH A . 
N 5 HOH 29  934  66  HOH HOH A . 
N 5 HOH 30  935  94  HOH HOH A . 
N 5 HOH 31  936  95  HOH HOH A . 
N 5 HOH 32  937  96  HOH HOH A . 
N 5 HOH 33  938  97  HOH HOH A . 
N 5 HOH 34  939  98  HOH HOH A . 
N 5 HOH 35  940  99  HOH HOH A . 
N 5 HOH 36  941  100 HOH HOH A . 
N 5 HOH 37  942  101 HOH HOH A . 
N 5 HOH 38  943  102 HOH HOH A . 
N 5 HOH 39  944  103 HOH HOH A . 
N 5 HOH 40  945  104 HOH HOH A . 
N 5 HOH 41  946  105 HOH HOH A . 
N 5 HOH 42  947  106 HOH HOH A . 
N 5 HOH 43  948  107 HOH HOH A . 
N 5 HOH 44  949  108 HOH HOH A . 
N 5 HOH 45  950  109 HOH HOH A . 
N 5 HOH 46  951  110 HOH HOH A . 
N 5 HOH 47  952  111 HOH HOH A . 
N 5 HOH 48  953  112 HOH HOH A . 
N 5 HOH 49  954  113 HOH HOH A . 
N 5 HOH 50  955  114 HOH HOH A . 
N 5 HOH 51  956  115 HOH HOH A . 
N 5 HOH 52  957  116 HOH HOH A . 
N 5 HOH 53  958  117 HOH HOH A . 
N 5 HOH 54  959  118 HOH HOH A . 
N 5 HOH 55  960  119 HOH HOH A . 
N 5 HOH 56  961  120 HOH HOH A . 
N 5 HOH 57  962  121 HOH HOH A . 
N 5 HOH 58  963  122 HOH HOH A . 
N 5 HOH 59  964  123 HOH HOH A . 
N 5 HOH 60  965  124 HOH HOH A . 
N 5 HOH 61  966  128 HOH HOH A . 
N 5 HOH 62  967  129 HOH HOH A . 
N 5 HOH 63  968  130 HOH HOH A . 
N 5 HOH 64  969  131 HOH HOH A . 
N 5 HOH 65  970  132 HOH HOH A . 
N 5 HOH 66  971  133 HOH HOH A . 
N 5 HOH 67  972  134 HOH HOH A . 
N 5 HOH 68  973  135 HOH HOH A . 
N 5 HOH 69  974  136 HOH HOH A . 
N 5 HOH 70  975  137 HOH HOH A . 
N 5 HOH 71  976  138 HOH HOH A . 
N 5 HOH 72  977  139 HOH HOH A . 
N 5 HOH 73  978  140 HOH HOH A . 
N 5 HOH 74  979  141 HOH HOH A . 
N 5 HOH 75  980  142 HOH HOH A . 
N 5 HOH 76  981  143 HOH HOH A . 
N 5 HOH 77  982  144 HOH HOH A . 
N 5 HOH 78  983  145 HOH HOH A . 
N 5 HOH 79  984  146 HOH HOH A . 
N 5 HOH 80  985  147 HOH HOH A . 
N 5 HOH 81  986  148 HOH HOH A . 
N 5 HOH 82  987  149 HOH HOH A . 
N 5 HOH 83  988  150 HOH HOH A . 
N 5 HOH 84  989  151 HOH HOH A . 
N 5 HOH 85  990  152 HOH HOH A . 
N 5 HOH 86  991  153 HOH HOH A . 
N 5 HOH 87  992  154 HOH HOH A . 
N 5 HOH 88  993  155 HOH HOH A . 
N 5 HOH 89  994  156 HOH HOH A . 
N 5 HOH 90  995  157 HOH HOH A . 
N 5 HOH 91  996  158 HOH HOH A . 
N 5 HOH 92  997  159 HOH HOH A . 
N 5 HOH 93  998  160 HOH HOH A . 
N 5 HOH 94  999  161 HOH HOH A . 
N 5 HOH 95  1000 162 HOH HOH A . 
N 5 HOH 96  1001 163 HOH HOH A . 
N 5 HOH 97  1002 164 HOH HOH A . 
N 5 HOH 98  1003 165 HOH HOH A . 
N 5 HOH 99  1004 166 HOH HOH A . 
N 5 HOH 100 1005 167 HOH HOH A . 
N 5 HOH 101 1006 168 HOH HOH A . 
N 5 HOH 102 1007 169 HOH HOH A . 
N 5 HOH 103 1008 170 HOH HOH A . 
N 5 HOH 104 1009 171 HOH HOH A . 
N 5 HOH 105 1010 172 HOH HOH A . 
N 5 HOH 106 1011 173 HOH HOH A . 
N 5 HOH 107 1012 174 HOH HOH A . 
N 5 HOH 108 1013 175 HOH HOH A . 
N 5 HOH 109 1014 176 HOH HOH A . 
N 5 HOH 110 1015 177 HOH HOH A . 
N 5 HOH 111 1016 178 HOH HOH A . 
N 5 HOH 112 1017 179 HOH HOH A . 
N 5 HOH 113 1018 180 HOH HOH A . 
N 5 HOH 114 1019 181 HOH HOH A . 
N 5 HOH 115 1020 182 HOH HOH A . 
N 5 HOH 116 1021 183 HOH HOH A . 
N 5 HOH 117 1022 185 HOH HOH A . 
N 5 HOH 118 1023 186 HOH HOH A . 
N 5 HOH 119 1024 187 HOH HOH A . 
N 5 HOH 120 1025 189 HOH HOH A . 
N 5 HOH 121 1026 190 HOH HOH A . 
N 5 HOH 122 1027 191 HOH HOH A . 
N 5 HOH 123 1028 197 HOH HOH A . 
N 5 HOH 124 1029 200 HOH HOH A . 
N 5 HOH 125 1030 208 HOH HOH A . 
N 5 HOH 126 1031 214 HOH HOH A . 
N 5 HOH 127 1032 215 HOH HOH A . 
N 5 HOH 128 1033 216 HOH HOH A . 
N 5 HOH 129 1034 217 HOH HOH A . 
N 5 HOH 130 1035 219 HOH HOH A . 
N 5 HOH 131 1036 220 HOH HOH A . 
N 5 HOH 132 1037 301 HOH HOH A . 
N 5 HOH 133 1038 406 HOH HOH A . 
N 5 HOH 134 1039 566 HOH HOH A . 
N 5 HOH 135 1040 608 HOH HOH A . 
O 5 HOH 1   905  1   HOH HOH B . 
O 5 HOH 2   906  2   HOH HOH B . 
O 5 HOH 3   907  3   HOH HOH B . 
O 5 HOH 4   908  4   HOH HOH B . 
O 5 HOH 5   909  5   HOH HOH B . 
O 5 HOH 6   910  10  HOH HOH B . 
O 5 HOH 7   911  11  HOH HOH B . 
O 5 HOH 8   912  12  HOH HOH B . 
O 5 HOH 9   913  13  HOH HOH B . 
O 5 HOH 10  914  14  HOH HOH B . 
O 5 HOH 11  915  15  HOH HOH B . 
O 5 HOH 12  916  16  HOH HOH B . 
O 5 HOH 13  917  17  HOH HOH B . 
O 5 HOH 14  918  18  HOH HOH B . 
O 5 HOH 15  919  19  HOH HOH B . 
O 5 HOH 16  920  20  HOH HOH B . 
O 5 HOH 17  921  21  HOH HOH B . 
O 5 HOH 18  922  22  HOH HOH B . 
O 5 HOH 19  923  23  HOH HOH B . 
O 5 HOH 20  924  24  HOH HOH B . 
O 5 HOH 21  925  25  HOH HOH B . 
O 5 HOH 22  926  26  HOH HOH B . 
O 5 HOH 23  927  27  HOH HOH B . 
O 5 HOH 24  928  28  HOH HOH B . 
O 5 HOH 25  929  29  HOH HOH B . 
O 5 HOH 26  930  30  HOH HOH B . 
O 5 HOH 27  931  31  HOH HOH B . 
O 5 HOH 28  932  32  HOH HOH B . 
O 5 HOH 29  933  33  HOH HOH B . 
O 5 HOH 30  934  34  HOH HOH B . 
O 5 HOH 31  935  35  HOH HOH B . 
O 5 HOH 32  936  36  HOH HOH B . 
O 5 HOH 33  937  59  HOH HOH B . 
O 5 HOH 34  938  64  HOH HOH B . 
O 5 HOH 35  939  67  HOH HOH B . 
O 5 HOH 36  940  68  HOH HOH B . 
O 5 HOH 37  941  69  HOH HOH B . 
O 5 HOH 38  942  70  HOH HOH B . 
O 5 HOH 39  943  71  HOH HOH B . 
O 5 HOH 40  944  72  HOH HOH B . 
O 5 HOH 41  945  73  HOH HOH B . 
O 5 HOH 42  946  74  HOH HOH B . 
O 5 HOH 43  947  75  HOH HOH B . 
O 5 HOH 44  948  76  HOH HOH B . 
O 5 HOH 45  949  77  HOH HOH B . 
O 5 HOH 46  950  78  HOH HOH B . 
O 5 HOH 47  951  79  HOH HOH B . 
O 5 HOH 48  952  80  HOH HOH B . 
O 5 HOH 49  953  81  HOH HOH B . 
O 5 HOH 50  954  82  HOH HOH B . 
O 5 HOH 51  955  83  HOH HOH B . 
O 5 HOH 52  956  84  HOH HOH B . 
O 5 HOH 53  957  85  HOH HOH B . 
O 5 HOH 54  958  86  HOH HOH B . 
O 5 HOH 55  959  87  HOH HOH B . 
O 5 HOH 56  960  88  HOH HOH B . 
O 5 HOH 57  961  89  HOH HOH B . 
O 5 HOH 58  962  90  HOH HOH B . 
O 5 HOH 59  963  91  HOH HOH B . 
O 5 HOH 60  964  92  HOH HOH B . 
O 5 HOH 61  965  93  HOH HOH B . 
O 5 HOH 62  966  125 HOH HOH B . 
O 5 HOH 63  967  126 HOH HOH B . 
O 5 HOH 64  968  127 HOH HOH B . 
O 5 HOH 65  969  184 HOH HOH B . 
O 5 HOH 66  970  188 HOH HOH B . 
O 5 HOH 67  971  192 HOH HOH B . 
O 5 HOH 68  972  193 HOH HOH B . 
O 5 HOH 69  973  194 HOH HOH B . 
O 5 HOH 70  974  195 HOH HOH B . 
O 5 HOH 71  975  196 HOH HOH B . 
O 5 HOH 72  976  201 HOH HOH B . 
O 5 HOH 73  977  202 HOH HOH B . 
O 5 HOH 74  978  203 HOH HOH B . 
O 5 HOH 75  979  204 HOH HOH B . 
O 5 HOH 76  980  205 HOH HOH B . 
O 5 HOH 77  981  206 HOH HOH B . 
O 5 HOH 78  982  207 HOH HOH B . 
O 5 HOH 79  983  209 HOH HOH B . 
O 5 HOH 80  984  210 HOH HOH B . 
O 5 HOH 81  985  211 HOH HOH B . 
O 5 HOH 82  986  212 HOH HOH B . 
O 5 HOH 83  987  213 HOH HOH B . 
O 5 HOH 84  988  218 HOH HOH B . 
O 5 HOH 85  989  221 HOH HOH B . 
O 5 HOH 86  990  222 HOH HOH B . 
O 5 HOH 87  991  223 HOH HOH B . 
O 5 HOH 88  992  426 HOH HOH B . 
# 
_pdbx_molecule_features.prd_id    PRD_000566 
_pdbx_molecule_features.name      KNI-764 
_pdbx_molecule_features.type      Peptide-like 
_pdbx_molecule_features.class     'Enzyme inhibitor' 
_pdbx_molecule_features.details   ? 
# 
_pdbx_molecule.instance_id   1 
_pdbx_molecule.prd_id        PRD_000566 
_pdbx_molecule.asym_id       C 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5980 ? 
1 MORE         -61  ? 
1 'SSA (A^2)'  9880 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-04-03 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2012-12-12 
5 'Structure model' 1 4 2018-01-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Atomic model'              
3 3 'Structure model' 'Database references'       
4 3 'Structure model' 'Derived calculations'      
5 3 'Structure model' 'Non-polymer description'   
6 3 'Structure model' 'Structure summary'         
7 3 'Structure model' 'Version format compliance' 
8 4 'Structure model' Other                       
9 5 'Structure model' 'Database references'       
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    5 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            citation_author 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    5 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_citation_author.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          . ? 1 
SHELXL-97 refinement       . ? 2 
DENZO     'data reduction' . ? 3 
SCALEPACK 'data scaling'   . ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   CL 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   CL 
_pdbx_validate_close_contact.auth_seq_id_1    901 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    991 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.97 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    CL 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    CL 
_pdbx_validate_symm_contact.auth_seq_id_1     901 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     938 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_554 
_pdbx_validate_symm_contact.dist              2.11 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE  A ARG 8  ? ? CZ A ARG 8  ? ? NH2 A ARG 8  ? ? 124.13 120.30 3.83  0.50 N 
2  1 NE  A ARG 14 ? ? CZ A ARG 14 ? ? NH1 A ARG 14 ? ? 125.01 120.30 4.71  0.50 N 
3  1 NE  A ARG 14 ? ? CZ A ARG 14 ? ? NH2 A ARG 14 ? ? 116.93 120.30 -3.37 0.50 N 
4  1 OE1 A GLU 34 ? ? CD A GLU 34 ? ? OE2 A GLU 34 ? ? 113.68 123.30 -9.62 1.20 N 
5  1 NE  A ARG 57 ? ? CZ A ARG 57 ? ? NH2 A ARG 57 ? ? 116.15 120.30 -4.15 0.50 N 
6  1 NE  B ARG 8  ? ? CZ B ARG 8  ? ? NH1 B ARG 8  ? ? 116.65 120.30 -3.65 0.50 N 
7  1 CD  B ARG 14 ? ? NE B ARG 14 ? ? CZ  B ARG 14 ? ? 135.22 123.60 11.62 1.40 N 
8  1 NE  B ARG 14 ? ? CZ B ARG 14 ? ? NH1 B ARG 14 ? ? 129.20 120.30 8.90  0.50 N 
9  1 CB  B ASP 29 ? ? CG B ASP 29 ? ? OD1 B ASP 29 ? ? 124.43 118.30 6.13  0.90 N 
10 1 CA  B LYS 43 ? ? CB B LYS 43 ? ? CG  B LYS 43 ? ? 132.48 113.40 19.08 2.20 N 
11 1 CA  B CYS 67 ? ? CB B CYS 67 ? A SG  B CYS 67 ? A 123.97 114.20 9.77  1.10 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    PRO 
_pdbx_validate_torsion.auth_asym_id    B 
_pdbx_validate_torsion.auth_seq_id     79 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -76.50 
_pdbx_validate_torsion.psi             46.03 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 7  ? CG ? A LYS 7  CG 
2 1 Y 1 A LYS 7  ? CD ? A LYS 7  CD 
3 1 Y 1 A LYS 7  ? CE ? A LYS 7  CE 
4 1 Y 1 A LYS 7  ? NZ ? A LYS 7  NZ 
5 1 Y 1 A LYS 70 ? CG ? A LYS 70 CG 
6 1 Y 1 A LYS 70 ? CD ? A LYS 70 CD 
7 1 Y 1 A LYS 70 ? CE ? A LYS 70 CE 
8 1 Y 1 A LYS 70 ? NZ ? A LYS 70 NZ 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
;(4R)-3-{(2S,3S)-2-hydroxy-3-[(3-hydroxy-2-methylbenzoyl)amino]-4-phenylbutanoyl}-5,5-dimethyl-N-(2-methylbenzyl)-1,3-thiazolidine-4-carboxamide
;
JE2 
3 'CHLORIDE ION' CL  
4 1,2-ETHANEDIOL EDO 
5 water HOH 
#