data_1L3E
# 
_entry.id   1L3E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1L3E         
RCSB  RCSB015604   
WWPDB D_1000015604 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1L3E 
_pdbx_database_status.recvd_initial_deposition_date   2002-02-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Freedman, S.J.'   1 
'Sun, Z.J.'        2 
'Poy, F.'          3 
'Kung, A.L.'       4 
'Livingston, D.M.' 5 
'Wagner, G.'       6 
'Eck, M.J.'        7 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for recruitment of CBP/p300 by hypoxia-inducible factor-1 alpha.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            99 
_citation.page_first                5367 
_citation.page_last                 5372 
_citation.year                      2002 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11959990 
_citation.pdbx_database_id_DOI      10.1073/pnas.082117899 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Freedman, S.J.'   1 
primary 'Sun, Z.Y.'        2 
primary 'Poy, F.'          3 
primary 'Kung, A.L.'       4 
primary 'Livingston, D.M.' 5 
primary 'Wagner, G.'       6 
primary 'Eck, M.J.'        7 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'hypoxia inducible factor-1 alpha subunit' 4563.988  1 ? ? 'C-terminal transactivation domain (CTAD)' ? 
2 polymer     man 'p300 protein'                             11425.289 1 ? ? 'cysteine/histidine-rich 1 domain (CH1)'   ? 
3 non-polymer syn 'ZINC ION'                                 65.409    3 ? ? ?                                          ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no GSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN                                                               
GSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN                                                               A ? 
2 'polypeptide(L)' no no 
;MGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISH
WKNCTRHDCPVCLPLKNAGDK
;
;MGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISH
WKNCTRHDCPVCLPLKNAGDK
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   MET n 
1 4   ASP n 
1 5   GLU n 
1 6   SER n 
1 7   GLY n 
1 8   LEU n 
1 9   PRO n 
1 10  GLN n 
1 11  LEU n 
1 12  THR n 
1 13  SER n 
1 14  TYR n 
1 15  ASP n 
1 16  CYS n 
1 17  GLU n 
1 18  VAL n 
1 19  ASN n 
1 20  ALA n 
1 21  PRO n 
1 22  ILE n 
1 23  GLN n 
1 24  GLY n 
1 25  SER n 
1 26  ARG n 
1 27  ASN n 
1 28  LEU n 
1 29  LEU n 
1 30  GLN n 
1 31  GLY n 
1 32  GLU n 
1 33  GLU n 
1 34  LEU n 
1 35  LEU n 
1 36  ARG n 
1 37  ALA n 
1 38  LEU n 
1 39  ASP n 
1 40  GLN n 
1 41  VAL n 
1 42  ASN n 
2 1   MET n 
2 2   GLY n 
2 3   SER n 
2 4   GLY n 
2 5   ALA n 
2 6   HIS n 
2 7   THR n 
2 8   ALA n 
2 9   ASP n 
2 10  PRO n 
2 11  GLU n 
2 12  LYS n 
2 13  ARG n 
2 14  LYS n 
2 15  LEU n 
2 16  ILE n 
2 17  GLN n 
2 18  GLN n 
2 19  GLN n 
2 20  LEU n 
2 21  VAL n 
2 22  LEU n 
2 23  LEU n 
2 24  LEU n 
2 25  HIS n 
2 26  ALA n 
2 27  HIS n 
2 28  LYS n 
2 29  CYS n 
2 30  GLN n 
2 31  ARG n 
2 32  ARG n 
2 33  GLU n 
2 34  GLN n 
2 35  ALA n 
2 36  ASN n 
2 37  GLY n 
2 38  GLU n 
2 39  VAL n 
2 40  ARG n 
2 41  GLN n 
2 42  CYS n 
2 43  ASN n 
2 44  LEU n 
2 45  PRO n 
2 46  HIS n 
2 47  CYS n 
2 48  ARG n 
2 49  THR n 
2 50  MET n 
2 51  LYS n 
2 52  ASN n 
2 53  VAL n 
2 54  LEU n 
2 55  ASN n 
2 56  HIS n 
2 57  MET n 
2 58  THR n 
2 59  HIS n 
2 60  CYS n 
2 61  GLN n 
2 62  SER n 
2 63  GLY n 
2 64  LYS n 
2 65  SER n 
2 66  CYS n 
2 67  GLN n 
2 68  VAL n 
2 69  ALA n 
2 70  HIS n 
2 71  CYS n 
2 72  ALA n 
2 73  SER n 
2 74  SER n 
2 75  ARG n 
2 76  GLN n 
2 77  ILE n 
2 78  ILE n 
2 79  SER n 
2 80  HIS n 
2 81  TRP n 
2 82  LYS n 
2 83  ASN n 
2 84  CYS n 
2 85  THR n 
2 86  ARG n 
2 87  HIS n 
2 88  ASP n 
2 89  CYS n 
2 90  PRO n 
2 91  VAL n 
2 92  CYS n 
2 93  LEU n 
2 94  PRO n 
2 95  LEU n 
2 96  LYS n 
2 97  ASN n 
2 98  ALA n 
2 99  GLY n 
2 100 ASP n 
2 101 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo 'hypoxia inducible factor-1 alpha' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21' 511693 Escherichia ? ? 'Escherichia coli' ? ? BL21 ? ? ? ? ? ? ? PLASMID ? ? ? pET   ? ? 
2 1 sample ? ? ? human Homo p300                               ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21' 511693 Escherichia ? ? 'Escherichia coli' ? ? BL21 ? ? ? ? ? ? ? PLASMID ? ? ? pACYC ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP HIF1A_HUMAN 1 QSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN                                                               785 
Q16665 ? 
2 UNP EP300_HUMAN 2 
;MGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISH
WKNCTRHDCPVCLPLKNAGDK
;
323 Q09472 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1L3E A 1 ? 42  ? Q16665 785 ? 826 ? 1   42  
2 2 1L3E B 1 ? 101 ? Q09472 323 ? 423 ? 101 201 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1L3E 
_struct_ref_seq_dif.mon_id                       GLY 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q16665 
_struct_ref_seq_dif.db_mon_id                    GLN 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          785 
_struct_ref_seq_dif.details                      'CLONING ARTIFACT' 
_struct_ref_seq_dif.pdbx_auth_seq_num            1 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 3 1 3D_15N-separated_NOESY 
2 4 1 2D_NOESY               
3 2 1 3D_13C-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '100 mM NaCl' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1mM CTAD/CH1 complex U-15N,13C; 0.1mM ZnSO4; 1mM DTT' '90% D2O, 10% H2O' 
2 '1mM CTAD/CH1 complex U-15N,13C; 0.1mM ZnSO4; 1mM DTT' '99.9% D2O'        
3 '1mM CTAD/CH1 complex U-15N; 0.1mM ZnSO4; 1mM DTT'     '90% D2O, 10% H2O' 
4 '1mM CTAD/CH1 complex; 0.1mM ZnSO4; 1mM DTT'           '99.9% D2O'        
5 '1mM CTAD/CH1 complex 10% U-13C; 0.1mM ZnSO4; 1mM DTT' '99.9% D2O'        
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker Avance 500 
2 ? Varian UNITY  500 
3 ? Varian INOVA  750 
# 
_pdbx_nmr_refine.entry_id           1L3E 
_pdbx_nmr_refine.method             
;distance geometry,  
simulated annealing
;
_pdbx_nmr_refine.details            
;the structures are based on a total of 1378 restraints; 1126 are NOE-derived distance restraints (including 1013 intramolecular, 113 intermolecular), 158 dihedral angle restraints, and 94 hydrogen bond restraints
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1L3E 
_pdbx_nmr_ensemble.conformers_calculated_total_number            25 
_pdbx_nmr_ensemble.conformers_submitted_total_number             17 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations,structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1L3E 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XWINNMR 2.5    collection           Bruker  1 
VNMR    5.3    collection           Varian  2 
PROSA   3.7    processing           Guntert 3 
XEASY   1.3.13 'data analysis'      Bartels 4 
DYANA   1.4    'structure solution' Guntert 5 
X-PLOR  3.1    refinement           Brunger 6 
# 
_exptl.entry_id          1L3E 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1L3E 
_struct.title                     'NMR Structures of the HIF-1alpha CTAD/p300 CH1 Complex' 
_struct.pdbx_descriptor           'hypoxia inducible factor-1 alpha subunit, p300 protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1L3E 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'PROTEIN-PROTEIN COMPLEX, TRANSCRIPTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 12 ? ALA A 20 ? THR A 12  ALA A 20  1 ? 9  
HELX_P HELX_P2 2 GLY A 31 ? ASP A 39 ? GLY A 31  ASP A 39  1 ? 9  
HELX_P HELX_P3 3 ASP B 9  ? GLU B 11 ? ASP B 109 GLU B 111 5 ? 3  
HELX_P HELX_P4 4 LYS B 12 ? GLN B 34 ? LYS B 112 GLN B 134 1 ? 23 
HELX_P HELX_P5 5 LEU B 44 ? THR B 58 ? LEU B 144 THR B 158 1 ? 15 
HELX_P HELX_P6 6 VAL B 68 ? CYS B 84 ? VAL B 168 CYS B 184 1 ? 17 
HELX_P HELX_P7 7 VAL B 91 ? ASN B 97 ? VAL B 191 ASN B 197 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? B CYS 60 SG ? ? ? 1_555 B CYS 66 SG  ? ? B CYS 160 B CYS 166 1_555 ? ? ? ? ? ? ? 2.372 ? 
disulf2  disulf ? ? B CYS 84 SG ? ? ? 1_555 B CYS 89 SG  ? ? B CYS 184 B CYS 189 1_555 ? ? ? ? ? ? ? 1.435 ? 
metalc1  metalc ? ? C ZN  .  ZN ? ? ? 1_555 B HIS 25 NE2 ? ? B ZN  202 B HIS 125 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc2  metalc ? ? C ZN  .  ZN ? ? ? 1_555 B CYS 29 SG  ? ? B ZN  202 B CYS 129 1_555 ? ? ? ? ? ? ? 2.349 ? 
metalc3  metalc ? ? C ZN  .  ZN ? ? ? 1_555 B CYS 42 SG  ? ? B ZN  202 B CYS 142 1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc4  metalc ? ? C ZN  .  ZN ? ? ? 1_555 B CYS 47 SG  ? ? B ZN  202 B CYS 147 1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc5  metalc ? ? E ZN  .  ZN ? ? ? 1_555 B HIS 80 NE2 ? ? B ZN  204 B HIS 180 1_555 ? ? ? ? ? ? ? 2.052 ? 
metalc6  metalc ? ? E ZN  .  ZN ? ? ? 1_555 B CYS 84 SG  ? ? B ZN  204 B CYS 184 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc7  metalc ? ? E ZN  .  ZN ? ? ? 1_555 B CYS 89 SG  ? ? B ZN  204 B CYS 189 1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc8  metalc ? ? E ZN  .  ZN ? ? ? 1_555 B CYS 92 SG  ? ? B ZN  204 B CYS 192 1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc9  metalc ? ? D ZN  .  ZN ? ? ? 1_555 B HIS 56 NE2 ? ? B ZN  203 B HIS 156 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc10 metalc ? ? D ZN  .  ZN ? ? ? 1_555 B CYS 60 SG  ? ? B ZN  203 B CYS 160 1_555 ? ? ? ? ? ? ? 2.348 ? 
metalc11 metalc ? ? D ZN  .  ZN ? ? ? 1_555 B CYS 66 SG  ? ? B ZN  203 B CYS 166 1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc12 metalc ? ? D ZN  .  ZN ? ? ? 1_555 B CYS 71 SG  ? ? B ZN  203 B CYS 171 1_555 ? ? ? ? ? ? ? 2.350 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
Zn1 Author   ? ? ? ? 4 'Zinc coordinate site 1'            
Zn2 Author   ? ? ? ? 4 'Zinc coordinate site 2'            
Zn3 Author   ? ? ? ? 4 'Zinc coordinate site 3'            
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 202' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 203' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 204' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  Zn1 4 HIS B 25 ? HIS B 125 . ? 1_555 ? 
2  Zn1 4 CYS B 29 ? CYS B 129 . ? 1_555 ? 
3  Zn1 4 CYS B 42 ? CYS B 142 . ? 1_555 ? 
4  Zn1 4 CYS B 47 ? CYS B 147 . ? 1_555 ? 
5  Zn2 4 HIS B 56 ? HIS B 156 . ? 1_555 ? 
6  Zn2 4 CYS B 60 ? CYS B 160 . ? 1_555 ? 
7  Zn2 4 CYS B 66 ? CYS B 166 . ? 1_555 ? 
8  Zn2 4 CYS B 71 ? CYS B 171 . ? 1_555 ? 
9  Zn3 4 HIS B 80 ? HIS B 180 . ? 1_555 ? 
10 Zn3 4 CYS B 84 ? CYS B 184 . ? 1_555 ? 
11 Zn3 4 CYS B 89 ? CYS B 189 . ? 1_555 ? 
12 Zn3 4 CYS B 92 ? CYS B 192 . ? 1_555 ? 
13 AC1 4 HIS B 25 ? HIS B 125 . ? 1_555 ? 
14 AC1 4 CYS B 29 ? CYS B 129 . ? 1_555 ? 
15 AC1 4 CYS B 42 ? CYS B 142 . ? 1_555 ? 
16 AC1 4 CYS B 47 ? CYS B 147 . ? 1_555 ? 
17 AC2 4 HIS B 56 ? HIS B 156 . ? 1_555 ? 
18 AC2 4 CYS B 60 ? CYS B 160 . ? 1_555 ? 
19 AC2 4 CYS B 66 ? CYS B 166 . ? 1_555 ? 
20 AC2 4 CYS B 71 ? CYS B 171 . ? 1_555 ? 
21 AC3 4 HIS B 80 ? HIS B 180 . ? 1_555 ? 
22 AC3 4 CYS B 84 ? CYS B 184 . ? 1_555 ? 
23 AC3 4 CYS B 89 ? CYS B 189 . ? 1_555 ? 
24 AC3 4 CYS B 92 ? CYS B 192 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1L3E 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1L3E 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLY A 1 1   ? 15.905  14.093  -33.851 1.00 0.00 ? 1   GLY A N    1  
ATOM   2     C  CA   . GLY A 1 1   ? 15.490  14.348  -32.443 1.00 0.00 ? 1   GLY A CA   1  
ATOM   3     C  C    . GLY A 1 1   ? 15.070  13.082  -31.725 1.00 0.00 ? 1   GLY A C    1  
ATOM   4     O  O    . GLY A 1 1   ? 14.425  12.212  -32.309 1.00 0.00 ? 1   GLY A O    1  
ATOM   5     H  H1   . GLY A 1 1   ? 15.584  14.870  -34.464 1.00 0.00 ? 1   GLY A H1   1  
ATOM   6     H  H2   . GLY A 1 1   ? 15.487  13.204  -34.190 1.00 0.00 ? 1   GLY A H2   1  
ATOM   7     H  H3   . GLY A 1 1   ? 16.940  14.022  -33.911 1.00 0.00 ? 1   GLY A H3   1  
ATOM   8     H  HA2  . GLY A 1 1   ? 16.318  14.794  -31.911 1.00 0.00 ? 1   GLY A HA2  1  
ATOM   9     H  HA3  . GLY A 1 1   ? 14.662  15.041  -32.444 1.00 0.00 ? 1   GLY A HA3  1  
ATOM   10    N  N    . SER A 1 2   ? 15.436  12.979  -30.450 1.00 0.00 ? 2   SER A N    1  
ATOM   11    C  CA   . SER A 1 2   ? 15.093  11.809  -29.650 1.00 0.00 ? 2   SER A CA   1  
ATOM   12    C  C    . SER A 1 2   ? 13.580  11.686  -29.492 1.00 0.00 ? 2   SER A C    1  
ATOM   13    O  O    . SER A 1 2   ? 13.000  12.213  -28.542 1.00 0.00 ? 2   SER A O    1  
ATOM   14    C  CB   . SER A 1 2   ? 15.760  11.890  -28.274 1.00 0.00 ? 2   SER A CB   1  
ATOM   15    O  OG   . SER A 1 2   ? 16.585  13.037  -28.169 1.00 0.00 ? 2   SER A OG   1  
ATOM   16    H  H    . SER A 1 2   ? 15.948  13.705  -30.040 1.00 0.00 ? 2   SER A H    1  
ATOM   17    H  HA   . SER A 1 2   ? 15.460  10.935  -30.167 1.00 0.00 ? 2   SER A HA   1  
ATOM   18    H  HB2  . SER A 1 2   ? 14.999  11.938  -27.508 1.00 0.00 ? 2   SER A HB2  1  
ATOM   19    H  HB3  . SER A 1 2   ? 16.368  11.010  -28.119 1.00 0.00 ? 2   SER A HB3  1  
ATOM   20    H  HG   . SER A 1 2   ? 16.606  13.335  -27.257 1.00 0.00 ? 2   SER A HG   1  
ATOM   21    N  N    . MET A 1 3   ? 12.947  10.985  -30.427 1.00 0.00 ? 3   MET A N    1  
ATOM   22    C  CA   . MET A 1 3   ? 11.501  10.794  -30.391 1.00 0.00 ? 3   MET A CA   1  
ATOM   23    C  C    . MET A 1 3   ? 11.153  9.331   -30.126 1.00 0.00 ? 3   MET A C    1  
ATOM   24    O  O    . MET A 1 3   ? 10.457  8.694   -30.917 1.00 0.00 ? 3   MET A O    1  
ATOM   25    C  CB   . MET A 1 3   ? 10.873  11.253  -31.708 1.00 0.00 ? 3   MET A CB   1  
ATOM   26    C  CG   . MET A 1 3   ? 11.140  12.715  -32.032 1.00 0.00 ? 3   MET A CG   1  
ATOM   27    S  SD   . MET A 1 3   ? 9.862   13.441  -33.074 1.00 0.00 ? 3   MET A SD   1  
ATOM   28    C  CE   . MET A 1 3   ? 10.853  14.140  -34.390 1.00 0.00 ? 3   MET A CE   1  
ATOM   29    H  H    . MET A 1 3   ? 13.463  10.589  -31.159 1.00 0.00 ? 3   MET A H    1  
ATOM   30    H  HA   . MET A 1 3   ? 11.108  11.395  -29.586 1.00 0.00 ? 3   MET A HA   1  
ATOM   31    H  HB2  . MET A 1 3   ? 11.269  10.650  -32.512 1.00 0.00 ? 3   MET A HB2  1  
ATOM   32    H  HB3  . MET A 1 3   ? 9.804   11.109  -31.654 1.00 0.00 ? 3   MET A HB3  1  
ATOM   33    H  HG2  . MET A 1 3   ? 11.190  13.271  -31.108 1.00 0.00 ? 3   MET A HG2  1  
ATOM   34    H  HG3  . MET A 1 3   ? 12.088  12.788  -32.546 1.00 0.00 ? 3   MET A HG3  1  
ATOM   35    H  HE1  . MET A 1 3   ? 11.021  15.189  -34.197 1.00 0.00 ? 3   MET A HE1  1  
ATOM   36    H  HE2  . MET A 1 3   ? 10.336  14.024  -35.332 1.00 0.00 ? 3   MET A HE2  1  
ATOM   37    H  HE3  . MET A 1 3   ? 11.802  13.626  -34.437 1.00 0.00 ? 3   MET A HE3  1  
ATOM   38    N  N    . ASP A 1 4   ? 11.645  8.804   -29.009 1.00 0.00 ? 4   ASP A N    1  
ATOM   39    C  CA   . ASP A 1 4   ? 11.390  7.418   -28.636 1.00 0.00 ? 4   ASP A CA   1  
ATOM   40    C  C    . ASP A 1 4   ? 9.895   7.106   -28.668 1.00 0.00 ? 4   ASP A C    1  
ATOM   41    O  O    . ASP A 1 4   ? 9.075   7.904   -28.214 1.00 0.00 ? 4   ASP A O    1  
ATOM   42    C  CB   . ASP A 1 4   ? 11.955  7.131   -27.243 1.00 0.00 ? 4   ASP A CB   1  
ATOM   43    C  CG   . ASP A 1 4   ? 13.220  6.297   -27.293 1.00 0.00 ? 4   ASP A CG   1  
ATOM   44    O  OD1  . ASP A 1 4   ? 13.111  5.057   -27.398 1.00 0.00 ? 4   ASP A OD1  1  
ATOM   45    O  OD2  . ASP A 1 4   ? 14.322  6.883   -27.227 1.00 0.00 ? 4   ASP A OD2  1  
ATOM   46    H  H    . ASP A 1 4   ? 12.194  9.361   -28.420 1.00 0.00 ? 4   ASP A H    1  
ATOM   47    H  HA   . ASP A 1 4   ? 11.891  6.788   -29.353 1.00 0.00 ? 4   ASP A HA   1  
ATOM   48    H  HB2  . ASP A 1 4   ? 12.183  8.067   -26.755 1.00 0.00 ? 4   ASP A HB2  1  
ATOM   49    H  HB3  . ASP A 1 4   ? 11.217  6.598   -26.661 1.00 0.00 ? 4   ASP A HB3  1  
ATOM   50    N  N    . GLU A 1 5   ? 9.551   5.942   -29.208 1.00 0.00 ? 5   GLU A N    1  
ATOM   51    C  CA   . GLU A 1 5   ? 8.157   5.524   -29.299 1.00 0.00 ? 5   GLU A CA   1  
ATOM   52    C  C    . GLU A 1 5   ? 7.807   4.545   -28.184 1.00 0.00 ? 5   GLU A C    1  
ATOM   53    O  O    . GLU A 1 5   ? 8.663   3.798   -27.710 1.00 0.00 ? 5   GLU A O    1  
ATOM   54    C  CB   . GLU A 1 5   ? 7.885   4.883   -30.661 1.00 0.00 ? 5   GLU A CB   1  
ATOM   55    C  CG   . GLU A 1 5   ? 6.406   4.750   -30.986 1.00 0.00 ? 5   GLU A CG   1  
ATOM   56    C  CD   . GLU A 1 5   ? 5.957   3.304   -31.084 1.00 0.00 ? 5   GLU A CD   1  
ATOM   57    O  OE1  . GLU A 1 5   ? 6.232   2.532   -30.141 1.00 0.00 ? 5   GLU A OE1  1  
ATOM   58    O  OE2  . GLU A 1 5   ? 5.330   2.946   -32.103 1.00 0.00 ? 5   GLU A OE2  1  
ATOM   59    H  H    . GLU A 1 5   ? 10.251  5.349   -29.552 1.00 0.00 ? 5   GLU A H    1  
ATOM   60    H  HA   . GLU A 1 5   ? 7.540   6.405   -29.197 1.00 0.00 ? 5   GLU A HA   1  
ATOM   61    H  HB2  . GLU A 1 5   ? 8.347   5.486   -31.429 1.00 0.00 ? 5   GLU A HB2  1  
ATOM   62    H  HB3  . GLU A 1 5   ? 8.326   3.897   -30.676 1.00 0.00 ? 5   GLU A HB3  1  
ATOM   63    H  HG2  . GLU A 1 5   ? 5.835   5.236   -30.210 1.00 0.00 ? 5   GLU A HG2  1  
ATOM   64    H  HG3  . GLU A 1 5   ? 6.214   5.236   -31.931 1.00 0.00 ? 5   GLU A HG3  1  
ATOM   65    N  N    . SER A 1 6   ? 6.545   4.557   -27.768 1.00 0.00 ? 6   SER A N    1  
ATOM   66    C  CA   . SER A 1 6   ? 6.082   3.669   -26.708 1.00 0.00 ? 6   SER A CA   1  
ATOM   67    C  C    . SER A 1 6   ? 4.558   3.627   -26.658 1.00 0.00 ? 6   SER A C    1  
ATOM   68    O  O    . SER A 1 6   ? 3.894   4.652   -26.806 1.00 0.00 ? 6   SER A O    1  
ATOM   69    C  CB   . SER A 1 6   ? 6.635   4.126   -25.356 1.00 0.00 ? 6   SER A CB   1  
ATOM   70    O  OG   . SER A 1 6   ? 6.660   5.539   -25.266 1.00 0.00 ? 6   SER A OG   1  
ATOM   71    H  H    . SER A 1 6   ? 5.909   5.176   -28.185 1.00 0.00 ? 6   SER A H    1  
ATOM   72    H  HA   . SER A 1 6   ? 6.451   2.677   -26.920 1.00 0.00 ? 6   SER A HA   1  
ATOM   73    H  HB2  . SER A 1 6   ? 6.009   3.739   -24.565 1.00 0.00 ? 6   SER A HB2  1  
ATOM   74    H  HB3  . SER A 1 6   ? 7.640   3.750   -25.234 1.00 0.00 ? 6   SER A HB3  1  
ATOM   75    H  HG   . SER A 1 6   ? 7.565   5.835   -25.141 1.00 0.00 ? 6   SER A HG   1  
ATOM   76    N  N    . GLY A 1 7   ? 4.011   2.434   -26.449 1.00 0.00 ? 7   GLY A N    1  
ATOM   77    C  CA   . GLY A 1 7   ? 2.569   2.280   -26.383 1.00 0.00 ? 7   GLY A CA   1  
ATOM   78    C  C    . GLY A 1 7   ? 2.040   2.390   -24.967 1.00 0.00 ? 7   GLY A C    1  
ATOM   79    O  O    . GLY A 1 7   ? 1.011   3.024   -24.730 1.00 0.00 ? 7   GLY A O    1  
ATOM   80    H  H    . GLY A 1 7   ? 4.590   1.652   -26.337 1.00 0.00 ? 7   GLY A H    1  
ATOM   81    H  HA2  . GLY A 1 7   ? 2.109   3.046   -26.989 1.00 0.00 ? 7   GLY A HA2  1  
ATOM   82    H  HA3  . GLY A 1 7   ? 2.304   1.312   -26.781 1.00 0.00 ? 7   GLY A HA3  1  
ATOM   83    N  N    . LEU A 1 8   ? 2.743   1.771   -24.024 1.00 0.00 ? 8   LEU A N    1  
ATOM   84    C  CA   . LEU A 1 8   ? 2.341   1.799   -22.627 1.00 0.00 ? 8   LEU A CA   1  
ATOM   85    C  C    . LEU A 1 8   ? 2.406   3.215   -22.065 1.00 0.00 ? 8   LEU A C    1  
ATOM   86    O  O    . LEU A 1 8   ? 3.448   3.866   -22.134 1.00 0.00 ? 8   LEU A O    1  
ATOM   87    C  CB   . LEU A 1 8   ? 3.247   0.888   -21.800 1.00 0.00 ? 8   LEU A CB   1  
ATOM   88    C  CG   . LEU A 1 8   ? 2.678   0.486   -20.440 1.00 0.00 ? 8   LEU A CG   1  
ATOM   89    C  CD1  . LEU A 1 8   ? 2.575   -1.027  -20.326 1.00 0.00 ? 8   LEU A CD1  1  
ATOM   90    C  CD2  . LEU A 1 8   ? 3.527   1.050   -19.310 1.00 0.00 ? 8   LEU A CD2  1  
ATOM   91    H  H    . LEU A 1 8   ? 3.552   1.282   -24.275 1.00 0.00 ? 8   LEU A H    1  
ATOM   92    H  HA   . LEU A 1 8   ? 1.327   1.437   -22.563 1.00 0.00 ? 8   LEU A HA   1  
ATOM   93    H  HB2  . LEU A 1 8   ? 3.440   -0.007  -22.370 1.00 0.00 ? 8   LEU A HB2  1  
ATOM   94    H  HB3  . LEU A 1 8   ? 4.183   1.398   -21.638 1.00 0.00 ? 8   LEU A HB3  1  
ATOM   95    H  HG   . LEU A 1 8   ? 1.686   0.898   -20.348 1.00 0.00 ? 8   LEU A HG   1  
ATOM   96    H  HD11 . LEU A 1 8   ? 2.095   -1.422  -21.208 1.00 0.00 ? 8   LEU A HD11 1  
ATOM   97    H  HD12 . LEU A 1 8   ? 1.995   -1.284  -19.453 1.00 0.00 ? 8   LEU A HD12 1  
ATOM   98    H  HD13 . LEU A 1 8   ? 3.566   -1.449  -20.236 1.00 0.00 ? 8   LEU A HD13 1  
ATOM   99    H  HD21 . LEU A 1 8   ? 4.567   0.835   -19.499 1.00 0.00 ? 8   LEU A HD21 1  
ATOM   100   H  HD22 . LEU A 1 8   ? 3.228   0.597   -18.376 1.00 0.00 ? 8   LEU A HD22 1  
ATOM   101   H  HD23 . LEU A 1 8   ? 3.385   2.119   -19.252 1.00 0.00 ? 8   LEU A HD23 1  
ATOM   102   N  N    . PRO A 1 9   ? 1.300   3.712   -21.485 1.00 0.00 ? 9   PRO A N    1  
ATOM   103   C  CA   . PRO A 1 9   ? 1.267   5.053   -20.902 1.00 0.00 ? 9   PRO A CA   1  
ATOM   104   C  C    . PRO A 1 9   ? 2.434   5.270   -19.949 1.00 0.00 ? 9   PRO A C    1  
ATOM   105   O  O    . PRO A 1 9   ? 2.444   4.749   -18.834 1.00 0.00 ? 9   PRO A O    1  
ATOM   106   C  CB   . PRO A 1 9   ? -0.058  5.078   -20.136 1.00 0.00 ? 9   PRO A CB   1  
ATOM   107   C  CG   . PRO A 1 9   ? -0.917  4.075   -20.827 1.00 0.00 ? 9   PRO A CG   1  
ATOM   108   C  CD   . PRO A 1 9   ? 0.011   3.009   -21.341 1.00 0.00 ? 9   PRO A CD   1  
ATOM   109   H  HA   . PRO A 1 9   ? 1.268   5.820   -21.662 1.00 0.00 ? 9   PRO A HA   1  
ATOM   110   H  HB2  . PRO A 1 9   ? 0.116   4.807   -19.105 1.00 0.00 ? 9   PRO A HB2  1  
ATOM   111   H  HB3  . PRO A 1 9   ? -0.487  6.066   -20.188 1.00 0.00 ? 9   PRO A HB3  1  
ATOM   112   H  HG2  . PRO A 1 9   ? -1.621  3.652   -20.125 1.00 0.00 ? 9   PRO A HG2  1  
ATOM   113   H  HG3  . PRO A 1 9   ? -1.441  4.544   -21.646 1.00 0.00 ? 9   PRO A HG3  1  
ATOM   114   H  HD2  . PRO A 1 9   ? 0.091   2.201   -20.629 1.00 0.00 ? 9   PRO A HD2  1  
ATOM   115   H  HD3  . PRO A 1 9   ? -0.333  2.638   -22.296 1.00 0.00 ? 9   PRO A HD3  1  
ATOM   116   N  N    . GLN A 1 10  ? 3.423   6.033   -20.396 1.00 0.00 ? 10  GLN A N    1  
ATOM   117   C  CA   . GLN A 1 10  ? 4.599   6.303   -19.581 1.00 0.00 ? 10  GLN A CA   1  
ATOM   118   C  C    . GLN A 1 10  ? 4.413   7.574   -18.756 1.00 0.00 ? 10  GLN A C    1  
ATOM   119   O  O    . GLN A 1 10  ? 3.573   8.415   -19.076 1.00 0.00 ? 10  GLN A O    1  
ATOM   120   C  CB   . GLN A 1 10  ? 5.842   6.418   -20.468 1.00 0.00 ? 10  GLN A CB   1  
ATOM   121   C  CG   . GLN A 1 10  ? 5.919   7.718   -21.258 1.00 0.00 ? 10  GLN A CG   1  
ATOM   122   C  CD   . GLN A 1 10  ? 7.144   8.541   -20.912 1.00 0.00 ? 10  GLN A CD   1  
ATOM   123   O  OE1  . GLN A 1 10  ? 7.642   8.492   -19.786 1.00 0.00 ? 10  GLN A OE1  1  
ATOM   124   N  NE2  . GLN A 1 10  ? 7.637   9.304   -21.880 1.00 0.00 ? 10  GLN A NE2  1  
ATOM   125   H  H    . GLN A 1 10  ? 3.365   6.415   -21.296 1.00 0.00 ? 10  GLN A H    1  
ATOM   126   H  HA   . GLN A 1 10  ? 4.728   5.466   -18.909 1.00 0.00 ? 10  GLN A HA   1  
ATOM   127   H  HB2  . GLN A 1 10  ? 6.719   6.346   -19.845 1.00 0.00 ? 10  GLN A HB2  1  
ATOM   128   H  HB3  . GLN A 1 10  ? 5.843   5.596   -21.170 1.00 0.00 ? 10  GLN A HB3  1  
ATOM   129   H  HG2  . GLN A 1 10  ? 5.950   7.482   -22.311 1.00 0.00 ? 10  GLN A HG2  1  
ATOM   130   H  HG3  . GLN A 1 10  ? 5.037   8.304   -21.048 1.00 0.00 ? 10  GLN A HG3  1  
ATOM   131   H  HE21 . GLN A 1 10  ? 7.190   9.294   -22.752 1.00 0.00 ? 10  GLN A HE21 1  
ATOM   132   H  HE22 . GLN A 1 10  ? 8.430   9.848   -21.684 1.00 0.00 ? 10  GLN A HE22 1  
ATOM   133   N  N    . LEU A 1 11  ? 5.201   7.707   -17.694 1.00 0.00 ? 11  LEU A N    1  
ATOM   134   C  CA   . LEU A 1 11  ? 5.123   8.873   -16.827 1.00 0.00 ? 11  LEU A CA   1  
ATOM   135   C  C    . LEU A 1 11  ? 6.497   9.511   -16.645 1.00 0.00 ? 11  LEU A C    1  
ATOM   136   O  O    . LEU A 1 11  ? 7.523   8.841   -16.766 1.00 0.00 ? 11  LEU A O    1  
ATOM   137   C  CB   . LEU A 1 11  ? 4.540   8.485   -15.466 1.00 0.00 ? 11  LEU A CB   1  
ATOM   138   C  CG   . LEU A 1 11  ? 3.297   7.596   -15.525 1.00 0.00 ? 11  LEU A CG   1  
ATOM   139   C  CD1  . LEU A 1 11  ? 2.945   7.077   -14.140 1.00 0.00 ? 11  LEU A CD1  1  
ATOM   140   C  CD2  . LEU A 1 11  ? 2.126   8.360   -16.125 1.00 0.00 ? 11  LEU A CD2  1  
ATOM   141   H  H    . LEU A 1 11  ? 5.849   7.008   -17.491 1.00 0.00 ? 11  LEU A H    1  
ATOM   142   H  HA   . LEU A 1 11  ? 4.469   9.586   -17.298 1.00 0.00 ? 11  LEU A HA   1  
ATOM   143   H  HB2  . LEU A 1 11  ? 5.304   7.965   -14.906 1.00 0.00 ? 11  LEU A HB2  1  
ATOM   144   H  HB3  . LEU A 1 11  ? 4.282   9.391   -14.937 1.00 0.00 ? 11  LEU A HB3  1  
ATOM   145   H  HG   . LEU A 1 11  ? 3.502   6.744   -16.157 1.00 0.00 ? 11  LEU A HG   1  
ATOM   146   H  HD11 . LEU A 1 11  ? 2.196   6.303   -14.224 1.00 0.00 ? 11  LEU A HD11 1  
ATOM   147   H  HD12 . LEU A 1 11  ? 2.557   7.887   -13.539 1.00 0.00 ? 11  LEU A HD12 1  
ATOM   148   H  HD13 . LEU A 1 11  ? 3.830   6.672   -13.670 1.00 0.00 ? 11  LEU A HD13 1  
ATOM   149   H  HD21 . LEU A 1 11  ? 1.869   9.187   -15.482 1.00 0.00 ? 11  LEU A HD21 1  
ATOM   150   H  HD22 . LEU A 1 11  ? 1.276   7.700   -16.220 1.00 0.00 ? 11  LEU A HD22 1  
ATOM   151   H  HD23 . LEU A 1 11  ? 2.402   8.733   -17.100 1.00 0.00 ? 11  LEU A HD23 1  
ATOM   152   N  N    . THR A 1 12  ? 6.508   10.808  -16.356 1.00 0.00 ? 12  THR A N    1  
ATOM   153   C  CA   . THR A 1 12  ? 7.753   11.536  -16.160 1.00 0.00 ? 12  THR A CA   1  
ATOM   154   C  C    . THR A 1 12  ? 8.203   11.461  -14.708 1.00 0.00 ? 12  THR A C    1  
ATOM   155   O  O    . THR A 1 12  ? 7.380   11.366  -13.798 1.00 0.00 ? 12  THR A O    1  
ATOM   156   C  CB   . THR A 1 12  ? 7.571   12.995  -16.571 1.00 0.00 ? 12  THR A CB   1  
ATOM   157   O  OG1  . THR A 1 12  ? 7.055   13.084  -17.887 1.00 0.00 ? 12  THR A OG1  1  
ATOM   158   C  CG2  . THR A 1 12  ? 8.852   13.799  -16.523 1.00 0.00 ? 12  THR A CG2  1  
ATOM   159   H  H    . THR A 1 12  ? 5.659   11.290  -16.274 1.00 0.00 ? 12  THR A H    1  
ATOM   160   H  HA   . THR A 1 12  ? 8.509   11.086  -16.783 1.00 0.00 ? 12  THR A HA   1  
ATOM   161   H  HB   . THR A 1 12  ? 6.864   13.455  -15.896 1.00 0.00 ? 12  THR A HB   1  
ATOM   162   H  HG1  . THR A 1 12  ? 6.097   13.130  -17.853 1.00 0.00 ? 12  THR A HG1  1  
ATOM   163   H  HG21 . THR A 1 12  ? 8.614   14.852  -16.491 1.00 0.00 ? 12  THR A HG21 1  
ATOM   164   H  HG22 . THR A 1 12  ? 9.441   13.591  -17.404 1.00 0.00 ? 12  THR A HG22 1  
ATOM   165   H  HG23 . THR A 1 12  ? 9.415   13.531  -15.642 1.00 0.00 ? 12  THR A HG23 1  
ATOM   166   N  N    . SER A 1 13  ? 9.515   11.509  -14.498 1.00 0.00 ? 13  SER A N    1  
ATOM   167   C  CA   . SER A 1 13  ? 10.081  11.452  -13.162 1.00 0.00 ? 13  SER A CA   1  
ATOM   168   C  C    . SER A 1 13  ? 9.362   12.411  -12.215 1.00 0.00 ? 13  SER A C    1  
ATOM   169   O  O    . SER A 1 13  ? 9.364   12.214  -11.000 1.00 0.00 ? 13  SER A O    1  
ATOM   170   C  CB   . SER A 1 13  ? 11.574  11.784  -13.204 1.00 0.00 ? 13  SER A CB   1  
ATOM   171   O  OG   . SER A 1 13  ? 11.784  13.150  -13.515 1.00 0.00 ? 13  SER A OG   1  
ATOM   172   H  H    . SER A 1 13  ? 10.117  11.583  -15.259 1.00 0.00 ? 13  SER A H    1  
ATOM   173   H  HA   . SER A 1 13  ? 9.958   10.447  -12.807 1.00 0.00 ? 13  SER A HA   1  
ATOM   174   H  HB2  . SER A 1 13  ? 12.014  11.575  -12.241 1.00 0.00 ? 13  SER A HB2  1  
ATOM   175   H  HB3  . SER A 1 13  ? 12.054  11.178  -13.958 1.00 0.00 ? 13  SER A HB3  1  
ATOM   176   H  HG   . SER A 1 13  ? 11.869  13.654  -12.701 1.00 0.00 ? 13  SER A HG   1  
ATOM   177   N  N    . TYR A 1 14  ? 8.745   13.448  -12.777 1.00 0.00 ? 14  TYR A N    1  
ATOM   178   C  CA   . TYR A 1 14  ? 8.023   14.432  -11.978 1.00 0.00 ? 14  TYR A CA   1  
ATOM   179   C  C    . TYR A 1 14  ? 6.600   13.965  -11.700 1.00 0.00 ? 14  TYR A C    1  
ATOM   180   O  O    . TYR A 1 14  ? 6.123   14.037  -10.567 1.00 0.00 ? 14  TYR A O    1  
ATOM   181   C  CB   . TYR A 1 14  ? 8.003   15.784  -12.693 1.00 0.00 ? 14  TYR A CB   1  
ATOM   182   C  CG   . TYR A 1 14  ? 7.454   16.913  -11.848 1.00 0.00 ? 14  TYR A CG   1  
ATOM   183   C  CD1  . TYR A 1 14  ? 8.016   17.222  -10.615 1.00 0.00 ? 14  TYR A CD1  1  
ATOM   184   C  CD2  . TYR A 1 14  ? 6.375   17.670  -12.286 1.00 0.00 ? 14  TYR A CD2  1  
ATOM   185   C  CE1  . TYR A 1 14  ? 7.517   18.253  -9.842  1.00 0.00 ? 14  TYR A CE1  1  
ATOM   186   C  CE2  . TYR A 1 14  ? 5.872   18.704  -11.518 1.00 0.00 ? 14  TYR A CE2  1  
ATOM   187   C  CZ   . TYR A 1 14  ? 6.446   18.992  -10.298 1.00 0.00 ? 14  TYR A CZ   1  
ATOM   188   O  OH   . TYR A 1 14  ? 5.947   20.020  -9.532  1.00 0.00 ? 14  TYR A OH   1  
ATOM   189   H  H    . TYR A 1 14  ? 8.775   13.554  -13.753 1.00 0.00 ? 14  TYR A H    1  
ATOM   190   H  HA   . TYR A 1 14  ? 8.544   14.537  -11.037 1.00 0.00 ? 14  TYR A HA   1  
ATOM   191   H  HB2  . TYR A 1 14  ? 9.011   16.047  -12.979 1.00 0.00 ? 14  TYR A HB2  1  
ATOM   192   H  HB3  . TYR A 1 14  ? 7.392   15.705  -13.579 1.00 0.00 ? 14  TYR A HB3  1  
ATOM   193   H  HD1  . TYR A 1 14  ? 8.856   16.642  -10.260 1.00 0.00 ? 14  TYR A HD1  1  
ATOM   194   H  HD2  . TYR A 1 14  ? 5.927   17.443  -13.241 1.00 0.00 ? 14  TYR A HD2  1  
ATOM   195   H  HE1  . TYR A 1 14  ? 7.968   18.478  -8.886  1.00 0.00 ? 14  TYR A HE1  1  
ATOM   196   H  HE2  . TYR A 1 14  ? 5.032   19.282  -11.875 1.00 0.00 ? 14  TYR A HE2  1  
ATOM   197   H  HH   . TYR A 1 14  ? 5.680   19.680  -8.675  1.00 0.00 ? 14  TYR A HH   1  
ATOM   198   N  N    . ASP A 1 15  ? 5.925   13.479  -12.738 1.00 0.00 ? 15  ASP A N    1  
ATOM   199   C  CA   . ASP A 1 15  ? 4.557   12.992  -12.599 1.00 0.00 ? 15  ASP A CA   1  
ATOM   200   C  C    . ASP A 1 15  ? 4.470   11.925  -11.513 1.00 0.00 ? 15  ASP A C    1  
ATOM   201   O  O    . ASP A 1 15  ? 3.415   11.719  -10.913 1.00 0.00 ? 15  ASP A O    1  
ATOM   202   C  CB   . ASP A 1 15  ? 4.057   12.426  -13.929 1.00 0.00 ? 15  ASP A CB   1  
ATOM   203   C  CG   . ASP A 1 15  ? 2.553   12.233  -13.946 1.00 0.00 ? 15  ASP A CG   1  
ATOM   204   O  OD1  . ASP A 1 15  ? 1.854   12.941  -13.190 1.00 0.00 ? 15  ASP A OD1  1  
ATOM   205   O  OD2  . ASP A 1 15  ? 2.072   11.375  -14.715 1.00 0.00 ? 15  ASP A OD2  1  
ATOM   206   H  H    . ASP A 1 15  ? 6.360   13.442  -13.615 1.00 0.00 ? 15  ASP A H    1  
ATOM   207   H  HA   . ASP A 1 15  ? 3.935   13.828  -12.315 1.00 0.00 ? 15  ASP A HA   1  
ATOM   208   H  HB2  . ASP A 1 15  ? 4.322   13.105  -14.726 1.00 0.00 ? 15  ASP A HB2  1  
ATOM   209   H  HB3  . ASP A 1 15  ? 4.526   11.470  -14.105 1.00 0.00 ? 15  ASP A HB3  1  
ATOM   210   N  N    . CYS A 1 16  ? 5.588   11.251  -11.264 1.00 0.00 ? 16  CYS A N    1  
ATOM   211   C  CA   . CYS A 1 16  ? 5.647   10.211  -10.252 1.00 0.00 ? 16  CYS A CA   1  
ATOM   212   C  C    . CYS A 1 16  ? 6.011   10.801  -8.897  1.00 0.00 ? 16  CYS A C    1  
ATOM   213   O  O    . CYS A 1 16  ? 5.376   10.505  -7.886  1.00 0.00 ? 16  CYS A O    1  
ATOM   214   C  CB   . CYS A 1 16  ? 6.676   9.158   -10.652 1.00 0.00 ? 16  CYS A CB   1  
ATOM   215   S  SG   . CYS A 1 16  ? 6.417   7.539   -9.890  1.00 0.00 ? 16  CYS A SG   1  
ATOM   216   H  H    . CYS A 1 16  ? 6.398   11.460  -11.771 1.00 0.00 ? 16  CYS A H    1  
ATOM   217   H  HA   . CYS A 1 16  ? 4.673   9.752   -10.187 1.00 0.00 ? 16  CYS A HA   1  
ATOM   218   H  HB2  . CYS A 1 16  ? 6.646   9.029   -11.721 1.00 0.00 ? 16  CYS A HB2  1  
ATOM   219   H  HB3  . CYS A 1 16  ? 7.657   9.505   -10.367 1.00 0.00 ? 16  CYS A HB3  1  
ATOM   220   H  HG   . CYS A 1 16  ? 5.631   7.151   -10.280 1.00 0.00 ? 16  CYS A HG   1  
ATOM   221   N  N    . GLU A 1 17  ? 7.040   11.638  -8.890  1.00 0.00 ? 17  GLU A N    1  
ATOM   222   C  CA   . GLU A 1 17  ? 7.498   12.278  -7.665  1.00 0.00 ? 17  GLU A CA   1  
ATOM   223   C  C    . GLU A 1 17  ? 6.386   13.121  -7.050  1.00 0.00 ? 17  GLU A C    1  
ATOM   224   O  O    . GLU A 1 17  ? 6.179   13.110  -5.838  1.00 0.00 ? 17  GLU A O    1  
ATOM   225   C  CB   . GLU A 1 17  ? 8.714   13.155  -7.957  1.00 0.00 ? 17  GLU A CB   1  
ATOM   226   C  CG   . GLU A 1 17  ? 9.743   13.168  -6.838  1.00 0.00 ? 17  GLU A CG   1  
ATOM   227   C  CD   . GLU A 1 17  ? 10.609  14.411  -6.857  1.00 0.00 ? 17  GLU A CD   1  
ATOM   228   O  OE1  . GLU A 1 17  ? 10.200  15.429  -6.263  1.00 0.00 ? 17  GLU A OE1  1  
ATOM   229   O  OE2  . GLU A 1 17  ? 11.698  14.365  -7.468  1.00 0.00 ? 17  GLU A OE2  1  
ATOM   230   H  H    . GLU A 1 17  ? 7.504   11.834  -9.732  1.00 0.00 ? 17  GLU A H    1  
ATOM   231   H  HA   . GLU A 1 17  ? 7.779   11.504  -6.966  1.00 0.00 ? 17  GLU A HA   1  
ATOM   232   H  HB2  . GLU A 1 17  ? 9.194   12.794  -8.854  1.00 0.00 ? 17  GLU A HB2  1  
ATOM   233   H  HB3  . GLU A 1 17  ? 8.381   14.167  -8.123  1.00 0.00 ? 17  GLU A HB3  1  
ATOM   234   H  HG2  . GLU A 1 17  ? 9.225   13.123  -5.891  1.00 0.00 ? 17  GLU A HG2  1  
ATOM   235   H  HG3  . GLU A 1 17  ? 10.378  12.300  -6.940  1.00 0.00 ? 17  GLU A HG3  1  
ATOM   236   N  N    . VAL A 1 18  ? 5.677   13.851  -7.903  1.00 0.00 ? 18  VAL A N    1  
ATOM   237   C  CA   . VAL A 1 18  ? 4.584   14.706  -7.456  1.00 0.00 ? 18  VAL A CA   1  
ATOM   238   C  C    . VAL A 1 18  ? 3.429   13.882  -6.895  1.00 0.00 ? 18  VAL A C    1  
ATOM   239   O  O    . VAL A 1 18  ? 2.910   14.177  -5.818  1.00 0.00 ? 18  VAL A O    1  
ATOM   240   C  CB   . VAL A 1 18  ? 4.058   15.590  -8.604  1.00 0.00 ? 18  VAL A CB   1  
ATOM   241   C  CG1  . VAL A 1 18  ? 3.024   16.581  -8.090  1.00 0.00 ? 18  VAL A CG1  1  
ATOM   242   C  CG2  . VAL A 1 18  ? 5.205   16.316  -9.290  1.00 0.00 ? 18  VAL A CG2  1  
ATOM   243   H  H    . VAL A 1 18  ? 5.895   13.815  -8.857  1.00 0.00 ? 18  VAL A H    1  
ATOM   244   H  HA   . VAL A 1 18  ? 4.963   15.352  -6.678  1.00 0.00 ? 18  VAL A HA   1  
ATOM   245   H  HB   . VAL A 1 18  ? 3.579   14.951  -9.332  1.00 0.00 ? 18  VAL A HB   1  
ATOM   246   H  HG11 . VAL A 1 18  ? 2.244   16.703  -8.826  1.00 0.00 ? 18  VAL A HG11 1  
ATOM   247   H  HG12 . VAL A 1 18  ? 3.499   17.533  -7.907  1.00 0.00 ? 18  VAL A HG12 1  
ATOM   248   H  HG13 . VAL A 1 18  ? 2.595   16.210  -7.171  1.00 0.00 ? 18  VAL A HG13 1  
ATOM   249   H  HG21 . VAL A 1 18  ? 5.002   16.392  -10.347 1.00 0.00 ? 18  VAL A HG21 1  
ATOM   250   H  HG22 . VAL A 1 18  ? 6.123   15.768  -9.136  1.00 0.00 ? 18  VAL A HG22 1  
ATOM   251   H  HG23 . VAL A 1 18  ? 5.303   17.308  -8.871  1.00 0.00 ? 18  VAL A HG23 1  
ATOM   252   N  N    . ASN A 1 19  ? 3.026   12.850  -7.631  1.00 0.00 ? 19  ASN A N    1  
ATOM   253   C  CA   . ASN A 1 19  ? 1.928   11.991  -7.203  1.00 0.00 ? 19  ASN A CA   1  
ATOM   254   C  C    . ASN A 1 19  ? 2.355   11.083  -6.052  1.00 0.00 ? 19  ASN A C    1  
ATOM   255   O  O    . ASN A 1 19  ? 1.539   10.707  -5.210  1.00 0.00 ? 19  ASN A O    1  
ATOM   256   C  CB   . ASN A 1 19  ? 1.427   11.147  -8.377  1.00 0.00 ? 19  ASN A CB   1  
ATOM   257   C  CG   . ASN A 1 19  ? -0.060  11.319  -8.620  1.00 0.00 ? 19  ASN A CG   1  
ATOM   258   O  OD1  . ASN A 1 19  ? -0.825  10.357  -8.566  1.00 0.00 ? 19  ASN A OD1  1  
ATOM   259   N  ND2  . ASN A 1 19  ? -0.477  12.552  -8.889  1.00 0.00 ? 19  ASN A ND2  1  
ATOM   260   H  H    . ASN A 1 19  ? 3.476   12.665  -8.484  1.00 0.00 ? 19  ASN A H    1  
ATOM   261   H  HA   . ASN A 1 19  ? 1.126   12.628  -6.861  1.00 0.00 ? 19  ASN A HA   1  
ATOM   262   H  HB2  . ASN A 1 19  ? 1.953   11.440  -9.273  1.00 0.00 ? 19  ASN A HB2  1  
ATOM   263   H  HB3  . ASN A 1 19  ? 1.621   10.104  -8.175  1.00 0.00 ? 19  ASN A HB3  1  
ATOM   264   H  HD21 . ASN A 1 19  ? 0.190   13.270  -8.916  1.00 0.00 ? 19  ASN A HD21 1  
ATOM   265   H  HD22 . ASN A 1 19  ? -1.432  12.693  -9.050  1.00 0.00 ? 19  ASN A HD22 1  
ATOM   266   N  N    . ALA A 1 20  ? 3.636   10.732  -6.022  1.00 0.00 ? 20  ALA A N    1  
ATOM   267   C  CA   . ALA A 1 20  ? 4.168   9.868   -4.977  1.00 0.00 ? 20  ALA A CA   1  
ATOM   268   C  C    . ALA A 1 20  ? 5.694   9.926   -4.941  1.00 0.00 ? 20  ALA A C    1  
ATOM   269   O  O    . ALA A 1 20  ? 6.369   9.166   -5.634  1.00 0.00 ? 20  ALA A O    1  
ATOM   270   C  CB   . ALA A 1 20  ? 3.697   8.436   -5.190  1.00 0.00 ? 20  ALA A CB   1  
ATOM   271   H  H    . ALA A 1 20  ? 4.237   11.063  -6.722  1.00 0.00 ? 20  ALA A H    1  
ATOM   272   H  HA   . ALA A 1 20  ? 3.780   10.212  -4.030  1.00 0.00 ? 20  ALA A HA   1  
ATOM   273   H  HB1  . ALA A 1 20  ? 4.517   7.756   -5.017  1.00 0.00 ? 20  ALA A HB1  1  
ATOM   274   H  HB2  . ALA A 1 20  ? 3.342   8.321   -6.204  1.00 0.00 ? 20  ALA A HB2  1  
ATOM   275   H  HB3  . ALA A 1 20  ? 2.894   8.215   -4.502  1.00 0.00 ? 20  ALA A HB3  1  
ATOM   276   N  N    . PRO A 1 21  ? 6.259   10.836  -4.128  1.00 0.00 ? 21  PRO A N    1  
ATOM   277   C  CA   . PRO A 1 21  ? 7.703   10.994  -4.004  1.00 0.00 ? 21  PRO A CA   1  
ATOM   278   C  C    . PRO A 1 21  ? 8.312   10.042  -2.984  1.00 0.00 ? 21  PRO A C    1  
ATOM   279   O  O    . PRO A 1 21  ? 7.603   9.425   -2.190  1.00 0.00 ? 21  PRO A O    1  
ATOM   280   C  CB   . PRO A 1 21  ? 7.848   12.437  -3.535  1.00 0.00 ? 21  PRO A CB   1  
ATOM   281   C  CG   . PRO A 1 21  ? 6.602   12.721  -2.757  1.00 0.00 ? 21  PRO A CG   1  
ATOM   282   C  CD   . PRO A 1 21  ? 5.530   11.785  -3.268  1.00 0.00 ? 21  PRO A CD   1  
ATOM   283   H  HA   . PRO A 1 21  ? 8.199   10.870  -4.955  1.00 0.00 ? 21  PRO A HA   1  
ATOM   284   H  HB2  . PRO A 1 21  ? 8.728   12.529  -2.916  1.00 0.00 ? 21  PRO A HB2  1  
ATOM   285   H  HB3  . PRO A 1 21  ? 7.936   13.087  -4.390  1.00 0.00 ? 21  PRO A HB3  1  
ATOM   286   H  HG2  . PRO A 1 21  ? 6.781   12.541  -1.708  1.00 0.00 ? 21  PRO A HG2  1  
ATOM   287   H  HG3  . PRO A 1 21  ? 6.304   13.748  -2.913  1.00 0.00 ? 21  PRO A HG3  1  
ATOM   288   H  HD2  . PRO A 1 21  ? 5.060   11.269  -2.445  1.00 0.00 ? 21  PRO A HD2  1  
ATOM   289   H  HD3  . PRO A 1 21  ? 4.794   12.331  -3.838  1.00 0.00 ? 21  PRO A HD3  1  
ATOM   290   N  N    . ILE A 1 22  ? 9.633   9.933   -3.012  1.00 0.00 ? 22  ILE A N    1  
ATOM   291   C  CA   . ILE A 1 22  ? 10.348  9.058   -2.090  1.00 0.00 ? 22  ILE A CA   1  
ATOM   292   C  C    . ILE A 1 22  ? 10.818  9.823   -0.852  1.00 0.00 ? 22  ILE A C    1  
ATOM   293   O  O    . ILE A 1 22  ? 11.263  9.222   0.126   1.00 0.00 ? 22  ILE A O    1  
ATOM   294   C  CB   . ILE A 1 22  ? 11.563  8.405   -2.771  1.00 0.00 ? 22  ILE A CB   1  
ATOM   295   C  CG1  . ILE A 1 22  ? 11.154  7.809   -4.120  1.00 0.00 ? 22  ILE A CG1  1  
ATOM   296   C  CG2  . ILE A 1 22  ? 12.170  7.337   -1.871  1.00 0.00 ? 22  ILE A CG2  1  
ATOM   297   C  CD1  . ILE A 1 22  ? 12.277  7.091   -4.829  1.00 0.00 ? 22  ILE A CD1  1  
ATOM   298   H  H    . ILE A 1 22  ? 10.140  10.456  -3.667  1.00 0.00 ? 22  ILE A H    1  
ATOM   299   H  HA   . ILE A 1 22  ? 9.671   8.273   -1.782  1.00 0.00 ? 22  ILE A HA   1  
ATOM   300   H  HB   . ILE A 1 22  ? 12.309  9.167   -2.935  1.00 0.00 ? 22  ILE A HB   1  
ATOM   301   H  HG12 . ILE A 1 22  ? 10.353  7.102   -3.964  1.00 0.00 ? 22  ILE A HG12 1  
ATOM   302   H  HG13 . ILE A 1 22  ? 10.807  8.603   -4.764  1.00 0.00 ? 22  ILE A HG13 1  
ATOM   303   H  HG21 . ILE A 1 22  ? 12.062  6.368   -2.337  1.00 0.00 ? 22  ILE A HG21 1  
ATOM   304   H  HG22 . ILE A 1 22  ? 11.663  7.337   -0.919  1.00 0.00 ? 22  ILE A HG22 1  
ATOM   305   H  HG23 . ILE A 1 22  ? 13.219  7.548   -1.719  1.00 0.00 ? 22  ILE A HG23 1  
ATOM   306   H  HD11 . ILE A 1 22  ? 12.958  7.814   -5.251  1.00 0.00 ? 22  ILE A HD11 1  
ATOM   307   H  HD12 . ILE A 1 22  ? 11.869  6.476   -5.617  1.00 0.00 ? 22  ILE A HD12 1  
ATOM   308   H  HD13 . ILE A 1 22  ? 12.807  6.467   -4.123  1.00 0.00 ? 22  ILE A HD13 1  
ATOM   309   N  N    . GLN A 1 23  ? 10.713  11.152  -0.900  1.00 0.00 ? 23  GLN A N    1  
ATOM   310   C  CA   . GLN A 1 23  ? 11.124  12.005  0.215   1.00 0.00 ? 23  GLN A CA   1  
ATOM   311   C  C    . GLN A 1 23  ? 12.638  12.171  0.245   1.00 0.00 ? 23  GLN A C    1  
ATOM   312   O  O    . GLN A 1 23  ? 13.272  12.032  1.291   1.00 0.00 ? 23  GLN A O    1  
ATOM   313   C  CB   . GLN A 1 23  ? 10.638  11.428  1.545   1.00 0.00 ? 23  GLN A CB   1  
ATOM   314   C  CG   . GLN A 1 23  ? 10.241  12.485  2.562   1.00 0.00 ? 23  GLN A CG   1  
ATOM   315   C  CD   . GLN A 1 23  ? 10.504  12.047  3.990   1.00 0.00 ? 23  GLN A CD   1  
ATOM   316   O  OE1  . GLN A 1 23  ? 11.645  12.051  4.452   1.00 0.00 ? 23  GLN A OE1  1  
ATOM   317   N  NE2  . GLN A 1 23  ? 9.446   11.664  4.696   1.00 0.00 ? 23  GLN A NE2  1  
ATOM   318   H  H    . GLN A 1 23  ? 10.352  11.571  -1.708  1.00 0.00 ? 23  GLN A H    1  
ATOM   319   H  HA   . GLN A 1 23  ? 10.674  12.976  0.070   1.00 0.00 ? 23  GLN A HA   1  
ATOM   320   H  HB2  . GLN A 1 23  ? 9.781   10.800  1.357   1.00 0.00 ? 23  GLN A HB2  1  
ATOM   321   H  HB3  . GLN A 1 23  ? 11.429  10.828  1.970   1.00 0.00 ? 23  GLN A HB3  1  
ATOM   322   H  HG2  . GLN A 1 23  ? 10.807  13.383  2.368   1.00 0.00 ? 23  GLN A HG2  1  
ATOM   323   H  HG3  . GLN A 1 23  ? 9.187   12.694  2.453   1.00 0.00 ? 23  GLN A HG3  1  
ATOM   324   H  HE21 . GLN A 1 23  ? 8.568   11.687  4.262   1.00 0.00 ? 23  GLN A HE21 1  
ATOM   325   H  HE22 . GLN A 1 23  ? 9.588   11.376  5.622   1.00 0.00 ? 23  GLN A HE22 1  
ATOM   326   N  N    . GLY A 1 24  ? 13.211  12.466  -0.914  1.00 0.00 ? 24  GLY A N    1  
ATOM   327   C  CA   . GLY A 1 24  ? 14.648  12.646  -1.008  1.00 0.00 ? 24  GLY A CA   1  
ATOM   328   C  C    . GLY A 1 24  ? 15.405  11.377  -0.679  1.00 0.00 ? 24  GLY A C    1  
ATOM   329   O  O    . GLY A 1 24  ? 14.859  10.466  -0.057  1.00 0.00 ? 24  GLY A O    1  
ATOM   330   H  H    . GLY A 1 24  ? 12.652  12.561  -1.711  1.00 0.00 ? 24  GLY A H    1  
ATOM   331   H  HA2  . GLY A 1 24  ? 14.897  12.953  -2.013  1.00 0.00 ? 24  GLY A HA2  1  
ATOM   332   H  HA3  . GLY A 1 24  ? 14.949  13.421  -0.319  1.00 0.00 ? 24  GLY A HA3  1  
ATOM   333   N  N    . SER A 1 25  ? 16.663  11.308  -1.105  1.00 0.00 ? 25  SER A N    1  
ATOM   334   C  CA   . SER A 1 25  ? 17.488  10.135  -0.857  1.00 0.00 ? 25  SER A CA   1  
ATOM   335   C  C    . SER A 1 25  ? 16.910  8.923   -1.576  1.00 0.00 ? 25  SER A C    1  
ATOM   336   O  O    . SER A 1 25  ? 15.961  8.299   -1.102  1.00 0.00 ? 25  SER A O    1  
ATOM   337   C  CB   . SER A 1 25  ? 17.602  9.862   0.646   1.00 0.00 ? 25  SER A CB   1  
ATOM   338   O  OG   . SER A 1 25  ? 16.509  9.096   1.120   1.00 0.00 ? 25  SER A OG   1  
ATOM   339   H  H    . SER A 1 25  ? 17.043  12.059  -1.604  1.00 0.00 ? 25  SER A H    1  
ATOM   340   H  HA   . SER A 1 25  ? 18.472  10.335  -1.253  1.00 0.00 ? 25  SER A HA   1  
ATOM   341   H  HB2  . SER A 1 25  ? 18.515  9.320   0.843   1.00 0.00 ? 25  SER A HB2  1  
ATOM   342   H  HB3  . SER A 1 25  ? 17.623  10.802  1.179   1.00 0.00 ? 25  SER A HB3  1  
ATOM   343   H  HG   . SER A 1 25  ? 16.039  9.589   1.796   1.00 0.00 ? 25  SER A HG   1  
ATOM   344   N  N    . ARG A 1 26  ? 17.487  8.607   -2.732  1.00 0.00 ? 26  ARG A N    1  
ATOM   345   C  CA   . ARG A 1 26  ? 17.049  7.488   -3.544  1.00 0.00 ? 26  ARG A CA   1  
ATOM   346   C  C    . ARG A 1 26  ? 16.659  6.287   -2.685  1.00 0.00 ? 26  ARG A C    1  
ATOM   347   O  O    . ARG A 1 26  ? 17.193  6.090   -1.594  1.00 0.00 ? 26  ARG A O    1  
ATOM   348   C  CB   . ARG A 1 26  ? 18.151  7.093   -4.531  1.00 0.00 ? 26  ARG A CB   1  
ATOM   349   C  CG   . ARG A 1 26  ? 19.299  8.087   -4.645  1.00 0.00 ? 26  ARG A CG   1  
ATOM   350   C  CD   . ARG A 1 26  ? 20.302  7.658   -5.704  1.00 0.00 ? 26  ARG A CD   1  
ATOM   351   N  NE   . ARG A 1 26  ? 21.600  8.308   -5.523  1.00 0.00 ? 26  ARG A NE   1  
ATOM   352   C  CZ   . ARG A 1 26  ? 22.415  8.060   -4.500  1.00 0.00 ? 26  ARG A CZ   1  
ATOM   353   N  NH1  . ARG A 1 26  ? 22.075  7.179   -3.569  1.00 0.00 ? 26  ARG A NH1  1  
ATOM   354   N  NH2  . ARG A 1 26  ? 23.576  8.696   -4.410  1.00 0.00 ? 26  ARG A NH2  1  
ATOM   355   H  H    . ARG A 1 26  ? 18.227  9.149   -3.056  1.00 0.00 ? 26  ARG A H    1  
ATOM   356   H  HA   . ARG A 1 26  ? 16.181  7.806   -4.104  1.00 0.00 ? 26  ARG A HA   1  
ATOM   357   H  HB2  . ARG A 1 26  ? 18.562  6.150   -4.224  1.00 0.00 ? 26  ARG A HB2  1  
ATOM   358   H  HB3  . ARG A 1 26  ? 17.707  6.989   -5.502  1.00 0.00 ? 26  ARG A HB3  1  
ATOM   359   H  HG2  . ARG A 1 26  ? 18.901  9.055   -4.913  1.00 0.00 ? 26  ARG A HG2  1  
ATOM   360   H  HG3  . ARG A 1 26  ? 19.802  8.154   -3.692  1.00 0.00 ? 26  ARG A HG3  1  
ATOM   361   H  HD2  . ARG A 1 26  ? 20.435  6.589   -5.643  1.00 0.00 ? 26  ARG A HD2  1  
ATOM   362   H  HD3  . ARG A 1 26  ? 19.913  7.918   -6.677  1.00 0.00 ? 26  ARG A HD3  1  
ATOM   363   H  HE   . ARG A 1 26  ? 21.876  8.962   -6.198  1.00 0.00 ? 26  ARG A HE   1  
ATOM   364   H  HH11 . ARG A 1 26  ? 21.202  6.696   -3.630  1.00 0.00 ? 26  ARG A HH11 1  
ATOM   365   H  HH12 . ARG A 1 26  ? 22.693  6.998   -2.803  1.00 0.00 ? 26  ARG A HH12 1  
ATOM   366   H  HH21 . ARG A 1 26  ? 23.837  9.361   -5.110  1.00 0.00 ? 26  ARG A HH21 1  
ATOM   367   H  HH22 . ARG A 1 26  ? 24.189  8.511   -3.644  1.00 0.00 ? 26  ARG A HH22 1  
ATOM   368   N  N    . ASN A 1 27  ? 15.718  5.498   -3.185  1.00 0.00 ? 27  ASN A N    1  
ATOM   369   C  CA   . ASN A 1 27  ? 15.241  4.323   -2.469  1.00 0.00 ? 27  ASN A CA   1  
ATOM   370   C  C    . ASN A 1 27  ? 16.290  3.213   -2.478  1.00 0.00 ? 27  ASN A C    1  
ATOM   371   O  O    . ASN A 1 27  ? 17.281  3.278   -3.206  1.00 0.00 ? 27  ASN A O    1  
ATOM   372   C  CB   . ASN A 1 27  ? 13.919  3.845   -3.083  1.00 0.00 ? 27  ASN A CB   1  
ATOM   373   C  CG   . ASN A 1 27  ? 13.615  2.380   -2.828  1.00 0.00 ? 27  ASN A CG   1  
ATOM   374   O  OD1  . ASN A 1 27  ? 13.921  1.522   -3.652  1.00 0.00 ? 27  ASN A OD1  1  
ATOM   375   N  ND2  . ASN A 1 27  ? 13.007  2.092   -1.683  1.00 0.00 ? 27  ASN A ND2  1  
ATOM   376   H  H    . ASN A 1 27  ? 15.328  5.716   -4.058  1.00 0.00 ? 27  ASN A H    1  
ATOM   377   H  HA   . ASN A 1 27  ? 15.062  4.617   -1.446  1.00 0.00 ? 27  ASN A HA   1  
ATOM   378   H  HB2  . ASN A 1 27  ? 13.113  4.429   -2.670  1.00 0.00 ? 27  ASN A HB2  1  
ATOM   379   H  HB3  . ASN A 1 27  ? 13.958  4.002   -4.145  1.00 0.00 ? 27  ASN A HB3  1  
ATOM   380   H  HD21 . ASN A 1 27  ? 12.793  2.828   -1.074  1.00 0.00 ? 27  ASN A HD21 1  
ATOM   381   H  HD22 . ASN A 1 27  ? 12.799  1.153   -1.493  1.00 0.00 ? 27  ASN A HD22 1  
ATOM   382   N  N    . LEU A 1 28  ? 16.064  2.209   -1.644  1.00 0.00 ? 28  LEU A N    1  
ATOM   383   C  CA   . LEU A 1 28  ? 16.965  1.086   -1.509  1.00 0.00 ? 28  LEU A CA   1  
ATOM   384   C  C    . LEU A 1 28  ? 16.860  0.117   -2.687  1.00 0.00 ? 28  LEU A C    1  
ATOM   385   O  O    . LEU A 1 28  ? 17.869  -0.255  -3.286  1.00 0.00 ? 28  LEU A O    1  
ATOM   386   C  CB   . LEU A 1 28  ? 16.652  0.365   -0.204  1.00 0.00 ? 28  LEU A CB   1  
ATOM   387   C  CG   . LEU A 1 28  ? 17.600  0.679   0.949   1.00 0.00 ? 28  LEU A CG   1  
ATOM   388   C  CD1  . LEU A 1 28  ? 17.227  -0.124  2.184   1.00 0.00 ? 28  LEU A CD1  1  
ATOM   389   C  CD2  . LEU A 1 28  ? 19.041  0.403   0.544   1.00 0.00 ? 28  LEU A CD2  1  
ATOM   390   H  H    . LEU A 1 28  ? 15.268  2.228   -1.086  1.00 0.00 ? 28  LEU A H    1  
ATOM   391   H  HA   . LEU A 1 28  ? 17.967  1.474   -1.460  1.00 0.00 ? 28  LEU A HA   1  
ATOM   392   H  HB2  . LEU A 1 28  ? 15.651  0.639   0.098   1.00 0.00 ? 28  LEU A HB2  1  
ATOM   393   H  HB3  . LEU A 1 28  ? 16.673  -0.690  -0.389  1.00 0.00 ? 28  LEU A HB3  1  
ATOM   394   H  HG   . LEU A 1 28  ? 17.515  1.728   1.193   1.00 0.00 ? 28  LEU A HG   1  
ATOM   395   H  HD11 . LEU A 1 28  ? 16.853  -1.093  1.886   1.00 0.00 ? 28  LEU A HD11 1  
ATOM   396   H  HD12 . LEU A 1 28  ? 16.461  0.401   2.738   1.00 0.00 ? 28  LEU A HD12 1  
ATOM   397   H  HD13 . LEU A 1 28  ? 18.098  -0.252  2.809   1.00 0.00 ? 28  LEU A HD13 1  
ATOM   398   H  HD21 . LEU A 1 28  ? 19.605  0.091   1.410   1.00 0.00 ? 28  LEU A HD21 1  
ATOM   399   H  HD22 . LEU A 1 28  ? 19.478  1.302   0.134   1.00 0.00 ? 28  LEU A HD22 1  
ATOM   400   H  HD23 . LEU A 1 28  ? 19.063  -0.380  -0.200  1.00 0.00 ? 28  LEU A HD23 1  
ATOM   401   N  N    . LEU A 1 29  ? 15.638  -0.298  -3.008  1.00 0.00 ? 29  LEU A N    1  
ATOM   402   C  CA   . LEU A 1 29  ? 15.418  -1.233  -4.107  1.00 0.00 ? 29  LEU A CA   1  
ATOM   403   C  C    . LEU A 1 29  ? 15.538  -0.528  -5.454  1.00 0.00 ? 29  LEU A C    1  
ATOM   404   O  O    . LEU A 1 29  ? 15.017  0.572   -5.644  1.00 0.00 ? 29  LEU A O    1  
ATOM   405   C  CB   . LEU A 1 29  ? 14.050  -1.930  -3.994  1.00 0.00 ? 29  LEU A CB   1  
ATOM   406   C  CG   . LEU A 1 29  ? 13.106  -1.404  -2.907  1.00 0.00 ? 29  LEU A CG   1  
ATOM   407   C  CD1  . LEU A 1 29  ? 11.698  -1.933  -3.129  1.00 0.00 ? 29  LEU A CD1  1  
ATOM   408   C  CD2  . LEU A 1 29  ? 13.613  -1.788  -1.521  1.00 0.00 ? 29  LEU A CD2  1  
ATOM   409   H  H    . LEU A 1 29  ? 14.874  0.027   -2.496  1.00 0.00 ? 29  LEU A H    1  
ATOM   410   H  HA   . LEU A 1 29  ? 16.193  -1.985  -4.050  1.00 0.00 ? 29  LEU A HA   1  
ATOM   411   H  HB2  . LEU A 1 29  ? 13.547  -1.838  -4.944  1.00 0.00 ? 29  LEU A HB2  1  
ATOM   412   H  HB3  . LEU A 1 29  ? 14.226  -2.979  -3.805  1.00 0.00 ? 29  LEU A HB3  1  
ATOM   413   H  HG   . LEU A 1 29  ? 13.066  -0.328  -2.964  1.00 0.00 ? 29  LEU A HG   1  
ATOM   414   H  HD11 . LEU A 1 29  ? 11.114  -1.191  -3.653  1.00 0.00 ? 29  LEU A HD11 1  
ATOM   415   H  HD12 . LEU A 1 29  ? 11.237  -2.144  -2.176  1.00 0.00 ? 29  LEU A HD12 1  
ATOM   416   H  HD13 . LEU A 1 29  ? 11.741  -2.837  -3.717  1.00 0.00 ? 29  LEU A HD13 1  
ATOM   417   H  HD21 . LEU A 1 29  ? 14.051  -0.923  -1.045  1.00 0.00 ? 29  LEU A HD21 1  
ATOM   418   H  HD22 . LEU A 1 29  ? 14.360  -2.563  -1.613  1.00 0.00 ? 29  LEU A HD22 1  
ATOM   419   H  HD23 . LEU A 1 29  ? 12.791  -2.150  -0.923  1.00 0.00 ? 29  LEU A HD23 1  
ATOM   420   N  N    . GLN A 1 30  ? 16.240  -1.167  -6.382  1.00 0.00 ? 30  GLN A N    1  
ATOM   421   C  CA   . GLN A 1 30  ? 16.448  -0.609  -7.709  1.00 0.00 ? 30  GLN A CA   1  
ATOM   422   C  C    . GLN A 1 30  ? 16.425  -1.702  -8.775  1.00 0.00 ? 30  GLN A C    1  
ATOM   423   O  O    . GLN A 1 30  ? 15.471  -1.812  -9.544  1.00 0.00 ? 30  GLN A O    1  
ATOM   424   C  CB   . GLN A 1 30  ? 17.781  0.132   -7.749  1.00 0.00 ? 30  GLN A CB   1  
ATOM   425   C  CG   . GLN A 1 30  ? 17.685  1.504   -8.384  1.00 0.00 ? 30  GLN A CG   1  
ATOM   426   C  CD   . GLN A 1 30  ? 18.959  1.911   -9.096  1.00 0.00 ? 30  GLN A CD   1  
ATOM   427   O  OE1  . GLN A 1 30  ? 19.994  2.131   -8.467  1.00 0.00 ? 30  GLN A OE1  1  
ATOM   428   N  NE2  . GLN A 1 30  ? 18.892  2.014   -10.419 1.00 0.00 ? 30  GLN A NE2  1  
ATOM   429   H  H    . GLN A 1 30  ? 16.636  -2.030  -6.167  1.00 0.00 ? 30  GLN A H    1  
ATOM   430   H  HA   . GLN A 1 30  ? 15.650  0.091   -7.905  1.00 0.00 ? 30  GLN A HA   1  
ATOM   431   H  HB2  . GLN A 1 30  ? 18.144  0.251   -6.739  1.00 0.00 ? 30  GLN A HB2  1  
ATOM   432   H  HB3  . GLN A 1 30  ? 18.491  -0.455  -8.309  1.00 0.00 ? 30  GLN A HB3  1  
ATOM   433   H  HG2  . GLN A 1 30  ? 16.876  1.496   -9.099  1.00 0.00 ? 30  GLN A HG2  1  
ATOM   434   H  HG3  . GLN A 1 30  ? 17.473  2.227   -7.610  1.00 0.00 ? 30  GLN A HG3  1  
ATOM   435   H  HE21 . GLN A 1 30  ? 18.035  1.824   -10.855 1.00 0.00 ? 30  GLN A HE21 1  
ATOM   436   H  HE22 . GLN A 1 30  ? 19.702  2.276   -10.905 1.00 0.00 ? 30  GLN A HE22 1  
ATOM   437   N  N    . GLY A 1 31  ? 17.482  -2.506  -8.819  1.00 0.00 ? 31  GLY A N    1  
ATOM   438   C  CA   . GLY A 1 31  ? 17.561  -3.571  -9.792  1.00 0.00 ? 31  GLY A CA   1  
ATOM   439   C  C    . GLY A 1 31  ? 17.055  -4.890  -9.243  1.00 0.00 ? 31  GLY A C    1  
ATOM   440   O  O    . GLY A 1 31  ? 15.851  -5.139  -9.216  1.00 0.00 ? 31  GLY A O    1  
ATOM   441   H  H    . GLY A 1 31  ? 18.211  -2.374  -8.193  1.00 0.00 ? 31  GLY A H    1  
ATOM   442   H  HA2  . GLY A 1 31  ? 16.971  -3.296  -10.643 1.00 0.00 ? 31  GLY A HA2  1  
ATOM   443   H  HA3  . GLY A 1 31  ? 18.588  -3.690  -10.100 1.00 0.00 ? 31  GLY A HA3  1  
ATOM   444   N  N    . GLU A 1 32  ? 17.981  -5.735  -8.801  1.00 0.00 ? 32  GLU A N    1  
ATOM   445   C  CA   . GLU A 1 32  ? 17.627  -7.034  -8.244  1.00 0.00 ? 32  GLU A CA   1  
ATOM   446   C  C    . GLU A 1 32  ? 16.994  -6.876  -6.866  1.00 0.00 ? 32  GLU A C    1  
ATOM   447   O  O    . GLU A 1 32  ? 16.218  -7.724  -6.427  1.00 0.00 ? 32  GLU A O    1  
ATOM   448   C  CB   . GLU A 1 32  ? 18.866  -7.924  -8.147  1.00 0.00 ? 32  GLU A CB   1  
ATOM   449   C  CG   . GLU A 1 32  ? 19.950  -7.362  -7.242  1.00 0.00 ? 32  GLU A CG   1  
ATOM   450   C  CD   . GLU A 1 32  ? 19.994  -8.047  -5.891  1.00 0.00 ? 32  GLU A CD   1  
ATOM   451   O  OE1  . GLU A 1 32  ? 18.972  -8.013  -5.174  1.00 0.00 ? 32  GLU A OE1  1  
ATOM   452   O  OE2  . GLU A 1 32  ? 21.052  -8.617  -5.549  1.00 0.00 ? 32  GLU A OE2  1  
ATOM   453   H  H    . GLU A 1 32  ? 18.925  -5.475  -8.847  1.00 0.00 ? 32  GLU A H    1  
ATOM   454   H  HA   . GLU A 1 32  ? 16.910  -7.496  -8.905  1.00 0.00 ? 32  GLU A HA   1  
ATOM   455   H  HB2  . GLU A 1 32  ? 18.572  -8.889  -7.764  1.00 0.00 ? 32  GLU A HB2  1  
ATOM   456   H  HB3  . GLU A 1 32  ? 19.281  -8.049  -9.135  1.00 0.00 ? 32  GLU A HB3  1  
ATOM   457   H  HG2  . GLU A 1 32  ? 20.907  -7.490  -7.726  1.00 0.00 ? 32  GLU A HG2  1  
ATOM   458   H  HG3  . GLU A 1 32  ? 19.763  -6.308  -7.090  1.00 0.00 ? 32  GLU A HG3  1  
ATOM   459   N  N    . GLU A 1 33  ? 17.329  -5.783  -6.190  1.00 0.00 ? 33  GLU A N    1  
ATOM   460   C  CA   . GLU A 1 33  ? 16.791  -5.512  -4.864  1.00 0.00 ? 33  GLU A CA   1  
ATOM   461   C  C    . GLU A 1 33  ? 15.311  -5.174  -4.945  1.00 0.00 ? 33  GLU A C    1  
ATOM   462   O  O    . GLU A 1 33  ? 14.563  -5.371  -3.989  1.00 0.00 ? 33  GLU A O    1  
ATOM   463   C  CB   . GLU A 1 33  ? 17.558  -4.369  -4.196  1.00 0.00 ? 33  GLU A CB   1  
ATOM   464   C  CG   . GLU A 1 33  ? 19.058  -4.608  -4.122  1.00 0.00 ? 33  GLU A CG   1  
ATOM   465   C  CD   . GLU A 1 33  ? 19.752  -3.665  -3.158  1.00 0.00 ? 33  GLU A CD   1  
ATOM   466   O  OE1  . GLU A 1 33  ? 20.162  -2.568  -3.592  1.00 0.00 ? 33  GLU A OE1  1  
ATOM   467   O  OE2  . GLU A 1 33  ? 19.886  -4.025  -1.970  1.00 0.00 ? 33  GLU A OE2  1  
ATOM   468   H  H    . GLU A 1 33  ? 17.948  -5.142  -6.592  1.00 0.00 ? 33  GLU A H    1  
ATOM   469   H  HA   . GLU A 1 33  ? 16.903  -6.403  -4.280  1.00 0.00 ? 33  GLU A HA   1  
ATOM   470   H  HB2  . GLU A 1 33  ? 17.386  -3.461  -4.752  1.00 0.00 ? 33  GLU A HB2  1  
ATOM   471   H  HB3  . GLU A 1 33  ? 17.187  -4.241  -3.190  1.00 0.00 ? 33  GLU A HB3  1  
ATOM   472   H  HG2  . GLU A 1 33  ? 19.233  -5.623  -3.797  1.00 0.00 ? 33  GLU A HG2  1  
ATOM   473   H  HG3  . GLU A 1 33  ? 19.480  -4.468  -5.106  1.00 0.00 ? 33  GLU A HG3  1  
ATOM   474   N  N    . LEU A 1 34  ? 14.898  -4.678  -6.100  1.00 0.00 ? 34  LEU A N    1  
ATOM   475   C  CA   . LEU A 1 34  ? 13.519  -4.323  -6.331  1.00 0.00 ? 34  LEU A CA   1  
ATOM   476   C  C    . LEU A 1 34  ? 12.640  -5.562  -6.274  1.00 0.00 ? 34  LEU A C    1  
ATOM   477   O  O    . LEU A 1 34  ? 11.512  -5.512  -5.790  1.00 0.00 ? 34  LEU A O    1  
ATOM   478   C  CB   . LEU A 1 34  ? 13.396  -3.644  -7.691  1.00 0.00 ? 34  LEU A CB   1  
ATOM   479   C  CG   . LEU A 1 34  ? 13.078  -2.152  -7.641  1.00 0.00 ? 34  LEU A CG   1  
ATOM   480   C  CD1  . LEU A 1 34  ? 12.862  -1.602  -9.044  1.00 0.00 ? 34  LEU A CD1  1  
ATOM   481   C  CD2  . LEU A 1 34  ? 11.856  -1.886  -6.771  1.00 0.00 ? 34  LEU A CD2  1  
ATOM   482   H  H    . LEU A 1 34  ? 15.539  -4.554  -6.820  1.00 0.00 ? 34  LEU A H    1  
ATOM   483   H  HA   . LEU A 1 34  ? 13.212  -3.636  -5.559  1.00 0.00 ? 34  LEU A HA   1  
ATOM   484   H  HB2  . LEU A 1 34  ? 14.333  -3.771  -8.214  1.00 0.00 ? 34  LEU A HB2  1  
ATOM   485   H  HB3  . LEU A 1 34  ? 12.628  -4.140  -8.249  1.00 0.00 ? 34  LEU A HB3  1  
ATOM   486   H  HG   . LEU A 1 34  ? 13.921  -1.636  -7.204  1.00 0.00 ? 34  LEU A HG   1  
ATOM   487   H  HD11 . LEU A 1 34  ? 13.286  -2.283  -9.767  1.00 0.00 ? 34  LEU A HD11 1  
ATOM   488   H  HD12 . LEU A 1 34  ? 13.343  -0.640  -9.131  1.00 0.00 ? 34  LEU A HD12 1  
ATOM   489   H  HD13 . LEU A 1 34  ? 11.804  -1.493  -9.228  1.00 0.00 ? 34  LEU A HD13 1  
ATOM   490   H  HD21 . LEU A 1 34  ? 11.038  -1.553  -7.392  1.00 0.00 ? 34  LEU A HD21 1  
ATOM   491   H  HD22 . LEU A 1 34  ? 12.090  -1.121  -6.046  1.00 0.00 ? 34  LEU A HD22 1  
ATOM   492   H  HD23 . LEU A 1 34  ? 11.571  -2.793  -6.259  1.00 0.00 ? 34  LEU A HD23 1  
ATOM   493   N  N    . LEU A 1 35  ? 13.173  -6.676  -6.763  1.00 0.00 ? 35  LEU A N    1  
ATOM   494   C  CA   . LEU A 1 35  ? 12.437  -7.932  -6.757  1.00 0.00 ? 35  LEU A CA   1  
ATOM   495   C  C    . LEU A 1 35  ? 12.500  -8.570  -5.376  1.00 0.00 ? 35  LEU A C    1  
ATOM   496   O  O    . LEU A 1 35  ? 11.518  -9.134  -4.894  1.00 0.00 ? 35  LEU A O    1  
ATOM   497   C  CB   . LEU A 1 35  ? 12.997  -8.894  -7.808  1.00 0.00 ? 35  LEU A CB   1  
ATOM   498   C  CG   . LEU A 1 35  ? 13.440  -8.238  -9.118  1.00 0.00 ? 35  LEU A CG   1  
ATOM   499   C  CD1  . LEU A 1 35  ? 14.016  -9.277  -10.067 1.00 0.00 ? 35  LEU A CD1  1  
ATOM   500   C  CD2  . LEU A 1 35  ? 12.274  -7.508  -9.768  1.00 0.00 ? 35  LEU A CD2  1  
ATOM   501   H  H    . LEU A 1 35  ? 14.085  -6.654  -7.129  1.00 0.00 ? 35  LEU A H    1  
ATOM   502   H  HA   . LEU A 1 35  ? 11.406  -7.712  -6.989  1.00 0.00 ? 35  LEU A HA   1  
ATOM   503   H  HB2  . LEU A 1 35  ? 13.847  -9.405  -7.381  1.00 0.00 ? 35  LEU A HB2  1  
ATOM   504   H  HB3  . LEU A 1 35  ? 12.237  -9.625  -8.038  1.00 0.00 ? 35  LEU A HB3  1  
ATOM   505   H  HG   . LEU A 1 35  ? 14.214  -7.514  -8.906  1.00 0.00 ? 35  LEU A HG   1  
ATOM   506   H  HD11 . LEU A 1 35  ? 14.736  -9.885  -9.540  1.00 0.00 ? 35  LEU A HD11 1  
ATOM   507   H  HD12 . LEU A 1 35  ? 14.501  -8.779  -10.894 1.00 0.00 ? 35  LEU A HD12 1  
ATOM   508   H  HD13 . LEU A 1 35  ? 13.220  -9.903  -10.441 1.00 0.00 ? 35  LEU A HD13 1  
ATOM   509   H  HD21 . LEU A 1 35  ? 12.216  -6.503  -9.375  1.00 0.00 ? 35  LEU A HD21 1  
ATOM   510   H  HD22 . LEU A 1 35  ? 11.355  -8.033  -9.552  1.00 0.00 ? 35  LEU A HD22 1  
ATOM   511   H  HD23 . LEU A 1 35  ? 12.424  -7.469  -10.836 1.00 0.00 ? 35  LEU A HD23 1  
ATOM   512   N  N    . ARG A 1 36  ? 13.657  -8.459  -4.735  1.00 0.00 ? 36  ARG A N    1  
ATOM   513   C  CA   . ARG A 1 36  ? 13.838  -9.007  -3.399  1.00 0.00 ? 36  ARG A CA   1  
ATOM   514   C  C    . ARG A 1 36  ? 13.059  -8.171  -2.391  1.00 0.00 ? 36  ARG A C    1  
ATOM   515   O  O    . ARG A 1 36  ? 12.567  -8.683  -1.385  1.00 0.00 ? 36  ARG A O    1  
ATOM   516   C  CB   . ARG A 1 36  ? 15.323  -9.037  -3.028  1.00 0.00 ? 36  ARG A CB   1  
ATOM   517   C  CG   . ARG A 1 36  ? 15.882  -10.442 -2.871  1.00 0.00 ? 36  ARG A CG   1  
ATOM   518   C  CD   . ARG A 1 36  ? 15.272  -11.153 -1.674  1.00 0.00 ? 36  ARG A CD   1  
ATOM   519   N  NE   . ARG A 1 36  ? 14.030  -11.842 -2.020  1.00 0.00 ? 36  ARG A NE   1  
ATOM   520   C  CZ   . ARG A 1 36  ? 13.966  -12.890 -2.839  1.00 0.00 ? 36  ARG A CZ   1  
ATOM   521   N  NH1  . ARG A 1 36  ? 15.070  -13.373 -3.396  1.00 0.00 ? 36  ARG A NH1  1  
ATOM   522   N  NH2  . ARG A 1 36  ? 12.797  -13.456 -3.100  1.00 0.00 ? 36  ARG A NH2  1  
ATOM   523   H  H    . ARG A 1 36  ? 14.401  -7.983  -5.163  1.00 0.00 ? 36  ARG A H    1  
ATOM   524   H  HA   . ARG A 1 36  ? 13.449  -10.014 -3.394  1.00 0.00 ? 36  ARG A HA   1  
ATOM   525   H  HB2  . ARG A 1 36  ? 15.885  -8.535  -3.801  1.00 0.00 ? 36  ARG A HB2  1  
ATOM   526   H  HB3  . ARG A 1 36  ? 15.463  -8.512  -2.095  1.00 0.00 ? 36  ARG A HB3  1  
ATOM   527   H  HG2  . ARG A 1 36  ? 15.661  -11.009 -3.764  1.00 0.00 ? 36  ARG A HG2  1  
ATOM   528   H  HG3  . ARG A 1 36  ? 16.951  -10.380 -2.736  1.00 0.00 ? 36  ARG A HG3  1  
ATOM   529   H  HD2  . ARG A 1 36  ? 15.981  -11.876 -1.301  1.00 0.00 ? 36  ARG A HD2  1  
ATOM   530   H  HD3  . ARG A 1 36  ? 15.066  -10.423 -0.905  1.00 0.00 ? 36  ARG A HD3  1  
ATOM   531   H  HE   . ARG A 1 36  ? 13.200  -11.507 -1.621  1.00 0.00 ? 36  ARG A HE   1  
ATOM   532   H  HH11 . ARG A 1 36  ? 15.955  -12.951 -3.203  1.00 0.00 ? 36  ARG A HH11 1  
ATOM   533   H  HH12 . ARG A 1 36  ? 15.016  -14.160 -4.010  1.00 0.00 ? 36  ARG A HH12 1  
ATOM   534   H  HH21 . ARG A 1 36  ? 11.963  -13.097 -2.682  1.00 0.00 ? 36  ARG A HH21 1  
ATOM   535   H  HH22 . ARG A 1 36  ? 12.748  -14.243 -3.716  1.00 0.00 ? 36  ARG A HH22 1  
ATOM   536   N  N    . ALA A 1 37  ? 12.948  -6.878  -2.680  1.00 0.00 ? 37  ALA A N    1  
ATOM   537   C  CA   . ALA A 1 37  ? 12.231  -5.958  -1.822  1.00 0.00 ? 37  ALA A CA   1  
ATOM   538   C  C    . ALA A 1 37  ? 10.732  -6.024  -2.085  1.00 0.00 ? 37  ALA A C    1  
ATOM   539   O  O    . ALA A 1 37  ? 9.938   -6.197  -1.161  1.00 0.00 ? 37  ALA A O    1  
ATOM   540   C  CB   . ALA A 1 37  ? 12.743  -4.544  -2.023  1.00 0.00 ? 37  ALA A CB   1  
ATOM   541   H  H    . ALA A 1 37  ? 13.358  -6.535  -3.492  1.00 0.00 ? 37  ALA A H    1  
ATOM   542   H  HA   . ALA A 1 37  ? 12.425  -6.244  -0.806  1.00 0.00 ? 37  ALA A HA   1  
ATOM   543   H  HB1  . ALA A 1 37  ? 12.055  -3.846  -1.571  1.00 0.00 ? 37  ALA A HB1  1  
ATOM   544   H  HB2  . ALA A 1 37  ? 12.824  -4.337  -3.079  1.00 0.00 ? 37  ALA A HB2  1  
ATOM   545   H  HB3  . ALA A 1 37  ? 13.714  -4.443  -1.560  1.00 0.00 ? 37  ALA A HB3  1  
ATOM   546   N  N    . LEU A 1 38  ? 10.347  -5.892  -3.356  1.00 0.00 ? 38  LEU A N    1  
ATOM   547   C  CA   . LEU A 1 38  ? 8.933   -5.946  -3.731  1.00 0.00 ? 38  LEU A CA   1  
ATOM   548   C  C    . LEU A 1 38  ? 8.250   -7.160  -3.105  1.00 0.00 ? 38  LEU A C    1  
ATOM   549   O  O    . LEU A 1 38  ? 7.040   -7.161  -2.885  1.00 0.00 ? 38  LEU A O    1  
ATOM   550   C  CB   . LEU A 1 38  ? 8.772   -6.002  -5.254  1.00 0.00 ? 38  LEU A CB   1  
ATOM   551   C  CG   . LEU A 1 38  ? 8.624   -4.647  -5.955  1.00 0.00 ? 38  LEU A CG   1  
ATOM   552   C  CD1  . LEU A 1 38  ? 8.270   -4.843  -7.423  1.00 0.00 ? 38  LEU A CD1  1  
ATOM   553   C  CD2  . LEU A 1 38  ? 7.568   -3.796  -5.263  1.00 0.00 ? 38  LEU A CD2  1  
ATOM   554   H  H    . LEU A 1 38  ? 11.027  -5.758  -4.055  1.00 0.00 ? 38  LEU A H    1  
ATOM   555   H  HA   . LEU A 1 38  ? 8.457   -5.051  -3.359  1.00 0.00 ? 38  LEU A HA   1  
ATOM   556   H  HB2  . LEU A 1 38  ? 9.633   -6.505  -5.667  1.00 0.00 ? 38  LEU A HB2  1  
ATOM   557   H  HB3  . LEU A 1 38  ? 7.895   -6.592  -5.479  1.00 0.00 ? 38  LEU A HB3  1  
ATOM   558   H  HG   . LEU A 1 38  ? 9.565   -4.119  -5.906  1.00 0.00 ? 38  LEU A HG   1  
ATOM   559   H  HD11 . LEU A 1 38  ? 7.254   -4.520  -7.595  1.00 0.00 ? 38  LEU A HD11 1  
ATOM   560   H  HD12 . LEU A 1 38  ? 8.364   -5.888  -7.681  1.00 0.00 ? 38  LEU A HD12 1  
ATOM   561   H  HD13 . LEU A 1 38  ? 8.940   -4.259  -8.035  1.00 0.00 ? 38  LEU A HD13 1  
ATOM   562   H  HD21 . LEU A 1 38  ? 7.143   -3.103  -5.974  1.00 0.00 ? 38  LEU A HD21 1  
ATOM   563   H  HD22 . LEU A 1 38  ? 8.023   -3.247  -4.452  1.00 0.00 ? 38  LEU A HD22 1  
ATOM   564   H  HD23 . LEU A 1 38  ? 6.789   -4.435  -4.873  1.00 0.00 ? 38  LEU A HD23 1  
ATOM   565   N  N    . ASP A 1 39  ? 9.039   -8.194  -2.823  1.00 0.00 ? 39  ASP A N    1  
ATOM   566   C  CA   . ASP A 1 39  ? 8.517   -9.414  -2.224  1.00 0.00 ? 39  ASP A CA   1  
ATOM   567   C  C    . ASP A 1 39  ? 8.624   -9.362  -0.706  1.00 0.00 ? 39  ASP A C    1  
ATOM   568   O  O    . ASP A 1 39  ? 9.030   -10.330 -0.064  1.00 0.00 ? 39  ASP A O    1  
ATOM   569   C  CB   . ASP A 1 39  ? 9.268   -10.635 -2.761  1.00 0.00 ? 39  ASP A CB   1  
ATOM   570   C  CG   . ASP A 1 39  ? 8.350   -11.815 -3.012  1.00 0.00 ? 39  ASP A CG   1  
ATOM   571   O  OD1  . ASP A 1 39  ? 7.588   -12.180 -2.093  1.00 0.00 ? 39  ASP A OD1  1  
ATOM   572   O  OD2  . ASP A 1 39  ? 8.394   -12.374 -4.128  1.00 0.00 ? 39  ASP A OD2  1  
ATOM   573   H  H    . ASP A 1 39  ? 9.994   -8.132  -3.022  1.00 0.00 ? 39  ASP A H    1  
ATOM   574   H  HA   . ASP A 1 39  ? 7.475   -9.493  -2.495  1.00 0.00 ? 39  ASP A HA   1  
ATOM   575   H  HB2  . ASP A 1 39  ? 9.749   -10.373 -3.693  1.00 0.00 ? 39  ASP A HB2  1  
ATOM   576   H  HB3  . ASP A 1 39  ? 10.019  -10.932 -2.044  1.00 0.00 ? 39  ASP A HB3  1  
ATOM   577   N  N    . GLN A 1 40  ? 8.250   -8.222  -0.140  1.00 0.00 ? 40  GLN A N    1  
ATOM   578   C  CA   . GLN A 1 40  ? 8.295   -8.034  1.303   1.00 0.00 ? 40  GLN A CA   1  
ATOM   579   C  C    . GLN A 1 40  ? 6.935   -7.593  1.828   1.00 0.00 ? 40  GLN A C    1  
ATOM   580   O  O    . GLN A 1 40  ? 6.828   -6.644  2.603   1.00 0.00 ? 40  GLN A O    1  
ATOM   581   C  CB   . GLN A 1 40  ? 9.365   -7.005  1.677   1.00 0.00 ? 40  GLN A CB   1  
ATOM   582   C  CG   . GLN A 1 40  ? 9.888   -7.159  3.095   1.00 0.00 ? 40  GLN A CG   1  
ATOM   583   C  CD   . GLN A 1 40  ? 11.193  -7.926  3.155   1.00 0.00 ? 40  GLN A CD   1  
ATOM   584   O  OE1  . GLN A 1 40  ? 12.272  -7.337  3.207   1.00 0.00 ? 40  GLN A OE1  1  
ATOM   585   N  NE2  . GLN A 1 40  ? 11.101  -9.252  3.149   1.00 0.00 ? 40  GLN A NE2  1  
ATOM   586   H  H    . GLN A 1 40  ? 7.932   -7.493  -0.710  1.00 0.00 ? 40  GLN A H    1  
ATOM   587   H  HA   . GLN A 1 40  ? 8.544   -8.982  1.752   1.00 0.00 ? 40  GLN A HA   1  
ATOM   588   H  HB2  . GLN A 1 40  ? 10.198  -7.106  0.996   1.00 0.00 ? 40  GLN A HB2  1  
ATOM   589   H  HB3  . GLN A 1 40  ? 8.947   -6.015  1.575   1.00 0.00 ? 40  GLN A HB3  1  
ATOM   590   H  HG2  . GLN A 1 40  ? 10.046  -6.176  3.515   1.00 0.00 ? 40  GLN A HG2  1  
ATOM   591   H  HG3  . GLN A 1 40  ? 9.149   -7.685  3.682   1.00 0.00 ? 40  GLN A HG3  1  
ATOM   592   H  HE21 . GLN A 1 40  ? 10.208  -9.654  3.107   1.00 0.00 ? 40  GLN A HE21 1  
ATOM   593   H  HE22 . GLN A 1 40  ? 11.930  -9.773  3.187   1.00 0.00 ? 40  GLN A HE22 1  
ATOM   594   N  N    . VAL A 1 41  ? 5.901   -8.297  1.393   1.00 0.00 ? 41  VAL A N    1  
ATOM   595   C  CA   . VAL A 1 41  ? 4.537   -7.996  1.806   1.00 0.00 ? 41  VAL A CA   1  
ATOM   596   C  C    . VAL A 1 41  ? 4.386   -8.099  3.321   1.00 0.00 ? 41  VAL A C    1  
ATOM   597   O  O    . VAL A 1 41  ? 4.490   -9.184  3.892   1.00 0.00 ? 41  VAL A O    1  
ATOM   598   C  CB   . VAL A 1 41  ? 3.523   -8.944  1.137   1.00 0.00 ? 41  VAL A CB   1  
ATOM   599   C  CG1  . VAL A 1 41  ? 2.102   -8.445  1.354   1.00 0.00 ? 41  VAL A CG1  1  
ATOM   600   C  CG2  . VAL A 1 41  ? 3.823   -9.089  -0.348  1.00 0.00 ? 41  VAL A CG2  1  
ATOM   601   H  H    . VAL A 1 41  ? 6.062   -9.041  0.775   1.00 0.00 ? 41  VAL A H    1  
ATOM   602   H  HA   . VAL A 1 41  ? 4.312   -6.987  1.499   1.00 0.00 ? 41  VAL A HA   1  
ATOM   603   H  HB   . VAL A 1 41  ? 3.612   -9.917  1.597   1.00 0.00 ? 41  VAL A HB   1  
ATOM   604   H  HG11 . VAL A 1 41  ? 2.087   -7.366  1.296   1.00 0.00 ? 41  VAL A HG11 1  
ATOM   605   H  HG12 . VAL A 1 41  ? 1.755   -8.759  2.328   1.00 0.00 ? 41  VAL A HG12 1  
ATOM   606   H  HG13 . VAL A 1 41  ? 1.456   -8.855  0.592   1.00 0.00 ? 41  VAL A HG13 1  
ATOM   607   H  HG21 . VAL A 1 41  ? 2.900   -9.240  -0.888  1.00 0.00 ? 41  VAL A HG21 1  
ATOM   608   H  HG22 . VAL A 1 41  ? 4.474   -9.936  -0.501  1.00 0.00 ? 41  VAL A HG22 1  
ATOM   609   H  HG23 . VAL A 1 41  ? 4.307   -8.192  -0.706  1.00 0.00 ? 41  VAL A HG23 1  
ATOM   610   N  N    . ASN A 1 42  ? 4.141   -6.963  3.964   1.00 0.00 ? 42  ASN A N    1  
ATOM   611   C  CA   . ASN A 1 42  ? 3.975   -6.926  5.414   1.00 0.00 ? 42  ASN A CA   1  
ATOM   612   C  C    . ASN A 1 42  ? 5.234   -7.423  6.117   1.00 0.00 ? 42  ASN A C    1  
ATOM   613   O  O    . ASN A 1 42  ? 6.303   -7.448  5.469   1.00 0.00 ? 42  ASN A O    1  
ATOM   614   C  CB   . ASN A 1 42  ? 2.775   -7.775  5.832   1.00 0.00 ? 42  ASN A CB   1  
ATOM   615   C  CG   . ASN A 1 42  ? 1.460   -7.038  5.670   1.00 0.00 ? 42  ASN A CG   1  
ATOM   616   O  OD1  . ASN A 1 42  ? 1.096   -6.631  4.566   1.00 0.00 ? 42  ASN A OD1  1  
ATOM   617   N  ND2  . ASN A 1 42  ? 0.740   -6.860  6.770   1.00 0.00 ? 42  ASN A ND2  1  
ATOM   618   O  OXT  . ASN A 1 42  ? 5.143   -7.782  7.310   1.00 0.00 ? 42  ASN A OXT  1  
ATOM   619   H  H    . ASN A 1 42  ? 4.069   -6.130  3.454   1.00 0.00 ? 42  ASN A H    1  
ATOM   620   H  HA   . ASN A 1 42  ? 3.798   -5.901  5.701   1.00 0.00 ? 42  ASN A HA   1  
ATOM   621   H  HB2  . ASN A 1 42  ? 2.742   -8.668  5.225   1.00 0.00 ? 42  ASN A HB2  1  
ATOM   622   H  HB3  . ASN A 1 42  ? 2.883   -8.056  6.870   1.00 0.00 ? 42  ASN A HB3  1  
ATOM   623   H  HD21 . ASN A 1 42  ? 1.092   -7.211  7.616   1.00 0.00 ? 42  ASN A HD21 1  
ATOM   624   H  HD22 . ASN A 1 42  ? -0.114  -6.386  6.694   1.00 0.00 ? 42  ASN A HD22 1  
ATOM   625   N  N    . MET B 2 1   ? 15.911  25.220  -11.287 1.00 0.00 ? 101 MET B N    1  
ATOM   626   C  CA   . MET B 2 1   ? 14.512  24.910  -10.892 1.00 0.00 ? 101 MET B CA   1  
ATOM   627   C  C    . MET B 2 1   ? 13.617  24.744  -12.115 1.00 0.00 ? 101 MET B C    1  
ATOM   628   O  O    . MET B 2 1   ? 13.877  25.322  -13.170 1.00 0.00 ? 101 MET B O    1  
ATOM   629   C  CB   . MET B 2 1   ? 13.993  26.046  -10.007 1.00 0.00 ? 101 MET B CB   1  
ATOM   630   C  CG   . MET B 2 1   ? 14.210  25.808  -8.522  1.00 0.00 ? 101 MET B CG   1  
ATOM   631   S  SD   . MET B 2 1   ? 12.822  24.961  -7.744  1.00 0.00 ? 101 MET B SD   1  
ATOM   632   C  CE   . MET B 2 1   ? 13.427  23.276  -7.714  1.00 0.00 ? 101 MET B CE   1  
ATOM   633   H  H1   . MET B 2 1   ? 15.898  26.103  -11.835 1.00 0.00 ? 101 MET B H1   1  
ATOM   634   H  H2   . MET B 2 1   ? 16.261  24.426  -11.862 1.00 0.00 ? 101 MET B H2   1  
ATOM   635   H  H3   . MET B 2 1   ? 16.470  25.329  -10.418 1.00 0.00 ? 101 MET B H3   1  
ATOM   636   H  HA   . MET B 2 1   ? 14.511  23.990  -10.326 1.00 0.00 ? 101 MET B HA   1  
ATOM   637   H  HB2  . MET B 2 1   ? 14.498  26.959  -10.281 1.00 0.00 ? 101 MET B HB2  1  
ATOM   638   H  HB3  . MET B 2 1   ? 12.933  26.165  -10.180 1.00 0.00 ? 101 MET B HB3  1  
ATOM   639   H  HG2  . MET B 2 1   ? 15.097  25.206  -8.393  1.00 0.00 ? 101 MET B HG2  1  
ATOM   640   H  HG3  . MET B 2 1   ? 14.350  26.762  -8.036  1.00 0.00 ? 101 MET B HG3  1  
ATOM   641   H  HE1  . MET B 2 1   ? 12.631  22.601  -7.990  1.00 0.00 ? 101 MET B HE1  1  
ATOM   642   H  HE2  . MET B 2 1   ? 13.773  23.035  -6.720  1.00 0.00 ? 101 MET B HE2  1  
ATOM   643   H  HE3  . MET B 2 1   ? 14.244  23.174  -8.413  1.00 0.00 ? 101 MET B HE3  1  
ATOM   644   N  N    . GLY B 2 2   ? 12.562  23.949  -11.967 1.00 0.00 ? 102 GLY B N    1  
ATOM   645   C  CA   . GLY B 2 2   ? 11.645  23.720  -13.068 1.00 0.00 ? 102 GLY B CA   1  
ATOM   646   C  C    . GLY B 2 2   ? 10.854  24.961  -13.430 1.00 0.00 ? 102 GLY B C    1  
ATOM   647   O  O    . GLY B 2 2   ? 11.393  26.068  -13.443 1.00 0.00 ? 102 GLY B O    1  
ATOM   648   H  H    . GLY B 2 2   ? 12.406  23.514  -11.103 1.00 0.00 ? 102 GLY B H    1  
ATOM   649   H  HA2  . GLY B 2 2   ? 12.210  23.402  -13.932 1.00 0.00 ? 102 GLY B HA2  1  
ATOM   650   H  HA3  . GLY B 2 2   ? 10.957  22.936  -12.792 1.00 0.00 ? 102 GLY B HA3  1  
ATOM   651   N  N    . SER B 2 3   ? 9.571   24.778  -13.725 1.00 0.00 ? 103 SER B N    1  
ATOM   652   C  CA   . SER B 2 3   ? 8.703   25.892  -14.090 1.00 0.00 ? 103 SER B CA   1  
ATOM   653   C  C    . SER B 2 3   ? 8.325   26.711  -12.860 1.00 0.00 ? 103 SER B C    1  
ATOM   654   O  O    . SER B 2 3   ? 8.114   27.920  -12.949 1.00 0.00 ? 103 SER B O    1  
ATOM   655   C  CB   . SER B 2 3   ? 7.440   25.376  -14.782 1.00 0.00 ? 103 SER B CB   1  
ATOM   656   O  OG   . SER B 2 3   ? 7.761   24.661  -15.963 1.00 0.00 ? 103 SER B OG   1  
ATOM   657   H  H    . SER B 2 3   ? 9.199   23.872  -13.698 1.00 0.00 ? 103 SER B H    1  
ATOM   658   H  HA   . SER B 2 3   ? 9.246   26.524  -14.776 1.00 0.00 ? 103 SER B HA   1  
ATOM   659   H  HB2  . SER B 2 3   ? 6.907   24.718  -14.112 1.00 0.00 ? 103 SER B HB2  1  
ATOM   660   H  HB3  . SER B 2 3   ? 6.809   26.213  -15.043 1.00 0.00 ? 103 SER B HB3  1  
ATOM   661   H  HG   . SER B 2 3   ? 7.885   23.733  -15.751 1.00 0.00 ? 103 SER B HG   1  
ATOM   662   N  N    . GLY B 2 4   ? 8.241   26.045  -11.713 1.00 0.00 ? 104 GLY B N    1  
ATOM   663   C  CA   . GLY B 2 4   ? 7.889   26.728  -10.483 1.00 0.00 ? 104 GLY B CA   1  
ATOM   664   C  C    . GLY B 2 4   ? 6.392   26.919  -10.333 1.00 0.00 ? 104 GLY B C    1  
ATOM   665   O  O    . GLY B 2 4   ? 5.942   27.880  -9.711  1.00 0.00 ? 104 GLY B O    1  
ATOM   666   H  H    . GLY B 2 4   ? 8.420   25.081  -11.703 1.00 0.00 ? 104 GLY B H    1  
ATOM   667   H  HA2  . GLY B 2 4   ? 8.252   26.150  -9.646  1.00 0.00 ? 104 GLY B HA2  1  
ATOM   668   H  HA3  . GLY B 2 4   ? 8.367   27.696  -10.472 1.00 0.00 ? 104 GLY B HA3  1  
ATOM   669   N  N    . ALA B 2 5   ? 5.621   26.000  -10.907 1.00 0.00 ? 105 ALA B N    1  
ATOM   670   C  CA   . ALA B 2 5   ? 4.166   26.072  -10.835 1.00 0.00 ? 105 ALA B CA   1  
ATOM   671   C  C    . ALA B 2 5   ? 3.618   25.093  -9.801  1.00 0.00 ? 105 ALA B C    1  
ATOM   672   O  O    . ALA B 2 5   ? 2.573   25.335  -9.198  1.00 0.00 ? 105 ALA B O    1  
ATOM   673   C  CB   . ALA B 2 5   ? 3.557   25.795  -12.201 1.00 0.00 ? 105 ALA B CB   1  
ATOM   674   H  H    . ALA B 2 5   ? 6.039   25.257  -11.390 1.00 0.00 ? 105 ALA B H    1  
ATOM   675   H  HA   . ALA B 2 5   ? 3.897   27.077  -10.544 1.00 0.00 ? 105 ALA B HA   1  
ATOM   676   H  HB1  . ALA B 2 5   ? 3.458   26.722  -12.745 1.00 0.00 ? 105 ALA B HB1  1  
ATOM   677   H  HB2  . ALA B 2 5   ? 2.583   25.345  -12.076 1.00 0.00 ? 105 ALA B HB2  1  
ATOM   678   H  HB3  . ALA B 2 5   ? 4.197   25.121  -12.751 1.00 0.00 ? 105 ALA B HB3  1  
ATOM   679   N  N    . HIS B 2 6   ? 4.329   23.988  -9.603  1.00 0.00 ? 106 HIS B N    1  
ATOM   680   C  CA   . HIS B 2 6   ? 3.912   22.973  -8.643  1.00 0.00 ? 106 HIS B CA   1  
ATOM   681   C  C    . HIS B 2 6   ? 2.565   22.372  -9.037  1.00 0.00 ? 106 HIS B C    1  
ATOM   682   O  O    . HIS B 2 6   ? 1.571   22.528  -8.328  1.00 0.00 ? 106 HIS B O    1  
ATOM   683   C  CB   . HIS B 2 6   ? 3.827   23.572  -7.237  1.00 0.00 ? 106 HIS B CB   1  
ATOM   684   C  CG   . HIS B 2 6   ? 4.128   22.589  -6.149  1.00 0.00 ? 106 HIS B CG   1  
ATOM   685   N  ND1  . HIS B 2 6   ? 3.414   22.531  -4.970  1.00 0.00 ? 106 HIS B ND1  1  
ATOM   686   C  CD2  . HIS B 2 6   ? 5.070   21.621  -6.064  1.00 0.00 ? 106 HIS B CD2  1  
ATOM   687   C  CE1  . HIS B 2 6   ? 3.906   21.569  -4.207  1.00 0.00 ? 106 HIS B CE1  1  
ATOM   688   N  NE2  . HIS B 2 6   ? 4.911   21.003  -4.849  1.00 0.00 ? 106 HIS B NE2  1  
ATOM   689   H  H    . HIS B 2 6   ? 5.153   23.851  -10.115 1.00 0.00 ? 106 HIS B H    1  
ATOM   690   H  HA   . HIS B 2 6   ? 4.656   22.190  -8.646  1.00 0.00 ? 106 HIS B HA   1  
ATOM   691   H  HB2  . HIS B 2 6   ? 4.535   24.383  -7.156  1.00 0.00 ? 106 HIS B HB2  1  
ATOM   692   H  HB3  . HIS B 2 6   ? 2.830   23.954  -7.076  1.00 0.00 ? 106 HIS B HB3  1  
ATOM   693   H  HD1  . HIS B 2 6   ? 2.660   23.107  -4.727  1.00 0.00 ? 106 HIS B HD1  1  
ATOM   694   H  HD2  . HIS B 2 6   ? 5.811   21.380  -6.815  1.00 0.00 ? 106 HIS B HD2  1  
ATOM   695   H  HE1  . HIS B 2 6   ? 3.546   21.294  -3.227  1.00 0.00 ? 106 HIS B HE1  1  
ATOM   696   H  HE2  . HIS B 2 6   ? 5.404   20.214  -4.543  1.00 0.00 ? 106 HIS B HE2  1  
ATOM   697   N  N    . THR B 2 7   ? 2.543   21.685  -10.175 1.00 0.00 ? 107 THR B N    1  
ATOM   698   C  CA   . THR B 2 7   ? 1.320   21.060  -10.666 1.00 0.00 ? 107 THR B CA   1  
ATOM   699   C  C    . THR B 2 7   ? 0.912   19.890  -9.778  1.00 0.00 ? 107 THR B C    1  
ATOM   700   O  O    . THR B 2 7   ? 1.678   19.449  -8.922  1.00 0.00 ? 107 THR B O    1  
ATOM   701   C  CB   . THR B 2 7   ? 1.513   20.581  -12.106 1.00 0.00 ? 107 THR B CB   1  
ATOM   702   O  OG1  . THR B 2 7   ? 2.827   20.088  -12.299 1.00 0.00 ? 107 THR B OG1  1  
ATOM   703   C  CG2  . THR B 2 7   ? 1.272   21.664  -13.135 1.00 0.00 ? 107 THR B CG2  1  
ATOM   704   H  H    . THR B 2 7   ? 3.368   21.596  -10.696 1.00 0.00 ? 107 THR B H    1  
ATOM   705   H  HA   . THR B 2 7   ? 0.538   21.803  -10.646 1.00 0.00 ? 107 THR B HA   1  
ATOM   706   H  HB   . THR B 2 7   ? 0.817   19.777  -12.302 1.00 0.00 ? 107 THR B HB   1  
ATOM   707   H  HG1  . THR B 2 7   ? 2.793   19.146  -12.476 1.00 0.00 ? 107 THR B HG1  1  
ATOM   708   H  HG21 . THR B 2 7   ? 0.515   21.337  -13.831 1.00 0.00 ? 107 THR B HG21 1  
ATOM   709   H  HG22 . THR B 2 7   ? 2.191   21.864  -13.668 1.00 0.00 ? 107 THR B HG22 1  
ATOM   710   H  HG23 . THR B 2 7   ? 0.940   22.564  -12.639 1.00 0.00 ? 107 THR B HG23 1  
ATOM   711   N  N    . ALA B 2 8   ? -0.303  19.389  -9.990  1.00 0.00 ? 108 ALA B N    1  
ATOM   712   C  CA   . ALA B 2 8   ? -0.816  18.269  -9.212  1.00 0.00 ? 108 ALA B CA   1  
ATOM   713   C  C    . ALA B 2 8   ? -2.228  17.898  -9.652  1.00 0.00 ? 108 ALA B C    1  
ATOM   714   O  O    . ALA B 2 8   ? -3.186  18.617  -9.370  1.00 0.00 ? 108 ALA B O    1  
ATOM   715   C  CB   . ALA B 2 8   ? -0.796  18.600  -7.727  1.00 0.00 ? 108 ALA B CB   1  
ATOM   716   H  H    . ALA B 2 8   ? -0.865  19.781  -10.686 1.00 0.00 ? 108 ALA B H    1  
ATOM   717   H  HA   . ALA B 2 8   ? -0.165  17.425  -9.378  1.00 0.00 ? 108 ALA B HA   1  
ATOM   718   H  HB1  . ALA B 2 8   ? -1.272  19.555  -7.563  1.00 0.00 ? 108 ALA B HB1  1  
ATOM   719   H  HB2  . ALA B 2 8   ? 0.227   18.645  -7.382  1.00 0.00 ? 108 ALA B HB2  1  
ATOM   720   H  HB3  . ALA B 2 8   ? -1.326  17.835  -7.179  1.00 0.00 ? 108 ALA B HB3  1  
ATOM   721   N  N    . ASP B 2 9   ? -2.350  16.770  -10.346 1.00 0.00 ? 109 ASP B N    1  
ATOM   722   C  CA   . ASP B 2 9   ? -3.645  16.303  -10.827 1.00 0.00 ? 109 ASP B CA   1  
ATOM   723   C  C    . ASP B 2 9   ? -3.980  14.931  -10.243 1.00 0.00 ? 109 ASP B C    1  
ATOM   724   O  O    . ASP B 2 9   ? -3.274  13.955  -10.495 1.00 0.00 ? 109 ASP B O    1  
ATOM   725   C  CB   . ASP B 2 9   ? -3.648  16.232  -12.354 1.00 0.00 ? 109 ASP B CB   1  
ATOM   726   C  CG   . ASP B 2 9   ? -5.051  16.207  -12.930 1.00 0.00 ? 109 ASP B CG   1  
ATOM   727   O  OD1  . ASP B 2 9   ? -5.915  16.948  -12.417 1.00 0.00 ? 109 ASP B OD1  1  
ATOM   728   O  OD2  . ASP B 2 9   ? -5.284  15.447  -13.893 1.00 0.00 ? 109 ASP B OD2  1  
ATOM   729   H  H    . ASP B 2 9   ? -1.549  16.240  -10.539 1.00 0.00 ? 109 ASP B H    1  
ATOM   730   H  HA   . ASP B 2 9   ? -4.391  17.014  -10.508 1.00 0.00 ? 109 ASP B HA   1  
ATOM   731   H  HB2  . ASP B 2 9   ? -3.133  17.094  -12.751 1.00 0.00 ? 109 ASP B HB2  1  
ATOM   732   H  HB3  . ASP B 2 9   ? -3.133  15.335  -12.668 1.00 0.00 ? 109 ASP B HB3  1  
ATOM   733   N  N    . PRO B 2 10  ? -5.065  14.835  -9.452  1.00 0.00 ? 110 PRO B N    1  
ATOM   734   C  CA   . PRO B 2 10  ? -5.481  13.570  -8.839  1.00 0.00 ? 110 PRO B CA   1  
ATOM   735   C  C    . PRO B 2 10  ? -6.028  12.582  -9.864  1.00 0.00 ? 110 PRO B C    1  
ATOM   736   O  O    . PRO B 2 10  ? -5.975  11.368  -9.662  1.00 0.00 ? 110 PRO B O    1  
ATOM   737   C  CB   . PRO B 2 10  ? -6.581  13.990  -7.863  1.00 0.00 ? 110 PRO B CB   1  
ATOM   738   C  CG   . PRO B 2 10  ? -7.128  15.254  -8.430  1.00 0.00 ? 110 PRO B CG   1  
ATOM   739   C  CD   . PRO B 2 10  ? -5.970  15.945  -9.095  1.00 0.00 ? 110 PRO B CD   1  
ATOM   740   H  HA   . PRO B 2 10  ? -4.670  13.108  -8.294  1.00 0.00 ? 110 PRO B HA   1  
ATOM   741   H  HB2  . PRO B 2 10  ? -7.336  13.220  -7.813  1.00 0.00 ? 110 PRO B HB2  1  
ATOM   742   H  HB3  . PRO B 2 10  ? -6.156  14.151  -6.884  1.00 0.00 ? 110 PRO B HB3  1  
ATOM   743   H  HG2  . PRO B 2 10  ? -7.896  15.028  -9.156  1.00 0.00 ? 110 PRO B HG2  1  
ATOM   744   H  HG3  . PRO B 2 10  ? -7.528  15.870  -7.639  1.00 0.00 ? 110 PRO B HG3  1  
ATOM   745   H  HD2  . PRO B 2 10  ? -6.301  16.472  -9.977  1.00 0.00 ? 110 PRO B HD2  1  
ATOM   746   H  HD3  . PRO B 2 10  ? -5.491  16.625  -8.406  1.00 0.00 ? 110 PRO B HD3  1  
ATOM   747   N  N    . GLU B 2 11  ? -6.556  13.109  -10.966 1.00 0.00 ? 111 GLU B N    1  
ATOM   748   C  CA   . GLU B 2 11  ? -7.115  12.278  -12.021 1.00 0.00 ? 111 GLU B CA   1  
ATOM   749   C  C    . GLU B 2 11  ? -6.089  11.281  -12.549 1.00 0.00 ? 111 GLU B C    1  
ATOM   750   O  O    . GLU B 2 11  ? -6.444  10.262  -13.141 1.00 0.00 ? 111 GLU B O    1  
ATOM   751   C  CB   . GLU B 2 11  ? -7.637  13.149  -13.164 1.00 0.00 ? 111 GLU B CB   1  
ATOM   752   C  CG   . GLU B 2 11  ? -8.716  14.130  -12.738 1.00 0.00 ? 111 GLU B CG   1  
ATOM   753   C  CD   . GLU B 2 11  ? -8.880  15.278  -13.715 1.00 0.00 ? 111 GLU B CD   1  
ATOM   754   O  OE1  . GLU B 2 11  ? -7.853  15.817  -14.177 1.00 0.00 ? 111 GLU B OE1  1  
ATOM   755   O  OE2  . GLU B 2 11  ? -10.037 15.637  -14.019 1.00 0.00 ? 111 GLU B OE2  1  
ATOM   756   H  H    . GLU B 2 11  ? -6.575  14.079  -11.069 1.00 0.00 ? 111 GLU B H    1  
ATOM   757   H  HA   . GLU B 2 11  ? -7.933  11.735  -11.597 1.00 0.00 ? 111 GLU B HA   1  
ATOM   758   H  HB2  . GLU B 2 11  ? -6.812  13.711  -13.579 1.00 0.00 ? 111 GLU B HB2  1  
ATOM   759   H  HB3  . GLU B 2 11  ? -8.046  12.509  -13.932 1.00 0.00 ? 111 GLU B HB3  1  
ATOM   760   H  HG2  . GLU B 2 11  ? -9.655  13.603  -12.664 1.00 0.00 ? 111 GLU B HG2  1  
ATOM   761   H  HG3  . GLU B 2 11  ? -8.454  14.535  -11.771 1.00 0.00 ? 111 GLU B HG3  1  
ATOM   762   N  N    . LYS B 2 12  ? -4.818  11.584  -12.329 1.00 0.00 ? 112 LYS B N    1  
ATOM   763   C  CA   . LYS B 2 12  ? -3.734  10.719  -12.780 1.00 0.00 ? 112 LYS B CA   1  
ATOM   764   C  C    . LYS B 2 12  ? -3.420  9.649   -11.740 1.00 0.00 ? 112 LYS B C    1  
ATOM   765   O  O    . LYS B 2 12  ? -2.906  8.582   -12.073 1.00 0.00 ? 112 LYS B O    1  
ATOM   766   C  CB   . LYS B 2 12  ? -2.481  11.545  -13.074 1.00 0.00 ? 112 LYS B CB   1  
ATOM   767   C  CG   . LYS B 2 12  ? -2.736  12.738  -13.980 1.00 0.00 ? 112 LYS B CG   1  
ATOM   768   C  CD   . LYS B 2 12  ? -3.337  12.311  -15.310 1.00 0.00 ? 112 LYS B CD   1  
ATOM   769   C  CE   . LYS B 2 12  ? -2.965  13.276  -16.426 1.00 0.00 ? 112 LYS B CE   1  
ATOM   770   N  NZ   . LYS B 2 12  ? -4.130  14.092  -16.865 1.00 0.00 ? 112 LYS B NZ   1  
ATOM   771   H  H    . LYS B 2 12  ? -4.604  12.409  -11.853 1.00 0.00 ? 112 LYS B H    1  
ATOM   772   H  HA   . LYS B 2 12  ? -4.055  10.231  -13.689 1.00 0.00 ? 112 LYS B HA   1  
ATOM   773   H  HB2  . LYS B 2 12  ? -2.076  11.908  -12.141 1.00 0.00 ? 112 LYS B HB2  1  
ATOM   774   H  HB3  . LYS B 2 12  ? -1.749  10.910  -13.551 1.00 0.00 ? 112 LYS B HB3  1  
ATOM   775   H  HG2  . LYS B 2 12  ? -3.422  13.412  -13.488 1.00 0.00 ? 112 LYS B HG2  1  
ATOM   776   H  HG3  . LYS B 2 12  ? -1.801  13.245  -14.163 1.00 0.00 ? 112 LYS B HG3  1  
ATOM   777   H  HD2  . LYS B 2 12  ? -2.968  11.328  -15.561 1.00 0.00 ? 112 LYS B HD2  1  
ATOM   778   H  HD3  . LYS B 2 12  ? -4.412  12.281  -15.215 1.00 0.00 ? 112 LYS B HD3  1  
ATOM   779   H  HE2  . LYS B 2 12  ? -2.187  13.935  -16.072 1.00 0.00 ? 112 LYS B HE2  1  
ATOM   780   H  HE3  . LYS B 2 12  ? -2.598  12.707  -17.268 1.00 0.00 ? 112 LYS B HE3  1  
ATOM   781   H  HZ1  . LYS B 2 12  ? -4.040  14.330  -17.874 1.00 0.00 ? 112 LYS B HZ1  1  
ATOM   782   H  HZ2  . LYS B 2 12  ? -4.176  14.974  -16.315 1.00 0.00 ? 112 LYS B HZ2  1  
ATOM   783   H  HZ3  . LYS B 2 12  ? -5.013  13.562  -16.722 1.00 0.00 ? 112 LYS B HZ3  1  
ATOM   784   N  N    . ARG B 2 13  ? -3.738  9.936   -10.478 1.00 0.00 ? 113 ARG B N    1  
ATOM   785   C  CA   . ARG B 2 13  ? -3.490  8.989   -9.394  1.00 0.00 ? 113 ARG B CA   1  
ATOM   786   C  C    . ARG B 2 13  ? -4.008  7.603   -9.754  1.00 0.00 ? 113 ARG B C    1  
ATOM   787   O  O    . ARG B 2 13  ? -3.490  6.590   -9.283  1.00 0.00 ? 113 ARG B O    1  
ATOM   788   C  CB   . ARG B 2 13  ? -4.146  9.474   -8.100  1.00 0.00 ? 113 ARG B CB   1  
ATOM   789   C  CG   . ARG B 2 13  ? -3.878  8.570   -6.908  1.00 0.00 ? 113 ARG B CG   1  
ATOM   790   C  CD   . ARG B 2 13  ? -4.417  9.171   -5.621  1.00 0.00 ? 113 ARG B CD   1  
ATOM   791   N  NE   . ARG B 2 13  ? -5.740  8.648   -5.284  1.00 0.00 ? 113 ARG B NE   1  
ATOM   792   C  CZ   . ARG B 2 13  ? -6.308  8.785   -4.088  1.00 0.00 ? 113 ARG B CZ   1  
ATOM   793   N  NH1  . ARG B 2 13  ? -5.675  9.424   -3.113  1.00 0.00 ? 113 ARG B NH1  1  
ATOM   794   N  NH2  . ARG B 2 13  ? -7.514  8.280   -3.867  1.00 0.00 ? 113 ARG B NH2  1  
ATOM   795   H  H    . ARG B 2 13  ? -4.150  10.800  -10.272 1.00 0.00 ? 113 ARG B H    1  
ATOM   796   H  HA   . ARG B 2 13  ? -2.426  8.930   -9.250  1.00 0.00 ? 113 ARG B HA   1  
ATOM   797   H  HB2  . ARG B 2 13  ? -3.772  10.460  -7.868  1.00 0.00 ? 113 ARG B HB2  1  
ATOM   798   H  HB3  . ARG B 2 13  ? -5.214  9.530   -8.250  1.00 0.00 ? 113 ARG B HB3  1  
ATOM   799   H  HG2  . ARG B 2 13  ? -4.357  7.617   -7.076  1.00 0.00 ? 113 ARG B HG2  1  
ATOM   800   H  HG3  . ARG B 2 13  ? -2.812  8.427   -6.809  1.00 0.00 ? 113 ARG B HG3  1  
ATOM   801   H  HD2  . ARG B 2 13  ? -3.735  8.940   -4.816  1.00 0.00 ? 113 ARG B HD2  1  
ATOM   802   H  HD3  . ARG B 2 13  ? -4.484  10.243  -5.740  1.00 0.00 ? 113 ARG B HD3  1  
ATOM   803   H  HE   . ARG B 2 13  ? -6.229  8.170   -5.985  1.00 0.00 ? 113 ARG B HE   1  
ATOM   804   H  HH11 . ARG B 2 13  ? -4.766  9.807   -3.274  1.00 0.00 ? 113 ARG B HH11 1  
ATOM   805   H  HH12 . ARG B 2 13  ? -6.108  9.524   -2.217  1.00 0.00 ? 113 ARG B HH12 1  
ATOM   806   H  HH21 . ARG B 2 13  ? -7.996  7.796   -4.598  1.00 0.00 ? 113 ARG B HH21 1  
ATOM   807   H  HH22 . ARG B 2 13  ? -7.942  8.382   -2.968  1.00 0.00 ? 113 ARG B HH22 1  
ATOM   808   N  N    . LYS B 2 14  ? -5.027  7.570   -10.600 1.00 0.00 ? 114 LYS B N    1  
ATOM   809   C  CA   . LYS B 2 14  ? -5.615  6.312   -11.041 1.00 0.00 ? 114 LYS B CA   1  
ATOM   810   C  C    . LYS B 2 14  ? -4.629  5.545   -11.912 1.00 0.00 ? 114 LYS B C    1  
ATOM   811   O  O    . LYS B 2 14  ? -4.517  4.323   -11.813 1.00 0.00 ? 114 LYS B O    1  
ATOM   812   C  CB   . LYS B 2 14  ? -6.910  6.569   -11.814 1.00 0.00 ? 114 LYS B CB   1  
ATOM   813   C  CG   . LYS B 2 14  ? -7.640  5.299   -12.217 1.00 0.00 ? 114 LYS B CG   1  
ATOM   814   C  CD   . LYS B 2 14  ? -8.046  4.481   -11.003 1.00 0.00 ? 114 LYS B CD   1  
ATOM   815   C  CE   . LYS B 2 14  ? -9.297  3.662   -11.274 1.00 0.00 ? 114 LYS B CE   1  
ATOM   816   N  NZ   . LYS B 2 14  ? -9.370  2.454   -10.408 1.00 0.00 ? 114 LYS B NZ   1  
ATOM   817   H  H    . LYS B 2 14  ? -5.386  8.411   -10.942 1.00 0.00 ? 114 LYS B H    1  
ATOM   818   H  HA   . LYS B 2 14  ? -5.837  5.723   -10.163 1.00 0.00 ? 114 LYS B HA   1  
ATOM   819   H  HB2  . LYS B 2 14  ? -7.572  7.160   -11.198 1.00 0.00 ? 114 LYS B HB2  1  
ATOM   820   H  HB3  . LYS B 2 14  ? -6.676  7.125   -12.711 1.00 0.00 ? 114 LYS B HB3  1  
ATOM   821   H  HG2  . LYS B 2 14  ? -8.528  5.565   -12.772 1.00 0.00 ? 114 LYS B HG2  1  
ATOM   822   H  HG3  . LYS B 2 14  ? -6.988  4.703   -12.841 1.00 0.00 ? 114 LYS B HG3  1  
ATOM   823   H  HD2  . LYS B 2 14  ? -7.238  3.811   -10.745 1.00 0.00 ? 114 LYS B HD2  1  
ATOM   824   H  HD3  . LYS B 2 14  ? -8.237  5.151   -10.176 1.00 0.00 ? 114 LYS B HD3  1  
ATOM   825   H  HE2  . LYS B 2 14  ? -10.163 4.280   -11.090 1.00 0.00 ? 114 LYS B HE2  1  
ATOM   826   H  HE3  . LYS B 2 14  ? -9.290  3.352   -12.310 1.00 0.00 ? 114 LYS B HE3  1  
ATOM   827   H  HZ1  . LYS B 2 14  ? -10.363 2.231   -10.189 1.00 0.00 ? 114 LYS B HZ1  1  
ATOM   828   H  HZ2  . LYS B 2 14  ? -8.861  2.621   -9.517  1.00 0.00 ? 114 LYS B HZ2  1  
ATOM   829   H  HZ3  . LYS B 2 14  ? -8.942  1.640   -10.891 1.00 0.00 ? 114 LYS B HZ3  1  
ATOM   830   N  N    . LEU B 2 15  ? -3.908  6.272   -12.761 1.00 0.00 ? 115 LEU B N    1  
ATOM   831   C  CA   . LEU B 2 15  ? -2.921  5.656   -13.641 1.00 0.00 ? 115 LEU B CA   1  
ATOM   832   C  C    . LEU B 2 15  ? -1.709  5.196   -12.842 1.00 0.00 ? 115 LEU B C    1  
ATOM   833   O  O    . LEU B 2 15  ? -1.040  4.228   -13.205 1.00 0.00 ? 115 LEU B O    1  
ATOM   834   C  CB   . LEU B 2 15  ? -2.490  6.637   -14.734 1.00 0.00 ? 115 LEU B CB   1  
ATOM   835   C  CG   . LEU B 2 15  ? -3.495  6.821   -15.873 1.00 0.00 ? 115 LEU B CG   1  
ATOM   836   C  CD1  . LEU B 2 15  ? -2.944  7.774   -16.922 1.00 0.00 ? 115 LEU B CD1  1  
ATOM   837   C  CD2  . LEU B 2 15  ? -3.843  5.480   -16.499 1.00 0.00 ? 115 LEU B CD2  1  
ATOM   838   H  H    . LEU B 2 15  ? -4.035  7.245   -12.790 1.00 0.00 ? 115 LEU B H    1  
ATOM   839   H  HA   . LEU B 2 15  ? -3.379  4.796   -14.096 1.00 0.00 ? 115 LEU B HA   1  
ATOM   840   H  HB2  . LEU B 2 15  ? -2.316  7.599   -14.275 1.00 0.00 ? 115 LEU B HB2  1  
ATOM   841   H  HB3  . LEU B 2 15  ? -1.562  6.285   -15.157 1.00 0.00 ? 115 LEU B HB3  1  
ATOM   842   H  HG   . LEU B 2 15  ? -4.403  7.251   -15.475 1.00 0.00 ? 115 LEU B HG   1  
ATOM   843   H  HD11 . LEU B 2 15  ? -1.904  7.545   -17.104 1.00 0.00 ? 115 LEU B HD11 1  
ATOM   844   H  HD12 . LEU B 2 15  ? -3.032  8.791   -16.567 1.00 0.00 ? 115 LEU B HD12 1  
ATOM   845   H  HD13 . LEU B 2 15  ? -3.503  7.663   -17.838 1.00 0.00 ? 115 LEU B HD13 1  
ATOM   846   H  HD21 . LEU B 2 15  ? -4.332  5.640   -17.447 1.00 0.00 ? 115 LEU B HD21 1  
ATOM   847   H  HD22 . LEU B 2 15  ? -4.503  4.935   -15.841 1.00 0.00 ? 115 LEU B HD22 1  
ATOM   848   H  HD23 . LEU B 2 15  ? -2.938  4.908   -16.653 1.00 0.00 ? 115 LEU B HD23 1  
ATOM   849   N  N    . ILE B 2 16  ? -1.445  5.892   -11.745 1.00 0.00 ? 116 ILE B N    1  
ATOM   850   C  CA   . ILE B 2 16  ? -0.323  5.554   -10.877 1.00 0.00 ? 116 ILE B CA   1  
ATOM   851   C  C    . ILE B 2 16  ? -0.608  4.264   -10.121 1.00 0.00 ? 116 ILE B C    1  
ATOM   852   O  O    . ILE B 2 16  ? 0.300   3.486   -9.831  1.00 0.00 ? 116 ILE B O    1  
ATOM   853   C  CB   . ILE B 2 16  ? -0.032  6.676   -9.858  1.00 0.00 ? 116 ILE B CB   1  
ATOM   854   C  CG1  . ILE B 2 16  ? -0.089  8.050   -10.530 1.00 0.00 ? 116 ILE B CG1  1  
ATOM   855   C  CG2  . ILE B 2 16  ? 1.325   6.456   -9.206  1.00 0.00 ? 116 ILE B CG2  1  
ATOM   856   C  CD1  . ILE B 2 16  ? 0.804   8.169   -11.746 1.00 0.00 ? 116 ILE B CD1  1  
ATOM   857   H  H    . ILE B 2 16  ? -2.024  6.643   -11.509 1.00 0.00 ? 116 ILE B H    1  
ATOM   858   H  HA   . ILE B 2 16  ? 0.552   5.417   -11.495 1.00 0.00 ? 116 ILE B HA   1  
ATOM   859   H  HB   . ILE B 2 16  ? -0.785  6.630   -9.084  1.00 0.00 ? 116 ILE B HB   1  
ATOM   860   H  HG12 . ILE B 2 16  ? -1.102  8.249   -10.843 1.00 0.00 ? 116 ILE B HG12 1  
ATOM   861   H  HG13 . ILE B 2 16  ? 0.217   8.804   -9.819  1.00 0.00 ? 116 ILE B HG13 1  
ATOM   862   H  HG21 . ILE B 2 16  ? 1.266   5.619   -8.526  1.00 0.00 ? 116 ILE B HG21 1  
ATOM   863   H  HG22 . ILE B 2 16  ? 1.611   7.343   -8.661  1.00 0.00 ? 116 ILE B HG22 1  
ATOM   864   H  HG23 . ILE B 2 16  ? 2.062   6.250   -9.969  1.00 0.00 ? 116 ILE B HG23 1  
ATOM   865   H  HD11 . ILE B 2 16  ? 1.524   7.364   -11.744 1.00 0.00 ? 116 ILE B HD11 1  
ATOM   866   H  HD12 . ILE B 2 16  ? 1.323   9.116   -11.719 1.00 0.00 ? 116 ILE B HD12 1  
ATOM   867   H  HD13 . ILE B 2 16  ? 0.203   8.112   -12.641 1.00 0.00 ? 116 ILE B HD13 1  
ATOM   868   N  N    . GLN B 2 17  ? -1.881  4.045   -9.809  1.00 0.00 ? 117 GLN B N    1  
ATOM   869   C  CA   . GLN B 2 17  ? -2.299  2.849   -9.089  1.00 0.00 ? 117 GLN B CA   1  
ATOM   870   C  C    . GLN B 2 17  ? -2.184  1.616   -9.978  1.00 0.00 ? 117 GLN B C    1  
ATOM   871   O  O    . GLN B 2 17  ? -1.652  0.588   -9.560  1.00 0.00 ? 117 GLN B O    1  
ATOM   872   C  CB   . GLN B 2 17  ? -3.739  3.008   -8.590  1.00 0.00 ? 117 GLN B CB   1  
ATOM   873   C  CG   . GLN B 2 17  ? -3.871  2.908   -7.079  1.00 0.00 ? 117 GLN B CG   1  
ATOM   874   C  CD   . GLN B 2 17  ? -4.632  4.076   -6.481  1.00 0.00 ? 117 GLN B CD   1  
ATOM   875   O  OE1  . GLN B 2 17  ? -5.858  4.046   -6.377  1.00 0.00 ? 117 GLN B OE1  1  
ATOM   876   N  NE2  . GLN B 2 17  ? -3.905  5.115   -6.086  1.00 0.00 ? 117 GLN B NE2  1  
ATOM   877   H  H    . GLN B 2 17  ? -2.558  4.704   -10.071 1.00 0.00 ? 117 GLN B H    1  
ATOM   878   H  HA   . GLN B 2 17  ? -1.644  2.729   -8.239  1.00 0.00 ? 117 GLN B HA   1  
ATOM   879   H  HB2  . GLN B 2 17  ? -4.109  3.974   -8.901  1.00 0.00 ? 117 GLN B HB2  1  
ATOM   880   H  HB3  . GLN B 2 17  ? -4.350  2.238   -9.035  1.00 0.00 ? 117 GLN B HB3  1  
ATOM   881   H  HG2  . GLN B 2 17  ? -4.397  1.997   -6.837  1.00 0.00 ? 117 GLN B HG2  1  
ATOM   882   H  HG3  . GLN B 2 17  ? -2.883  2.881   -6.645  1.00 0.00 ? 117 GLN B HG3  1  
ATOM   883   H  HE21 . GLN B 2 17  ? -2.932  5.070   -6.200  1.00 0.00 ? 117 GLN B HE21 1  
ATOM   884   H  HE22 . GLN B 2 17  ? -4.370  5.884   -5.695  1.00 0.00 ? 117 GLN B HE22 1  
ATOM   885   N  N    . GLN B 2 18  ? -2.683  1.724   -11.206 1.00 0.00 ? 118 GLN B N    1  
ATOM   886   C  CA   . GLN B 2 18  ? -2.630  0.613   -12.149 1.00 0.00 ? 118 GLN B CA   1  
ATOM   887   C  C    . GLN B 2 18  ? -1.197  0.174   -12.386 1.00 0.00 ? 118 GLN B C    1  
ATOM   888   O  O    . GLN B 2 18  ? -0.897  -1.017  -12.420 1.00 0.00 ? 118 GLN B O    1  
ATOM   889   C  CB   . GLN B 2 18  ? -3.294  1.000   -13.473 1.00 0.00 ? 118 GLN B CB   1  
ATOM   890   C  CG   . GLN B 2 18  ? -4.544  0.192   -13.785 1.00 0.00 ? 118 GLN B CG   1  
ATOM   891   C  CD   . GLN B 2 18  ? -4.363  -0.725  -14.981 1.00 0.00 ? 118 GLN B CD   1  
ATOM   892   O  OE1  . GLN B 2 18  ? -3.731  -1.777  -14.880 1.00 0.00 ? 118 GLN B OE1  1  
ATOM   893   N  NE2  . GLN B 2 18  ? -4.919  -0.329  -16.120 1.00 0.00 ? 118 GLN B NE2  1  
ATOM   894   H  H    . GLN B 2 18  ? -3.093  2.571   -11.485 1.00 0.00 ? 118 GLN B H    1  
ATOM   895   H  HA   . GLN B 2 18  ? -3.163  -0.210  -11.716 1.00 0.00 ? 118 GLN B HA   1  
ATOM   896   H  HB2  . GLN B 2 18  ? -3.568  2.044   -13.432 1.00 0.00 ? 118 GLN B HB2  1  
ATOM   897   H  HB3  . GLN B 2 18  ? -2.587  0.855   -14.277 1.00 0.00 ? 118 GLN B HB3  1  
ATOM   898   H  HG2  . GLN B 2 18  ? -4.791  -0.411  -12.924 1.00 0.00 ? 118 GLN B HG2  1  
ATOM   899   H  HG3  . GLN B 2 18  ? -5.356  0.873   -13.992 1.00 0.00 ? 118 GLN B HG3  1  
ATOM   900   H  HE21 . GLN B 2 18  ? -5.407  0.521   -16.125 1.00 0.00 ? 118 GLN B HE21 1  
ATOM   901   H  HE22 . GLN B 2 18  ? -4.818  -0.902  -16.908 1.00 0.00 ? 118 GLN B HE22 1  
ATOM   902   N  N    . GLN B 2 19  ? -0.315  1.145   -12.535 1.00 0.00 ? 119 GLN B N    1  
ATOM   903   C  CA   . GLN B 2 19  ? 1.096   0.860   -12.755 1.00 0.00 ? 119 GLN B CA   1  
ATOM   904   C  C    . GLN B 2 19  ? 1.700   0.220   -11.516 1.00 0.00 ? 119 GLN B C    1  
ATOM   905   O  O    . GLN B 2 19  ? 2.604   -0.611  -11.607 1.00 0.00 ? 119 GLN B O    1  
ATOM   906   C  CB   . GLN B 2 19  ? 1.856   2.137   -13.120 1.00 0.00 ? 119 GLN B CB   1  
ATOM   907   C  CG   . GLN B 2 19  ? 1.304   2.843   -14.347 1.00 0.00 ? 119 GLN B CG   1  
ATOM   908   C  CD   . GLN B 2 19  ? 2.044   2.470   -15.618 1.00 0.00 ? 119 GLN B CD   1  
ATOM   909   O  OE1  . GLN B 2 19  ? 3.270   2.366   -15.628 1.00 0.00 ? 119 GLN B OE1  1  
ATOM   910   N  NE2  . GLN B 2 19  ? 1.300   2.266   -16.698 1.00 0.00 ? 119 GLN B NE2  1  
ATOM   911   H  H    . GLN B 2 19  ? -0.621  2.072   -12.486 1.00 0.00 ? 119 GLN B H    1  
ATOM   912   H  HA   . GLN B 2 19  ? 1.164   0.160   -13.568 1.00 0.00 ? 119 GLN B HA   1  
ATOM   913   H  HB2  . GLN B 2 19  ? 1.809   2.821   -12.285 1.00 0.00 ? 119 GLN B HB2  1  
ATOM   914   H  HB3  . GLN B 2 19  ? 2.889   1.885   -13.310 1.00 0.00 ? 119 GLN B HB3  1  
ATOM   915   H  HG2  . GLN B 2 19  ? 0.264   2.577   -14.464 1.00 0.00 ? 119 GLN B HG2  1  
ATOM   916   H  HG3  . GLN B 2 19  ? 1.386   3.910   -14.201 1.00 0.00 ? 119 GLN B HG3  1  
ATOM   917   H  HE21 . GLN B 2 19  ? 0.328   2.367   -16.617 1.00 0.00 ? 119 GLN B HE21 1  
ATOM   918   H  HE22 . GLN B 2 19  ? 1.752   2.023   -17.533 1.00 0.00 ? 119 GLN B HE22 1  
ATOM   919   N  N    . LEU B 2 20  ? 1.173   0.597   -10.362 1.00 0.00 ? 120 LEU B N    1  
ATOM   920   C  CA   . LEU B 2 20  ? 1.633   0.047   -9.097  1.00 0.00 ? 120 LEU B CA   1  
ATOM   921   C  C    . LEU B 2 20  ? 1.023   -1.334  -8.883  1.00 0.00 ? 120 LEU B C    1  
ATOM   922   O  O    . LEU B 2 20  ? 1.624   -2.202  -8.253  1.00 0.00 ? 120 LEU B O    1  
ATOM   923   C  CB   . LEU B 2 20  ? 1.258   0.975   -7.940  1.00 0.00 ? 120 LEU B CB   1  
ATOM   924   C  CG   . LEU B 2 20  ? 2.336   1.140   -6.866  1.00 0.00 ? 120 LEU B CG   1  
ATOM   925   C  CD1  . LEU B 2 20  ? 2.193   2.482   -6.168  1.00 0.00 ? 120 LEU B CD1  1  
ATOM   926   C  CD2  . LEU B 2 20  ? 2.263   0.001   -5.861  1.00 0.00 ? 120 LEU B CD2  1  
ATOM   927   H  H    . LEU B 2 20  ? 0.444   1.248   -10.365 1.00 0.00 ? 120 LEU B H    1  
ATOM   928   H  HA   . LEU B 2 20  ? 2.708   -0.048  -9.143  1.00 0.00 ? 120 LEU B HA   1  
ATOM   929   H  HB2  . LEU B 2 20  ? 1.034   1.950   -8.348  1.00 0.00 ? 120 LEU B HB2  1  
ATOM   930   H  HB3  . LEU B 2 20  ? 0.368   0.588   -7.468  1.00 0.00 ? 120 LEU B HB3  1  
ATOM   931   H  HG   . LEU B 2 20  ? 3.309   1.110   -7.335  1.00 0.00 ? 120 LEU B HG   1  
ATOM   932   H  HD11 . LEU B 2 20  ? 1.328   2.460   -5.521  1.00 0.00 ? 120 LEU B HD11 1  
ATOM   933   H  HD12 . LEU B 2 20  ? 2.069   3.261   -6.906  1.00 0.00 ? 120 LEU B HD12 1  
ATOM   934   H  HD13 . LEU B 2 20  ? 3.078   2.679   -5.581  1.00 0.00 ? 120 LEU B HD13 1  
ATOM   935   H  HD21 . LEU B 2 20  ? 1.355   0.091   -5.282  1.00 0.00 ? 120 LEU B HD21 1  
ATOM   936   H  HD22 . LEU B 2 20  ? 3.115   0.049   -5.200  1.00 0.00 ? 120 LEU B HD22 1  
ATOM   937   H  HD23 . LEU B 2 20  ? 2.265   -0.944  -6.384  1.00 0.00 ? 120 LEU B HD23 1  
ATOM   938   N  N    . VAL B 2 21  ? -0.175  -1.528  -9.431  1.00 0.00 ? 121 VAL B N    1  
ATOM   939   C  CA   . VAL B 2 21  ? -0.870  -2.801  -9.321  1.00 0.00 ? 121 VAL B CA   1  
ATOM   940   C  C    . VAL B 2 21  ? -0.341  -3.789  -10.352 1.00 0.00 ? 121 VAL B C    1  
ATOM   941   O  O    . VAL B 2 21  ? -0.141  -4.964  -10.046 1.00 0.00 ? 121 VAL B O    1  
ATOM   942   C  CB   . VAL B 2 21  ? -2.392  -2.636  -9.508  1.00 0.00 ? 121 VAL B CB   1  
ATOM   943   C  CG1  . VAL B 2 21  ? -3.106  -3.966  -9.312  1.00 0.00 ? 121 VAL B CG1  1  
ATOM   944   C  CG2  . VAL B 2 21  ? -2.938  -1.586  -8.552  1.00 0.00 ? 121 VAL B CG2  1  
ATOM   945   H  H    . VAL B 2 21  ? -0.597  -0.797  -9.930  1.00 0.00 ? 121 VAL B H    1  
ATOM   946   H  HA   . VAL B 2 21  ? -0.688  -3.200  -8.331  1.00 0.00 ? 121 VAL B HA   1  
ATOM   947   H  HB   . VAL B 2 21  ? -2.575  -2.301  -10.518 1.00 0.00 ? 121 VAL B HB   1  
ATOM   948   H  HG11 . VAL B 2 21  ? -2.668  -4.490  -8.476  1.00 0.00 ? 121 VAL B HG11 1  
ATOM   949   H  HG12 . VAL B 2 21  ? -3.003  -4.565  -10.206 1.00 0.00 ? 121 VAL B HG12 1  
ATOM   950   H  HG13 . VAL B 2 21  ? -4.152  -3.787  -9.118  1.00 0.00 ? 121 VAL B HG13 1  
ATOM   951   H  HG21 . VAL B 2 21  ? -3.524  -2.067  -7.782  1.00 0.00 ? 121 VAL B HG21 1  
ATOM   952   H  HG22 . VAL B 2 21  ? -3.562  -0.893  -9.097  1.00 0.00 ? 121 VAL B HG22 1  
ATOM   953   H  HG23 . VAL B 2 21  ? -2.119  -1.049  -8.098  1.00 0.00 ? 121 VAL B HG23 1  
ATOM   954   N  N    . LEU B 2 22  ? -0.099  -3.312  -11.575 1.00 0.00 ? 122 LEU B N    1  
ATOM   955   C  CA   . LEU B 2 22  ? 0.420   -4.167  -12.615 1.00 0.00 ? 122 LEU B CA   1  
ATOM   956   C  C    . LEU B 2 22  ? 1.835   -4.602  -12.251 1.00 0.00 ? 122 LEU B C    1  
ATOM   957   O  O    . LEU B 2 22  ? 2.216   -5.752  -12.462 1.00 0.00 ? 122 LEU B O    1  
ATOM   958   C  CB   . LEU B 2 22  ? 0.382   -3.429  -13.953 1.00 0.00 ? 122 LEU B CB   1  
ATOM   959   C  CG   . LEU B 2 22  ? 1.704   -3.365  -14.711 1.00 0.00 ? 122 LEU B CG   1  
ATOM   960   C  CD1  . LEU B 2 22  ? 2.165   -4.760  -15.116 1.00 0.00 ? 122 LEU B CD1  1  
ATOM   961   C  CD2  . LEU B 2 22  ? 1.579   -2.470  -15.931 1.00 0.00 ? 122 LEU B CD2  1  
ATOM   962   H  H    . LEU B 2 22  ? -0.258  -2.365  -11.780 1.00 0.00 ? 122 LEU B H    1  
ATOM   963   H  HA   . LEU B 2 22  ? -0.210  -5.042  -12.673 1.00 0.00 ? 122 LEU B HA   1  
ATOM   964   H  HB2  . LEU B 2 22  ? -0.348  -3.908  -14.579 1.00 0.00 ? 122 LEU B HB2  1  
ATOM   965   H  HB3  . LEU B 2 22  ? 0.055   -2.417  -13.768 1.00 0.00 ? 122 LEU B HB3  1  
ATOM   966   H  HG   . LEU B 2 22  ? 2.449   -2.939  -14.054 1.00 0.00 ? 122 LEU B HG   1  
ATOM   967   H  HD11 . LEU B 2 22  ? 2.951   -5.086  -14.452 1.00 0.00 ? 122 LEU B HD11 1  
ATOM   968   H  HD12 . LEU B 2 22  ? 2.537   -4.736  -16.130 1.00 0.00 ? 122 LEU B HD12 1  
ATOM   969   H  HD13 . LEU B 2 22  ? 1.333   -5.446  -15.055 1.00 0.00 ? 122 LEU B HD13 1  
ATOM   970   H  HD21 . LEU B 2 22  ? 0.535   -2.341  -16.177 1.00 0.00 ? 122 LEU B HD21 1  
ATOM   971   H  HD22 . LEU B 2 22  ? 2.091   -2.925  -16.766 1.00 0.00 ? 122 LEU B HD22 1  
ATOM   972   H  HD23 . LEU B 2 22  ? 2.020   -1.508  -15.718 1.00 0.00 ? 122 LEU B HD23 1  
ATOM   973   N  N    . LEU B 2 23  ? 2.602   -3.681  -11.673 1.00 0.00 ? 123 LEU B N    1  
ATOM   974   C  CA   . LEU B 2 23  ? 3.958   -3.991  -11.251 1.00 0.00 ? 123 LEU B CA   1  
ATOM   975   C  C    . LEU B 2 23  ? 3.891   -5.017  -10.136 1.00 0.00 ? 123 LEU B C    1  
ATOM   976   O  O    . LEU B 2 23  ? 4.655   -5.982  -10.107 1.00 0.00 ? 123 LEU B O    1  
ATOM   977   C  CB   . LEU B 2 23  ? 4.684   -2.730  -10.775 1.00 0.00 ? 123 LEU B CB   1  
ATOM   978   C  CG   . LEU B 2 23  ? 5.598   -2.076  -11.812 1.00 0.00 ? 123 LEU B CG   1  
ATOM   979   C  CD1  . LEU B 2 23  ? 5.808   -0.606  -11.484 1.00 0.00 ? 123 LEU B CD1  1  
ATOM   980   C  CD2  . LEU B 2 23  ? 6.931   -2.805  -11.881 1.00 0.00 ? 123 LEU B CD2  1  
ATOM   981   H  H    . LEU B 2 23  ? 2.240   -2.786  -11.506 1.00 0.00 ? 123 LEU B H    1  
ATOM   982   H  HA   . LEU B 2 23  ? 4.481   -4.417  -12.093 1.00 0.00 ? 123 LEU B HA   1  
ATOM   983   H  HB2  . LEU B 2 23  ? 3.943   -2.006  -10.470 1.00 0.00 ? 123 LEU B HB2  1  
ATOM   984   H  HB3  . LEU B 2 23  ? 5.284   -2.988  -9.914  1.00 0.00 ? 123 LEU B HB3  1  
ATOM   985   H  HG   . LEU B 2 23  ? 5.131   -2.138  -12.784 1.00 0.00 ? 123 LEU B HG   1  
ATOM   986   H  HD11 . LEU B 2 23  ? 5.935   -0.046  -12.400 1.00 0.00 ? 123 LEU B HD11 1  
ATOM   987   H  HD12 . LEU B 2 23  ? 6.690   -0.496  -10.871 1.00 0.00 ? 123 LEU B HD12 1  
ATOM   988   H  HD13 . LEU B 2 23  ? 4.949   -0.229  -10.949 1.00 0.00 ? 123 LEU B HD13 1  
ATOM   989   H  HD21 . LEU B 2 23  ? 7.611   -2.380  -11.158 1.00 0.00 ? 123 LEU B HD21 1  
ATOM   990   H  HD22 . LEU B 2 23  ? 7.348   -2.701  -12.872 1.00 0.00 ? 123 LEU B HD22 1  
ATOM   991   H  HD23 . LEU B 2 23  ? 6.781   -3.852  -11.662 1.00 0.00 ? 123 LEU B HD23 1  
ATOM   992   N  N    . LEU B 2 24  ? 2.930   -4.814  -9.243  1.00 0.00 ? 124 LEU B N    1  
ATOM   993   C  CA   . LEU B 2 24  ? 2.703   -5.731  -8.143  1.00 0.00 ? 124 LEU B CA   1  
ATOM   994   C  C    . LEU B 2 24  ? 2.282   -7.071  -8.719  1.00 0.00 ? 124 LEU B C    1  
ATOM   995   O  O    . LEU B 2 24  ? 2.733   -8.131  -8.284  1.00 0.00 ? 124 LEU B O    1  
ATOM   996   C  CB   . LEU B 2 24  ? 1.617   -5.175  -7.219  1.00 0.00 ? 124 LEU B CB   1  
ATOM   997   C  CG   . LEU B 2 24  ? 2.118   -4.506  -5.936  1.00 0.00 ? 124 LEU B CG   1  
ATOM   998   C  CD1  . LEU B 2 24  ? 3.326   -3.625  -6.220  1.00 0.00 ? 124 LEU B CD1  1  
ATOM   999   C  CD2  . LEU B 2 24  ? 1.004   -3.690  -5.302  1.00 0.00 ? 124 LEU B CD2  1  
ATOM   1000  H  H    . LEU B 2 24  ? 2.338   -4.041  -9.347  1.00 0.00 ? 124 LEU B H    1  
ATOM   1001  H  HA   . LEU B 2 24  ? 3.624   -5.849  -7.602  1.00 0.00 ? 124 LEU B HA   1  
ATOM   1002  H  HB2  . LEU B 2 24  ? 1.050   -4.447  -7.778  1.00 0.00 ? 124 LEU B HB2  1  
ATOM   1003  H  HB3  . LEU B 2 24  ? 0.955   -5.981  -6.944  1.00 0.00 ? 124 LEU B HB3  1  
ATOM   1004  H  HG   . LEU B 2 24  ? 2.418   -5.269  -5.233  1.00 0.00 ? 124 LEU B HG   1  
ATOM   1005  H  HD11 . LEU B 2 24  ? 4.231   -4.188  -6.049  1.00 0.00 ? 124 LEU B HD11 1  
ATOM   1006  H  HD12 . LEU B 2 24  ? 3.308   -2.767  -5.564  1.00 0.00 ? 124 LEU B HD12 1  
ATOM   1007  H  HD13 . LEU B 2 24  ? 3.298   -3.293  -7.246  1.00 0.00 ? 124 LEU B HD13 1  
ATOM   1008  H  HD21 . LEU B 2 24  ? 0.988   -2.703  -5.739  1.00 0.00 ? 124 LEU B HD21 1  
ATOM   1009  H  HD22 . LEU B 2 24  ? 1.177   -3.610  -4.239  1.00 0.00 ? 124 LEU B HD22 1  
ATOM   1010  H  HD23 . LEU B 2 24  ? 0.056   -4.177  -5.477  1.00 0.00 ? 124 LEU B HD23 1  
ATOM   1011  N  N    . HIS B 2 25  ? 1.441   -6.992  -9.740  1.00 0.00 ? 125 HIS B N    1  
ATOM   1012  C  CA   . HIS B 2 25  ? 0.969   -8.167  -10.444 1.00 0.00 ? 125 HIS B CA   1  
ATOM   1013  C  C    . HIS B 2 25  ? 2.152   -8.877  -11.057 1.00 0.00 ? 125 HIS B C    1  
ATOM   1014  O  O    . HIS B 2 25  ? 2.564   -9.946  -10.614 1.00 0.00 ? 125 HIS B O    1  
ATOM   1015  C  CB   . HIS B 2 25  ? 0.003   -7.768  -11.562 1.00 0.00 ? 125 HIS B CB   1  
ATOM   1016  C  CG   . HIS B 2 25  ? -0.196  -8.837  -12.597 1.00 0.00 ? 125 HIS B CG   1  
ATOM   1017  N  ND1  . HIS B 2 25  ? -1.174  -9.804  -12.527 1.00 0.00 ? 125 HIS B ND1  1  
ATOM   1018  C  CD2  . HIS B 2 25  ? 0.502   -9.092  -13.735 1.00 0.00 ? 125 HIS B CD2  1  
ATOM   1019  C  CE1  . HIS B 2 25  ? -1.040  -10.600 -13.597 1.00 0.00 ? 125 HIS B CE1  1  
ATOM   1020  N  NE2  . HIS B 2 25  ? -0.041  -10.209 -14.362 1.00 0.00 ? 125 HIS B NE2  1  
ATOM   1021  H  H    . HIS B 2 25  ? 1.155   -6.111  -10.046 1.00 0.00 ? 125 HIS B H    1  
ATOM   1022  H  HA   . HIS B 2 25  ? 0.475   -8.815  -9.747  1.00 0.00 ? 125 HIS B HA   1  
ATOM   1023  H  HB2  . HIS B 2 25  ? -0.946  -7.535  -11.137 1.00 0.00 ? 125 HIS B HB2  1  
ATOM   1024  H  HB3  . HIS B 2 25  ? 0.388   -6.892  -12.063 1.00 0.00 ? 125 HIS B HB3  1  
ATOM   1025  H  HD1  . HIS B 2 25  ? -1.846  -9.895  -11.820 1.00 0.00 ? 125 HIS B HD1  1  
ATOM   1026  H  HD2  . HIS B 2 25  ? 1.349   -8.529  -14.104 1.00 0.00 ? 125 HIS B HD2  1  
ATOM   1027  H  HE1  . HIS B 2 25  ? -1.665  -11.455 -13.803 1.00 0.00 ? 125 HIS B HE1  1  
ATOM   1028  N  N    . ALA B 2 26  ? 2.687   -8.241  -12.084 1.00 0.00 ? 126 ALA B N    1  
ATOM   1029  C  CA   . ALA B 2 26  ? 3.840   -8.758  -12.808 1.00 0.00 ? 126 ALA B CA   1  
ATOM   1030  C  C    . ALA B 2 26  ? 4.877   -9.335  -11.848 1.00 0.00 ? 126 ALA B C    1  
ATOM   1031  O  O    . ALA B 2 26  ? 5.575   -10.294 -12.178 1.00 0.00 ? 126 ALA B O    1  
ATOM   1032  C  CB   . ALA B 2 26  ? 4.460   -7.664  -13.664 1.00 0.00 ? 126 ALA B CB   1  
ATOM   1033  H  H    . ALA B 2 26  ? 2.284   -7.389  -12.360 1.00 0.00 ? 126 ALA B H    1  
ATOM   1034  H  HA   . ALA B 2 26  ? 3.493   -9.543  -13.464 1.00 0.00 ? 126 ALA B HA   1  
ATOM   1035  H  HB1  . ALA B 2 26  ? 5.524   -7.834  -13.750 1.00 0.00 ? 126 ALA B HB1  1  
ATOM   1036  H  HB2  . ALA B 2 26  ? 4.285   -6.704  -13.202 1.00 0.00 ? 126 ALA B HB2  1  
ATOM   1037  H  HB3  . ALA B 2 26  ? 4.011   -7.679  -14.646 1.00 0.00 ? 126 ALA B HB3  1  
ATOM   1038  N  N    . HIS B 2 27  ? 4.965   -8.752  -10.652 1.00 0.00 ? 127 HIS B N    1  
ATOM   1039  C  CA   . HIS B 2 27  ? 5.909   -9.227  -9.649  1.00 0.00 ? 127 HIS B CA   1  
ATOM   1040  C  C    . HIS B 2 27  ? 5.560   -10.651 -9.234  1.00 0.00 ? 127 HIS B C    1  
ATOM   1041  O  O    . HIS B 2 27  ? 6.426   -11.525 -9.177  1.00 0.00 ? 127 HIS B O    1  
ATOM   1042  C  CB   . HIS B 2 27  ? 5.902   -8.308  -8.427  1.00 0.00 ? 127 HIS B CB   1  
ATOM   1043  C  CG   . HIS B 2 27  ? 6.951   -8.652  -7.418  1.00 0.00 ? 127 HIS B CG   1  
ATOM   1044  N  ND1  . HIS B 2 27  ? 8.299   -8.667  -7.710  1.00 0.00 ? 127 HIS B ND1  1  
ATOM   1045  C  CD2  . HIS B 2 27  ? 6.849   -8.998  -6.112  1.00 0.00 ? 127 HIS B CD2  1  
ATOM   1046  C  CE1  . HIS B 2 27  ? 8.978   -9.009  -6.631  1.00 0.00 ? 127 HIS B CE1  1  
ATOM   1047  N  NE2  . HIS B 2 27  ? 8.122   -9.213  -5.648  1.00 0.00 ? 127 HIS B NE2  1  
ATOM   1048  H  H    . HIS B 2 27  ? 4.376   -7.994  -10.437 1.00 0.00 ? 127 HIS B H    1  
ATOM   1049  H  HA   . HIS B 2 27  ? 6.895   -9.222  -10.089 1.00 0.00 ? 127 HIS B HA   1  
ATOM   1050  H  HB2  . HIS B 2 27  ? 6.070   -7.291  -8.748  1.00 0.00 ? 127 HIS B HB2  1  
ATOM   1051  H  HB3  . HIS B 2 27  ? 4.938   -8.372  -7.942  1.00 0.00 ? 127 HIS B HB3  1  
ATOM   1052  H  HD1  . HIS B 2 27  ? 8.697   -8.461  -8.581  1.00 0.00 ? 127 HIS B HD1  1  
ATOM   1053  H  HD2  . HIS B 2 27  ? 5.934   -9.089  -5.542  1.00 0.00 ? 127 HIS B HD2  1  
ATOM   1054  H  HE1  . HIS B 2 27  ? 10.051  -9.104  -6.564  1.00 0.00 ? 127 HIS B HE1  1  
ATOM   1055  H  HE2  . HIS B 2 27  ? 8.365   -9.382  -4.714  1.00 0.00 ? 127 HIS B HE2  1  
ATOM   1056  N  N    . LYS B 2 28  ? 4.281   -10.877 -8.954  1.00 0.00 ? 128 LYS B N    1  
ATOM   1057  C  CA   . LYS B 2 28  ? 3.803   -12.195 -8.555  1.00 0.00 ? 128 LYS B CA   1  
ATOM   1058  C  C    . LYS B 2 28  ? 3.436   -13.028 -9.782  1.00 0.00 ? 128 LYS B C    1  
ATOM   1059  O  O    . LYS B 2 28  ? 3.513   -14.256 -9.756  1.00 0.00 ? 128 LYS B O    1  
ATOM   1060  C  CB   . LYS B 2 28  ? 2.591   -12.065 -7.631  1.00 0.00 ? 128 LYS B CB   1  
ATOM   1061  C  CG   . LYS B 2 28  ? 2.877   -11.281 -6.360  1.00 0.00 ? 128 LYS B CG   1  
ATOM   1062  C  CD   . LYS B 2 28  ? 1.618   -11.093 -5.527  1.00 0.00 ? 128 LYS B CD   1  
ATOM   1063  C  CE   . LYS B 2 28  ? 1.029   -9.704  -5.712  1.00 0.00 ? 128 LYS B CE   1  
ATOM   1064  N  NZ   . LYS B 2 28  ? 0.550   -9.127  -4.426  1.00 0.00 ? 128 LYS B NZ   1  
ATOM   1065  H  H    . LYS B 2 28  ? 3.638   -10.138 -9.025  1.00 0.00 ? 128 LYS B H    1  
ATOM   1066  H  HA   . LYS B 2 28  ? 4.601   -12.691 -8.023  1.00 0.00 ? 128 LYS B HA   1  
ATOM   1067  H  HB2  . LYS B 2 28  ? 1.797   -11.564 -8.166  1.00 0.00 ? 128 LYS B HB2  1  
ATOM   1068  H  HB3  . LYS B 2 28  ? 2.257   -13.054 -7.352  1.00 0.00 ? 128 LYS B HB3  1  
ATOM   1069  H  HG2  . LYS B 2 28  ? 3.607   -11.819 -5.774  1.00 0.00 ? 128 LYS B HG2  1  
ATOM   1070  H  HG3  . LYS B 2 28  ? 3.270   -10.311 -6.627  1.00 0.00 ? 128 LYS B HG3  1  
ATOM   1071  H  HD2  . LYS B 2 28  ? 0.887   -11.827 -5.826  1.00 0.00 ? 128 LYS B HD2  1  
ATOM   1072  H  HD3  . LYS B 2 28  ? 1.865   -11.233 -4.484  1.00 0.00 ? 128 LYS B HD3  1  
ATOM   1073  H  HE2  . LYS B 2 28  ? 1.787   -9.056  -6.126  1.00 0.00 ? 128 LYS B HE2  1  
ATOM   1074  H  HE3  . LYS B 2 28  ? 0.197   -9.769  -6.400  1.00 0.00 ? 128 LYS B HE3  1  
ATOM   1075  H  HZ1  . LYS B 2 28  ? 1.213   -9.362  -3.660  1.00 0.00 ? 128 LYS B HZ1  1  
ATOM   1076  H  HZ2  . LYS B 2 28  ? -0.387  -9.512  -4.188  1.00 0.00 ? 128 LYS B HZ2  1  
ATOM   1077  H  HZ3  . LYS B 2 28  ? 0.478   -8.092  -4.503  1.00 0.00 ? 128 LYS B HZ3  1  
ATOM   1078  N  N    . CYS B 2 29  ? 3.041   -12.348 -10.856 1.00 0.00 ? 129 CYS B N    1  
ATOM   1079  C  CA   . CYS B 2 29  ? 2.665   -13.020 -12.096 1.00 0.00 ? 129 CYS B CA   1  
ATOM   1080  C  C    . CYS B 2 29  ? 3.797   -13.918 -12.583 1.00 0.00 ? 129 CYS B C    1  
ATOM   1081  O  O    . CYS B 2 29  ? 3.566   -15.046 -13.017 1.00 0.00 ? 129 CYS B O    1  
ATOM   1082  C  CB   . CYS B 2 29  ? 2.306   -11.993 -13.171 1.00 0.00 ? 129 CYS B CB   1  
ATOM   1083  S  SG   . CYS B 2 29  ? 1.229   -12.644 -14.489 1.00 0.00 ? 129 CYS B SG   1  
ATOM   1084  H  H    . CYS B 2 29  ? 3.002   -11.370 -10.815 1.00 0.00 ? 129 CYS B H    1  
ATOM   1085  H  HA   . CYS B 2 29  ? 1.800   -13.629 -11.892 1.00 0.00 ? 129 CYS B HA   1  
ATOM   1086  H  HB2  . CYS B 2 29  ? 1.793   -11.163 -12.709 1.00 0.00 ? 129 CYS B HB2  1  
ATOM   1087  H  HB3  . CYS B 2 29  ? 3.212   -11.635 -13.635 1.00 0.00 ? 129 CYS B HB3  1  
ATOM   1088  N  N    . GLN B 2 30  ? 5.023   -13.411 -12.497 1.00 0.00 ? 130 GLN B N    1  
ATOM   1089  C  CA   . GLN B 2 30  ? 6.194   -14.167 -12.916 1.00 0.00 ? 130 GLN B CA   1  
ATOM   1090  C  C    . GLN B 2 30  ? 6.489   -15.294 -11.936 1.00 0.00 ? 130 GLN B C    1  
ATOM   1091  O  O    . GLN B 2 30  ? 7.144   -16.279 -12.276 1.00 0.00 ? 130 GLN B O    1  
ATOM   1092  C  CB   . GLN B 2 30  ? 7.410   -13.246 -13.034 1.00 0.00 ? 130 GLN B CB   1  
ATOM   1093  C  CG   . GLN B 2 30  ? 8.301   -13.560 -14.225 1.00 0.00 ? 130 GLN B CG   1  
ATOM   1094  C  CD   . GLN B 2 30  ? 9.730   -13.098 -14.021 1.00 0.00 ? 130 GLN B CD   1  
ATOM   1095  O  OE1  . GLN B 2 30  ? 10.176  -12.902 -12.891 1.00 0.00 ? 130 GLN B OE1  1  
ATOM   1096  N  NE2  . GLN B 2 30  ? 10.456  -12.919 -15.119 1.00 0.00 ? 130 GLN B NE2  1  
ATOM   1097  H  H    . GLN B 2 30  ? 5.143   -12.509 -12.135 1.00 0.00 ? 130 GLN B H    1  
ATOM   1098  H  HA   . GLN B 2 30  ? 5.980   -14.593 -13.875 1.00 0.00 ? 130 GLN B HA   1  
ATOM   1099  H  HB2  . GLN B 2 30  ? 7.065   -12.228 -13.127 1.00 0.00 ? 130 GLN B HB2  1  
ATOM   1100  H  HB3  . GLN B 2 30  ? 8.002   -13.334 -12.135 1.00 0.00 ? 130 GLN B HB3  1  
ATOM   1101  H  HG2  . GLN B 2 30  ? 8.304   -14.629 -14.383 1.00 0.00 ? 130 GLN B HG2  1  
ATOM   1102  H  HG3  . GLN B 2 30  ? 7.899   -13.070 -15.099 1.00 0.00 ? 130 GLN B HG3  1  
ATOM   1103  H  HE21 . GLN B 2 30  ? 10.034  -13.093 -15.986 1.00 0.00 ? 130 GLN B HE21 1  
ATOM   1104  H  HE22 . GLN B 2 30  ? 11.383  -12.619 -15.017 1.00 0.00 ? 130 GLN B HE22 1  
ATOM   1105  N  N    . ARG B 2 31  ? 5.994   -15.136 -10.720 1.00 0.00 ? 131 ARG B N    1  
ATOM   1106  C  CA   . ARG B 2 31  ? 6.188   -16.131 -9.672  1.00 0.00 ? 131 ARG B CA   1  
ATOM   1107  C  C    . ARG B 2 31  ? 5.057   -17.152 -9.660  1.00 0.00 ? 131 ARG B C    1  
ATOM   1108  O  O    . ARG B 2 31  ? 5.116   -18.155 -8.949  1.00 0.00 ? 131 ARG B O    1  
ATOM   1109  C  CB   . ARG B 2 31  ? 6.298   -15.453 -8.305  1.00 0.00 ? 131 ARG B CB   1  
ATOM   1110  C  CG   . ARG B 2 31  ? 7.188   -16.201 -7.324  1.00 0.00 ? 131 ARG B CG   1  
ATOM   1111  C  CD   . ARG B 2 31  ? 8.497   -15.467 -7.083  1.00 0.00 ? 131 ARG B CD   1  
ATOM   1112  N  NE   . ARG B 2 31  ? 9.634   -16.383 -7.015  1.00 0.00 ? 131 ARG B NE   1  
ATOM   1113  C  CZ   . ARG B 2 31  ? 10.839  -16.037 -6.567  1.00 0.00 ? 131 ARG B CZ   1  
ATOM   1114  N  NH1  . ARG B 2 31  ? 11.068  -14.799 -6.147  1.00 0.00 ? 131 ARG B NH1  1  
ATOM   1115  N  NH2  . ARG B 2 31  ? 11.818  -16.931 -6.540  1.00 0.00 ? 131 ARG B NH2  1  
ATOM   1116  H  H    . ARG B 2 31  ? 5.480   -14.328 -10.524 1.00 0.00 ? 131 ARG B H    1  
ATOM   1117  H  HA   . ARG B 2 31  ? 7.104   -16.646 -9.884  1.00 0.00 ? 131 ARG B HA   1  
ATOM   1118  H  HB2  . ARG B 2 31  ? 6.702   -14.460 -8.441  1.00 0.00 ? 131 ARG B HB2  1  
ATOM   1119  H  HB3  . ARG B 2 31  ? 5.311   -15.373 -7.875  1.00 0.00 ? 131 ARG B HB3  1  
ATOM   1120  H  HG2  . ARG B 2 31  ? 6.665   -16.301 -6.384  1.00 0.00 ? 131 ARG B HG2  1  
ATOM   1121  H  HG3  . ARG B 2 31  ? 7.402   -17.182 -7.724  1.00 0.00 ? 131 ARG B HG3  1  
ATOM   1122  H  HD2  . ARG B 2 31  ? 8.658   -14.769 -7.891  1.00 0.00 ? 131 ARG B HD2  1  
ATOM   1123  H  HD3  . ARG B 2 31  ? 8.426   -14.927 -6.150  1.00 0.00 ? 131 ARG B HD3  1  
ATOM   1124  H  HE   . ARG B 2 31  ? 9.492   -17.303 -7.320  1.00 0.00 ? 131 ARG B HE   1  
ATOM   1125  H  HH11 . ARG B 2 31  ? 10.334  -14.120 -6.166  1.00 0.00 ? 131 ARG B HH11 1  
ATOM   1126  H  HH12 . ARG B 2 31  ? 11.975  -14.546 -5.812  1.00 0.00 ? 131 ARG B HH12 1  
ATOM   1127  H  HH21 . ARG B 2 31  ? 11.651  -17.865 -6.855  1.00 0.00 ? 131 ARG B HH21 1  
ATOM   1128  H  HH22 . ARG B 2 31  ? 12.722  -16.672 -6.204  1.00 0.00 ? 131 ARG B HH22 1  
ATOM   1129  N  N    . ARG B 2 32  ? 4.029   -16.889 -10.454 1.00 0.00 ? 132 ARG B N    1  
ATOM   1130  C  CA   . ARG B 2 32  ? 2.879   -17.780 -10.543 1.00 0.00 ? 132 ARG B CA   1  
ATOM   1131  C  C    . ARG B 2 32  ? 3.135   -18.896 -11.550 1.00 0.00 ? 132 ARG B C    1  
ATOM   1132  O  O    . ARG B 2 32  ? 2.616   -20.004 -11.412 1.00 0.00 ? 132 ARG B O    1  
ATOM   1133  C  CB   . ARG B 2 32  ? 1.628   -16.994 -10.942 1.00 0.00 ? 132 ARG B CB   1  
ATOM   1134  C  CG   . ARG B 2 32  ? 0.368   -17.842 -10.996 1.00 0.00 ? 132 ARG B CG   1  
ATOM   1135  C  CD   . ARG B 2 32  ? -0.687  -17.217 -11.895 1.00 0.00 ? 132 ARG B CD   1  
ATOM   1136  N  NE   . ARG B 2 32  ? -2.011  -17.229 -11.276 1.00 0.00 ? 132 ARG B NE   1  
ATOM   1137  C  CZ   . ARG B 2 32  ? -3.030  -16.481 -11.692 1.00 0.00 ? 132 ARG B CZ   1  
ATOM   1138  N  NH1  . ARG B 2 32  ? -2.883  -15.663 -12.727 1.00 0.00 ? 132 ARG B NH1  1  
ATOM   1139  N  NH2  . ARG B 2 32  ? -4.200  -16.551 -11.072 1.00 0.00 ? 132 ARG B NH2  1  
ATOM   1140  H  H    . ARG B 2 32  ? 4.050   -16.076 -10.995 1.00 0.00 ? 132 ARG B H    1  
ATOM   1141  H  HA   . ARG B 2 32  ? 2.723   -18.218 -9.570  1.00 0.00 ? 132 ARG B HA   1  
ATOM   1142  H  HB2  . ARG B 2 32  ? 1.472   -16.201 -10.225 1.00 0.00 ? 132 ARG B HB2  1  
ATOM   1143  H  HB3  . ARG B 2 32  ? 1.786   -16.558 -11.917 1.00 0.00 ? 132 ARG B HB3  1  
ATOM   1144  H  HG2  . ARG B 2 32  ? 0.620   -18.819 -11.380 1.00 0.00 ? 132 ARG B HG2  1  
ATOM   1145  H  HG3  . ARG B 2 32  ? -0.033  -17.937 -9.997  1.00 0.00 ? 132 ARG B HG3  1  
ATOM   1146  H  HD2  . ARG B 2 32  ? -0.408  -16.194 -12.103 1.00 0.00 ? 132 ARG B HD2  1  
ATOM   1147  H  HD3  . ARG B 2 32  ? -0.728  -17.773 -12.821 1.00 0.00 ? 132 ARG B HD3  1  
ATOM   1148  H  HE   . ARG B 2 32  ? -2.146  -17.825 -10.511 1.00 0.00 ? 132 ARG B HE   1  
ATOM   1149  H  HH11 . ARG B 2 32  ? -2.003  -15.605 -13.200 1.00 0.00 ? 132 ARG B HH11 1  
ATOM   1150  H  HH12 . ARG B 2 32  ? -3.653  -15.103 -13.034 1.00 0.00 ? 132 ARG B HH12 1  
ATOM   1151  H  HH21 . ARG B 2 32  ? -4.316  -17.166 -10.292 1.00 0.00 ? 132 ARG B HH21 1  
ATOM   1152  H  HH22 . ARG B 2 32  ? -4.966  -15.989 -11.385 1.00 0.00 ? 132 ARG B HH22 1  
ATOM   1153  N  N    . GLU B 2 33  ? 3.941   -18.598 -12.565 1.00 0.00 ? 133 GLU B N    1  
ATOM   1154  C  CA   . GLU B 2 33  ? 4.267   -19.576 -13.596 1.00 0.00 ? 133 GLU B CA   1  
ATOM   1155  C  C    . GLU B 2 33  ? 5.208   -20.646 -13.052 1.00 0.00 ? 133 GLU B C    1  
ATOM   1156  O  O    . GLU B 2 33  ? 5.064   -21.829 -13.361 1.00 0.00 ? 133 GLU B O    1  
ATOM   1157  C  CB   . GLU B 2 33  ? 4.906   -18.883 -14.802 1.00 0.00 ? 133 GLU B CB   1  
ATOM   1158  C  CG   . GLU B 2 33  ? 3.907   -18.159 -15.688 1.00 0.00 ? 133 GLU B CG   1  
ATOM   1159  C  CD   . GLU B 2 33  ? 4.379   -18.047 -17.125 1.00 0.00 ? 133 GLU B CD   1  
ATOM   1160  O  OE1  . GLU B 2 33  ? 4.830   -19.069 -17.683 1.00 0.00 ? 133 GLU B OE1  1  
ATOM   1161  O  OE2  . GLU B 2 33  ? 4.296   -16.937 -17.692 1.00 0.00 ? 133 GLU B OE2  1  
ATOM   1162  H  H    . GLU B 2 33  ? 4.326   -17.698 -12.622 1.00 0.00 ? 133 GLU B H    1  
ATOM   1163  H  HA   . GLU B 2 33  ? 3.347   -20.047 -13.909 1.00 0.00 ? 133 GLU B HA   1  
ATOM   1164  H  HB2  . GLU B 2 33  ? 5.628   -18.163 -14.447 1.00 0.00 ? 133 GLU B HB2  1  
ATOM   1165  H  HB3  . GLU B 2 33  ? 5.415   -19.626 -15.400 1.00 0.00 ? 133 GLU B HB3  1  
ATOM   1166  H  HG2  . GLU B 2 33  ? 2.973   -18.701 -15.674 1.00 0.00 ? 133 GLU B HG2  1  
ATOM   1167  H  HG3  . GLU B 2 33  ? 3.752   -17.165 -15.296 1.00 0.00 ? 133 GLU B HG3  1  
ATOM   1168  N  N    . GLN B 2 34  ? 6.173   -20.224 -12.239 1.00 0.00 ? 134 GLN B N    1  
ATOM   1169  C  CA   . GLN B 2 34  ? 7.139   -21.148 -11.652 1.00 0.00 ? 134 GLN B CA   1  
ATOM   1170  C  C    . GLN B 2 34  ? 6.433   -22.249 -10.868 1.00 0.00 ? 134 GLN B C    1  
ATOM   1171  O  O    . GLN B 2 34  ? 6.922   -23.376 -10.784 1.00 0.00 ? 134 GLN B O    1  
ATOM   1172  C  CB   . GLN B 2 34  ? 8.106   -20.393 -10.737 1.00 0.00 ? 134 GLN B CB   1  
ATOM   1173  C  CG   . GLN B 2 34  ? 9.425   -21.117 -10.520 1.00 0.00 ? 134 GLN B CG   1  
ATOM   1174  C  CD   . GLN B 2 34  ? 9.382   -22.065 -9.338  1.00 0.00 ? 134 GLN B CD   1  
ATOM   1175  O  OE1  . GLN B 2 34  ? 8.328   -22.286 -8.743  1.00 0.00 ? 134 GLN B OE1  1  
ATOM   1176  N  NE2  . GLN B 2 34  ? 10.533  -22.632 -8.993  1.00 0.00 ? 134 GLN B NE2  1  
ATOM   1177  H  H    . GLN B 2 34  ? 6.237   -19.269 -12.029 1.00 0.00 ? 134 GLN B H    1  
ATOM   1178  H  HA   . GLN B 2 34  ? 7.698   -21.598 -12.458 1.00 0.00 ? 134 GLN B HA   1  
ATOM   1179  H  HB2  . GLN B 2 34  ? 8.316   -19.428 -11.172 1.00 0.00 ? 134 GLN B HB2  1  
ATOM   1180  H  HB3  . GLN B 2 34  ? 7.636   -20.251 -9.775  1.00 0.00 ? 134 GLN B HB3  1  
ATOM   1181  H  HG2  . GLN B 2 34  ? 9.661   -21.683 -11.408 1.00 0.00 ? 134 GLN B HG2  1  
ATOM   1182  H  HG3  . GLN B 2 34  ? 10.198  -20.382 -10.346 1.00 0.00 ? 134 GLN B HG3  1  
ATOM   1183  H  HE21 . GLN B 2 34  ? 11.333  -22.409 -9.512  1.00 0.00 ? 134 GLN B HE21 1  
ATOM   1184  H  HE22 . GLN B 2 34  ? 10.533  -23.250 -8.232  1.00 0.00 ? 134 GLN B HE22 1  
ATOM   1185  N  N    . ALA B 2 35  ? 5.281   -21.917 -10.296 1.00 0.00 ? 135 ALA B N    1  
ATOM   1186  C  CA   . ALA B 2 35  ? 4.509   -22.878 -9.519  1.00 0.00 ? 135 ALA B CA   1  
ATOM   1187  C  C    . ALA B 2 35  ? 3.771   -23.854 -10.428 1.00 0.00 ? 135 ALA B C    1  
ATOM   1188  O  O    . ALA B 2 35  ? 3.593   -25.023 -10.087 1.00 0.00 ? 135 ALA B O    1  
ATOM   1189  C  CB   . ALA B 2 35  ? 3.527   -22.155 -8.610  1.00 0.00 ? 135 ALA B CB   1  
ATOM   1190  H  H    . ALA B 2 35  ? 4.942   -21.003 -10.399 1.00 0.00 ? 135 ALA B H    1  
ATOM   1191  H  HA   . ALA B 2 35  ? 5.197   -23.433 -8.897  1.00 0.00 ? 135 ALA B HA   1  
ATOM   1192  H  HB1  . ALA B 2 35  ? 2.660   -22.777 -8.448  1.00 0.00 ? 135 ALA B HB1  1  
ATOM   1193  H  HB2  . ALA B 2 35  ? 3.224   -21.227 -9.073  1.00 0.00 ? 135 ALA B HB2  1  
ATOM   1194  H  HB3  . ALA B 2 35  ? 4.002   -21.945 -7.662  1.00 0.00 ? 135 ALA B HB3  1  
ATOM   1195  N  N    . ASN B 2 36  ? 3.343   -23.367 -11.588 1.00 0.00 ? 136 ASN B N    1  
ATOM   1196  C  CA   . ASN B 2 36  ? 2.624   -24.199 -12.546 1.00 0.00 ? 136 ASN B CA   1  
ATOM   1197  C  C    . ASN B 2 36  ? 3.536   -24.617 -13.698 1.00 0.00 ? 136 ASN B C    1  
ATOM   1198  O  O    . ASN B 2 36  ? 3.075   -24.851 -14.814 1.00 0.00 ? 136 ASN B O    1  
ATOM   1199  C  CB   . ASN B 2 36  ? 1.404   -23.451 -13.089 1.00 0.00 ? 136 ASN B CB   1  
ATOM   1200  C  CG   . ASN B 2 36  ? 0.106   -23.950 -12.484 1.00 0.00 ? 136 ASN B CG   1  
ATOM   1201  O  OD1  . ASN B 2 36  ? -0.519  -23.264 -11.675 1.00 0.00 ? 136 ASN B OD1  1  
ATOM   1202  N  ND2  . ASN B 2 36  ? -0.306  -25.150 -12.875 1.00 0.00 ? 136 ASN B ND2  1  
ATOM   1203  H  H    . ASN B 2 36  ? 3.514   -22.427 -11.806 1.00 0.00 ? 136 ASN B H    1  
ATOM   1204  H  HA   . ASN B 2 36  ? 2.291   -25.086 -12.029 1.00 0.00 ? 136 ASN B HA   1  
ATOM   1205  H  HB2  . ASN B 2 36  ? 1.503   -22.400 -12.861 1.00 0.00 ? 136 ASN B HB2  1  
ATOM   1206  H  HB3  . ASN B 2 36  ? 1.353   -23.579 -14.160 1.00 0.00 ? 136 ASN B HB3  1  
ATOM   1207  H  HD21 . ASN B 2 36  ? 0.242   -25.639 -13.522 1.00 0.00 ? 136 ASN B HD21 1  
ATOM   1208  H  HD22 . ASN B 2 36  ? -1.143  -25.498 -12.499 1.00 0.00 ? 136 ASN B HD22 1  
ATOM   1209  N  N    . GLY B 2 37  ? 4.834   -24.710 -13.417 1.00 0.00 ? 137 GLY B N    1  
ATOM   1210  C  CA   . GLY B 2 37  ? 5.787   -25.100 -14.439 1.00 0.00 ? 137 GLY B CA   1  
ATOM   1211  C  C    . GLY B 2 37  ? 5.764   -24.175 -15.639 1.00 0.00 ? 137 GLY B C    1  
ATOM   1212  O  O    . GLY B 2 37  ? 5.572   -22.967 -15.498 1.00 0.00 ? 137 GLY B O    1  
ATOM   1213  H  H    . GLY B 2 37  ? 5.144   -24.511 -12.509 1.00 0.00 ? 137 GLY B H    1  
ATOM   1214  H  HA2  . GLY B 2 37  ? 6.779   -25.092 -14.011 1.00 0.00 ? 137 GLY B HA2  1  
ATOM   1215  H  HA3  . GLY B 2 37  ? 5.556   -26.103 -14.767 1.00 0.00 ? 137 GLY B HA3  1  
ATOM   1216  N  N    . GLU B 2 38  ? 5.962   -24.740 -16.825 1.00 0.00 ? 138 GLU B N    1  
ATOM   1217  C  CA   . GLU B 2 38  ? 5.964   -23.958 -18.054 1.00 0.00 ? 138 GLU B CA   1  
ATOM   1218  C  C    . GLU B 2 38  ? 4.550   -23.510 -18.414 1.00 0.00 ? 138 GLU B C    1  
ATOM   1219  O  O    . GLU B 2 38  ? 3.728   -24.315 -18.853 1.00 0.00 ? 138 GLU B O    1  
ATOM   1220  C  CB   . GLU B 2 38  ? 6.562   -24.775 -19.200 1.00 0.00 ? 138 GLU B CB   1  
ATOM   1221  C  CG   . GLU B 2 38  ? 7.164   -23.923 -20.306 1.00 0.00 ? 138 GLU B CG   1  
ATOM   1222  C  CD   . GLU B 2 38  ? 8.307   -24.619 -21.021 1.00 0.00 ? 138 GLU B CD   1  
ATOM   1223  O  OE1  . GLU B 2 38  ? 8.798   -25.642 -20.501 1.00 0.00 ? 138 GLU B OE1  1  
ATOM   1224  O  OE2  . GLU B 2 38  ? 8.710   -24.139 -22.101 1.00 0.00 ? 138 GLU B OE2  1  
ATOM   1225  H  H    . GLU B 2 38  ? 6.111   -25.706 -16.875 1.00 0.00 ? 138 GLU B H    1  
ATOM   1226  H  HA   . GLU B 2 38  ? 6.575   -23.086 -17.887 1.00 0.00 ? 138 GLU B HA   1  
ATOM   1227  H  HB2  . GLU B 2 38  ? 7.337   -25.414 -18.805 1.00 0.00 ? 138 GLU B HB2  1  
ATOM   1228  H  HB3  . GLU B 2 38  ? 5.786   -25.390 -19.631 1.00 0.00 ? 138 GLU B HB3  1  
ATOM   1229  H  HG2  . GLU B 2 38  ? 6.393   -23.696 -21.028 1.00 0.00 ? 138 GLU B HG2  1  
ATOM   1230  H  HG3  . GLU B 2 38  ? 7.535   -23.004 -19.874 1.00 0.00 ? 138 GLU B HG3  1  
ATOM   1231  N  N    . VAL B 2 39  ? 4.274   -22.224 -18.223 1.00 0.00 ? 139 VAL B N    1  
ATOM   1232  C  CA   . VAL B 2 39  ? 2.960   -21.672 -18.524 1.00 0.00 ? 139 VAL B CA   1  
ATOM   1233  C  C    . VAL B 2 39  ? 3.031   -20.684 -19.682 1.00 0.00 ? 139 VAL B C    1  
ATOM   1234  O  O    . VAL B 2 39  ? 4.090   -20.135 -19.982 1.00 0.00 ? 139 VAL B O    1  
ATOM   1235  C  CB   . VAL B 2 39  ? 2.350   -20.959 -17.306 1.00 0.00 ? 139 VAL B CB   1  
ATOM   1236  C  CG1  . VAL B 2 39  ? 0.866   -20.707 -17.522 1.00 0.00 ? 139 VAL B CG1  1  
ATOM   1237  C  CG2  . VAL B 2 39  ? 2.585   -21.762 -16.035 1.00 0.00 ? 139 VAL B CG2  1  
ATOM   1238  H  H    . VAL B 2 39  ? 4.969   -21.633 -17.866 1.00 0.00 ? 139 VAL B H    1  
ATOM   1239  H  HA   . VAL B 2 39  ? 2.309   -22.489 -18.800 1.00 0.00 ? 139 VAL B HA   1  
ATOM   1240  H  HB   . VAL B 2 39  ? 2.841   -20.005 -17.200 1.00 0.00 ? 139 VAL B HB   1  
ATOM   1241  H  HG11 . VAL B 2 39  ? 0.403   -20.456 -16.580 1.00 0.00 ? 139 VAL B HG11 1  
ATOM   1242  H  HG12 . VAL B 2 39  ? 0.406   -21.597 -17.924 1.00 0.00 ? 139 VAL B HG12 1  
ATOM   1243  H  HG13 . VAL B 2 39  ? 0.737   -19.890 -18.217 1.00 0.00 ? 139 VAL B HG13 1  
ATOM   1244  H  HG21 . VAL B 2 39  ? 3.645   -21.904 -15.889 1.00 0.00 ? 139 VAL B HG21 1  
ATOM   1245  H  HG22 . VAL B 2 39  ? 2.101   -22.724 -16.123 1.00 0.00 ? 139 VAL B HG22 1  
ATOM   1246  H  HG23 . VAL B 2 39  ? 2.173   -21.229 -15.192 1.00 0.00 ? 139 VAL B HG23 1  
ATOM   1247  N  N    . ARG B 2 40  ? 1.892   -20.464 -20.325 1.00 0.00 ? 140 ARG B N    1  
ATOM   1248  C  CA   . ARG B 2 40  ? 1.815   -19.540 -21.452 1.00 0.00 ? 140 ARG B CA   1  
ATOM   1249  C  C    . ARG B 2 40  ? 1.824   -18.094 -20.966 1.00 0.00 ? 140 ARG B C    1  
ATOM   1250  O  O    . ARG B 2 40  ? 1.571   -17.821 -19.792 1.00 0.00 ? 140 ARG B O    1  
ATOM   1251  C  CB   . ARG B 2 40  ? 0.551   -19.810 -22.273 1.00 0.00 ? 140 ARG B CB   1  
ATOM   1252  C  CG   . ARG B 2 40  ? 0.805   -20.635 -23.525 1.00 0.00 ? 140 ARG B CG   1  
ATOM   1253  C  CD   . ARG B 2 40  ? 0.073   -20.064 -24.729 1.00 0.00 ? 140 ARG B CD   1  
ATOM   1254  N  NE   . ARG B 2 40  ? 0.768   -20.356 -25.980 1.00 0.00 ? 140 ARG B NE   1  
ATOM   1255  C  CZ   . ARG B 2 40  ? 0.546   -19.706 -27.120 1.00 0.00 ? 140 ARG B CZ   1  
ATOM   1256  N  NH1  . ARG B 2 40  ? -0.348  -18.725 -27.171 1.00 0.00 ? 140 ARG B NH1  1  
ATOM   1257  N  NH2  . ARG B 2 40  ? 1.220   -20.035 -28.213 1.00 0.00 ? 140 ARG B NH2  1  
ATOM   1258  H  H    . ARG B 2 40  ? 1.083   -20.930 -20.033 1.00 0.00 ? 140 ARG B H    1  
ATOM   1259  H  HA   . ARG B 2 40  ? 2.681   -19.704 -22.075 1.00 0.00 ? 140 ARG B HA   1  
ATOM   1260  H  HB2  . ARG B 2 40  ? -0.158  -20.342 -21.655 1.00 0.00 ? 140 ARG B HB2  1  
ATOM   1261  H  HB3  . ARG B 2 40  ? 0.118   -18.866 -22.570 1.00 0.00 ? 140 ARG B HB3  1  
ATOM   1262  H  HG2  . ARG B 2 40  ? 1.864   -20.641 -23.730 1.00 0.00 ? 140 ARG B HG2  1  
ATOM   1263  H  HG3  . ARG B 2 40  ? 0.464   -21.645 -23.353 1.00 0.00 ? 140 ARG B HG3  1  
ATOM   1264  H  HD2  . ARG B 2 40  ? -0.917  -20.494 -24.770 1.00 0.00 ? 140 ARG B HD2  1  
ATOM   1265  H  HD3  . ARG B 2 40  ? -0.004  -18.993 -24.612 1.00 0.00 ? 140 ARG B HD3  1  
ATOM   1266  H  HE   . ARG B 2 40  ? 1.434   -21.075 -25.972 1.00 0.00 ? 140 ARG B HE   1  
ATOM   1267  H  HH11 . ARG B 2 40  ? -0.859  -18.471 -26.350 1.00 0.00 ? 140 ARG B HH11 1  
ATOM   1268  H  HH12 . ARG B 2 40  ? -0.510  -18.241 -28.030 1.00 0.00 ? 140 ARG B HH12 1  
ATOM   1269  H  HH21 . ARG B 2 40  ? 1.895   -20.772 -28.181 1.00 0.00 ? 140 ARG B HH21 1  
ATOM   1270  H  HH22 . ARG B 2 40  ? 1.053   -19.547 -29.070 1.00 0.00 ? 140 ARG B HH22 1  
ATOM   1271  N  N    . GLN B 2 41  ? 2.117   -17.171 -21.875 1.00 0.00 ? 141 GLN B N    1  
ATOM   1272  C  CA   . GLN B 2 41  ? 2.161   -15.752 -21.539 1.00 0.00 ? 141 GLN B CA   1  
ATOM   1273  C  C    . GLN B 2 41  ? 0.761   -15.216 -21.259 1.00 0.00 ? 141 GLN B C    1  
ATOM   1274  O  O    . GLN B 2 41  ? 0.004   -14.920 -22.184 1.00 0.00 ? 141 GLN B O    1  
ATOM   1275  C  CB   . GLN B 2 41  ? 2.808   -14.958 -22.675 1.00 0.00 ? 141 GLN B CB   1  
ATOM   1276  C  CG   . GLN B 2 41  ? 2.079   -15.092 -24.002 1.00 0.00 ? 141 GLN B CG   1  
ATOM   1277  C  CD   . GLN B 2 41  ? 3.014   -14.996 -25.191 1.00 0.00 ? 141 GLN B CD   1  
ATOM   1278  O  OE1  . GLN B 2 41  ? 3.824   -15.891 -25.434 1.00 0.00 ? 141 GLN B OE1  1  
ATOM   1279  N  NE2  . GLN B 2 41  ? 2.908   -13.905 -25.942 1.00 0.00 ? 141 GLN B NE2  1  
ATOM   1280  H  H    . GLN B 2 41  ? 2.310   -17.450 -22.796 1.00 0.00 ? 141 GLN B H    1  
ATOM   1281  H  HA   . GLN B 2 41  ? 2.760   -15.642 -20.648 1.00 0.00 ? 141 GLN B HA   1  
ATOM   1282  H  HB2  . GLN B 2 41  ? 2.825   -13.912 -22.403 1.00 0.00 ? 141 GLN B HB2  1  
ATOM   1283  H  HB3  . GLN B 2 41  ? 3.822   -15.304 -22.809 1.00 0.00 ? 141 GLN B HB3  1  
ATOM   1284  H  HG2  . GLN B 2 41  ? 1.582   -16.050 -24.031 1.00 0.00 ? 141 GLN B HG2  1  
ATOM   1285  H  HG3  . GLN B 2 41  ? 1.344   -14.304 -24.076 1.00 0.00 ? 141 GLN B HG3  1  
ATOM   1286  H  HE21 . GLN B 2 41  ? 2.241   -13.233 -25.689 1.00 0.00 ? 141 GLN B HE21 1  
ATOM   1287  H  HE22 . GLN B 2 41  ? 3.500   -13.817 -26.716 1.00 0.00 ? 141 GLN B HE22 1  
ATOM   1288  N  N    . CYS B 2 42  ? 0.421   -15.106 -19.975 1.00 0.00 ? 142 CYS B N    1  
ATOM   1289  C  CA   . CYS B 2 42  ? -0.882  -14.619 -19.549 1.00 0.00 ? 142 CYS B CA   1  
ATOM   1290  C  C    . CYS B 2 42  ? -1.377  -13.472 -20.427 1.00 0.00 ? 142 CYS B C    1  
ATOM   1291  O  O    . CYS B 2 42  ? -0.599  -12.613 -20.840 1.00 0.00 ? 142 CYS B O    1  
ATOM   1292  C  CB   . CYS B 2 42  ? -0.824  -14.167 -18.089 1.00 0.00 ? 142 CYS B CB   1  
ATOM   1293  S  SG   . CYS B 2 42  ? 0.314   -12.775 -17.787 1.00 0.00 ? 142 CYS B SG   1  
ATOM   1294  H  H    . CYS B 2 42  ? 1.060   -15.371 -19.293 1.00 0.00 ? 142 CYS B H    1  
ATOM   1295  H  HA   . CYS B 2 42  ? -1.564  -15.443 -19.626 1.00 0.00 ? 142 CYS B HA   1  
ATOM   1296  H  HB2  . CYS B 2 42  ? -1.809  -13.858 -17.775 1.00 0.00 ? 142 CYS B HB2  1  
ATOM   1297  H  HB3  . CYS B 2 42  ? -0.500  -14.995 -17.475 1.00 0.00 ? 142 CYS B HB3  1  
ATOM   1298  N  N    . ASN B 2 43  ? -2.677  -13.466 -20.706 1.00 0.00 ? 143 ASN B N    1  
ATOM   1299  C  CA   . ASN B 2 43  ? -3.275  -12.425 -21.534 1.00 0.00 ? 143 ASN B CA   1  
ATOM   1300  C  C    . ASN B 2 43  ? -3.347  -11.102 -20.778 1.00 0.00 ? 143 ASN B C    1  
ATOM   1301  O  O    . ASN B 2 43  ? -4.381  -10.757 -20.208 1.00 0.00 ? 143 ASN B O    1  
ATOM   1302  C  CB   . ASN B 2 43  ? -4.676  -12.844 -21.985 1.00 0.00 ? 143 ASN B CB   1  
ATOM   1303  C  CG   . ASN B 2 43  ? -4.658  -13.597 -23.301 1.00 0.00 ? 143 ASN B CG   1  
ATOM   1304  O  OD1  . ASN B 2 43  ? -5.410  -13.278 -24.222 1.00 0.00 ? 143 ASN B OD1  1  
ATOM   1305  N  ND2  . ASN B 2 43  ? -3.796  -14.602 -23.395 1.00 0.00 ? 143 ASN B ND2  1  
ATOM   1306  H  H    . ASN B 2 43  ? -3.246  -14.177 -20.348 1.00 0.00 ? 143 ASN B H    1  
ATOM   1307  H  HA   . ASN B 2 43  ? -2.651  -12.295 -22.405 1.00 0.00 ? 143 ASN B HA   1  
ATOM   1308  H  HB2  . ASN B 2 43  ? -5.114  -13.484 -21.232 1.00 0.00 ? 143 ASN B HB2  1  
ATOM   1309  H  HB3  . ASN B 2 43  ? -5.289  -11.963 -22.103 1.00 0.00 ? 143 ASN B HB3  1  
ATOM   1310  H  HD21 . ASN B 2 43  ? -3.228  -14.800 -22.621 1.00 0.00 ? 143 ASN B HD21 1  
ATOM   1311  H  HD22 . ASN B 2 43  ? -3.763  -15.107 -24.236 1.00 0.00 ? 143 ASN B HD22 1  
ATOM   1312  N  N    . LEU B 2 44  ? -2.241  -10.367 -20.780 1.00 0.00 ? 144 LEU B N    1  
ATOM   1313  C  CA   . LEU B 2 44  ? -2.175  -9.081  -20.096 1.00 0.00 ? 144 LEU B CA   1  
ATOM   1314  C  C    . LEU B 2 44  ? -0.983  -8.263  -20.590 1.00 0.00 ? 144 LEU B C    1  
ATOM   1315  O  O    . LEU B 2 44  ? 0.117   -8.367  -20.048 1.00 0.00 ? 144 LEU B O    1  
ATOM   1316  C  CB   . LEU B 2 44  ? -2.077  -9.288  -18.582 1.00 0.00 ? 144 LEU B CB   1  
ATOM   1317  C  CG   . LEU B 2 44  ? -3.396  -9.130  -17.821 1.00 0.00 ? 144 LEU B CG   1  
ATOM   1318  C  CD1  . LEU B 2 44  ? -3.865  -10.469 -17.273 1.00 0.00 ? 144 LEU B CD1  1  
ATOM   1319  C  CD2  . LEU B 2 44  ? -3.247  -8.117  -16.695 1.00 0.00 ? 144 LEU B CD2  1  
ATOM   1320  H  H    . LEU B 2 44  ? -1.449  -10.697 -21.254 1.00 0.00 ? 144 LEU B H    1  
ATOM   1321  H  HA   . LEU B 2 44  ? -3.084  -8.541  -20.318 1.00 0.00 ? 144 LEU B HA   1  
ATOM   1322  H  HB2  . LEU B 2 44  ? -1.697  -10.284 -18.402 1.00 0.00 ? 144 LEU B HB2  1  
ATOM   1323  H  HB3  . LEU B 2 44  ? -1.370  -8.575  -18.186 1.00 0.00 ? 144 LEU B HB3  1  
ATOM   1324  H  HG   . LEU B 2 44  ? -4.154  -8.765  -18.500 1.00 0.00 ? 144 LEU B HG   1  
ATOM   1325  H  HD11 . LEU B 2 44  ? -3.015  -11.121 -17.139 1.00 0.00 ? 144 LEU B HD11 1  
ATOM   1326  H  HD12 . LEU B 2 44  ? -4.558  -10.919 -17.969 1.00 0.00 ? 144 LEU B HD12 1  
ATOM   1327  H  HD13 . LEU B 2 44  ? -4.356  -10.318 -16.323 1.00 0.00 ? 144 LEU B HD13 1  
ATOM   1328  H  HD21 . LEU B 2 44  ? -2.445  -7.432  -16.931 1.00 0.00 ? 144 LEU B HD21 1  
ATOM   1329  H  HD22 . LEU B 2 44  ? -3.018  -8.633  -15.774 1.00 0.00 ? 144 LEU B HD22 1  
ATOM   1330  H  HD23 . LEU B 2 44  ? -4.168  -7.566  -16.580 1.00 0.00 ? 144 LEU B HD23 1  
ATOM   1331  N  N    . PRO B 2 45  ? -1.188  -7.435  -21.630 1.00 0.00 ? 145 PRO B N    1  
ATOM   1332  C  CA   . PRO B 2 45  ? -0.124  -6.598  -22.195 1.00 0.00 ? 145 PRO B CA   1  
ATOM   1333  C  C    . PRO B 2 45  ? 0.657   -5.849  -21.121 1.00 0.00 ? 145 PRO B C    1  
ATOM   1334  O  O    . PRO B 2 45  ? 1.871   -5.675  -21.230 1.00 0.00 ? 145 PRO B O    1  
ATOM   1335  C  CB   . PRO B 2 45  ? -0.889  -5.618  -23.085 1.00 0.00 ? 145 PRO B CB   1  
ATOM   1336  C  CG   . PRO B 2 45  ? -2.110  -6.363  -23.498 1.00 0.00 ? 145 PRO B CG   1  
ATOM   1337  C  CD   . PRO B 2 45  ? -2.471  -7.250  -22.337 1.00 0.00 ? 145 PRO B CD   1  
ATOM   1338  H  HA   . PRO B 2 45  ? 0.559   -7.179  -22.797 1.00 0.00 ? 145 PRO B HA   1  
ATOM   1339  H  HB2  . PRO B 2 45  ? -1.136  -4.732  -22.518 1.00 0.00 ? 145 PRO B HB2  1  
ATOM   1340  H  HB3  . PRO B 2 45  ? -0.281  -5.351  -23.936 1.00 0.00 ? 145 PRO B HB3  1  
ATOM   1341  H  HG2  . PRO B 2 45  ? -2.911  -5.669  -23.704 1.00 0.00 ? 145 PRO B HG2  1  
ATOM   1342  H  HG3  . PRO B 2 45  ? -1.896  -6.960  -24.373 1.00 0.00 ? 145 PRO B HG3  1  
ATOM   1343  H  HD2  . PRO B 2 45  ? -3.194  -6.760  -21.701 1.00 0.00 ? 145 PRO B HD2  1  
ATOM   1344  H  HD3  . PRO B 2 45  ? -2.856  -8.195  -22.690 1.00 0.00 ? 145 PRO B HD3  1  
ATOM   1345  N  N    . HIS B 2 46  ? -0.045  -5.407  -20.083 1.00 0.00 ? 146 HIS B N    1  
ATOM   1346  C  CA   . HIS B 2 46  ? 0.583   -4.678  -18.988 1.00 0.00 ? 146 HIS B CA   1  
ATOM   1347  C  C    . HIS B 2 46  ? 1.672   -5.519  -18.328 1.00 0.00 ? 146 HIS B C    1  
ATOM   1348  O  O    . HIS B 2 46  ? 2.842   -5.134  -18.309 1.00 0.00 ? 146 HIS B O    1  
ATOM   1349  C  CB   . HIS B 2 46  ? -0.467  -4.274  -17.952 1.00 0.00 ? 146 HIS B CB   1  
ATOM   1350  C  CG   . HIS B 2 46  ? -1.257  -3.064  -18.343 1.00 0.00 ? 146 HIS B CG   1  
ATOM   1351  N  ND1  . HIS B 2 46  ? -2.610  -3.101  -18.610 1.00 0.00 ? 146 HIS B ND1  1  
ATOM   1352  C  CD2  . HIS B 2 46  ? -0.878  -1.775  -18.514 1.00 0.00 ? 146 HIS B CD2  1  
ATOM   1353  C  CE1  . HIS B 2 46  ? -3.027  -1.889  -18.930 1.00 0.00 ? 146 HIS B CE1  1  
ATOM   1354  N  NE2  . HIS B 2 46  ? -1.997  -1.067  -18.878 1.00 0.00 ? 146 HIS B NE2  1  
ATOM   1355  H  H    . HIS B 2 46  ? -1.010  -5.579  -20.052 1.00 0.00 ? 146 HIS B H    1  
ATOM   1356  H  HA   . HIS B 2 46  ? 1.032   -3.786  -19.399 1.00 0.00 ? 146 HIS B HA   1  
ATOM   1357  H  HB2  . HIS B 2 46  ? -1.160  -5.091  -17.816 1.00 0.00 ? 146 HIS B HB2  1  
ATOM   1358  H  HB3  . HIS B 2 46  ? 0.024   -4.065  -17.014 1.00 0.00 ? 146 HIS B HB3  1  
ATOM   1359  H  HD1  . HIS B 2 46  ? -3.179  -3.898  -18.573 1.00 0.00 ? 146 HIS B HD1  1  
ATOM   1360  H  HD2  . HIS B 2 46  ? 0.120   -1.378  -18.388 1.00 0.00 ? 146 HIS B HD2  1  
ATOM   1361  H  HE1  . HIS B 2 46  ? -4.041  -1.618  -19.188 1.00 0.00 ? 146 HIS B HE1  1  
ATOM   1362  H  HE2  . HIS B 2 46  ? -2.043  -0.094  -18.992 1.00 0.00 ? 146 HIS B HE2  1  
ATOM   1363  N  N    . CYS B 2 47  ? 1.278   -6.670  -17.792 1.00 0.00 ? 147 CYS B N    1  
ATOM   1364  C  CA   . CYS B 2 47  ? 2.216   -7.575  -17.133 1.00 0.00 ? 147 CYS B CA   1  
ATOM   1365  C  C    . CYS B 2 47  ? 3.414   -7.868  -18.024 1.00 0.00 ? 147 CYS B C    1  
ATOM   1366  O  O    . CYS B 2 47  ? 4.546   -7.500  -17.709 1.00 0.00 ? 147 CYS B O    1  
ATOM   1367  C  CB   . CYS B 2 47  ? 1.518   -8.887  -16.782 1.00 0.00 ? 147 CYS B CB   1  
ATOM   1368  S  SG   . CYS B 2 47  ? 2.570   -10.080 -15.895 1.00 0.00 ? 147 CYS B SG   1  
ATOM   1369  H  H    . CYS B 2 47  ? 0.332   -6.919  -17.843 1.00 0.00 ? 147 CYS B H    1  
ATOM   1370  H  HA   . CYS B 2 47  ? 2.558   -7.103  -16.225 1.00 0.00 ? 147 CYS B HA   1  
ATOM   1371  H  HB2  . CYS B 2 47  ? 0.665   -8.676  -16.165 1.00 0.00 ? 147 CYS B HB2  1  
ATOM   1372  H  HB3  . CYS B 2 47  ? 1.184   -9.359  -17.691 1.00 0.00 ? 147 CYS B HB3  1  
ATOM   1373  N  N    . ARG B 2 48  ? 3.146   -8.540  -19.137 1.00 0.00 ? 148 ARG B N    1  
ATOM   1374  C  CA   . ARG B 2 48  ? 4.189   -8.904  -20.097 1.00 0.00 ? 148 ARG B CA   1  
ATOM   1375  C  C    . ARG B 2 48  ? 5.150   -7.742  -20.334 1.00 0.00 ? 148 ARG B C    1  
ATOM   1376  O  O    . ARG B 2 48  ? 6.369   -7.918  -20.318 1.00 0.00 ? 148 ARG B O    1  
ATOM   1377  C  CB   . ARG B 2 48  ? 3.560   -9.336  -21.423 1.00 0.00 ? 148 ARG B CB   1  
ATOM   1378  C  CG   . ARG B 2 48  ? 4.578   -9.763  -22.468 1.00 0.00 ? 148 ARG B CG   1  
ATOM   1379  C  CD   . ARG B 2 48  ? 4.003   -9.680  -23.873 1.00 0.00 ? 148 ARG B CD   1  
ATOM   1380  N  NE   . ARG B 2 48  ? 2.781   -10.469 -24.012 1.00 0.00 ? 148 ARG B NE   1  
ATOM   1381  C  CZ   . ARG B 2 48  ? 2.020   -10.472 -25.105 1.00 0.00 ? 148 ARG B CZ   1  
ATOM   1382  N  NH1  . ARG B 2 48  ? 2.353   -9.733  -26.156 1.00 0.00 ? 148 ARG B NH1  1  
ATOM   1383  N  NH2  . ARG B 2 48  ? 0.925   -11.218 -25.148 1.00 0.00 ? 148 ARG B NH2  1  
ATOM   1384  H  H    . ARG B 2 48  ? 2.219   -8.803  -19.316 1.00 0.00 ? 148 ARG B H    1  
ATOM   1385  H  HA   . ARG B 2 48  ? 4.742   -9.734  -19.684 1.00 0.00 ? 148 ARG B HA   1  
ATOM   1386  H  HB2  . ARG B 2 48  ? 2.896   -10.167 -21.239 1.00 0.00 ? 148 ARG B HB2  1  
ATOM   1387  H  HB3  . ARG B 2 48  ? 2.989   -8.511  -21.824 1.00 0.00 ? 148 ARG B HB3  1  
ATOM   1388  H  HG2  . ARG B 2 48  ? 5.438   -9.114  -22.404 1.00 0.00 ? 148 ARG B HG2  1  
ATOM   1389  H  HG3  . ARG B 2 48  ? 4.877   -10.781 -22.271 1.00 0.00 ? 148 ARG B HG3  1  
ATOM   1390  H  HD2  . ARG B 2 48  ? 3.780   -8.647  -24.097 1.00 0.00 ? 148 ARG B HD2  1  
ATOM   1391  H  HD3  . ARG B 2 48  ? 4.739   -10.048 -24.571 1.00 0.00 ? 148 ARG B HD3  1  
ATOM   1392  H  HE   . ARG B 2 48  ? 2.512   -11.025 -23.251 1.00 0.00 ? 148 ARG B HE   1  
ATOM   1393  H  HH11 . ARG B 2 48  ? 3.178   -9.168  -26.130 1.00 0.00 ? 148 ARG B HH11 1  
ATOM   1394  H  HH12 . ARG B 2 48  ? 1.778   -9.739  -26.974 1.00 0.00 ? 148 ARG B HH12 1  
ATOM   1395  H  HH21 . ARG B 2 48  ? 0.669   -11.777 -24.360 1.00 0.00 ? 148 ARG B HH21 1  
ATOM   1396  H  HH22 . ARG B 2 48  ? 0.354   -11.220 -25.969 1.00 0.00 ? 148 ARG B HH22 1  
ATOM   1397  N  N    . THR B 2 49  ? 4.593   -6.555  -20.543 1.00 0.00 ? 149 THR B N    1  
ATOM   1398  C  CA   . THR B 2 49  ? 5.405   -5.366  -20.773 1.00 0.00 ? 149 THR B CA   1  
ATOM   1399  C  C    . THR B 2 49  ? 6.271   -5.071  -19.555 1.00 0.00 ? 149 THR B C    1  
ATOM   1400  O  O    . THR B 2 49  ? 7.471   -4.828  -19.682 1.00 0.00 ? 149 THR B O    1  
ATOM   1401  C  CB   . THR B 2 49  ? 4.513   -4.163  -21.092 1.00 0.00 ? 149 THR B CB   1  
ATOM   1402  O  OG1  . THR B 2 49  ? 3.735   -4.409  -22.249 1.00 0.00 ? 149 THR B OG1  1  
ATOM   1403  C  CG2  . THR B 2 49  ? 5.292   -2.885  -21.326 1.00 0.00 ? 149 THR B CG2  1  
ATOM   1404  H  H    . THR B 2 49  ? 3.616   -6.478  -20.536 1.00 0.00 ? 149 THR B H    1  
ATOM   1405  H  HA   . THR B 2 49  ? 6.050   -5.562  -21.618 1.00 0.00 ? 149 THR B HA   1  
ATOM   1406  H  HB   . THR B 2 49  ? 3.844   -3.993  -20.260 1.00 0.00 ? 149 THR B HB   1  
ATOM   1407  H  HG1  . THR B 2 49  ? 4.309   -4.461  -23.016 1.00 0.00 ? 149 THR B HG1  1  
ATOM   1408  H  HG21 . THR B 2 49  ? 5.532   -2.431  -20.376 1.00 0.00 ? 149 THR B HG21 1  
ATOM   1409  H  HG22 . THR B 2 49  ? 4.695   -2.202  -21.912 1.00 0.00 ? 149 THR B HG22 1  
ATOM   1410  H  HG23 . THR B 2 49  ? 6.204   -3.113  -21.857 1.00 0.00 ? 149 THR B HG23 1  
ATOM   1411  N  N    . MET B 2 50  ? 5.662   -5.103  -18.374 1.00 0.00 ? 150 MET B N    1  
ATOM   1412  C  CA   . MET B 2 50  ? 6.395   -4.851  -17.141 1.00 0.00 ? 150 MET B CA   1  
ATOM   1413  C  C    . MET B 2 50  ? 7.486   -5.892  -16.964 1.00 0.00 ? 150 MET B C    1  
ATOM   1414  O  O    . MET B 2 50  ? 8.598   -5.571  -16.550 1.00 0.00 ? 150 MET B O    1  
ATOM   1415  C  CB   . MET B 2 50  ? 5.454   -4.856  -15.934 1.00 0.00 ? 150 MET B CB   1  
ATOM   1416  C  CG   . MET B 2 50  ? 4.906   -3.481  -15.580 1.00 0.00 ? 150 MET B CG   1  
ATOM   1417  S  SD   . MET B 2 50  ? 6.205   -2.276  -15.248 1.00 0.00 ? 150 MET B SD   1  
ATOM   1418  C  CE   . MET B 2 50  ? 5.914   -1.093  -16.561 1.00 0.00 ? 150 MET B CE   1  
ATOM   1419  H  H    . MET B 2 50  ? 4.705   -5.310  -18.330 1.00 0.00 ? 150 MET B H    1  
ATOM   1420  H  HA   . MET B 2 50  ? 6.862   -3.881  -17.228 1.00 0.00 ? 150 MET B HA   1  
ATOM   1421  H  HB2  . MET B 2 50  ? 4.619   -5.507  -16.146 1.00 0.00 ? 150 MET B HB2  1  
ATOM   1422  H  HB3  . MET B 2 50  ? 5.988   -5.237  -15.077 1.00 0.00 ? 150 MET B HB3  1  
ATOM   1423  H  HG2  . MET B 2 50  ? 4.307   -3.124  -16.405 1.00 0.00 ? 150 MET B HG2  1  
ATOM   1424  H  HG3  . MET B 2 50  ? 4.287   -3.572  -14.700 1.00 0.00 ? 150 MET B HG3  1  
ATOM   1425  H  HE1  . MET B 2 50  ? 6.537   -0.223  -16.407 1.00 0.00 ? 150 MET B HE1  1  
ATOM   1426  H  HE2  . MET B 2 50  ? 4.875   -0.798  -16.556 1.00 0.00 ? 150 MET B HE2  1  
ATOM   1427  H  HE3  . MET B 2 50  ? 6.156   -1.544  -17.512 1.00 0.00 ? 150 MET B HE3  1  
ATOM   1428  N  N    . LYS B 2 51  ? 7.179   -7.136  -17.313 1.00 0.00 ? 151 LYS B N    1  
ATOM   1429  C  CA   . LYS B 2 51  ? 8.163   -8.204  -17.224 1.00 0.00 ? 151 LYS B CA   1  
ATOM   1430  C  C    . LYS B 2 51  ? 9.390   -7.807  -18.032 1.00 0.00 ? 151 LYS B C    1  
ATOM   1431  O  O    . LYS B 2 51  ? 10.527  -8.109  -17.665 1.00 0.00 ? 151 LYS B O    1  
ATOM   1432  C  CB   . LYS B 2 51  ? 7.581   -9.516  -17.754 1.00 0.00 ? 151 LYS B CB   1  
ATOM   1433  C  CG   . LYS B 2 51  ? 7.242   -10.517 -16.659 1.00 0.00 ? 151 LYS B CG   1  
ATOM   1434  C  CD   . LYS B 2 51  ? 5.791   -10.963 -16.739 1.00 0.00 ? 151 LYS B CD   1  
ATOM   1435  C  CE   . LYS B 2 51  ? 5.469   -12.003 -15.677 1.00 0.00 ? 151 LYS B CE   1  
ATOM   1436  N  NZ   . LYS B 2 51  ? 5.362   -13.371 -16.253 1.00 0.00 ? 151 LYS B NZ   1  
ATOM   1437  H  H    . LYS B 2 51  ? 6.285   -7.333  -17.661 1.00 0.00 ? 151 LYS B H    1  
ATOM   1438  H  HA   . LYS B 2 51  ? 8.440   -8.323  -16.188 1.00 0.00 ? 151 LYS B HA   1  
ATOM   1439  H  HB2  . LYS B 2 51  ? 6.679   -9.298  -18.306 1.00 0.00 ? 151 LYS B HB2  1  
ATOM   1440  H  HB3  . LYS B 2 51  ? 8.298   -9.973  -18.419 1.00 0.00 ? 151 LYS B HB3  1  
ATOM   1441  H  HG2  . LYS B 2 51  ? 7.880   -11.381 -16.767 1.00 0.00 ? 151 LYS B HG2  1  
ATOM   1442  H  HG3  . LYS B 2 51  ? 7.416   -10.057 -15.698 1.00 0.00 ? 151 LYS B HG3  1  
ATOM   1443  H  HD2  . LYS B 2 51  ? 5.152   -10.105 -16.593 1.00 0.00 ? 151 LYS B HD2  1  
ATOM   1444  H  HD3  . LYS B 2 51  ? 5.608   -11.389 -17.714 1.00 0.00 ? 151 LYS B HD3  1  
ATOM   1445  H  HE2  . LYS B 2 51  ? 6.251   -11.995 -14.933 1.00 0.00 ? 151 LYS B HE2  1  
ATOM   1446  H  HE3  . LYS B 2 51  ? 4.530   -11.745 -15.211 1.00 0.00 ? 151 LYS B HE3  1  
ATOM   1447  H  HZ1  . LYS B 2 51  ? 6.298   -13.701 -16.565 1.00 0.00 ? 151 LYS B HZ1  1  
ATOM   1448  H  HZ2  . LYS B 2 51  ? 4.720   -13.366 -17.071 1.00 0.00 ? 151 LYS B HZ2  1  
ATOM   1449  H  HZ3  . LYS B 2 51  ? 4.993   -14.032 -15.541 1.00 0.00 ? 151 LYS B HZ3  1  
ATOM   1450  N  N    . ASN B 2 52  ? 9.134   -7.102  -19.131 1.00 0.00 ? 152 ASN B N    1  
ATOM   1451  C  CA   . ASN B 2 52  ? 10.184  -6.621  -20.008 1.00 0.00 ? 152 ASN B CA   1  
ATOM   1452  C  C    . ASN B 2 52  ? 10.883  -5.416  -19.386 1.00 0.00 ? 152 ASN B C    1  
ATOM   1453  O  O    . ASN B 2 52  ? 12.113  -5.346  -19.352 1.00 0.00 ? 152 ASN B O    1  
ATOM   1454  C  CB   . ASN B 2 52  ? 9.595   -6.243  -21.369 1.00 0.00 ? 152 ASN B CB   1  
ATOM   1455  C  CG   . ASN B 2 52  ? 10.512  -6.606  -22.520 1.00 0.00 ? 152 ASN B CG   1  
ATOM   1456  O  OD1  . ASN B 2 52  ? 11.688  -6.910  -22.321 1.00 0.00 ? 152 ASN B OD1  1  
ATOM   1457  N  ND2  . ASN B 2 52  ? 9.976   -6.579  -23.736 1.00 0.00 ? 152 ASN B ND2  1  
ATOM   1458  H  H    . ASN B 2 52  ? 8.205   -6.890  -19.350 1.00 0.00 ? 152 ASN B H    1  
ATOM   1459  H  HA   . ASN B 2 52  ? 10.900  -7.416  -20.138 1.00 0.00 ? 152 ASN B HA   1  
ATOM   1460  H  HB2  . ASN B 2 52  ? 8.656   -6.759  -21.503 1.00 0.00 ? 152 ASN B HB2  1  
ATOM   1461  H  HB3  . ASN B 2 52  ? 9.419   -5.177  -21.394 1.00 0.00 ? 152 ASN B HB3  1  
ATOM   1462  H  HD21 . ASN B 2 52  ? 9.031   -6.328  -23.818 1.00 0.00 ? 152 ASN B HD21 1  
ATOM   1463  H  HD22 . ASN B 2 52  ? 10.544  -6.809  -24.498 1.00 0.00 ? 152 ASN B HD22 1  
ATOM   1464  N  N    . VAL B 2 53  ? 10.090  -4.471  -18.882 1.00 0.00 ? 153 VAL B N    1  
ATOM   1465  C  CA   . VAL B 2 53  ? 10.640  -3.279  -18.252 1.00 0.00 ? 153 VAL B CA   1  
ATOM   1466  C  C    . VAL B 2 53  ? 11.387  -3.648  -16.980 1.00 0.00 ? 153 VAL B C    1  
ATOM   1467  O  O    . VAL B 2 53  ? 12.374  -3.009  -16.616 1.00 0.00 ? 153 VAL B O    1  
ATOM   1468  C  CB   . VAL B 2 53  ? 9.540   -2.251  -17.919 1.00 0.00 ? 153 VAL B CB   1  
ATOM   1469  C  CG1  . VAL B 2 53  ? 10.146  -0.986  -17.331 1.00 0.00 ? 153 VAL B CG1  1  
ATOM   1470  C  CG2  . VAL B 2 53  ? 8.719   -1.928  -19.159 1.00 0.00 ? 153 VAL B CG2  1  
ATOM   1471  H  H    . VAL B 2 53  ? 9.115   -4.585  -18.927 1.00 0.00 ? 153 VAL B H    1  
ATOM   1472  H  HA   . VAL B 2 53  ? 11.334  -2.826  -18.944 1.00 0.00 ? 153 VAL B HA   1  
ATOM   1473  H  HB   . VAL B 2 53  ? 8.881   -2.685  -17.182 1.00 0.00 ? 153 VAL B HB   1  
ATOM   1474  H  HG11 . VAL B 2 53  ? 10.673  -1.229  -16.419 1.00 0.00 ? 153 VAL B HG11 1  
ATOM   1475  H  HG12 . VAL B 2 53  ? 9.361   -0.276  -17.115 1.00 0.00 ? 153 VAL B HG12 1  
ATOM   1476  H  HG13 . VAL B 2 53  ? 10.836  -0.553  -18.040 1.00 0.00 ? 153 VAL B HG13 1  
ATOM   1477  H  HG21 . VAL B 2 53  ? 7.681   -1.810  -18.884 1.00 0.00 ? 153 VAL B HG21 1  
ATOM   1478  H  HG22 . VAL B 2 53  ? 8.813   -2.733  -19.873 1.00 0.00 ? 153 VAL B HG22 1  
ATOM   1479  H  HG23 . VAL B 2 53  ? 9.080   -1.011  -19.602 1.00 0.00 ? 153 VAL B HG23 1  
ATOM   1480  N  N    . LEU B 2 54  ? 10.917  -4.692  -16.310 1.00 0.00 ? 154 LEU B N    1  
ATOM   1481  C  CA   . LEU B 2 54  ? 11.535  -5.159  -15.096 1.00 0.00 ? 154 LEU B CA   1  
ATOM   1482  C  C    . LEU B 2 54  ? 12.932  -5.681  -15.387 1.00 0.00 ? 154 LEU B C    1  
ATOM   1483  O  O    . LEU B 2 54  ? 13.893  -5.333  -14.703 1.00 0.00 ? 154 LEU B O    1  
ATOM   1484  C  CB   . LEU B 2 54  ? 10.665  -6.252  -14.492 1.00 0.00 ? 154 LEU B CB   1  
ATOM   1485  C  CG   . LEU B 2 54  ? 9.711   -5.784  -13.398 1.00 0.00 ? 154 LEU B CG   1  
ATOM   1486  C  CD1  . LEU B 2 54  ? 8.887   -6.951  -12.874 1.00 0.00 ? 154 LEU B CD1  1  
ATOM   1487  C  CD2  . LEU B 2 54  ? 10.479  -5.119  -12.267 1.00 0.00 ? 154 LEU B CD2  1  
ATOM   1488  H  H    . LEU B 2 54  ? 10.131  -5.168  -16.643 1.00 0.00 ? 154 LEU B H    1  
ATOM   1489  H  HA   . LEU B 2 54  ? 11.605  -4.333  -14.413 1.00 0.00 ? 154 LEU B HA   1  
ATOM   1490  H  HB2  . LEU B 2 54  ? 10.078  -6.690  -15.288 1.00 0.00 ? 154 LEU B HB2  1  
ATOM   1491  H  HB3  . LEU B 2 54  ? 11.304  -7.005  -14.091 1.00 0.00 ? 154 LEU B HB3  1  
ATOM   1492  H  HG   . LEU B 2 54  ? 9.032   -5.056  -13.817 1.00 0.00 ? 154 LEU B HG   1  
ATOM   1493  H  HD11 . LEU B 2 54  ? 9.478   -7.854  -12.908 1.00 0.00 ? 154 LEU B HD11 1  
ATOM   1494  H  HD12 . LEU B 2 54  ? 8.006   -7.073  -13.487 1.00 0.00 ? 154 LEU B HD12 1  
ATOM   1495  H  HD13 . LEU B 2 54  ? 8.589   -6.753  -11.855 1.00 0.00 ? 154 LEU B HD13 1  
ATOM   1496  H  HD21 . LEU B 2 54  ? 11.336  -5.723  -12.009 1.00 0.00 ? 154 LEU B HD21 1  
ATOM   1497  H  HD22 . LEU B 2 54  ? 9.837   -5.019  -11.403 1.00 0.00 ? 154 LEU B HD22 1  
ATOM   1498  H  HD23 . LEU B 2 54  ? 10.812  -4.141  -12.583 1.00 0.00 ? 154 LEU B HD23 1  
ATOM   1499  N  N    . ASN B 2 55  ? 13.036  -6.503  -16.424 1.00 0.00 ? 155 ASN B N    1  
ATOM   1500  C  CA   . ASN B 2 55  ? 14.320  -7.062  -16.830 1.00 0.00 ? 155 ASN B CA   1  
ATOM   1501  C  C    . ASN B 2 55  ? 15.304  -5.934  -17.116 1.00 0.00 ? 155 ASN B C    1  
ATOM   1502  O  O    . ASN B 2 55  ? 16.498  -6.044  -16.838 1.00 0.00 ? 155 ASN B O    1  
ATOM   1503  C  CB   . ASN B 2 55  ? 14.153  -7.943  -18.069 1.00 0.00 ? 155 ASN B CB   1  
ATOM   1504  C  CG   . ASN B 2 55  ? 13.916  -9.398  -17.717 1.00 0.00 ? 155 ASN B CG   1  
ATOM   1505  O  OD1  . ASN B 2 55  ? 14.590  -9.957  -16.852 1.00 0.00 ? 155 ASN B OD1  1  
ATOM   1506  N  ND2  . ASN B 2 55  ? 12.953  -10.021 -18.388 1.00 0.00 ? 155 ASN B ND2  1  
ATOM   1507  H  H    . ASN B 2 55  ? 12.231  -6.725  -16.935 1.00 0.00 ? 155 ASN B H    1  
ATOM   1508  H  HA   . ASN B 2 55  ? 14.698  -7.660  -16.014 1.00 0.00 ? 155 ASN B HA   1  
ATOM   1509  H  HB2  . ASN B 2 55  ? 13.310  -7.589  -18.644 1.00 0.00 ? 155 ASN B HB2  1  
ATOM   1510  H  HB3  . ASN B 2 55  ? 15.047  -7.877  -18.672 1.00 0.00 ? 155 ASN B HB3  1  
ATOM   1511  H  HD21 . ASN B 2 55  ? 12.458  -9.512  -19.064 1.00 0.00 ? 155 ASN B HD21 1  
ATOM   1512  H  HD22 . ASN B 2 55  ? 12.779  -10.962 -18.181 1.00 0.00 ? 155 ASN B HD22 1  
ATOM   1513  N  N    . HIS B 2 56  ? 14.779  -4.839  -17.657 1.00 0.00 ? 156 HIS B N    1  
ATOM   1514  C  CA   . HIS B 2 56  ? 15.584  -3.667  -17.969 1.00 0.00 ? 156 HIS B CA   1  
ATOM   1515  C  C    . HIS B 2 56  ? 16.153  -3.069  -16.696 1.00 0.00 ? 156 HIS B C    1  
ATOM   1516  O  O    . HIS B 2 56  ? 17.364  -3.042  -16.483 1.00 0.00 ? 156 HIS B O    1  
ATOM   1517  C  CB   . HIS B 2 56  ? 14.716  -2.622  -18.667 1.00 0.00 ? 156 HIS B CB   1  
ATOM   1518  C  CG   . HIS B 2 56  ? 15.404  -1.315  -18.925 1.00 0.00 ? 156 HIS B CG   1  
ATOM   1519  N  ND1  . HIS B 2 56  ? 16.728  -1.065  -18.633 1.00 0.00 ? 156 HIS B ND1  1  
ATOM   1520  C  CD2  . HIS B 2 56  ? 14.910  -0.160  -19.437 1.00 0.00 ? 156 HIS B CD2  1  
ATOM   1521  C  CE1  . HIS B 2 56  ? 16.986  0.209   -18.963 1.00 0.00 ? 156 HIS B CE1  1  
ATOM   1522  N  NE2  . HIS B 2 56  ? 15.918  0.799   -19.456 1.00 0.00 ? 156 HIS B NE2  1  
ATOM   1523  H  H    . HIS B 2 56  ? 13.813  -4.814  -17.840 1.00 0.00 ? 156 HIS B H    1  
ATOM   1524  H  HA   . HIS B 2 56  ? 16.390  -3.965  -18.622 1.00 0.00 ? 156 HIS B HA   1  
ATOM   1525  H  HB2  . HIS B 2 56  ? 14.386  -3.014  -19.607 1.00 0.00 ? 156 HIS B HB2  1  
ATOM   1526  H  HB3  . HIS B 2 56  ? 13.854  -2.420  -18.052 1.00 0.00 ? 156 HIS B HB3  1  
ATOM   1527  H  HD1  . HIS B 2 56  ? 17.369  -1.703  -18.259 1.00 0.00 ? 156 HIS B HD1  1  
ATOM   1528  H  HD2  . HIS B 2 56  ? 13.897  0.003   -19.773 1.00 0.00 ? 156 HIS B HD2  1  
ATOM   1529  H  HE1  . HIS B 2 56  ? 17.938  0.694   -18.827 1.00 0.00 ? 156 HIS B HE1  1  
ATOM   1530  N  N    . MET B 2 57  ? 15.249  -2.578  -15.862 1.00 0.00 ? 157 MET B N    1  
ATOM   1531  C  CA   . MET B 2 57  ? 15.615  -1.954  -14.592 1.00 0.00 ? 157 MET B CA   1  
ATOM   1532  C  C    . MET B 2 57  ? 16.683  -2.756  -13.851 1.00 0.00 ? 157 MET B C    1  
ATOM   1533  O  O    . MET B 2 57  ? 17.589  -2.186  -13.243 1.00 0.00 ? 157 MET B O    1  
ATOM   1534  C  CB   . MET B 2 57  ? 14.376  -1.810  -13.709 1.00 0.00 ? 157 MET B CB   1  
ATOM   1535  C  CG   . MET B 2 57  ? 14.446  -0.639  -12.743 1.00 0.00 ? 157 MET B CG   1  
ATOM   1536  S  SD   . MET B 2 57  ? 12.816  -0.092  -12.198 1.00 0.00 ? 157 MET B SD   1  
ATOM   1537  C  CE   . MET B 2 57  ? 11.998  -1.665  -11.937 1.00 0.00 ? 157 MET B CE   1  
ATOM   1538  H  H    . MET B 2 57  ? 14.300  -2.633  -16.116 1.00 0.00 ? 157 MET B H    1  
ATOM   1539  H  HA   . MET B 2 57  ? 16.007  -0.971  -14.809 1.00 0.00 ? 157 MET B HA   1  
ATOM   1540  H  HB2  . MET B 2 57  ? 13.513  -1.674  -14.343 1.00 0.00 ? 157 MET B HB2  1  
ATOM   1541  H  HB3  . MET B 2 57  ? 14.251  -2.716  -13.137 1.00 0.00 ? 157 MET B HB3  1  
ATOM   1542  H  HG2  . MET B 2 57  ? 15.016  -0.938  -11.877 1.00 0.00 ? 157 MET B HG2  1  
ATOM   1543  H  HG3  . MET B 2 57  ? 14.943  0.186   -13.232 1.00 0.00 ? 157 MET B HG3  1  
ATOM   1544  H  HE1  . MET B 2 57  ? 11.275  -1.567  -11.140 1.00 0.00 ? 157 MET B HE1  1  
ATOM   1545  H  HE2  . MET B 2 57  ? 12.732  -2.411  -11.667 1.00 0.00 ? 157 MET B HE2  1  
ATOM   1546  H  HE3  . MET B 2 57  ? 11.496  -1.964  -12.844 1.00 0.00 ? 157 MET B HE3  1  
ATOM   1547  N  N    . THR B 2 58  ? 16.571  -4.080  -13.903 1.00 0.00 ? 158 THR B N    1  
ATOM   1548  C  CA   . THR B 2 58  ? 17.531  -4.955  -13.233 1.00 0.00 ? 158 THR B CA   1  
ATOM   1549  C  C    . THR B 2 58  ? 18.955  -4.692  -13.719 1.00 0.00 ? 158 THR B C    1  
ATOM   1550  O  O    . THR B 2 58  ? 19.923  -5.047  -13.045 1.00 0.00 ? 158 THR B O    1  
ATOM   1551  C  CB   . THR B 2 58  ? 17.165  -6.424  -13.460 1.00 0.00 ? 158 THR B CB   1  
ATOM   1552  O  OG1  . THR B 2 58  ? 15.904  -6.541  -14.092 1.00 0.00 ? 158 THR B OG1  1  
ATOM   1553  C  CG2  . THR B 2 58  ? 17.111  -7.230  -12.181 1.00 0.00 ? 158 THR B CG2  1  
ATOM   1554  H  H    . THR B 2 58  ? 15.828  -4.478  -14.401 1.00 0.00 ? 158 THR B H    1  
ATOM   1555  H  HA   . THR B 2 58  ? 17.483  -4.745  -12.174 1.00 0.00 ? 158 THR B HA   1  
ATOM   1556  H  HB   . THR B 2 58  ? 17.908  -6.875  -14.102 1.00 0.00 ? 158 THR B HB   1  
ATOM   1557  H  HG1  . THR B 2 58  ? 15.219  -6.220  -13.501 1.00 0.00 ? 158 THR B HG1  1  
ATOM   1558  H  HG21 . THR B 2 58  ? 18.040  -7.766  -12.053 1.00 0.00 ? 158 THR B HG21 1  
ATOM   1559  H  HG22 . THR B 2 58  ? 16.292  -7.933  -12.232 1.00 0.00 ? 158 THR B HG22 1  
ATOM   1560  H  HG23 . THR B 2 58  ? 16.962  -6.565  -11.343 1.00 0.00 ? 158 THR B HG23 1  
ATOM   1561  N  N    . HIS B 2 59  ? 19.079  -4.067  -14.886 1.00 0.00 ? 159 HIS B N    1  
ATOM   1562  C  CA   . HIS B 2 59  ? 20.383  -3.756  -15.451 1.00 0.00 ? 159 HIS B CA   1  
ATOM   1563  C  C    . HIS B 2 59  ? 20.497  -2.266  -15.757 1.00 0.00 ? 159 HIS B C    1  
ATOM   1564  O  O    . HIS B 2 59  ? 21.365  -1.841  -16.518 1.00 0.00 ? 159 HIS B O    1  
ATOM   1565  C  CB   . HIS B 2 59  ? 20.619  -4.573  -16.723 1.00 0.00 ? 159 HIS B CB   1  
ATOM   1566  C  CG   . HIS B 2 59  ? 22.010  -5.115  -16.834 1.00 0.00 ? 159 HIS B CG   1  
ATOM   1567  N  ND1  . HIS B 2 59  ? 23.135  -4.318  -16.777 1.00 0.00 ? 159 HIS B ND1  1  
ATOM   1568  C  CD2  . HIS B 2 59  ? 22.457  -6.383  -17.000 1.00 0.00 ? 159 HIS B CD2  1  
ATOM   1569  C  CE1  . HIS B 2 59  ? 24.212  -5.072  -16.903 1.00 0.00 ? 159 HIS B CE1  1  
ATOM   1570  N  NE2  . HIS B 2 59  ? 23.829  -6.328  -17.039 1.00 0.00 ? 159 HIS B NE2  1  
ATOM   1571  H  H    . HIS B 2 59  ? 18.277  -3.803  -15.376 1.00 0.00 ? 159 HIS B H    1  
ATOM   1572  H  HA   . HIS B 2 59  ? 21.126  -4.019  -14.720 1.00 0.00 ? 159 HIS B HA   1  
ATOM   1573  H  HB2  . HIS B 2 59  ? 19.936  -5.409  -16.737 1.00 0.00 ? 159 HIS B HB2  1  
ATOM   1574  H  HB3  . HIS B 2 59  ? 20.435  -3.948  -17.585 1.00 0.00 ? 159 HIS B HB3  1  
ATOM   1575  H  HD1  . HIS B 2 59  ? 23.142  -3.345  -16.661 1.00 0.00 ? 159 HIS B HD1  1  
ATOM   1576  H  HD2  . HIS B 2 59  ? 21.847  -7.271  -17.086 1.00 0.00 ? 159 HIS B HD2  1  
ATOM   1577  H  HE1  . HIS B 2 59  ? 25.234  -4.721  -16.896 1.00 0.00 ? 159 HIS B HE1  1  
ATOM   1578  H  HE2  . HIS B 2 59  ? 24.423  -7.083  -17.232 1.00 0.00 ? 159 HIS B HE2  1  
ATOM   1579  N  N    . CYS B 2 60  ? 19.610  -1.479  -15.156 1.00 0.00 ? 160 CYS B N    1  
ATOM   1580  C  CA   . CYS B 2 60  ? 19.599  -0.038  -15.354 1.00 0.00 ? 160 CYS B CA   1  
ATOM   1581  C  C    . CYS B 2 60  ? 20.142  0.679   -14.121 1.00 0.00 ? 160 CYS B C    1  
ATOM   1582  O  O    . CYS B 2 60  ? 19.419  1.410   -13.444 1.00 0.00 ? 160 CYS B O    1  
ATOM   1583  C  CB   . CYS B 2 60  ? 18.175  0.429   -15.655 1.00 0.00 ? 160 CYS B CB   1  
ATOM   1584  S  SG   . CYS B 2 60  ? 18.044  2.191   -16.101 1.00 0.00 ? 160 CYS B SG   1  
ATOM   1585  H  H    . CYS B 2 60  ? 18.943  -1.878  -14.562 1.00 0.00 ? 160 CYS B H    1  
ATOM   1586  H  HA   . CYS B 2 60  ? 20.232  0.189   -16.200 1.00 0.00 ? 160 CYS B HA   1  
ATOM   1587  H  HB2  . CYS B 2 60  ? 17.780  -0.150  -16.475 1.00 0.00 ? 160 CYS B HB2  1  
ATOM   1588  H  HB3  . CYS B 2 60  ? 17.562  0.261   -14.784 1.00 0.00 ? 160 CYS B HB3  1  
ATOM   1589  N  N    . GLN B 2 61  ? 21.419  0.456   -13.832 1.00 0.00 ? 161 GLN B N    1  
ATOM   1590  C  CA   . GLN B 2 61  ? 22.065  1.069   -12.675 1.00 0.00 ? 161 GLN B CA   1  
ATOM   1591  C  C    . GLN B 2 61  ? 22.018  2.596   -12.751 1.00 0.00 ? 161 GLN B C    1  
ATOM   1592  O  O    . GLN B 2 61  ? 22.185  3.277   -11.740 1.00 0.00 ? 161 GLN B O    1  
ATOM   1593  C  CB   . GLN B 2 61  ? 23.517  0.594   -12.567 1.00 0.00 ? 161 GLN B CB   1  
ATOM   1594  C  CG   . GLN B 2 61  ? 23.818  -0.145  -11.275 1.00 0.00 ? 161 GLN B CG   1  
ATOM   1595  C  CD   . GLN B 2 61  ? 25.189  0.185   -10.719 1.00 0.00 ? 161 GLN B CD   1  
ATOM   1596  O  OE1  . GLN B 2 61  ? 25.978  0.881   -11.357 1.00 0.00 ? 161 GLN B OE1  1  
ATOM   1597  N  NE2  . GLN B 2 61  ? 25.481  -0.317  -9.524  1.00 0.00 ? 161 GLN B NE2  1  
ATOM   1598  H  H    . GLN B 2 61  ? 21.941  -0.142  -14.406 1.00 0.00 ? 161 GLN B H    1  
ATOM   1599  H  HA   . GLN B 2 61  ? 21.530  0.752   -11.794 1.00 0.00 ? 161 GLN B HA   1  
ATOM   1600  H  HB2  . GLN B 2 61  ? 23.728  -0.068  -13.393 1.00 0.00 ? 161 GLN B HB2  1  
ATOM   1601  H  HB3  . GLN B 2 61  ? 24.172  1.451   -12.627 1.00 0.00 ? 161 GLN B HB3  1  
ATOM   1602  H  HG2  . GLN B 2 61  ? 23.075  0.123   -10.538 1.00 0.00 ? 161 GLN B HG2  1  
ATOM   1603  H  HG3  . GLN B 2 61  ? 23.768  -1.208  -11.462 1.00 0.00 ? 161 GLN B HG3  1  
ATOM   1604  H  HE21 . GLN B 2 61  ? 24.803  -0.863  -9.074  1.00 0.00 ? 161 GLN B HE21 1  
ATOM   1605  H  HE22 . GLN B 2 61  ? 26.360  -0.118  -9.141  1.00 0.00 ? 161 GLN B HE22 1  
ATOM   1606  N  N    . SER B 2 62  ? 21.791  3.128   -13.948 1.00 0.00 ? 162 SER B N    1  
ATOM   1607  C  CA   . SER B 2 62  ? 21.725  4.571   -14.136 1.00 0.00 ? 162 SER B CA   1  
ATOM   1608  C  C    . SER B 2 62  ? 20.530  5.156   -13.391 1.00 0.00 ? 162 SER B C    1  
ATOM   1609  O  O    . SER B 2 62  ? 20.690  5.918   -12.438 1.00 0.00 ? 162 SER B O    1  
ATOM   1610  C  CB   . SER B 2 62  ? 21.629  4.908   -15.625 1.00 0.00 ? 162 SER B CB   1  
ATOM   1611  O  OG   . SER B 2 62  ? 21.354  6.285   -15.821 1.00 0.00 ? 162 SER B OG   1  
ATOM   1612  H  H    . SER B 2 62  ? 21.663  2.540   -14.719 1.00 0.00 ? 162 SER B H    1  
ATOM   1613  H  HA   . SER B 2 62  ? 22.630  5.001   -13.734 1.00 0.00 ? 162 SER B HA   1  
ATOM   1614  H  HB2  . SER B 2 62  ? 22.565  4.670   -16.107 1.00 0.00 ? 162 SER B HB2  1  
ATOM   1615  H  HB3  . SER B 2 62  ? 20.835  4.329   -16.072 1.00 0.00 ? 162 SER B HB3  1  
ATOM   1616  H  HG   . SER B 2 62  ? 20.987  6.416   -16.698 1.00 0.00 ? 162 SER B HG   1  
ATOM   1617  N  N    . GLY B 2 63  ? 19.333  4.787   -13.832 1.00 0.00 ? 163 GLY B N    1  
ATOM   1618  C  CA   . GLY B 2 63  ? 18.125  5.277   -13.201 1.00 0.00 ? 163 GLY B CA   1  
ATOM   1619  C  C    . GLY B 2 63  ? 17.973  6.776   -13.314 1.00 0.00 ? 163 GLY B C    1  
ATOM   1620  O  O    . GLY B 2 63  ? 18.833  7.536   -12.870 1.00 0.00 ? 163 GLY B O    1  
ATOM   1621  H  H    . GLY B 2 63  ? 19.269  4.178   -14.596 1.00 0.00 ? 163 GLY B H    1  
ATOM   1622  H  HA2  . GLY B 2 63  ? 17.275  4.807   -13.673 1.00 0.00 ? 163 GLY B HA2  1  
ATOM   1623  H  HA3  . GLY B 2 63  ? 18.135  5.008   -12.161 1.00 0.00 ? 163 GLY B HA3  1  
ATOM   1624  N  N    . LYS B 2 64  ? 16.866  7.188   -13.913 1.00 0.00 ? 164 LYS B N    1  
ATOM   1625  C  CA   . LYS B 2 64  ? 16.547  8.604   -14.110 1.00 0.00 ? 164 LYS B CA   1  
ATOM   1626  C  C    . LYS B 2 64  ? 17.218  9.157   -15.361 1.00 0.00 ? 164 LYS B C    1  
ATOM   1627  O  O    . LYS B 2 64  ? 16.598  9.877   -16.144 1.00 0.00 ? 164 LYS B O    1  
ATOM   1628  C  CB   . LYS B 2 64  ? 16.950  9.434   -12.888 1.00 0.00 ? 164 LYS B CB   1  
ATOM   1629  C  CG   . LYS B 2 64  ? 16.079  10.660  -12.669 1.00 0.00 ? 164 LYS B CG   1  
ATOM   1630  C  CD   . LYS B 2 64  ? 16.641  11.556  -11.577 1.00 0.00 ? 164 LYS B CD   1  
ATOM   1631  C  CE   . LYS B 2 64  ? 15.765  12.778  -11.354 1.00 0.00 ? 164 LYS B CE   1  
ATOM   1632  N  NZ   . LYS B 2 64  ? 16.229  13.948  -12.150 1.00 0.00 ? 164 LYS B NZ   1  
ATOM   1633  H  H    . LYS B 2 64  ? 16.240  6.511   -14.234 1.00 0.00 ? 164 LYS B H    1  
ATOM   1634  H  HA   . LYS B 2 64  ? 15.482  8.678   -14.240 1.00 0.00 ? 164 LYS B HA   1  
ATOM   1635  H  HB2  . LYS B 2 64  ? 16.884  8.810   -12.008 1.00 0.00 ? 164 LYS B HB2  1  
ATOM   1636  H  HB3  . LYS B 2 64  ? 17.972  9.761   -13.010 1.00 0.00 ? 164 LYS B HB3  1  
ATOM   1637  H  HG2  . LYS B 2 64  ? 16.028  11.222  -13.590 1.00 0.00 ? 164 LYS B HG2  1  
ATOM   1638  H  HG3  . LYS B 2 64  ? 15.088  10.339  -12.386 1.00 0.00 ? 164 LYS B HG3  1  
ATOM   1639  H  HD2  . LYS B 2 64  ? 16.697  10.994  -10.657 1.00 0.00 ? 164 LYS B HD2  1  
ATOM   1640  H  HD3  . LYS B 2 64  ? 17.631  11.880  -11.864 1.00 0.00 ? 164 LYS B HD3  1  
ATOM   1641  H  HE2  . LYS B 2 64  ? 14.752  12.537  -11.643 1.00 0.00 ? 164 LYS B HE2  1  
ATOM   1642  H  HE3  . LYS B 2 64  ? 15.788  13.035  -10.305 1.00 0.00 ? 164 LYS B HE3  1  
ATOM   1643  H  HZ1  . LYS B 2 64  ? 17.212  14.181  -11.903 1.00 0.00 ? 164 LYS B HZ1  1  
ATOM   1644  H  HZ2  . LYS B 2 64  ? 15.629  14.774  -11.955 1.00 0.00 ? 164 LYS B HZ2  1  
ATOM   1645  H  HZ3  . LYS B 2 64  ? 16.181  13.731  -13.166 1.00 0.00 ? 164 LYS B HZ3  1  
ATOM   1646  N  N    . SER B 2 65  ? 18.482  8.813   -15.545 1.00 0.00 ? 165 SER B N    1  
ATOM   1647  C  CA   . SER B 2 65  ? 19.240  9.269   -16.703 1.00 0.00 ? 165 SER B CA   1  
ATOM   1648  C  C    . SER B 2 65  ? 19.465  8.127   -17.688 1.00 0.00 ? 165 SER B C    1  
ATOM   1649  O  O    . SER B 2 65  ? 20.402  8.159   -18.487 1.00 0.00 ? 165 SER B O    1  
ATOM   1650  C  CB   . SER B 2 65  ? 20.584  9.851   -16.263 1.00 0.00 ? 165 SER B CB   1  
ATOM   1651  O  OG   . SER B 2 65  ? 20.405  11.035  -15.503 1.00 0.00 ? 165 SER B OG   1  
ATOM   1652  H  H    . SER B 2 65  ? 18.914  8.235   -14.887 1.00 0.00 ? 165 SER B H    1  
ATOM   1653  H  HA   . SER B 2 65  ? 18.666  10.043  -17.191 1.00 0.00 ? 165 SER B HA   1  
ATOM   1654  H  HB2  . SER B 2 65  ? 21.108  9.126   -15.657 1.00 0.00 ? 165 SER B HB2  1  
ATOM   1655  H  HB3  . SER B 2 65  ? 21.177  10.084  -17.136 1.00 0.00 ? 165 SER B HB3  1  
ATOM   1656  H  HG   . SER B 2 65  ? 20.835  10.936  -14.651 1.00 0.00 ? 165 SER B HG   1  
ATOM   1657  N  N    . CYS B 2 66  ? 18.601  7.118   -17.626 1.00 0.00 ? 166 CYS B N    1  
ATOM   1658  C  CA   . CYS B 2 66  ? 18.701  5.969   -18.506 1.00 0.00 ? 166 CYS B CA   1  
ATOM   1659  C  C    . CYS B 2 66  ? 18.179  6.313   -19.899 1.00 0.00 ? 166 CYS B C    1  
ATOM   1660  O  O    . CYS B 2 66  ? 18.052  7.486   -20.249 1.00 0.00 ? 166 CYS B O    1  
ATOM   1661  C  CB   . CYS B 2 66  ? 17.916  4.802   -17.910 1.00 0.00 ? 166 CYS B CB   1  
ATOM   1662  S  SG   . CYS B 2 66  ? 18.685  3.169   -18.165 1.00 0.00 ? 166 CYS B SG   1  
ATOM   1663  H  H    . CYS B 2 66  ? 17.876  7.146   -16.973 1.00 0.00 ? 166 CYS B H    1  
ATOM   1664  H  HA   . CYS B 2 66  ? 19.741  5.696   -18.578 1.00 0.00 ? 166 CYS B HA   1  
ATOM   1665  H  HB2  . CYS B 2 66  ? 17.819  4.953   -16.845 1.00 0.00 ? 166 CYS B HB2  1  
ATOM   1666  H  HB3  . CYS B 2 66  ? 16.933  4.781   -18.352 1.00 0.00 ? 166 CYS B HB3  1  
ATOM   1667  N  N    . GLN B 2 67  ? 17.877  5.290   -20.693 1.00 0.00 ? 167 GLN B N    1  
ATOM   1668  C  CA   . GLN B 2 67  ? 17.371  5.500   -22.044 1.00 0.00 ? 167 GLN B CA   1  
ATOM   1669  C  C    . GLN B 2 67  ? 15.955  4.947   -22.203 1.00 0.00 ? 167 GLN B C    1  
ATOM   1670  O  O    . GLN B 2 67  ? 15.463  4.799   -23.321 1.00 0.00 ? 167 GLN B O    1  
ATOM   1671  C  CB   . GLN B 2 67  ? 18.302  4.842   -23.065 1.00 0.00 ? 167 GLN B CB   1  
ATOM   1672  C  CG   . GLN B 2 67  ? 19.714  5.405   -23.050 1.00 0.00 ? 167 GLN B CG   1  
ATOM   1673  C  CD   . GLN B 2 67  ? 20.771  4.331   -23.212 1.00 0.00 ? 167 GLN B CD   1  
ATOM   1674  O  OE1  . GLN B 2 67  ? 21.725  4.259   -22.438 1.00 0.00 ? 167 GLN B OE1  1  
ATOM   1675  N  NE2  . GLN B 2 67  ? 20.606  3.486   -24.225 1.00 0.00 ? 167 GLN B NE2  1  
ATOM   1676  H  H    . GLN B 2 67  ? 17.997  4.377   -20.365 1.00 0.00 ? 167 GLN B H    1  
ATOM   1677  H  HA   . GLN B 2 67  ? 17.348  6.563   -22.227 1.00 0.00 ? 167 GLN B HA   1  
ATOM   1678  H  HB2  . GLN B 2 67  ? 18.356  3.784   -22.856 1.00 0.00 ? 167 GLN B HB2  1  
ATOM   1679  H  HB3  . GLN B 2 67  ? 17.891  4.985   -24.054 1.00 0.00 ? 167 GLN B HB3  1  
ATOM   1680  H  HG2  . GLN B 2 67  ? 19.815  6.113   -23.859 1.00 0.00 ? 167 GLN B HG2  1  
ATOM   1681  H  HG3  . GLN B 2 67  ? 19.876  5.909   -22.109 1.00 0.00 ? 167 GLN B HG3  1  
ATOM   1682  H  HE21 . GLN B 2 67  ? 19.822  3.603   -24.801 1.00 0.00 ? 167 GLN B HE21 1  
ATOM   1683  H  HE22 . GLN B 2 67  ? 21.275  2.781   -24.353 1.00 0.00 ? 167 GLN B HE22 1  
ATOM   1684  N  N    . VAL B 2 68  ? 15.302  4.643   -21.083 1.00 0.00 ? 168 VAL B N    1  
ATOM   1685  C  CA   . VAL B 2 68  ? 13.961  4.114   -21.106 1.00 0.00 ? 168 VAL B CA   1  
ATOM   1686  C  C    . VAL B 2 68  ? 13.080  4.875   -20.129 1.00 0.00 ? 168 VAL B C    1  
ATOM   1687  O  O    . VAL B 2 68  ? 13.479  5.167   -19.002 1.00 0.00 ? 168 VAL B O    1  
ATOM   1688  C  CB   . VAL B 2 68  ? 13.964  2.625   -20.740 1.00 0.00 ? 168 VAL B CB   1  
ATOM   1689  C  CG1  . VAL B 2 68  ? 12.544  2.077   -20.638 1.00 0.00 ? 168 VAL B CG1  1  
ATOM   1690  C  CG2  . VAL B 2 68  ? 14.776  1.835   -21.756 1.00 0.00 ? 168 VAL B CG2  1  
ATOM   1691  H  H    . VAL B 2 68  ? 15.728  4.774   -20.219 1.00 0.00 ? 168 VAL B H    1  
ATOM   1692  H  HA   . VAL B 2 68  ? 13.567  4.224   -22.105 1.00 0.00 ? 168 VAL B HA   1  
ATOM   1693  H  HB   . VAL B 2 68  ? 14.441  2.530   -19.777 1.00 0.00 ? 168 VAL B HB   1  
ATOM   1694  H  HG11 . VAL B 2 68  ? 11.837  2.864   -20.855 1.00 0.00 ? 168 VAL B HG11 1  
ATOM   1695  H  HG12 . VAL B 2 68  ? 12.372  1.706   -19.639 1.00 0.00 ? 168 VAL B HG12 1  
ATOM   1696  H  HG13 . VAL B 2 68  ? 12.415  1.273   -21.347 1.00 0.00 ? 168 VAL B HG13 1  
ATOM   1697  H  HG21 . VAL B 2 68  ? 15.827  1.919   -21.521 1.00 0.00 ? 168 VAL B HG21 1  
ATOM   1698  H  HG22 . VAL B 2 68  ? 14.596  2.228   -22.745 1.00 0.00 ? 168 VAL B HG22 1  
ATOM   1699  H  HG23 . VAL B 2 68  ? 14.482  0.796   -21.722 1.00 0.00 ? 168 VAL B HG23 1  
ATOM   1700  N  N    . ALA B 2 69  ? 11.887  5.191   -20.581 1.00 0.00 ? 169 ALA B N    1  
ATOM   1701  C  CA   . ALA B 2 69  ? 10.923  5.923   -19.772 1.00 0.00 ? 169 ALA B CA   1  
ATOM   1702  C  C    . ALA B 2 69  ? 10.345  5.037   -18.677 1.00 0.00 ? 169 ALA B C    1  
ATOM   1703  O  O    . ALA B 2 69  ? 10.346  5.402   -17.502 1.00 0.00 ? 169 ALA B O    1  
ATOM   1704  C  CB   . ALA B 2 69  ? 9.809   6.470   -20.651 1.00 0.00 ? 169 ALA B CB   1  
ATOM   1705  H  H    . ALA B 2 69  ? 11.651  4.923   -21.486 1.00 0.00 ? 169 ALA B H    1  
ATOM   1706  H  HA   . ALA B 2 69  ? 11.434  6.759   -19.316 1.00 0.00 ? 169 ALA B HA   1  
ATOM   1707  H  HB1  . ALA B 2 69  ? 9.643   5.798   -21.481 1.00 0.00 ? 169 ALA B HB1  1  
ATOM   1708  H  HB2  . ALA B 2 69  ? 10.089  7.443   -21.025 1.00 0.00 ? 169 ALA B HB2  1  
ATOM   1709  H  HB3  . ALA B 2 69  ? 8.901   6.555   -20.071 1.00 0.00 ? 169 ALA B HB3  1  
ATOM   1710  N  N    . HIS B 2 70  ? 9.845   3.875   -19.077 1.00 0.00 ? 170 HIS B N    1  
ATOM   1711  C  CA   . HIS B 2 70  ? 9.255   2.935   -18.142 1.00 0.00 ? 170 HIS B CA   1  
ATOM   1712  C  C    . HIS B 2 70  ? 10.280  2.423   -17.135 1.00 0.00 ? 170 HIS B C    1  
ATOM   1713  O  O    . HIS B 2 70  ? 9.914   1.882   -16.092 1.00 0.00 ? 170 HIS B O    1  
ATOM   1714  C  CB   . HIS B 2 70  ? 8.628   1.764   -18.898 1.00 0.00 ? 170 HIS B CB   1  
ATOM   1715  C  CG   . HIS B 2 70  ? 7.494   2.175   -19.784 1.00 0.00 ? 170 HIS B CG   1  
ATOM   1716  N  ND1  . HIS B 2 70  ? 6.322   2.719   -19.303 1.00 0.00 ? 170 HIS B ND1  1  
ATOM   1717  C  CD2  . HIS B 2 70  ? 7.361   2.127   -21.130 1.00 0.00 ? 170 HIS B CD2  1  
ATOM   1718  C  CE1  . HIS B 2 70  ? 5.517   2.989   -20.315 1.00 0.00 ? 170 HIS B CE1  1  
ATOM   1719  N  NE2  . HIS B 2 70  ? 6.124   2.640   -21.434 1.00 0.00 ? 170 HIS B NE2  1  
ATOM   1720  H  H    . HIS B 2 70  ? 9.866   3.647   -20.023 1.00 0.00 ? 170 HIS B H    1  
ATOM   1721  H  HA   . HIS B 2 70  ? 8.480   3.458   -17.612 1.00 0.00 ? 170 HIS B HA   1  
ATOM   1722  H  HB2  . HIS B 2 70  ? 9.381   1.297   -19.514 1.00 0.00 ? 170 HIS B HB2  1  
ATOM   1723  H  HB3  . HIS B 2 70  ? 8.252   1.044   -18.185 1.00 0.00 ? 170 HIS B HB3  1  
ATOM   1724  H  HD1  . HIS B 2 70  ? 6.113   2.883   -18.360 1.00 0.00 ? 170 HIS B HD1  1  
ATOM   1725  H  HD2  . HIS B 2 70  ? 8.091   1.755   -21.833 1.00 0.00 ? 170 HIS B HD2  1  
ATOM   1726  H  HE1  . HIS B 2 70  ? 4.526   3.414   -20.239 1.00 0.00 ? 170 HIS B HE1  1  
ATOM   1727  H  HE2  . HIS B 2 70  ? 5.712   2.642   -22.324 1.00 0.00 ? 170 HIS B HE2  1  
ATOM   1728  N  N    . CYS B 2 71  ? 11.565  2.596   -17.440 1.00 0.00 ? 171 CYS B N    1  
ATOM   1729  C  CA   . CYS B 2 71  ? 12.619  2.145   -16.540 1.00 0.00 ? 171 CYS B CA   1  
ATOM   1730  C  C    . CYS B 2 71  ? 12.754  3.094   -15.364 1.00 0.00 ? 171 CYS B C    1  
ATOM   1731  O  O    . CYS B 2 71  ? 12.423  2.754   -14.229 1.00 0.00 ? 171 CYS B O    1  
ATOM   1732  C  CB   . CYS B 2 71  ? 13.949  2.055   -17.284 1.00 0.00 ? 171 CYS B CB   1  
ATOM   1733  S  SG   . CYS B 2 71  ? 15.167  0.957   -16.490 1.00 0.00 ? 171 CYS B SG   1  
ATOM   1734  H  H    . CYS B 2 71  ? 11.811  3.037   -18.285 1.00 0.00 ? 171 CYS B H    1  
ATOM   1735  H  HA   . CYS B 2 71  ? 12.352  1.169   -16.174 1.00 0.00 ? 171 CYS B HA   1  
ATOM   1736  H  HB2  . CYS B 2 71  ? 13.767  1.688   -18.273 1.00 0.00 ? 171 CYS B HB2  1  
ATOM   1737  H  HB3  . CYS B 2 71  ? 14.388  3.038   -17.354 1.00 0.00 ? 171 CYS B HB3  1  
ATOM   1738  N  N    . ALA B 2 72  ? 13.241  4.288   -15.653 1.00 0.00 ? 172 ALA B N    1  
ATOM   1739  C  CA   . ALA B 2 72  ? 13.424  5.309   -14.629 1.00 0.00 ? 172 ALA B CA   1  
ATOM   1740  C  C    . ALA B 2 72  ? 12.114  5.590   -13.899 1.00 0.00 ? 172 ALA B C    1  
ATOM   1741  O  O    . ALA B 2 72  ? 12.079  5.668   -12.669 1.00 0.00 ? 172 ALA B O    1  
ATOM   1742  C  CB   . ALA B 2 72  ? 13.971  6.587   -15.246 1.00 0.00 ? 172 ALA B CB   1  
ATOM   1743  H  H    . ALA B 2 72  ? 13.482  4.484   -16.585 1.00 0.00 ? 172 ALA B H    1  
ATOM   1744  H  HA   . ALA B 2 72  ? 14.148  4.941   -13.917 1.00 0.00 ? 172 ALA B HA   1  
ATOM   1745  H  HB1  . ALA B 2 72  ? 14.093  7.334   -14.476 1.00 0.00 ? 172 ALA B HB1  1  
ATOM   1746  H  HB2  . ALA B 2 72  ? 13.281  6.951   -15.993 1.00 0.00 ? 172 ALA B HB2  1  
ATOM   1747  H  HB3  . ALA B 2 72  ? 14.926  6.385   -15.707 1.00 0.00 ? 172 ALA B HB3  1  
ATOM   1748  N  N    . SER B 2 73  ? 11.037  5.738   -14.663 1.00 0.00 ? 173 SER B N    1  
ATOM   1749  C  CA   . SER B 2 73  ? 9.723   6.007   -14.091 1.00 0.00 ? 173 SER B CA   1  
ATOM   1750  C  C    . SER B 2 73  ? 9.321   4.905   -13.116 1.00 0.00 ? 173 SER B C    1  
ATOM   1751  O  O    . SER B 2 73  ? 9.021   5.171   -11.952 1.00 0.00 ? 173 SER B O    1  
ATOM   1752  C  CB   . SER B 2 73  ? 8.675   6.132   -15.198 1.00 0.00 ? 173 SER B CB   1  
ATOM   1753  O  OG   . SER B 2 73  ? 7.418   6.515   -14.669 1.00 0.00 ? 173 SER B OG   1  
ATOM   1754  H  H    . SER B 2 73  ? 11.128  5.662   -15.636 1.00 0.00 ? 173 SER B H    1  
ATOM   1755  H  HA   . SER B 2 73  ? 9.781   6.942   -13.555 1.00 0.00 ? 173 SER B HA   1  
ATOM   1756  H  HB2  . SER B 2 73  ? 8.994   6.878   -15.911 1.00 0.00 ? 173 SER B HB2  1  
ATOM   1757  H  HB3  . SER B 2 73  ? 8.567   5.180   -15.697 1.00 0.00 ? 173 SER B HB3  1  
ATOM   1758  H  HG   . SER B 2 73  ? 6.898   5.731   -14.479 1.00 0.00 ? 173 SER B HG   1  
ATOM   1759  N  N    . SER B 2 74  ? 9.322   3.666   -13.598 1.00 0.00 ? 174 SER B N    1  
ATOM   1760  C  CA   . SER B 2 74  ? 8.960   2.521   -12.768 1.00 0.00 ? 174 SER B CA   1  
ATOM   1761  C  C    . SER B 2 74  ? 9.841   2.450   -11.526 1.00 0.00 ? 174 SER B C    1  
ATOM   1762  O  O    . SER B 2 74  ? 9.398   2.014   -10.463 1.00 0.00 ? 174 SER B O    1  
ATOM   1763  C  CB   . SER B 2 74  ? 9.084   1.224   -13.569 1.00 0.00 ? 174 SER B CB   1  
ATOM   1764  O  OG   . SER B 2 74  ? 8.845   0.092   -12.749 1.00 0.00 ? 174 SER B OG   1  
ATOM   1765  H  H    . SER B 2 74  ? 9.574   3.516   -14.533 1.00 0.00 ? 174 SER B H    1  
ATOM   1766  H  HA   . SER B 2 74  ? 7.933   2.647   -12.459 1.00 0.00 ? 174 SER B HA   1  
ATOM   1767  H  HB2  . SER B 2 74  ? 8.361   1.228   -14.371 1.00 0.00 ? 174 SER B HB2  1  
ATOM   1768  H  HB3  . SER B 2 74  ? 10.080  1.151   -13.981 1.00 0.00 ? 174 SER B HB3  1  
ATOM   1769  H  HG   . SER B 2 74  ? 8.196   -0.476  -13.168 1.00 0.00 ? 174 SER B HG   1  
ATOM   1770  N  N    . ARG B 2 75  ? 11.089  2.882   -11.666 1.00 0.00 ? 175 ARG B N    1  
ATOM   1771  C  CA   . ARG B 2 75  ? 12.029  2.869   -10.552 1.00 0.00 ? 175 ARG B CA   1  
ATOM   1772  C  C    . ARG B 2 75  ? 11.540  3.768   -9.422  1.00 0.00 ? 175 ARG B C    1  
ATOM   1773  O  O    . ARG B 2 75  ? 11.673  3.433   -8.247  1.00 0.00 ? 175 ARG B O    1  
ATOM   1774  C  CB   . ARG B 2 75  ? 13.414  3.323   -11.019 1.00 0.00 ? 175 ARG B CB   1  
ATOM   1775  C  CG   . ARG B 2 75  ? 14.522  3.019   -10.022 1.00 0.00 ? 175 ARG B CG   1  
ATOM   1776  C  CD   . ARG B 2 75  ? 15.415  4.228   -9.793  1.00 0.00 ? 175 ARG B CD   1  
ATOM   1777  N  NE   . ARG B 2 75  ? 14.719  5.294   -9.077  1.00 0.00 ? 175 ARG B NE   1  
ATOM   1778  C  CZ   . ARG B 2 75  ? 15.259  6.479   -8.803  1.00 0.00 ? 175 ARG B CZ   1  
ATOM   1779  N  NH1  . ARG B 2 75  ? 16.500  6.755   -9.186  1.00 0.00 ? 175 ARG B NH1  1  
ATOM   1780  N  NH2  . ARG B 2 75  ? 14.556  7.391   -8.146  1.00 0.00 ? 175 ARG B NH2  1  
ATOM   1781  H  H    . ARG B 2 75  ? 11.386  3.221   -12.537 1.00 0.00 ? 175 ARG B H    1  
ATOM   1782  H  HA   . ARG B 2 75  ? 12.096  1.855   -10.186 1.00 0.00 ? 175 ARG B HA   1  
ATOM   1783  H  HB2  . ARG B 2 75  ? 13.648  2.823   -11.948 1.00 0.00 ? 175 ARG B HB2  1  
ATOM   1784  H  HB3  . ARG B 2 75  ? 13.393  4.389   -11.189 1.00 0.00 ? 175 ARG B HB3  1  
ATOM   1785  H  HG2  . ARG B 2 75  ? 14.077  2.730   -9.082  1.00 0.00 ? 175 ARG B HG2  1  
ATOM   1786  H  HG3  . ARG B 2 75  ? 15.122  2.205   -10.403 1.00 0.00 ? 175 ARG B HG3  1  
ATOM   1787  H  HD2  . ARG B 2 75  ? 16.274  3.920   -9.215  1.00 0.00 ? 175 ARG B HD2  1  
ATOM   1788  H  HD3  . ARG B 2 75  ? 15.742  4.604   -10.751 1.00 0.00 ? 175 ARG B HD3  1  
ATOM   1789  H  HE   . ARG B 2 75  ? 13.801  5.117   -8.783  1.00 0.00 ? 175 ARG B HE   1  
ATOM   1790  H  HH11 . ARG B 2 75  ? 17.035  6.071   -9.681  1.00 0.00 ? 175 ARG B HH11 1  
ATOM   1791  H  HH12 . ARG B 2 75  ? 16.900  7.648   -8.977  1.00 0.00 ? 175 ARG B HH12 1  
ATOM   1792  H  HH21 . ARG B 2 75  ? 13.621  7.189   -7.856  1.00 0.00 ? 175 ARG B HH21 1  
ATOM   1793  H  HH22 . ARG B 2 75  ? 14.962  8.282   -7.941  1.00 0.00 ? 175 ARG B HH22 1  
ATOM   1794  N  N    . GLN B 2 76  ? 10.971  4.913   -9.790  1.00 0.00 ? 176 GLN B N    1  
ATOM   1795  C  CA   . GLN B 2 76  ? 10.460  5.862   -8.807  1.00 0.00 ? 176 GLN B CA   1  
ATOM   1796  C  C    . GLN B 2 76  ? 9.161   5.362   -8.182  1.00 0.00 ? 176 GLN B C    1  
ATOM   1797  O  O    . GLN B 2 76  ? 8.904   5.585   -7.000  1.00 0.00 ? 176 GLN B O    1  
ATOM   1798  C  CB   . GLN B 2 76  ? 10.233  7.228   -9.458  1.00 0.00 ? 176 GLN B CB   1  
ATOM   1799  C  CG   . GLN B 2 76  ? 10.615  8.397   -8.565  1.00 0.00 ? 176 GLN B CG   1  
ATOM   1800  C  CD   . GLN B 2 76  ? 9.425   9.255   -8.183  1.00 0.00 ? 176 GLN B CD   1  
ATOM   1801  O  OE1  . GLN B 2 76  ? 9.387   10.451  -8.475  1.00 0.00 ? 176 GLN B OE1  1  
ATOM   1802  N  NE2  . GLN B 2 76  ? 8.443   8.648   -7.525  1.00 0.00 ? 176 GLN B NE2  1  
ATOM   1803  H  H    . GLN B 2 76  ? 10.894  5.125   -10.744 1.00 0.00 ? 176 GLN B H    1  
ATOM   1804  H  HA   . GLN B 2 76  ? 11.202  5.965   -8.030  1.00 0.00 ? 176 GLN B HA   1  
ATOM   1805  H  HB2  . GLN B 2 76  ? 10.822  7.286   -10.361 1.00 0.00 ? 176 GLN B HB2  1  
ATOM   1806  H  HB3  . GLN B 2 76  ? 9.187   7.323   -9.714  1.00 0.00 ? 176 GLN B HB3  1  
ATOM   1807  H  HG2  . GLN B 2 76  ? 11.063  8.011   -7.661  1.00 0.00 ? 176 GLN B HG2  1  
ATOM   1808  H  HG3  . GLN B 2 76  ? 11.332  9.012   -9.087  1.00 0.00 ? 176 GLN B HG3  1  
ATOM   1809  H  HE21 . GLN B 2 76  ? 8.541   7.693   -7.326  1.00 0.00 ? 176 GLN B HE21 1  
ATOM   1810  H  HE22 . GLN B 2 76  ? 7.662   9.179   -7.265  1.00 0.00 ? 176 GLN B HE22 1  
ATOM   1811  N  N    . ILE B 2 77  ? 8.344   4.685   -8.984  1.00 0.00 ? 177 ILE B N    1  
ATOM   1812  C  CA   . ILE B 2 77  ? 7.070   4.155   -8.507  1.00 0.00 ? 177 ILE B CA   1  
ATOM   1813  C  C    . ILE B 2 77  ? 7.273   3.199   -7.336  1.00 0.00 ? 177 ILE B C    1  
ATOM   1814  O  O    . ILE B 2 77  ? 6.872   3.489   -6.209  1.00 0.00 ? 177 ILE B O    1  
ATOM   1815  C  CB   . ILE B 2 77  ? 6.306   3.425   -9.632  1.00 0.00 ? 177 ILE B CB   1  
ATOM   1816  C  CG1  . ILE B 2 77  ? 6.088   4.359   -10.822 1.00 0.00 ? 177 ILE B CG1  1  
ATOM   1817  C  CG2  . ILE B 2 77  ? 4.972   2.900   -9.118  1.00 0.00 ? 177 ILE B CG2  1  
ATOM   1818  C  CD1  . ILE B 2 77  ? 5.560   3.655   -12.054 1.00 0.00 ? 177 ILE B CD1  1  
ATOM   1819  H  H    . ILE B 2 77  ? 8.603   4.540   -9.918  1.00 0.00 ? 177 ILE B H    1  
ATOM   1820  H  HA   . ILE B 2 77  ? 6.468   4.988   -8.176  1.00 0.00 ? 177 ILE B HA   1  
ATOM   1821  H  HB   . ILE B 2 77  ? 6.898   2.580   -9.950  1.00 0.00 ? 177 ILE B HB   1  
ATOM   1822  H  HG12 . ILE B 2 77  ? 5.375   5.122   -10.547 1.00 0.00 ? 177 ILE B HG12 1  
ATOM   1823  H  HG13 . ILE B 2 77  ? 7.025   4.826   -11.082 1.00 0.00 ? 177 ILE B HG13 1  
ATOM   1824  H  HG21 . ILE B 2 77  ? 4.613   3.541   -8.327  1.00 0.00 ? 177 ILE B HG21 1  
ATOM   1825  H  HG22 . ILE B 2 77  ? 5.102   1.897   -8.737  1.00 0.00 ? 177 ILE B HG22 1  
ATOM   1826  H  HG23 . ILE B 2 77  ? 4.255   2.888   -9.925  1.00 0.00 ? 177 ILE B HG23 1  
ATOM   1827  H  HD11 . ILE B 2 77  ? 6.254   3.790   -12.871 1.00 0.00 ? 177 ILE B HD11 1  
ATOM   1828  H  HD12 . ILE B 2 77  ? 4.600   4.072   -12.323 1.00 0.00 ? 177 ILE B HD12 1  
ATOM   1829  H  HD13 . ILE B 2 77  ? 5.450   2.601   -11.846 1.00 0.00 ? 177 ILE B HD13 1  
ATOM   1830  N  N    . ILE B 2 78  ? 7.896   2.058   -7.610  1.00 0.00 ? 178 ILE B N    1  
ATOM   1831  C  CA   . ILE B 2 78  ? 8.148   1.058   -6.578  1.00 0.00 ? 178 ILE B CA   1  
ATOM   1832  C  C    . ILE B 2 78  ? 9.004   1.633   -5.455  1.00 0.00 ? 178 ILE B C    1  
ATOM   1833  O  O    . ILE B 2 78  ? 8.767   1.361   -4.277  1.00 0.00 ? 178 ILE B O    1  
ATOM   1834  C  CB   . ILE B 2 78  ? 8.848   -0.190  -7.151  1.00 0.00 ? 178 ILE B CB   1  
ATOM   1835  C  CG1  . ILE B 2 78  ? 8.092   -0.714  -8.374  1.00 0.00 ? 178 ILE B CG1  1  
ATOM   1836  C  CG2  . ILE B 2 78  ? 8.956   -1.270  -6.085  1.00 0.00 ? 178 ILE B CG2  1  
ATOM   1837  C  CD1  . ILE B 2 78  ? 8.711   -1.957  -8.979  1.00 0.00 ? 178 ILE B CD1  1  
ATOM   1838  H  H    . ILE B 2 78  ? 8.190   1.884   -8.528  1.00 0.00 ? 178 ILE B H    1  
ATOM   1839  H  HA   . ILE B 2 78  ? 7.195   0.755   -6.169  1.00 0.00 ? 178 ILE B HA   1  
ATOM   1840  H  HB   . ILE B 2 78  ? 9.848   0.090   -7.447  1.00 0.00 ? 178 ILE B HB   1  
ATOM   1841  H  HG12 . ILE B 2 78  ? 7.079   -0.956  -8.087  1.00 0.00 ? 178 ILE B HG12 1  
ATOM   1842  H  HG13 . ILE B 2 78  ? 8.073   0.052   -9.135  1.00 0.00 ? 178 ILE B HG13 1  
ATOM   1843  H  HG21 . ILE B 2 78  ? 9.747   -1.018  -5.395  1.00 0.00 ? 178 ILE B HG21 1  
ATOM   1844  H  HG22 . ILE B 2 78  ? 9.175   -2.218  -6.553  1.00 0.00 ? 178 ILE B HG22 1  
ATOM   1845  H  HG23 . ILE B 2 78  ? 8.021   -1.343  -5.549  1.00 0.00 ? 178 ILE B HG23 1  
ATOM   1846  H  HD11 . ILE B 2 78  ? 9.173   -1.705  -9.922  1.00 0.00 ? 178 ILE B HD11 1  
ATOM   1847  H  HD12 . ILE B 2 78  ? 7.944   -2.698  -9.141  1.00 0.00 ? 178 ILE B HD12 1  
ATOM   1848  H  HD13 . ILE B 2 78  ? 9.457   -2.351  -8.306  1.00 0.00 ? 178 ILE B HD13 1  
ATOM   1849  N  N    . SER B 2 79  ? 10.004  2.427   -5.826  1.00 0.00 ? 179 SER B N    1  
ATOM   1850  C  CA   . SER B 2 79  ? 10.898  3.040   -4.850  1.00 0.00 ? 179 SER B CA   1  
ATOM   1851  C  C    . SER B 2 79  ? 10.110  3.814   -3.798  1.00 0.00 ? 179 SER B C    1  
ATOM   1852  O  O    . SER B 2 79  ? 10.300  3.619   -2.598  1.00 0.00 ? 179 SER B O    1  
ATOM   1853  C  CB   . SER B 2 79  ? 11.887  3.972   -5.549  1.00 0.00 ? 179 SER B CB   1  
ATOM   1854  O  OG   . SER B 2 79  ? 12.952  3.243   -6.133  1.00 0.00 ? 179 SER B OG   1  
ATOM   1855  H  H    . SER B 2 79  ? 10.143  2.605   -6.780  1.00 0.00 ? 179 SER B H    1  
ATOM   1856  H  HA   . SER B 2 79  ? 11.448  2.249   -4.362  1.00 0.00 ? 179 SER B HA   1  
ATOM   1857  H  HB2  . SER B 2 79  ? 11.375  4.521   -6.326  1.00 0.00 ? 179 SER B HB2  1  
ATOM   1858  H  HB3  . SER B 2 79  ? 12.294  4.665   -4.829  1.00 0.00 ? 179 SER B HB3  1  
ATOM   1859  H  HG   . SER B 2 79  ? 13.000  3.439   -7.071  1.00 0.00 ? 179 SER B HG   1  
ATOM   1860  N  N    . HIS B 2 80  ? 9.222   4.689   -4.259  1.00 0.00 ? 180 HIS B N    1  
ATOM   1861  C  CA   . HIS B 2 80  ? 8.398   5.490   -3.361  1.00 0.00 ? 180 HIS B CA   1  
ATOM   1862  C  C    . HIS B 2 80  ? 7.630   4.592   -2.392  1.00 0.00 ? 180 HIS B C    1  
ATOM   1863  O  O    . HIS B 2 80  ? 7.694   4.770   -1.179  1.00 0.00 ? 180 HIS B O    1  
ATOM   1864  C  CB   . HIS B 2 80  ? 7.416   6.346   -4.177  1.00 0.00 ? 180 HIS B CB   1  
ATOM   1865  C  CG   . HIS B 2 80  ? 6.106   6.608   -3.490  1.00 0.00 ? 180 HIS B CG   1  
ATOM   1866  N  ND1  . HIS B 2 80  ? 5.763   7.817   -2.929  1.00 0.00 ? 180 HIS B ND1  1  
ATOM   1867  C  CD2  . HIS B 2 80  ? 5.045   5.783   -3.278  1.00 0.00 ? 180 HIS B CD2  1  
ATOM   1868  C  CE1  . HIS B 2 80  ? 4.537   7.694   -2.402  1.00 0.00 ? 180 HIS B CE1  1  
ATOM   1869  N  NE2  . HIS B 2 80  ? 4.057   6.479   -2.587  1.00 0.00 ? 180 HIS B NE2  1  
ATOM   1870  H  H    . HIS B 2 80  ? 9.115   4.796   -5.226  1.00 0.00 ? 180 HIS B H    1  
ATOM   1871  H  HA   . HIS B 2 80  ? 9.053   6.142   -2.799  1.00 0.00 ? 180 HIS B HA   1  
ATOM   1872  H  HB2  . HIS B 2 80  ? 7.875   7.300   -4.387  1.00 0.00 ? 180 HIS B HB2  1  
ATOM   1873  H  HB3  . HIS B 2 80  ? 7.206   5.844   -5.111  1.00 0.00 ? 180 HIS B HB3  1  
ATOM   1874  H  HD1  . HIS B 2 80  ? 6.316   8.624   -2.915  1.00 0.00 ? 180 HIS B HD1  1  
ATOM   1875  H  HD2  . HIS B 2 80  ? 4.970   4.751   -3.591  1.00 0.00 ? 180 HIS B HD2  1  
ATOM   1876  H  HE1  . HIS B 2 80  ? 4.009   8.489   -1.894  1.00 0.00 ? 180 HIS B HE1  1  
ATOM   1877  N  N    . TRP B 2 81  ? 6.896   3.635   -2.952  1.00 0.00 ? 181 TRP B N    1  
ATOM   1878  C  CA   . TRP B 2 81  ? 6.091   2.699   -2.169  1.00 0.00 ? 181 TRP B CA   1  
ATOM   1879  C  C    . TRP B 2 81  ? 6.822   2.214   -0.919  1.00 0.00 ? 181 TRP B C    1  
ATOM   1880  O  O    . TRP B 2 81  ? 6.409   2.500   0.205   1.00 0.00 ? 181 TRP B O    1  
ATOM   1881  C  CB   . TRP B 2 81  ? 5.719   1.497   -3.032  1.00 0.00 ? 181 TRP B CB   1  
ATOM   1882  C  CG   . TRP B 2 81  ? 4.821   0.519   -2.341  1.00 0.00 ? 181 TRP B CG   1  
ATOM   1883  C  CD1  . TRP B 2 81  ? 5.198   -0.501  -1.516  1.00 0.00 ? 181 TRP B CD1  1  
ATOM   1884  C  CD2  . TRP B 2 81  ? 3.393   0.468   -2.416  1.00 0.00 ? 181 TRP B CD2  1  
ATOM   1885  N  NE1  . TRP B 2 81  ? 4.092   -1.184  -1.074  1.00 0.00 ? 181 TRP B NE1  1  
ATOM   1886  C  CE2  . TRP B 2 81  ? 2.971   -0.609  -1.613  1.00 0.00 ? 181 TRP B CE2  1  
ATOM   1887  C  CE3  . TRP B 2 81  ? 2.430   1.228   -3.085  1.00 0.00 ? 181 TRP B CE3  1  
ATOM   1888  C  CZ2  . TRP B 2 81  ? 1.627   -0.942  -1.461  1.00 0.00 ? 181 TRP B CZ2  1  
ATOM   1889  C  CZ3  . TRP B 2 81  ? 1.098   0.896   -2.934  1.00 0.00 ? 181 TRP B CZ3  1  
ATOM   1890  C  CH2  . TRP B 2 81  ? 0.707   -0.179  -2.127  1.00 0.00 ? 181 TRP B CH2  1  
ATOM   1891  H  H    . TRP B 2 81  ? 6.888   3.560   -3.930  1.00 0.00 ? 181 TRP B H    1  
ATOM   1892  H  HA   . TRP B 2 81  ? 5.187   3.207   -1.870  1.00 0.00 ? 181 TRP B HA   1  
ATOM   1893  H  HB2  . TRP B 2 81  ? 5.216   1.845   -3.918  1.00 0.00 ? 181 TRP B HB2  1  
ATOM   1894  H  HB3  . TRP B 2 81  ? 6.619   0.980   -3.320  1.00 0.00 ? 181 TRP B HB3  1  
ATOM   1895  H  HD1  . TRP B 2 81  ? 6.223   -0.728  -1.258  1.00 0.00 ? 181 TRP B HD1  1  
ATOM   1896  H  HE1  . TRP B 2 81  ? 4.103   -1.957  -0.470  1.00 0.00 ? 181 TRP B HE1  1  
ATOM   1897  H  HE3  . TRP B 2 81  ? 2.714   2.061   -3.710  1.00 0.00 ? 181 TRP B HE3  1  
ATOM   1898  H  HZ2  . TRP B 2 81  ? 1.310   -1.768  -0.842  1.00 0.00 ? 181 TRP B HZ2  1  
ATOM   1899  H  HZ3  . TRP B 2 81  ? 0.339   1.472   -3.443  1.00 0.00 ? 181 TRP B HZ3  1  
ATOM   1900  H  HH2  . TRP B 2 81  ? -0.346  -0.402  -2.038  1.00 0.00 ? 181 TRP B HH2  1  
ATOM   1901  N  N    . LYS B 2 82  ? 7.894   1.463   -1.128  1.00 0.00 ? 182 LYS B N    1  
ATOM   1902  C  CA   . LYS B 2 82  ? 8.672   0.918   -0.020  1.00 0.00 ? 182 LYS B CA   1  
ATOM   1903  C  C    . LYS B 2 82  ? 9.235   2.027   0.865   1.00 0.00 ? 182 LYS B C    1  
ATOM   1904  O  O    . LYS B 2 82  ? 9.055   2.010   2.083   1.00 0.00 ? 182 LYS B O    1  
ATOM   1905  C  CB   . LYS B 2 82  ? 9.810   0.041   -0.550  1.00 0.00 ? 182 LYS B CB   1  
ATOM   1906  C  CG   . LYS B 2 82  ? 9.834   -1.352  0.058   1.00 0.00 ? 182 LYS B CG   1  
ATOM   1907  C  CD   . LYS B 2 82  ? 11.020  -1.539  0.990   1.00 0.00 ? 182 LYS B CD   1  
ATOM   1908  C  CE   . LYS B 2 82  ? 11.288  -3.010  1.264   1.00 0.00 ? 182 LYS B CE   1  
ATOM   1909  N  NZ   . LYS B 2 82  ? 11.686  -3.249  2.679   1.00 0.00 ? 182 LYS B NZ   1  
ATOM   1910  H  H    . LYS B 2 82  ? 8.160   1.259   -2.051  1.00 0.00 ? 182 LYS B H    1  
ATOM   1911  H  HA   . LYS B 2 82  ? 8.010   0.306   0.574   1.00 0.00 ? 182 LYS B HA   1  
ATOM   1912  H  HB2  . LYS B 2 82  ? 9.703   -0.058  -1.620  1.00 0.00 ? 182 LYS B HB2  1  
ATOM   1913  H  HB3  . LYS B 2 82  ? 10.752  0.522   -0.334  1.00 0.00 ? 182 LYS B HB3  1  
ATOM   1914  H  HG2  . LYS B 2 82  ? 8.924   -1.505  0.618   1.00 0.00 ? 182 LYS B HG2  1  
ATOM   1915  H  HG3  . LYS B 2 82  ? 9.893   -2.081  -0.737  1.00 0.00 ? 182 LYS B HG3  1  
ATOM   1916  H  HD2  . LYS B 2 82  ? 11.897  -1.104  0.532   1.00 0.00 ? 182 LYS B HD2  1  
ATOM   1917  H  HD3  . LYS B 2 82  ? 10.814  -1.039  1.925   1.00 0.00 ? 182 LYS B HD3  1  
ATOM   1918  H  HE2  . LYS B 2 82  ? 10.389  -3.571  1.054   1.00 0.00 ? 182 LYS B HE2  1  
ATOM   1919  H  HE3  . LYS B 2 82  ? 12.081  -3.346  0.613   1.00 0.00 ? 182 LYS B HE3  1  
ATOM   1920  H  HZ1  . LYS B 2 82  ? 11.305  -4.159  3.009   1.00 0.00 ? 182 LYS B HZ1  1  
ATOM   1921  H  HZ2  . LYS B 2 82  ? 11.317  -2.491  3.287   1.00 0.00 ? 182 LYS B HZ2  1  
ATOM   1922  H  HZ3  . LYS B 2 82  ? 12.722  -3.269  2.760   1.00 0.00 ? 182 LYS B HZ3  1  
ATOM   1923  N  N    . ASN B 2 83  ? 9.916   2.986   0.251   1.00 0.00 ? 183 ASN B N    1  
ATOM   1924  C  CA   . ASN B 2 83  ? 10.502  4.096   0.993   1.00 0.00 ? 183 ASN B CA   1  
ATOM   1925  C  C    . ASN B 2 83  ? 9.431   4.891   1.736   1.00 0.00 ? 183 ASN B C    1  
ATOM   1926  O  O    . ASN B 2 83  ? 9.724   5.587   2.708   1.00 0.00 ? 183 ASN B O    1  
ATOM   1927  C  CB   . ASN B 2 83  ? 11.272  5.018   0.048   1.00 0.00 ? 183 ASN B CB   1  
ATOM   1928  C  CG   . ASN B 2 83  ? 12.465  5.670   0.721   1.00 0.00 ? 183 ASN B CG   1  
ATOM   1929  O  OD1  . ASN B 2 83  ? 12.327  6.675   1.417   1.00 0.00 ? 183 ASN B OD1  1  
ATOM   1930  N  ND2  . ASN B 2 83  ? 13.645  5.097   0.518   1.00 0.00 ? 183 ASN B ND2  1  
ATOM   1931  H  H    . ASN B 2 83  ? 10.029  2.947   -0.722  1.00 0.00 ? 183 ASN B H    1  
ATOM   1932  H  HA   . ASN B 2 83  ? 11.190  3.684   1.715   1.00 0.00 ? 183 ASN B HA   1  
ATOM   1933  H  HB2  . ASN B 2 83  ? 11.628  4.445   -0.794  1.00 0.00 ? 183 ASN B HB2  1  
ATOM   1934  H  HB3  . ASN B 2 83  ? 10.612  5.796   -0.304  1.00 0.00 ? 183 ASN B HB3  1  
ATOM   1935  H  HD21 . ASN B 2 83  ? 13.680  4.297   -0.047  1.00 0.00 ? 183 ASN B HD21 1  
ATOM   1936  H  HD22 . ASN B 2 83  ? 14.433  5.496   0.942   1.00 0.00 ? 183 ASN B HD22 1  
ATOM   1937  N  N    . CYS B 2 84  ? 8.189   4.785   1.272   1.00 0.00 ? 184 CYS B N    1  
ATOM   1938  C  CA   . CYS B 2 84  ? 7.077   5.497   1.891   1.00 0.00 ? 184 CYS B CA   1  
ATOM   1939  C  C    . CYS B 2 84  ? 6.828   4.993   3.308   1.00 0.00 ? 184 CYS B C    1  
ATOM   1940  O  O    . CYS B 2 84  ? 6.543   3.813   3.519   1.00 0.00 ? 184 CYS B O    1  
ATOM   1941  C  CB   . CYS B 2 84  ? 5.810   5.335   1.047   1.00 0.00 ? 184 CYS B CB   1  
ATOM   1942  S  SG   . CYS B 2 84  ? 4.430   6.409   1.560   1.00 0.00 ? 184 CYS B SG   1  
ATOM   1943  H  H    . CYS B 2 84  ? 8.017   4.217   0.492   1.00 0.00 ? 184 CYS B H    1  
ATOM   1944  H  HA   . CYS B 2 84  ? 7.337   6.543   1.935   1.00 0.00 ? 184 CYS B HA   1  
ATOM   1945  H  HB2  . CYS B 2 84  ? 6.040   5.569   0.019   1.00 0.00 ? 184 CYS B HB2  1  
ATOM   1946  H  HB3  . CYS B 2 84  ? 5.472   4.312   1.112   1.00 0.00 ? 184 CYS B HB3  1  
ATOM   1947  N  N    . THR B 2 85  ? 6.939   5.895   4.277   1.00 0.00 ? 185 THR B N    1  
ATOM   1948  C  CA   . THR B 2 85  ? 6.727   5.546   5.677   1.00 0.00 ? 185 THR B CA   1  
ATOM   1949  C  C    . THR B 2 85  ? 6.427   6.791   6.505   1.00 0.00 ? 185 THR B C    1  
ATOM   1950  O  O    . THR B 2 85  ? 7.191   7.757   6.490   1.00 0.00 ? 185 THR B O    1  
ATOM   1951  C  CB   . THR B 2 85  ? 7.957   4.830   6.237   1.00 0.00 ? 185 THR B CB   1  
ATOM   1952  O  OG1  . THR B 2 85  ? 7.803   4.579   7.624   1.00 0.00 ? 185 THR B OG1  1  
ATOM   1953  C  CG2  . THR B 2 85  ? 9.240   5.611   6.052   1.00 0.00 ? 185 THR B CG2  1  
ATOM   1954  H  H    . THR B 2 85  ? 7.168   6.819   4.045   1.00 0.00 ? 185 THR B H    1  
ATOM   1955  H  HA   . THR B 2 85  ? 5.878   4.881   5.728   1.00 0.00 ? 185 THR B HA   1  
ATOM   1956  H  HB   . THR B 2 85  ? 8.070   3.882   5.732   1.00 0.00 ? 185 THR B HB   1  
ATOM   1957  H  HG1  . THR B 2 85  ? 7.267   3.792   7.749   1.00 0.00 ? 185 THR B HG1  1  
ATOM   1958  H  HG21 . THR B 2 85  ? 10.086  4.957   6.211   1.00 0.00 ? 185 THR B HG21 1  
ATOM   1959  H  HG22 . THR B 2 85  ? 9.273   6.423   6.764   1.00 0.00 ? 185 THR B HG22 1  
ATOM   1960  H  HG23 . THR B 2 85  ? 9.278   6.009   5.050   1.00 0.00 ? 185 THR B HG23 1  
ATOM   1961  N  N    . ARG B 2 86  ? 5.310   6.763   7.225   1.00 0.00 ? 186 ARG B N    1  
ATOM   1962  C  CA   . ARG B 2 86  ? 4.912   7.892   8.058   1.00 0.00 ? 186 ARG B CA   1  
ATOM   1963  C  C    . ARG B 2 86  ? 4.687   9.140   7.209   1.00 0.00 ? 186 ARG B C    1  
ATOM   1964  O  O    . ARG B 2 86  ? 5.359   10.157  7.390   1.00 0.00 ? 186 ARG B O    1  
ATOM   1965  C  CB   . ARG B 2 86  ? 5.976   8.165   9.124   1.00 0.00 ? 186 ARG B CB   1  
ATOM   1966  C  CG   . ARG B 2 86  ? 6.201   6.998   10.070  1.00 0.00 ? 186 ARG B CG   1  
ATOM   1967  C  CD   . ARG B 2 86  ? 6.563   7.476   11.467  1.00 0.00 ? 186 ARG B CD   1  
ATOM   1968  N  NE   . ARG B 2 86  ? 7.584   8.520   11.443  1.00 0.00 ? 186 ARG B NE   1  
ATOM   1969  C  CZ   . ARG B 2 86  ? 7.839   9.333   12.465  1.00 0.00 ? 186 ARG B CZ   1  
ATOM   1970  N  NH1  . ARG B 2 86  ? 7.150   9.224   13.595  1.00 0.00 ? 186 ARG B NH1  1  
ATOM   1971  N  NH2  . ARG B 2 86  ? 8.784   10.256  12.359  1.00 0.00 ? 186 ARG B NH2  1  
ATOM   1972  H  H    . ARG B 2 86  ? 4.742   5.966   7.195   1.00 0.00 ? 186 ARG B H    1  
ATOM   1973  H  HA   . ARG B 2 86  ? 3.986   7.632   8.546   1.00 0.00 ? 186 ARG B HA   1  
ATOM   1974  H  HB2  . ARG B 2 86  ? 6.912   8.388   8.632   1.00 0.00 ? 186 ARG B HB2  1  
ATOM   1975  H  HB3  . ARG B 2 86  ? 5.673   9.022   9.708   1.00 0.00 ? 186 ARG B HB3  1  
ATOM   1976  H  HG2  . ARG B 2 86  ? 5.297   6.412   10.125  1.00 0.00 ? 186 ARG B HG2  1  
ATOM   1977  H  HG3  . ARG B 2 86  ? 7.006   6.387   9.689   1.00 0.00 ? 186 ARG B HG3  1  
ATOM   1978  H  HD2  . ARG B 2 86  ? 5.674   7.866   11.942  1.00 0.00 ? 186 ARG B HD2  1  
ATOM   1979  H  HD3  . ARG B 2 86  ? 6.934   6.635   12.036  1.00 0.00 ? 186 ARG B HD3  1  
ATOM   1980  H  HE   . ARG B 2 86  ? 8.107   8.622   10.620  1.00 0.00 ? 186 ARG B HE   1  
ATOM   1981  H  HH11 . ARG B 2 86  ? 6.436   8.531   13.683  1.00 0.00 ? 186 ARG B HH11 1  
ATOM   1982  H  HH12 . ARG B 2 86  ? 7.346   9.837   14.361  1.00 0.00 ? 186 ARG B HH12 1  
ATOM   1983  H  HH21 . ARG B 2 86  ? 9.306   10.342  11.510  1.00 0.00 ? 186 ARG B HH21 1  
ATOM   1984  H  HH22 . ARG B 2 86  ? 8.976   10.867  13.127  1.00 0.00 ? 186 ARG B HH22 1  
ATOM   1985  N  N    . HIS B 2 87  ? 3.738   9.057   6.282   1.00 0.00 ? 187 HIS B N    1  
ATOM   1986  C  CA   . HIS B 2 87  ? 3.426   10.179  5.406   1.00 0.00 ? 187 HIS B CA   1  
ATOM   1987  C  C    . HIS B 2 87  ? 1.969   10.130  4.953   1.00 0.00 ? 187 HIS B C    1  
ATOM   1988  O  O    . HIS B 2 87  ? 1.158   9.395   5.517   1.00 0.00 ? 187 HIS B O    1  
ATOM   1989  C  CB   . HIS B 2 87  ? 4.356   10.176  4.188   1.00 0.00 ? 187 HIS B CB   1  
ATOM   1990  C  CG   . HIS B 2 87  ? 5.099   11.462  4.000   1.00 0.00 ? 187 HIS B CG   1  
ATOM   1991  N  ND1  . HIS B 2 87  ? 5.906   12.015  4.972   1.00 0.00 ? 187 HIS B ND1  1  
ATOM   1992  C  CD2  . HIS B 2 87  ? 5.156   12.306  2.942   1.00 0.00 ? 187 HIS B CD2  1  
ATOM   1993  C  CE1  . HIS B 2 87  ? 6.425   13.143  4.521   1.00 0.00 ? 187 HIS B CE1  1  
ATOM   1994  N  NE2  . HIS B 2 87  ? 5.986   13.342  3.293   1.00 0.00 ? 187 HIS B NE2  1  
ATOM   1995  H  H    . HIS B 2 87  ? 3.237   8.221   6.186   1.00 0.00 ? 187 HIS B H    1  
ATOM   1996  H  HA   . HIS B 2 87  ? 3.585   11.089  5.965   1.00 0.00 ? 187 HIS B HA   1  
ATOM   1997  H  HB2  . HIS B 2 87  ? 5.084   9.386   4.303   1.00 0.00 ? 187 HIS B HB2  1  
ATOM   1998  H  HB3  . HIS B 2 87  ? 3.774   9.994   3.297   1.00 0.00 ? 187 HIS B HB3  1  
ATOM   1999  H  HD1  . HIS B 2 87  ? 6.072   11.637  5.861   1.00 0.00 ? 187 HIS B HD1  1  
ATOM   2000  H  HD2  . HIS B 2 87  ? 4.644   12.186  1.997   1.00 0.00 ? 187 HIS B HD2  1  
ATOM   2001  H  HE1  . HIS B 2 87  ? 7.095   13.792  5.066   1.00 0.00 ? 187 HIS B HE1  1  
ATOM   2002  H  HE2  . HIS B 2 87  ? 6.286   14.058  2.695   1.00 0.00 ? 187 HIS B HE2  1  
ATOM   2003  N  N    . ASP B 2 88  ? 1.644   10.916  3.931   1.00 0.00 ? 188 ASP B N    1  
ATOM   2004  C  CA   . ASP B 2 88  ? 0.286   10.963  3.400   1.00 0.00 ? 188 ASP B CA   1  
ATOM   2005  C  C    . ASP B 2 88  ? 0.215   10.283  2.037   1.00 0.00 ? 188 ASP B C    1  
ATOM   2006  O  O    . ASP B 2 88  ? -0.360  10.822  1.091   1.00 0.00 ? 188 ASP B O    1  
ATOM   2007  C  CB   . ASP B 2 88  ? -0.190  12.413  3.291   1.00 0.00 ? 188 ASP B CB   1  
ATOM   2008  C  CG   . ASP B 2 88  ? -1.633  12.582  3.724   1.00 0.00 ? 188 ASP B CG   1  
ATOM   2009  O  OD1  . ASP B 2 88  ? -1.985  12.096  4.820   1.00 0.00 ? 188 ASP B OD1  1  
ATOM   2010  O  OD2  . ASP B 2 88  ? -2.411  13.201  2.969   1.00 0.00 ? 188 ASP B OD2  1  
ATOM   2011  H  H    . ASP B 2 88  ? 2.335   11.478  3.523   1.00 0.00 ? 188 ASP B H    1  
ATOM   2012  H  HA   . ASP B 2 88  ? -0.356  10.432  4.088   1.00 0.00 ? 188 ASP B HA   1  
ATOM   2013  H  HB2  . ASP B 2 88  ? 0.429   13.038  3.916   1.00 0.00 ? 188 ASP B HB2  1  
ATOM   2014  H  HB3  . ASP B 2 88  ? -0.101  12.739  2.264   1.00 0.00 ? 188 ASP B HB3  1  
ATOM   2015  N  N    . CYS B 2 89  ? 0.808   9.096   1.944   1.00 0.00 ? 189 CYS B N    1  
ATOM   2016  C  CA   . CYS B 2 89  ? 0.821   8.333   0.698   1.00 0.00 ? 189 CYS B CA   1  
ATOM   2017  C  C    . CYS B 2 89  ? -0.567  8.292   0.053   1.00 0.00 ? 189 CYS B C    1  
ATOM   2018  O  O    . CYS B 2 89  ? -1.448  7.565   0.511   1.00 0.00 ? 189 CYS B O    1  
ATOM   2019  C  CB   . CYS B 2 89  ? 1.310   6.908   0.958   1.00 0.00 ? 189 CYS B CB   1  
ATOM   2020  S  SG   . CYS B 2 89  ? 3.054   6.806   1.476   1.00 0.00 ? 189 CYS B SG   1  
ATOM   2021  H  H    . CYS B 2 89  ? 1.251   8.723   2.734   1.00 0.00 ? 189 CYS B H    1  
ATOM   2022  H  HA   . CYS B 2 89  ? 1.506   8.819   0.021   1.00 0.00 ? 189 CYS B HA   1  
ATOM   2023  H  HB2  . CYS B 2 89  ? 0.710   6.467   1.739   1.00 0.00 ? 189 CYS B HB2  1  
ATOM   2024  H  HB3  . CYS B 2 89  ? 1.201   6.327   0.055   1.00 0.00 ? 189 CYS B HB3  1  
ATOM   2025  N  N    . PRO B 2 90  ? -0.779  9.074   -1.021  1.00 0.00 ? 190 PRO B N    1  
ATOM   2026  C  CA   . PRO B 2 90  ? -2.064  9.118   -1.722  1.00 0.00 ? 190 PRO B CA   1  
ATOM   2027  C  C    . PRO B 2 90  ? -2.272  7.914   -2.636  1.00 0.00 ? 190 PRO B C    1  
ATOM   2028  O  O    . PRO B 2 90  ? -3.398  7.615   -3.035  1.00 0.00 ? 190 PRO B O    1  
ATOM   2029  C  CB   . PRO B 2 90  ? -1.962  10.400  -2.543  1.00 0.00 ? 190 PRO B CB   1  
ATOM   2030  C  CG   . PRO B 2 90  ? -0.508  10.541  -2.834  1.00 0.00 ? 190 PRO B CG   1  
ATOM   2031  C  CD   . PRO B 2 90  ? 0.215   9.976   -1.639  1.00 0.00 ? 190 PRO B CD   1  
ATOM   2032  H  HA   . PRO B 2 90  ? -2.890  9.193   -1.031  1.00 0.00 ? 190 PRO B HA   1  
ATOM   2033  H  HB2  . PRO B 2 90  ? -2.541  10.298  -3.450  1.00 0.00 ? 190 PRO B HB2  1  
ATOM   2034  H  HB3  . PRO B 2 90  ? -2.331  11.234  -1.965  1.00 0.00 ? 190 PRO B HB3  1  
ATOM   2035  H  HG2  . PRO B 2 90  ? -0.256  9.982   -3.722  1.00 0.00 ? 190 PRO B HG2  1  
ATOM   2036  H  HG3  . PRO B 2 90  ? -0.259  11.584  -2.963  1.00 0.00 ? 190 PRO B HG3  1  
ATOM   2037  H  HD2  . PRO B 2 90  ? 1.090   9.427   -1.954  1.00 0.00 ? 190 PRO B HD2  1  
ATOM   2038  H  HD3  . PRO B 2 90  ? 0.492   10.768  -0.958  1.00 0.00 ? 190 PRO B HD3  1  
ATOM   2039  N  N    . VAL B 2 91  ? -1.182  7.230   -2.971  1.00 0.00 ? 191 VAL B N    1  
ATOM   2040  C  CA   . VAL B 2 91  ? -1.249  6.062   -3.840  1.00 0.00 ? 191 VAL B CA   1  
ATOM   2041  C  C    . VAL B 2 91  ? -1.310  4.771   -3.030  1.00 0.00 ? 191 VAL B C    1  
ATOM   2042  O  O    . VAL B 2 91  ? -2.136  3.898   -3.295  1.00 0.00 ? 191 VAL B O    1  
ATOM   2043  C  CB   . VAL B 2 91  ? -0.038  6.004   -4.791  1.00 0.00 ? 191 VAL B CB   1  
ATOM   2044  C  CG1  . VAL B 2 91  ? -0.209  4.888   -5.809  1.00 0.00 ? 191 VAL B CG1  1  
ATOM   2045  C  CG2  . VAL B 2 91  ? 0.155   7.343   -5.487  1.00 0.00 ? 191 VAL B CG2  1  
ATOM   2046  H  H    . VAL B 2 91  ? -0.310  7.517   -2.626  1.00 0.00 ? 191 VAL B H    1  
ATOM   2047  H  HA   . VAL B 2 91  ? -2.146  6.144   -4.438  1.00 0.00 ? 191 VAL B HA   1  
ATOM   2048  H  HB   . VAL B 2 91  ? 0.847   5.796   -4.206  1.00 0.00 ? 191 VAL B HB   1  
ATOM   2049  H  HG11 . VAL B 2 91  ? -0.731  4.059   -5.353  1.00 0.00 ? 191 VAL B HG11 1  
ATOM   2050  H  HG12 . VAL B 2 91  ? 0.762   4.558   -6.149  1.00 0.00 ? 191 VAL B HG12 1  
ATOM   2051  H  HG13 . VAL B 2 91  ? -0.779  5.252   -6.651  1.00 0.00 ? 191 VAL B HG13 1  
ATOM   2052  H  HG21 . VAL B 2 91  ? 1.096   7.341   -6.017  1.00 0.00 ? 191 VAL B HG21 1  
ATOM   2053  H  HG22 . VAL B 2 91  ? 0.159   8.134   -4.752  1.00 0.00 ? 191 VAL B HG22 1  
ATOM   2054  H  HG23 . VAL B 2 91  ? -0.651  7.506   -6.188  1.00 0.00 ? 191 VAL B HG23 1  
ATOM   2055  N  N    . CYS B 2 92  ? -0.430  4.658   -2.041  1.00 0.00 ? 192 CYS B N    1  
ATOM   2056  C  CA   . CYS B 2 92  ? -0.383  3.473   -1.191  1.00 0.00 ? 192 CYS B CA   1  
ATOM   2057  C  C    . CYS B 2 92  ? -1.651  3.352   -0.349  1.00 0.00 ? 192 CYS B C    1  
ATOM   2058  O  O    . CYS B 2 92  ? -2.067  2.251   0.008   1.00 0.00 ? 192 CYS B O    1  
ATOM   2059  C  CB   . CYS B 2 92  ? 0.845   3.515   -0.277  1.00 0.00 ? 192 CYS B CB   1  
ATOM   2060  S  SG   . CYS B 2 92  ? 2.371   4.089   -1.095  1.00 0.00 ? 192 CYS B SG   1  
ATOM   2061  H  H    . CYS B 2 92  ? 0.202   5.388   -1.878  1.00 0.00 ? 192 CYS B H    1  
ATOM   2062  H  HA   . CYS B 2 92  ? -0.311  2.609   -1.834  1.00 0.00 ? 192 CYS B HA   1  
ATOM   2063  H  HB2  . CYS B 2 92  ? 0.646   4.181   0.547   1.00 0.00 ? 192 CYS B HB2  1  
ATOM   2064  H  HB3  . CYS B 2 92  ? 1.032   2.522   0.106   1.00 0.00 ? 192 CYS B HB3  1  
ATOM   2065  N  N    . LEU B 2 93  ? -2.256  4.493   -0.035  1.00 0.00 ? 193 LEU B N    1  
ATOM   2066  C  CA   . LEU B 2 93  ? -3.474  4.518   0.768   1.00 0.00 ? 193 LEU B CA   1  
ATOM   2067  C  C    . LEU B 2 93  ? -4.613  3.775   0.069   1.00 0.00 ? 193 LEU B C    1  
ATOM   2068  O  O    . LEU B 2 93  ? -5.135  2.792   0.594   1.00 0.00 ? 193 LEU B O    1  
ATOM   2069  C  CB   . LEU B 2 93  ? -3.890  5.963   1.054   1.00 0.00 ? 193 LEU B CB   1  
ATOM   2070  C  CG   . LEU B 2 93  ? -3.344  6.547   2.358   1.00 0.00 ? 193 LEU B CG   1  
ATOM   2071  C  CD1  . LEU B 2 93  ? -3.743  8.008   2.495   1.00 0.00 ? 193 LEU B CD1  1  
ATOM   2072  C  CD2  . LEU B 2 93  ? -3.841  5.743   3.550   1.00 0.00 ? 193 LEU B CD2  1  
ATOM   2073  H  H    . LEU B 2 93  ? -1.874  5.339   -0.348  1.00 0.00 ? 193 LEU B H    1  
ATOM   2074  H  HA   . LEU B 2 93  ? -3.261  4.024   1.704   1.00 0.00 ? 193 LEU B HA   1  
ATOM   2075  H  HB2  . LEU B 2 93  ? -3.550  6.582   0.236   1.00 0.00 ? 193 LEU B HB2  1  
ATOM   2076  H  HB3  . LEU B 2 93  ? -4.968  6.005   1.091   1.00 0.00 ? 193 LEU B HB3  1  
ATOM   2077  H  HG   . LEU B 2 93  ? -2.265  6.495   2.344   1.00 0.00 ? 193 LEU B HG   1  
ATOM   2078  H  HD11 . LEU B 2 93  ? -3.688  8.489   1.530   1.00 0.00 ? 193 LEU B HD11 1  
ATOM   2079  H  HD12 . LEU B 2 93  ? -3.070  8.501   3.182   1.00 0.00 ? 193 LEU B HD12 1  
ATOM   2080  H  HD13 . LEU B 2 93  ? -4.752  8.073   2.872   1.00 0.00 ? 193 LEU B HD13 1  
ATOM   2081  H  HD21 . LEU B 2 93  ? -3.220  4.869   3.678   1.00 0.00 ? 193 LEU B HD21 1  
ATOM   2082  H  HD22 . LEU B 2 93  ? -4.861  5.437   3.378   1.00 0.00 ? 193 LEU B HD22 1  
ATOM   2083  H  HD23 . LEU B 2 93  ? -3.793  6.353   4.440   1.00 0.00 ? 193 LEU B HD23 1  
ATOM   2084  N  N    . PRO B 2 94  ? -5.022  4.238   -1.124  1.00 0.00 ? 194 PRO B N    1  
ATOM   2085  C  CA   . PRO B 2 94  ? -6.110  3.610   -1.883  1.00 0.00 ? 194 PRO B CA   1  
ATOM   2086  C  C    . PRO B 2 94  ? -5.782  2.182   -2.310  1.00 0.00 ? 194 PRO B C    1  
ATOM   2087  O  O    . PRO B 2 94  ? -6.676  1.351   -2.463  1.00 0.00 ? 194 PRO B O    1  
ATOM   2088  C  CB   . PRO B 2 94  ? -6.267  4.511   -3.112  1.00 0.00 ? 194 PRO B CB   1  
ATOM   2089  C  CG   . PRO B 2 94  ? -4.969  5.235   -3.229  1.00 0.00 ? 194 PRO B CG   1  
ATOM   2090  C  CD   . PRO B 2 94  ? -4.466  5.408   -1.826  1.00 0.00 ? 194 PRO B CD   1  
ATOM   2091  H  HA   . PRO B 2 94  ? -7.031  3.608   -1.318  1.00 0.00 ? 194 PRO B HA   1  
ATOM   2092  H  HB2  . PRO B 2 94  ? -6.460  3.904   -3.985  1.00 0.00 ? 194 PRO B HB2  1  
ATOM   2093  H  HB3  . PRO B 2 94  ? -7.086  5.198   -2.956  1.00 0.00 ? 194 PRO B HB3  1  
ATOM   2094  H  HG2  . PRO B 2 94  ? -4.272  4.647   -3.808  1.00 0.00 ? 194 PRO B HG2  1  
ATOM   2095  H  HG3  . PRO B 2 94  ? -5.125  6.197   -3.693  1.00 0.00 ? 194 PRO B HG3  1  
ATOM   2096  H  HD2  . PRO B 2 94  ? -3.387  5.395   -1.808  1.00 0.00 ? 194 PRO B HD2  1  
ATOM   2097  H  HD3  . PRO B 2 94  ? -4.841  6.327   -1.400  1.00 0.00 ? 194 PRO B HD3  1  
ATOM   2098  N  N    . LEU B 2 95  ? -4.497  1.903   -2.508  1.00 0.00 ? 195 LEU B N    1  
ATOM   2099  C  CA   . LEU B 2 95  ? -4.062  0.580   -2.925  1.00 0.00 ? 195 LEU B CA   1  
ATOM   2100  C  C    . LEU B 2 95  ? -4.044  -0.395  -1.750  1.00 0.00 ? 195 LEU B C    1  
ATOM   2101  O  O    . LEU B 2 95  ? -4.396  -1.566  -1.898  1.00 0.00 ? 195 LEU B O    1  
ATOM   2102  C  CB   . LEU B 2 95  ? -2.670  0.662   -3.550  1.00 0.00 ? 195 LEU B CB   1  
ATOM   2103  C  CG   . LEU B 2 95  ? -2.604  0.299   -5.034  1.00 0.00 ? 195 LEU B CG   1  
ATOM   2104  C  CD1  . LEU B 2 95  ? -1.165  0.315   -5.521  1.00 0.00 ? 195 LEU B CD1  1  
ATOM   2105  C  CD2  . LEU B 2 95  ? -3.238  -1.062  -5.280  1.00 0.00 ? 195 LEU B CD2  1  
ATOM   2106  H  H    . LEU B 2 95  ? -3.826  2.603   -2.378  1.00 0.00 ? 195 LEU B H    1  
ATOM   2107  H  HA   . LEU B 2 95  ? -4.758  0.221   -3.665  1.00 0.00 ? 195 LEU B HA   1  
ATOM   2108  H  HB2  . LEU B 2 95  ? -2.307  1.672   -3.431  1.00 0.00 ? 195 LEU B HB2  1  
ATOM   2109  H  HB3  . LEU B 2 95  ? -2.016  -0.001  -3.011  1.00 0.00 ? 195 LEU B HB3  1  
ATOM   2110  H  HG   . LEU B 2 95  ? -3.156  1.034   -5.602  1.00 0.00 ? 195 LEU B HG   1  
ATOM   2111  H  HD11 . LEU B 2 95  ? -0.519  -0.067  -4.745  1.00 0.00 ? 195 LEU B HD11 1  
ATOM   2112  H  HD12 . LEU B 2 95  ? -0.877  1.328   -5.762  1.00 0.00 ? 195 LEU B HD12 1  
ATOM   2113  H  HD13 . LEU B 2 95  ? -1.075  -0.304  -6.402  1.00 0.00 ? 195 LEU B HD13 1  
ATOM   2114  H  HD21 . LEU B 2 95  ? -2.675  -1.590  -6.036  1.00 0.00 ? 195 LEU B HD21 1  
ATOM   2115  H  HD22 . LEU B 2 95  ? -4.256  -0.931  -5.615  1.00 0.00 ? 195 LEU B HD22 1  
ATOM   2116  H  HD23 . LEU B 2 95  ? -3.231  -1.633  -4.363  1.00 0.00 ? 195 LEU B HD23 1  
ATOM   2117  N  N    . LYS B 2 96  ? -3.629  0.092   -0.586  1.00 0.00 ? 196 LYS B N    1  
ATOM   2118  C  CA   . LYS B 2 96  ? -3.562  -0.744  0.606   1.00 0.00 ? 196 LYS B CA   1  
ATOM   2119  C  C    . LYS B 2 96  ? -3.790  0.082   1.869   1.00 0.00 ? 196 LYS B C    1  
ATOM   2120  O  O    . LYS B 2 96  ? -2.920  0.162   2.737   1.00 0.00 ? 196 LYS B O    1  
ATOM   2121  C  CB   . LYS B 2 96  ? -2.208  -1.453  0.680   1.00 0.00 ? 196 LYS B CB   1  
ATOM   2122  C  CG   . LYS B 2 96  ? -2.202  -2.821  0.017   1.00 0.00 ? 196 LYS B CG   1  
ATOM   2123  C  CD   . LYS B 2 96  ? -0.791  -3.264  -0.334  1.00 0.00 ? 196 LYS B CD   1  
ATOM   2124  C  CE   . LYS B 2 96  ? -0.626  -4.767  -0.187  1.00 0.00 ? 196 LYS B CE   1  
ATOM   2125  N  NZ   . LYS B 2 96  ? -0.044  -5.135  1.133   1.00 0.00 ? 196 LYS B NZ   1  
ATOM   2126  H  H    . LYS B 2 96  ? -3.357  1.032   -0.530  1.00 0.00 ? 196 LYS B H    1  
ATOM   2127  H  HA   . LYS B 2 96  ? -4.343  -1.485  0.530   1.00 0.00 ? 196 LYS B HA   1  
ATOM   2128  H  HB2  . LYS B 2 96  ? -1.466  -0.838  0.194   1.00 0.00 ? 196 LYS B HB2  1  
ATOM   2129  H  HB3  . LYS B 2 96  ? -1.937  -1.579  1.718   1.00 0.00 ? 196 LYS B HB3  1  
ATOM   2130  H  HG2  . LYS B 2 96  ? -2.637  -3.541  0.694   1.00 0.00 ? 196 LYS B HG2  1  
ATOM   2131  H  HG3  . LYS B 2 96  ? -2.790  -2.775  -0.888  1.00 0.00 ? 196 LYS B HG3  1  
ATOM   2132  H  HD2  . LYS B 2 96  ? -0.580  -2.987  -1.356  1.00 0.00 ? 196 LYS B HD2  1  
ATOM   2133  H  HD3  . LYS B 2 96  ? -0.094  -2.767  0.327   1.00 0.00 ? 196 LYS B HD3  1  
ATOM   2134  H  HE2  . LYS B 2 96  ? -1.595  -5.233  -0.284  1.00 0.00 ? 196 LYS B HE2  1  
ATOM   2135  H  HE3  . LYS B 2 96  ? 0.025   -5.124  -0.970  1.00 0.00 ? 196 LYS B HE3  1  
ATOM   2136  H  HZ1  . LYS B 2 96  ? 0.561   -5.975  1.035   1.00 0.00 ? 196 LYS B HZ1  1  
ATOM   2137  H  HZ2  . LYS B 2 96  ? -0.802  -5.346  1.814   1.00 0.00 ? 196 LYS B HZ2  1  
ATOM   2138  H  HZ3  . LYS B 2 96  ? 0.529   -4.350  1.503   1.00 0.00 ? 196 LYS B HZ3  1  
ATOM   2139  N  N    . ASN B 2 97  ? -4.965  0.702   1.960   1.00 0.00 ? 197 ASN B N    1  
ATOM   2140  C  CA   . ASN B 2 97  ? -5.318  1.529   3.106   1.00 0.00 ? 197 ASN B CA   1  
ATOM   2141  C  C    . ASN B 2 97  ? -4.923  0.861   4.421   1.00 0.00 ? 197 ASN B C    1  
ATOM   2142  O  O    . ASN B 2 97  ? -5.655  0.021   4.946   1.00 0.00 ? 197 ASN B O    1  
ATOM   2143  C  CB   . ASN B 2 97  ? -6.818  1.823   3.101   1.00 0.00 ? 197 ASN B CB   1  
ATOM   2144  C  CG   . ASN B 2 97  ? -7.221  2.794   4.195   1.00 0.00 ? 197 ASN B CG   1  
ATOM   2145  O  OD1  . ASN B 2 97  ? -7.393  2.406   5.351   1.00 0.00 ? 197 ASN B OD1  1  
ATOM   2146  N  ND2  . ASN B 2 97  ? -7.371  4.062   3.834   1.00 0.00 ? 197 ASN B ND2  1  
ATOM   2147  H  H    . ASN B 2 97  ? -5.608  0.608   1.235   1.00 0.00 ? 197 ASN B H    1  
ATOM   2148  H  HA   . ASN B 2 97  ? -4.782  2.455   3.009   1.00 0.00 ? 197 ASN B HA   1  
ATOM   2149  H  HB2  . ASN B 2 97  ? -7.093  2.251   2.148   1.00 0.00 ? 197 ASN B HB2  1  
ATOM   2150  H  HB3  . ASN B 2 97  ? -7.361  0.900   3.247   1.00 0.00 ? 197 ASN B HB3  1  
ATOM   2151  H  HD21 . ASN B 2 97  ? -7.217  4.298   2.895   1.00 0.00 ? 197 ASN B HD21 1  
ATOM   2152  H  HD22 . ASN B 2 97  ? -7.631  4.712   4.522   1.00 0.00 ? 197 ASN B HD22 1  
ATOM   2153  N  N    . ALA B 2 98  ? -3.763  1.240   4.946   1.00 0.00 ? 198 ALA B N    1  
ATOM   2154  C  CA   . ALA B 2 98  ? -3.273  0.678   6.198   1.00 0.00 ? 198 ALA B CA   1  
ATOM   2155  C  C    . ALA B 2 98  ? -2.396  1.678   6.944   1.00 0.00 ? 198 ALA B C    1  
ATOM   2156  O  O    . ALA B 2 98  ? -1.270  1.958   6.533   1.00 0.00 ? 198 ALA B O    1  
ATOM   2157  C  CB   . ALA B 2 98  ? -2.502  -0.607  5.932   1.00 0.00 ? 198 ALA B CB   1  
ATOM   2158  H  H    . ALA B 2 98  ? -3.224  1.913   4.481   1.00 0.00 ? 198 ALA B H    1  
ATOM   2159  H  HA   . ALA B 2 98  ? -4.128  0.435   6.813   1.00 0.00 ? 198 ALA B HA   1  
ATOM   2160  H  HB1  . ALA B 2 98  ? -1.448  -0.384  5.848   1.00 0.00 ? 198 ALA B HB1  1  
ATOM   2161  H  HB2  . ALA B 2 98  ? -2.850  -1.052  5.012   1.00 0.00 ? 198 ALA B HB2  1  
ATOM   2162  H  HB3  . ALA B 2 98  ? -2.659  -1.297  6.748   1.00 0.00 ? 198 ALA B HB3  1  
ATOM   2163  N  N    . GLY B 2 99  ? -2.920  2.212   8.041   1.00 0.00 ? 199 GLY B N    1  
ATOM   2164  C  CA   . GLY B 2 99  ? -2.171  3.176   8.826   1.00 0.00 ? 199 GLY B CA   1  
ATOM   2165  C  C    . GLY B 2 99  ? -2.814  3.453   10.171  1.00 0.00 ? 199 GLY B C    1  
ATOM   2166  O  O    . GLY B 2 99  ? -2.128  3.527   11.191  1.00 0.00 ? 199 GLY B O    1  
ATOM   2167  H  H    . GLY B 2 99  ? -3.822  1.951   8.321   1.00 0.00 ? 199 GLY B H    1  
ATOM   2168  H  HA2  . GLY B 2 99  ? -1.174  2.794   8.989   1.00 0.00 ? 199 GLY B HA2  1  
ATOM   2169  H  HA3  . GLY B 2 99  ? -2.105  4.102   8.274   1.00 0.00 ? 199 GLY B HA3  1  
ATOM   2170  N  N    . ASP B 2 100 ? -4.134  3.607   10.173  1.00 0.00 ? 200 ASP B N    1  
ATOM   2171  C  CA   . ASP B 2 100 ? -4.870  3.879   11.402  1.00 0.00 ? 200 ASP B CA   1  
ATOM   2172  C  C    . ASP B 2 100 ? -5.663  2.652   11.843  1.00 0.00 ? 200 ASP B C    1  
ATOM   2173  O  O    . ASP B 2 100 ? -6.834  2.501   11.494  1.00 0.00 ? 200 ASP B O    1  
ATOM   2174  C  CB   . ASP B 2 100 ? -5.814  5.066   11.205  1.00 0.00 ? 200 ASP B CB   1  
ATOM   2175  C  CG   . ASP B 2 100 ? -6.318  5.629   12.520  1.00 0.00 ? 200 ASP B CG   1  
ATOM   2176  O  OD1  . ASP B 2 100 ? -6.297  4.892   13.528  1.00 0.00 ? 200 ASP B OD1  1  
ATOM   2177  O  OD2  . ASP B 2 100 ? -6.733  6.806   12.541  1.00 0.00 ? 200 ASP B OD2  1  
ATOM   2178  H  H    . ASP B 2 100 ? -4.625  3.537   9.328   1.00 0.00 ? 200 ASP B H    1  
ATOM   2179  H  HA   . ASP B 2 100 ? -4.152  4.124   12.171  1.00 0.00 ? 200 ASP B HA   1  
ATOM   2180  H  HB2  . ASP B 2 100 ? -5.292  5.850   10.677  1.00 0.00 ? 200 ASP B HB2  1  
ATOM   2181  H  HB3  . ASP B 2 100 ? -6.664  4.749   10.621  1.00 0.00 ? 200 ASP B HB3  1  
ATOM   2182  N  N    . LYS B 2 101 ? -5.018  1.780   12.611  1.00 0.00 ? 201 LYS B N    1  
ATOM   2183  C  CA   . LYS B 2 101 ? -5.664  0.568   13.099  1.00 0.00 ? 201 LYS B CA   1  
ATOM   2184  C  C    . LYS B 2 101 ? -6.695  0.895   14.175  1.00 0.00 ? 201 LYS B C    1  
ATOM   2185  O  O    . LYS B 2 101 ? -6.382  1.720   15.060  1.00 0.00 ? 201 LYS B O    1  
ATOM   2186  C  CB   . LYS B 2 101 ? -4.623  -0.405  13.653  1.00 0.00 ? 201 LYS B CB   1  
ATOM   2187  C  CG   . LYS B 2 101 ? -4.974  -1.867  13.428  1.00 0.00 ? 201 LYS B CG   1  
ATOM   2188  C  CD   . LYS B 2 101 ? -4.696  -2.294  11.994  1.00 0.00 ? 201 LYS B CD   1  
ATOM   2189  C  CE   . LYS B 2 101 ? -5.857  -3.085  11.412  1.00 0.00 ? 201 LYS B CE   1  
ATOM   2190  N  NZ   . LYS B 2 101 ? -6.697  -2.254  10.505  1.00 0.00 ? 201 LYS B NZ   1  
ATOM   2191  O  OXT  . LYS B 2 101 ? -7.805  0.327   14.123  1.00 0.00 ? 201 LYS B OXT  1  
ATOM   2192  H  H    . LYS B 2 101 ? -4.086  1.957   12.855  1.00 0.00 ? 201 LYS B H    1  
ATOM   2193  H  HA   . LYS B 2 101 ? -6.170  0.103   12.265  1.00 0.00 ? 201 LYS B HA   1  
ATOM   2194  H  HB2  . LYS B 2 101 ? -3.673  -0.208  13.177  1.00 0.00 ? 201 LYS B HB2  1  
ATOM   2195  H  HB3  . LYS B 2 101 ? -4.523  -0.241  14.716  1.00 0.00 ? 201 LYS B HB3  1  
ATOM   2196  H  HG2  . LYS B 2 101 ? -4.382  -2.476  14.094  1.00 0.00 ? 201 LYS B HG2  1  
ATOM   2197  H  HG3  . LYS B 2 101 ? -6.023  -2.010  13.641  1.00 0.00 ? 201 LYS B HG3  1  
ATOM   2198  H  HD2  . LYS B 2 101 ? -4.537  -1.412  11.390  1.00 0.00 ? 201 LYS B HD2  1  
ATOM   2199  H  HD3  . LYS B 2 101 ? -3.809  -2.909  11.978  1.00 0.00 ? 201 LYS B HD3  1  
ATOM   2200  H  HE2  . LYS B 2 101 ? -5.461  -3.922  10.855  1.00 0.00 ? 201 LYS B HE2  1  
ATOM   2201  H  HE3  . LYS B 2 101 ? -6.471  -3.450  12.223  1.00 0.00 ? 201 LYS B HE3  1  
ATOM   2202  H  HZ1  . LYS B 2 101 ? -7.267  -2.865  9.886   1.00 0.00 ? 201 LYS B HZ1  1  
ATOM   2203  H  HZ2  . LYS B 2 101 ? -6.093  -1.649  9.913   1.00 0.00 ? 201 LYS B HZ2  1  
ATOM   2204  H  HZ3  . LYS B 2 101 ? -7.334  -1.649  11.061  1.00 0.00 ? 201 LYS B HZ3  1  
HETATM 2205  ZN ZN   . ZN  C 3 .   ? 0.479   -11.128 -16.119 1.00 0.00 ? 202 ZN  B ZN   1  
HETATM 2206  ZN ZN   . ZN  D 3 .   ? 16.643  2.020   -17.978 1.00 0.00 ? 203 ZN  B ZN   1  
HETATM 2207  ZN ZN   . ZN  E 3 .   ? 3.689   5.980   -0.631  1.00 0.00 ? 204 ZN  B ZN   1  
ATOM   2208  N  N    . GLY A 1 1   ? 5.392   1.707   -42.993 1.00 0.00 ? 1   GLY A N    2  
ATOM   2209  C  CA   . GLY A 1 1   ? 6.233   1.186   -41.880 1.00 0.00 ? 1   GLY A CA   2  
ATOM   2210  C  C    . GLY A 1 1   ? 5.514   1.217   -40.546 1.00 0.00 ? 1   GLY A C    2  
ATOM   2211  O  O    . GLY A 1 1   ? 5.198   2.287   -40.027 1.00 0.00 ? 1   GLY A O    2  
ATOM   2212  H  H1   . GLY A 1 1   ? 5.897   1.613   -43.898 1.00 0.00 ? 1   GLY A H1   2  
ATOM   2213  H  H2   . GLY A 1 1   ? 5.171   2.711   -42.834 1.00 0.00 ? 1   GLY A H2   2  
ATOM   2214  H  H3   . GLY A 1 1   ? 4.501   1.172   -43.048 1.00 0.00 ? 1   GLY A H3   2  
ATOM   2215  H  HA2  . GLY A 1 1   ? 6.513   0.167   -42.102 1.00 0.00 ? 1   GLY A HA2  2  
ATOM   2216  H  HA3  . GLY A 1 1   ? 7.128   1.786   -41.808 1.00 0.00 ? 1   GLY A HA3  2  
ATOM   2217  N  N    . SER A 1 2   ? 5.255   0.039   -39.989 1.00 0.00 ? 2   SER A N    2  
ATOM   2218  C  CA   . SER A 1 2   ? 4.568   -0.067  -38.707 1.00 0.00 ? 2   SER A CA   2  
ATOM   2219  C  C    . SER A 1 2   ? 5.520   0.232   -37.553 1.00 0.00 ? 2   SER A C    2  
ATOM   2220  O  O    . SER A 1 2   ? 5.984   -0.678  -36.865 1.00 0.00 ? 2   SER A O    2  
ATOM   2221  C  CB   . SER A 1 2   ? 3.968   -1.464  -38.540 1.00 0.00 ? 2   SER A CB   2  
ATOM   2222  O  OG   . SER A 1 2   ? 2.759   -1.415  -37.802 1.00 0.00 ? 2   SER A OG   2  
ATOM   2223  H  H    . SER A 1 2   ? 5.532   -0.780  -40.451 1.00 0.00 ? 2   SER A H    2  
ATOM   2224  H  HA   . SER A 1 2   ? 3.772   0.661   -38.698 1.00 0.00 ? 2   SER A HA   2  
ATOM   2225  H  HB2  . SER A 1 2   ? 3.763   -1.885  -39.513 1.00 0.00 ? 2   SER A HB2  2  
ATOM   2226  H  HB3  . SER A 1 2   ? 4.671   -2.095  -38.015 1.00 0.00 ? 2   SER A HB3  2  
ATOM   2227  H  HG   . SER A 1 2   ? 2.125   -2.026  -38.185 1.00 0.00 ? 2   SER A HG   2  
ATOM   2228  N  N    . MET A 1 3   ? 5.806   1.513   -37.344 1.00 0.00 ? 3   MET A N    2  
ATOM   2229  C  CA   . MET A 1 3   ? 6.701   1.932   -36.271 1.00 0.00 ? 3   MET A CA   2  
ATOM   2230  C  C    . MET A 1 3   ? 6.126   1.563   -34.906 1.00 0.00 ? 3   MET A C    2  
ATOM   2231  O  O    . MET A 1 3   ? 6.867   1.388   -33.938 1.00 0.00 ? 3   MET A O    2  
ATOM   2232  C  CB   . MET A 1 3   ? 6.947   3.442   -36.345 1.00 0.00 ? 3   MET A CB   2  
ATOM   2233  C  CG   . MET A 1 3   ? 8.398   3.833   -36.120 1.00 0.00 ? 3   MET A CG   2  
ATOM   2234  S  SD   . MET A 1 3   ? 9.045   3.230   -34.548 1.00 0.00 ? 3   MET A SD   2  
ATOM   2235  C  CE   . MET A 1 3   ? 10.687  3.949   -34.560 1.00 0.00 ? 3   MET A CE   2  
ATOM   2236  H  H    . MET A 1 3   ? 5.404   2.193   -37.925 1.00 0.00 ? 3   MET A H    2  
ATOM   2237  H  HA   . MET A 1 3   ? 7.639   1.417   -36.404 1.00 0.00 ? 3   MET A HA   2  
ATOM   2238  H  HB2  . MET A 1 3   ? 6.649   3.795   -37.321 1.00 0.00 ? 3   MET A HB2  2  
ATOM   2239  H  HB3  . MET A 1 3   ? 6.344   3.931   -35.595 1.00 0.00 ? 3   MET A HB3  2  
ATOM   2240  H  HG2  . MET A 1 3   ? 8.996   3.423   -36.920 1.00 0.00 ? 3   MET A HG2  2  
ATOM   2241  H  HG3  . MET A 1 3   ? 8.471   4.911   -36.134 1.00 0.00 ? 3   MET A HG3  2  
ATOM   2242  H  HE1  . MET A 1 3   ? 11.216  3.623   -35.443 1.00 0.00 ? 3   MET A HE1  2  
ATOM   2243  H  HE2  . MET A 1 3   ? 11.225  3.630   -33.679 1.00 0.00 ? 3   MET A HE2  2  
ATOM   2244  H  HE3  . MET A 1 3   ? 10.608  5.026   -34.564 1.00 0.00 ? 3   MET A HE3  2  
ATOM   2245  N  N    . ASP A 1 4   ? 4.803   1.448   -34.833 1.00 0.00 ? 4   ASP A N    2  
ATOM   2246  C  CA   . ASP A 1 4   ? 4.127   1.100   -33.588 1.00 0.00 ? 4   ASP A CA   2  
ATOM   2247  C  C    . ASP A 1 4   ? 4.756   -0.132  -32.942 1.00 0.00 ? 4   ASP A C    2  
ATOM   2248  O  O    . ASP A 1 4   ? 4.451   -1.265  -33.313 1.00 0.00 ? 4   ASP A O    2  
ATOM   2249  C  CB   . ASP A 1 4   ? 2.640   0.851   -33.843 1.00 0.00 ? 4   ASP A CB   2  
ATOM   2250  C  CG   . ASP A 1 4   ? 2.402   -0.074  -35.020 1.00 0.00 ? 4   ASP A CG   2  
ATOM   2251  O  OD1  . ASP A 1 4   ? 2.472   -1.307  -34.831 1.00 0.00 ? 4   ASP A OD1  2  
ATOM   2252  O  OD2  . ASP A 1 4   ? 2.146   0.434   -36.132 1.00 0.00 ? 4   ASP A OD2  2  
ATOM   2253  H  H    . ASP A 1 4   ? 4.266   1.601   -35.637 1.00 0.00 ? 4   ASP A H    2  
ATOM   2254  H  HA   . ASP A 1 4   ? 4.230   1.937   -32.914 1.00 0.00 ? 4   ASP A HA   2  
ATOM   2255  H  HB2  . ASP A 1 4   ? 2.199   0.406   -32.964 1.00 0.00 ? 4   ASP A HB2  2  
ATOM   2256  H  HB3  . ASP A 1 4   ? 2.153   1.794   -34.046 1.00 0.00 ? 4   ASP A HB3  2  
ATOM   2257  N  N    . GLU A 1 5   ? 5.636   0.099   -31.972 1.00 0.00 ? 5   GLU A N    2  
ATOM   2258  C  CA   . GLU A 1 5   ? 6.309   -0.991  -31.273 1.00 0.00 ? 5   GLU A CA   2  
ATOM   2259  C  C    . GLU A 1 5   ? 6.440   -0.694  -29.786 1.00 0.00 ? 5   GLU A C    2  
ATOM   2260  O  O    . GLU A 1 5   ? 7.263   -1.285  -29.086 1.00 0.00 ? 5   GLU A O    2  
ATOM   2261  C  CB   . GLU A 1 5   ? 7.688   -1.225  -31.877 1.00 0.00 ? 5   GLU A CB   2  
ATOM   2262  C  CG   . GLU A 1 5   ? 7.875   -2.618  -32.457 1.00 0.00 ? 5   GLU A CG   2  
ATOM   2263  C  CD   . GLU A 1 5   ? 8.117   -3.666  -31.390 1.00 0.00 ? 5   GLU A CD   2  
ATOM   2264  O  OE1  . GLU A 1 5   ? 7.439   -3.614  -30.342 1.00 0.00 ? 5   GLU A OE1  2  
ATOM   2265  O  OE2  . GLU A 1 5   ? 8.985   -4.539  -31.601 1.00 0.00 ? 5   GLU A OE2  2  
ATOM   2266  H  H    . GLU A 1 5   ? 5.838   1.025   -31.721 1.00 0.00 ? 5   GLU A H    2  
ATOM   2267  H  HA   . GLU A 1 5   ? 5.712   -1.876  -31.394 1.00 0.00 ? 5   GLU A HA   2  
ATOM   2268  H  HB2  . GLU A 1 5   ? 7.843   -0.504  -32.665 1.00 0.00 ? 5   GLU A HB2  2  
ATOM   2269  H  HB3  . GLU A 1 5   ? 8.432   -1.073  -31.110 1.00 0.00 ? 5   GLU A HB3  2  
ATOM   2270  H  HG2  . GLU A 1 5   ? 6.986   -2.887  -33.009 1.00 0.00 ? 5   GLU A HG2  2  
ATOM   2271  H  HG3  . GLU A 1 5   ? 8.723   -2.604  -33.127 1.00 0.00 ? 5   GLU A HG3  2  
ATOM   2272  N  N    . SER A 1 6   ? 5.619   0.225   -29.319 1.00 0.00 ? 6   SER A N    2  
ATOM   2273  C  CA   . SER A 1 6   ? 5.616   0.627   -27.916 1.00 0.00 ? 6   SER A CA   2  
ATOM   2274  C  C    . SER A 1 6   ? 4.652   1.787   -27.685 1.00 0.00 ? 6   SER A C    2  
ATOM   2275  O  O    . SER A 1 6   ? 4.721   2.808   -28.370 1.00 0.00 ? 6   SER A O    2  
ATOM   2276  C  CB   . SER A 1 6   ? 7.025   1.026   -27.470 1.00 0.00 ? 6   SER A CB   2  
ATOM   2277  O  OG   . SER A 1 6   ? 7.791   1.504   -28.563 1.00 0.00 ? 6   SER A OG   2  
ATOM   2278  H  H    . SER A 1 6   ? 4.995   0.646   -29.940 1.00 0.00 ? 6   SER A H    2  
ATOM   2279  H  HA   . SER A 1 6   ? 5.288   -0.218  -27.330 1.00 0.00 ? 6   SER A HA   2  
ATOM   2280  H  HB2  . SER A 1 6   ? 6.958   1.807   -26.726 1.00 0.00 ? 6   SER A HB2  2  
ATOM   2281  H  HB3  . SER A 1 6   ? 7.523   0.166   -27.046 1.00 0.00 ? 6   SER A HB3  2  
ATOM   2282  H  HG   . SER A 1 6   ? 7.271   2.134   -29.067 1.00 0.00 ? 6   SER A HG   2  
ATOM   2283  N  N    . GLY A 1 7   ? 3.755   1.624   -26.718 1.00 0.00 ? 7   GLY A N    2  
ATOM   2284  C  CA   . GLY A 1 7   ? 2.793   2.668   -26.419 1.00 0.00 ? 7   GLY A CA   2  
ATOM   2285  C  C    . GLY A 1 7   ? 2.377   2.681   -24.960 1.00 0.00 ? 7   GLY A C    2  
ATOM   2286  O  O    . GLY A 1 7   ? 1.330   3.229   -24.614 1.00 0.00 ? 7   GLY A O    2  
ATOM   2287  H  H    . GLY A 1 7   ? 3.747   0.790   -26.205 1.00 0.00 ? 7   GLY A H    2  
ATOM   2288  H  HA2  . GLY A 1 7   ? 3.229   3.624   -26.666 1.00 0.00 ? 7   GLY A HA2  2  
ATOM   2289  H  HA3  . GLY A 1 7   ? 1.915   2.518   -27.030 1.00 0.00 ? 7   GLY A HA3  2  
ATOM   2290  N  N    . LEU A 1 8   ? 3.194   2.080   -24.101 1.00 0.00 ? 8   LEU A N    2  
ATOM   2291  C  CA   . LEU A 1 8   ? 2.899   2.030   -22.677 1.00 0.00 ? 8   LEU A CA   2  
ATOM   2292  C  C    . LEU A 1 8   ? 2.969   3.419   -22.055 1.00 0.00 ? 8   LEU A C    2  
ATOM   2293  O  O    . LEU A 1 8   ? 3.980   4.110   -22.179 1.00 0.00 ? 8   LEU A O    2  
ATOM   2294  C  CB   . LEU A 1 8   ? 3.887   1.109   -21.960 1.00 0.00 ? 8   LEU A CB   2  
ATOM   2295  C  CG   . LEU A 1 8   ? 3.396   0.579   -20.614 1.00 0.00 ? 8   LEU A CG   2  
ATOM   2296  C  CD1  . LEU A 1 8   ? 3.335   -0.941  -20.622 1.00 0.00 ? 8   LEU A CD1  2  
ATOM   2297  C  CD2  . LEU A 1 8   ? 4.283   1.074   -19.481 1.00 0.00 ? 8   LEU A CD2  2  
ATOM   2298  H  H    . LEU A 1 8   ? 4.014   1.661   -24.431 1.00 0.00 ? 8   LEU A H    2  
ATOM   2299  H  HA   . LEU A 1 8   ? 1.903   1.637   -22.556 1.00 0.00 ? 8   LEU A HA   2  
ATOM   2300  H  HB2  . LEU A 1 8   ? 4.100   0.273   -22.604 1.00 0.00 ? 8   LEU A HB2  2  
ATOM   2301  H  HB3  . LEU A 1 8   ? 4.802   1.657   -21.796 1.00 0.00 ? 8   LEU A HB3  2  
ATOM   2302  H  HG   . LEU A 1 8   ? 2.399   0.952   -20.442 1.00 0.00 ? 8   LEU A HG   2  
ATOM   2303  H  HD11 . LEU A 1 8   ? 4.325   -1.340  -20.781 1.00 0.00 ? 8   LEU A HD11 2  
ATOM   2304  H  HD12 . LEU A 1 8   ? 2.683   -1.270  -21.416 1.00 0.00 ? 8   LEU A HD12 2  
ATOM   2305  H  HD13 . LEU A 1 8   ? 2.954   -1.291  -19.674 1.00 0.00 ? 8   LEU A HD13 2  
ATOM   2306  H  HD21 . LEU A 1 8   ? 5.320   0.918   -19.741 1.00 0.00 ? 8   LEU A HD21 2  
ATOM   2307  H  HD22 . LEU A 1 8   ? 4.051   0.530   -18.578 1.00 0.00 ? 8   LEU A HD22 2  
ATOM   2308  H  HD23 . LEU A 1 8   ? 4.108   2.128   -19.322 1.00 0.00 ? 8   LEU A HD23 2  
ATOM   2309  N  N    . PRO A 1 9   ? 1.901   3.848   -21.361 1.00 0.00 ? 9   PRO A N    2  
ATOM   2310  C  CA   . PRO A 1 9   ? 1.876   5.159   -20.711 1.00 0.00 ? 9   PRO A CA   2  
ATOM   2311  C  C    . PRO A 1 9   ? 3.116   5.374   -19.854 1.00 0.00 ? 9   PRO A C    2  
ATOM   2312  O  O    . PRO A 1 9   ? 3.239   4.802   -18.770 1.00 0.00 ? 9   PRO A O    2  
ATOM   2313  C  CB   . PRO A 1 9   ? 0.623   5.098   -19.835 1.00 0.00 ? 9   PRO A CB   2  
ATOM   2314  C  CG   . PRO A 1 9   ? -0.262  4.105   -20.506 1.00 0.00 ? 9   PRO A CG   2  
ATOM   2315  C  CD   . PRO A 1 9   ? 0.653   3.094   -21.142 1.00 0.00 ? 9   PRO A CD   2  
ATOM   2316  H  HA   . PRO A 1 9   ? 1.786   5.961   -21.430 1.00 0.00 ? 9   PRO A HA   2  
ATOM   2317  H  HB2  . PRO A 1 9   ? 0.894   4.777   -18.839 1.00 0.00 ? 9   PRO A HB2  2  
ATOM   2318  H  HB3  . PRO A 1 9   ? 0.163   6.072   -19.793 1.00 0.00 ? 9   PRO A HB3  2  
ATOM   2319  H  HG2  . PRO A 1 9   ? -0.897  3.627   -19.775 1.00 0.00 ? 9   PRO A HG2  2  
ATOM   2320  H  HG3  . PRO A 1 9   ? -0.858  4.596   -21.260 1.00 0.00 ? 9   PRO A HG3  2  
ATOM   2321  H  HD2  . PRO A 1 9   ? 0.818   2.261   -20.476 1.00 0.00 ? 9   PRO A HD2  2  
ATOM   2322  H  HD3  . PRO A 1 9   ? 0.242   2.752   -22.081 1.00 0.00 ? 9   PRO A HD3  2  
ATOM   2323  N  N    . GLN A 1 10  ? 4.037   6.191   -20.347 1.00 0.00 ? 10  GLN A N    2  
ATOM   2324  C  CA   . GLN A 1 10  ? 5.270   6.464   -19.623 1.00 0.00 ? 10  GLN A CA   2  
ATOM   2325  C  C    . GLN A 1 10  ? 5.171   7.778   -18.849 1.00 0.00 ? 10  GLN A C    2  
ATOM   2326  O  O    . GLN A 1 10  ? 5.053   8.851   -19.441 1.00 0.00 ? 10  GLN A O    2  
ATOM   2327  C  CB   . GLN A 1 10  ? 6.455   6.506   -20.593 1.00 0.00 ? 10  GLN A CB   2  
ATOM   2328  C  CG   . GLN A 1 10  ? 6.481   7.740   -21.482 1.00 0.00 ? 10  GLN A CG   2  
ATOM   2329  C  CD   . GLN A 1 10  ? 7.369   7.565   -22.699 1.00 0.00 ? 10  GLN A CD   2  
ATOM   2330  O  OE1  . GLN A 1 10  ? 7.991   6.518   -22.880 1.00 0.00 ? 10  GLN A OE1  2  
ATOM   2331  N  NE2  . GLN A 1 10  ? 7.431   8.591   -23.540 1.00 0.00 ? 10  GLN A NE2  2  
ATOM   2332  H  H    . GLN A 1 10  ? 3.889   6.612   -21.219 1.00 0.00 ? 10  GLN A H    2  
ATOM   2333  H  HA   . GLN A 1 10  ? 5.423   5.655   -18.924 1.00 0.00 ? 10  GLN A HA   2  
ATOM   2334  H  HB2  . GLN A 1 10  ? 7.371   6.478   -20.025 1.00 0.00 ? 10  GLN A HB2  2  
ATOM   2335  H  HB3  . GLN A 1 10  ? 6.412   5.634   -21.229 1.00 0.00 ? 10  GLN A HB3  2  
ATOM   2336  H  HG2  . GLN A 1 10  ? 5.476   7.950   -21.816 1.00 0.00 ? 10  GLN A HG2  2  
ATOM   2337  H  HG3  . GLN A 1 10  ? 6.849   8.576   -20.904 1.00 0.00 ? 10  GLN A HG3  2  
ATOM   2338  H  HE21 . GLN A 1 10  ? 6.907   9.393   -23.331 1.00 0.00 ? 10  GLN A HE21 2  
ATOM   2339  H  HE22 . GLN A 1 10  ? 7.996   8.504   -24.334 1.00 0.00 ? 10  GLN A HE22 2  
ATOM   2340  N  N    . LEU A 1 11  ? 5.216   7.685   -17.523 1.00 0.00 ? 11  LEU A N    2  
ATOM   2341  C  CA   . LEU A 1 11  ? 5.126   8.867   -16.673 1.00 0.00 ? 11  LEU A CA   2  
ATOM   2342  C  C    . LEU A 1 11  ? 6.437   9.648   -16.679 1.00 0.00 ? 11  LEU A C    2  
ATOM   2343  O  O    . LEU A 1 11  ? 7.490   9.110   -17.019 1.00 0.00 ? 11  LEU A O    2  
ATOM   2344  C  CB   . LEU A 1 11  ? 4.766   8.466   -15.240 1.00 0.00 ? 11  LEU A CB   2  
ATOM   2345  C  CG   . LEU A 1 11  ? 3.326   7.989   -15.044 1.00 0.00 ? 11  LEU A CG   2  
ATOM   2346  C  CD1  . LEU A 1 11  ? 3.055   7.699   -13.577 1.00 0.00 ? 11  LEU A CD1  2  
ATOM   2347  C  CD2  . LEU A 1 11  ? 2.345   9.025   -15.573 1.00 0.00 ? 11  LEU A CD2  2  
ATOM   2348  H  H    . LEU A 1 11  ? 5.308   6.804   -17.107 1.00 0.00 ? 11  LEU A H    2  
ATOM   2349  H  HA   . LEU A 1 11  ? 4.345   9.497   -17.067 1.00 0.00 ? 11  LEU A HA   2  
ATOM   2350  H  HB2  . LEU A 1 11  ? 5.431   7.672   -14.933 1.00 0.00 ? 11  LEU A HB2  2  
ATOM   2351  H  HB3  . LEU A 1 11  ? 4.929   9.318   -14.598 1.00 0.00 ? 11  LEU A HB3  2  
ATOM   2352  H  HG   . LEU A 1 11  ? 3.179   7.074   -15.598 1.00 0.00 ? 11  LEU A HG   2  
ATOM   2353  H  HD11 . LEU A 1 11  ? 3.240   6.654   -13.377 1.00 0.00 ? 11  LEU A HD11 2  
ATOM   2354  H  HD12 . LEU A 1 11  ? 2.027   7.933   -13.347 1.00 0.00 ? 11  LEU A HD12 2  
ATOM   2355  H  HD13 . LEU A 1 11  ? 3.708   8.303   -12.964 1.00 0.00 ? 11  LEU A HD13 2  
ATOM   2356  H  HD21 . LEU A 1 11  ? 2.444   9.100   -16.646 1.00 0.00 ? 11  LEU A HD21 2  
ATOM   2357  H  HD22 . LEU A 1 11  ? 2.558   9.984   -15.125 1.00 0.00 ? 11  LEU A HD22 2  
ATOM   2358  H  HD23 . LEU A 1 11  ? 1.338   8.726   -15.324 1.00 0.00 ? 11  LEU A HD23 2  
ATOM   2359  N  N    . THR A 1 12  ? 6.363   10.921  -16.303 1.00 0.00 ? 12  THR A N    2  
ATOM   2360  C  CA   . THR A 1 12  ? 7.537   11.780  -16.265 1.00 0.00 ? 12  THR A CA   2  
ATOM   2361  C  C    . THR A 1 12  ? 8.228   11.699  -14.911 1.00 0.00 ? 12  THR A C    2  
ATOM   2362  O  O    . THR A 1 12  ? 7.580   11.508  -13.881 1.00 0.00 ? 12  THR A O    2  
ATOM   2363  C  CB   . THR A 1 12  ? 7.130   13.223  -16.549 1.00 0.00 ? 12  THR A CB   2  
ATOM   2364  O  OG1  . THR A 1 12  ? 6.364   13.304  -17.738 1.00 0.00 ? 12  THR A OG1  2  
ATOM   2365  C  CG2  . THR A 1 12  ? 8.306   14.165  -16.696 1.00 0.00 ? 12  THR A CG2  2  
ATOM   2366  H  H    . THR A 1 12  ? 5.495   11.296  -16.044 1.00 0.00 ? 12  THR A H    2  
ATOM   2367  H  HA   . THR A 1 12  ? 8.223   11.449  -17.029 1.00 0.00 ? 12  THR A HA   2  
ATOM   2368  H  HB   . THR A 1 12  ? 6.523   13.576  -15.728 1.00 0.00 ? 12  THR A HB   2  
ATOM   2369  H  HG1  . THR A 1 12  ? 5.546   12.813  -17.625 1.00 0.00 ? 12  THR A HG1  2  
ATOM   2370  H  HG21 . THR A 1 12  ? 8.064   15.116  -16.246 1.00 0.00 ? 12  THR A HG21 2  
ATOM   2371  H  HG22 . THR A 1 12  ? 8.524   14.308  -17.744 1.00 0.00 ? 12  THR A HG22 2  
ATOM   2372  H  HG23 . THR A 1 12  ? 9.169   13.744  -16.202 1.00 0.00 ? 12  THR A HG23 2  
ATOM   2373  N  N    . SER A 1 13  ? 9.548   11.850  -14.916 1.00 0.00 ? 13  SER A N    2  
ATOM   2374  C  CA   . SER A 1 13  ? 10.332  11.800  -13.696 1.00 0.00 ? 13  SER A CA   2  
ATOM   2375  C  C    . SER A 1 13  ? 9.732   12.695  -12.611 1.00 0.00 ? 13  SER A C    2  
ATOM   2376  O  O    . SER A 1 13  ? 9.962   12.482  -11.421 1.00 0.00 ? 13  SER A O    2  
ATOM   2377  C  CB   . SER A 1 13  ? 11.776  12.222  -13.976 1.00 0.00 ? 13  SER A CB   2  
ATOM   2378  O  OG   . SER A 1 13  ? 12.470  12.499  -12.771 1.00 0.00 ? 13  SER A OG   2  
ATOM   2379  H  H    . SER A 1 13  ? 10.007  11.997  -15.761 1.00 0.00 ? 13  SER A H    2  
ATOM   2380  H  HA   . SER A 1 13  ? 10.327  10.783  -13.356 1.00 0.00 ? 13  SER A HA   2  
ATOM   2381  H  HB2  . SER A 1 13  ? 12.287  11.423  -14.495 1.00 0.00 ? 13  SER A HB2  2  
ATOM   2382  H  HB3  . SER A 1 13  ? 11.777  13.109  -14.591 1.00 0.00 ? 13  SER A HB3  2  
ATOM   2383  H  HG   . SER A 1 13  ? 12.267  11.823  -12.121 1.00 0.00 ? 13  SER A HG   2  
ATOM   2384  N  N    . TYR A 1 14  ? 8.961   13.699  -13.030 1.00 0.00 ? 14  TYR A N    2  
ATOM   2385  C  CA   . TYR A 1 14  ? 8.335   14.621  -12.089 1.00 0.00 ? 14  TYR A CA   2  
ATOM   2386  C  C    . TYR A 1 14  ? 6.902   14.201  -11.787 1.00 0.00 ? 14  TYR A C    2  
ATOM   2387  O  O    . TYR A 1 14  ? 6.485   14.175  -10.629 1.00 0.00 ? 14  TYR A O    2  
ATOM   2388  C  CB   . TYR A 1 14  ? 8.356   16.045  -12.650 1.00 0.00 ? 14  TYR A CB   2  
ATOM   2389  C  CG   . TYR A 1 14  ? 8.232   17.118  -11.591 1.00 0.00 ? 14  TYR A CG   2  
ATOM   2390  C  CD1  . TYR A 1 14  ? 9.187   17.247  -10.590 1.00 0.00 ? 14  TYR A CD1  2  
ATOM   2391  C  CD2  . TYR A 1 14  ? 7.161   18.003  -11.595 1.00 0.00 ? 14  TYR A CD2  2  
ATOM   2392  C  CE1  . TYR A 1 14  ? 9.076   18.228  -9.622  1.00 0.00 ? 14  TYR A CE1  2  
ATOM   2393  C  CE2  . TYR A 1 14  ? 7.045   18.986  -10.631 1.00 0.00 ? 14  TYR A CE2  2  
ATOM   2394  C  CZ   . TYR A 1 14  ? 8.004   19.094  -9.647  1.00 0.00 ? 14  TYR A CZ   2  
ATOM   2395  O  OH   . TYR A 1 14  ? 7.892   20.073  -8.686  1.00 0.00 ? 14  TYR A OH   2  
ATOM   2396  H  H    . TYR A 1 14  ? 8.811   13.824  -13.993 1.00 0.00 ? 14  TYR A H    2  
ATOM   2397  H  HA   . TYR A 1 14  ? 8.902   14.596  -11.172 1.00 0.00 ? 14  TYR A HA   2  
ATOM   2398  H  HB2  . TYR A 1 14  ? 9.287   16.203  -13.174 1.00 0.00 ? 14  TYR A HB2  2  
ATOM   2399  H  HB3  . TYR A 1 14  ? 7.535   16.163  -13.342 1.00 0.00 ? 14  TYR A HB3  2  
ATOM   2400  H  HD1  . TYR A 1 14  ? 10.024  16.566  -10.572 1.00 0.00 ? 14  TYR A HD1  2  
ATOM   2401  H  HD2  . TYR A 1 14  ? 6.411   17.915  -12.367 1.00 0.00 ? 14  TYR A HD2  2  
ATOM   2402  H  HE1  . TYR A 1 14  ? 9.828   18.312  -8.851  1.00 0.00 ? 14  TYR A HE1  2  
ATOM   2403  H  HE2  . TYR A 1 14  ? 6.205   19.664  -10.652 1.00 0.00 ? 14  TYR A HE2  2  
ATOM   2404  H  HH   . TYR A 1 14  ? 7.980   20.936  -9.096  1.00 0.00 ? 14  TYR A HH   2  
ATOM   2405  N  N    . ASP A 1 15  ? 6.151   13.863  -12.832 1.00 0.00 ? 15  ASP A N    2  
ATOM   2406  C  CA   . ASP A 1 15  ? 4.766   13.435  -12.669 1.00 0.00 ? 15  ASP A CA   2  
ATOM   2407  C  C    . ASP A 1 15  ? 4.672   12.283  -11.673 1.00 0.00 ? 15  ASP A C    2  
ATOM   2408  O  O    . ASP A 1 15  ? 3.636   12.076  -11.043 1.00 0.00 ? 15  ASP A O    2  
ATOM   2409  C  CB   . ASP A 1 15  ? 4.176   13.012  -14.015 1.00 0.00 ? 15  ASP A CB   2  
ATOM   2410  C  CG   . ASP A 1 15  ? 2.664   13.122  -14.044 1.00 0.00 ? 15  ASP A CG   2  
ATOM   2411  O  OD1  . ASP A 1 15  ? 2.150   14.256  -13.948 1.00 0.00 ? 15  ASP A OD1  2  
ATOM   2412  O  OD2  . ASP A 1 15  ? 1.995   12.075  -14.162 1.00 0.00 ? 15  ASP A OD2  2  
ATOM   2413  H  H    . ASP A 1 15  ? 6.539   13.898  -13.731 1.00 0.00 ? 15  ASP A H    2  
ATOM   2414  H  HA   . ASP A 1 15  ? 4.202   14.272  -12.285 1.00 0.00 ? 15  ASP A HA   2  
ATOM   2415  H  HB2  . ASP A 1 15  ? 4.579   13.644  -14.793 1.00 0.00 ? 15  ASP A HB2  2  
ATOM   2416  H  HB3  . ASP A 1 15  ? 4.448   11.985  -14.214 1.00 0.00 ? 15  ASP A HB3  2  
ATOM   2417  N  N    . CYS A 1 16  ? 5.766   11.541  -11.533 1.00 0.00 ? 16  CYS A N    2  
ATOM   2418  C  CA   . CYS A 1 16  ? 5.817   10.416  -10.613 1.00 0.00 ? 16  CYS A CA   2  
ATOM   2419  C  C    . CYS A 1 16  ? 6.176   10.887  -9.212  1.00 0.00 ? 16  CYS A C    2  
ATOM   2420  O  O    . CYS A 1 16  ? 5.511   10.540  -8.239  1.00 0.00 ? 16  CYS A O    2  
ATOM   2421  C  CB   . CYS A 1 16  ? 6.850   9.400   -11.093 1.00 0.00 ? 16  CYS A CB   2  
ATOM   2422  S  SG   . CYS A 1 16  ? 6.632   7.741   -10.409 1.00 0.00 ? 16  CYS A SG   2  
ATOM   2423  H  H    . CYS A 1 16  ? 6.562   11.757  -12.059 1.00 0.00 ? 16  CYS A H    2  
ATOM   2424  H  HA   . CYS A 1 16  ? 4.843   9.954   -10.592 1.00 0.00 ? 16  CYS A HA   2  
ATOM   2425  H  HB2  . CYS A 1 16  ? 6.795   9.324   -12.166 1.00 0.00 ? 16  CYS A HB2  2  
ATOM   2426  H  HB3  . CYS A 1 16  ? 7.834   9.745   -10.814 1.00 0.00 ? 16  CYS A HB3  2  
ATOM   2427  H  HG   . CYS A 1 16  ? 6.826   7.780   -9.470  1.00 0.00 ? 16  CYS A HG   2  
ATOM   2428  N  N    . GLU A 1 17  ? 7.237   11.679  -9.123  1.00 0.00 ? 17  GLU A N    2  
ATOM   2429  C  CA   . GLU A 1 17  ? 7.693   12.205  -7.844  1.00 0.00 ? 17  GLU A CA   2  
ATOM   2430  C  C    . GLU A 1 17  ? 6.613   13.064  -7.196  1.00 0.00 ? 17  GLU A C    2  
ATOM   2431  O  O    . GLU A 1 17  ? 6.363   12.965  -5.994  1.00 0.00 ? 17  GLU A O    2  
ATOM   2432  C  CB   . GLU A 1 17  ? 8.964   13.031  -8.043  1.00 0.00 ? 17  GLU A CB   2  
ATOM   2433  C  CG   . GLU A 1 17  ? 9.953   12.916  -6.895  1.00 0.00 ? 17  GLU A CG   2  
ATOM   2434  C  CD   . GLU A 1 17  ? 9.626   13.853  -5.748  1.00 0.00 ? 17  GLU A CD   2  
ATOM   2435  O  OE1  . GLU A 1 17  ? 8.957   14.879  -5.992  1.00 0.00 ? 17  GLU A OE1  2  
ATOM   2436  O  OE2  . GLU A 1 17  ? 10.042  13.561  -4.607  1.00 0.00 ? 17  GLU A OE2  2  
ATOM   2437  H  H    . GLU A 1 17  ? 7.725   11.918  -9.940  1.00 0.00 ? 17  GLU A H    2  
ATOM   2438  H  HA   . GLU A 1 17  ? 7.913   11.369  -7.198  1.00 0.00 ? 17  GLU A HA   2  
ATOM   2439  H  HB2  . GLU A 1 17  ? 9.452   12.703  -8.947  1.00 0.00 ? 17  GLU A HB2  2  
ATOM   2440  H  HB3  . GLU A 1 17  ? 8.688   14.069  -8.151  1.00 0.00 ? 17  GLU A HB3  2  
ATOM   2441  H  HG2  . GLU A 1 17  ? 9.941   11.901  -6.526  1.00 0.00 ? 17  GLU A HG2  2  
ATOM   2442  H  HG3  . GLU A 1 17  ? 10.941  13.152  -7.264  1.00 0.00 ? 17  GLU A HG3  2  
ATOM   2443  N  N    . VAL A 1 18  ? 5.982   13.909  -8.002  1.00 0.00 ? 18  VAL A N    2  
ATOM   2444  C  CA   . VAL A 1 18  ? 4.930   14.793  -7.513  1.00 0.00 ? 18  VAL A CA   2  
ATOM   2445  C  C    . VAL A 1 18  ? 3.721   14.005  -7.015  1.00 0.00 ? 18  VAL A C    2  
ATOM   2446  O  O    . VAL A 1 18  ? 3.138   14.338  -5.982  1.00 0.00 ? 18  VAL A O    2  
ATOM   2447  C  CB   . VAL A 1 18  ? 4.470   15.778  -8.606  1.00 0.00 ? 18  VAL A CB   2  
ATOM   2448  C  CG1  . VAL A 1 18  ? 3.481   16.785  -8.037  1.00 0.00 ? 18  VAL A CG1  2  
ATOM   2449  C  CG2  . VAL A 1 18  ? 5.664   16.487  -9.227  1.00 0.00 ? 18  VAL A CG2  2  
ATOM   2450  H  H    . VAL A 1 18  ? 6.233   13.941  -8.949  1.00 0.00 ? 18  VAL A H    2  
ATOM   2451  H  HA   . VAL A 1 18  ? 5.335   15.367  -6.692  1.00 0.00 ? 18  VAL A HA   2  
ATOM   2452  H  HB   . VAL A 1 18  ? 3.969   15.215  -9.381  1.00 0.00 ? 18  VAL A HB   2  
ATOM   2453  H  HG11 . VAL A 1 18  ? 2.637   16.261  -7.615  1.00 0.00 ? 18  VAL A HG11 2  
ATOM   2454  H  HG12 . VAL A 1 18  ? 3.141   17.440  -8.825  1.00 0.00 ? 18  VAL A HG12 2  
ATOM   2455  H  HG13 . VAL A 1 18  ? 3.965   17.368  -7.268  1.00 0.00 ? 18  VAL A HG13 2  
ATOM   2456  H  HG21 . VAL A 1 18  ? 5.787   17.456  -8.766  1.00 0.00 ? 18  VAL A HG21 2  
ATOM   2457  H  HG22 . VAL A 1 18  ? 5.496   16.612  -10.287 1.00 0.00 ? 18  VAL A HG22 2  
ATOM   2458  H  HG23 . VAL A 1 18  ? 6.555   15.899  -9.071  1.00 0.00 ? 18  VAL A HG23 2  
ATOM   2459  N  N    . ASN A 1 19  ? 3.341   12.967  -7.754  1.00 0.00 ? 19  ASN A N    2  
ATOM   2460  C  CA   . ASN A 1 19  ? 2.193   12.146  -7.380  1.00 0.00 ? 19  ASN A CA   2  
ATOM   2461  C  C    . ASN A 1 19  ? 2.580   11.063  -6.374  1.00 0.00 ? 19  ASN A C    2  
ATOM   2462  O  O    . ASN A 1 19  ? 1.726   10.533  -5.662  1.00 0.00 ? 19  ASN A O    2  
ATOM   2463  C  CB   . ASN A 1 19  ? 1.573   11.506  -8.624  1.00 0.00 ? 19  ASN A CB   2  
ATOM   2464  C  CG   . ASN A 1 19  ? 0.097   11.821  -8.764  1.00 0.00 ? 19  ASN A CG   2  
ATOM   2465  O  OD1  . ASN A 1 19  ? -0.759  11.023  -8.383  1.00 0.00 ? 19  ASN A OD1  2  
ATOM   2466  N  ND2  . ASN A 1 19  ? -0.209  12.992  -9.313  1.00 0.00 ? 19  ASN A ND2  2  
ATOM   2467  H  H    . ASN A 1 19  ? 3.840   12.750  -8.572  1.00 0.00 ? 19  ASN A H    2  
ATOM   2468  H  HA   . ASN A 1 19  ? 1.461   12.796  -6.924  1.00 0.00 ? 19  ASN A HA   2  
ATOM   2469  H  HB2  . ASN A 1 19  ? 2.083   11.872  -9.501  1.00 0.00 ? 19  ASN A HB2  2  
ATOM   2470  H  HB3  . ASN A 1 19  ? 1.690   10.434  -8.566  1.00 0.00 ? 19  ASN A HB3  2  
ATOM   2471  H  HD21 . ASN A 1 19  ? 0.525   13.578  -9.591  1.00 0.00 ? 19  ASN A HD21 2  
ATOM   2472  H  HD22 . ASN A 1 19  ? -1.156  13.220  -9.415  1.00 0.00 ? 19  ASN A HD22 2  
ATOM   2473  N  N    . ALA A 1 20  ? 3.866   10.735  -6.318  1.00 0.00 ? 20  ALA A N    2  
ATOM   2474  C  CA   . ALA A 1 20  ? 4.354   9.714   -5.400  1.00 0.00 ? 20  ALA A CA   2  
ATOM   2475  C  C    . ALA A 1 20  ? 5.846   9.888   -5.131  1.00 0.00 ? 20  ALA A C    2  
ATOM   2476  O  O    . ALA A 1 20  ? 6.683   9.365   -5.868  1.00 0.00 ? 20  ALA A O    2  
ATOM   2477  C  CB   . ALA A 1 20  ? 4.074   8.326   -5.955  1.00 0.00 ? 20  ALA A CB   2  
ATOM   2478  H  H    . ALA A 1 20  ? 4.501   11.187  -6.908  1.00 0.00 ? 20  ALA A H    2  
ATOM   2479  H  HA   . ALA A 1 20  ? 3.816   9.821   -4.469  1.00 0.00 ? 20  ALA A HA   2  
ATOM   2480  H  HB1  . ALA A 1 20  ? 4.399   7.582   -5.242  1.00 0.00 ? 20  ALA A HB1  2  
ATOM   2481  H  HB2  . ALA A 1 20  ? 4.609   8.194   -6.883  1.00 0.00 ? 20  ALA A HB2  2  
ATOM   2482  H  HB3  . ALA A 1 20  ? 3.014   8.216   -6.131  1.00 0.00 ? 20  ALA A HB3  2  
ATOM   2483  N  N    . PRO A 1 21  ? 6.199   10.633  -4.071  1.00 0.00 ? 21  PRO A N    2  
ATOM   2484  C  CA   . PRO A 1 21  ? 7.592   10.879  -3.708  1.00 0.00 ? 21  PRO A CA   2  
ATOM   2485  C  C    . PRO A 1 21  ? 8.195   9.743   -2.889  1.00 0.00 ? 21  PRO A C    2  
ATOM   2486  O  O    . PRO A 1 21  ? 7.491   8.834   -2.454  1.00 0.00 ? 21  PRO A O    2  
ATOM   2487  C  CB   . PRO A 1 21  ? 7.505   12.151  -2.872  1.00 0.00 ? 21  PRO A CB   2  
ATOM   2488  C  CG   . PRO A 1 21  ? 6.163   12.086  -2.220  1.00 0.00 ? 21  PRO A CG   2  
ATOM   2489  C  CD   . PRO A 1 21  ? 5.265   11.297  -3.143  1.00 0.00 ? 21  PRO A CD   2  
ATOM   2490  H  HA   . PRO A 1 21  ? 8.204   11.059  -4.580  1.00 0.00 ? 21  PRO A HA   2  
ATOM   2491  H  HB2  . PRO A 1 21  ? 8.301   12.159  -2.142  1.00 0.00 ? 21  PRO A HB2  2  
ATOM   2492  H  HB3  . PRO A 1 21  ? 7.588   13.013  -3.515  1.00 0.00 ? 21  PRO A HB3  2  
ATOM   2493  H  HG2  . PRO A 1 21  ? 6.247   11.585  -1.266  1.00 0.00 ? 21  PRO A HG2  2  
ATOM   2494  H  HG3  . PRO A 1 21  ? 5.775   13.084  -2.085  1.00 0.00 ? 21  PRO A HG3  2  
ATOM   2495  H  HD2  . PRO A 1 21  ? 4.699   10.568  -2.585  1.00 0.00 ? 21  PRO A HD2  2  
ATOM   2496  H  HD3  . PRO A 1 21  ? 4.600   11.959  -3.678  1.00 0.00 ? 21  PRO A HD3  2  
ATOM   2497  N  N    . ILE A 1 22  ? 9.504   9.811   -2.680  1.00 0.00 ? 22  ILE A N    2  
ATOM   2498  C  CA   . ILE A 1 22  ? 10.210  8.794   -1.910  1.00 0.00 ? 22  ILE A CA   2  
ATOM   2499  C  C    . ILE A 1 22  ? 10.601  9.323   -0.528  1.00 0.00 ? 22  ILE A C    2  
ATOM   2500  O  O    . ILE A 1 22  ? 10.999  8.556   0.348   1.00 0.00 ? 22  ILE A O    2  
ATOM   2501  C  CB   . ILE A 1 22  ? 11.470  8.309   -2.657  1.00 0.00 ? 22  ILE A CB   2  
ATOM   2502  C  CG1  . ILE A 1 22  ? 11.075  7.727   -4.017  1.00 0.00 ? 22  ILE A CG1  2  
ATOM   2503  C  CG2  . ILE A 1 22  ? 12.229  7.281   -1.829  1.00 0.00 ? 22  ILE A CG2  2  
ATOM   2504  C  CD1  . ILE A 1 22  ? 12.194  6.987   -4.716  1.00 0.00 ? 22  ILE A CD1  2  
ATOM   2505  H  H    . ILE A 1 22  ? 10.007  10.565  -3.052  1.00 0.00 ? 22  ILE A H    2  
ATOM   2506  H  HA   . ILE A 1 22  ? 9.546   7.950   -1.786  1.00 0.00 ? 22  ILE A HA   2  
ATOM   2507  H  HB   . ILE A 1 22  ? 12.120  9.156   -2.813  1.00 0.00 ? 22  ILE A HB   2  
ATOM   2508  H  HG12 . ILE A 1 22  ? 10.258  7.034   -3.881  1.00 0.00 ? 22  ILE A HG12 2  
ATOM   2509  H  HG13 . ILE A 1 22  ? 10.753  8.529   -4.665  1.00 0.00 ? 22  ILE A HG13 2  
ATOM   2510  H  HG21 . ILE A 1 22  ? 11.574  6.459   -1.588  1.00 0.00 ? 22  ILE A HG21 2  
ATOM   2511  H  HG22 . ILE A 1 22  ? 12.582  7.741   -0.919  1.00 0.00 ? 22  ILE A HG22 2  
ATOM   2512  H  HG23 . ILE A 1 22  ? 13.072  6.914   -2.395  1.00 0.00 ? 22  ILE A HG23 2  
ATOM   2513  H  HD11 . ILE A 1 22  ? 11.808  6.503   -5.601  1.00 0.00 ? 22  ILE A HD11 2  
ATOM   2514  H  HD12 . ILE A 1 22  ? 12.603  6.243   -4.049  1.00 0.00 ? 22  ILE A HD12 2  
ATOM   2515  H  HD13 . ILE A 1 22  ? 12.968  7.685   -4.994  1.00 0.00 ? 22  ILE A HD13 2  
ATOM   2516  N  N    . GLN A 1 23  ? 10.481  10.637  -0.340  1.00 0.00 ? 23  GLN A N    2  
ATOM   2517  C  CA   . GLN A 1 23  ? 10.817  11.273  0.934   1.00 0.00 ? 23  GLN A CA   2  
ATOM   2518  C  C    . GLN A 1 23  ? 12.326  11.407  1.095   1.00 0.00 ? 23  GLN A C    2  
ATOM   2519  O  O    . GLN A 1 23  ? 12.869  11.189  2.179   1.00 0.00 ? 23  GLN A O    2  
ATOM   2520  C  CB   . GLN A 1 23  ? 10.235  10.482  2.109   1.00 0.00 ? 23  GLN A CB   2  
ATOM   2521  C  CG   . GLN A 1 23  ? 8.826   9.967   1.859   1.00 0.00 ? 23  GLN A CG   2  
ATOM   2522  C  CD   . GLN A 1 23  ? 7.865   10.328  2.976   1.00 0.00 ? 23  GLN A CD   2  
ATOM   2523  O  OE1  . GLN A 1 23  ? 7.678   11.501  3.295   1.00 0.00 ? 23  GLN A OE1  2  
ATOM   2524  N  NE2  . GLN A 1 23  ? 7.248   9.315   3.575   1.00 0.00 ? 23  GLN A NE2  2  
ATOM   2525  H  H    . GLN A 1 23  ? 10.156  11.195  -1.075  1.00 0.00 ? 23  GLN A H    2  
ATOM   2526  H  HA   . GLN A 1 23  ? 10.382  12.262  0.931   1.00 0.00 ? 23  GLN A HA   2  
ATOM   2527  H  HB2  . GLN A 1 23  ? 10.875  9.635   2.308   1.00 0.00 ? 23  GLN A HB2  2  
ATOM   2528  H  HB3  . GLN A 1 23  ? 10.214  11.119  2.979   1.00 0.00 ? 23  GLN A HB3  2  
ATOM   2529  H  HG2  . GLN A 1 23  ? 8.458   10.393  0.938   1.00 0.00 ? 23  GLN A HG2  2  
ATOM   2530  H  HG3  . GLN A 1 23  ? 8.861   8.890   1.768   1.00 0.00 ? 23  GLN A HG3  2  
ATOM   2531  H  HE21 . GLN A 1 23  ? 7.445   8.405   3.269   1.00 0.00 ? 23  GLN A HE21 2  
ATOM   2532  H  HE22 . GLN A 1 23  ? 6.621   9.520   4.300   1.00 0.00 ? 23  GLN A HE22 2  
ATOM   2533  N  N    . GLY A 1 24  ? 12.996  11.768  0.009   1.00 0.00 ? 24  GLY A N    2  
ATOM   2534  C  CA   . GLY A 1 24  ? 14.433  11.930  0.041   1.00 0.00 ? 24  GLY A CA   2  
ATOM   2535  C  C    . GLY A 1 24  ? 15.051  11.868  -1.341  1.00 0.00 ? 24  GLY A C    2  
ATOM   2536  O  O    . GLY A 1 24  ? 14.340  11.862  -2.346  1.00 0.00 ? 24  GLY A O    2  
ATOM   2537  H  H    . GLY A 1 24  ? 12.510  11.928  -0.822  1.00 0.00 ? 24  GLY A H    2  
ATOM   2538  H  HA2  . GLY A 1 24  ? 14.668  12.883  0.488   1.00 0.00 ? 24  GLY A HA2  2  
ATOM   2539  H  HA3  . GLY A 1 24  ? 14.855  11.145  0.646   1.00 0.00 ? 24  GLY A HA3  2  
ATOM   2540  N  N    . SER A 1 25  ? 16.379  11.821  -1.394  1.00 0.00 ? 25  SER A N    2  
ATOM   2541  C  CA   . SER A 1 25  ? 17.089  11.757  -2.666  1.00 0.00 ? 25  SER A CA   2  
ATOM   2542  C  C    . SER A 1 25  ? 16.639  10.546  -3.476  1.00 0.00 ? 25  SER A C    2  
ATOM   2543  O  O    . SER A 1 25  ? 15.915  10.679  -4.462  1.00 0.00 ? 25  SER A O    2  
ATOM   2544  C  CB   . SER A 1 25  ? 18.600  11.694  -2.427  1.00 0.00 ? 25  SER A CB   2  
ATOM   2545  O  OG   . SER A 1 25  ? 19.189  12.977  -2.543  1.00 0.00 ? 25  SER A OG   2  
ATOM   2546  H  H    . SER A 1 25  ? 16.891  11.827  -0.559  1.00 0.00 ? 25  SER A H    2  
ATOM   2547  H  HA   . SER A 1 25  ? 16.858  12.653  -3.221  1.00 0.00 ? 25  SER A HA   2  
ATOM   2548  H  HB2  . SER A 1 25  ? 18.789  11.314  -1.434  1.00 0.00 ? 25  SER A HB2  2  
ATOM   2549  H  HB3  . SER A 1 25  ? 19.051  11.037  -3.156  1.00 0.00 ? 25  SER A HB3  2  
ATOM   2550  H  HG   . SER A 1 25  ? 19.095  13.293  -3.445  1.00 0.00 ? 25  SER A HG   2  
ATOM   2551  N  N    . ARG A 1 26  ? 17.069  9.363   -3.049  1.00 0.00 ? 26  ARG A N    2  
ATOM   2552  C  CA   . ARG A 1 26  ? 16.710  8.128   -3.728  1.00 0.00 ? 26  ARG A CA   2  
ATOM   2553  C  C    . ARG A 1 26  ? 16.157  7.108   -2.750  1.00 0.00 ? 26  ARG A C    2  
ATOM   2554  O  O    . ARG A 1 26  ? 15.816  7.426   -1.611  1.00 0.00 ? 26  ARG A O    2  
ATOM   2555  C  CB   . ARG A 1 26  ? 17.923  7.542   -4.449  1.00 0.00 ? 26  ARG A CB   2  
ATOM   2556  C  CG   . ARG A 1 26  ? 17.694  7.301   -5.932  1.00 0.00 ? 26  ARG A CG   2  
ATOM   2557  C  CD   . ARG A 1 26  ? 18.870  7.782   -6.768  1.00 0.00 ? 26  ARG A CD   2  
ATOM   2558  N  NE   . ARG A 1 26  ? 19.677  6.672   -7.270  1.00 0.00 ? 26  ARG A NE   2  
ATOM   2559  C  CZ   . ARG A 1 26  ? 20.613  6.053   -6.555  1.00 0.00 ? 26  ARG A CZ   2  
ATOM   2560  N  NH1  . ARG A 1 26  ? 20.864  6.429   -5.307  1.00 0.00 ? 26  ARG A NH1  2  
ATOM   2561  N  NH2  . ARG A 1 26  ? 21.302  5.053   -7.089  1.00 0.00 ? 26  ARG A NH2  2  
ATOM   2562  H  H    . ARG A 1 26  ? 17.643  9.320   -2.256  1.00 0.00 ? 26  ARG A H    2  
ATOM   2563  H  HA   . ARG A 1 26  ? 15.947  8.351   -4.457  1.00 0.00 ? 26  ARG A HA   2  
ATOM   2564  H  HB2  . ARG A 1 26  ? 18.747  8.216   -4.338  1.00 0.00 ? 26  ARG A HB2  2  
ATOM   2565  H  HB3  . ARG A 1 26  ? 18.179  6.602   -3.988  1.00 0.00 ? 26  ARG A HB3  2  
ATOM   2566  H  HG2  . ARG A 1 26  ? 17.558  6.243   -6.097  1.00 0.00 ? 26  ARG A HG2  2  
ATOM   2567  H  HG3  . ARG A 1 26  ? 16.804  7.831   -6.239  1.00 0.00 ? 26  ARG A HG3  2  
ATOM   2568  H  HD2  . ARG A 1 26  ? 18.490  8.345   -7.609  1.00 0.00 ? 26  ARG A HD2  2  
ATOM   2569  H  HD3  . ARG A 1 26  ? 19.492  8.422   -6.161  1.00 0.00 ? 26  ARG A HD3  2  
ATOM   2570  H  HE   . ARG A 1 26  ? 19.512  6.372   -8.188  1.00 0.00 ? 26  ARG A HE   2  
ATOM   2571  H  HH11 . ARG A 1 26  ? 20.350  7.181   -4.898  1.00 0.00 ? 26  ARG A HH11 2  
ATOM   2572  H  HH12 . ARG A 1 26  ? 21.570  5.959   -4.776  1.00 0.00 ? 26  ARG A HH12 2  
ATOM   2573  H  HH21 . ARG A 1 26  ? 21.117  4.765   -8.028  1.00 0.00 ? 26  ARG A HH21 2  
ATOM   2574  H  HH22 . ARG A 1 26  ? 22.006  4.589   -6.552  1.00 0.00 ? 26  ARG A HH22 2  
ATOM   2575  N  N    . ASN A 1 27  ? 16.074  5.879   -3.223  1.00 0.00 ? 27  ASN A N    2  
ATOM   2576  C  CA   . ASN A 1 27  ? 15.564  4.776   -2.428  1.00 0.00 ? 27  ASN A CA   2  
ATOM   2577  C  C    . ASN A 1 27  ? 16.567  3.626   -2.385  1.00 0.00 ? 27  ASN A C    2  
ATOM   2578  O  O    . ASN A 1 27  ? 17.521  3.584   -3.162  1.00 0.00 ? 27  ASN A O    2  
ATOM   2579  C  CB   . ASN A 1 27  ? 14.223  4.309   -2.998  1.00 0.00 ? 27  ASN A CB   2  
ATOM   2580  C  CG   . ASN A 1 27  ? 13.746  2.987   -2.426  1.00 0.00 ? 27  ASN A CG   2  
ATOM   2581  O  OD1  . ASN A 1 27  ? 13.791  1.958   -3.098  1.00 0.00 ? 27  ASN A OD1  2  
ATOM   2582  N  ND2  . ASN A 1 27  ? 13.282  3.012   -1.182  1.00 0.00 ? 27  ASN A ND2  2  
ATOM   2583  H  H    . ASN A 1 27  ? 16.362  5.715   -4.138  1.00 0.00 ? 27  ASN A H    2  
ATOM   2584  H  HA   . ASN A 1 27  ? 15.412  5.140   -1.428  1.00 0.00 ? 27  ASN A HA   2  
ATOM   2585  H  HB2  . ASN A 1 27  ? 13.482  5.055   -2.781  1.00 0.00 ? 27  ASN A HB2  2  
ATOM   2586  H  HB3  . ASN A 1 27  ? 14.316  4.205   -4.066  1.00 0.00 ? 27  ASN A HB3  2  
ATOM   2587  H  HD21 . ASN A 1 27  ? 13.276  3.869   -0.708  1.00 0.00 ? 27  ASN A HD21 2  
ATOM   2588  H  HD22 . ASN A 1 27  ? 12.968  2.172   -0.789  1.00 0.00 ? 27  ASN A HD22 2  
ATOM   2589  N  N    . LEU A 1 28  ? 16.340  2.704   -1.461  1.00 0.00 ? 28  LEU A N    2  
ATOM   2590  C  CA   . LEU A 1 28  ? 17.202  1.556   -1.281  1.00 0.00 ? 28  LEU A CA   2  
ATOM   2591  C  C    . LEU A 1 28  ? 17.174  0.632   -2.497  1.00 0.00 ? 28  LEU A C    2  
ATOM   2592  O  O    . LEU A 1 28  ? 18.124  0.589   -3.278  1.00 0.00 ? 28  LEU A O    2  
ATOM   2593  C  CB   . LEU A 1 28  ? 16.755  0.798   -0.034  1.00 0.00 ? 28  LEU A CB   2  
ATOM   2594  C  CG   . LEU A 1 28  ? 17.653  0.975   1.187   1.00 0.00 ? 28  LEU A CG   2  
ATOM   2595  C  CD1  . LEU A 1 28  ? 17.067  0.252   2.390   1.00 0.00 ? 28  LEU A CD1  2  
ATOM   2596  C  CD2  . LEU A 1 28  ? 19.060  0.475   0.895   1.00 0.00 ? 28  LEU A CD2  2  
ATOM   2597  H  H    . LEU A 1 28  ? 15.571  2.802   -0.872  1.00 0.00 ? 28  LEU A H    2  
ATOM   2598  H  HA   . LEU A 1 28  ? 18.206  1.913   -1.132  1.00 0.00 ? 28  LEU A HA   2  
ATOM   2599  H  HB2  . LEU A 1 28  ? 15.762  1.138   0.226   1.00 0.00 ? 28  LEU A HB2  2  
ATOM   2600  H  HB3  . LEU A 1 28  ? 16.704  -0.244  -0.273  1.00 0.00 ? 28  LEU A HB3  2  
ATOM   2601  H  HG   . LEU A 1 28  ? 17.712  2.028   1.426   1.00 0.00 ? 28  LEU A HG   2  
ATOM   2602  H  HD11 . LEU A 1 28  ? 16.483  -0.591  2.053   1.00 0.00 ? 28  LEU A HD11 2  
ATOM   2603  H  HD12 . LEU A 1 28  ? 16.434  0.931   2.944   1.00 0.00 ? 28  LEU A HD12 2  
ATOM   2604  H  HD13 . LEU A 1 28  ? 17.868  -0.094  3.027   1.00 0.00 ? 28  LEU A HD13 2  
ATOM   2605  H  HD21 . LEU A 1 28  ? 19.500  1.076   0.112   1.00 0.00 ? 28  LEU A HD21 2  
ATOM   2606  H  HD22 . LEU A 1 28  ? 19.017  -0.555  0.575   1.00 0.00 ? 28  LEU A HD22 2  
ATOM   2607  H  HD23 . LEU A 1 28  ? 19.662  0.552   1.787   1.00 0.00 ? 28  LEU A HD23 2  
ATOM   2608  N  N    . LEU A 1 29  ? 16.080  -0.111  -2.644  1.00 0.00 ? 29  LEU A N    2  
ATOM   2609  C  CA   . LEU A 1 29  ? 15.928  -1.043  -3.761  1.00 0.00 ? 29  LEU A CA   2  
ATOM   2610  C  C    . LEU A 1 29  ? 16.222  -0.347  -5.088  1.00 0.00 ? 29  LEU A C    2  
ATOM   2611  O  O    . LEU A 1 29  ? 15.780  0.779   -5.322  1.00 0.00 ? 29  LEU A O    2  
ATOM   2612  C  CB   . LEU A 1 29  ? 14.519  -1.670  -3.792  1.00 0.00 ? 29  LEU A CB   2  
ATOM   2613  C  CG   . LEU A 1 29  ? 13.548  -1.218  -2.693  1.00 0.00 ? 29  LEU A CG   2  
ATOM   2614  C  CD1  . LEU A 1 29  ? 12.118  -1.577  -3.069  1.00 0.00 ? 29  LEU A CD1  2  
ATOM   2615  C  CD2  . LEU A 1 29  ? 13.923  -1.840  -1.352  1.00 0.00 ? 29  LEU A CD2  2  
ATOM   2616  H  H    . LEU A 1 29  ? 15.366  -0.032  -1.986  1.00 0.00 ? 29  LEU A H    2  
ATOM   2617  H  HA   . LEU A 1 29  ? 16.654  -1.832  -3.624  1.00 0.00 ? 29  LEU A HA   2  
ATOM   2618  H  HB2  . LEU A 1 29  ? 14.072  -1.441  -4.745  1.00 0.00 ? 29  LEU A HB2  2  
ATOM   2619  H  HB3  . LEU A 1 29  ? 14.628  -2.744  -3.721  1.00 0.00 ? 29  LEU A HB3  2  
ATOM   2620  H  HG   . LEU A 1 29  ? 13.602  -0.145  -2.594  1.00 0.00 ? 29  LEU A HG   2  
ATOM   2621  H  HD11 . LEU A 1 29  ? 12.125  -2.407  -3.759  1.00 0.00 ? 29  LEU A HD11 2  
ATOM   2622  H  HD12 . LEU A 1 29  ? 11.644  -0.726  -3.534  1.00 0.00 ? 29  LEU A HD12 2  
ATOM   2623  H  HD13 . LEU A 1 29  ? 11.570  -1.852  -2.179  1.00 0.00 ? 29  LEU A HD13 2  
ATOM   2624  H  HD21 . LEU A 1 29  ? 14.585  -2.677  -1.517  1.00 0.00 ? 29  LEU A HD21 2  
ATOM   2625  H  HD22 . LEU A 1 29  ? 13.030  -2.178  -0.850  1.00 0.00 ? 29  LEU A HD22 2  
ATOM   2626  H  HD23 . LEU A 1 29  ? 14.422  -1.103  -0.740  1.00 0.00 ? 29  LEU A HD23 2  
ATOM   2627  N  N    . GLN A 1 30  ? 16.984  -1.018  -5.944  1.00 0.00 ? 30  GLN A N    2  
ATOM   2628  C  CA   . GLN A 1 30  ? 17.355  -0.464  -7.238  1.00 0.00 ? 30  GLN A CA   2  
ATOM   2629  C  C    . GLN A 1 30  ? 17.170  -1.491  -8.355  1.00 0.00 ? 30  GLN A C    2  
ATOM   2630  O  O    . GLN A 1 30  ? 16.118  -1.547  -8.988  1.00 0.00 ? 30  GLN A O    2  
ATOM   2631  C  CB   . GLN A 1 30  ? 18.808  0.012   -7.197  1.00 0.00 ? 30  GLN A CB   2  
ATOM   2632  C  CG   . GLN A 1 30  ? 19.301  0.568   -8.521  1.00 0.00 ? 30  GLN A CG   2  
ATOM   2633  C  CD   . GLN A 1 30  ? 20.546  1.420   -8.369  1.00 0.00 ? 30  GLN A CD   2  
ATOM   2634  O  OE1  . GLN A 1 30  ? 21.392  1.158   -7.514  1.00 0.00 ? 30  GLN A OE1  2  
ATOM   2635  N  NE2  . GLN A 1 30  ? 20.665  2.447   -9.202  1.00 0.00 ? 30  GLN A NE2  2  
ATOM   2636  H  H    . GLN A 1 30  ? 17.312  -1.903  -5.695  1.00 0.00 ? 30  GLN A H    2  
ATOM   2637  H  HA   . GLN A 1 30  ? 16.714  0.382   -7.434  1.00 0.00 ? 30  GLN A HA   2  
ATOM   2638  H  HB2  . GLN A 1 30  ? 18.897  0.781   -6.451  1.00 0.00 ? 30  GLN A HB2  2  
ATOM   2639  H  HB3  . GLN A 1 30  ? 19.440  -0.817  -6.921  1.00 0.00 ? 30  GLN A HB3  2  
ATOM   2640  H  HG2  . GLN A 1 30  ? 19.526  -0.259  -9.178  1.00 0.00 ? 30  GLN A HG2  2  
ATOM   2641  H  HG3  . GLN A 1 30  ? 18.519  1.170   -8.955  1.00 0.00 ? 30  GLN A HG3  2  
ATOM   2642  H  HE21 . GLN A 1 30  ? 19.953  2.596   -9.858  1.00 0.00 ? 30  GLN A HE21 2  
ATOM   2643  H  HE22 . GLN A 1 30  ? 21.460  3.015   -9.126  1.00 0.00 ? 30  GLN A HE22 2  
ATOM   2644  N  N    . GLY A 1 31  ? 18.199  -2.294  -8.601  1.00 0.00 ? 31  GLY A N    2  
ATOM   2645  C  CA   . GLY A 1 31  ? 18.124  -3.294  -9.642  1.00 0.00 ? 31  GLY A CA   2  
ATOM   2646  C  C    . GLY A 1 31  ? 17.487  -4.584  -9.167  1.00 0.00 ? 31  GLY A C    2  
ATOM   2647  O  O    . GLY A 1 31  ? 16.263  -4.710  -9.146  1.00 0.00 ? 31  GLY A O    2  
ATOM   2648  H  H    . GLY A 1 31  ? 19.014  -2.203  -8.078  1.00 0.00 ? 31  GLY A H    2  
ATOM   2649  H  HA2  . GLY A 1 31  ? 17.544  -2.895  -10.452 1.00 0.00 ? 31  GLY A HA2  2  
ATOM   2650  H  HA3  . GLY A 1 31  ? 19.120  -3.506  -9.999  1.00 0.00 ? 31  GLY A HA3  2  
ATOM   2651  N  N    . GLU A 1 32  ? 18.322  -5.545  -8.786  1.00 0.00 ? 32  GLU A N    2  
ATOM   2652  C  CA   . GLU A 1 32  ? 17.836  -6.835  -8.309  1.00 0.00 ? 32  GLU A CA   2  
ATOM   2653  C  C    . GLU A 1 32  ? 17.148  -6.694  -6.956  1.00 0.00 ? 32  GLU A C    2  
ATOM   2654  O  O    . GLU A 1 32  ? 16.294  -7.504  -6.597  1.00 0.00 ? 32  GLU A O    2  
ATOM   2655  C  CB   . GLU A 1 32  ? 18.991  -7.835  -8.200  1.00 0.00 ? 32  GLU A CB   2  
ATOM   2656  C  CG   . GLU A 1 32  ? 19.993  -7.745  -9.340  1.00 0.00 ? 32  GLU A CG   2  
ATOM   2657  C  CD   . GLU A 1 32  ? 20.467  -9.107  -9.809  1.00 0.00 ? 32  GLU A CD   2  
ATOM   2658  O  OE1  . GLU A 1 32  ? 19.752  -9.740  -10.613 1.00 0.00 ? 32  GLU A OE1  2  
ATOM   2659  O  OE2  . GLU A 1 32  ? 21.554  -9.539  -9.372  1.00 0.00 ? 32  GLU A OE2  2  
ATOM   2660  H  H    . GLU A 1 32  ? 19.288  -5.383  -8.826  1.00 0.00 ? 32  GLU A H    2  
ATOM   2661  H  HA   . GLU A 1 32  ? 17.119  -7.203  -9.026  1.00 0.00 ? 32  GLU A HA   2  
ATOM   2662  H  HB2  . GLU A 1 32  ? 19.517  -7.660  -7.274  1.00 0.00 ? 32  GLU A HB2  2  
ATOM   2663  H  HB3  . GLU A 1 32  ? 18.583  -8.835  -8.187  1.00 0.00 ? 32  GLU A HB3  2  
ATOM   2664  H  HG2  . GLU A 1 32  ? 19.529  -7.237  -10.172 1.00 0.00 ? 32  GLU A HG2  2  
ATOM   2665  H  HG3  . GLU A 1 32  ? 20.849  -7.177  -9.006  1.00 0.00 ? 32  GLU A HG3  2  
ATOM   2666  N  N    . GLU A 1 33  ? 17.524  -5.662  -6.204  1.00 0.00 ? 33  GLU A N    2  
ATOM   2667  C  CA   . GLU A 1 33  ? 16.936  -5.428  -4.892  1.00 0.00 ? 33  GLU A CA   2  
ATOM   2668  C  C    . GLU A 1 33  ? 15.503  -4.945  -5.017  1.00 0.00 ? 33  GLU A C    2  
ATOM   2669  O  O    . GLU A 1 33  ? 14.679  -5.177  -4.135  1.00 0.00 ? 33  GLU A O    2  
ATOM   2670  C  CB   . GLU A 1 33  ? 17.769  -4.418  -4.101  1.00 0.00 ? 33  GLU A CB   2  
ATOM   2671  C  CG   . GLU A 1 33  ? 19.191  -4.881  -3.829  1.00 0.00 ? 33  GLU A CG   2  
ATOM   2672  C  CD   . GLU A 1 33  ? 19.399  -5.313  -2.391  1.00 0.00 ? 33  GLU A CD   2  
ATOM   2673  O  OE1  . GLU A 1 33  ? 18.843  -6.362  -1.999  1.00 0.00 ? 33  GLU A OE1  2  
ATOM   2674  O  OE2  . GLU A 1 33  ? 20.116  -4.604  -1.655  1.00 0.00 ? 33  GLU A OE2  2  
ATOM   2675  H  H    . GLU A 1 33  ? 18.208  -5.048  -6.538  1.00 0.00 ? 33  GLU A H    2  
ATOM   2676  H  HA   . GLU A 1 33  ? 16.928  -6.363  -4.371  1.00 0.00 ? 33  GLU A HA   2  
ATOM   2677  H  HB2  . GLU A 1 33  ? 17.815  -3.493  -4.656  1.00 0.00 ? 33  GLU A HB2  2  
ATOM   2678  H  HB3  . GLU A 1 33  ? 17.285  -4.234  -3.152  1.00 0.00 ? 33  GLU A HB3  2  
ATOM   2679  H  HG2  . GLU A 1 33  ? 19.413  -5.716  -4.475  1.00 0.00 ? 33  GLU A HG2  2  
ATOM   2680  H  HG3  . GLU A 1 33  ? 19.868  -4.068  -4.047  1.00 0.00 ? 33  GLU A HG3  2  
ATOM   2681  N  N    . LEU A 1 34  ? 15.211  -4.286  -6.124  1.00 0.00 ? 34  LEU A N    2  
ATOM   2682  C  CA   . LEU A 1 34  ? 13.883  -3.784  -6.382  1.00 0.00 ? 34  LEU A CA   2  
ATOM   2683  C  C    . LEU A 1 34  ? 12.905  -4.939  -6.508  1.00 0.00 ? 34  LEU A C    2  
ATOM   2684  O  O    . LEU A 1 34  ? 11.771  -4.864  -6.039  1.00 0.00 ? 34  LEU A O    2  
ATOM   2685  C  CB   . LEU A 1 34  ? 13.895  -2.956  -7.662  1.00 0.00 ? 34  LEU A CB   2  
ATOM   2686  C  CG   . LEU A 1 34  ? 13.702  -1.454  -7.460  1.00 0.00 ? 34  LEU A CG   2  
ATOM   2687  C  CD1  . LEU A 1 34  ? 13.608  -0.739  -8.800  1.00 0.00 ? 34  LEU A CD1  2  
ATOM   2688  C  CD2  . LEU A 1 34  ? 12.463  -1.175  -6.619  1.00 0.00 ? 34  LEU A CD2  2  
ATOM   2689  H  H    . LEU A 1 34  ? 15.904  -4.144  -6.790  1.00 0.00 ? 34  LEU A H    2  
ATOM   2690  H  HA   . LEU A 1 34  ? 13.590  -3.159  -5.554  1.00 0.00 ? 34  LEU A HA   2  
ATOM   2691  H  HB2  . LEU A 1 34  ? 14.845  -3.113  -8.151  1.00 0.00 ? 34  LEU A HB2  2  
ATOM   2692  H  HB3  . LEU A 1 34  ? 13.119  -3.318  -8.306  1.00 0.00 ? 34  LEU A HB3  2  
ATOM   2693  H  HG   . LEU A 1 34  ? 14.561  -1.066  -6.933  1.00 0.00 ? 34  LEU A HG   2  
ATOM   2694  H  HD11 . LEU A 1 34  ? 13.917  -1.408  -9.589  1.00 0.00 ? 34  LEU A HD11 2  
ATOM   2695  H  HD12 . LEU A 1 34  ? 14.252  0.127   -8.791  1.00 0.00 ? 34  LEU A HD12 2  
ATOM   2696  H  HD13 . LEU A 1 34  ? 12.588  -0.427  -8.972  1.00 0.00 ? 34  LEU A HD13 2  
ATOM   2697  H  HD21 . LEU A 1 34  ? 12.718  -0.500  -5.815  1.00 0.00 ? 34  LEU A HD21 2  
ATOM   2698  H  HD22 . LEU A 1 34  ? 12.088  -2.099  -6.206  1.00 0.00 ? 34  LEU A HD22 2  
ATOM   2699  H  HD23 . LEU A 1 34  ? 11.703  -0.724  -7.237  1.00 0.00 ? 34  LEU A HD23 2  
ATOM   2700  N  N    . LEU A 1 35  ? 13.358  -6.015  -7.139  1.00 0.00 ? 35  LEU A N    2  
ATOM   2701  C  CA   . LEU A 1 35  ? 12.526  -7.193  -7.319  1.00 0.00 ? 35  LEU A CA   2  
ATOM   2702  C  C    . LEU A 1 35  ? 12.435  -7.977  -6.019  1.00 0.00 ? 35  LEU A C    2  
ATOM   2703  O  O    . LEU A 1 35  ? 11.371  -8.477  -5.659  1.00 0.00 ? 35  LEU A O    2  
ATOM   2704  C  CB   . LEU A 1 35  ? 13.079  -8.085  -8.435  1.00 0.00 ? 35  LEU A CB   2  
ATOM   2705  C  CG   . LEU A 1 35  ? 13.807  -7.352  -9.564  1.00 0.00 ? 35  LEU A CG   2  
ATOM   2706  C  CD1  . LEU A 1 35  ? 14.199  -8.328  -10.663 1.00 0.00 ? 35  LEU A CD1  2  
ATOM   2707  C  CD2  . LEU A 1 35  ? 12.939  -6.236  -10.124 1.00 0.00 ? 35  LEU A CD2  2  
ATOM   2708  H  H    . LEU A 1 35  ? 14.277  -6.018  -7.485  1.00 0.00 ? 35  LEU A H    2  
ATOM   2709  H  HA   . LEU A 1 35  ? 11.536  -6.856  -7.588  1.00 0.00 ? 35  LEU A HA   2  
ATOM   2710  H  HB2  . LEU A 1 35  ? 13.766  -8.792  -7.993  1.00 0.00 ? 35  LEU A HB2  2  
ATOM   2711  H  HB3  . LEU A 1 35  ? 12.257  -8.634  -8.867  1.00 0.00 ? 35  LEU A HB3  2  
ATOM   2712  H  HG   . LEU A 1 35  ? 14.712  -6.911  -9.173  1.00 0.00 ? 35  LEU A HG   2  
ATOM   2713  H  HD11 . LEU A 1 35  ? 13.477  -9.129  -10.707 1.00 0.00 ? 35  LEU A HD11 2  
ATOM   2714  H  HD12 . LEU A 1 35  ? 15.177  -8.734  -10.452 1.00 0.00 ? 35  LEU A HD12 2  
ATOM   2715  H  HD13 . LEU A 1 35  ? 14.222  -7.811  -11.611 1.00 0.00 ? 35  LEU A HD13 2  
ATOM   2716  H  HD21 . LEU A 1 35  ? 11.898  -6.506  -10.027 1.00 0.00 ? 35  LEU A HD21 2  
ATOM   2717  H  HD22 . LEU A 1 35  ? 13.176  -6.085  -11.168 1.00 0.00 ? 35  LEU A HD22 2  
ATOM   2718  H  HD23 . LEU A 1 35  ? 13.127  -5.324  -9.577  1.00 0.00 ? 35  LEU A HD23 2  
ATOM   2719  N  N    . ARG A 1 36  ? 13.552  -8.063  -5.307  1.00 0.00 ? 36  ARG A N    2  
ATOM   2720  C  CA   . ARG A 1 36  ? 13.579  -8.771  -4.036  1.00 0.00 ? 36  ARG A CA   2  
ATOM   2721  C  C    . ARG A 1 36  ? 12.837  -7.965  -2.977  1.00 0.00 ? 36  ARG A C    2  
ATOM   2722  O  O    . ARG A 1 36  ? 12.310  -8.518  -2.011  1.00 0.00 ? 36  ARG A O    2  
ATOM   2723  C  CB   . ARG A 1 36  ? 15.022  -9.024  -3.593  1.00 0.00 ? 36  ARG A CB   2  
ATOM   2724  C  CG   . ARG A 1 36  ? 15.746  -10.053 -4.447  1.00 0.00 ? 36  ARG A CG   2  
ATOM   2725  C  CD   . ARG A 1 36  ? 16.758  -10.845 -3.633  1.00 0.00 ? 36  ARG A CD   2  
ATOM   2726  N  NE   . ARG A 1 36  ? 18.132  -10.534 -4.016  1.00 0.00 ? 36  ARG A NE   2  
ATOM   2727  C  CZ   . ARG A 1 36  ? 19.202  -10.937 -3.333  1.00 0.00 ? 36  ARG A CZ   2  
ATOM   2728  N  NH1  . ARG A 1 36  ? 19.060  -11.667 -2.233  1.00 0.00 ? 36  ARG A NH1  2  
ATOM   2729  N  NH2  . ARG A 1 36  ? 20.417  -10.609 -3.751  1.00 0.00 ? 36  ARG A NH2  2  
ATOM   2730  H  H    . ARG A 1 36  ? 14.370  -7.629  -5.635  1.00 0.00 ? 36  ARG A H    2  
ATOM   2731  H  HA   . ARG A 1 36  ? 13.077  -9.718  -4.170  1.00 0.00 ? 36  ARG A HA   2  
ATOM   2732  H  HB2  . ARG A 1 36  ? 15.570  -8.095  -3.644  1.00 0.00 ? 36  ARG A HB2  2  
ATOM   2733  H  HB3  . ARG A 1 36  ? 15.017  -9.374  -2.572  1.00 0.00 ? 36  ARG A HB3  2  
ATOM   2734  H  HG2  . ARG A 1 36  ? 15.020  -10.736 -4.862  1.00 0.00 ? 36  ARG A HG2  2  
ATOM   2735  H  HG3  . ARG A 1 36  ? 16.262  -9.543  -5.247  1.00 0.00 ? 36  ARG A HG3  2  
ATOM   2736  H  HD2  . ARG A 1 36  ? 16.624  -10.610 -2.588  1.00 0.00 ? 36  ARG A HD2  2  
ATOM   2737  H  HD3  . ARG A 1 36  ? 16.580  -11.899 -3.790  1.00 0.00 ? 36  ARG A HD3  2  
ATOM   2738  H  HE   . ARG A 1 36  ? 18.266  -9.996  -4.824  1.00 0.00 ? 36  ARG A HE   2  
ATOM   2739  H  HH11 . ARG A 1 36  ? 18.146  -11.918 -1.913  1.00 0.00 ? 36  ARG A HH11 2  
ATOM   2740  H  HH12 . ARG A 1 36  ? 19.867  -11.967 -1.725  1.00 0.00 ? 36  ARG A HH12 2  
ATOM   2741  H  HH21 . ARG A 1 36  ? 20.530  -10.060 -4.578  1.00 0.00 ? 36  ARG A HH21 2  
ATOM   2742  H  HH22 . ARG A 1 36  ? 21.221  -10.913 -3.237  1.00 0.00 ? 36  ARG A HH22 2  
ATOM   2743  N  N    . ALA A 1 37  ? 12.800  -6.649  -3.171  1.00 0.00 ? 37  ALA A N    2  
ATOM   2744  C  CA   . ALA A 1 37  ? 12.130  -5.756  -2.251  1.00 0.00 ? 37  ALA A CA   2  
ATOM   2745  C  C    . ALA A 1 37  ? 10.660  -5.583  -2.612  1.00 0.00 ? 37  ALA A C    2  
ATOM   2746  O  O    . ALA A 1 37  ? 9.782   -5.764  -1.768  1.00 0.00 ? 37  ALA A O    2  
ATOM   2747  C  CB   . ALA A 1 37  ? 12.827  -4.409  -2.224  1.00 0.00 ? 37  ALA A CB   2  
ATOM   2748  H  H    . ALA A 1 37  ? 13.238  -6.272  -3.951  1.00 0.00 ? 37  ALA A H    2  
ATOM   2749  H  HA   . ALA A 1 37  ? 12.203  -6.188  -1.272  1.00 0.00 ? 37  ALA A HA   2  
ATOM   2750  H  HB1  . ALA A 1 37  ? 13.015  -4.080  -3.235  1.00 0.00 ? 37  ALA A HB1  2  
ATOM   2751  H  HB2  . ALA A 1 37  ? 13.763  -4.496  -1.693  1.00 0.00 ? 37  ALA A HB2  2  
ATOM   2752  H  HB3  . ALA A 1 37  ? 12.195  -3.689  -1.725  1.00 0.00 ? 37  ALA A HB3  2  
ATOM   2753  N  N    . LEU A 1 38  ? 10.388  -5.225  -3.868  1.00 0.00 ? 38  LEU A N    2  
ATOM   2754  C  CA   . LEU A 1 38  ? 9.009   -5.026  -4.312  1.00 0.00 ? 38  LEU A CA   2  
ATOM   2755  C  C    . LEU A 1 38  ? 8.160   -6.278  -4.079  1.00 0.00 ? 38  LEU A C    2  
ATOM   2756  O  O    . LEU A 1 38  ? 6.931   -6.208  -4.062  1.00 0.00 ? 38  LEU A O    2  
ATOM   2757  C  CB   . LEU A 1 38  ? 8.962   -4.616  -5.792  1.00 0.00 ? 38  LEU A CB   2  
ATOM   2758  C  CG   . LEU A 1 38  ? 8.975   -5.764  -6.807  1.00 0.00 ? 38  LEU A CG   2  
ATOM   2759  C  CD1  . LEU A 1 38  ? 7.560   -6.246  -7.087  1.00 0.00 ? 38  LEU A CD1  2  
ATOM   2760  C  CD2  . LEU A 1 38  ? 9.643   -5.322  -8.099  1.00 0.00 ? 38  LEU A CD2  2  
ATOM   2761  H  H    . LEU A 1 38  ? 11.129  -5.086  -4.505  1.00 0.00 ? 38  LEU A H    2  
ATOM   2762  H  HA   . LEU A 1 38  ? 8.594   -4.223  -3.720  1.00 0.00 ? 38  LEU A HA   2  
ATOM   2763  H  HB2  . LEU A 1 38  ? 8.061   -4.041  -5.950  1.00 0.00 ? 38  LEU A HB2  2  
ATOM   2764  H  HB3  . LEU A 1 38  ? 9.809   -3.980  -5.993  1.00 0.00 ? 38  LEU A HB3  2  
ATOM   2765  H  HG   . LEU A 1 38  ? 9.538   -6.592  -6.402  1.00 0.00 ? 38  LEU A HG   2  
ATOM   2766  H  HD11 . LEU A 1 38  ? 7.542   -6.778  -8.028  1.00 0.00 ? 38  LEU A HD11 2  
ATOM   2767  H  HD12 . LEU A 1 38  ? 6.895   -5.397  -7.142  1.00 0.00 ? 38  LEU A HD12 2  
ATOM   2768  H  HD13 . LEU A 1 38  ? 7.240   -6.905  -6.295  1.00 0.00 ? 38  LEU A HD13 2  
ATOM   2769  H  HD21 . LEU A 1 38  ? 10.483  -4.684  -7.870  1.00 0.00 ? 38  LEU A HD21 2  
ATOM   2770  H  HD22 . LEU A 1 38  ? 8.932   -4.777  -8.704  1.00 0.00 ? 38  LEU A HD22 2  
ATOM   2771  H  HD23 . LEU A 1 38  ? 9.987   -6.190  -8.641  1.00 0.00 ? 38  LEU A HD23 2  
ATOM   2772  N  N    . ASP A 1 39  ? 8.819   -7.421  -3.898  1.00 0.00 ? 39  ASP A N    2  
ATOM   2773  C  CA   . ASP A 1 39  ? 8.114   -8.677  -3.665  1.00 0.00 ? 39  ASP A CA   2  
ATOM   2774  C  C    . ASP A 1 39  ? 8.032   -8.990  -2.176  1.00 0.00 ? 39  ASP A C    2  
ATOM   2775  O  O    . ASP A 1 39  ? 8.291   -10.117 -1.751  1.00 0.00 ? 39  ASP A O    2  
ATOM   2776  C  CB   . ASP A 1 39  ? 8.807   -9.822  -4.405  1.00 0.00 ? 39  ASP A CB   2  
ATOM   2777  C  CG   . ASP A 1 39  ? 7.820   -10.796 -5.018  1.00 0.00 ? 39  ASP A CG   2  
ATOM   2778  O  OD1  . ASP A 1 39  ? 6.949   -10.351 -5.794  1.00 0.00 ? 39  ASP A OD1  2  
ATOM   2779  O  OD2  . ASP A 1 39  ? 7.918   -12.006 -4.721  1.00 0.00 ? 39  ASP A OD2  2  
ATOM   2780  H  H    . ASP A 1 39  ? 9.796   -7.421  -3.920  1.00 0.00 ? 39  ASP A H    2  
ATOM   2781  H  HA   . ASP A 1 39  ? 7.112   -8.566  -4.048  1.00 0.00 ? 39  ASP A HA   2  
ATOM   2782  H  HB2  . ASP A 1 39  ? 9.416   -9.412  -5.196  1.00 0.00 ? 39  ASP A HB2  2  
ATOM   2783  H  HB3  . ASP A 1 39  ? 9.437   -10.361 -3.713  1.00 0.00 ? 39  ASP A HB3  2  
ATOM   2784  N  N    . GLN A 1 40  ? 7.665   -7.987  -1.390  1.00 0.00 ? 40  GLN A N    2  
ATOM   2785  C  CA   . GLN A 1 40  ? 7.540   -8.154  0.052   1.00 0.00 ? 40  GLN A CA   2  
ATOM   2786  C  C    . GLN A 1 40  ? 6.073   -8.228  0.459   1.00 0.00 ? 40  GLN A C    2  
ATOM   2787  O  O    . GLN A 1 40  ? 5.624   -7.512  1.354   1.00 0.00 ? 40  GLN A O    2  
ATOM   2788  C  CB   . GLN A 1 40  ? 8.235   -7.007  0.789   1.00 0.00 ? 40  GLN A CB   2  
ATOM   2789  C  CG   . GLN A 1 40  ? 8.998   -7.452  2.026   1.00 0.00 ? 40  GLN A CG   2  
ATOM   2790  C  CD   . GLN A 1 40  ? 8.877   -6.467  3.173   1.00 0.00 ? 40  GLN A CD   2  
ATOM   2791  O  OE1  . GLN A 1 40  ? 7.814   -6.325  3.775   1.00 0.00 ? 40  GLN A OE1  2  
ATOM   2792  N  NE2  . GLN A 1 40  ? 9.971   -5.777  3.478   1.00 0.00 ? 40  GLN A NE2  2  
ATOM   2793  H  H    . GLN A 1 40  ? 7.467   -7.116  -1.794  1.00 0.00 ? 40  GLN A H    2  
ATOM   2794  H  HA   . GLN A 1 40  ? 8.017   -9.085  0.319   1.00 0.00 ? 40  GLN A HA   2  
ATOM   2795  H  HB2  . GLN A 1 40  ? 8.931   -6.531  0.116   1.00 0.00 ? 40  GLN A HB2  2  
ATOM   2796  H  HB3  . GLN A 1 40  ? 7.491   -6.285  1.093   1.00 0.00 ? 40  GLN A HB3  2  
ATOM   2797  H  HG2  . GLN A 1 40  ? 8.609   -8.406  2.351   1.00 0.00 ? 40  GLN A HG2  2  
ATOM   2798  H  HG3  . GLN A 1 40  ? 10.042  -7.557  1.771   1.00 0.00 ? 40  GLN A HG3  2  
ATOM   2799  H  HE21 . GLN A 1 40  ? 10.783  -5.941  2.955   1.00 0.00 ? 40  GLN A HE21 2  
ATOM   2800  H  HE22 . GLN A 1 40  ? 9.921   -5.134  4.215   1.00 0.00 ? 40  GLN A HE22 2  
ATOM   2801  N  N    . VAL A 1 41  ? 5.332   -9.102  -0.212  1.00 0.00 ? 41  VAL A N    2  
ATOM   2802  C  CA   . VAL A 1 41  ? 3.916   -9.279  0.066   1.00 0.00 ? 41  VAL A CA   2  
ATOM   2803  C  C    . VAL A 1 41  ? 3.698   -10.188 1.270   1.00 0.00 ? 41  VAL A C    2  
ATOM   2804  O  O    . VAL A 1 41  ? 3.527   -11.398 1.125   1.00 0.00 ? 41  VAL A O    2  
ATOM   2805  C  CB   . VAL A 1 41  ? 3.175   -9.869  -1.149  1.00 0.00 ? 41  VAL A CB   2  
ATOM   2806  C  CG1  . VAL A 1 41  ? 1.673   -9.855  -0.918  1.00 0.00 ? 41  VAL A CG1  2  
ATOM   2807  C  CG2  . VAL A 1 41  ? 3.535   -9.105  -2.415  1.00 0.00 ? 41  VAL A CG2  2  
ATOM   2808  H  H    . VAL A 1 41  ? 5.749   -9.638  -0.913  1.00 0.00 ? 41  VAL A H    2  
ATOM   2809  H  HA   . VAL A 1 41  ? 3.500   -8.309  0.276   1.00 0.00 ? 41  VAL A HA   2  
ATOM   2810  H  HB   . VAL A 1 41  ? 3.489   -10.896 -1.273  1.00 0.00 ? 41  VAL A HB   2  
ATOM   2811  H  HG11 . VAL A 1 41  ? 1.465   -10.089 0.116   1.00 0.00 ? 41  VAL A HG11 2  
ATOM   2812  H  HG12 . VAL A 1 41  ? 1.204   -10.591 -1.554  1.00 0.00 ? 41  VAL A HG12 2  
ATOM   2813  H  HG13 . VAL A 1 41  ? 1.281   -8.876  -1.152  1.00 0.00 ? 41  VAL A HG13 2  
ATOM   2814  H  HG21 . VAL A 1 41  ? 4.601   -9.160  -2.579  1.00 0.00 ? 41  VAL A HG21 2  
ATOM   2815  H  HG22 . VAL A 1 41  ? 3.240   -8.073  -2.308  1.00 0.00 ? 41  VAL A HG22 2  
ATOM   2816  H  HG23 . VAL A 1 41  ? 3.019   -9.542  -3.258  1.00 0.00 ? 41  VAL A HG23 2  
ATOM   2817  N  N    . ASN A 1 42  ? 3.708   -9.596  2.460   1.00 0.00 ? 42  ASN A N    2  
ATOM   2818  C  CA   . ASN A 1 42  ? 3.511   -10.354 3.692   1.00 0.00 ? 42  ASN A CA   2  
ATOM   2819  C  C    . ASN A 1 42  ? 2.381   -9.756  4.524   1.00 0.00 ? 42  ASN A C    2  
ATOM   2820  O  O    . ASN A 1 42  ? 2.250   -10.140 5.705   1.00 0.00 ? 42  ASN A O    2  
ATOM   2821  C  CB   . ASN A 1 42  ? 4.803   -10.382 4.510   1.00 0.00 ? 42  ASN A CB   2  
ATOM   2822  C  CG   . ASN A 1 42  ? 6.012   -10.745 3.671   1.00 0.00 ? 42  ASN A CG   2  
ATOM   2823  O  OD1  . ASN A 1 42  ? 6.843   -9.892  3.358   1.00 0.00 ? 42  ASN A OD1  2  
ATOM   2824  N  ND2  . ASN A 1 42  ? 6.117   -12.016 3.300   1.00 0.00 ? 42  ASN A ND2  2  
ATOM   2825  O  OXT  . ASN A 1 42  ? 1.638   -8.907  3.988   1.00 0.00 ? 42  ASN A OXT  2  
ATOM   2826  H  H    . ASN A 1 42  ? 3.850   -8.628  2.513   1.00 0.00 ? 42  ASN A H    2  
ATOM   2827  H  HA   . ASN A 1 42  ? 3.245   -11.364 3.420   1.00 0.00 ? 42  ASN A HA   2  
ATOM   2828  H  HB2  . ASN A 1 42  ? 4.969   -9.407  4.944   1.00 0.00 ? 42  ASN A HB2  2  
ATOM   2829  H  HB3  . ASN A 1 42  ? 4.705   -11.111 5.301   1.00 0.00 ? 42  ASN A HB3  2  
ATOM   2830  H  HD21 . ASN A 1 42  ? 5.417   -12.640 3.586   1.00 0.00 ? 42  ASN A HD21 2  
ATOM   2831  H  HD22 . ASN A 1 42  ? 6.889   -12.278 2.758   1.00 0.00 ? 42  ASN A HD22 2  
ATOM   2832  N  N    . MET B 2 1   ? -4.878  22.795  -17.770 1.00 0.00 ? 101 MET B N    2  
ATOM   2833  C  CA   . MET B 2 1   ? -3.730  22.126  -17.102 1.00 0.00 ? 101 MET B CA   2  
ATOM   2834  C  C    . MET B 2 1   ? -2.832  23.141  -16.402 1.00 0.00 ? 101 MET B C    2  
ATOM   2835  O  O    . MET B 2 1   ? -2.565  23.026  -15.206 1.00 0.00 ? 101 MET B O    2  
ATOM   2836  C  CB   . MET B 2 1   ? -2.934  21.356  -18.158 1.00 0.00 ? 101 MET B CB   2  
ATOM   2837  C  CG   . MET B 2 1   ? -3.438  19.940  -18.386 1.00 0.00 ? 101 MET B CG   2  
ATOM   2838  S  SD   . MET B 2 1   ? -3.289  18.905  -16.917 1.00 0.00 ? 101 MET B SD   2  
ATOM   2839  C  CE   . MET B 2 1   ? -4.012  17.375  -17.507 1.00 0.00 ? 101 MET B CE   2  
ATOM   2840  H  H1   . MET B 2 1   ? -5.577  22.063  -18.007 1.00 0.00 ? 101 MET B H1   2  
ATOM   2841  H  H2   . MET B 2 1   ? -4.517  23.262  -18.627 1.00 0.00 ? 101 MET B H2   2  
ATOM   2842  H  H3   . MET B 2 1   ? -5.273  23.487  -17.103 1.00 0.00 ? 101 MET B H3   2  
ATOM   2843  H  HA   . MET B 2 1   ? -4.115  21.432  -16.370 1.00 0.00 ? 101 MET B HA   2  
ATOM   2844  H  HB2  . MET B 2 1   ? -2.989  21.890  -19.095 1.00 0.00 ? 101 MET B HB2  2  
ATOM   2845  H  HB3  . MET B 2 1   ? -1.901  21.302  -17.845 1.00 0.00 ? 101 MET B HB3  2  
ATOM   2846  H  HG2  . MET B 2 1   ? -4.478  19.985  -18.674 1.00 0.00 ? 101 MET B HG2  2  
ATOM   2847  H  HG3  . MET B 2 1   ? -2.863  19.493  -19.185 1.00 0.00 ? 101 MET B HG3  2  
ATOM   2848  H  HE1  . MET B 2 1   ? -3.437  17.005  -18.344 1.00 0.00 ? 101 MET B HE1  2  
ATOM   2849  H  HE2  . MET B 2 1   ? -5.030  17.555  -17.820 1.00 0.00 ? 101 MET B HE2  2  
ATOM   2850  H  HE3  . MET B 2 1   ? -4.003  16.644  -16.713 1.00 0.00 ? 101 MET B HE3  2  
ATOM   2851  N  N    . GLY B 2 2   ? -2.369  24.133  -17.156 1.00 0.00 ? 102 GLY B N    2  
ATOM   2852  C  CA   . GLY B 2 2   ? -1.505  25.153  -16.591 1.00 0.00 ? 102 GLY B CA   2  
ATOM   2853  C  C    . GLY B 2 2   ? -0.301  25.444  -17.465 1.00 0.00 ? 102 GLY B C    2  
ATOM   2854  O  O    . GLY B 2 2   ? -0.284  25.093  -18.645 1.00 0.00 ? 102 GLY B O    2  
ATOM   2855  H  H    . GLY B 2 2   ? -2.615  24.173  -18.104 1.00 0.00 ? 102 GLY B H    2  
ATOM   2856  H  HA2  . GLY B 2 2   ? -2.074  26.063  -16.468 1.00 0.00 ? 102 GLY B HA2  2  
ATOM   2857  H  HA3  . GLY B 2 2   ? -1.162  24.823  -15.621 1.00 0.00 ? 102 GLY B HA3  2  
ATOM   2858  N  N    . SER B 2 3   ? 0.709   26.084  -16.885 1.00 0.00 ? 103 SER B N    2  
ATOM   2859  C  CA   . SER B 2 3   ? 1.923   26.420  -17.619 1.00 0.00 ? 103 SER B CA   2  
ATOM   2860  C  C    . SER B 2 3   ? 3.088   25.542  -17.171 1.00 0.00 ? 103 SER B C    2  
ATOM   2861  O  O    . SER B 2 3   ? 3.687   24.829  -17.977 1.00 0.00 ? 103 SER B O    2  
ATOM   2862  C  CB   . SER B 2 3   ? 2.274   27.896  -17.418 1.00 0.00 ? 103 SER B CB   2  
ATOM   2863  O  OG   . SER B 2 3   ? 2.758   28.473  -18.619 1.00 0.00 ? 103 SER B OG   2  
ATOM   2864  H  H    . SER B 2 3   ? 0.636   26.335  -15.940 1.00 0.00 ? 103 SER B H    2  
ATOM   2865  H  HA   . SER B 2 3   ? 1.736   26.243  -18.667 1.00 0.00 ? 103 SER B HA   2  
ATOM   2866  H  HB2  . SER B 2 3   ? 1.392   28.434  -17.105 1.00 0.00 ? 103 SER B HB2  2  
ATOM   2867  H  HB3  . SER B 2 3   ? 3.036   27.982  -16.659 1.00 0.00 ? 103 SER B HB3  2  
ATOM   2868  H  HG   . SER B 2 3   ? 2.726   29.429  -18.551 1.00 0.00 ? 103 SER B HG   2  
ATOM   2869  N  N    . GLY B 2 4   ? 3.405   25.601  -15.882 1.00 0.00 ? 104 GLY B N    2  
ATOM   2870  C  CA   . GLY B 2 4   ? 4.497   24.806  -15.350 1.00 0.00 ? 104 GLY B CA   2  
ATOM   2871  C  C    . GLY B 2 4   ? 4.017   23.524  -14.700 1.00 0.00 ? 104 GLY B C    2  
ATOM   2872  O  O    . GLY B 2 4   ? 2.814   23.313  -14.540 1.00 0.00 ? 104 GLY B O    2  
ATOM   2873  H  H    . GLY B 2 4   ? 2.892   26.187  -15.287 1.00 0.00 ? 104 GLY B H    2  
ATOM   2874  H  HA2  . GLY B 2 4   ? 5.173   24.559  -16.154 1.00 0.00 ? 104 GLY B HA2  2  
ATOM   2875  H  HA3  . GLY B 2 4   ? 5.028   25.393  -14.615 1.00 0.00 ? 104 GLY B HA3  2  
ATOM   2876  N  N    . ALA B 2 5   ? 4.958   22.664  -14.325 1.00 0.00 ? 105 ALA B N    2  
ATOM   2877  C  CA   . ALA B 2 5   ? 4.626   21.396  -13.689 1.00 0.00 ? 105 ALA B CA   2  
ATOM   2878  C  C    . ALA B 2 5   ? 4.493   21.557  -12.179 1.00 0.00 ? 105 ALA B C    2  
ATOM   2879  O  O    . ALA B 2 5   ? 5.491   21.629  -11.463 1.00 0.00 ? 105 ALA B O    2  
ATOM   2880  C  CB   . ALA B 2 5   ? 5.679   20.348  -14.019 1.00 0.00 ? 105 ALA B CB   2  
ATOM   2881  H  H    . ALA B 2 5   ? 5.900   22.889  -14.479 1.00 0.00 ? 105 ALA B H    2  
ATOM   2882  H  HA   . ALA B 2 5   ? 3.680   21.059  -14.089 1.00 0.00 ? 105 ALA B HA   2  
ATOM   2883  H  HB1  . ALA B 2 5   ? 5.382   19.804  -14.903 1.00 0.00 ? 105 ALA B HB1  2  
ATOM   2884  H  HB2  . ALA B 2 5   ? 5.777   19.663  -13.189 1.00 0.00 ? 105 ALA B HB2  2  
ATOM   2885  H  HB3  . ALA B 2 5   ? 6.627   20.835  -14.198 1.00 0.00 ? 105 ALA B HB3  2  
ATOM   2886  N  N    . HIS B 2 6   ? 3.254   21.612  -11.701 1.00 0.00 ? 106 HIS B N    2  
ATOM   2887  C  CA   . HIS B 2 6   ? 2.992   21.765  -10.274 1.00 0.00 ? 106 HIS B CA   2  
ATOM   2888  C  C    . HIS B 2 6   ? 1.494   21.718  -9.988  1.00 0.00 ? 106 HIS B C    2  
ATOM   2889  O  O    . HIS B 2 6   ? 0.812   22.741  -10.028 1.00 0.00 ? 106 HIS B O    2  
ATOM   2890  C  CB   . HIS B 2 6   ? 3.583   23.082  -9.764  1.00 0.00 ? 106 HIS B CB   2  
ATOM   2891  C  CG   . HIS B 2 6   ? 4.574   22.903  -8.657  1.00 0.00 ? 106 HIS B CG   2  
ATOM   2892  N  ND1  . HIS B 2 6   ? 4.324   22.131  -7.542  1.00 0.00 ? 106 HIS B ND1  2  
ATOM   2893  C  CD2  . HIS B 2 6   ? 5.824   23.399  -8.496  1.00 0.00 ? 106 HIS B CD2  2  
ATOM   2894  C  CE1  . HIS B 2 6   ? 5.376   22.161  -6.743  1.00 0.00 ? 106 HIS B CE1  2  
ATOM   2895  N  NE2  . HIS B 2 6   ? 6.300   22.923  -7.300  1.00 0.00 ? 106 HIS B NE2  2  
ATOM   2896  H  H    . HIS B 2 6   ? 2.499   21.549  -12.322 1.00 0.00 ? 106 HIS B H    2  
ATOM   2897  H  HA   . HIS B 2 6   ? 3.471   20.945  -9.761  1.00 0.00 ? 106 HIS B HA   2  
ATOM   2898  H  HB2  . HIS B 2 6   ? 4.085   23.582  -10.580 1.00 0.00 ? 106 HIS B HB2  2  
ATOM   2899  H  HB3  . HIS B 2 6   ? 2.785   23.712  -9.399  1.00 0.00 ? 106 HIS B HB3  2  
ATOM   2900  H  HD1  . HIS B 2 6   ? 3.497   21.636  -7.361  1.00 0.00 ? 106 HIS B HD1  2  
ATOM   2901  H  HD2  . HIS B 2 6   ? 6.348   24.048  -9.183  1.00 0.00 ? 106 HIS B HD2  2  
ATOM   2902  H  HE1  . HIS B 2 6   ? 5.466   21.649  -5.797  1.00 0.00 ? 106 HIS B HE1  2  
ATOM   2903  H  HE2  . HIS B 2 6   ? 7.212   23.042  -6.962  1.00 0.00 ? 106 HIS B HE2  2  
ATOM   2904  N  N    . THR B 2 7   ? 0.990   20.523  -9.696  1.00 0.00 ? 107 THR B N    2  
ATOM   2905  C  CA   . THR B 2 7   ? -0.427  20.343  -9.400  1.00 0.00 ? 107 THR B CA   2  
ATOM   2906  C  C    . THR B 2 7   ? -0.712  18.918  -8.939  1.00 0.00 ? 107 THR B C    2  
ATOM   2907  O  O    . THR B 2 7   ? -0.706  17.984  -9.742  1.00 0.00 ? 107 THR B O    2  
ATOM   2908  C  CB   . THR B 2 7   ? -1.274  20.671  -10.632 1.00 0.00 ? 107 THR B CB   2  
ATOM   2909  O  OG1  . THR B 2 7   ? -2.595  20.188  -10.473 1.00 0.00 ? 107 THR B OG1  2  
ATOM   2910  C  CG2  . THR B 2 7   ? -0.722  20.084  -11.913 1.00 0.00 ? 107 THR B CG2  2  
ATOM   2911  H  H    . THR B 2 7   ? 1.585   19.744  -9.678  1.00 0.00 ? 107 THR B H    2  
ATOM   2912  H  HA   . THR B 2 7   ? -0.687  21.024  -8.605  1.00 0.00 ? 107 THR B HA   2  
ATOM   2913  H  HB   . THR B 2 7   ? -1.317  21.744  -10.751 1.00 0.00 ? 107 THR B HB   2  
ATOM   2914  H  HG1  . THR B 2 7   ? -3.159  20.565  -11.153 1.00 0.00 ? 107 THR B HG1  2  
ATOM   2915  H  HG21 . THR B 2 7   ? -0.214  20.857  -12.474 1.00 0.00 ? 107 THR B HG21 2  
ATOM   2916  H  HG22 . THR B 2 7   ? -1.532  19.684  -12.505 1.00 0.00 ? 107 THR B HG22 2  
ATOM   2917  H  HG23 . THR B 2 7   ? -0.023  19.295  -11.677 1.00 0.00 ? 107 THR B HG23 2  
ATOM   2918  N  N    . ALA B 2 8   ? -0.959  18.758  -7.643  1.00 0.00 ? 108 ALA B N    2  
ATOM   2919  C  CA   . ALA B 2 8   ? -1.248  17.450  -7.075  1.00 0.00 ? 108 ALA B CA   2  
ATOM   2920  C  C    . ALA B 2 8   ? -2.551  16.889  -7.634  1.00 0.00 ? 108 ALA B C    2  
ATOM   2921  O  O    . ALA B 2 8   ? -3.589  16.931  -6.976  1.00 0.00 ? 108 ALA B O    2  
ATOM   2922  C  CB   . ALA B 2 8   ? -1.316  17.536  -5.557  1.00 0.00 ? 108 ALA B CB   2  
ATOM   2923  H  H    . ALA B 2 8   ? -0.948  19.539  -7.055  1.00 0.00 ? 108 ALA B H    2  
ATOM   2924  H  HA   . ALA B 2 8   ? -0.438  16.790  -7.338  1.00 0.00 ? 108 ALA B HA   2  
ATOM   2925  H  HB1  . ALA B 2 8   ? -2.344  17.661  -5.249  1.00 0.00 ? 108 ALA B HB1  2  
ATOM   2926  H  HB2  . ALA B 2 8   ? -0.734  18.381  -5.218  1.00 0.00 ? 108 ALA B HB2  2  
ATOM   2927  H  HB3  . ALA B 2 8   ? -0.919  16.629  -5.127  1.00 0.00 ? 108 ALA B HB3  2  
ATOM   2928  N  N    . ASP B 2 9   ? -2.488  16.370  -8.856  1.00 0.00 ? 109 ASP B N    2  
ATOM   2929  C  CA   . ASP B 2 9   ? -3.661  15.805  -9.509  1.00 0.00 ? 109 ASP B CA   2  
ATOM   2930  C  C    . ASP B 2 9   ? -3.860  14.342  -9.115  1.00 0.00 ? 109 ASP B C    2  
ATOM   2931  O  O    . ASP B 2 9   ? -3.089  13.473  -9.525  1.00 0.00 ? 109 ASP B O    2  
ATOM   2932  C  CB   . ASP B 2 9   ? -3.525  15.919  -11.029 1.00 0.00 ? 109 ASP B CB   2  
ATOM   2933  C  CG   . ASP B 2 9   ? -4.822  15.609  -11.751 1.00 0.00 ? 109 ASP B CG   2  
ATOM   2934  O  OD1  . ASP B 2 9   ? -5.841  16.266  -11.451 1.00 0.00 ? 109 ASP B OD1  2  
ATOM   2935  O  OD2  . ASP B 2 9   ? -4.819  14.709  -12.617 1.00 0.00 ? 109 ASP B OD2  2  
ATOM   2936  H  H    . ASP B 2 9   ? -1.631  16.371  -9.331  1.00 0.00 ? 109 ASP B H    2  
ATOM   2937  H  HA   . ASP B 2 9   ? -4.521  16.373  -9.192  1.00 0.00 ? 109 ASP B HA   2  
ATOM   2938  H  HB2  . ASP B 2 9   ? -3.226  16.925  -11.283 1.00 0.00 ? 109 ASP B HB2  2  
ATOM   2939  H  HB3  . ASP B 2 9   ? -2.770  15.226  -11.369 1.00 0.00 ? 109 ASP B HB3  2  
ATOM   2940  N  N    . PRO B 2 10  ? -4.900  14.045  -8.315  1.00 0.00 ? 110 PRO B N    2  
ATOM   2941  C  CA   . PRO B 2 10  ? -5.190  12.677  -7.876  1.00 0.00 ? 110 PRO B CA   2  
ATOM   2942  C  C    . PRO B 2 10  ? -5.802  11.830  -8.987  1.00 0.00 ? 110 PRO B C    2  
ATOM   2943  O  O    . PRO B 2 10  ? -5.739  10.601  -8.950  1.00 0.00 ? 110 PRO B O    2  
ATOM   2944  C  CB   . PRO B 2 10  ? -6.197  12.880  -6.744  1.00 0.00 ? 110 PRO B CB   2  
ATOM   2945  C  CG   . PRO B 2 10  ? -6.898  14.146  -7.092  1.00 0.00 ? 110 PRO B CG   2  
ATOM   2946  C  CD   . PRO B 2 10  ? -5.877  15.014  -7.777  1.00 0.00 ? 110 PRO B CD   2  
ATOM   2947  H  HA   . PRO B 2 10  ? -4.307  12.187  -7.494  1.00 0.00 ? 110 PRO B HA   2  
ATOM   2948  H  HB2  . PRO B 2 10  ? -6.880  12.044  -6.710  1.00 0.00 ? 110 PRO B HB2  2  
ATOM   2949  H  HB3  . PRO B 2 10  ? -5.674  12.965  -5.803  1.00 0.00 ? 110 PRO B HB3  2  
ATOM   2950  H  HG2  . PRO B 2 10  ? -7.721  13.938  -7.759  1.00 0.00 ? 110 PRO B HG2  2  
ATOM   2951  H  HG3  . PRO B 2 10  ? -7.254  14.628  -6.194  1.00 0.00 ? 110 PRO B HG3  2  
ATOM   2952  H  HD2  . PRO B 2 10  ? -6.337  15.578  -8.575  1.00 0.00 ? 110 PRO B HD2  2  
ATOM   2953  H  HD3  . PRO B 2 10  ? -5.408  15.678  -7.067  1.00 0.00 ? 110 PRO B HD3  2  
ATOM   2954  N  N    . GLU B 2 11  ? -6.397  12.496  -9.975  1.00 0.00 ? 111 GLU B N    2  
ATOM   2955  C  CA   . GLU B 2 11  ? -7.023  11.808  -11.097 1.00 0.00 ? 111 GLU B CA   2  
ATOM   2956  C  C    . GLU B 2 11  ? -6.064  10.820  -11.750 1.00 0.00 ? 111 GLU B C    2  
ATOM   2957  O  O    . GLU B 2 11  ? -6.485  9.849   -12.378 1.00 0.00 ? 111 GLU B O    2  
ATOM   2958  C  CB   . GLU B 2 11  ? -7.518  12.821  -12.131 1.00 0.00 ? 111 GLU B CB   2  
ATOM   2959  C  CG   . GLU B 2 11  ? -8.890  12.496  -12.695 1.00 0.00 ? 111 GLU B CG   2  
ATOM   2960  C  CD   . GLU B 2 11  ? -9.097  13.057  -14.088 1.00 0.00 ? 111 GLU B CD   2  
ATOM   2961  O  OE1  . GLU B 2 11  ? -8.971  14.288  -14.257 1.00 0.00 ? 111 GLU B OE1  2  
ATOM   2962  O  OE2  . GLU B 2 11  ? -9.384  12.265  -15.010 1.00 0.00 ? 111 GLU B OE2  2  
ATOM   2963  H  H    . GLU B 2 11  ? -6.419  13.470  -9.948  1.00 0.00 ? 111 GLU B H    2  
ATOM   2964  H  HA   . GLU B 2 11  ? -7.861  11.267  -10.711 1.00 0.00 ? 111 GLU B HA   2  
ATOM   2965  H  HB2  . GLU B 2 11  ? -7.564  13.797  -11.669 1.00 0.00 ? 111 GLU B HB2  2  
ATOM   2966  H  HB3  . GLU B 2 11  ? -6.814  12.855  -12.951 1.00 0.00 ? 111 GLU B HB3  2  
ATOM   2967  H  HG2  . GLU B 2 11  ? -9.004  11.423  -12.735 1.00 0.00 ? 111 GLU B HG2  2  
ATOM   2968  H  HG3  . GLU B 2 11  ? -9.642  12.912  -12.040 1.00 0.00 ? 111 GLU B HG3  2  
ATOM   2969  N  N    . LYS B 2 12  ? -4.775  11.074  -11.591 1.00 0.00 ? 112 LYS B N    2  
ATOM   2970  C  CA   . LYS B 2 12  ? -3.744  10.212  -12.157 1.00 0.00 ? 112 LYS B CA   2  
ATOM   2971  C  C    . LYS B 2 12  ? -3.419  9.057   -11.214 1.00 0.00 ? 112 LYS B C    2  
ATOM   2972  O  O    . LYS B 2 12  ? -2.867  8.040   -11.633 1.00 0.00 ? 112 LYS B O    2  
ATOM   2973  C  CB   . LYS B 2 12  ? -2.478  11.019  -12.451 1.00 0.00 ? 112 LYS B CB   2  
ATOM   2974  C  CG   . LYS B 2 12  ? -2.550  11.815  -13.744 1.00 0.00 ? 112 LYS B CG   2  
ATOM   2975  C  CD   . LYS B 2 12  ? -1.367  12.759  -13.884 1.00 0.00 ? 112 LYS B CD   2  
ATOM   2976  C  CE   . LYS B 2 12  ? -1.103  13.109  -15.339 1.00 0.00 ? 112 LYS B CE   2  
ATOM   2977  N  NZ   . LYS B 2 12  ? -2.329  13.605  -16.023 1.00 0.00 ? 112 LYS B NZ   2  
ATOM   2978  H  H    . LYS B 2 12  ? -4.511  11.862  -11.076 1.00 0.00 ? 112 LYS B H    2  
ATOM   2979  H  HA   . LYS B 2 12  ? -4.124  9.806   -13.083 1.00 0.00 ? 112 LYS B HA   2  
ATOM   2980  H  HB2  . LYS B 2 12  ? -2.308  11.709  -11.637 1.00 0.00 ? 112 LYS B HB2  2  
ATOM   2981  H  HB3  . LYS B 2 12  ? -1.641  10.342  -12.517 1.00 0.00 ? 112 LYS B HB3  2  
ATOM   2982  H  HG2  . LYS B 2 12  ? -2.552  11.130  -14.578 1.00 0.00 ? 112 LYS B HG2  2  
ATOM   2983  H  HG3  . LYS B 2 12  ? -3.463  12.393  -13.748 1.00 0.00 ? 112 LYS B HG3  2  
ATOM   2984  H  HD2  . LYS B 2 12  ? -1.575  13.667  -13.339 1.00 0.00 ? 112 LYS B HD2  2  
ATOM   2985  H  HD3  . LYS B 2 12  ? -0.488  12.283  -13.472 1.00 0.00 ? 112 LYS B HD3  2  
ATOM   2986  H  HE2  . LYS B 2 12  ? -0.343  13.877  -15.380 1.00 0.00 ? 112 LYS B HE2  2  
ATOM   2987  H  HE3  . LYS B 2 12  ? -0.748  12.227  -15.851 1.00 0.00 ? 112 LYS B HE3  2  
ATOM   2988  H  HZ1  . LYS B 2 12  ? -2.077  14.322  -16.733 1.00 0.00 ? 112 LYS B HZ1  2  
ATOM   2989  H  HZ2  . LYS B 2 12  ? -2.976  14.032  -15.330 1.00 0.00 ? 112 LYS B HZ2  2  
ATOM   2990  H  HZ3  . LYS B 2 12  ? -2.817  12.818  -16.498 1.00 0.00 ? 112 LYS B HZ3  2  
ATOM   2991  N  N    . ARG B 2 13  ? -3.765  9.218   -9.938  1.00 0.00 ? 113 ARG B N    2  
ATOM   2992  C  CA   . ARG B 2 13  ? -3.510  8.186   -8.938  1.00 0.00 ? 113 ARG B CA   2  
ATOM   2993  C  C    . ARG B 2 13  ? -4.041  6.832   -9.398  1.00 0.00 ? 113 ARG B C    2  
ATOM   2994  O  O    . ARG B 2 13  ? -3.550  5.785   -8.978  1.00 0.00 ? 113 ARG B O    2  
ATOM   2995  C  CB   . ARG B 2 13  ? -4.147  8.572   -7.603  1.00 0.00 ? 113 ARG B CB   2  
ATOM   2996  C  CG   . ARG B 2 13  ? -3.877  7.577   -6.488  1.00 0.00 ? 113 ARG B CG   2  
ATOM   2997  C  CD   . ARG B 2 13  ? -4.671  7.915   -5.236  1.00 0.00 ? 113 ARG B CD   2  
ATOM   2998  N  NE   . ARG B 2 13  ? -5.867  7.087   -5.106  1.00 0.00 ? 113 ARG B NE   2  
ATOM   2999  C  CZ   . ARG B 2 13  ? -6.550  6.942   -3.973  1.00 0.00 ? 113 ARG B CZ   2  
ATOM   3000  N  NH1  . ARG B 2 13  ? -6.156  7.566   -2.869  1.00 0.00 ? 113 ARG B NH1  2  
ATOM   3001  N  NH2  . ARG B 2 13  ? -7.627  6.170   -3.942  1.00 0.00 ? 113 ARG B NH2  2  
ATOM   3002  H  H    . ARG B 2 13  ? -4.203  10.049  -9.662  1.00 0.00 ? 113 ARG B H    2  
ATOM   3003  H  HA   . ARG B 2 13  ? -2.446  8.110   -8.811  1.00 0.00 ? 113 ARG B HA   2  
ATOM   3004  H  HB2  . ARG B 2 13  ? -3.762  9.534   -7.299  1.00 0.00 ? 113 ARG B HB2  2  
ATOM   3005  H  HB3  . ARG B 2 13  ? -5.217  8.649   -7.736  1.00 0.00 ? 113 ARG B HB3  2  
ATOM   3006  H  HG2  . ARG B 2 13  ? -4.157  6.589   -6.823  1.00 0.00 ? 113 ARG B HG2  2  
ATOM   3007  H  HG3  . ARG B 2 13  ? -2.823  7.593   -6.251  1.00 0.00 ? 113 ARG B HG3  2  
ATOM   3008  H  HD2  . ARG B 2 13  ? -4.042  7.758   -4.373  1.00 0.00 ? 113 ARG B HD2  2  
ATOM   3009  H  HD3  . ARG B 2 13  ? -4.965  8.953   -5.281  1.00 0.00 ? 113 ARG B HD3  2  
ATOM   3010  H  HE   . ARG B 2 13  ? -6.179  6.615   -5.906  1.00 0.00 ? 113 ARG B HE   2  
ATOM   3011  H  HH11 . ARG B 2 13  ? -5.344  8.149   -2.886  1.00 0.00 ? 113 ARG B HH11 2  
ATOM   3012  H  HH12 . ARG B 2 13  ? -6.673  7.453   -2.021  1.00 0.00 ? 113 ARG B HH12 2  
ATOM   3013  H  HH21 . ARG B 2 13  ? -7.927  5.698   -4.770  1.00 0.00 ? 113 ARG B HH21 2  
ATOM   3014  H  HH22 . ARG B 2 13  ? -8.140  6.061   -3.090  1.00 0.00 ? 113 ARG B HH22 2  
ATOM   3015  N  N    . LYS B 2 14  ? -5.041  6.867   -10.266 1.00 0.00 ? 114 LYS B N    2  
ATOM   3016  C  CA   . LYS B 2 14  ? -5.637  5.647   -10.794 1.00 0.00 ? 114 LYS B CA   2  
ATOM   3017  C  C    . LYS B 2 14  ? -4.692  4.977   -11.785 1.00 0.00 ? 114 LYS B C    2  
ATOM   3018  O  O    . LYS B 2 14  ? -4.474  3.768   -11.732 1.00 0.00 ? 114 LYS B O    2  
ATOM   3019  C  CB   . LYS B 2 14  ? -6.974  5.956   -11.473 1.00 0.00 ? 114 LYS B CB   2  
ATOM   3020  C  CG   . LYS B 2 14  ? -7.847  6.924   -10.690 1.00 0.00 ? 114 LYS B CG   2  
ATOM   3021  C  CD   . LYS B 2 14  ? -8.093  6.433   -9.272  1.00 0.00 ? 114 LYS B CD   2  
ATOM   3022  C  CE   . LYS B 2 14  ? -9.534  6.663   -8.845  1.00 0.00 ? 114 LYS B CE   2  
ATOM   3023  N  NZ   . LYS B 2 14  ? -10.459 5.664   -9.449  1.00 0.00 ? 114 LYS B NZ   2  
ATOM   3024  H  H    . LYS B 2 14  ? -5.380  7.734   -10.564 1.00 0.00 ? 114 LYS B H    2  
ATOM   3025  H  HA   . LYS B 2 14  ? -5.808  4.975   -9.966  1.00 0.00 ? 114 LYS B HA   2  
ATOM   3026  H  HB2  . LYS B 2 14  ? -6.780  6.386   -12.445 1.00 0.00 ? 114 LYS B HB2  2  
ATOM   3027  H  HB3  . LYS B 2 14  ? -7.521  5.033   -11.600 1.00 0.00 ? 114 LYS B HB3  2  
ATOM   3028  H  HG2  . LYS B 2 14  ? -7.355  7.884   -10.648 1.00 0.00 ? 114 LYS B HG2  2  
ATOM   3029  H  HG3  . LYS B 2 14  ? -8.796  7.027   -11.197 1.00 0.00 ? 114 LYS B HG3  2  
ATOM   3030  H  HD2  . LYS B 2 14  ? -7.879  5.376   -9.225  1.00 0.00 ? 114 LYS B HD2  2  
ATOM   3031  H  HD3  . LYS B 2 14  ? -7.438  6.966   -8.599  1.00 0.00 ? 114 LYS B HD3  2  
ATOM   3032  H  HE2  . LYS B 2 14  ? -9.592  6.589   -7.769  1.00 0.00 ? 114 LYS B HE2  2  
ATOM   3033  H  HE3  . LYS B 2 14  ? -9.834  7.652   -9.155  1.00 0.00 ? 114 LYS B HE3  2  
ATOM   3034  H  HZ1  . LYS B 2 14  ? -11.192 5.394   -8.761  1.00 0.00 ? 114 LYS B HZ1  2  
ATOM   3035  H  HZ2  . LYS B 2 14  ? -9.932  4.812   -9.730  1.00 0.00 ? 114 LYS B HZ2  2  
ATOM   3036  H  HZ3  . LYS B 2 14  ? -10.920 6.066   -10.290 1.00 0.00 ? 114 LYS B HZ3  2  
ATOM   3037  N  N    . LEU B 2 15  ? -4.129  5.777   -12.687 1.00 0.00 ? 115 LEU B N    2  
ATOM   3038  C  CA   . LEU B 2 15  ? -3.202  5.262   -13.687 1.00 0.00 ? 115 LEU B CA   2  
ATOM   3039  C  C    . LEU B 2 15  ? -1.886  4.854   -13.039 1.00 0.00 ? 115 LEU B C    2  
ATOM   3040  O  O    . LEU B 2 15  ? -1.213  3.931   -13.497 1.00 0.00 ? 115 LEU B O    2  
ATOM   3041  C  CB   . LEU B 2 15  ? -2.955  6.308   -14.776 1.00 0.00 ? 115 LEU B CB   2  
ATOM   3042  C  CG   . LEU B 2 15  ? -3.751  6.099   -16.065 1.00 0.00 ? 115 LEU B CG   2  
ATOM   3043  C  CD1  . LEU B 2 15  ? -5.244  6.061   -15.772 1.00 0.00 ? 115 LEU B CD1  2  
ATOM   3044  C  CD2  . LEU B 2 15  ? -3.433  7.197   -17.071 1.00 0.00 ? 115 LEU B CD2  2  
ATOM   3045  H  H    . LEU B 2 15  ? -4.337  6.735   -12.677 1.00 0.00 ? 115 LEU B H    2  
ATOM   3046  H  HA   . LEU B 2 15  ? -3.649  4.390   -14.128 1.00 0.00 ? 115 LEU B HA   2  
ATOM   3047  H  HB2  . LEU B 2 15  ? -3.206  7.279   -14.375 1.00 0.00 ? 115 LEU B HB2  2  
ATOM   3048  H  HB3  . LEU B 2 15  ? -1.905  6.300   -15.025 1.00 0.00 ? 115 LEU B HB3  2  
ATOM   3049  H  HG   . LEU B 2 15  ? -3.473  5.152   -16.504 1.00 0.00 ? 115 LEU B HG   2  
ATOM   3050  H  HD11 . LEU B 2 15  ? -5.660  7.051   -15.888 1.00 0.00 ? 115 LEU B HD11 2  
ATOM   3051  H  HD12 . LEU B 2 15  ? -5.403  5.720   -14.759 1.00 0.00 ? 115 LEU B HD12 2  
ATOM   3052  H  HD13 . LEU B 2 15  ? -5.729  5.383   -16.459 1.00 0.00 ? 115 LEU B HD13 2  
ATOM   3053  H  HD21 . LEU B 2 15  ? -3.091  8.077   -16.546 1.00 0.00 ? 115 LEU B HD21 2  
ATOM   3054  H  HD22 . LEU B 2 15  ? -4.321  7.436   -17.636 1.00 0.00 ? 115 LEU B HD22 2  
ATOM   3055  H  HD23 . LEU B 2 15  ? -2.660  6.855   -17.743 1.00 0.00 ? 115 LEU B HD23 2  
ATOM   3056  N  N    . ILE B 2 16  ? -1.534  5.544   -11.963 1.00 0.00 ? 116 ILE B N    2  
ATOM   3057  C  CA   . ILE B 2 16  ? -0.306  5.251   -11.239 1.00 0.00 ? 116 ILE B CA   2  
ATOM   3058  C  C    . ILE B 2 16  ? -0.431  3.926   -10.497 1.00 0.00 ? 116 ILE B C    2  
ATOM   3059  O  O    . ILE B 2 16  ? 0.512   3.137   -10.452 1.00 0.00 ? 116 ILE B O    2  
ATOM   3060  C  CB   . ILE B 2 16  ? 0.041   6.372   -10.238 1.00 0.00 ? 116 ILE B CB   2  
ATOM   3061  C  CG1  . ILE B 2 16  ? 0.234   7.697   -10.975 1.00 0.00 ? 116 ILE B CG1  2  
ATOM   3062  C  CG2  . ILE B 2 16  ? 1.293   6.017   -9.445  1.00 0.00 ? 116 ILE B CG2  2  
ATOM   3063  C  CD1  . ILE B 2 16  ? 0.491   8.869   -10.054 1.00 0.00 ? 116 ILE B CD1  2  
ATOM   3064  H  H    . ILE B 2 16  ? -2.120  6.260   -11.647 1.00 0.00 ? 116 ILE B H    2  
ATOM   3065  H  HA   . ILE B 2 16  ? 0.497   5.175   -11.958 1.00 0.00 ? 116 ILE B HA   2  
ATOM   3066  H  HB   . ILE B 2 16  ? -0.778  6.471   -9.542  1.00 0.00 ? 116 ILE B HB   2  
ATOM   3067  H  HG12 . ILE B 2 16  ? 1.079   7.610   -11.642 1.00 0.00 ? 116 ILE B HG12 2  
ATOM   3068  H  HG13 . ILE B 2 16  ? -0.652  7.915   -11.551 1.00 0.00 ? 116 ILE B HG13 2  
ATOM   3069  H  HG21 . ILE B 2 16  ? 2.080   5.726   -10.127 1.00 0.00 ? 116 ILE B HG21 2  
ATOM   3070  H  HG22 . ILE B 2 16  ? 1.076   5.198   -8.777  1.00 0.00 ? 116 ILE B HG22 2  
ATOM   3071  H  HG23 . ILE B 2 16  ? 1.613   6.875   -8.872  1.00 0.00 ? 116 ILE B HG23 2  
ATOM   3072  H  HD11 . ILE B 2 16  ? 1.538   8.896   -9.790  1.00 0.00 ? 116 ILE B HD11 2  
ATOM   3073  H  HD12 . ILE B 2 16  ? -0.103  8.761   -9.159  1.00 0.00 ? 116 ILE B HD12 2  
ATOM   3074  H  HD13 . ILE B 2 16  ? 0.223   9.787   -10.555 1.00 0.00 ? 116 ILE B HD13 2  
ATOM   3075  N  N    . GLN B 2 17  ? -1.606  3.685   -9.924  1.00 0.00 ? 117 GLN B N    2  
ATOM   3076  C  CA   . GLN B 2 17  ? -1.857  2.451   -9.195  1.00 0.00 ? 117 GLN B CA   2  
ATOM   3077  C  C    . GLN B 2 17  ? -1.768  1.252   -10.133 1.00 0.00 ? 117 GLN B C    2  
ATOM   3078  O  O    . GLN B 2 17  ? -1.230  0.208   -9.771  1.00 0.00 ? 117 GLN B O    2  
ATOM   3079  C  CB   . GLN B 2 17  ? -3.232  2.494   -8.524  1.00 0.00 ? 117 GLN B CB   2  
ATOM   3080  C  CG   . GLN B 2 17  ? -3.216  2.034   -7.075  1.00 0.00 ? 117 GLN B CG   2  
ATOM   3081  C  CD   . GLN B 2 17  ? -4.055  2.918   -6.174  1.00 0.00 ? 117 GLN B CD   2  
ATOM   3082  O  OE1  . GLN B 2 17  ? -5.040  2.470   -5.589  1.00 0.00 ? 117 GLN B OE1  2  
ATOM   3083  N  NE2  . GLN B 2 17  ? -3.668  4.183   -6.059  1.00 0.00 ? 117 GLN B NE2  2  
ATOM   3084  H  H    . GLN B 2 17  ? -2.323  4.349   -10.001 1.00 0.00 ? 117 GLN B H    2  
ATOM   3085  H  HA   . GLN B 2 17  ? -1.096  2.354   -8.433  1.00 0.00 ? 117 GLN B HA   2  
ATOM   3086  H  HB2  . GLN B 2 17  ? -3.604  3.507   -8.553  1.00 0.00 ? 117 GLN B HB2  2  
ATOM   3087  H  HB3  . GLN B 2 17  ? -3.910  1.855   -9.073  1.00 0.00 ? 117 GLN B HB3  2  
ATOM   3088  H  HG2  . GLN B 2 17  ? -3.602  1.027   -7.027  1.00 0.00 ? 117 GLN B HG2  2  
ATOM   3089  H  HG3  . GLN B 2 17  ? -2.197  2.046   -6.720  1.00 0.00 ? 117 GLN B HG3  2  
ATOM   3090  H  HE21 . GLN B 2 17  ? -2.873  4.471   -6.556  1.00 0.00 ? 117 GLN B HE21 2  
ATOM   3091  H  HE22 . GLN B 2 17  ? -4.192  4.778   -5.483  1.00 0.00 ? 117 GLN B HE22 2  
ATOM   3092  N  N    . GLN B 2 18  ? -2.295  1.416   -11.343 1.00 0.00 ? 118 GLN B N    2  
ATOM   3093  C  CA   . GLN B 2 18  ? -2.269  0.347   -12.335 1.00 0.00 ? 118 GLN B CA   2  
ATOM   3094  C  C    . GLN B 2 18  ? -0.843  -0.052  -12.657 1.00 0.00 ? 118 GLN B C    2  
ATOM   3095  O  O    . GLN B 2 18  ? -0.415  -1.163  -12.355 1.00 0.00 ? 118 GLN B O    2  
ATOM   3096  C  CB   . GLN B 2 18  ? -2.995  0.782   -13.610 1.00 0.00 ? 118 GLN B CB   2  
ATOM   3097  C  CG   . GLN B 2 18  ? -4.493  0.533   -13.571 1.00 0.00 ? 118 GLN B CG   2  
ATOM   3098  C  CD   . GLN B 2 18  ? -5.023  -0.037  -14.873 1.00 0.00 ? 118 GLN B CD   2  
ATOM   3099  O  OE1  . GLN B 2 18  ? -5.740  -1.037  -14.881 1.00 0.00 ? 118 GLN B OE1  2  
ATOM   3100  N  NE2  . GLN B 2 18  ? -4.670  0.599   -15.984 1.00 0.00 ? 118 GLN B NE2  2  
ATOM   3101  H  H    . GLN B 2 18  ? -2.708  2.275   -11.575 1.00 0.00 ? 118 GLN B H    2  
ATOM   3102  H  HA   . GLN B 2 18  ? -2.767  -0.504  -11.919 1.00 0.00 ? 118 GLN B HA   2  
ATOM   3103  H  HB2  . GLN B 2 18  ? -2.831  1.839   -13.761 1.00 0.00 ? 118 GLN B HB2  2  
ATOM   3104  H  HB3  . GLN B 2 18  ? -2.583  0.240   -14.448 1.00 0.00 ? 118 GLN B HB3  2  
ATOM   3105  H  HG2  . GLN B 2 18  ? -4.709  -0.166  -12.776 1.00 0.00 ? 118 GLN B HG2  2  
ATOM   3106  H  HG3  . GLN B 2 18  ? -4.997  1.468   -13.374 1.00 0.00 ? 118 GLN B HG3  2  
ATOM   3107  H  HE21 . GLN B 2 18  ? -4.096  1.390   -15.902 1.00 0.00 ? 118 GLN B HE21 2  
ATOM   3108  H  HE22 . GLN B 2 18  ? -4.998  0.253   -16.839 1.00 0.00 ? 118 GLN B HE22 2  
ATOM   3109  N  N    . GLN B 2 19  ? -0.112  0.860   -13.268 1.00 0.00 ? 119 GLN B N    2  
ATOM   3110  C  CA   . GLN B 2 19  ? 1.277   0.603   -13.629 1.00 0.00 ? 119 GLN B CA   2  
ATOM   3111  C  C    . GLN B 2 19  ? 2.070   0.133   -12.417 1.00 0.00 ? 119 GLN B C    2  
ATOM   3112  O  O    . GLN B 2 19  ? 3.053   -0.598  -12.547 1.00 0.00 ? 119 GLN B O    2  
ATOM   3113  C  CB   . GLN B 2 19  ? 1.918   1.856   -14.229 1.00 0.00 ? 119 GLN B CB   2  
ATOM   3114  C  CG   . GLN B 2 19  ? 1.574   2.071   -15.695 1.00 0.00 ? 119 GLN B CG   2  
ATOM   3115  C  CD   . GLN B 2 19  ? 0.990   3.444   -15.963 1.00 0.00 ? 119 GLN B CD   2  
ATOM   3116  O  OE1  . GLN B 2 19  ? 1.667   4.461   -15.808 1.00 0.00 ? 119 GLN B OE1  2  
ATOM   3117  N  NE2  . GLN B 2 19  ? -0.274  3.480   -16.369 1.00 0.00 ? 119 GLN B NE2  2  
ATOM   3118  H  H    . GLN B 2 19  ? -0.516  1.725   -13.475 1.00 0.00 ? 119 GLN B H    2  
ATOM   3119  H  HA   . GLN B 2 19  ? 1.281   -0.183  -14.363 1.00 0.00 ? 119 GLN B HA   2  
ATOM   3120  H  HB2  . GLN B 2 19  ? 1.585   2.719   -13.672 1.00 0.00 ? 119 GLN B HB2  2  
ATOM   3121  H  HB3  . GLN B 2 19  ? 2.992   1.775   -14.141 1.00 0.00 ? 119 GLN B HB3  2  
ATOM   3122  H  HG2  . GLN B 2 19  ? 2.473   1.959   -16.282 1.00 0.00 ? 119 GLN B HG2  2  
ATOM   3123  H  HG3  . GLN B 2 19  ? 0.854   1.324   -15.995 1.00 0.00 ? 119 GLN B HG3  2  
ATOM   3124  H  HE21 . GLN B 2 19  ? -0.752  2.631   -16.471 1.00 0.00 ? 119 GLN B HE21 2  
ATOM   3125  H  HE22 . GLN B 2 19  ? -0.677  4.355   -16.551 1.00 0.00 ? 119 GLN B HE22 2  
ATOM   3126  N  N    . LEU B 2 20  ? 1.622   0.542   -11.237 1.00 0.00 ? 120 LEU B N    2  
ATOM   3127  C  CA   . LEU B 2 20  ? 2.273   0.147   -9.998  1.00 0.00 ? 120 LEU B CA   2  
ATOM   3128  C  C    . LEU B 2 20  ? 1.908   -1.293  -9.661  1.00 0.00 ? 120 LEU B C    2  
ATOM   3129  O  O    . LEU B 2 20  ? 2.771   -2.106  -9.341  1.00 0.00 ? 120 LEU B O    2  
ATOM   3130  C  CB   . LEU B 2 20  ? 1.862   1.076   -8.854  1.00 0.00 ? 120 LEU B CB   2  
ATOM   3131  C  CG   . LEU B 2 20  ? 2.658   0.902   -7.559  1.00 0.00 ? 120 LEU B CG   2  
ATOM   3132  C  CD1  . LEU B 2 20  ? 2.834   2.241   -6.857  1.00 0.00 ? 120 LEU B CD1  2  
ATOM   3133  C  CD2  . LEU B 2 20  ? 1.970   -0.099  -6.644  1.00 0.00 ? 120 LEU B CD2  2  
ATOM   3134  H  H    . LEU B 2 20  ? 0.826   1.109   -11.202 1.00 0.00 ? 120 LEU B H    2  
ATOM   3135  H  HA   . LEU B 2 20  ? 3.340   0.213   -10.145 1.00 0.00 ? 120 LEU B HA   2  
ATOM   3136  H  HB2  . LEU B 2 20  ? 1.980   2.096   -9.189  1.00 0.00 ? 120 LEU B HB2  2  
ATOM   3137  H  HB3  . LEU B 2 20  ? 0.819   0.905   -8.635  1.00 0.00 ? 120 LEU B HB3  2  
ATOM   3138  H  HG   . LEU B 2 20  ? 3.640   0.520   -7.798  1.00 0.00 ? 120 LEU B HG   2  
ATOM   3139  H  HD11 . LEU B 2 20  ? 3.843   2.597   -7.009  1.00 0.00 ? 120 LEU B HD11 2  
ATOM   3140  H  HD12 . LEU B 2 20  ? 2.651   2.121   -5.800  1.00 0.00 ? 120 LEU B HD12 2  
ATOM   3141  H  HD13 . LEU B 2 20  ? 2.135   2.957   -7.264  1.00 0.00 ? 120 LEU B HD13 2  
ATOM   3142  H  HD21 . LEU B 2 20  ? 1.356   0.429   -5.929  1.00 0.00 ? 120 LEU B HD21 2  
ATOM   3143  H  HD22 . LEU B 2 20  ? 2.715   -0.679  -6.120  1.00 0.00 ? 120 LEU B HD22 2  
ATOM   3144  H  HD23 . LEU B 2 20  ? 1.349   -0.759  -7.232  1.00 0.00 ? 120 LEU B HD23 2  
ATOM   3145  N  N    . VAL B 2 21  ? 0.617   -1.601  -9.757  1.00 0.00 ? 121 VAL B N    2  
ATOM   3146  C  CA   . VAL B 2 21  ? 0.129   -2.946  -9.482  1.00 0.00 ? 121 VAL B CA   2  
ATOM   3147  C  C    . VAL B 2 21  ? 0.507   -3.893  -10.611 1.00 0.00 ? 121 VAL B C    2  
ATOM   3148  O  O    . VAL B 2 21  ? 0.777   -5.067  -10.373 1.00 0.00 ? 121 VAL B O    2  
ATOM   3149  C  CB   . VAL B 2 21  ? -1.401  -2.968  -9.294  1.00 0.00 ? 121 VAL B CB   2  
ATOM   3150  C  CG1  . VAL B 2 21  ? -1.877  -4.366  -8.924  1.00 0.00 ? 121 VAL B CG1  2  
ATOM   3151  C  CG2  . VAL B 2 21  ? -1.826  -1.957  -8.240  1.00 0.00 ? 121 VAL B CG2  2  
ATOM   3152  H  H    . VAL B 2 21  ? -0.020  -0.910  -10.031 1.00 0.00 ? 121 VAL B H    2  
ATOM   3153  H  HA   . VAL B 2 21  ? 0.593   -3.295  -8.565  1.00 0.00 ? 121 VAL B HA   2  
ATOM   3154  H  HB   . VAL B 2 21  ? -1.863  -2.693  -10.232 1.00 0.00 ? 121 VAL B HB   2  
ATOM   3155  H  HG11 . VAL B 2 21  ? -1.338  -4.711  -8.055  1.00 0.00 ? 121 VAL B HG11 2  
ATOM   3156  H  HG12 . VAL B 2 21  ? -1.696  -5.038  -9.750  1.00 0.00 ? 121 VAL B HG12 2  
ATOM   3157  H  HG13 . VAL B 2 21  ? -2.934  -4.340  -8.706  1.00 0.00 ? 121 VAL B HG13 2  
ATOM   3158  H  HG21 . VAL B 2 21  ? -2.576  -1.300  -8.654  1.00 0.00 ? 121 VAL B HG21 2  
ATOM   3159  H  HG22 . VAL B 2 21  ? -0.970  -1.376  -7.930  1.00 0.00 ? 121 VAL B HG22 2  
ATOM   3160  H  HG23 . VAL B 2 21  ? -2.235  -2.478  -7.387  1.00 0.00 ? 121 VAL B HG23 2  
ATOM   3161  N  N    . LEU B 2 22  ? 0.542   -3.384  -11.842 1.00 0.00 ? 122 LEU B N    2  
ATOM   3162  C  CA   . LEU B 2 22  ? 0.911   -4.201  -12.971 1.00 0.00 ? 122 LEU B CA   2  
ATOM   3163  C  C    . LEU B 2 22  ? 2.366   -4.636  -12.823 1.00 0.00 ? 122 LEU B C    2  
ATOM   3164  O  O    . LEU B 2 22  ? 2.717   -5.777  -13.120 1.00 0.00 ? 122 LEU B O    2  
ATOM   3165  C  CB   . LEU B 2 22  ? 0.675   -3.424  -14.266 1.00 0.00 ? 122 LEU B CB   2  
ATOM   3166  C  CG   . LEU B 2 22  ? 1.879   -3.302  -15.192 1.00 0.00 ? 122 LEU B CG   2  
ATOM   3167  C  CD1  . LEU B 2 22  ? 2.316   -4.670  -15.699 1.00 0.00 ? 122 LEU B CD1  2  
ATOM   3168  C  CD2  . LEU B 2 22  ? 1.564   -2.382  -16.356 1.00 0.00 ? 122 LEU B CD2  2  
ATOM   3169  H  H    . LEU B 2 22  ? 0.331   -2.436  -11.995 1.00 0.00 ? 122 LEU B H    2  
ATOM   3170  H  HA   . LEU B 2 22  ? 0.281   -5.079  -12.964 1.00 0.00 ? 122 LEU B HA   2  
ATOM   3171  H  HB2  . LEU B 2 22  ? -0.123  -3.903  -14.802 1.00 0.00 ? 122 LEU B HB2  2  
ATOM   3172  H  HB3  . LEU B 2 22  ? 0.355   -2.427  -14.003 1.00 0.00 ? 122 LEU B HB3  2  
ATOM   3173  H  HG   . LEU B 2 22  ? 2.693   -2.869  -14.630 1.00 0.00 ? 122 LEU B HG   2  
ATOM   3174  H  HD11 . LEU B 2 22  ? 2.537   -4.612  -16.755 1.00 0.00 ? 122 LEU B HD11 2  
ATOM   3175  H  HD12 . LEU B 2 22  ? 1.523   -5.386  -15.537 1.00 0.00 ? 122 LEU B HD12 2  
ATOM   3176  H  HD13 . LEU B 2 22  ? 3.199   -4.988  -15.164 1.00 0.00 ? 122 LEU B HD13 2  
ATOM   3177  H  HD21 . LEU B 2 22  ? 1.838   -1.372  -16.100 1.00 0.00 ? 122 LEU B HD21 2  
ATOM   3178  H  HD22 . LEU B 2 22  ? 0.507   -2.428  -16.571 1.00 0.00 ? 122 LEU B HD22 2  
ATOM   3179  H  HD23 . LEU B 2 22  ? 2.123   -2.700  -17.224 1.00 0.00 ? 122 LEU B HD23 2  
ATOM   3180  N  N    . LEU B 2 23  ? 3.204   -3.728  -12.320 1.00 0.00 ? 123 LEU B N    2  
ATOM   3181  C  CA   . LEU B 2 23  ? 4.604   -4.042  -12.092 1.00 0.00 ? 123 LEU B CA   2  
ATOM   3182  C  C    . LEU B 2 23  ? 4.674   -5.083  -10.993 1.00 0.00 ? 123 LEU B C    2  
ATOM   3183  O  O    . LEU B 2 23  ? 5.431   -6.051  -11.069 1.00 0.00 ? 123 LEU B O    2  
ATOM   3184  C  CB   . LEU B 2 23  ? 5.390   -2.792  -11.692 1.00 0.00 ? 123 LEU B CB   2  
ATOM   3185  C  CG   . LEU B 2 23  ? 5.994   -2.004  -12.855 1.00 0.00 ? 123 LEU B CG   2  
ATOM   3186  C  CD1  . LEU B 2 23  ? 6.237   -0.558  -12.452 1.00 0.00 ? 123 LEU B CD1  2  
ATOM   3187  C  CD2  . LEU B 2 23  ? 7.288   -2.654  -13.321 1.00 0.00 ? 123 LEU B CD2  2  
ATOM   3188  H  H    . LEU B 2 23  ? 2.865   -2.845  -12.070 1.00 0.00 ? 123 LEU B H    2  
ATOM   3189  H  HA   . LEU B 2 23  ? 5.011   -4.456  -13.002 1.00 0.00 ? 123 LEU B HA   2  
ATOM   3190  H  HB2  . LEU B 2 23  ? 4.727   -2.136  -11.145 1.00 0.00 ? 123 LEU B HB2  2  
ATOM   3191  H  HB3  . LEU B 2 23  ? 6.193   -3.092  -11.036 1.00 0.00 ? 123 LEU B HB3  2  
ATOM   3192  H  HG   . LEU B 2 23  ? 5.299   -2.007  -13.681 1.00 0.00 ? 123 LEU B HG   2  
ATOM   3193  H  HD11 . LEU B 2 23  ? 5.367   -0.177  -11.938 1.00 0.00 ? 123 LEU B HD11 2  
ATOM   3194  H  HD12 . LEU B 2 23  ? 6.422   0.036   -13.335 1.00 0.00 ? 123 LEU B HD12 2  
ATOM   3195  H  HD13 . LEU B 2 23  ? 7.094   -0.506  -11.797 1.00 0.00 ? 123 LEU B HD13 2  
ATOM   3196  H  HD21 . LEU B 2 23  ? 7.886   -2.923  -12.463 1.00 0.00 ? 123 LEU B HD21 2  
ATOM   3197  H  HD22 . LEU B 2 23  ? 7.837   -1.959  -13.940 1.00 0.00 ? 123 LEU B HD22 2  
ATOM   3198  H  HD23 . LEU B 2 23  ? 7.059   -3.542  -13.893 1.00 0.00 ? 123 LEU B HD23 2  
ATOM   3199  N  N    . LEU B 2 24  ? 3.822   -4.888  -9.994  1.00 0.00 ? 124 LEU B N    2  
ATOM   3200  C  CA   . LEU B 2 24  ? 3.709   -5.812  -8.884  1.00 0.00 ? 124 LEU B CA   2  
ATOM   3201  C  C    . LEU B 2 24  ? 3.270   -7.153  -9.435  1.00 0.00 ? 124 LEU B C    2  
ATOM   3202  O  O    . LEU B 2 24  ? 3.881   -8.191  -9.181  1.00 0.00 ? 124 LEU B O    2  
ATOM   3203  C  CB   . LEU B 2 24  ? 2.676   -5.280  -7.886  1.00 0.00 ? 124 LEU B CB   2  
ATOM   3204  C  CG   . LEU B 2 24  ? 3.128   -4.086  -7.043  1.00 0.00 ? 124 LEU B CG   2  
ATOM   3205  C  CD1  . LEU B 2 24  ? 1.966   -3.538  -6.230  1.00 0.00 ? 124 LEU B CD1  2  
ATOM   3206  C  CD2  . LEU B 2 24  ? 4.279   -4.474  -6.134  1.00 0.00 ? 124 LEU B CD2  2  
ATOM   3207  H  H    . LEU B 2 24  ? 3.224   -4.113  -10.025 1.00 0.00 ? 124 LEU B H    2  
ATOM   3208  H  HA   . LEU B 2 24  ? 4.672   -5.916  -8.416  1.00 0.00 ? 124 LEU B HA   2  
ATOM   3209  H  HB2  . LEU B 2 24  ? 1.801   -4.980  -8.444  1.00 0.00 ? 124 LEU B HB2  2  
ATOM   3210  H  HB3  . LEU B 2 24  ? 2.392   -6.078  -7.228  1.00 0.00 ? 124 LEU B HB3  2  
ATOM   3211  H  HG   . LEU B 2 24  ? 3.471   -3.302  -7.700  1.00 0.00 ? 124 LEU B HG   2  
ATOM   3212  H  HD11 . LEU B 2 24  ? 1.261   -4.331  -6.028  1.00 0.00 ? 124 LEU B HD11 2  
ATOM   3213  H  HD12 . LEU B 2 24  ? 1.475   -2.753  -6.787  1.00 0.00 ? 124 LEU B HD12 2  
ATOM   3214  H  HD13 . LEU B 2 24  ? 2.336   -3.139  -5.296  1.00 0.00 ? 124 LEU B HD13 2  
ATOM   3215  H  HD21 . LEU B 2 24  ? 4.748   -5.369  -6.510  1.00 0.00 ? 124 LEU B HD21 2  
ATOM   3216  H  HD22 . LEU B 2 24  ? 3.905   -4.651  -5.137  1.00 0.00 ? 124 LEU B HD22 2  
ATOM   3217  H  HD23 . LEU B 2 24  ? 5.001   -3.671  -6.110  1.00 0.00 ? 124 LEU B HD23 2  
ATOM   3218  N  N    . HIS B 2 25  ? 2.222   -7.092  -10.241 1.00 0.00 ? 125 HIS B N    2  
ATOM   3219  C  CA   . HIS B 2 25  ? 1.684   -8.261  -10.912 1.00 0.00 ? 125 HIS B CA   2  
ATOM   3220  C  C    . HIS B 2 25  ? 2.797   -8.951  -11.660 1.00 0.00 ? 125 HIS B C    2  
ATOM   3221  O  O    . HIS B 2 25  ? 3.234   -10.040 -11.305 1.00 0.00 ? 125 HIS B O    2  
ATOM   3222  C  CB   . HIS B 2 25  ? 0.610   -7.841  -11.920 1.00 0.00 ? 125 HIS B CB   2  
ATOM   3223  C  CG   . HIS B 2 25  ? 0.304   -8.889  -12.952 1.00 0.00 ? 125 HIS B CG   2  
ATOM   3224  N  ND1  . HIS B 2 25  ? -0.631  -9.884  -12.783 1.00 0.00 ? 125 HIS B ND1  2  
ATOM   3225  C  CD2  . HIS B 2 25  ? 0.851   -9.094  -14.183 1.00 0.00 ? 125 HIS B CD2  2  
ATOM   3226  C  CE1  . HIS B 2 25  ? -0.624  -10.646 -13.886 1.00 0.00 ? 125 HIS B CE1  2  
ATOM   3227  N  NE2  . HIS B 2 25  ? 0.256   -10.209 -14.765 1.00 0.00 ? 125 HIS B NE2  2  
ATOM   3228  H  H    . HIS B 2 25  ? 1.819   -6.219  -10.412 1.00 0.00 ? 125 HIS B H    2  
ATOM   3229  H  HA   . HIS B 2 25  ? 1.263   -8.925  -10.182 1.00 0.00 ? 125 HIS B HA   2  
ATOM   3230  H  HB2  . HIS B 2 25  ? -0.292  -7.616  -11.397 1.00 0.00 ? 125 HIS B HB2  2  
ATOM   3231  H  HB3  . HIS B 2 25  ? 0.945   -6.956  -12.440 1.00 0.00 ? 125 HIS B HB3  2  
ATOM   3232  H  HD1  . HIS B 2 25  ? -1.201  -10.014 -11.996 1.00 0.00 ? 125 HIS B HD1  2  
ATOM   3233  H  HD2  . HIS B 2 25  ? 1.629   -8.499  -14.644 1.00 0.00 ? 125 HIS B HD2  2  
ATOM   3234  H  HE1  . HIS B 2 25  ? -1.252  -11.511 -14.033 1.00 0.00 ? 125 HIS B HE1  2  
ATOM   3235  N  N    . ALA B 2 26  ? 3.236   -8.276  -12.708 1.00 0.00 ? 126 ALA B N    2  
ATOM   3236  C  CA   . ALA B 2 26  ? 4.306   -8.765  -13.566 1.00 0.00 ? 126 ALA B CA   2  
ATOM   3237  C  C    . ALA B 2 26  ? 5.370   -9.510  -12.765 1.00 0.00 ? 126 ALA B C    2  
ATOM   3238  O  O    . ALA B 2 26  ? 5.935   -10.497 -13.238 1.00 0.00 ? 126 ALA B O    2  
ATOM   3239  C  CB   . ALA B 2 26  ? 4.932   -7.611  -14.336 1.00 0.00 ? 126 ALA B CB   2  
ATOM   3240  H  H    . ALA B 2 26  ? 2.811   -7.412  -12.908 1.00 0.00 ? 126 ALA B H    2  
ATOM   3241  H  HA   . ALA B 2 26  ? 3.866   -9.444  -14.281 1.00 0.00 ? 126 ALA B HA   2  
ATOM   3242  H  HB1  . ALA B 2 26  ? 4.792   -6.693  -13.785 1.00 0.00 ? 126 ALA B HB1  2  
ATOM   3243  H  HB2  . ALA B 2 26  ? 4.461   -7.526  -15.304 1.00 0.00 ? 126 ALA B HB2  2  
ATOM   3244  H  HB3  . ALA B 2 26  ? 5.989   -7.796  -14.465 1.00 0.00 ? 126 ALA B HB3  2  
ATOM   3245  N  N    . HIS B 2 27  ? 5.631   -9.045  -11.543 1.00 0.00 ? 127 HIS B N    2  
ATOM   3246  C  CA   . HIS B 2 27  ? 6.618   -9.692  -10.691 1.00 0.00 ? 127 HIS B CA   2  
ATOM   3247  C  C    . HIS B 2 27  ? 6.101   -11.047 -10.221 1.00 0.00 ? 127 HIS B C    2  
ATOM   3248  O  O    . HIS B 2 27  ? 6.779   -12.065 -10.360 1.00 0.00 ? 127 HIS B O    2  
ATOM   3249  C  CB   . HIS B 2 27  ? 6.959   -8.814  -9.487  1.00 0.00 ? 127 HIS B CB   2  
ATOM   3250  C  CG   . HIS B 2 27  ? 8.247   -9.203  -8.831  1.00 0.00 ? 127 HIS B CG   2  
ATOM   3251  N  ND1  . HIS B 2 27  ? 9.276   -9.820  -9.510  1.00 0.00 ? 127 HIS B ND1  2  
ATOM   3252  C  CD2  . HIS B 2 27  ? 8.671   -9.069  -7.553  1.00 0.00 ? 127 HIS B CD2  2  
ATOM   3253  C  CE1  . HIS B 2 27  ? 10.276  -10.049 -8.680  1.00 0.00 ? 127 HIS B CE1  2  
ATOM   3254  N  NE2  . HIS B 2 27  ? 9.936   -9.603  -7.485  1.00 0.00 ? 127 HIS B NE2  2  
ATOM   3255  H  H    . HIS B 2 27  ? 5.145   -8.259  -11.208 1.00 0.00 ? 127 HIS B H    2  
ATOM   3256  H  HA   . HIS B 2 27  ? 7.510   -9.846  -11.280 1.00 0.00 ? 127 HIS B HA   2  
ATOM   3257  H  HB2  . HIS B 2 27  ? 7.043   -7.785  -9.808  1.00 0.00 ? 127 HIS B HB2  2  
ATOM   3258  H  HB3  . HIS B 2 27  ? 6.171   -8.894  -8.752  1.00 0.00 ? 127 HIS B HB3  2  
ATOM   3259  H  HD1  . HIS B 2 27  ? 9.274   -10.056 -10.461 1.00 0.00 ? 127 HIS B HD1  2  
ATOM   3260  H  HD2  . HIS B 2 27  ? 8.117   -8.631  -6.736  1.00 0.00 ? 127 HIS B HD2  2  
ATOM   3261  H  HE1  . HIS B 2 27  ? 11.213  -10.521 -8.934  1.00 0.00 ? 127 HIS B HE1  2  
ATOM   3262  H  HE2  . HIS B 2 27  ? 10.550  -9.510  -6.728  1.00 0.00 ? 127 HIS B HE2  2  
ATOM   3263  N  N    . LYS B 2 28  ? 4.889   -11.052 -9.676  1.00 0.00 ? 128 LYS B N    2  
ATOM   3264  C  CA   . LYS B 2 28  ? 4.269   -12.281 -9.198  1.00 0.00 ? 128 LYS B CA   2  
ATOM   3265  C  C    . LYS B 2 28  ? 3.755   -13.112 -10.371 1.00 0.00 ? 128 LYS B C    2  
ATOM   3266  O  O    . LYS B 2 28  ? 3.633   -14.333 -10.272 1.00 0.00 ? 128 LYS B O    2  
ATOM   3267  C  CB   . LYS B 2 28  ? 3.119   -11.960 -8.243  1.00 0.00 ? 128 LYS B CB   2  
ATOM   3268  C  CG   . LYS B 2 28  ? 2.009   -11.142 -8.881  1.00 0.00 ? 128 LYS B CG   2  
ATOM   3269  C  CD   . LYS B 2 28  ? 0.712   -11.251 -8.095  1.00 0.00 ? 128 LYS B CD   2  
ATOM   3270  C  CE   . LYS B 2 28  ? 0.729   -10.359 -6.866  1.00 0.00 ? 128 LYS B CE   2  
ATOM   3271  N  NZ   . LYS B 2 28  ? -0.576  -10.375 -6.149  1.00 0.00 ? 128 LYS B NZ   2  
ATOM   3272  H  H    . LYS B 2 28  ? 4.396   -10.208 -9.602  1.00 0.00 ? 128 LYS B H    2  
ATOM   3273  H  HA   . LYS B 2 28  ? 5.020   -12.849 -8.669  1.00 0.00 ? 128 LYS B HA   2  
ATOM   3274  H  HB2  . LYS B 2 28  ? 2.694   -12.885 -7.883  1.00 0.00 ? 128 LYS B HB2  2  
ATOM   3275  H  HB3  . LYS B 2 28  ? 3.509   -11.403 -7.403  1.00 0.00 ? 128 LYS B HB3  2  
ATOM   3276  H  HG2  . LYS B 2 28  ? 2.311   -10.106 -8.915  1.00 0.00 ? 128 LYS B HG2  2  
ATOM   3277  H  HG3  . LYS B 2 28  ? 1.843   -11.503 -9.886  1.00 0.00 ? 128 LYS B HG3  2  
ATOM   3278  H  HD2  . LYS B 2 28  ? -0.108  -10.955 -8.731  1.00 0.00 ? 128 LYS B HD2  2  
ATOM   3279  H  HD3  . LYS B 2 28  ? 0.577   -12.277 -7.784  1.00 0.00 ? 128 LYS B HD3  2  
ATOM   3280  H  HE2  . LYS B 2 28  ? 1.501   -10.705 -6.196  1.00 0.00 ? 128 LYS B HE2  2  
ATOM   3281  H  HE3  . LYS B 2 28  ? 0.948   -9.347  -7.174  1.00 0.00 ? 128 LYS B HE3  2  
ATOM   3282  H  HZ1  . LYS B 2 28  ? -0.781  -9.433  -5.759  1.00 0.00 ? 128 LYS B HZ1  2  
ATOM   3283  H  HZ2  . LYS B 2 28  ? -0.547  -11.063 -5.370  1.00 0.00 ? 128 LYS B HZ2  2  
ATOM   3284  H  HZ3  . LYS B 2 28  ? -1.339  -10.641 -6.804  1.00 0.00 ? 128 LYS B HZ3  2  
ATOM   3285  N  N    . CYS B 2 29  ? 3.457   -12.441 -11.482 1.00 0.00 ? 129 CYS B N    2  
ATOM   3286  C  CA   . CYS B 2 29  ? 2.963   -13.113 -12.676 1.00 0.00 ? 129 CYS B CA   2  
ATOM   3287  C  C    . CYS B 2 29  ? 3.972   -14.147 -13.156 1.00 0.00 ? 129 CYS B C    2  
ATOM   3288  O  O    . CYS B 2 29  ? 3.672   -15.340 -13.223 1.00 0.00 ? 129 CYS B O    2  
ATOM   3289  C  CB   . CYS B 2 29  ? 2.684   -12.096 -13.785 1.00 0.00 ? 129 CYS B CB   2  
ATOM   3290  S  SG   . CYS B 2 29  ? 1.919   -12.811 -15.276 1.00 0.00 ? 129 CYS B SG   2  
ATOM   3291  H  H    . CYS B 2 29  ? 3.579   -11.469 -11.499 1.00 0.00 ? 129 CYS B H    2  
ATOM   3292  H  HA   . CYS B 2 29  ? 2.045   -13.614 -12.419 1.00 0.00 ? 129 CYS B HA   2  
ATOM   3293  H  HB2  . CYS B 2 29  ? 2.017   -11.337 -13.406 1.00 0.00 ? 129 CYS B HB2  2  
ATOM   3294  H  HB3  . CYS B 2 29  ? 3.614   -11.634 -14.081 1.00 0.00 ? 129 CYS B HB3  2  
ATOM   3295  N  N    . GLN B 2 30  ? 5.176   -13.685 -13.474 1.00 0.00 ? 130 GLN B N    2  
ATOM   3296  C  CA   . GLN B 2 30  ? 6.236   -14.572 -13.929 1.00 0.00 ? 130 GLN B CA   2  
ATOM   3297  C  C    . GLN B 2 30  ? 6.663   -15.514 -12.809 1.00 0.00 ? 130 GLN B C    2  
ATOM   3298  O  O    . GLN B 2 30  ? 7.281   -16.550 -13.051 1.00 0.00 ? 130 GLN B O    2  
ATOM   3299  C  CB   . GLN B 2 30  ? 7.434   -13.760 -14.422 1.00 0.00 ? 130 GLN B CB   2  
ATOM   3300  C  CG   . GLN B 2 30  ? 7.707   -13.917 -15.908 1.00 0.00 ? 130 GLN B CG   2  
ATOM   3301  C  CD   . GLN B 2 30  ? 9.188   -13.936 -16.231 1.00 0.00 ? 130 GLN B CD   2  
ATOM   3302  O  OE1  . GLN B 2 30  ? 9.644   -14.718 -17.065 1.00 0.00 ? 130 GLN B OE1  2  
ATOM   3303  N  NE2  . GLN B 2 30  ? 9.949   -13.073 -15.568 1.00 0.00 ? 130 GLN B NE2  2  
ATOM   3304  H  H    . GLN B 2 30  ? 5.359   -12.726 -13.388 1.00 0.00 ? 130 GLN B H    2  
ATOM   3305  H  HA   . GLN B 2 30  ? 5.846   -15.156 -14.739 1.00 0.00 ? 130 GLN B HA   2  
ATOM   3306  H  HB2  . GLN B 2 30  ? 7.253   -12.715 -14.219 1.00 0.00 ? 130 GLN B HB2  2  
ATOM   3307  H  HB3  . GLN B 2 30  ? 8.317   -14.074 -13.882 1.00 0.00 ? 130 GLN B HB3  2  
ATOM   3308  H  HG2  . GLN B 2 30  ? 7.269   -14.845 -16.246 1.00 0.00 ? 130 GLN B HG2  2  
ATOM   3309  H  HG3  . GLN B 2 30  ? 7.250   -13.092 -16.435 1.00 0.00 ? 130 GLN B HG3  2  
ATOM   3310  H  HE21 . GLN B 2 30  ? 9.518   -12.480 -14.917 1.00 0.00 ? 130 GLN B HE21 2  
ATOM   3311  H  HE22 . GLN B 2 30  ? 10.910  -13.062 -15.758 1.00 0.00 ? 130 GLN B HE22 2  
ATOM   3312  N  N    . ARG B 2 31  ? 6.322   -15.138 -11.585 1.00 0.00 ? 131 ARG B N    2  
ATOM   3313  C  CA   . ARG B 2 31  ? 6.657   -15.937 -10.412 1.00 0.00 ? 131 ARG B CA   2  
ATOM   3314  C  C    . ARG B 2 31  ? 5.523   -16.888 -10.043 1.00 0.00 ? 131 ARG B C    2  
ATOM   3315  O  O    . ARG B 2 31  ? 5.676   -17.748 -9.177  1.00 0.00 ? 131 ARG B O    2  
ATOM   3316  C  CB   . ARG B 2 31  ? 6.992   -15.028 -9.226  1.00 0.00 ? 131 ARG B CB   2  
ATOM   3317  C  CG   . ARG B 2 31  ? 7.637   -15.760 -8.059  1.00 0.00 ? 131 ARG B CG   2  
ATOM   3318  C  CD   . ARG B 2 31  ? 9.144   -15.563 -8.038  1.00 0.00 ? 131 ARG B CD   2  
ATOM   3319  N  NE   . ARG B 2 31  ? 9.635   -15.237 -6.700  1.00 0.00 ? 131 ARG B NE   2  
ATOM   3320  C  CZ   . ARG B 2 31  ? 10.919  -15.279 -6.351  1.00 0.00 ? 131 ARG B CZ   2  
ATOM   3321  N  NH1  . ARG B 2 31  ? 11.843  -15.632 -7.236  1.00 0.00 ? 131 ARG B NH1  2  
ATOM   3322  N  NH2  . ARG B 2 31  ? 11.279  -14.967 -5.113  1.00 0.00 ? 131 ARG B NH2  2  
ATOM   3323  H  H    . ARG B 2 31  ? 5.829   -14.304 -11.468 1.00 0.00 ? 131 ARG B H    2  
ATOM   3324  H  HA   . ARG B 2 31  ? 7.519   -16.522 -10.659 1.00 0.00 ? 131 ARG B HA   2  
ATOM   3325  H  HB2  . ARG B 2 31  ? 7.672   -14.256 -9.558  1.00 0.00 ? 131 ARG B HB2  2  
ATOM   3326  H  HB3  . ARG B 2 31  ? 6.082   -14.565 -8.873  1.00 0.00 ? 131 ARG B HB3  2  
ATOM   3327  H  HG2  . ARG B 2 31  ? 7.222   -15.382 -7.137  1.00 0.00 ? 131 ARG B HG2  2  
ATOM   3328  H  HG3  . ARG B 2 31  ? 7.422   -16.816 -8.146  1.00 0.00 ? 131 ARG B HG3  2  
ATOM   3329  H  HD2  . ARG B 2 31  ? 9.618   -16.474 -8.371  1.00 0.00 ? 131 ARG B HD2  2  
ATOM   3330  H  HD3  . ARG B 2 31  ? 9.400   -14.758 -8.711  1.00 0.00 ? 131 ARG B HD3  2  
ATOM   3331  H  HE   . ARG B 2 31  ? 8.973   -14.973 -6.027  1.00 0.00 ? 131 ARG B HE   2  
ATOM   3332  H  HH11 . ARG B 2 31  ? 11.578  -15.869 -8.170  1.00 0.00 ? 131 ARG B HH11 2  
ATOM   3333  H  HH12 . ARG B 2 31  ? 12.806  -15.662 -6.967  1.00 0.00 ? 131 ARG B HH12 2  
ATOM   3334  H  HH21 . ARG B 2 31  ? 10.586  -14.700 -4.444  1.00 0.00 ? 131 ARG B HH21 2  
ATOM   3335  H  HH22 . ARG B 2 31  ? 12.244  -14.999 -4.850  1.00 0.00 ? 131 ARG B HH22 2  
ATOM   3336  N  N    . ARG B 2 32  ? 4.388   -16.726 -10.706 1.00 0.00 ? 132 ARG B N    2  
ATOM   3337  C  CA   . ARG B 2 32  ? 3.226   -17.568 -10.452 1.00 0.00 ? 132 ARG B CA   2  
ATOM   3338  C  C    . ARG B 2 32  ? 3.425   -18.961 -11.044 1.00 0.00 ? 132 ARG B C    2  
ATOM   3339  O  O    . ARG B 2 32  ? 2.983   -19.958 -10.473 1.00 0.00 ? 132 ARG B O    2  
ATOM   3340  C  CB   . ARG B 2 32  ? 1.964   -16.927 -11.034 1.00 0.00 ? 132 ARG B CB   2  
ATOM   3341  C  CG   . ARG B 2 32  ? 0.712   -17.770 -10.851 1.00 0.00 ? 132 ARG B CG   2  
ATOM   3342  C  CD   . ARG B 2 32  ? -0.525  -17.056 -11.373 1.00 0.00 ? 132 ARG B CD   2  
ATOM   3343  N  NE   . ARG B 2 32  ? -1.706  -17.917 -11.336 1.00 0.00 ? 132 ARG B NE   2  
ATOM   3344  C  CZ   . ARG B 2 32  ? -2.882  -17.586 -11.866 1.00 0.00 ? 132 ARG B CZ   2  
ATOM   3345  N  NH1  . ARG B 2 32  ? -3.038  -16.418 -12.475 1.00 0.00 ? 132 ARG B NH1  2  
ATOM   3346  N  NH2  . ARG B 2 32  ? -3.903  -18.429 -11.787 1.00 0.00 ? 132 ARG B NH2  2  
ATOM   3347  H  H    . ARG B 2 32  ? 4.333   -16.023 -11.385 1.00 0.00 ? 132 ARG B H    2  
ATOM   3348  H  HA   . ARG B 2 32  ? 3.111   -17.658 -9.382  1.00 0.00 ? 132 ARG B HA   2  
ATOM   3349  H  HB2  . ARG B 2 32  ? 1.803   -15.973 -10.553 1.00 0.00 ? 132 ARG B HB2  2  
ATOM   3350  H  HB3  . ARG B 2 32  ? 2.111   -16.765 -12.093 1.00 0.00 ? 132 ARG B HB3  2  
ATOM   3351  H  HG2  . ARG B 2 32  ? 0.833   -18.698 -11.390 1.00 0.00 ? 132 ARG B HG2  2  
ATOM   3352  H  HG3  . ARG B 2 32  ? 0.580   -17.977 -9.799  1.00 0.00 ? 132 ARG B HG3  2  
ATOM   3353  H  HD2  . ARG B 2 32  ? -0.708  -16.185 -10.762 1.00 0.00 ? 132 ARG B HD2  2  
ATOM   3354  H  HD3  . ARG B 2 32  ? -0.346  -16.750 -12.393 1.00 0.00 ? 132 ARG B HD3  2  
ATOM   3355  H  HE   . ARG B 2 32  ? -1.619  -18.786 -10.892 1.00 0.00 ? 132 ARG B HE   2  
ATOM   3356  H  HH11 . ARG B 2 32  ? -2.272  -15.779 -12.540 1.00 0.00 ? 132 ARG B HH11 2  
ATOM   3357  H  HH12 . ARG B 2 32  ? -3.924  -16.176 -12.872 1.00 0.00 ? 132 ARG B HH12 2  
ATOM   3358  H  HH21 . ARG B 2 32  ? -3.790  -19.310 -11.329 1.00 0.00 ? 132 ARG B HH21 2  
ATOM   3359  H  HH22 . ARG B 2 32  ? -4.787  -18.181 -12.184 1.00 0.00 ? 132 ARG B HH22 2  
ATOM   3360  N  N    . GLU B 2 33  ? 4.091   -19.020 -12.192 1.00 0.00 ? 133 GLU B N    2  
ATOM   3361  C  CA   . GLU B 2 33  ? 4.348   -20.290 -12.862 1.00 0.00 ? 133 GLU B CA   2  
ATOM   3362  C  C    . GLU B 2 33  ? 5.185   -21.214 -11.981 1.00 0.00 ? 133 GLU B C    2  
ATOM   3363  O  O    . GLU B 2 33  ? 5.059   -22.436 -12.052 1.00 0.00 ? 133 GLU B O    2  
ATOM   3364  C  CB   . GLU B 2 33  ? 5.062   -20.051 -14.193 1.00 0.00 ? 133 GLU B CB   2  
ATOM   3365  C  CG   . GLU B 2 33  ? 4.336   -19.077 -15.107 1.00 0.00 ? 133 GLU B CG   2  
ATOM   3366  C  CD   . GLU B 2 33  ? 5.155   -17.837 -15.409 1.00 0.00 ? 133 GLU B CD   2  
ATOM   3367  O  OE1  . GLU B 2 33  ? 6.398   -17.942 -15.445 1.00 0.00 ? 133 GLU B OE1  2  
ATOM   3368  O  OE2  . GLU B 2 33  ? 4.552   -16.762 -15.610 1.00 0.00 ? 133 GLU B OE2  2  
ATOM   3369  H  H    . GLU B 2 33  ? 4.419   -18.191 -12.598 1.00 0.00 ? 133 GLU B H    2  
ATOM   3370  H  HA   . GLU B 2 33  ? 3.397   -20.761 -13.054 1.00 0.00 ? 133 GLU B HA   2  
ATOM   3371  H  HB2  . GLU B 2 33  ? 6.049   -19.659 -13.994 1.00 0.00 ? 133 GLU B HB2  2  
ATOM   3372  H  HB3  . GLU B 2 33  ? 5.157   -20.995 -14.712 1.00 0.00 ? 133 GLU B HB3  2  
ATOM   3373  H  HG2  . GLU B 2 33  ? 4.110   -19.575 -16.038 1.00 0.00 ? 133 GLU B HG2  2  
ATOM   3374  H  HG3  . GLU B 2 33  ? 3.414   -18.774 -14.629 1.00 0.00 ? 133 GLU B HG3  2  
ATOM   3375  N  N    . GLN B 2 34  ? 6.038   -20.621 -11.152 1.00 0.00 ? 134 GLN B N    2  
ATOM   3376  C  CA   . GLN B 2 34  ? 6.895   -21.391 -10.258 1.00 0.00 ? 134 GLN B CA   2  
ATOM   3377  C  C    . GLN B 2 34  ? 6.064   -22.249 -9.309  1.00 0.00 ? 134 GLN B C    2  
ATOM   3378  O  O    . GLN B 2 34  ? 6.502   -23.314 -8.876  1.00 0.00 ? 134 GLN B O    2  
ATOM   3379  C  CB   . GLN B 2 34  ? 7.802   -20.455 -9.456  1.00 0.00 ? 134 GLN B CB   2  
ATOM   3380  C  CG   . GLN B 2 34  ? 9.062   -21.126 -8.937  1.00 0.00 ? 134 GLN B CG   2  
ATOM   3381  C  CD   . GLN B 2 34  ? 10.289  -20.779 -9.755  1.00 0.00 ? 134 GLN B CD   2  
ATOM   3382  O  OE1  . GLN B 2 34  ? 11.162  -20.036 -9.304  1.00 0.00 ? 134 GLN B OE1  2  
ATOM   3383  N  NE2  . GLN B 2 34  ? 10.364  -21.317 -10.968 1.00 0.00 ? 134 GLN B NE2  2  
ATOM   3384  H  H    . GLN B 2 34  ? 6.093   -19.642 -11.142 1.00 0.00 ? 134 GLN B H    2  
ATOM   3385  H  HA   . GLN B 2 34  ? 7.509   -22.039 -10.865 1.00 0.00 ? 134 GLN B HA   2  
ATOM   3386  H  HB2  . GLN B 2 34  ? 8.094   -19.629 -10.088 1.00 0.00 ? 134 GLN B HB2  2  
ATOM   3387  H  HB3  . GLN B 2 34  ? 7.248   -20.072 -8.612  1.00 0.00 ? 134 GLN B HB3  2  
ATOM   3388  H  HG2  . GLN B 2 34  ? 9.228   -20.811 -7.917  1.00 0.00 ? 134 GLN B HG2  2  
ATOM   3389  H  HG3  . GLN B 2 34  ? 8.921   -22.198 -8.962  1.00 0.00 ? 134 GLN B HG3  2  
ATOM   3390  H  HE21 . GLN B 2 34  ? 9.632   -21.899 -11.261 1.00 0.00 ? 134 GLN B HE21 2  
ATOM   3391  H  HE22 . GLN B 2 34  ? 11.147  -21.109 -11.519 1.00 0.00 ? 134 GLN B HE22 2  
ATOM   3392  N  N    . ALA B 2 35  ? 4.863   -21.777 -8.988  1.00 0.00 ? 135 ALA B N    2  
ATOM   3393  C  CA   . ALA B 2 35  ? 3.973   -22.502 -8.090  1.00 0.00 ? 135 ALA B CA   2  
ATOM   3394  C  C    . ALA B 2 35  ? 2.830   -23.159 -8.857  1.00 0.00 ? 135 ALA B C    2  
ATOM   3395  O  O    . ALA B 2 35  ? 2.423   -24.278 -8.545  1.00 0.00 ? 135 ALA B O    2  
ATOM   3396  C  CB   . ALA B 2 35  ? 3.424   -21.566 -7.023  1.00 0.00 ? 135 ALA B CB   2  
ATOM   3397  H  H    . ALA B 2 35  ? 4.569   -20.922 -9.364  1.00 0.00 ? 135 ALA B H    2  
ATOM   3398  H  HA   . ALA B 2 35  ? 4.551   -23.270 -7.597  1.00 0.00 ? 135 ALA B HA   2  
ATOM   3399  H  HB1  . ALA B 2 35  ? 2.681   -22.086 -6.437  1.00 0.00 ? 135 ALA B HB1  2  
ATOM   3400  H  HB2  . ALA B 2 35  ? 2.973   -20.707 -7.495  1.00 0.00 ? 135 ALA B HB2  2  
ATOM   3401  H  HB3  . ALA B 2 35  ? 4.229   -21.242 -6.379  1.00 0.00 ? 135 ALA B HB3  2  
ATOM   3402  N  N    . ASN B 2 36  ? 2.317   -22.456 -9.861  1.00 0.00 ? 136 ASN B N    2  
ATOM   3403  C  CA   . ASN B 2 36  ? 1.220   -22.972 -10.671 1.00 0.00 ? 136 ASN B CA   2  
ATOM   3404  C  C    . ASN B 2 36  ? 1.739   -23.725 -11.895 1.00 0.00 ? 136 ASN B C    2  
ATOM   3405  O  O    . ASN B 2 36  ? 0.980   -24.014 -12.822 1.00 0.00 ? 136 ASN B O    2  
ATOM   3406  C  CB   . ASN B 2 36  ? 0.306   -21.828 -11.116 1.00 0.00 ? 136 ASN B CB   2  
ATOM   3407  C  CG   . ASN B 2 36  ? -1.146  -22.252 -11.215 1.00 0.00 ? 136 ASN B CG   2  
ATOM   3408  O  OD1  . ASN B 2 36  ? -1.606  -22.687 -12.270 1.00 0.00 ? 136 ASN B OD1  2  
ATOM   3409  N  ND2  . ASN B 2 36  ? -1.876  -22.126 -10.113 1.00 0.00 ? 136 ASN B ND2  2  
ATOM   3410  H  H    . ASN B 2 36  ? 2.683   -21.570 -10.061 1.00 0.00 ? 136 ASN B H    2  
ATOM   3411  H  HA   . ASN B 2 36  ? 0.651   -23.656 -10.060 1.00 0.00 ? 136 ASN B HA   2  
ATOM   3412  H  HB2  . ASN B 2 36  ? 0.377   -21.021 -10.402 1.00 0.00 ? 136 ASN B HB2  2  
ATOM   3413  H  HB3  . ASN B 2 36  ? 0.627   -21.475 -12.085 1.00 0.00 ? 136 ASN B HB3  2  
ATOM   3414  H  HD21 . ASN B 2 36  ? -1.443  -21.771 -9.309  1.00 0.00 ? 136 ASN B HD21 2  
ATOM   3415  H  HD22 . ASN B 2 36  ? -2.818  -22.392 -10.149 1.00 0.00 ? 136 ASN B HD22 2  
ATOM   3416  N  N    . GLY B 2 37  ? 3.031   -24.043 -11.898 1.00 0.00 ? 137 GLY B N    2  
ATOM   3417  C  CA   . GLY B 2 37  ? 3.618   -24.760 -13.017 1.00 0.00 ? 137 GLY B CA   2  
ATOM   3418  C  C    . GLY B 2 37  ? 3.311   -24.110 -14.353 1.00 0.00 ? 137 GLY B C    2  
ATOM   3419  O  O    . GLY B 2 37  ? 3.516   -22.909 -14.527 1.00 0.00 ? 137 GLY B O    2  
ATOM   3420  H  H    . GLY B 2 37  ? 3.592   -23.790 -11.135 1.00 0.00 ? 137 GLY B H    2  
ATOM   3421  H  HA2  . GLY B 2 37  ? 4.689   -24.795 -12.885 1.00 0.00 ? 137 GLY B HA2  2  
ATOM   3422  H  HA3  . GLY B 2 37  ? 3.235   -25.770 -13.023 1.00 0.00 ? 137 GLY B HA3  2  
ATOM   3423  N  N    . GLU B 2 38  ? 2.815   -24.906 -15.295 1.00 0.00 ? 138 GLU B N    2  
ATOM   3424  C  CA   . GLU B 2 38  ? 2.477   -24.402 -16.619 1.00 0.00 ? 138 GLU B CA   2  
ATOM   3425  C  C    . GLU B 2 38  ? 1.223   -23.535 -16.565 1.00 0.00 ? 138 GLU B C    2  
ATOM   3426  O  O    . GLU B 2 38  ? 0.113   -24.042 -16.404 1.00 0.00 ? 138 GLU B O    2  
ATOM   3427  C  CB   . GLU B 2 38  ? 2.269   -25.565 -17.591 1.00 0.00 ? 138 GLU B CB   2  
ATOM   3428  C  CG   . GLU B 2 38  ? 2.344   -25.156 -19.054 1.00 0.00 ? 138 GLU B CG   2  
ATOM   3429  C  CD   . GLU B 2 38  ? 3.104   -26.157 -19.900 1.00 0.00 ? 138 GLU B CD   2  
ATOM   3430  O  OE1  . GLU B 2 38  ? 2.477   -27.119 -20.390 1.00 0.00 ? 138 GLU B OE1  2  
ATOM   3431  O  OE2  . GLU B 2 38  ? 4.329   -25.979 -20.073 1.00 0.00 ? 138 GLU B OE2  2  
ATOM   3432  H  H    . GLU B 2 38  ? 2.674   -25.852 -15.095 1.00 0.00 ? 138 GLU B H    2  
ATOM   3433  H  HA   . GLU B 2 38  ? 3.303   -23.800 -16.962 1.00 0.00 ? 138 GLU B HA   2  
ATOM   3434  H  HB2  . GLU B 2 38  ? 3.028   -26.311 -17.409 1.00 0.00 ? 138 GLU B HB2  2  
ATOM   3435  H  HB3  . GLU B 2 38  ? 1.298   -26.000 -17.410 1.00 0.00 ? 138 GLU B HB3  2  
ATOM   3436  H  HG2  . GLU B 2 38  ? 1.340   -25.071 -19.441 1.00 0.00 ? 138 GLU B HG2  2  
ATOM   3437  H  HG3  . GLU B 2 38  ? 2.838   -24.199 -19.122 1.00 0.00 ? 138 GLU B HG3  2  
ATOM   3438  N  N    . VAL B 2 39  ? 1.408   -22.226 -16.700 1.00 0.00 ? 139 VAL B N    2  
ATOM   3439  C  CA   . VAL B 2 39  ? 0.292   -21.289 -16.665 1.00 0.00 ? 139 VAL B CA   2  
ATOM   3440  C  C    . VAL B 2 39  ? -0.108  -20.861 -18.071 1.00 0.00 ? 139 VAL B C    2  
ATOM   3441  O  O    . VAL B 2 39  ? 0.687   -20.946 -19.008 1.00 0.00 ? 139 VAL B O    2  
ATOM   3442  C  CB   . VAL B 2 39  ? 0.629   -20.034 -15.841 1.00 0.00 ? 139 VAL B CB   2  
ATOM   3443  C  CG1  . VAL B 2 39  ? -0.641  -19.284 -15.469 1.00 0.00 ? 139 VAL B CG1  2  
ATOM   3444  C  CG2  . VAL B 2 39  ? 1.424   -20.400 -14.596 1.00 0.00 ? 139 VAL B CG2  2  
ATOM   3445  H  H    . VAL B 2 39  ? 2.316   -21.880 -16.823 1.00 0.00 ? 139 VAL B H    2  
ATOM   3446  H  HA   . VAL B 2 39  ? -0.547  -21.786 -16.198 1.00 0.00 ? 139 VAL B HA   2  
ATOM   3447  H  HB   . VAL B 2 39  ? 1.236   -19.385 -16.453 1.00 0.00 ? 139 VAL B HB   2  
ATOM   3448  H  HG11 . VAL B 2 39  ? -0.445  -18.642 -14.623 1.00 0.00 ? 139 VAL B HG11 2  
ATOM   3449  H  HG12 . VAL B 2 39  ? -1.416  -19.991 -15.212 1.00 0.00 ? 139 VAL B HG12 2  
ATOM   3450  H  HG13 . VAL B 2 39  ? -0.964  -18.685 -16.308 1.00 0.00 ? 139 VAL B HG13 2  
ATOM   3451  H  HG21 . VAL B 2 39  ? 0.948   -21.230 -14.096 1.00 0.00 ? 139 VAL B HG21 2  
ATOM   3452  H  HG22 . VAL B 2 39  ? 1.461   -19.551 -13.930 1.00 0.00 ? 139 VAL B HG22 2  
ATOM   3453  H  HG23 . VAL B 2 39  ? 2.429   -20.679 -14.880 1.00 0.00 ? 139 VAL B HG23 2  
ATOM   3454  N  N    . ARG B 2 40  ? -1.344  -20.398 -18.210 1.00 0.00 ? 140 ARG B N    2  
ATOM   3455  C  CA   . ARG B 2 40  ? -1.854  -19.952 -19.499 1.00 0.00 ? 140 ARG B CA   2  
ATOM   3456  C  C    . ARG B 2 40  ? -1.028  -18.787 -20.035 1.00 0.00 ? 140 ARG B C    2  
ATOM   3457  O  O    . ARG B 2 40  ? -0.296  -18.137 -19.288 1.00 0.00 ? 140 ARG B O    2  
ATOM   3458  C  CB   . ARG B 2 40  ? -3.322  -19.538 -19.377 1.00 0.00 ? 140 ARG B CB   2  
ATOM   3459  C  CG   . ARG B 2 40  ? -4.239  -20.671 -18.942 1.00 0.00 ? 140 ARG B CG   2  
ATOM   3460  C  CD   . ARG B 2 40  ? -4.172  -21.845 -19.907 1.00 0.00 ? 140 ARG B CD   2  
ATOM   3461  N  NE   . ARG B 2 40  ? -3.408  -22.962 -19.357 1.00 0.00 ? 140 ARG B NE   2  
ATOM   3462  C  CZ   . ARG B 2 40  ? -3.176  -24.097 -20.014 1.00 0.00 ? 140 ARG B CZ   2  
ATOM   3463  N  NH1  . ARG B 2 40  ? -3.647  -24.268 -21.243 1.00 0.00 ? 140 ARG B NH1  2  
ATOM   3464  N  NH2  . ARG B 2 40  ? -2.473  -25.062 -19.441 1.00 0.00 ? 140 ARG B NH2  2  
ATOM   3465  H  H    . ARG B 2 40  ? -1.925  -20.352 -17.423 1.00 0.00 ? 140 ARG B H    2  
ATOM   3466  H  HA   . ARG B 2 40  ? -1.778  -20.778 -20.190 1.00 0.00 ? 140 ARG B HA   2  
ATOM   3467  H  HB2  . ARG B 2 40  ? -3.400  -18.743 -18.650 1.00 0.00 ? 140 ARG B HB2  2  
ATOM   3468  H  HB3  . ARG B 2 40  ? -3.663  -19.175 -20.334 1.00 0.00 ? 140 ARG B HB3  2  
ATOM   3469  H  HG2  . ARG B 2 40  ? -3.939  -21.008 -17.962 1.00 0.00 ? 140 ARG B HG2  2  
ATOM   3470  H  HG3  . ARG B 2 40  ? -5.255  -20.305 -18.906 1.00 0.00 ? 140 ARG B HG3  2  
ATOM   3471  H  HD2  . ARG B 2 40  ? -5.177  -22.179 -20.118 1.00 0.00 ? 140 ARG B HD2  2  
ATOM   3472  H  HD3  . ARG B 2 40  ? -3.702  -21.516 -20.823 1.00 0.00 ? 140 ARG B HD3  2  
ATOM   3473  H  HE   . ARG B 2 40  ? -3.049  -22.863 -18.450 1.00 0.00 ? 140 ARG B HE   2  
ATOM   3474  H  HH11 . ARG B 2 40  ? -4.178  -23.543 -21.681 1.00 0.00 ? 140 ARG B HH11 2  
ATOM   3475  H  HH12 . ARG B 2 40  ? -3.469  -25.121 -21.732 1.00 0.00 ? 140 ARG B HH12 2  
ATOM   3476  H  HH21 . ARG B 2 40  ? -2.116  -24.940 -18.514 1.00 0.00 ? 140 ARG B HH21 2  
ATOM   3477  H  HH22 . ARG B 2 40  ? -2.298  -25.915 -19.935 1.00 0.00 ? 140 ARG B HH22 2  
ATOM   3478  N  N    . GLN B 2 41  ? -1.151  -18.527 -21.333 1.00 0.00 ? 141 GLN B N    2  
ATOM   3479  C  CA   . GLN B 2 41  ? -0.415  -17.439 -21.967 1.00 0.00 ? 141 GLN B CA   2  
ATOM   3480  C  C    . GLN B 2 41  ? -0.874  -16.087 -21.432 1.00 0.00 ? 141 GLN B C    2  
ATOM   3481  O  O    . GLN B 2 41  ? -2.038  -15.714 -21.582 1.00 0.00 ? 141 GLN B O    2  
ATOM   3482  C  CB   . GLN B 2 41  ? -0.597  -17.489 -23.485 1.00 0.00 ? 141 GLN B CB   2  
ATOM   3483  C  CG   . GLN B 2 41  ? 0.458   -18.319 -24.198 1.00 0.00 ? 141 GLN B CG   2  
ATOM   3484  C  CD   . GLN B 2 41  ? 0.825   -17.752 -25.555 1.00 0.00 ? 141 GLN B CD   2  
ATOM   3485  O  OE1  . GLN B 2 41  ? -0.046  -17.379 -26.340 1.00 0.00 ? 141 GLN B OE1  2  
ATOM   3486  N  NE2  . GLN B 2 41  ? 2.121   -17.682 -25.837 1.00 0.00 ? 141 GLN B NE2  2  
ATOM   3487  H  H    . GLN B 2 41  ? -1.750  -19.080 -21.876 1.00 0.00 ? 141 GLN B H    2  
ATOM   3488  H  HA   . GLN B 2 41  ? 0.632   -17.568 -21.735 1.00 0.00 ? 141 GLN B HA   2  
ATOM   3489  H  HB2  . GLN B 2 41  ? -1.567  -17.911 -23.706 1.00 0.00 ? 141 GLN B HB2  2  
ATOM   3490  H  HB3  . GLN B 2 41  ? -0.556  -16.482 -23.874 1.00 0.00 ? 141 GLN B HB3  2  
ATOM   3491  H  HG2  . GLN B 2 41  ? 1.347   -18.352 -23.586 1.00 0.00 ? 141 GLN B HG2  2  
ATOM   3492  H  HG3  . GLN B 2 41  ? 0.077   -19.321 -24.333 1.00 0.00 ? 141 GLN B HG3  2  
ATOM   3493  H  HE21 . GLN B 2 41  ? 2.758   -17.997 -25.162 1.00 0.00 ? 141 GLN B HE21 2  
ATOM   3494  H  HE22 . GLN B 2 41  ? 2.387   -17.319 -26.707 1.00 0.00 ? 141 GLN B HE22 2  
ATOM   3495  N  N    . CYS B 2 42  ? 0.048   -15.361 -20.799 1.00 0.00 ? 142 CYS B N    2  
ATOM   3496  C  CA   . CYS B 2 42  ? -0.242  -14.056 -20.228 1.00 0.00 ? 142 CYS B CA   2  
ATOM   3497  C  C    . CYS B 2 42  ? -1.177  -13.241 -21.119 1.00 0.00 ? 142 CYS B C    2  
ATOM   3498  O  O    . CYS B 2 42  ? -0.743  -12.627 -22.094 1.00 0.00 ? 142 CYS B O    2  
ATOM   3499  C  CB   . CYS B 2 42  ? 1.056   -13.282 -19.993 1.00 0.00 ? 142 CYS B CB   2  
ATOM   3500  S  SG   . CYS B 2 42  ? 0.938   -12.011 -18.693 1.00 0.00 ? 142 CYS B SG   2  
ATOM   3501  H  H    . CYS B 2 42  ? 0.946   -15.719 -20.701 1.00 0.00 ? 142 CYS B H    2  
ATOM   3502  H  HA   . CYS B 2 42  ? -0.716  -14.227 -19.282 1.00 0.00 ? 142 CYS B HA   2  
ATOM   3503  H  HB2  . CYS B 2 42  ? 1.832   -13.975 -19.706 1.00 0.00 ? 142 CYS B HB2  2  
ATOM   3504  H  HB3  . CYS B 2 42  ? 1.343   -12.789 -20.911 1.00 0.00 ? 142 CYS B HB3  2  
ATOM   3505  N  N    . ASN B 2 43  ? -2.460  -13.239 -20.776 1.00 0.00 ? 143 ASN B N    2  
ATOM   3506  C  CA   . ASN B 2 43  ? -3.457  -12.501 -21.542 1.00 0.00 ? 143 ASN B CA   2  
ATOM   3507  C  C    . ASN B 2 43  ? -3.287  -10.994 -21.362 1.00 0.00 ? 143 ASN B C    2  
ATOM   3508  O  O    . ASN B 2 43  ? -3.805  -10.205 -22.152 1.00 0.00 ? 143 ASN B O    2  
ATOM   3509  C  CB   . ASN B 2 43  ? -4.866  -12.920 -21.119 1.00 0.00 ? 143 ASN B CB   2  
ATOM   3510  C  CG   . ASN B 2 43  ? -5.062  -14.422 -21.167 1.00 0.00 ? 143 ASN B CG   2  
ATOM   3511  O  OD1  . ASN B 2 43  ? -5.492  -15.036 -20.191 1.00 0.00 ? 143 ASN B OD1  2  
ATOM   3512  N  ND2  . ASN B 2 43  ? -4.747  -15.023 -22.309 1.00 0.00 ? 143 ASN B ND2  2  
ATOM   3513  H  H    . ASN B 2 43  ? -2.746  -13.747 -19.988 1.00 0.00 ? 143 ASN B H    2  
ATOM   3514  H  HA   . ASN B 2 43  ? -3.319  -12.744 -22.585 1.00 0.00 ? 143 ASN B HA   2  
ATOM   3515  H  HB2  . ASN B 2 43  ? -5.045  -12.585 -20.109 1.00 0.00 ? 143 ASN B HB2  2  
ATOM   3516  H  HB3  . ASN B 2 43  ? -5.584  -12.459 -21.779 1.00 0.00 ? 143 ASN B HB3  2  
ATOM   3517  H  HD21 . ASN B 2 43  ? -4.410  -14.470 -23.045 1.00 0.00 ? 143 ASN B HD21 2  
ATOM   3518  H  HD22 . ASN B 2 43  ? -4.864  -15.994 -22.368 1.00 0.00 ? 143 ASN B HD22 2  
ATOM   3519  N  N    . LEU B 2 44  ? -2.565  -10.599 -20.317 1.00 0.00 ? 144 LEU B N    2  
ATOM   3520  C  CA   . LEU B 2 44  ? -2.334  -9.185  -20.035 1.00 0.00 ? 144 LEU B CA   2  
ATOM   3521  C  C    . LEU B 2 44  ? -1.058  -8.689  -20.716 1.00 0.00 ? 144 LEU B C    2  
ATOM   3522  O  O    . LEU B 2 44  ? 0.045   -9.078  -20.333 1.00 0.00 ? 144 LEU B O    2  
ATOM   3523  C  CB   . LEU B 2 44  ? -2.237  -8.956  -18.526 1.00 0.00 ? 144 LEU B CB   2  
ATOM   3524  C  CG   . LEU B 2 44  ? -3.230  -9.761  -17.681 1.00 0.00 ? 144 LEU B CG   2  
ATOM   3525  C  CD1  . LEU B 2 44  ? -2.500  -10.565 -16.616 1.00 0.00 ? 144 LEU B CD1  2  
ATOM   3526  C  CD2  . LEU B 2 44  ? -4.260  -8.840  -17.043 1.00 0.00 ? 144 LEU B CD2  2  
ATOM   3527  H  H    . LEU B 2 44  ? -2.180  -11.271 -19.718 1.00 0.00 ? 144 LEU B H    2  
ATOM   3528  H  HA   . LEU B 2 44  ? -3.177  -8.631  -20.419 1.00 0.00 ? 144 LEU B HA   2  
ATOM   3529  H  HB2  . LEU B 2 44  ? -1.236  -9.210  -18.209 1.00 0.00 ? 144 LEU B HB2  2  
ATOM   3530  H  HB3  . LEU B 2 44  ? -2.402  -7.906  -18.332 1.00 0.00 ? 144 LEU B HB3  2  
ATOM   3531  H  HG   . LEU B 2 44  ? -3.754  -10.457 -18.320 1.00 0.00 ? 144 LEU B HG   2  
ATOM   3532  H  HD11 . LEU B 2 44  ? -1.751  -9.945  -16.146 1.00 0.00 ? 144 LEU B HD11 2  
ATOM   3533  H  HD12 . LEU B 2 44  ? -2.023  -11.420 -17.073 1.00 0.00 ? 144 LEU B HD12 2  
ATOM   3534  H  HD13 . LEU B 2 44  ? -3.206  -10.903 -15.872 1.00 0.00 ? 144 LEU B HD13 2  
ATOM   3535  H  HD21 . LEU B 2 44  ? -4.867  -8.390  -17.815 1.00 0.00 ? 144 LEU B HD21 2  
ATOM   3536  H  HD22 . LEU B 2 44  ? -3.754  -8.066  -16.486 1.00 0.00 ? 144 LEU B HD22 2  
ATOM   3537  H  HD23 . LEU B 2 44  ? -4.889  -9.411  -16.377 1.00 0.00 ? 144 LEU B HD23 2  
ATOM   3538  N  N    . PRO B 2 45  ? -1.187  -7.819  -21.735 1.00 0.00 ? 145 PRO B N    2  
ATOM   3539  C  CA   . PRO B 2 45  ? -0.032  -7.276  -22.458 1.00 0.00 ? 145 PRO B CA   2  
ATOM   3540  C  C    . PRO B 2 45  ? 0.871   -6.441  -21.554 1.00 0.00 ? 145 PRO B C    2  
ATOM   3541  O  O    . PRO B 2 45  ? 2.093   -6.571  -21.589 1.00 0.00 ? 145 PRO B O    2  
ATOM   3542  C  CB   . PRO B 2 45  ? -0.656  -6.392  -23.548 1.00 0.00 ? 145 PRO B CB   2  
ATOM   3543  C  CG   . PRO B 2 45  ? -2.079  -6.824  -23.638 1.00 0.00 ? 145 PRO B CG   2  
ATOM   3544  C  CD   . PRO B 2 45  ? -2.456  -7.296  -22.264 1.00 0.00 ? 145 PRO B CD   2  
ATOM   3545  H  HA   . PRO B 2 45  ? 0.552   -8.061  -22.917 1.00 0.00 ? 145 PRO B HA   2  
ATOM   3546  H  HB2  . PRO B 2 45  ? -0.577  -5.355  -23.260 1.00 0.00 ? 145 PRO B HB2  2  
ATOM   3547  H  HB3  . PRO B 2 45  ? -0.137  -6.551  -24.482 1.00 0.00 ? 145 PRO B HB3  2  
ATOM   3548  H  HG2  . PRO B 2 45  ? -2.699  -5.990  -23.931 1.00 0.00 ? 145 PRO B HG2  2  
ATOM   3549  H  HG3  . PRO B 2 45  ? -2.175  -7.632  -24.349 1.00 0.00 ? 145 PRO B HG3  2  
ATOM   3550  H  HD2  . PRO B 2 45  ? -2.814  -6.471  -21.665 1.00 0.00 ? 145 PRO B HD2  2  
ATOM   3551  H  HD3  . PRO B 2 45  ? -3.202  -8.075  -22.321 1.00 0.00 ? 145 PRO B HD3  2  
ATOM   3552  N  N    . HIS B 2 46  ? 0.256   -5.583  -20.744 1.00 0.00 ? 146 HIS B N    2  
ATOM   3553  C  CA   . HIS B 2 46  ? 0.996   -4.722  -19.825 1.00 0.00 ? 146 HIS B CA   2  
ATOM   3554  C  C    . HIS B 2 46  ? 2.022   -5.524  -19.027 1.00 0.00 ? 146 HIS B C    2  
ATOM   3555  O  O    . HIS B 2 46  ? 3.184   -5.133  -18.917 1.00 0.00 ? 146 HIS B O    2  
ATOM   3556  C  CB   . HIS B 2 46  ? 0.030   -4.016  -18.873 1.00 0.00 ? 146 HIS B CB   2  
ATOM   3557  C  CG   . HIS B 2 46  ? -0.316  -2.621  -19.298 1.00 0.00 ? 146 HIS B CG   2  
ATOM   3558  N  ND1  . HIS B 2 46  ? -1.460  -2.312  -20.003 1.00 0.00 ? 146 HIS B ND1  2  
ATOM   3559  C  CD2  . HIS B 2 46  ? 0.337   -1.449  -19.112 1.00 0.00 ? 146 HIS B CD2  2  
ATOM   3560  C  CE1  . HIS B 2 46  ? -1.495  -1.011  -20.234 1.00 0.00 ? 146 HIS B CE1  2  
ATOM   3561  N  NE2  . HIS B 2 46  ? -0.417  -0.465  -19.702 1.00 0.00 ? 146 HIS B NE2  2  
ATOM   3562  H  H    . HIS B 2 46  ? -0.723  -5.527  -20.764 1.00 0.00 ? 146 HIS B H    2  
ATOM   3563  H  HA   . HIS B 2 46  ? 1.516   -3.980  -20.412 1.00 0.00 ? 146 HIS B HA   2  
ATOM   3564  H  HB2  . HIS B 2 46  ? -0.887  -4.582  -18.818 1.00 0.00 ? 146 HIS B HB2  2  
ATOM   3565  H  HB3  . HIS B 2 46  ? 0.474   -3.965  -17.891 1.00 0.00 ? 146 HIS B HB3  2  
ATOM   3566  H  HD1  . HIS B 2 46  ? -2.144  -2.951  -20.293 1.00 0.00 ? 146 HIS B HD1  2  
ATOM   3567  H  HD2  . HIS B 2 46  ? 1.277   -1.315  -18.595 1.00 0.00 ? 146 HIS B HD2  2  
ATOM   3568  H  HE1  . HIS B 2 46  ? -2.273  -0.484  -20.765 1.00 0.00 ? 146 HIS B HE1  2  
ATOM   3569  H  HE2  . HIS B 2 46  ? -0.239  0.496   -19.649 1.00 0.00 ? 146 HIS B HE2  2  
ATOM   3570  N  N    . CYS B 2 47  ? 1.582   -6.652  -18.478 1.00 0.00 ? 147 CYS B N    2  
ATOM   3571  C  CA   . CYS B 2 47  ? 2.454   -7.522  -17.694 1.00 0.00 ? 147 CYS B CA   2  
ATOM   3572  C  C    . CYS B 2 47  ? 3.725   -7.850  -18.465 1.00 0.00 ? 147 CYS B C    2  
ATOM   3573  O  O    . CYS B 2 47  ? 4.821   -7.422  -18.103 1.00 0.00 ? 147 CYS B O    2  
ATOM   3574  C  CB   . CYS B 2 47  ? 1.718   -8.817  -17.346 1.00 0.00 ? 147 CYS B CB   2  
ATOM   3575  S  SG   . CYS B 2 47  ? 2.747   -10.079 -16.526 1.00 0.00 ? 147 CYS B SG   2  
ATOM   3576  H  H    . CYS B 2 47  ? 0.645   -6.910  -18.607 1.00 0.00 ? 147 CYS B H    2  
ATOM   3577  H  HA   . CYS B 2 47  ? 2.716   -7.006  -16.783 1.00 0.00 ? 147 CYS B HA   2  
ATOM   3578  H  HB2  . CYS B 2 47  ? 0.900   -8.587  -16.691 1.00 0.00 ? 147 CYS B HB2  2  
ATOM   3579  H  HB3  . CYS B 2 47  ? 1.328   -9.251  -18.250 1.00 0.00 ? 147 CYS B HB3  2  
ATOM   3580  N  N    . ARG B 2 48  ? 3.557   -8.622  -19.531 1.00 0.00 ? 148 ARG B N    2  
ATOM   3581  C  CA   . ARG B 2 48  ? 4.674   -9.036  -20.379 1.00 0.00 ? 148 ARG B CA   2  
ATOM   3582  C  C    . ARG B 2 48  ? 5.626   -7.873  -20.649 1.00 0.00 ? 148 ARG B C    2  
ATOM   3583  O  O    . ARG B 2 48  ? 6.844   -8.014  -20.533 1.00 0.00 ? 148 ARG B O    2  
ATOM   3584  C  CB   . ARG B 2 48  ? 4.150   -9.597  -21.702 1.00 0.00 ? 148 ARG B CB   2  
ATOM   3585  C  CG   . ARG B 2 48  ? 5.243   -10.134 -22.611 1.00 0.00 ? 148 ARG B CG   2  
ATOM   3586  C  CD   . ARG B 2 48  ? 4.677   -11.064 -23.672 1.00 0.00 ? 148 ARG B CD   2  
ATOM   3587  N  NE   . ARG B 2 48  ? 5.683   -11.995 -24.176 1.00 0.00 ? 148 ARG B NE   2  
ATOM   3588  C  CZ   . ARG B 2 48  ? 5.393   -13.108 -24.846 1.00 0.00 ? 148 ARG B CZ   2  
ATOM   3589  N  NH1  . ARG B 2 48  ? 4.130   -13.430 -25.094 1.00 0.00 ? 148 ARG B NH1  2  
ATOM   3590  N  NH2  . ARG B 2 48  ? 6.368   -13.900 -25.269 1.00 0.00 ? 148 ARG B NH2  2  
ATOM   3591  H  H    . ARG B 2 48  ? 2.652   -8.927  -19.751 1.00 0.00 ? 148 ARG B H    2  
ATOM   3592  H  HA   . ARG B 2 48  ? 5.214   -9.813  -19.860 1.00 0.00 ? 148 ARG B HA   2  
ATOM   3593  H  HB2  . ARG B 2 48  ? 3.460   -10.401 -21.491 1.00 0.00 ? 148 ARG B HB2  2  
ATOM   3594  H  HB3  . ARG B 2 48  ? 3.626   -8.813  -22.229 1.00 0.00 ? 148 ARG B HB3  2  
ATOM   3595  H  HG2  . ARG B 2 48  ? 5.733   -9.304  -23.098 1.00 0.00 ? 148 ARG B HG2  2  
ATOM   3596  H  HG3  . ARG B 2 48  ? 5.961   -10.678 -22.013 1.00 0.00 ? 148 ARG B HG3  2  
ATOM   3597  H  HD2  . ARG B 2 48  ? 3.863   -11.627 -23.241 1.00 0.00 ? 148 ARG B HD2  2  
ATOM   3598  H  HD3  . ARG B 2 48  ? 4.307   -10.468 -24.494 1.00 0.00 ? 148 ARG B HD3  2  
ATOM   3599  H  HE   . ARG B 2 48  ? 6.624   -11.781 -24.006 1.00 0.00 ? 148 ARG B HE   2  
ATOM   3600  H  HH11 . ARG B 2 48  ? 3.390   -12.838 -24.777 1.00 0.00 ? 148 ARG B HH11 2  
ATOM   3601  H  HH12 . ARG B 2 48  ? 3.918   -14.268 -25.599 1.00 0.00 ? 148 ARG B HH12 2  
ATOM   3602  H  HH21 . ARG B 2 48  ? 7.322   -13.661 -25.085 1.00 0.00 ? 148 ARG B HH21 2  
ATOM   3603  H  HH22 . ARG B 2 48  ? 6.151   -14.736 -25.773 1.00 0.00 ? 148 ARG B HH22 2  
ATOM   3604  N  N    . THR B 2 49  ? 5.061   -6.726  -21.006 1.00 0.00 ? 149 THR B N    2  
ATOM   3605  C  CA   . THR B 2 49  ? 5.863   -5.539  -21.287 1.00 0.00 ? 149 THR B CA   2  
ATOM   3606  C  C    . THR B 2 49  ? 6.639   -5.113  -20.048 1.00 0.00 ? 149 THR B C    2  
ATOM   3607  O  O    . THR B 2 49  ? 7.839   -4.845  -20.122 1.00 0.00 ? 149 THR B O    2  
ATOM   3608  C  CB   . THR B 2 49  ? 4.973   -4.392  -21.769 1.00 0.00 ? 149 THR B CB   2  
ATOM   3609  O  OG1  . THR B 2 49  ? 3.765   -4.892  -22.315 1.00 0.00 ? 149 THR B OG1  2  
ATOM   3610  C  CG2  . THR B 2 49  ? 5.629   -3.528  -22.824 1.00 0.00 ? 149 THR B CG2  2  
ATOM   3611  H  H    . THR B 2 49  ? 4.085   -6.675  -21.077 1.00 0.00 ? 149 THR B H    2  
ATOM   3612  H  HA   . THR B 2 49  ? 6.571   -5.789  -22.066 1.00 0.00 ? 149 THR B HA   2  
ATOM   3613  H  HB   . THR B 2 49  ? 4.729   -3.760  -20.928 1.00 0.00 ? 149 THR B HB   2  
ATOM   3614  H  HG1  . THR B 2 49  ? 3.958   -5.626  -22.902 1.00 0.00 ? 149 THR B HG1  2  
ATOM   3615  H  HG21 . THR B 2 49  ? 6.675   -3.786  -22.900 1.00 0.00 ? 149 THR B HG21 2  
ATOM   3616  H  HG22 . THR B 2 49  ? 5.534   -2.489  -22.547 1.00 0.00 ? 149 THR B HG22 2  
ATOM   3617  H  HG23 . THR B 2 49  ? 5.148   -3.693  -23.776 1.00 0.00 ? 149 THR B HG23 2  
ATOM   3618  N  N    . MET B 2 50  ? 5.959   -5.063  -18.906 1.00 0.00 ? 150 MET B N    2  
ATOM   3619  C  CA   . MET B 2 50  ? 6.613   -4.681  -17.662 1.00 0.00 ? 150 MET B CA   2  
ATOM   3620  C  C    . MET B 2 50  ? 7.735   -5.654  -17.351 1.00 0.00 ? 150 MET B C    2  
ATOM   3621  O  O    . MET B 2 50  ? 8.796   -5.255  -16.880 1.00 0.00 ? 150 MET B O    2  
ATOM   3622  C  CB   . MET B 2 50  ? 5.613   -4.629  -16.507 1.00 0.00 ? 150 MET B CB   2  
ATOM   3623  C  CG   . MET B 2 50  ? 4.954   -3.269  -16.327 1.00 0.00 ? 150 MET B CG   2  
ATOM   3624  S  SD   . MET B 2 50  ? 6.145   -1.920  -16.188 1.00 0.00 ? 150 MET B SD   2  
ATOM   3625  C  CE   . MET B 2 50  ? 5.802   -1.008  -17.690 1.00 0.00 ? 150 MET B CE   2  
ATOM   3626  H  H    . MET B 2 50  ? 5.007   -5.295  -18.900 1.00 0.00 ? 150 MET B H    2  
ATOM   3627  H  HA   . MET B 2 50  ? 7.046   -3.703  -17.806 1.00 0.00 ? 150 MET B HA   2  
ATOM   3628  H  HB2  . MET B 2 50  ? 4.837   -5.359  -16.684 1.00 0.00 ? 150 MET B HB2  2  
ATOM   3629  H  HB3  . MET B 2 50  ? 6.126   -4.880  -15.589 1.00 0.00 ? 150 MET B HB3  2  
ATOM   3630  H  HG2  . MET B 2 50  ? 4.316   -3.078  -17.177 1.00 0.00 ? 150 MET B HG2  2  
ATOM   3631  H  HG3  . MET B 2 50  ? 4.356   -3.293  -15.430 1.00 0.00 ? 150 MET B HG3  2  
ATOM   3632  H  HE1  . MET B 2 50  ? 4.876   -1.360  -18.122 1.00 0.00 ? 150 MET B HE1  2  
ATOM   3633  H  HE2  . MET B 2 50  ? 6.606   -1.159  -18.395 1.00 0.00 ? 150 MET B HE2  2  
ATOM   3634  H  HE3  . MET B 2 50  ? 5.717   0.044   -17.462 1.00 0.00 ? 150 MET B HE3  2  
ATOM   3635  N  N    . LYS B 2 51  ? 7.519   -6.929  -17.662 1.00 0.00 ? 151 LYS B N    2  
ATOM   3636  C  CA   . LYS B 2 51  ? 8.548   -7.936  -17.456 1.00 0.00 ? 151 LYS B CA   2  
ATOM   3637  C  C    . LYS B 2 51  ? 9.818   -7.457  -18.136 1.00 0.00 ? 151 LYS B C    2  
ATOM   3638  O  O    . LYS B 2 51  ? 10.915  -7.519  -17.583 1.00 0.00 ? 151 LYS B O    2  
ATOM   3639  C  CB   . LYS B 2 51  ? 8.115   -9.270  -18.056 1.00 0.00 ? 151 LYS B CB   2  
ATOM   3640  C  CG   . LYS B 2 51  ? 8.699   -10.476 -17.344 1.00 0.00 ? 151 LYS B CG   2  
ATOM   3641  C  CD   . LYS B 2 51  ? 10.157  -10.683 -17.720 1.00 0.00 ? 151 LYS B CD   2  
ATOM   3642  C  CE   . LYS B 2 51  ? 10.298  -11.208 -19.141 1.00 0.00 ? 151 LYS B CE   2  
ATOM   3643  N  NZ   . LYS B 2 51  ? 11.293  -12.312 -19.229 1.00 0.00 ? 151 LYS B NZ   2  
ATOM   3644  H  H    . LYS B 2 51  ? 6.666   -7.189  -18.068 1.00 0.00 ? 151 LYS B H    2  
ATOM   3645  H  HA   . LYS B 2 51  ? 8.721   -8.045  -16.396 1.00 0.00 ? 151 LYS B HA   2  
ATOM   3646  H  HB2  . LYS B 2 51  ? 7.041   -9.332  -18.019 1.00 0.00 ? 151 LYS B HB2  2  
ATOM   3647  H  HB3  . LYS B 2 51  ? 8.430   -9.303  -19.088 1.00 0.00 ? 151 LYS B HB3  2  
ATOM   3648  H  HG2  . LYS B 2 51  ? 8.630   -10.323 -16.278 1.00 0.00 ? 151 LYS B HG2  2  
ATOM   3649  H  HG3  . LYS B 2 51  ? 8.135   -11.355 -17.621 1.00 0.00 ? 151 LYS B HG3  2  
ATOM   3650  H  HD2  . LYS B 2 51  ? 10.676  -9.740  -17.644 1.00 0.00 ? 151 LYS B HD2  2  
ATOM   3651  H  HD3  . LYS B 2 51  ? 10.597  -11.394 -17.039 1.00 0.00 ? 151 LYS B HD3  2  
ATOM   3652  H  HE2  . LYS B 2 51  ? 9.338   -11.574 -19.474 1.00 0.00 ? 151 LYS B HE2  2  
ATOM   3653  H  HE3  . LYS B 2 51  ? 10.615  -10.397 -19.781 1.00 0.00 ? 151 LYS B HE3  2  
ATOM   3654  H  HZ1  . LYS B 2 51  ? 11.184  -12.821 -20.129 1.00 0.00 ? 151 LYS B HZ1  2  
ATOM   3655  H  HZ2  . LYS B 2 51  ? 11.154  -12.982 -18.446 1.00 0.00 ? 151 LYS B HZ2  2  
ATOM   3656  H  HZ3  . LYS B 2 51  ? 12.259  -11.927 -19.174 1.00 0.00 ? 151 LYS B HZ3  2  
ATOM   3657  N  N    . ASN B 2 52  ? 9.622   -6.951  -19.345 1.00 0.00 ? 152 ASN B N    2  
ATOM   3658  C  CA   . ASN B 2 52  ? 10.703  -6.411  -20.149 1.00 0.00 ? 152 ASN B CA   2  
ATOM   3659  C  C    . ASN B 2 52  ? 11.314  -5.193  -19.463 1.00 0.00 ? 152 ASN B C    2  
ATOM   3660  O  O    . ASN B 2 52  ? 12.532  -5.098  -19.307 1.00 0.00 ? 152 ASN B O    2  
ATOM   3661  C  CB   . ASN B 2 52  ? 10.174  -6.023  -21.532 1.00 0.00 ? 152 ASN B CB   2  
ATOM   3662  C  CG   . ASN B 2 52  ? 11.223  -6.166  -22.616 1.00 0.00 ? 152 ASN B CG   2  
ATOM   3663  O  OD1  . ASN B 2 52  ? 11.727  -5.174  -23.144 1.00 0.00 ? 152 ASN B OD1  2  
ATOM   3664  N  ND2  . ASN B 2 52  ? 11.560  -7.405  -22.955 1.00 0.00 ? 152 ASN B ND2  2  
ATOM   3665  H  H    . ASN B 2 52  ? 8.708   -6.928  -19.700 1.00 0.00 ? 152 ASN B H    2  
ATOM   3666  H  HA   . ASN B 2 52  ? 11.458  -7.175  -20.257 1.00 0.00 ? 152 ASN B HA   2  
ATOM   3667  H  HB2  . ASN B 2 52  ? 9.336   -6.658  -21.780 1.00 0.00 ? 152 ASN B HB2  2  
ATOM   3668  H  HB3  . ASN B 2 52  ? 9.841   -4.995  -21.509 1.00 0.00 ? 152 ASN B HB3  2  
ATOM   3669  H  HD21 . ASN B 2 52  ? 11.119  -8.148  -22.492 1.00 0.00 ? 152 ASN B HD21 2  
ATOM   3670  H  HD22 . ASN B 2 52  ? 12.237  -7.527  -23.653 1.00 0.00 ? 152 ASN B HD22 2  
ATOM   3671  N  N    . VAL B 2 53  ? 10.455  -4.265  -19.045 1.00 0.00 ? 153 VAL B N    2  
ATOM   3672  C  CA   . VAL B 2 53  ? 10.907  -3.057  -18.365 1.00 0.00 ? 153 VAL B CA   2  
ATOM   3673  C  C    . VAL B 2 53  ? 11.566  -3.402  -17.035 1.00 0.00 ? 153 VAL B C    2  
ATOM   3674  O  O    . VAL B 2 53  ? 12.549  -2.782  -16.636 1.00 0.00 ? 153 VAL B O    2  
ATOM   3675  C  CB   . VAL B 2 53  ? 9.743   -2.077  -18.120 1.00 0.00 ? 153 VAL B CB   2  
ATOM   3676  C  CG1  . VAL B 2 53  ? 10.233  -0.819  -17.414 1.00 0.00 ? 153 VAL B CG1  2  
ATOM   3677  C  CG2  . VAL B 2 53  ? 9.059   -1.725  -19.433 1.00 0.00 ? 153 VAL B CG2  2  
ATOM   3678  H  H    . VAL B 2 53  ? 9.492   -4.402  -19.192 1.00 0.00 ? 153 VAL B H    2  
ATOM   3679  H  HA   . VAL B 2 53  ? 11.636  -2.572  -18.996 1.00 0.00 ? 153 VAL B HA   2  
ATOM   3680  H  HB   . VAL B 2 53  ? 9.019   -2.561  -17.481 1.00 0.00 ? 153 VAL B HB   2  
ATOM   3681  H  HG11 . VAL B 2 53  ? 10.730  -1.094  -16.495 1.00 0.00 ? 153 VAL B HG11 2  
ATOM   3682  H  HG12 . VAL B 2 53  ? 9.393   -0.180  -17.192 1.00 0.00 ? 153 VAL B HG12 2  
ATOM   3683  H  HG13 . VAL B 2 53  ? 10.926  -0.294  -18.056 1.00 0.00 ? 153 VAL B HG13 2  
ATOM   3684  H  HG21 . VAL B 2 53  ? 8.495   -2.576  -19.785 1.00 0.00 ? 153 VAL B HG21 2  
ATOM   3685  H  HG22 . VAL B 2 53  ? 9.805   -1.458  -20.167 1.00 0.00 ? 153 VAL B HG22 2  
ATOM   3686  H  HG23 . VAL B 2 53  ? 8.392   -0.890  -19.279 1.00 0.00 ? 153 VAL B HG23 2  
ATOM   3687  N  N    . LEU B 2 54  ? 11.020  -4.400  -16.354 1.00 0.00 ? 154 LEU B N    2  
ATOM   3688  C  CA   . LEU B 2 54  ? 11.550  -4.833  -15.086 1.00 0.00 ? 154 LEU B CA   2  
ATOM   3689  C  C    . LEU B 2 54  ? 12.948  -5.404  -15.264 1.00 0.00 ? 154 LEU B C    2  
ATOM   3690  O  O    . LEU B 2 54  ? 13.835  -5.174  -14.441 1.00 0.00 ? 154 LEU B O    2  
ATOM   3691  C  CB   . LEU B 2 54  ? 10.612  -5.875  -14.490 1.00 0.00 ? 154 LEU B CB   2  
ATOM   3692  C  CG   . LEU B 2 54  ? 9.611   -5.337  -13.468 1.00 0.00 ? 154 LEU B CG   2  
ATOM   3693  C  CD1  . LEU B 2 54  ? 8.821   -6.475  -12.838 1.00 0.00 ? 154 LEU B CD1  2  
ATOM   3694  C  CD2  . LEU B 2 54  ? 10.321  -4.522  -12.396 1.00 0.00 ? 154 LEU B CD2  2  
ATOM   3695  H  H    . LEU B 2 54  ? 10.238  -4.862  -16.713 1.00 0.00 ? 154 LEU B H    2  
ATOM   3696  H  HA   . LEU B 2 54  ? 11.601  -3.980  -14.435 1.00 0.00 ? 154 LEU B HA   2  
ATOM   3697  H  HB2  . LEU B 2 54  ? 10.057  -6.328  -15.299 1.00 0.00 ? 154 LEU B HB2  2  
ATOM   3698  H  HB3  . LEU B 2 54  ? 11.204  -6.631  -14.024 1.00 0.00 ? 154 LEU B HB3  2  
ATOM   3699  H  HG   . LEU B 2 54  ? 8.913   -4.687  -13.977 1.00 0.00 ? 154 LEU B HG   2  
ATOM   3700  H  HD11 . LEU B 2 54  ? 8.844   -7.334  -13.492 1.00 0.00 ? 154 LEU B HD11 2  
ATOM   3701  H  HD12 . LEU B 2 54  ? 7.798   -6.163  -12.689 1.00 0.00 ? 154 LEU B HD12 2  
ATOM   3702  H  HD13 . LEU B 2 54  ? 9.261   -6.734  -11.887 1.00 0.00 ? 154 LEU B HD13 2  
ATOM   3703  H  HD21 . LEU B 2 54  ? 10.334  -3.482  -12.685 1.00 0.00 ? 154 LEU B HD21 2  
ATOM   3704  H  HD22 . LEU B 2 54  ? 11.334  -4.878  -12.286 1.00 0.00 ? 154 LEU B HD22 2  
ATOM   3705  H  HD23 . LEU B 2 54  ? 9.797   -4.630  -11.457 1.00 0.00 ? 154 LEU B HD23 2  
ATOM   3706  N  N    . ASN B 2 55  ? 13.143  -6.129  -16.358 1.00 0.00 ? 155 ASN B N    2  
ATOM   3707  C  CA   . ASN B 2 55  ? 14.444  -6.713  -16.662 1.00 0.00 ? 155 ASN B CA   2  
ATOM   3708  C  C    . ASN B 2 55  ? 15.471  -5.604  -16.842 1.00 0.00 ? 155 ASN B C    2  
ATOM   3709  O  O    . ASN B 2 55  ? 16.631  -5.740  -16.455 1.00 0.00 ? 155 ASN B O    2  
ATOM   3710  C  CB   . ASN B 2 55  ? 14.365  -7.570  -17.927 1.00 0.00 ? 155 ASN B CB   2  
ATOM   3711  C  CG   . ASN B 2 55  ? 15.679  -8.255  -18.246 1.00 0.00 ? 155 ASN B CG   2  
ATOM   3712  O  OD1  . ASN B 2 55  ? 16.612  -7.629  -18.749 1.00 0.00 ? 155 ASN B OD1  2  
ATOM   3713  N  ND2  . ASN B 2 55  ? 15.759  -9.549  -17.955 1.00 0.00 ? 155 ASN B ND2  2  
ATOM   3714  H  H    . ASN B 2 55  ? 12.400  -6.259  -16.980 1.00 0.00 ? 155 ASN B H    2  
ATOM   3715  H  HA   . ASN B 2 55  ? 14.737  -7.334  -15.828 1.00 0.00 ? 155 ASN B HA   2  
ATOM   3716  H  HB2  . ASN B 2 55  ? 13.609  -8.330  -17.794 1.00 0.00 ? 155 ASN B HB2  2  
ATOM   3717  H  HB3  . ASN B 2 55  ? 14.094  -6.942  -18.764 1.00 0.00 ? 155 ASN B HB3  2  
ATOM   3718  H  HD21 . ASN B 2 55  ? 14.975  -9.983  -17.557 1.00 0.00 ? 155 ASN B HD21 2  
ATOM   3719  H  HD22 . ASN B 2 55  ? 16.598  -10.016 -18.151 1.00 0.00 ? 155 ASN B HD22 2  
ATOM   3720  N  N    . HIS B 2 56  ? 15.016  -4.495  -17.416 1.00 0.00 ? 156 HIS B N    2  
ATOM   3721  C  CA   . HIS B 2 56  ? 15.863  -3.332  -17.637 1.00 0.00 ? 156 HIS B CA   2  
ATOM   3722  C  C    . HIS B 2 56  ? 16.348  -2.784  -16.309 1.00 0.00 ? 156 HIS B C    2  
ATOM   3723  O  O    . HIS B 2 56  ? 17.540  -2.791  -16.005 1.00 0.00 ? 156 HIS B O    2  
ATOM   3724  C  CB   . HIS B 2 56  ? 15.065  -2.251  -18.364 1.00 0.00 ? 156 HIS B CB   2  
ATOM   3725  C  CG   . HIS B 2 56  ? 15.732  -0.909  -18.398 1.00 0.00 ? 156 HIS B CG   2  
ATOM   3726  N  ND1  . HIS B 2 56  ? 17.070  -0.710  -18.148 1.00 0.00 ? 156 HIS B ND1  2  
ATOM   3727  C  CD2  . HIS B 2 56  ? 15.206  0.317   -18.639 1.00 0.00 ? 156 HIS B CD2  2  
ATOM   3728  C  CE1  . HIS B 2 56  ? 17.311  0.606   -18.239 1.00 0.00 ? 156 HIS B CE1  2  
ATOM   3729  N  NE2  . HIS B 2 56  ? 16.213  1.274   -18.536 1.00 0.00 ? 156 HIS B NE2  2  
ATOM   3730  H  H    . HIS B 2 56  ? 14.072  -4.451  -17.683 1.00 0.00 ? 156 HIS B H    2  
ATOM   3731  H  HA   . HIS B 2 56  ? 16.708  -3.628  -18.239 1.00 0.00 ? 156 HIS B HA   2  
ATOM   3732  H  HB2  . HIS B 2 56  ? 14.894  -2.562  -19.371 1.00 0.00 ? 156 HIS B HB2  2  
ATOM   3733  H  HB3  . HIS B 2 56  ? 14.114  -2.130  -17.872 1.00 0.00 ? 156 HIS B HB3  2  
ATOM   3734  H  HD1  . HIS B 2 56  ? 17.729  -1.404  -17.940 1.00 0.00 ? 156 HIS B HD1  2  
ATOM   3735  H  HD2  . HIS B 2 56  ? 14.173  0.529   -18.874 1.00 0.00 ? 156 HIS B HD2  2  
ATOM   3736  H  HE1  . HIS B 2 56  ? 18.275  1.060   -18.084 1.00 0.00 ? 156 HIS B HE1  2  
ATOM   3737  N  N    . MET B 2 57  ? 15.391  -2.299  -15.533 1.00 0.00 ? 157 MET B N    2  
ATOM   3738  C  CA   . MET B 2 57  ? 15.661  -1.718  -14.218 1.00 0.00 ? 157 MET B CA   2  
ATOM   3739  C  C    . MET B 2 57  ? 16.706  -2.523  -13.440 1.00 0.00 ? 157 MET B C    2  
ATOM   3740  O  O    . MET B 2 57  ? 17.623  -1.955  -12.848 1.00 0.00 ? 157 MET B O    2  
ATOM   3741  C  CB   . MET B 2 57  ? 14.366  -1.640  -13.408 1.00 0.00 ? 157 MET B CB   2  
ATOM   3742  C  CG   . MET B 2 57  ? 14.393  -0.588  -12.312 1.00 0.00 ? 157 MET B CG   2  
ATOM   3743  S  SD   . MET B 2 57  ? 12.741  -0.113  -11.767 1.00 0.00 ? 157 MET B SD   2  
ATOM   3744  C  CE   . MET B 2 57  ? 12.055  -1.708  -11.325 1.00 0.00 ? 157 MET B CE   2  
ATOM   3745  H  H    . MET B 2 57  ? 14.464  -2.326  -15.867 1.00 0.00 ? 157 MET B H    2  
ATOM   3746  H  HA   . MET B 2 57  ? 16.038  -0.718  -14.371 1.00 0.00 ? 157 MET B HA   2  
ATOM   3747  H  HB2  . MET B 2 57  ? 13.552  -1.409  -14.077 1.00 0.00 ? 157 MET B HB2  2  
ATOM   3748  H  HB3  . MET B 2 57  ? 14.183  -2.600  -12.950 1.00 0.00 ? 157 MET B HB3  2  
ATOM   3749  H  HG2  . MET B 2 57  ? 14.936  -0.982  -11.466 1.00 0.00 ? 157 MET B HG2  2  
ATOM   3750  H  HG3  . MET B 2 57  ? 14.900  0.290   -12.686 1.00 0.00 ? 157 MET B HG3  2  
ATOM   3751  H  HE1  . MET B 2 57  ? 11.138  -1.870  -11.873 1.00 0.00 ? 157 MET B HE1  2  
ATOM   3752  H  HE2  . MET B 2 57  ? 11.850  -1.732  -10.265 1.00 0.00 ? 157 MET B HE2  2  
ATOM   3753  H  HE3  . MET B 2 57  ? 12.763  -2.486  -11.572 1.00 0.00 ? 157 MET B HE3  2  
ATOM   3754  N  N    . THR B 2 58  ? 16.557  -3.845  -13.441 1.00 0.00 ? 158 THR B N    2  
ATOM   3755  C  CA   . THR B 2 58  ? 17.485  -4.722  -12.729 1.00 0.00 ? 158 THR B CA   2  
ATOM   3756  C  C    . THR B 2 58  ? 18.929  -4.477  -13.163 1.00 0.00 ? 158 THR B C    2  
ATOM   3757  O  O    . THR B 2 58  ? 19.865  -4.746  -12.411 1.00 0.00 ? 158 THR B O    2  
ATOM   3758  C  CB   . THR B 2 58  ? 17.113  -6.190  -12.956 1.00 0.00 ? 158 THR B CB   2  
ATOM   3759  O  OG1  . THR B 2 58  ? 15.851  -6.298  -13.591 1.00 0.00 ? 158 THR B OG1  2  
ATOM   3760  C  CG2  . THR B 2 58  ? 17.053  -6.994  -11.677 1.00 0.00 ? 158 THR B CG2  2  
ATOM   3761  H  H    . THR B 2 58  ? 15.803  -4.240  -13.926 1.00 0.00 ? 158 THR B H    2  
ATOM   3762  H  HA   . THR B 2 58  ? 17.402  -4.502  -11.675 1.00 0.00 ? 158 THR B HA   2  
ATOM   3763  H  HB   . THR B 2 58  ? 17.855  -6.644  -13.598 1.00 0.00 ? 158 THR B HB   2  
ATOM   3764  H  HG1  . THR B 2 58  ? 15.833  -7.089  -14.134 1.00 0.00 ? 158 THR B HG1  2  
ATOM   3765  H  HG21 . THR B 2 58  ? 17.162  -8.043  -11.906 1.00 0.00 ? 158 THR B HG21 2  
ATOM   3766  H  HG22 . THR B 2 58  ? 16.103  -6.828  -11.192 1.00 0.00 ? 158 THR B HG22 2  
ATOM   3767  H  HG23 . THR B 2 58  ? 17.852  -6.684  -11.020 1.00 0.00 ? 158 THR B HG23 2  
ATOM   3768  N  N    . HIS B 2 59  ? 19.104  -3.959  -14.374 1.00 0.00 ? 159 HIS B N    2  
ATOM   3769  C  CA   . HIS B 2 59  ? 20.431  -3.673  -14.899 1.00 0.00 ? 159 HIS B CA   2  
ATOM   3770  C  C    . HIS B 2 59  ? 20.600  -2.178  -15.154 1.00 0.00 ? 159 HIS B C    2  
ATOM   3771  O  O    . HIS B 2 59  ? 21.508  -1.757  -15.870 1.00 0.00 ? 159 HIS B O    2  
ATOM   3772  C  CB   . HIS B 2 59  ? 20.675  -4.459  -16.189 1.00 0.00 ? 159 HIS B CB   2  
ATOM   3773  C  CG   . HIS B 2 59  ? 21.970  -5.209  -16.195 1.00 0.00 ? 159 HIS B CG   2  
ATOM   3774  N  ND1  . HIS B 2 59  ? 22.777  -5.308  -17.310 1.00 0.00 ? 159 HIS B ND1  2  
ATOM   3775  C  CD2  . HIS B 2 59  ? 22.599  -5.898  -15.214 1.00 0.00 ? 159 HIS B CD2  2  
ATOM   3776  C  CE1  . HIS B 2 59  ? 23.846  -6.027  -17.013 1.00 0.00 ? 159 HIS B CE1  2  
ATOM   3777  N  NE2  . HIS B 2 59  ? 23.762  -6.395  -15.748 1.00 0.00 ? 159 HIS B NE2  2  
ATOM   3778  H  H    . HIS B 2 59  ? 18.323  -3.758  -14.924 1.00 0.00 ? 159 HIS B H    2  
ATOM   3779  H  HA   . HIS B 2 59  ? 21.147  -3.982  -14.159 1.00 0.00 ? 159 HIS B HA   2  
ATOM   3780  H  HB2  . HIS B 2 59  ? 19.877  -5.175  -16.323 1.00 0.00 ? 159 HIS B HB2  2  
ATOM   3781  H  HB3  . HIS B 2 59  ? 20.681  -3.774  -17.026 1.00 0.00 ? 159 HIS B HB3  2  
ATOM   3782  H  HD1  . HIS B 2 59  ? 22.594  -4.912  -18.187 1.00 0.00 ? 159 HIS B HD1  2  
ATOM   3783  H  HD2  . HIS B 2 59  ? 22.251  -6.030  -14.199 1.00 0.00 ? 159 HIS B HD2  2  
ATOM   3784  H  HE1  . HIS B 2 59  ? 24.652  -6.270  -17.690 1.00 0.00 ? 159 HIS B HE1  2  
ATOM   3785  H  HE2  . HIS B 2 59  ? 24.463  -6.863  -15.249 1.00 0.00 ? 159 HIS B HE2  2  
ATOM   3786  N  N    . CYS B 2 60  ? 19.714  -1.386  -14.564 1.00 0.00 ? 160 CYS B N    2  
ATOM   3787  C  CA   . CYS B 2 60  ? 19.744  0.059   -14.719 1.00 0.00 ? 160 CYS B CA   2  
ATOM   3788  C  C    . CYS B 2 60  ? 20.359  0.725   -13.491 1.00 0.00 ? 160 CYS B C    2  
ATOM   3789  O  O    . CYS B 2 60  ? 19.836  0.606   -12.383 1.00 0.00 ? 160 CYS B O    2  
ATOM   3790  C  CB   . CYS B 2 60  ? 18.325  0.571   -14.943 1.00 0.00 ? 160 CYS B CB   2  
ATOM   3791  S  SG   . CYS B 2 60  ? 18.194  2.380   -15.105 1.00 0.00 ? 160 CYS B SG   2  
ATOM   3792  H  H    . CYS B 2 60  ? 19.011  -1.784  -14.012 1.00 0.00 ? 160 CYS B H    2  
ATOM   3793  H  HA   . CYS B 2 60  ? 20.345  0.292   -15.585 1.00 0.00 ? 160 CYS B HA   2  
ATOM   3794  H  HB2  . CYS B 2 60  ? 17.931  0.129   -15.844 1.00 0.00 ? 160 CYS B HB2  2  
ATOM   3795  H  HB3  . CYS B 2 60  ? 17.710  0.269   -14.110 1.00 0.00 ? 160 CYS B HB3  2  
ATOM   3796  N  N    . GLN B 2 61  ? 21.474  1.420   -13.694 1.00 0.00 ? 161 GLN B N    2  
ATOM   3797  C  CA   . GLN B 2 61  ? 22.161  2.098   -12.598 1.00 0.00 ? 161 GLN B CA   2  
ATOM   3798  C  C    . GLN B 2 61  ? 22.240  3.608   -12.829 1.00 0.00 ? 161 GLN B C    2  
ATOM   3799  O  O    . GLN B 2 61  ? 22.636  4.357   -11.935 1.00 0.00 ? 161 GLN B O    2  
ATOM   3800  C  CB   . GLN B 2 61  ? 23.568  1.525   -12.427 1.00 0.00 ? 161 GLN B CB   2  
ATOM   3801  C  CG   . GLN B 2 61  ? 23.730  0.674   -11.178 1.00 0.00 ? 161 GLN B CG   2  
ATOM   3802  C  CD   . GLN B 2 61  ? 23.551  -0.806  -11.454 1.00 0.00 ? 161 GLN B CD   2  
ATOM   3803  O  OE1  . GLN B 2 61  ? 22.518  -1.233  -11.970 1.00 0.00 ? 161 GLN B OE1  2  
ATOM   3804  N  NE2  . GLN B 2 61  ? 24.559  -1.598  -11.109 1.00 0.00 ? 161 GLN B NE2  2  
ATOM   3805  H  H    . GLN B 2 61  ? 21.846  1.475   -14.598 1.00 0.00 ? 161 GLN B H    2  
ATOM   3806  H  HA   . GLN B 2 61  ? 21.600  1.916   -11.694 1.00 0.00 ? 161 GLN B HA   2  
ATOM   3807  H  HB2  . GLN B 2 61  ? 23.801  0.913   -13.286 1.00 0.00 ? 161 GLN B HB2  2  
ATOM   3808  H  HB3  . GLN B 2 61  ? 24.275  2.341   -12.375 1.00 0.00 ? 161 GLN B HB3  2  
ATOM   3809  H  HG2  . GLN B 2 61  ? 24.719  0.832   -10.776 1.00 0.00 ? 161 GLN B HG2  2  
ATOM   3810  H  HG3  . GLN B 2 61  ? 22.994  0.982   -10.451 1.00 0.00 ? 161 GLN B HG3  2  
ATOM   3811  H  HE21 . GLN B 2 61  ? 25.351  -1.188  -10.702 1.00 0.00 ? 161 GLN B HE21 2  
ATOM   3812  H  HE22 . GLN B 2 61  ? 24.471  -2.559  -11.276 1.00 0.00 ? 161 GLN B HE22 2  
ATOM   3813  N  N    . SER B 2 62  ? 21.868  4.053   -14.026 1.00 0.00 ? 162 SER B N    2  
ATOM   3814  C  CA   . SER B 2 62  ? 21.906  5.473   -14.355 1.00 0.00 ? 162 SER B CA   2  
ATOM   3815  C  C    . SER B 2 62  ? 20.996  6.268   -13.426 1.00 0.00 ? 162 SER B C    2  
ATOM   3816  O  O    . SER B 2 62  ? 21.452  7.152   -12.700 1.00 0.00 ? 162 SER B O    2  
ATOM   3817  C  CB   . SER B 2 62  ? 21.489  5.692   -15.810 1.00 0.00 ? 162 SER B CB   2  
ATOM   3818  O  OG   . SER B 2 62  ? 21.696  7.038   -16.203 1.00 0.00 ? 162 SER B OG   2  
ATOM   3819  H  H    . SER B 2 62  ? 21.561  3.415   -14.702 1.00 0.00 ? 162 SER B H    2  
ATOM   3820  H  HA   . SER B 2 62  ? 22.921  5.816   -14.225 1.00 0.00 ? 162 SER B HA   2  
ATOM   3821  H  HB2  . SER B 2 62  ? 22.074  5.050   -16.451 1.00 0.00 ? 162 SER B HB2  2  
ATOM   3822  H  HB3  . SER B 2 62  ? 20.441  5.454   -15.921 1.00 0.00 ? 162 SER B HB3  2  
ATOM   3823  H  HG   . SER B 2 62  ? 21.854  7.074   -17.149 1.00 0.00 ? 162 SER B HG   2  
ATOM   3824  N  N    . GLY B 2 63  ? 19.708  5.947   -13.453 1.00 0.00 ? 163 GLY B N    2  
ATOM   3825  C  CA   . GLY B 2 63  ? 18.752  6.635   -12.609 1.00 0.00 ? 163 GLY B CA   2  
ATOM   3826  C  C    . GLY B 2 63  ? 18.351  7.983   -13.163 1.00 0.00 ? 163 GLY B C    2  
ATOM   3827  O  O    . GLY B 2 63  ? 19.199  8.829   -13.449 1.00 0.00 ? 163 GLY B O    2  
ATOM   3828  H  H    . GLY B 2 63  ? 19.402  5.233   -14.051 1.00 0.00 ? 163 GLY B H    2  
ATOM   3829  H  HA2  . GLY B 2 63  ? 17.869  6.023   -12.515 1.00 0.00 ? 163 GLY B HA2  2  
ATOM   3830  H  HA3  . GLY B 2 63  ? 19.181  6.775   -11.632 1.00 0.00 ? 163 GLY B HA3  2  
ATOM   3831  N  N    . LYS B 2 64  ? 17.048  8.175   -13.309 1.00 0.00 ? 164 LYS B N    2  
ATOM   3832  C  CA   . LYS B 2 64  ? 16.490  9.425   -13.830 1.00 0.00 ? 164 LYS B CA   2  
ATOM   3833  C  C    . LYS B 2 64  ? 17.277  9.933   -15.036 1.00 0.00 ? 164 LYS B C    2  
ATOM   3834  O  O    . LYS B 2 64  ? 17.351  11.138  -15.279 1.00 0.00 ? 164 LYS B O    2  
ATOM   3835  C  CB   . LYS B 2 64  ? 16.459  10.496  -12.736 1.00 0.00 ? 164 LYS B CB   2  
ATOM   3836  C  CG   . LYS B 2 64  ? 17.771  10.646  -11.982 1.00 0.00 ? 164 LYS B CG   2  
ATOM   3837  C  CD   . LYS B 2 64  ? 17.721  11.812  -11.008 1.00 0.00 ? 164 LYS B CD   2  
ATOM   3838  C  CE   . LYS B 2 64  ? 18.777  11.680  -9.921  1.00 0.00 ? 164 LYS B CE   2  
ATOM   3839  N  NZ   . LYS B 2 64  ? 19.742  12.813  -9.943  1.00 0.00 ? 164 LYS B NZ   2  
ATOM   3840  H  H    . LYS B 2 64  ? 16.442  7.451   -13.056 1.00 0.00 ? 164 LYS B H    2  
ATOM   3841  H  HA   . LYS B 2 64  ? 15.477  9.222   -14.144 1.00 0.00 ? 164 LYS B HA   2  
ATOM   3842  H  HB2  . LYS B 2 64  ? 16.219  11.447  -13.188 1.00 0.00 ? 164 LYS B HB2  2  
ATOM   3843  H  HB3  . LYS B 2 64  ? 15.688  10.242  -12.024 1.00 0.00 ? 164 LYS B HB3  2  
ATOM   3844  H  HG2  . LYS B 2 64  ? 17.965  9.738   -11.431 1.00 0.00 ? 164 LYS B HG2  2  
ATOM   3845  H  HG3  . LYS B 2 64  ? 18.565  10.816  -12.693 1.00 0.00 ? 164 LYS B HG3  2  
ATOM   3846  H  HD2  . LYS B 2 64  ? 17.894  12.730  -11.552 1.00 0.00 ? 164 LYS B HD2  2  
ATOM   3847  H  HD3  . LYS B 2 64  ? 16.744  11.843  -10.548 1.00 0.00 ? 164 LYS B HD3  2  
ATOM   3848  H  HE2  . LYS B 2 64  ? 18.284  11.657  -8.960  1.00 0.00 ? 164 LYS B HE2  2  
ATOM   3849  H  HE3  . LYS B 2 64  ? 19.316  10.756  -10.069 1.00 0.00 ? 164 LYS B HE3  2  
ATOM   3850  H  HZ1  . LYS B 2 64  ? 19.746  13.262  -10.881 1.00 0.00 ? 164 LYS B HZ1  2  
ATOM   3851  H  HZ2  . LYS B 2 64  ? 20.701  12.471  -9.732  1.00 0.00 ? 164 LYS B HZ2  2  
ATOM   3852  H  HZ3  . LYS B 2 64  ? 19.475  13.524  -9.232  1.00 0.00 ? 164 LYS B HZ3  2  
ATOM   3853  N  N    . SER B 2 65  ? 17.862  9.006   -15.791 1.00 0.00 ? 165 SER B N    2  
ATOM   3854  C  CA   . SER B 2 65  ? 18.642  9.355   -16.976 1.00 0.00 ? 165 SER B CA   2  
ATOM   3855  C  C    . SER B 2 65  ? 19.299  8.116   -17.575 1.00 0.00 ? 165 SER B C    2  
ATOM   3856  O  O    . SER B 2 65  ? 20.443  8.164   -18.029 1.00 0.00 ? 165 SER B O    2  
ATOM   3857  C  CB   . SER B 2 65  ? 19.711  10.395  -16.628 1.00 0.00 ? 165 SER B CB   2  
ATOM   3858  O  OG   . SER B 2 65  ? 19.219  11.713  -16.805 1.00 0.00 ? 165 SER B OG   2  
ATOM   3859  H  H    . SER B 2 65  ? 17.763  8.063   -15.546 1.00 0.00 ? 165 SER B H    2  
ATOM   3860  H  HA   . SER B 2 65  ? 17.965  9.777   -17.705 1.00 0.00 ? 165 SER B HA   2  
ATOM   3861  H  HB2  . SER B 2 65  ? 20.009  10.271  -15.597 1.00 0.00 ? 165 SER B HB2  2  
ATOM   3862  H  HB3  . SER B 2 65  ? 20.568  10.256  -17.270 1.00 0.00 ? 165 SER B HB3  2  
ATOM   3863  H  HG   . SER B 2 65  ? 18.832  11.797  -17.679 1.00 0.00 ? 165 SER B HG   2  
ATOM   3864  N  N    . CYS B 2 66  ? 18.569  7.005   -17.567 1.00 0.00 ? 166 CYS B N    2  
ATOM   3865  C  CA   . CYS B 2 66  ? 19.078  5.751   -18.101 1.00 0.00 ? 166 CYS B CA   2  
ATOM   3866  C  C    . CYS B 2 66  ? 18.689  5.569   -19.567 1.00 0.00 ? 166 CYS B C    2  
ATOM   3867  O  O    . CYS B 2 66  ? 18.782  4.467   -20.108 1.00 0.00 ? 166 CYS B O    2  
ATOM   3868  C  CB   . CYS B 2 66  ? 18.543  4.581   -17.279 1.00 0.00 ? 166 CYS B CB   2  
ATOM   3869  S  SG   . CYS B 2 66  ? 19.649  3.133   -17.237 1.00 0.00 ? 166 CYS B SG   2  
ATOM   3870  H  H    . CYS B 2 66  ? 17.670  7.027   -17.190 1.00 0.00 ? 166 CYS B H    2  
ATOM   3871  H  HA   . CYS B 2 66  ? 20.150  5.773   -18.024 1.00 0.00 ? 166 CYS B HA   2  
ATOM   3872  H  HB2  . CYS B 2 66  ? 18.394  4.906   -16.260 1.00 0.00 ? 166 CYS B HB2  2  
ATOM   3873  H  HB3  . CYS B 2 66  ? 17.598  4.263   -17.691 1.00 0.00 ? 166 CYS B HB3  2  
ATOM   3874  N  N    . GLN B 2 67  ? 18.249  6.651   -20.205 1.00 0.00 ? 167 GLN B N    2  
ATOM   3875  C  CA   . GLN B 2 67  ? 17.845  6.604   -21.607 1.00 0.00 ? 167 GLN B CA   2  
ATOM   3876  C  C    . GLN B 2 67  ? 16.523  5.853   -21.780 1.00 0.00 ? 167 GLN B C    2  
ATOM   3877  O  O    . GLN B 2 67  ? 16.076  5.629   -22.905 1.00 0.00 ? 167 GLN B O    2  
ATOM   3878  C  CB   . GLN B 2 67  ? 18.933  5.945   -22.459 1.00 0.00 ? 167 GLN B CB   2  
ATOM   3879  C  CG   . GLN B 2 67  ? 20.336  6.437   -22.144 1.00 0.00 ? 167 GLN B CG   2  
ATOM   3880  C  CD   . GLN B 2 67  ? 20.512  7.917   -22.422 1.00 0.00 ? 167 GLN B CD   2  
ATOM   3881  O  OE1  . GLN B 2 67  ? 20.964  8.672   -21.560 1.00 0.00 ? 167 GLN B OE1  2  
ATOM   3882  N  NE2  . GLN B 2 67  ? 20.154  8.339   -23.629 1.00 0.00 ? 167 GLN B NE2  2  
ATOM   3883  H  H    . GLN B 2 67  ? 18.195  7.501   -19.722 1.00 0.00 ? 167 GLN B H    2  
ATOM   3884  H  HA   . GLN B 2 67  ? 17.708  7.621   -21.942 1.00 0.00 ? 167 GLN B HA   2  
ATOM   3885  H  HB2  . GLN B 2 67  ? 18.903  4.877   -22.299 1.00 0.00 ? 167 GLN B HB2  2  
ATOM   3886  H  HB3  . GLN B 2 67  ? 18.729  6.149   -23.501 1.00 0.00 ? 167 GLN B HB3  2  
ATOM   3887  H  HG2  . GLN B 2 67  ? 20.540  6.256   -21.099 1.00 0.00 ? 167 GLN B HG2  2  
ATOM   3888  H  HG3  . GLN B 2 67  ? 21.041  5.885   -22.748 1.00 0.00 ? 167 GLN B HG3  2  
ATOM   3889  H  HE21 . GLN B 2 67  ? 19.802  7.681   -24.264 1.00 0.00 ? 167 GLN B HE21 2  
ATOM   3890  H  HE22 . GLN B 2 67  ? 20.258  9.292   -23.835 1.00 0.00 ? 167 GLN B HE22 2  
ATOM   3891  N  N    . VAL B 2 68  ? 15.898  5.467   -20.669 1.00 0.00 ? 168 VAL B N    2  
ATOM   3892  C  CA   . VAL B 2 68  ? 14.644  4.756   -20.708 1.00 0.00 ? 168 VAL B CA   2  
ATOM   3893  C  C    . VAL B 2 68  ? 13.621  5.464   -19.837 1.00 0.00 ? 168 VAL B C    2  
ATOM   3894  O  O    . VAL B 2 68  ? 13.860  5.732   -18.659 1.00 0.00 ? 168 VAL B O    2  
ATOM   3895  C  CB   . VAL B 2 68  ? 14.824  3.320   -20.214 1.00 0.00 ? 168 VAL B CB   2  
ATOM   3896  C  CG1  . VAL B 2 68  ? 13.514  2.548   -20.284 1.00 0.00 ? 168 VAL B CG1  2  
ATOM   3897  C  CG2  . VAL B 2 68  ? 15.914  2.616   -21.009 1.00 0.00 ? 168 VAL B CG2  2  
ATOM   3898  H  H    . VAL B 2 68  ? 16.283  5.666   -19.797 1.00 0.00 ? 168 VAL B H    2  
ATOM   3899  H  HA   . VAL B 2 68  ? 14.295  4.733   -21.729 1.00 0.00 ? 168 VAL B HA   2  
ATOM   3900  H  HB   . VAL B 2 68  ? 15.136  3.374   -19.187 1.00 0.00 ? 168 VAL B HB   2  
ATOM   3901  H  HG11 . VAL B 2 68  ? 12.843  3.040   -20.974 1.00 0.00 ? 168 VAL B HG11 2  
ATOM   3902  H  HG12 . VAL B 2 68  ? 13.062  2.516   -19.304 1.00 0.00 ? 168 VAL B HG12 2  
ATOM   3903  H  HG13 . VAL B 2 68  ? 13.705  1.542   -20.624 1.00 0.00 ? 168 VAL B HG13 2  
ATOM   3904  H  HG21 . VAL B 2 68  ? 16.849  2.679   -20.471 1.00 0.00 ? 168 VAL B HG21 2  
ATOM   3905  H  HG22 . VAL B 2 68  ? 16.020  3.090   -21.973 1.00 0.00 ? 168 VAL B HG22 2  
ATOM   3906  H  HG23 . VAL B 2 68  ? 15.647  1.578   -21.144 1.00 0.00 ? 168 VAL B HG23 2  
ATOM   3907  N  N    . ALA B 2 69  ? 12.491  5.770   -20.433 1.00 0.00 ? 169 ALA B N    2  
ATOM   3908  C  CA   . ALA B 2 69  ? 11.413  6.462   -19.737 1.00 0.00 ? 169 ALA B CA   2  
ATOM   3909  C  C    . ALA B 2 69  ? 10.791  5.576   -18.667 1.00 0.00 ? 169 ALA B C    2  
ATOM   3910  O  O    . ALA B 2 69  ? 10.654  5.981   -17.513 1.00 0.00 ? 169 ALA B O    2  
ATOM   3911  C  CB   . ALA B 2 69  ? 10.351  6.911   -20.729 1.00 0.00 ? 169 ALA B CB   2  
ATOM   3912  H  H    . ALA B 2 69  ? 12.382  5.529   -21.369 1.00 0.00 ? 169 ALA B H    2  
ATOM   3913  H  HA   . ALA B 2 69  ? 11.828  7.341   -19.267 1.00 0.00 ? 169 ALA B HA   2  
ATOM   3914  H  HB1  . ALA B 2 69  ? 10.756  7.685   -21.365 1.00 0.00 ? 169 ALA B HB1  2  
ATOM   3915  H  HB2  . ALA B 2 69  ? 9.496   7.297   -20.192 1.00 0.00 ? 169 ALA B HB2  2  
ATOM   3916  H  HB3  . ALA B 2 69  ? 10.045  6.071   -21.335 1.00 0.00 ? 169 ALA B HB3  2  
ATOM   3917  N  N    . HIS B 2 70  ? 10.407  4.371   -19.063 1.00 0.00 ? 170 HIS B N    2  
ATOM   3918  C  CA   . HIS B 2 70  ? 9.788   3.428   -18.152 1.00 0.00 ? 170 HIS B CA   2  
ATOM   3919  C  C    . HIS B 2 70  ? 10.749  2.980   -17.054 1.00 0.00 ? 170 HIS B C    2  
ATOM   3920  O  O    . HIS B 2 70  ? 10.327  2.376   -16.069 1.00 0.00 ? 170 HIS B O    2  
ATOM   3921  C  CB   . HIS B 2 70  ? 9.266   2.219   -18.926 1.00 0.00 ? 170 HIS B CB   2  
ATOM   3922  C  CG   . HIS B 2 70  ? 8.113   2.549   -19.823 1.00 0.00 ? 170 HIS B CG   2  
ATOM   3923  N  ND1  . HIS B 2 70  ? 6.910   3.033   -19.352 1.00 0.00 ? 170 HIS B ND1  2  
ATOM   3924  C  CD2  . HIS B 2 70  ? 7.987   2.478   -21.169 1.00 0.00 ? 170 HIS B CD2  2  
ATOM   3925  C  CE1  . HIS B 2 70  ? 6.094   3.243   -20.369 1.00 0.00 ? 170 HIS B CE1  2  
ATOM   3926  N  NE2  . HIS B 2 70  ? 6.724   2.915   -21.483 1.00 0.00 ? 170 HIS B NE2  2  
ATOM   3927  H  H    . HIS B 2 70  ? 10.532  4.113   -19.994 1.00 0.00 ? 170 HIS B H    2  
ATOM   3928  H  HA   . HIS B 2 70  ? 8.954   3.929   -17.698 1.00 0.00 ? 170 HIS B HA   2  
ATOM   3929  H  HB2  . HIS B 2 70  ? 10.060  1.819   -19.538 1.00 0.00 ? 170 HIS B HB2  2  
ATOM   3930  H  HB3  . HIS B 2 70  ? 8.939   1.464   -18.226 1.00 0.00 ? 170 HIS B HB3  2  
ATOM   3931  H  HD1  . HIS B 2 70  ? 6.686   3.196   -18.413 1.00 0.00 ? 170 HIS B HD1  2  
ATOM   3932  H  HD2  . HIS B 2 70  ? 8.740   2.140   -21.866 1.00 0.00 ? 170 HIS B HD2  2  
ATOM   3933  H  HE1  . HIS B 2 70  ? 5.083   3.619   -20.302 1.00 0.00 ? 170 HIS B HE1  2  
ATOM   3934  H  HE2  . HIS B 2 70  ? 6.384   3.066   -22.390 1.00 0.00 ? 170 HIS B HE2  2  
ATOM   3935  N  N    . CYS B 2 71  ? 12.039  3.277   -17.212 1.00 0.00 ? 171 CYS B N    2  
ATOM   3936  C  CA   . CYS B 2 71  ? 13.024  2.891   -16.209 1.00 0.00 ? 171 CYS B CA   2  
ATOM   3937  C  C    . CYS B 2 71  ? 12.980  3.838   -15.024 1.00 0.00 ? 171 CYS B C    2  
ATOM   3938  O  O    . CYS B 2 71  ? 12.560  3.470   -13.927 1.00 0.00 ? 171 CYS B O    2  
ATOM   3939  C  CB   . CYS B 2 71  ? 14.425  2.893   -16.809 1.00 0.00 ? 171 CYS B CB   2  
ATOM   3940  S  SG   . CYS B 2 71  ? 15.619  1.862   -15.901 1.00 0.00 ? 171 CYS B SG   2  
ATOM   3941  H  H    . CYS B 2 71  ? 12.336  3.767   -18.013 1.00 0.00 ? 171 CYS B H    2  
ATOM   3942  H  HA   . CYS B 2 71  ? 12.785  1.897   -15.871 1.00 0.00 ? 171 CYS B HA   2  
ATOM   3943  H  HB2  . CYS B 2 71  ? 14.370  2.526   -17.815 1.00 0.00 ? 171 CYS B HB2  2  
ATOM   3944  H  HB3  . CYS B 2 71  ? 14.807  3.902   -16.825 1.00 0.00 ? 171 CYS B HB3  2  
ATOM   3945  N  N    . ALA B 2 72  ? 13.419  5.063   -15.262 1.00 0.00 ? 172 ALA B N    2  
ATOM   3946  C  CA   . ALA B 2 72  ? 13.437  6.087   -14.224 1.00 0.00 ? 172 ALA B CA   2  
ATOM   3947  C  C    . ALA B 2 72  ? 12.057  6.259   -13.598 1.00 0.00 ? 172 ALA B C    2  
ATOM   3948  O  O    . ALA B 2 72  ? 11.924  6.361   -12.378 1.00 0.00 ? 172 ALA B O    2  
ATOM   3949  C  CB   . ALA B 2 72  ? 13.930  7.407   -14.794 1.00 0.00 ? 172 ALA B CB   2  
ATOM   3950  H  H    . ALA B 2 72  ? 13.739  5.281   -16.163 1.00 0.00 ? 172 ALA B H    2  
ATOM   3951  H  HA   . ALA B 2 72  ? 14.132  5.771   -13.458 1.00 0.00 ? 172 ALA B HA   2  
ATOM   3952  H  HB1  . ALA B 2 72  ? 13.682  8.208   -14.113 1.00 0.00 ? 172 ALA B HB1  2  
ATOM   3953  H  HB2  . ALA B 2 72  ? 13.456  7.586   -15.748 1.00 0.00 ? 172 ALA B HB2  2  
ATOM   3954  H  HB3  . ALA B 2 72  ? 15.000  7.365   -14.927 1.00 0.00 ? 172 ALA B HB3  2  
ATOM   3955  N  N    . SER B 2 73  ? 11.031  6.288   -14.442 1.00 0.00 ? 173 SER B N    2  
ATOM   3956  C  CA   . SER B 2 73  ? 9.661   6.444   -13.971 1.00 0.00 ? 173 SER B CA   2  
ATOM   3957  C  C    . SER B 2 73  ? 9.262   5.279   -13.071 1.00 0.00 ? 173 SER B C    2  
ATOM   3958  O  O    . SER B 2 73  ? 8.818   5.479   -11.941 1.00 0.00 ? 173 SER B O    2  
ATOM   3959  C  CB   . SER B 2 73  ? 8.699   6.543   -15.157 1.00 0.00 ? 173 SER B CB   2  
ATOM   3960  O  OG   . SER B 2 73  ? 7.656   7.465   -14.892 1.00 0.00 ? 173 SER B OG   2  
ATOM   3961  H  H    . SER B 2 73  ? 11.200  6.199   -15.403 1.00 0.00 ? 173 SER B H    2  
ATOM   3962  H  HA   . SER B 2 73  ? 9.609   7.358   -13.400 1.00 0.00 ? 173 SER B HA   2  
ATOM   3963  H  HB2  . SER B 2 73  ? 9.241   6.874   -16.030 1.00 0.00 ? 173 SER B HB2  2  
ATOM   3964  H  HB3  . SER B 2 73  ? 8.266   5.573   -15.349 1.00 0.00 ? 173 SER B HB3  2  
ATOM   3965  H  HG   . SER B 2 73  ? 8.023   8.257   -14.490 1.00 0.00 ? 173 SER B HG   2  
ATOM   3966  N  N    . SER B 2 74  ? 9.430   4.060   -13.577 1.00 0.00 ? 174 SER B N    2  
ATOM   3967  C  CA   . SER B 2 74  ? 9.093   2.865   -12.813 1.00 0.00 ? 174 SER B CA   2  
ATOM   3968  C  C    . SER B 2 74  ? 9.928   2.787   -11.541 1.00 0.00 ? 174 SER B C    2  
ATOM   3969  O  O    . SER B 2 74  ? 9.475   2.275   -10.518 1.00 0.00 ? 174 SER B O    2  
ATOM   3970  C  CB   . SER B 2 74  ? 9.312   1.609   -13.659 1.00 0.00 ? 174 SER B CB   2  
ATOM   3971  O  OG   . SER B 2 74  ? 8.986   0.438   -12.930 1.00 0.00 ? 174 SER B OG   2  
ATOM   3972  H  H    . SER B 2 74  ? 9.792   3.962   -14.482 1.00 0.00 ? 174 SER B H    2  
ATOM   3973  H  HA   . SER B 2 74  ? 8.049   2.928   -12.539 1.00 0.00 ? 174 SER B HA   2  
ATOM   3974  H  HB2  . SER B 2 74  ? 8.685   1.656   -14.537 1.00 0.00 ? 174 SER B HB2  2  
ATOM   3975  H  HB3  . SER B 2 74  ? 10.348  1.556   -13.958 1.00 0.00 ? 174 SER B HB3  2  
ATOM   3976  H  HG   . SER B 2 74  ? 9.599   0.336   -12.199 1.00 0.00 ? 174 SER B HG   2  
ATOM   3977  N  N    . ARG B 2 75  ? 11.153  3.302   -11.612 1.00 0.00 ? 175 ARG B N    2  
ATOM   3978  C  CA   . ARG B 2 75  ? 12.051  3.296   -10.464 1.00 0.00 ? 175 ARG B CA   2  
ATOM   3979  C  C    . ARG B 2 75  ? 11.414  4.018   -9.280  1.00 0.00 ? 175 ARG B C    2  
ATOM   3980  O  O    . ARG B 2 75  ? 11.407  3.508   -8.161  1.00 0.00 ? 175 ARG B O    2  
ATOM   3981  C  CB   . ARG B 2 75  ? 13.383  3.958   -10.830 1.00 0.00 ? 175 ARG B CB   2  
ATOM   3982  C  CG   . ARG B 2 75  ? 14.360  4.051   -9.668  1.00 0.00 ? 175 ARG B CG   2  
ATOM   3983  C  CD   . ARG B 2 75  ? 14.833  2.676   -9.224  1.00 0.00 ? 175 ARG B CD   2  
ATOM   3984  N  NE   . ARG B 2 75  ? 15.516  1.958   -10.298 1.00 0.00 ? 175 ARG B NE   2  
ATOM   3985  C  CZ   . ARG B 2 75  ? 16.732  2.268   -10.742 1.00 0.00 ? 175 ARG B CZ   2  
ATOM   3986  N  NH1  . ARG B 2 75  ? 17.401  3.284   -10.209 1.00 0.00 ? 175 ARG B NH1  2  
ATOM   3987  N  NH2  . ARG B 2 75  ? 17.282  1.562   -11.720 1.00 0.00 ? 175 ARG B NH2  2  
ATOM   3988  H  H    . ARG B 2 75  ? 11.456  3.700   -12.455 1.00 0.00 ? 175 ARG B H    2  
ATOM   3989  H  HA   . ARG B 2 75  ? 12.232  2.268   -10.190 1.00 0.00 ? 175 ARG B HA   2  
ATOM   3990  H  HB2  . ARG B 2 75  ? 13.849  3.388   -11.619 1.00 0.00 ? 175 ARG B HB2  2  
ATOM   3991  H  HB3  . ARG B 2 75  ? 13.186  4.958   -11.187 1.00 0.00 ? 175 ARG B HB3  2  
ATOM   3992  H  HG2  . ARG B 2 75  ? 15.216  4.631   -9.978  1.00 0.00 ? 175 ARG B HG2  2  
ATOM   3993  H  HG3  . ARG B 2 75  ? 13.872  4.539   -8.839  1.00 0.00 ? 175 ARG B HG3  2  
ATOM   3994  H  HD2  . ARG B 2 75  ? 15.513  2.793   -8.395  1.00 0.00 ? 175 ARG B HD2  2  
ATOM   3995  H  HD3  . ARG B 2 75  ? 13.976  2.100   -8.908  1.00 0.00 ? 175 ARG B HD3  2  
ATOM   3996  H  HE   . ARG B 2 75  ? 15.045  1.203   -10.709 1.00 0.00 ? 175 ARG B HE   2  
ATOM   3997  H  HH11 . ARG B 2 75  ? 16.993  3.820   -9.471  1.00 0.00 ? 175 ARG B HH11 2  
ATOM   3998  H  HH12 . ARG B 2 75  ? 18.314  3.512   -10.548 1.00 0.00 ? 175 ARG B HH12 2  
ATOM   3999  H  HH21 . ARG B 2 75  ? 16.782  0.795   -12.124 1.00 0.00 ? 175 ARG B HH21 2  
ATOM   4000  H  HH22 . ARG B 2 75  ? 18.194  1.796   -12.054 1.00 0.00 ? 175 ARG B HH22 2  
ATOM   4001  N  N    . GLN B 2 76  ? 10.878  5.207   -9.540  1.00 0.00 ? 176 GLN B N    2  
ATOM   4002  C  CA   . GLN B 2 76  ? 10.237  5.999   -8.497  1.00 0.00 ? 176 GLN B CA   2  
ATOM   4003  C  C    . GLN B 2 76  ? 8.983   5.305   -7.975  1.00 0.00 ? 176 GLN B C    2  
ATOM   4004  O  O    . GLN B 2 76  ? 8.725   5.296   -6.772  1.00 0.00 ? 176 GLN B O    2  
ATOM   4005  C  CB   . GLN B 2 76  ? 9.878   7.387   -9.033  1.00 0.00 ? 176 GLN B CB   2  
ATOM   4006  C  CG   . GLN B 2 76  ? 11.089  8.263   -9.310  1.00 0.00 ? 176 GLN B CG   2  
ATOM   4007  C  CD   . GLN B 2 76  ? 11.413  9.190   -8.155  1.00 0.00 ? 176 GLN B CD   2  
ATOM   4008  O  OE1  . GLN B 2 76  ? 10.575  9.434   -7.286  1.00 0.00 ? 176 GLN B OE1  2  
ATOM   4009  N  NE2  . GLN B 2 76  ? 12.633  9.713   -8.139  1.00 0.00 ? 176 GLN B NE2  2  
ATOM   4010  H  H    . GLN B 2 76  ? 10.915  5.558   -10.455 1.00 0.00 ? 176 GLN B H    2  
ATOM   4011  H  HA   . GLN B 2 76  ? 10.939  6.108   -7.686  1.00 0.00 ? 176 GLN B HA   2  
ATOM   4012  H  HB2  . GLN B 2 76  ? 9.324   7.273   -9.954  1.00 0.00 ? 176 GLN B HB2  2  
ATOM   4013  H  HB3  . GLN B 2 76  ? 9.255   7.889   -8.309  1.00 0.00 ? 176 GLN B HB3  2  
ATOM   4014  H  HG2  . GLN B 2 76  ? 11.943  7.629   -9.492  1.00 0.00 ? 176 GLN B HG2  2  
ATOM   4015  H  HG3  . GLN B 2 76  ? 10.891  8.861   -10.188 1.00 0.00 ? 176 GLN B HG3  2  
ATOM   4016  H  HE21 . GLN B 2 76  ? 13.248  9.474   -8.864  1.00 0.00 ? 176 GLN B HE21 2  
ATOM   4017  H  HE22 . GLN B 2 76  ? 12.869  10.316  -7.404  1.00 0.00 ? 176 GLN B HE22 2  
ATOM   4018  N  N    . ILE B 2 77  ? 8.207   4.722   -8.886  1.00 0.00 ? 177 ILE B N    2  
ATOM   4019  C  CA   . ILE B 2 77  ? 6.980   4.023   -8.517  1.00 0.00 ? 177 ILE B CA   2  
ATOM   4020  C  C    . ILE B 2 77  ? 7.237   3.002   -7.411  1.00 0.00 ? 177 ILE B C    2  
ATOM   4021  O  O    . ILE B 2 77  ? 6.769   3.162   -6.283  1.00 0.00 ? 177 ILE B O    2  
ATOM   4022  C  CB   . ILE B 2 77  ? 6.356   3.305   -9.734  1.00 0.00 ? 177 ILE B CB   2  
ATOM   4023  C  CG1  . ILE B 2 77  ? 6.019   4.314   -10.835 1.00 0.00 ? 177 ILE B CG1  2  
ATOM   4024  C  CG2  . ILE B 2 77  ? 5.114   2.523   -9.322  1.00 0.00 ? 177 ILE B CG2  2  
ATOM   4025  C  CD1  . ILE B 2 77  ? 4.801   5.165   -10.532 1.00 0.00 ? 177 ILE B CD1  2  
ATOM   4026  H  H    . ILE B 2 77  ? 8.468   4.764   -9.830  1.00 0.00 ? 177 ILE B H    2  
ATOM   4027  H  HA   . ILE B 2 77  ? 6.273   4.757   -8.158  1.00 0.00 ? 177 ILE B HA   2  
ATOM   4028  H  HB   . ILE B 2 77  ? 7.080   2.600   -10.115 1.00 0.00 ? 177 ILE B HB   2  
ATOM   4029  H  HG12 . ILE B 2 77  ? 6.858   4.979   -10.975 1.00 0.00 ? 177 ILE B HG12 2  
ATOM   4030  H  HG13 . ILE B 2 77  ? 5.831   3.782   -11.756 1.00 0.00 ? 177 ILE B HG13 2  
ATOM   4031  H  HG21 . ILE B 2 77  ? 4.413   3.189   -8.839  1.00 0.00 ? 177 ILE B HG21 2  
ATOM   4032  H  HG22 . ILE B 2 77  ? 5.393   1.737   -8.637  1.00 0.00 ? 177 ILE B HG22 2  
ATOM   4033  H  HG23 . ILE B 2 77  ? 4.653   2.091   -10.199 1.00 0.00 ? 177 ILE B HG23 2  
ATOM   4034  H  HD11 . ILE B 2 77  ? 4.856   5.522   -9.514  1.00 0.00 ? 177 ILE B HD11 2  
ATOM   4035  H  HD12 . ILE B 2 77  ? 3.908   4.571   -10.658 1.00 0.00 ? 177 ILE B HD12 2  
ATOM   4036  H  HD13 . ILE B 2 77  ? 4.773   6.006   -11.208 1.00 0.00 ? 177 ILE B HD13 2  
ATOM   4037  N  N    . ILE B 2 78  ? 7.980   1.955   -7.747  1.00 0.00 ? 178 ILE B N    2  
ATOM   4038  C  CA   . ILE B 2 78  ? 8.298   0.903   -6.787  1.00 0.00 ? 178 ILE B CA   2  
ATOM   4039  C  C    . ILE B 2 78  ? 9.104   1.452   -5.613  1.00 0.00 ? 178 ILE B C    2  
ATOM   4040  O  O    . ILE B 2 78  ? 8.813   1.154   -4.453  1.00 0.00 ? 178 ILE B O    2  
ATOM   4041  C  CB   . ILE B 2 78  ? 9.083   -0.241  -7.454  1.00 0.00 ? 178 ILE B CB   2  
ATOM   4042  C  CG1  . ILE B 2 78  ? 8.333   -0.750  -8.686  1.00 0.00 ? 178 ILE B CG1  2  
ATOM   4043  C  CG2  . ILE B 2 78  ? 9.318   -1.375  -6.465  1.00 0.00 ? 178 ILE B CG2  2  
ATOM   4044  C  CD1  . ILE B 2 78  ? 9.043   -1.876  -9.406  1.00 0.00 ? 178 ILE B CD1  2  
ATOM   4045  H  H    . ILE B 2 78  ? 8.321   1.886   -8.662  1.00 0.00 ? 178 ILE B H    2  
ATOM   4046  H  HA   . ILE B 2 78  ? 7.368   0.502   -6.413  1.00 0.00 ? 178 ILE B HA   2  
ATOM   4047  H  HB   . ILE B 2 78  ? 10.045  0.142   -7.759  1.00 0.00 ? 178 ILE B HB   2  
ATOM   4048  H  HG12 . ILE B 2 78  ? 7.362   -1.111  -8.384  1.00 0.00 ? 178 ILE B HG12 2  
ATOM   4049  H  HG13 . ILE B 2 78  ? 8.208   0.065   -9.385  1.00 0.00 ? 178 ILE B HG13 2  
ATOM   4050  H  HG21 . ILE B 2 78  ? 10.103  -1.096  -5.777  1.00 0.00 ? 178 ILE B HG21 2  
ATOM   4051  H  HG22 . ILE B 2 78  ? 9.608   -2.266  -7.001  1.00 0.00 ? 178 ILE B HG22 2  
ATOM   4052  H  HG23 . ILE B 2 78  ? 8.409   -1.566  -5.915  1.00 0.00 ? 178 ILE B HG23 2  
ATOM   4053  H  HD11 . ILE B 2 78  ? 8.853   -1.801  -10.467 1.00 0.00 ? 178 ILE B HD11 2  
ATOM   4054  H  HD12 . ILE B 2 78  ? 8.678   -2.824  -9.040  1.00 0.00 ? 178 ILE B HD12 2  
ATOM   4055  H  HD13 . ILE B 2 78  ? 10.105  -1.805  -9.226  1.00 0.00 ? 178 ILE B HD13 2  
ATOM   4056  N  N    . SER B 2 79  ? 10.117  2.260   -5.918  1.00 0.00 ? 179 SER B N    2  
ATOM   4057  C  CA   . SER B 2 79  ? 10.960  2.852   -4.883  1.00 0.00 ? 179 SER B CA   2  
ATOM   4058  C  C    . SER B 2 79  ? 10.110  3.570   -3.841  1.00 0.00 ? 179 SER B C    2  
ATOM   4059  O  O    . SER B 2 79  ? 10.260  3.348   -2.639  1.00 0.00 ? 179 SER B O    2  
ATOM   4060  C  CB   . SER B 2 79  ? 11.959  3.829   -5.505  1.00 0.00 ? 179 SER B CB   2  
ATOM   4061  O  OG   . SER B 2 79  ? 12.949  3.142   -6.251  1.00 0.00 ? 179 SER B OG   2  
ATOM   4062  H  H    . SER B 2 79  ? 10.300  2.464   -6.859  1.00 0.00 ? 179 SER B H    2  
ATOM   4063  H  HA   . SER B 2 79  ? 11.503  2.053   -4.400  1.00 0.00 ? 179 SER B HA   2  
ATOM   4064  H  HB2  . SER B 2 79  ? 11.436  4.507   -6.162  1.00 0.00 ? 179 SER B HB2  2  
ATOM   4065  H  HB3  . SER B 2 79  ? 12.443  4.391   -4.721  1.00 0.00 ? 179 SER B HB3  2  
ATOM   4066  H  HG   . SER B 2 79  ? 12.528  2.624   -6.942  1.00 0.00 ? 179 SER B HG   2  
ATOM   4067  N  N    . HIS B 2 80  ? 9.207   4.425   -4.313  1.00 0.00 ? 180 HIS B N    2  
ATOM   4068  C  CA   . HIS B 2 80  ? 8.319   5.172   -3.428  1.00 0.00 ? 180 HIS B CA   2  
ATOM   4069  C  C    . HIS B 2 80  ? 7.586   4.217   -2.486  1.00 0.00 ? 180 HIS B C    2  
ATOM   4070  O  O    . HIS B 2 80  ? 7.584   4.403   -1.271  1.00 0.00 ? 180 HIS B O    2  
ATOM   4071  C  CB   . HIS B 2 80  ? 7.312   5.979   -4.265  1.00 0.00 ? 180 HIS B CB   2  
ATOM   4072  C  CG   . HIS B 2 80  ? 5.968   6.164   -3.620  1.00 0.00 ? 180 HIS B CG   2  
ATOM   4073  N  ND1  . HIS B 2 80  ? 5.505   7.369   -3.145  1.00 0.00 ? 180 HIS B ND1  2  
ATOM   4074  C  CD2  . HIS B 2 80  ? 4.977   5.263   -3.383  1.00 0.00 ? 180 HIS B CD2  2  
ATOM   4075  C  CE1  . HIS B 2 80  ? 4.278   7.173   -2.645  1.00 0.00 ? 180 HIS B CE1  2  
ATOM   4076  N  NE2  . HIS B 2 80  ? 3.910   5.911   -2.765  1.00 0.00 ? 180 HIS B NE2  2  
ATOM   4077  H  H    . HIS B 2 80  ? 9.131   4.552   -5.282  1.00 0.00 ? 180 HIS B H    2  
ATOM   4078  H  HA   . HIS B 2 80  ? 8.925   5.853   -2.846  1.00 0.00 ? 180 HIS B HA   2  
ATOM   4079  H  HB2  . HIS B 2 80  ? 7.722   6.959   -4.453  1.00 0.00 ? 180 HIS B HB2  2  
ATOM   4080  H  HB3  . HIS B 2 80  ? 7.160   5.475   -5.208  1.00 0.00 ? 180 HIS B HB3  2  
ATOM   4081  H  HD1  . HIS B 2 80  ? 5.989   8.222   -3.167  1.00 0.00 ? 180 HIS B HD1  2  
ATOM   4082  H  HD2  . HIS B 2 80  ? 5.001   4.208   -3.629  1.00 0.00 ? 180 HIS B HD2  2  
ATOM   4083  H  HE1  . HIS B 2 80  ? 3.668   7.949   -2.204  1.00 0.00 ? 180 HIS B HE1  2  
ATOM   4084  N  N    . TRP B 2 81  ? 6.963   3.200   -3.072  1.00 0.00 ? 181 TRP B N    2  
ATOM   4085  C  CA   . TRP B 2 81  ? 6.211   2.200   -2.317  1.00 0.00 ? 181 TRP B CA   2  
ATOM   4086  C  C    . TRP B 2 81  ? 6.951   1.767   -1.055  1.00 0.00 ? 181 TRP B C    2  
ATOM   4087  O  O    . TRP B 2 81  ? 6.500   2.019   0.063   1.00 0.00 ? 181 TRP B O    2  
ATOM   4088  C  CB   . TRP B 2 81  ? 5.965   0.978   -3.196  1.00 0.00 ? 181 TRP B CB   2  
ATOM   4089  C  CG   . TRP B 2 81  ? 5.130   -0.074  -2.536  1.00 0.00 ? 181 TRP B CG   2  
ATOM   4090  C  CD1  . TRP B 2 81  ? 5.550   -1.034  -1.660  1.00 0.00 ? 181 TRP B CD1  2  
ATOM   4091  C  CD2  . TRP B 2 81  ? 3.727   -0.271  -2.705  1.00 0.00 ? 181 TRP B CD2  2  
ATOM   4092  N  NE1  . TRP B 2 81  ? 4.487   -1.817  -1.276  1.00 0.00 ? 181 TRP B NE1  2  
ATOM   4093  C  CE2  . TRP B 2 81  ? 3.356   -1.367  -1.905  1.00 0.00 ? 181 TRP B CE2  2  
ATOM   4094  C  CE3  . TRP B 2 81  ? 2.750   0.378   -3.457  1.00 0.00 ? 181 TRP B CE3  2  
ATOM   4095  C  CZ2  . TRP B 2 81  ? 2.043   -1.828  -1.839  1.00 0.00 ? 181 TRP B CZ2  2  
ATOM   4096  C  CZ3  . TRP B 2 81  ? 1.449   -0.078  -3.393  1.00 0.00 ? 181 TRP B CZ3  2  
ATOM   4097  C  CH2  . TRP B 2 81  ? 1.105   -1.172  -2.590  1.00 0.00 ? 181 TRP B CH2  2  
ATOM   4098  H  H    . TRP B 2 81  ? 7.006   3.119   -4.048  1.00 0.00 ? 181 TRP B H    2  
ATOM   4099  H  HA   . TRP B 2 81  ? 5.259   2.628   -2.043  1.00 0.00 ? 181 TRP B HA   2  
ATOM   4100  H  HB2  . TRP B 2 81  ? 5.460   1.290   -4.095  1.00 0.00 ? 181 TRP B HB2  2  
ATOM   4101  H  HB3  . TRP B 2 81  ? 6.913   0.540   -3.458  1.00 0.00 ? 181 TRP B HB3  2  
ATOM   4102  H  HD1  . TRP B 2 81  ? 6.571   -1.149  -1.327  1.00 0.00 ? 181 TRP B HD1  2  
ATOM   4103  H  HE1  . TRP B 2 81  ? 4.532   -2.572  -0.653  1.00 0.00 ? 181 TRP B HE1  2  
ATOM   4104  H  HE3  . TRP B 2 81  ? 3.000   1.226   -4.078  1.00 0.00 ? 181 TRP B HE3  2  
ATOM   4105  H  HZ2  . TRP B 2 81  ? 1.762   -2.669  -1.224  1.00 0.00 ? 181 TRP B HZ2  2  
ATOM   4106  H  HZ3  . TRP B 2 81  ? 0.683   0.407   -3.973  1.00 0.00 ? 181 TRP B HZ3  2  
ATOM   4107  H  HH2  . TRP B 2 81  ? 0.073   -1.493  -2.571  1.00 0.00 ? 181 TRP B HH2  2  
ATOM   4108  N  N    . LYS B 2 82  ? 8.083   1.105   -1.251  1.00 0.00 ? 182 LYS B N    2  
ATOM   4109  C  CA   . LYS B 2 82  ? 8.892   0.616   -0.138  1.00 0.00 ? 182 LYS B CA   2  
ATOM   4110  C  C    . LYS B 2 82  ? 9.373   1.759   0.754   1.00 0.00 ? 182 LYS B C    2  
ATOM   4111  O  O    . LYS B 2 82  ? 9.760   1.536   1.901   1.00 0.00 ? 182 LYS B O    2  
ATOM   4112  C  CB   . LYS B 2 82  ? 10.093  -0.170  -0.665  1.00 0.00 ? 182 LYS B CB   2  
ATOM   4113  C  CG   . LYS B 2 82  ? 10.844  -0.933  0.416   1.00 0.00 ? 182 LYS B CG   2  
ATOM   4114  C  CD   . LYS B 2 82  ? 10.433  -2.396  0.455   1.00 0.00 ? 182 LYS B CD   2  
ATOM   4115  C  CE   . LYS B 2 82  ? 10.952  -3.087  1.706   1.00 0.00 ? 182 LYS B CE   2  
ATOM   4116  N  NZ   . LYS B 2 82  ? 12.426  -3.293  1.654   1.00 0.00 ? 182 LYS B NZ   2  
ATOM   4117  H  H    . LYS B 2 82  ? 8.378   0.930   -2.171  1.00 0.00 ? 182 LYS B H    2  
ATOM   4118  H  HA   . LYS B 2 82  ? 8.275   -0.045  0.451   1.00 0.00 ? 182 LYS B HA   2  
ATOM   4119  H  HB2  . LYS B 2 82  ? 9.748   -0.880  -1.402  1.00 0.00 ? 182 LYS B HB2  2  
ATOM   4120  H  HB3  . LYS B 2 82  ? 10.781  0.517   -1.133  1.00 0.00 ? 182 LYS B HB3  2  
ATOM   4121  H  HG2  . LYS B 2 82  ? 11.903  -0.873  0.215   1.00 0.00 ? 182 LYS B HG2  2  
ATOM   4122  H  HG3  . LYS B 2 82  ? 10.631  -0.483  1.375   1.00 0.00 ? 182 LYS B HG3  2  
ATOM   4123  H  HD2  . LYS B 2 82  ? 9.354   -2.457  0.444   1.00 0.00 ? 182 LYS B HD2  2  
ATOM   4124  H  HD3  . LYS B 2 82  ? 10.832  -2.895  -0.415  1.00 0.00 ? 182 LYS B HD3  2  
ATOM   4125  H  HE2  . LYS B 2 82  ? 10.713  -2.477  2.564   1.00 0.00 ? 182 LYS B HE2  2  
ATOM   4126  H  HE3  . LYS B 2 82  ? 10.465  -4.046  1.799   1.00 0.00 ? 182 LYS B HE3  2  
ATOM   4127  H  HZ1  . LYS B 2 82  ? 12.917  -2.462  2.042   1.00 0.00 ? 182 LYS B HZ1  2  
ATOM   4128  H  HZ2  . LYS B 2 82  ? 12.733  -3.436  0.671   1.00 0.00 ? 182 LYS B HZ2  2  
ATOM   4129  H  HZ3  . LYS B 2 82  ? 12.689  -4.130  2.212   1.00 0.00 ? 182 LYS B HZ3  2  
ATOM   4130  N  N    . ASN B 2 83  ? 9.353   2.979   0.227   1.00 0.00 ? 183 ASN B N    2  
ATOM   4131  C  CA   . ASN B 2 83  ? 9.798   4.142   0.988   1.00 0.00 ? 183 ASN B CA   2  
ATOM   4132  C  C    . ASN B 2 83  ? 8.628   5.049   1.368   1.00 0.00 ? 183 ASN B C    2  
ATOM   4133  O  O    . ASN B 2 83  ? 8.831   6.195   1.772   1.00 0.00 ? 183 ASN B O    2  
ATOM   4134  C  CB   . ASN B 2 83  ? 10.823  4.933   0.175   1.00 0.00 ? 183 ASN B CB   2  
ATOM   4135  C  CG   . ASN B 2 83  ? 12.080  5.240   0.964   1.00 0.00 ? 183 ASN B CG   2  
ATOM   4136  O  OD1  . ASN B 2 83  ? 12.783  4.332   1.411   1.00 0.00 ? 183 ASN B OD1  2  
ATOM   4137  N  ND2  . ASN B 2 83  ? 12.369  6.523   1.141   1.00 0.00 ? 183 ASN B ND2  2  
ATOM   4138  H  H    . ASN B 2 83  ? 9.041   3.101   -0.693  1.00 0.00 ? 183 ASN B H    2  
ATOM   4139  H  HA   . ASN B 2 83  ? 10.270  3.785   1.891   1.00 0.00 ? 183 ASN B HA   2  
ATOM   4140  H  HB2  . ASN B 2 83  ? 11.101  4.360   -0.697  1.00 0.00 ? 183 ASN B HB2  2  
ATOM   4141  H  HB3  . ASN B 2 83  ? 10.381  5.867   -0.140  1.00 0.00 ? 183 ASN B HB3  2  
ATOM   4142  H  HD21 . ASN B 2 83  ? 11.761  7.190   0.759   1.00 0.00 ? 183 ASN B HD21 2  
ATOM   4143  H  HD22 . ASN B 2 83  ? 13.180  6.751   1.639   1.00 0.00 ? 183 ASN B HD22 2  
ATOM   4144  N  N    . CYS B 2 84  ? 7.407   4.541   1.234   1.00 0.00 ? 184 CYS B N    2  
ATOM   4145  C  CA   . CYS B 2 84  ? 6.221   5.321   1.563   1.00 0.00 ? 184 CYS B CA   2  
ATOM   4146  C  C    . CYS B 2 84  ? 5.648   4.908   2.915   1.00 0.00 ? 184 CYS B C    2  
ATOM   4147  O  O    . CYS B 2 84  ? 5.509   3.720   3.205   1.00 0.00 ? 184 CYS B O    2  
ATOM   4148  C  CB   . CYS B 2 84  ? 5.161   5.153   0.473   1.00 0.00 ? 184 CYS B CB   2  
ATOM   4149  S  SG   . CYS B 2 84  ? 3.914   6.480   0.438   1.00 0.00 ? 184 CYS B SG   2  
ATOM   4150  H  H    . CYS B 2 84  ? 7.300   3.626   0.902   1.00 0.00 ? 184 CYS B H    2  
ATOM   4151  H  HA   . CYS B 2 84  ? 6.511   6.359   1.610   1.00 0.00 ? 184 CYS B HA   2  
ATOM   4152  H  HB2  . CYS B 2 84  ? 5.646   5.135   -0.491  1.00 0.00 ? 184 CYS B HB2  2  
ATOM   4153  H  HB3  . CYS B 2 84  ? 4.644   4.218   0.627   1.00 0.00 ? 184 CYS B HB3  2  
ATOM   4154  N  N    . THR B 2 85  ? 5.316   5.899   3.735   1.00 0.00 ? 185 THR B N    2  
ATOM   4155  C  CA   . THR B 2 85  ? 4.754   5.645   5.057   1.00 0.00 ? 185 THR B CA   2  
ATOM   4156  C  C    . THR B 2 85  ? 3.361   6.252   5.178   1.00 0.00 ? 185 THR B C    2  
ATOM   4157  O  O    . THR B 2 85  ? 2.905   6.959   4.279   1.00 0.00 ? 185 THR B O    2  
ATOM   4158  C  CB   . THR B 2 85  ? 5.669   6.215   6.142   1.00 0.00 ? 185 THR B CB   2  
ATOM   4159  O  OG1  . THR B 2 85  ? 6.994   6.349   5.661   1.00 0.00 ? 185 THR B OG1  2  
ATOM   4160  C  CG2  . THR B 2 85  ? 5.718   5.364   7.392   1.00 0.00 ? 185 THR B CG2  2  
ATOM   4161  H  H    . THR B 2 85  ? 5.449   6.825   3.444   1.00 0.00 ? 185 THR B H    2  
ATOM   4162  H  HA   . THR B 2 85  ? 4.681   4.575   5.186   1.00 0.00 ? 185 THR B HA   2  
ATOM   4163  H  HB   . THR B 2 85  ? 5.309   7.195   6.423   1.00 0.00 ? 185 THR B HB   2  
ATOM   4164  H  HG1  . THR B 2 85  ? 7.483   6.949   6.230   1.00 0.00 ? 185 THR B HG1  2  
ATOM   4165  H  HG21 . THR B 2 85  ? 4.938   4.619   7.352   1.00 0.00 ? 185 THR B HG21 2  
ATOM   4166  H  HG22 . THR B 2 85  ? 5.573   5.990   8.261   1.00 0.00 ? 185 THR B HG22 2  
ATOM   4167  H  HG23 . THR B 2 85  ? 6.679   4.876   7.459   1.00 0.00 ? 185 THR B HG23 2  
ATOM   4168  N  N    . ARG B 2 86  ? 2.687   5.966   6.292   1.00 0.00 ? 186 ARG B N    2  
ATOM   4169  C  CA   . ARG B 2 86  ? 1.341   6.468   6.544   1.00 0.00 ? 186 ARG B CA   2  
ATOM   4170  C  C    . ARG B 2 86  ? 1.161   7.897   6.032   1.00 0.00 ? 186 ARG B C    2  
ATOM   4171  O  O    . ARG B 2 86  ? 0.220   8.188   5.292   1.00 0.00 ? 186 ARG B O    2  
ATOM   4172  C  CB   . ARG B 2 86  ? 1.028   6.407   8.041   1.00 0.00 ? 186 ARG B CB   2  
ATOM   4173  C  CG   . ARG B 2 86  ? -0.027  5.372   8.400   1.00 0.00 ? 186 ARG B CG   2  
ATOM   4174  C  CD   . ARG B 2 86  ? 0.356   3.988   7.900   1.00 0.00 ? 186 ARG B CD   2  
ATOM   4175  N  NE   . ARG B 2 86  ? 1.636   3.544   8.446   1.00 0.00 ? 186 ARG B NE   2  
ATOM   4176  C  CZ   . ARG B 2 86  ? 2.074   2.289   8.381   1.00 0.00 ? 186 ARG B CZ   2  
ATOM   4177  N  NH1  . ARG B 2 86  ? 1.339   1.351   7.797   1.00 0.00 ? 186 ARG B NH1  2  
ATOM   4178  N  NH2  . ARG B 2 86  ? 3.251   1.970   8.904   1.00 0.00 ? 186 ARG B NH2  2  
ATOM   4179  H  H    . ARG B 2 86  ? 3.102   5.392   6.960   1.00 0.00 ? 186 ARG B H    2  
ATOM   4180  H  HA   . ARG B 2 86  ? 0.659   5.822   6.022   1.00 0.00 ? 186 ARG B HA   2  
ATOM   4181  H  HB2  . ARG B 2 86  ? 1.934   6.166   8.577   1.00 0.00 ? 186 ARG B HB2  2  
ATOM   4182  H  HB3  . ARG B 2 86  ? 0.675   7.375   8.366   1.00 0.00 ? 186 ARG B HB3  2  
ATOM   4183  H  HG2  . ARG B 2 86  ? -0.133  5.338   9.474   1.00 0.00 ? 186 ARG B HG2  2  
ATOM   4184  H  HG3  . ARG B 2 86  ? -0.966  5.660   7.952   1.00 0.00 ? 186 ARG B HG3  2  
ATOM   4185  H  HD2  . ARG B 2 86  ? -0.412  3.288   8.195   1.00 0.00 ? 186 ARG B HD2  2  
ATOM   4186  H  HD3  . ARG B 2 86  ? 0.424   4.015   6.822   1.00 0.00 ? 186 ARG B HD3  2  
ATOM   4187  H  HE   . ARG B 2 86  ? 2.200   4.216   8.883   1.00 0.00 ? 186 ARG B HE   2  
ATOM   4188  H  HH11 . ARG B 2 86  ? 0.451   1.585   7.401   1.00 0.00 ? 186 ARG B HH11 2  
ATOM   4189  H  HH12 . ARG B 2 86  ? 1.673   0.410   7.752   1.00 0.00 ? 186 ARG B HH12 2  
ATOM   4190  H  HH21 . ARG B 2 86  ? 3.809   2.673   9.345   1.00 0.00 ? 186 ARG B HH21 2  
ATOM   4191  H  HH22 . ARG B 2 86  ? 3.580   1.026   8.856   1.00 0.00 ? 186 ARG B HH22 2  
ATOM   4192  N  N    . HIS B 2 87  ? 2.067   8.784   6.431   1.00 0.00 ? 187 HIS B N    2  
ATOM   4193  C  CA   . HIS B 2 87  ? 2.005   10.180  6.012   1.00 0.00 ? 187 HIS B CA   2  
ATOM   4194  C  C    . HIS B 2 87  ? 2.353   10.320  4.533   1.00 0.00 ? 187 HIS B C    2  
ATOM   4195  O  O    . HIS B 2 87  ? 3.464   9.998   4.113   1.00 0.00 ? 187 HIS B O    2  
ATOM   4196  C  CB   . HIS B 2 87  ? 2.958   11.031  6.854   1.00 0.00 ? 187 HIS B CB   2  
ATOM   4197  C  CG   . HIS B 2 87  ? 2.441   12.408  7.135   1.00 0.00 ? 187 HIS B CG   2  
ATOM   4198  N  ND1  . HIS B 2 87  ? 2.005   12.809  8.380   1.00 0.00 ? 187 HIS B ND1  2  
ATOM   4199  C  CD2  . HIS B 2 87  ? 2.294   13.482  6.322   1.00 0.00 ? 187 HIS B CD2  2  
ATOM   4200  C  CE1  . HIS B 2 87  ? 1.611   14.069  8.320   1.00 0.00 ? 187 HIS B CE1  2  
ATOM   4201  N  NE2  . HIS B 2 87  ? 1.776   14.500  7.084   1.00 0.00 ? 187 HIS B NE2  2  
ATOM   4202  H  H    . HIS B 2 87  ? 2.793   8.494   7.020   1.00 0.00 ? 187 HIS B H    2  
ATOM   4203  H  HA   . HIS B 2 87  ? 0.994   10.528  6.166   1.00 0.00 ? 187 HIS B HA   2  
ATOM   4204  H  HB2  . HIS B 2 87  ? 3.125   10.541  7.801   1.00 0.00 ? 187 HIS B HB2  2  
ATOM   4205  H  HB3  . HIS B 2 87  ? 3.899   11.128  6.332   1.00 0.00 ? 187 HIS B HB3  2  
ATOM   4206  H  HD1  . HIS B 2 87  ? 1.986   12.253  9.186   1.00 0.00 ? 187 HIS B HD1  2  
ATOM   4207  H  HD2  . HIS B 2 87  ? 2.538   13.528  5.270   1.00 0.00 ? 187 HIS B HD2  2  
ATOM   4208  H  HE1  . HIS B 2 87  ? 1.221   14.648  9.145   1.00 0.00 ? 187 HIS B HE1  2  
ATOM   4209  H  HE2  . HIS B 2 87  ? 1.656   15.427  6.788   1.00 0.00 ? 187 HIS B HE2  2  
ATOM   4210  N  N    . ASP B 2 88  ? 1.394   10.805  3.748   1.00 0.00 ? 188 ASP B N    2  
ATOM   4211  C  CA   . ASP B 2 88  ? 1.597   10.991  2.314   1.00 0.00 ? 188 ASP B CA   2  
ATOM   4212  C  C    . ASP B 2 88  ? 1.736   9.647   1.605   1.00 0.00 ? 188 ASP B C    2  
ATOM   4213  O  O    . ASP B 2 88  ? 2.839   9.236   1.243   1.00 0.00 ? 188 ASP B O    2  
ATOM   4214  C  CB   . ASP B 2 88  ? 2.837   11.849  2.055   1.00 0.00 ? 188 ASP B CB   2  
ATOM   4215  C  CG   . ASP B 2 88  ? 2.814   12.498  0.685   1.00 0.00 ? 188 ASP B CG   2  
ATOM   4216  O  OD1  . ASP B 2 88  ? 2.661   11.766  -0.315  1.00 0.00 ? 188 ASP B OD1  2  
ATOM   4217  O  OD2  . ASP B 2 88  ? 2.947   13.738  0.612   1.00 0.00 ? 188 ASP B OD2  2  
ATOM   4218  H  H    . ASP B 2 88  ? 0.530   11.045  4.142   1.00 0.00 ? 188 ASP B H    2  
ATOM   4219  H  HA   . ASP B 2 88  ? 0.729   11.501  1.923   1.00 0.00 ? 188 ASP B HA   2  
ATOM   4220  H  HB2  . ASP B 2 88  ? 2.890   12.629  2.801   1.00 0.00 ? 188 ASP B HB2  2  
ATOM   4221  H  HB3  . ASP B 2 88  ? 3.718   11.228  2.125   1.00 0.00 ? 188 ASP B HB3  2  
ATOM   4222  N  N    . CYS B 2 89  ? 0.610   8.969   1.407   1.00 0.00 ? 189 CYS B N    2  
ATOM   4223  C  CA   . CYS B 2 89  ? 0.607   7.673   0.738   1.00 0.00 ? 189 CYS B CA   2  
ATOM   4224  C  C    . CYS B 2 89  ? -0.771  7.359   0.158   1.00 0.00 ? 189 CYS B C    2  
ATOM   4225  O  O    . CYS B 2 89  ? -1.430  6.410   0.580   1.00 0.00 ? 189 CYS B O    2  
ATOM   4226  C  CB   . CYS B 2 89  ? 1.024   6.574   1.715   1.00 0.00 ? 189 CYS B CB   2  
ATOM   4227  S  SG   . CYS B 2 89  ? 1.782   5.120   0.919   1.00 0.00 ? 189 CYS B SG   2  
ATOM   4228  H  H    . CYS B 2 89  ? -0.238  9.350   1.717   1.00 0.00 ? 189 CYS B H    2  
ATOM   4229  H  HA   . CYS B 2 89  ? 1.323   7.715   -0.069  1.00 0.00 ? 189 CYS B HA   2  
ATOM   4230  H  HB2  . CYS B 2 89  ? 1.743   6.977   2.412   1.00 0.00 ? 189 CYS B HB2  2  
ATOM   4231  H  HB3  . CYS B 2 89  ? 0.154   6.237   2.259   1.00 0.00 ? 189 CYS B HB3  2  
ATOM   4232  N  N    . PRO B 2 90  ? -1.230  8.160   -0.820  1.00 0.00 ? 190 PRO B N    2  
ATOM   4233  C  CA   . PRO B 2 90  ? -2.537  7.971   -1.455  1.00 0.00 ? 190 PRO B CA   2  
ATOM   4234  C  C    . PRO B 2 90  ? -2.585  6.743   -2.361  1.00 0.00 ? 190 PRO B C    2  
ATOM   4235  O  O    . PRO B 2 90  ? -3.663  6.287   -2.745  1.00 0.00 ? 190 PRO B O    2  
ATOM   4236  C  CB   . PRO B 2 90  ? -2.729  9.246   -2.292  1.00 0.00 ? 190 PRO B CB   2  
ATOM   4237  C  CG   . PRO B 2 90  ? -1.648  10.181  -1.861  1.00 0.00 ? 190 PRO B CG   2  
ATOM   4238  C  CD   . PRO B 2 90  ? -0.521  9.317   -1.381  1.00 0.00 ? 190 PRO B CD   2  
ATOM   4239  H  HA   . PRO B 2 90  ? -3.326  7.901   -0.720  1.00 0.00 ? 190 PRO B HA   2  
ATOM   4240  H  HB2  . PRO B 2 90  ? -2.643  9.005   -3.342  1.00 0.00 ? 190 PRO B HB2  2  
ATOM   4241  H  HB3  . PRO B 2 90  ? -3.704  9.657   -2.097  1.00 0.00 ? 190 PRO B HB3  2  
ATOM   4242  H  HG2  . PRO B 2 90  ? -1.327  10.784  -2.699  1.00 0.00 ? 190 PRO B HG2  2  
ATOM   4243  H  HG3  . PRO B 2 90  ? -2.005  10.811  -1.059  1.00 0.00 ? 190 PRO B HG3  2  
ATOM   4244  H  HD2  . PRO B 2 90  ? 0.111   9.023   -2.207  1.00 0.00 ? 190 PRO B HD2  2  
ATOM   4245  H  HD3  . PRO B 2 90  ? 0.052   9.827   -0.622  1.00 0.00 ? 190 PRO B HD3  2  
ATOM   4246  N  N    . VAL B 2 91  ? -1.416  6.220   -2.714  1.00 0.00 ? 191 VAL B N    2  
ATOM   4247  C  CA   . VAL B 2 91  ? -1.335  5.057   -3.589  1.00 0.00 ? 191 VAL B CA   2  
ATOM   4248  C  C    . VAL B 2 91  ? -1.336  3.751   -2.799  1.00 0.00 ? 191 VAL B C    2  
ATOM   4249  O  O    . VAL B 2 91  ? -2.250  2.937   -2.930  1.00 0.00 ? 191 VAL B O    2  
ATOM   4250  C  CB   . VAL B 2 91  ? -0.068  5.107   -4.465  1.00 0.00 ? 191 VAL B CB   2  
ATOM   4251  C  CG1  . VAL B 2 91  ? -0.094  4.001   -5.509  1.00 0.00 ? 191 VAL B CG1  2  
ATOM   4252  C  CG2  . VAL B 2 91  ? 0.072   6.472   -5.125  1.00 0.00 ? 191 VAL B CG2  2  
ATOM   4253  H  H    . VAL B 2 91  ? -0.591  6.631   -2.388  1.00 0.00 ? 191 VAL B H    2  
ATOM   4254  H  HA   . VAL B 2 91  ? -2.195  5.071   -4.241  1.00 0.00 ? 191 VAL B HA   2  
ATOM   4255  H  HB   . VAL B 2 91  ? 0.791   4.951   -3.828  1.00 0.00 ? 191 VAL B HB   2  
ATOM   4256  H  HG11 . VAL B 2 91  ? 0.912   3.653   -5.689  1.00 0.00 ? 191 VAL B HG11 2  
ATOM   4257  H  HG12 . VAL B 2 91  ? -0.514  4.384   -6.427  1.00 0.00 ? 191 VAL B HG12 2  
ATOM   4258  H  HG13 . VAL B 2 91  ? -0.700  3.182   -5.150  1.00 0.00 ? 191 VAL B HG13 2  
ATOM   4259  H  HG21 . VAL B 2 91  ? -0.861  7.011   -5.041  1.00 0.00 ? 191 VAL B HG21 2  
ATOM   4260  H  HG22 . VAL B 2 91  ? 0.321   6.345   -6.168  1.00 0.00 ? 191 VAL B HG22 2  
ATOM   4261  H  HG23 . VAL B 2 91  ? 0.854   7.031   -4.634  1.00 0.00 ? 191 VAL B HG23 2  
ATOM   4262  N  N    . CYS B 2 92  ? -0.300  3.552   -1.993  1.00 0.00 ? 192 CYS B N    2  
ATOM   4263  C  CA   . CYS B 2 92  ? -0.175  2.336   -1.194  1.00 0.00 ? 192 CYS B CA   2  
ATOM   4264  C  C    . CYS B 2 92  ? -1.283  2.226   -0.148  1.00 0.00 ? 192 CYS B C    2  
ATOM   4265  O  O    . CYS B 2 92  ? -1.563  1.138   0.355   1.00 0.00 ? 192 CYS B O    2  
ATOM   4266  C  CB   . CYS B 2 92  ? 1.194   2.280   -0.513  1.00 0.00 ? 192 CYS B CB   2  
ATOM   4267  S  SG   . CYS B 2 92  ? 1.667   3.817   0.343   1.00 0.00 ? 192 CYS B SG   2  
ATOM   4268  H  H    . CYS B 2 92  ? 0.401   4.236   -1.940  1.00 0.00 ? 192 CYS B H    2  
ATOM   4269  H  HA   . CYS B 2 92  ? -0.259  1.496   -1.868  1.00 0.00 ? 192 CYS B HA   2  
ATOM   4270  H  HB2  . CYS B 2 92  ? 1.191   1.487   0.219   1.00 0.00 ? 192 CYS B HB2  2  
ATOM   4271  H  HB3  . CYS B 2 92  ? 1.949   2.073   -1.258  1.00 0.00 ? 192 CYS B HB3  2  
ATOM   4272  N  N    . LEU B 2 93  ? -1.915  3.351   0.180   1.00 0.00 ? 193 LEU B N    2  
ATOM   4273  C  CA   . LEU B 2 93  ? -2.989  3.354   1.169   1.00 0.00 ? 193 LEU B CA   2  
ATOM   4274  C  C    . LEU B 2 93  ? -4.189  2.547   0.671   1.00 0.00 ? 193 LEU B C    2  
ATOM   4275  O  O    . LEU B 2 93  ? -4.564  1.544   1.278   1.00 0.00 ? 193 LEU B O    2  
ATOM   4276  C  CB   . LEU B 2 93  ? -3.405  4.793   1.505   1.00 0.00 ? 193 LEU B CB   2  
ATOM   4277  C  CG   . LEU B 2 93  ? -4.785  4.946   2.150   1.00 0.00 ? 193 LEU B CG   2  
ATOM   4278  C  CD1  . LEU B 2 93  ? -4.818  4.266   3.511   1.00 0.00 ? 193 LEU B CD1  2  
ATOM   4279  C  CD2  . LEU B 2 93  ? -5.153  6.417   2.278   1.00 0.00 ? 193 LEU B CD2  2  
ATOM   4280  H  H    . LEU B 2 93  ? -1.655  4.192   -0.249  1.00 0.00 ? 193 LEU B H    2  
ATOM   4281  H  HA   . LEU B 2 93  ? -2.608  2.885   2.065   1.00 0.00 ? 193 LEU B HA   2  
ATOM   4282  H  HB2  . LEU B 2 93  ? -2.670  5.204   2.182   1.00 0.00 ? 193 LEU B HB2  2  
ATOM   4283  H  HB3  . LEU B 2 93  ? -3.391  5.372   0.595   1.00 0.00 ? 193 LEU B HB3  2  
ATOM   4284  H  HG   . LEU B 2 93  ? -5.524  4.470   1.522   1.00 0.00 ? 193 LEU B HG   2  
ATOM   4285  H  HD11 . LEU B 2 93  ? -4.295  4.879   4.231   1.00 0.00 ? 193 LEU B HD11 2  
ATOM   4286  H  HD12 . LEU B 2 93  ? -4.337  3.301   3.442   1.00 0.00 ? 193 LEU B HD12 2  
ATOM   4287  H  HD13 . LEU B 2 93  ? -5.843  4.137   3.824   1.00 0.00 ? 193 LEU B HD13 2  
ATOM   4288  H  HD21 . LEU B 2 93  ? -4.263  6.995   2.477   1.00 0.00 ? 193 LEU B HD21 2  
ATOM   4289  H  HD22 . LEU B 2 93  ? -5.853  6.544   3.091   1.00 0.00 ? 193 LEU B HD22 2  
ATOM   4290  H  HD23 . LEU B 2 93  ? -5.606  6.756   1.358   1.00 0.00 ? 193 LEU B HD23 2  
ATOM   4291  N  N    . PRO B 2 94  ? -4.811  2.971   -0.443  1.00 0.00 ? 194 PRO B N    2  
ATOM   4292  C  CA   . PRO B 2 94  ? -5.971  2.275   -1.011  1.00 0.00 ? 194 PRO B CA   2  
ATOM   4293  C  C    . PRO B 2 94  ? -5.605  0.915   -1.597  1.00 0.00 ? 194 PRO B C    2  
ATOM   4294  O  O    . PRO B 2 94  ? -6.455  0.033   -1.714  1.00 0.00 ? 194 PRO B O    2  
ATOM   4295  C  CB   . PRO B 2 94  ? -6.446  3.218   -2.118  1.00 0.00 ? 194 PRO B CB   2  
ATOM   4296  C  CG   . PRO B 2 94  ? -5.231  3.988   -2.502  1.00 0.00 ? 194 PRO B CG   2  
ATOM   4297  C  CD   . PRO B 2 94  ? -4.438  4.157   -1.237  1.00 0.00 ? 194 PRO B CD   2  
ATOM   4298  H  HA   . PRO B 2 94  ? -6.754  2.151   -0.279  1.00 0.00 ? 194 PRO B HA   2  
ATOM   4299  H  HB2  . PRO B 2 94  ? -6.829  2.641   -2.947  1.00 0.00 ? 194 PRO B HB2  2  
ATOM   4300  H  HB3  . PRO B 2 94  ? -7.220  3.867   -1.736  1.00 0.00 ? 194 PRO B HB3  2  
ATOM   4301  H  HG2  . PRO B 2 94  ? -4.661  3.434   -3.233  1.00 0.00 ? 194 PRO B HG2  2  
ATOM   4302  H  HG3  . PRO B 2 94  ? -5.517  4.952   -2.898  1.00 0.00 ? 194 PRO B HG3  2  
ATOM   4303  H  HD2  . PRO B 2 94  ? -3.381  4.163   -1.451  1.00 0.00 ? 194 PRO B HD2  2  
ATOM   4304  H  HD3  . PRO B 2 94  ? -4.729  5.065   -0.731  1.00 0.00 ? 194 PRO B HD3  2  
ATOM   4305  N  N    . LEU B 2 95  ? -4.339  0.752   -1.969  1.00 0.00 ? 195 LEU B N    2  
ATOM   4306  C  CA   . LEU B 2 95  ? -3.871  -0.495  -2.546  1.00 0.00 ? 195 LEU B CA   2  
ATOM   4307  C  C    . LEU B 2 95  ? -3.687  -1.561  -1.471  1.00 0.00 ? 195 LEU B C    2  
ATOM   4308  O  O    . LEU B 2 95  ? -3.981  -2.736  -1.692  1.00 0.00 ? 195 LEU B O    2  
ATOM   4309  C  CB   . LEU B 2 95  ? -2.553  -0.261  -3.280  1.00 0.00 ? 195 LEU B CB   2  
ATOM   4310  C  CG   . LEU B 2 95  ? -2.637  -0.337  -4.805  1.00 0.00 ? 195 LEU B CG   2  
ATOM   4311  C  CD1  . LEU B 2 95  ? -1.278  -0.064  -5.429  1.00 0.00 ? 195 LEU B CD1  2  
ATOM   4312  C  CD2  . LEU B 2 95  ? -3.163  -1.697  -5.243  1.00 0.00 ? 195 LEU B CD2  2  
ATOM   4313  H  H    . LEU B 2 95  ? -3.704  1.488   -1.858  1.00 0.00 ? 195 LEU B H    2  
ATOM   4314  H  HA   . LEU B 2 95  ? -4.612  -0.833  -3.252  1.00 0.00 ? 195 LEU B HA   2  
ATOM   4315  H  HB2  . LEU B 2 95  ? -2.185  0.717   -3.009  1.00 0.00 ? 195 LEU B HB2  2  
ATOM   4316  H  HB3  . LEU B 2 95  ? -1.843  -0.995  -2.942  1.00 0.00 ? 195 LEU B HB3  2  
ATOM   4317  H  HG   . LEU B 2 95  ? -3.324  0.417   -5.159  1.00 0.00 ? 195 LEU B HG   2  
ATOM   4318  H  HD11 . LEU B 2 95  ? -1.378  -0.020  -6.504  1.00 0.00 ? 195 LEU B HD11 2  
ATOM   4319  H  HD12 . LEU B 2 95  ? -0.593  -0.855  -5.164  1.00 0.00 ? 195 LEU B HD12 2  
ATOM   4320  H  HD13 . LEU B 2 95  ? -0.898  0.879   -5.065  1.00 0.00 ? 195 LEU B HD13 2  
ATOM   4321  H  HD21 . LEU B 2 95  ? -3.734  -1.584  -6.153  1.00 0.00 ? 195 LEU B HD21 2  
ATOM   4322  H  HD22 . LEU B 2 95  ? -3.793  -2.106  -4.470  1.00 0.00 ? 195 LEU B HD22 2  
ATOM   4323  H  HD23 . LEU B 2 95  ? -2.332  -2.363  -5.420  1.00 0.00 ? 195 LEU B HD23 2  
ATOM   4324  N  N    . LYS B 2 96  ? -3.195  -1.145  -0.310  1.00 0.00 ? 196 LYS B N    2  
ATOM   4325  C  CA   . LYS B 2 96  ? -2.972  -2.069  0.796   1.00 0.00 ? 196 LYS B CA   2  
ATOM   4326  C  C    . LYS B 2 96  ? -3.019  -1.341  2.137   1.00 0.00 ? 196 LYS B C    2  
ATOM   4327  O  O    . LYS B 2 96  ? -2.055  -1.364  2.902   1.00 0.00 ? 196 LYS B O    2  
ATOM   4328  C  CB   . LYS B 2 96  ? -1.624  -2.777  0.630   1.00 0.00 ? 196 LYS B CB   2  
ATOM   4329  C  CG   . LYS B 2 96  ? -0.427  -1.844  0.748   1.00 0.00 ? 196 LYS B CG   2  
ATOM   4330  C  CD   . LYS B 2 96  ? 0.562   -2.334  1.794   1.00 0.00 ? 196 LYS B CD   2  
ATOM   4331  C  CE   . LYS B 2 96  ? 1.722   -1.367  1.962   1.00 0.00 ? 196 LYS B CE   2  
ATOM   4332  N  NZ   . LYS B 2 96  ? 2.472   -1.610  3.225   1.00 0.00 ? 196 LYS B NZ   2  
ATOM   4333  H  H    . LYS B 2 96  ? -2.977  -0.197  -0.193  1.00 0.00 ? 196 LYS B H    2  
ATOM   4334  H  HA   . LYS B 2 96  ? -3.758  -2.805  0.771   1.00 0.00 ? 196 LYS B HA   2  
ATOM   4335  H  HB2  . LYS B 2 96  ? -1.536  -3.540  1.388   1.00 0.00 ? 196 LYS B HB2  2  
ATOM   4336  H  HB3  . LYS B 2 96  ? -1.594  -3.243  -0.343  1.00 0.00 ? 196 LYS B HB3  2  
ATOM   4337  H  HG2  . LYS B 2 96  ? 0.072   -1.792  -0.207  1.00 0.00 ? 196 LYS B HG2  2  
ATOM   4338  H  HG3  . LYS B 2 96  ? -0.776  -0.861  1.028   1.00 0.00 ? 196 LYS B HG3  2  
ATOM   4339  H  HD2  . LYS B 2 96  ? 0.051   -2.435  2.739   1.00 0.00 ? 196 LYS B HD2  2  
ATOM   4340  H  HD3  . LYS B 2 96  ? 0.949   -3.295  1.487   1.00 0.00 ? 196 LYS B HD3  2  
ATOM   4341  H  HE2  . LYS B 2 96  ? 2.396   -1.483  1.126   1.00 0.00 ? 196 LYS B HE2  2  
ATOM   4342  H  HE3  . LYS B 2 96  ? 1.334   -0.358  1.971   1.00 0.00 ? 196 LYS B HE3  2  
ATOM   4343  H  HZ1  . LYS B 2 96  ? 1.808   -1.782  4.007   1.00 0.00 ? 196 LYS B HZ1  2  
ATOM   4344  H  HZ2  . LYS B 2 96  ? 3.058   -0.784  3.458   1.00 0.00 ? 196 LYS B HZ2  2  
ATOM   4345  H  HZ3  . LYS B 2 96  ? 3.089   -2.440  3.119   1.00 0.00 ? 196 LYS B HZ3  2  
ATOM   4346  N  N    . ASN B 2 97  ? -4.148  -0.690  2.411   1.00 0.00 ? 197 ASN B N    2  
ATOM   4347  C  CA   . ASN B 2 97  ? -4.334  0.053   3.651   1.00 0.00 ? 197 ASN B CA   2  
ATOM   4348  C  C    . ASN B 2 97  ? -3.785  -0.716  4.851   1.00 0.00 ? 197 ASN B C    2  
ATOM   4349  O  O    . ASN B 2 97  ? -3.821  -1.946  4.881   1.00 0.00 ? 197 ASN B O    2  
ATOM   4350  C  CB   . ASN B 2 97  ? -5.817  0.362   3.865   1.00 0.00 ? 197 ASN B CB   2  
ATOM   4351  C  CG   . ASN B 2 97  ? -6.660  -0.893  3.973   1.00 0.00 ? 197 ASN B CG   2  
ATOM   4352  O  OD1  . ASN B 2 97  ? -6.706  -1.536  5.021   1.00 0.00 ? 197 ASN B OD1  2  
ATOM   4353  N  ND2  . ASN B 2 97  ? -7.334  -1.248  2.885   1.00 0.00 ? 197 ASN B ND2  2  
ATOM   4354  H  H    . ASN B 2 97  ? -4.874  -0.701  1.760   1.00 0.00 ? 197 ASN B H    2  
ATOM   4355  H  HA   . ASN B 2 97  ? -3.797  0.979   3.553   1.00 0.00 ? 197 ASN B HA   2  
ATOM   4356  H  HB2  . ASN B 2 97  ? -5.932  0.929   4.776   1.00 0.00 ? 197 ASN B HB2  2  
ATOM   4357  H  HB3  . ASN B 2 97  ? -6.179  0.948   3.032   1.00 0.00 ? 197 ASN B HB3  2  
ATOM   4358  H  HD21 . ASN B 2 97  ? -7.251  -0.687  2.085   1.00 0.00 ? 197 ASN B HD21 2  
ATOM   4359  H  HD22 . ASN B 2 97  ? -7.887  -2.055  2.926   1.00 0.00 ? 197 ASN B HD22 2  
ATOM   4360  N  N    . ALA B 2 98  ? -3.275  0.018   5.834   1.00 0.00 ? 198 ALA B N    2  
ATOM   4361  C  CA   . ALA B 2 98  ? -2.715  -0.594  7.034   1.00 0.00 ? 198 ALA B CA   2  
ATOM   4362  C  C    . ALA B 2 98  ? -1.479  -1.422  6.699   1.00 0.00 ? 198 ALA B C    2  
ATOM   4363  O  O    . ALA B 2 98  ? -1.151  -1.619  5.529   1.00 0.00 ? 198 ALA B O    2  
ATOM   4364  C  CB   . ALA B 2 98  ? -3.760  -1.459  7.725   1.00 0.00 ? 198 ALA B CB   2  
ATOM   4365  H  H    . ALA B 2 98  ? -3.273  0.995   5.752   1.00 0.00 ? 198 ALA B H    2  
ATOM   4366  H  HA   . ALA B 2 98  ? -2.433  0.198   7.712   1.00 0.00 ? 198 ALA B HA   2  
ATOM   4367  H  HB1  . ALA B 2 98  ? -3.617  -2.492  7.442   1.00 0.00 ? 198 ALA B HB1  2  
ATOM   4368  H  HB2  . ALA B 2 98  ? -4.747  -1.138  7.427   1.00 0.00 ? 198 ALA B HB2  2  
ATOM   4369  H  HB3  . ALA B 2 98  ? -3.657  -1.362  8.796   1.00 0.00 ? 198 ALA B HB3  2  
ATOM   4370  N  N    . GLY B 2 99  ? -0.797  -1.903  7.733   1.00 0.00 ? 199 GLY B N    2  
ATOM   4371  C  CA   . GLY B 2 99  ? 0.395   -2.704  7.525   1.00 0.00 ? 199 GLY B CA   2  
ATOM   4372  C  C    . GLY B 2 99  ? 0.990   -3.207  8.825   1.00 0.00 ? 199 GLY B C    2  
ATOM   4373  O  O    . GLY B 2 99  ? 2.209   -3.205  9.001   1.00 0.00 ? 199 GLY B O    2  
ATOM   4374  H  H    . GLY B 2 99  ? -1.106  -1.714  8.643   1.00 0.00 ? 199 GLY B H    2  
ATOM   4375  H  HA2  . GLY B 2 99  ? 0.143   -3.552  6.906   1.00 0.00 ? 199 GLY B HA2  2  
ATOM   4376  H  HA3  . GLY B 2 99  ? 1.132   -2.104  7.013   1.00 0.00 ? 199 GLY B HA3  2  
ATOM   4377  N  N    . ASP B 2 100 ? 0.128   -3.640  9.739   1.00 0.00 ? 200 ASP B N    2  
ATOM   4378  C  CA   . ASP B 2 100 ? 0.574   -4.151  11.031  1.00 0.00 ? 200 ASP B CA   2  
ATOM   4379  C  C    . ASP B 2 100 ? 0.320   -5.650  11.141  1.00 0.00 ? 200 ASP B C    2  
ATOM   4380  O  O    . ASP B 2 100 ? -0.170  -6.277  10.202  1.00 0.00 ? 200 ASP B O    2  
ATOM   4381  C  CB   . ASP B 2 100 ? -0.139  -3.416  12.167  1.00 0.00 ? 200 ASP B CB   2  
ATOM   4382  C  CG   . ASP B 2 100 ? -1.644  -3.584  12.108  1.00 0.00 ? 200 ASP B CG   2  
ATOM   4383  O  OD1  . ASP B 2 100 ? -2.238  -3.257  11.058  1.00 0.00 ? 200 ASP B OD1  2  
ATOM   4384  O  OD2  . ASP B 2 100 ? -2.232  -4.041  13.110  1.00 0.00 ? 200 ASP B OD2  2  
ATOM   4385  H  H    . ASP B 2 100 ? -0.831  -3.618  9.540   1.00 0.00 ? 200 ASP B H    2  
ATOM   4386  H  HA   . ASP B 2 100 ? 1.636   -3.971  11.109  1.00 0.00 ? 200 ASP B HA   2  
ATOM   4387  H  HB2  . ASP B 2 100 ? 0.210   -3.803  13.113  1.00 0.00 ? 200 ASP B HB2  2  
ATOM   4388  H  HB3  . ASP B 2 100 ? 0.090   -2.362  12.106  1.00 0.00 ? 200 ASP B HB3  2  
ATOM   4389  N  N    . LYS B 2 101 ? 0.656   -6.220  12.293  1.00 0.00 ? 201 LYS B N    2  
ATOM   4390  C  CA   . LYS B 2 101 ? 0.463   -7.647  12.526  1.00 0.00 ? 201 LYS B CA   2  
ATOM   4391  C  C    . LYS B 2 101 ? -0.977  -7.942  12.936  1.00 0.00 ? 201 LYS B C    2  
ATOM   4392  O  O    . LYS B 2 101 ? -1.792  -8.259  12.044  1.00 0.00 ? 201 LYS B O    2  
ATOM   4393  C  CB   . LYS B 2 101 ? 1.424   -8.144  13.606  1.00 0.00 ? 201 LYS B CB   2  
ATOM   4394  C  CG   . LYS B 2 101 ? 1.495   -9.658  13.709  1.00 0.00 ? 201 LYS B CG   2  
ATOM   4395  C  CD   . LYS B 2 101 ? 1.808   -10.107 15.127  1.00 0.00 ? 201 LYS B CD   2  
ATOM   4396  C  CE   . LYS B 2 101 ? 2.047   -11.607 15.196  1.00 0.00 ? 201 LYS B CE   2  
ATOM   4397  N  NZ   . LYS B 2 101 ? 2.727   -12.003 16.460  1.00 0.00 ? 201 LYS B NZ   2  
ATOM   4398  O  OXT  . LYS B 2 101 ? -1.277  -7.855  14.144  1.00 0.00 ? 201 LYS B OXT  2  
ATOM   4399  H  H    . LYS B 2 101 ? 1.041   -5.668  13.006  1.00 0.00 ? 201 LYS B H    2  
ATOM   4400  H  HA   . LYS B 2 101 ? 0.675   -8.165  11.602  1.00 0.00 ? 201 LYS B HA   2  
ATOM   4401  H  HB2  . LYS B 2 101 ? 2.415   -7.773  13.388  1.00 0.00 ? 201 LYS B HB2  2  
ATOM   4402  H  HB3  . LYS B 2 101 ? 1.106   -7.754  14.562  1.00 0.00 ? 201 LYS B HB3  2  
ATOM   4403  H  HG2  . LYS B 2 101 ? 0.544   -10.074 13.412  1.00 0.00 ? 201 LYS B HG2  2  
ATOM   4404  H  HG3  . LYS B 2 101 ? 2.270   -10.018 13.047  1.00 0.00 ? 201 LYS B HG3  2  
ATOM   4405  H  HD2  . LYS B 2 101 ? 2.694   -9.595  15.469  1.00 0.00 ? 201 LYS B HD2  2  
ATOM   4406  H  HD3  . LYS B 2 101 ? 0.974   -9.854  15.766  1.00 0.00 ? 201 LYS B HD3  2  
ATOM   4407  H  HE2  . LYS B 2 101 ? 1.096   -12.113 15.137  1.00 0.00 ? 201 LYS B HE2  2  
ATOM   4408  H  HE3  . LYS B 2 101 ? 2.663   -11.899 14.359  1.00 0.00 ? 201 LYS B HE3  2  
ATOM   4409  H  HZ1  . LYS B 2 101 ? 3.382   -12.791 16.281  1.00 0.00 ? 201 LYS B HZ1  2  
ATOM   4410  H  HZ2  . LYS B 2 101 ? 2.025   -12.303 17.165  1.00 0.00 ? 201 LYS B HZ2  2  
ATOM   4411  H  HZ3  . LYS B 2 101 ? 3.264   -11.199 16.843  1.00 0.00 ? 201 LYS B HZ3  2  
HETATM 4412  ZN ZN   . ZN  C 3 .   ? 0.692   -11.220 -16.494 1.00 0.00 ? 202 ZN  B ZN   2  
HETATM 4413  ZN ZN   . ZN  D 3 .   ? 17.406  2.423   -17.321 1.00 0.00 ? 203 ZN  B ZN   2  
HETATM 4414  ZN ZN   . ZN  E 3 .   ? 2.830   5.173   -1.185  1.00 0.00 ? 204 ZN  B ZN   2  
ATOM   4415  N  N    . GLY A 1 1   ? 9.724   10.614  -26.478 1.00 0.00 ? 1   GLY A N    3  
ATOM   4416  C  CA   . GLY A 1 1   ? 9.110   9.395   -27.076 1.00 0.00 ? 1   GLY A CA   3  
ATOM   4417  C  C    . GLY A 1 1   ? 7.760   9.673   -27.705 1.00 0.00 ? 1   GLY A C    3  
ATOM   4418  O  O    . GLY A 1 1   ? 6.728   9.594   -27.037 1.00 0.00 ? 1   GLY A O    3  
ATOM   4419  H  H1   . GLY A 1 1   ? 9.001   11.353  -26.352 1.00 0.00 ? 1   GLY A H1   3  
ATOM   4420  H  H2   . GLY A 1 1   ? 10.471  10.980  -27.101 1.00 0.00 ? 1   GLY A H2   3  
ATOM   4421  H  H3   . GLY A 1 1   ? 10.139  10.388  -25.552 1.00 0.00 ? 1   GLY A H3   3  
ATOM   4422  H  HA2  . GLY A 1 1   ? 9.775   9.006   -27.833 1.00 0.00 ? 1   GLY A HA2  3  
ATOM   4423  H  HA3  . GLY A 1 1   ? 8.989   8.651   -26.302 1.00 0.00 ? 1   GLY A HA3  3  
ATOM   4424  N  N    . SER A 1 2   ? 7.765   10.001  -28.993 1.00 0.00 ? 2   SER A N    3  
ATOM   4425  C  CA   . SER A 1 2   ? 6.530   10.291  -29.714 1.00 0.00 ? 2   SER A CA   3  
ATOM   4426  C  C    . SER A 1 2   ? 6.253   9.228   -30.771 1.00 0.00 ? 2   SER A C    3  
ATOM   4427  O  O    . SER A 1 2   ? 5.162   8.658   -30.823 1.00 0.00 ? 2   SER A O    3  
ATOM   4428  C  CB   . SER A 1 2   ? 6.611   11.670  -30.370 1.00 0.00 ? 2   SER A CB   3  
ATOM   4429  O  OG   . SER A 1 2   ? 5.420   11.971  -31.077 1.00 0.00 ? 2   SER A OG   3  
ATOM   4430  H  H    . SER A 1 2   ? 8.619   10.047  -29.471 1.00 0.00 ? 2   SER A H    3  
ATOM   4431  H  HA   . SER A 1 2   ? 5.721   10.289  -28.999 1.00 0.00 ? 2   SER A HA   3  
ATOM   4432  H  HB2  . SER A 1 2   ? 6.762   12.421  -29.609 1.00 0.00 ? 2   SER A HB2  3  
ATOM   4433  H  HB3  . SER A 1 2   ? 7.440   11.689  -31.062 1.00 0.00 ? 2   SER A HB3  3  
ATOM   4434  H  HG   . SER A 1 2   ? 4.798   12.403  -30.487 1.00 0.00 ? 2   SER A HG   3  
ATOM   4435  N  N    . MET A 1 3   ? 7.247   8.965   -31.614 1.00 0.00 ? 3   MET A N    3  
ATOM   4436  C  CA   . MET A 1 3   ? 7.111   7.970   -32.671 1.00 0.00 ? 3   MET A CA   3  
ATOM   4437  C  C    . MET A 1 3   ? 6.901   6.578   -32.084 1.00 0.00 ? 3   MET A C    3  
ATOM   4438  O  O    . MET A 1 3   ? 6.041   5.824   -32.541 1.00 0.00 ? 3   MET A O    3  
ATOM   4439  C  CB   . MET A 1 3   ? 8.349   7.977   -33.569 1.00 0.00 ? 3   MET A CB   3  
ATOM   4440  C  CG   . MET A 1 3   ? 8.259   7.009   -34.738 1.00 0.00 ? 3   MET A CG   3  
ATOM   4441  S  SD   . MET A 1 3   ? 9.544   7.288   -35.972 1.00 0.00 ? 3   MET A SD   3  
ATOM   4442  C  CE   . MET A 1 3   ? 8.561   7.831   -37.367 1.00 0.00 ? 3   MET A CE   3  
ATOM   4443  H  H    . MET A 1 3   ? 8.092   9.452   -31.522 1.00 0.00 ? 3   MET A H    3  
ATOM   4444  H  HA   . MET A 1 3   ? 6.247   8.232   -33.263 1.00 0.00 ? 3   MET A HA   3  
ATOM   4445  H  HB2  . MET A 1 3   ? 8.488   8.973   -33.964 1.00 0.00 ? 3   MET A HB2  3  
ATOM   4446  H  HB3  . MET A 1 3   ? 9.212   7.712   -32.975 1.00 0.00 ? 3   MET A HB3  3  
ATOM   4447  H  HG2  . MET A 1 3   ? 8.354   6.002   -34.361 1.00 0.00 ? 3   MET A HG2  3  
ATOM   4448  H  HG3  . MET A 1 3   ? 7.294   7.126   -35.209 1.00 0.00 ? 3   MET A HG3  3  
ATOM   4449  H  HE1  . MET A 1 3   ? 7.541   7.987   -37.049 1.00 0.00 ? 3   MET A HE1  3  
ATOM   4450  H  HE2  . MET A 1 3   ? 8.586   7.077   -38.139 1.00 0.00 ? 3   MET A HE2  3  
ATOM   4451  H  HE3  . MET A 1 3   ? 8.964   8.755   -37.753 1.00 0.00 ? 3   MET A HE3  3  
ATOM   4452  N  N    . ASP A 1 4   ? 7.694   6.242   -31.071 1.00 0.00 ? 4   ASP A N    3  
ATOM   4453  C  CA   . ASP A 1 4   ? 7.599   4.939   -30.421 1.00 0.00 ? 4   ASP A CA   3  
ATOM   4454  C  C    . ASP A 1 4   ? 6.166   4.646   -29.986 1.00 0.00 ? 4   ASP A C    3  
ATOM   4455  O  O    . ASP A 1 4   ? 5.496   5.499   -29.404 1.00 0.00 ? 4   ASP A O    3  
ATOM   4456  C  CB   . ASP A 1 4   ? 8.536   4.882   -29.211 1.00 0.00 ? 4   ASP A CB   3  
ATOM   4457  C  CG   . ASP A 1 4   ? 9.650   3.871   -29.390 1.00 0.00 ? 4   ASP A CG   3  
ATOM   4458  O  OD1  . ASP A 1 4   ? 10.689  4.229   -29.985 1.00 0.00 ? 4   ASP A OD1  3  
ATOM   4459  O  OD2  . ASP A 1 4   ? 9.485   2.719   -28.935 1.00 0.00 ? 4   ASP A OD2  3  
ATOM   4460  H  H    . ASP A 1 4   ? 8.361   6.883   -30.754 1.00 0.00 ? 4   ASP A H    3  
ATOM   4461  H  HA   . ASP A 1 4   ? 7.906   4.193   -31.136 1.00 0.00 ? 4   ASP A HA   3  
ATOM   4462  H  HB2  . ASP A 1 4   ? 8.980   5.855   -29.062 1.00 0.00 ? 4   ASP A HB2  3  
ATOM   4463  H  HB3  . ASP A 1 4   ? 7.968   4.614   -28.333 1.00 0.00 ? 4   ASP A HB3  3  
ATOM   4464  N  N    . GLU A 1 5   ? 5.702   3.434   -30.273 1.00 0.00 ? 5   GLU A N    3  
ATOM   4465  C  CA   . GLU A 1 5   ? 4.349   3.028   -29.911 1.00 0.00 ? 5   GLU A CA   3  
ATOM   4466  C  C    . GLU A 1 5   ? 4.367   2.061   -28.734 1.00 0.00 ? 5   GLU A C    3  
ATOM   4467  O  O    . GLU A 1 5   ? 5.301   1.274   -28.577 1.00 0.00 ? 5   GLU A O    3  
ATOM   4468  C  CB   . GLU A 1 5   ? 3.648   2.382   -31.106 1.00 0.00 ? 5   GLU A CB   3  
ATOM   4469  C  CG   . GLU A 1 5   ? 2.151   2.211   -30.914 1.00 0.00 ? 5   GLU A CG   3  
ATOM   4470  C  CD   . GLU A 1 5   ? 1.573   1.111   -31.783 1.00 0.00 ? 5   GLU A CD   3  
ATOM   4471  O  OE1  . GLU A 1 5   ? 2.063   -0.035  -31.693 1.00 0.00 ? 5   GLU A OE1  3  
ATOM   4472  O  OE2  . GLU A 1 5   ? 0.632   1.394   -32.553 1.00 0.00 ? 5   GLU A OE2  3  
ATOM   4473  H  H    . GLU A 1 5   ? 6.283   2.797   -30.739 1.00 0.00 ? 5   GLU A H    3  
ATOM   4474  H  HA   . GLU A 1 5   ? 3.805   3.916   -29.623 1.00 0.00 ? 5   GLU A HA   3  
ATOM   4475  H  HB2  . GLU A 1 5   ? 3.809   2.996   -31.979 1.00 0.00 ? 5   GLU A HB2  3  
ATOM   4476  H  HB3  . GLU A 1 5   ? 4.081   1.407   -31.277 1.00 0.00 ? 5   GLU A HB3  3  
ATOM   4477  H  HG2  . GLU A 1 5   ? 1.957   1.969   -29.879 1.00 0.00 ? 5   GLU A HG2  3  
ATOM   4478  H  HG3  . GLU A 1 5   ? 1.660   3.141   -31.162 1.00 0.00 ? 5   GLU A HG3  3  
ATOM   4479  N  N    . SER A 1 6   ? 3.328   2.126   -27.908 1.00 0.00 ? 6   SER A N    3  
ATOM   4480  C  CA   . SER A 1 6   ? 3.216   1.257   -26.741 1.00 0.00 ? 6   SER A CA   3  
ATOM   4481  C  C    . SER A 1 6   ? 1.980   1.609   -25.920 1.00 0.00 ? 6   SER A C    3  
ATOM   4482  O  O    . SER A 1 6   ? 1.697   2.782   -25.678 1.00 0.00 ? 6   SER A O    3  
ATOM   4483  C  CB   . SER A 1 6   ? 4.469   1.368   -25.868 1.00 0.00 ? 6   SER A CB   3  
ATOM   4484  O  OG   . SER A 1 6   ? 4.993   2.685   -25.891 1.00 0.00 ? 6   SER A OG   3  
ATOM   4485  H  H    . SER A 1 6   ? 2.617   2.776   -28.089 1.00 0.00 ? 6   SER A H    3  
ATOM   4486  H  HA   . SER A 1 6   ? 3.123   0.240   -27.092 1.00 0.00 ? 6   SER A HA   3  
ATOM   4487  H  HB2  . SER A 1 6   ? 4.219   1.113   -24.849 1.00 0.00 ? 6   SER A HB2  3  
ATOM   4488  H  HB3  . SER A 1 6   ? 5.223   0.687   -26.234 1.00 0.00 ? 6   SER A HB3  3  
ATOM   4489  H  HG   . SER A 1 6   ? 5.299   2.924   -25.013 1.00 0.00 ? 6   SER A HG   3  
ATOM   4490  N  N    . GLY A 1 7   ? 1.248   0.586   -25.493 1.00 0.00 ? 7   GLY A N    3  
ATOM   4491  C  CA   . GLY A 1 7   ? 0.050   0.809   -24.704 1.00 0.00 ? 7   GLY A CA   3  
ATOM   4492  C  C    . GLY A 1 7   ? 0.342   0.978   -23.224 1.00 0.00 ? 7   GLY A C    3  
ATOM   4493  O  O    . GLY A 1 7   ? -0.565  1.254   -22.437 1.00 0.00 ? 7   GLY A O    3  
ATOM   4494  H  H    . GLY A 1 7   ? 1.522   -0.328  -25.716 1.00 0.00 ? 7   GLY A H    3  
ATOM   4495  H  HA2  . GLY A 1 7   ? -0.443  1.699   -25.065 1.00 0.00 ? 7   GLY A HA2  3  
ATOM   4496  H  HA3  . GLY A 1 7   ? -0.614  -0.033  -24.835 1.00 0.00 ? 7   GLY A HA3  3  
ATOM   4497  N  N    . LEU A 1 8   ? 1.604   0.808   -22.838 1.00 0.00 ? 8   LEU A N    3  
ATOM   4498  C  CA   . LEU A 1 8   ? 2.004   0.938   -21.449 1.00 0.00 ? 8   LEU A CA   3  
ATOM   4499  C  C    . LEU A 1 8   ? 1.809   2.360   -20.940 1.00 0.00 ? 8   LEU A C    3  
ATOM   4500  O  O    . LEU A 1 8   ? 2.262   3.317   -21.567 1.00 0.00 ? 8   LEU A O    3  
ATOM   4501  C  CB   . LEU A 1 8   ? 3.474   0.562   -21.300 1.00 0.00 ? 8   LEU A CB   3  
ATOM   4502  C  CG   . LEU A 1 8   ? 3.864   -0.051  -19.958 1.00 0.00 ? 8   LEU A CG   3  
ATOM   4503  C  CD1  . LEU A 1 8   ? 3.829   0.992   -18.848 1.00 0.00 ? 8   LEU A CD1  3  
ATOM   4504  C  CD2  . LEU A 1 8   ? 2.960   -1.226  -19.618 1.00 0.00 ? 8   LEU A CD2  3  
ATOM   4505  H  H    . LEU A 1 8   ? 2.286   0.582   -23.503 1.00 0.00 ? 8   LEU A H    3  
ATOM   4506  H  HA   . LEU A 1 8   ? 1.404   0.262   -20.861 1.00 0.00 ? 8   LEU A HA   3  
ATOM   4507  H  HB2  . LEU A 1 8   ? 3.722   -0.142  -22.078 1.00 0.00 ? 8   LEU A HB2  3  
ATOM   4508  H  HB3  . LEU A 1 8   ? 4.066   1.453   -21.446 1.00 0.00 ? 8   LEU A HB3  3  
ATOM   4509  H  HG   . LEU A 1 8   ? 4.872   -0.416  -20.035 1.00 0.00 ? 8   LEU A HG   3  
ATOM   4510  H  HD11 . LEU A 1 8   ? 3.508   1.940   -19.251 1.00 0.00 ? 8   LEU A HD11 3  
ATOM   4511  H  HD12 . LEU A 1 8   ? 4.817   1.097   -18.425 1.00 0.00 ? 8   LEU A HD12 3  
ATOM   4512  H  HD13 . LEU A 1 8   ? 3.141   0.677   -18.078 1.00 0.00 ? 8   LEU A HD13 3  
ATOM   4513  H  HD21 . LEU A 1 8   ? 2.298   -1.426  -20.448 1.00 0.00 ? 8   LEU A HD21 3  
ATOM   4514  H  HD22 . LEU A 1 8   ? 2.375   -0.989  -18.741 1.00 0.00 ? 8   LEU A HD22 3  
ATOM   4515  H  HD23 . LEU A 1 8   ? 3.564   -2.098  -19.421 1.00 0.00 ? 8   LEU A HD23 3  
ATOM   4516  N  N    . PRO A 1 9   ? 1.160   2.519   -19.777 1.00 0.00 ? 9   PRO A N    3  
ATOM   4517  C  CA   . PRO A 1 9   ? 0.952   3.837   -19.185 1.00 0.00 ? 9   PRO A CA   3  
ATOM   4518  C  C    . PRO A 1 9   ? 2.284   4.468   -18.803 1.00 0.00 ? 9   PRO A C    3  
ATOM   4519  O  O    . PRO A 1 9   ? 2.906   4.076   -17.815 1.00 0.00 ? 9   PRO A O    3  
ATOM   4520  C  CB   . PRO A 1 9   ? 0.115   3.548   -17.935 1.00 0.00 ? 9   PRO A CB   3  
ATOM   4521  C  CG   . PRO A 1 9   ? 0.362   2.112   -17.623 1.00 0.00 ? 9   PRO A CG   3  
ATOM   4522  C  CD   . PRO A 1 9   ? 0.611   1.438   -18.940 1.00 0.00 ? 9   PRO A CD   3  
ATOM   4523  H  HA   . PRO A 1 9   ? 0.413   4.496   -19.851 1.00 0.00 ? 9   PRO A HA   3  
ATOM   4524  H  HB2  . PRO A 1 9   ? 0.442   4.184   -17.129 1.00 0.00 ? 9   PRO A HB2  3  
ATOM   4525  H  HB3  . PRO A 1 9   ? -0.927  3.731   -18.146 1.00 0.00 ? 9   PRO A HB3  3  
ATOM   4526  H  HG2  . PRO A 1 9   ? 1.228   2.019   -16.985 1.00 0.00 ? 9   PRO A HG2  3  
ATOM   4527  H  HG3  . PRO A 1 9   ? -0.507  1.686   -17.142 1.00 0.00 ? 9   PRO A HG3  3  
ATOM   4528  H  HD2  . PRO A 1 9   ? 1.327   0.638   -18.825 1.00 0.00 ? 9   PRO A HD2  3  
ATOM   4529  H  HD3  . PRO A 1 9   ? -0.312  1.062   -19.355 1.00 0.00 ? 9   PRO A HD3  3  
ATOM   4530  N  N    . GLN A 1 10  ? 2.730   5.431   -19.600 1.00 0.00 ? 10  GLN A N    3  
ATOM   4531  C  CA   . GLN A 1 10  ? 4.001   6.096   -19.348 1.00 0.00 ? 10  GLN A CA   3  
ATOM   4532  C  C    . GLN A 1 10  ? 3.791   7.441   -18.657 1.00 0.00 ? 10  GLN A C    3  
ATOM   4533  O  O    . GLN A 1 10  ? 2.801   8.130   -18.904 1.00 0.00 ? 10  GLN A O    3  
ATOM   4534  C  CB   . GLN A 1 10  ? 4.762   6.288   -20.663 1.00 0.00 ? 10  GLN A CB   3  
ATOM   4535  C  CG   . GLN A 1 10  ? 6.026   7.124   -20.526 1.00 0.00 ? 10  GLN A CG   3  
ATOM   4536  C  CD   . GLN A 1 10  ? 6.738   7.323   -21.850 1.00 0.00 ? 10  GLN A CD   3  
ATOM   4537  O  OE1  . GLN A 1 10  ? 7.222   6.369   -22.457 1.00 0.00 ? 10  GLN A OE1  3  
ATOM   4538  N  NE2  . GLN A 1 10  ? 6.805   8.570   -22.304 1.00 0.00 ? 10  GLN A NE2  3  
ATOM   4539  H  H    . GLN A 1 10  ? 2.199   5.693   -20.380 1.00 0.00 ? 10  GLN A H    3  
ATOM   4540  H  HA   . GLN A 1 10  ? 4.582   5.455   -18.700 1.00 0.00 ? 10  GLN A HA   3  
ATOM   4541  H  HB2  . GLN A 1 10  ? 5.041   5.317   -21.046 1.00 0.00 ? 10  GLN A HB2  3  
ATOM   4542  H  HB3  . GLN A 1 10  ? 4.111   6.771   -21.373 1.00 0.00 ? 10  GLN A HB3  3  
ATOM   4543  H  HG2  . GLN A 1 10  ? 5.760   8.092   -20.129 1.00 0.00 ? 10  GLN A HG2  3  
ATOM   4544  H  HG3  . GLN A 1 10  ? 6.698   6.628   -19.842 1.00 0.00 ? 10  GLN A HG3  3  
ATOM   4545  H  HE21 . GLN A 1 10  ? 6.397   9.281   -21.767 1.00 0.00 ? 10  GLN A HE21 3  
ATOM   4546  H  HE22 . GLN A 1 10  ? 7.260   8.727   -23.158 1.00 0.00 ? 10  GLN A HE22 3  
ATOM   4547  N  N    . LEU A 1 11  ? 4.732   7.810   -17.793 1.00 0.00 ? 11  LEU A N    3  
ATOM   4548  C  CA   . LEU A 1 11  ? 4.656   9.070   -17.069 1.00 0.00 ? 11  LEU A CA   3  
ATOM   4549  C  C    . LEU A 1 11  ? 5.949   9.864   -17.222 1.00 0.00 ? 11  LEU A C    3  
ATOM   4550  O  O    . LEU A 1 11  ? 6.929   9.369   -17.778 1.00 0.00 ? 11  LEU A O    3  
ATOM   4551  C  CB   . LEU A 1 11  ? 4.370   8.816   -15.587 1.00 0.00 ? 11  LEU A CB   3  
ATOM   4552  C  CG   . LEU A 1 11  ? 3.037   8.126   -15.294 1.00 0.00 ? 11  LEU A CG   3  
ATOM   4553  C  CD1  . LEU A 1 11  ? 2.997   7.633   -13.855 1.00 0.00 ? 11  LEU A CD1  3  
ATOM   4554  C  CD2  . LEU A 1 11  ? 1.877   9.071   -15.568 1.00 0.00 ? 11  LEU A CD2  3  
ATOM   4555  H  H    . LEU A 1 11  ? 5.495   7.222   -17.641 1.00 0.00 ? 11  LEU A H    3  
ATOM   4556  H  HA   . LEU A 1 11  ? 3.846   9.639   -17.490 1.00 0.00 ? 11  LEU A HA   3  
ATOM   4557  H  HB2  . LEU A 1 11  ? 5.166   8.203   -15.189 1.00 0.00 ? 11  LEU A HB2  3  
ATOM   4558  H  HB3  . LEU A 1 11  ? 4.378   9.766   -15.073 1.00 0.00 ? 11  LEU A HB3  3  
ATOM   4559  H  HG   . LEU A 1 11  ? 2.933   7.269   -15.944 1.00 0.00 ? 11  LEU A HG   3  
ATOM   4560  H  HD11 . LEU A 1 11  ? 2.053   7.142   -13.670 1.00 0.00 ? 11  LEU A HD11 3  
ATOM   4561  H  HD12 . LEU A 1 11  ? 3.105   8.472   -13.184 1.00 0.00 ? 11  LEU A HD12 3  
ATOM   4562  H  HD13 . LEU A 1 11  ? 3.804   6.935   -13.692 1.00 0.00 ? 11  LEU A HD13 3  
ATOM   4563  H  HD21 . LEU A 1 11  ? 2.197   9.848   -16.246 1.00 0.00 ? 11  LEU A HD21 3  
ATOM   4564  H  HD22 . LEU A 1 11  ? 1.548   9.516   -14.640 1.00 0.00 ? 11  LEU A HD22 3  
ATOM   4565  H  HD23 . LEU A 1 11  ? 1.061   8.520   -16.011 1.00 0.00 ? 11  LEU A HD23 3  
ATOM   4566  N  N    . THR A 1 12  ? 5.945   11.098  -16.727 1.00 0.00 ? 12  THR A N    3  
ATOM   4567  C  CA   . THR A 1 12  ? 7.115   11.958  -16.809 1.00 0.00 ? 12  THR A CA   3  
ATOM   4568  C  C    . THR A 1 12  ? 7.998   11.790  -15.581 1.00 0.00 ? 12  THR A C    3  
ATOM   4569  O  O    . THR A 1 12  ? 7.507   11.522  -14.484 1.00 0.00 ? 12  THR A O    3  
ATOM   4570  C  CB   . THR A 1 12  ? 6.681   13.414  -16.932 1.00 0.00 ? 12  THR A CB   3  
ATOM   4571  O  OG1  . THR A 1 12  ? 5.749   13.575  -17.985 1.00 0.00 ? 12  THR A OG1  3  
ATOM   4572  C  CG2  . THR A 1 12  ? 7.832   14.364  -17.185 1.00 0.00 ? 12  THR A CG2  3  
ATOM   4573  H  H    . THR A 1 12  ? 5.134   11.441  -16.294 1.00 0.00 ? 12  THR A H    3  
ATOM   4574  H  HA   . THR A 1 12  ? 7.678   11.682  -17.685 1.00 0.00 ? 12  THR A HA   3  
ATOM   4575  H  HB   . THR A 1 12  ? 6.206   13.709  -16.008 1.00 0.00 ? 12  THR A HB   3  
ATOM   4576  H  HG1  . THR A 1 12  ? 5.426   14.479  -17.994 1.00 0.00 ? 12  THR A HG1  3  
ATOM   4577  H  HG21 . THR A 1 12  ? 7.547   15.081  -17.943 1.00 0.00 ? 12  THR A HG21 3  
ATOM   4578  H  HG22 . THR A 1 12  ? 8.693   13.807  -17.523 1.00 0.00 ? 12  THR A HG22 3  
ATOM   4579  H  HG23 . THR A 1 12  ? 8.077   14.886  -16.272 1.00 0.00 ? 12  THR A HG23 3  
ATOM   4580  N  N    . SER A 1 13  ? 9.302   11.957  -15.770 1.00 0.00 ? 13  SER A N    3  
ATOM   4581  C  CA   . SER A 1 13  ? 10.254  11.833  -14.682 1.00 0.00 ? 13  SER A CA   3  
ATOM   4582  C  C    . SER A 1 13  ? 9.793   12.622  -13.458 1.00 0.00 ? 13  SER A C    3  
ATOM   4583  O  O    . SER A 1 13  ? 10.152  12.297  -12.326 1.00 0.00 ? 13  SER A O    3  
ATOM   4584  C  CB   . SER A 1 13  ? 11.635  12.318  -15.126 1.00 0.00 ? 13  SER A CB   3  
ATOM   4585  O  OG   . SER A 1 13  ? 11.563  13.618  -15.684 1.00 0.00 ? 13  SER A OG   3  
ATOM   4586  H  H    . SER A 1 13  ? 9.632   12.168  -16.660 1.00 0.00 ? 13  SER A H    3  
ATOM   4587  H  HA   . SER A 1 13  ? 10.314  10.792  -14.428 1.00 0.00 ? 13  SER A HA   3  
ATOM   4588  H  HB2  . SER A 1 13  ? 12.296  12.343  -14.272 1.00 0.00 ? 13  SER A HB2  3  
ATOM   4589  H  HB3  . SER A 1 13  ? 12.029  11.641  -15.869 1.00 0.00 ? 13  SER A HB3  3  
ATOM   4590  H  HG   . SER A 1 13  ? 12.196  13.694  -16.402 1.00 0.00 ? 13  SER A HG   3  
ATOM   4591  N  N    . TYR A 1 14  ? 8.995   13.662  -13.694 1.00 0.00 ? 14  TYR A N    3  
ATOM   4592  C  CA   . TYR A 1 14  ? 8.486   14.495  -12.610 1.00 0.00 ? 14  TYR A CA   3  
ATOM   4593  C  C    . TYR A 1 14  ? 7.056   14.109  -12.250 1.00 0.00 ? 14  TYR A C    3  
ATOM   4594  O  O    . TYR A 1 14  ? 6.756   13.811  -11.095 1.00 0.00 ? 14  TYR A O    3  
ATOM   4595  C  CB   . TYR A 1 14  ? 8.549   15.973  -12.999 1.00 0.00 ? 14  TYR A CB   3  
ATOM   4596  C  CG   . TYR A 1 14  ? 8.494   16.915  -11.818 1.00 0.00 ? 14  TYR A CG   3  
ATOM   4597  C  CD1  . TYR A 1 14  ? 9.478   16.886  -10.835 1.00 0.00 ? 14  TYR A CD1  3  
ATOM   4598  C  CD2  . TYR A 1 14  ? 7.461   17.834  -11.684 1.00 0.00 ? 14  TYR A CD2  3  
ATOM   4599  C  CE1  . TYR A 1 14  ? 9.431   17.746  -9.754  1.00 0.00 ? 14  TYR A CE1  3  
ATOM   4600  C  CE2  . TYR A 1 14  ? 7.409   18.697  -10.607 1.00 0.00 ? 14  TYR A CE2  3  
ATOM   4601  C  CZ   . TYR A 1 14  ? 8.395   18.650  -9.644  1.00 0.00 ? 14  TYR A CZ   3  
ATOM   4602  O  OH   . TYR A 1 14  ? 8.345   19.507  -8.569  1.00 0.00 ? 14  TYR A OH   3  
ATOM   4603  H  H    . TYR A 1 14  ? 8.738   13.872  -14.620 1.00 0.00 ? 14  TYR A H    3  
ATOM   4604  H  HA   . TYR A 1 14  ? 9.114   14.331  -11.747 1.00 0.00 ? 14  TYR A HA   3  
ATOM   4605  H  HB2  . TYR A 1 14  ? 9.471   16.160  -13.529 1.00 0.00 ? 14  TYR A HB2  3  
ATOM   4606  H  HB3  . TYR A 1 14  ? 7.715   16.203  -13.646 1.00 0.00 ? 14  TYR A HB3  3  
ATOM   4607  H  HD1  . TYR A 1 14  ? 10.288  16.179  -10.924 1.00 0.00 ? 14  TYR A HD1  3  
ATOM   4608  H  HD2  . TYR A 1 14  ? 6.690   17.869  -12.440 1.00 0.00 ? 14  TYR A HD2  3  
ATOM   4609  H  HE1  . TYR A 1 14  ? 10.204  17.708  -9.001  1.00 0.00 ? 14  TYR A HE1  3  
ATOM   4610  H  HE2  . TYR A 1 14  ? 6.597   19.404  -10.521 1.00 0.00 ? 14  TYR A HE2  3  
ATOM   4611  H  HH   . TYR A 1 14  ? 8.530   19.020  -7.763  1.00 0.00 ? 14  TYR A HH   3  
ATOM   4612  N  N    . ASP A 1 15  ? 6.176   14.117  -13.248 1.00 0.00 ? 15  ASP A N    3  
ATOM   4613  C  CA   . ASP A 1 15  ? 4.775   13.765  -13.037 1.00 0.00 ? 15  ASP A CA   3  
ATOM   4614  C  C    . ASP A 1 15  ? 4.651   12.455  -12.268 1.00 0.00 ? 15  ASP A C    3  
ATOM   4615  O  O    . ASP A 1 15  ? 3.668   12.225  -11.568 1.00 0.00 ? 15  ASP A O    3  
ATOM   4616  C  CB   . ASP A 1 15  ? 4.047   13.657  -14.378 1.00 0.00 ? 15  ASP A CB   3  
ATOM   4617  C  CG   . ASP A 1 15  ? 4.126   14.939  -15.183 1.00 0.00 ? 15  ASP A CG   3  
ATOM   4618  O  OD1  . ASP A 1 15  ? 4.367   16.005  -14.580 1.00 0.00 ? 15  ASP A OD1  3  
ATOM   4619  O  OD2  . ASP A 1 15  ? 3.945   14.876  -16.418 1.00 0.00 ? 15  ASP A OD2  3  
ATOM   4620  H  H    . ASP A 1 15  ? 6.477   14.363  -14.148 1.00 0.00 ? 15  ASP A H    3  
ATOM   4621  H  HA   . ASP A 1 15  ? 4.321   14.552  -12.454 1.00 0.00 ? 15  ASP A HA   3  
ATOM   4622  H  HB2  . ASP A 1 15  ? 4.491   12.862  -14.958 1.00 0.00 ? 15  ASP A HB2  3  
ATOM   4623  H  HB3  . ASP A 1 15  ? 3.007   13.429  -14.198 1.00 0.00 ? 15  ASP A HB3  3  
ATOM   4624  N  N    . CYS A 1 16  ? 5.661   11.600  -12.400 1.00 0.00 ? 16  CYS A N    3  
ATOM   4625  C  CA   . CYS A 1 16  ? 5.674   10.319  -11.717 1.00 0.00 ? 16  CYS A CA   3  
ATOM   4626  C  C    . CYS A 1 16  ? 6.248   10.467  -10.315 1.00 0.00 ? 16  CYS A C    3  
ATOM   4627  O  O    . CYS A 1 16  ? 5.677   9.978   -9.340  1.00 0.00 ? 16  CYS A O    3  
ATOM   4628  C  CB   . CYS A 1 16  ? 6.503   9.317   -12.513 1.00 0.00 ? 16  CYS A CB   3  
ATOM   4629  S  SG   . CYS A 1 16  ? 6.106   7.586   -12.173 1.00 0.00 ? 16  CYS A SG   3  
ATOM   4630  H  H    . CYS A 1 16  ? 6.419   11.838  -12.970 1.00 0.00 ? 16  CYS A H    3  
ATOM   4631  H  HA   . CYS A 1 16  ? 4.658   9.966   -11.647 1.00 0.00 ? 16  CYS A HA   3  
ATOM   4632  H  HB2  . CYS A 1 16  ? 6.347   9.490   -13.565 1.00 0.00 ? 16  CYS A HB2  3  
ATOM   4633  H  HB3  . CYS A 1 16  ? 7.547   9.468   -12.283 1.00 0.00 ? 16  CYS A HB3  3  
ATOM   4634  H  HG   . CYS A 1 16  ? 5.174   7.535   -11.948 1.00 0.00 ? 16  CYS A HG   3  
ATOM   4635  N  N    . GLU A 1 17  ? 7.382   11.151  -10.225 1.00 0.00 ? 17  GLU A N    3  
ATOM   4636  C  CA   . GLU A 1 17  ? 8.041   11.373  -8.945  1.00 0.00 ? 17  GLU A CA   3  
ATOM   4637  C  C    . GLU A 1 17  ? 7.142   12.173  -8.009  1.00 0.00 ? 17  GLU A C    3  
ATOM   4638  O  O    . GLU A 1 17  ? 7.026   11.861  -6.823  1.00 0.00 ? 17  GLU A O    3  
ATOM   4639  C  CB   . GLU A 1 17  ? 9.361   12.115  -9.157  1.00 0.00 ? 17  GLU A CB   3  
ATOM   4640  C  CG   . GLU A 1 17  ? 10.463  11.685  -8.202  1.00 0.00 ? 17  GLU A CG   3  
ATOM   4641  C  CD   . GLU A 1 17  ? 10.958  12.823  -7.330  1.00 0.00 ? 17  GLU A CD   3  
ATOM   4642  O  OE1  . GLU A 1 17  ? 10.128  13.663  -6.922  1.00 0.00 ? 17  GLU A OE1  3  
ATOM   4643  O  OE2  . GLU A 1 17  ? 12.175  12.874  -7.055  1.00 0.00 ? 17  GLU A OE2  3  
ATOM   4644  H  H    . GLU A 1 17  ? 7.786   11.520  -11.041 1.00 0.00 ? 17  GLU A H    3  
ATOM   4645  H  HA   . GLU A 1 17  ? 8.244   10.411  -8.501  1.00 0.00 ? 17  GLU A HA   3  
ATOM   4646  H  HB2  . GLU A 1 17  ? 9.699   11.939  -10.167 1.00 0.00 ? 17  GLU A HB2  3  
ATOM   4647  H  HB3  . GLU A 1 17  ? 9.189   13.173  -9.025  1.00 0.00 ? 17  GLU A HB3  3  
ATOM   4648  H  HG2  . GLU A 1 17  ? 10.084  10.902  -7.564  1.00 0.00 ? 17  GLU A HG2  3  
ATOM   4649  H  HG3  . GLU A 1 17  ? 11.294  11.307  -8.780  1.00 0.00 ? 17  GLU A HG3  3  
ATOM   4650  N  N    . VAL A 1 18  ? 6.510   13.206  -8.553  1.00 0.00 ? 18  VAL A N    3  
ATOM   4651  C  CA   . VAL A 1 18  ? 5.620   14.057  -7.774  1.00 0.00 ? 18  VAL A CA   3  
ATOM   4652  C  C    . VAL A 1 18  ? 4.405   13.282  -7.272  1.00 0.00 ? 18  VAL A C    3  
ATOM   4653  O  O    . VAL A 1 18  ? 3.996   13.431  -6.120  1.00 0.00 ? 18  VAL A O    3  
ATOM   4654  C  CB   . VAL A 1 18  ? 5.138   15.266  -8.599  1.00 0.00 ? 18  VAL A CB   3  
ATOM   4655  C  CG1  . VAL A 1 18  ? 4.325   16.219  -7.734  1.00 0.00 ? 18  VAL A CG1  3  
ATOM   4656  C  CG2  . VAL A 1 18  ? 6.320   15.987  -9.233  1.00 0.00 ? 18  VAL A CG2  3  
ATOM   4657  H  H    . VAL A 1 18  ? 6.648   13.401  -9.503  1.00 0.00 ? 18  VAL A H    3  
ATOM   4658  H  HA   . VAL A 1 18  ? 6.174   14.428  -6.924  1.00 0.00 ? 18  VAL A HA   3  
ATOM   4659  H  HB   . VAL A 1 18  ? 4.499   14.904  -9.391  1.00 0.00 ? 18  VAL A HB   3  
ATOM   4660  H  HG11 . VAL A 1 18  ? 4.713   16.207  -6.726  1.00 0.00 ? 18  VAL A HG11 3  
ATOM   4661  H  HG12 . VAL A 1 18  ? 3.292   15.904  -7.725  1.00 0.00 ? 18  VAL A HG12 3  
ATOM   4662  H  HG13 . VAL A 1 18  ? 4.394   17.218  -8.135  1.00 0.00 ? 18  VAL A HG13 3  
ATOM   4663  H  HG21 . VAL A 1 18  ? 6.478   16.930  -8.733  1.00 0.00 ? 18  VAL A HG21 3  
ATOM   4664  H  HG22 . VAL A 1 18  ? 6.114   16.164  -10.278 1.00 0.00 ? 18  VAL A HG22 3  
ATOM   4665  H  HG23 . VAL A 1 18  ? 7.206   15.377  -9.140  1.00 0.00 ? 18  VAL A HG23 3  
ATOM   4666  N  N    . ASN A 1 19  ? 3.826   12.458  -8.141  1.00 0.00 ? 19  ASN A N    3  
ATOM   4667  C  CA   . ASN A 1 19  ? 2.654   11.670  -7.777  1.00 0.00 ? 19  ASN A CA   3  
ATOM   4668  C  C    . ASN A 1 19  ? 3.003   10.599  -6.744  1.00 0.00 ? 19  ASN A C    3  
ATOM   4669  O  O    . ASN A 1 19  ? 2.146   10.171  -5.971  1.00 0.00 ? 19  ASN A O    3  
ATOM   4670  C  CB   . ASN A 1 19  ? 2.044   11.023  -9.021  1.00 0.00 ? 19  ASN A CB   3  
ATOM   4671  C  CG   . ASN A 1 19  ? 0.584   11.390  -9.208  1.00 0.00 ? 19  ASN A CG   3  
ATOM   4672  O  OD1  . ASN A 1 19  ? -0.306  10.563  -9.016  1.00 0.00 ? 19  ASN A OD1  3  
ATOM   4673  N  ND2  . ASN A 1 19  ? 0.332   12.640  -9.583  1.00 0.00 ? 19  ASN A ND2  3  
ATOM   4674  H  H    . ASN A 1 19  ? 4.191   12.381  -9.049  1.00 0.00 ? 19  ASN A H    3  
ATOM   4675  H  HA   . ASN A 1 19  ? 1.929   12.343  -7.343  1.00 0.00 ? 19  ASN A HA   3  
ATOM   4676  H  HB2  . ASN A 1 19  ? 2.591   11.349  -9.892  1.00 0.00 ? 19  ASN A HB2  3  
ATOM   4677  H  HB3  . ASN A 1 19  ? 2.120   9.950   -8.937  1.00 0.00 ? 19  ASN A HB3  3  
ATOM   4678  H  HD21 . ASN A 1 19  ? 1.092   13.245  -9.717  1.00 0.00 ? 19  ASN A HD21 3  
ATOM   4679  H  HD22 . ASN A 1 19  ? -0.602  12.904  -9.712  1.00 0.00 ? 19  ASN A HD22 3  
ATOM   4680  N  N    . ALA A 1 20  ? 4.261   10.167  -6.735  1.00 0.00 ? 20  ALA A N    3  
ATOM   4681  C  CA   . ALA A 1 20  ? 4.708   9.147   -5.795  1.00 0.00 ? 20  ALA A CA   3  
ATOM   4682  C  C    . ALA A 1 20  ? 6.189   9.310   -5.462  1.00 0.00 ? 20  ALA A C    3  
ATOM   4683  O  O    . ALA A 1 20  ? 7.042   8.637   -6.040  1.00 0.00 ? 20  ALA A O    3  
ATOM   4684  C  CB   . ALA A 1 20  ? 4.440   7.759   -6.356  1.00 0.00 ? 20  ALA A CB   3  
ATOM   4685  H  H    . ALA A 1 20  ? 4.900   10.542  -7.373  1.00 0.00 ? 20  ALA A H    3  
ATOM   4686  H  HA   . ALA A 1 20  ? 4.134   9.260   -4.889  1.00 0.00 ? 20  ALA A HA   3  
ATOM   4687  H  HB1  . ALA A 1 20  ? 3.509   7.765   -6.903  1.00 0.00 ? 20  ALA A HB1  3  
ATOM   4688  H  HB2  . ALA A 1 20  ? 4.376   7.049   -5.545  1.00 0.00 ? 20  ALA A HB2  3  
ATOM   4689  H  HB3  . ALA A 1 20  ? 5.245   7.478   -7.019  1.00 0.00 ? 20  ALA A HB3  3  
ATOM   4690  N  N    . PRO A 1 21  ? 6.512   10.215  -4.522  1.00 0.00 ? 21  PRO A N    3  
ATOM   4691  C  CA   . PRO A 1 21  ? 7.883   10.478  -4.108  1.00 0.00 ? 21  PRO A CA   3  
ATOM   4692  C  C    . PRO A 1 21  ? 8.315   9.614   -2.926  1.00 0.00 ? 21  PRO A C    3  
ATOM   4693  O  O    . PRO A 1 21  ? 7.519   8.856   -2.373  1.00 0.00 ? 21  PRO A O    3  
ATOM   4694  C  CB   . PRO A 1 21  ? 7.815   11.944  -3.698  1.00 0.00 ? 21  PRO A CB   3  
ATOM   4695  C  CG   . PRO A 1 21  ? 6.433   12.126  -3.153  1.00 0.00 ? 21  PRO A CG   3  
ATOM   4696  C  CD   . PRO A 1 21  ? 5.559   11.065  -3.789  1.00 0.00 ? 21  PRO A CD   3  
ATOM   4697  H  HA   . PRO A 1 21  ? 8.580   10.357  -4.924  1.00 0.00 ? 21  PRO A HA   3  
ATOM   4698  H  HB2  . PRO A 1 21  ? 8.567   12.145  -2.947  1.00 0.00 ? 21  PRO A HB2  3  
ATOM   4699  H  HB3  . PRO A 1 21  ? 7.984   12.570  -4.561  1.00 0.00 ? 21  PRO A HB3  3  
ATOM   4700  H  HG2  . PRO A 1 21  ? 6.446   12.001  -2.080  1.00 0.00 ? 21  PRO A HG2  3  
ATOM   4701  H  HG3  . PRO A 1 21  ? 6.068   13.109  -3.408  1.00 0.00 ? 21  PRO A HG3  3  
ATOM   4702  H  HD2  . PRO A 1 21  ? 5.045   10.496  -3.029  1.00 0.00 ? 21  PRO A HD2  3  
ATOM   4703  H  HD3  . PRO A 1 21  ? 4.848   11.518  -4.464  1.00 0.00 ? 21  PRO A HD3  3  
ATOM   4704  N  N    . ILE A 1 22  ? 9.580   9.743   -2.539  1.00 0.00 ? 22  ILE A N    3  
ATOM   4705  C  CA   . ILE A 1 22  ? 10.118  8.984   -1.416  1.00 0.00 ? 22  ILE A CA   3  
ATOM   4706  C  C    . ILE A 1 22  ? 10.233  9.863   -0.168  1.00 0.00 ? 22  ILE A C    3  
ATOM   4707  O  O    . ILE A 1 22  ? 10.405  9.358   0.943   1.00 0.00 ? 22  ILE A O    3  
ATOM   4708  C  CB   . ILE A 1 22  ? 11.501  8.377   -1.756  1.00 0.00 ? 22  ILE A CB   3  
ATOM   4709  C  CG1  . ILE A 1 22  ? 11.347  7.262   -2.792  1.00 0.00 ? 22  ILE A CG1  3  
ATOM   4710  C  CG2  . ILE A 1 22  ? 12.189  7.849   -0.503  1.00 0.00 ? 22  ILE A CG2  3  
ATOM   4711  C  CD1  . ILE A 1 22  ? 11.998  7.578   -4.118  1.00 0.00 ? 22  ILE A CD1  3  
ATOM   4712  H  H    . ILE A 1 22  ? 10.164  10.370  -3.016  1.00 0.00 ? 22  ILE A H    3  
ATOM   4713  H  HA   . ILE A 1 22  ? 9.435   8.172   -1.210  1.00 0.00 ? 22  ILE A HA   3  
ATOM   4714  H  HB   . ILE A 1 22  ? 12.120  9.157   -2.172  1.00 0.00 ? 22  ILE A HB   3  
ATOM   4715  H  HG12 . ILE A 1 22  ? 11.797  6.357   -2.411  1.00 0.00 ? 22  ILE A HG12 3  
ATOM   4716  H  HG13 . ILE A 1 22  ? 10.298  7.088   -2.972  1.00 0.00 ? 22  ILE A HG13 3  
ATOM   4717  H  HG21 . ILE A 1 22  ? 12.790  6.989   -0.759  1.00 0.00 ? 22  ILE A HG21 3  
ATOM   4718  H  HG22 . ILE A 1 22  ? 11.444  7.564   0.223   1.00 0.00 ? 22  ILE A HG22 3  
ATOM   4719  H  HG23 . ILE A 1 22  ? 12.821  8.620   -0.088  1.00 0.00 ? 22  ILE A HG23 3  
ATOM   4720  H  HD11 . ILE A 1 22  ? 11.277  7.451   -4.911  1.00 0.00 ? 22  ILE A HD11 3  
ATOM   4721  H  HD12 . ILE A 1 22  ? 12.832  6.909   -4.278  1.00 0.00 ? 22  ILE A HD12 3  
ATOM   4722  H  HD13 . ILE A 1 22  ? 12.351  8.598   -4.110  1.00 0.00 ? 22  ILE A HD13 3  
ATOM   4723  N  N    . GLN A 1 23  ? 10.137  11.180  -0.355  1.00 0.00 ? 23  GLN A N    3  
ATOM   4724  C  CA   . GLN A 1 23  ? 10.228  12.127  0.756   1.00 0.00 ? 23  GLN A CA   3  
ATOM   4725  C  C    . GLN A 1 23  ? 11.669  12.283  1.223   1.00 0.00 ? 23  GLN A C    3  
ATOM   4726  O  O    . GLN A 1 23  ? 11.998  12.005  2.377   1.00 0.00 ? 23  GLN A O    3  
ATOM   4727  C  CB   . GLN A 1 23  ? 9.351   11.678  1.920   1.00 0.00 ? 23  GLN A CB   3  
ATOM   4728  C  CG   . GLN A 1 23  ? 8.785   12.827  2.738   1.00 0.00 ? 23  GLN A CG   3  
ATOM   4729  C  CD   . GLN A 1 23  ? 7.308   12.658  3.038   1.00 0.00 ? 23  GLN A CD   3  
ATOM   4730  O  OE1  . GLN A 1 23  ? 6.478   12.612  2.129   1.00 0.00 ? 23  GLN A OE1  3  
ATOM   4731  N  NE2  . GLN A 1 23  ? 6.972   12.563  4.320   1.00 0.00 ? 23  GLN A NE2  3  
ATOM   4732  H  H    . GLN A 1 23  ? 10.000  11.525  -1.262  1.00 0.00 ? 23  GLN A H    3  
ATOM   4733  H  HA   . GLN A 1 23  ? 9.875   13.084  0.402   1.00 0.00 ? 23  GLN A HA   3  
ATOM   4734  H  HB2  . GLN A 1 23  ? 8.529   11.100  1.529   1.00 0.00 ? 23  GLN A HB2  3  
ATOM   4735  H  HB3  . GLN A 1 23  ? 9.942   11.054  2.574   1.00 0.00 ? 23  GLN A HB3  3  
ATOM   4736  H  HG2  . GLN A 1 23  ? 9.322   12.885  3.673   1.00 0.00 ? 23  GLN A HG2  3  
ATOM   4737  H  HG3  . GLN A 1 23  ? 8.922   13.745  2.188   1.00 0.00 ? 23  GLN A HG3  3  
ATOM   4738  H  HE21 . GLN A 1 23  ? 7.685   12.607  4.991   1.00 0.00 ? 23  GLN A HE21 3  
ATOM   4739  H  HE22 . GLN A 1 23  ? 6.024   12.453  4.543   1.00 0.00 ? 23  GLN A HE22 3  
ATOM   4740  N  N    . GLY A 1 24  ? 12.521  12.731  0.316   1.00 0.00 ? 24  GLY A N    3  
ATOM   4741  C  CA   . GLY A 1 24  ? 13.923  12.924  0.639   1.00 0.00 ? 24  GLY A CA   3  
ATOM   4742  C  C    . GLY A 1 24  ? 14.642  11.613  0.887   1.00 0.00 ? 24  GLY A C    3  
ATOM   4743  O  O    . GLY A 1 24  ? 14.068  10.680  1.449   1.00 0.00 ? 24  GLY A O    3  
ATOM   4744  H  H    . GLY A 1 24  ? 12.193  12.933  -0.581  1.00 0.00 ? 24  GLY A H    3  
ATOM   4745  H  HA2  . GLY A 1 24  ? 14.403  13.437  -0.181  1.00 0.00 ? 24  GLY A HA2  3  
ATOM   4746  H  HA3  . GLY A 1 24  ? 13.996  13.536  1.526   1.00 0.00 ? 24  GLY A HA3  3  
ATOM   4747  N  N    . SER A 1 25  ? 15.901  11.538  0.462   1.00 0.00 ? 25  SER A N    3  
ATOM   4748  C  CA   . SER A 1 25  ? 16.693  10.328  0.636   1.00 0.00 ? 25  SER A CA   3  
ATOM   4749  C  C    . SER A 1 25  ? 16.171  9.220   -0.269  1.00 0.00 ? 25  SER A C    3  
ATOM   4750  O  O    . SER A 1 25  ? 15.173  8.570   0.041   1.00 0.00 ? 25  SER A O    3  
ATOM   4751  C  CB   . SER A 1 25  ? 16.671  9.873   2.098   1.00 0.00 ? 25  SER A CB   3  
ATOM   4752  O  OG   . SER A 1 25  ? 17.977  9.873   2.650   1.00 0.00 ? 25  SER A OG   3  
ATOM   4753  H  H    . SER A 1 25  ? 16.302  12.311  0.014   1.00 0.00 ? 25  SER A H    3  
ATOM   4754  H  HA   . SER A 1 25  ? 17.710  10.556  0.353   1.00 0.00 ? 25  SER A HA   3  
ATOM   4755  H  HB2  . SER A 1 25  ? 16.052  10.545  2.673   1.00 0.00 ? 25  SER A HB2  3  
ATOM   4756  H  HB3  . SER A 1 25  ? 16.269  8.872   2.157   1.00 0.00 ? 25  SER A HB3  3  
ATOM   4757  H  HG   . SER A 1 25  ? 17.924  10.032  3.596   1.00 0.00 ? 25  SER A HG   3  
ATOM   4758  N  N    . ARG A 1 26  ? 16.851  9.015   -1.392  1.00 0.00 ? 26  ARG A N    3  
ATOM   4759  C  CA   . ARG A 1 26  ? 16.474  8.000   -2.350  1.00 0.00 ? 26  ARG A CA   3  
ATOM   4760  C  C    . ARG A 1 26  ? 16.174  6.671   -1.664  1.00 0.00 ? 26  ARG A C    3  
ATOM   4761  O  O    . ARG A 1 26  ? 16.426  6.502   -0.471  1.00 0.00 ? 26  ARG A O    3  
ATOM   4762  C  CB   . ARG A 1 26  ? 17.599  7.834   -3.359  1.00 0.00 ? 26  ARG A CB   3  
ATOM   4763  C  CG   . ARG A 1 26  ? 18.149  9.150   -3.893  1.00 0.00 ? 26  ARG A CG   3  
ATOM   4764  C  CD   . ARG A 1 26  ? 19.502  9.484   -3.281  1.00 0.00 ? 26  ARG A CD   3  
ATOM   4765  N  NE   . ARG A 1 26  ? 20.514  9.743   -4.301  1.00 0.00 ? 26  ARG A NE   3  
ATOM   4766  C  CZ   . ARG A 1 26  ? 21.825  9.700   -4.072  1.00 0.00 ? 26  ARG A CZ   3  
ATOM   4767  N  NH1  . ARG A 1 26  ? 22.286  9.410   -2.861  1.00 0.00 ? 26  ARG A NH1  3  
ATOM   4768  N  NH2  . ARG A 1 26  ? 22.678  9.946   -5.057  1.00 0.00 ? 26  ARG A NH2  3  
ATOM   4769  H  H    . ARG A 1 26  ? 17.633  9.561   -1.587  1.00 0.00 ? 26  ARG A H    3  
ATOM   4770  H  HA   . ARG A 1 26  ? 15.587  8.339   -2.864  1.00 0.00 ? 26  ARG A HA   3  
ATOM   4771  H  HB2  . ARG A 1 26  ? 18.407  7.293   -2.893  1.00 0.00 ? 26  ARG A HB2  3  
ATOM   4772  H  HB3  . ARG A 1 26  ? 17.230  7.271   -4.184  1.00 0.00 ? 26  ARG A HB3  3  
ATOM   4773  H  HG2  . ARG A 1 26  ? 18.261  9.074   -4.964  1.00 0.00 ? 26  ARG A HG2  3  
ATOM   4774  H  HG3  . ARG A 1 26  ? 17.452  9.941   -3.657  1.00 0.00 ? 26  ARG A HG3  3  
ATOM   4775  H  HD2  . ARG A 1 26  ? 19.395  10.363  -2.662  1.00 0.00 ? 26  ARG A HD2  3  
ATOM   4776  H  HD3  . ARG A 1 26  ? 19.823  8.653   -2.670  1.00 0.00 ? 26  ARG A HD3  3  
ATOM   4777  H  HE   . ARG A 1 26  ? 20.202  9.960   -5.204  1.00 0.00 ? 26  ARG A HE   3  
ATOM   4778  H  HH11 . ARG A 1 26  ? 21.648  9.223   -2.114  1.00 0.00 ? 26  ARG A HH11 3  
ATOM   4779  H  HH12 . ARG A 1 26  ? 23.271  9.379   -2.697  1.00 0.00 ? 26  ARG A HH12 3  
ATOM   4780  H  HH21 . ARG A 1 26  ? 22.335  10.165  -5.971  1.00 0.00 ? 26  ARG A HH21 3  
ATOM   4781  H  HH22 . ARG A 1 26  ? 23.662  9.914   -4.887  1.00 0.00 ? 26  ARG A HH22 3  
ATOM   4782  N  N    . ASN A 1 27  ? 15.626  5.732   -2.426  1.00 0.00 ? 27  ASN A N    3  
ATOM   4783  C  CA   . ASN A 1 27  ? 15.281  4.424   -1.894  1.00 0.00 ? 27  ASN A CA   3  
ATOM   4784  C  C    . ASN A 1 27  ? 16.441  3.444   -2.044  1.00 0.00 ? 27  ASN A C    3  
ATOM   4785  O  O    . ASN A 1 27  ? 17.404  3.700   -2.768  1.00 0.00 ? 27  ASN A O    3  
ATOM   4786  C  CB   . ASN A 1 27  ? 14.020  3.895   -2.587  1.00 0.00 ? 27  ASN A CB   3  
ATOM   4787  C  CG   . ASN A 1 27  ? 13.854  2.389   -2.487  1.00 0.00 ? 27  ASN A CG   3  
ATOM   4788  O  OD1  . ASN A 1 27  ? 14.317  1.646   -3.351  1.00 0.00 ? 27  ASN A OD1  3  
ATOM   4789  N  ND2  . ASN A 1 27  ? 13.192  1.934   -1.430  1.00 0.00 ? 27  ASN A ND2  3  
ATOM   4790  H  H    . ASN A 1 27  ? 15.444  5.927   -3.366  1.00 0.00 ? 27  ASN A H    3  
ATOM   4791  H  HA   . ASN A 1 27  ? 15.073  4.549   -0.844  1.00 0.00 ? 27  ASN A HA   3  
ATOM   4792  H  HB2  . ASN A 1 27  ? 13.156  4.354   -2.135  1.00 0.00 ? 27  ASN A HB2  3  
ATOM   4793  H  HB3  . ASN A 1 27  ? 14.060  4.163   -3.627  1.00 0.00 ? 27  ASN A HB3  3  
ATOM   4794  H  HD21 . ASN A 1 27  ? 12.850  2.585   -0.782  1.00 0.00 ? 27  ASN A HD21 3  
ATOM   4795  H  HD22 . ASN A 1 27  ? 13.070  0.966   -1.342  1.00 0.00 ? 27  ASN A HD22 3  
ATOM   4796  N  N    . LEU A 1 28  ? 16.335  2.330   -1.337  1.00 0.00 ? 28  LEU A N    3  
ATOM   4797  C  CA   . LEU A 1 28  ? 17.347  1.299   -1.345  1.00 0.00 ? 28  LEU A CA   3  
ATOM   4798  C  C    . LEU A 1 28  ? 17.288  0.452   -2.617  1.00 0.00 ? 28  LEU A C    3  
ATOM   4799  O  O    . LEU A 1 28  ? 18.276  0.335   -3.341  1.00 0.00 ? 28  LEU A O    3  
ATOM   4800  C  CB   . LEU A 1 28  ? 17.151  0.414   -0.120  1.00 0.00 ? 28  LEU A CB   3  
ATOM   4801  C  CG   . LEU A 1 28  ? 18.096  0.703   1.043   1.00 0.00 ? 28  LEU A CG   3  
ATOM   4802  C  CD1  . LEU A 1 28  ? 17.814  -0.236  2.206   1.00 0.00 ? 28  LEU A CD1  3  
ATOM   4803  C  CD2  . LEU A 1 28  ? 19.545  0.584   0.595   1.00 0.00 ? 28  LEU A CD2  3  
ATOM   4804  H  H    . LEU A 1 28  ? 15.552  2.199   -0.777  1.00 0.00 ? 28  LEU A H    3  
ATOM   4805  H  HA   . LEU A 1 28  ? 18.308  1.776   -1.281  1.00 0.00 ? 28  LEU A HA   3  
ATOM   4806  H  HB2  . LEU A 1 28  ? 16.136  0.545   0.229   1.00 0.00 ? 28  LEU A HB2  3  
ATOM   4807  H  HB3  . LEU A 1 28  ? 17.275  -0.607  -0.417  1.00 0.00 ? 28  LEU A HB3  3  
ATOM   4808  H  HG   . LEU A 1 28  ? 17.929  1.715   1.382   1.00 0.00 ? 28  LEU A HG   3  
ATOM   4809  H  HD11 . LEU A 1 28  ? 17.975  -1.257  1.891   1.00 0.00 ? 28  LEU A HD11 3  
ATOM   4810  H  HD12 . LEU A 1 28  ? 16.789  -0.116  2.526   1.00 0.00 ? 28  LEU A HD12 3  
ATOM   4811  H  HD13 . LEU A 1 28  ? 18.477  -0.004  3.025   1.00 0.00 ? 28  LEU A HD13 3  
ATOM   4812  H  HD21 . LEU A 1 28  ? 20.150  0.246   1.423   1.00 0.00 ? 28  LEU A HD21 3  
ATOM   4813  H  HD22 . LEU A 1 28  ? 19.898  1.549   0.261   1.00 0.00 ? 28  LEU A HD22 3  
ATOM   4814  H  HD23 . LEU A 1 28  ? 19.614  -0.126  -0.215  1.00 0.00 ? 28  LEU A HD23 3  
ATOM   4815  N  N    . LEU A 1 29  ? 16.128  -0.145  -2.875  1.00 0.00 ? 29  LEU A N    3  
ATOM   4816  C  CA   . LEU A 1 29  ? 15.953  -0.989  -4.053  1.00 0.00 ? 29  LEU A CA   3  
ATOM   4817  C  C    . LEU A 1 29  ? 16.035  -0.161  -5.330  1.00 0.00 ? 29  LEU A C    3  
ATOM   4818  O  O    . LEU A 1 29  ? 15.438  0.910   -5.431  1.00 0.00 ? 29  LEU A O    3  
ATOM   4819  C  CB   . LEU A 1 29  ? 14.621  -1.763  -4.011  1.00 0.00 ? 29  LEU A CB   3  
ATOM   4820  C  CG   . LEU A 1 29  ? 13.662  -1.410  -2.867  1.00 0.00 ? 29  LEU A CG   3  
ATOM   4821  C  CD1  . LEU A 1 29  ? 12.266  -1.935  -3.165  1.00 0.00 ? 29  LEU A CD1  3  
ATOM   4822  C  CD2  . LEU A 1 29  ? 14.175  -1.963  -1.542  1.00 0.00 ? 29  LEU A CD2  3  
ATOM   4823  H  H    . LEU A 1 29  ? 15.382  -0.017  -2.260  1.00 0.00 ? 29  LEU A H    3  
ATOM   4824  H  HA   . LEU A 1 29  ? 16.765  -1.701  -4.060  1.00 0.00 ? 29  LEU A HA   3  
ATOM   4825  H  HB2  . LEU A 1 29  ? 14.106  -1.591  -4.942  1.00 0.00 ? 29  LEU A HB2  3  
ATOM   4826  H  HB3  . LEU A 1 29  ? 14.851  -2.818  -3.943  1.00 0.00 ? 29  LEU A HB3  3  
ATOM   4827  H  HG   . LEU A 1 29  ? 13.598  -0.336  -2.779  1.00 0.00 ? 29  LEU A HG   3  
ATOM   4828  H  HD11 . LEU A 1 29  ? 12.326  -2.724  -3.901  1.00 0.00 ? 29  LEU A HD11 3  
ATOM   4829  H  HD12 . LEU A 1 29  ? 11.654  -1.132  -3.549  1.00 0.00 ? 29  LEU A HD12 3  
ATOM   4830  H  HD13 . LEU A 1 29  ? 11.824  -2.322  -2.259  1.00 0.00 ? 29  LEU A HD13 3  
ATOM   4831  H  HD21 . LEU A 1 29  ? 14.972  -2.668  -1.730  1.00 0.00 ? 29  LEU A HD21 3  
ATOM   4832  H  HD22 . LEU A 1 29  ? 13.370  -2.461  -1.023  1.00 0.00 ? 29  LEU A HD22 3  
ATOM   4833  H  HD23 . LEU A 1 29  ? 14.547  -1.153  -0.933  1.00 0.00 ? 29  LEU A HD23 3  
ATOM   4834  N  N    . GLN A 1 30  ? 16.789  -0.665  -6.297  1.00 0.00 ? 30  GLN A N    3  
ATOM   4835  C  CA   . GLN A 1 30  ? 16.973  0.019   -7.565  1.00 0.00 ? 30  GLN A CA   3  
ATOM   4836  C  C    . GLN A 1 30  ? 17.086  -0.979  -8.718  1.00 0.00 ? 30  GLN A C    3  
ATOM   4837  O  O    . GLN A 1 30  ? 16.156  -1.138  -9.507  1.00 0.00 ? 30  GLN A O    3  
ATOM   4838  C  CB   . GLN A 1 30  ? 18.225  0.885   -7.498  1.00 0.00 ? 30  GLN A CB   3  
ATOM   4839  C  CG   . GLN A 1 30  ? 17.991  2.317   -7.939  1.00 0.00 ? 30  GLN A CG   3  
ATOM   4840  C  CD   . GLN A 1 30  ? 18.829  2.707   -9.141  1.00 0.00 ? 30  GLN A CD   3  
ATOM   4841  O  OE1  . GLN A 1 30  ? 18.454  2.447   -10.284 1.00 0.00 ? 30  GLN A OE1  3  
ATOM   4842  N  NE2  . GLN A 1 30  ? 19.972  3.334   -8.886  1.00 0.00 ? 30  GLN A NE2  3  
ATOM   4843  H  H    . GLN A 1 30  ? 17.245  -1.513  -6.150  1.00 0.00 ? 30  GLN A H    3  
ATOM   4844  H  HA   . GLN A 1 30  ? 16.114  0.651   -7.730  1.00 0.00 ? 30  GLN A HA   3  
ATOM   4845  H  HB2  . GLN A 1 30  ? 18.582  0.900   -6.478  1.00 0.00 ? 30  GLN A HB2  3  
ATOM   4846  H  HB3  . GLN A 1 30  ? 18.983  0.451   -8.127  1.00 0.00 ? 30  GLN A HB3  3  
ATOM   4847  H  HG2  . GLN A 1 30  ? 16.948  2.432   -8.192  1.00 0.00 ? 30  GLN A HG2  3  
ATOM   4848  H  HG3  . GLN A 1 30  ? 18.235  2.973   -7.117  1.00 0.00 ? 30  GLN A HG3  3  
ATOM   4849  H  HE21 . GLN A 1 30  ? 20.208  3.507   -7.951  1.00 0.00 ? 30  GLN A HE21 3  
ATOM   4850  H  HE22 . GLN A 1 30  ? 20.534  3.598   -9.645  1.00 0.00 ? 30  GLN A HE22 3  
ATOM   4851  N  N    . GLY A 1 31  ? 18.231  -1.645  -8.810  1.00 0.00 ? 31  GLY A N    3  
ATOM   4852  C  CA   . GLY A 1 31  ? 18.441  -2.610  -9.864  1.00 0.00 ? 31  GLY A CA   3  
ATOM   4853  C  C    . GLY A 1 31  ? 17.999  -4.003  -9.467  1.00 0.00 ? 31  GLY A C    3  
ATOM   4854  O  O    . GLY A 1 31  ? 16.809  -4.318  -9.504  1.00 0.00 ? 31  GLY A O    3  
ATOM   4855  H  H    . GLY A 1 31  ? 18.937  -1.481  -8.164  1.00 0.00 ? 31  GLY A H    3  
ATOM   4856  H  HA2  . GLY A 1 31  ? 17.883  -2.297  -10.726 1.00 0.00 ? 31  GLY A HA2  3  
ATOM   4857  H  HA3  . GLY A 1 31  ? 19.491  -2.635  -10.116 1.00 0.00 ? 31  GLY A HA3  3  
ATOM   4858  N  N    . GLU A 1 32  ? 18.957  -4.836  -9.080  1.00 0.00 ? 32  GLU A N    3  
ATOM   4859  C  CA   . GLU A 1 32  ? 18.659  -6.201  -8.664  1.00 0.00 ? 32  GLU A CA   3  
ATOM   4860  C  C    . GLU A 1 32  ? 17.995  -6.216  -7.292  1.00 0.00 ? 32  GLU A C    3  
ATOM   4861  O  O    . GLU A 1 32  ? 17.320  -7.181  -6.931  1.00 0.00 ? 32  GLU A O    3  
ATOM   4862  C  CB   . GLU A 1 32  ? 19.938  -7.040  -8.637  1.00 0.00 ? 32  GLU A CB   3  
ATOM   4863  C  CG   . GLU A 1 32  ? 19.687  -8.524  -8.420  1.00 0.00 ? 32  GLU A CG   3  
ATOM   4864  C  CD   . GLU A 1 32  ? 20.919  -9.258  -7.929  1.00 0.00 ? 32  GLU A CD   3  
ATOM   4865  O  OE1  . GLU A 1 32  ? 22.038  -8.743  -8.134  1.00 0.00 ? 32  GLU A OE1  3  
ATOM   4866  O  OE2  . GLU A 1 32  ? 20.764  -10.347 -7.339  1.00 0.00 ? 32  GLU A OE2  3  
ATOM   4867  H  H    . GLU A 1 32  ? 19.887  -4.524  -9.066  1.00 0.00 ? 32  GLU A H    3  
ATOM   4868  H  HA   . GLU A 1 32  ? 17.975  -6.623  -9.385  1.00 0.00 ? 32  GLU A HA   3  
ATOM   4869  H  HB2  . GLU A 1 32  ? 20.455  -6.918  -9.577  1.00 0.00 ? 32  GLU A HB2  3  
ATOM   4870  H  HB3  . GLU A 1 32  ? 20.571  -6.684  -7.838  1.00 0.00 ? 32  GLU A HB3  3  
ATOM   4871  H  HG2  . GLU A 1 32  ? 18.902  -8.640  -7.687  1.00 0.00 ? 32  GLU A HG2  3  
ATOM   4872  H  HG3  . GLU A 1 32  ? 19.373  -8.962  -9.356  1.00 0.00 ? 32  GLU A HG3  3  
ATOM   4873  N  N    . GLU A 1 33  ? 18.183  -5.141  -6.531  1.00 0.00 ? 33  GLU A N    3  
ATOM   4874  C  CA   . GLU A 1 33  ? 17.593  -5.038  -5.203  1.00 0.00 ? 33  GLU A CA   3  
ATOM   4875  C  C    . GLU A 1 33  ? 16.100  -4.771  -5.299  1.00 0.00 ? 33  GLU A C    3  
ATOM   4876  O  O    . GLU A 1 33  ? 15.338  -5.103  -4.392  1.00 0.00 ? 33  GLU A O    3  
ATOM   4877  C  CB   . GLU A 1 33  ? 18.278  -3.935  -4.394  1.00 0.00 ? 33  GLU A CB   3  
ATOM   4878  C  CG   . GLU A 1 33  ? 19.755  -4.193  -4.142  1.00 0.00 ? 33  GLU A CG   3  
ATOM   4879  C  CD   . GLU A 1 33  ? 20.047  -4.548  -2.698  1.00 0.00 ? 33  GLU A CD   3  
ATOM   4880  O  OE1  . GLU A 1 33  ? 19.449  -3.920  -1.798  1.00 0.00 ? 33  GLU A OE1  3  
ATOM   4881  O  OE2  . GLU A 1 33  ? 20.875  -5.454  -2.465  1.00 0.00 ? 33  GLU A OE2  3  
ATOM   4882  H  H    . GLU A 1 33  ? 18.725  -4.400  -6.871  1.00 0.00 ? 33  GLU A H    3  
ATOM   4883  H  HA   . GLU A 1 33  ? 17.736  -5.979  -4.712  1.00 0.00 ? 33  GLU A HA   3  
ATOM   4884  H  HB2  . GLU A 1 33  ? 18.184  -3.001  -4.928  1.00 0.00 ? 33  GLU A HB2  3  
ATOM   4885  H  HB3  . GLU A 1 33  ? 17.782  -3.845  -3.439  1.00 0.00 ? 33  GLU A HB3  3  
ATOM   4886  H  HG2  . GLU A 1 33  ? 20.076  -5.011  -4.769  1.00 0.00 ? 33  GLU A HG2  3  
ATOM   4887  H  HG3  . GLU A 1 33  ? 20.312  -3.303  -4.399  1.00 0.00 ? 33  GLU A HG3  3  
ATOM   4888  N  N    . LEU A 1 34  ? 15.691  -4.180  -6.408  1.00 0.00 ? 34  LEU A N    3  
ATOM   4889  C  CA   . LEU A 1 34  ? 14.300  -3.877  -6.644  1.00 0.00 ? 34  LEU A CA   3  
ATOM   4890  C  C    . LEU A 1 34  ? 13.496  -5.162  -6.753  1.00 0.00 ? 34  LEU A C    3  
ATOM   4891  O  O    . LEU A 1 34  ? 12.363  -5.237  -6.281  1.00 0.00 ? 34  LEU A O    3  
ATOM   4892  C  CB   . LEU A 1 34  ? 14.171  -3.054  -7.920  1.00 0.00 ? 34  LEU A CB   3  
ATOM   4893  C  CG   . LEU A 1 34  ? 13.766  -1.597  -7.709  1.00 0.00 ? 34  LEU A CG   3  
ATOM   4894  C  CD1  . LEU A 1 34  ? 13.553  -0.898  -9.045  1.00 0.00 ? 34  LEU A CD1  3  
ATOM   4895  C  CD2  . LEU A 1 34  ? 12.510  -1.503  -6.852  1.00 0.00 ? 34  LEU A CD2  3  
ATOM   4896  H  H    . LEU A 1 34  ? 16.341  -3.949  -7.094  1.00 0.00 ? 34  LEU A H    3  
ATOM   4897  H  HA   . LEU A 1 34  ? 13.935  -3.302  -5.809  1.00 0.00 ? 34  LEU A HA   3  
ATOM   4898  H  HB2  . LEU A 1 34  ? 15.126  -3.069  -8.428  1.00 0.00 ? 34  LEU A HB2  3  
ATOM   4899  H  HB3  . LEU A 1 34  ? 13.444  -3.524  -8.554  1.00 0.00 ? 34  LEU A HB3  3  
ATOM   4900  H  HG   . LEU A 1 34  ? 14.568  -1.092  -7.189  1.00 0.00 ? 34  LEU A HG   3  
ATOM   4901  H  HD11 . LEU A 1 34  ? 12.497  -0.747  -9.208  1.00 0.00 ? 34  LEU A HD11 3  
ATOM   4902  H  HD12 . LEU A 1 34  ? 13.957  -1.507  -9.840  1.00 0.00 ? 34  LEU A HD12 3  
ATOM   4903  H  HD13 . LEU A 1 34  ? 14.056  0.058   -9.033  1.00 0.00 ? 34  LEU A HD13 3  
ATOM   4904  H  HD21 . LEU A 1 34  ? 12.270  -2.476  -6.450  1.00 0.00 ? 34  LEU A HD21 3  
ATOM   4905  H  HD22 . LEU A 1 34  ? 11.688  -1.152  -7.457  1.00 0.00 ? 34  LEU A HD22 3  
ATOM   4906  H  HD23 . LEU A 1 34  ? 12.680  -0.811  -6.041  1.00 0.00 ? 34  LEU A HD23 3  
ATOM   4907  N  N    . LEU A 1 35  ? 14.096  -6.175  -7.368  1.00 0.00 ? 35  LEU A N    3  
ATOM   4908  C  CA   . LEU A 1 35  ? 13.435  -7.463  -7.525  1.00 0.00 ? 35  LEU A CA   3  
ATOM   4909  C  C    . LEU A 1 35  ? 13.504  -8.248  -6.225  1.00 0.00 ? 35  LEU A C    3  
ATOM   4910  O  O    . LEU A 1 35  ? 12.539  -8.902  -5.830  1.00 0.00 ? 35  LEU A O    3  
ATOM   4911  C  CB   . LEU A 1 35  ? 14.073  -8.268  -8.662  1.00 0.00 ? 35  LEU A CB   3  
ATOM   4912  C  CG   . LEU A 1 35  ? 14.687  -7.436  -9.791  1.00 0.00 ? 35  LEU A CG   3  
ATOM   4913  C  CD1  . LEU A 1 35  ? 15.131  -8.335  -10.935 1.00 0.00 ? 35  LEU A CD1  3  
ATOM   4914  C  CD2  . LEU A 1 35  ? 13.696  -6.393  -10.287 1.00 0.00 ? 35  LEU A CD2  3  
ATOM   4915  H  H    . LEU A 1 35  ? 15.006  -6.056  -7.715  1.00 0.00 ? 35  LEU A H    3  
ATOM   4916  H  HA   . LEU A 1 35  ? 12.398  -7.274  -7.760  1.00 0.00 ? 35  LEU A HA   3  
ATOM   4917  H  HB2  . LEU A 1 35  ? 14.848  -8.891  -8.241  1.00 0.00 ? 35  LEU A HB2  3  
ATOM   4918  H  HB3  . LEU A 1 35  ? 13.315  -8.907  -9.089  1.00 0.00 ? 35  LEU A HB3  3  
ATOM   4919  H  HG   . LEU A 1 35  ? 15.558  -6.919  -9.417  1.00 0.00 ? 35  LEU A HG   3  
ATOM   4920  H  HD11 . LEU A 1 35  ? 16.074  -8.799  -10.683 1.00 0.00 ? 35  LEU A HD11 3  
ATOM   4921  H  HD12 . LEU A 1 35  ? 15.248  -7.746  -11.832 1.00 0.00 ? 35  LEU A HD12 3  
ATOM   4922  H  HD13 . LEU A 1 35  ? 14.387  -9.100  -11.101 1.00 0.00 ? 35  LEU A HD13 3  
ATOM   4923  H  HD21 . LEU A 1 35  ? 12.690  -6.772  -10.178 1.00 0.00 ? 35  LEU A HD21 3  
ATOM   4924  H  HD22 . LEU A 1 35  ? 13.889  -6.178  -11.327 1.00 0.00 ? 35  LEU A HD22 3  
ATOM   4925  H  HD23 . LEU A 1 35  ? 13.805  -5.489  -9.706  1.00 0.00 ? 35  LEU A HD23 3  
ATOM   4926  N  N    . ARG A 1 36  ? 14.646  -8.163  -5.550  1.00 0.00 ? 36  ARG A N    3  
ATOM   4927  C  CA   . ARG A 1 36  ? 14.825  -8.851  -4.282  1.00 0.00 ? 36  ARG A CA   3  
ATOM   4928  C  C    . ARG A 1 36  ? 13.970  -8.187  -3.211  1.00 0.00 ? 36  ARG A C    3  
ATOM   4929  O  O    . ARG A 1 36  ? 13.488  -8.840  -2.287  1.00 0.00 ? 36  ARG A O    3  
ATOM   4930  C  CB   . ARG A 1 36  ? 16.299  -8.834  -3.867  1.00 0.00 ? 36  ARG A CB   3  
ATOM   4931  C  CG   . ARG A 1 36  ? 17.047  -10.107 -4.228  1.00 0.00 ? 36  ARG A CG   3  
ATOM   4932  C  CD   . ARG A 1 36  ? 17.924  -9.910  -5.453  1.00 0.00 ? 36  ARG A CD   3  
ATOM   4933  N  NE   . ARG A 1 36  ? 17.199  -10.178 -6.694  1.00 0.00 ? 36  ARG A NE   3  
ATOM   4934  C  CZ   . ARG A 1 36  ? 16.771  -11.386 -7.056  1.00 0.00 ? 36  ARG A CZ   3  
ATOM   4935  N  NH1  . ARG A 1 36  ? 16.995  -12.438 -6.278  1.00 0.00 ? 36  ARG A NH1  3  
ATOM   4936  N  NH2  . ARG A 1 36  ? 16.118  -11.541 -8.199  1.00 0.00 ? 36  ARG A NH2  3  
ATOM   4937  H  H    . ARG A 1 36  ? 15.376  -7.612  -5.907  1.00 0.00 ? 36  ARG A H    3  
ATOM   4938  H  HA   . ARG A 1 36  ? 14.503  -9.874  -4.406  1.00 0.00 ? 36  ARG A HA   3  
ATOM   4939  H  HB2  . ARG A 1 36  ? 16.788  -8.003  -4.352  1.00 0.00 ? 36  ARG A HB2  3  
ATOM   4940  H  HB3  . ARG A 1 36  ? 16.358  -8.699  -2.796  1.00 0.00 ? 36  ARG A HB3  3  
ATOM   4941  H  HG2  . ARG A 1 36  ? 17.670  -10.396 -3.394  1.00 0.00 ? 36  ARG A HG2  3  
ATOM   4942  H  HG3  . ARG A 1 36  ? 16.329  -10.889 -4.431  1.00 0.00 ? 36  ARG A HG3  3  
ATOM   4943  H  HD2  . ARG A 1 36  ? 18.277  -8.889  -5.468  1.00 0.00 ? 36  ARG A HD2  3  
ATOM   4944  H  HD3  . ARG A 1 36  ? 18.767  -10.581 -5.388  1.00 0.00 ? 36  ARG A HD3  3  
ATOM   4945  H  HE   . ARG A 1 36  ? 17.022  -9.419  -7.287  1.00 0.00 ? 36  ARG A HE   3  
ATOM   4946  H  HH11 . ARG A 1 36  ? 17.486  -12.327 -5.414  1.00 0.00 ? 36  ARG A HH11 3  
ATOM   4947  H  HH12 . ARG A 1 36  ? 16.670  -13.341 -6.555  1.00 0.00 ? 36  ARG A HH12 3  
ATOM   4948  H  HH21 . ARG A 1 36  ? 15.947  -10.753 -8.788  1.00 0.00 ? 36  ARG A HH21 3  
ATOM   4949  H  HH22 . ARG A 1 36  ? 15.797  -12.448 -8.472  1.00 0.00 ? 36  ARG A HH22 3  
ATOM   4950  N  N    . ALA A 1 37  ? 13.785  -6.878  -3.354  1.00 0.00 ? 37  ALA A N    3  
ATOM   4951  C  CA   . ALA A 1 37  ? 12.991  -6.108  -2.420  1.00 0.00 ? 37  ALA A CA   3  
ATOM   4952  C  C    . ALA A 1 37  ? 11.504  -6.254  -2.717  1.00 0.00 ? 37  ALA A C    3  
ATOM   4953  O  O    . ALA A 1 37  ? 10.718  -6.605  -1.836  1.00 0.00 ? 37  ALA A O    3  
ATOM   4954  C  CB   . ALA A 1 37  ? 13.399  -4.647  -2.462  1.00 0.00 ? 37  ALA A CB   3  
ATOM   4955  H  H    . ALA A 1 37  ? 14.193  -6.419  -4.109  1.00 0.00 ? 37  ALA A H    3  
ATOM   4956  H  HA   . ALA A 1 37  ? 13.193  -6.486  -1.436  1.00 0.00 ? 37  ALA A HA   3  
ATOM   4957  H  HB1  . ALA A 1 37  ? 12.676  -4.058  -1.920  1.00 0.00 ? 37  ALA A HB1  3  
ATOM   4958  H  HB2  . ALA A 1 37  ? 13.439  -4.314  -3.489  1.00 0.00 ? 37  ALA A HB2  3  
ATOM   4959  H  HB3  . ALA A 1 37  ? 14.372  -4.533  -2.007  1.00 0.00 ? 37  ALA A HB3  3  
ATOM   4960  N  N    . LEU A 1 38  ? 11.116  -5.982  -3.964  1.00 0.00 ? 38  LEU A N    3  
ATOM   4961  C  CA   . LEU A 1 38  ? 9.712   -6.091  -4.363  1.00 0.00 ? 38  LEU A CA   3  
ATOM   4962  C  C    . LEU A 1 38  ? 9.124   -7.431  -3.929  1.00 0.00 ? 38  LEU A C    3  
ATOM   4963  O  O    . LEU A 1 38  ? 7.918   -7.553  -3.716  1.00 0.00 ? 38  LEU A O    3  
ATOM   4964  C  CB   . LEU A 1 38  ? 9.556   -5.931  -5.881  1.00 0.00 ? 38  LEU A CB   3  
ATOM   4965  C  CG   . LEU A 1 38  ? 9.201   -4.522  -6.366  1.00 0.00 ? 38  LEU A CG   3  
ATOM   4966  C  CD1  . LEU A 1 38  ? 8.796   -4.554  -7.832  1.00 0.00 ? 38  LEU A CD1  3  
ATOM   4967  C  CD2  . LEU A 1 38  ? 8.082   -3.925  -5.523  1.00 0.00 ? 38  LEU A CD2  3  
ATOM   4968  H  H    . LEU A 1 38  ? 11.789  -5.705  -4.629  1.00 0.00 ? 38  LEU A H    3  
ATOM   4969  H  HA   . LEU A 1 38  ? 9.169   -5.300  -3.868  1.00 0.00 ? 38  LEU A HA   3  
ATOM   4970  H  HB2  . LEU A 1 38  ? 10.483  -6.227  -6.348  1.00 0.00 ? 38  LEU A HB2  3  
ATOM   4971  H  HB3  . LEU A 1 38  ? 8.780   -6.605  -6.212  1.00 0.00 ? 38  LEU A HB3  3  
ATOM   4972  H  HG   . LEU A 1 38  ? 10.069  -3.885  -6.272  1.00 0.00 ? 38  LEU A HG   3  
ATOM   4973  H  HD11 . LEU A 1 38  ? 7.910   -5.161  -7.948  1.00 0.00 ? 38  LEU A HD11 3  
ATOM   4974  H  HD12 . LEU A 1 38  ? 9.600   -4.975  -8.418  1.00 0.00 ? 38  LEU A HD12 3  
ATOM   4975  H  HD13 . LEU A 1 38  ? 8.591   -3.550  -8.171  1.00 0.00 ? 38  LEU A HD13 3  
ATOM   4976  H  HD21 . LEU A 1 38  ? 8.507   -3.368  -4.702  1.00 0.00 ? 38  LEU A HD21 3  
ATOM   4977  H  HD22 . LEU A 1 38  ? 7.461   -4.719  -5.136  1.00 0.00 ? 38  LEU A HD22 3  
ATOM   4978  H  HD23 . LEU A 1 38  ? 7.484   -3.265  -6.134  1.00 0.00 ? 38  LEU A HD23 3  
ATOM   4979  N  N    . ASP A 1 39  ? 9.987   -8.435  -3.801  1.00 0.00 ? 39  ASP A N    3  
ATOM   4980  C  CA   . ASP A 1 39  ? 9.554   -9.765  -3.392  1.00 0.00 ? 39  ASP A CA   3  
ATOM   4981  C  C    . ASP A 1 39  ? 9.672   -9.934  -1.883  1.00 0.00 ? 39  ASP A C    3  
ATOM   4982  O  O    . ASP A 1 39  ? 10.150  -10.958 -1.393  1.00 0.00 ? 39  ASP A O    3  
ATOM   4983  C  CB   . ASP A 1 39  ? 10.376  -10.837 -4.109  1.00 0.00 ? 39  ASP A CB   3  
ATOM   4984  C  CG   . ASP A 1 39  ? 9.622   -12.146 -4.249  1.00 0.00 ? 39  ASP A CG   3  
ATOM   4985  O  OD1  . ASP A 1 39  ? 8.920   -12.533 -3.292  1.00 0.00 ? 39  ASP A OD1  3  
ATOM   4986  O  OD2  . ASP A 1 39  ? 9.737   -12.785 -5.317  1.00 0.00 ? 39  ASP A OD2  3  
ATOM   4987  H  H    . ASP A 1 39  ? 10.935  -8.276  -3.985  1.00 0.00 ? 39  ASP A H    3  
ATOM   4988  H  HA   . ASP A 1 39  ? 8.517   -9.872  -3.669  1.00 0.00 ? 39  ASP A HA   3  
ATOM   4989  H  HB2  . ASP A 1 39  ? 10.634  -10.484 -5.096  1.00 0.00 ? 39  ASP A HB2  3  
ATOM   4990  H  HB3  . ASP A 1 39  ? 11.281  -11.022 -3.548  1.00 0.00 ? 39  ASP A HB3  3  
ATOM   4991  N  N    . GLN A 1 40  ? 9.225   -8.922  -1.155  1.00 0.00 ? 40  GLN A N    3  
ATOM   4992  C  CA   . GLN A 1 40  ? 9.265   -8.945  0.301   1.00 0.00 ? 40  GLN A CA   3  
ATOM   4993  C  C    . GLN A 1 40  ? 7.980   -8.365  0.871   1.00 0.00 ? 40  GLN A C    3  
ATOM   4994  O  O    . GLN A 1 40  ? 8.000   -7.532  1.778   1.00 0.00 ? 40  GLN A O    3  
ATOM   4995  C  CB   . GLN A 1 40  ? 10.475  -8.166  0.820   1.00 0.00 ? 40  GLN A CB   3  
ATOM   4996  C  CG   . GLN A 1 40  ? 10.830  -8.486  2.263   1.00 0.00 ? 40  GLN A CG   3  
ATOM   4997  C  CD   . GLN A 1 40  ? 12.285  -8.878  2.434   1.00 0.00 ? 40  GLN A CD   3  
ATOM   4998  O  OE1  . GLN A 1 40  ? 12.918  -9.382  1.506   1.00 0.00 ? 40  GLN A OE1  3  
ATOM   4999  N  NE2  . GLN A 1 40  ? 12.824  -8.650  3.626   1.00 0.00 ? 40  GLN A NE2  3  
ATOM   5000  H  H    . GLN A 1 40  ? 8.850   -8.140  -1.610  1.00 0.00 ? 40  GLN A H    3  
ATOM   5001  H  HA   . GLN A 1 40  ? 9.344   -9.975  0.611   1.00 0.00 ? 40  GLN A HA   3  
ATOM   5002  H  HB2  . GLN A 1 40  ? 11.330  -8.398  0.200   1.00 0.00 ? 40  GLN A HB2  3  
ATOM   5003  H  HB3  . GLN A 1 40  ? 10.266  -7.109  0.749   1.00 0.00 ? 40  GLN A HB3  3  
ATOM   5004  H  HG2  . GLN A 1 40  ? 10.636  -7.615  2.869   1.00 0.00 ? 40  GLN A HG2  3  
ATOM   5005  H  HG3  . GLN A 1 40  ? 10.210  -9.303  2.600   1.00 0.00 ? 40  GLN A HG3  3  
ATOM   5006  H  HE21 . GLN A 1 40  ? 12.260  -8.246  4.319   1.00 0.00 ? 40  GLN A HE21 3  
ATOM   5007  H  HE22 . GLN A 1 40  ? 13.763  -8.894  3.765   1.00 0.00 ? 40  GLN A HE22 3  
ATOM   5008  N  N    . VAL A 1 41  ? 6.862   -8.816  0.321   1.00 0.00 ? 41  VAL A N    3  
ATOM   5009  C  CA   . VAL A 1 41  ? 5.552   -8.357  0.749   1.00 0.00 ? 41  VAL A CA   3  
ATOM   5010  C  C    . VAL A 1 41  ? 5.086   -9.101  1.997   1.00 0.00 ? 41  VAL A C    3  
ATOM   5011  O  O    . VAL A 1 41  ? 5.452   -10.256 2.215   1.00 0.00 ? 41  VAL A O    3  
ATOM   5012  C  CB   . VAL A 1 41  ? 4.509   -8.535  -0.372  1.00 0.00 ? 41  VAL A CB   3  
ATOM   5013  C  CG1  . VAL A 1 41  ? 4.386   -10.000 -0.764  1.00 0.00 ? 41  VAL A CG1  3  
ATOM   5014  C  CG2  . VAL A 1 41  ? 3.161   -7.971  0.053   1.00 0.00 ? 41  VAL A CG2  3  
ATOM   5015  H  H    . VAL A 1 41  ? 6.923   -9.473  -0.397  1.00 0.00 ? 41  VAL A H    3  
ATOM   5016  H  HA   . VAL A 1 41  ? 5.631   -7.307  0.974   1.00 0.00 ? 41  VAL A HA   3  
ATOM   5017  H  HB   . VAL A 1 41  ? 4.847   -7.983  -1.238  1.00 0.00 ? 41  VAL A HB   3  
ATOM   5018  H  HG11 . VAL A 1 41  ? 3.484   -10.413 -0.337  1.00 0.00 ? 41  VAL A HG11 3  
ATOM   5019  H  HG12 . VAL A 1 41  ? 5.242   -10.545 -0.394  1.00 0.00 ? 41  VAL A HG12 3  
ATOM   5020  H  HG13 . VAL A 1 41  ? 4.344   -10.082 -1.841  1.00 0.00 ? 41  VAL A HG13 3  
ATOM   5021  H  HG21 . VAL A 1 41  ? 2.673   -8.667  0.718   1.00 0.00 ? 41  VAL A HG21 3  
ATOM   5022  H  HG22 . VAL A 1 41  ? 2.545   -7.815  -0.821  1.00 0.00 ? 41  VAL A HG22 3  
ATOM   5023  H  HG23 . VAL A 1 41  ? 3.308   -7.029  0.560   1.00 0.00 ? 41  VAL A HG23 3  
ATOM   5024  N  N    . ASN A 1 42  ? 4.278   -8.431  2.812   1.00 0.00 ? 42  ASN A N    3  
ATOM   5025  C  CA   . ASN A 1 42  ? 3.762   -9.029  4.038   1.00 0.00 ? 42  ASN A CA   3  
ATOM   5026  C  C    . ASN A 1 42  ? 2.354   -8.523  4.340   1.00 0.00 ? 42  ASN A C    3  
ATOM   5027  O  O    . ASN A 1 42  ? 1.395   -9.299  4.149   1.00 0.00 ? 42  ASN A O    3  
ATOM   5028  C  CB   . ASN A 1 42  ? 4.693   -8.718  5.212   1.00 0.00 ? 42  ASN A CB   3  
ATOM   5029  C  CG   . ASN A 1 42  ? 5.601   -9.885  5.554   1.00 0.00 ? 42  ASN A CG   3  
ATOM   5030  O  OD1  . ASN A 1 42  ? 5.388   -11.007 5.094   1.00 0.00 ? 42  ASN A OD1  3  
ATOM   5031  N  ND2  . ASN A 1 42  ? 6.620   -9.624  6.363   1.00 0.00 ? 42  ASN A ND2  3  
ATOM   5032  O  OXT  . ASN A 1 42  ? 2.225   -7.356  4.763   1.00 0.00 ? 42  ASN A OXT  3  
ATOM   5033  H  H    . ASN A 1 42  ? 4.022   -7.513  2.584   1.00 0.00 ? 42  ASN A H    3  
ATOM   5034  H  HA   . ASN A 1 42  ? 3.723   -10.100 3.894   1.00 0.00 ? 42  ASN A HA   3  
ATOM   5035  H  HB2  . ASN A 1 42  ? 5.310   -7.870  4.959   1.00 0.00 ? 42  ASN A HB2  3  
ATOM   5036  H  HB3  . ASN A 1 42  ? 4.100   -8.481  6.083   1.00 0.00 ? 42  ASN A HB3  3  
ATOM   5037  H  HD21 . ASN A 1 42  ? 6.728   -8.707  6.691   1.00 0.00 ? 42  ASN A HD21 3  
ATOM   5038  H  HD22 . ASN A 1 42  ? 7.222   -10.360 6.601   1.00 0.00 ? 42  ASN A HD22 3  
ATOM   5039  N  N    . MET B 2 1   ? 13.693  24.783  -9.066  1.00 0.00 ? 101 MET B N    3  
ATOM   5040  C  CA   . MET B 2 1   ? 12.430  24.011  -8.925  1.00 0.00 ? 101 MET B CA   3  
ATOM   5041  C  C    . MET B 2 1   ? 11.289  24.674  -9.691  1.00 0.00 ? 101 MET B C    3  
ATOM   5042  O  O    . MET B 2 1   ? 10.880  24.197  -10.751 1.00 0.00 ? 101 MET B O    3  
ATOM   5043  C  CB   . MET B 2 1   ? 12.082  23.913  -7.437  1.00 0.00 ? 101 MET B CB   3  
ATOM   5044  C  CG   . MET B 2 1   ? 12.390  22.554  -6.829  1.00 0.00 ? 101 MET B CG   3  
ATOM   5045  S  SD   . MET B 2 1   ? 10.950  21.793  -6.053  1.00 0.00 ? 101 MET B SD   3  
ATOM   5046  C  CE   . MET B 2 1   ? 11.538  20.117  -5.817  1.00 0.00 ? 101 MET B CE   3  
ATOM   5047  H  H1   . MET B 2 1   ? 13.631  25.608  -8.436  1.00 0.00 ? 101 MET B H1   3  
ATOM   5048  H  H2   . MET B 2 1   ? 13.775  25.074  -10.062 1.00 0.00 ? 101 MET B H2   3  
ATOM   5049  H  H3   . MET B 2 1   ? 14.477  24.160  -8.790  1.00 0.00 ? 101 MET B H3   3  
ATOM   5050  H  HA   . MET B 2 1   ? 12.588  23.018  -9.318  1.00 0.00 ? 101 MET B HA   3  
ATOM   5051  H  HB2  . MET B 2 1   ? 12.647  24.660  -6.898  1.00 0.00 ? 101 MET B HB2  3  
ATOM   5052  H  HB3  . MET B 2 1   ? 11.028  24.112  -7.310  1.00 0.00 ? 101 MET B HB3  3  
ATOM   5053  H  HG2  . MET B 2 1   ? 12.747  21.899  -7.609  1.00 0.00 ? 101 MET B HG2  3  
ATOM   5054  H  HG3  . MET B 2 1   ? 13.161  22.675  -6.082  1.00 0.00 ? 101 MET B HG3  3  
ATOM   5055  H  HE1  . MET B 2 1   ? 12.512  20.011  -6.270  1.00 0.00 ? 101 MET B HE1  3  
ATOM   5056  H  HE2  . MET B 2 1   ? 10.848  19.426  -6.279  1.00 0.00 ? 101 MET B HE2  3  
ATOM   5057  H  HE3  . MET B 2 1   ? 11.606  19.906  -4.760  1.00 0.00 ? 101 MET B HE3  3  
ATOM   5058  N  N    . GLY B 2 2   ? 10.780  25.775  -9.150  1.00 0.00 ? 102 GLY B N    3  
ATOM   5059  C  CA   . GLY B 2 2   ? 9.693   26.486  -9.797  1.00 0.00 ? 102 GLY B CA   3  
ATOM   5060  C  C    . GLY B 2 2   ? 8.440   25.641  -9.918  1.00 0.00 ? 102 GLY B C    3  
ATOM   5061  O  O    . GLY B 2 2   ? 7.854   25.537  -10.996 1.00 0.00 ? 102 GLY B O    3  
ATOM   5062  H  H    . GLY B 2 2   ? 11.146  26.110  -8.304  1.00 0.00 ? 102 GLY B H    3  
ATOM   5063  H  HA2  . GLY B 2 2   ? 9.463   27.371  -9.222  1.00 0.00 ? 102 GLY B HA2  3  
ATOM   5064  H  HA3  . GLY B 2 2   ? 10.009  26.784  -10.786 1.00 0.00 ? 102 GLY B HA3  3  
ATOM   5065  N  N    . SER B 2 3   ? 8.028   25.034  -8.809  1.00 0.00 ? 103 SER B N    3  
ATOM   5066  C  CA   . SER B 2 3   ? 6.836   24.194  -8.794  1.00 0.00 ? 103 SER B CA   3  
ATOM   5067  C  C    . SER B 2 3   ? 5.661   24.926  -8.157  1.00 0.00 ? 103 SER B C    3  
ATOM   5068  O  O    . SER B 2 3   ? 4.515   24.765  -8.575  1.00 0.00 ? 103 SER B O    3  
ATOM   5069  C  CB   . SER B 2 3   ? 7.113   22.894  -8.037  1.00 0.00 ? 103 SER B CB   3  
ATOM   5070  O  OG   . SER B 2 3   ? 6.467   21.795  -8.657  1.00 0.00 ? 103 SER B OG   3  
ATOM   5071  H  H    . SER B 2 3   ? 8.537   25.156  -7.981  1.00 0.00 ? 103 SER B H    3  
ATOM   5072  H  HA   . SER B 2 3   ? 6.585   23.957  -9.818  1.00 0.00 ? 103 SER B HA   3  
ATOM   5073  H  HB2  . SER B 2 3   ? 8.177   22.708  -8.023  1.00 0.00 ? 103 SER B HB2  3  
ATOM   5074  H  HB3  . SER B 2 3   ? 6.750   22.986  -7.025  1.00 0.00 ? 103 SER B HB3  3  
ATOM   5075  H  HG   . SER B 2 3   ? 7.116   21.120  -8.869  1.00 0.00 ? 103 SER B HG   3  
ATOM   5076  N  N    . GLY B 2 4   ? 5.954   25.733  -7.142  1.00 0.00 ? 104 GLY B N    3  
ATOM   5077  C  CA   . GLY B 2 4   ? 4.912   26.479  -6.461  1.00 0.00 ? 104 GLY B CA   3  
ATOM   5078  C  C    . GLY B 2 4   ? 4.595   25.914  -5.091  1.00 0.00 ? 104 GLY B C    3  
ATOM   5079  O  O    . GLY B 2 4   ? 5.217   26.288  -4.098  1.00 0.00 ? 104 GLY B O    3  
ATOM   5080  H  H    . GLY B 2 4   ? 6.886   25.821  -6.852  1.00 0.00 ? 104 GLY B H    3  
ATOM   5081  H  HA2  . GLY B 2 4   ? 5.232   27.504  -6.350  1.00 0.00 ? 104 GLY B HA2  3  
ATOM   5082  H  HA3  . GLY B 2 4   ? 4.016   26.455  -7.064  1.00 0.00 ? 104 GLY B HA3  3  
ATOM   5083  N  N    . ALA B 2 5   ? 3.621   25.010  -5.036  1.00 0.00 ? 105 ALA B N    3  
ATOM   5084  C  CA   . ALA B 2 5   ? 3.222   24.393  -3.777  1.00 0.00 ? 105 ALA B CA   3  
ATOM   5085  C  C    . ALA B 2 5   ? 3.098   22.879  -3.920  1.00 0.00 ? 105 ALA B C    3  
ATOM   5086  O  O    . ALA B 2 5   ? 2.040   22.306  -3.662  1.00 0.00 ? 105 ALA B O    3  
ATOM   5087  C  CB   . ALA B 2 5   ? 1.910   24.991  -3.292  1.00 0.00 ? 105 ALA B CB   3  
ATOM   5088  H  H    . ALA B 2 5   ? 3.161   24.752  -5.862  1.00 0.00 ? 105 ALA B H    3  
ATOM   5089  H  HA   . ALA B 2 5   ? 3.983   24.614  -3.043  1.00 0.00 ? 105 ALA B HA   3  
ATOM   5090  H  HB1  . ALA B 2 5   ? 1.848   24.901  -2.217  1.00 0.00 ? 105 ALA B HB1  3  
ATOM   5091  H  HB2  . ALA B 2 5   ? 1.084   24.463  -3.745  1.00 0.00 ? 105 ALA B HB2  3  
ATOM   5092  H  HB3  . ALA B 2 5   ? 1.864   26.034  -3.569  1.00 0.00 ? 105 ALA B HB3  3  
ATOM   5093  N  N    . HIS B 2 6   ? 4.189   22.237  -4.330  1.00 0.00 ? 106 HIS B N    3  
ATOM   5094  C  CA   . HIS B 2 6   ? 4.208   20.787  -4.507  1.00 0.00 ? 106 HIS B CA   3  
ATOM   5095  C  C    . HIS B 2 6   ? 3.333   20.368  -5.685  1.00 0.00 ? 106 HIS B C    3  
ATOM   5096  O  O    . HIS B 2 6   ? 3.832   19.870  -6.694  1.00 0.00 ? 106 HIS B O    3  
ATOM   5097  C  CB   . HIS B 2 6   ? 3.737   20.084  -3.231  1.00 0.00 ? 106 HIS B CB   3  
ATOM   5098  C  CG   . HIS B 2 6   ? 4.350   20.639  -1.982  1.00 0.00 ? 106 HIS B CG   3  
ATOM   5099  N  ND1  . HIS B 2 6   ? 3.617   20.940  -0.853  1.00 0.00 ? 106 HIS B ND1  3  
ATOM   5100  C  CD2  . HIS B 2 6   ? 5.634   20.949  -1.687  1.00 0.00 ? 106 HIS B CD2  3  
ATOM   5101  C  CE1  . HIS B 2 6   ? 4.424   21.411  0.081   1.00 0.00 ? 106 HIS B CE1  3  
ATOM   5102  N  NE2  . HIS B 2 6   ? 5.653   21.426  -0.400  1.00 0.00 ? 106 HIS B NE2  3  
ATOM   5103  H  H    . HIS B 2 6   ? 5.002   22.750  -4.517  1.00 0.00 ? 106 HIS B H    3  
ATOM   5104  H  HA   . HIS B 2 6   ? 5.227   20.494  -4.712  1.00 0.00 ? 106 HIS B HA   3  
ATOM   5105  H  HB2  . HIS B 2 6   ? 2.665   20.185  -3.147  1.00 0.00 ? 106 HIS B HB2  3  
ATOM   5106  H  HB3  . HIS B 2 6   ? 3.992   19.036  -3.290  1.00 0.00 ? 106 HIS B HB3  3  
ATOM   5107  H  HD1  . HIS B 2 6   ? 2.649   20.825  -0.751  1.00 0.00 ? 106 HIS B HD1  3  
ATOM   5108  H  HD2  . HIS B 2 6   ? 6.487   20.841  -2.343  1.00 0.00 ? 106 HIS B HD2  3  
ATOM   5109  H  HE1  . HIS B 2 6   ? 4.128   21.728  1.070   1.00 0.00 ? 106 HIS B HE1  3  
ATOM   5110  H  HE2  . HIS B 2 6   ? 6.435   21.798  0.059   1.00 0.00 ? 106 HIS B HE2  3  
ATOM   5111  N  N    . THR B 2 7   ? 2.026   20.575  -5.548  1.00 0.00 ? 107 THR B N    3  
ATOM   5112  C  CA   . THR B 2 7   ? 1.077   20.221  -6.600  1.00 0.00 ? 107 THR B CA   3  
ATOM   5113  C  C    . THR B 2 7   ? 1.092   18.720  -6.867  1.00 0.00 ? 107 THR B C    3  
ATOM   5114  O  O    . THR B 2 7   ? 2.123   18.063  -6.726  1.00 0.00 ? 107 THR B O    3  
ATOM   5115  C  CB   . THR B 2 7   ? 1.392   20.985  -7.890  1.00 0.00 ? 107 THR B CB   3  
ATOM   5116  O  OG1  . THR B 2 7   ? 2.402   20.326  -8.634  1.00 0.00 ? 107 THR B OG1  3  
ATOM   5117  C  CG2  . THR B 2 7   ? 1.853   22.408  -7.651  1.00 0.00 ? 107 THR B CG2  3  
ATOM   5118  H  H    . THR B 2 7   ? 1.691   20.977  -4.720  1.00 0.00 ? 107 THR B H    3  
ATOM   5119  H  HA   . THR B 2 7   ? 0.091   20.502  -6.260  1.00 0.00 ? 107 THR B HA   3  
ATOM   5120  H  HB   . THR B 2 7   ? 0.499   21.027  -8.496  1.00 0.00 ? 107 THR B HB   3  
ATOM   5121  H  HG1  . THR B 2 7   ? 2.415   20.669  -9.530  1.00 0.00 ? 107 THR B HG1  3  
ATOM   5122  H  HG21 . THR B 2 7   ? 1.500   22.744  -6.688  1.00 0.00 ? 107 THR B HG21 3  
ATOM   5123  H  HG22 . THR B 2 7   ? 1.457   23.050  -8.424  1.00 0.00 ? 107 THR B HG22 3  
ATOM   5124  H  HG23 . THR B 2 7   ? 2.932   22.445  -7.671  1.00 0.00 ? 107 THR B HG23 3  
ATOM   5125  N  N    . ALA B 2 8   ? -0.060  18.183  -7.258  1.00 0.00 ? 108 ALA B N    3  
ATOM   5126  C  CA   . ALA B 2 8   ? -0.186  16.760  -7.549  1.00 0.00 ? 108 ALA B CA   3  
ATOM   5127  C  C    . ALA B 2 8   ? -1.620  16.405  -7.930  1.00 0.00 ? 108 ALA B C    3  
ATOM   5128  O  O    . ALA B 2 8   ? -2.422  16.021  -7.080  1.00 0.00 ? 108 ALA B O    3  
ATOM   5129  C  CB   . ALA B 2 8   ? 0.264   15.931  -6.354  1.00 0.00 ? 108 ALA B CB   3  
ATOM   5130  H  H    . ALA B 2 8   ? -0.846  18.759  -7.354  1.00 0.00 ? 108 ALA B H    3  
ATOM   5131  H  HA   . ALA B 2 8   ? 0.463   16.534  -8.380  1.00 0.00 ? 108 ALA B HA   3  
ATOM   5132  H  HB1  . ALA B 2 8   ? 0.081   16.481  -5.444  1.00 0.00 ? 108 ALA B HB1  3  
ATOM   5133  H  HB2  . ALA B 2 8   ? 1.320   15.720  -6.441  1.00 0.00 ? 108 ALA B HB2  3  
ATOM   5134  H  HB3  . ALA B 2 8   ? -0.289  15.003  -6.332  1.00 0.00 ? 108 ALA B HB3  3  
ATOM   5135  N  N    . ASP B 2 9   ? -1.934  16.536  -9.215  1.00 0.00 ? 109 ASP B N    3  
ATOM   5136  C  CA   . ASP B 2 9   ? -3.271  16.230  -9.712  1.00 0.00 ? 109 ASP B CA   3  
ATOM   5137  C  C    . ASP B 2 9   ? -3.659  14.789  -9.383  1.00 0.00 ? 109 ASP B C    3  
ATOM   5138  O  O    . ASP B 2 9   ? -2.946  13.851  -9.739  1.00 0.00 ? 109 ASP B O    3  
ATOM   5139  C  CB   . ASP B 2 9   ? -3.338  16.454  -11.223 1.00 0.00 ? 109 ASP B CB   3  
ATOM   5140  C  CG   . ASP B 2 9   ? -4.750  16.723  -11.706 1.00 0.00 ? 109 ASP B CG   3  
ATOM   5141  O  OD1  . ASP B 2 9   ? -5.677  16.019  -11.252 1.00 0.00 ? 109 ASP B OD1  3  
ATOM   5142  O  OD2  . ASP B 2 9   ? -4.930  17.639  -12.537 1.00 0.00 ? 109 ASP B OD2  3  
ATOM   5143  H  H    . ASP B 2 9   ? -1.250  16.847  -9.845  1.00 0.00 ? 109 ASP B H    3  
ATOM   5144  H  HA   . ASP B 2 9   ? -3.965  16.899  -9.228  1.00 0.00 ? 109 ASP B HA   3  
ATOM   5145  H  HB2  . ASP B 2 9   ? -2.722  17.301  -11.483 1.00 0.00 ? 109 ASP B HB2  3  
ATOM   5146  H  HB3  . ASP B 2 9   ? -2.966  15.575  -11.729 1.00 0.00 ? 109 ASP B HB3  3  
ATOM   5147  N  N    . PRO B 2 10  ? -4.801  14.589  -8.699  1.00 0.00 ? 110 PRO B N    3  
ATOM   5148  C  CA   . PRO B 2 10  ? -5.274  13.251  -8.332  1.00 0.00 ? 110 PRO B CA   3  
ATOM   5149  C  C    . PRO B 2 10  ? -5.676  12.428  -9.551  1.00 0.00 ? 110 PRO B C    3  
ATOM   5150  O  O    . PRO B 2 10  ? -5.696  11.197  -9.502  1.00 0.00 ? 110 PRO B O    3  
ATOM   5151  C  CB   . PRO B 2 10  ? -6.492  13.527  -7.446  1.00 0.00 ? 110 PRO B CB   3  
ATOM   5152  C  CG   . PRO B 2 10  ? -6.957  14.884  -7.847  1.00 0.00 ? 110 PRO B CG   3  
ATOM   5153  C  CD   . PRO B 2 10  ? -5.721  15.645  -8.235  1.00 0.00 ? 110 PRO B CD   3  
ATOM   5154  H  HA   . PRO B 2 10  ? -4.528  12.711  -7.766  1.00 0.00 ? 110 PRO B HA   3  
ATOM   5155  H  HB2  . PRO B 2 10  ? -7.250  12.779  -7.629  1.00 0.00 ? 110 PRO B HB2  3  
ATOM   5156  H  HB3  . PRO B 2 10  ? -6.197  13.503  -6.408  1.00 0.00 ? 110 PRO B HB3  3  
ATOM   5157  H  HG2  . PRO B 2 10  ? -7.630  14.807  -8.689  1.00 0.00 ? 110 PRO B HG2  3  
ATOM   5158  H  HG3  . PRO B 2 10  ? -7.447  15.365  -7.015  1.00 0.00 ? 110 PRO B HG3  3  
ATOM   5159  H  HD2  . PRO B 2 10  ? -5.941  16.342  -9.031  1.00 0.00 ? 110 PRO B HD2  3  
ATOM   5160  H  HD3  . PRO B 2 10  ? -5.312  16.163  -7.381  1.00 0.00 ? 110 PRO B HD3  3  
ATOM   5161  N  N    . GLU B 2 11  ? -6.000  13.113  -10.644 1.00 0.00 ? 111 GLU B N    3  
ATOM   5162  C  CA   . GLU B 2 11  ? -6.403  12.448  -11.871 1.00 0.00 ? 111 GLU B CA   3  
ATOM   5163  C  C    . GLU B 2 11  ? -5.312  11.514  -12.385 1.00 0.00 ? 111 GLU B C    3  
ATOM   5164  O  O    . GLU B 2 11  ? -5.576  10.611  -13.181 1.00 0.00 ? 111 GLU B O    3  
ATOM   5165  C  CB   . GLU B 2 11  ? -6.761  13.478  -12.945 1.00 0.00 ? 111 GLU B CB   3  
ATOM   5166  C  CG   . GLU B 2 11  ? -7.970  13.091  -13.780 1.00 0.00 ? 111 GLU B CG   3  
ATOM   5167  C  CD   . GLU B 2 11  ? -8.691  14.295  -14.355 1.00 0.00 ? 111 GLU B CD   3  
ATOM   5168  O  OE1  . GLU B 2 11  ? -8.529  15.404  -13.803 1.00 0.00 ? 111 GLU B OE1  3  
ATOM   5169  O  OE2  . GLU B 2 11  ? -9.419  14.128  -15.357 1.00 0.00 ? 111 GLU B OE2  3  
ATOM   5170  H  H    . GLU B 2 11  ? -5.970  14.088  -10.622 1.00 0.00 ? 111 GLU B H    3  
ATOM   5171  H  HA   . GLU B 2 11  ? -7.273  11.866  -11.645 1.00 0.00 ? 111 GLU B HA   3  
ATOM   5172  H  HB2  . GLU B 2 11  ? -6.969  14.423  -12.465 1.00 0.00 ? 111 GLU B HB2  3  
ATOM   5173  H  HB3  . GLU B 2 11  ? -5.916  13.600  -13.607 1.00 0.00 ? 111 GLU B HB3  3  
ATOM   5174  H  HG2  . GLU B 2 11  ? -7.642  12.465  -14.596 1.00 0.00 ? 111 GLU B HG2  3  
ATOM   5175  H  HG3  . GLU B 2 11  ? -8.659  12.539  -13.158 1.00 0.00 ? 111 GLU B HG3  3  
ATOM   5176  N  N    . LYS B 2 12  ? -4.089  11.738  -11.926 1.00 0.00 ? 112 LYS B N    3  
ATOM   5177  C  CA   . LYS B 2 12  ? -2.953  10.920  -12.334 1.00 0.00 ? 112 LYS B CA   3  
ATOM   5178  C  C    . LYS B 2 12  ? -2.734  9.760   -11.367 1.00 0.00 ? 112 LYS B C    3  
ATOM   5179  O  O    . LYS B 2 12  ? -2.087  8.771   -11.711 1.00 0.00 ? 112 LYS B O    3  
ATOM   5180  C  CB   . LYS B 2 12  ? -1.688  11.775  -12.421 1.00 0.00 ? 112 LYS B CB   3  
ATOM   5181  C  CG   . LYS B 2 12  ? -1.408  12.309  -13.817 1.00 0.00 ? 112 LYS B CG   3  
ATOM   5182  C  CD   . LYS B 2 12  ? -2.557  13.165  -14.327 1.00 0.00 ? 112 LYS B CD   3  
ATOM   5183  C  CE   . LYS B 2 12  ? -2.153  13.969  -15.552 1.00 0.00 ? 112 LYS B CE   3  
ATOM   5184  N  NZ   . LYS B 2 12  ? -2.642  15.374  -15.480 1.00 0.00 ? 112 LYS B NZ   3  
ATOM   5185  H  H    . LYS B 2 12  ? -3.948  12.471  -11.296 1.00 0.00 ? 112 LYS B H    3  
ATOM   5186  H  HA   . LYS B 2 12  ? -3.171  10.516  -13.312 1.00 0.00 ? 112 LYS B HA   3  
ATOM   5187  H  HB2  . LYS B 2 12  ? -1.788  12.616  -11.751 1.00 0.00 ? 112 LYS B HB2  3  
ATOM   5188  H  HB3  . LYS B 2 12  ? -0.841  11.180  -12.112 1.00 0.00 ? 112 LYS B HB3  3  
ATOM   5189  H  HG2  . LYS B 2 12  ? -0.511  12.908  -13.790 1.00 0.00 ? 112 LYS B HG2  3  
ATOM   5190  H  HG3  . LYS B 2 12  ? -1.267  11.475  -14.489 1.00 0.00 ? 112 LYS B HG3  3  
ATOM   5191  H  HD2  . LYS B 2 12  ? -3.384  12.521  -14.588 1.00 0.00 ? 112 LYS B HD2  3  
ATOM   5192  H  HD3  . LYS B 2 12  ? -2.861  13.845  -13.544 1.00 0.00 ? 112 LYS B HD3  3  
ATOM   5193  H  HE2  . LYS B 2 12  ? -1.075  13.976  -15.624 1.00 0.00 ? 112 LYS B HE2  3  
ATOM   5194  H  HE3  . LYS B 2 12  ? -2.568  13.496  -16.430 1.00 0.00 ? 112 LYS B HE3  3  
ATOM   5195  H  HZ1  . LYS B 2 12  ? -2.016  15.939  -14.872 1.00 0.00 ? 112 LYS B HZ1  3  
ATOM   5196  H  HZ2  . LYS B 2 12  ? -3.603  15.398  -15.087 1.00 0.00 ? 112 LYS B HZ2  3  
ATOM   5197  H  HZ3  . LYS B 2 12  ? -2.658  15.796  -16.431 1.00 0.00 ? 112 LYS B HZ3  3  
ATOM   5198  N  N    . ARG B 2 13  ? -3.275  9.882   -10.156 1.00 0.00 ? 113 ARG B N    3  
ATOM   5199  C  CA   . ARG B 2 13  ? -3.134  8.837   -9.146  1.00 0.00 ? 113 ARG B CA   3  
ATOM   5200  C  C    . ARG B 2 13  ? -3.533  7.477   -9.708  1.00 0.00 ? 113 ARG B C    3  
ATOM   5201  O  O    . ARG B 2 13  ? -3.060  6.439   -9.247  1.00 0.00 ? 113 ARG B O    3  
ATOM   5202  C  CB   . ARG B 2 13  ? -3.983  9.166   -7.917  1.00 0.00 ? 113 ARG B CB   3  
ATOM   5203  C  CG   . ARG B 2 13  ? -3.870  8.135   -6.805  1.00 0.00 ? 113 ARG B CG   3  
ATOM   5204  C  CD   . ARG B 2 13  ? -4.636  8.566   -5.566  1.00 0.00 ? 113 ARG B CD   3  
ATOM   5205  N  NE   . ARG B 2 13  ? -6.078  8.610   -5.800  1.00 0.00 ? 113 ARG B NE   3  
ATOM   5206  C  CZ   . ARG B 2 13  ? -6.971  8.930   -4.866  1.00 0.00 ? 113 ARG B CZ   3  
ATOM   5207  N  NH1  . ARG B 2 13  ? -6.576  9.234   -3.637  1.00 0.00 ? 113 ARG B NH1  3  
ATOM   5208  N  NH2  . ARG B 2 13  ? -8.263  8.947   -5.165  1.00 0.00 ? 113 ARG B NH2  3  
ATOM   5209  H  H    . ARG B 2 13  ? -3.781  10.692  -9.936  1.00 0.00 ? 113 ARG B H    3  
ATOM   5210  H  HA   . ARG B 2 13  ? -2.100  8.798   -8.859  1.00 0.00 ? 113 ARG B HA   3  
ATOM   5211  H  HB2  . ARG B 2 13  ? -3.670  10.123  -7.524  1.00 0.00 ? 113 ARG B HB2  3  
ATOM   5212  H  HB3  . ARG B 2 13  ? -5.019  9.231   -8.215  1.00 0.00 ? 113 ARG B HB3  3  
ATOM   5213  H  HG2  . ARG B 2 13  ? -4.271  7.196   -7.157  1.00 0.00 ? 113 ARG B HG2  3  
ATOM   5214  H  HG3  . ARG B 2 13  ? -2.828  8.010   -6.549  1.00 0.00 ? 113 ARG B HG3  3  
ATOM   5215  H  HD2  . ARG B 2 13  ? -4.432  7.864   -4.770  1.00 0.00 ? 113 ARG B HD2  3  
ATOM   5216  H  HD3  . ARG B 2 13  ? -4.298  9.549   -5.273  1.00 0.00 ? 113 ARG B HD3  3  
ATOM   5217  H  HE   . ARG B 2 13  ? -6.397  8.389   -6.700  1.00 0.00 ? 113 ARG B HE   3  
ATOM   5218  H  HH11 . ARG B 2 13  ? -5.604  9.225   -3.406  1.00 0.00 ? 113 ARG B HH11 3  
ATOM   5219  H  HH12 . ARG B 2 13  ? -7.252  9.474   -2.940  1.00 0.00 ? 113 ARG B HH12 3  
ATOM   5220  H  HH21 . ARG B 2 13  ? -8.567  8.719   -6.090  1.00 0.00 ? 113 ARG B HH21 3  
ATOM   5221  H  HH22 . ARG B 2 13  ? -8.935  9.186   -4.463  1.00 0.00 ? 113 ARG B HH22 3  
ATOM   5222  N  N    . LYS B 2 14  ? -4.399  7.496   -10.710 1.00 0.00 ? 114 LYS B N    3  
ATOM   5223  C  CA   . LYS B 2 14  ? -4.858  6.270   -11.348 1.00 0.00 ? 114 LYS B CA   3  
ATOM   5224  C  C    . LYS B 2 14  ? -3.734  5.642   -12.164 1.00 0.00 ? 114 LYS B C    3  
ATOM   5225  O  O    . LYS B 2 14  ? -3.567  4.423   -12.175 1.00 0.00 ? 114 LYS B O    3  
ATOM   5226  C  CB   . LYS B 2 14  ? -6.063  6.555   -12.246 1.00 0.00 ? 114 LYS B CB   3  
ATOM   5227  C  CG   . LYS B 2 14  ? -6.813  5.303   -12.675 1.00 0.00 ? 114 LYS B CG   3  
ATOM   5228  C  CD   . LYS B 2 14  ? -7.412  4.572   -11.482 1.00 0.00 ? 114 LYS B CD   3  
ATOM   5229  C  CE   . LYS B 2 14  ? -8.922  4.441   -11.606 1.00 0.00 ? 114 LYS B CE   3  
ATOM   5230  N  NZ   . LYS B 2 14  ? -9.641  5.429   -10.753 1.00 0.00 ? 114 LYS B NZ   3  
ATOM   5231  H  H    . LYS B 2 14  ? -4.731  8.357   -11.033 1.00 0.00 ? 114 LYS B H    3  
ATOM   5232  H  HA   . LYS B 2 14  ? -5.151  5.579   -10.570 1.00 0.00 ? 114 LYS B HA   3  
ATOM   5233  H  HB2  . LYS B 2 14  ? -6.750  7.196   -11.714 1.00 0.00 ? 114 LYS B HB2  3  
ATOM   5234  H  HB3  . LYS B 2 14  ? -5.722  7.066   -13.134 1.00 0.00 ? 114 LYS B HB3  3  
ATOM   5235  H  HG2  . LYS B 2 14  ? -7.608  5.586   -13.349 1.00 0.00 ? 114 LYS B HG2  3  
ATOM   5236  H  HG3  . LYS B 2 14  ? -6.126  4.642   -13.183 1.00 0.00 ? 114 LYS B HG3  3  
ATOM   5237  H  HD2  . LYS B 2 14  ? -6.980  3.585   -11.424 1.00 0.00 ? 114 LYS B HD2  3  
ATOM   5238  H  HD3  . LYS B 2 14  ? -7.180  5.122   -10.581 1.00 0.00 ? 114 LYS B HD3  3  
ATOM   5239  H  HE2  . LYS B 2 14  ? -9.201  4.600   -12.638 1.00 0.00 ? 114 LYS B HE2  3  
ATOM   5240  H  HE3  . LYS B 2 14  ? -9.209  3.444   -11.308 1.00 0.00 ? 114 LYS B HE3  3  
ATOM   5241  H  HZ1  . LYS B 2 14  ? -10.046 4.954   -9.922  1.00 0.00 ? 114 LYS B HZ1  3  
ATOM   5242  H  HZ2  . LYS B 2 14  ? -10.410 5.874   -11.293 1.00 0.00 ? 114 LYS B HZ2  3  
ATOM   5243  H  HZ3  . LYS B 2 14  ? -8.984  6.169   -10.432 1.00 0.00 ? 114 LYS B HZ3  3  
ATOM   5244  N  N    . LEU B 2 15  ? -2.960  6.486   -12.841 1.00 0.00 ? 115 LEU B N    3  
ATOM   5245  C  CA   . LEU B 2 15  ? -1.846  6.012   -13.651 1.00 0.00 ? 115 LEU B CA   3  
ATOM   5246  C  C    . LEU B 2 15  ? -0.750  5.438   -12.767 1.00 0.00 ? 115 LEU B C    3  
ATOM   5247  O  O    . LEU B 2 15  ? -0.041  4.507   -13.155 1.00 0.00 ? 115 LEU B O    3  
ATOM   5248  C  CB   . LEU B 2 15  ? -1.288  7.148   -14.511 1.00 0.00 ? 115 LEU B CB   3  
ATOM   5249  C  CG   . LEU B 2 15  ? -2.255  7.703   -15.556 1.00 0.00 ? 115 LEU B CG   3  
ATOM   5250  C  CD1  . LEU B 2 15  ? -1.805  9.079   -16.022 1.00 0.00 ? 115 LEU B CD1  3  
ATOM   5251  C  CD2  . LEU B 2 15  ? -2.367  6.749   -16.736 1.00 0.00 ? 115 LEU B CD2  3  
ATOM   5252  H  H    . LEU B 2 15  ? -3.139  7.450   -12.789 1.00 0.00 ? 115 LEU B H    3  
ATOM   5253  H  HA   . LEU B 2 15  ? -2.214  5.231   -14.292 1.00 0.00 ? 115 LEU B HA   3  
ATOM   5254  H  HB2  . LEU B 2 15  ? -0.995  7.956   -13.856 1.00 0.00 ? 115 LEU B HB2  3  
ATOM   5255  H  HB3  . LEU B 2 15  ? -0.409  6.785   -15.023 1.00 0.00 ? 115 LEU B HB3  3  
ATOM   5256  H  HG   . LEU B 2 15  ? -3.235  7.805   -15.113 1.00 0.00 ? 115 LEU B HG   3  
ATOM   5257  H  HD11 . LEU B 2 15  ? -2.672  9.687   -16.240 1.00 0.00 ? 115 LEU B HD11 3  
ATOM   5258  H  HD12 . LEU B 2 15  ? -1.203  8.978   -16.914 1.00 0.00 ? 115 LEU B HD12 3  
ATOM   5259  H  HD13 . LEU B 2 15  ? -1.221  9.549   -15.246 1.00 0.00 ? 115 LEU B HD13 3  
ATOM   5260  H  HD21 . LEU B 2 15  ? -3.039  7.164   -17.473 1.00 0.00 ? 115 LEU B HD21 3  
ATOM   5261  H  HD22 . LEU B 2 15  ? -2.751  5.798   -16.395 1.00 0.00 ? 115 LEU B HD22 3  
ATOM   5262  H  HD23 . LEU B 2 15  ? -1.392  6.605   -17.177 1.00 0.00 ? 115 LEU B HD23 3  
ATOM   5263  N  N    . ILE B 2 16  ? -0.628  5.992   -11.570 1.00 0.00 ? 116 ILE B N    3  
ATOM   5264  C  CA   . ILE B 2 16  ? 0.371   5.535   -10.613 1.00 0.00 ? 116 ILE B CA   3  
ATOM   5265  C  C    . ILE B 2 16  ? 0.026   4.139   -10.115 1.00 0.00 ? 116 ILE B C    3  
ATOM   5266  O  O    . ILE B 2 16  ? 0.888   3.265   -10.033 1.00 0.00 ? 116 ILE B O    3  
ATOM   5267  C  CB   . ILE B 2 16  ? 0.480   6.485   -9.403  1.00 0.00 ? 116 ILE B CB   3  
ATOM   5268  C  CG1  . ILE B 2 16  ? 0.462   7.947   -9.857  1.00 0.00 ? 116 ILE B CG1  3  
ATOM   5269  C  CG2  . ILE B 2 16  ? 1.745   6.189   -8.612  1.00 0.00 ? 116 ILE B CG2  3  
ATOM   5270  C  CD1  . ILE B 2 16  ? 1.457   8.257   -10.954 1.00 0.00 ? 116 ILE B CD1  3  
ATOM   5271  H  H    . ILE B 2 16  ? -1.231  6.720   -11.323 1.00 0.00 ? 116 ILE B H    3  
ATOM   5272  H  HA   . ILE B 2 16  ? 1.328   5.505   -11.114 1.00 0.00 ? 116 ILE B HA   3  
ATOM   5273  H  HB   . ILE B 2 16  ? -0.367  6.306   -8.757  1.00 0.00 ? 116 ILE B HB   3  
ATOM   5274  H  HG12 . ILE B 2 16  ? -0.523  8.191   -10.225 1.00 0.00 ? 116 ILE B HG12 3  
ATOM   5275  H  HG13 . ILE B 2 16  ? 0.691   8.580   -9.012  1.00 0.00 ? 116 ILE B HG13 3  
ATOM   5276  H  HG21 . ILE B 2 16  ? 2.544   6.828   -8.957  1.00 0.00 ? 116 ILE B HG21 3  
ATOM   5277  H  HG22 . ILE B 2 16  ? 2.025   5.155   -8.754  1.00 0.00 ? 116 ILE B HG22 3  
ATOM   5278  H  HG23 . ILE B 2 16  ? 1.564   6.372   -7.563  1.00 0.00 ? 116 ILE B HG23 3  
ATOM   5279  H  HD11 . ILE B 2 16  ? 2.408   7.807   -10.714 1.00 0.00 ? 116 ILE B HD11 3  
ATOM   5280  H  HD12 . ILE B 2 16  ? 1.577   9.328   -11.040 1.00 0.00 ? 116 ILE B HD12 3  
ATOM   5281  H  HD13 . ILE B 2 16  ? 1.096   7.859   -11.891 1.00 0.00 ? 116 ILE B HD13 3  
ATOM   5282  N  N    . GLN B 2 17  ? -1.248  3.938   -9.794  1.00 0.00 ? 117 GLN B N    3  
ATOM   5283  C  CA   . GLN B 2 17  ? -1.720  2.649   -9.312  1.00 0.00 ? 117 GLN B CA   3  
ATOM   5284  C  C    . GLN B 2 17  ? -1.492  1.571   -10.366 1.00 0.00 ? 117 GLN B C    3  
ATOM   5285  O  O    . GLN B 2 17  ? -1.140  0.437   -10.043 1.00 0.00 ? 117 GLN B O    3  
ATOM   5286  C  CB   . GLN B 2 17  ? -3.206  2.729   -8.951  1.00 0.00 ? 117 GLN B CB   3  
ATOM   5287  C  CG   . GLN B 2 17  ? -3.501  2.365   -7.505  1.00 0.00 ? 117 GLN B CG   3  
ATOM   5288  C  CD   . GLN B 2 17  ? -4.358  3.403   -6.805  1.00 0.00 ? 117 GLN B CD   3  
ATOM   5289  O  OE1  . GLN B 2 17  ? -5.541  3.177   -6.550  1.00 0.00 ? 117 GLN B OE1  3  
ATOM   5290  N  NE2  . GLN B 2 17  ? -3.763  4.548   -6.492  1.00 0.00 ? 117 GLN B NE2  3  
ATOM   5291  H  H    . GLN B 2 17  ? -1.887  4.675   -9.888  1.00 0.00 ? 117 GLN B H    3  
ATOM   5292  H  HA   . GLN B 2 17  ? -1.155  2.397   -8.427  1.00 0.00 ? 117 GLN B HA   3  
ATOM   5293  H  HB2  . GLN B 2 17  ? -3.552  3.738   -9.124  1.00 0.00 ? 117 GLN B HB2  3  
ATOM   5294  H  HB3  . GLN B 2 17  ? -3.759  2.055   -9.589  1.00 0.00 ? 117 GLN B HB3  3  
ATOM   5295  H  HG2  . GLN B 2 17  ? -4.020  1.419   -7.483  1.00 0.00 ? 117 GLN B HG2  3  
ATOM   5296  H  HG3  . GLN B 2 17  ? -2.565  2.275   -6.972  1.00 0.00 ? 117 GLN B HG3  3  
ATOM   5297  H  HE21 . GLN B 2 17  ? -2.818  4.659   -6.727  1.00 0.00 ? 117 GLN B HE21 3  
ATOM   5298  H  HE22 . GLN B 2 17  ? -4.294  5.236   -6.039  1.00 0.00 ? 117 GLN B HE22 3  
ATOM   5299  N  N    . GLN B 2 18  ? -1.692  1.936   -11.629 1.00 0.00 ? 118 GLN B N    3  
ATOM   5300  C  CA   . GLN B 2 18  ? -1.504  1.002   -12.732 1.00 0.00 ? 118 GLN B CA   3  
ATOM   5301  C  C    . GLN B 2 18  ? -0.089  0.458   -12.744 1.00 0.00 ? 118 GLN B C    3  
ATOM   5302  O  O    . GLN B 2 18  ? 0.128   -0.743  -12.609 1.00 0.00 ? 118 GLN B O    3  
ATOM   5303  C  CB   . GLN B 2 18  ? -1.820  1.682   -14.067 1.00 0.00 ? 118 GLN B CB   3  
ATOM   5304  C  CG   . GLN B 2 18  ? -2.655  0.823   -15.004 1.00 0.00 ? 118 GLN B CG   3  
ATOM   5305  C  CD   . GLN B 2 18  ? -4.018  1.423   -15.288 1.00 0.00 ? 118 GLN B CD   3  
ATOM   5306  O  OE1  . GLN B 2 18  ? -5.039  0.931   -14.807 1.00 0.00 ? 118 GLN B OE1  3  
ATOM   5307  N  NE2  . GLN B 2 18  ? -4.042  2.494   -16.074 1.00 0.00 ? 118 GLN B NE2  3  
ATOM   5308  H  H    . GLN B 2 18  ? -1.968  2.856   -11.823 1.00 0.00 ? 118 GLN B H    3  
ATOM   5309  H  HA   . GLN B 2 18  ? -2.176  0.182   -12.588 1.00 0.00 ? 118 GLN B HA   3  
ATOM   5310  H  HB2  . GLN B 2 18  ? -2.361  2.596   -13.872 1.00 0.00 ? 118 GLN B HB2  3  
ATOM   5311  H  HB3  . GLN B 2 18  ? -0.892  1.922   -14.565 1.00 0.00 ? 118 GLN B HB3  3  
ATOM   5312  H  HG2  . GLN B 2 18  ? -2.126  0.713   -15.938 1.00 0.00 ? 118 GLN B HG2  3  
ATOM   5313  H  HG3  . GLN B 2 18  ? -2.793  -0.149  -14.554 1.00 0.00 ? 118 GLN B HG3  3  
ATOM   5314  H  HE21 . GLN B 2 18  ? -3.189  2.831   -16.422 1.00 0.00 ? 118 GLN B HE21 3  
ATOM   5315  H  HE22 . GLN B 2 18  ? -4.909  2.902   -16.275 1.00 0.00 ? 118 GLN B HE22 3  
ATOM   5316  N  N    . GLN B 2 19  ? 0.869   1.350   -12.905 1.00 0.00 ? 119 GLN B N    3  
ATOM   5317  C  CA   . GLN B 2 19  ? 2.274   0.963   -12.933 1.00 0.00 ? 119 GLN B CA   3  
ATOM   5318  C  C    . GLN B 2 19  ? 2.668   0.266   -11.638 1.00 0.00 ? 119 GLN B C    3  
ATOM   5319  O  O    . GLN B 2 19  ? 3.561   -0.582  -11.622 1.00 0.00 ? 119 GLN B O    3  
ATOM   5320  C  CB   . GLN B 2 19  ? 3.164   2.184   -13.169 1.00 0.00 ? 119 GLN B CB   3  
ATOM   5321  C  CG   . GLN B 2 19  ? 4.448   1.864   -13.919 1.00 0.00 ? 119 GLN B CG   3  
ATOM   5322  C  CD   . GLN B 2 19  ? 4.625   2.712   -15.164 1.00 0.00 ? 119 GLN B CD   3  
ATOM   5323  O  OE1  . GLN B 2 19  ? 4.949   2.202   -16.236 1.00 0.00 ? 119 GLN B OE1  3  
ATOM   5324  N  NE2  . GLN B 2 19  ? 4.413   4.016   -15.026 1.00 0.00 ? 119 GLN B NE2  3  
ATOM   5325  H  H    . GLN B 2 19  ? 0.623   2.290   -13.003 1.00 0.00 ? 119 GLN B H    3  
ATOM   5326  H  HA   . GLN B 2 19  ? 2.402   0.269   -13.744 1.00 0.00 ? 119 GLN B HA   3  
ATOM   5327  H  HB2  . GLN B 2 19  ? 2.611   2.914   -13.739 1.00 0.00 ? 119 GLN B HB2  3  
ATOM   5328  H  HB3  . GLN B 2 19  ? 3.429   2.612   -12.213 1.00 0.00 ? 119 GLN B HB3  3  
ATOM   5329  H  HG2  . GLN B 2 19  ? 5.287   2.038   -13.262 1.00 0.00 ? 119 GLN B HG2  3  
ATOM   5330  H  HG3  . GLN B 2 19  ? 4.430   0.824   -14.210 1.00 0.00 ? 119 GLN B HG3  3  
ATOM   5331  H  HE21 . GLN B 2 19  ? 4.159   4.354   -14.142 1.00 0.00 ? 119 GLN B HE21 3  
ATOM   5332  H  HE22 . GLN B 2 19  ? 4.522   4.588   -15.814 1.00 0.00 ? 119 GLN B HE22 3  
ATOM   5333  N  N    . LEU B 2 20  ? 1.987   0.618   -10.559 1.00 0.00 ? 120 LEU B N    3  
ATOM   5334  C  CA   . LEU B 2 20  ? 2.253   0.017   -9.259  1.00 0.00 ? 120 LEU B CA   3  
ATOM   5335  C  C    . LEU B 2 20  ? 1.663   -1.386  -9.203  1.00 0.00 ? 120 LEU B C    3  
ATOM   5336  O  O    . LEU B 2 20  ? 2.246   -2.297  -8.613  1.00 0.00 ? 120 LEU B O    3  
ATOM   5337  C  CB   . LEU B 2 20  ? 1.668   0.880   -8.139  1.00 0.00 ? 120 LEU B CB   3  
ATOM   5338  C  CG   . LEU B 2 20  ? 2.388   0.779   -6.791  1.00 0.00 ? 120 LEU B CG   3  
ATOM   5339  C  CD1  . LEU B 2 20  ? 2.610   -0.676  -6.407  1.00 0.00 ? 120 LEU B CD1  3  
ATOM   5340  C  CD2  . LEU B 2 20  ? 3.712   1.526   -6.840  1.00 0.00 ? 120 LEU B CD2  3  
ATOM   5341  H  H    . LEU B 2 20  ? 1.281   1.291   -10.641 1.00 0.00 ? 120 LEU B H    3  
ATOM   5342  H  HA   . LEU B 2 20  ? 3.324   -0.048  -9.134  1.00 0.00 ? 120 LEU B HA   3  
ATOM   5343  H  HB2  . LEU B 2 20  ? 1.692   1.912   -8.459  1.00 0.00 ? 120 LEU B HB2  3  
ATOM   5344  H  HB3  . LEU B 2 20  ? 0.638   0.592   -7.992  1.00 0.00 ? 120 LEU B HB3  3  
ATOM   5345  H  HG   . LEU B 2 20  ? 1.775   1.235   -6.027  1.00 0.00 ? 120 LEU B HG   3  
ATOM   5346  H  HD11 . LEU B 2 20  ? 1.678   -1.216  -6.490  1.00 0.00 ? 120 LEU B HD11 3  
ATOM   5347  H  HD12 . LEU B 2 20  ? 2.967   -0.729  -5.389  1.00 0.00 ? 120 LEU B HD12 3  
ATOM   5348  H  HD13 . LEU B 2 20  ? 3.342   -1.116  -7.068  1.00 0.00 ? 120 LEU B HD13 3  
ATOM   5349  H  HD21 . LEU B 2 20  ? 4.137   1.570   -5.848  1.00 0.00 ? 120 LEU B HD21 3  
ATOM   5350  H  HD22 . LEU B 2 20  ? 3.547   2.529   -7.205  1.00 0.00 ? 120 LEU B HD22 3  
ATOM   5351  H  HD23 . LEU B 2 20  ? 4.393   1.011   -7.501  1.00 0.00 ? 120 LEU B HD23 3  
ATOM   5352  N  N    . VAL B 2 21  ? 0.503   -1.554  -9.833  1.00 0.00 ? 121 VAL B N    3  
ATOM   5353  C  CA   . VAL B 2 21  ? -0.168  -2.846  -9.869  1.00 0.00 ? 121 VAL B CA   3  
ATOM   5354  C  C    . VAL B 2 21  ? 0.405   -3.722  -10.976 1.00 0.00 ? 121 VAL B C    3  
ATOM   5355  O  O    . VAL B 2 21  ? 0.568   -4.926  -10.795 1.00 0.00 ? 121 VAL B O    3  
ATOM   5356  C  CB   . VAL B 2 21  ? -1.689  -2.689  -10.081 1.00 0.00 ? 121 VAL B CB   3  
ATOM   5357  C  CG1  . VAL B 2 21  ? -2.375  -4.048  -10.094 1.00 0.00 ? 121 VAL B CG1  3  
ATOM   5358  C  CG2  . VAL B 2 21  ? -2.290  -1.792  -9.008  1.00 0.00 ? 121 VAL B CG2  3  
ATOM   5359  H  H    . VAL B 2 21  ? 0.094   -0.790  -10.291 1.00 0.00 ? 121 VAL B H    3  
ATOM   5360  H  HA   . VAL B 2 21  ? -0.005  -3.335  -8.917  1.00 0.00 ? 121 VAL B HA   3  
ATOM   5361  H  HB   . VAL B 2 21  ? -1.851  -2.221  -11.041 1.00 0.00 ? 121 VAL B HB   3  
ATOM   5362  H  HG11 . VAL B 2 21  ? -3.408  -3.933  -9.803  1.00 0.00 ? 121 VAL B HG11 3  
ATOM   5363  H  HG12 . VAL B 2 21  ? -1.877  -4.710  -9.400  1.00 0.00 ? 121 VAL B HG12 3  
ATOM   5364  H  HG13 . VAL B 2 21  ? -2.326  -4.466  -11.088 1.00 0.00 ? 121 VAL B HG13 3  
ATOM   5365  H  HG21 . VAL B 2 21  ? -2.988  -2.360  -8.410  1.00 0.00 ? 121 VAL B HG21 3  
ATOM   5366  H  HG22 . VAL B 2 21  ? -2.806  -0.968  -9.476  1.00 0.00 ? 121 VAL B HG22 3  
ATOM   5367  H  HG23 . VAL B 2 21  ? -1.503  -1.409  -8.375  1.00 0.00 ? 121 VAL B HG23 3  
ATOM   5368  N  N    . LEU B 2 22  ? 0.714   -3.118  -12.122 1.00 0.00 ? 122 LEU B N    3  
ATOM   5369  C  CA   . LEU B 2 22  ? 1.269   -3.857  -13.234 1.00 0.00 ? 122 LEU B CA   3  
ATOM   5370  C  C    . LEU B 2 22  ? 2.602   -4.487  -12.852 1.00 0.00 ? 122 LEU B C    3  
ATOM   5371  O  O    . LEU B 2 22  ? 2.854   -5.656  -13.148 1.00 0.00 ? 122 LEU B O    3  
ATOM   5372  C  CB   . LEU B 2 22  ? 1.445   -2.927  -14.429 1.00 0.00 ? 122 LEU B CB   3  
ATOM   5373  C  CG   . LEU B 2 22  ? 0.619   -3.291  -15.659 1.00 0.00 ? 122 LEU B CG   3  
ATOM   5374  C  CD1  . LEU B 2 22  ? 1.102   -2.518  -16.873 1.00 0.00 ? 122 LEU B CD1  3  
ATOM   5375  C  CD2  . LEU B 2 22  ? 0.674   -4.788  -15.931 1.00 0.00 ? 122 LEU B CD2  3  
ATOM   5376  H  H    . LEU B 2 22  ? 0.567   -2.152  -12.225 1.00 0.00 ? 122 LEU B H    3  
ATOM   5377  H  HA   . LEU B 2 22  ? 0.573   -4.639  -13.495 1.00 0.00 ? 122 LEU B HA   3  
ATOM   5378  H  HB2  . LEU B 2 22  ? 1.168   -1.929  -14.121 1.00 0.00 ? 122 LEU B HB2  3  
ATOM   5379  H  HB3  . LEU B 2 22  ? 2.482   -2.920  -14.703 1.00 0.00 ? 122 LEU B HB3  3  
ATOM   5380  H  HG   . LEU B 2 22  ? -0.411  -3.019  -15.477 1.00 0.00 ? 122 LEU B HG   3  
ATOM   5381  H  HD11 . LEU B 2 22  ? 1.446   -1.542  -16.565 1.00 0.00 ? 122 LEU B HD11 3  
ATOM   5382  H  HD12 . LEU B 2 22  ? 0.292   -2.410  -17.577 1.00 0.00 ? 122 LEU B HD12 3  
ATOM   5383  H  HD13 . LEU B 2 22  ? 1.916   -3.056  -17.340 1.00 0.00 ? 122 LEU B HD13 3  
ATOM   5384  H  HD21 . LEU B 2 22  ? 0.586   -4.965  -16.992 1.00 0.00 ? 122 LEU B HD21 3  
ATOM   5385  H  HD22 . LEU B 2 22  ? -0.140  -5.278  -15.415 1.00 0.00 ? 122 LEU B HD22 3  
ATOM   5386  H  HD23 . LEU B 2 22  ? 1.614   -5.183  -15.576 1.00 0.00 ? 122 LEU B HD23 3  
ATOM   5387  N  N    . LEU B 2 23  ? 3.449   -3.714  -12.178 1.00 0.00 ? 123 LEU B N    3  
ATOM   5388  C  CA   . LEU B 2 23  ? 4.743   -4.217  -11.747 1.00 0.00 ? 123 LEU B CA   3  
ATOM   5389  C  C    . LEU B 2 23  ? 4.539   -5.267  -10.671 1.00 0.00 ? 123 LEU B C    3  
ATOM   5390  O  O    . LEU B 2 23  ? 5.090   -6.365  -10.741 1.00 0.00 ? 123 LEU B O    3  
ATOM   5391  C  CB   . LEU B 2 23  ? 5.621   -3.079  -11.222 1.00 0.00 ? 123 LEU B CB   3  
ATOM   5392  C  CG   . LEU B 2 23  ? 6.315   -2.245  -12.301 1.00 0.00 ? 123 LEU B CG   3  
ATOM   5393  C  CD1  . LEU B 2 23  ? 6.545   -0.825  -11.812 1.00 0.00 ? 123 LEU B CD1  3  
ATOM   5394  C  CD2  . LEU B 2 23  ? 7.632   -2.892  -12.707 1.00 0.00 ? 123 LEU B CD2  3  
ATOM   5395  H  H    . LEU B 2 23  ? 3.193   -2.797  -11.956 1.00 0.00 ? 123 LEU B H    3  
ATOM   5396  H  HA   . LEU B 2 23  ? 5.220   -4.678  -12.597 1.00 0.00 ? 123 LEU B HA   3  
ATOM   5397  H  HB2  . LEU B 2 23  ? 5.003   -2.420  -10.629 1.00 0.00 ? 123 LEU B HB2  3  
ATOM   5398  H  HB3  . LEU B 2 23  ? 6.380   -3.504  -10.583 1.00 0.00 ? 123 LEU B HB3  3  
ATOM   5399  H  HG   . LEU B 2 23  ? 5.682   -2.199  -13.174 1.00 0.00 ? 123 LEU B HG   3  
ATOM   5400  H  HD11 . LEU B 2 23  ? 7.450   -0.433  -12.254 1.00 0.00 ? 123 LEU B HD11 3  
ATOM   5401  H  HD12 . LEU B 2 23  ? 6.643   -0.824  -10.736 1.00 0.00 ? 123 LEU B HD12 3  
ATOM   5402  H  HD13 . LEU B 2 23  ? 5.709   -0.205  -12.098 1.00 0.00 ? 123 LEU B HD13 3  
ATOM   5403  H  HD21 . LEU B 2 23  ? 8.366   -2.730  -11.931 1.00 0.00 ? 123 LEU B HD21 3  
ATOM   5404  H  HD22 . LEU B 2 23  ? 7.980   -2.450  -13.629 1.00 0.00 ? 123 LEU B HD22 3  
ATOM   5405  H  HD23 . LEU B 2 23  ? 7.485   -3.951  -12.848 1.00 0.00 ? 123 LEU B HD23 3  
ATOM   5406  N  N    . LEU B 2 24  ? 3.708   -4.932  -9.691  1.00 0.00 ? 124 LEU B N    3  
ATOM   5407  C  CA   . LEU B 2 24  ? 3.386   -5.855  -8.615  1.00 0.00 ? 124 LEU B CA   3  
ATOM   5408  C  C    . LEU B 2 24  ? 2.805   -7.120  -9.217  1.00 0.00 ? 124 LEU B C    3  
ATOM   5409  O  O    . LEU B 2 24  ? 3.143   -8.238  -8.825  1.00 0.00 ? 124 LEU B O    3  
ATOM   5410  C  CB   . LEU B 2 24  ? 2.375   -5.211  -7.665  1.00 0.00 ? 124 LEU B CB   3  
ATOM   5411  C  CG   . LEU B 2 24  ? 2.962   -4.525  -6.429  1.00 0.00 ? 124 LEU B CG   3  
ATOM   5412  C  CD1  . LEU B 2 24  ? 4.167   -3.672  -6.799  1.00 0.00 ? 124 LEU B CD1  3  
ATOM   5413  C  CD2  . LEU B 2 24  ? 1.902   -3.673  -5.750  1.00 0.00 ? 124 LEU B CD2  3  
ATOM   5414  H  H    . LEU B 2 24  ? 3.279   -4.050  -9.708  1.00 0.00 ? 124 LEU B H    3  
ATOM   5415  H  HA   . LEU B 2 24  ? 4.291   -6.094  -8.087  1.00 0.00 ? 124 LEU B HA   3  
ATOM   5416  H  HB2  . LEU B 2 24  ? 1.819   -4.474  -8.225  1.00 0.00 ? 124 LEU B HB2  3  
ATOM   5417  H  HB3  . LEU B 2 24  ? 1.685   -5.972  -7.334  1.00 0.00 ? 124 LEU B HB3  3  
ATOM   5418  H  HG   . LEU B 2 24  ? 3.288   -5.278  -5.726  1.00 0.00 ? 124 LEU B HG   3  
ATOM   5419  H  HD11 . LEU B 2 24  ? 4.069   -3.337  -7.821  1.00 0.00 ? 124 LEU B HD11 3  
ATOM   5420  H  HD12 . LEU B 2 24  ? 5.067   -4.257  -6.695  1.00 0.00 ? 124 LEU B HD12 3  
ATOM   5421  H  HD13 . LEU B 2 24  ? 4.214   -2.816  -6.143  1.00 0.00 ? 124 LEU B HD13 3  
ATOM   5422  H  HD21 . LEU B 2 24  ? 1.295   -4.296  -5.112  1.00 0.00 ? 124 LEU B HD21 3  
ATOM   5423  H  HD22 . LEU B 2 24  ? 1.279   -3.211  -6.503  1.00 0.00 ? 124 LEU B HD22 3  
ATOM   5424  H  HD23 . LEU B 2 24  ? 2.380   -2.906  -5.160  1.00 0.00 ? 124 LEU B HD23 3  
ATOM   5425  N  N    . HIS B 2 25  ? 1.949   -6.914  -10.206 1.00 0.00 ? 125 HIS B N    3  
ATOM   5426  C  CA   . HIS B 2 25  ? 1.322   -8.003  -10.927 1.00 0.00 ? 125 HIS B CA   3  
ATOM   5427  C  C    . HIS B 2 25  ? 2.386   -8.864  -11.559 1.00 0.00 ? 125 HIS B C    3  
ATOM   5428  O  O    . HIS B 2 25  ? 2.651   -9.983  -11.128 1.00 0.00 ? 125 HIS B O    3  
ATOM   5429  C  CB   . HIS B 2 25  ? 0.416   -7.456  -12.032 1.00 0.00 ? 125 HIS B CB   3  
ATOM   5430  C  CG   . HIS B 2 25  ? 0.033   -8.486  -13.053 1.00 0.00 ? 125 HIS B CG   3  
ATOM   5431  N  ND1  . HIS B 2 25  ? -1.078  -9.294  -12.950 1.00 0.00 ? 125 HIS B ND1  3  
ATOM   5432  C  CD2  . HIS B 2 25  ? 0.652   -8.846  -14.208 1.00 0.00 ? 125 HIS B CD2  3  
ATOM   5433  C  CE1  . HIS B 2 25  ? -1.096  -10.104 -14.018 1.00 0.00 ? 125 HIS B CE1  3  
ATOM   5434  N  NE2  . HIS B 2 25  ? -0.069  -9.871  -14.812 1.00 0.00 ? 125 HIS B NE2  3  
ATOM   5435  H  H    . HIS B 2 25  ? 1.755   -5.995  -10.473 1.00 0.00 ? 125 HIS B H    3  
ATOM   5436  H  HA   . HIS B 2 25  ? 0.744   -8.586  -10.237 1.00 0.00 ? 125 HIS B HA   3  
ATOM   5437  H  HB2  . HIS B 2 25  ? -0.477  -7.070  -11.594 1.00 0.00 ? 125 HIS B HB2  3  
ATOM   5438  H  HB3  . HIS B 2 25  ? 0.930   -6.658  -12.545 1.00 0.00 ? 125 HIS B HB3  3  
ATOM   5439  H  HD1  . HIS B 2 25  ? -1.736  -9.280  -12.225 1.00 0.00 ? 125 HIS B HD1  3  
ATOM   5440  H  HD2  . HIS B 2 25  ? 1.560   -8.413  -14.609 1.00 0.00 ? 125 HIS B HD2  3  
ATOM   5441  H  HE1  . HIS B 2 25  ? -1.849  -10.852 -14.202 1.00 0.00 ? 125 HIS B HE1  3  
ATOM   5442  N  N    . ALA B 2 26  ? 2.987   -8.306  -12.594 1.00 0.00 ? 126 ALA B N    3  
ATOM   5443  C  CA   . ALA B 2 26  ? 4.038   -8.980  -13.338 1.00 0.00 ? 126 ALA B CA   3  
ATOM   5444  C  C    . ALA B 2 26  ? 5.003   -9.701  -12.399 1.00 0.00 ? 126 ALA B C    3  
ATOM   5445  O  O    . ALA B 2 26  ? 5.529   -10.763 -12.734 1.00 0.00 ? 126 ALA B O    3  
ATOM   5446  C  CB   . ALA B 2 26  ? 4.789   -7.984  -14.209 1.00 0.00 ? 126 ALA B CB   3  
ATOM   5447  H  H    . ALA B 2 26  ? 2.703   -7.404  -12.865 1.00 0.00 ? 126 ALA B H    3  
ATOM   5448  H  HA   . ALA B 2 26  ? 3.566   -9.705  -13.989 1.00 0.00 ? 126 ALA B HA   3  
ATOM   5449  H  HB1  . ALA B 2 26  ? 4.314   -7.920  -15.177 1.00 0.00 ? 126 ALA B HB1  3  
ATOM   5450  H  HB2  . ALA B 2 26  ? 5.812   -8.312  -14.331 1.00 0.00 ? 126 ALA B HB2  3  
ATOM   5451  H  HB3  . ALA B 2 26  ? 4.777   -7.012  -13.737 1.00 0.00 ? 126 ALA B HB3  3  
ATOM   5452  N  N    . HIS B 2 27  ? 5.224   -9.121  -11.217 1.00 0.00 ? 127 HIS B N    3  
ATOM   5453  C  CA   . HIS B 2 27  ? 6.119   -9.721  -10.236 1.00 0.00 ? 127 HIS B CA   3  
ATOM   5454  C  C    . HIS B 2 27  ? 5.592   -11.081 -9.791  1.00 0.00 ? 127 HIS B C    3  
ATOM   5455  O  O    . HIS B 2 27  ? 6.346   -12.048 -9.684  1.00 0.00 ? 127 HIS B O    3  
ATOM   5456  C  CB   . HIS B 2 27  ? 6.285   -8.798  -9.027  1.00 0.00 ? 127 HIS B CB   3  
ATOM   5457  C  CG   . HIS B 2 27  ? 7.671   -8.798  -8.460  1.00 0.00 ? 127 HIS B CG   3  
ATOM   5458  N  ND1  . HIS B 2 27  ? 8.760   -8.290  -9.135  1.00 0.00 ? 127 HIS B ND1  3  
ATOM   5459  C  CD2  . HIS B 2 27  ? 8.143   -9.248  -7.272  1.00 0.00 ? 127 HIS B CD2  3  
ATOM   5460  C  CE1  . HIS B 2 27  ? 9.842   -8.428  -8.388  1.00 0.00 ? 127 HIS B CE1  3  
ATOM   5461  N  NE2  . HIS B 2 27  ? 9.494   -9.006  -7.253  1.00 0.00 ? 127 HIS B NE2  3  
ATOM   5462  H  H    . HIS B 2 27  ? 4.769   -8.274  -10.997 1.00 0.00 ? 127 HIS B H    3  
ATOM   5463  H  HA   . HIS B 2 27  ? 7.081   -9.859  -10.708 1.00 0.00 ? 127 HIS B HA   3  
ATOM   5464  H  HB2  . HIS B 2 27  ? 6.048   -7.787  -9.320  1.00 0.00 ? 127 HIS B HB2  3  
ATOM   5465  H  HB3  . HIS B 2 27  ? 5.605   -9.111  -8.249  1.00 0.00 ? 127 HIS B HB3  3  
ATOM   5466  H  HD1  . HIS B 2 27  ? 8.744   -7.889  -10.028 1.00 0.00 ? 127 HIS B HD1  3  
ATOM   5467  H  HD2  . HIS B 2 27  ? 7.563   -9.711  -6.487  1.00 0.00 ? 127 HIS B HD2  3  
ATOM   5468  H  HE1  . HIS B 2 27  ? 10.840  -8.120  -8.660  1.00 0.00 ? 127 HIS B HE1  3  
ATOM   5469  H  HE2  . HIS B 2 27  ? 10.083  -9.131  -6.480  1.00 0.00 ? 127 HIS B HE2  3  
ATOM   5470  N  N    . LYS B 2 28  ? 4.288   -11.148 -9.539  1.00 0.00 ? 128 LYS B N    3  
ATOM   5471  C  CA   . LYS B 2 28  ? 3.652   -12.390 -9.112  1.00 0.00 ? 128 LYS B CA   3  
ATOM   5472  C  C    . LYS B 2 28  ? 3.037   -13.131 -10.300 1.00 0.00 ? 128 LYS B C    3  
ATOM   5473  O  O    . LYS B 2 28  ? 2.771   -14.329 -10.223 1.00 0.00 ? 128 LYS B O    3  
ATOM   5474  C  CB   . LYS B 2 28  ? 2.575   -12.101 -8.065  1.00 0.00 ? 128 LYS B CB   3  
ATOM   5475  C  CG   . LYS B 2 28  ? 3.059   -11.235 -6.916  1.00 0.00 ? 128 LYS B CG   3  
ATOM   5476  C  CD   . LYS B 2 28  ? 3.832   -12.049 -5.890  1.00 0.00 ? 128 LYS B CD   3  
ATOM   5477  C  CE   . LYS B 2 28  ? 5.332   -11.881 -6.062  1.00 0.00 ? 128 LYS B CE   3  
ATOM   5478  N  NZ   . LYS B 2 28  ? 6.054   -11.962 -4.762  1.00 0.00 ? 128 LYS B NZ   3  
ATOM   5479  H  H    . LYS B 2 28  ? 3.739   -10.341 -9.646  1.00 0.00 ? 128 LYS B H    3  
ATOM   5480  H  HA   . LYS B 2 28  ? 4.413   -13.016 -8.668  1.00 0.00 ? 128 LYS B HA   3  
ATOM   5481  H  HB2  . LYS B 2 28  ? 1.750   -11.596 -8.546  1.00 0.00 ? 128 LYS B HB2  3  
ATOM   5482  H  HB3  . LYS B 2 28  ? 2.224   -13.039 -7.659  1.00 0.00 ? 128 LYS B HB3  3  
ATOM   5483  H  HG2  . LYS B 2 28  ? 3.703   -10.461 -7.307  1.00 0.00 ? 128 LYS B HG2  3  
ATOM   5484  H  HG3  . LYS B 2 28  ? 2.204   -10.783 -6.433  1.00 0.00 ? 128 LYS B HG3  3  
ATOM   5485  H  HD2  . LYS B 2 28  ? 3.554   -11.721 -4.900  1.00 0.00 ? 128 LYS B HD2  3  
ATOM   5486  H  HD3  . LYS B 2 28  ? 3.579   -13.092 -6.010  1.00 0.00 ? 128 LYS B HD3  3  
ATOM   5487  H  HE2  . LYS B 2 28  ? 5.697   -12.660 -6.715  1.00 0.00 ? 128 LYS B HE2  3  
ATOM   5488  H  HE3  . LYS B 2 28  ? 5.525   -10.917 -6.511  1.00 0.00 ? 128 LYS B HE3  3  
ATOM   5489  H  HZ1  . LYS B 2 28  ? 5.840   -11.126 -4.181  1.00 0.00 ? 128 LYS B HZ1  3  
ATOM   5490  H  HZ2  . LYS B 2 28  ? 7.080   -12.004 -4.923  1.00 0.00 ? 128 LYS B HZ2  3  
ATOM   5491  H  HZ3  . LYS B 2 28  ? 5.761   -12.815 -4.244  1.00 0.00 ? 128 LYS B HZ3  3  
ATOM   5492  N  N    . CYS B 2 29  ? 2.811   -12.408 -11.394 1.00 0.00 ? 129 CYS B N    3  
ATOM   5493  C  CA   . CYS B 2 29  ? 2.225   -12.994 -12.594 1.00 0.00 ? 129 CYS B CA   3  
ATOM   5494  C  C    . CYS B 2 29  ? 3.120   -14.093 -13.156 1.00 0.00 ? 129 CYS B C    3  
ATOM   5495  O  O    . CYS B 2 29  ? 2.715   -15.252 -13.237 1.00 0.00 ? 129 CYS B O    3  
ATOM   5496  C  CB   . CYS B 2 29  ? 1.994   -11.914 -13.654 1.00 0.00 ? 129 CYS B CB   3  
ATOM   5497  S  SG   . CYS B 2 29  ? 0.864   -12.411 -14.993 1.00 0.00 ? 129 CYS B SG   3  
ATOM   5498  H  H    . CYS B 2 29  ? 3.042   -11.457 -11.395 1.00 0.00 ? 129 CYS B H    3  
ATOM   5499  H  HA   . CYS B 2 29  ? 1.276   -13.428 -12.321 1.00 0.00 ? 129 CYS B HA   3  
ATOM   5500  H  HB2  . CYS B 2 29  ? 1.573   -11.040 -13.179 1.00 0.00 ? 129 CYS B HB2  3  
ATOM   5501  H  HB3  . CYS B 2 29  ? 2.941   -11.651 -14.101 1.00 0.00 ? 129 CYS B HB3  3  
ATOM   5502  N  N    . GLN B 2 30  ? 4.338   -13.726 -13.537 1.00 0.00 ? 130 GLN B N    3  
ATOM   5503  C  CA   . GLN B 2 30  ? 5.280   -14.695 -14.081 1.00 0.00 ? 130 GLN B CA   3  
ATOM   5504  C  C    . GLN B 2 30  ? 5.665   -15.726 -13.029 1.00 0.00 ? 130 GLN B C    3  
ATOM   5505  O  O    . GLN B 2 30  ? 6.142   -16.815 -13.352 1.00 0.00 ? 130 GLN B O    3  
ATOM   5506  C  CB   . GLN B 2 30  ? 6.528   -13.987 -14.614 1.00 0.00 ? 130 GLN B CB   3  
ATOM   5507  C  CG   . GLN B 2 30  ? 6.514   -13.787 -16.120 1.00 0.00 ? 130 GLN B CG   3  
ATOM   5508  C  CD   . GLN B 2 30  ? 5.514   -12.735 -16.558 1.00 0.00 ? 130 GLN B CD   3  
ATOM   5509  O  OE1  . GLN B 2 30  ? 4.393   -12.679 -16.052 1.00 0.00 ? 130 GLN B OE1  3  
ATOM   5510  N  NE2  . GLN B 2 30  ? 5.916   -11.893 -17.503 1.00 0.00 ? 130 GLN B NE2  3  
ATOM   5511  H  H    . GLN B 2 30  ? 4.610   -12.788 -13.445 1.00 0.00 ? 130 GLN B H    3  
ATOM   5512  H  HA   . GLN B 2 30  ? 4.791   -15.201 -14.891 1.00 0.00 ? 130 GLN B HA   3  
ATOM   5513  H  HB2  . GLN B 2 30  ? 6.606   -13.018 -14.143 1.00 0.00 ? 130 GLN B HB2  3  
ATOM   5514  H  HB3  . GLN B 2 30  ? 7.398   -14.574 -14.357 1.00 0.00 ? 130 GLN B HB3  3  
ATOM   5515  H  HG2  . GLN B 2 30  ? 7.498   -13.481 -16.440 1.00 0.00 ? 130 GLN B HG2  3  
ATOM   5516  H  HG3  . GLN B 2 30  ? 6.258   -14.724 -16.593 1.00 0.00 ? 130 GLN B HG3  3  
ATOM   5517  H  HE21 . GLN B 2 30  ? 6.822   -11.998 -17.860 1.00 0.00 ? 130 GLN B HE21 3  
ATOM   5518  H  HE22 . GLN B 2 30  ? 5.289   -11.203 -17.804 1.00 0.00 ? 130 GLN B HE22 3  
ATOM   5519  N  N    . ARG B 2 31  ? 5.448   -15.373 -11.772 1.00 0.00 ? 131 ARG B N    3  
ATOM   5520  C  CA   . ARG B 2 31  ? 5.762   -16.258 -10.657 1.00 0.00 ? 131 ARG B CA   3  
ATOM   5521  C  C    . ARG B 2 31  ? 4.550   -17.085 -10.241 1.00 0.00 ? 131 ARG B C    3  
ATOM   5522  O  O    . ARG B 2 31  ? 4.658   -17.994 -9.419  1.00 0.00 ? 131 ARG B O    3  
ATOM   5523  C  CB   . ARG B 2 31  ? 6.283   -15.452 -9.466  1.00 0.00 ? 131 ARG B CB   3  
ATOM   5524  C  CG   . ARG B 2 31  ? 6.792   -16.316 -8.323  1.00 0.00 ? 131 ARG B CG   3  
ATOM   5525  C  CD   . ARG B 2 31  ? 8.015   -15.702 -7.662  1.00 0.00 ? 131 ARG B CD   3  
ATOM   5526  N  NE   . ARG B 2 31  ? 9.254   -16.326 -8.119  1.00 0.00 ? 131 ARG B NE   3  
ATOM   5527  C  CZ   . ARG B 2 31  ? 10.458  -15.774 -7.978  1.00 0.00 ? 131 ARG B CZ   3  
ATOM   5528  N  NH1  . ARG B 2 31  ? 10.587  -14.589 -7.396  1.00 0.00 ? 131 ARG B NH1  3  
ATOM   5529  N  NH2  . ARG B 2 31  ? 11.534  -16.411 -8.420  1.00 0.00 ? 131 ARG B NH2  3  
ATOM   5530  H  H    . ARG B 2 31  ? 5.063   -14.494 -11.590 1.00 0.00 ? 131 ARG B H    3  
ATOM   5531  H  HA   . ARG B 2 31  ? 6.528   -16.930 -10.988 1.00 0.00 ? 131 ARG B HA   3  
ATOM   5532  H  HB2  . ARG B 2 31  ? 7.094   -14.822 -9.800  1.00 0.00 ? 131 ARG B HB2  3  
ATOM   5533  H  HB3  . ARG B 2 31  ? 5.485   -14.830 -9.090  1.00 0.00 ? 131 ARG B HB3  3  
ATOM   5534  H  HG2  . ARG B 2 31  ? 6.010   -16.417 -7.585  1.00 0.00 ? 131 ARG B HG2  3  
ATOM   5535  H  HG3  . ARG B 2 31  ? 7.053   -17.291 -8.710  1.00 0.00 ? 131 ARG B HG3  3  
ATOM   5536  H  HD2  . ARG B 2 31  ? 8.046   -14.649 -7.898  1.00 0.00 ? 131 ARG B HD2  3  
ATOM   5537  H  HD3  . ARG B 2 31  ? 7.932   -15.828 -6.592  1.00 0.00 ? 131 ARG B HD3  3  
ATOM   5538  H  HE   . ARG B 2 31  ? 9.187   -17.202 -8.553  1.00 0.00 ? 131 ARG B HE   3  
ATOM   5539  H  HH11 . ARG B 2 31  ? 9.780   -14.104 -7.059  1.00 0.00 ? 131 ARG B HH11 3  
ATOM   5540  H  HH12 . ARG B 2 31  ? 11.495  -14.180 -7.292  1.00 0.00 ? 131 ARG B HH12 3  
ATOM   5541  H  HH21 . ARG B 2 31  ? 11.442  -17.303 -8.859  1.00 0.00 ? 131 ARG B HH21 3  
ATOM   5542  H  HH22 . ARG B 2 31  ? 12.438  -15.995 -8.315  1.00 0.00 ? 131 ARG B HH22 3  
ATOM   5543  N  N    . ARG B 2 32  ? 3.401   -16.761 -10.812 1.00 0.00 ? 132 ARG B N    3  
ATOM   5544  C  CA   . ARG B 2 32  ? 2.164   -17.470 -10.501 1.00 0.00 ? 132 ARG B CA   3  
ATOM   5545  C  C    . ARG B 2 32  ? 2.159   -18.859 -11.133 1.00 0.00 ? 132 ARG B C    3  
ATOM   5546  O  O    . ARG B 2 32  ? 1.632   -19.812 -10.559 1.00 0.00 ? 132 ARG B O    3  
ATOM   5547  C  CB   . ARG B 2 32  ? 0.954   -16.668 -10.988 1.00 0.00 ? 132 ARG B CB   3  
ATOM   5548  C  CG   . ARG B 2 32  ? 0.174   -16.002 -9.866  1.00 0.00 ? 132 ARG B CG   3  
ATOM   5549  C  CD   . ARG B 2 32  ? -0.964  -16.884 -9.379  1.00 0.00 ? 132 ARG B CD   3  
ATOM   5550  N  NE   . ARG B 2 32  ? -2.152  -16.106 -9.040  1.00 0.00 ? 132 ARG B NE   3  
ATOM   5551  C  CZ   . ARG B 2 32  ? -3.308  -16.645 -8.658  1.00 0.00 ? 132 ARG B CZ   3  
ATOM   5552  N  NH1  . ARG B 2 32  ? -3.435  -17.964 -8.565  1.00 0.00 ? 132 ARG B NH1  3  
ATOM   5553  N  NH2  . ARG B 2 32  ? -4.340  -15.865 -8.368  1.00 0.00 ? 132 ARG B NH2  3  
ATOM   5554  H  H    . ARG B 2 32  ? 3.384   -16.028 -11.458 1.00 0.00 ? 132 ARG B H    3  
ATOM   5555  H  HA   . ARG B 2 32  ? 2.105   -17.576 -9.429  1.00 0.00 ? 132 ARG B HA   3  
ATOM   5556  H  HB2  . ARG B 2 32  ? 1.295   -15.899 -11.664 1.00 0.00 ? 132 ARG B HB2  3  
ATOM   5557  H  HB3  . ARG B 2 32  ? 0.285   -17.330 -11.518 1.00 0.00 ? 132 ARG B HB3  3  
ATOM   5558  H  HG2  . ARG B 2 32  ? 0.843   -15.809 -9.041  1.00 0.00 ? 132 ARG B HG2  3  
ATOM   5559  H  HG3  . ARG B 2 32  ? -0.233  -15.070 -10.228 1.00 0.00 ? 132 ARG B HG3  3  
ATOM   5560  H  HD2  . ARG B 2 32  ? -1.217  -17.586 -10.160 1.00 0.00 ? 132 ARG B HD2  3  
ATOM   5561  H  HD3  . ARG B 2 32  ? -0.636  -17.424 -8.504  1.00 0.00 ? 132 ARG B HD3  3  
ATOM   5562  H  HE   . ARG B 2 32  ? -2.086  -15.130 -9.099  1.00 0.00 ? 132 ARG B HE   3  
ATOM   5563  H  HH11 . ARG B 2 32  ? -2.661  -18.558 -8.784  1.00 0.00 ? 132 ARG B HH11 3  
ATOM   5564  H  HH12 . ARG B 2 32  ? -4.305  -18.363 -8.278  1.00 0.00 ? 132 ARG B HH12 3  
ATOM   5565  H  HH21 . ARG B 2 32  ? -4.250  -14.871 -8.434  1.00 0.00 ? 132 ARG B HH21 3  
ATOM   5566  H  HH22 . ARG B 2 32  ? -5.208  -16.270 -8.081  1.00 0.00 ? 132 ARG B HH22 3  
ATOM   5567  N  N    . GLU B 2 33  ? 2.751   -18.966 -12.318 1.00 0.00 ? 133 GLU B N    3  
ATOM   5568  C  CA   . GLU B 2 33  ? 2.815   -20.239 -13.027 1.00 0.00 ? 133 GLU B CA   3  
ATOM   5569  C  C    . GLU B 2 33  ? 3.785   -21.196 -12.341 1.00 0.00 ? 133 GLU B C    3  
ATOM   5570  O  O    . GLU B 2 33  ? 3.583   -22.410 -12.345 1.00 0.00 ? 133 GLU B O    3  
ATOM   5571  C  CB   . GLU B 2 33  ? 3.244   -20.015 -14.479 1.00 0.00 ? 133 GLU B CB   3  
ATOM   5572  C  CG   . GLU B 2 33  ? 2.289   -19.130 -15.265 1.00 0.00 ? 133 GLU B CG   3  
ATOM   5573  C  CD   . GLU B 2 33  ? 2.904   -17.795 -15.638 1.00 0.00 ? 133 GLU B CD   3  
ATOM   5574  O  OE1  . GLU B 2 33  ? 3.800   -17.328 -14.905 1.00 0.00 ? 133 GLU B OE1  3  
ATOM   5575  O  OE2  . GLU B 2 33  ? 2.490   -17.216 -16.664 1.00 0.00 ? 133 GLU B OE2  3  
ATOM   5576  H  H    . GLU B 2 33  ? 3.154   -18.171 -12.724 1.00 0.00 ? 133 GLU B H    3  
ATOM   5577  H  HA   . GLU B 2 33  ? 1.828   -20.675 -13.015 1.00 0.00 ? 133 GLU B HA   3  
ATOM   5578  H  HB2  . GLU B 2 33  ? 4.220   -19.554 -14.487 1.00 0.00 ? 133 GLU B HB2  3  
ATOM   5579  H  HB3  . GLU B 2 33  ? 3.303   -20.972 -14.976 1.00 0.00 ? 133 GLU B HB3  3  
ATOM   5580  H  HG2  . GLU B 2 33  ? 2.006   -19.643 -16.171 1.00 0.00 ? 133 GLU B HG2  3  
ATOM   5581  H  HG3  . GLU B 2 33  ? 1.410   -18.949 -14.664 1.00 0.00 ? 133 GLU B HG3  3  
ATOM   5582  N  N    . GLN B 2 34  ? 4.839   -20.640 -11.752 1.00 0.00 ? 134 GLN B N    3  
ATOM   5583  C  CA   . GLN B 2 34  ? 5.843   -21.444 -11.062 1.00 0.00 ? 134 GLN B CA   3  
ATOM   5584  C  C    . GLN B 2 34  ? 5.208   -22.291 -9.962  1.00 0.00 ? 134 GLN B C    3  
ATOM   5585  O  O    . GLN B 2 34  ? 5.714   -23.361 -9.622  1.00 0.00 ? 134 GLN B O    3  
ATOM   5586  C  CB   . GLN B 2 34  ? 6.924   -20.541 -10.465 1.00 0.00 ? 134 GLN B CB   3  
ATOM   5587  C  CG   . GLN B 2 34  ? 7.659   -19.707 -11.500 1.00 0.00 ? 134 GLN B CG   3  
ATOM   5588  C  CD   . GLN B 2 34  ? 8.459   -20.555 -12.470 1.00 0.00 ? 134 GLN B CD   3  
ATOM   5589  O  OE1  . GLN B 2 34  ? 9.618   -20.883 -12.217 1.00 0.00 ? 134 GLN B OE1  3  
ATOM   5590  N  NE2  . GLN B 2 34  ? 7.841   -20.916 -13.588 1.00 0.00 ? 134 GLN B NE2  3  
ATOM   5591  H  H    . GLN B 2 34  ? 4.945   -19.667 -11.783 1.00 0.00 ? 134 GLN B H    3  
ATOM   5592  H  HA   . GLN B 2 34  ? 6.296   -22.100 -11.788 1.00 0.00 ? 134 GLN B HA   3  
ATOM   5593  H  HB2  . GLN B 2 34  ? 6.464   -19.871 -9.754  1.00 0.00 ? 134 GLN B HB2  3  
ATOM   5594  H  HB3  . GLN B 2 34  ? 7.646   -21.157 -9.950  1.00 0.00 ? 134 GLN B HB3  3  
ATOM   5595  H  HG2  . GLN B 2 34  ? 6.938   -19.131 -12.060 1.00 0.00 ? 134 GLN B HG2  3  
ATOM   5596  H  HG3  . GLN B 2 34  ? 8.335   -19.037 -10.989 1.00 0.00 ? 134 GLN B HG3  3  
ATOM   5597  H  HE21 . GLN B 2 34  ? 6.917   -20.618 -13.723 1.00 0.00 ? 134 GLN B HE21 3  
ATOM   5598  H  HE22 . GLN B 2 34  ? 8.335   -21.465 -14.233 1.00 0.00 ? 134 GLN B HE22 3  
ATOM   5599  N  N    . ALA B 2 35  ? 4.103   -21.806 -9.406  1.00 0.00 ? 135 ALA B N    3  
ATOM   5600  C  CA   . ALA B 2 35  ? 3.407   -22.520 -8.343  1.00 0.00 ? 135 ALA B CA   3  
ATOM   5601  C  C    . ALA B 2 35  ? 2.356   -23.469 -8.909  1.00 0.00 ? 135 ALA B C    3  
ATOM   5602  O  O    . ALA B 2 35  ? 2.118   -24.544 -8.359  1.00 0.00 ? 135 ALA B O    3  
ATOM   5603  C  CB   . ALA B 2 35  ? 2.765   -21.534 -7.379  1.00 0.00 ? 135 ALA B CB   3  
ATOM   5604  H  H    . ALA B 2 35  ? 3.749   -20.946 -9.717  1.00 0.00 ? 135 ALA B H    3  
ATOM   5605  H  HA   . ALA B 2 35  ? 4.138   -23.096 -7.796  1.00 0.00 ? 135 ALA B HA   3  
ATOM   5606  H  HB1  . ALA B 2 35  ? 2.150   -20.839 -7.931  1.00 0.00 ? 135 ALA B HB1  3  
ATOM   5607  H  HB2  . ALA B 2 35  ? 3.536   -20.993 -6.851  1.00 0.00 ? 135 ALA B HB2  3  
ATOM   5608  H  HB3  . ALA B 2 35  ? 2.153   -22.071 -6.669  1.00 0.00 ? 135 ALA B HB3  3  
ATOM   5609  N  N    . ASN B 2 36  ? 1.730   -23.067 -10.009 1.00 0.00 ? 136 ASN B N    3  
ATOM   5610  C  CA   . ASN B 2 36  ? 0.705   -23.885 -10.646 1.00 0.00 ? 136 ASN B CA   3  
ATOM   5611  C  C    . ASN B 2 36  ? 1.255   -24.584 -11.885 1.00 0.00 ? 136 ASN B C    3  
ATOM   5612  O  O    . ASN B 2 36  ? 0.510   -24.890 -12.816 1.00 0.00 ? 136 ASN B O    3  
ATOM   5613  C  CB   . ASN B 2 36  ? -0.502  -23.024 -11.024 1.00 0.00 ? 136 ASN B CB   3  
ATOM   5614  C  CG   . ASN B 2 36  ? -1.562  -23.006 -9.941  1.00 0.00 ? 136 ASN B CG   3  
ATOM   5615  O  OD1  . ASN B 2 36  ? -1.279  -23.278 -8.774  1.00 0.00 ? 136 ASN B OD1  3  
ATOM   5616  N  ND2  . ASN B 2 36  ? -2.792  -22.685 -10.323 1.00 0.00 ? 136 ASN B ND2  3  
ATOM   5617  H  H    . ASN B 2 36  ? 1.963   -22.199 -10.401 1.00 0.00 ? 136 ASN B H    3  
ATOM   5618  H  HA   . ASN B 2 36  ? 0.391   -24.634 -9.934  1.00 0.00 ? 136 ASN B HA   3  
ATOM   5619  H  HB2  . ASN B 2 36  ? -0.173  -22.010 -11.196 1.00 0.00 ? 136 ASN B HB2  3  
ATOM   5620  H  HB3  . ASN B 2 36  ? -0.944  -23.413 -11.929 1.00 0.00 ? 136 ASN B HB3  3  
ATOM   5621  H  HD21 . ASN B 2 36  ? -2.945  -22.480 -11.269 1.00 0.00 ? 136 ASN B HD21 3  
ATOM   5622  H  HD22 . ASN B 2 36  ? -3.498  -22.665 -9.643  1.00 0.00 ? 136 ASN B HD22 3  
ATOM   5623  N  N    . GLY B 2 37  ? 2.562   -24.833 -11.893 1.00 0.00 ? 137 GLY B N    3  
ATOM   5624  C  CA   . GLY B 2 37  ? 3.183   -25.494 -13.028 1.00 0.00 ? 137 GLY B CA   3  
ATOM   5625  C  C    . GLY B 2 37  ? 2.887   -24.795 -14.341 1.00 0.00 ? 137 GLY B C    3  
ATOM   5626  O  O    . GLY B 2 37  ? 2.829   -23.568 -14.398 1.00 0.00 ? 137 GLY B O    3  
ATOM   5627  H  H    . GLY B 2 37  ? 3.107   -24.566 -11.124 1.00 0.00 ? 137 GLY B H    3  
ATOM   5628  H  HA2  . GLY B 2 37  ? 4.253   -25.514 -12.876 1.00 0.00 ? 137 GLY B HA2  3  
ATOM   5629  H  HA3  . GLY B 2 37  ? 2.819   -26.509 -13.082 1.00 0.00 ? 137 GLY B HA3  3  
ATOM   5630  N  N    . GLU B 2 38  ? 2.697   -25.577 -15.398 1.00 0.00 ? 138 GLU B N    3  
ATOM   5631  C  CA   . GLU B 2 38  ? 2.404   -25.022 -16.713 1.00 0.00 ? 138 GLU B CA   3  
ATOM   5632  C  C    . GLU B 2 38  ? 1.018   -24.383 -16.735 1.00 0.00 ? 138 GLU B C    3  
ATOM   5633  O  O    . GLU B 2 38  ? 0.003   -25.079 -16.734 1.00 0.00 ? 138 GLU B O    3  
ATOM   5634  C  CB   . GLU B 2 38  ? 2.492   -26.112 -17.783 1.00 0.00 ? 138 GLU B CB   3  
ATOM   5635  C  CG   . GLU B 2 38  ? 2.284   -25.594 -19.196 1.00 0.00 ? 138 GLU B CG   3  
ATOM   5636  C  CD   . GLU B 2 38  ? 3.572   -25.115 -19.837 1.00 0.00 ? 138 GLU B CD   3  
ATOM   5637  O  OE1  . GLU B 2 38  ? 3.952   -23.949 -19.606 1.00 0.00 ? 138 GLU B OE1  3  
ATOM   5638  O  OE2  . GLU B 2 38  ? 4.201   -25.908 -20.570 1.00 0.00 ? 138 GLU B OE2  3  
ATOM   5639  H  H    . GLU B 2 38  ? 2.754   -26.549 -15.292 1.00 0.00 ? 138 GLU B H    3  
ATOM   5640  H  HA   . GLU B 2 38  ? 3.141   -24.264 -16.922 1.00 0.00 ? 138 GLU B HA   3  
ATOM   5641  H  HB2  . GLU B 2 38  ? 3.468   -26.573 -17.731 1.00 0.00 ? 138 GLU B HB2  3  
ATOM   5642  H  HB3  . GLU B 2 38  ? 1.739   -26.860 -17.582 1.00 0.00 ? 138 GLU B HB3  3  
ATOM   5643  H  HG2  . GLU B 2 38  ? 1.874   -26.390 -19.800 1.00 0.00 ? 138 GLU B HG2  3  
ATOM   5644  H  HG3  . GLU B 2 38  ? 1.587   -24.770 -19.165 1.00 0.00 ? 138 GLU B HG3  3  
ATOM   5645  N  N    . VAL B 2 39  ? 0.985   -23.054 -16.752 1.00 0.00 ? 139 VAL B N    3  
ATOM   5646  C  CA   . VAL B 2 39  ? -0.272  -22.319 -16.769 1.00 0.00 ? 139 VAL B CA   3  
ATOM   5647  C  C    . VAL B 2 39  ? -0.397  -21.478 -18.034 1.00 0.00 ? 139 VAL B C    3  
ATOM   5648  O  O    . VAL B 2 39  ? 0.599   -21.152 -18.678 1.00 0.00 ? 139 VAL B O    3  
ATOM   5649  C  CB   . VAL B 2 39  ? -0.405  -21.397 -15.547 1.00 0.00 ? 139 VAL B CB   3  
ATOM   5650  C  CG1  . VAL B 2 39  ? -1.838  -20.912 -15.396 1.00 0.00 ? 139 VAL B CG1  3  
ATOM   5651  C  CG2  . VAL B 2 39  ? 0.064   -22.103 -14.283 1.00 0.00 ? 139 VAL B CG2  3  
ATOM   5652  H  H    . VAL B 2 39  ? 1.827   -22.554 -16.746 1.00 0.00 ? 139 VAL B H    3  
ATOM   5653  H  HA   . VAL B 2 39  ? -1.079  -23.037 -16.743 1.00 0.00 ? 139 VAL B HA   3  
ATOM   5654  H  HB   . VAL B 2 39  ? 0.226   -20.538 -15.710 1.00 0.00 ? 139 VAL B HB   3  
ATOM   5655  H  HG11 . VAL B 2 39  ? -2.517  -21.720 -15.620 1.00 0.00 ? 139 VAL B HG11 3  
ATOM   5656  H  HG12 . VAL B 2 39  ? -2.015  -20.092 -16.078 1.00 0.00 ? 139 VAL B HG12 3  
ATOM   5657  H  HG13 . VAL B 2 39  ? -1.999  -20.577 -14.381 1.00 0.00 ? 139 VAL B HG13 3  
ATOM   5658  H  HG21 . VAL B 2 39  ? -0.295  -23.121 -14.286 1.00 0.00 ? 139 VAL B HG21 3  
ATOM   5659  H  HG22 . VAL B 2 39  ? -0.324  -21.587 -13.418 1.00 0.00 ? 139 VAL B HG22 3  
ATOM   5660  H  HG23 . VAL B 2 39  ? 1.143   -22.102 -14.249 1.00 0.00 ? 139 VAL B HG23 3  
ATOM   5661  N  N    . ARG B 2 40  ? -1.630  -21.129 -18.379 1.00 0.00 ? 140 ARG B N    3  
ATOM   5662  C  CA   . ARG B 2 40  ? -1.895  -20.324 -19.566 1.00 0.00 ? 140 ARG B CA   3  
ATOM   5663  C  C    . ARG B 2 40  ? -1.294  -18.928 -19.421 1.00 0.00 ? 140 ARG B C    3  
ATOM   5664  O  O    . ARG B 2 40  ? -1.314  -18.344 -18.339 1.00 0.00 ? 140 ARG B O    3  
ATOM   5665  C  CB   . ARG B 2 40  ? -3.401  -20.221 -19.813 1.00 0.00 ? 140 ARG B CB   3  
ATOM   5666  C  CG   . ARG B 2 40  ? -3.759  -19.473 -21.087 1.00 0.00 ? 140 ARG B CG   3  
ATOM   5667  C  CD   . ARG B 2 40  ? -5.081  -19.953 -21.662 1.00 0.00 ? 140 ARG B CD   3  
ATOM   5668  N  NE   . ARG B 2 40  ? -4.952  -21.252 -22.318 1.00 0.00 ? 140 ARG B NE   3  
ATOM   5669  C  CZ   . ARG B 2 40  ? -5.988  -21.984 -22.724 1.00 0.00 ? 140 ARG B CZ   3  
ATOM   5670  N  NH1  . ARG B 2 40  ? -7.228  -21.549 -22.541 1.00 0.00 ? 140 ARG B NH1  3  
ATOM   5671  N  NH2  . ARG B 2 40  ? -5.782  -23.154 -23.313 1.00 0.00 ? 140 ARG B NH2  3  
ATOM   5672  H  H    . ARG B 2 40  ? -2.378  -21.419 -17.820 1.00 0.00 ? 140 ARG B H    3  
ATOM   5673  H  HA   . ARG B 2 40  ? -1.433  -20.816 -20.410 1.00 0.00 ? 140 ARG B HA   3  
ATOM   5674  H  HB2  . ARG B 2 40  ? -3.812  -21.217 -19.879 1.00 0.00 ? 140 ARG B HB2  3  
ATOM   5675  H  HB3  . ARG B 2 40  ? -3.856  -19.708 -18.979 1.00 0.00 ? 140 ARG B HB3  3  
ATOM   5676  H  HG2  . ARG B 2 40  ? -3.837  -18.419 -20.864 1.00 0.00 ? 140 ARG B HG2  3  
ATOM   5677  H  HG3  . ARG B 2 40  ? -2.979  -19.631 -21.817 1.00 0.00 ? 140 ARG B HG3  3  
ATOM   5678  H  HD2  . ARG B 2 40  ? -5.799  -20.037 -20.859 1.00 0.00 ? 140 ARG B HD2  3  
ATOM   5679  H  HD3  . ARG B 2 40  ? -5.431  -19.228 -22.382 1.00 0.00 ? 140 ARG B HD3  3  
ATOM   5680  H  HE   . ARG B 2 40  ? -4.047  -21.596 -22.466 1.00 0.00 ? 140 ARG B HE   3  
ATOM   5681  H  HH11 . ARG B 2 40  ? -7.390  -20.668 -22.097 1.00 0.00 ? 140 ARG B HH11 3  
ATOM   5682  H  HH12 . ARG B 2 40  ? -8.001  -22.103 -22.847 1.00 0.00 ? 140 ARG B HH12 3  
ATOM   5683  H  HH21 . ARG B 2 40  ? -4.849  -23.486 -23.453 1.00 0.00 ? 140 ARG B HH21 3  
ATOM   5684  H  HH22 . ARG B 2 40  ? -6.560  -23.703 -23.617 1.00 0.00 ? 140 ARG B HH22 3  
ATOM   5685  N  N    . GLN B 2 41  ? -0.763  -18.401 -20.519 1.00 0.00 ? 141 GLN B N    3  
ATOM   5686  C  CA   . GLN B 2 41  ? -0.157  -17.075 -20.515 1.00 0.00 ? 141 GLN B CA   3  
ATOM   5687  C  C    . GLN B 2 41  ? -1.225  -15.987 -20.493 1.00 0.00 ? 141 GLN B C    3  
ATOM   5688  O  O    . GLN B 2 41  ? -1.880  -15.728 -21.503 1.00 0.00 ? 141 GLN B O    3  
ATOM   5689  C  CB   . GLN B 2 41  ? 0.741   -16.897 -21.740 1.00 0.00 ? 141 GLN B CB   3  
ATOM   5690  C  CG   . GLN B 2 41  ? 1.726   -18.036 -21.944 1.00 0.00 ? 141 GLN B CG   3  
ATOM   5691  C  CD   . GLN B 2 41  ? 2.785   -18.092 -20.860 1.00 0.00 ? 141 GLN B CD   3  
ATOM   5692  O  OE1  . GLN B 2 41  ? 3.691   -17.258 -20.818 1.00 0.00 ? 141 GLN B OE1  3  
ATOM   5693  N  NE2  . GLN B 2 41  ? 2.677   -19.076 -19.977 1.00 0.00 ? 141 GLN B NE2  3  
ATOM   5694  H  H    . GLN B 2 41  ? -0.778  -18.917 -21.353 1.00 0.00 ? 141 GLN B H    3  
ATOM   5695  H  HA   . GLN B 2 41  ? 0.446   -16.989 -19.624 1.00 0.00 ? 141 GLN B HA   3  
ATOM   5696  H  HB2  . GLN B 2 41  ? 0.119   -16.826 -22.621 1.00 0.00 ? 141 GLN B HB2  3  
ATOM   5697  H  HB3  . GLN B 2 41  ? 1.302   -15.980 -21.632 1.00 0.00 ? 141 GLN B HB3  3  
ATOM   5698  H  HG2  . GLN B 2 41  ? 1.184   -18.970 -21.941 1.00 0.00 ? 141 GLN B HG2  3  
ATOM   5699  H  HG3  . GLN B 2 41  ? 2.215   -17.907 -22.898 1.00 0.00 ? 141 GLN B HG3  3  
ATOM   5700  H  HE21 . GLN B 2 41  ? 1.930   -19.704 -20.073 1.00 0.00 ? 141 GLN B HE21 3  
ATOM   5701  H  HE22 . GLN B 2 41  ? 3.349   -19.136 -19.265 1.00 0.00 ? 141 GLN B HE22 3  
ATOM   5702  N  N    . CYS B 2 42  ? -1.402  -15.360 -19.330 1.00 0.00 ? 142 CYS B N    3  
ATOM   5703  C  CA   . CYS B 2 42  ? -2.389  -14.307 -19.151 1.00 0.00 ? 142 CYS B CA   3  
ATOM   5704  C  C    . CYS B 2 42  ? -2.471  -13.393 -20.374 1.00 0.00 ? 142 CYS B C    3  
ATOM   5705  O  O    . CYS B 2 42  ? -1.451  -12.944 -20.896 1.00 0.00 ? 142 CYS B O    3  
ATOM   5706  C  CB   . CYS B 2 42  ? -2.060  -13.480 -17.907 1.00 0.00 ? 142 CYS B CB   3  
ATOM   5707  S  SG   . CYS B 2 42  ? -0.512  -12.525 -18.031 1.00 0.00 ? 142 CYS B SG   3  
ATOM   5708  H  H    . CYS B 2 42  ? -0.862  -15.620 -18.566 1.00 0.00 ? 142 CYS B H    3  
ATOM   5709  H  HA   . CYS B 2 42  ? -3.335  -14.787 -19.006 1.00 0.00 ? 142 CYS B HA   3  
ATOM   5710  H  HB2  . CYS B 2 42  ? -2.862  -12.781 -17.726 1.00 0.00 ? 142 CYS B HB2  3  
ATOM   5711  H  HB3  . CYS B 2 42  ? -1.971  -14.142 -17.058 1.00 0.00 ? 142 CYS B HB3  3  
ATOM   5712  N  N    . ASN B 2 43  ? -3.692  -13.125 -20.826 1.00 0.00 ? 143 ASN B N    3  
ATOM   5713  C  CA   . ASN B 2 43  ? -3.908  -12.269 -21.986 1.00 0.00 ? 143 ASN B CA   3  
ATOM   5714  C  C    . ASN B 2 43  ? -3.630  -10.806 -21.644 1.00 0.00 ? 143 ASN B C    3  
ATOM   5715  O  O    . ASN B 2 43  ? -4.527  -9.965  -21.692 1.00 0.00 ? 143 ASN B O    3  
ATOM   5716  C  CB   . ASN B 2 43  ? -5.341  -12.424 -22.496 1.00 0.00 ? 143 ASN B CB   3  
ATOM   5717  C  CG   . ASN B 2 43  ? -5.728  -13.876 -22.698 1.00 0.00 ? 143 ASN B CG   3  
ATOM   5718  O  OD1  . ASN B 2 43  ? -6.825  -14.295 -22.326 1.00 0.00 ? 143 ASN B OD1  3  
ATOM   5719  N  ND2  . ASN B 2 43  ? -4.828  -14.652 -23.290 1.00 0.00 ? 143 ASN B ND2  3  
ATOM   5720  H  H    . ASN B 2 43  ? -4.467  -13.514 -20.369 1.00 0.00 ? 143 ASN B H    3  
ATOM   5721  H  HA   . ASN B 2 43  ? -3.223  -12.581 -22.760 1.00 0.00 ? 143 ASN B HA   3  
ATOM   5722  H  HB2  . ASN B 2 43  ? -6.022  -11.985 -21.782 1.00 0.00 ? 143 ASN B HB2  3  
ATOM   5723  H  HB3  . ASN B 2 43  ? -5.437  -11.909 -23.441 1.00 0.00 ? 143 ASN B HB3  3  
ATOM   5724  H  HD21 . ASN B 2 43  ? -3.975  -14.249 -23.559 1.00 0.00 ? 143 ASN B HD21 3  
ATOM   5725  H  HD22 . ASN B 2 43  ? -5.052  -15.596 -23.432 1.00 0.00 ? 143 ASN B HD22 3  
ATOM   5726  N  N    . LEU B 2 44  ? -2.380  -10.512 -21.303 1.00 0.00 ? 144 LEU B N    3  
ATOM   5727  C  CA   . LEU B 2 44  ? -1.979  -9.153  -20.955 1.00 0.00 ? 144 LEU B CA   3  
ATOM   5728  C  C    . LEU B 2 44  ? -0.541  -8.883  -21.393 1.00 0.00 ? 144 LEU B C    3  
ATOM   5729  O  O    . LEU B 2 44  ? 0.406   -9.281  -20.713 1.00 0.00 ? 144 LEU B O    3  
ATOM   5730  C  CB   . LEU B 2 44  ? -2.108  -8.930  -19.447 1.00 0.00 ? 144 LEU B CB   3  
ATOM   5731  C  CG   . LEU B 2 44  ? -3.543  -8.878  -18.913 1.00 0.00 ? 144 LEU B CG   3  
ATOM   5732  C  CD1  . LEU B 2 44  ? -3.804  -10.037 -17.964 1.00 0.00 ? 144 LEU B CD1  3  
ATOM   5733  C  CD2  . LEU B 2 44  ? -3.806  -7.549  -18.216 1.00 0.00 ? 144 LEU B CD2  3  
ATOM   5734  H  H    . LEU B 2 44  ? -1.708  -11.225 -21.285 1.00 0.00 ? 144 LEU B H    3  
ATOM   5735  H  HA   . LEU B 2 44  ? -2.639  -8.471  -21.469 1.00 0.00 ? 144 LEU B HA   3  
ATOM   5736  H  HB2  . LEU B 2 44  ? -1.586  -9.730  -18.943 1.00 0.00 ? 144 LEU B HB2  3  
ATOM   5737  H  HB3  . LEU B 2 44  ? -1.622  -7.996  -19.203 1.00 0.00 ? 144 LEU B HB3  3  
ATOM   5738  H  HG   . LEU B 2 44  ? -4.232  -8.963  -19.742 1.00 0.00 ? 144 LEU B HG   3  
ATOM   5739  H  HD11 . LEU B 2 44  ? -3.276  -9.868  -17.036 1.00 0.00 ? 144 LEU B HD11 3  
ATOM   5740  H  HD12 . LEU B 2 44  ? -3.455  -10.955 -18.414 1.00 0.00 ? 144 LEU B HD12 3  
ATOM   5741  H  HD13 . LEU B 2 44  ? -4.863  -10.112 -17.768 1.00 0.00 ? 144 LEU B HD13 3  
ATOM   5742  H  HD21 . LEU B 2 44  ? -3.924  -6.772  -18.956 1.00 0.00 ? 144 LEU B HD21 3  
ATOM   5743  H  HD22 . LEU B 2 44  ? -2.973  -7.309  -17.573 1.00 0.00 ? 144 LEU B HD22 3  
ATOM   5744  H  HD23 . LEU B 2 44  ? -4.707  -7.625  -17.625 1.00 0.00 ? 144 LEU B HD23 3  
ATOM   5745  N  N    . PRO B 2 45  ? -0.352  -8.198  -22.536 1.00 0.00 ? 145 PRO B N    3  
ATOM   5746  C  CA   . PRO B 2 45  ? 0.986   -7.881  -23.049 1.00 0.00 ? 145 PRO B CA   3  
ATOM   5747  C  C    . PRO B 2 45  ? 1.719   -6.870  -22.173 1.00 0.00 ? 145 PRO B C    3  
ATOM   5748  O  O    . PRO B 2 45  ? 2.947   -6.784  -22.204 1.00 0.00 ? 145 PRO B O    3  
ATOM   5749  C  CB   . PRO B 2 45  ? 0.707   -7.289  -24.432 1.00 0.00 ? 145 PRO B CB   3  
ATOM   5750  C  CG   . PRO B 2 45  ? -0.684  -6.760  -24.347 1.00 0.00 ? 145 PRO B CG   3  
ATOM   5751  C  CD   . PRO B 2 45  ? -1.419  -7.681  -23.413 1.00 0.00 ? 145 PRO B CD   3  
ATOM   5752  H  HA   . PRO B 2 45  ? 1.589   -8.771  -23.151 1.00 0.00 ? 145 PRO B HA   3  
ATOM   5753  H  HB2  . PRO B 2 45  ? 1.417   -6.502  -24.640 1.00 0.00 ? 145 PRO B HB2  3  
ATOM   5754  H  HB3  . PRO B 2 45  ? 0.789   -8.061  -25.182 1.00 0.00 ? 145 PRO B HB3  3  
ATOM   5755  H  HG2  . PRO B 2 45  ? -0.671  -5.755  -23.952 1.00 0.00 ? 145 PRO B HG2  3  
ATOM   5756  H  HG3  . PRO B 2 45  ? -1.142  -6.774  -25.325 1.00 0.00 ? 145 PRO B HG3  3  
ATOM   5757  H  HD2  . PRO B 2 45  ? -2.154  -7.131  -22.844 1.00 0.00 ? 145 PRO B HD2  3  
ATOM   5758  H  HD3  . PRO B 2 45  ? -1.887  -8.483  -23.964 1.00 0.00 ? 145 PRO B HD3  3  
ATOM   5759  N  N    . HIS B 2 46  ? 0.960   -6.104  -21.396 1.00 0.00 ? 146 HIS B N    3  
ATOM   5760  C  CA   . HIS B 2 46  ? 1.539   -5.096  -20.513 1.00 0.00 ? 146 HIS B CA   3  
ATOM   5761  C  C    . HIS B 2 46  ? 2.414   -5.741  -19.442 1.00 0.00 ? 146 HIS B C    3  
ATOM   5762  O  O    . HIS B 2 46  ? 3.506   -5.257  -19.143 1.00 0.00 ? 146 HIS B O    3  
ATOM   5763  C  CB   . HIS B 2 46  ? 0.432   -4.272  -19.854 1.00 0.00 ? 146 HIS B CB   3  
ATOM   5764  C  CG   . HIS B 2 46  ? -0.095  -3.173  -20.724 1.00 0.00 ? 146 HIS B CG   3  
ATOM   5765  N  ND1  . HIS B 2 46  ? -0.378  -3.343  -22.063 1.00 0.00 ? 146 HIS B ND1  3  
ATOM   5766  C  CD2  . HIS B 2 46  ? -0.393  -1.884  -20.439 1.00 0.00 ? 146 HIS B CD2  3  
ATOM   5767  C  CE1  . HIS B 2 46  ? -0.826  -2.206  -22.563 1.00 0.00 ? 146 HIS B CE1  3  
ATOM   5768  N  NE2  . HIS B 2 46  ? -0.845  -1.305  -21.599 1.00 0.00 ? 146 HIS B NE2  3  
ATOM   5769  H  H    . HIS B 2 46  ? -0.012  -6.217  -21.416 1.00 0.00 ? 146 HIS B H    3  
ATOM   5770  H  HA   . HIS B 2 46  ? 2.151   -4.442  -21.115 1.00 0.00 ? 146 HIS B HA   3  
ATOM   5771  H  HB2  . HIS B 2 46  ? -0.392  -4.924  -19.606 1.00 0.00 ? 146 HIS B HB2  3  
ATOM   5772  H  HB3  . HIS B 2 46  ? 0.817   -3.826  -18.950 1.00 0.00 ? 146 HIS B HB3  3  
ATOM   5773  H  HD1  . HIS B 2 46  ? -0.267  -4.173  -22.571 1.00 0.00 ? 146 HIS B HD1  3  
ATOM   5774  H  HD2  . HIS B 2 46  ? -0.293  -1.401  -19.477 1.00 0.00 ? 146 HIS B HD2  3  
ATOM   5775  H  HE1  . HIS B 2 46  ? -1.125  -2.041  -23.588 1.00 0.00 ? 146 HIS B HE1  3  
ATOM   5776  H  HE2  . HIS B 2 46  ? -1.218  -0.403  -21.677 1.00 0.00 ? 146 HIS B HE2  3  
ATOM   5777  N  N    . CYS B 2 47  ? 1.929   -6.837  -18.867 1.00 0.00 ? 147 CYS B N    3  
ATOM   5778  C  CA   . CYS B 2 47  ? 2.669   -7.548  -17.830 1.00 0.00 ? 147 CYS B CA   3  
ATOM   5779  C  C    . CYS B 2 47  ? 4.045   -7.957  -18.341 1.00 0.00 ? 147 CYS B C    3  
ATOM   5780  O  O    . CYS B 2 47  ? 5.071   -7.509  -17.828 1.00 0.00 ? 147 CYS B O    3  
ATOM   5781  C  CB   . CYS B 2 47  ? 1.897   -8.787  -17.370 1.00 0.00 ? 147 CYS B CB   3  
ATOM   5782  S  SG   . CYS B 2 47  ? 0.095   -8.551  -17.227 1.00 0.00 ? 147 CYS B SG   3  
ATOM   5783  H  H    . CYS B 2 47  ? 1.056   -7.176  -19.147 1.00 0.00 ? 147 CYS B H    3  
ATOM   5784  H  HA   . CYS B 2 47  ? 2.793   -6.878  -16.992 1.00 0.00 ? 147 CYS B HA   3  
ATOM   5785  H  HB2  . CYS B 2 47  ? 2.065   -9.586  -18.070 1.00 0.00 ? 147 CYS B HB2  3  
ATOM   5786  H  HB3  . CYS B 2 47  ? 2.265   -9.084  -16.405 1.00 0.00 ? 147 CYS B HB3  3  
ATOM   5787  N  N    . ARG B 2 48  ? 4.055   -8.807  -19.363 1.00 0.00 ? 148 ARG B N    3  
ATOM   5788  C  CA   . ARG B 2 48  ? 5.302   -9.279  -19.959 1.00 0.00 ? 148 ARG B CA   3  
ATOM   5789  C  C    . ARG B 2 48  ? 6.252   -8.111  -20.213 1.00 0.00 ? 148 ARG B C    3  
ATOM   5790  O  O    . ARG B 2 48  ? 7.465   -8.233  -20.034 1.00 0.00 ? 148 ARG B O    3  
ATOM   5791  C  CB   . ARG B 2 48  ? 5.019   -10.016 -21.269 1.00 0.00 ? 148 ARG B CB   3  
ATOM   5792  C  CG   . ARG B 2 48  ? 4.153   -11.254 -21.095 1.00 0.00 ? 148 ARG B CG   3  
ATOM   5793  C  CD   . ARG B 2 48  ? 4.032   -12.035 -22.392 1.00 0.00 ? 148 ARG B CD   3  
ATOM   5794  N  NE   . ARG B 2 48  ? 5.327   -12.523 -22.861 1.00 0.00 ? 148 ARG B NE   3  
ATOM   5795  C  CZ   . ARG B 2 48  ? 5.558   -12.931 -24.107 1.00 0.00 ? 148 ARG B CZ   3  
ATOM   5796  N  NH1  . ARG B 2 48  ? 4.587   -12.909 -25.012 1.00 0.00 ? 148 ARG B NH1  3  
ATOM   5797  N  NH2  . ARG B 2 48  ? 6.764   -13.361 -24.449 1.00 0.00 ? 148 ARG B NH2  3  
ATOM   5798  H  H    . ARG B 2 48  ? 3.202   -9.123  -19.726 1.00 0.00 ? 148 ARG B H    3  
ATOM   5799  H  HA   . ARG B 2 48  ? 5.765   -9.961  -19.264 1.00 0.00 ? 148 ARG B HA   3  
ATOM   5800  H  HB2  . ARG B 2 48  ? 4.515   -9.343  -21.947 1.00 0.00 ? 148 ARG B HB2  3  
ATOM   5801  H  HB3  . ARG B 2 48  ? 5.957   -10.320 -21.708 1.00 0.00 ? 148 ARG B HB3  3  
ATOM   5802  H  HG2  . ARG B 2 48  ? 4.597   -11.890 -20.343 1.00 0.00 ? 148 ARG B HG2  3  
ATOM   5803  H  HG3  . ARG B 2 48  ? 3.168   -10.949 -20.774 1.00 0.00 ? 148 ARG B HG3  3  
ATOM   5804  H  HD2  . ARG B 2 48  ? 3.377   -12.879 -22.229 1.00 0.00 ? 148 ARG B HD2  3  
ATOM   5805  H  HD3  . ARG B 2 48  ? 3.605   -11.392 -23.147 1.00 0.00 ? 148 ARG B HD3  3  
ATOM   5806  H  HE   . ARG B 2 48  ? 6.062   -12.549 -22.213 1.00 0.00 ? 148 ARG B HE   3  
ATOM   5807  H  HH11 . ARG B 2 48  ? 3.675   -12.584 -24.760 1.00 0.00 ? 148 ARG B HH11 3  
ATOM   5808  H  HH12 . ARG B 2 48  ? 4.767   -13.216 -25.945 1.00 0.00 ? 148 ARG B HH12 3  
ATOM   5809  H  HH21 . ARG B 2 48  ? 7.500   -13.379 -23.771 1.00 0.00 ? 148 ARG B HH21 3  
ATOM   5810  H  HH22 . ARG B 2 48  ? 6.939   -13.668 -25.385 1.00 0.00 ? 148 ARG B HH22 3  
ATOM   5811  N  N    . THR B 2 49  ? 5.689   -6.976  -20.619 1.00 0.00 ? 149 THR B N    3  
ATOM   5812  C  CA   . THR B 2 49  ? 6.485   -5.784  -20.881 1.00 0.00 ? 149 THR B CA   3  
ATOM   5813  C  C    . THR B 2 49  ? 7.255   -5.382  -19.629 1.00 0.00 ? 149 THR B C    3  
ATOM   5814  O  O    . THR B 2 49  ? 8.425   -5.004  -19.701 1.00 0.00 ? 149 THR B O    3  
ATOM   5815  C  CB   . THR B 2 49  ? 5.591   -4.631  -21.340 1.00 0.00 ? 149 THR B CB   3  
ATOM   5816  O  OG1  . THR B 2 49  ? 4.724   -5.052  -22.378 1.00 0.00 ? 149 THR B OG1  3  
ATOM   5817  C  CG2  . THR B 2 49  ? 6.368   -3.436  -21.848 1.00 0.00 ? 149 THR B CG2  3  
ATOM   5818  H  H    . THR B 2 49  ? 4.717   -6.937  -20.734 1.00 0.00 ? 149 THR B H    3  
ATOM   5819  H  HA   . THR B 2 49  ? 7.192   -6.019  -21.664 1.00 0.00 ? 149 THR B HA   3  
ATOM   5820  H  HB   . THR B 2 49  ? 4.988   -4.303  -20.506 1.00 0.00 ? 149 THR B HB   3  
ATOM   5821  H  HG1  . THR B 2 49  ? 4.055   -4.381  -22.529 1.00 0.00 ? 149 THR B HG1  3  
ATOM   5822  H  HG21 . THR B 2 49  ? 5.704   -2.590  -21.947 1.00 0.00 ? 149 THR B HG21 3  
ATOM   5823  H  HG22 . THR B 2 49  ? 6.800   -3.670  -22.811 1.00 0.00 ? 149 THR B HG22 3  
ATOM   5824  H  HG23 . THR B 2 49  ? 7.156   -3.195  -21.149 1.00 0.00 ? 149 THR B HG23 3  
ATOM   5825  N  N    . MET B 2 50  ? 6.594   -5.479  -18.479 1.00 0.00 ? 150 MET B N    3  
ATOM   5826  C  CA   . MET B 2 50  ? 7.226   -5.140  -17.211 1.00 0.00 ? 150 MET B CA   3  
ATOM   5827  C  C    . MET B 2 50  ? 8.421   -6.044  -16.966 1.00 0.00 ? 150 MET B C    3  
ATOM   5828  O  O    . MET B 2 50  ? 9.491   -5.575  -16.587 1.00 0.00 ? 150 MET B O    3  
ATOM   5829  C  CB   . MET B 2 50  ? 6.224   -5.255  -16.058 1.00 0.00 ? 150 MET B CB   3  
ATOM   5830  C  CG   . MET B 2 50  ? 5.729   -3.912  -15.546 1.00 0.00 ? 150 MET B CG   3  
ATOM   5831  S  SD   . MET B 2 50  ? 4.755   -3.018  -16.772 1.00 0.00 ? 150 MET B SD   3  
ATOM   5832  C  CE   . MET B 2 50  ? 5.674   -1.484  -16.880 1.00 0.00 ? 150 MET B CE   3  
ATOM   5833  H  H    . MET B 2 50  ? 5.666   -5.795  -18.483 1.00 0.00 ? 150 MET B H    3  
ATOM   5834  H  HA   . MET B 2 50  ? 7.579   -4.121  -17.278 1.00 0.00 ? 150 MET B HA   3  
ATOM   5835  H  HB2  . MET B 2 50  ? 5.370   -5.824  -16.394 1.00 0.00 ? 150 MET B HB2  3  
ATOM   5836  H  HB3  . MET B 2 50  ? 6.693   -5.777  -15.238 1.00 0.00 ? 150 MET B HB3  3  
ATOM   5837  H  HG2  . MET B 2 50  ? 5.115   -4.079  -14.674 1.00 0.00 ? 150 MET B HG2  3  
ATOM   5838  H  HG3  . MET B 2 50  ? 6.583   -3.309  -15.274 1.00 0.00 ? 150 MET B HG3  3  
ATOM   5839  H  HE1  . MET B 2 50  ? 5.538   -0.919  -15.969 1.00 0.00 ? 150 MET B HE1  3  
ATOM   5840  H  HE2  . MET B 2 50  ? 5.315   -0.908  -17.719 1.00 0.00 ? 150 MET B HE2  3  
ATOM   5841  H  HE3  . MET B 2 50  ? 6.723   -1.702  -17.015 1.00 0.00 ? 150 MET B HE3  3  
ATOM   5842  N  N    . LYS B 2 51  ? 8.250   -7.339  -17.213 1.00 0.00 ? 151 LYS B N    3  
ATOM   5843  C  CA   . LYS B 2 51  ? 9.348   -8.282  -17.042 1.00 0.00 ? 151 LYS B CA   3  
ATOM   5844  C  C    . LYS B 2 51  ? 10.553  -7.789  -17.829 1.00 0.00 ? 151 LYS B C    3  
ATOM   5845  O  O    . LYS B 2 51  ? 11.699  -7.928  -17.402 1.00 0.00 ? 151 LYS B O    3  
ATOM   5846  C  CB   . LYS B 2 51  ? 8.940   -9.677  -17.519 1.00 0.00 ? 151 LYS B CB   3  
ATOM   5847  C  CG   . LYS B 2 51  ? 8.993   -10.727 -16.424 1.00 0.00 ? 151 LYS B CG   3  
ATOM   5848  C  CD   . LYS B 2 51  ? 8.088   -10.354 -15.261 1.00 0.00 ? 151 LYS B CD   3  
ATOM   5849  C  CE   . LYS B 2 51  ? 8.441   -11.124 -13.993 1.00 0.00 ? 151 LYS B CE   3  
ATOM   5850  N  NZ   . LYS B 2 51  ? 9.182   -12.386 -14.277 1.00 0.00 ? 151 LYS B NZ   3  
ATOM   5851  H  H    . LYS B 2 51  ? 7.381   -7.660  -17.535 1.00 0.00 ? 151 LYS B H    3  
ATOM   5852  H  HA   . LYS B 2 51  ? 9.601   -8.319  -15.994 1.00 0.00 ? 151 LYS B HA   3  
ATOM   5853  H  HB2  . LYS B 2 51  ? 7.930   -9.635  -17.900 1.00 0.00 ? 151 LYS B HB2  3  
ATOM   5854  H  HB3  . LYS B 2 51  ? 9.604   -9.984  -18.315 1.00 0.00 ? 151 LYS B HB3  3  
ATOM   5855  H  HG2  . LYS B 2 51  ? 8.670   -11.674 -16.831 1.00 0.00 ? 151 LYS B HG2  3  
ATOM   5856  H  HG3  . LYS B 2 51  ? 10.009  -10.812 -16.067 1.00 0.00 ? 151 LYS B HG3  3  
ATOM   5857  H  HD2  . LYS B 2 51  ? 8.190   -9.299  -15.065 1.00 0.00 ? 151 LYS B HD2  3  
ATOM   5858  H  HD3  . LYS B 2 51  ? 7.067   -10.573 -15.533 1.00 0.00 ? 151 LYS B HD3  3  
ATOM   5859  H  HE2  . LYS B 2 51  ? 9.055   -10.494 -13.366 1.00 0.00 ? 151 LYS B HE2  3  
ATOM   5860  H  HE3  . LYS B 2 51  ? 7.528   -11.365 -13.469 1.00 0.00 ? 151 LYS B HE3  3  
ATOM   5861  H  HZ1  . LYS B 2 51  ? 10.190  -12.180 -14.436 1.00 0.00 ? 151 LYS B HZ1  3  
ATOM   5862  H  HZ2  . LYS B 2 51  ? 8.796   -12.844 -15.126 1.00 0.00 ? 151 LYS B HZ2  3  
ATOM   5863  H  HZ3  . LYS B 2 51  ? 9.094   -13.040 -13.475 1.00 0.00 ? 151 LYS B HZ3  3  
ATOM   5864  N  N    . ASN B 2 52  ? 10.265  -7.187  -18.978 1.00 0.00 ? 152 ASN B N    3  
ATOM   5865  C  CA   . ASN B 2 52  ? 11.294  -6.636  -19.841 1.00 0.00 ? 152 ASN B CA   3  
ATOM   5866  C  C    . ASN B 2 52  ? 11.832  -5.333  -19.255 1.00 0.00 ? 152 ASN B C    3  
ATOM   5867  O  O    . ASN B 2 52  ? 13.042  -5.107  -19.222 1.00 0.00 ? 152 ASN B O    3  
ATOM   5868  C  CB   . ASN B 2 52  ? 10.732  -6.388  -21.243 1.00 0.00 ? 152 ASN B CB   3  
ATOM   5869  C  CG   . ASN B 2 52  ? 11.715  -6.764  -22.335 1.00 0.00 ? 152 ASN B CG   3  
ATOM   5870  O  OD1  . ASN B 2 52  ? 11.341  -7.373  -23.337 1.00 0.00 ? 152 ASN B OD1  3  
ATOM   5871  N  ND2  . ASN B 2 52  ? 12.978  -6.400  -22.145 1.00 0.00 ? 152 ASN B ND2  3  
ATOM   5872  H  H    . ASN B 2 52  ? 9.327   -7.102  -19.244 1.00 0.00 ? 152 ASN B H    3  
ATOM   5873  H  HA   . ASN B 2 52  ? 12.096  -7.353  -19.902 1.00 0.00 ? 152 ASN B HA   3  
ATOM   5874  H  HB2  . ASN B 2 52  ? 9.836   -6.976  -21.372 1.00 0.00 ? 152 ASN B HB2  3  
ATOM   5875  H  HB3  . ASN B 2 52  ? 10.488  -5.341  -21.346 1.00 0.00 ? 152 ASN B HB3  3  
ATOM   5876  H  HD21 . ASN B 2 52  ? 13.202  -5.917  -21.323 1.00 0.00 ? 152 ASN B HD21 3  
ATOM   5877  H  HD22 . ASN B 2 52  ? 13.634  -6.630  -22.836 1.00 0.00 ? 152 ASN B HD22 3  
ATOM   5878  N  N    . VAL B 2 53  ? 10.922  -4.482  -18.783 1.00 0.00 ? 153 VAL B N    3  
ATOM   5879  C  CA   . VAL B 2 53  ? 11.310  -3.211  -18.189 1.00 0.00 ? 153 VAL B CA   3  
ATOM   5880  C  C    . VAL B 2 53  ? 12.049  -3.438  -16.879 1.00 0.00 ? 153 VAL B C    3  
ATOM   5881  O  O    . VAL B 2 53  ? 12.951  -2.683  -16.519 1.00 0.00 ? 153 VAL B O    3  
ATOM   5882  C  CB   . VAL B 2 53  ? 10.088  -2.308  -17.935 1.00 0.00 ? 153 VAL B CB   3  
ATOM   5883  C  CG1  . VAL B 2 53  ? 10.522  -0.956  -17.388 1.00 0.00 ? 153 VAL B CG1  3  
ATOM   5884  C  CG2  . VAL B 2 53  ? 9.275   -2.138  -19.210 1.00 0.00 ? 153 VAL B CG2  3  
ATOM   5885  H  H    . VAL B 2 53  ? 9.969   -4.721  -18.827 1.00 0.00 ? 153 VAL B H    3  
ATOM   5886  H  HA   . VAL B 2 53  ? 11.970  -2.707  -18.880 1.00 0.00 ? 153 VAL B HA   3  
ATOM   5887  H  HB   . VAL B 2 53  ? 9.461   -2.785  -17.195 1.00 0.00 ? 153 VAL B HB   3  
ATOM   5888  H  HG11 . VAL B 2 53  ? 9.719   -0.244  -17.508 1.00 0.00 ? 153 VAL B HG11 3  
ATOM   5889  H  HG12 . VAL B 2 53  ? 11.392  -0.612  -17.928 1.00 0.00 ? 153 VAL B HG12 3  
ATOM   5890  H  HG13 . VAL B 2 53  ? 10.764  -1.052  -16.340 1.00 0.00 ? 153 VAL B HG13 3  
ATOM   5891  H  HG21 . VAL B 2 53  ? 9.551   -1.212  -19.692 1.00 0.00 ? 153 VAL B HG21 3  
ATOM   5892  H  HG22 . VAL B 2 53  ? 8.223   -2.117  -18.966 1.00 0.00 ? 153 VAL B HG22 3  
ATOM   5893  H  HG23 . VAL B 2 53  ? 9.474   -2.964  -19.876 1.00 0.00 ? 153 VAL B HG23 3  
ATOM   5894  N  N    . LEU B 2 54  ? 11.663  -4.492  -16.172 1.00 0.00 ? 154 LEU B N    3  
ATOM   5895  C  CA   . LEU B 2 54  ? 12.279  -4.838  -14.917 1.00 0.00 ? 154 LEU B CA   3  
ATOM   5896  C  C    . LEU B 2 54  ? 13.726  -5.253  -15.136 1.00 0.00 ? 154 LEU B C    3  
ATOM   5897  O  O    . LEU B 2 54  ? 14.619  -4.857  -14.387 1.00 0.00 ? 154 LEU B O    3  
ATOM   5898  C  CB   . LEU B 2 54  ? 11.484  -5.969  -14.278 1.00 0.00 ? 154 LEU B CB   3  
ATOM   5899  C  CG   . LEU B 2 54  ? 10.403  -5.527  -13.293 1.00 0.00 ? 154 LEU B CG   3  
ATOM   5900  C  CD1  . LEU B 2 54  ? 9.398   -6.646  -13.068 1.00 0.00 ? 154 LEU B CD1  3  
ATOM   5901  C  CD2  . LEU B 2 54  ? 11.025  -5.093  -11.974 1.00 0.00 ? 154 LEU B CD2  3  
ATOM   5902  H  H    . LEU B 2 54  ? 10.942  -5.061  -16.505 1.00 0.00 ? 154 LEU B H    3  
ATOM   5903  H  HA   . LEU B 2 54  ? 12.255  -3.974  -14.279 1.00 0.00 ? 154 LEU B HA   3  
ATOM   5904  H  HB2  . LEU B 2 54  ? 11.009  -6.532  -15.069 1.00 0.00 ? 154 LEU B HB2  3  
ATOM   5905  H  HB3  . LEU B 2 54  ? 12.167  -6.613  -13.773 1.00 0.00 ? 154 LEU B HB3  3  
ATOM   5906  H  HG   . LEU B 2 54  ? 9.875   -4.683  -13.711 1.00 0.00 ? 154 LEU B HG   3  
ATOM   5907  H  HD11 . LEU B 2 54  ? 9.180   -7.128  -14.010 1.00 0.00 ? 154 LEU B HD11 3  
ATOM   5908  H  HD12 . LEU B 2 54  ? 8.488   -6.236  -12.655 1.00 0.00 ? 154 LEU B HD12 3  
ATOM   5909  H  HD13 . LEU B 2 54  ? 9.811   -7.370  -12.380 1.00 0.00 ? 154 LEU B HD13 3  
ATOM   5910  H  HD21 . LEU B 2 54  ? 12.016  -5.511  -11.888 1.00 0.00 ? 154 LEU B HD21 3  
ATOM   5911  H  HD22 . LEU B 2 54  ? 10.415  -5.443  -11.154 1.00 0.00 ? 154 LEU B HD22 3  
ATOM   5912  H  HD23 . LEU B 2 54  ? 11.085  -4.015  -11.943 1.00 0.00 ? 154 LEU B HD23 3  
ATOM   5913  N  N    . ASN B 2 55  ? 13.949  -6.037  -16.183 1.00 0.00 ? 155 ASN B N    3  
ATOM   5914  C  CA   . ASN B 2 55  ? 15.291  -6.491  -16.524 1.00 0.00 ? 155 ASN B CA   3  
ATOM   5915  C  C    . ASN B 2 55  ? 16.174  -5.289  -16.829 1.00 0.00 ? 155 ASN B C    3  
ATOM   5916  O  O    . ASN B 2 55  ? 17.358  -5.265  -16.490 1.00 0.00 ? 155 ASN B O    3  
ATOM   5917  C  CB   . ASN B 2 55  ? 15.246  -7.437  -17.727 1.00 0.00 ? 155 ASN B CB   3  
ATOM   5918  C  CG   . ASN B 2 55  ? 15.622  -8.858  -17.359 1.00 0.00 ? 155 ASN B CG   3  
ATOM   5919  O  OD1  . ASN B 2 55  ? 15.034  -9.454  -16.457 1.00 0.00 ? 155 ASN B OD1  3  
ATOM   5920  N  ND2  . ASN B 2 55  ? 16.608  -9.409  -18.057 1.00 0.00 ? 155 ASN B ND2  3  
ATOM   5921  H  H    . ASN B 2 55  ? 13.194  -6.301  -16.746 1.00 0.00 ? 155 ASN B H    3  
ATOM   5922  H  HA   . ASN B 2 55  ? 15.693  -7.018  -15.672 1.00 0.00 ? 155 ASN B HA   3  
ATOM   5923  H  HB2  . ASN B 2 55  ? 14.247  -7.444  -18.135 1.00 0.00 ? 155 ASN B HB2  3  
ATOM   5924  H  HB3  . ASN B 2 55  ? 15.936  -7.085  -18.482 1.00 0.00 ? 155 ASN B HB3  3  
ATOM   5925  H  HD21 . ASN B 2 55  ? 17.031  -8.876  -18.761 1.00 0.00 ? 155 ASN B HD21 3  
ATOM   5926  H  HD22 . ASN B 2 55  ? 16.871  -10.329 -17.840 1.00 0.00 ? 155 ASN B HD22 3  
ATOM   5927  N  N    . HIS B 2 56  ? 15.572  -4.282  -17.453 1.00 0.00 ? 156 HIS B N    3  
ATOM   5928  C  CA   . HIS B 2 56  ? 16.272  -3.052  -17.793 1.00 0.00 ? 156 HIS B CA   3  
ATOM   5929  C  C    . HIS B 2 56  ? 16.772  -2.374  -16.532 1.00 0.00 ? 156 HIS B C    3  
ATOM   5930  O  O    . HIS B 2 56  ? 17.973  -2.222  -16.316 1.00 0.00 ? 156 HIS B O    3  
ATOM   5931  C  CB   . HIS B 2 56  ? 15.317  -2.108  -18.522 1.00 0.00 ? 156 HIS B CB   3  
ATOM   5932  C  CG   . HIS B 2 56  ? 15.860  -0.729  -18.753 1.00 0.00 ? 156 HIS B CG   3  
ATOM   5933  N  ND1  . HIS B 2 56  ? 17.158  -0.352  -18.481 1.00 0.00 ? 156 HIS B ND1  3  
ATOM   5934  C  CD2  . HIS B 2 56  ? 15.237  0.384   -19.216 1.00 0.00 ? 156 HIS B CD2  3  
ATOM   5935  C  CE1  . HIS B 2 56  ? 17.276  0.949   -18.776 1.00 0.00 ? 156 HIS B CE1  3  
ATOM   5936  N  NE2  . HIS B 2 56  ? 16.141  1.442   -19.226 1.00 0.00 ? 156 HIS B NE2  3  
ATOM   5937  H  H    . HIS B 2 56  ? 14.620  -4.363  -17.677 1.00 0.00 ? 156 HIS B H    3  
ATOM   5938  H  HA   . HIS B 2 56  ? 17.106  -3.291  -18.434 1.00 0.00 ? 156 HIS B HA   3  
ATOM   5939  H  HB2  . HIS B 2 56  ? 15.068  -2.530  -19.472 1.00 0.00 ? 156 HIS B HB2  3  
ATOM   5940  H  HB3  . HIS B 2 56  ? 14.414  -2.010  -17.939 1.00 0.00 ? 156 HIS B HB3  3  
ATOM   5941  H  HD1  . HIS B 2 56  ? 17.870  -0.933  -18.141 1.00 0.00 ? 156 HIS B HD1  3  
ATOM   5942  H  HD2  . HIS B 2 56  ? 14.205  0.452   -19.525 1.00 0.00 ? 156 HIS B HD2  3  
ATOM   5943  H  HE1  . HIS B 2 56  ? 18.177  1.525   -18.646 1.00 0.00 ? 156 HIS B HE1  3  
ATOM   5944  N  N    . MET B 2 57  ? 15.818  -1.965  -15.712 1.00 0.00 ? 157 MET B N    3  
ATOM   5945  C  CA   . MET B 2 57  ? 16.109  -1.286  -14.452 1.00 0.00 ? 157 MET B CA   3  
ATOM   5946  C  C    . MET B 2 57  ? 17.243  -1.971  -13.691 1.00 0.00 ? 157 MET B C    3  
ATOM   5947  O  O    . MET B 2 57  ? 18.078  -1.309  -13.074 1.00 0.00 ? 157 MET B O    3  
ATOM   5948  C  CB   . MET B 2 57  ? 14.854  -1.245  -13.585 1.00 0.00 ? 157 MET B CB   3  
ATOM   5949  C  CG   . MET B 2 57  ? 14.787  -0.041  -12.659 1.00 0.00 ? 157 MET B CG   3  
ATOM   5950  S  SD   . MET B 2 57  ? 13.107  0.321   -12.112 1.00 0.00 ? 157 MET B SD   3  
ATOM   5951  C  CE   . MET B 2 57  ? 12.470  -1.332  -11.845 1.00 0.00 ? 157 MET B CE   3  
ATOM   5952  H  H    . MET B 2 57  ? 14.879  -2.123  -15.969 1.00 0.00 ? 157 MET B H    3  
ATOM   5953  H  HA   . MET B 2 57  ? 16.408  -0.273  -14.686 1.00 0.00 ? 157 MET B HA   3  
ATOM   5954  H  HB2  . MET B 2 57  ? 13.988  -1.224  -14.229 1.00 0.00 ? 157 MET B HB2  3  
ATOM   5955  H  HB3  . MET B 2 57  ? 14.819  -2.139  -12.982 1.00 0.00 ? 157 MET B HB3  3  
ATOM   5956  H  HG2  . MET B 2 57  ? 15.398  -0.238  -11.790 1.00 0.00 ? 157 MET B HG2  3  
ATOM   5957  H  HG3  . MET B 2 57  ? 15.174  0.821   -13.182 1.00 0.00 ? 157 MET B HG3  3  
ATOM   5958  H  HE1  . MET B 2 57  ? 11.832  -1.336  -10.974 1.00 0.00 ? 157 MET B HE1  3  
ATOM   5959  H  HE2  . MET B 2 57  ? 13.293  -2.014  -11.689 1.00 0.00 ? 157 MET B HE2  3  
ATOM   5960  H  HE3  . MET B 2 57  ? 11.903  -1.643  -12.709 1.00 0.00 ? 157 MET B HE3  3  
ATOM   5961  N  N    . THR B 2 58  ? 17.264  -3.299  -13.735 1.00 0.00 ? 158 THR B N    3  
ATOM   5962  C  CA   . THR B 2 58  ? 18.295  -4.072  -13.046 1.00 0.00 ? 158 THR B CA   3  
ATOM   5963  C  C    . THR B 2 58  ? 19.695  -3.675  -13.516 1.00 0.00 ? 158 THR B C    3  
ATOM   5964  O  O    . THR B 2 58  ? 20.682  -3.916  -12.822 1.00 0.00 ? 158 THR B O    3  
ATOM   5965  C  CB   . THR B 2 58  ? 18.076  -5.572  -13.266 1.00 0.00 ? 158 THR B CB   3  
ATOM   5966  O  OG1  . THR B 2 58  ? 16.832  -5.814  -13.896 1.00 0.00 ? 158 THR B OG1  3  
ATOM   5967  C  CG2  . THR B 2 58  ? 18.103  -6.372  -11.981 1.00 0.00 ? 158 THR B CG2  3  
ATOM   5968  H  H    . THR B 2 58  ? 16.571  -3.772  -14.242 1.00 0.00 ? 158 THR B H    3  
ATOM   5969  H  HA   . THR B 2 58  ? 18.213  -3.859  -11.991 1.00 0.00 ? 158 THR B HA   3  
ATOM   5970  H  HB   . THR B 2 58  ? 18.859  -5.951  -13.907 1.00 0.00 ? 158 THR B HB   3  
ATOM   5971  H  HG1  . THR B 2 58  ? 16.697  -6.760  -13.989 1.00 0.00 ? 158 THR B HG1  3  
ATOM   5972  H  HG21 . THR B 2 58  ? 17.101  -6.452  -11.586 1.00 0.00 ? 158 THR B HG21 3  
ATOM   5973  H  HG22 . THR B 2 58  ? 18.735  -5.876  -11.261 1.00 0.00 ? 158 THR B HG22 3  
ATOM   5974  H  HG23 . THR B 2 58  ? 18.490  -7.361  -12.180 1.00 0.00 ? 158 THR B HG23 3  
ATOM   5975  N  N    . HIS B 2 59  ? 19.774  -3.063  -14.694 1.00 0.00 ? 159 HIS B N    3  
ATOM   5976  C  CA   . HIS B 2 59  ? 21.049  -2.632  -15.248 1.00 0.00 ? 159 HIS B CA   3  
ATOM   5977  C  C    . HIS B 2 59  ? 21.025  -1.142  -15.576 1.00 0.00 ? 159 HIS B C    3  
ATOM   5978  O  O    . HIS B 2 59  ? 21.866  -0.647  -16.328 1.00 0.00 ? 159 HIS B O    3  
ATOM   5979  C  CB   . HIS B 2 59  ? 21.383  -3.438  -16.503 1.00 0.00 ? 159 HIS B CB   3  
ATOM   5980  C  CG   . HIS B 2 59  ? 22.842  -3.446  -16.838 1.00 0.00 ? 159 HIS B CG   3  
ATOM   5981  N  ND1  . HIS B 2 59  ? 23.760  -4.247  -16.190 1.00 0.00 ? 159 HIS B ND1  3  
ATOM   5982  C  CD2  . HIS B 2 59  ? 23.544  -2.745  -17.761 1.00 0.00 ? 159 HIS B CD2  3  
ATOM   5983  C  CE1  . HIS B 2 59  ? 24.961  -4.037  -16.698 1.00 0.00 ? 159 HIS B CE1  3  
ATOM   5984  N  NE2  . HIS B 2 59  ? 24.857  -3.131  -17.653 1.00 0.00 ? 159 HIS B NE2  3  
ATOM   5985  H  H    . HIS B 2 59  ? 18.957  -2.892  -15.201 1.00 0.00 ? 159 HIS B H    3  
ATOM   5986  H  HA   . HIS B 2 59  ? 21.803  -2.811  -14.504 1.00 0.00 ? 159 HIS B HA   3  
ATOM   5987  H  HB2  . HIS B 2 59  ? 21.070  -4.461  -16.359 1.00 0.00 ? 159 HIS B HB2  3  
ATOM   5988  H  HB3  . HIS B 2 59  ? 20.851  -3.019  -17.345 1.00 0.00 ? 159 HIS B HB3  3  
ATOM   5989  H  HD1  . HIS B 2 59  ? 23.560  -4.874  -15.464 1.00 0.00 ? 159 HIS B HD1  3  
ATOM   5990  H  HD2  . HIS B 2 59  ? 23.144  -2.018  -18.453 1.00 0.00 ? 159 HIS B HD2  3  
ATOM   5991  H  HE1  . HIS B 2 59  ? 25.873  -4.525  -16.387 1.00 0.00 ? 159 HIS B HE1  3  
ATOM   5992  H  HE2  . HIS B 2 59  ? 25.583  -2.855  -18.251 1.00 0.00 ? 159 HIS B HE2  3  
ATOM   5993  N  N    . CYS B 2 60  ? 20.055  -0.434  -15.009 1.00 0.00 ? 160 CYS B N    3  
ATOM   5994  C  CA   . CYS B 2 60  ? 19.913  0.995   -15.236 1.00 0.00 ? 160 CYS B CA   3  
ATOM   5995  C  C    . CYS B 2 60  ? 20.451  1.788   -14.049 1.00 0.00 ? 160 CYS B C    3  
ATOM   5996  O  O    . CYS B 2 60  ? 19.697  2.184   -13.159 1.00 0.00 ? 160 CYS B O    3  
ATOM   5997  C  CB   . CYS B 2 60  ? 18.443  1.336   -15.474 1.00 0.00 ? 160 CYS B CB   3  
ATOM   5998  S  SG   . CYS B 2 60  ? 18.130  3.094   -15.828 1.00 0.00 ? 160 CYS B SG   3  
ATOM   5999  H  H    . CYS B 2 60  ? 19.415  -0.886  -14.423 1.00 0.00 ? 160 CYS B H    3  
ATOM   6000  H  HA   . CYS B 2 60  ? 20.482  1.252   -16.117 1.00 0.00 ? 160 CYS B HA   3  
ATOM   6001  H  HB2  . CYS B 2 60  ? 18.081  0.761   -16.313 1.00 0.00 ? 160 CYS B HB2  3  
ATOM   6002  H  HB3  . CYS B 2 60  ? 17.876  1.069   -14.597 1.00 0.00 ? 160 CYS B HB3  3  
ATOM   6003  N  N    . GLN B 2 61  ? 21.762  2.012   -14.040 1.00 0.00 ? 161 GLN B N    3  
ATOM   6004  C  CA   . GLN B 2 61  ? 22.407  2.750   -12.959 1.00 0.00 ? 161 GLN B CA   3  
ATOM   6005  C  C    . GLN B 2 61  ? 22.143  4.252   -13.067 1.00 0.00 ? 161 GLN B C    3  
ATOM   6006  O  O    . GLN B 2 61  ? 22.416  5.003   -12.130 1.00 0.00 ? 161 GLN B O    3  
ATOM   6007  C  CB   . GLN B 2 61  ? 23.914  2.484   -12.967 1.00 0.00 ? 161 GLN B CB   3  
ATOM   6008  C  CG   . GLN B 2 61  ? 24.364  1.508   -11.891 1.00 0.00 ? 161 GLN B CG   3  
ATOM   6009  C  CD   . GLN B 2 61  ? 24.324  2.113   -10.502 1.00 0.00 ? 161 GLN B CD   3  
ATOM   6010  O  OE1  . GLN B 2 61  ? 24.352  3.334   -10.343 1.00 0.00 ? 161 GLN B OE1  3  
ATOM   6011  N  NE2  . GLN B 2 61  ? 24.260  1.260   -9.487  1.00 0.00 ? 161 GLN B NE2  3  
ATOM   6012  H  H    . GLN B 2 61  ? 22.310  1.667   -14.775 1.00 0.00 ? 161 GLN B H    3  
ATOM   6013  H  HA   . GLN B 2 61  ? 21.996  2.393   -12.027 1.00 0.00 ? 161 GLN B HA   3  
ATOM   6014  H  HB2  . GLN B 2 61  ? 24.191  2.078   -13.929 1.00 0.00 ? 161 GLN B HB2  3  
ATOM   6015  H  HB3  . GLN B 2 61  ? 24.436  3.418   -12.816 1.00 0.00 ? 161 GLN B HB3  3  
ATOM   6016  H  HG2  . GLN B 2 61  ? 23.714  0.647   -11.911 1.00 0.00 ? 161 GLN B HG2  3  
ATOM   6017  H  HG3  . GLN B 2 61  ? 25.377  1.199   -12.106 1.00 0.00 ? 161 GLN B HG3  3  
ATOM   6018  H  HE21 . GLN B 2 61  ? 24.242  0.301   -9.688  1.00 0.00 ? 161 GLN B HE21 3  
ATOM   6019  H  HE22 . GLN B 2 61  ? 24.234  1.624   -8.577  1.00 0.00 ? 161 GLN B HE22 3  
ATOM   6020  N  N    . SER B 2 62  ? 21.614  4.688   -14.206 1.00 0.00 ? 162 SER B N    3  
ATOM   6021  C  CA   . SER B 2 62  ? 21.321  6.101   -14.415 1.00 0.00 ? 162 SER B CA   3  
ATOM   6022  C  C    . SER B 2 62  ? 20.283  6.591   -13.413 1.00 0.00 ? 162 SER B C    3  
ATOM   6023  O  O    . SER B 2 62  ? 20.557  7.472   -12.599 1.00 0.00 ? 162 SER B O    3  
ATOM   6024  C  CB   . SER B 2 62  ? 20.823  6.335   -15.843 1.00 0.00 ? 162 SER B CB   3  
ATOM   6025  O  OG   . SER B 2 62  ? 21.905  6.420   -16.754 1.00 0.00 ? 162 SER B OG   3  
ATOM   6026  H  H    . SER B 2 62  ? 21.414  4.049   -14.920 1.00 0.00 ? 162 SER B H    3  
ATOM   6027  H  HA   . SER B 2 62  ? 22.236  6.654   -14.267 1.00 0.00 ? 162 SER B HA   3  
ATOM   6028  H  HB2  . SER B 2 62  ? 20.184  5.517   -16.138 1.00 0.00 ? 162 SER B HB2  3  
ATOM   6029  H  HB3  . SER B 2 62  ? 20.264  7.259   -15.878 1.00 0.00 ? 162 SER B HB3  3  
ATOM   6030  H  HG   . SER B 2 62  ? 22.107  7.343   -16.927 1.00 0.00 ? 162 SER B HG   3  
ATOM   6031  N  N    . GLY B 2 63  ? 19.090  6.012   -13.481 1.00 0.00 ? 163 GLY B N    3  
ATOM   6032  C  CA   . GLY B 2 63  ? 18.026  6.397   -12.578 1.00 0.00 ? 163 GLY B CA   3  
ATOM   6033  C  C    . GLY B 2 63  ? 17.563  7.817   -12.797 1.00 0.00 ? 163 GLY B C    3  
ATOM   6034  O  O    . GLY B 2 63  ? 18.347  8.762   -12.709 1.00 0.00 ? 163 GLY B O    3  
ATOM   6035  H  H    . GLY B 2 63  ? 18.930  5.316   -14.151 1.00 0.00 ? 163 GLY B H    3  
ATOM   6036  H  HA2  . GLY B 2 63  ? 17.187  5.733   -12.727 1.00 0.00 ? 163 GLY B HA2  3  
ATOM   6037  H  HA3  . GLY B 2 63  ? 18.368  6.297   -11.563 1.00 0.00 ? 163 GLY B HA3  3  
ATOM   6038  N  N    . LYS B 2 64  ? 16.282  7.958   -13.083 1.00 0.00 ? 164 LYS B N    3  
ATOM   6039  C  CA   . LYS B 2 64  ? 15.677  9.266   -13.321 1.00 0.00 ? 164 LYS B CA   3  
ATOM   6040  C  C    . LYS B 2 64  ? 16.459  10.056  -14.368 1.00 0.00 ? 164 LYS B C    3  
ATOM   6041  O  O    . LYS B 2 64  ? 16.430  11.287  -14.379 1.00 0.00 ? 164 LYS B O    3  
ATOM   6042  C  CB   . LYS B 2 64  ? 15.605  10.061  -12.016 1.00 0.00 ? 164 LYS B CB   3  
ATOM   6043  C  CG   . LYS B 2 64  ? 14.653  11.246  -12.078 1.00 0.00 ? 164 LYS B CG   3  
ATOM   6044  C  CD   . LYS B 2 64  ? 15.332  12.533  -11.638 1.00 0.00 ? 164 LYS B CD   3  
ATOM   6045  C  CE   . LYS B 2 64  ? 14.358  13.700  -11.625 1.00 0.00 ? 164 LYS B CE   3  
ATOM   6046  N  NZ   . LYS B 2 64  ? 14.106  14.229  -12.994 1.00 0.00 ? 164 LYS B NZ   3  
ATOM   6047  H  H    . LYS B 2 64  ? 15.725  7.155   -13.133 1.00 0.00 ? 164 LYS B H    3  
ATOM   6048  H  HA   . LYS B 2 64  ? 14.675  9.104   -13.687 1.00 0.00 ? 164 LYS B HA   3  
ATOM   6049  H  HB2  . LYS B 2 64  ? 15.274  9.403   -11.226 1.00 0.00 ? 164 LYS B HB2  3  
ATOM   6050  H  HB3  . LYS B 2 64  ? 16.591  10.429  -11.777 1.00 0.00 ? 164 LYS B HB3  3  
ATOM   6051  H  HG2  . LYS B 2 64  ? 14.307  11.364  -13.094 1.00 0.00 ? 164 LYS B HG2  3  
ATOM   6052  H  HG3  . LYS B 2 64  ? 13.812  11.054  -11.430 1.00 0.00 ? 164 LYS B HG3  3  
ATOM   6053  H  HD2  . LYS B 2 64  ? 15.729  12.398  -10.644 1.00 0.00 ? 164 LYS B HD2  3  
ATOM   6054  H  HD3  . LYS B 2 64  ? 16.138  12.756  -12.323 1.00 0.00 ? 164 LYS B HD3  3  
ATOM   6055  H  HE2  . LYS B 2 64  ? 13.423  13.367  -11.200 1.00 0.00 ? 164 LYS B HE2  3  
ATOM   6056  H  HE3  . LYS B 2 64  ? 14.770  14.490  -11.013 1.00 0.00 ? 164 LYS B HE3  3  
ATOM   6057  H  HZ1  . LYS B 2 64  ? 14.728  15.039  -13.185 1.00 0.00 ? 164 LYS B HZ1  3  
ATOM   6058  H  HZ2  . LYS B 2 64  ? 13.116  14.537  -13.082 1.00 0.00 ? 164 LYS B HZ2  3  
ATOM   6059  H  HZ3  . LYS B 2 64  ? 14.291  13.489  -13.703 1.00 0.00 ? 164 LYS B HZ3  3  
ATOM   6060  N  N    . SER B 2 65  ? 17.158  9.342   -15.244 1.00 0.00 ? 165 SER B N    3  
ATOM   6061  C  CA   . SER B 2 65  ? 17.946  9.979   -16.293 1.00 0.00 ? 165 SER B CA   3  
ATOM   6062  C  C    . SER B 2 65  ? 18.472  8.942   -17.281 1.00 0.00 ? 165 SER B C    3  
ATOM   6063  O  O    . SER B 2 65  ? 19.560  9.095   -17.837 1.00 0.00 ? 165 SER B O    3  
ATOM   6064  C  CB   . SER B 2 65  ? 19.114  10.756  -15.683 1.00 0.00 ? 165 SER B CB   3  
ATOM   6065  O  OG   . SER B 2 65  ? 19.791  11.518  -16.669 1.00 0.00 ? 165 SER B OG   3  
ATOM   6066  H  H    . SER B 2 65  ? 17.143  8.365   -15.184 1.00 0.00 ? 165 SER B H    3  
ATOM   6067  H  HA   . SER B 2 65  ? 17.303  10.668  -16.820 1.00 0.00 ? 165 SER B HA   3  
ATOM   6068  H  HB2  . SER B 2 65  ? 18.740  11.426  -14.924 1.00 0.00 ? 165 SER B HB2  3  
ATOM   6069  H  HB3  . SER B 2 65  ? 19.814  10.062  -15.240 1.00 0.00 ? 165 SER B HB3  3  
ATOM   6070  H  HG   . SER B 2 65  ? 20.586  11.055  -16.941 1.00 0.00 ? 165 SER B HG   3  
ATOM   6071  N  N    . CYS B 2 66  ? 17.693  7.886   -17.492 1.00 0.00 ? 166 CYS B N    3  
ATOM   6072  C  CA   . CYS B 2 66  ? 18.073  6.824   -18.403 1.00 0.00 ? 166 CYS B CA   3  
ATOM   6073  C  C    . CYS B 2 66  ? 17.464  7.052   -19.784 1.00 0.00 ? 166 CYS B C    3  
ATOM   6074  O  O    . CYS B 2 66  ? 16.768  8.042   -20.009 1.00 0.00 ? 166 CYS B O    3  
ATOM   6075  C  CB   . CYS B 2 66  ? 17.620  5.477   -17.844 1.00 0.00 ? 166 CYS B CB   3  
ATOM   6076  S  SG   . CYS B 2 66  ? 18.742  4.093   -18.220 1.00 0.00 ? 166 CYS B SG   3  
ATOM   6077  H  H    . CYS B 2 66  ? 16.842  7.818   -17.020 1.00 0.00 ? 166 CYS B H    3  
ATOM   6078  H  HA   . CYS B 2 66  ? 19.145  6.830   -18.486 1.00 0.00 ? 166 CYS B HA   3  
ATOM   6079  H  HB2  . CYS B 2 66  ? 17.544  5.553   -16.769 1.00 0.00 ? 166 CYS B HB2  3  
ATOM   6080  H  HB3  . CYS B 2 66  ? 16.649  5.239   -18.250 1.00 0.00 ? 166 CYS B HB3  3  
ATOM   6081  N  N    . GLN B 2 67  ? 17.732  6.133   -20.706 1.00 0.00 ? 167 GLN B N    3  
ATOM   6082  C  CA   . GLN B 2 67  ? 17.209  6.240   -22.063 1.00 0.00 ? 167 GLN B CA   3  
ATOM   6083  C  C    . GLN B 2 67  ? 15.851  5.552   -22.194 1.00 0.00 ? 167 GLN B C    3  
ATOM   6084  O  O    . GLN B 2 67  ? 15.360  5.342   -23.302 1.00 0.00 ? 167 GLN B O    3  
ATOM   6085  C  CB   . GLN B 2 67  ? 18.197  5.631   -23.060 1.00 0.00 ? 167 GLN B CB   3  
ATOM   6086  C  CG   . GLN B 2 67  ? 19.526  6.365   -23.124 1.00 0.00 ? 167 GLN B CG   3  
ATOM   6087  C  CD   . GLN B 2 67  ? 20.019  6.556   -24.545 1.00 0.00 ? 167 GLN B CD   3  
ATOM   6088  O  OE1  . GLN B 2 67  ? 20.809  5.761   -25.054 1.00 0.00 ? 167 GLN B OE1  3  
ATOM   6089  N  NE2  . GLN B 2 67  ? 19.553  7.618   -25.195 1.00 0.00 ? 167 GLN B NE2  3  
ATOM   6090  H  H    . GLN B 2 67  ? 18.294  5.367   -20.470 1.00 0.00 ? 167 GLN B H    3  
ATOM   6091  H  HA   . GLN B 2 67  ? 17.089  7.289   -22.288 1.00 0.00 ? 167 GLN B HA   3  
ATOM   6092  H  HB2  . GLN B 2 67  ? 18.390  4.606   -22.777 1.00 0.00 ? 167 GLN B HB2  3  
ATOM   6093  H  HB3  . GLN B 2 67  ? 17.753  5.647   -24.044 1.00 0.00 ? 167 GLN B HB3  3  
ATOM   6094  H  HG2  . GLN B 2 67  ? 19.410  7.336   -22.666 1.00 0.00 ? 167 GLN B HG2  3  
ATOM   6095  H  HG3  . GLN B 2 67  ? 20.264  5.796   -22.577 1.00 0.00 ? 167 GLN B HG3  3  
ATOM   6096  H  HE21 . GLN B 2 67  ? 18.926  8.209   -24.727 1.00 0.00 ? 167 GLN B HE21 3  
ATOM   6097  H  HE22 . GLN B 2 67  ? 19.855  7.767   -26.115 1.00 0.00 ? 167 GLN B HE22 3  
ATOM   6098  N  N    . VAL B 2 68  ? 15.242  5.204   -21.061 1.00 0.00 ? 168 VAL B N    3  
ATOM   6099  C  CA   . VAL B 2 68  ? 13.956  4.552   -21.057 1.00 0.00 ? 168 VAL B CA   3  
ATOM   6100  C  C    . VAL B 2 68  ? 13.002  5.282   -20.125 1.00 0.00 ? 168 VAL B C    3  
ATOM   6101  O  O    . VAL B 2 68  ? 13.367  5.679   -19.018 1.00 0.00 ? 168 VAL B O    3  
ATOM   6102  C  CB   . VAL B 2 68  ? 14.088  3.089   -20.615 1.00 0.00 ? 168 VAL B CB   3  
ATOM   6103  C  CG1  . VAL B 2 68  ? 12.721  2.426   -20.484 1.00 0.00 ? 168 VAL B CG1  3  
ATOM   6104  C  CG2  . VAL B 2 68  ? 14.971  2.323   -21.589 1.00 0.00 ? 168 VAL B CG2  3  
ATOM   6105  H  H    . VAL B 2 68  ? 15.663  5.390   -20.204 1.00 0.00 ? 168 VAL B H    3  
ATOM   6106  H  HA   . VAL B 2 68  ? 13.561  4.575   -22.062 1.00 0.00 ? 168 VAL B HA   3  
ATOM   6107  H  HB   . VAL B 2 68  ? 14.567  3.085   -19.649 1.00 0.00 ? 168 VAL B HB   3  
ATOM   6108  H  HG11 . VAL B 2 68  ? 12.566  2.119   -19.461 1.00 0.00 ? 168 VAL B HG11 3  
ATOM   6109  H  HG12 . VAL B 2 68  ? 12.677  1.560   -21.129 1.00 0.00 ? 168 VAL B HG12 3  
ATOM   6110  H  HG13 . VAL B 2 68  ? 11.952  3.126   -20.772 1.00 0.00 ? 168 VAL B HG13 3  
ATOM   6111  H  HG21 . VAL B 2 68  ? 14.782  2.668   -22.595 1.00 0.00 ? 168 VAL B HG21 3  
ATOM   6112  H  HG22 . VAL B 2 68  ? 14.748  1.267   -21.523 1.00 0.00 ? 168 VAL B HG22 3  
ATOM   6113  H  HG23 . VAL B 2 68  ? 16.009  2.486   -21.340 1.00 0.00 ? 168 VAL B HG23 3  
ATOM   6114  N  N    . ALA B 2 69  ? 11.786  5.453   -20.592 1.00 0.00 ? 169 ALA B N    3  
ATOM   6115  C  CA   . ALA B 2 69  ? 10.752  6.138   -19.830 1.00 0.00 ? 169 ALA B CA   3  
ATOM   6116  C  C    . ALA B 2 69  ? 10.257  5.280   -18.674 1.00 0.00 ? 169 ALA B C    3  
ATOM   6117  O  O    . ALA B 2 69  ? 10.213  5.727   -17.527 1.00 0.00 ? 169 ALA B O    3  
ATOM   6118  C  CB   . ALA B 2 69  ? 9.591   6.508   -20.741 1.00 0.00 ? 169 ALA B CB   3  
ATOM   6119  H  H    . ALA B 2 69  ? 11.581  5.110   -21.480 1.00 0.00 ? 169 ALA B H    3  
ATOM   6120  H  HA   . ALA B 2 69  ? 11.175  7.051   -19.435 1.00 0.00 ? 169 ALA B HA   3  
ATOM   6121  H  HB1  . ALA B 2 69  ? 9.767   7.482   -21.172 1.00 0.00 ? 169 ALA B HB1  3  
ATOM   6122  H  HB2  . ALA B 2 69  ? 8.677   6.526   -20.168 1.00 0.00 ? 169 ALA B HB2  3  
ATOM   6123  H  HB3  . ALA B 2 69  ? 9.507   5.775   -21.531 1.00 0.00 ? 169 ALA B HB3  3  
ATOM   6124  N  N    . HIS B 2 70  ? 9.872   4.051   -18.987 1.00 0.00 ? 170 HIS B N    3  
ATOM   6125  C  CA   . HIS B 2 70  ? 9.362   3.130   -17.990 1.00 0.00 ? 170 HIS B CA   3  
ATOM   6126  C  C    . HIS B 2 70  ? 10.438  2.718   -16.986 1.00 0.00 ? 170 HIS B C    3  
ATOM   6127  O  O    . HIS B 2 70  ? 10.127  2.156   -15.937 1.00 0.00 ? 170 HIS B O    3  
ATOM   6128  C  CB   . HIS B 2 70  ? 8.772   1.893   -18.668 1.00 0.00 ? 170 HIS B CB   3  
ATOM   6129  C  CG   . HIS B 2 70  ? 7.613   2.209   -19.562 1.00 0.00 ? 170 HIS B CG   3  
ATOM   6130  N  ND1  . HIS B 2 70  ? 6.449   2.791   -19.106 1.00 0.00 ? 170 HIS B ND1  3  
ATOM   6131  C  CD2  . HIS B 2 70  ? 7.444   2.030   -20.893 1.00 0.00 ? 170 HIS B CD2  3  
ATOM   6132  C  CE1  . HIS B 2 70  ? 5.615   2.954   -20.118 1.00 0.00 ? 170 HIS B CE1  3  
ATOM   6133  N  NE2  . HIS B 2 70  ? 6.195   2.501   -21.213 1.00 0.00 ? 170 HIS B NE2  3  
ATOM   6134  H  H    . HIS B 2 70  ? 9.917   3.760   -19.916 1.00 0.00 ? 170 HIS B H    3  
ATOM   6135  H  HA   . HIS B 2 70  ? 8.577   3.639   -17.462 1.00 0.00 ? 170 HIS B HA   3  
ATOM   6136  H  HB2  . HIS B 2 70  ? 9.535   1.419   -19.266 1.00 0.00 ? 170 HIS B HB2  3  
ATOM   6137  H  HB3  . HIS B 2 70  ? 8.431   1.203   -17.911 1.00 0.00 ? 170 HIS B HB3  3  
ATOM   6138  H  HD1  . HIS B 2 70  ? 6.260   3.044   -18.179 1.00 0.00 ? 170 HIS B HD1  3  
ATOM   6139  H  HD2  . HIS B 2 70  ? 8.159   1.598   -21.577 1.00 0.00 ? 170 HIS B HD2  3  
ATOM   6140  H  HE1  . HIS B 2 70  ? 4.623   3.379   -20.057 1.00 0.00 ? 170 HIS B HE1  3  
ATOM   6141  H  HE2  . HIS B 2 70  ? 5.763   2.420   -22.089 1.00 0.00 ? 170 HIS B HE2  3  
ATOM   6142  N  N    . CYS B 2 71  ? 11.704  2.998   -17.299 1.00 0.00 ? 171 CYS B N    3  
ATOM   6143  C  CA   . CYS B 2 71  ? 12.793  2.646   -16.396 1.00 0.00 ? 171 CYS B CA   3  
ATOM   6144  C  C    . CYS B 2 71  ? 12.882  3.636   -15.251 1.00 0.00 ? 171 CYS B C    3  
ATOM   6145  O  O    . CYS B 2 71  ? 12.581  3.312   -14.102 1.00 0.00 ? 171 CYS B O    3  
ATOM   6146  C  CB   . CYS B 2 71  ? 14.122  2.616   -17.147 1.00 0.00 ? 171 CYS B CB   3  
ATOM   6147  S  SG   . CYS B 2 71  ? 15.412  1.627   -16.324 1.00 0.00 ? 171 CYS B SG   3  
ATOM   6148  H  H    . CYS B 2 71  ? 11.908  3.452   -18.146 1.00 0.00 ? 171 CYS B H    3  
ATOM   6149  H  HA   . CYS B 2 71  ? 12.592  1.666   -15.997 1.00 0.00 ? 171 CYS B HA   3  
ATOM   6150  H  HB2  . CYS B 2 71  ? 13.960  2.202   -18.121 1.00 0.00 ? 171 CYS B HB2  3  
ATOM   6151  H  HB3  . CYS B 2 71  ? 14.496  3.622   -17.252 1.00 0.00 ? 171 CYS B HB3  3  
ATOM   6152  N  N    . ALA B 2 72  ? 13.295  4.847   -15.581 1.00 0.00 ? 172 ALA B N    3  
ATOM   6153  C  CA   . ALA B 2 72  ? 13.426  5.908   -14.588 1.00 0.00 ? 172 ALA B CA   3  
ATOM   6154  C  C    . ALA B 2 72  ? 12.118  6.109   -13.828 1.00 0.00 ? 172 ALA B C    3  
ATOM   6155  O  O    . ALA B 2 72  ? 12.115  6.280   -12.608 1.00 0.00 ? 172 ALA B O    3  
ATOM   6156  C  CB   . ALA B 2 72  ? 13.860  7.207   -15.255 1.00 0.00 ? 172 ALA B CB   3  
ATOM   6157  H  H    . ALA B 2 72  ? 13.516  5.030   -16.520 1.00 0.00 ? 172 ALA B H    3  
ATOM   6158  H  HA   . ALA B 2 72  ? 14.196  5.616   -13.888 1.00 0.00 ? 172 ALA B HA   3  
ATOM   6159  H  HB1  . ALA B 2 72  ? 13.347  8.038   -14.794 1.00 0.00 ? 172 ALA B HB1  3  
ATOM   6160  H  HB2  . ALA B 2 72  ? 13.613  7.170   -16.307 1.00 0.00 ? 172 ALA B HB2  3  
ATOM   6161  H  HB3  . ALA B 2 72  ? 14.927  7.331   -15.140 1.00 0.00 ? 172 ALA B HB3  3  
ATOM   6162  N  N    . SER B 2 73  ? 11.009  6.081   -14.560 1.00 0.00 ? 173 SER B N    3  
ATOM   6163  C  CA   . SER B 2 73  ? 9.693   6.252   -13.958 1.00 0.00 ? 173 SER B CA   3  
ATOM   6164  C  C    . SER B 2 73  ? 9.420   5.152   -12.938 1.00 0.00 ? 173 SER B C    3  
ATOM   6165  O  O    . SER B 2 73  ? 9.076   5.429   -11.789 1.00 0.00 ? 173 SER B O    3  
ATOM   6166  C  CB   . SER B 2 73  ? 8.610   6.244   -15.039 1.00 0.00 ? 173 SER B CB   3  
ATOM   6167  O  OG   . SER B 2 73  ? 7.319   6.120   -14.466 1.00 0.00 ? 173 SER B OG   3  
ATOM   6168  H  H    . SER B 2 73  ? 11.077  5.935   -15.527 1.00 0.00 ? 173 SER B H    3  
ATOM   6169  H  HA   . SER B 2 73  ? 9.680   7.207   -13.453 1.00 0.00 ? 173 SER B HA   3  
ATOM   6170  H  HB2  . SER B 2 73  ? 8.654   7.167   -15.596 1.00 0.00 ? 173 SER B HB2  3  
ATOM   6171  H  HB3  . SER B 2 73  ? 8.777   5.411   -15.706 1.00 0.00 ? 173 SER B HB3  3  
ATOM   6172  H  HG   . SER B 2 73  ? 6.767   6.847   -14.761 1.00 0.00 ? 173 SER B HG   3  
ATOM   6173  N  N    . SER B 2 74  ? 9.576   3.903   -13.366 1.00 0.00 ? 174 SER B N    3  
ATOM   6174  C  CA   . SER B 2 74  ? 9.348   2.758   -12.489 1.00 0.00 ? 174 SER B CA   3  
ATOM   6175  C  C    . SER B 2 74  ? 10.219  2.848   -11.239 1.00 0.00 ? 174 SER B C    3  
ATOM   6176  O  O    . SER B 2 74  ? 9.816   2.420   -10.158 1.00 0.00 ? 174 SER B O    3  
ATOM   6177  C  CB   . SER B 2 74  ? 9.638   1.454   -13.235 1.00 0.00 ? 174 SER B CB   3  
ATOM   6178  O  OG   . SER B 2 74  ? 9.816   0.376   -12.332 1.00 0.00 ? 174 SER B OG   3  
ATOM   6179  H  H    . SER B 2 74  ? 9.853   3.746   -14.292 1.00 0.00 ? 174 SER B H    3  
ATOM   6180  H  HA   . SER B 2 74  ? 8.310   2.770   -12.192 1.00 0.00 ? 174 SER B HA   3  
ATOM   6181  H  HB2  . SER B 2 74  ? 8.811   1.225   -13.890 1.00 0.00 ? 174 SER B HB2  3  
ATOM   6182  H  HB3  . SER B 2 74  ? 10.539  1.569   -13.820 1.00 0.00 ? 174 SER B HB3  3  
ATOM   6183  H  HG   . SER B 2 74  ? 9.144   0.417   -11.647 1.00 0.00 ? 174 SER B HG   3  
ATOM   6184  N  N    . ARG B 2 75  ? 11.414  3.408   -11.397 1.00 0.00 ? 175 ARG B N    3  
ATOM   6185  C  CA   . ARG B 2 75  ? 12.341  3.556   -10.282 1.00 0.00 ? 175 ARG B CA   3  
ATOM   6186  C  C    . ARG B 2 75  ? 11.747  4.449   -9.197  1.00 0.00 ? 175 ARG B C    3  
ATOM   6187  O  O    . ARG B 2 75  ? 11.833  4.140   -8.008  1.00 0.00 ? 175 ARG B O    3  
ATOM   6188  C  CB   . ARG B 2 75  ? 13.667  4.140   -10.770 1.00 0.00 ? 175 ARG B CB   3  
ATOM   6189  C  CG   . ARG B 2 75  ? 14.759  4.143   -9.712  1.00 0.00 ? 175 ARG B CG   3  
ATOM   6190  C  CD   . ARG B 2 75  ? 16.018  4.832   -10.211 1.00 0.00 ? 175 ARG B CD   3  
ATOM   6191  N  NE   . ARG B 2 75  ? 16.052  6.246   -9.842  1.00 0.00 ? 175 ARG B NE   3  
ATOM   6192  C  CZ   . ARG B 2 75  ? 16.394  6.689   -8.634  1.00 0.00 ? 175 ARG B CZ   3  
ATOM   6193  N  NH1  . ARG B 2 75  ? 16.731  5.833   -7.677  1.00 0.00 ? 175 ARG B NH1  3  
ATOM   6194  N  NH2  . ARG B 2 75  ? 16.399  7.991   -8.383  1.00 0.00 ? 175 ARG B NH2  3  
ATOM   6195  H  H    . ARG B 2 75  ? 11.677  3.732   -12.284 1.00 0.00 ? 175 ARG B H    3  
ATOM   6196  H  HA   . ARG B 2 75  ? 12.519  2.576   -9.867  1.00 0.00 ? 175 ARG B HA   3  
ATOM   6197  H  HB2  . ARG B 2 75  ? 14.014  3.560   -11.612 1.00 0.00 ? 175 ARG B HB2  3  
ATOM   6198  H  HB3  . ARG B 2 75  ? 13.504  5.158   -11.090 1.00 0.00 ? 175 ARG B HB3  3  
ATOM   6199  H  HG2  . ARG B 2 75  ? 14.397  4.665   -8.838  1.00 0.00 ? 175 ARG B HG2  3  
ATOM   6200  H  HG3  . ARG B 2 75  ? 14.996  3.122   -9.451  1.00 0.00 ? 175 ARG B HG3  3  
ATOM   6201  H  HD2  . ARG B 2 75  ? 16.877  4.338   -9.784  1.00 0.00 ? 175 ARG B HD2  3  
ATOM   6202  H  HD3  . ARG B 2 75  ? 16.055  4.750   -11.288 1.00 0.00 ? 175 ARG B HD3  3  
ATOM   6203  H  HE   . ARG B 2 75  ? 15.808  6.899   -10.530 1.00 0.00 ? 175 ARG B HE   3  
ATOM   6204  H  HH11 . ARG B 2 75  ? 16.730  4.851   -7.859  1.00 0.00 ? 175 ARG B HH11 3  
ATOM   6205  H  HH12 . ARG B 2 75  ? 16.987  6.173   -6.772  1.00 0.00 ? 175 ARG B HH12 3  
ATOM   6206  H  HH21 . ARG B 2 75  ? 16.146  8.639   -9.101  1.00 0.00 ? 175 ARG B HH21 3  
ATOM   6207  H  HH22 . ARG B 2 75  ? 16.656  8.324   -7.476  1.00 0.00 ? 175 ARG B HH22 3  
ATOM   6208  N  N    . GLN B 2 76  ? 11.146  5.559   -9.615  1.00 0.00 ? 176 GLN B N    3  
ATOM   6209  C  CA   . GLN B 2 76  ? 10.541  6.501   -8.680  1.00 0.00 ? 176 GLN B CA   3  
ATOM   6210  C  C    . GLN B 2 76  ? 9.257   5.937   -8.077  1.00 0.00 ? 176 GLN B C    3  
ATOM   6211  O  O    . GLN B 2 76  ? 8.902   6.257   -6.943  1.00 0.00 ? 176 GLN B O    3  
ATOM   6212  C  CB   . GLN B 2 76  ? 10.246  7.827   -9.382  1.00 0.00 ? 176 GLN B CB   3  
ATOM   6213  C  CG   . GLN B 2 76  ? 11.495  8.584   -9.801  1.00 0.00 ? 176 GLN B CG   3  
ATOM   6214  C  CD   . GLN B 2 76  ? 12.327  9.036   -8.617  1.00 0.00 ? 176 GLN B CD   3  
ATOM   6215  O  OE1  . GLN B 2 76  ? 11.962  8.806   -7.464  1.00 0.00 ? 176 GLN B OE1  3  
ATOM   6216  N  NE2  . GLN B 2 76  ? 13.451  9.686   -8.896  1.00 0.00 ? 176 GLN B NE2  3  
ATOM   6217  H  H    . GLN B 2 76  ? 11.113  5.750   -10.577 1.00 0.00 ? 176 GLN B H    3  
ATOM   6218  H  HA   . GLN B 2 76  ? 11.249  6.677   -7.886  1.00 0.00 ? 176 GLN B HA   3  
ATOM   6219  H  HB2  . GLN B 2 76  ? 9.658   7.629   -10.267 1.00 0.00 ? 176 GLN B HB2  3  
ATOM   6220  H  HB3  . GLN B 2 76  ? 9.676   8.456   -8.715  1.00 0.00 ? 176 GLN B HB3  3  
ATOM   6221  H  HG2  . GLN B 2 76  ? 12.101  7.940   -10.421 1.00 0.00 ? 176 GLN B HG2  3  
ATOM   6222  H  HG3  . GLN B 2 76  ? 11.200  9.455   -10.369 1.00 0.00 ? 176 GLN B HG3  3  
ATOM   6223  H  HE21 . GLN B 2 76  ? 13.677  9.835   -9.837  1.00 0.00 ? 176 GLN B HE21 3  
ATOM   6224  H  HE22 . GLN B 2 76  ? 14.007  9.990   -8.149  1.00 0.00 ? 176 GLN B HE22 3  
ATOM   6225  N  N    . ILE B 2 77  ? 8.560   5.103   -8.841  1.00 0.00 ? 177 ILE B N    3  
ATOM   6226  C  CA   . ILE B 2 77  ? 7.313   4.504   -8.380  1.00 0.00 ? 177 ILE B CA   3  
ATOM   6227  C  C    . ILE B 2 77  ? 7.555   3.495   -7.261  1.00 0.00 ? 177 ILE B C    3  
ATOM   6228  O  O    . ILE B 2 77  ? 7.124   3.699   -6.126  1.00 0.00 ? 177 ILE B O    3  
ATOM   6229  C  CB   . ILE B 2 77  ? 6.561   3.809   -9.534  1.00 0.00 ? 177 ILE B CB   3  
ATOM   6230  C  CG1  . ILE B 2 77  ? 6.323   4.793   -10.680 1.00 0.00 ? 177 ILE B CG1  3  
ATOM   6231  C  CG2  . ILE B 2 77  ? 5.240   3.232   -9.042  1.00 0.00 ? 177 ILE B CG2  3  
ATOM   6232  C  CD1  . ILE B 2 77  ? 6.228   4.130   -12.037 1.00 0.00 ? 177 ILE B CD1  3  
ATOM   6233  H  H    . ILE B 2 77  ? 8.891   4.888   -9.740  1.00 0.00 ? 177 ILE B H    3  
ATOM   6234  H  HA   . ILE B 2 77  ? 6.686   5.298   -8.001  1.00 0.00 ? 177 ILE B HA   3  
ATOM   6235  H  HB   . ILE B 2 77  ? 7.171   2.992   -9.891  1.00 0.00 ? 177 ILE B HB   3  
ATOM   6236  H  HG12 . ILE B 2 77  ? 5.398   5.322   -10.504 1.00 0.00 ? 177 ILE B HG12 3  
ATOM   6237  H  HG13 . ILE B 2 77  ? 7.137   5.502   -10.712 1.00 0.00 ? 177 ILE B HG13 3  
ATOM   6238  H  HG21 . ILE B 2 77  ? 4.937   3.746   -8.142  1.00 0.00 ? 177 ILE B HG21 3  
ATOM   6239  H  HG22 . ILE B 2 77  ? 5.361   2.181   -8.833  1.00 0.00 ? 177 ILE B HG22 3  
ATOM   6240  H  HG23 . ILE B 2 77  ? 4.485   3.364   -9.802  1.00 0.00 ? 177 ILE B HG23 3  
ATOM   6241  H  HD11 . ILE B 2 77  ? 7.008   4.511   -12.679 1.00 0.00 ? 177 ILE B HD11 3  
ATOM   6242  H  HD12 . ILE B 2 77  ? 5.264   4.343   -12.475 1.00 0.00 ? 177 ILE B HD12 3  
ATOM   6243  H  HD13 . ILE B 2 77  ? 6.344   3.062   -11.925 1.00 0.00 ? 177 ILE B HD13 3  
ATOM   6244  N  N    . ILE B 2 78  ? 8.240   2.406   -7.590  1.00 0.00 ? 178 ILE B N    3  
ATOM   6245  C  CA   . ILE B 2 78  ? 8.530   1.360   -6.612  1.00 0.00 ? 178 ILE B CA   3  
ATOM   6246  C  C    . ILE B 2 78  ? 9.235   1.930   -5.385  1.00 0.00 ? 178 ILE B C    3  
ATOM   6247  O  O    . ILE B 2 78  ? 8.894   1.595   -4.251  1.00 0.00 ? 178 ILE B O    3  
ATOM   6248  C  CB   . ILE B 2 78  ? 9.397   0.239   -7.217  1.00 0.00 ? 178 ILE B CB   3  
ATOM   6249  C  CG1  . ILE B 2 78  ? 8.764   -0.284  -8.509  1.00 0.00 ? 178 ILE B CG1  3  
ATOM   6250  C  CG2  . ILE B 2 78  ? 9.574   -0.891  -6.212  1.00 0.00 ? 178 ILE B CG2  3  
ATOM   6251  C  CD1  . ILE B 2 78  ? 9.559   -1.391  -9.167  1.00 0.00 ? 178 ILE B CD1  3  
ATOM   6252  H  H    . ILE B 2 78  ? 8.552   2.298   -8.512  1.00 0.00 ? 178 ILE B H    3  
ATOM   6253  H  HA   . ILE B 2 78  ? 7.590   0.929   -6.302  1.00 0.00 ? 178 ILE B HA   3  
ATOM   6254  H  HB   . ILE B 2 78  ? 10.371  0.647   -7.440  1.00 0.00 ? 178 ILE B HB   3  
ATOM   6255  H  HG12 . ILE B 2 78  ? 7.780   -0.668  -8.290  1.00 0.00 ? 178 ILE B HG12 3  
ATOM   6256  H  HG13 . ILE B 2 78  ? 8.680   0.529   -9.216  1.00 0.00 ? 178 ILE B HG13 3  
ATOM   6257  H  HG21 . ILE B 2 78  ? 9.692   -1.827  -6.739  1.00 0.00 ? 178 ILE B HG21 3  
ATOM   6258  H  HG22 . ILE B 2 78  ? 8.705   -0.945  -5.574  1.00 0.00 ? 178 ILE B HG22 3  
ATOM   6259  H  HG23 . ILE B 2 78  ? 10.451  -0.704  -5.612  1.00 0.00 ? 178 ILE B HG23 3  
ATOM   6260  H  HD11 . ILE B 2 78  ? 9.963   -2.043  -8.408  1.00 0.00 ? 178 ILE B HD11 3  
ATOM   6261  H  HD12 . ILE B 2 78  ? 10.365  -0.961  -9.741  1.00 0.00 ? 178 ILE B HD12 3  
ATOM   6262  H  HD13 . ILE B 2 78  ? 8.912   -1.957  -9.821  1.00 0.00 ? 178 ILE B HD13 3  
ATOM   6263  N  N    . SER B 2 79  ? 10.219  2.795   -5.616  1.00 0.00 ? 179 SER B N    3  
ATOM   6264  C  CA   . SER B 2 79  ? 10.966  3.408   -4.522  1.00 0.00 ? 179 SER B CA   3  
ATOM   6265  C  C    . SER B 2 79  ? 10.018  4.060   -3.520  1.00 0.00 ? 179 SER B C    3  
ATOM   6266  O  O    . SER B 2 79  ? 10.090  3.798   -2.321  1.00 0.00 ? 179 SER B O    3  
ATOM   6267  C  CB   . SER B 2 79  ? 11.950  4.446   -5.064  1.00 0.00 ? 179 SER B CB   3  
ATOM   6268  O  OG   . SER B 2 79  ? 11.299  5.375   -5.913  1.00 0.00 ? 179 SER B OG   3  
ATOM   6269  H  H    . SER B 2 79  ? 10.447  3.025   -6.541  1.00 0.00 ? 179 SER B H    3  
ATOM   6270  H  HA   . SER B 2 79  ? 11.519  2.629   -4.021  1.00 0.00 ? 179 SER B HA   3  
ATOM   6271  H  HB2  . SER B 2 79  ? 12.391  4.984   -4.239  1.00 0.00 ? 179 SER B HB2  3  
ATOM   6272  H  HB3  . SER B 2 79  ? 12.726  3.946   -5.624  1.00 0.00 ? 179 SER B HB3  3  
ATOM   6273  H  HG   . SER B 2 79  ? 11.919  6.061   -6.169  1.00 0.00 ? 179 SER B HG   3  
ATOM   6274  N  N    . HIS B 2 80  ? 9.122   4.903   -4.024  1.00 0.00 ? 180 HIS B N    3  
ATOM   6275  C  CA   . HIS B 2 80  ? 8.147   5.586   -3.179  1.00 0.00 ? 180 HIS B CA   3  
ATOM   6276  C  C    . HIS B 2 80  ? 7.393   4.578   -2.313  1.00 0.00 ? 180 HIS B C    3  
ATOM   6277  O  O    . HIS B 2 80  ? 7.331   4.711   -1.092  1.00 0.00 ? 180 HIS B O    3  
ATOM   6278  C  CB   . HIS B 2 80  ? 7.166   6.382   -4.053  1.00 0.00 ? 180 HIS B CB   3  
ATOM   6279  C  CG   . HIS B 2 80  ? 5.786   6.517   -3.475  1.00 0.00 ? 180 HIS B CG   3  
ATOM   6280  N  ND1  . HIS B 2 80  ? 5.294   7.681   -2.931  1.00 0.00 ? 180 HIS B ND1  3  
ATOM   6281  C  CD2  . HIS B 2 80  ? 4.788   5.599   -3.363  1.00 0.00 ? 180 HIS B CD2  3  
ATOM   6282  C  CE1  . HIS B 2 80  ? 4.043   7.445   -2.515  1.00 0.00 ? 180 HIS B CE1  3  
ATOM   6283  N  NE2  . HIS B 2 80  ? 3.688   6.197   -2.754  1.00 0.00 ? 180 HIS B NE2  3  
ATOM   6284  H  H    . HIS B 2 80  ? 9.109   5.065   -4.991  1.00 0.00 ? 180 HIS B H    3  
ATOM   6285  H  HA   . HIS B 2 80  ? 8.683   6.271   -2.536  1.00 0.00 ? 180 HIS B HA   3  
ATOM   6286  H  HB2  . HIS B 2 80  ? 7.557   7.377   -4.203  1.00 0.00 ? 180 HIS B HB2  3  
ATOM   6287  H  HB3  . HIS B 2 80  ? 7.076   5.892   -5.013  1.00 0.00 ? 180 HIS B HB3  3  
ATOM   6288  H  HD1  . HIS B 2 80  ? 5.774   8.534   -2.860  1.00 0.00 ? 180 HIS B HD1  3  
ATOM   6289  H  HD2  . HIS B 2 80  ? 4.830   4.570   -3.690  1.00 0.00 ? 180 HIS B HD2  3  
ATOM   6290  H  HE1  . HIS B 2 80  ? 3.408   8.181   -2.044  1.00 0.00 ? 180 HIS B HE1  3  
ATOM   6291  N  N    . TRP B 2 81  ? 6.825   3.572   -2.966  1.00 0.00 ? 181 TRP B N    3  
ATOM   6292  C  CA   . TRP B 2 81  ? 6.067   2.526   -2.284  1.00 0.00 ? 181 TRP B CA   3  
ATOM   6293  C  C    . TRP B 2 81  ? 6.791   2.024   -1.038  1.00 0.00 ? 181 TRP B C    3  
ATOM   6294  O  O    . TRP B 2 81  ? 6.326   2.211   0.086   1.00 0.00 ? 181 TRP B O    3  
ATOM   6295  C  CB   . TRP B 2 81  ? 5.840   1.360   -3.243  1.00 0.00 ? 181 TRP B CB   3  
ATOM   6296  C  CG   . TRP B 2 81  ? 5.037   0.242   -2.656  1.00 0.00 ? 181 TRP B CG   3  
ATOM   6297  C  CD1  . TRP B 2 81  ? 5.502   -0.795  -1.900  1.00 0.00 ? 181 TRP B CD1  3  
ATOM   6298  C  CD2  . TRP B 2 81  ? 3.627   0.045   -2.787  1.00 0.00 ? 181 TRP B CD2  3  
ATOM   6299  N  NE1  . TRP B 2 81  ? 4.464   -1.626  -1.552  1.00 0.00 ? 181 TRP B NE1  3  
ATOM   6300  C  CE2  . TRP B 2 81  ? 3.302   -1.131  -2.086  1.00 0.00 ? 181 TRP B CE2  3  
ATOM   6301  C  CE3  . TRP B 2 81  ? 2.608   0.750   -3.430  1.00 0.00 ? 181 TRP B CE3  3  
ATOM   6302  C  CZ2  . TRP B 2 81  ? 2.000   -1.617  -2.011  1.00 0.00 ? 181 TRP B CZ2  3  
ATOM   6303  C  CZ3  . TRP B 2 81  ? 1.316   0.268   -3.355  1.00 0.00 ? 181 TRP B CZ3  3  
ATOM   6304  C  CH2  . TRP B 2 81  ? 1.022   -0.905  -2.651  1.00 0.00 ? 181 TRP B CH2  3  
ATOM   6305  H  H    . TRP B 2 81  ? 6.915   3.530   -3.941  1.00 0.00 ? 181 TRP B H    3  
ATOM   6306  H  HA   . TRP B 2 81  ? 5.110   2.936   -1.997  1.00 0.00 ? 181 TRP B HA   3  
ATOM   6307  H  HB2  . TRP B 2 81  ? 5.322   1.720   -4.116  1.00 0.00 ? 181 TRP B HB2  3  
ATOM   6308  H  HB3  . TRP B 2 81  ? 6.798   0.964   -3.541  1.00 0.00 ? 181 TRP B HB3  3  
ATOM   6309  H  HD1  . TRP B 2 81  ? 6.536   -0.930  -1.623  1.00 0.00 ? 181 TRP B HD1  3  
ATOM   6310  H  HE1  . TRP B 2 81  ? 4.542   -2.439  -1.011  1.00 0.00 ? 181 TRP B HE1  3  
ATOM   6311  H  HE3  . TRP B 2 81  ? 2.817   1.658   -3.978  1.00 0.00 ? 181 TRP B HE3  3  
ATOM   6312  H  HZ2  . TRP B 2 81  ? 1.757   -2.519  -1.470  1.00 0.00 ? 181 TRP B HZ2  3  
ATOM   6313  H  HZ3  . TRP B 2 81  ? 0.516   0.799   -3.847  1.00 0.00 ? 181 TRP B HZ3  3  
ATOM   6314  H  HH2  . TRP B 2 81  ? -0.001  -1.246  -2.621  1.00 0.00 ? 181 TRP B HH2  3  
ATOM   6315  N  N    . LYS B 2 82  ? 7.925   1.372   -1.256  1.00 0.00 ? 182 LYS B N    3  
ATOM   6316  C  CA   . LYS B 2 82  ? 8.720   0.821   -0.163  1.00 0.00 ? 182 LYS B CA   3  
ATOM   6317  C  C    . LYS B 2 82  ? 9.274   1.917   0.748   1.00 0.00 ? 182 LYS B C    3  
ATOM   6318  O  O    . LYS B 2 82  ? 9.725   1.636   1.858   1.00 0.00 ? 182 LYS B O    3  
ATOM   6319  C  CB   . LYS B 2 82  ? 9.871   -0.019  -0.721  1.00 0.00 ? 182 LYS B CB   3  
ATOM   6320  C  CG   . LYS B 2 82  ? 9.542   -1.499  -0.841  1.00 0.00 ? 182 LYS B CG   3  
ATOM   6321  C  CD   . LYS B 2 82  ? 10.301  -2.326  0.185   1.00 0.00 ? 182 LYS B CD   3  
ATOM   6322  C  CE   . LYS B 2 82  ? 9.748   -3.738  0.283   1.00 0.00 ? 182 LYS B CE   3  
ATOM   6323  N  NZ   . LYS B 2 82  ? 9.591   -4.367  -1.058  1.00 0.00 ? 182 LYS B NZ   3  
ATOM   6324  H  H    . LYS B 2 82  ? 8.231   1.249   -2.180  1.00 0.00 ? 182 LYS B H    3  
ATOM   6325  H  HA   . LYS B 2 82  ? 8.076   0.181   0.421   1.00 0.00 ? 182 LYS B HA   3  
ATOM   6326  H  HB2  . LYS B 2 82  ? 10.128  0.351   -1.702  1.00 0.00 ? 182 LYS B HB2  3  
ATOM   6327  H  HB3  . LYS B 2 82  ? 10.727  0.087   -0.071  1.00 0.00 ? 182 LYS B HB3  3  
ATOM   6328  H  HG2  . LYS B 2 82  ? 8.483   -1.636  -0.685  1.00 0.00 ? 182 LYS B HG2  3  
ATOM   6329  H  HG3  . LYS B 2 82  ? 9.810   -1.837  -1.831  1.00 0.00 ? 182 LYS B HG3  3  
ATOM   6330  H  HD2  . LYS B 2 82  ? 11.341  -2.376  -0.104  1.00 0.00 ? 182 LYS B HD2  3  
ATOM   6331  H  HD3  . LYS B 2 82  ? 10.219  -1.848  1.151   1.00 0.00 ? 182 LYS B HD3  3  
ATOM   6332  H  HE2  . LYS B 2 82  ? 10.426  -4.336  0.874   1.00 0.00 ? 182 LYS B HE2  3  
ATOM   6333  H  HE3  . LYS B 2 82  ? 8.785   -3.701  0.769   1.00 0.00 ? 182 LYS B HE3  3  
ATOM   6334  H  HZ1  . LYS B 2 82  ? 8.634   -4.189  -1.426  1.00 0.00 ? 182 LYS B HZ1  3  
ATOM   6335  H  HZ2  . LYS B 2 82  ? 9.738   -5.394  -0.991  1.00 0.00 ? 182 LYS B HZ2  3  
ATOM   6336  H  HZ3  . LYS B 2 82  ? 10.286  -3.971  -1.722  1.00 0.00 ? 182 LYS B HZ3  3  
ATOM   6337  N  N    . ASN B 2 83  ? 9.248   3.160   0.278   1.00 0.00 ? 183 ASN B N    3  
ATOM   6338  C  CA   . ASN B 2 83  ? 9.762   4.276   1.064   1.00 0.00 ? 183 ASN B CA   3  
ATOM   6339  C  C    . ASN B 2 83  ? 8.656   5.260   1.439   1.00 0.00 ? 183 ASN B C    3  
ATOM   6340  O  O    . ASN B 2 83  ? 8.931   6.411   1.781   1.00 0.00 ? 183 ASN B O    3  
ATOM   6341  C  CB   . ASN B 2 83  ? 10.863  5.001   0.289   1.00 0.00 ? 183 ASN B CB   3  
ATOM   6342  C  CG   . ASN B 2 83  ? 12.043  5.367   1.166   1.00 0.00 ? 183 ASN B CG   3  
ATOM   6343  O  OD1  . ASN B 2 83  ? 11.891  6.039   2.186   1.00 0.00 ? 183 ASN B OD1  3  
ATOM   6344  N  ND2  . ASN B 2 83  ? 13.231  4.924   0.771   1.00 0.00 ? 183 ASN B ND2  3  
ATOM   6345  H  H    . ASN B 2 83  ? 8.884   3.330   -0.616  1.00 0.00 ? 183 ASN B H    3  
ATOM   6346  H  HA   . ASN B 2 83  ? 10.186  3.872   1.972   1.00 0.00 ? 183 ASN B HA   3  
ATOM   6347  H  HB2  . ASN B 2 83  ? 11.216  4.361   -0.505  1.00 0.00 ? 183 ASN B HB2  3  
ATOM   6348  H  HB3  . ASN B 2 83  ? 10.459  5.908   -0.136  1.00 0.00 ? 183 ASN B HB3  3  
ATOM   6349  H  HD21 . ASN B 2 83  ? 13.276  4.393   -0.051  1.00 0.00 ? 183 ASN B HD21 3  
ATOM   6350  H  HD22 . ASN B 2 83  ? 14.014  5.146   1.317   1.00 0.00 ? 183 ASN B HD22 3  
ATOM   6351  N  N    . CYS B 2 84  ? 7.407   4.809   1.375   1.00 0.00 ? 184 CYS B N    3  
ATOM   6352  C  CA   . CYS B 2 84  ? 6.274   5.662   1.710   1.00 0.00 ? 184 CYS B CA   3  
ATOM   6353  C  C    . CYS B 2 84  ? 5.954   5.580   3.199   1.00 0.00 ? 184 CYS B C    3  
ATOM   6354  O  O    . CYS B 2 84  ? 6.196   4.557   3.840   1.00 0.00 ? 184 CYS B O    3  
ATOM   6355  C  CB   . CYS B 2 84  ? 5.047   5.262   0.889   1.00 0.00 ? 184 CYS B CB   3  
ATOM   6356  S  SG   . CYS B 2 84  ? 3.797   6.577   0.734   1.00 0.00 ? 184 CYS B SG   3  
ATOM   6357  H  H    . CYS B 2 84  ? 7.244   3.886   1.094   1.00 0.00 ? 184 CYS B H    3  
ATOM   6358  H  HA   . CYS B 2 84  ? 6.542   6.679   1.468   1.00 0.00 ? 184 CYS B HA   3  
ATOM   6359  H  HB2  . CYS B 2 84  ? 5.364   4.992   -0.108  1.00 0.00 ? 184 CYS B HB2  3  
ATOM   6360  H  HB3  . CYS B 2 84  ? 4.575   4.410   1.353   1.00 0.00 ? 184 CYS B HB3  3  
ATOM   6361  N  N    . THR B 2 85  ? 5.412   6.665   3.744   1.00 0.00 ? 185 THR B N    3  
ATOM   6362  C  CA   . THR B 2 85  ? 5.061   6.719   5.158   1.00 0.00 ? 185 THR B CA   3  
ATOM   6363  C  C    . THR B 2 85  ? 4.148   5.558   5.542   1.00 0.00 ? 185 THR B C    3  
ATOM   6364  O  O    . THR B 2 85  ? 3.174   5.266   4.848   1.00 0.00 ? 185 THR B O    3  
ATOM   6365  C  CB   . THR B 2 85  ? 4.378   8.048   5.484   1.00 0.00 ? 185 THR B CB   3  
ATOM   6366  O  OG1  . THR B 2 85  ? 3.273   8.267   4.626   1.00 0.00 ? 185 THR B OG1  3  
ATOM   6367  C  CG2  . THR B 2 85  ? 5.301   9.241   5.359   1.00 0.00 ? 185 THR B CG2  3  
ATOM   6368  H  H    . THR B 2 85  ? 5.246   7.449   3.180   1.00 0.00 ? 185 THR B H    3  
ATOM   6369  H  HA   . THR B 2 85  ? 5.974   6.646   5.729   1.00 0.00 ? 185 THR B HA   3  
ATOM   6370  H  HB   . THR B 2 85  ? 4.015   8.016   6.502   1.00 0.00 ? 185 THR B HB   3  
ATOM   6371  H  HG1  . THR B 2 85  ? 3.588   8.420   3.731   1.00 0.00 ? 185 THR B HG1  3  
ATOM   6372  H  HG21 . THR B 2 85  ? 4.750   10.146  5.567   1.00 0.00 ? 185 THR B HG21 3  
ATOM   6373  H  HG22 . THR B 2 85  ? 5.699   9.284   4.357   1.00 0.00 ? 185 THR B HG22 3  
ATOM   6374  H  HG23 . THR B 2 85  ? 6.112   9.144   6.066   1.00 0.00 ? 185 THR B HG23 3  
ATOM   6375  N  N    . ARG B 2 86  ? 4.481   4.893   6.650   1.00 0.00 ? 186 ARG B N    3  
ATOM   6376  C  CA   . ARG B 2 86  ? 3.713   3.754   7.141   1.00 0.00 ? 186 ARG B CA   3  
ATOM   6377  C  C    . ARG B 2 86  ? 2.210   3.948   6.937   1.00 0.00 ? 186 ARG B C    3  
ATOM   6378  O  O    . ARG B 2 86  ? 1.591   3.255   6.129   1.00 0.00 ? 186 ARG B O    3  
ATOM   6379  C  CB   . ARG B 2 86  ? 4.008   3.504   8.626   1.00 0.00 ? 186 ARG B CB   3  
ATOM   6380  C  CG   . ARG B 2 86  ? 4.397   4.755   9.403   1.00 0.00 ? 186 ARG B CG   3  
ATOM   6381  C  CD   . ARG B 2 86  ? 5.903   4.842   9.600   1.00 0.00 ? 186 ARG B CD   3  
ATOM   6382  N  NE   . ARG B 2 86  ? 6.254   5.320   10.935  1.00 0.00 ? 186 ARG B NE   3  
ATOM   6383  C  CZ   . ARG B 2 86  ? 7.496   5.613   11.314  1.00 0.00 ? 186 ARG B CZ   3  
ATOM   6384  N  NH1  . ARG B 2 86  ? 8.506   5.478   10.465  1.00 0.00 ? 186 ARG B NH1  3  
ATOM   6385  N  NH2  . ARG B 2 86  ? 7.729   6.042   12.548  1.00 0.00 ? 186 ARG B NH2  3  
ATOM   6386  H  H    . ARG B 2 86  ? 5.272   5.169   7.145   1.00 0.00 ? 186 ARG B H    3  
ATOM   6387  H  HA   . ARG B 2 86  ? 4.030   2.895   6.580   1.00 0.00 ? 186 ARG B HA   3  
ATOM   6388  H  HB2  . ARG B 2 86  ? 3.128   3.081   9.088   1.00 0.00 ? 186 ARG B HB2  3  
ATOM   6389  H  HB3  . ARG B 2 86  ? 4.817   2.793   8.703   1.00 0.00 ? 186 ARG B HB3  3  
ATOM   6390  H  HG2  . ARG B 2 86  ? 4.065   5.623   8.857   1.00 0.00 ? 186 ARG B HG2  3  
ATOM   6391  H  HG3  . ARG B 2 86  ? 3.916   4.729   10.370  1.00 0.00 ? 186 ARG B HG3  3  
ATOM   6392  H  HD2  . ARG B 2 86  ? 6.330   3.861   9.456   1.00 0.00 ? 186 ARG B HD2  3  
ATOM   6393  H  HD3  . ARG B 2 86  ? 6.309   5.522   8.866   1.00 0.00 ? 186 ARG B HD3  3  
ATOM   6394  H  HE   . ARG B 2 86  ? 5.527   5.429   11.583  1.00 0.00 ? 186 ARG B HE   3  
ATOM   6395  H  HH11 . ARG B 2 86  ? 8.338   5.155   9.534   1.00 0.00 ? 186 ARG B HH11 3  
ATOM   6396  H  HH12 . ARG B 2 86  ? 9.437   5.699   10.756  1.00 0.00 ? 186 ARG B HH12 3  
ATOM   6397  H  HH21 . ARG B 2 86  ? 6.972   6.146   13.192  1.00 0.00 ? 186 ARG B HH21 3  
ATOM   6398  H  HH22 . ARG B 2 86  ? 8.662   6.261   12.833  1.00 0.00 ? 186 ARG B HH22 3  
ATOM   6399  N  N    . HIS B 2 87  ? 1.630   4.891   7.672   1.00 0.00 ? 187 HIS B N    3  
ATOM   6400  C  CA   . HIS B 2 87  ? 0.202   5.171   7.568   1.00 0.00 ? 187 HIS B CA   3  
ATOM   6401  C  C    . HIS B 2 87  ? -0.042  6.607   7.113   1.00 0.00 ? 187 HIS B C    3  
ATOM   6402  O  O    . HIS B 2 87  ? -0.416  7.467   7.911   1.00 0.00 ? 187 HIS B O    3  
ATOM   6403  C  CB   . HIS B 2 87  ? -0.495  4.921   8.908   1.00 0.00 ? 187 HIS B CB   3  
ATOM   6404  C  CG   . HIS B 2 87  ? 0.343   5.266   10.101  1.00 0.00 ? 187 HIS B CG   3  
ATOM   6405  N  ND1  . HIS B 2 87  ? 1.002   4.319   10.857  1.00 0.00 ? 187 HIS B ND1  3  
ATOM   6406  C  CD2  . HIS B 2 87  ? 0.630   6.463   10.667  1.00 0.00 ? 187 HIS B CD2  3  
ATOM   6407  C  CE1  . HIS B 2 87  ? 1.656   4.918   11.836  1.00 0.00 ? 187 HIS B CE1  3  
ATOM   6408  N  NE2  . HIS B 2 87  ? 1.448   6.218   11.743  1.00 0.00 ? 187 HIS B NE2  3  
ATOM   6409  H  H    . HIS B 2 87  ? 2.175   5.411   8.299   1.00 0.00 ? 187 HIS B H    3  
ATOM   6410  H  HA   . HIS B 2 87  ? -0.212  4.501   6.829   1.00 0.00 ? 187 HIS B HA   3  
ATOM   6411  H  HB2  . HIS B 2 87  ? -1.395  5.517   8.954   1.00 0.00 ? 187 HIS B HB2  3  
ATOM   6412  H  HB3  . HIS B 2 87  ? -0.759  3.876   8.978   1.00 0.00 ? 187 HIS B HB3  3  
ATOM   6413  H  HD1  . HIS B 2 87  ? 0.989   3.353   10.699  1.00 0.00 ? 187 HIS B HD1  3  
ATOM   6414  H  HD2  . HIS B 2 87  ? 0.281   7.429   10.334  1.00 0.00 ? 187 HIS B HD2  3  
ATOM   6415  H  HE1  . HIS B 2 87  ? 2.259   4.426   12.585  1.00 0.00 ? 187 HIS B HE1  3  
ATOM   6416  H  HE2  . HIS B 2 87  ? 1.899   6.901   12.280  1.00 0.00 ? 187 HIS B HE2  3  
ATOM   6417  N  N    . ASP B 2 88  ? 0.173   6.859   5.824   1.00 0.00 ? 188 ASP B N    3  
ATOM   6418  C  CA   . ASP B 2 88  ? -0.025  8.189   5.258   1.00 0.00 ? 188 ASP B CA   3  
ATOM   6419  C  C    . ASP B 2 88  ? 0.324   8.201   3.772   1.00 0.00 ? 188 ASP B C    3  
ATOM   6420  O  O    . ASP B 2 88  ? 1.244   8.898   3.341   1.00 0.00 ? 188 ASP B O    3  
ATOM   6421  C  CB   . ASP B 2 88  ? 0.823   9.220   6.011   1.00 0.00 ? 188 ASP B CB   3  
ATOM   6422  C  CG   . ASP B 2 88  ? -0.014  10.113  6.906   1.00 0.00 ? 188 ASP B CG   3  
ATOM   6423  O  OD1  . ASP B 2 88  ? -1.192  10.354  6.569   1.00 0.00 ? 188 ASP B OD1  3  
ATOM   6424  O  OD2  . ASP B 2 88  ? 0.508   10.572  7.944   1.00 0.00 ? 188 ASP B OD2  3  
ATOM   6425  H  H    . ASP B 2 88  ? 0.469   6.130   5.240   1.00 0.00 ? 188 ASP B H    3  
ATOM   6426  H  HA   . ASP B 2 88  ? -1.068  8.444   5.372   1.00 0.00 ? 188 ASP B HA   3  
ATOM   6427  H  HB2  . ASP B 2 88  ? 1.545   8.704   6.627   1.00 0.00 ? 188 ASP B HB2  3  
ATOM   6428  H  HB3  . ASP B 2 88  ? 1.344   9.843   5.300   1.00 0.00 ? 188 ASP B HB3  3  
ATOM   6429  N  N    . CYS B 2 89  ? -0.418  7.424   2.990   1.00 0.00 ? 189 CYS B N    3  
ATOM   6430  C  CA   . CYS B 2 89  ? -0.186  7.344   1.552   1.00 0.00 ? 189 CYS B CA   3  
ATOM   6431  C  C    . CYS B 2 89  ? -1.508  7.232   0.793   1.00 0.00 ? 189 CYS B C    3  
ATOM   6432  O  O    . CYS B 2 89  ? -2.393  6.474   1.187   1.00 0.00 ? 189 CYS B O    3  
ATOM   6433  C  CB   . CYS B 2 89  ? 0.704   6.144   1.226   1.00 0.00 ? 189 CYS B CB   3  
ATOM   6434  S  SG   . CYS B 2 89  ? 1.906   6.452   -0.109  1.00 0.00 ? 189 CYS B SG   3  
ATOM   6435  H  H    . CYS B 2 89  ? -1.137  6.890   3.389   1.00 0.00 ? 189 CYS B H    3  
ATOM   6436  H  HA   . CYS B 2 89  ? 0.318   8.248   1.249   1.00 0.00 ? 189 CYS B HA   3  
ATOM   6437  H  HB2  . CYS B 2 89  ? 1.259   5.867   2.109   1.00 0.00 ? 189 CYS B HB2  3  
ATOM   6438  H  HB3  . CYS B 2 89  ? 0.081   5.315   0.923   1.00 0.00 ? 189 CYS B HB3  3  
ATOM   6439  N  N    . PRO B 2 90  ? -1.662  7.990   -0.306  1.00 0.00 ? 190 PRO B N    3  
ATOM   6440  C  CA   . PRO B 2 90  ? -2.879  7.974   -1.112  1.00 0.00 ? 190 PRO B CA   3  
ATOM   6441  C  C    . PRO B 2 90  ? -2.865  6.884   -2.183  1.00 0.00 ? 190 PRO B C    3  
ATOM   6442  O  O    . PRO B 2 90  ? -3.909  6.522   -2.724  1.00 0.00 ? 190 PRO B O    3  
ATOM   6443  C  CB   . PRO B 2 90  ? -2.860  9.355   -1.758  1.00 0.00 ? 190 PRO B CB   3  
ATOM   6444  C  CG   . PRO B 2 90  ? -1.410  9.661   -1.944  1.00 0.00 ? 190 PRO B CG   3  
ATOM   6445  C  CD   . PRO B 2 90  ? -0.664  8.933   -0.850  1.00 0.00 ? 190 PRO B CD   3  
ATOM   6446  H  HA   . PRO B 2 90  ? -3.762  7.869   -0.500  1.00 0.00 ? 190 PRO B HA   3  
ATOM   6447  H  HB2  . PRO B 2 90  ? -3.384  9.321   -2.701  1.00 0.00 ? 190 PRO B HB2  3  
ATOM   6448  H  HB3  . PRO B 2 90  ? -3.332  10.070  -1.101  1.00 0.00 ? 190 PRO B HB3  3  
ATOM   6449  H  HG2  . PRO B 2 90  ? -1.086  9.312   -2.913  1.00 0.00 ? 190 PRO B HG2  3  
ATOM   6450  H  HG3  . PRO B 2 90  ? -1.249  10.726  -1.859  1.00 0.00 ? 190 PRO B HG3  3  
ATOM   6451  H  HD2  . PRO B 2 90  ? 0.181   8.401   -1.262  1.00 0.00 ? 190 PRO B HD2  3  
ATOM   6452  H  HD3  . PRO B 2 90  ? -0.339  9.628   -0.091  1.00 0.00 ? 190 PRO B HD3  3  
ATOM   6453  N  N    . VAL B 2 91  ? -1.677  6.372   -2.492  1.00 0.00 ? 191 VAL B N    3  
ATOM   6454  C  CA   . VAL B 2 91  ? -1.534  5.333   -3.505  1.00 0.00 ? 191 VAL B CA   3  
ATOM   6455  C  C    . VAL B 2 91  ? -1.528  3.937   -2.884  1.00 0.00 ? 191 VAL B C    3  
ATOM   6456  O  O    . VAL B 2 91  ? -2.330  3.079   -3.254  1.00 0.00 ? 191 VAL B O    3  
ATOM   6457  C  CB   . VAL B 2 91  ? -0.241  5.524   -4.324  1.00 0.00 ? 191 VAL B CB   3  
ATOM   6458  C  CG1  . VAL B 2 91  ? -0.175  4.521   -5.466  1.00 0.00 ? 191 VAL B CG1  3  
ATOM   6459  C  CG2  . VAL B 2 91  ? -0.154  6.949   -4.853  1.00 0.00 ? 191 VAL B CG2  3  
ATOM   6460  H  H    . VAL B 2 91  ? -0.877  6.703   -2.033  1.00 0.00 ? 191 VAL B H    3  
ATOM   6461  H  HA   . VAL B 2 91  ? -2.374  5.409   -4.180  1.00 0.00 ? 191 VAL B HA   3  
ATOM   6462  H  HB   . VAL B 2 91  ? 0.606   5.352   -3.673  1.00 0.00 ? 191 VAL B HB   3  
ATOM   6463  H  HG11 . VAL B 2 91  ? 0.425   3.674   -5.166  1.00 0.00 ? 191 VAL B HG11 3  
ATOM   6464  H  HG12 . VAL B 2 91  ? 0.272   4.988   -6.332  1.00 0.00 ? 191 VAL B HG12 3  
ATOM   6465  H  HG13 . VAL B 2 91  ? -1.172  4.187   -5.711  1.00 0.00 ? 191 VAL B HG13 3  
ATOM   6466  H  HG21 . VAL B 2 91  ? 0.776   7.077   -5.388  1.00 0.00 ? 191 VAL B HG21 3  
ATOM   6467  H  HG22 . VAL B 2 91  ? -0.192  7.642   -4.027  1.00 0.00 ? 191 VAL B HG22 3  
ATOM   6468  H  HG23 . VAL B 2 91  ? -0.982  7.136   -5.521  1.00 0.00 ? 191 VAL B HG23 3  
ATOM   6469  N  N    . CYS B 2 92  ? -0.615  3.715   -1.946  1.00 0.00 ? 192 CYS B N    3  
ATOM   6470  C  CA   . CYS B 2 92  ? -0.500  2.420   -1.283  1.00 0.00 ? 192 CYS B CA   3  
ATOM   6471  C  C    . CYS B 2 92  ? -1.776  2.067   -0.523  1.00 0.00 ? 192 CYS B C    3  
ATOM   6472  O  O    . CYS B 2 92  ? -2.103  0.892   -0.353  1.00 0.00 ? 192 CYS B O    3  
ATOM   6473  C  CB   . CYS B 2 92  ? 0.694   2.415   -0.326  1.00 0.00 ? 192 CYS B CB   3  
ATOM   6474  S  SG   . CYS B 2 92  ? 2.216   3.133   -1.029  1.00 0.00 ? 192 CYS B SG   3  
ATOM   6475  H  H    . CYS B 2 92  ? 0.001   4.435   -1.697  1.00 0.00 ? 192 CYS B H    3  
ATOM   6476  H  HA   . CYS B 2 92  ? -0.337  1.674   -2.046  1.00 0.00 ? 192 CYS B HA   3  
ATOM   6477  H  HB2  . CYS B 2 92  ? 0.441   2.984   0.556   1.00 0.00 ? 192 CYS B HB2  3  
ATOM   6478  H  HB3  . CYS B 2 92  ? 0.912   1.397   -0.041  1.00 0.00 ? 192 CYS B HB3  3  
ATOM   6479  N  N    . LEU B 2 93  ? -2.495  3.087   -0.065  1.00 0.00 ? 193 LEU B N    3  
ATOM   6480  C  CA   . LEU B 2 93  ? -3.733  2.875   0.679   1.00 0.00 ? 193 LEU B CA   3  
ATOM   6481  C  C    . LEU B 2 93  ? -4.772  2.149   -0.175  1.00 0.00 ? 193 LEU B C    3  
ATOM   6482  O  O    . LEU B 2 93  ? -5.191  1.040   0.156   1.00 0.00 ? 193 LEU B O    3  
ATOM   6483  C  CB   . LEU B 2 93  ? -4.298  4.212   1.168   1.00 0.00 ? 193 LEU B CB   3  
ATOM   6484  C  CG   . LEU B 2 93  ? -4.010  4.542   2.635   1.00 0.00 ? 193 LEU B CG   3  
ATOM   6485  C  CD1  . LEU B 2 93  ? -2.527  4.390   2.939   1.00 0.00 ? 193 LEU B CD1  3  
ATOM   6486  C  CD2  . LEU B 2 93  ? -4.485  5.950   2.966   1.00 0.00 ? 193 LEU B CD2  3  
ATOM   6487  H  H    . LEU B 2 93  ? -2.186  4.003   -0.228  1.00 0.00 ? 193 LEU B H    3  
ATOM   6488  H  HA   . LEU B 2 93  ? -3.500  2.260   1.536   1.00 0.00 ? 193 LEU B HA   3  
ATOM   6489  H  HB2  . LEU B 2 93  ? -3.884  4.998   0.555   1.00 0.00 ? 193 LEU B HB2  3  
ATOM   6490  H  HB3  . LEU B 2 93  ? -5.369  4.200   1.030   1.00 0.00 ? 193 LEU B HB3  3  
ATOM   6491  H  HG   . LEU B 2 93  ? -4.552  3.850   3.264   1.00 0.00 ? 193 LEU B HG   3  
ATOM   6492  H  HD11 . LEU B 2 93  ? -2.203  5.203   3.573   1.00 0.00 ? 193 LEU B HD11 3  
ATOM   6493  H  HD12 . LEU B 2 93  ? -1.967  4.408   2.016   1.00 0.00 ? 193 LEU B HD12 3  
ATOM   6494  H  HD13 . LEU B 2 93  ? -2.358  3.451   3.445   1.00 0.00 ? 193 LEU B HD13 3  
ATOM   6495  H  HD21 . LEU B 2 93  ? -4.532  6.536   2.060   1.00 0.00 ? 193 LEU B HD21 3  
ATOM   6496  H  HD22 . LEU B 2 93  ? -3.795  6.409   3.658   1.00 0.00 ? 193 LEU B HD22 3  
ATOM   6497  H  HD23 . LEU B 2 93  ? -5.466  5.902   3.414   1.00 0.00 ? 193 LEU B HD23 3  
ATOM   6498  N  N    . PRO B 2 94  ? -5.208  2.766   -1.287  1.00 0.00 ? 194 PRO B N    3  
ATOM   6499  C  CA   . PRO B 2 94  ? -6.207  2.166   -2.179  1.00 0.00 ? 194 PRO B CA   3  
ATOM   6500  C  C    . PRO B 2 94  ? -5.721  0.865   -2.810  1.00 0.00 ? 194 PRO B C    3  
ATOM   6501  O  O    . PRO B 2 94  ? -6.523  0.014   -3.193  1.00 0.00 ? 194 PRO B O    3  
ATOM   6502  C  CB   . PRO B 2 94  ? -6.424  3.235   -3.256  1.00 0.00 ? 194 PRO B CB   3  
ATOM   6503  C  CG   . PRO B 2 94  ? -5.211  4.098   -3.196  1.00 0.00 ? 194 PRO B CG   3  
ATOM   6504  C  CD   . PRO B 2 94  ? -4.771  4.090   -1.761  1.00 0.00 ? 194 PRO B CD   3  
ATOM   6505  H  HA   . PRO B 2 94  ? -7.137  1.983   -1.660  1.00 0.00 ? 194 PRO B HA   3  
ATOM   6506  H  HB2  . PRO B 2 94  ? -6.524  2.760   -4.222  1.00 0.00 ? 194 PRO B HB2  3  
ATOM   6507  H  HB3  . PRO B 2 94  ? -7.319  3.797   -3.033  1.00 0.00 ? 194 PRO B HB3  3  
ATOM   6508  H  HG2  . PRO B 2 94  ? -4.437  3.687   -3.829  1.00 0.00 ? 194 PRO B HG2  3  
ATOM   6509  H  HG3  . PRO B 2 94  ? -5.459  5.102   -3.508  1.00 0.00 ? 194 PRO B HG3  3  
ATOM   6510  H  HD2  . PRO B 2 94  ? -3.698  4.191   -1.695  1.00 0.00 ? 194 PRO B HD2  3  
ATOM   6511  H  HD3  . PRO B 2 94  ? -5.262  4.879   -1.211  1.00 0.00 ? 194 PRO B HD3  3  
ATOM   6512  N  N    . LEU B 2 95  ? -4.405  0.718   -2.922  1.00 0.00 ? 195 LEU B N    3  
ATOM   6513  C  CA   . LEU B 2 95  ? -3.821  -0.475  -3.514  1.00 0.00 ? 195 LEU B CA   3  
ATOM   6514  C  C    . LEU B 2 95  ? -3.789  -1.631  -2.517  1.00 0.00 ? 195 LEU B C    3  
ATOM   6515  O  O    . LEU B 2 95  ? -4.018  -2.783  -2.884  1.00 0.00 ? 195 LEU B O    3  
ATOM   6516  C  CB   . LEU B 2 95  ? -2.408  -0.173  -4.011  1.00 0.00 ? 195 LEU B CB   3  
ATOM   6517  C  CG   . LEU B 2 95  ? -2.222  -0.272  -5.526  1.00 0.00 ? 195 LEU B CG   3  
ATOM   6518  C  CD1  . LEU B 2 95  ? -0.761  -0.072  -5.899  1.00 0.00 ? 195 LEU B CD1  3  
ATOM   6519  C  CD2  . LEU B 2 95  ? -2.731  -1.612  -6.042  1.00 0.00 ? 195 LEU B CD2  3  
ATOM   6520  H  H    . LEU B 2 95  ? -3.811  1.428   -2.608  1.00 0.00 ? 195 LEU B H    3  
ATOM   6521  H  HA   . LEU B 2 95  ? -4.434  -0.759  -4.355  1.00 0.00 ? 195 LEU B HA   3  
ATOM   6522  H  HB2  . LEU B 2 95  ? -2.150  0.830   -3.702  1.00 0.00 ? 195 LEU B HB2  3  
ATOM   6523  H  HB3  . LEU B 2 95  ? -1.727  -0.861  -3.540  1.00 0.00 ? 195 LEU B HB3  3  
ATOM   6524  H  HG   . LEU B 2 95  ? -2.796  0.510   -6.001  1.00 0.00 ? 195 LEU B HG   3  
ATOM   6525  H  HD11 . LEU B 2 95  ? -0.531  0.983   -5.902  1.00 0.00 ? 195 LEU B HD11 3  
ATOM   6526  H  HD12 . LEU B 2 95  ? -0.581  -0.484  -6.881  1.00 0.00 ? 195 LEU B HD12 3  
ATOM   6527  H  HD13 . LEU B 2 95  ? -0.134  -0.575  -5.178  1.00 0.00 ? 195 LEU B HD13 3  
ATOM   6528  H  HD21 . LEU B 2 95  ? -3.066  -2.216  -5.212  1.00 0.00 ? 195 LEU B HD21 3  
ATOM   6529  H  HD22 . LEU B 2 95  ? -1.934  -2.125  -6.560  1.00 0.00 ? 195 LEU B HD22 3  
ATOM   6530  H  HD23 . LEU B 2 95  ? -3.553  -1.446  -6.722  1.00 0.00 ? 195 LEU B HD23 3  
ATOM   6531  N  N    . LYS B 2 96  ? -3.499  -1.320  -1.258  1.00 0.00 ? 196 LYS B N    3  
ATOM   6532  C  CA   . LYS B 2 96  ? -3.435  -2.341  -0.220  1.00 0.00 ? 196 LYS B CA   3  
ATOM   6533  C  C    . LYS B 2 96  ? -3.891  -1.788  1.128   1.00 0.00 ? 196 LYS B C    3  
ATOM   6534  O  O    . LYS B 2 96  ? -3.158  -1.847  2.116   1.00 0.00 ? 196 LYS B O    3  
ATOM   6535  C  CB   . LYS B 2 96  ? -2.011  -2.890  -0.109  1.00 0.00 ? 196 LYS B CB   3  
ATOM   6536  C  CG   . LYS B 2 96  ? -1.855  -3.958  0.960   1.00 0.00 ? 196 LYS B CG   3  
ATOM   6537  C  CD   . LYS B 2 96  ? -0.840  -5.016  0.553   1.00 0.00 ? 196 LYS B CD   3  
ATOM   6538  C  CE   . LYS B 2 96  ? 0.353   -5.040  1.496   1.00 0.00 ? 196 LYS B CE   3  
ATOM   6539  N  NZ   . LYS B 2 96  ? -0.036  -5.448  2.873   1.00 0.00 ? 196 LYS B NZ   3  
ATOM   6540  H  H    . LYS B 2 96  ? -3.321  -0.386  -1.021  1.00 0.00 ? 196 LYS B H    3  
ATOM   6541  H  HA   . LYS B 2 96  ? -4.096  -3.143  -0.508  1.00 0.00 ? 196 LYS B HA   3  
ATOM   6542  H  HB2  . LYS B 2 96  ? -1.726  -3.317  -1.058  1.00 0.00 ? 196 LYS B HB2  3  
ATOM   6543  H  HB3  . LYS B 2 96  ? -1.341  -2.076  0.126   1.00 0.00 ? 196 LYS B HB3  3  
ATOM   6544  H  HG2  . LYS B 2 96  ? -1.525  -3.490  1.876   1.00 0.00 ? 196 LYS B HG2  3  
ATOM   6545  H  HG3  . LYS B 2 96  ? -2.812  -4.432  1.121   1.00 0.00 ? 196 LYS B HG3  3  
ATOM   6546  H  HD2  . LYS B 2 96  ? -1.317  -5.984  0.569   1.00 0.00 ? 196 LYS B HD2  3  
ATOM   6547  H  HD3  . LYS B 2 96  ? -0.492  -4.802  -0.449  1.00 0.00 ? 196 LYS B HD3  3  
ATOM   6548  H  HE2  . LYS B 2 96  ? 1.082   -5.739  1.115   1.00 0.00 ? 196 LYS B HE2  3  
ATOM   6549  H  HE3  . LYS B 2 96  ? 0.787   -4.051  1.531   1.00 0.00 ? 196 LYS B HE3  3  
ATOM   6550  H  HZ1  . LYS B 2 96  ? -1.026  -5.184  3.059   1.00 0.00 ? 196 LYS B HZ1  3  
ATOM   6551  H  HZ2  . LYS B 2 96  ? 0.572   -4.976  3.572   1.00 0.00 ? 196 LYS B HZ2  3  
ATOM   6552  H  HZ3  . LYS B 2 96  ? 0.064   -6.478  2.982   1.00 0.00 ? 196 LYS B HZ3  3  
ATOM   6553  N  N    . ASN B 2 97  ? -5.111  -1.256  1.164   1.00 0.00 ? 197 ASN B N    3  
ATOM   6554  C  CA   . ASN B 2 97  ? -5.675  -0.699  2.383   1.00 0.00 ? 197 ASN B CA   3  
ATOM   6555  C  C    . ASN B 2 97  ? -6.953  0.079   2.083   1.00 0.00 ? 197 ASN B C    3  
ATOM   6556  O  O    . ASN B 2 97  ? -6.927  1.300   1.923   1.00 0.00 ? 197 ASN B O    3  
ATOM   6557  C  CB   . ASN B 2 97  ? -4.662  0.209   3.090   1.00 0.00 ? 197 ASN B CB   3  
ATOM   6558  C  CG   . ASN B 2 97  ? -4.190  -0.371  4.410   1.00 0.00 ? 197 ASN B CG   3  
ATOM   6559  O  OD1  . ASN B 2 97  ? -3.129  -0.993  4.484   1.00 0.00 ? 197 ASN B OD1  3  
ATOM   6560  N  ND2  . ASN B 2 97  ? -4.977  -0.170  5.460   1.00 0.00 ? 197 ASN B ND2  3  
ATOM   6561  H  H    . ASN B 2 97  ? -5.647  -1.243  0.351   1.00 0.00 ? 197 ASN B H    3  
ATOM   6562  H  HA   . ASN B 2 97  ? -5.919  -1.523  3.027   1.00 0.00 ? 197 ASN B HA   3  
ATOM   6563  H  HB2  . ASN B 2 97  ? -3.803  0.345   2.451   1.00 0.00 ? 197 ASN B HB2  3  
ATOM   6564  H  HB3  . ASN B 2 97  ? -5.118  1.170   3.283   1.00 0.00 ? 197 ASN B HB3  3  
ATOM   6565  H  HD21 . ASN B 2 97  ? -5.807  0.334   5.327   1.00 0.00 ? 197 ASN B HD21 3  
ATOM   6566  H  HD22 . ASN B 2 97  ? -4.696  -0.534  6.326   1.00 0.00 ? 197 ASN B HD22 3  
ATOM   6567  N  N    . ALA B 2 98  ? -8.070  -0.638  2.006   1.00 0.00 ? 198 ALA B N    3  
ATOM   6568  C  CA   . ALA B 2 98  ? -9.359  -0.017  1.726   1.00 0.00 ? 198 ALA B CA   3  
ATOM   6569  C  C    . ALA B 2 98  ? -10.508 -0.947  2.100   1.00 0.00 ? 198 ALA B C    3  
ATOM   6570  O  O    . ALA B 2 98  ? -10.433 -2.158  1.890   1.00 0.00 ? 198 ALA B O    3  
ATOM   6571  C  CB   . ALA B 2 98  ? -9.449  0.371   0.257   1.00 0.00 ? 198 ALA B CB   3  
ATOM   6572  H  H    . ALA B 2 98  ? -8.026  -1.607  2.144   1.00 0.00 ? 198 ALA B H    3  
ATOM   6573  H  HA   . ALA B 2 98  ? -9.432  0.884   2.316   1.00 0.00 ? 198 ALA B HA   3  
ATOM   6574  H  HB1  . ALA B 2 98  ? -9.064  1.371   0.125   1.00 0.00 ? 198 ALA B HB1  3  
ATOM   6575  H  HB2  . ALA B 2 98  ? -10.480 0.336   -0.061  1.00 0.00 ? 198 ALA B HB2  3  
ATOM   6576  H  HB3  . ALA B 2 98  ? -8.866  -0.320  -0.333  1.00 0.00 ? 198 ALA B HB3  3  
ATOM   6577  N  N    . GLY B 2 99  ? -11.571 -0.373  2.656   1.00 0.00 ? 199 GLY B N    3  
ATOM   6578  C  CA   . GLY B 2 99  ? -12.720 -1.167  3.050   1.00 0.00 ? 199 GLY B CA   3  
ATOM   6579  C  C    . GLY B 2 99  ? -12.375 -2.208  4.097   1.00 0.00 ? 199 GLY B C    3  
ATOM   6580  O  O    . GLY B 2 99  ? -11.466 -2.009  4.903   1.00 0.00 ? 199 GLY B O    3  
ATOM   6581  H  H    . GLY B 2 99  ? -11.573 0.596   2.799   1.00 0.00 ? 199 GLY B H    3  
ATOM   6582  H  HA2  . GLY B 2 99  ? -13.477 -0.507  3.450   1.00 0.00 ? 199 GLY B HA2  3  
ATOM   6583  H  HA3  . GLY B 2 99  ? -13.116 -1.665  2.178   1.00 0.00 ? 199 GLY B HA3  3  
ATOM   6584  N  N    . ASP B 2 100 ? -13.101 -3.320  4.083   1.00 0.00 ? 200 ASP B N    3  
ATOM   6585  C  CA   . ASP B 2 100 ? -12.868 -4.398  5.039   1.00 0.00 ? 200 ASP B CA   3  
ATOM   6586  C  C    . ASP B 2 100 ? -12.316 -5.635  4.338   1.00 0.00 ? 200 ASP B C    3  
ATOM   6587  O  O    . ASP B 2 100 ? -13.070 -6.512  3.917   1.00 0.00 ? 200 ASP B O    3  
ATOM   6588  C  CB   . ASP B 2 100 ? -14.165 -4.745  5.773   1.00 0.00 ? 200 ASP B CB   3  
ATOM   6589  C  CG   . ASP B 2 100 ? -14.130 -4.340  7.234   1.00 0.00 ? 200 ASP B CG   3  
ATOM   6590  O  OD1  . ASP B 2 100 ? -13.655 -3.223  7.528   1.00 0.00 ? 200 ASP B OD1  3  
ATOM   6591  O  OD2  . ASP B 2 100 ? -14.576 -5.140  8.083   1.00 0.00 ? 200 ASP B OD2  3  
ATOM   6592  H  H    . ASP B 2 100 ? -13.811 -3.419  3.416   1.00 0.00 ? 200 ASP B H    3  
ATOM   6593  H  HA   . ASP B 2 100 ? -12.140 -4.051  5.756   1.00 0.00 ? 200 ASP B HA   3  
ATOM   6594  H  HB2  . ASP B 2 100 ? -14.988 -4.234  5.298   1.00 0.00 ? 200 ASP B HB2  3  
ATOM   6595  H  HB3  . ASP B 2 100 ? -14.331 -5.812  5.718   1.00 0.00 ? 200 ASP B HB3  3  
ATOM   6596  N  N    . LYS B 2 101 ? -10.993 -5.700  4.216   1.00 0.00 ? 201 LYS B N    3  
ATOM   6597  C  CA   . LYS B 2 101 ? -10.339 -6.830  3.567   1.00 0.00 ? 201 LYS B CA   3  
ATOM   6598  C  C    . LYS B 2 101 ? -9.399  -7.543  4.534   1.00 0.00 ? 201 LYS B C    3  
ATOM   6599  O  O    . LYS B 2 101 ? -8.533  -8.308  4.060   1.00 0.00 ? 201 LYS B O    3  
ATOM   6600  C  CB   . LYS B 2 101 ? -9.561  -6.360  2.337   1.00 0.00 ? 201 LYS B CB   3  
ATOM   6601  C  CG   . LYS B 2 101 ? -10.364 -5.453  1.420   1.00 0.00 ? 201 LYS B CG   3  
ATOM   6602  C  CD   . LYS B 2 101 ? -10.091 -5.755  -0.046  1.00 0.00 ? 201 LYS B CD   3  
ATOM   6603  C  CE   . LYS B 2 101 ? -11.260 -6.482  -0.693  1.00 0.00 ? 201 LYS B CE   3  
ATOM   6604  N  NZ   . LYS B 2 101 ? -12.395 -5.563  -0.982  1.00 0.00 ? 201 LYS B NZ   3  
ATOM   6605  O  OXT  . LYS B 2 101 ? -9.537  -7.330  5.757   1.00 0.00 ? 201 LYS B OXT  3  
ATOM   6606  H  H    . LYS B 2 101 ? -10.444 -4.970  4.573   1.00 0.00 ? 201 LYS B H    3  
ATOM   6607  H  HA   . LYS B 2 101 ? -11.106 -7.523  3.255   1.00 0.00 ? 201 LYS B HA   3  
ATOM   6608  H  HB2  . LYS B 2 101 ? -8.684  -5.820  2.665   1.00 0.00 ? 201 LYS B HB2  3  
ATOM   6609  H  HB3  . LYS B 2 101 ? -9.250  -7.225  1.770   1.00 0.00 ? 201 LYS B HB3  3  
ATOM   6610  H  HG2  . LYS B 2 101 ? -11.416 -5.598  1.617   1.00 0.00 ? 201 LYS B HG2  3  
ATOM   6611  H  HG3  . LYS B 2 101 ? -10.096 -4.426  1.621   1.00 0.00 ? 201 LYS B HG3  3  
ATOM   6612  H  HD2  . LYS B 2 101 ? -9.924  -4.825  -0.571  1.00 0.00 ? 201 LYS B HD2  3  
ATOM   6613  H  HD3  . LYS B 2 101 ? -9.209  -6.374  -0.118  1.00 0.00 ? 201 LYS B HD3  3  
ATOM   6614  H  HE2  . LYS B 2 101 ? -10.923 -6.924  -1.619  1.00 0.00 ? 201 LYS B HE2  3  
ATOM   6615  H  HE3  . LYS B 2 101 ? -11.597 -7.260  -0.025  1.00 0.00 ? 201 LYS B HE3  3  
ATOM   6616  H  HZ1  . LYS B 2 101 ? -13.047 -5.535  -0.171  1.00 0.00 ? 201 LYS B HZ1  3  
ATOM   6617  H  HZ2  . LYS B 2 101 ? -12.917 -5.890  -1.819  1.00 0.00 ? 201 LYS B HZ2  3  
ATOM   6618  H  HZ3  . LYS B 2 101 ? -12.041 -4.602  -1.162  1.00 0.00 ? 201 LYS B HZ3  3  
HETATM 6619  ZN ZN   . ZN  C 3 .   ? 0.241   -10.816 -16.604 1.00 0.00 ? 202 ZN  B ZN   3  
HETATM 6620  ZN ZN   . ZN  D 3 .   ? 16.905  2.692   -17.793 1.00 0.00 ? 203 ZN  B ZN   3  
HETATM 6621  ZN ZN   . ZN  E 3 .   ? 3.553   5.066   -1.049  1.00 0.00 ? 204 ZN  B ZN   3  
ATOM   6622  N  N    . GLY A 1 1   ? 1.290   15.468  -33.019 1.00 0.00 ? 1   GLY A N    4  
ATOM   6623  C  CA   . GLY A 1 1   ? 1.338   14.214  -33.820 1.00 0.00 ? 1   GLY A CA   4  
ATOM   6624  C  C    . GLY A 1 1   ? 2.599   13.412  -33.565 1.00 0.00 ? 1   GLY A C    4  
ATOM   6625  O  O    . GLY A 1 1   ? 2.765   12.828  -32.493 1.00 0.00 ? 1   GLY A O    4  
ATOM   6626  H  H1   . GLY A 1 1   ? 0.823   16.221  -33.562 1.00 0.00 ? 1   GLY A H1   4  
ATOM   6627  H  H2   . GLY A 1 1   ? 2.253   15.777  -32.778 1.00 0.00 ? 1   GLY A H2   4  
ATOM   6628  H  H3   . GLY A 1 1   ? 0.758   15.309  -32.138 1.00 0.00 ? 1   GLY A H3   4  
ATOM   6629  H  HA2  . GLY A 1 1   ? 0.482   13.606  -33.570 1.00 0.00 ? 1   GLY A HA2  4  
ATOM   6630  H  HA3  . GLY A 1 1   ? 1.293   14.468  -34.869 1.00 0.00 ? 1   GLY A HA3  4  
ATOM   6631  N  N    . SER A 1 2   ? 3.490   13.382  -34.550 1.00 0.00 ? 2   SER A N    4  
ATOM   6632  C  CA   . SER A 1 2   ? 4.743   12.645  -34.427 1.00 0.00 ? 2   SER A CA   4  
ATOM   6633  C  C    . SER A 1 2   ? 4.480   11.154  -34.243 1.00 0.00 ? 2   SER A C    4  
ATOM   6634  O  O    . SER A 1 2   ? 3.364   10.679  -34.456 1.00 0.00 ? 2   SER A O    4  
ATOM   6635  C  CB   . SER A 1 2   ? 5.561   13.181  -33.250 1.00 0.00 ? 2   SER A CB   4  
ATOM   6636  O  OG   . SER A 1 2   ? 6.916   12.780  -33.346 1.00 0.00 ? 2   SER A OG   4  
ATOM   6637  H  H    . SER A 1 2   ? 3.301   13.869  -35.379 1.00 0.00 ? 2   SER A H    4  
ATOM   6638  H  HA   . SER A 1 2   ? 5.303   12.790  -35.338 1.00 0.00 ? 2   SER A HA   4  
ATOM   6639  H  HB2  . SER A 1 2   ? 5.518   14.261  -33.245 1.00 0.00 ? 2   SER A HB2  4  
ATOM   6640  H  HB3  . SER A 1 2   ? 5.150   12.801  -32.326 1.00 0.00 ? 2   SER A HB3  4  
ATOM   6641  H  HG   . SER A 1 2   ? 7.170   12.317  -32.545 1.00 0.00 ? 2   SER A HG   4  
ATOM   6642  N  N    . MET A 1 3   ? 5.515   10.419  -33.849 1.00 0.00 ? 3   MET A N    4  
ATOM   6643  C  CA   . MET A 1 3   ? 5.395   8.980   -33.638 1.00 0.00 ? 3   MET A CA   4  
ATOM   6644  C  C    . MET A 1 3   ? 4.325   8.668   -32.599 1.00 0.00 ? 3   MET A C    4  
ATOM   6645  O  O    . MET A 1 3   ? 4.269   9.296   -31.541 1.00 0.00 ? 3   MET A O    4  
ATOM   6646  C  CB   . MET A 1 3   ? 6.737   8.394   -33.195 1.00 0.00 ? 3   MET A CB   4  
ATOM   6647  C  CG   . MET A 1 3   ? 6.706   6.887   -32.996 1.00 0.00 ? 3   MET A CG   4  
ATOM   6648  S  SD   . MET A 1 3   ? 6.924   6.404   -31.272 1.00 0.00 ? 3   MET A SD   4  
ATOM   6649  C  CE   . MET A 1 3   ? 7.318   4.666   -31.455 1.00 0.00 ? 3   MET A CE   4  
ATOM   6650  H  H    . MET A 1 3   ? 6.380   10.853  -33.696 1.00 0.00 ? 3   MET A H    4  
ATOM   6651  H  HA   . MET A 1 3   ? 5.110   8.531   -34.577 1.00 0.00 ? 3   MET A HA   4  
ATOM   6652  H  HB2  . MET A 1 3   ? 7.481   8.622   -33.945 1.00 0.00 ? 3   MET A HB2  4  
ATOM   6653  H  HB3  . MET A 1 3   ? 7.027   8.855   -32.262 1.00 0.00 ? 3   MET A HB3  4  
ATOM   6654  H  HG2  . MET A 1 3   ? 5.755   6.511   -33.341 1.00 0.00 ? 3   MET A HG2  4  
ATOM   6655  H  HG3  . MET A 1 3   ? 7.499   6.444   -33.582 1.00 0.00 ? 3   MET A HG3  4  
ATOM   6656  H  HE1  . MET A 1 3   ? 6.533   4.175   -32.011 1.00 0.00 ? 3   MET A HE1  4  
ATOM   6657  H  HE2  . MET A 1 3   ? 7.405   4.212   -30.478 1.00 0.00 ? 3   MET A HE2  4  
ATOM   6658  H  HE3  . MET A 1 3   ? 8.254   4.562   -31.984 1.00 0.00 ? 3   MET A HE3  4  
ATOM   6659  N  N    . ASP A 1 4   ? 3.475   7.692   -32.907 1.00 0.00 ? 4   ASP A N    4  
ATOM   6660  C  CA   . ASP A 1 4   ? 2.402   7.292   -32.003 1.00 0.00 ? 4   ASP A CA   4  
ATOM   6661  C  C    . ASP A 1 4   ? 2.932   7.034   -30.597 1.00 0.00 ? 4   ASP A C    4  
ATOM   6662  O  O    . ASP A 1 4   ? 4.142   6.973   -30.379 1.00 0.00 ? 4   ASP A O    4  
ATOM   6663  C  CB   . ASP A 1 4   ? 1.701   6.035   -32.525 1.00 0.00 ? 4   ASP A CB   4  
ATOM   6664  C  CG   . ASP A 1 4   ? 2.671   5.025   -33.111 1.00 0.00 ? 4   ASP A CG   4  
ATOM   6665  O  OD1  . ASP A 1 4   ? 3.189   4.186   -32.347 1.00 0.00 ? 4   ASP A OD1  4  
ATOM   6666  O  OD2  . ASP A 1 4   ? 2.913   5.077   -34.335 1.00 0.00 ? 4   ASP A OD2  4  
ATOM   6667  H  H    . ASP A 1 4   ? 3.570   7.233   -33.765 1.00 0.00 ? 4   ASP A H    4  
ATOM   6668  H  HA   . ASP A 1 4   ? 1.687   8.098   -31.964 1.00 0.00 ? 4   ASP A HA   4  
ATOM   6669  H  HB2  . ASP A 1 4   ? 1.172   5.562   -31.711 1.00 0.00 ? 4   ASP A HB2  4  
ATOM   6670  H  HB3  . ASP A 1 4   ? 0.995   6.316   -33.292 1.00 0.00 ? 4   ASP A HB3  4  
ATOM   6671  N  N    . GLU A 1 5   ? 2.016   6.880   -29.647 1.00 0.00 ? 5   GLU A N    4  
ATOM   6672  C  CA   . GLU A 1 5   ? 2.390   6.622   -28.262 1.00 0.00 ? 5   GLU A CA   4  
ATOM   6673  C  C    . GLU A 1 5   ? 2.066   5.187   -27.871 1.00 0.00 ? 5   GLU A C    4  
ATOM   6674  O  O    . GLU A 1 5   ? 1.078   4.613   -28.330 1.00 0.00 ? 5   GLU A O    4  
ATOM   6675  C  CB   . GLU A 1 5   ? 1.672   7.594   -27.325 1.00 0.00 ? 5   GLU A CB   4  
ATOM   6676  C  CG   . GLU A 1 5   ? 2.560   8.140   -26.218 1.00 0.00 ? 5   GLU A CG   4  
ATOM   6677  C  CD   . GLU A 1 5   ? 1.893   8.094   -24.857 1.00 0.00 ? 5   GLU A CD   4  
ATOM   6678  O  OE1  . GLU A 1 5   ? 0.646   8.111   -24.807 1.00 0.00 ? 5   GLU A OE1  4  
ATOM   6679  O  OE2  . GLU A 1 5   ? 2.619   8.042   -23.841 1.00 0.00 ? 5   GLU A OE2  4  
ATOM   6680  H  H    . GLU A 1 5   ? 1.067   6.935   -29.884 1.00 0.00 ? 5   GLU A H    4  
ATOM   6681  H  HA   . GLU A 1 5   ? 3.456   6.775   -28.175 1.00 0.00 ? 5   GLU A HA   4  
ATOM   6682  H  HB2  . GLU A 1 5   ? 1.304   8.427   -27.903 1.00 0.00 ? 5   GLU A HB2  4  
ATOM   6683  H  HB3  . GLU A 1 5   ? 0.835   7.087   -26.869 1.00 0.00 ? 5   GLU A HB3  4  
ATOM   6684  H  HG2  . GLU A 1 5   ? 3.465   7.551   -26.177 1.00 0.00 ? 5   GLU A HG2  4  
ATOM   6685  H  HG3  . GLU A 1 5   ? 2.811   9.165   -26.446 1.00 0.00 ? 5   GLU A HG3  4  
ATOM   6686  N  N    . SER A 1 6   ? 2.908   4.614   -27.021 1.00 0.00 ? 6   SER A N    4  
ATOM   6687  C  CA   . SER A 1 6   ? 2.719   3.242   -26.562 1.00 0.00 ? 6   SER A CA   4  
ATOM   6688  C  C    . SER A 1 6   ? 1.519   3.141   -25.626 1.00 0.00 ? 6   SER A C    4  
ATOM   6689  O  O    . SER A 1 6   ? 1.289   4.023   -24.798 1.00 0.00 ? 6   SER A O    4  
ATOM   6690  C  CB   . SER A 1 6   ? 3.981   2.743   -25.854 1.00 0.00 ? 6   SER A CB   4  
ATOM   6691  O  OG   . SER A 1 6   ? 4.673   1.798   -26.651 1.00 0.00 ? 6   SER A OG   4  
ATOM   6692  H  H    . SER A 1 6   ? 3.675   5.126   -26.695 1.00 0.00 ? 6   SER A H    4  
ATOM   6693  H  HA   . SER A 1 6   ? 2.536   2.625   -27.429 1.00 0.00 ? 6   SER A HA   4  
ATOM   6694  H  HB2  . SER A 1 6   ? 4.636   3.578   -25.660 1.00 0.00 ? 6   SER A HB2  4  
ATOM   6695  H  HB3  . SER A 1 6   ? 3.708   2.275   -24.920 1.00 0.00 ? 6   SER A HB3  4  
ATOM   6696  H  HG   . SER A 1 6   ? 4.704   0.955   -26.194 1.00 0.00 ? 6   SER A HG   4  
ATOM   6697  N  N    . GLY A 1 7   ? 0.758   2.060   -25.762 1.00 0.00 ? 7   GLY A N    4  
ATOM   6698  C  CA   . GLY A 1 7   ? -0.409  1.862   -24.922 1.00 0.00 ? 7   GLY A CA   4  
ATOM   6699  C  C    . GLY A 1 7   ? -0.065  1.834   -23.444 1.00 0.00 ? 7   GLY A C    4  
ATOM   6700  O  O    . GLY A 1 7   ? -0.923  2.079   -22.596 1.00 0.00 ? 7   GLY A O    4  
ATOM   6701  H  H    . GLY A 1 7   ? 0.991   1.390   -26.438 1.00 0.00 ? 7   GLY A H    4  
ATOM   6702  H  HA2  . GLY A 1 7   ? -1.107  2.666   -25.101 1.00 0.00 ? 7   GLY A HA2  4  
ATOM   6703  H  HA3  . GLY A 1 7   ? -0.876  0.927   -25.189 1.00 0.00 ? 7   GLY A HA3  4  
ATOM   6704  N  N    . LEU A 1 8   ? 1.192   1.529   -23.134 1.00 0.00 ? 8   LEU A N    4  
ATOM   6705  C  CA   . LEU A 1 8   ? 1.647   1.464   -21.756 1.00 0.00 ? 8   LEU A CA   4  
ATOM   6706  C  C    . LEU A 1 8   ? 1.574   2.826   -21.081 1.00 0.00 ? 8   LEU A C    4  
ATOM   6707  O  O    . LEU A 1 8   ? 2.067   3.818   -21.616 1.00 0.00 ? 8   LEU A O    4  
ATOM   6708  C  CB   . LEU A 1 8   ? 3.090   0.973   -21.719 1.00 0.00 ? 8   LEU A CB   4  
ATOM   6709  C  CG   . LEU A 1 8   ? 3.488   0.195   -20.470 1.00 0.00 ? 8   LEU A CG   4  
ATOM   6710  C  CD1  . LEU A 1 8   ? 3.566   1.110   -19.254 1.00 0.00 ? 8   LEU A CD1  4  
ATOM   6711  C  CD2  . LEU A 1 8   ? 2.521   -0.953  -20.216 1.00 0.00 ? 8   LEU A CD2  4  
ATOM   6712  H  H    . LEU A 1 8   ? 1.832   1.337   -23.848 1.00 0.00 ? 8   LEU A H    4  
ATOM   6713  H  HA   . LEU A 1 8   ? 1.020   0.766   -21.225 1.00 0.00 ? 8   LEU A HA   4  
ATOM   6714  H  HB2  . LEU A 1 8   ? 3.254   0.341   -22.577 1.00 0.00 ? 8   LEU A HB2  4  
ATOM   6715  H  HB3  . LEU A 1 8   ? 3.739   1.831   -21.800 1.00 0.00 ? 8   LEU A HB3  4  
ATOM   6716  H  HG   . LEU A 1 8   ? 4.466   -0.222  -20.631 1.00 0.00 ? 8   LEU A HG   4  
ATOM   6717  H  HD11 . LEU A 1 8   ? 3.305   2.117   -19.541 1.00 0.00 ? 8   LEU A HD11 4  
ATOM   6718  H  HD12 . LEU A 1 8   ? 4.572   1.099   -18.860 1.00 0.00 ? 8   LEU A HD12 4  
ATOM   6719  H  HD13 . LEU A 1 8   ? 2.881   0.764   -18.494 1.00 0.00 ? 8   LEU A HD13 4  
ATOM   6720  H  HD21 . LEU A 1 8   ? 2.000   -0.786  -19.285 1.00 0.00 ? 8   LEU A HD21 4  
ATOM   6721  H  HD22 . LEU A 1 8   ? 3.072   -1.879  -20.159 1.00 0.00 ? 8   LEU A HD22 4  
ATOM   6722  H  HD23 . LEU A 1 8   ? 1.807   -1.008  -21.024 1.00 0.00 ? 8   LEU A HD23 4  
ATOM   6723  N  N    . PRO A 1 9   ? 0.985   2.891   -19.876 1.00 0.00 ? 9   PRO A N    4  
ATOM   6724  C  CA   . PRO A 1 9   ? 0.897   4.144   -19.132 1.00 0.00 ? 9   PRO A CA   4  
ATOM   6725  C  C    . PRO A 1 9   ? 2.286   4.638   -18.753 1.00 0.00 ? 9   PRO A C    4  
ATOM   6726  O  O    . PRO A 1 9   ? 2.922   4.098   -17.847 1.00 0.00 ? 9   PRO A O    4  
ATOM   6727  C  CB   . PRO A 1 9   ? 0.096   3.767   -17.880 1.00 0.00 ? 9   PRO A CB   4  
ATOM   6728  C  CG   . PRO A 1 9   ? 0.255   2.292   -17.746 1.00 0.00 ? 9   PRO A CG   4  
ATOM   6729  C  CD   . PRO A 1 9   ? 0.396   1.759   -19.142 1.00 0.00 ? 9   PRO A CD   4  
ATOM   6730  H  HA   . PRO A 1 9   ? 0.375   4.907   -19.690 1.00 0.00 ? 9   PRO A HA   4  
ATOM   6731  H  HB2  . PRO A 1 9   ? 0.502   4.283   -17.026 1.00 0.00 ? 9   PRO A HB2  4  
ATOM   6732  H  HB3  . PRO A 1 9   ? -0.939  4.040   -18.015 1.00 0.00 ? 9   PRO A HB3  4  
ATOM   6733  H  HG2  . PRO A 1 9   ? 1.140   2.069   -17.168 1.00 0.00 ? 9   PRO A HG2  4  
ATOM   6734  H  HG3  . PRO A 1 9   ? -0.618  1.871   -17.270 1.00 0.00 ? 9   PRO A HG3  4  
ATOM   6735  H  HD2  . PRO A 1 9   ? 1.055   0.906   -19.155 1.00 0.00 ? 9   PRO A HD2  4  
ATOM   6736  H  HD3  . PRO A 1 9   ? -0.570  1.499   -19.548 1.00 0.00 ? 9   PRO A HD3  4  
ATOM   6737  N  N    . GLN A 1 10  ? 2.762   5.653   -19.462 1.00 0.00 ? 10  GLN A N    4  
ATOM   6738  C  CA   . GLN A 1 10  ? 4.088   6.201   -19.207 1.00 0.00 ? 10  GLN A CA   4  
ATOM   6739  C  C    . GLN A 1 10  ? 4.003   7.471   -18.364 1.00 0.00 ? 10  GLN A C    4  
ATOM   6740  O  O    . GLN A 1 10  ? 3.148   8.326   -18.595 1.00 0.00 ? 10  GLN A O    4  
ATOM   6741  C  CB   . GLN A 1 10  ? 4.799   6.492   -20.531 1.00 0.00 ? 10  GLN A CB   4  
ATOM   6742  C  CG   . GLN A 1 10  ? 6.146   7.181   -20.368 1.00 0.00 ? 10  GLN A CG   4  
ATOM   6743  C  CD   . GLN A 1 10  ? 6.215   8.509   -21.097 1.00 0.00 ? 10  GLN A CD   4  
ATOM   6744  O  OE1  . GLN A 1 10  ? 5.686   8.652   -22.200 1.00 0.00 ? 10  GLN A OE1  4  
ATOM   6745  N  NE2  . GLN A 1 10  ? 6.869   9.488   -20.484 1.00 0.00 ? 10  GLN A NE2  4  
ATOM   6746  H  H    . GLN A 1 10  ? 2.217   6.035   -20.181 1.00 0.00 ? 10  GLN A H    4  
ATOM   6747  H  HA   . GLN A 1 10  ? 4.651   5.456   -18.666 1.00 0.00 ? 10  GLN A HA   4  
ATOM   6748  H  HB2  . GLN A 1 10  ? 4.961   5.558   -21.049 1.00 0.00 ? 10  GLN A HB2  4  
ATOM   6749  H  HB3  . GLN A 1 10  ? 4.166   7.121   -21.136 1.00 0.00 ? 10  GLN A HB3  4  
ATOM   6750  H  HG2  . GLN A 1 10  ? 6.320   7.357   -19.317 1.00 0.00 ? 10  GLN A HG2  4  
ATOM   6751  H  HG3  . GLN A 1 10  ? 6.917   6.533   -20.756 1.00 0.00 ? 10  GLN A HG3  4  
ATOM   6752  H  HE21 . GLN A 1 10  ? 7.264   9.302   -19.606 1.00 0.00 ? 10  GLN A HE21 4  
ATOM   6753  H  HE22 . GLN A 1 10  ? 6.928   10.357  -20.932 1.00 0.00 ? 10  GLN A HE22 4  
ATOM   6754  N  N    . LEU A 1 11  ? 4.898   7.589   -17.388 1.00 0.00 ? 11  LEU A N    4  
ATOM   6755  C  CA   . LEU A 1 11  ? 4.927   8.752   -16.513 1.00 0.00 ? 11  LEU A CA   4  
ATOM   6756  C  C    . LEU A 1 11  ? 6.267   9.475   -16.616 1.00 0.00 ? 11  LEU A C    4  
ATOM   6757  O  O    . LEU A 1 11  ? 7.283   8.873   -16.963 1.00 0.00 ? 11  LEU A O    4  
ATOM   6758  C  CB   . LEU A 1 11  ? 4.667   8.336   -15.064 1.00 0.00 ? 11  LEU A CB   4  
ATOM   6759  C  CG   . LEU A 1 11  ? 3.272   7.769   -14.795 1.00 0.00 ? 11  LEU A CG   4  
ATOM   6760  C  CD1  . LEU A 1 11  ? 3.207   7.146   -13.409 1.00 0.00 ? 11  LEU A CD1  4  
ATOM   6761  C  CD2  . LEU A 1 11  ? 2.218   8.857   -14.943 1.00 0.00 ? 11  LEU A CD2  4  
ATOM   6762  H  H    . LEU A 1 11  ? 5.553   6.879   -17.254 1.00 0.00 ? 11  LEU A H    4  
ATOM   6763  H  HA   . LEU A 1 11  ? 4.147   9.419   -16.833 1.00 0.00 ? 11  LEU A HA   4  
ATOM   6764  H  HB2  . LEU A 1 11  ? 5.397   7.587   -14.790 1.00 0.00 ? 11  LEU A HB2  4  
ATOM   6765  H  HB3  . LEU A 1 11  ? 4.807   9.200   -14.432 1.00 0.00 ? 11  LEU A HB3  4  
ATOM   6766  H  HG   . LEU A 1 11  ? 3.059   6.995   -15.518 1.00 0.00 ? 11  LEU A HG   4  
ATOM   6767  H  HD11 . LEU A 1 11  ? 3.854   7.693   -12.738 1.00 0.00 ? 11  LEU A HD11 4  
ATOM   6768  H  HD12 . LEU A 1 11  ? 3.531   6.117   -13.462 1.00 0.00 ? 11  LEU A HD12 4  
ATOM   6769  H  HD13 . LEU A 1 11  ? 2.193   7.186   -13.043 1.00 0.00 ? 11  LEU A HD13 4  
ATOM   6770  H  HD21 . LEU A 1 11  ? 1.818   8.837   -15.945 1.00 0.00 ? 11  LEU A HD21 4  
ATOM   6771  H  HD22 . LEU A 1 11  ? 2.667   9.820   -14.752 1.00 0.00 ? 11  LEU A HD22 4  
ATOM   6772  H  HD23 . LEU A 1 11  ? 1.422   8.685   -14.234 1.00 0.00 ? 11  LEU A HD23 4  
ATOM   6773  N  N    . THR A 1 12  ? 6.261   10.770  -16.315 1.00 0.00 ? 12  THR A N    4  
ATOM   6774  C  CA   . THR A 1 12  ? 7.473   11.574  -16.376 1.00 0.00 ? 12  THR A CA   4  
ATOM   6775  C  C    . THR A 1 12  ? 8.249   11.495  -15.068 1.00 0.00 ? 12  THR A C    4  
ATOM   6776  O  O    . THR A 1 12  ? 7.664   11.355  -13.994 1.00 0.00 ? 12  THR A O    4  
ATOM   6777  C  CB   . THR A 1 12  ? 7.117   13.027  -16.674 1.00 0.00 ? 12  THR A CB   4  
ATOM   6778  O  OG1  . THR A 1 12  ? 6.293   13.117  -17.823 1.00 0.00 ? 12  THR A OG1  4  
ATOM   6779  C  CG2  . THR A 1 12  ? 8.326   13.909  -16.906 1.00 0.00 ? 12  THR A CG2  4  
ATOM   6780  H  H    . THR A 1 12  ? 5.422   11.198  -16.046 1.00 0.00 ? 12  THR A H    4  
ATOM   6781  H  HA   . THR A 1 12  ? 8.091   11.191  -17.174 1.00 0.00 ? 12  THR A HA   4  
ATOM   6782  H  HB   . THR A 1 12  ? 6.572   13.426  -15.832 1.00 0.00 ? 12  THR A HB   4  
ATOM   6783  H  HG1  . THR A 1 12  ? 5.508   12.578  -17.697 1.00 0.00 ? 12  THR A HG1  4  
ATOM   6784  H  HG21 . THR A 1 12  ? 8.063   14.938  -16.708 1.00 0.00 ? 12  THR A HG21 4  
ATOM   6785  H  HG22 . THR A 1 12  ? 8.652   13.811  -17.931 1.00 0.00 ? 12  THR A HG22 4  
ATOM   6786  H  HG23 . THR A 1 12  ? 9.124   13.608  -16.244 1.00 0.00 ? 12  THR A HG23 4  
ATOM   6787  N  N    . SER A 1 13  ? 9.570   11.590  -15.167 1.00 0.00 ? 13  SER A N    4  
ATOM   6788  C  CA   . SER A 1 13  ? 10.434  11.535  -14.003 1.00 0.00 ? 13  SER A CA   4  
ATOM   6789  C  C    . SER A 1 13  ? 9.962   12.500  -12.915 1.00 0.00 ? 13  SER A C    4  
ATOM   6790  O  O    . SER A 1 13  ? 10.279  12.324  -11.739 1.00 0.00 ? 13  SER A O    4  
ATOM   6791  C  CB   . SER A 1 13  ? 11.874  11.862  -14.397 1.00 0.00 ? 13  SER A CB   4  
ATOM   6792  O  OG   . SER A 1 13  ? 11.912  12.777  -15.479 1.00 0.00 ? 13  SER A OG   4  
ATOM   6793  H  H    . SER A 1 13  ? 9.976   11.698  -16.044 1.00 0.00 ? 13  SER A H    4  
ATOM   6794  H  HA   . SER A 1 13  ? 10.396  10.532  -13.625 1.00 0.00 ? 13  SER A HA   4  
ATOM   6795  H  HB2  . SER A 1 13  ? 12.386  12.301  -13.553 1.00 0.00 ? 13  SER A HB2  4  
ATOM   6796  H  HB3  . SER A 1 13  ? 12.380  10.953  -14.692 1.00 0.00 ? 13  SER A HB3  4  
ATOM   6797  H  HG   . SER A 1 13  ? 12.708  13.309  -15.421 1.00 0.00 ? 13  SER A HG   4  
ATOM   6798  N  N    . TYR A 1 14  ? 9.207   13.523  -13.313 1.00 0.00 ? 14  TYR A N    4  
ATOM   6799  C  CA   . TYR A 1 14  ? 8.703   14.509  -12.366 1.00 0.00 ? 14  TYR A CA   4  
ATOM   6800  C  C    . TYR A 1 14  ? 7.260   14.209  -11.979 1.00 0.00 ? 14  TYR A C    4  
ATOM   6801  O  O    . TYR A 1 14  ? 6.893   14.288  -10.807 1.00 0.00 ? 14  TYR A O    4  
ATOM   6802  C  CB   . TYR A 1 14  ? 8.803   15.914  -12.961 1.00 0.00 ? 14  TYR A CB   4  
ATOM   6803  C  CG   . TYR A 1 14  ? 8.767   17.016  -11.924 1.00 0.00 ? 14  TYR A CG   4  
ATOM   6804  C  CD1  . TYR A 1 14  ? 9.622   16.994  -10.830 1.00 0.00 ? 14  TYR A CD1  4  
ATOM   6805  C  CD2  . TYR A 1 14  ? 7.878   18.076  -12.042 1.00 0.00 ? 14  TYR A CD2  4  
ATOM   6806  C  CE1  . TYR A 1 14  ? 9.593   17.999  -9.882  1.00 0.00 ? 14  TYR A CE1  4  
ATOM   6807  C  CE2  . TYR A 1 14  ? 7.842   19.084  -11.099 1.00 0.00 ? 14  TYR A CE2  4  
ATOM   6808  C  CZ   . TYR A 1 14  ? 8.702   19.041  -10.021 1.00 0.00 ? 14  TYR A CZ   4  
ATOM   6809  O  OH   . TYR A 1 14  ? 8.669   20.044  -9.079  1.00 0.00 ? 14  TYR A OH   4  
ATOM   6810  H  H    . TYR A 1 14  ? 8.986   13.617  -14.265 1.00 0.00 ? 14  TYR A H    4  
ATOM   6811  H  HA   . TYR A 1 14  ? 9.316   14.459  -11.478 1.00 0.00 ? 14  TYR A HA   4  
ATOM   6812  H  HB2  . TYR A 1 14  ? 9.733   16.003  -13.503 1.00 0.00 ? 14  TYR A HB2  4  
ATOM   6813  H  HB3  . TYR A 1 14  ? 7.979   16.070  -13.641 1.00 0.00 ? 14  TYR A HB3  4  
ATOM   6814  H  HD1  . TYR A 1 14  ? 10.319  16.176  -10.724 1.00 0.00 ? 14  TYR A HD1  4  
ATOM   6815  H  HD2  . TYR A 1 14  ? 7.206   18.106  -12.887 1.00 0.00 ? 14  TYR A HD2  4  
ATOM   6816  H  HE1  . TYR A 1 14  ? 10.266  17.965  -9.038  1.00 0.00 ? 14  TYR A HE1  4  
ATOM   6817  H  HE2  . TYR A 1 14  ? 7.143   19.900  -11.207 1.00 0.00 ? 14  TYR A HE2  4  
ATOM   6818  H  HH   . TYR A 1 14  ? 8.324   19.697  -8.253  1.00 0.00 ? 14  TYR A HH   4  
ATOM   6819  N  N    . ASP A 1 15  ? 6.444   13.858  -12.969 1.00 0.00 ? 15  ASP A N    4  
ATOM   6820  C  CA   . ASP A 1 15  ? 5.041   13.541  -12.723 1.00 0.00 ? 15  ASP A CA   4  
ATOM   6821  C  C    . ASP A 1 15  ? 4.909   12.437  -11.677 1.00 0.00 ? 15  ASP A C    4  
ATOM   6822  O  O    . ASP A 1 15  ? 3.874   12.307  -11.026 1.00 0.00 ? 15  ASP A O    4  
ATOM   6823  C  CB   . ASP A 1 15  ? 4.356   13.112  -14.023 1.00 0.00 ? 15  ASP A CB   4  
ATOM   6824  C  CG   . ASP A 1 15  ? 4.276   14.241  -15.032 1.00 0.00 ? 15  ASP A CG   4  
ATOM   6825  O  OD1  . ASP A 1 15  ? 4.314   15.417  -14.613 1.00 0.00 ? 15  ASP A OD1  4  
ATOM   6826  O  OD2  . ASP A 1 15  ? 4.177   13.948  -16.243 1.00 0.00 ? 15  ASP A OD2  4  
ATOM   6827  H  H    . ASP A 1 15  ? 6.794   13.808  -13.883 1.00 0.00 ? 15  ASP A H    4  
ATOM   6828  H  HA   . ASP A 1 15  ? 4.560   14.431  -12.349 1.00 0.00 ? 15  ASP A HA   4  
ATOM   6829  H  HB2  . ASP A 1 15  ? 4.910   12.298  -14.464 1.00 0.00 ? 15  ASP A HB2  4  
ATOM   6830  H  HB3  . ASP A 1 15  ? 3.352   12.781  -13.801 1.00 0.00 ? 15  ASP A HB3  4  
ATOM   6831  N  N    . CYS A 1 16  ? 5.967   11.647  -11.519 1.00 0.00 ? 16  CYS A N    4  
ATOM   6832  C  CA   . CYS A 1 16  ? 5.974   10.560  -10.554 1.00 0.00 ? 16  CYS A CA   4  
ATOM   6833  C  C    . CYS A 1 16  ? 6.511   11.034  -9.212  1.00 0.00 ? 16  CYS A C    4  
ATOM   6834  O  O    . CYS A 1 16  ? 5.910   10.788  -8.166  1.00 0.00 ? 16  CYS A O    4  
ATOM   6835  C  CB   . CYS A 1 16  ? 6.833   9.411   -11.073 1.00 0.00 ? 16  CYS A CB   4  
ATOM   6836  S  SG   . CYS A 1 16  ? 6.484   7.817   -10.296 1.00 0.00 ? 16  CYS A SG   4  
ATOM   6837  H  H    . CYS A 1 16  ? 6.763   11.797  -12.066 1.00 0.00 ? 16  CYS A H    4  
ATOM   6838  H  HA   . CYS A 1 16  ? 4.960   10.218  -10.428 1.00 0.00 ? 16  CYS A HA   4  
ATOM   6839  H  HB2  . CYS A 1 16  ? 6.674   9.306   -12.133 1.00 0.00 ? 16  CYS A HB2  4  
ATOM   6840  H  HB3  . CYS A 1 16  ? 7.872   9.645   -10.893 1.00 0.00 ? 16  CYS A HB3  4  
ATOM   6841  H  HG   . CYS A 1 16  ? 5.615   7.869   -9.891  1.00 0.00 ? 16  CYS A HG   4  
ATOM   6842  N  N    . GLU A 1 17  ? 7.651   11.712  -9.251  1.00 0.00 ? 17  GLU A N    4  
ATOM   6843  C  CA   . GLU A 1 17  ? 8.282   12.223  -8.042  1.00 0.00 ? 17  GLU A CA   4  
ATOM   6844  C  C    . GLU A 1 17  ? 7.355   13.185  -7.307  1.00 0.00 ? 17  GLU A C    4  
ATOM   6845  O  O    . GLU A 1 17  ? 7.228   13.131  -6.084  1.00 0.00 ? 17  GLU A O    4  
ATOM   6846  C  CB   . GLU A 1 17  ? 9.588   12.932  -8.396  1.00 0.00 ? 17  GLU A CB   4  
ATOM   6847  C  CG   . GLU A 1 17  ? 10.678  12.759  -7.352  1.00 0.00 ? 17  GLU A CG   4  
ATOM   6848  C  CD   . GLU A 1 17  ? 11.517  14.010  -7.173  1.00 0.00 ? 17  GLU A CD   4  
ATOM   6849  O  OE1  . GLU A 1 17  ? 11.052  14.942  -6.484  1.00 0.00 ? 17  GLU A OE1  4  
ATOM   6850  O  OE2  . GLU A 1 17  ? 12.639  14.055  -7.721  1.00 0.00 ? 17  GLU A OE2  4  
ATOM   6851  H  H    . GLU A 1 17  ? 8.080   11.871  -10.119 1.00 0.00 ? 17  GLU A H    4  
ATOM   6852  H  HA   . GLU A 1 17  ? 8.499   11.385  -7.398  1.00 0.00 ? 17  GLU A HA   4  
ATOM   6853  H  HB2  . GLU A 1 17  ? 9.951   12.542  -9.334  1.00 0.00 ? 17  GLU A HB2  4  
ATOM   6854  H  HB3  . GLU A 1 17  ? 9.390   13.987  -8.509  1.00 0.00 ? 17  GLU A HB3  4  
ATOM   6855  H  HG2  . GLU A 1 17  ? 10.219  12.515  -6.406  1.00 0.00 ? 17  GLU A HG2  4  
ATOM   6856  H  HG3  . GLU A 1 17  ? 11.326  11.950  -7.657  1.00 0.00 ? 17  GLU A HG3  4  
ATOM   6857  N  N    . VAL A 1 18  ? 6.716   14.070  -8.063  1.00 0.00 ? 18  VAL A N    4  
ATOM   6858  C  CA   . VAL A 1 18  ? 5.806   15.055  -7.491  1.00 0.00 ? 18  VAL A CA   4  
ATOM   6859  C  C    . VAL A 1 18  ? 4.548   14.399  -6.924  1.00 0.00 ? 18  VAL A C    4  
ATOM   6860  O  O    . VAL A 1 18  ? 4.083   14.763  -5.845  1.00 0.00 ? 18  VAL A O    4  
ATOM   6861  C  CB   . VAL A 1 18  ? 5.391   16.110  -8.535  1.00 0.00 ? 18  VAL A CB   4  
ATOM   6862  C  CG1  . VAL A 1 18  ? 4.592   17.227  -7.880  1.00 0.00 ? 18  VAL A CG1  4  
ATOM   6863  C  CG2  . VAL A 1 18  ? 6.613   16.669  -9.249  1.00 0.00 ? 18  VAL A CG2  4  
ATOM   6864  H  H    . VAL A 1 18  ? 6.867   14.064  -9.033  1.00 0.00 ? 18  VAL A H    4  
ATOM   6865  H  HA   . VAL A 1 18  ? 6.326   15.560  -6.690  1.00 0.00 ? 18  VAL A HA   4  
ATOM   6866  H  HB   . VAL A 1 18  ? 4.759   15.631  -9.269  1.00 0.00 ? 18  VAL A HB   4  
ATOM   6867  H  HG11 . VAL A 1 18  ? 3.849   17.593  -8.574  1.00 0.00 ? 18  VAL A HG11 4  
ATOM   6868  H  HG12 . VAL A 1 18  ? 5.257   18.033  -7.608  1.00 0.00 ? 18  VAL A HG12 4  
ATOM   6869  H  HG13 . VAL A 1 18  ? 4.103   16.849  -6.994  1.00 0.00 ? 18  VAL A HG13 4  
ATOM   6870  H  HG21 . VAL A 1 18  ? 6.860   17.635  -8.835  1.00 0.00 ? 18  VAL A HG21 4  
ATOM   6871  H  HG22 . VAL A 1 18  ? 6.398   16.774  -10.302 1.00 0.00 ? 18  VAL A HG22 4  
ATOM   6872  H  HG23 . VAL A 1 18  ? 7.447   15.997  -9.119  1.00 0.00 ? 18  VAL A HG23 4  
ATOM   6873  N  N    . ASN A 1 19  ? 3.995   13.439  -7.659  1.00 0.00 ? 19  ASN A N    4  
ATOM   6874  C  CA   . ASN A 1 19  ? 2.784   12.749  -7.225  1.00 0.00 ? 19  ASN A CA   4  
ATOM   6875  C  C    . ASN A 1 19  ? 3.096   11.631  -6.230  1.00 0.00 ? 19  ASN A C    4  
ATOM   6876  O  O    . ASN A 1 19  ? 2.210   11.167  -5.511  1.00 0.00 ? 19  ASN A O    4  
ATOM   6877  C  CB   . ASN A 1 19  ? 2.038   12.178  -8.433  1.00 0.00 ? 19  ASN A CB   4  
ATOM   6878  C  CG   . ASN A 1 19  ? 0.591   12.629  -8.486  1.00 0.00 ? 19  ASN A CG   4  
ATOM   6879  O  OD1  . ASN A 1 19  ? -0.327  11.831  -8.306  1.00 0.00 ? 19  ASN A OD1  4  
ATOM   6880  N  ND2  . ASN A 1 19  ? 0.383   13.917  -8.735  1.00 0.00 ? 19  ASN A ND2  4  
ATOM   6881  H  H    . ASN A 1 19  ? 4.405   13.193  -8.518  1.00 0.00 ? 19  ASN A H    4  
ATOM   6882  H  HA   . ASN A 1 19  ? 2.150   13.475  -6.738  1.00 0.00 ? 19  ASN A HA   4  
ATOM   6883  H  HB2  . ASN A 1 19  ? 2.529   12.504  -9.335  1.00 0.00 ? 19  ASN A HB2  4  
ATOM   6884  H  HB3  . ASN A 1 19  ? 2.058   11.099  -8.386  1.00 0.00 ? 19  ASN A HB3  4  
ATOM   6885  H  HD21 . ASN A 1 19  ? 1.163   14.495  -8.870  1.00 0.00 ? 19  ASN A HD21 4  
ATOM   6886  H  HD22 . ASN A 1 19  ? -0.543  14.236  -8.777  1.00 0.00 ? 19  ASN A HD22 4  
ATOM   6887  N  N    . ALA A 1 20  ? 4.352   11.199  -6.193  1.00 0.00 ? 20  ALA A N    4  
ATOM   6888  C  CA   . ALA A 1 20  ? 4.762   10.136  -5.287  1.00 0.00 ? 20  ALA A CA   4  
ATOM   6889  C  C    . ALA A 1 20  ? 6.250   10.230  -4.961  1.00 0.00 ? 20  ALA A C    4  
ATOM   6890  O  O    . ALA A 1 20  ? 7.086   9.669   -5.668  1.00 0.00 ? 20  ALA A O    4  
ATOM   6891  C  CB   . ALA A 1 20  ? 4.435   8.776   -5.885  1.00 0.00 ? 20  ALA A CB   4  
ATOM   6892  H  H    . ALA A 1 20  ? 5.016   11.601  -6.788  1.00 0.00 ? 20  ALA A H    4  
ATOM   6893  H  HA   . ALA A 1 20  ? 4.198   10.247  -4.373  1.00 0.00 ? 20  ALA A HA   4  
ATOM   6894  H  HB1  . ALA A 1 20  ? 3.466   8.814   -6.357  1.00 0.00 ? 20  ALA A HB1  4  
ATOM   6895  H  HB2  . ALA A 1 20  ? 4.425   8.032   -5.103  1.00 0.00 ? 20  ALA A HB2  4  
ATOM   6896  H  HB3  . ALA A 1 20  ? 5.184   8.516   -6.619  1.00 0.00 ? 20  ALA A HB3  4  
ATOM   6897  N  N    . PRO A 1 21  ? 6.597   10.945  -3.878  1.00 0.00 ? 21  PRO A N    4  
ATOM   6898  C  CA   . PRO A 1 21  ? 7.985   11.113  -3.455  1.00 0.00 ? 21  PRO A CA   4  
ATOM   6899  C  C    . PRO A 1 21  ? 8.490   9.930   -2.638  1.00 0.00 ? 21  PRO A C    4  
ATOM   6900  O  O    . PRO A 1 21  ? 7.727   9.025   -2.298  1.00 0.00 ? 21  PRO A O    4  
ATOM   6901  C  CB   . PRO A 1 21  ? 7.924   12.372  -2.596  1.00 0.00 ? 21  PRO A CB   4  
ATOM   6902  C  CG   . PRO A 1 21  ? 6.558   12.355  -1.996  1.00 0.00 ? 21  PRO A CG   4  
ATOM   6903  C  CD   . PRO A 1 21  ? 5.660   11.646  -2.981  1.00 0.00 ? 21  PRO A CD   4  
ATOM   6904  H  HA   . PRO A 1 21  ? 8.641   11.278  -4.298  1.00 0.00 ? 21  PRO A HA   4  
ATOM   6905  H  HB2  . PRO A 1 21  ? 8.692   12.330  -1.836  1.00 0.00 ? 21  PRO A HB2  4  
ATOM   6906  H  HB3  . PRO A 1 21  ? 8.072   13.243  -3.216  1.00 0.00 ? 21  PRO A HB3  4  
ATOM   6907  H  HG2  . PRO A 1 21  ? 6.578   11.820  -1.059  1.00 0.00 ? 21  PRO A HG2  4  
ATOM   6908  H  HG3  . PRO A 1 21  ? 6.214   13.367  -1.841  1.00 0.00 ? 21  PRO A HG3  4  
ATOM   6909  H  HD2  . PRO A 1 21  ? 5.023   10.941  -2.469  1.00 0.00 ? 21  PRO A HD2  4  
ATOM   6910  H  HD3  . PRO A 1 21  ? 5.064   12.360  -3.531  1.00 0.00 ? 21  PRO A HD3  4  
ATOM   6911  N  N    . ILE A 1 22  ? 9.780   9.942   -2.324  1.00 0.00 ? 22  ILE A N    4  
ATOM   6912  C  CA   . ILE A 1 22  ? 10.389  8.870   -1.546  1.00 0.00 ? 22  ILE A CA   4  
ATOM   6913  C  C    . ILE A 1 22  ? 10.875  9.377   -0.187  1.00 0.00 ? 22  ILE A C    4  
ATOM   6914  O  O    . ILE A 1 22  ? 11.190  8.587   0.704   1.00 0.00 ? 22  ILE A O    4  
ATOM   6915  C  CB   . ILE A 1 22  ? 11.564  8.227   -2.313  1.00 0.00 ? 22  ILE A CB   4  
ATOM   6916  C  CG1  . ILE A 1 22  ? 11.075  7.707   -3.664  1.00 0.00 ? 22  ILE A CG1  4  
ATOM   6917  C  CG2  . ILE A 1 22  ? 12.193  7.104   -1.503  1.00 0.00 ? 22  ILE A CG2  4  
ATOM   6918  C  CD1  . ILE A 1 22  ? 12.176  7.129   -4.520  1.00 0.00 ? 22  ILE A CD1  4  
ATOM   6919  H  H    . ILE A 1 22  ? 10.337  10.692  -2.624  1.00 0.00 ? 22  ILE A H    4  
ATOM   6920  H  HA   . ILE A 1 22  ? 9.637   8.110   -1.385  1.00 0.00 ? 22  ILE A HA   4  
ATOM   6921  H  HB   . ILE A 1 22  ? 12.317  8.981   -2.478  1.00 0.00 ? 22  ILE A HB   4  
ATOM   6922  H  HG12 . ILE A 1 22  ? 10.345  6.931   -3.499  1.00 0.00 ? 22  ILE A HG12 4  
ATOM   6923  H  HG13 . ILE A 1 22  ? 10.616  8.516   -4.211  1.00 0.00 ? 22  ILE A HG13 4  
ATOM   6924  H  HG21 . ILE A 1 22  ? 11.442  6.365   -1.269  1.00 0.00 ? 22  ILE A HG21 4  
ATOM   6925  H  HG22 . ILE A 1 22  ? 12.603  7.503   -0.587  1.00 0.00 ? 22  ILE A HG22 4  
ATOM   6926  H  HG23 . ILE A 1 22  ? 12.983  6.644   -2.078  1.00 0.00 ? 22  ILE A HG23 4  
ATOM   6927  H  HD11 . ILE A 1 22  ? 12.758  7.931   -4.945  1.00 0.00 ? 22  ILE A HD11 4  
ATOM   6928  H  HD12 . ILE A 1 22  ? 11.740  6.540   -5.313  1.00 0.00 ? 22  ILE A HD12 4  
ATOM   6929  H  HD13 . ILE A 1 22  ? 12.811  6.503   -3.913  1.00 0.00 ? 22  ILE A HD13 4  
ATOM   6930  N  N    . GLN A 1 23  ? 10.926  10.700  -0.028  1.00 0.00 ? 23  GLN A N    4  
ATOM   6931  C  CA   . GLN A 1 23  ? 11.365  11.310  1.226   1.00 0.00 ? 23  GLN A CA   4  
ATOM   6932  C  C    . GLN A 1 23  ? 12.876  11.194  1.396   1.00 0.00 ? 23  GLN A C    4  
ATOM   6933  O  O    . GLN A 1 23  ? 13.370  10.895  2.483   1.00 0.00 ? 23  GLN A O    4  
ATOM   6934  C  CB   . GLN A 1 23  ? 10.656  10.662  2.416   1.00 0.00 ? 23  GLN A CB   4  
ATOM   6935  C  CG   . GLN A 1 23  ? 10.197  11.659  3.468   1.00 0.00 ? 23  GLN A CG   4  
ATOM   6936  C  CD   . GLN A 1 23  ? 9.875   11.000  4.795   1.00 0.00 ? 23  GLN A CD   4  
ATOM   6937  O  OE1  . GLN A 1 23  ? 10.771  10.674  5.574   1.00 0.00 ? 23  GLN A OE1  4  
ATOM   6938  N  NE2  . GLN A 1 23  ? 8.589   10.801  5.060   1.00 0.00 ? 23  GLN A NE2  4  
ATOM   6939  H  H    . GLN A 1 23  ? 10.659  11.280  -0.768  1.00 0.00 ? 23  GLN A H    4  
ATOM   6940  H  HA   . GLN A 1 23  ? 11.102  12.357  1.190   1.00 0.00 ? 23  GLN A HA   4  
ATOM   6941  H  HB2  . GLN A 1 23  ? 9.790   10.128  2.056   1.00 0.00 ? 23  GLN A HB2  4  
ATOM   6942  H  HB3  . GLN A 1 23  ? 11.331  9.961   2.885   1.00 0.00 ? 23  GLN A HB3  4  
ATOM   6943  H  HG2  . GLN A 1 23  ? 10.983  12.383  3.624   1.00 0.00 ? 23  GLN A HG2  4  
ATOM   6944  H  HG3  . GLN A 1 23  ? 9.312   12.162  3.107   1.00 0.00 ? 23  GLN A HG3  4  
ATOM   6945  H  HE21 . GLN A 1 23  ? 7.929   11.086  4.394   1.00 0.00 ? 23  GLN A HE21 4  
ATOM   6946  H  HE22 . GLN A 1 23  ? 8.352   10.378  5.912   1.00 0.00 ? 23  GLN A HE22 4  
ATOM   6947  N  N    . GLY A 1 24  ? 13.605  11.435  0.313   1.00 0.00 ? 24  GLY A N    4  
ATOM   6948  C  CA   . GLY A 1 24  ? 15.049  11.356  0.359   1.00 0.00 ? 24  GLY A CA   4  
ATOM   6949  C  C    . GLY A 1 24  ? 15.665  11.231  -1.019  1.00 0.00 ? 24  GLY A C    4  
ATOM   6950  O  O    . GLY A 1 24  ? 14.957  11.242  -2.027  1.00 0.00 ? 24  GLY A O    4  
ATOM   6951  H  H    . GLY A 1 24  ? 13.158  11.669  -0.521  1.00 0.00 ? 24  GLY A H    4  
ATOM   6952  H  HA2  . GLY A 1 24  ? 15.432  12.246  0.833   1.00 0.00 ? 24  GLY A HA2  4  
ATOM   6953  H  HA3  . GLY A 1 24  ? 15.330  10.497  0.945   1.00 0.00 ? 24  GLY A HA3  4  
ATOM   6954  N  N    . SER A 1 25  ? 16.989  11.107  -1.067  1.00 0.00 ? 25  SER A N    4  
ATOM   6955  C  CA   . SER A 1 25  ? 17.699  10.974  -2.335  1.00 0.00 ? 25  SER A CA   4  
ATOM   6956  C  C    . SER A 1 25  ? 17.132  9.818   -3.151  1.00 0.00 ? 25  SER A C    4  
ATOM   6957  O  O    . SER A 1 25  ? 16.544  10.022  -4.213  1.00 0.00 ? 25  SER A O    4  
ATOM   6958  C  CB   . SER A 1 25  ? 19.192  10.758  -2.088  1.00 0.00 ? 25  SER A CB   4  
ATOM   6959  O  OG   . SER A 1 25  ? 19.973  11.415  -3.072  1.00 0.00 ? 25  SER A OG   4  
ATOM   6960  H  H    . SER A 1 25  ? 17.499  11.103  -0.230  1.00 0.00 ? 25  SER A H    4  
ATOM   6961  H  HA   . SER A 1 25  ? 17.562  11.891  -2.888  1.00 0.00 ? 25  SER A HA   4  
ATOM   6962  H  HB2  . SER A 1 25  ? 19.455  11.152  -1.117  1.00 0.00 ? 25  SER A HB2  4  
ATOM   6963  H  HB3  . SER A 1 25  ? 19.411  9.701   -2.119  1.00 0.00 ? 25  SER A HB3  4  
ATOM   6964  H  HG   . SER A 1 25  ? 20.414  12.171  -2.679  1.00 0.00 ? 25  SER A HG   4  
ATOM   6965  N  N    . ARG A 1 26  ? 17.306  8.602   -2.643  1.00 0.00 ? 26  ARG A N    4  
ATOM   6966  C  CA   . ARG A 1 26  ? 16.807  7.415   -3.319  1.00 0.00 ? 26  ARG A CA   4  
ATOM   6967  C  C    . ARG A 1 26  ? 16.014  6.537   -2.368  1.00 0.00 ? 26  ARG A C    4  
ATOM   6968  O  O    . ARG A 1 26  ? 15.635  6.952   -1.273  1.00 0.00 ? 26  ARG A O    4  
ATOM   6969  C  CB   . ARG A 1 26  ? 17.961  6.608   -3.918  1.00 0.00 ? 26  ARG A CB   4  
ATOM   6970  C  CG   . ARG A 1 26  ? 17.783  6.292   -5.394  1.00 0.00 ? 26  ARG A CG   4  
ATOM   6971  C  CD   . ARG A 1 26  ? 19.103  6.369   -6.144  1.00 0.00 ? 26  ARG A CD   4  
ATOM   6972  N  NE   . ARG A 1 26  ? 18.936  6.906   -7.492  1.00 0.00 ? 26  ARG A NE   4  
ATOM   6973  C  CZ   . ARG A 1 26  ? 18.655  8.180   -7.753  1.00 0.00 ? 26  ARG A CZ   4  
ATOM   6974  N  NH1  . ARG A 1 26  ? 18.505  9.049   -6.760  1.00 0.00 ? 26  ARG A NH1  4  
ATOM   6975  N  NH2  . ARG A 1 26  ? 18.520  8.587   -9.008  1.00 0.00 ? 26  ARG A NH2  4  
ATOM   6976  H  H    . ARG A 1 26  ? 17.779  8.502   -1.791  1.00 0.00 ? 26  ARG A H    4  
ATOM   6977  H  HA   . ARG A 1 26  ? 16.154  7.727   -4.117  1.00 0.00 ? 26  ARG A HA   4  
ATOM   6978  H  HB2  . ARG A 1 26  ? 18.868  7.164   -3.798  1.00 0.00 ? 26  ARG A HB2  4  
ATOM   6979  H  HB3  . ARG A 1 26  ? 18.050  5.677   -3.381  1.00 0.00 ? 26  ARG A HB3  4  
ATOM   6980  H  HG2  . ARG A 1 26  ? 17.382  5.295   -5.493  1.00 0.00 ? 26  ARG A HG2  4  
ATOM   6981  H  HG3  . ARG A 1 26  ? 17.093  7.004   -5.824  1.00 0.00 ? 26  ARG A HG3  4  
ATOM   6982  H  HD2  . ARG A 1 26  ? 19.778  7.007   -5.595  1.00 0.00 ? 26  ARG A HD2  4  
ATOM   6983  H  HD3  . ARG A 1 26  ? 19.523  5.375   -6.211  1.00 0.00 ? 26  ARG A HD3  4  
ATOM   6984  H  HE   . ARG A 1 26  ? 19.040  6.285   -8.243  1.00 0.00 ? 26  ARG A HE   4  
ATOM   6985  H  HH11 . ARG A 1 26  ? 18.605  8.749   -5.813  1.00 0.00 ? 26  ARG A HH11 4  
ATOM   6986  H  HH12 . ARG A 1 26  ? 18.293  10.006  -6.962  1.00 0.00 ? 26  ARG A HH12 4  
ATOM   6987  H  HH21 . ARG A 1 26  ? 18.631  7.936   -9.759  1.00 0.00 ? 26  ARG A HH21 4  
ATOM   6988  H  HH22 . ARG A 1 26  ? 18.308  9.545   -9.203  1.00 0.00 ? 26  ARG A HH22 4  
ATOM   6989  N  N    . ASN A 1 27  ? 15.769  5.321   -2.814  1.00 0.00 ? 27  ASN A N    4  
ATOM   6990  C  CA   . ASN A 1 27  ? 15.018  4.348   -2.040  1.00 0.00 ? 27  ASN A CA   4  
ATOM   6991  C  C    . ASN A 1 27  ? 15.869  3.118   -1.735  1.00 0.00 ? 27  ASN A C    4  
ATOM   6992  O  O    . ASN A 1 27  ? 16.945  2.931   -2.306  1.00 0.00 ? 27  ASN A O    4  
ATOM   6993  C  CB   . ASN A 1 27  ? 13.746  3.962   -2.801  1.00 0.00 ? 27  ASN A CB   4  
ATOM   6994  C  CG   . ASN A 1 27  ? 13.111  2.669   -2.322  1.00 0.00 ? 27  ASN A CG   4  
ATOM   6995  O  OD1  . ASN A 1 27  ? 13.304  1.613   -2.924  1.00 0.00 ? 27  ASN A OD1  4  
ATOM   6996  N  ND2  . ASN A 1 27  ? 12.352  2.746   -1.237  1.00 0.00 ? 27  ASN A ND2  4  
ATOM   6997  H  H    . ASN A 1 27  ? 16.100  5.075   -3.695  1.00 0.00 ? 27  ASN A H    4  
ATOM   6998  H  HA   . ASN A 1 27  ? 14.741  4.816   -1.111  1.00 0.00 ? 27  ASN A HA   4  
ATOM   6999  H  HB2  . ASN A 1 27  ? 13.026  4.752   -2.687  1.00 0.00 ? 27  ASN A HB2  4  
ATOM   7000  H  HB3  . ASN A 1 27  ? 13.987  3.856   -3.844  1.00 0.00 ? 27  ASN A HB3  4  
ATOM   7001  H  HD21 . ASN A 1 27  ? 12.243  3.621   -0.810  1.00 0.00 ? 27  ASN A HD21 4  
ATOM   7002  H  HD22 . ASN A 1 27  ? 11.932  1.926   -0.906  1.00 0.00 ? 27  ASN A HD22 4  
ATOM   7003  N  N    . LEU A 1 28  ? 15.378  2.290   -0.824  1.00 0.00 ? 28  LEU A N    4  
ATOM   7004  C  CA   . LEU A 1 28  ? 16.066  1.083   -0.415  1.00 0.00 ? 28  LEU A CA   4  
ATOM   7005  C  C    . LEU A 1 28  ? 16.292  0.137   -1.592  1.00 0.00 ? 28  LEU A C    4  
ATOM   7006  O  O    . LEU A 1 28  ? 17.426  -0.239  -1.888  1.00 0.00 ? 28  LEU A O    4  
ATOM   7007  C  CB   . LEU A 1 28  ? 15.247  0.395   0.672   1.00 0.00 ? 28  LEU A CB   4  
ATOM   7008  C  CG   . LEU A 1 28  ? 15.833  0.489   2.078   1.00 0.00 ? 28  LEU A CG   4  
ATOM   7009  C  CD1  . LEU A 1 28  ? 14.900  -0.161  3.090   1.00 0.00 ? 28  LEU A CD1  4  
ATOM   7010  C  CD2  . LEU A 1 28  ? 17.211  -0.154  2.129   1.00 0.00 ? 28  LEU A CD2  4  
ATOM   7011  H  H    . LEU A 1 28  ? 14.522  2.499   -0.406  1.00 0.00 ? 28  LEU A H    4  
ATOM   7012  H  HA   . LEU A 1 28  ? 17.022  1.368   -0.005  1.00 0.00 ? 28  LEU A HA   4  
ATOM   7013  H  HB2  . LEU A 1 28  ? 14.264  0.843   0.685   1.00 0.00 ? 28  LEU A HB2  4  
ATOM   7014  H  HB3  . LEU A 1 28  ? 15.143  -0.639  0.413   1.00 0.00 ? 28  LEU A HB3  4  
ATOM   7015  H  HG   . LEU A 1 28  ? 15.938  1.531   2.343   1.00 0.00 ? 28  LEU A HG   4  
ATOM   7016  H  HD11 . LEU A 1 28  ? 14.363  -0.968  2.615   1.00 0.00 ? 28  LEU A HD11 4  
ATOM   7017  H  HD12 . LEU A 1 28  ? 14.199  0.573   3.456   1.00 0.00 ? 28  LEU A HD12 4  
ATOM   7018  H  HD13 . LEU A 1 28  ? 15.480  -0.550  3.914   1.00 0.00 ? 28  LEU A HD13 4  
ATOM   7019  H  HD21 . LEU A 1 28  ? 17.119  -1.175  2.472   1.00 0.00 ? 28  LEU A HD21 4  
ATOM   7020  H  HD22 . LEU A 1 28  ? 17.841  0.399   2.810   1.00 0.00 ? 28  LEU A HD22 4  
ATOM   7021  H  HD23 . LEU A 1 28  ? 17.649  -0.143  1.143   1.00 0.00 ? 28  LEU A HD23 4  
ATOM   7022  N  N    . LEU A 1 29  ? 15.208  -0.249  -2.260  1.00 0.00 ? 29  LEU A N    4  
ATOM   7023  C  CA   . LEU A 1 29  ? 15.297  -1.154  -3.401  1.00 0.00 ? 29  LEU A CA   4  
ATOM   7024  C  C    . LEU A 1 29  ? 15.610  -0.378  -4.676  1.00 0.00 ? 29  LEU A C    4  
ATOM   7025  O  O    . LEU A 1 29  ? 15.063  0.700   -4.911  1.00 0.00 ? 29  LEU A O    4  
ATOM   7026  C  CB   . LEU A 1 29  ? 14.002  -1.965  -3.574  1.00 0.00 ? 29  LEU A CB   4  
ATOM   7027  C  CG   . LEU A 1 29  ? 12.820  -1.554  -2.690  1.00 0.00 ? 29  LEU A CG   4  
ATOM   7028  C  CD1  . LEU A 1 29  ? 11.543  -2.236  -3.161  1.00 0.00 ? 29  LEU A CD1  4  
ATOM   7029  C  CD2  . LEU A 1 29  ? 13.102  -1.888  -1.231  1.00 0.00 ? 29  LEU A CD2  4  
ATOM   7030  H  H    . LEU A 1 29  ? 14.333  0.080   -1.980  1.00 0.00 ? 29  LEU A H    4  
ATOM   7031  H  HA   . LEU A 1 29  ? 16.112  -1.837  -3.208  1.00 0.00 ? 29  LEU A HA   4  
ATOM   7032  H  HB2  . LEU A 1 29  ? 13.690  -1.887  -4.603  1.00 0.00 ? 29  LEU A HB2  4  
ATOM   7033  H  HB3  . LEU A 1 29  ? 14.227  -3.000  -3.366  1.00 0.00 ? 29  LEU A HB3  4  
ATOM   7034  H  HG   . LEU A 1 29  ? 12.673  -0.487  -2.768  1.00 0.00 ? 29  LEU A HG   4  
ATOM   7035  H  HD11 . LEU A 1 29  ? 11.796  -3.079  -3.788  1.00 0.00 ? 29  LEU A HD11 4  
ATOM   7036  H  HD12 . LEU A 1 29  ? 10.948  -1.534  -3.725  1.00 0.00 ? 29  LEU A HD12 4  
ATOM   7037  H  HD13 . LEU A 1 29  ? 10.981  -2.579  -2.306  1.00 0.00 ? 29  LEU A HD13 4  
ATOM   7038  H  HD21 . LEU A 1 29  ? 12.222  -2.325  -0.784  1.00 0.00 ? 29  LEU A HD21 4  
ATOM   7039  H  HD22 . LEU A 1 29  ? 13.364  -0.986  -0.698  1.00 0.00 ? 29  LEU A HD22 4  
ATOM   7040  H  HD23 . LEU A 1 29  ? 13.921  -2.590  -1.173  1.00 0.00 ? 29  LEU A HD23 4  
ATOM   7041  N  N    . GLN A 1 30  ? 16.502  -0.930  -5.491  1.00 0.00 ? 30  GLN A N    4  
ATOM   7042  C  CA   . GLN A 1 30  ? 16.902  -0.294  -6.736  1.00 0.00 ? 30  GLN A CA   4  
ATOM   7043  C  C    . GLN A 1 30  ? 16.815  -1.275  -7.908  1.00 0.00 ? 30  GLN A C    4  
ATOM   7044  O  O    . GLN A 1 30  ? 15.747  -1.459  -8.489  1.00 0.00 ? 30  GLN A O    4  
ATOM   7045  C  CB   . GLN A 1 30  ? 18.323  0.261   -6.600  1.00 0.00 ? 30  GLN A CB   4  
ATOM   7046  C  CG   . GLN A 1 30  ? 18.861  0.882   -7.877  1.00 0.00 ? 30  GLN A CG   4  
ATOM   7047  C  CD   . GLN A 1 30  ? 20.087  1.740   -7.637  1.00 0.00 ? 30  GLN A CD   4  
ATOM   7048  O  OE1  . GLN A 1 30  ? 21.197  1.230   -7.484  1.00 0.00 ? 30  GLN A OE1  4  
ATOM   7049  N  NE2  . GLN A 1 30  ? 19.893  3.054   -7.601  1.00 0.00 ? 30  GLN A NE2  4  
ATOM   7050  H  H    . GLN A 1 30  ? 16.906  -1.784  -5.245  1.00 0.00 ? 30  GLN A H    4  
ATOM   7051  H  HA   . GLN A 1 30  ? 16.224  0.527   -6.919  1.00 0.00 ? 30  GLN A HA   4  
ATOM   7052  H  HB2  . GLN A 1 30  ? 18.329  1.012   -5.831  1.00 0.00 ? 30  GLN A HB2  4  
ATOM   7053  H  HB3  . GLN A 1 30  ? 18.984  -0.541  -6.308  1.00 0.00 ? 30  GLN A HB3  4  
ATOM   7054  H  HG2  . GLN A 1 30  ? 19.123  0.090   -8.563  1.00 0.00 ? 30  GLN A HG2  4  
ATOM   7055  H  HG3  . GLN A 1 30  ? 18.088  1.496   -8.314  1.00 0.00 ? 30  GLN A HG3  4  
ATOM   7056  H  HE21 . GLN A 1 30  ? 18.982  3.391   -7.729  1.00 0.00 ? 30  GLN A HE21 4  
ATOM   7057  H  HE22 . GLN A 1 30  ? 20.670  3.632   -7.450  1.00 0.00 ? 30  GLN A HE22 4  
ATOM   7058  N  N    . GLY A 1 31  ? 17.937  -1.899  -8.256  1.00 0.00 ? 31  GLY A N    4  
ATOM   7059  C  CA   . GLY A 1 31  ? 17.949  -2.839  -9.354  1.00 0.00 ? 31  GLY A CA   4  
ATOM   7060  C  C    . GLY A 1 31  ? 17.559  -4.240  -8.927  1.00 0.00 ? 31  GLY A C    4  
ATOM   7061  O  O    . GLY A 1 31  ? 16.404  -4.641  -9.067  1.00 0.00 ? 31  GLY A O    4  
ATOM   7062  H  H    . GLY A 1 31  ? 18.759  -1.716  -7.770  1.00 0.00 ? 31  GLY A H    4  
ATOM   7063  H  HA2  . GLY A 1 31  ? 17.258  -2.496  -10.100 1.00 0.00 ? 31  GLY A HA2  4  
ATOM   7064  H  HA3  . GLY A 1 31  ? 18.939  -2.867  -9.782  1.00 0.00 ? 31  GLY A HA3  4  
ATOM   7065  N  N    . GLU A 1 32  ? 18.527  -4.989  -8.409  1.00 0.00 ? 32  GLU A N    4  
ATOM   7066  C  CA   . GLU A 1 32  ? 18.282  -6.356  -7.963  1.00 0.00 ? 32  GLU A CA   4  
ATOM   7067  C  C    . GLU A 1 32  ? 17.598  -6.379  -6.600  1.00 0.00 ? 32  GLU A C    4  
ATOM   7068  O  O    . GLU A 1 32  ? 16.956  -7.365  -6.237  1.00 0.00 ? 32  GLU A O    4  
ATOM   7069  C  CB   . GLU A 1 32  ? 19.594  -7.139  -7.900  1.00 0.00 ? 32  GLU A CB   4  
ATOM   7070  C  CG   . GLU A 1 32  ? 20.407  -7.068  -9.182  1.00 0.00 ? 32  GLU A CG   4  
ATOM   7071  C  CD   . GLU A 1 32  ? 21.888  -6.866  -8.923  1.00 0.00 ? 32  GLU A CD   4  
ATOM   7072  O  OE1  . GLU A 1 32  ? 22.602  -7.875  -8.751  1.00 0.00 ? 32  GLU A OE1  4  
ATOM   7073  O  OE2  . GLU A 1 32  ? 22.331  -5.699  -8.891  1.00 0.00 ? 32  GLU A OE2  4  
ATOM   7074  H  H    . GLU A 1 32  ? 19.429  -4.614  -8.325  1.00 0.00 ? 32  GLU A H    4  
ATOM   7075  H  HA   . GLU A 1 32  ? 17.627  -6.824  -8.683  1.00 0.00 ? 32  GLU A HA   4  
ATOM   7076  H  HB2  . GLU A 1 32  ? 20.195  -6.747  -7.095  1.00 0.00 ? 32  GLU A HB2  4  
ATOM   7077  H  HB3  . GLU A 1 32  ? 19.370  -8.176  -7.699  1.00 0.00 ? 32  GLU A HB3  4  
ATOM   7078  H  HG2  . GLU A 1 32  ? 20.276  -7.988  -9.729  1.00 0.00 ? 32  GLU A HG2  4  
ATOM   7079  H  HG3  . GLU A 1 32  ? 20.045  -6.241  -9.778  1.00 0.00 ? 32  GLU A HG3  4  
ATOM   7080  N  N    . GLU A 1 33  ? 17.727  -5.289  -5.849  1.00 0.00 ? 33  GLU A N    4  
ATOM   7081  C  CA   . GLU A 1 33  ? 17.107  -5.202  -4.535  1.00 0.00 ? 33  GLU A CA   4  
ATOM   7082  C  C    . GLU A 1 33  ? 15.611  -4.969  -4.671  1.00 0.00 ? 33  GLU A C    4  
ATOM   7083  O  O    . GLU A 1 33  ? 14.839  -5.251  -3.755  1.00 0.00 ? 33  GLU A O    4  
ATOM   7084  C  CB   . GLU A 1 33  ? 17.747  -4.090  -3.701  1.00 0.00 ? 33  GLU A CB   4  
ATOM   7085  C  CG   . GLU A 1 33  ? 19.263  -4.054  -3.794  1.00 0.00 ? 33  GLU A CG   4  
ATOM   7086  C  CD   . GLU A 1 33  ? 19.904  -3.380  -2.597  1.00 0.00 ? 33  GLU A CD   4  
ATOM   7087  O  OE1  . GLU A 1 33  ? 19.867  -3.966  -1.495  1.00 0.00 ? 33  GLU A OE1  4  
ATOM   7088  O  OE2  . GLU A 1 33  ? 20.443  -2.266  -2.762  1.00 0.00 ? 33  GLU A OE2  4  
ATOM   7089  H  H    . GLU A 1 33  ? 18.240  -4.528  -6.186  1.00 0.00 ? 33  GLU A H    4  
ATOM   7090  H  HA   . GLU A 1 33  ? 17.259  -6.144  -4.043  1.00 0.00 ? 33  GLU A HA   4  
ATOM   7091  H  HB2  . GLU A 1 33  ? 17.365  -3.139  -4.038  1.00 0.00 ? 33  GLU A HB2  4  
ATOM   7092  H  HB3  . GLU A 1 33  ? 17.474  -4.231  -2.666  1.00 0.00 ? 33  GLU A HB3  4  
ATOM   7093  H  HG2  . GLU A 1 33  ? 19.631  -5.068  -3.856  1.00 0.00 ? 33  GLU A HG2  4  
ATOM   7094  H  HG3  . GLU A 1 33  ? 19.544  -3.515  -4.686  1.00 0.00 ? 33  GLU A HG3  4  
ATOM   7095  N  N    . LEU A 1 34  ? 15.210  -4.468  -5.831  1.00 0.00 ? 34  LEU A N    4  
ATOM   7096  C  CA   . LEU A 1 34  ? 13.819  -4.210  -6.115  1.00 0.00 ? 34  LEU A CA   4  
ATOM   7097  C  C    . LEU A 1 34  ? 13.048  -5.517  -6.172  1.00 0.00 ? 34  LEU A C    4  
ATOM   7098  O  O    . LEU A 1 34  ? 11.904  -5.596  -5.729  1.00 0.00 ? 34  LEU A O    4  
ATOM   7099  C  CB   . LEU A 1 34  ? 13.707  -3.465  -7.440  1.00 0.00 ? 34  LEU A CB   4  
ATOM   7100  C  CG   . LEU A 1 34  ? 13.296  -1.999  -7.326  1.00 0.00 ? 34  LEU A CG   4  
ATOM   7101  C  CD1  . LEU A 1 34  ? 13.088  -1.394  -8.704  1.00 0.00 ? 34  LEU A CD1  4  
ATOM   7102  C  CD2  . LEU A 1 34  ? 12.036  -1.855  -6.482  1.00 0.00 ? 34  LEU A CD2  4  
ATOM   7103  H  H    . LEU A 1 34  ? 15.869  -4.277  -6.522  1.00 0.00 ? 34  LEU A H    4  
ATOM   7104  H  HA   . LEU A 1 34  ? 13.419  -3.598  -5.325  1.00 0.00 ? 34  LEU A HA   4  
ATOM   7105  H  HB2  . LEU A 1 34  ? 14.670  -3.508  -7.932  1.00 0.00 ? 34  LEU A HB2  4  
ATOM   7106  H  HB3  . LEU A 1 34  ? 12.992  -3.975  -8.055  1.00 0.00 ? 34  LEU A HB3  4  
ATOM   7107  H  HG   . LEU A 1 34  ? 14.092  -1.457  -6.837  1.00 0.00 ? 34  LEU A HG   4  
ATOM   7108  H  HD11 . LEU A 1 34  ? 12.055  -1.507  -8.996  1.00 0.00 ? 34  LEU A HD11 4  
ATOM   7109  H  HD12 . LEU A 1 34  ? 13.722  -1.898  -9.419  1.00 0.00 ? 34  LEU A HD12 4  
ATOM   7110  H  HD13 . LEU A 1 34  ? 13.340  -0.343  -8.678  1.00 0.00 ? 34  LEU A HD13 4  
ATOM   7111  H  HD21 . LEU A 1 34  ? 12.213  -1.143  -5.690  1.00 0.00 ? 34  LEU A HD21 4  
ATOM   7112  H  HD22 . LEU A 1 34  ? 11.774  -2.811  -6.055  1.00 0.00 ? 34  LEU A HD22 4  
ATOM   7113  H  HD23 . LEU A 1 34  ? 11.225  -1.506  -7.104  1.00 0.00 ? 34  LEU A HD23 4  
ATOM   7114  N  N    . LEU A 1 35  ? 13.693  -6.546  -6.711  1.00 0.00 ? 35  LEU A N    4  
ATOM   7115  C  CA   . LEU A 1 35  ? 13.072  -7.857  -6.812  1.00 0.00 ? 35  LEU A CA   4  
ATOM   7116  C  C    . LEU A 1 35  ? 13.124  -8.562  -5.466  1.00 0.00 ? 35  LEU A C    4  
ATOM   7117  O  O    . LEU A 1 35  ? 12.155  -9.193  -5.043  1.00 0.00 ? 35  LEU A O    4  
ATOM   7118  C  CB   . LEU A 1 35  ? 13.768  -8.702  -7.881  1.00 0.00 ? 35  LEU A CB   4  
ATOM   7119  C  CG   . LEU A 1 35  ? 14.131  -7.954  -9.165  1.00 0.00 ? 35  LEU A CG   4  
ATOM   7120  C  CD1  . LEU A 1 35  ? 15.021  -8.813  -10.050 1.00 0.00 ? 35  LEU A CD1  4  
ATOM   7121  C  CD2  . LEU A 1 35  ? 12.873  -7.541  -9.914  1.00 0.00 ? 35  LEU A CD2  4  
ATOM   7122  H  H    . LEU A 1 35  ? 14.612  -6.421  -7.037  1.00 0.00 ? 35  LEU A H    4  
ATOM   7123  H  HA   . LEU A 1 35  ? 12.038  -7.712  -7.087  1.00 0.00 ? 35  LEU A HA   4  
ATOM   7124  H  HB2  . LEU A 1 35  ? 14.676  -9.105  -7.455  1.00 0.00 ? 35  LEU A HB2  4  
ATOM   7125  H  HB3  . LEU A 1 35  ? 13.117  -9.523  -8.141  1.00 0.00 ? 35  LEU A HB3  4  
ATOM   7126  H  HG   . LEU A 1 35  ? 14.680  -7.060  -8.910  1.00 0.00 ? 35  LEU A HG   4  
ATOM   7127  H  HD11 . LEU A 1 35  ? 15.473  -8.198  -10.812 1.00 0.00 ? 35  LEU A HD11 4  
ATOM   7128  H  HD12 . LEU A 1 35  ? 14.427  -9.586  -10.515 1.00 0.00 ? 35  LEU A HD12 4  
ATOM   7129  H  HD13 . LEU A 1 35  ? 15.795  -9.268  -9.449  1.00 0.00 ? 35  LEU A HD13 4  
ATOM   7130  H  HD21 . LEU A 1 35  ? 12.074  -7.369  -9.209  1.00 0.00 ? 35  LEU A HD21 4  
ATOM   7131  H  HD22 . LEU A 1 35  ? 12.587  -8.324  -10.599 1.00 0.00 ? 35  LEU A HD22 4  
ATOM   7132  H  HD23 . LEU A 1 35  ? 13.067  -6.633  -10.467 1.00 0.00 ? 35  LEU A HD23 4  
ATOM   7133  N  N    . ARG A 1 36  ? 14.257  -8.433  -4.786  1.00 0.00 ? 36  ARG A N    4  
ATOM   7134  C  CA   . ARG A 1 36  ? 14.429  -9.040  -3.475  1.00 0.00 ? 36  ARG A CA   4  
ATOM   7135  C  C    . ARG A 1 36  ? 13.542  -8.335  -2.457  1.00 0.00 ? 36  ARG A C    4  
ATOM   7136  O  O    . ARG A 1 36  ? 13.060  -8.946  -1.503  1.00 0.00 ? 36  ARG A O    4  
ATOM   7137  C  CB   . ARG A 1 36  ? 15.893  -8.966  -3.036  1.00 0.00 ? 36  ARG A CB   4  
ATOM   7138  C  CG   . ARG A 1 36  ? 16.818  -9.858  -3.848  1.00 0.00 ? 36  ARG A CG   4  
ATOM   7139  C  CD   . ARG A 1 36  ? 18.273  -9.448  -3.686  1.00 0.00 ? 36  ARG A CD   4  
ATOM   7140  N  NE   . ARG A 1 36  ? 18.997  -10.343 -2.786  1.00 0.00 ? 36  ARG A NE   4  
ATOM   7141  C  CZ   . ARG A 1 36  ? 20.283  -10.200 -2.476  1.00 0.00 ? 36  ARG A CZ   4  
ATOM   7142  N  NH1  . ARG A 1 36  ? 20.989  -9.199  -2.987  1.00 0.00 ? 36  ARG A NH1  4  
ATOM   7143  N  NH2  . ARG A 1 36  ? 20.865  -11.060 -1.651  1.00 0.00 ? 36  ARG A NH2  4  
ATOM   7144  H  H    . ARG A 1 36  ? 14.989  -7.904  -5.169  1.00 0.00 ? 36  ARG A H    4  
ATOM   7145  H  HA   . ARG A 1 36  ? 14.130  -10.076 -3.543  1.00 0.00 ? 36  ARG A HA   4  
ATOM   7146  H  HB2  . ARG A 1 36  ? 16.234  -7.945  -3.135  1.00 0.00 ? 36  ARG A HB2  4  
ATOM   7147  H  HB3  . ARG A 1 36  ? 15.963  -9.260  -1.999  1.00 0.00 ? 36  ARG A HB3  4  
ATOM   7148  H  HG2  . ARG A 1 36  ? 16.703  -10.878 -3.514  1.00 0.00 ? 36  ARG A HG2  4  
ATOM   7149  H  HG3  . ARG A 1 36  ? 16.546  -9.786  -4.892  1.00 0.00 ? 36  ARG A HG3  4  
ATOM   7150  H  HD2  . ARG A 1 36  ? 18.748  -9.466  -4.655  1.00 0.00 ? 36  ARG A HD2  4  
ATOM   7151  H  HD3  . ARG A 1 36  ? 18.309  -8.444  -3.287  1.00 0.00 ? 36  ARG A HD3  4  
ATOM   7152  H  HE   . ARG A 1 36  ? 18.498  -11.090 -2.394  1.00 0.00 ? 36  ARG A HE   4  
ATOM   7153  H  HH11 . ARG A 1 36  ? 20.556  -8.547  -3.608  1.00 0.00 ? 36  ARG A HH11 4  
ATOM   7154  H  HH12 . ARG A 1 36  ? 21.955  -9.096  -2.749  1.00 0.00 ? 36  ARG A HH12 4  
ATOM   7155  H  HH21 . ARG A 1 36  ? 20.337  -11.815 -1.263  1.00 0.00 ? 36  ARG A HH21 4  
ATOM   7156  H  HH22 . ARG A 1 36  ? 21.832  -10.953 -1.418  1.00 0.00 ? 36  ARG A HH22 4  
ATOM   7157  N  N    . ALA A 1 37  ? 13.330  -7.039  -2.675  1.00 0.00 ? 37  ALA A N    4  
ATOM   7158  C  CA   . ALA A 1 37  ? 12.504  -6.241  -1.794  1.00 0.00 ? 37  ALA A CA   4  
ATOM   7159  C  C    . ALA A 1 37  ? 11.026  -6.419  -2.118  1.00 0.00 ? 37  ALA A C    4  
ATOM   7160  O  O    . ALA A 1 37  ? 10.220  -6.718  -1.237  1.00 0.00 ? 37  ALA A O    4  
ATOM   7161  C  CB   . ALA A 1 37  ? 12.892  -4.775  -1.888  1.00 0.00 ? 37  ALA A CB   4  
ATOM   7162  H  H    . ALA A 1 37  ? 13.739  -6.613  -3.447  1.00 0.00 ? 37  ALA A H    4  
ATOM   7163  H  HA   . ALA A 1 37  ? 12.688  -6.572  -0.789  1.00 0.00 ? 37  ALA A HA   4  
ATOM   7164  H  HB1  . ALA A 1 37  ? 12.922  -4.477  -2.926  1.00 0.00 ? 37  ALA A HB1  4  
ATOM   7165  H  HB2  . ALA A 1 37  ? 13.867  -4.631  -1.444  1.00 0.00 ? 37  ALA A HB2  4  
ATOM   7166  H  HB3  . ALA A 1 37  ? 12.165  -4.178  -1.363  1.00 0.00 ? 37  ALA A HB3  4  
ATOM   7167  N  N    . LEU A 1 38  ? 10.673  -6.237  -3.391  1.00 0.00 ? 38  LEU A N    4  
ATOM   7168  C  CA   . LEU A 1 38  ? 9.283   -6.385  -3.823  1.00 0.00 ? 38  LEU A CA   4  
ATOM   7169  C  C    . LEU A 1 38  ? 8.701   -7.715  -3.350  1.00 0.00 ? 38  LEU A C    4  
ATOM   7170  O  O    . LEU A 1 38  ? 7.488   -7.850  -3.187  1.00 0.00 ? 38  LEU A O    4  
ATOM   7171  C  CB   . LEU A 1 38  ? 9.172   -6.294  -5.349  1.00 0.00 ? 38  LEU A CB   4  
ATOM   7172  C  CG   . LEU A 1 38  ? 9.008   -4.880  -5.918  1.00 0.00 ? 38  LEU A CG   4  
ATOM   7173  C  CD1  . LEU A 1 38  ? 8.661   -4.939  -7.399  1.00 0.00 ? 38  LEU A CD1  4  
ATOM   7174  C  CD2  . LEU A 1 38  ? 7.939   -4.112  -5.152  1.00 0.00 ? 38  LEU A CD2  4  
ATOM   7175  H  H    . LEU A 1 38  ? 11.362  -6.000  -4.054  1.00 0.00 ? 38  LEU A H    4  
ATOM   7176  H  HA   . LEU A 1 38  ? 8.714   -5.582  -3.381  1.00 0.00 ? 38  LEU A HA   4  
ATOM   7177  H  HB2  . LEU A 1 38  ? 10.060  -6.732  -5.779  1.00 0.00 ? 38  LEU A HB2  4  
ATOM   7178  H  HB3  . LEU A 1 38  ? 8.319   -6.880  -5.659  1.00 0.00 ? 38  LEU A HB3  4  
ATOM   7179  H  HG   . LEU A 1 38  ? 9.942   -4.347  -5.814  1.00 0.00 ? 38  LEU A HG   4  
ATOM   7180  H  HD11 . LEU A 1 38  ? 8.689   -5.964  -7.737  1.00 0.00 ? 38  LEU A HD11 4  
ATOM   7181  H  HD12 . LEU A 1 38  ? 9.376   -4.357  -7.960  1.00 0.00 ? 38  LEU A HD12 4  
ATOM   7182  H  HD13 . LEU A 1 38  ? 7.670   -4.537  -7.555  1.00 0.00 ? 38  LEU A HD13 4  
ATOM   7183  H  HD21 . LEU A 1 38  ? 8.398   -3.570  -4.338  1.00 0.00 ? 38  LEU A HD21 4  
ATOM   7184  H  HD22 . LEU A 1 38  ? 7.210   -4.806  -4.758  1.00 0.00 ? 38  LEU A HD22 4  
ATOM   7185  H  HD23 . LEU A 1 38  ? 7.450   -3.417  -5.817  1.00 0.00 ? 38  LEU A HD23 4  
ATOM   7186  N  N    . ASP A 1 39  ? 9.573   -8.694  -3.132  1.00 0.00 ? 39  ASP A N    4  
ATOM   7187  C  CA   . ASP A 1 39  ? 9.145   -10.011 -2.678  1.00 0.00 ? 39  ASP A CA   4  
ATOM   7188  C  C    . ASP A 1 39  ? 9.222   -10.114 -1.161  1.00 0.00 ? 39  ASP A C    4  
ATOM   7189  O  O    . ASP A 1 39  ? 9.705   -11.106 -0.615  1.00 0.00 ? 39  ASP A O    4  
ATOM   7190  C  CB   . ASP A 1 39  ? 10.001  -11.102 -3.324  1.00 0.00 ? 39  ASP A CB   4  
ATOM   7191  C  CG   . ASP A 1 39  ? 9.196   -12.340 -3.669  1.00 0.00 ? 39  ASP A CG   4  
ATOM   7192  O  OD1  . ASP A 1 39  ? 8.342   -12.258 -4.576  1.00 0.00 ? 39  ASP A OD1  4  
ATOM   7193  O  OD2  . ASP A 1 39  ? 9.419   -13.390 -3.030  1.00 0.00 ? 39  ASP A OD2  4  
ATOM   7194  H  H    . ASP A 1 39  ? 10.526  -8.527  -3.278  1.00 0.00 ? 39  ASP A H    4  
ATOM   7195  H  HA   . ASP A 1 39  ? 8.118   -10.144 -2.980  1.00 0.00 ? 39  ASP A HA   4  
ATOM   7196  H  HB2  . ASP A 1 39  ? 10.440  -10.717 -4.233  1.00 0.00 ? 39  ASP A HB2  4  
ATOM   7197  H  HB3  . ASP A 1 39  ? 10.788  -11.385 -2.642  1.00 0.00 ? 39  ASP A HB3  4  
ATOM   7198  N  N    . GLN A 1 40  ? 8.734   -9.081  -0.489  1.00 0.00 ? 40  GLN A N    4  
ATOM   7199  C  CA   . GLN A 1 40  ? 8.734   -9.045  0.967   1.00 0.00 ? 40  GLN A CA   4  
ATOM   7200  C  C    . GLN A 1 40  ? 7.398   -8.537  1.489   1.00 0.00 ? 40  GLN A C    4  
ATOM   7201  O  O    . GLN A 1 40  ? 7.342   -7.668  2.359   1.00 0.00 ? 40  GLN A O    4  
ATOM   7202  C  CB   . GLN A 1 40  ? 9.873   -8.162  1.482   1.00 0.00 ? 40  GLN A CB   4  
ATOM   7203  C  CG   . GLN A 1 40  ? 10.425  -8.604  2.827   1.00 0.00 ? 40  GLN A CG   4  
ATOM   7204  C  CD   . GLN A 1 40  ? 11.831  -8.095  3.075   1.00 0.00 ? 40  GLN A CD   4  
ATOM   7205  O  OE1  . GLN A 1 40  ? 12.198  -7.008  2.631   1.00 0.00 ? 40  GLN A OE1  4  
ATOM   7206  N  NE2  . GLN A 1 40  ? 12.629  -8.882  3.789   1.00 0.00 ? 40  GLN A NE2  4  
ATOM   7207  H  H    . GLN A 1 40  ? 8.359   -8.326  -0.986  1.00 0.00 ? 40  GLN A H    4  
ATOM   7208  H  HA   . GLN A 1 40  ? 8.880   -10.054 1.321   1.00 0.00 ? 40  GLN A HA   4  
ATOM   7209  H  HB2  . GLN A 1 40  ? 10.679  -8.178  0.763   1.00 0.00 ? 40  GLN A HB2  4  
ATOM   7210  H  HB3  . GLN A 1 40  ? 9.512   -7.149  1.581   1.00 0.00 ? 40  GLN A HB3  4  
ATOM   7211  H  HG2  . GLN A 1 40  ? 9.781   -8.230  3.608   1.00 0.00 ? 40  GLN A HG2  4  
ATOM   7212  H  HG3  . GLN A 1 40  ? 10.437  -9.684  2.859   1.00 0.00 ? 40  GLN A HG3  4  
ATOM   7213  H  HE21 . GLN A 1 40  ? 12.269  -9.736  4.110   1.00 0.00 ? 40  GLN A HE21 4  
ATOM   7214  H  HE22 . GLN A 1 40  ? 13.543  -8.578  3.965   1.00 0.00 ? 40  GLN A HE22 4  
ATOM   7215  N  N    . VAL A 1 41  ? 6.326   -9.092  0.945   1.00 0.00 ? 41  VAL A N    4  
ATOM   7216  C  CA   . VAL A 1 41  ? 4.978   -8.709  1.342   1.00 0.00 ? 41  VAL A CA   4  
ATOM   7217  C  C    . VAL A 1 41  ? 4.752   -8.953  2.830   1.00 0.00 ? 41  VAL A C    4  
ATOM   7218  O  O    . VAL A 1 41  ? 4.544   -10.089 3.257   1.00 0.00 ? 41  VAL A O    4  
ATOM   7219  C  CB   . VAL A 1 41  ? 3.913   -9.481  0.540   1.00 0.00 ? 41  VAL A CB   4  
ATOM   7220  C  CG1  . VAL A 1 41  ? 2.528   -8.910  0.803   1.00 0.00 ? 41  VAL A CG1  4  
ATOM   7221  C  CG2  . VAL A 1 41  ? 4.237   -9.452  -0.945  1.00 0.00 ? 41  VAL A CG2  4  
ATOM   7222  H  H    . VAL A 1 41  ? 6.447   -9.779  0.257   1.00 0.00 ? 41  VAL A H    4  
ATOM   7223  H  HA   . VAL A 1 41  ? 4.858   -7.656  1.137   1.00 0.00 ? 41  VAL A HA   4  
ATOM   7224  H  HB   . VAL A 1 41  ? 3.920   -10.510 0.868   1.00 0.00 ? 41  VAL A HB   4  
ATOM   7225  H  HG11 . VAL A 1 41  ? 2.607   -7.850  0.999   1.00 0.00 ? 41  VAL A HG11 4  
ATOM   7226  H  HG12 . VAL A 1 41  ? 2.091   -9.402  1.657   1.00 0.00 ? 41  VAL A HG12 4  
ATOM   7227  H  HG13 . VAL A 1 41  ? 1.903   -9.069  -0.064  1.00 0.00 ? 41  VAL A HG13 4  
ATOM   7228  H  HG21 . VAL A 1 41  ? 5.045   -10.139 -1.151  1.00 0.00 ? 41  VAL A HG21 4  
ATOM   7229  H  HG22 . VAL A 1 41  ? 4.531   -8.453  -1.230  1.00 0.00 ? 41  VAL A HG22 4  
ATOM   7230  H  HG23 . VAL A 1 41  ? 3.364   -9.745  -1.510  1.00 0.00 ? 41  VAL A HG23 4  
ATOM   7231  N  N    . ASN A 1 42  ? 4.794   -7.881  3.614   1.00 0.00 ? 42  ASN A N    4  
ATOM   7232  C  CA   . ASN A 1 42  ? 4.594   -7.979  5.055   1.00 0.00 ? 42  ASN A CA   4  
ATOM   7233  C  C    . ASN A 1 42  ? 5.629   -8.905  5.688   1.00 0.00 ? 42  ASN A C    4  
ATOM   7234  O  O    . ASN A 1 42  ? 6.426   -9.503  4.935   1.00 0.00 ? 42  ASN A O    4  
ATOM   7235  C  CB   . ASN A 1 42  ? 3.184   -8.488  5.361   1.00 0.00 ? 42  ASN A CB   4  
ATOM   7236  C  CG   . ASN A 1 42  ? 2.654   -7.968  6.683   1.00 0.00 ? 42  ASN A CG   4  
ATOM   7237  O  OD1  . ASN A 1 42  ? 3.086   -6.924  7.171   1.00 0.00 ? 42  ASN A OD1  4  
ATOM   7238  N  ND2  . ASN A 1 42  ? 1.712   -8.697  7.269   1.00 0.00 ? 42  ASN A ND2  4  
ATOM   7239  O  OXT  . ASN A 1 42  ? 5.634   -9.024  6.931   1.00 0.00 ? 42  ASN A OXT  4  
ATOM   7240  H  H    . ASN A 1 42  ? 4.963   -7.002  3.213   1.00 0.00 ? 42  ASN A H    4  
ATOM   7241  H  HA   . ASN A 1 42  ? 4.709   -6.991  5.474   1.00 0.00 ? 42  ASN A HA   4  
ATOM   7242  H  HB2  . ASN A 1 42  ? 2.514   -8.169  4.576   1.00 0.00 ? 42  ASN A HB2  4  
ATOM   7243  H  HB3  . ASN A 1 42  ? 3.199   -9.568  5.399   1.00 0.00 ? 42  ASN A HB3  4  
ATOM   7244  H  HD21 . ASN A 1 42  ? 1.418   -9.518  6.823   1.00 0.00 ? 42  ASN A HD21 4  
ATOM   7245  H  HD22 . ASN A 1 42  ? 1.351   -8.385  8.125   1.00 0.00 ? 42  ASN A HD22 4  
ATOM   7246  N  N    . MET B 2 1   ? -4.439  23.103  -23.573 1.00 0.00 ? 101 MET B N    4  
ATOM   7247  C  CA   . MET B 2 1   ? -5.843  23.177  -23.090 1.00 0.00 ? 101 MET B CA   4  
ATOM   7248  C  C    . MET B 2 1   ? -6.039  22.336  -21.834 1.00 0.00 ? 101 MET B C    4  
ATOM   7249  O  O    . MET B 2 1   ? -7.104  21.758  -21.620 1.00 0.00 ? 101 MET B O    4  
ATOM   7250  C  CB   . MET B 2 1   ? -6.769  22.684  -24.204 1.00 0.00 ? 101 MET B CB   4  
ATOM   7251  C  CG   . MET B 2 1   ? -8.188  23.217  -24.096 1.00 0.00 ? 101 MET B CG   4  
ATOM   7252  S  SD   . MET B 2 1   ? -9.367  22.249  -25.059 1.00 0.00 ? 101 MET B SD   4  
ATOM   7253  C  CE   . MET B 2 1   ? -8.564  22.230  -26.659 1.00 0.00 ? 101 MET B CE   4  
ATOM   7254  H  H1   . MET B 2 1   ? -3.859  23.701  -22.951 1.00 0.00 ? 101 MET B H1   4  
ATOM   7255  H  H2   . MET B 2 1   ? -4.423  23.453  -24.554 1.00 0.00 ? 101 MET B H2   4  
ATOM   7256  H  H3   . MET B 2 1   ? -4.139  22.110  -23.524 1.00 0.00 ? 101 MET B H3   4  
ATOM   7257  H  HA   . MET B 2 1   ? -6.075  24.207  -22.865 1.00 0.00 ? 101 MET B HA   4  
ATOM   7258  H  HB2  . MET B 2 1   ? -6.363  22.992  -25.157 1.00 0.00 ? 101 MET B HB2  4  
ATOM   7259  H  HB3  . MET B 2 1   ? -6.809  21.605  -24.172 1.00 0.00 ? 101 MET B HB3  4  
ATOM   7260  H  HG2  . MET B 2 1   ? -8.489  23.195  -23.060 1.00 0.00 ? 101 MET B HG2  4  
ATOM   7261  H  HG3  . MET B 2 1   ? -8.204  24.237  -24.453 1.00 0.00 ? 101 MET B HG3  4  
ATOM   7262  H  HE1  . MET B 2 1   ? -7.929  23.099  -26.753 1.00 0.00 ? 101 MET B HE1  4  
ATOM   7263  H  HE2  . MET B 2 1   ? -9.311  22.244  -27.438 1.00 0.00 ? 101 MET B HE2  4  
ATOM   7264  H  HE3  . MET B 2 1   ? -7.965  21.336  -26.750 1.00 0.00 ? 101 MET B HE3  4  
ATOM   7265  N  N    . GLY B 2 2   ? -5.001  22.270  -21.006 1.00 0.00 ? 102 GLY B N    4  
ATOM   7266  C  CA   . GLY B 2 2   ? -5.078  21.496  -19.782 1.00 0.00 ? 102 GLY B CA   4  
ATOM   7267  C  C    . GLY B 2 2   ? -5.236  22.367  -18.552 1.00 0.00 ? 102 GLY B C    4  
ATOM   7268  O  O    . GLY B 2 2   ? -5.820  23.449  -18.619 1.00 0.00 ? 102 GLY B O    4  
ATOM   7269  H  H    . GLY B 2 2   ? -4.176  22.750  -21.229 1.00 0.00 ? 102 GLY B H    4  
ATOM   7270  H  HA2  . GLY B 2 2   ? -5.923  20.826  -19.845 1.00 0.00 ? 102 GLY B HA2  4  
ATOM   7271  H  HA3  . GLY B 2 2   ? -4.176  20.911  -19.681 1.00 0.00 ? 102 GLY B HA3  4  
ATOM   7272  N  N    . SER B 2 3   ? -4.714  21.897  -17.424 1.00 0.00 ? 103 SER B N    4  
ATOM   7273  C  CA   . SER B 2 3   ? -4.800  22.640  -16.173 1.00 0.00 ? 103 SER B CA   4  
ATOM   7274  C  C    . SER B 2 3   ? -3.962  21.977  -15.085 1.00 0.00 ? 103 SER B C    4  
ATOM   7275  O  O    . SER B 2 3   ? -4.359  20.962  -14.514 1.00 0.00 ? 103 SER B O    4  
ATOM   7276  C  CB   . SER B 2 3   ? -6.256  22.745  -15.717 1.00 0.00 ? 103 SER B CB   4  
ATOM   7277  O  OG   . SER B 2 3   ? -6.980  21.573  -16.050 1.00 0.00 ? 103 SER B OG   4  
ATOM   7278  H  H    . SER B 2 3   ? -4.260  21.028  -17.433 1.00 0.00 ? 103 SER B H    4  
ATOM   7279  H  HA   . SER B 2 3   ? -4.416  23.633  -16.351 1.00 0.00 ? 103 SER B HA   4  
ATOM   7280  H  HB2  . SER B 2 3   ? -6.288  22.879  -14.647 1.00 0.00 ? 103 SER B HB2  4  
ATOM   7281  H  HB3  . SER B 2 3   ? -6.723  23.591  -16.201 1.00 0.00 ? 103 SER B HB3  4  
ATOM   7282  H  HG   . SER B 2 3   ? -7.421  21.698  -16.894 1.00 0.00 ? 103 SER B HG   4  
ATOM   7283  N  N    . GLY B 2 4   ? -2.799  22.556  -14.805 1.00 0.00 ? 104 GLY B N    4  
ATOM   7284  C  CA   . GLY B 2 4   ? -1.921  22.008  -13.787 1.00 0.00 ? 104 GLY B CA   4  
ATOM   7285  C  C    . GLY B 2 4   ? -0.595  21.543  -14.355 1.00 0.00 ? 104 GLY B C    4  
ATOM   7286  O  O    . GLY B 2 4   ? -0.317  20.345  -14.400 1.00 0.00 ? 104 GLY B O    4  
ATOM   7287  H  H    . GLY B 2 4   ? -2.534  23.363  -15.295 1.00 0.00 ? 104 GLY B H    4  
ATOM   7288  H  HA2  . GLY B 2 4   ? -1.735  22.767  -13.042 1.00 0.00 ? 104 GLY B HA2  4  
ATOM   7289  H  HA3  . GLY B 2 4   ? -2.413  21.170  -13.317 1.00 0.00 ? 104 GLY B HA3  4  
ATOM   7290  N  N    . ALA B 2 5   ? 0.226   22.494  -14.789 1.00 0.00 ? 105 ALA B N    4  
ATOM   7291  C  CA   . ALA B 2 5   ? 1.531   22.176  -15.357 1.00 0.00 ? 105 ALA B CA   4  
ATOM   7292  C  C    . ALA B 2 5   ? 2.521   21.777  -14.268 1.00 0.00 ? 105 ALA B C    4  
ATOM   7293  O  O    . ALA B 2 5   ? 3.356   20.894  -14.468 1.00 0.00 ? 105 ALA B O    4  
ATOM   7294  C  CB   . ALA B 2 5   ? 2.063   23.362  -16.148 1.00 0.00 ? 105 ALA B CB   4  
ATOM   7295  H  H    . ALA B 2 5   ? -0.052  23.431  -14.726 1.00 0.00 ? 105 ALA B H    4  
ATOM   7296  H  HA   . ALA B 2 5   ? 1.405   21.347  -16.038 1.00 0.00 ? 105 ALA B HA   4  
ATOM   7297  H  HB1  . ALA B 2 5   ? 2.128   24.225  -15.503 1.00 0.00 ? 105 ALA B HB1  4  
ATOM   7298  H  HB2  . ALA B 2 5   ? 1.395   23.576  -16.969 1.00 0.00 ? 105 ALA B HB2  4  
ATOM   7299  H  HB3  . ALA B 2 5   ? 3.044   23.126  -16.534 1.00 0.00 ? 105 ALA B HB3  4  
ATOM   7300  N  N    . HIS B 2 6   ? 2.422   22.432  -13.116 1.00 0.00 ? 106 HIS B N    4  
ATOM   7301  C  CA   . HIS B 2 6   ? 3.309   22.145  -11.995 1.00 0.00 ? 106 HIS B CA   4  
ATOM   7302  C  C    . HIS B 2 6   ? 2.527   22.084  -10.686 1.00 0.00 ? 106 HIS B C    4  
ATOM   7303  O  O    . HIS B 2 6   ? 2.992   22.559  -9.650  1.00 0.00 ? 106 HIS B O    4  
ATOM   7304  C  CB   . HIS B 2 6   ? 4.405   23.207  -11.900 1.00 0.00 ? 106 HIS B CB   4  
ATOM   7305  C  CG   . HIS B 2 6   ? 3.878   24.606  -11.837 1.00 0.00 ? 106 HIS B CG   4  
ATOM   7306  N  ND1  . HIS B 2 6   ? 4.200   25.488  -10.827 1.00 0.00 ? 106 HIS B ND1  4  
ATOM   7307  C  CD2  . HIS B 2 6   ? 3.045   25.278  -12.667 1.00 0.00 ? 106 HIS B CD2  4  
ATOM   7308  C  CE1  . HIS B 2 6   ? 3.588   26.640  -11.038 1.00 0.00 ? 106 HIS B CE1  4  
ATOM   7309  N  NE2  . HIS B 2 6   ? 2.882   26.538  -12.148 1.00 0.00 ? 106 HIS B NE2  4  
ATOM   7310  H  H    . HIS B 2 6   ? 1.735   23.125  -13.018 1.00 0.00 ? 106 HIS B H    4  
ATOM   7311  H  HA   . HIS B 2 6   ? 3.766   21.183  -12.172 1.00 0.00 ? 106 HIS B HA   4  
ATOM   7312  H  HB2  . HIS B 2 6   ? 4.991   23.032  -11.011 1.00 0.00 ? 106 HIS B HB2  4  
ATOM   7313  H  HB3  . HIS B 2 6   ? 5.045   23.131  -12.768 1.00 0.00 ? 106 HIS B HB3  4  
ATOM   7314  H  HD1  . HIS B 2 6   ? 4.790   25.298  -10.068 1.00 0.00 ? 106 HIS B HD1  4  
ATOM   7315  H  HD2  . HIS B 2 6   ? 2.592   24.893  -13.571 1.00 0.00 ? 106 HIS B HD2  4  
ATOM   7316  H  HE1  . HIS B 2 6   ? 3.656   27.516  -10.410 1.00 0.00 ? 106 HIS B HE1  4  
ATOM   7317  H  HE2  . HIS B 2 6   ? 2.269   27.221  -12.492 1.00 0.00 ? 106 HIS B HE2  4  
ATOM   7318  N  N    . THR B 2 7   ? 1.336   21.495  -10.741 1.00 0.00 ? 107 THR B N    4  
ATOM   7319  C  CA   . THR B 2 7   ? 0.489   21.372  -9.560  1.00 0.00 ? 107 THR B CA   4  
ATOM   7320  C  C    . THR B 2 7   ? 0.192   19.907  -9.252  1.00 0.00 ? 107 THR B C    4  
ATOM   7321  O  O    . THR B 2 7   ? 0.237   19.055  -10.139 1.00 0.00 ? 107 THR B O    4  
ATOM   7322  C  CB   . THR B 2 7   ? -0.820  22.139  -9.762  1.00 0.00 ? 107 THR B CB   4  
ATOM   7323  O  OG1  . THR B 2 7   ? -1.468  21.721  -10.949 1.00 0.00 ? 107 THR B OG1  4  
ATOM   7324  C  CG2  . THR B 2 7   ? -0.627  23.637  -9.846  1.00 0.00 ? 107 THR B CG2  4  
ATOM   7325  H  H    . THR B 2 7   ? 1.019   21.135  -11.596 1.00 0.00 ? 107 THR B H    4  
ATOM   7326  H  HA   . THR B 2 7   ? 1.022   21.801  -8.724  1.00 0.00 ? 107 THR B HA   4  
ATOM   7327  H  HB   . THR B 2 7   ? -1.476  21.936  -8.928  1.00 0.00 ? 107 THR B HB   4  
ATOM   7328  H  HG1  . THR B 2 7   ? -2.357  22.085  -10.974 1.00 0.00 ? 107 THR B HG1  4  
ATOM   7329  H  HG21 . THR B 2 7   ? 0.279   23.914  -9.327  1.00 0.00 ? 107 THR B HG21 4  
ATOM   7330  H  HG22 . THR B 2 7   ? -1.470  24.135  -9.390  1.00 0.00 ? 107 THR B HG22 4  
ATOM   7331  H  HG23 . THR B 2 7   ? -0.552  23.933  -10.882 1.00 0.00 ? 107 THR B HG23 4  
ATOM   7332  N  N    . ALA B 2 8   ? -0.108  19.623  -7.989  1.00 0.00 ? 108 ALA B N    4  
ATOM   7333  C  CA   . ALA B 2 8   ? -0.411  18.266  -7.559  1.00 0.00 ? 108 ALA B CA   4  
ATOM   7334  C  C    . ALA B 2 8   ? -1.684  17.747  -8.217  1.00 0.00 ? 108 ALA B C    4  
ATOM   7335  O  O    . ALA B 2 8   ? -2.746  17.711  -7.595  1.00 0.00 ? 108 ALA B O    4  
ATOM   7336  C  CB   . ALA B 2 8   ? -0.536  18.207  -6.044  1.00 0.00 ? 108 ALA B CB   4  
ATOM   7337  H  H    . ALA B 2 8   ? -0.124  20.343  -7.329  1.00 0.00 ? 108 ALA B H    4  
ATOM   7338  H  HA   . ALA B 2 8   ? 0.416   17.638  -7.850  1.00 0.00 ? 108 ALA B HA   4  
ATOM   7339  H  HB1  . ALA B 2 8   ? 0.356   18.616  -5.592  1.00 0.00 ? 108 ALA B HB1  4  
ATOM   7340  H  HB2  . ALA B 2 8   ? -0.660  17.181  -5.732  1.00 0.00 ? 108 ALA B HB2  4  
ATOM   7341  H  HB3  . ALA B 2 8   ? -1.394  18.785  -5.731  1.00 0.00 ? 108 ALA B HB3  4  
ATOM   7342  N  N    . ASP B 2 9   ? -1.570  17.346  -9.478  1.00 0.00 ? 109 ASP B N    4  
ATOM   7343  C  CA   . ASP B 2 9   ? -2.713  16.828  -10.222 1.00 0.00 ? 109 ASP B CA   4  
ATOM   7344  C  C    . ASP B 2 9   ? -3.009  15.381  -9.828  1.00 0.00 ? 109 ASP B C    4  
ATOM   7345  O  O    . ASP B 2 9   ? -2.216  14.481  -10.109 1.00 0.00 ? 109 ASP B O    4  
ATOM   7346  C  CB   . ASP B 2 9   ? -2.448  16.913  -11.726 1.00 0.00 ? 109 ASP B CB   4  
ATOM   7347  C  CG   . ASP B 2 9   ? -3.728  16.979  -12.536 1.00 0.00 ? 109 ASP B CG   4  
ATOM   7348  O  OD1  . ASP B 2 9   ? -4.757  17.418  -11.984 1.00 0.00 ? 109 ASP B OD1  4  
ATOM   7349  O  OD2  . ASP B 2 9   ? -3.699  16.590  -13.724 1.00 0.00 ? 109 ASP B OD2  4  
ATOM   7350  H  H    . ASP B 2 9   ? -0.697  17.399  -9.919  1.00 0.00 ? 109 ASP B H    4  
ATOM   7351  H  HA   . ASP B 2 9   ? -3.569  17.439  -9.983  1.00 0.00 ? 109 ASP B HA   4  
ATOM   7352  H  HB2  . ASP B 2 9   ? -1.867  17.800  -11.934 1.00 0.00 ? 109 ASP B HB2  4  
ATOM   7353  H  HB3  . ASP B 2 9   ? -1.890  16.042  -12.037 1.00 0.00 ? 109 ASP B HB3  4  
ATOM   7354  N  N    . PRO B 2 10  ? -4.155  15.134  -9.167  1.00 0.00 ? 110 PRO B N    4  
ATOM   7355  C  CA   . PRO B 2 10  ? -4.542  13.785  -8.739  1.00 0.00 ? 110 PRO B CA   4  
ATOM   7356  C  C    . PRO B 2 10  ? -4.968  12.899  -9.905  1.00 0.00 ? 110 PRO B C    4  
ATOM   7357  O  O    . PRO B 2 10  ? -5.001  11.673  -9.783  1.00 0.00 ? 110 PRO B O    4  
ATOM   7358  C  CB   . PRO B 2 10  ? -5.723  14.037  -7.800  1.00 0.00 ? 110 PRO B CB   4  
ATOM   7359  C  CG   . PRO B 2 10  ? -6.311  15.321  -8.270  1.00 0.00 ? 110 PRO B CG   4  
ATOM   7360  C  CD   . PRO B 2 10  ? -5.162  16.144  -8.786  1.00 0.00 ? 110 PRO B CD   4  
ATOM   7361  H  HA   . PRO B 2 10  ? -3.744  13.302  -8.194  1.00 0.00 ? 110 PRO B HA   4  
ATOM   7362  H  HB2  . PRO B 2 10  ? -6.429  13.224  -7.881  1.00 0.00 ? 110 PRO B HB2  4  
ATOM   7363  H  HB3  . PRO B 2 10  ? -5.369  14.114  -6.783  1.00 0.00 ? 110 PRO B HB3  4  
ATOM   7364  H  HG2  . PRO B 2 10  ? -7.021  15.131  -9.062  1.00 0.00 ? 110 PRO B HG2  4  
ATOM   7365  H  HG3  . PRO B 2 10  ? -6.794  15.827  -7.447  1.00 0.00 ? 110 PRO B HG3  4  
ATOM   7366  H  HD2  . PRO B 2 10  ? -5.469  16.723  -9.645  1.00 0.00 ? 110 PRO B HD2  4  
ATOM   7367  H  HD3  . PRO B 2 10  ? -4.782  16.791  -8.010  1.00 0.00 ? 110 PRO B HD3  4  
ATOM   7368  N  N    . GLU B 2 11  ? -5.297  13.522  -11.035 1.00 0.00 ? 111 GLU B N    4  
ATOM   7369  C  CA   . GLU B 2 11  ? -5.724  12.786  -12.218 1.00 0.00 ? 111 GLU B CA   4  
ATOM   7370  C  C    . GLU B 2 11  ? -4.706  11.721  -12.612 1.00 0.00 ? 111 GLU B C    4  
ATOM   7371  O  O    . GLU B 2 11  ? -5.038  10.748  -13.289 1.00 0.00 ? 111 GLU B O    4  
ATOM   7372  C  CB   . GLU B 2 11  ? -5.958  13.749  -13.386 1.00 0.00 ? 111 GLU B CB   4  
ATOM   7373  C  CG   . GLU B 2 11  ? -7.323  13.595  -14.034 1.00 0.00 ? 111 GLU B CG   4  
ATOM   7374  C  CD   . GLU B 2 11  ? -7.367  14.150  -15.444 1.00 0.00 ? 111 GLU B CD   4  
ATOM   7375  O  OE1  . GLU B 2 11  ? -6.934  15.306  -15.640 1.00 0.00 ? 111 GLU B OE1  4  
ATOM   7376  O  OE2  . GLU B 2 11  ? -7.834  13.432  -16.351 1.00 0.00 ? 111 GLU B OE2  4  
ATOM   7377  H  H    . GLU B 2 11  ? -5.257  14.496  -11.072 1.00 0.00 ? 111 GLU B H    4  
ATOM   7378  H  HA   . GLU B 2 11  ? -6.647  12.304  -11.975 1.00 0.00 ? 111 GLU B HA   4  
ATOM   7379  H  HB2  . GLU B 2 11  ? -5.866  14.763  -13.025 1.00 0.00 ? 111 GLU B HB2  4  
ATOM   7380  H  HB3  . GLU B 2 11  ? -5.203  13.575  -14.140 1.00 0.00 ? 111 GLU B HB3  4  
ATOM   7381  H  HG2  . GLU B 2 11  ? -7.574  12.545  -14.071 1.00 0.00 ? 111 GLU B HG2  4  
ATOM   7382  H  HG3  . GLU B 2 11  ? -8.053  14.118  -13.434 1.00 0.00 ? 111 GLU B HG3  4  
ATOM   7383  N  N    . LYS B 2 12  ? -3.469  11.913  -12.180 1.00 0.00 ? 112 LYS B N    4  
ATOM   7384  C  CA   . LYS B 2 12  ? -2.397  10.972  -12.481 1.00 0.00 ? 112 LYS B CA   4  
ATOM   7385  C  C    . LYS B 2 12  ? -2.403  9.802   -11.498 1.00 0.00 ? 112 LYS B C    4  
ATOM   7386  O  O    . LYS B 2 12  ? -1.860  8.737   -11.788 1.00 0.00 ? 112 LYS B O    4  
ATOM   7387  C  CB   . LYS B 2 12  ? -1.042  11.685  -12.443 1.00 0.00 ? 112 LYS B CB   4  
ATOM   7388  C  CG   . LYS B 2 12  ? -0.428  11.894  -13.818 1.00 0.00 ? 112 LYS B CG   4  
ATOM   7389  C  CD   . LYS B 2 12  ? -0.899  13.197  -14.446 1.00 0.00 ? 112 LYS B CD   4  
ATOM   7390  C  CE   . LYS B 2 12  ? 0.218   13.881  -15.220 1.00 0.00 ? 112 LYS B CE   4  
ATOM   7391  N  NZ   . LYS B 2 12  ? -0.212  14.264  -16.594 1.00 0.00 ? 112 LYS B NZ   4  
ATOM   7392  H  H    . LYS B 2 12  ? -3.274  12.706  -11.645 1.00 0.00 ? 112 LYS B H    4  
ATOM   7393  H  HA   . LYS B 2 12  ? -2.564  10.587  -13.475 1.00 0.00 ? 112 LYS B HA   4  
ATOM   7394  H  HB2  . LYS B 2 12  ? -1.171  12.652  -11.979 1.00 0.00 ? 112 LYS B HB2  4  
ATOM   7395  H  HB3  . LYS B 2 12  ? -0.354  11.099  -11.851 1.00 0.00 ? 112 LYS B HB3  4  
ATOM   7396  H  HG2  . LYS B 2 12  ? 0.647   11.921  -13.721 1.00 0.00 ? 112 LYS B HG2  4  
ATOM   7397  H  HG3  . LYS B 2 12  ? -0.712  11.072  -14.458 1.00 0.00 ? 112 LYS B HG3  4  
ATOM   7398  H  HD2  . LYS B 2 12  ? -1.713  12.985  -15.122 1.00 0.00 ? 112 LYS B HD2  4  
ATOM   7399  H  HD3  . LYS B 2 12  ? -1.241  13.859  -13.664 1.00 0.00 ? 112 LYS B HD3  4  
ATOM   7400  H  HE2  . LYS B 2 12  ? 0.515   14.771  -14.686 1.00 0.00 ? 112 LYS B HE2  4  
ATOM   7401  H  HE3  . LYS B 2 12  ? 1.058   13.205  -15.290 1.00 0.00 ? 112 LYS B HE3  4  
ATOM   7402  H  HZ1  . LYS B 2 12  ? 0.592   14.199  -17.250 1.00 0.00 ? 112 LYS B HZ1  4  
ATOM   7403  H  HZ2  . LYS B 2 12  ? -0.569  15.241  -16.598 1.00 0.00 ? 112 LYS B HZ2  4  
ATOM   7404  H  HZ3  . LYS B 2 12  ? -0.967  13.630  -16.923 1.00 0.00 ? 112 LYS B HZ3  4  
ATOM   7405  N  N    . ARG B 2 13  ? -3.022  10.006  -10.337 1.00 0.00 ? 113 ARG B N    4  
ATOM   7406  C  CA   . ARG B 2 13  ? -3.097  8.964   -9.318  1.00 0.00 ? 113 ARG B CA   4  
ATOM   7407  C  C    . ARG B 2 13  ? -3.645  7.666   -9.896  1.00 0.00 ? 113 ARG B C    4  
ATOM   7408  O  O    . ARG B 2 13  ? -3.366  6.580   -9.389  1.00 0.00 ? 113 ARG B O    4  
ATOM   7409  C  CB   . ARG B 2 13  ? -3.970  9.427   -8.150  1.00 0.00 ? 113 ARG B CB   4  
ATOM   7410  C  CG   . ARG B 2 13  ? -4.062  8.412   -7.022  1.00 0.00 ? 113 ARG B CG   4  
ATOM   7411  C  CD   . ARG B 2 13  ? -5.481  7.894   -6.844  1.00 0.00 ? 113 ARG B CD   4  
ATOM   7412  N  NE   . ARG B 2 13  ? -5.868  7.834   -5.438  1.00 0.00 ? 113 ARG B NE   4  
ATOM   7413  C  CZ   . ARG B 2 13  ? -6.069  8.908   -4.677  1.00 0.00 ? 113 ARG B CZ   4  
ATOM   7414  N  NH1  . ARG B 2 13  ? -5.923  10.126  -5.186  1.00 0.00 ? 113 ARG B NH1  4  
ATOM   7415  N  NH2  . ARG B 2 13  ? -6.416  8.765   -3.406  1.00 0.00 ? 113 ARG B NH2  4  
ATOM   7416  H  H    . ARG B 2 13  ? -3.436  10.874  -10.160 1.00 0.00 ? 113 ARG B H    4  
ATOM   7417  H  HA   . ARG B 2 13  ? -2.099  8.785   -8.960  1.00 0.00 ? 113 ARG B HA   4  
ATOM   7418  H  HB2  . ARG B 2 13  ? -3.559  10.343  -7.749  1.00 0.00 ? 113 ARG B HB2  4  
ATOM   7419  H  HB3  . ARG B 2 13  ? -4.968  9.620   -8.517  1.00 0.00 ? 113 ARG B HB3  4  
ATOM   7420  H  HG2  . ARG B 2 13  ? -3.412  7.580   -7.246  1.00 0.00 ? 113 ARG B HG2  4  
ATOM   7421  H  HG3  . ARG B 2 13  ? -3.743  8.882   -6.102  1.00 0.00 ? 113 ARG B HG3  4  
ATOM   7422  H  HD2  . ARG B 2 13  ? -6.160  8.552   -7.367  1.00 0.00 ? 113 ARG B HD2  4  
ATOM   7423  H  HD3  . ARG B 2 13  ? -5.544  6.903   -7.268  1.00 0.00 ? 113 ARG B HD3  4  
ATOM   7424  H  HE   . ARG B 2 13  ? -5.983  6.947   -5.037  1.00 0.00 ? 113 ARG B HE   4  
ATOM   7425  H  HH11 . ARG B 2 13  ? -5.662  10.241  -6.144  1.00 0.00 ? 113 ARG B HH11 4  
ATOM   7426  H  HH12 . ARG B 2 13  ? -6.076  10.929  -4.610  1.00 0.00 ? 113 ARG B HH12 4  
ATOM   7427  H  HH21 . ARG B 2 13  ? -6.526  7.850   -3.018  1.00 0.00 ? 113 ARG B HH21 4  
ATOM   7428  H  HH22 . ARG B 2 13  ? -6.567  9.572   -2.835  1.00 0.00 ? 113 ARG B HH22 4  
ATOM   7429  N  N    . LYS B 2 14  ? -4.419  7.786   -10.964 1.00 0.00 ? 114 LYS B N    4  
ATOM   7430  C  CA   . LYS B 2 14  ? -5.002  6.623   -11.620 1.00 0.00 ? 114 LYS B CA   4  
ATOM   7431  C  C    . LYS B 2 14  ? -3.937  5.859   -12.398 1.00 0.00 ? 114 LYS B C    4  
ATOM   7432  O  O    . LYS B 2 14  ? -3.861  4.633   -12.326 1.00 0.00 ? 114 LYS B O    4  
ATOM   7433  C  CB   . LYS B 2 14  ? -6.134  7.050   -12.559 1.00 0.00 ? 114 LYS B CB   4  
ATOM   7434  C  CG   . LYS B 2 14  ? -7.520  6.837   -11.974 1.00 0.00 ? 114 LYS B CG   4  
ATOM   7435  C  CD   . LYS B 2 14  ? -7.716  7.641   -10.699 1.00 0.00 ? 114 LYS B CD   4  
ATOM   7436  C  CE   . LYS B 2 14  ? -8.595  6.903   -9.703  1.00 0.00 ? 114 LYS B CE   4  
ATOM   7437  N  NZ   . LYS B 2 14  ? -8.073  5.542   -9.401  1.00 0.00 ? 114 LYS B NZ   4  
ATOM   7438  H  H    . LYS B 2 14  ? -4.598  8.679   -11.322 1.00 0.00 ? 114 LYS B H    4  
ATOM   7439  H  HA   . LYS B 2 14  ? -5.405  5.976   -10.854 1.00 0.00 ? 114 LYS B HA   4  
ATOM   7440  H  HB2  . LYS B 2 14  ? -6.020  8.100   -12.785 1.00 0.00 ? 114 LYS B HB2  4  
ATOM   7441  H  HB3  . LYS B 2 14  ? -6.061  6.483   -13.475 1.00 0.00 ? 114 LYS B HB3  4  
ATOM   7442  H  HG2  . LYS B 2 14  ? -8.258  7.144   -12.700 1.00 0.00 ? 114 LYS B HG2  4  
ATOM   7443  H  HG3  . LYS B 2 14  ? -7.648  5.787   -11.750 1.00 0.00 ? 114 LYS B HG3  4  
ATOM   7444  H  HD2  . LYS B 2 14  ? -6.752  7.823   -10.248 1.00 0.00 ? 114 LYS B HD2  4  
ATOM   7445  H  HD3  . LYS B 2 14  ? -8.182  8.583   -10.949 1.00 0.00 ? 114 LYS B HD3  4  
ATOM   7446  H  HE2  . LYS B 2 14  ? -8.635  7.474   -8.787  1.00 0.00 ? 114 LYS B HE2  4  
ATOM   7447  H  HE3  . LYS B 2 14  ? -9.589  6.815   -10.116 1.00 0.00 ? 114 LYS B HE3  4  
ATOM   7448  H  HZ1  . LYS B 2 14  ? -7.037  5.527   -9.502  1.00 0.00 ? 114 LYS B HZ1  4  
ATOM   7449  H  HZ2  . LYS B 2 14  ? -8.483  4.848   -10.057 1.00 0.00 ? 114 LYS B HZ2  4  
ATOM   7450  H  HZ3  . LYS B 2 14  ? -8.320  5.272   -8.428  1.00 0.00 ? 114 LYS B HZ3  4  
ATOM   7451  N  N    . LEU B 2 15  ? -3.112  6.594   -13.138 1.00 0.00 ? 115 LEU B N    4  
ATOM   7452  C  CA   . LEU B 2 15  ? -2.047  5.983   -13.922 1.00 0.00 ? 115 LEU B CA   4  
ATOM   7453  C  C    . LEU B 2 15  ? -0.947  5.454   -13.014 1.00 0.00 ? 115 LEU B C    4  
ATOM   7454  O  O    . LEU B 2 15  ? -0.275  4.474   -13.337 1.00 0.00 ? 115 LEU B O    4  
ATOM   7455  C  CB   . LEU B 2 15  ? -1.469  6.990   -14.917 1.00 0.00 ? 115 LEU B CB   4  
ATOM   7456  C  CG   . LEU B 2 15  ? -2.483  7.590   -15.893 1.00 0.00 ? 115 LEU B CG   4  
ATOM   7457  C  CD1  . LEU B 2 15  ? -1.800  8.567   -16.837 1.00 0.00 ? 115 LEU B CD1  4  
ATOM   7458  C  CD2  . LEU B 2 15  ? -3.183  6.490   -16.677 1.00 0.00 ? 115 LEU B CD2  4  
ATOM   7459  H  H    . LEU B 2 15  ? -3.218  7.569   -13.152 1.00 0.00 ? 115 LEU B H    4  
ATOM   7460  H  HA   . LEU B 2 15  ? -2.472  5.156   -14.464 1.00 0.00 ? 115 LEU B HA   4  
ATOM   7461  H  HB2  . LEU B 2 15  ? -1.016  7.797   -14.360 1.00 0.00 ? 115 LEU B HB2  4  
ATOM   7462  H  HB3  . LEU B 2 15  ? -0.700  6.496   -15.492 1.00 0.00 ? 115 LEU B HB3  4  
ATOM   7463  H  HG   . LEU B 2 15  ? -3.232  8.134   -15.335 1.00 0.00 ? 115 LEU B HG   4  
ATOM   7464  H  HD11 . LEU B 2 15  ? -0.956  9.022   -16.337 1.00 0.00 ? 115 LEU B HD11 4  
ATOM   7465  H  HD12 . LEU B 2 15  ? -2.501  9.335   -17.130 1.00 0.00 ? 115 LEU B HD12 4  
ATOM   7466  H  HD13 . LEU B 2 15  ? -1.456  8.040   -17.715 1.00 0.00 ? 115 LEU B HD13 4  
ATOM   7467  H  HD21 . LEU B 2 15  ? -3.742  6.928   -17.490 1.00 0.00 ? 115 LEU B HD21 4  
ATOM   7468  H  HD22 . LEU B 2 15  ? -3.857  5.955   -16.022 1.00 0.00 ? 115 LEU B HD22 4  
ATOM   7469  H  HD23 . LEU B 2 15  ? -2.448  5.806   -17.073 1.00 0.00 ? 115 LEU B HD23 4  
ATOM   7470  N  N    . ILE B 2 16  ? -0.779  6.105   -11.873 1.00 0.00 ? 116 ILE B N    4  
ATOM   7471  C  CA   . ILE B 2 16  ? 0.229   5.699   -10.904 1.00 0.00 ? 116 ILE B CA   4  
ATOM   7472  C  C    . ILE B 2 16  ? -0.210  4.433   -10.181 1.00 0.00 ? 116 ILE B C    4  
ATOM   7473  O  O    . ILE B 2 16  ? 0.616   3.600   -9.804  1.00 0.00 ? 116 ILE B O    4  
ATOM   7474  C  CB   . ILE B 2 16  ? 0.493   6.812   -9.869  1.00 0.00 ? 116 ILE B CB   4  
ATOM   7475  C  CG1  . ILE B 2 16  ? 0.889   8.108   -10.579 1.00 0.00 ? 116 ILE B CG1  4  
ATOM   7476  C  CG2  . ILE B 2 16  ? 1.576   6.386   -8.889  1.00 0.00 ? 116 ILE B CG2  4  
ATOM   7477  C  CD1  . ILE B 2 16  ? 0.711   9.344   -9.724  1.00 0.00 ? 116 ILE B CD1  4  
ATOM   7478  H  H    . ILE B 2 16  ? -1.355  6.871   -11.675 1.00 0.00 ? 116 ILE B H    4  
ATOM   7479  H  HA   . ILE B 2 16  ? 1.147   5.502   -11.437 1.00 0.00 ? 116 ILE B HA   4  
ATOM   7480  H  HB   . ILE B 2 16  ? -0.418  6.978   -9.314  1.00 0.00 ? 116 ILE B HB   4  
ATOM   7481  H  HG12 . ILE B 2 16  ? 1.928   8.050   -10.865 1.00 0.00 ? 116 ILE B HG12 4  
ATOM   7482  H  HG13 . ILE B 2 16  ? 0.283   8.227   -11.465 1.00 0.00 ? 116 ILE B HG13 4  
ATOM   7483  H  HG21 . ILE B 2 16  ? 2.242   5.687   -9.370  1.00 0.00 ? 116 ILE B HG21 4  
ATOM   7484  H  HG22 . ILE B 2 16  ? 1.118   5.916   -8.031  1.00 0.00 ? 116 ILE B HG22 4  
ATOM   7485  H  HG23 . ILE B 2 16  ? 2.133   7.254   -8.569  1.00 0.00 ? 116 ILE B HG23 4  
ATOM   7486  H  HD11 . ILE B 2 16  ? 1.478   10.064  -9.970  1.00 0.00 ? 116 ILE B HD11 4  
ATOM   7487  H  HD12 . ILE B 2 16  ? 0.791   9.075   -8.681  1.00 0.00 ? 116 ILE B HD12 4  
ATOM   7488  H  HD13 . ILE B 2 16  ? -0.261  9.775   -9.912  1.00 0.00 ? 116 ILE B HD13 4  
ATOM   7489  N  N    . GLN B 2 17  ? -1.519  4.290   -9.999  1.00 0.00 ? 117 GLN B N    4  
ATOM   7490  C  CA   . GLN B 2 17  ? -2.075  3.123   -9.331  1.00 0.00 ? 117 GLN B CA   4  
ATOM   7491  C  C    . GLN B 2 17  ? -1.910  1.881   -10.201 1.00 0.00 ? 117 GLN B C    4  
ATOM   7492  O  O    . GLN B 2 17  ? -1.580  0.804   -9.703  1.00 0.00 ? 117 GLN B O    4  
ATOM   7493  C  CB   . GLN B 2 17  ? -3.555  3.350   -9.008  1.00 0.00 ? 117 GLN B CB   4  
ATOM   7494  C  CG   . GLN B 2 17  ? -3.829  3.574   -7.529  1.00 0.00 ? 117 GLN B CG   4  
ATOM   7495  C  CD   . GLN B 2 17  ? -3.289  4.900   -7.030  1.00 0.00 ? 117 GLN B CD   4  
ATOM   7496  O  OE1  . GLN B 2 17  ? -2.273  5.393   -7.520  1.00 0.00 ? 117 GLN B OE1  4  
ATOM   7497  N  NE2  . GLN B 2 17  ? -3.965  5.483   -6.046  1.00 0.00 ? 117 GLN B NE2  4  
ATOM   7498  H  H    . GLN B 2 17  ? -2.124  4.987   -10.328 1.00 0.00 ? 117 GLN B H    4  
ATOM   7499  H  HA   . GLN B 2 17  ? -1.532  2.979   -8.409  1.00 0.00 ? 117 GLN B HA   4  
ATOM   7500  H  HB2  . GLN B 2 17  ? -3.900  4.218   -9.550  1.00 0.00 ? 117 GLN B HB2  4  
ATOM   7501  H  HB3  . GLN B 2 17  ? -4.121  2.489   -9.330  1.00 0.00 ? 117 GLN B HB3  4  
ATOM   7502  H  HG2  . GLN B 2 17  ? -4.896  3.553   -7.366  1.00 0.00 ? 117 GLN B HG2  4  
ATOM   7503  H  HG3  . GLN B 2 17  ? -3.365  2.777   -6.966  1.00 0.00 ? 117 GLN B HG3  4  
ATOM   7504  H  HE21 . GLN B 2 17  ? -4.763  5.031   -5.702  1.00 0.00 ? 117 GLN B HE21 4  
ATOM   7505  H  HE22 . GLN B 2 17  ? -3.640  6.343   -5.707  1.00 0.00 ? 117 GLN B HE22 4  
ATOM   7506  N  N    . GLN B 2 18  ? -2.137  2.037   -11.503 1.00 0.00 ? 118 GLN B N    4  
ATOM   7507  C  CA   . GLN B 2 18  ? -2.006  0.924   -12.437 1.00 0.00 ? 118 GLN B CA   4  
ATOM   7508  C  C    . GLN B 2 18  ? -0.554  0.501   -12.571 1.00 0.00 ? 118 GLN B C    4  
ATOM   7509  O  O    . GLN B 2 18  ? -0.249  -0.687  -12.646 1.00 0.00 ? 118 GLN B O    4  
ATOM   7510  C  CB   . GLN B 2 18  ? -2.578  1.303   -13.807 1.00 0.00 ? 118 GLN B CB   4  
ATOM   7511  C  CG   . GLN B 2 18  ? -3.895  0.614   -14.128 1.00 0.00 ? 118 GLN B CG   4  
ATOM   7512  C  CD   . GLN B 2 18  ? -5.050  1.587   -14.260 1.00 0.00 ? 118 GLN B CD   4  
ATOM   7513  O  OE1  . GLN B 2 18  ? -6.079  1.440   -13.599 1.00 0.00 ? 118 GLN B OE1  4  
ATOM   7514  N  NE2  . GLN B 2 18  ? -4.886  2.588   -15.117 1.00 0.00 ? 118 GLN B NE2  4  
ATOM   7515  H  H    . GLN B 2 18  ? -2.393  2.921   -11.843 1.00 0.00 ? 118 GLN B H    4  
ATOM   7516  H  HA   . GLN B 2 18  ? -2.560  0.095   -12.042 1.00 0.00 ? 118 GLN B HA   4  
ATOM   7517  H  HB2  . GLN B 2 18  ? -2.739  2.371   -13.834 1.00 0.00 ? 118 GLN B HB2  4  
ATOM   7518  H  HB3  . GLN B 2 18  ? -1.863  1.038   -14.572 1.00 0.00 ? 118 GLN B HB3  4  
ATOM   7519  H  HG2  . GLN B 2 18  ? -3.788  0.078   -15.059 1.00 0.00 ? 118 GLN B HG2  4  
ATOM   7520  H  HG3  . GLN B 2 18  ? -4.121  -0.086  -13.337 1.00 0.00 ? 118 GLN B HG3  4  
ATOM   7521  H  HE21 . GLN B 2 18  ? -4.041  2.641   -15.610 1.00 0.00 ? 118 GLN B HE21 4  
ATOM   7522  H  HE22 . GLN B 2 18  ? -5.618  3.232   -15.220 1.00 0.00 ? 118 GLN B HE22 4  
ATOM   7523  N  N    . GLN B 2 19  ? 0.332   1.479   -12.587 1.00 0.00 ? 119 GLN B N    4  
ATOM   7524  C  CA   . GLN B 2 19  ? 1.760   1.207   -12.696 1.00 0.00 ? 119 GLN B CA   4  
ATOM   7525  C  C    . GLN B 2 19  ? 2.253   0.487   -11.453 1.00 0.00 ? 119 GLN B C    4  
ATOM   7526  O  O    . GLN B 2 19  ? 3.163   -0.340  -11.515 1.00 0.00 ? 119 GLN B O    4  
ATOM   7527  C  CB   . GLN B 2 19  ? 2.542   2.505   -12.905 1.00 0.00 ? 119 GLN B CB   4  
ATOM   7528  C  CG   . GLN B 2 19  ? 3.988   2.281   -13.322 1.00 0.00 ? 119 GLN B CG   4  
ATOM   7529  C  CD   . GLN B 2 19  ? 4.322   2.937   -14.648 1.00 0.00 ? 119 GLN B CD   4  
ATOM   7530  O  OE1  . GLN B 2 19  ? 4.761   4.086   -14.692 1.00 0.00 ? 119 GLN B OE1  4  
ATOM   7531  N  NE2  . GLN B 2 19  ? 4.116   2.207   -15.739 1.00 0.00 ? 119 GLN B NE2  4  
ATOM   7532  H  H    . GLN B 2 19  ? 0.020   2.402   -12.511 1.00 0.00 ? 119 GLN B H    4  
ATOM   7533  H  HA   . GLN B 2 19  ? 1.905   0.563   -13.545 1.00 0.00 ? 119 GLN B HA   4  
ATOM   7534  H  HB2  . GLN B 2 19  ? 2.054   3.087   -13.672 1.00 0.00 ? 119 GLN B HB2  4  
ATOM   7535  H  HB3  . GLN B 2 19  ? 2.540   3.066   -11.983 1.00 0.00 ? 119 GLN B HB3  4  
ATOM   7536  H  HG2  . GLN B 2 19  ? 4.636   2.692   -12.563 1.00 0.00 ? 119 GLN B HG2  4  
ATOM   7537  H  HG3  . GLN B 2 19  ? 4.164   1.219   -13.408 1.00 0.00 ? 119 GLN B HG3  4  
ATOM   7538  H  HE21 . GLN B 2 19  ? 3.766   1.299   -15.629 1.00 0.00 ? 119 GLN B HE21 4  
ATOM   7539  H  HE22 . GLN B 2 19  ? 4.325   2.607   -16.609 1.00 0.00 ? 119 GLN B HE22 4  
ATOM   7540  N  N    . LEU B 2 20  ? 1.627   0.794   -10.328 1.00 0.00 ? 120 LEU B N    4  
ATOM   7541  C  CA   . LEU B 2 20  ? 1.975   0.167   -9.062  1.00 0.00 ? 120 LEU B CA   4  
ATOM   7542  C  C    . LEU B 2 20  ? 1.445   -1.259  -9.032  1.00 0.00 ? 120 LEU B C    4  
ATOM   7543  O  O    . LEU B 2 20  ? 2.081   -2.164  -8.494  1.00 0.00 ? 120 LEU B O    4  
ATOM   7544  C  CB   . LEU B 2 20  ? 1.395   0.966   -7.894  1.00 0.00 ? 120 LEU B CB   4  
ATOM   7545  C  CG   . LEU B 2 20  ? 2.232   0.948   -6.614  1.00 0.00 ? 120 LEU B CG   4  
ATOM   7546  C  CD1  . LEU B 2 20  ? 2.592   -0.478  -6.227  1.00 0.00 ? 120 LEU B CD1  4  
ATOM   7547  C  CD2  . LEU B 2 20  ? 3.488   1.789   -6.787  1.00 0.00 ? 120 LEU B CD2  4  
ATOM   7548  H  H    . LEU B 2 20  ? 0.901   1.450   -10.354 1.00 0.00 ? 120 LEU B H    4  
ATOM   7549  H  HA   . LEU B 2 20  ? 3.052   0.146   -8.982  1.00 0.00 ? 120 LEU B HA   4  
ATOM   7550  H  HB2  . LEU B 2 20  ? 1.280   1.992   -8.210  1.00 0.00 ? 120 LEU B HB2  4  
ATOM   7551  H  HB3  . LEU B 2 20  ? 0.420   0.566   -7.664  1.00 0.00 ? 120 LEU B HB3  4  
ATOM   7552  H  HG   . LEU B 2 20  ? 1.651   1.376   -5.809  1.00 0.00 ? 120 LEU B HG   4  
ATOM   7553  H  HD11 . LEU B 2 20  ? 3.199   -0.919  -7.003  1.00 0.00 ? 120 LEU B HD11 4  
ATOM   7554  H  HD12 . LEU B 2 20  ? 1.689   -1.056  -6.102  1.00 0.00 ? 120 LEU B HD12 4  
ATOM   7555  H  HD13 . LEU B 2 20  ? 3.147   -0.471  -5.299  1.00 0.00 ? 120 LEU B HD13 4  
ATOM   7556  H  HD21 . LEU B 2 20  ? 4.242   1.208   -7.296  1.00 0.00 ? 120 LEU B HD21 4  
ATOM   7557  H  HD22 . LEU B 2 20  ? 3.857   2.090   -5.818  1.00 0.00 ? 120 LEU B HD22 4  
ATOM   7558  H  HD23 . LEU B 2 20  ? 3.254   2.667   -7.372  1.00 0.00 ? 120 LEU B HD23 4  
ATOM   7559  N  N    . VAL B 2 21  ? 0.272   -1.448  -9.631  1.00 0.00 ? 121 VAL B N    4  
ATOM   7560  C  CA   . VAL B 2 21  ? -0.351  -2.761  -9.693  1.00 0.00 ? 121 VAL B CA   4  
ATOM   7561  C  C    . VAL B 2 21  ? 0.306   -3.612  -10.769 1.00 0.00 ? 121 VAL B C    4  
ATOM   7562  O  O    . VAL B 2 21  ? 0.554   -4.798  -10.564 1.00 0.00 ? 121 VAL B O    4  
ATOM   7563  C  CB   . VAL B 2 21  ? -1.861  -2.659  -9.980  1.00 0.00 ? 121 VAL B CB   4  
ATOM   7564  C  CG1  . VAL B 2 21  ? -2.519  -4.027  -9.874  1.00 0.00 ? 121 VAL B CG1  4  
ATOM   7565  C  CG2  . VAL B 2 21  ? -2.520  -1.664  -9.034  1.00 0.00 ? 121 VAL B CG2  4  
ATOM   7566  H  H    . VAL B 2 21  ? -0.179  -0.687  -10.049 1.00 0.00 ? 121 VAL B H    4  
ATOM   7567  H  HA   . VAL B 2 21  ? -0.215  -3.244  -8.733  1.00 0.00 ? 121 VAL B HA   4  
ATOM   7568  H  HB   . VAL B 2 21  ? -1.991  -2.301  -10.991 1.00 0.00 ? 121 VAL B HB   4  
ATOM   7569  H  HG11 . VAL B 2 21  ? -2.345  -4.582  -10.784 1.00 0.00 ? 121 VAL B HG11 4  
ATOM   7570  H  HG12 . VAL B 2 21  ? -3.582  -3.904  -9.724  1.00 0.00 ? 121 VAL B HG12 4  
ATOM   7571  H  HG13 . VAL B 2 21  ? -2.098  -4.565  -9.038  1.00 0.00 ? 121 VAL B HG13 4  
ATOM   7572  H  HG21 . VAL B 2 21  ? -3.035  -0.908  -9.610  1.00 0.00 ? 121 VAL B HG21 4  
ATOM   7573  H  HG22 . VAL B 2 21  ? -1.765  -1.196  -8.419  1.00 0.00 ? 121 VAL B HG22 4  
ATOM   7574  H  HG23 . VAL B 2 21  ? -3.229  -2.179  -8.403  1.00 0.00 ? 121 VAL B HG23 4  
ATOM   7575  N  N    . LEU B 2 22  ? 0.595   -3.004  -11.920 1.00 0.00 ? 122 LEU B N    4  
ATOM   7576  C  CA   . LEU B 2 22  ? 1.229   -3.717  -13.010 1.00 0.00 ? 122 LEU B CA   4  
ATOM   7577  C  C    . LEU B 2 22  ? 2.544   -4.343  -12.558 1.00 0.00 ? 122 LEU B C    4  
ATOM   7578  O  O    . LEU B 2 22  ? 2.778   -5.535  -12.764 1.00 0.00 ? 122 LEU B O    4  
ATOM   7579  C  CB   . LEU B 2 22  ? 1.476   -2.759  -14.170 1.00 0.00 ? 122 LEU B CB   4  
ATOM   7580  C  CG   . LEU B 2 22  ? 0.782   -3.130  -15.479 1.00 0.00 ? 122 LEU B CG   4  
ATOM   7581  C  CD1  . LEU B 2 22  ? 1.395   -2.360  -16.637 1.00 0.00 ? 122 LEU B CD1  4  
ATOM   7582  C  CD2  . LEU B 2 22  ? 0.862   -4.629  -15.737 1.00 0.00 ? 122 LEU B CD2  4  
ATOM   7583  H  H    . LEU B 2 22  ? 0.381   -2.054  -12.042 1.00 0.00 ? 122 LEU B H    4  
ATOM   7584  H  HA   . LEU B 2 22  ? 0.559   -4.499  -13.332 1.00 0.00 ? 122 LEU B HA   4  
ATOM   7585  H  HB2  . LEU B 2 22  ? 1.135   -1.780  -13.873 1.00 0.00 ? 122 LEU B HB2  4  
ATOM   7586  H  HB3  . LEU B 2 22  ? 2.533   -2.708  -14.346 1.00 0.00 ? 122 LEU B HB3  4  
ATOM   7587  H  HG   . LEU B 2 22  ? -0.260  -2.855  -15.404 1.00 0.00 ? 122 LEU B HG   4  
ATOM   7588  H  HD11 . LEU B 2 22  ? 1.894   -1.480  -16.260 1.00 0.00 ? 122 LEU B HD11 4  
ATOM   7589  H  HD12 . LEU B 2 22  ? 0.616   -2.067  -17.325 1.00 0.00 ? 122 LEU B HD12 4  
ATOM   7590  H  HD13 . LEU B 2 22  ? 2.109   -2.989  -17.147 1.00 0.00 ? 122 LEU B HD13 4  
ATOM   7591  H  HD21 . LEU B 2 22  ? 1.609   -5.066  -15.090 1.00 0.00 ? 122 LEU B HD21 4  
ATOM   7592  H  HD22 . LEU B 2 22  ? 1.132   -4.806  -16.768 1.00 0.00 ? 122 LEU B HD22 4  
ATOM   7593  H  HD23 . LEU B 2 22  ? -0.098  -5.081  -15.533 1.00 0.00 ? 122 LEU B HD23 4  
ATOM   7594  N  N    . LEU B 2 23  ? 3.396   -3.537  -11.932 1.00 0.00 ? 123 LEU B N    4  
ATOM   7595  C  CA   . LEU B 2 23  ? 4.676   -4.027  -11.444 1.00 0.00 ? 123 LEU B CA   4  
ATOM   7596  C  C    . LEU B 2 23  ? 4.443   -5.101  -10.396 1.00 0.00 ? 123 LEU B C    4  
ATOM   7597  O  O    . LEU B 2 23  ? 5.082   -6.152  -10.410 1.00 0.00 ? 123 LEU B O    4  
ATOM   7598  C  CB   . LEU B 2 23  ? 5.505   -2.883  -10.859 1.00 0.00 ? 123 LEU B CB   4  
ATOM   7599  C  CG   . LEU B 2 23  ? 6.257   -2.037  -11.887 1.00 0.00 ? 123 LEU B CG   4  
ATOM   7600  C  CD1  . LEU B 2 23  ? 6.549   -0.653  -11.329 1.00 0.00 ? 123 LEU B CD1  4  
ATOM   7601  C  CD2  . LEU B 2 23  ? 7.546   -2.730  -12.302 1.00 0.00 ? 123 LEU B CD2  4  
ATOM   7602  H  H    . LEU B 2 23  ? 3.152   -2.600  -11.785 1.00 0.00 ? 123 LEU B H    4  
ATOM   7603  H  HA   . LEU B 2 23  ? 5.204   -4.464  -12.278 1.00 0.00 ? 123 LEU B HA   4  
ATOM   7604  H  HB2  . LEU B 2 23  ? 4.842   -2.234  -10.304 1.00 0.00 ? 123 LEU B HB2  4  
ATOM   7605  H  HB3  . LEU B 2 23  ? 6.226   -3.302  -10.173 1.00 0.00 ? 123 LEU B HB3  4  
ATOM   7606  H  HG   . LEU B 2 23  ? 5.641   -1.919  -12.766 1.00 0.00 ? 123 LEU B HG   4  
ATOM   7607  H  HD11 . LEU B 2 23  ? 7.492   -0.299  -11.718 1.00 0.00 ? 123 LEU B HD11 4  
ATOM   7608  H  HD12 . LEU B 2 23  ? 6.600   -0.703  -10.251 1.00 0.00 ? 123 LEU B HD12 4  
ATOM   7609  H  HD13 . LEU B 2 23  ? 5.761   0.026   -11.621 1.00 0.00 ? 123 LEU B HD13 4  
ATOM   7610  H  HD21 . LEU B 2 23  ? 8.274   -2.643  -11.509 1.00 0.00 ? 123 LEU B HD21 4  
ATOM   7611  H  HD22 . LEU B 2 23  ? 7.932   -2.266  -13.198 1.00 0.00 ? 123 LEU B HD22 4  
ATOM   7612  H  HD23 . LEU B 2 23  ? 7.348   -3.774  -12.495 1.00 0.00 ? 123 LEU B HD23 4  
ATOM   7613  N  N    . LEU B 2 24  ? 3.497   -4.835  -9.503  1.00 0.00 ? 124 LEU B N    4  
ATOM   7614  C  CA   . LEU B 2 24  ? 3.144   -5.785  -8.464  1.00 0.00 ? 124 LEU B CA   4  
ATOM   7615  C  C    . LEU B 2 24  ? 2.662   -7.070  -9.113  1.00 0.00 ? 124 LEU B C    4  
ATOM   7616  O  O    . LEU B 2 24  ? 3.044   -8.174  -8.721  1.00 0.00 ? 124 LEU B O    4  
ATOM   7617  C  CB   . LEU B 2 24  ? 2.050   -5.198  -7.569  1.00 0.00 ? 124 LEU B CB   4  
ATOM   7618  C  CG   . LEU B 2 24  ? 2.542   -4.484  -6.307  1.00 0.00 ? 124 LEU B CG   4  
ATOM   7619  C  CD1  . LEU B 2 24  ? 3.762   -3.624  -6.608  1.00 0.00 ? 124 LEU B CD1  4  
ATOM   7620  C  CD2  . LEU B 2 24  ? 1.427   -3.635  -5.719  1.00 0.00 ? 124 LEU B CD2  4  
ATOM   7621  H  H    . LEU B 2 24  ? 3.008   -3.987  -9.561  1.00 0.00 ? 124 LEU B H    4  
ATOM   7622  H  HA   . LEU B 2 24  ? 4.024   -5.993  -7.882  1.00 0.00 ? 124 LEU B HA   4  
ATOM   7623  H  HB2  . LEU B 2 24  ? 1.485   -4.491  -8.158  1.00 0.00 ? 124 LEU B HB2  4  
ATOM   7624  H  HB3  . LEU B 2 24  ? 1.389   -5.995  -7.271  1.00 0.00 ? 124 LEU B HB3  4  
ATOM   7625  H  HG   . LEU B 2 24  ? 2.825   -5.221  -5.570  1.00 0.00 ? 124 LEU B HG   4  
ATOM   7626  H  HD11 . LEU B 2 24  ? 4.659   -4.173  -6.364  1.00 0.00 ? 124 LEU B HD11 4  
ATOM   7627  H  HD12 . LEU B 2 24  ? 3.720   -2.721  -6.017  1.00 0.00 ? 124 LEU B HD12 4  
ATOM   7628  H  HD13 . LEU B 2 24  ? 3.771   -3.368  -7.657  1.00 0.00 ? 124 LEU B HD13 4  
ATOM   7629  H  HD21 . LEU B 2 24  ? 1.021   -2.993  -6.488  1.00 0.00 ? 124 LEU B HD21 4  
ATOM   7630  H  HD22 . LEU B 2 24  ? 1.821   -3.029  -4.916  1.00 0.00 ? 124 LEU B HD22 4  
ATOM   7631  H  HD23 . LEU B 2 24  ? 0.648   -4.277  -5.338  1.00 0.00 ? 124 LEU B HD23 4  
ATOM   7632  N  N    . HIS B 2 25  ? 1.845   -6.900  -10.141 1.00 0.00 ? 125 HIS B N    4  
ATOM   7633  C  CA   . HIS B 2 25  ? 1.322   -8.016  -10.902 1.00 0.00 ? 125 HIS B CA   4  
ATOM   7634  C  C    . HIS B 2 25  ? 2.469   -8.791  -11.496 1.00 0.00 ? 125 HIS B C    4  
ATOM   7635  O  O    . HIS B 2 25  ? 2.760   -9.919  -11.106 1.00 0.00 ? 125 HIS B O    4  
ATOM   7636  C  CB   . HIS B 2 25  ? 0.434   -7.522  -12.046 1.00 0.00 ? 125 HIS B CB   4  
ATOM   7637  C  CG   . HIS B 2 25  ? 0.167   -8.572  -13.083 1.00 0.00 ? 125 HIS B CG   4  
ATOM   7638  N  ND1  . HIS B 2 25  ? -0.862  -9.484  -13.007 1.00 0.00 ? 125 HIS B ND1  4  
ATOM   7639  C  CD2  . HIS B 2 25  ? 0.845   -8.871  -14.224 1.00 0.00 ? 125 HIS B CD2  4  
ATOM   7640  C  CE1  . HIS B 2 25  ? -0.776  -10.289 -14.074 1.00 0.00 ? 125 HIS B CE1  4  
ATOM   7641  N  NE2  . HIS B 2 25  ? 0.240   -9.958  -14.843 1.00 0.00 ? 125 HIS B NE2  4  
ATOM   7642  H  H    . HIS B 2 25  ? 1.610   -5.991  -10.409 1.00 0.00 ? 125 HIS B H    4  
ATOM   7643  H  HA   . HIS B 2 25  ? 0.755   -8.648  -10.246 1.00 0.00 ? 125 HIS B HA   4  
ATOM   7644  H  HB2  . HIS B 2 25  ? -0.501  -7.195  -11.648 1.00 0.00 ? 125 HIS B HB2  4  
ATOM   7645  H  HB3  . HIS B 2 25  ? 0.920   -6.691  -12.535 1.00 0.00 ? 125 HIS B HB3  4  
ATOM   7646  H  HD1  . HIS B 2 25  ? -1.537  -9.535  -12.297 1.00 0.00 ? 125 HIS B HD1  4  
ATOM   7647  H  HD2  . HIS B 2 25  ? 1.723   -8.360  -14.597 1.00 0.00 ? 125 HIS B HD2  4  
ATOM   7648  H  HE1  . HIS B 2 25  ? -1.442  -11.112 -14.270 1.00 0.00 ? 125 HIS B HE1  4  
ATOM   7649  N  N    . ALA B 2 26  ? 3.106   -8.150  -12.458 1.00 0.00 ? 126 ALA B N    4  
ATOM   7650  C  CA   . ALA B 2 26  ? 4.239   -8.727  -13.161 1.00 0.00 ? 126 ALA B CA   4  
ATOM   7651  C  C    . ALA B 2 26  ? 5.169   -9.460  -12.198 1.00 0.00 ? 126 ALA B C    4  
ATOM   7652  O  O    . ALA B 2 26  ? 5.788   -10.462 -12.560 1.00 0.00 ? 126 ALA B O    4  
ATOM   7653  C  CB   . ALA B 2 26  ? 5.000   -7.648  -13.916 1.00 0.00 ? 126 ALA B CB   4  
ATOM   7654  H  H    . ALA B 2 26  ? 2.790   -7.251  -12.703 1.00 0.00 ? 126 ALA B H    4  
ATOM   7655  H  HA   . ALA B 2 26  ? 3.847   -9.432  -13.883 1.00 0.00 ? 126 ALA B HA   4  
ATOM   7656  H  HB1  . ALA B 2 26  ? 5.386   -8.057  -14.838 1.00 0.00 ? 126 ALA B HB1  4  
ATOM   7657  H  HB2  . ALA B 2 26  ? 5.820   -7.294  -13.309 1.00 0.00 ? 126 ALA B HB2  4  
ATOM   7658  H  HB3  . ALA B 2 26  ? 4.335   -6.826  -14.137 1.00 0.00 ? 126 ALA B HB3  4  
ATOM   7659  N  N    . HIS B 2 27  ? 5.255   -8.964  -10.963 1.00 0.00 ? 127 HIS B N    4  
ATOM   7660  C  CA   . HIS B 2 27  ? 6.101   -9.590  -9.954  1.00 0.00 ? 127 HIS B CA   4  
ATOM   7661  C  C    . HIS B 2 27  ? 5.578   -10.982 -9.620  1.00 0.00 ? 127 HIS B C    4  
ATOM   7662  O  O    . HIS B 2 27  ? 6.338   -11.949 -9.571  1.00 0.00 ? 127 HIS B O    4  
ATOM   7663  C  CB   . HIS B 2 27  ? 6.155   -8.730  -8.690  1.00 0.00 ? 127 HIS B CB   4  
ATOM   7664  C  CG   . HIS B 2 27  ? 7.423   -8.896  -7.911  1.00 0.00 ? 127 HIS B CG   4  
ATOM   7665  N  ND1  . HIS B 2 27  ? 8.675   -8.800  -8.482  1.00 0.00 ? 127 HIS B ND1  4  
ATOM   7666  C  CD2  . HIS B 2 27  ? 7.629   -9.153  -6.597  1.00 0.00 ? 127 HIS B CD2  4  
ATOM   7667  C  CE1  . HIS B 2 27  ? 9.595   -8.992  -7.554  1.00 0.00 ? 127 HIS B CE1  4  
ATOM   7668  N  NE2  . HIS B 2 27  ? 8.988   -9.208  -6.403  1.00 0.00 ? 127 HIS B NE2  4  
ATOM   7669  H  H    . HIS B 2 27  ? 4.731   -8.167  -10.723 1.00 0.00 ? 127 HIS B H    4  
ATOM   7670  H  HA   . HIS B 2 27  ? 7.096   -9.680  -10.365 1.00 0.00 ? 127 HIS B HA   4  
ATOM   7671  H  HB2  . HIS B 2 27  ? 6.070   -7.690  -8.967  1.00 0.00 ? 127 HIS B HB2  4  
ATOM   7672  H  HB3  . HIS B 2 27  ? 5.331   -8.995  -8.046  1.00 0.00 ? 127 HIS B HB3  4  
ATOM   7673  H  HD1  . HIS B 2 27  ? 8.860   -8.618  -9.427  1.00 0.00 ? 127 HIS B HD1  4  
ATOM   7674  H  HD2  . HIS B 2 27  ? 6.867   -9.290  -5.844  1.00 0.00 ? 127 HIS B HD2  4  
ATOM   7675  H  HE1  . HIS B 2 27  ? 10.663  -8.976  -7.711  1.00 0.00 ? 127 HIS B HE1  4  
ATOM   7676  H  HE2  . HIS B 2 27  ? 9.434   -9.458  -5.567  1.00 0.00 ? 127 HIS B HE2  4  
ATOM   7677  N  N    . LYS B 2 28  ? 4.269   -11.076 -9.404  1.00 0.00 ? 128 LYS B N    4  
ATOM   7678  C  CA   . LYS B 2 28  ? 3.634   -12.350 -9.090  1.00 0.00 ? 128 LYS B CA   4  
ATOM   7679  C  C    . LYS B 2 28  ? 3.309   -13.116 -10.370 1.00 0.00 ? 128 LYS B C    4  
ATOM   7680  O  O    . LYS B 2 28  ? 3.291   -14.347 -10.382 1.00 0.00 ? 128 LYS B O    4  
ATOM   7681  C  CB   . LYS B 2 28  ? 2.358   -12.124 -8.277  1.00 0.00 ? 128 LYS B CB   4  
ATOM   7682  C  CG   . LYS B 2 28  ? 2.529   -11.126 -7.144  1.00 0.00 ? 128 LYS B CG   4  
ATOM   7683  C  CD   . LYS B 2 28  ? 3.509   -11.632 -6.099  1.00 0.00 ? 128 LYS B CD   4  
ATOM   7684  C  CE   . LYS B 2 28  ? 4.436   -10.526 -5.622  1.00 0.00 ? 128 LYS B CE   4  
ATOM   7685  N  NZ   . LYS B 2 28  ? 4.762   -10.659 -4.175  1.00 0.00 ? 128 LYS B NZ   4  
ATOM   7686  H  H    . LYS B 2 28  ? 3.715   -10.269 -9.466  1.00 0.00 ? 128 LYS B H    4  
ATOM   7687  H  HA   . LYS B 2 28  ? 4.329   -12.932 -8.501  1.00 0.00 ? 128 LYS B HA   4  
ATOM   7688  H  HB2  . LYS B 2 28  ? 1.585   -11.759 -8.938  1.00 0.00 ? 128 LYS B HB2  4  
ATOM   7689  H  HB3  . LYS B 2 28  ? 2.043   -13.066 -7.854  1.00 0.00 ? 128 LYS B HB3  4  
ATOM   7690  H  HG2  . LYS B 2 28  ? 2.897   -10.195 -7.549  1.00 0.00 ? 128 LYS B HG2  4  
ATOM   7691  H  HG3  . LYS B 2 28  ? 1.569   -10.962 -6.675  1.00 0.00 ? 128 LYS B HG3  4  
ATOM   7692  H  HD2  . LYS B 2 28  ? 2.955   -12.013 -5.254  1.00 0.00 ? 128 LYS B HD2  4  
ATOM   7693  H  HD3  . LYS B 2 28  ? 4.102   -12.425 -6.530  1.00 0.00 ? 128 LYS B HD3  4  
ATOM   7694  H  HE2  . LYS B 2 28  ? 5.351   -10.570 -6.193  1.00 0.00 ? 128 LYS B HE2  4  
ATOM   7695  H  HE3  . LYS B 2 28  ? 3.954   -9.574  -5.789  1.00 0.00 ? 128 LYS B HE3  4  
ATOM   7696  H  HZ1  . LYS B 2 28  ? 5.687   -11.118 -4.059  1.00 0.00 ? 128 LYS B HZ1  4  
ATOM   7697  H  HZ2  . LYS B 2 28  ? 4.039   -11.233 -3.696  1.00 0.00 ? 128 LYS B HZ2  4  
ATOM   7698  H  HZ3  . LYS B 2 28  ? 4.793   -9.720  -3.729  1.00 0.00 ? 128 LYS B HZ3  4  
ATOM   7699  N  N    . CYS B 2 29  ? 3.057   -12.375 -11.447 1.00 0.00 ? 129 CYS B N    4  
ATOM   7700  C  CA   . CYS B 2 29  ? 2.737   -12.978 -12.735 1.00 0.00 ? 129 CYS B CA   4  
ATOM   7701  C  C    . CYS B 2 29  ? 3.869   -13.890 -13.196 1.00 0.00 ? 129 CYS B C    4  
ATOM   7702  O  O    . CYS B 2 29  ? 3.636   -15.021 -13.621 1.00 0.00 ? 129 CYS B O    4  
ATOM   7703  C  CB   . CYS B 2 29  ? 2.477   -11.893 -13.782 1.00 0.00 ? 129 CYS B CB   4  
ATOM   7704  S  SG   . CYS B 2 29  ? 1.674   -12.503 -15.300 1.00 0.00 ? 129 CYS B SG   4  
ATOM   7705  H  H    . CYS B 2 29  ? 3.090   -11.398 -11.374 1.00 0.00 ? 129 CYS B H    4  
ATOM   7706  H  HA   . CYS B 2 29  ? 1.843   -13.566 -12.612 1.00 0.00 ? 129 CYS B HA   4  
ATOM   7707  H  HB2  . CYS B 2 29  ? 1.836   -11.137 -13.354 1.00 0.00 ? 129 CYS B HB2  4  
ATOM   7708  H  HB3  . CYS B 2 29  ? 3.416   -11.442 -14.065 1.00 0.00 ? 129 CYS B HB3  4  
ATOM   7709  N  N    . GLN B 2 30  ? 5.098   -13.390 -13.100 1.00 0.00 ? 130 GLN B N    4  
ATOM   7710  C  CA   . GLN B 2 30  ? 6.268   -14.160 -13.498 1.00 0.00 ? 130 GLN B CA   4  
ATOM   7711  C  C    . GLN B 2 30  ? 6.533   -15.294 -12.516 1.00 0.00 ? 130 GLN B C    4  
ATOM   7712  O  O    . GLN B 2 30  ? 7.193   -16.279 -12.844 1.00 0.00 ? 130 GLN B O    4  
ATOM   7713  C  CB   . GLN B 2 30  ? 7.495   -13.253 -13.590 1.00 0.00 ? 130 GLN B CB   4  
ATOM   7714  C  CG   . GLN B 2 30  ? 8.390   -13.555 -14.781 1.00 0.00 ? 130 GLN B CG   4  
ATOM   7715  C  CD   . GLN B 2 30  ? 9.864   -13.489 -14.433 1.00 0.00 ? 130 GLN B CD   4  
ATOM   7716  O  OE1  . GLN B 2 30  ? 10.573  -14.495 -14.490 1.00 0.00 ? 130 GLN B OE1  4  
ATOM   7717  N  NE2  . GLN B 2 30  ? 10.334  -12.302 -14.070 1.00 0.00 ? 130 GLN B NE2  4  
ATOM   7718  H  H    . GLN B 2 30  ? 5.219   -12.485 -12.749 1.00 0.00 ? 130 GLN B H    4  
ATOM   7719  H  HA   . GLN B 2 30  ? 6.067   -14.582 -14.462 1.00 0.00 ? 130 GLN B HA   4  
ATOM   7720  H  HB2  . GLN B 2 30  ? 7.163   -12.228 -13.666 1.00 0.00 ? 130 GLN B HB2  4  
ATOM   7721  H  HB3  . GLN B 2 30  ? 8.081   -13.365 -12.690 1.00 0.00 ? 130 GLN B HB3  4  
ATOM   7722  H  HG2  . GLN B 2 30  ? 8.166   -14.547 -15.142 1.00 0.00 ? 130 GLN B HG2  4  
ATOM   7723  H  HG3  . GLN B 2 30  ? 8.187   -12.835 -15.560 1.00 0.00 ? 130 GLN B HG3  4  
ATOM   7724  H  HE21 . GLN B 2 30  ? 9.711   -11.545 -14.048 1.00 0.00 ? 130 GLN B HE21 4  
ATOM   7725  H  HE22 . GLN B 2 30  ? 11.284  -12.229 -13.841 1.00 0.00 ? 130 GLN B HE22 4  
ATOM   7726  N  N    . ARG B 2 31  ? 6.008   -15.140 -11.312 1.00 0.00 ? 131 ARG B N    4  
ATOM   7727  C  CA   . ARG B 2 31  ? 6.173   -16.140 -10.265 1.00 0.00 ? 131 ARG B CA   4  
ATOM   7728  C  C    . ARG B 2 31  ? 5.010   -17.127 -10.248 1.00 0.00 ? 131 ARG B C    4  
ATOM   7729  O  O    . ARG B 2 31  ? 5.039   -18.127 -9.532  1.00 0.00 ? 131 ARG B O    4  
ATOM   7730  C  CB   . ARG B 2 31  ? 6.311   -15.464 -8.899  1.00 0.00 ? 131 ARG B CB   4  
ATOM   7731  C  CG   . ARG B 2 31  ? 7.101   -16.282 -7.891  1.00 0.00 ? 131 ARG B CG   4  
ATOM   7732  C  CD   . ARG B 2 31  ? 8.088   -15.417 -7.121  1.00 0.00 ? 131 ARG B CD   4  
ATOM   7733  N  NE   . ARG B 2 31  ? 9.231   -15.027 -7.944  1.00 0.00 ? 131 ARG B NE   4  
ATOM   7734  C  CZ   . ARG B 2 31  ? 10.221  -14.248 -7.516  1.00 0.00 ? 131 ARG B CZ   4  
ATOM   7735  N  NH1  . ARG B 2 31  ? 10.212  -13.771 -6.277  1.00 0.00 ? 131 ARG B NH1  4  
ATOM   7736  N  NH2  . ARG B 2 31  ? 11.224  -13.944 -8.328  1.00 0.00 ? 131 ARG B NH2  4  
ATOM   7737  H  H    . ARG B 2 31  ? 5.494   -14.331 -11.124 1.00 0.00 ? 131 ARG B H    4  
ATOM   7738  H  HA   . ARG B 2 31  ? 7.071   -16.683 -10.479 1.00 0.00 ? 131 ARG B HA   4  
ATOM   7739  H  HB2  . ARG B 2 31  ? 6.807   -14.514 -9.030  1.00 0.00 ? 131 ARG B HB2  4  
ATOM   7740  H  HB3  . ARG B 2 31  ? 5.324   -15.291 -8.495  1.00 0.00 ? 131 ARG B HB3  4  
ATOM   7741  H  HG2  . ARG B 2 31  ? 6.415   -16.734 -7.191  1.00 0.00 ? 131 ARG B HG2  4  
ATOM   7742  H  HG3  . ARG B 2 31  ? 7.646   -17.054 -8.416  1.00 0.00 ? 131 ARG B HG3  4  
ATOM   7743  H  HD2  . ARG B 2 31  ? 7.579   -14.527 -6.783  1.00 0.00 ? 131 ARG B HD2  4  
ATOM   7744  H  HD3  . ARG B 2 31  ? 8.444   -15.974 -6.268  1.00 0.00 ? 131 ARG B HD3  4  
ATOM   7745  H  HE   . ARG B 2 31  ? 9.263   -15.365 -8.864  1.00 0.00 ? 131 ARG B HE   4  
ATOM   7746  H  HH11 . ARG B 2 31  ? 9.459   -13.995 -5.660  1.00 0.00 ? 131 ARG B HH11 4  
ATOM   7747  H  HH12 . ARG B 2 31  ? 10.960  -13.186 -5.961  1.00 0.00 ? 131 ARG B HH12 4  
ATOM   7748  H  HH21 . ARG B 2 31  ? 11.237  -14.301 -9.262  1.00 0.00 ? 131 ARG B HH21 4  
ATOM   7749  H  HH22 . ARG B 2 31  ? 11.969  -13.359 -8.007  1.00 0.00 ? 131 ARG B HH22 4  
ATOM   7750  N  N    . ARG B 2 32  ? 3.991   -16.835 -11.040 1.00 0.00 ? 132 ARG B N    4  
ATOM   7751  C  CA   . ARG B 2 32  ? 2.812   -17.691 -11.124 1.00 0.00 ? 132 ARG B CA   4  
ATOM   7752  C  C    . ARG B 2 32  ? 3.131   -18.994 -11.850 1.00 0.00 ? 132 ARG B C    4  
ATOM   7753  O  O    . ARG B 2 32  ? 2.504   -20.024 -11.600 1.00 0.00 ? 132 ARG B O    4  
ATOM   7754  C  CB   . ARG B 2 32  ? 1.675   -16.961 -11.840 1.00 0.00 ? 132 ARG B CB   4  
ATOM   7755  C  CG   . ARG B 2 32  ? 0.367   -17.734 -11.847 1.00 0.00 ? 132 ARG B CG   4  
ATOM   7756  C  CD   . ARG B 2 32  ? -0.833  -16.799 -11.846 1.00 0.00 ? 132 ARG B CD   4  
ATOM   7757  N  NE   . ARG B 2 32  ? -2.056  -17.477 -12.273 1.00 0.00 ? 132 ARG B NE   4  
ATOM   7758  C  CZ   . ARG B 2 32  ? -2.717  -18.355 -11.521 1.00 0.00 ? 132 ARG B CZ   4  
ATOM   7759  N  NH1  . ARG B 2 32  ? -2.277  -18.668 -10.309 1.00 0.00 ? 132 ARG B NH1  4  
ATOM   7760  N  NH2  . ARG B 2 32  ? -3.823  -18.922 -11.985 1.00 0.00 ? 132 ARG B NH2  4  
ATOM   7761  H  H    . ARG B 2 32  ? 4.034   -16.025 -11.585 1.00 0.00 ? 132 ARG B H    4  
ATOM   7762  H  HA   . ARG B 2 32  ? 2.500   -17.922 -10.116 1.00 0.00 ? 132 ARG B HA   4  
ATOM   7763  H  HB2  . ARG B 2 32  ? 1.506   -16.013 -11.351 1.00 0.00 ? 132 ARG B HB2  4  
ATOM   7764  H  HB3  . ARG B 2 32  ? 1.967   -16.781 -12.864 1.00 0.00 ? 132 ARG B HB3  4  
ATOM   7765  H  HG2  . ARG B 2 32  ? 0.329   -18.350 -12.733 1.00 0.00 ? 132 ARG B HG2  4  
ATOM   7766  H  HG3  . ARG B 2 32  ? 0.326   -18.360 -10.968 1.00 0.00 ? 132 ARG B HG3  4  
ATOM   7767  H  HD2  . ARG B 2 32  ? -0.975  -16.418 -10.846 1.00 0.00 ? 132 ARG B HD2  4  
ATOM   7768  H  HD3  . ARG B 2 32  ? -0.634  -15.979 -12.519 1.00 0.00 ? 132 ARG B HD3  4  
ATOM   7769  H  HE   . ARG B 2 32  ? -2.402  -17.265 -13.164 1.00 0.00 ? 132 ARG B HE   4  
ATOM   7770  H  HH11 . ARG B 2 32  ? -1.444  -18.244 -9.953  1.00 0.00 ? 132 ARG B HH11 4  
ATOM   7771  H  HH12 . ARG B 2 32  ? -2.778  -19.329 -9.750  1.00 0.00 ? 132 ARG B HH12 4  
ATOM   7772  H  HH21 . ARG B 2 32  ? -4.159  -18.691 -12.897 1.00 0.00 ? 132 ARG B HH21 4  
ATOM   7773  H  HH22 . ARG B 2 32  ? -4.320  -19.583 -11.421 1.00 0.00 ? 132 ARG B HH22 4  
ATOM   7774  N  N    . GLU B 2 33  ? 4.105   -18.945 -12.753 1.00 0.00 ? 133 GLU B N    4  
ATOM   7775  C  CA   . GLU B 2 33  ? 4.499   -20.124 -13.517 1.00 0.00 ? 133 GLU B CA   4  
ATOM   7776  C  C    . GLU B 2 33  ? 5.536   -20.950 -12.760 1.00 0.00 ? 133 GLU B C    4  
ATOM   7777  O  O    . GLU B 2 33  ? 5.633   -22.162 -12.947 1.00 0.00 ? 133 GLU B O    4  
ATOM   7778  C  CB   . GLU B 2 33  ? 5.056   -19.712 -14.880 1.00 0.00 ? 133 GLU B CB   4  
ATOM   7779  C  CG   . GLU B 2 33  ? 4.203   -18.680 -15.599 1.00 0.00 ? 133 GLU B CG   4  
ATOM   7780  C  CD   . GLU B 2 33  ? 4.364   -18.737 -17.106 1.00 0.00 ? 133 GLU B CD   4  
ATOM   7781  O  OE1  . GLU B 2 33  ? 4.657   -19.833 -17.631 1.00 0.00 ? 133 GLU B OE1  4  
ATOM   7782  O  OE2  . GLU B 2 33  ? 4.198   -17.688 -17.762 1.00 0.00 ? 133 GLU B OE2  4  
ATOM   7783  H  H    . GLU B 2 33  ? 4.567   -18.096 -12.912 1.00 0.00 ? 133 GLU B H    4  
ATOM   7784  H  HA   . GLU B 2 33  ? 3.617   -20.728 -13.667 1.00 0.00 ? 133 GLU B HA   4  
ATOM   7785  H  HB2  . GLU B 2 33  ? 6.044   -19.299 -14.742 1.00 0.00 ? 133 GLU B HB2  4  
ATOM   7786  H  HB3  . GLU B 2 33  ? 5.127   -20.589 -15.506 1.00 0.00 ? 133 GLU B HB3  4  
ATOM   7787  H  HG2  . GLU B 2 33  ? 3.166   -18.857 -15.357 1.00 0.00 ? 133 GLU B HG2  4  
ATOM   7788  H  HG3  . GLU B 2 33  ? 4.489   -17.696 -15.258 1.00 0.00 ? 133 GLU B HG3  4  
ATOM   7789  N  N    . GLN B 2 34  ? 6.311   -20.288 -11.907 1.00 0.00 ? 134 GLN B N    4  
ATOM   7790  C  CA   . GLN B 2 34  ? 7.342   -20.965 -11.127 1.00 0.00 ? 134 GLN B CA   4  
ATOM   7791  C  C    . GLN B 2 34  ? 6.740   -22.069 -10.263 1.00 0.00 ? 134 GLN B C    4  
ATOM   7792  O  O    . GLN B 2 34  ? 7.420   -23.033 -9.911  1.00 0.00 ? 134 GLN B O    4  
ATOM   7793  C  CB   . GLN B 2 34  ? 8.087   -19.960 -10.246 1.00 0.00 ? 134 GLN B CB   4  
ATOM   7794  C  CG   . GLN B 2 34  ? 9.182   -20.587 -9.398  1.00 0.00 ? 134 GLN B CG   4  
ATOM   7795  C  CD   . GLN B 2 34  ? 10.208  -21.334 -10.229 1.00 0.00 ? 134 GLN B CD   4  
ATOM   7796  O  OE1  . GLN B 2 34  ? 10.605  -20.881 -11.302 1.00 0.00 ? 134 GLN B OE1  4  
ATOM   7797  N  NE2  . GLN B 2 34  ? 10.644  -22.487 -9.733  1.00 0.00 ? 134 GLN B NE2  4  
ATOM   7798  H  H    . GLN B 2 34  ? 6.190   -19.321 -11.801 1.00 0.00 ? 134 GLN B H    4  
ATOM   7799  H  HA   . GLN B 2 34  ? 8.041   -21.408 -11.819 1.00 0.00 ? 134 GLN B HA   4  
ATOM   7800  H  HB2  . GLN B 2 34  ? 8.537   -19.208 -10.878 1.00 0.00 ? 134 GLN B HB2  4  
ATOM   7801  H  HB3  . GLN B 2 34  ? 7.378   -19.484 -9.584  1.00 0.00 ? 134 GLN B HB3  4  
ATOM   7802  H  HG2  . GLN B 2 34  ? 9.687   -19.806 -8.849  1.00 0.00 ? 134 GLN B HG2  4  
ATOM   7803  H  HG3  . GLN B 2 34  ? 8.731   -21.279 -8.703  1.00 0.00 ? 134 GLN B HG3  4  
ATOM   7804  H  HE21 . GLN B 2 34  ? 10.283  -22.786 -8.872  1.00 0.00 ? 134 GLN B HE21 4  
ATOM   7805  H  HE22 . GLN B 2 34  ? 11.307  -22.992 -10.249 1.00 0.00 ? 134 GLN B HE22 4  
ATOM   7806  N  N    . ALA B 2 35  ? 5.463   -21.924 -9.920  1.00 0.00 ? 135 ALA B N    4  
ATOM   7807  C  CA   . ALA B 2 35  ? 4.778   -22.911 -9.094  1.00 0.00 ? 135 ALA B CA   4  
ATOM   7808  C  C    . ALA B 2 35  ? 4.044   -23.938 -9.950  1.00 0.00 ? 135 ALA B C    4  
ATOM   7809  O  O    . ALA B 2 35  ? 4.130   -25.140 -9.703  1.00 0.00 ? 135 ALA B O    4  
ATOM   7810  C  CB   . ALA B 2 35  ? 3.809   -22.224 -8.145  1.00 0.00 ? 135 ALA B CB   4  
ATOM   7811  H  H    . ALA B 2 35  ? 4.972   -21.134 -10.228 1.00 0.00 ? 135 ALA B H    4  
ATOM   7812  H  HA   . ALA B 2 35  ? 5.523   -23.422 -8.502  1.00 0.00 ? 135 ALA B HA   4  
ATOM   7813  H  HB1  . ALA B 2 35  ? 3.144   -21.585 -8.709  1.00 0.00 ? 135 ALA B HB1  4  
ATOM   7814  H  HB2  . ALA B 2 35  ? 4.362   -21.628 -7.434  1.00 0.00 ? 135 ALA B HB2  4  
ATOM   7815  H  HB3  . ALA B 2 35  ? 3.232   -22.969 -7.618  1.00 0.00 ? 135 ALA B HB3  4  
ATOM   7816  N  N    . ASN B 2 36  ? 3.320   -23.456 -10.955 1.00 0.00 ? 136 ASN B N    4  
ATOM   7817  C  CA   . ASN B 2 36  ? 2.571   -24.335 -11.844 1.00 0.00 ? 136 ASN B CA   4  
ATOM   7818  C  C    . ASN B 2 36  ? 3.363   -24.634 -13.114 1.00 0.00 ? 136 ASN B C    4  
ATOM   7819  O  O    . ASN B 2 36  ? 2.785   -24.922 -14.162 1.00 0.00 ? 136 ASN B O    4  
ATOM   7820  C  CB   . ASN B 2 36  ? 1.226   -23.702 -12.204 1.00 0.00 ? 136 ASN B CB   4  
ATOM   7821  C  CG   . ASN B 2 36  ? 0.113   -24.138 -11.270 1.00 0.00 ? 136 ASN B CG   4  
ATOM   7822  O  OD1  . ASN B 2 36  ? -0.945  -24.585 -11.712 1.00 0.00 ? 136 ASN B OD1  4  
ATOM   7823  N  ND2  . ASN B 2 36  ? 0.348   -24.007 -9.970  1.00 0.00 ? 136 ASN B ND2  4  
ATOM   7824  H  H    . ASN B 2 36  ? 3.289   -22.487 -11.101 1.00 0.00 ? 136 ASN B H    4  
ATOM   7825  H  HA   . ASN B 2 36  ? 2.393   -25.262 -11.319 1.00 0.00 ? 136 ASN B HA   4  
ATOM   7826  H  HB2  . ASN B 2 36  ? 1.315   -22.627 -12.150 1.00 0.00 ? 136 ASN B HB2  4  
ATOM   7827  H  HB3  . ASN B 2 36  ? 0.958   -23.987 -13.211 1.00 0.00 ? 136 ASN B HB3  4  
ATOM   7828  H  HD21 . ASN B 2 36  ? 1.213   -23.643 -9.690  1.00 0.00 ? 136 ASN B HD21 4  
ATOM   7829  H  HD22 . ASN B 2 36  ? -0.354  -24.281 -9.343  1.00 0.00 ? 136 ASN B HD22 4  
ATOM   7830  N  N    . GLY B 2 37  ? 4.688   -24.567 -13.015 1.00 0.00 ? 137 GLY B N    4  
ATOM   7831  C  CA   . GLY B 2 37  ? 5.532   -24.834 -14.167 1.00 0.00 ? 137 GLY B CA   4  
ATOM   7832  C  C    . GLY B 2 37  ? 5.161   -23.987 -15.371 1.00 0.00 ? 137 GLY B C    4  
ATOM   7833  O  O    . GLY B 2 37  ? 4.816   -22.814 -15.229 1.00 0.00 ? 137 GLY B O    4  
ATOM   7834  H  H    . GLY B 2 37  ? 5.096   -24.334 -12.154 1.00 0.00 ? 137 GLY B H    4  
ATOM   7835  H  HA2  . GLY B 2 37  ? 6.559   -24.632 -13.901 1.00 0.00 ? 137 GLY B HA2  4  
ATOM   7836  H  HA3  . GLY B 2 37  ? 5.439   -25.877 -14.433 1.00 0.00 ? 137 GLY B HA3  4  
ATOM   7837  N  N    . GLU B 2 38  ? 5.233   -24.583 -16.557 1.00 0.00 ? 138 GLU B N    4  
ATOM   7838  C  CA   . GLU B 2 38  ? 4.900   -23.875 -17.786 1.00 0.00 ? 138 GLU B CA   4  
ATOM   7839  C  C    . GLU B 2 38  ? 3.402   -23.602 -17.867 1.00 0.00 ? 138 GLU B C    4  
ATOM   7840  O  O    . GLU B 2 38  ? 2.607   -24.512 -18.101 1.00 0.00 ? 138 GLU B O    4  
ATOM   7841  C  CB   . GLU B 2 38  ? 5.350   -24.685 -19.005 1.00 0.00 ? 138 GLU B CB   4  
ATOM   7842  C  CG   . GLU B 2 38  ? 5.079   -23.991 -20.330 1.00 0.00 ? 138 GLU B CG   4  
ATOM   7843  C  CD   . GLU B 2 38  ? 4.280   -24.853 -21.288 1.00 0.00 ? 138 GLU B CD   4  
ATOM   7844  O  OE1  . GLU B 2 38  ? 4.868   -25.778 -21.889 1.00 0.00 ? 138 GLU B OE1  4  
ATOM   7845  O  OE2  . GLU B 2 38  ? 3.065   -24.603 -21.439 1.00 0.00 ? 138 GLU B OE2  4  
ATOM   7846  H  H    . GLU B 2 38  ? 5.513   -25.518 -16.607 1.00 0.00 ? 138 GLU B H    4  
ATOM   7847  H  HA   . GLU B 2 38  ? 5.427   -22.934 -17.777 1.00 0.00 ? 138 GLU B HA   4  
ATOM   7848  H  HB2  . GLU B 2 38  ? 6.412   -24.867 -18.928 1.00 0.00 ? 138 GLU B HB2  4  
ATOM   7849  H  HB3  . GLU B 2 38  ? 4.830   -25.632 -19.004 1.00 0.00 ? 138 GLU B HB3  4  
ATOM   7850  H  HG2  . GLU B 2 38  ? 4.526   -23.084 -20.142 1.00 0.00 ? 138 GLU B HG2  4  
ATOM   7851  H  HG3  . GLU B 2 38  ? 6.024   -23.747 -20.792 1.00 0.00 ? 138 GLU B HG3  4  
ATOM   7852  N  N    . VAL B 2 39  ? 3.024   -22.343 -17.669 1.00 0.00 ? 139 VAL B N    4  
ATOM   7853  C  CA   . VAL B 2 39  ? 1.622   -21.949 -17.716 1.00 0.00 ? 139 VAL B CA   4  
ATOM   7854  C  C    . VAL B 2 39  ? 1.343   -21.053 -18.916 1.00 0.00 ? 139 VAL B C    4  
ATOM   7855  O  O    . VAL B 2 39  ? 2.252   -20.427 -19.462 1.00 0.00 ? 139 VAL B O    4  
ATOM   7856  C  CB   . VAL B 2 39  ? 1.198   -21.209 -16.437 1.00 0.00 ? 139 VAL B CB   4  
ATOM   7857  C  CG1  . VAL B 2 39  ? -0.318  -21.129 -16.344 1.00 0.00 ? 139 VAL B CG1  4  
ATOM   7858  C  CG2  . VAL B 2 39  ? 1.780   -21.885 -15.205 1.00 0.00 ? 139 VAL B CG2  4  
ATOM   7859  H  H    . VAL B 2 39  ? 3.702   -21.662 -17.484 1.00 0.00 ? 139 VAL B H    4  
ATOM   7860  H  HA   . VAL B 2 39  ? 1.026   -22.846 -17.804 1.00 0.00 ? 139 VAL B HA   4  
ATOM   7861  H  HB   . VAL B 2 39  ? 1.585   -20.206 -16.489 1.00 0.00 ? 139 VAL B HB   4  
ATOM   7862  H  HG11 . VAL B 2 39  ? -0.753  -22.003 -16.804 1.00 0.00 ? 139 VAL B HG11 4  
ATOM   7863  H  HG12 . VAL B 2 39  ? -0.663  -20.242 -16.855 1.00 0.00 ? 139 VAL B HG12 4  
ATOM   7864  H  HG13 . VAL B 2 39  ? -0.613  -21.084 -15.306 1.00 0.00 ? 139 VAL B HG13 4  
ATOM   7865  H  HG21 . VAL B 2 39  ? 1.343   -21.454 -14.316 1.00 0.00 ? 139 VAL B HG21 4  
ATOM   7866  H  HG22 . VAL B 2 39  ? 2.851   -21.741 -15.186 1.00 0.00 ? 139 VAL B HG22 4  
ATOM   7867  H  HG23 . VAL B 2 39  ? 1.561   -22.942 -15.236 1.00 0.00 ? 139 VAL B HG23 4  
ATOM   7868  N  N    . ARG B 2 40  ? 0.080   -20.997 -19.318 1.00 0.00 ? 140 ARG B N    4  
ATOM   7869  C  CA   . ARG B 2 40  ? -0.327  -20.178 -20.453 1.00 0.00 ? 140 ARG B CA   4  
ATOM   7870  C  C    . ARG B 2 40  ? -0.018  -18.706 -20.200 1.00 0.00 ? 140 ARG B C    4  
ATOM   7871  O  O    . ARG B 2 40  ? 0.092   -18.273 -19.053 1.00 0.00 ? 140 ARG B O    4  
ATOM   7872  C  CB   . ARG B 2 40  ? -1.823  -20.355 -20.726 1.00 0.00 ? 140 ARG B CB   4  
ATOM   7873  C  CG   . ARG B 2 40  ? -2.131  -21.436 -21.751 1.00 0.00 ? 140 ARG B CG   4  
ATOM   7874  C  CD   . ARG B 2 40  ? -3.450  -22.127 -21.448 1.00 0.00 ? 140 ARG B CD   4  
ATOM   7875  N  NE   . ARG B 2 40  ? -3.418  -23.546 -21.795 1.00 0.00 ? 140 ARG B NE   4  
ATOM   7876  C  CZ   . ARG B 2 40  ? -2.733  -24.461 -21.111 1.00 0.00 ? 140 ARG B CZ   4  
ATOM   7877  N  NH1  . ARG B 2 40  ? -2.026  -24.110 -20.044 1.00 0.00 ? 140 ARG B NH1  4  
ATOM   7878  N  NH2  . ARG B 2 40  ? -2.760  -25.730 -21.494 1.00 0.00 ? 140 ARG B NH2  4  
ATOM   7879  H  H    . ARG B 2 40  ? -0.594  -21.518 -18.836 1.00 0.00 ? 140 ARG B H    4  
ATOM   7880  H  HA   . ARG B 2 40  ? 0.229   -20.507 -21.318 1.00 0.00 ? 140 ARG B HA   4  
ATOM   7881  H  HB2  . ARG B 2 40  ? -2.318  -20.615 -19.803 1.00 0.00 ? 140 ARG B HB2  4  
ATOM   7882  H  HB3  . ARG B 2 40  ? -2.225  -19.421 -21.090 1.00 0.00 ? 140 ARG B HB3  4  
ATOM   7883  H  HG2  . ARG B 2 40  ? -2.189  -20.985 -22.730 1.00 0.00 ? 140 ARG B HG2  4  
ATOM   7884  H  HG3  . ARG B 2 40  ? -1.338  -22.169 -21.735 1.00 0.00 ? 140 ARG B HG3  4  
ATOM   7885  H  HD2  . ARG B 2 40  ? -3.660  -22.029 -20.394 1.00 0.00 ? 140 ARG B HD2  4  
ATOM   7886  H  HD3  . ARG B 2 40  ? -4.232  -21.646 -22.016 1.00 0.00 ? 140 ARG B HD3  4  
ATOM   7887  H  HE   . ARG B 2 40  ? -3.933  -23.833 -22.578 1.00 0.00 ? 140 ARG B HE   4  
ATOM   7888  H  HH11 . ARG B 2 40  ? -2.004  -23.155 -19.749 1.00 0.00 ? 140 ARG B HH11 4  
ATOM   7889  H  HH12 . ARG B 2 40  ? -1.514  -24.803 -19.535 1.00 0.00 ? 140 ARG B HH12 4  
ATOM   7890  H  HH21 . ARG B 2 40  ? -3.293  -26.000 -22.296 1.00 0.00 ? 140 ARG B HH21 4  
ATOM   7891  H  HH22 . ARG B 2 40  ? -2.246  -26.418 -20.981 1.00 0.00 ? 140 ARG B HH22 4  
ATOM   7892  N  N    . GLN B 2 41  ? 0.122   -17.942 -21.278 1.00 0.00 ? 141 GLN B N    4  
ATOM   7893  C  CA   . GLN B 2 41  ? 0.419   -16.519 -21.171 1.00 0.00 ? 141 GLN B CA   4  
ATOM   7894  C  C    . GLN B 2 41  ? -0.809  -15.744 -20.703 1.00 0.00 ? 141 GLN B C    4  
ATOM   7895  O  O    . GLN B 2 41  ? -1.769  -15.573 -21.454 1.00 0.00 ? 141 GLN B O    4  
ATOM   7896  C  CB   . GLN B 2 41  ? 0.900   -15.973 -22.517 1.00 0.00 ? 141 GLN B CB   4  
ATOM   7897  C  CG   . GLN B 2 41  ? -0.029  -16.301 -23.674 1.00 0.00 ? 141 GLN B CG   4  
ATOM   7898  C  CD   . GLN B 2 41  ? -0.609  -15.062 -24.329 1.00 0.00 ? 141 GLN B CD   4  
ATOM   7899  O  OE1  . GLN B 2 41  ? 0.112   -14.110 -24.627 1.00 0.00 ? 141 GLN B OE1  4  
ATOM   7900  N  NE2  . GLN B 2 41  ? -1.917  -15.070 -24.555 1.00 0.00 ? 141 GLN B NE2  4  
ATOM   7901  H  H    . GLN B 2 41  ? 0.023   -18.344 -22.166 1.00 0.00 ? 141 GLN B H    4  
ATOM   7902  H  HA   . GLN B 2 41  ? 1.206   -16.397 -20.442 1.00 0.00 ? 141 GLN B HA   4  
ATOM   7903  H  HB2  . GLN B 2 41  ? 0.987   -14.898 -22.446 1.00 0.00 ? 141 GLN B HB2  4  
ATOM   7904  H  HB3  . GLN B 2 41  ? 1.872   -16.389 -22.734 1.00 0.00 ? 141 GLN B HB3  4  
ATOM   7905  H  HG2  . GLN B 2 41  ? 0.524   -16.856 -24.417 1.00 0.00 ? 141 GLN B HG2  4  
ATOM   7906  H  HG3  . GLN B 2 41  ? -0.842  -16.909 -23.304 1.00 0.00 ? 141 GLN B HG3  4  
ATOM   7907  H  HE21 . GLN B 2 41  ? -2.428  -15.862 -24.291 1.00 0.00 ? 141 GLN B HE21 4  
ATOM   7908  H  HE22 . GLN B 2 41  ? -2.317  -14.281 -24.978 1.00 0.00 ? 141 GLN B HE22 4  
ATOM   7909  N  N    . CYS B 2 42  ? -0.772  -15.289 -19.451 1.00 0.00 ? 142 CYS B N    4  
ATOM   7910  C  CA   . CYS B 2 42  ? -1.870  -14.543 -18.856 1.00 0.00 ? 142 CYS B CA   4  
ATOM   7911  C  C    . CYS B 2 42  ? -2.512  -13.582 -19.855 1.00 0.00 ? 142 CYS B C    4  
ATOM   7912  O  O    . CYS B 2 42  ? -1.858  -13.111 -20.786 1.00 0.00 ? 142 CYS B O    4  
ATOM   7913  C  CB   . CYS B 2 42  ? -1.377  -13.767 -17.634 1.00 0.00 ? 142 CYS B CB   4  
ATOM   7914  S  SG   . CYS B 2 42  ? -0.150  -12.476 -18.018 1.00 0.00 ? 142 CYS B SG   4  
ATOM   7915  H  H    . CYS B 2 42  ? 0.010   -15.471 -18.904 1.00 0.00 ? 142 CYS B H    4  
ATOM   7916  H  HA   . CYS B 2 42  ? -2.600  -15.260 -18.539 1.00 0.00 ? 142 CYS B HA   4  
ATOM   7917  H  HB2  . CYS B 2 42  ? -2.220  -13.287 -17.157 1.00 0.00 ? 142 CYS B HB2  4  
ATOM   7918  H  HB3  . CYS B 2 42  ? -0.923  -14.457 -16.938 1.00 0.00 ? 142 CYS B HB3  4  
ATOM   7919  N  N    . ASN B 2 43  ? -3.794  -13.297 -19.654 1.00 0.00 ? 143 ASN B N    4  
ATOM   7920  C  CA   . ASN B 2 43  ? -4.523  -12.394 -20.536 1.00 0.00 ? 143 ASN B CA   4  
ATOM   7921  C  C    . ASN B 2 43  ? -4.270  -10.939 -20.151 1.00 0.00 ? 143 ASN B C    4  
ATOM   7922  O  O    . ASN B 2 43  ? -5.140  -10.274 -19.590 1.00 0.00 ? 143 ASN B O    4  
ATOM   7923  C  CB   . ASN B 2 43  ? -6.023  -12.697 -20.484 1.00 0.00 ? 143 ASN B CB   4  
ATOM   7924  C  CG   . ASN B 2 43  ? -6.427  -13.783 -21.462 1.00 0.00 ? 143 ASN B CG   4  
ATOM   7925  O  OD1  . ASN B 2 43  ? -7.359  -13.611 -22.248 1.00 0.00 ? 143 ASN B OD1  4  
ATOM   7926  N  ND2  . ASN B 2 43  ? -5.727  -14.911 -21.416 1.00 0.00 ? 143 ASN B ND2  4  
ATOM   7927  H  H    . ASN B 2 43  ? -4.261  -13.704 -18.894 1.00 0.00 ? 143 ASN B H    4  
ATOM   7928  H  HA   . ASN B 2 43  ? -4.167  -12.555 -21.542 1.00 0.00 ? 143 ASN B HA   4  
ATOM   7929  H  HB2  . ASN B 2 43  ? -6.283  -13.020 -19.488 1.00 0.00 ? 143 ASN B HB2  4  
ATOM   7930  H  HB3  . ASN B 2 43  ? -6.573  -11.799 -20.723 1.00 0.00 ? 143 ASN B HB3  4  
ATOM   7931  H  HD21 . ASN B 2 43  ? -5.000  -14.978 -20.764 1.00 0.00 ? 143 ASN B HD21 4  
ATOM   7932  H  HD22 . ASN B 2 43  ? -5.968  -15.630 -22.037 1.00 0.00 ? 143 ASN B HD22 4  
ATOM   7933  N  N    . LEU B 2 44  ? -3.072  -10.453 -20.458 1.00 0.00 ? 144 LEU B N    4  
ATOM   7934  C  CA   . LEU B 2 44  ? -2.700  -9.079  -20.146 1.00 0.00 ? 144 LEU B CA   4  
ATOM   7935  C  C    . LEU B 2 44  ? -1.307  -8.757  -20.687 1.00 0.00 ? 144 LEU B C    4  
ATOM   7936  O  O    . LEU B 2 44  ? -0.301  -9.119  -20.077 1.00 0.00 ? 144 LEU B O    4  
ATOM   7937  C  CB   . LEU B 2 44  ? -2.740  -8.851  -18.631 1.00 0.00 ? 144 LEU B CB   4  
ATOM   7938  C  CG   . LEU B 2 44  ? -3.755  -7.808  -18.161 1.00 0.00 ? 144 LEU B CG   4  
ATOM   7939  C  CD1  . LEU B 2 44  ? -4.309  -8.180  -16.795 1.00 0.00 ? 144 LEU B CD1  4  
ATOM   7940  C  CD2  . LEU B 2 44  ? -3.118  -6.427  -18.122 1.00 0.00 ? 144 LEU B CD2  4  
ATOM   7941  H  H    . LEU B 2 44  ? -2.420  -11.035 -20.905 1.00 0.00 ? 144 LEU B H    4  
ATOM   7942  H  HA   . LEU B 2 44  ? -3.419  -8.428  -20.616 1.00 0.00 ? 144 LEU B HA   4  
ATOM   7943  H  HB2  . LEU B 2 44  ? -2.975  -9.792  -18.154 1.00 0.00 ? 144 LEU B HB2  4  
ATOM   7944  H  HB3  . LEU B 2 44  ? -1.759  -8.537  -18.307 1.00 0.00 ? 144 LEU B HB3  4  
ATOM   7945  H  HG   . LEU B 2 44  ? -4.579  -7.777  -18.859 1.00 0.00 ? 144 LEU B HG   4  
ATOM   7946  H  HD11 . LEU B 2 44  ? -3.493  -8.302  -16.098 1.00 0.00 ? 144 LEU B HD11 4  
ATOM   7947  H  HD12 . LEU B 2 44  ? -4.859  -9.106  -16.870 1.00 0.00 ? 144 LEU B HD12 4  
ATOM   7948  H  HD13 . LEU B 2 44  ? -4.966  -7.397  -16.448 1.00 0.00 ? 144 LEU B HD13 4  
ATOM   7949  H  HD21 . LEU B 2 44  ? -2.091  -6.514  -17.796 1.00 0.00 ? 144 LEU B HD21 4  
ATOM   7950  H  HD22 . LEU B 2 44  ? -3.661  -5.799  -17.432 1.00 0.00 ? 144 LEU B HD22 4  
ATOM   7951  H  HD23 . LEU B 2 44  ? -3.147  -5.989  -19.108 1.00 0.00 ? 144 LEU B HD23 4  
ATOM   7952  N  N    . PRO B 2 45  ? -1.226  -8.069  -21.840 1.00 0.00 ? 145 PRO B N    4  
ATOM   7953  C  CA   . PRO B 2 45  ? 0.057   -7.704  -22.451 1.00 0.00 ? 145 PRO B CA   4  
ATOM   7954  C  C    . PRO B 2 45  ? 0.847   -6.724  -21.590 1.00 0.00 ? 145 PRO B C    4  
ATOM   7955  O  O    . PRO B 2 45  ? 2.076   -6.670  -21.660 1.00 0.00 ? 145 PRO B O    4  
ATOM   7956  C  CB   . PRO B 2 45  ? -0.345  -7.048  -23.775 1.00 0.00 ? 145 PRO B CB   4  
ATOM   7957  C  CG   . PRO B 2 45  ? -1.746  -6.589  -23.564 1.00 0.00 ? 145 PRO B CG   4  
ATOM   7958  C  CD   . PRO B 2 45  ? -2.371  -7.592  -22.637 1.00 0.00 ? 145 PRO B CD   4  
ATOM   7959  H  HA   . PRO B 2 45  ? 0.663   -8.576  -22.647 1.00 0.00 ? 145 PRO B HA   4  
ATOM   7960  H  HB2  . PRO B 2 45  ? 0.315   -6.220  -23.985 1.00 0.00 ? 145 PRO B HB2  4  
ATOM   7961  H  HB3  . PRO B 2 45  ? -0.284  -7.774  -24.572 1.00 0.00 ? 145 PRO B HB3  4  
ATOM   7962  H  HG2  . PRO B 2 45  ? -1.747  -5.608  -23.111 1.00 0.00 ? 145 PRO B HG2  4  
ATOM   7963  H  HG3  . PRO B 2 45  ? -2.273  -6.570  -24.507 1.00 0.00 ? 145 PRO B HG3  4  
ATOM   7964  H  HD2  . PRO B 2 45  ? -3.110  -7.117  -22.010 1.00 0.00 ? 145 PRO B HD2  4  
ATOM   7965  H  HD3  . PRO B 2 45  ? -2.814  -8.401  -23.199 1.00 0.00 ? 145 PRO B HD3  4  
ATOM   7966  N  N    . HIS B 2 46  ? 0.134   -5.953  -20.774 1.00 0.00 ? 146 HIS B N    4  
ATOM   7967  C  CA   . HIS B 2 46  ? 0.765   -4.976  -19.894 1.00 0.00 ? 146 HIS B CA   4  
ATOM   7968  C  C    . HIS B 2 46  ? 1.834   -5.638  -19.028 1.00 0.00 ? 146 HIS B C    4  
ATOM   7969  O  O    . HIS B 2 46  ? 2.921   -5.092  -18.839 1.00 0.00 ? 146 HIS B O    4  
ATOM   7970  C  CB   . HIS B 2 46  ? -0.287  -4.307  -19.010 1.00 0.00 ? 146 HIS B CB   4  
ATOM   7971  C  CG   . HIS B 2 46  ? -1.124  -3.301  -19.736 1.00 0.00 ? 146 HIS B CG   4  
ATOM   7972  N  ND1  . HIS B 2 46  ? -2.225  -2.689  -19.174 1.00 0.00 ? 146 HIS B ND1  4  
ATOM   7973  C  CD2  . HIS B 2 46  ? -1.016  -2.798  -20.989 1.00 0.00 ? 146 HIS B CD2  4  
ATOM   7974  C  CE1  . HIS B 2 46  ? -2.757  -1.855  -20.049 1.00 0.00 ? 146 HIS B CE1  4  
ATOM   7975  N  NE2  . HIS B 2 46  ? -2.042  -1.902  -21.158 1.00 0.00 ? 146 HIS B NE2  4  
ATOM   7976  H  H    . HIS B 2 46  ? -0.842  -6.045  -20.762 1.00 0.00 ? 146 HIS B H    4  
ATOM   7977  H  HA   . HIS B 2 46  ? 1.233   -4.226  -20.513 1.00 0.00 ? 146 HIS B HA   4  
ATOM   7978  H  HB2  . HIS B 2 46  ? -0.949  -5.064  -18.613 1.00 0.00 ? 146 HIS B HB2  4  
ATOM   7979  H  HB3  . HIS B 2 46  ? 0.206   -3.804  -18.193 1.00 0.00 ? 146 HIS B HB3  4  
ATOM   7980  H  HD1  . HIS B 2 46  ? -2.565  -2.843  -18.267 1.00 0.00 ? 146 HIS B HD1  4  
ATOM   7981  H  HD2  . HIS B 2 46  ? -0.261  -3.055  -21.719 1.00 0.00 ? 146 HIS B HD2  4  
ATOM   7982  H  HE1  . HIS B 2 46  ? -3.630  -1.239  -19.886 1.00 0.00 ? 146 HIS B HE1  4  
ATOM   7983  H  HE2  . HIS B 2 46  ? -2.174  -1.328  -21.940 1.00 0.00 ? 146 HIS B HE2  4  
ATOM   7984  N  N    . CYS B 2 47  ? 1.518   -6.821  -18.513 1.00 0.00 ? 147 CYS B N    4  
ATOM   7985  C  CA   . CYS B 2 47  ? 2.449   -7.570  -17.675 1.00 0.00 ? 147 CYS B CA   4  
ATOM   7986  C  C    . CYS B 2 47  ? 3.748   -7.829  -18.419 1.00 0.00 ? 147 CYS B C    4  
ATOM   7987  O  O    . CYS B 2 47  ? 4.813   -7.358  -18.024 1.00 0.00 ? 147 CYS B O    4  
ATOM   7988  C  CB   . CYS B 2 47  ? 1.828   -8.904  -17.267 1.00 0.00 ? 147 CYS B CB   4  
ATOM   7989  S  SG   . CYS B 2 47  ? 2.929   -9.980  -16.293 1.00 0.00 ? 147 CYS B SG   4  
ATOM   7990  H  H    . CYS B 2 47  ? 0.637   -7.206  -18.708 1.00 0.00 ? 147 CYS B H    4  
ATOM   7991  H  HA   . CYS B 2 47  ? 2.654   -6.986  -16.791 1.00 0.00 ? 147 CYS B HA   4  
ATOM   7992  H  HB2  . CYS B 2 47  ? 0.950   -8.714  -16.683 1.00 0.00 ? 147 CYS B HB2  4  
ATOM   7993  H  HB3  . CYS B 2 47  ? 1.546   -9.444  -18.153 1.00 0.00 ? 147 CYS B HB3  4  
ATOM   7994  N  N    . ARG B 2 48  ? 3.638   -8.593  -19.500 1.00 0.00 ? 148 ARG B N    4  
ATOM   7995  C  CA   . ARG B 2 48  ? 4.790   -8.945  -20.331 1.00 0.00 ? 148 ARG B CA   4  
ATOM   7996  C  C    . ARG B 2 48  ? 5.733   -7.756  -20.496 1.00 0.00 ? 148 ARG B C    4  
ATOM   7997  O  O    . ARG B 2 48  ? 6.954   -7.906  -20.444 1.00 0.00 ? 148 ARG B O    4  
ATOM   7998  C  CB   . ARG B 2 48  ? 4.320   -9.432  -21.703 1.00 0.00 ? 148 ARG B CB   4  
ATOM   7999  C  CG   . ARG B 2 48  ? 5.440   -9.973  -22.574 1.00 0.00 ? 148 ARG B CG   4  
ATOM   8000  C  CD   . ARG B 2 48  ? 4.901   -10.849 -23.694 1.00 0.00 ? 148 ARG B CD   4  
ATOM   8001  N  NE   . ARG B 2 48  ? 5.056   -12.271 -23.399 1.00 0.00 ? 148 ARG B NE   4  
ATOM   8002  C  CZ   . ARG B 2 48  ? 6.233   -12.884 -23.300 1.00 0.00 ? 148 ARG B CZ   4  
ATOM   8003  N  NH1  . ARG B 2 48  ? 7.360   -12.204 -23.476 1.00 0.00 ? 148 ARG B NH1  4  
ATOM   8004  N  NH2  . ARG B 2 48  ? 6.285   -14.179 -23.024 1.00 0.00 ? 148 ARG B NH2  4  
ATOM   8005  H  H    . ARG B 2 48  ? 2.751   -8.934  -19.741 1.00 0.00 ? 148 ARG B H    4  
ATOM   8006  H  HA   . ARG B 2 48  ? 5.321   -9.744  -19.838 1.00 0.00 ? 148 ARG B HA   4  
ATOM   8007  H  HB2  . ARG B 2 48  ? 3.591   -10.216 -21.563 1.00 0.00 ? 148 ARG B HB2  4  
ATOM   8008  H  HB3  . ARG B 2 48  ? 3.854   -8.608  -22.224 1.00 0.00 ? 148 ARG B HB3  4  
ATOM   8009  H  HG2  . ARG B 2 48  ? 5.980   -9.144  -23.009 1.00 0.00 ? 148 ARG B HG2  4  
ATOM   8010  H  HG3  . ARG B 2 48  ? 6.109   -10.559 -21.961 1.00 0.00 ? 148 ARG B HG3  4  
ATOM   8011  H  HD2  . ARG B 2 48  ? 3.851   -10.632 -23.829 1.00 0.00 ? 148 ARG B HD2  4  
ATOM   8012  H  HD3  . ARG B 2 48  ? 5.434   -10.619 -24.603 1.00 0.00 ? 148 ARG B HD3  4  
ATOM   8013  H  HE   . ARG B 2 48  ? 4.240   -12.798 -23.266 1.00 0.00 ? 148 ARG B HE   4  
ATOM   8014  H  HH11 . ARG B 2 48  ? 7.328   -11.226 -23.687 1.00 0.00 ? 148 ARG B HH11 4  
ATOM   8015  H  HH12 . ARG B 2 48  ? 8.242   -12.669 -23.400 1.00 0.00 ? 148 ARG B HH12 4  
ATOM   8016  H  HH21 . ARG B 2 48  ? 5.440   -14.695 -22.890 1.00 0.00 ? 148 ARG B HH21 4  
ATOM   8017  H  HH22 . ARG B 2 48  ? 7.169   -14.640 -22.948 1.00 0.00 ? 148 ARG B HH22 4  
ATOM   8018  N  N    . THR B 2 49  ? 5.156   -6.575  -20.683 1.00 0.00 ? 149 THR B N    4  
ATOM   8019  C  CA   . THR B 2 49  ? 5.945   -5.359  -20.841 1.00 0.00 ? 149 THR B CA   4  
ATOM   8020  C  C    . THR B 2 49  ? 6.732   -5.073  -19.569 1.00 0.00 ? 149 THR B C    4  
ATOM   8021  O  O    . THR B 2 49  ? 7.930   -4.794  -19.618 1.00 0.00 ? 149 THR B O    4  
ATOM   8022  C  CB   . THR B 2 49  ? 5.038   -4.173  -21.177 1.00 0.00 ? 149 THR B CB   4  
ATOM   8023  O  OG1  . THR B 2 49  ? 3.867   -4.611  -21.841 1.00 0.00 ? 149 THR B OG1  4  
ATOM   8024  C  CG2  . THR B 2 49  ? 5.705   -3.137  -22.056 1.00 0.00 ? 149 THR B CG2  4  
ATOM   8025  H  H    . THR B 2 49  ? 4.176   -6.519  -20.706 1.00 0.00 ? 149 THR B H    4  
ATOM   8026  H  HA   . THR B 2 49  ? 6.642   -5.515  -21.653 1.00 0.00 ? 149 THR B HA   4  
ATOM   8027  H  HB   . THR B 2 49  ? 4.744   -3.688  -20.257 1.00 0.00 ? 149 THR B HB   4  
ATOM   8028  H  HG1  . THR B 2 49  ? 3.168   -3.964  -21.719 1.00 0.00 ? 149 THR B HG1  4  
ATOM   8029  H  HG21 . THR B 2 49  ? 4.994   -2.362  -22.300 1.00 0.00 ? 149 THR B HG21 4  
ATOM   8030  H  HG22 . THR B 2 49  ? 6.053   -3.607  -22.964 1.00 0.00 ? 149 THR B HG22 4  
ATOM   8031  H  HG23 . THR B 2 49  ? 6.543   -2.704  -21.530 1.00 0.00 ? 149 THR B HG23 4  
ATOM   8032  N  N    . MET B 2 50  ? 6.055   -5.161  -18.426 1.00 0.00 ? 150 MET B N    4  
ATOM   8033  C  CA   . MET B 2 50  ? 6.702   -4.926  -17.142 1.00 0.00 ? 150 MET B CA   4  
ATOM   8034  C  C    . MET B 2 50  ? 7.831   -5.923  -16.941 1.00 0.00 ? 150 MET B C    4  
ATOM   8035  O  O    . MET B 2 50  ? 8.910   -5.563  -16.478 1.00 0.00 ? 150 MET B O    4  
ATOM   8036  C  CB   . MET B 2 50  ? 5.688   -5.028  -16.000 1.00 0.00 ? 150 MET B CB   4  
ATOM   8037  C  CG   . MET B 2 50  ? 5.333   -3.685  -15.381 1.00 0.00 ? 150 MET B CG   4  
ATOM   8038  S  SD   . MET B 2 50  ? 4.726   -2.501  -16.598 1.00 0.00 ? 150 MET B SD   4  
ATOM   8039  C  CE   . MET B 2 50  ? 5.994   -1.239  -16.507 1.00 0.00 ? 150 MET B CE   4  
ATOM   8040  H  H    . MET B 2 50  ? 5.105   -5.399  -18.449 1.00 0.00 ? 150 MET B H    4  
ATOM   8041  H  HA   . MET B 2 50  ? 7.125   -3.933  -17.158 1.00 0.00 ? 150 MET B HA   4  
ATOM   8042  H  HB2  . MET B 2 50  ? 4.781   -5.477  -16.377 1.00 0.00 ? 150 MET B HB2  4  
ATOM   8043  H  HB3  . MET B 2 50  ? 6.096   -5.660  -15.224 1.00 0.00 ? 150 MET B HB3  4  
ATOM   8044  H  HG2  . MET B 2 50  ? 4.566   -3.840  -14.637 1.00 0.00 ? 150 MET B HG2  4  
ATOM   8045  H  HG3  . MET B 2 50  ? 6.214   -3.277  -14.910 1.00 0.00 ? 150 MET B HG3  4  
ATOM   8046  H  HE1  . MET B 2 50  ? 6.964   -1.692  -16.654 1.00 0.00 ? 150 MET B HE1  4  
ATOM   8047  H  HE2  . MET B 2 50  ? 5.962   -0.766  -15.537 1.00 0.00 ? 150 MET B HE2  4  
ATOM   8048  H  HE3  . MET B 2 50  ? 5.821   -0.500  -17.275 1.00 0.00 ? 150 MET B HE3  4  
ATOM   8049  N  N    . LYS B 2 51  ? 7.590   -7.174  -17.321 1.00 0.00 ? 151 LYS B N    4  
ATOM   8050  C  CA   . LYS B 2 51  ? 8.613   -8.203  -17.208 1.00 0.00 ? 151 LYS B CA   4  
ATOM   8051  C  C    . LYS B 2 51  ? 9.862   -7.739  -17.945 1.00 0.00 ? 151 LYS B C    4  
ATOM   8052  O  O    . LYS B 2 51  ? 10.990  -7.981  -17.514 1.00 0.00 ? 151 LYS B O    4  
ATOM   8053  C  CB   . LYS B 2 51  ? 8.111   -9.524  -17.793 1.00 0.00 ? 151 LYS B CB   4  
ATOM   8054  C  CG   . LYS B 2 51  ? 7.604   -10.501 -16.744 1.00 0.00 ? 151 LYS B CG   4  
ATOM   8055  C  CD   . LYS B 2 51  ? 6.084   -10.533 -16.697 1.00 0.00 ? 151 LYS B CD   4  
ATOM   8056  C  CE   . LYS B 2 51  ? 5.563   -11.951 -16.529 1.00 0.00 ? 151 LYS B CE   4  
ATOM   8057  N  NZ   . LYS B 2 51  ? 5.225   -12.577 -17.836 1.00 0.00 ? 151 LYS B NZ   4  
ATOM   8058  H  H    . LYS B 2 51  ? 6.719   -7.402  -17.705 1.00 0.00 ? 151 LYS B H    4  
ATOM   8059  H  HA   . LYS B 2 51  ? 8.846   -8.335  -16.162 1.00 0.00 ? 151 LYS B HA   4  
ATOM   8060  H  HB2  . LYS B 2 51  ? 7.305   -9.316  -18.480 1.00 0.00 ? 151 LYS B HB2  4  
ATOM   8061  H  HB3  . LYS B 2 51  ? 8.919   -9.995  -18.332 1.00 0.00 ? 151 LYS B HB3  4  
ATOM   8062  H  HG2  . LYS B 2 51  ? 7.967   -11.488 -16.983 1.00 0.00 ? 151 LYS B HG2  4  
ATOM   8063  H  HG3  . LYS B 2 51  ? 7.980   -10.202 -15.777 1.00 0.00 ? 151 LYS B HG3  4  
ATOM   8064  H  HD2  . LYS B 2 51  ? 5.747   -9.934  -15.863 1.00 0.00 ? 151 LYS B HD2  4  
ATOM   8065  H  HD3  . LYS B 2 51  ? 5.697   -10.122 -17.617 1.00 0.00 ? 151 LYS B HD3  4  
ATOM   8066  H  HE2  . LYS B 2 51  ? 6.322   -12.544 -16.042 1.00 0.00 ? 151 LYS B HE2  4  
ATOM   8067  H  HE3  . LYS B 2 51  ? 4.677   -11.925 -15.911 1.00 0.00 ? 151 LYS B HE3  4  
ATOM   8068  H  HZ1  . LYS B 2 51  ? 5.988   -12.407 -18.522 1.00 0.00 ? 151 LYS B HZ1  4  
ATOM   8069  H  HZ2  . LYS B 2 51  ? 4.343   -12.172 -18.210 1.00 0.00 ? 151 LYS B HZ2  4  
ATOM   8070  H  HZ3  . LYS B 2 51  ? 5.099   -13.603 -17.719 1.00 0.00 ? 151 LYS B HZ3  4  
ATOM   8071  N  N    . ASN B 2 52  ? 9.634   -7.046  -19.056 1.00 0.00 ? 152 ASN B N    4  
ATOM   8072  C  CA   . ASN B 2 52  ? 10.710  -6.508  -19.868 1.00 0.00 ? 152 ASN B CA   4  
ATOM   8073  C  C    . ASN B 2 52  ? 11.302  -5.270  -19.206 1.00 0.00 ? 152 ASN B C    4  
ATOM   8074  O  O    . ASN B 2 52  ? 12.520  -5.098  -19.160 1.00 0.00 ? 152 ASN B O    4  
ATOM   8075  C  CB   . ASN B 2 52  ? 10.191  -6.159  -21.264 1.00 0.00 ? 152 ASN B CB   4  
ATOM   8076  C  CG   . ASN B 2 52  ? 11.180  -6.516  -22.357 1.00 0.00 ? 152 ASN B CG   4  
ATOM   8077  O  OD1  . ASN B 2 52  ? 12.364  -6.187  -22.269 1.00 0.00 ? 152 ASN B OD1  4  
ATOM   8078  N  ND2  . ASN B 2 52  ? 10.700  -7.194  -23.393 1.00 0.00 ? 152 ASN B ND2  4  
ATOM   8079  H  H    . ASN B 2 52  ? 8.710   -6.879  -19.330 1.00 0.00 ? 152 ASN B H    4  
ATOM   8080  H  HA   . ASN B 2 52  ? 11.474  -7.265  -19.950 1.00 0.00 ? 152 ASN B HA   4  
ATOM   8081  H  HB2  . ASN B 2 52  ? 9.273   -6.699  -21.444 1.00 0.00 ? 152 ASN B HB2  4  
ATOM   8082  H  HB3  . ASN B 2 52  ? 9.993   -5.098  -21.314 1.00 0.00 ? 152 ASN B HB3  4  
ATOM   8083  H  HD21 . ASN B 2 52  ? 9.748   -7.422  -23.395 1.00 0.00 ? 152 ASN B HD21 4  
ATOM   8084  H  HD22 . ASN B 2 52  ? 11.319  -7.438  -24.113 1.00 0.00 ? 152 ASN B HD22 4  
ATOM   8085  N  N    . VAL B 2 53  ? 10.428  -4.411  -18.686 1.00 0.00 ? 153 VAL B N    4  
ATOM   8086  C  CA   . VAL B 2 53  ? 10.866  -3.194  -18.020 1.00 0.00 ? 153 VAL B CA   4  
ATOM   8087  C  C    . VAL B 2 53  ? 11.606  -3.528  -16.732 1.00 0.00 ? 153 VAL B C    4  
ATOM   8088  O  O    . VAL B 2 53  ? 12.554  -2.845  -16.349 1.00 0.00 ? 153 VAL B O    4  
ATOM   8089  C  CB   . VAL B 2 53  ? 9.679   -2.263  -17.703 1.00 0.00 ? 153 VAL B CB   4  
ATOM   8090  C  CG1  . VAL B 2 53  ? 10.162  -0.971  -17.061 1.00 0.00 ? 153 VAL B CG1  4  
ATOM   8091  C  CG2  . VAL B 2 53  ? 8.881   -1.969  -18.964 1.00 0.00 ? 153 VAL B CG2  4  
ATOM   8092  H  H    . VAL B 2 53  ? 9.466   -4.606  -18.747 1.00 0.00 ? 153 VAL B H    4  
ATOM   8093  H  HA   . VAL B 2 53  ? 11.542  -2.675  -18.683 1.00 0.00 ? 153 VAL B HA   4  
ATOM   8094  H  HB   . VAL B 2 53  ? 9.030   -2.766  -17.001 1.00 0.00 ? 153 VAL B HB   4  
ATOM   8095  H  HG11 . VAL B 2 53  ? 11.168  -0.758  -17.392 1.00 0.00 ? 153 VAL B HG11 4  
ATOM   8096  H  HG12 . VAL B 2 53  ? 10.152  -1.077  -15.985 1.00 0.00 ? 153 VAL B HG12 4  
ATOM   8097  H  HG13 . VAL B 2 53  ? 9.510   -0.160  -17.348 1.00 0.00 ? 153 VAL B HG13 4  
ATOM   8098  H  HG21 . VAL B 2 53  ? 9.090   -2.724  -19.707 1.00 0.00 ? 153 VAL B HG21 4  
ATOM   8099  H  HG22 . VAL B 2 53  ? 9.158   -0.999  -19.349 1.00 0.00 ? 153 VAL B HG22 4  
ATOM   8100  H  HG23 . VAL B 2 53  ? 7.825   -1.977  -18.732 1.00 0.00 ? 153 VAL B HG23 4  
ATOM   8101  N  N    . LEU B 2 54  ? 11.169  -4.592  -16.071 1.00 0.00 ? 154 LEU B N    4  
ATOM   8102  C  CA   . LEU B 2 54  ? 11.782  -5.032  -14.842 1.00 0.00 ? 154 LEU B CA   4  
ATOM   8103  C  C    . LEU B 2 54  ? 13.212  -5.485  -15.096 1.00 0.00 ? 154 LEU B C    4  
ATOM   8104  O  O    . LEU B 2 54  ? 14.135  -5.099  -14.379 1.00 0.00 ? 154 LEU B O    4  
ATOM   8105  C  CB   . LEU B 2 54  ? 10.951  -6.167  -14.260 1.00 0.00 ? 154 LEU B CB   4  
ATOM   8106  C  CG   . LEU B 2 54  ? 9.950   -5.749  -13.185 1.00 0.00 ? 154 LEU B CG   4  
ATOM   8107  C  CD1  . LEU B 2 54  ? 9.166   -6.953  -12.688 1.00 0.00 ? 154 LEU B CD1  4  
ATOM   8108  C  CD2  . LEU B 2 54  ? 10.660  -5.058  -12.031 1.00 0.00 ? 154 LEU B CD2  4  
ATOM   8109  H  H    . LEU B 2 54  ? 10.413  -5.103  -16.420 1.00 0.00 ? 154 LEU B H    4  
ATOM   8110  H  HA   . LEU B 2 54  ? 11.793  -4.206  -14.157 1.00 0.00 ? 154 LEU B HA   4  
ATOM   8111  H  HB2  . LEU B 2 54  ? 10.404  -6.630  -15.068 1.00 0.00 ? 154 LEU B HB2  4  
ATOM   8112  H  HB3  . LEU B 2 54  ? 11.616  -6.892  -13.846 1.00 0.00 ? 154 LEU B HB3  4  
ATOM   8113  H  HG   . LEU B 2 54  ? 9.251   -5.048  -13.618 1.00 0.00 ? 154 LEU B HG   4  
ATOM   8114  H  HD11 . LEU B 2 54  ? 9.657   -7.370  -11.821 1.00 0.00 ? 154 LEU B HD11 4  
ATOM   8115  H  HD12 . LEU B 2 54  ? 9.117   -7.699  -13.468 1.00 0.00 ? 154 LEU B HD12 4  
ATOM   8116  H  HD13 . LEU B 2 54  ? 8.165   -6.645  -12.422 1.00 0.00 ? 154 LEU B HD13 4  
ATOM   8117  H  HD21 . LEU B 2 54  ? 10.825  -4.020  -12.279 1.00 0.00 ? 154 LEU B HD21 4  
ATOM   8118  H  HD22 . LEU B 2 54  ? 11.611  -5.541  -11.853 1.00 0.00 ? 154 LEU B HD22 4  
ATOM   8119  H  HD23 . LEU B 2 54  ? 10.051  -5.124  -11.142 1.00 0.00 ? 154 LEU B HD23 4  
ATOM   8120  N  N    . ASN B 2 55  ? 13.388  -6.290  -16.135 1.00 0.00 ? 155 ASN B N    4  
ATOM   8121  C  CA   . ASN B 2 55  ? 14.711  -6.779  -16.501 1.00 0.00 ? 155 ASN B CA   4  
ATOM   8122  C  C    . ASN B 2 55  ? 15.624  -5.602  -16.827 1.00 0.00 ? 155 ASN B C    4  
ATOM   8123  O  O    . ASN B 2 55  ? 16.830  -5.647  -16.590 1.00 0.00 ? 155 ASN B O    4  
ATOM   8124  C  CB   . ASN B 2 55  ? 14.622  -7.725  -17.701 1.00 0.00 ? 155 ASN B CB   4  
ATOM   8125  C  CG   . ASN B 2 55  ? 15.937  -8.427  -17.983 1.00 0.00 ? 155 ASN B CG   4  
ATOM   8126  O  OD1  . ASN B 2 55  ? 16.441  -8.397  -19.106 1.00 0.00 ? 155 ASN B OD1  4  
ATOM   8127  N  ND2  . ASN B 2 55  ? 16.498  -9.064  -16.962 1.00 0.00 ? 155 ASN B ND2  4  
ATOM   8128  H  H    . ASN B 2 55  ? 12.611  -6.547  -16.675 1.00 0.00 ? 155 ASN B H    4  
ATOM   8129  H  HA   . ASN B 2 55  ? 15.117  -7.315  -15.655 1.00 0.00 ? 155 ASN B HA   4  
ATOM   8130  H  HB2  . ASN B 2 55  ? 13.870  -8.475  -17.506 1.00 0.00 ? 155 ASN B HB2  4  
ATOM   8131  H  HB3  . ASN B 2 55  ? 14.342  -7.159  -18.578 1.00 0.00 ? 155 ASN B HB3  4  
ATOM   8132  H  HD21 . ASN B 2 55  ? 16.039  -9.047  -16.096 1.00 0.00 ? 155 ASN B HD21 4  
ATOM   8133  H  HD22 . ASN B 2 55  ? 17.349  -9.526  -17.116 1.00 0.00 ? 155 ASN B HD22 4  
ATOM   8134  N  N    . HIS B 2 56  ? 15.022  -4.543  -17.359 1.00 0.00 ? 156 HIS B N    4  
ATOM   8135  C  CA   . HIS B 2 56  ? 15.749  -3.332  -17.709 1.00 0.00 ? 156 HIS B CA   4  
ATOM   8136  C  C    . HIS B 2 56  ? 16.273  -2.650  -16.459 1.00 0.00 ? 156 HIS B C    4  
ATOM   8137  O  O    . HIS B 2 56  ? 17.479  -2.501  -16.269 1.00 0.00 ? 156 HIS B O    4  
ATOM   8138  C  CB   . HIS B 2 56  ? 14.820  -2.372  -18.444 1.00 0.00 ? 156 HIS B CB   4  
ATOM   8139  C  CG   . HIS B 2 56  ? 15.477  -1.100  -18.880 1.00 0.00 ? 156 HIS B CG   4  
ATOM   8140  N  ND1  . HIS B 2 56  ? 16.789  -0.775  -18.612 1.00 0.00 ? 156 HIS B ND1  4  
ATOM   8141  C  CD2  . HIS B 2 56  ? 14.964  -0.047  -19.561 1.00 0.00 ? 156 HIS B CD2  4  
ATOM   8142  C  CE1  . HIS B 2 56  ? 17.021  0.443   -19.121 1.00 0.00 ? 156 HIS B CE1  4  
ATOM   8143  N  NE2  . HIS B 2 56  ? 15.948  0.924   -19.709 1.00 0.00 ? 156 HIS B NE2  4  
ATOM   8144  H  H    . HIS B 2 56  ? 14.052  -4.573  -17.511 1.00 0.00 ? 156 HIS B H    4  
ATOM   8145  H  HA   . HIS B 2 56  ? 16.575  -3.598  -18.350 1.00 0.00 ? 156 HIS B HA   4  
ATOM   8146  H  HB2  . HIS B 2 56  ? 14.426  -2.861  -19.311 1.00 0.00 ? 156 HIS B HB2  4  
ATOM   8147  H  HB3  . HIS B 2 56  ? 14.002  -2.110  -17.789 1.00 0.00 ? 156 HIS B HB3  4  
ATOM   8148  H  HD1  . HIS B 2 56  ? 17.439  -1.335  -18.139 1.00 0.00 ? 156 HIS B HD1  4  
ATOM   8149  H  HD2  . HIS B 2 56  ? 13.952  0.040   -19.926 1.00 0.00 ? 156 HIS B HD2  4  
ATOM   8150  H  HE1  . HIS B 2 56  ? 17.957  0.969   -19.043 1.00 0.00 ? 156 HIS B HE1  4  
ATOM   8151  N  N    . MET B 2 57  ? 15.341  -2.228  -15.619 1.00 0.00 ? 157 MET B N    4  
ATOM   8152  C  CA   . MET B 2 57  ? 15.671  -1.541  -14.373 1.00 0.00 ? 157 MET B CA   4  
ATOM   8153  C  C    . MET B 2 57  ? 16.791  -2.256  -13.615 1.00 0.00 ? 157 MET B C    4  
ATOM   8154  O  O    . MET B 2 57  ? 17.716  -1.618  -13.114 1.00 0.00 ? 157 MET B O    4  
ATOM   8155  C  CB   . MET B 2 57  ? 14.428  -1.435  -13.491 1.00 0.00 ? 157 MET B CB   4  
ATOM   8156  C  CG   . MET B 2 57  ? 14.424  -0.216  -12.584 1.00 0.00 ? 157 MET B CG   4  
ATOM   8157  S  SD   . MET B 2 57  ? 12.777  0.184   -11.966 1.00 0.00 ? 157 MET B SD   4  
ATOM   8158  C  CE   . MET B 2 57  ? 12.143  -1.452  -11.604 1.00 0.00 ? 157 MET B CE   4  
ATOM   8159  H  H    . MET B 2 57  ? 14.397  -2.377  -15.851 1.00 0.00 ? 157 MET B H    4  
ATOM   8160  H  HA   . MET B 2 57  ? 16.006  -0.546  -14.627 1.00 0.00 ? 157 MET B HA   4  
ATOM   8161  H  HB2  . MET B 2 57  ? 13.555  -1.385  -14.125 1.00 0.00 ? 157 MET B HB2  4  
ATOM   8162  H  HB3  . MET B 2 57  ? 14.362  -2.318  -12.874 1.00 0.00 ? 157 MET B HB3  4  
ATOM   8163  H  HG2  . MET B 2 57  ? 15.071  -0.408  -11.741 1.00 0.00 ? 157 MET B HG2  4  
ATOM   8164  H  HG3  . MET B 2 57  ? 14.800  0.630   -13.139 1.00 0.00 ? 157 MET B HG3  4  
ATOM   8165  H  HE1  . MET B 2 57  ? 11.738  -1.889  -12.504 1.00 0.00 ? 157 MET B HE1  4  
ATOM   8166  H  HE2  . MET B 2 57  ? 11.367  -1.380  -10.857 1.00 0.00 ? 157 MET B HE2  4  
ATOM   8167  H  HE3  . MET B 2 57  ? 12.944  -2.073  -11.231 1.00 0.00 ? 157 MET B HE3  4  
ATOM   8168  N  N    . THR B 2 58  ? 16.700  -3.580  -13.535 1.00 0.00 ? 158 THR B N    4  
ATOM   8169  C  CA   . THR B 2 58  ? 17.707  -4.376  -12.838 1.00 0.00 ? 158 THR B CA   4  
ATOM   8170  C  C    . THR B 2 58  ? 19.058  -4.314  -13.553 1.00 0.00 ? 158 THR B C    4  
ATOM   8171  O  O    . THR B 2 58  ? 20.085  -4.690  -12.989 1.00 0.00 ? 158 THR B O    4  
ATOM   8172  C  CB   . THR B 2 58  ? 17.246  -5.829  -12.722 1.00 0.00 ? 158 THR B CB   4  
ATOM   8173  O  OG1  . THR B 2 58  ? 15.833  -5.912  -12.770 1.00 0.00 ? 158 THR B OG1  4  
ATOM   8174  C  CG2  . THR B 2 58  ? 17.702  -6.500  -11.445 1.00 0.00 ? 158 THR B CG2  4  
ATOM   8175  H  H    . THR B 2 58  ? 15.939  -4.033  -13.954 1.00 0.00 ? 158 THR B H    4  
ATOM   8176  H  HA   . THR B 2 58  ? 17.823  -3.966  -11.844 1.00 0.00 ? 158 THR B HA   4  
ATOM   8177  H  HB   . THR B 2 58  ? 17.648  -6.390  -13.553 1.00 0.00 ? 158 THR B HB   4  
ATOM   8178  H  HG1  . THR B 2 58  ? 15.574  -6.768  -13.121 1.00 0.00 ? 158 THR B HG1  4  
ATOM   8179  H  HG21 . THR B 2 58  ? 18.198  -7.428  -11.684 1.00 0.00 ? 158 THR B HG21 4  
ATOM   8180  H  HG22 . THR B 2 58  ? 16.846  -6.701  -10.819 1.00 0.00 ? 158 THR B HG22 4  
ATOM   8181  H  HG23 . THR B 2 58  ? 18.386  -5.850  -10.922 1.00 0.00 ? 158 THR B HG23 4  
ATOM   8182  N  N    . HIS B 2 59  ? 19.050  -3.834  -14.793 1.00 0.00 ? 159 HIS B N    4  
ATOM   8183  C  CA   . HIS B 2 59  ? 20.270  -3.717  -15.579 1.00 0.00 ? 159 HIS B CA   4  
ATOM   8184  C  C    . HIS B 2 59  ? 20.371  -2.328  -16.201 1.00 0.00 ? 159 HIS B C    4  
ATOM   8185  O  O    . HIS B 2 59  ? 21.043  -2.134  -17.215 1.00 0.00 ? 159 HIS B O    4  
ATOM   8186  C  CB   . HIS B 2 59  ? 20.305  -4.788  -16.671 1.00 0.00 ? 159 HIS B CB   4  
ATOM   8187  C  CG   . HIS B 2 59  ? 21.640  -5.451  -16.817 1.00 0.00 ? 159 HIS B CG   4  
ATOM   8188  N  ND1  . HIS B 2 59  ? 22.630  -4.974  -17.650 1.00 0.00 ? 159 HIS B ND1  4  
ATOM   8189  C  CD2  . HIS B 2 59  ? 22.148  -6.559  -16.226 1.00 0.00 ? 159 HIS B CD2  4  
ATOM   8190  C  CE1  . HIS B 2 59  ? 23.689  -5.761  -17.567 1.00 0.00 ? 159 HIS B CE1  4  
ATOM   8191  N  NE2  . HIS B 2 59  ? 23.422  -6.729  -16.710 1.00 0.00 ? 159 HIS B NE2  4  
ATOM   8192  H  H    . HIS B 2 59  ? 18.207  -3.544  -15.188 1.00 0.00 ? 159 HIS B H    4  
ATOM   8193  H  HA   . HIS B 2 59  ? 21.103  -3.864  -14.914 1.00 0.00 ? 159 HIS B HA   4  
ATOM   8194  H  HB2  . HIS B 2 59  ? 19.579  -5.553  -16.439 1.00 0.00 ? 159 HIS B HB2  4  
ATOM   8195  H  HB3  . HIS B 2 59  ? 20.053  -4.335  -17.620 1.00 0.00 ? 159 HIS B HB3  4  
ATOM   8196  H  HD1  . HIS B 2 59  ? 22.566  -4.179  -18.219 1.00 0.00 ? 159 HIS B HD1  4  
ATOM   8197  H  HD2  . HIS B 2 59  ? 21.644  -7.191  -15.508 1.00 0.00 ? 159 HIS B HD2  4  
ATOM   8198  H  HE1  . HIS B 2 59  ? 24.615  -5.633  -18.108 1.00 0.00 ? 159 HIS B HE1  4  
ATOM   8199  H  HE2  . HIS B 2 59  ? 24.006  -7.492  -16.519 1.00 0.00 ? 159 HIS B HE2  4  
ATOM   8200  N  N    . CYS B 2 60  ? 19.694  -1.368  -15.581 1.00 0.00 ? 160 CYS B N    4  
ATOM   8201  C  CA   . CYS B 2 60  ? 19.690  0.008   -16.054 1.00 0.00 ? 160 CYS B CA   4  
ATOM   8202  C  C    . CYS B 2 60  ? 20.618  0.868   -15.220 1.00 0.00 ? 160 CYS B C    4  
ATOM   8203  O  O    . CYS B 2 60  ? 20.915  0.545   -14.069 1.00 0.00 ? 160 CYS B O    4  
ATOM   8204  C  CB   . CYS B 2 60  ? 18.268  0.570   -16.000 1.00 0.00 ? 160 CYS B CB   4  
ATOM   8205  S  SG   . CYS B 2 60  ? 18.101  2.247   -16.689 1.00 0.00 ? 160 CYS B SG   4  
ATOM   8206  H  H    . CYS B 2 60  ? 19.178  -1.593  -14.780 1.00 0.00 ? 160 CYS B H    4  
ATOM   8207  H  HA   . CYS B 2 60  ? 20.031  0.026   -17.067 1.00 0.00 ? 160 CYS B HA   4  
ATOM   8208  H  HB2  . CYS B 2 60  ? 17.611  -0.081  -16.556 1.00 0.00 ? 160 CYS B HB2  4  
ATOM   8209  H  HB3  . CYS B 2 60  ? 17.943  0.600   -14.973 1.00 0.00 ? 160 CYS B HB3  4  
ATOM   8210  N  N    . GLN B 2 61  ? 21.063  1.981   -15.798 1.00 0.00 ? 161 GLN B N    4  
ATOM   8211  C  CA   . GLN B 2 61  ? 21.942  2.901   -15.090 1.00 0.00 ? 161 GLN B CA   4  
ATOM   8212  C  C    . GLN B 2 61  ? 21.329  3.275   -13.742 1.00 0.00 ? 161 GLN B C    4  
ATOM   8213  O  O    . GLN B 2 61  ? 22.019  3.758   -12.845 1.00 0.00 ? 161 GLN B O    4  
ATOM   8214  C  CB   . GLN B 2 61  ? 22.185  4.159   -15.930 1.00 0.00 ? 161 GLN B CB   4  
ATOM   8215  C  CG   . GLN B 2 61  ? 23.638  4.350   -16.333 1.00 0.00 ? 161 GLN B CG   4  
ATOM   8216  C  CD   . GLN B 2 61  ? 23.826  5.493   -17.310 1.00 0.00 ? 161 GLN B CD   4  
ATOM   8217  O  OE1  . GLN B 2 61  ? 23.502  6.642   -17.010 1.00 0.00 ? 161 GLN B OE1  4  
ATOM   8218  N  NE2  . GLN B 2 61  ? 24.356  5.184   -18.489 1.00 0.00 ? 161 GLN B NE2  4  
ATOM   8219  H  H    . GLN B 2 61  ? 20.780  2.194   -16.711 1.00 0.00 ? 161 GLN B H    4  
ATOM   8220  H  HA   . GLN B 2 61  ? 22.883  2.400   -14.921 1.00 0.00 ? 161 GLN B HA   4  
ATOM   8221  H  HB2  . GLN B 2 61  ? 21.589  4.097   -16.829 1.00 0.00 ? 161 GLN B HB2  4  
ATOM   8222  H  HB3  . GLN B 2 61  ? 21.875  5.025   -15.362 1.00 0.00 ? 161 GLN B HB3  4  
ATOM   8223  H  HG2  . GLN B 2 61  ? 24.220  4.553   -15.447 1.00 0.00 ? 161 GLN B HG2  4  
ATOM   8224  H  HG3  . GLN B 2 61  ? 23.992  3.438   -16.794 1.00 0.00 ? 161 GLN B HG3  4  
ATOM   8225  H  HE21 . GLN B 2 61  ? 24.590  4.248   -18.660 1.00 0.00 ? 161 GLN B HE21 4  
ATOM   8226  H  HE22 . GLN B 2 61  ? 24.489  5.904   -19.139 1.00 0.00 ? 161 GLN B HE22 4  
ATOM   8227  N  N    . SER B 2 62  ? 20.024  3.034   -13.609 1.00 0.00 ? 162 SER B N    4  
ATOM   8228  C  CA   . SER B 2 62  ? 19.312  3.331   -12.373 1.00 0.00 ? 162 SER B CA   4  
ATOM   8229  C  C    . SER B 2 62  ? 19.403  4.814   -12.028 1.00 0.00 ? 162 SER B C    4  
ATOM   8230  O  O    . SER B 2 62  ? 19.882  5.186   -10.956 1.00 0.00 ? 162 SER B O    4  
ATOM   8231  C  CB   . SER B 2 62  ? 19.873  2.491   -11.224 1.00 0.00 ? 162 SER B CB   4  
ATOM   8232  O  OG   . SER B 2 62  ? 19.121  2.681   -10.038 1.00 0.00 ? 162 SER B OG   4  
ATOM   8233  H  H    . SER B 2 62  ? 19.530  2.637   -14.366 1.00 0.00 ? 162 SER B H    4  
ATOM   8234  H  HA   . SER B 2 62  ? 18.274  3.072   -12.520 1.00 0.00 ? 162 SER B HA   4  
ATOM   8235  H  HB2  . SER B 2 62  ? 19.838  1.446   -11.494 1.00 0.00 ? 162 SER B HB2  4  
ATOM   8236  H  HB3  . SER B 2 62  ? 20.897  2.781   -11.036 1.00 0.00 ? 162 SER B HB3  4  
ATOM   8237  H  HG   . SER B 2 62  ? 19.145  3.608   -9.789  1.00 0.00 ? 162 SER B HG   4  
ATOM   8238  N  N    . GLY B 2 63  ? 18.937  5.655   -12.943 1.00 0.00 ? 163 GLY B N    4  
ATOM   8239  C  CA   . GLY B 2 63  ? 18.970  7.084   -12.720 1.00 0.00 ? 163 GLY B CA   4  
ATOM   8240  C  C    . GLY B 2 63  ? 17.615  7.727   -12.915 1.00 0.00 ? 163 GLY B C    4  
ATOM   8241  O  O    . GLY B 2 63  ? 16.610  7.261   -12.380 1.00 0.00 ? 163 GLY B O    4  
ATOM   8242  H  H    . GLY B 2 63  ? 18.566  5.303   -13.776 1.00 0.00 ? 163 GLY B H    4  
ATOM   8243  H  HA2  . GLY B 2 63  ? 19.303  7.276   -11.715 1.00 0.00 ? 163 GLY B HA2  4  
ATOM   8244  H  HA3  . GLY B 2 63  ? 19.669  7.529   -13.411 1.00 0.00 ? 163 GLY B HA3  4  
ATOM   8245  N  N    . LYS B 2 64  ? 17.594  8.799   -13.690 1.00 0.00 ? 164 LYS B N    4  
ATOM   8246  C  CA   . LYS B 2 64  ? 16.361  9.521   -13.972 1.00 0.00 ? 164 LYS B CA   4  
ATOM   8247  C  C    . LYS B 2 64  ? 16.390  10.111  -15.378 1.00 0.00 ? 164 LYS B C    4  
ATOM   8248  O  O    . LYS B 2 64  ? 15.737  11.117  -15.656 1.00 0.00 ? 164 LYS B O    4  
ATOM   8249  C  CB   . LYS B 2 64  ? 16.145  10.631  -12.942 1.00 0.00 ? 164 LYS B CB   4  
ATOM   8250  C  CG   . LYS B 2 64  ? 17.368  11.508  -12.729 1.00 0.00 ? 164 LYS B CG   4  
ATOM   8251  C  CD   . LYS B 2 64  ? 16.977  12.946  -12.428 1.00 0.00 ? 164 LYS B CD   4  
ATOM   8252  C  CE   . LYS B 2 64  ? 16.549  13.680  -13.689 1.00 0.00 ? 164 LYS B CE   4  
ATOM   8253  N  NZ   . LYS B 2 64  ? 17.718  14.102  -14.510 1.00 0.00 ? 164 LYS B NZ   4  
ATOM   8254  H  H    . LYS B 2 64  ? 18.433  9.111   -14.085 1.00 0.00 ? 164 LYS B H    4  
ATOM   8255  H  HA   . LYS B 2 64  ? 15.543  8.818   -13.907 1.00 0.00 ? 164 LYS B HA   4  
ATOM   8256  H  HB2  . LYS B 2 64  ? 15.332  11.260  -13.273 1.00 0.00 ? 164 LYS B HB2  4  
ATOM   8257  H  HB3  . LYS B 2 64  ? 15.881  10.183  -11.997 1.00 0.00 ? 164 LYS B HB3  4  
ATOM   8258  H  HG2  . LYS B 2 64  ? 17.937  11.120  -11.897 1.00 0.00 ? 164 LYS B HG2  4  
ATOM   8259  H  HG3  . LYS B 2 64  ? 17.975  11.488  -13.622 1.00 0.00 ? 164 LYS B HG3  4  
ATOM   8260  H  HD2  . LYS B 2 64  ? 16.155  12.946  -11.728 1.00 0.00 ? 164 LYS B HD2  4  
ATOM   8261  H  HD3  . LYS B 2 64  ? 17.824  13.456  -11.994 1.00 0.00 ? 164 LYS B HD3  4  
ATOM   8262  H  HE2  . LYS B 2 64  ? 15.925  13.025  -14.277 1.00 0.00 ? 164 LYS B HE2  4  
ATOM   8263  H  HE3  . LYS B 2 64  ? 15.984  14.556  -13.405 1.00 0.00 ? 164 LYS B HE3  4  
ATOM   8264  H  HZ1  . LYS B 2 64  ? 17.416  14.778  -15.240 1.00 0.00 ? 164 LYS B HZ1  4  
ATOM   8265  H  HZ2  . LYS B 2 64  ? 18.145  13.275  -14.974 1.00 0.00 ? 164 LYS B HZ2  4  
ATOM   8266  H  HZ3  . LYS B 2 64  ? 18.434  14.555  -13.907 1.00 0.00 ? 164 LYS B HZ3  4  
ATOM   8267  N  N    . SER B 2 65  ? 17.153  9.475   -16.260 1.00 0.00 ? 165 SER B N    4  
ATOM   8268  C  CA   . SER B 2 65  ? 17.274  9.927   -17.640 1.00 0.00 ? 165 SER B CA   4  
ATOM   8269  C  C    . SER B 2 65  ? 17.736  8.784   -18.537 1.00 0.00 ? 165 SER B C    4  
ATOM   8270  O  O    . SER B 2 65  ? 18.405  9.001   -19.545 1.00 0.00 ? 165 SER B O    4  
ATOM   8271  C  CB   . SER B 2 65  ? 18.258  11.095  -17.732 1.00 0.00 ? 165 SER B CB   4  
ATOM   8272  O  OG   . SER B 2 65  ? 19.524  10.741  -17.203 1.00 0.00 ? 165 SER B OG   4  
ATOM   8273  H  H    . SER B 2 65  ? 17.647  8.678   -15.976 1.00 0.00 ? 165 SER B H    4  
ATOM   8274  H  HA   . SER B 2 65  ? 16.301  10.258  -17.969 1.00 0.00 ? 165 SER B HA   4  
ATOM   8275  H  HB2  . SER B 2 65  ? 18.382  11.378  -18.767 1.00 0.00 ? 165 SER B HB2  4  
ATOM   8276  H  HB3  . SER B 2 65  ? 17.870  11.935  -17.175 1.00 0.00 ? 165 SER B HB3  4  
ATOM   8277  H  HG   . SER B 2 65  ? 19.859  11.461  -16.663 1.00 0.00 ? 165 SER B HG   4  
ATOM   8278  N  N    . CYS B 2 66  ? 17.372  7.562   -18.156 1.00 0.00 ? 166 CYS B N    4  
ATOM   8279  C  CA   . CYS B 2 66  ? 17.744  6.379   -18.916 1.00 0.00 ? 166 CYS B CA   4  
ATOM   8280  C  C    . CYS B 2 66  ? 17.128  6.417   -20.311 1.00 0.00 ? 166 CYS B C    4  
ATOM   8281  O  O    . CYS B 2 66  ? 16.300  7.279   -20.610 1.00 0.00 ? 166 CYS B O    4  
ATOM   8282  C  CB   . CYS B 2 66  ? 17.292  5.120   -18.174 1.00 0.00 ? 166 CYS B CB   4  
ATOM   8283  S  SG   . CYS B 2 66  ? 18.292  3.638   -18.528 1.00 0.00 ? 166 CYS B SG   4  
ATOM   8284  H  H    . CYS B 2 66  ? 16.838  7.453   -17.342 1.00 0.00 ? 166 CYS B H    4  
ATOM   8285  H  HA   . CYS B 2 66  ? 18.819  6.367   -19.010 1.00 0.00 ? 166 CYS B HA   4  
ATOM   8286  H  HB2  . CYS B 2 66  ? 17.345  5.302   -17.111 1.00 0.00 ? 166 CYS B HB2  4  
ATOM   8287  H  HB3  . CYS B 2 66  ? 16.270  4.902   -18.445 1.00 0.00 ? 166 CYS B HB3  4  
ATOM   8288  N  N    . GLN B 2 67  ? 17.536  5.481   -21.161 1.00 0.00 ? 167 GLN B N    4  
ATOM   8289  C  CA   . GLN B 2 67  ? 17.024  5.409   -22.525 1.00 0.00 ? 167 GLN B CA   4  
ATOM   8290  C  C    . GLN B 2 67  ? 15.590  4.877   -22.562 1.00 0.00 ? 167 GLN B C    4  
ATOM   8291  O  O    . GLN B 2 67  ? 14.979  4.811   -23.628 1.00 0.00 ? 167 GLN B O    4  
ATOM   8292  C  CB   . GLN B 2 67  ? 17.929  4.522   -23.381 1.00 0.00 ? 167 GLN B CB   4  
ATOM   8293  C  CG   . GLN B 2 67  ? 19.406  4.854   -23.251 1.00 0.00 ? 167 GLN B CG   4  
ATOM   8294  C  CD   . GLN B 2 67  ? 20.262  4.113   -24.260 1.00 0.00 ? 167 GLN B CD   4  
ATOM   8295  O  OE1  . GLN B 2 67  ? 21.187  4.681   -24.842 1.00 0.00 ? 167 GLN B OE1  4  
ATOM   8296  N  NE2  . GLN B 2 67  ? 19.959  2.839   -24.472 1.00 0.00 ? 167 GLN B NE2  4  
ATOM   8297  H  H    . GLN B 2 67  ? 18.198  4.824   -20.866 1.00 0.00 ? 167 GLN B H    4  
ATOM   8298  H  HA   . GLN B 2 67  ? 17.033  6.409   -22.932 1.00 0.00 ? 167 GLN B HA   4  
ATOM   8299  H  HB2  . GLN B 2 67  ? 17.787  3.492   -23.085 1.00 0.00 ? 167 GLN B HB2  4  
ATOM   8300  H  HB3  . GLN B 2 67  ? 17.646  4.631   -24.417 1.00 0.00 ? 167 GLN B HB3  4  
ATOM   8301  H  HG2  . GLN B 2 67  ? 19.537  5.916   -23.401 1.00 0.00 ? 167 GLN B HG2  4  
ATOM   8302  H  HG3  . GLN B 2 67  ? 19.736  4.590   -22.257 1.00 0.00 ? 167 GLN B HG3  4  
ATOM   8303  H  HE21 . GLN B 2 67  ? 19.211  2.451   -23.974 1.00 0.00 ? 167 GLN B HE21 4  
ATOM   8304  H  HE22 . GLN B 2 67  ? 20.496  2.336   -25.120 1.00 0.00 ? 167 GLN B HE22 4  
ATOM   8305  N  N    . VAL B 2 68  ? 15.056  4.497   -21.402 1.00 0.00 ? 168 VAL B N    4  
ATOM   8306  C  CA   . VAL B 2 68  ? 13.713  3.979   -21.317 1.00 0.00 ? 168 VAL B CA   4  
ATOM   8307  C  C    . VAL B 2 68  ? 12.904  4.777   -20.310 1.00 0.00 ? 168 VAL B C    4  
ATOM   8308  O  O    . VAL B 2 68  ? 13.371  5.087   -19.214 1.00 0.00 ? 168 VAL B O    4  
ATOM   8309  C  CB   . VAL B 2 68  ? 13.725  2.501   -20.907 1.00 0.00 ? 168 VAL B CB   4  
ATOM   8310  C  CG1  . VAL B 2 68  ? 12.308  1.975   -20.697 1.00 0.00 ? 168 VAL B CG1  4  
ATOM   8311  C  CG2  . VAL B 2 68  ? 14.460  1.672   -21.950 1.00 0.00 ? 168 VAL B CG2  4  
ATOM   8312  H  H    . VAL B 2 68  ? 15.572  4.564   -20.582 1.00 0.00 ? 168 VAL B H    4  
ATOM   8313  H  HA   . VAL B 2 68  ? 13.254  4.063   -22.292 1.00 0.00 ? 168 VAL B HA   4  
ATOM   8314  H  HB   . VAL B 2 68  ? 14.260  2.427   -19.973 1.00 0.00 ? 168 VAL B HB   4  
ATOM   8315  H  HG11 . VAL B 2 68  ? 12.131  1.141   -21.360 1.00 0.00 ? 168 VAL B HG11 4  
ATOM   8316  H  HG12 . VAL B 2 68  ? 11.596  2.759   -20.907 1.00 0.00 ? 168 VAL B HG12 4  
ATOM   8317  H  HG13 . VAL B 2 68  ? 12.193  1.649   -19.673 1.00 0.00 ? 168 VAL B HG13 4  
ATOM   8318  H  HG21 . VAL B 2 68  ? 15.526  1.807   -21.831 1.00 0.00 ? 168 VAL B HG21 4  
ATOM   8319  H  HG22 . VAL B 2 68  ? 14.164  1.992   -22.937 1.00 0.00 ? 168 VAL B HG22 4  
ATOM   8320  H  HG23 . VAL B 2 68  ? 14.213  0.628   -21.821 1.00 0.00 ? 168 VAL B HG23 4  
ATOM   8321  N  N    . ALA B 2 69  ? 11.693  5.101   -20.702 1.00 0.00 ? 169 ALA B N    4  
ATOM   8322  C  CA   . ALA B 2 69  ? 10.786  5.868   -19.860 1.00 0.00 ? 169 ALA B CA   4  
ATOM   8323  C  C    . ALA B 2 69  ? 10.257  5.018   -18.713 1.00 0.00 ? 169 ALA B C    4  
ATOM   8324  O  O    . ALA B 2 69  ? 10.328  5.410   -17.549 1.00 0.00 ? 169 ALA B O    4  
ATOM   8325  C  CB   . ALA B 2 69  ? 9.631   6.407   -20.691 1.00 0.00 ? 169 ALA B CB   4  
ATOM   8326  H  H    . ALA B 2 69  ? 11.404  4.815   -21.586 1.00 0.00 ? 169 ALA B H    4  
ATOM   8327  H  HA   . ALA B 2 69  ? 11.331  6.707   -19.455 1.00 0.00 ? 169 ALA B HA   4  
ATOM   8328  H  HB1  . ALA B 2 69  ? 10.010  6.803   -21.620 1.00 0.00 ? 169 ALA B HB1  4  
ATOM   8329  H  HB2  . ALA B 2 69  ? 9.127   7.188   -20.142 1.00 0.00 ? 169 ALA B HB2  4  
ATOM   8330  H  HB3  . ALA B 2 69  ? 8.935   5.607   -20.898 1.00 0.00 ? 169 ALA B HB3  4  
ATOM   8331  N  N    . HIS B 2 70  ? 9.719   3.855   -19.055 1.00 0.00 ? 170 HIS B N    4  
ATOM   8332  C  CA   . HIS B 2 70  ? 9.166   2.947   -18.069 1.00 0.00 ? 170 HIS B CA   4  
ATOM   8333  C  C    . HIS B 2 70  ? 10.237  2.438   -17.107 1.00 0.00 ? 170 HIS B C    4  
ATOM   8334  O  O    . HIS B 2 70  ? 9.917   1.908   -16.043 1.00 0.00 ? 170 HIS B O    4  
ATOM   8335  C  CB   . HIS B 2 70  ? 8.481   1.772   -18.766 1.00 0.00 ? 170 HIS B CB   4  
ATOM   8336  C  CG   . HIS B 2 70  ? 7.386   2.192   -19.696 1.00 0.00 ? 170 HIS B CG   4  
ATOM   8337  N  ND1  . HIS B 2 70  ? 6.240   2.829   -19.268 1.00 0.00 ? 170 HIS B ND1  4  
ATOM   8338  C  CD2  . HIS B 2 70  ? 7.269   2.074   -21.039 1.00 0.00 ? 170 HIS B CD2  4  
ATOM   8339  C  CE1  . HIS B 2 70  ? 5.466   3.082   -20.308 1.00 0.00 ? 170 HIS B CE1  4  
ATOM   8340  N  NE2  . HIS B 2 70  ? 6.067   2.635   -21.395 1.00 0.00 ? 170 HIS B NE2  4  
ATOM   8341  H  H    . HIS B 2 70  ? 9.684   3.606   -19.997 1.00 0.00 ? 170 HIS B H    4  
ATOM   8342  H  HA   . HIS B 2 70  ? 8.429   3.493   -17.510 1.00 0.00 ? 170 HIS B HA   4  
ATOM   8343  H  HB2  . HIS B 2 70  ? 9.214   1.225   -19.340 1.00 0.00 ? 170 HIS B HB2  4  
ATOM   8344  H  HB3  . HIS B 2 70  ? 8.053   1.119   -18.019 1.00 0.00 ? 170 HIS B HB3  4  
ATOM   8345  H  HD1  . HIS B 2 70  ? 6.025   3.059   -18.340 1.00 0.00 ? 170 HIS B HD1  4  
ATOM   8346  H  HD2  . HIS B 2 70  ? 7.988   1.622   -21.706 1.00 0.00 ? 170 HIS B HD2  4  
ATOM   8347  H  HE1  . HIS B 2 70  ? 4.501   3.567   -20.274 1.00 0.00 ? 170 HIS B HE1  4  
ATOM   8348  H  HE2  . HIS B 2 70  ? 5.670   2.607   -22.289 1.00 0.00 ? 170 HIS B HE2  4  
ATOM   8349  N  N    . CYS B 2 71  ? 11.506  2.599   -17.476 1.00 0.00 ? 171 CYS B N    4  
ATOM   8350  C  CA   . CYS B 2 71  ? 12.598  2.148   -16.624 1.00 0.00 ? 171 CYS B CA   4  
ATOM   8351  C  C    . CYS B 2 71  ? 12.775  3.080   -15.441 1.00 0.00 ? 171 CYS B C    4  
ATOM   8352  O  O    . CYS B 2 71  ? 12.484  2.726   -14.298 1.00 0.00 ? 171 CYS B O    4  
ATOM   8353  C  CB   . CYS B 2 71  ? 13.896  2.083   -17.422 1.00 0.00 ? 171 CYS B CB   4  
ATOM   8354  S  SG   . CYS B 2 71  ? 15.208  1.105   -16.623 1.00 0.00 ? 171 CYS B SG   4  
ATOM   8355  H  H    . CYS B 2 71  ? 11.715  3.030   -18.335 1.00 0.00 ? 171 CYS B H    4  
ATOM   8356  H  HA   . CYS B 2 71  ? 12.356  1.162   -16.261 1.00 0.00 ? 171 CYS B HA   4  
ATOM   8357  H  HB2  . CYS B 2 71  ? 13.690  1.646   -18.375 1.00 0.00 ? 171 CYS B HB2  4  
ATOM   8358  H  HB3  . CYS B 2 71  ? 14.275  3.082   -17.573 1.00 0.00 ? 171 CYS B HB3  4  
ATOM   8359  N  N    . ALA B 2 72  ? 13.253  4.277   -15.734 1.00 0.00 ? 172 ALA B N    4  
ATOM   8360  C  CA   . ALA B 2 72  ? 13.477  5.288   -14.704 1.00 0.00 ? 172 ALA B CA   4  
ATOM   8361  C  C    . ALA B 2 72  ? 12.201  5.548   -13.907 1.00 0.00 ? 172 ALA B C    4  
ATOM   8362  O  O    . ALA B 2 72  ? 12.219  5.581   -12.676 1.00 0.00 ? 172 ALA B O    4  
ATOM   8363  C  CB   . ALA B 2 72  ? 13.983  6.580   -15.330 1.00 0.00 ? 172 ALA B CB   4  
ATOM   8364  H  H    . ALA B 2 72  ? 13.462  4.483   -16.671 1.00 0.00 ? 172 ALA B H    4  
ATOM   8365  H  HA   . ALA B 2 72  ? 14.238  4.917   -14.033 1.00 0.00 ? 172 ALA B HA   4  
ATOM   8366  H  HB1  . ALA B 2 72  ? 15.062  6.564   -15.365 1.00 0.00 ? 172 ALA B HB1  4  
ATOM   8367  H  HB2  . ALA B 2 72  ? 13.656  7.420   -14.735 1.00 0.00 ? 172 ALA B HB2  4  
ATOM   8368  H  HB3  . ALA B 2 72  ? 13.591  6.673   -16.331 1.00 0.00 ? 172 ALA B HB3  4  
ATOM   8369  N  N    . SER B 2 73  ? 11.093  5.728   -14.619 1.00 0.00 ? 173 SER B N    4  
ATOM   8370  C  CA   . SER B 2 73  ? 9.807   5.981   -13.980 1.00 0.00 ? 173 SER B CA   4  
ATOM   8371  C  C    . SER B 2 73  ? 9.464   4.862   -13.003 1.00 0.00 ? 173 SER B C    4  
ATOM   8372  O  O    . SER B 2 73  ? 9.140   5.114   -11.843 1.00 0.00 ? 173 SER B O    4  
ATOM   8373  C  CB   . SER B 2 73  ? 8.705   6.112   -15.033 1.00 0.00 ? 173 SER B CB   4  
ATOM   8374  O  OG   . SER B 2 73  ? 8.940   7.221   -15.882 1.00 0.00 ? 173 SER B OG   4  
ATOM   8375  H  H    . SER B 2 73  ? 11.141  5.688   -15.597 1.00 0.00 ? 173 SER B H    4  
ATOM   8376  H  HA   . SER B 2 73  ? 9.885   6.909   -13.433 1.00 0.00 ? 173 SER B HA   4  
ATOM   8377  H  HB2  . SER B 2 73  ? 8.676   5.214   -15.633 1.00 0.00 ? 173 SER B HB2  4  
ATOM   8378  H  HB3  . SER B 2 73  ? 7.754   6.246   -14.540 1.00 0.00 ? 173 SER B HB3  4  
ATOM   8379  H  HG   . SER B 2 73  ? 8.789   8.035   -15.396 1.00 0.00 ? 173 SER B HG   4  
ATOM   8380  N  N    . SER B 2 74  ? 9.544   3.622   -13.479 1.00 0.00 ? 174 SER B N    4  
ATOM   8381  C  CA   . SER B 2 74  ? 9.246   2.460   -12.649 1.00 0.00 ? 174 SER B CA   4  
ATOM   8382  C  C    . SER B 2 74  ? 10.062  2.487   -11.360 1.00 0.00 ? 174 SER B C    4  
ATOM   8383  O  O    . SER B 2 74  ? 9.576   2.100   -10.297 1.00 0.00 ? 174 SER B O    4  
ATOM   8384  C  CB   . SER B 2 74  ? 9.534   1.169   -13.418 1.00 0.00 ? 174 SER B CB   4  
ATOM   8385  O  OG   . SER B 2 74  ? 9.577   0.053   -12.545 1.00 0.00 ? 174 SER B OG   4  
ATOM   8386  H  H    . SER B 2 74  ? 9.812   3.485   -14.412 1.00 0.00 ? 174 SER B H    4  
ATOM   8387  H  HA   . SER B 2 74  ? 8.197   2.492   -12.397 1.00 0.00 ? 174 SER B HA   4  
ATOM   8388  H  HB2  . SER B 2 74  ? 8.756   1.006   -14.149 1.00 0.00 ? 174 SER B HB2  4  
ATOM   8389  H  HB3  . SER B 2 74  ? 10.486  1.256   -13.919 1.00 0.00 ? 174 SER B HB3  4  
ATOM   8390  H  HG   . SER B 2 74  ? 9.892   -0.717  -13.024 1.00 0.00 ? 174 SER B HG   4  
ATOM   8391  N  N    . ARG B 2 75  ? 11.304  2.951   -11.460 1.00 0.00 ? 175 ARG B N    4  
ATOM   8392  C  CA   . ARG B 2 75  ? 12.183  3.033   -10.301 1.00 0.00 ? 175 ARG B CA   4  
ATOM   8393  C  C    . ARG B 2 75  ? 11.579  3.931   -9.229  1.00 0.00 ? 175 ARG B C    4  
ATOM   8394  O  O    . ARG B 2 75  ? 11.544  3.574   -8.052  1.00 0.00 ? 175 ARG B O    4  
ATOM   8395  C  CB   . ARG B 2 75  ? 13.560  3.562   -10.710 1.00 0.00 ? 175 ARG B CB   4  
ATOM   8396  C  CG   . ARG B 2 75  ? 14.550  3.633   -9.560  1.00 0.00 ? 175 ARG B CG   4  
ATOM   8397  C  CD   . ARG B 2 75  ? 15.959  3.929   -10.051 1.00 0.00 ? 175 ARG B CD   4  
ATOM   8398  N  NE   . ARG B 2 75  ? 16.321  3.112   -11.206 1.00 0.00 ? 175 ARG B NE   4  
ATOM   8399  C  CZ   . ARG B 2 75  ? 16.573  1.805   -11.140 1.00 0.00 ? 175 ARG B CZ   4  
ATOM   8400  N  NH1  . ARG B 2 75  ? 16.496  1.166   -9.981  1.00 0.00 ? 175 ARG B NH1  4  
ATOM   8401  N  NH2  . ARG B 2 75  ? 16.901  1.137   -12.238 1.00 0.00 ? 175 ARG B NH2  4  
ATOM   8402  H  H    . ARG B 2 75  ? 11.635  3.249   -12.334 1.00 0.00 ? 175 ARG B H    4  
ATOM   8403  H  HA   . ARG B 2 75  ? 12.296  2.036   -9.900  1.00 0.00 ? 175 ARG B HA   4  
ATOM   8404  H  HB2  . ARG B 2 75  ? 13.969  2.915   -11.471 1.00 0.00 ? 175 ARG B HB2  4  
ATOM   8405  H  HB3  . ARG B 2 75  ? 13.443  4.554   -11.118 1.00 0.00 ? 175 ARG B HB3  4  
ATOM   8406  H  HG2  . ARG B 2 75  ? 14.245  4.416   -8.882  1.00 0.00 ? 175 ARG B HG2  4  
ATOM   8407  H  HG3  . ARG B 2 75  ? 14.551  2.686   -9.040  1.00 0.00 ? 175 ARG B HG3  4  
ATOM   8408  H  HD2  . ARG B 2 75  ? 16.017  4.972   -10.329 1.00 0.00 ? 175 ARG B HD2  4  
ATOM   8409  H  HD3  . ARG B 2 75  ? 16.654  3.732   -9.249  1.00 0.00 ? 175 ARG B HD3  4  
ATOM   8410  H  HE   . ARG B 2 75  ? 16.384  3.558   -12.076 1.00 0.00 ? 175 ARG B HE   4  
ATOM   8411  H  HH11 . ARG B 2 75  ? 16.249  1.663   -9.149  1.00 0.00 ? 175 ARG B HH11 4  
ATOM   8412  H  HH12 . ARG B 2 75  ? 16.684  0.184   -9.938  1.00 0.00 ? 175 ARG B HH12 4  
ATOM   8413  H  HH21 . ARG B 2 75  ? 16.961  1.615   -13.115 1.00 0.00 ? 175 ARG B HH21 4  
ATOM   8414  H  HH22 . ARG B 2 75  ? 17.089  0.157   -12.189 1.00 0.00 ? 175 ARG B HH22 4  
ATOM   8415  N  N    . GLN B 2 76  ? 11.099  5.098   -9.645  1.00 0.00 ? 176 GLN B N    4  
ATOM   8416  C  CA   . GLN B 2 76  ? 10.489  6.047   -8.720  1.00 0.00 ? 176 GLN B CA   4  
ATOM   8417  C  C    . GLN B 2 76  ? 9.159   5.519   -8.187  1.00 0.00 ? 176 GLN B C    4  
ATOM   8418  O  O    . GLN B 2 76  ? 8.717   5.905   -7.105  1.00 0.00 ? 176 GLN B O    4  
ATOM   8419  C  CB   . GLN B 2 76  ? 10.277  7.397   -9.407  1.00 0.00 ? 176 GLN B CB   4  
ATOM   8420  C  CG   . GLN B 2 76  ? 11.570  8.076   -9.827  1.00 0.00 ? 176 GLN B CG   4  
ATOM   8421  C  CD   . GLN B 2 76  ? 11.333  9.283   -10.713 1.00 0.00 ? 176 GLN B CD   4  
ATOM   8422  O  OE1  . GLN B 2 76  ? 11.058  9.148   -11.905 1.00 0.00 ? 176 GLN B OE1  4  
ATOM   8423  N  NE2  . GLN B 2 76  ? 11.439  10.474  -10.134 1.00 0.00 ? 176 GLN B NE2  4  
ATOM   8424  H  H    . GLN B 2 76  ? 11.154  5.326   -10.599 1.00 0.00 ? 176 GLN B H    4  
ATOM   8425  H  HA   . GLN B 2 76  ? 11.168  6.180   -7.889  1.00 0.00 ? 176 GLN B HA   4  
ATOM   8426  H  HB2  . GLN B 2 76  ? 9.671   7.249   -10.288 1.00 0.00 ? 176 GLN B HB2  4  
ATOM   8427  H  HB3  . GLN B 2 76  ? 9.754   8.055   -8.728  1.00 0.00 ? 176 GLN B HB3  4  
ATOM   8428  H  HG2  . GLN B 2 76  ? 12.097  8.398   -8.941  1.00 0.00 ? 176 GLN B HG2  4  
ATOM   8429  H  HG3  . GLN B 2 76  ? 12.176  7.364   -10.367 1.00 0.00 ? 176 GLN B HG3  4  
ATOM   8430  H  HE21 . GLN B 2 76  ? 11.661  10.506  -9.180  1.00 0.00 ? 176 GLN B HE21 4  
ATOM   8431  H  HE22 . GLN B 2 76  ? 11.291  11.271  -10.684 1.00 0.00 ? 176 GLN B HE22 4  
ATOM   8432  N  N    . ILE B 2 77  ? 8.524   4.636   -8.954  1.00 0.00 ? 177 ILE B N    4  
ATOM   8433  C  CA   . ILE B 2 77  ? 7.244   4.059   -8.557  1.00 0.00 ? 177 ILE B CA   4  
ATOM   8434  C  C    . ILE B 2 77  ? 7.406   3.127   -7.358  1.00 0.00 ? 177 ILE B C    4  
ATOM   8435  O  O    . ILE B 2 77  ? 6.993   3.453   -6.245  1.00 0.00 ? 177 ILE B O    4  
ATOM   8436  C  CB   . ILE B 2 77  ? 6.595   3.277   -9.722  1.00 0.00 ? 177 ILE B CB   4  
ATOM   8437  C  CG1  . ILE B 2 77  ? 6.302   4.220   -10.895 1.00 0.00 ? 177 ILE B CG1  4  
ATOM   8438  C  CG2  . ILE B 2 77  ? 5.323   2.574   -9.261  1.00 0.00 ? 177 ILE B CG2  4  
ATOM   8439  C  CD1  . ILE B 2 77  ? 5.041   5.042   -10.720 1.00 0.00 ? 177 ILE B CD1  4  
ATOM   8440  H  H    . ILE B 2 77  ? 8.924   4.367   -9.807  1.00 0.00 ? 177 ILE B H    4  
ATOM   8441  H  HA   . ILE B 2 77  ? 6.584   4.868   -8.283  1.00 0.00 ? 177 ILE B HA   4  
ATOM   8442  H  HB   . ILE B 2 77  ? 7.293   2.521   -10.047 1.00 0.00 ? 177 ILE B HB   4  
ATOM   8443  H  HG12 . ILE B 2 77  ? 7.128   4.906   -11.010 1.00 0.00 ? 177 ILE B HG12 4  
ATOM   8444  H  HG13 . ILE B 2 77  ? 6.197   3.637   -11.797 1.00 0.00 ? 177 ILE B HG13 4  
ATOM   8445  H  HG21 . ILE B 2 77  ? 4.552   2.699   -10.007 1.00 0.00 ? 177 ILE B HG21 4  
ATOM   8446  H  HG22 . ILE B 2 77  ? 4.993   3.004   -8.328  1.00 0.00 ? 177 ILE B HG22 4  
ATOM   8447  H  HG23 . ILE B 2 77  ? 5.523   1.522   -9.122  1.00 0.00 ? 177 ILE B HG23 4  
ATOM   8448  H  HD11 . ILE B 2 77  ? 4.999   5.428   -9.712  1.00 0.00 ? 177 ILE B HD11 4  
ATOM   8449  H  HD12 . ILE B 2 77  ? 4.178   4.420   -10.904 1.00 0.00 ? 177 ILE B HD12 4  
ATOM   8450  H  HD13 . ILE B 2 77  ? 5.048   5.864   -11.421 1.00 0.00 ? 177 ILE B HD13 4  
ATOM   8451  N  N    . ILE B 2 78  ? 8.005   1.964   -7.596  1.00 0.00 ? 178 ILE B N    4  
ATOM   8452  C  CA   . ILE B 2 78  ? 8.216   0.981   -6.539  1.00 0.00 ? 178 ILE B CA   4  
ATOM   8453  C  C    . ILE B 2 78  ? 8.993   1.580   -5.371  1.00 0.00 ? 178 ILE B C    4  
ATOM   8454  O  O    . ILE B 2 78  ? 8.728   1.266   -4.211  1.00 0.00 ? 178 ILE B O    4  
ATOM   8455  C  CB   . ILE B 2 78  ? 8.973   -0.257  -7.059  1.00 0.00 ? 178 ILE B CB   4  
ATOM   8456  C  CG1  . ILE B 2 78  ? 8.315   -0.792  -8.336  1.00 0.00 ? 178 ILE B CG1  4  
ATOM   8457  C  CG2  . ILE B 2 78  ? 9.015   -1.334  -5.986  1.00 0.00 ? 178 ILE B CG2  4  
ATOM   8458  C  CD1  . ILE B 2 78  ? 8.947   -2.065  -8.858  1.00 0.00 ? 178 ILE B CD1  4  
ATOM   8459  H  H    . ILE B 2 78  ? 8.307   1.762   -8.505  1.00 0.00 ? 178 ILE B H    4  
ATOM   8460  H  HA   . ILE B 2 78  ? 7.247   0.660   -6.185  1.00 0.00 ? 178 ILE B HA   4  
ATOM   8461  H  HB   . ILE B 2 78  ? 9.988   0.036   -7.281  1.00 0.00 ? 178 ILE B HB   4  
ATOM   8462  H  HG12 . ILE B 2 78  ? 7.273   -0.996  -8.138  1.00 0.00 ? 178 ILE B HG12 4  
ATOM   8463  H  HG13 . ILE B 2 78  ? 8.389   -0.044  -9.110  1.00 0.00 ? 178 ILE B HG13 4  
ATOM   8464  H  HG21 . ILE B 2 78  ? 9.457   -2.232  -6.394  1.00 0.00 ? 178 ILE B HG21 4  
ATOM   8465  H  HG22 . ILE B 2 78  ? 8.012   -1.547  -5.650  1.00 0.00 ? 178 ILE B HG22 4  
ATOM   8466  H  HG23 . ILE B 2 78  ? 9.608   -0.989  -5.151  1.00 0.00 ? 178 ILE B HG23 4  
ATOM   8467  H  HD11 . ILE B 2 78  ? 9.199   -1.939  -9.899  1.00 0.00 ? 178 ILE B HD11 4  
ATOM   8468  H  HD12 . ILE B 2 78  ? 8.249   -2.882  -8.751  1.00 0.00 ? 178 ILE B HD12 4  
ATOM   8469  H  HD13 . ILE B 2 78  ? 9.842   -2.280  -8.293  1.00 0.00 ? 178 ILE B HD13 4  
ATOM   8470  N  N    . SER B 2 79  ? 9.954   2.442   -5.684  1.00 0.00 ? 179 SER B N    4  
ATOM   8471  C  CA   . SER B 2 79  ? 10.770  3.082   -4.659  1.00 0.00 ? 179 SER B CA   4  
ATOM   8472  C  C    . SER B 2 79  ? 9.898   3.820   -3.647  1.00 0.00 ? 179 SER B C    4  
ATOM   8473  O  O    . SER B 2 79  ? 9.927   3.522   -2.453  1.00 0.00 ? 179 SER B O    4  
ATOM   8474  C  CB   . SER B 2 79  ? 11.760  4.053   -5.304  1.00 0.00 ? 179 SER B CB   4  
ATOM   8475  O  OG   . SER B 2 79  ? 12.827  3.358   -5.924  1.00 0.00 ? 179 SER B OG   4  
ATOM   8476  H  H    . SER B 2 79  ? 10.119  2.652   -6.627  1.00 0.00 ? 179 SER B H    4  
ATOM   8477  H  HA   . SER B 2 79  ? 11.322  2.309   -4.144  1.00 0.00 ? 179 SER B HA   4  
ATOM   8478  H  HB2  . SER B 2 79  ? 11.249  4.643   -6.050  1.00 0.00 ? 179 SER B HB2  4  
ATOM   8479  H  HB3  . SER B 2 79  ? 12.165  4.705   -4.545  1.00 0.00 ? 179 SER B HB3  4  
ATOM   8480  H  HG   . SER B 2 79  ? 13.314  3.960   -6.492  1.00 0.00 ? 179 SER B HG   4  
ATOM   8481  N  N    . HIS B 2 80  ? 9.120   4.782   -4.133  1.00 0.00 ? 180 HIS B N    4  
ATOM   8482  C  CA   . HIS B 2 80  ? 8.233   5.562   -3.276  1.00 0.00 ? 180 HIS B CA   4  
ATOM   8483  C  C    . HIS B 2 80  ? 7.383   4.642   -2.399  1.00 0.00 ? 180 HIS B C    4  
ATOM   8484  O  O    . HIS B 2 80  ? 7.312   4.814   -1.184  1.00 0.00 ? 180 HIS B O    4  
ATOM   8485  C  CB   . HIS B 2 80  ? 7.334   6.461   -4.140  1.00 0.00 ? 180 HIS B CB   4  
ATOM   8486  C  CG   . HIS B 2 80  ? 5.958   6.685   -3.581  1.00 0.00 ? 180 HIS B CG   4  
ATOM   8487  N  ND1  . HIS B 2 80  ? 5.537   7.874   -3.029  1.00 0.00 ? 180 HIS B ND1  4  
ATOM   8488  C  CD2  . HIS B 2 80  ? 4.898   5.837   -3.495  1.00 0.00 ? 180 HIS B CD2  4  
ATOM   8489  C  CE1  . HIS B 2 80  ? 4.267   7.717   -2.633  1.00 0.00 ? 180 HIS B CE1  4  
ATOM   8490  N  NE2  . HIS B 2 80  ? 3.832   6.499   -2.893  1.00 0.00 ? 180 HIS B NE2  4  
ATOM   8491  H  H    . HIS B 2 80  ? 9.140   4.971   -5.095  1.00 0.00 ? 180 HIS B H    4  
ATOM   8492  H  HA   . HIS B 2 80  ? 8.850   6.185   -2.642  1.00 0.00 ? 180 HIS B HA   4  
ATOM   8493  H  HB2  . HIS B 2 80  ? 7.805   7.425   -4.249  1.00 0.00 ? 180 HIS B HB2  4  
ATOM   8494  H  HB3  . HIS B 2 80  ? 7.225   6.011   -5.117  1.00 0.00 ? 180 HIS B HB3  4  
ATOM   8495  H  HD1  . HIS B 2 80  ? 6.072   8.690   -2.942  1.00 0.00 ? 180 HIS B HD1  4  
ATOM   8496  H  HD2  . HIS B 2 80  ? 4.875   4.810   -3.834  1.00 0.00 ? 180 HIS B HD2  4  
ATOM   8497  H  HE1  . HIS B 2 80  ? 3.676   8.489   -2.162  1.00 0.00 ? 180 HIS B HE1  4  
ATOM   8498  N  N    . TRP B 2 81  ? 6.738   3.671   -3.038  1.00 0.00 ? 181 TRP B N    4  
ATOM   8499  C  CA   . TRP B 2 81  ? 5.879   2.710   -2.348  1.00 0.00 ? 181 TRP B CA   4  
ATOM   8500  C  C    . TRP B 2 81  ? 6.508   2.223   -1.047  1.00 0.00 ? 181 TRP B C    4  
ATOM   8501  O  O    . TRP B 2 81  ? 5.979   2.453   0.040   1.00 0.00 ? 181 TRP B O    4  
ATOM   8502  C  CB   . TRP B 2 81  ? 5.618   1.514   -3.260  1.00 0.00 ? 181 TRP B CB   4  
ATOM   8503  C  CG   . TRP B 2 81  ? 4.750   0.461   -2.639  1.00 0.00 ? 181 TRP B CG   4  
ATOM   8504  C  CD1  . TRP B 2 81  ? 5.153   -0.557  -1.823  1.00 0.00 ? 181 TRP B CD1  4  
ATOM   8505  C  CD2  . TRP B 2 81  ? 3.333   0.323   -2.786  1.00 0.00 ? 181 TRP B CD2  4  
ATOM   8506  N  NE1  . TRP B 2 81  ? 4.072   -1.321  -1.456  1.00 0.00 ? 181 TRP B NE1  4  
ATOM   8507  C  CE2  . TRP B 2 81  ? 2.943   -0.802  -2.033  1.00 0.00 ? 181 TRP B CE2  4  
ATOM   8508  C  CE3  . TRP B 2 81  ? 2.358   1.040   -3.480  1.00 0.00 ? 181 TRP B CE3  4  
ATOM   8509  C  CZ2  . TRP B 2 81  ? 1.619   -1.224  -1.958  1.00 0.00 ? 181 TRP B CZ2  4  
ATOM   8510  C  CZ3  . TRP B 2 81  ? 1.043   0.621   -3.405  1.00 0.00 ? 181 TRP B CZ3  4  
ATOM   8511  C  CH2  . TRP B 2 81  ? 0.684   -0.502  -2.649  1.00 0.00 ? 181 TRP B CH2  4  
ATOM   8512  H  H    . TRP B 2 81  ? 6.839   3.598   -4.010  1.00 0.00 ? 181 TRP B H    4  
ATOM   8513  H  HA   . TRP B 2 81  ? 4.941   3.195   -2.127  1.00 0.00 ? 181 TRP B HA   4  
ATOM   8514  H  HB2  . TRP B 2 81  ? 5.135   1.857   -4.157  1.00 0.00 ? 181 TRP B HB2  4  
ATOM   8515  H  HB3  . TRP B 2 81  ? 6.560   1.060   -3.519  1.00 0.00 ? 181 TRP B HB3  4  
ATOM   8516  H  HD1  . TRP B 2 81  ? 6.176   -0.725  -1.520  1.00 0.00 ? 181 TRP B HD1  4  
ATOM   8517  H  HE1  . TRP B 2 81  ? 4.103   -2.109  -0.873  1.00 0.00 ? 181 TRP B HE1  4  
ATOM   8518  H  HE3  . TRP B 2 81  ? 2.617   1.910   -4.068  1.00 0.00 ? 181 TRP B HE3  4  
ATOM   8519  H  HZ2  . TRP B 2 81  ? 1.326   -2.087  -1.379  1.00 0.00 ? 181 TRP B HZ2  4  
ATOM   8520  H  HZ3  . TRP B 2 81  ? 0.275   1.162   -3.936  1.00 0.00 ? 181 TRP B HZ3  4  
ATOM   8521  H  HH2  . TRP B 2 81  ? -0.355  -0.794  -2.620  1.00 0.00 ? 181 TRP B HH2  4  
ATOM   8522  N  N    . LYS B 2 82  ? 7.631   1.534   -1.177  1.00 0.00 ? 182 LYS B N    4  
ATOM   8523  C  CA   . LYS B 2 82  ? 8.336   0.989   -0.021  1.00 0.00 ? 182 LYS B CA   4  
ATOM   8524  C  C    . LYS B 2 82  ? 8.751   2.090   0.952   1.00 0.00 ? 182 LYS B C    4  
ATOM   8525  O  O    . LYS B 2 82  ? 8.963   1.832   2.136   1.00 0.00 ? 182 LYS B O    4  
ATOM   8526  C  CB   . LYS B 2 82  ? 9.567   0.203   -0.473  1.00 0.00 ? 182 LYS B CB   4  
ATOM   8527  C  CG   . LYS B 2 82  ? 10.301  -0.485  0.666   1.00 0.00 ? 182 LYS B CG   4  
ATOM   8528  C  CD   . LYS B 2 82  ? 9.393   -1.450  1.410   1.00 0.00 ? 182 LYS B CD   4  
ATOM   8529  C  CE   . LYS B 2 82  ? 10.155  -2.673  1.897   1.00 0.00 ? 182 LYS B CE   4  
ATOM   8530  N  NZ   . LYS B 2 82  ? 10.449  -2.599  3.354   1.00 0.00 ? 182 LYS B NZ   4  
ATOM   8531  H  H    . LYS B 2 82  ? 7.988   1.375   -2.078  1.00 0.00 ? 182 LYS B H    4  
ATOM   8532  H  HA   . LYS B 2 82  ? 7.661   0.316   0.487   1.00 0.00 ? 182 LYS B HA   4  
ATOM   8533  H  HB2  . LYS B 2 82  ? 9.259   -0.552  -1.182  1.00 0.00 ? 182 LYS B HB2  4  
ATOM   8534  H  HB3  . LYS B 2 82  ? 10.254  0.880   -0.958  1.00 0.00 ? 182 LYS B HB3  4  
ATOM   8535  H  HG2  . LYS B 2 82  ? 11.139  -1.033  0.263   1.00 0.00 ? 182 LYS B HG2  4  
ATOM   8536  H  HG3  . LYS B 2 82  ? 10.657  0.265   1.357   1.00 0.00 ? 182 LYS B HG3  4  
ATOM   8537  H  HD2  . LYS B 2 82  ? 8.965   -0.943  2.261   1.00 0.00 ? 182 LYS B HD2  4  
ATOM   8538  H  HD3  . LYS B 2 82  ? 8.603   -1.771  0.746   1.00 0.00 ? 182 LYS B HD3  4  
ATOM   8539  H  HE2  . LYS B 2 82  ? 9.560   -3.552  1.704   1.00 0.00 ? 182 LYS B HE2  4  
ATOM   8540  H  HE3  . LYS B 2 82  ? 11.085  -2.742  1.353   1.00 0.00 ? 182 LYS B HE3  4  
ATOM   8541  H  HZ1  . LYS B 2 82  ? 9.702   -3.078  3.895   1.00 0.00 ? 182 LYS B HZ1  4  
ATOM   8542  H  HZ2  . LYS B 2 82  ? 10.499  -1.606  3.660   1.00 0.00 ? 182 LYS B HZ2  4  
ATOM   8543  H  HZ3  . LYS B 2 82  ? 11.359  -3.058  3.559   1.00 0.00 ? 182 LYS B HZ3  4  
ATOM   8544  N  N    . ASN B 2 83  ? 8.863   3.317   0.454   1.00 0.00 ? 183 ASN B N    4  
ATOM   8545  C  CA   . ASN B 2 83  ? 9.249   4.445   1.297   1.00 0.00 ? 183 ASN B CA   4  
ATOM   8546  C  C    . ASN B 2 83  ? 8.049   5.336   1.621   1.00 0.00 ? 183 ASN B C    4  
ATOM   8547  O  O    . ASN B 2 83  ? 8.210   6.441   2.138   1.00 0.00 ? 183 ASN B O    4  
ATOM   8548  C  CB   . ASN B 2 83  ? 10.341  5.268   0.613   1.00 0.00 ? 183 ASN B CB   4  
ATOM   8549  C  CG   . ASN B 2 83  ? 11.495  5.585   1.544   1.00 0.00 ? 183 ASN B CG   4  
ATOM   8550  O  OD1  . ASN B 2 83  ? 11.294  5.881   2.722   1.00 0.00 ? 183 ASN B OD1  4  
ATOM   8551  N  ND2  . ASN B 2 83  ? 12.714  5.525   1.019   1.00 0.00 ? 183 ASN B ND2  4  
ATOM   8552  H  H    . ASN B 2 83  ? 8.681   3.469   -0.498  1.00 0.00 ? 183 ASN B H    4  
ATOM   8553  H  HA   . ASN B 2 83  ? 9.641   4.045   2.220   1.00 0.00 ? 183 ASN B HA   4  
ATOM   8554  H  HB2  . ASN B 2 83  ? 10.725  4.715   -0.230  1.00 0.00 ? 183 ASN B HB2  4  
ATOM   8555  H  HB3  . ASN B 2 83  ? 9.917   6.199   0.264   1.00 0.00 ? 183 ASN B HB3  4  
ATOM   8556  H  HD21 . ASN B 2 83  ? 12.799  5.283   0.074   1.00 0.00 ? 183 ASN B HD21 4  
ATOM   8557  H  HD22 . ASN B 2 83  ? 13.477  5.726   1.600   1.00 0.00 ? 183 ASN B HD22 4  
ATOM   8558  N  N    . CYS B 2 84  ? 6.848   4.852   1.311   1.00 0.00 ? 184 CYS B N    4  
ATOM   8559  C  CA   . CYS B 2 84  ? 5.629   5.610   1.571   1.00 0.00 ? 184 CYS B CA   4  
ATOM   8560  C  C    . CYS B 2 84  ? 4.857   5.017   2.744   1.00 0.00 ? 184 CYS B C    4  
ATOM   8561  O  O    . CYS B 2 84  ? 4.290   3.929   2.641   1.00 0.00 ? 184 CYS B O    4  
ATOM   8562  C  CB   . CYS B 2 84  ? 4.746   5.631   0.323   1.00 0.00 ? 184 CYS B CB   4  
ATOM   8563  S  SG   . CYS B 2 84  ? 3.468   6.930   0.339   1.00 0.00 ? 184 CYS B SG   4  
ATOM   8564  H  H    . CYS B 2 84  ? 6.778   3.968   0.898   1.00 0.00 ? 184 CYS B H    4  
ATOM   8565  H  HA   . CYS B 2 84  ? 5.914   6.623   1.817   1.00 0.00 ? 184 CYS B HA   4  
ATOM   8566  H  HB2  . CYS B 2 84  ? 5.366   5.792   -0.546  1.00 0.00 ? 184 CYS B HB2  4  
ATOM   8567  H  HB3  . CYS B 2 84  ? 4.246   4.679   0.231   1.00 0.00 ? 184 CYS B HB3  4  
ATOM   8568  N  N    . THR B 2 85  ? 4.837   5.739   3.859   1.00 0.00 ? 185 THR B N    4  
ATOM   8569  C  CA   . THR B 2 85  ? 4.134   5.285   5.052   1.00 0.00 ? 185 THR B CA   4  
ATOM   8570  C  C    . THR B 2 85  ? 2.682   5.753   5.038   1.00 0.00 ? 185 THR B C    4  
ATOM   8571  O  O    . THR B 2 85  ? 2.315   6.638   4.264   1.00 0.00 ? 185 THR B O    4  
ATOM   8572  C  CB   . THR B 2 85  ? 4.833   5.801   6.310   1.00 0.00 ? 185 THR B CB   4  
ATOM   8573  O  OG1  . THR B 2 85  ? 4.059   5.526   7.464   1.00 0.00 ? 185 THR B OG1  4  
ATOM   8574  C  CG2  . THR B 2 85  ? 5.096   7.292   6.277   1.00 0.00 ? 185 THR B CG2  4  
ATOM   8575  H  H    . THR B 2 85  ? 5.308   6.600   3.880   1.00 0.00 ? 185 THR B H    4  
ATOM   8576  H  HA   . THR B 2 85  ? 4.151   4.206   5.058   1.00 0.00 ? 185 THR B HA   4  
ATOM   8577  H  HB   . THR B 2 85  ? 5.786   5.300   6.411   1.00 0.00 ? 185 THR B HB   4  
ATOM   8578  H  HG1  . THR B 2 85  ? 4.590   5.033   8.095   1.00 0.00 ? 185 THR B HG1  4  
ATOM   8579  H  HG21 . THR B 2 85  ? 6.135   7.469   6.042   1.00 0.00 ? 185 THR B HG21 4  
ATOM   8580  H  HG22 . THR B 2 85  ? 4.868   7.718   7.243   1.00 0.00 ? 185 THR B HG22 4  
ATOM   8581  H  HG23 . THR B 2 85  ? 4.471   7.751   5.526   1.00 0.00 ? 185 THR B HG23 4  
ATOM   8582  N  N    . ARG B 2 86  ? 1.860   5.149   5.895   1.00 0.00 ? 186 ARG B N    4  
ATOM   8583  C  CA   . ARG B 2 86  ? 0.447   5.489   5.988   1.00 0.00 ? 186 ARG B CA   4  
ATOM   8584  C  C    . ARG B 2 86  ? 0.223   6.998   5.902   1.00 0.00 ? 186 ARG B C    4  
ATOM   8585  O  O    . ARG B 2 86  ? -0.796  7.456   5.386   1.00 0.00 ? 186 ARG B O    4  
ATOM   8586  C  CB   . ARG B 2 86  ? -0.144  4.949   7.294   1.00 0.00 ? 186 ARG B CB   4  
ATOM   8587  C  CG   . ARG B 2 86  ? 0.695   5.269   8.521   1.00 0.00 ? 186 ARG B CG   4  
ATOM   8588  C  CD   . ARG B 2 86  ? 0.438   4.277   9.643   1.00 0.00 ? 186 ARG B CD   4  
ATOM   8589  N  NE   . ARG B 2 86  ? -0.595  4.746   10.565  1.00 0.00 ? 186 ARG B NE   4  
ATOM   8590  C  CZ   . ARG B 2 86  ? -1.254  3.953   11.407  1.00 0.00 ? 186 ARG B CZ   4  
ATOM   8591  N  NH1  . ARG B 2 86  ? -0.990  2.653   11.450  1.00 0.00 ? 186 ARG B NH1  4  
ATOM   8592  N  NH2  . ARG B 2 86  ? -2.178  4.461   12.210  1.00 0.00 ? 186 ARG B NH2  4  
ATOM   8593  H  H    . ARG B 2 86  ? 2.210   4.450   6.475   1.00 0.00 ? 186 ARG B H    4  
ATOM   8594  H  HA   . ARG B 2 86  ? -0.048  5.014   5.163   1.00 0.00 ? 186 ARG B HA   4  
ATOM   8595  H  HB2  . ARG B 2 86  ? -1.125  5.377   7.435   1.00 0.00 ? 186 ARG B HB2  4  
ATOM   8596  H  HB3  . ARG B 2 86  ? -0.236  3.876   7.217   1.00 0.00 ? 186 ARG B HB3  4  
ATOM   8597  H  HG2  . ARG B 2 86  ? 1.740   5.230   8.252   1.00 0.00 ? 186 ARG B HG2  4  
ATOM   8598  H  HG3  . ARG B 2 86  ? 0.447   6.262   8.867   1.00 0.00 ? 186 ARG B HG3  4  
ATOM   8599  H  HD2  . ARG B 2 86  ? 0.121   3.339   9.213   1.00 0.00 ? 186 ARG B HD2  4  
ATOM   8600  H  HD3  . ARG B 2 86  ? 1.356   4.127   10.192  1.00 0.00 ? 186 ARG B HD3  4  
ATOM   8601  H  HE   . ARG B 2 86  ? -0.809  5.702   10.556  1.00 0.00 ? 186 ARG B HE   4  
ATOM   8602  H  HH11 . ARG B 2 86  ? -0.293  2.262   10.849  1.00 0.00 ? 186 ARG B HH11 4  
ATOM   8603  H  HH12 . ARG B 2 86  ? -1.489  2.063   12.085  1.00 0.00 ? 186 ARG B HH12 4  
ATOM   8604  H  HH21 . ARG B 2 86  ? -2.381  5.440   12.182  1.00 0.00 ? 186 ARG B HH21 4  
ATOM   8605  H  HH22 . ARG B 2 86  ? -2.674  3.865   12.842  1.00 0.00 ? 186 ARG B HH22 4  
ATOM   8606  N  N    . HIS B 2 87  ? 1.183   7.763   6.412   1.00 0.00 ? 187 HIS B N    4  
ATOM   8607  C  CA   . HIS B 2 87  ? 1.091   9.218   6.392   1.00 0.00 ? 187 HIS B CA   4  
ATOM   8608  C  C    . HIS B 2 87  ? 1.391   9.763   4.998   1.00 0.00 ? 187 HIS B C    4  
ATOM   8609  O  O    . HIS B 2 87  ? 2.477   9.550   4.459   1.00 0.00 ? 187 HIS B O    4  
ATOM   8610  C  CB   . HIS B 2 87  ? 2.061   9.825   7.408   1.00 0.00 ? 187 HIS B CB   4  
ATOM   8611  C  CG   . HIS B 2 87  ? 1.524   9.854   8.805   1.00 0.00 ? 187 HIS B CG   4  
ATOM   8612  N  ND1  . HIS B 2 87  ? 1.751   8.848   9.721   1.00 0.00 ? 187 HIS B ND1  4  
ATOM   8613  C  CD2  . HIS B 2 87  ? 0.766   10.777  9.445   1.00 0.00 ? 187 HIS B CD2  4  
ATOM   8614  C  CE1  . HIS B 2 87  ? 1.156   9.150   10.862  1.00 0.00 ? 187 HIS B CE1  4  
ATOM   8615  N  NE2  . HIS B 2 87  ? 0.552   10.315  10.720  1.00 0.00 ? 187 HIS B NE2  4  
ATOM   8616  H  H    . HIS B 2 87  ? 1.971   7.339   6.811   1.00 0.00 ? 187 HIS B H    4  
ATOM   8617  H  HA   . HIS B 2 87  ? 0.082   9.491   6.663   1.00 0.00 ? 187 HIS B HA   4  
ATOM   8618  H  HB2  . HIS B 2 87  ? 2.972   9.245   7.416   1.00 0.00 ? 187 HIS B HB2  4  
ATOM   8619  H  HB3  . HIS B 2 87  ? 2.288   10.839  7.117   1.00 0.00 ? 187 HIS B HB3  4  
ATOM   8620  H  HD1  . HIS B 2 87  ? 2.270   8.033   9.559   1.00 0.00 ? 187 HIS B HD1  4  
ATOM   8621  H  HD2  . HIS B 2 87  ? 0.399   11.705  9.029   1.00 0.00 ? 187 HIS B HD2  4  
ATOM   8622  H  HE1  . HIS B 2 87  ? 1.164   8.547   11.757  1.00 0.00 ? 187 HIS B HE1  4  
ATOM   8623  H  HE2  . HIS B 2 87  ? 0.115   10.816  11.441  1.00 0.00 ? 187 HIS B HE2  4  
ATOM   8624  N  N    . ASP B 2 88  ? 0.423   10.469  4.423   1.00 0.00 ? 188 ASP B N    4  
ATOM   8625  C  CA   . ASP B 2 88  ? 0.584   11.047  3.093   1.00 0.00 ? 188 ASP B CA   4  
ATOM   8626  C  C    . ASP B 2 88  ? 0.867   9.964   2.054   1.00 0.00 ? 188 ASP B C    4  
ATOM   8627  O  O    . ASP B 2 88  ? 1.944   9.928   1.456   1.00 0.00 ? 188 ASP B O    4  
ATOM   8628  C  CB   . ASP B 2 88  ? 1.713   12.078  3.098   1.00 0.00 ? 188 ASP B CB   4  
ATOM   8629  C  CG   . ASP B 2 88  ? 1.654   13.006  1.899   1.00 0.00 ? 188 ASP B CG   4  
ATOM   8630  O  OD1  . ASP B 2 88  ? 1.158   12.574  0.838   1.00 0.00 ? 188 ASP B OD1  4  
ATOM   8631  O  OD2  . ASP B 2 88  ? 2.107   14.164  2.022   1.00 0.00 ? 188 ASP B OD2  4  
ATOM   8632  H  H    . ASP B 2 88  ? -0.419  10.606  4.904   1.00 0.00 ? 188 ASP B H    4  
ATOM   8633  H  HA   . ASP B 2 88  ? -0.341  11.541  2.834   1.00 0.00 ? 188 ASP B HA   4  
ATOM   8634  H  HB2  . ASP B 2 88  ? 1.643   12.677  3.994   1.00 0.00 ? 188 ASP B HB2  4  
ATOM   8635  H  HB3  . ASP B 2 88  ? 2.663   11.564  3.086   1.00 0.00 ? 188 ASP B HB3  4  
ATOM   8636  N  N    . CYS B 2 89  ? -0.106  9.084   1.844   1.00 0.00 ? 189 CYS B N    4  
ATOM   8637  C  CA   . CYS B 2 89  ? 0.036   8.001   0.875   1.00 0.00 ? 189 CYS B CA   4  
ATOM   8638  C  C    . CYS B 2 89  ? -1.292  7.722   0.175   1.00 0.00 ? 189 CYS B C    4  
ATOM   8639  O  O    . CYS B 2 89  ? -1.988  6.763   0.508   1.00 0.00 ? 189 CYS B O    4  
ATOM   8640  C  CB   . CYS B 2 89  ? 0.538   6.731   1.564   1.00 0.00 ? 189 CYS B CB   4  
ATOM   8641  S  SG   . CYS B 2 89  ? 1.583   5.678   0.507   1.00 0.00 ? 189 CYS B SG   4  
ATOM   8642  H  H    . CYS B 2 89  ? -0.941  9.166   2.350   1.00 0.00 ? 189 CYS B H    4  
ATOM   8643  H  HA   . CYS B 2 89  ? 0.761   8.310   0.137   1.00 0.00 ? 189 CYS B HA   4  
ATOM   8644  H  HB2  . CYS B 2 89  ? 1.119   7.006   2.431   1.00 0.00 ? 189 CYS B HB2  4  
ATOM   8645  H  HB3  . CYS B 2 89  ? -0.311  6.142   1.879   1.00 0.00 ? 189 CYS B HB3  4  
ATOM   8646  N  N    . PRO B 2 90  ? -1.661  8.561   -0.807  1.00 0.00 ? 190 PRO B N    4  
ATOM   8647  C  CA   . PRO B 2 90  ? -2.913  8.404   -1.554  1.00 0.00 ? 190 PRO B CA   4  
ATOM   8648  C  C    . PRO B 2 90  ? -2.870  7.240   -2.539  1.00 0.00 ? 190 PRO B C    4  
ATOM   8649  O  O    . PRO B 2 90  ? -3.904  6.815   -3.056  1.00 0.00 ? 190 PRO B O    4  
ATOM   8650  C  CB   . PRO B 2 90  ? -3.039  9.728   -2.304  1.00 0.00 ? 190 PRO B CB   4  
ATOM   8651  C  CG   . PRO B 2 90  ? -1.636  10.191  -2.485  1.00 0.00 ? 190 PRO B CG   4  
ATOM   8652  C  CD   . PRO B 2 90  ? -0.887  9.732   -1.265  1.00 0.00 ? 190 PRO B CD   4  
ATOM   8653  H  HA   . PRO B 2 90  ? -3.757  8.281   -0.890  1.00 0.00 ? 190 PRO B HA   4  
ATOM   8654  H  HB2  . PRO B 2 90  ? -3.529  9.563   -3.252  1.00 0.00 ? 190 PRO B HB2  4  
ATOM   8655  H  HB3  . PRO B 2 90  ? -3.609  10.425  -1.712  1.00 0.00 ? 190 PRO B HB3  4  
ATOM   8656  H  HG2  . PRO B 2 90  ? -1.215  9.746   -3.375  1.00 0.00 ? 190 PRO B HG2  4  
ATOM   8657  H  HG3  . PRO B 2 90  ? -1.611  11.268  -2.556  1.00 0.00 ? 190 PRO B HG3  4  
ATOM   8658  H  HD2  . PRO B 2 90  ? 0.122   9.448   -1.526  1.00 0.00 ? 190 PRO B HD2  4  
ATOM   8659  H  HD3  . PRO B 2 90  ? -0.879  10.506  -0.512  1.00 0.00 ? 190 PRO B HD3  4  
ATOM   8660  N  N    . VAL B 2 91  ? -1.672  6.735   -2.803  1.00 0.00 ? 191 VAL B N    4  
ATOM   8661  C  CA   . VAL B 2 91  ? -1.498  5.628   -3.734  1.00 0.00 ? 191 VAL B CA   4  
ATOM   8662  C  C    . VAL B 2 91  ? -1.608  4.277   -3.032  1.00 0.00 ? 191 VAL B C    4  
ATOM   8663  O  O    . VAL B 2 91  ? -2.469  3.464   -3.363  1.00 0.00 ? 191 VAL B O    4  
ATOM   8664  C  CB   . VAL B 2 91  ? -0.138  5.712   -4.456  1.00 0.00 ? 191 VAL B CB   4  
ATOM   8665  C  CG1  . VAL B 2 91  ? -0.046  4.661   -5.554  1.00 0.00 ? 191 VAL B CG1  4  
ATOM   8666  C  CG2  . VAL B 2 91  ? 0.074   7.108   -5.023  1.00 0.00 ? 191 VAL B CG2  4  
ATOM   8667  H  H    . VAL B 2 91  ? -0.885  7.120   -2.369  1.00 0.00 ? 191 VAL B H    4  
ATOM   8668  H  HA   . VAL B 2 91  ? -2.276  5.696   -4.477  1.00 0.00 ? 191 VAL B HA   4  
ATOM   8669  H  HB   . VAL B 2 91  ? 0.643   5.518   -3.734  1.00 0.00 ? 191 VAL B HB   4  
ATOM   8670  H  HG11 . VAL B 2 91  ? 0.048   5.147   -6.513  1.00 0.00 ? 191 VAL B HG11 4  
ATOM   8671  H  HG12 . VAL B 2 91  ? -0.938  4.051   -5.546  1.00 0.00 ? 191 VAL B HG12 4  
ATOM   8672  H  HG13 . VAL B 2 91  ? 0.817   4.036   -5.382  1.00 0.00 ? 191 VAL B HG13 4  
ATOM   8673  H  HG21 . VAL B 2 91  ? -0.798  7.403   -5.589  1.00 0.00 ? 191 VAL B HG21 4  
ATOM   8674  H  HG22 . VAL B 2 91  ? 0.939   7.106   -5.670  1.00 0.00 ? 191 VAL B HG22 4  
ATOM   8675  H  HG23 . VAL B 2 91  ? 0.231   7.806   -4.214  1.00 0.00 ? 191 VAL B HG23 4  
ATOM   8676  N  N    . CYS B 2 92  ? -0.726  4.040   -2.066  1.00 0.00 ? 192 CYS B N    4  
ATOM   8677  C  CA   . CYS B 2 92  ? -0.720  2.781   -1.326  1.00 0.00 ? 192 CYS B CA   4  
ATOM   8678  C  C    . CYS B 2 92  ? -1.985  2.615   -0.488  1.00 0.00 ? 192 CYS B C    4  
ATOM   8679  O  O    . CYS B 2 92  ? -2.424  1.494   -0.228  1.00 0.00 ? 192 CYS B O    4  
ATOM   8680  C  CB   . CYS B 2 92  ? 0.514   2.698   -0.425  1.00 0.00 ? 192 CYS B CB   4  
ATOM   8681  S  SG   . CYS B 2 92  ? 2.058   3.253   -1.218  1.00 0.00 ? 192 CYS B SG   4  
ATOM   8682  H  H    . CYS B 2 92  ? -0.059  4.725   -1.850  1.00 0.00 ? 192 CYS B H    4  
ATOM   8683  H  HA   . CYS B 2 92  ? -0.677  1.978   -2.047  1.00 0.00 ? 192 CYS B HA   4  
ATOM   8684  H  HB2  . CYS B 2 92  ? 0.354   3.313   0.447   1.00 0.00 ? 192 CYS B HB2  4  
ATOM   8685  H  HB3  . CYS B 2 92  ? 0.654   1.673   -0.115  1.00 0.00 ? 192 CYS B HB3  4  
ATOM   8686  N  N    . LEU B 2 93  ? -2.566  3.731   -0.058  1.00 0.00 ? 193 LEU B N    4  
ATOM   8687  C  CA   . LEU B 2 93  ? -3.776  3.696   0.759   1.00 0.00 ? 193 LEU B CA   4  
ATOM   8688  C  C    . LEU B 2 93  ? -4.897  2.922   0.065   1.00 0.00 ? 193 LEU B C    4  
ATOM   8689  O  O    . LEU B 2 93  ? -5.364  1.904   0.575   1.00 0.00 ? 193 LEU B O    4  
ATOM   8690  C  CB   . LEU B 2 93  ? -4.243  5.118   1.079   1.00 0.00 ? 193 LEU B CB   4  
ATOM   8691  C  CG   . LEU B 2 93  ? -3.683  5.708   2.374   1.00 0.00 ? 193 LEU B CG   4  
ATOM   8692  C  CD1  . LEU B 2 93  ? -4.072  7.172   2.504   1.00 0.00 ? 193 LEU B CD1  4  
ATOM   8693  C  CD2  . LEU B 2 93  ? -4.171  4.914   3.576   1.00 0.00 ? 193 LEU B CD2  4  
ATOM   8694  H  H    . LEU B 2 93  ? -2.169  4.597   -0.290  1.00 0.00 ? 193 LEU B H    4  
ATOM   8695  H  HA   . LEU B 2 93  ? -3.532  3.195   1.684   1.00 0.00 ? 193 LEU B HA   4  
ATOM   8696  H  HB2  . LEU B 2 93  ? -3.956  5.761   0.259   1.00 0.00 ? 193 LEU B HB2  4  
ATOM   8697  H  HB3  . LEU B 2 93  ? -5.321  5.114   1.150   1.00 0.00 ? 193 LEU B HB3  4  
ATOM   8698  H  HG   . LEU B 2 93  ? -2.604  5.651   2.350   1.00 0.00 ? 193 LEU B HG   4  
ATOM   8699  H  HD11 . LEU B 2 93  ? -4.986  7.352   1.959   1.00 0.00 ? 193 LEU B HD11 4  
ATOM   8700  H  HD12 . LEU B 2 93  ? -3.284  7.791   2.101   1.00 0.00 ? 193 LEU B HD12 4  
ATOM   8701  H  HD13 . LEU B 2 93  ? -4.221  7.413   3.547   1.00 0.00 ? 193 LEU B HD13 4  
ATOM   8702  H  HD21 . LEU B 2 93  ? -4.506  3.940   3.253   1.00 0.00 ? 193 LEU B HD21 4  
ATOM   8703  H  HD22 . LEU B 2 93  ? -4.990  5.439   4.047   1.00 0.00 ? 193 LEU B HD22 4  
ATOM   8704  H  HD23 . LEU B 2 93  ? -3.364  4.800   4.284   1.00 0.00 ? 193 LEU B HD23 4  
ATOM   8705  N  N    . PRO B 2 94  ? -5.350  3.398   -1.107  1.00 0.00 ? 194 PRO B N    4  
ATOM   8706  C  CA   . PRO B 2 94  ? -6.427  2.746   -1.862  1.00 0.00 ? 194 PRO B CA   4  
ATOM   8707  C  C    . PRO B 2 94  ? -6.001  1.409   -2.457  1.00 0.00 ? 194 PRO B C    4  
ATOM   8708  O  O    . PRO B 2 94  ? -6.826  0.514   -2.647  1.00 0.00 ? 194 PRO B O    4  
ATOM   8709  C  CB   . PRO B 2 94  ? -6.741  3.748   -2.975  1.00 0.00 ? 194 PRO B CB   4  
ATOM   8710  C  CG   . PRO B 2 94  ? -5.482  4.524   -3.150  1.00 0.00 ? 194 PRO B CG   4  
ATOM   8711  C  CD   . PRO B 2 94  ? -4.856  4.610   -1.786  1.00 0.00 ? 194 PRO B CD   4  
ATOM   8712  H  HA   . PRO B 2 94  ? -7.304  2.600   -1.249  1.00 0.00 ? 194 PRO B HA   4  
ATOM   8713  H  HB2  . PRO B 2 94  ? -7.008  3.216   -3.876  1.00 0.00 ? 194 PRO B HB2  4  
ATOM   8714  H  HB3  . PRO B 2 94  ? -7.557  4.385   -2.669  1.00 0.00 ? 194 PRO B HB3  4  
ATOM   8715  H  HG2  . PRO B 2 94  ? -4.824  4.007   -3.834  1.00 0.00 ? 194 PRO B HG2  4  
ATOM   8716  H  HG3  . PRO B 2 94  ? -5.708  5.513   -3.521  1.00 0.00 ? 194 PRO B HG3  4  
ATOM   8717  H  HD2  . PRO B 2 94  ? -3.779  4.597   -1.864  1.00 0.00 ? 194 PRO B HD2  4  
ATOM   8718  H  HD3  . PRO B 2 94  ? -5.188  5.501   -1.275  1.00 0.00 ? 194 PRO B HD3  4  
ATOM   8719  N  N    . LEU B 2 95  ? -4.714  1.276   -2.757  1.00 0.00 ? 195 LEU B N    4  
ATOM   8720  C  CA   . LEU B 2 95  ? -4.189  0.052   -3.334  1.00 0.00 ? 195 LEU B CA   4  
ATOM   8721  C  C    . LEU B 2 95  ? -4.045  -1.036  -2.274  1.00 0.00 ? 195 LEU B C    4  
ATOM   8722  O  O    . LEU B 2 95  ? -4.306  -2.211  -2.537  1.00 0.00 ? 195 LEU B O    4  
ATOM   8723  C  CB   . LEU B 2 95  ? -2.837  0.330   -3.985  1.00 0.00 ? 195 LEU B CB   4  
ATOM   8724  C  CG   . LEU B 2 95  ? -2.836  0.315   -5.514  1.00 0.00 ? 195 LEU B CG   4  
ATOM   8725  C  CD1  . LEU B 2 95  ? -1.455  0.652   -6.049  1.00 0.00 ? 195 LEU B CD1  4  
ATOM   8726  C  CD2  . LEU B 2 95  ? -3.298  -1.038  -6.035  1.00 0.00 ? 195 LEU B CD2  4  
ATOM   8727  H  H    . LEU B 2 95  ? -4.101  2.019   -2.590  1.00 0.00 ? 195 LEU B H    4  
ATOM   8728  H  HA   . LEU B 2 95  ? -4.882  -0.283  -4.090  1.00 0.00 ? 195 LEU B HA   4  
ATOM   8729  H  HB2  . LEU B 2 95  ? -2.500  1.299   -3.654  1.00 0.00 ? 195 LEU B HB2  4  
ATOM   8730  H  HB3  . LEU B 2 95  ? -2.138  -0.409  -3.637  1.00 0.00 ? 195 LEU B HB3  4  
ATOM   8731  H  HG   . LEU B 2 95  ? -3.525  1.065   -5.874  1.00 0.00 ? 195 LEU B HG   4  
ATOM   8732  H  HD11 . LEU B 2 95  ? -1.493  0.718   -7.127  1.00 0.00 ? 195 LEU B HD11 4  
ATOM   8733  H  HD12 . LEU B 2 95  ? -0.757  -0.121  -5.760  1.00 0.00 ? 195 LEU B HD12 4  
ATOM   8734  H  HD13 . LEU B 2 95  ? -1.131  1.598   -5.641  1.00 0.00 ? 195 LEU B HD13 4  
ATOM   8735  H  HD21 . LEU B 2 95  ? -3.895  -1.529  -5.281  1.00 0.00 ? 195 LEU B HD21 4  
ATOM   8736  H  HD22 . LEU B 2 95  ? -2.437  -1.647  -6.266  1.00 0.00 ? 195 LEU B HD22 4  
ATOM   8737  H  HD23 . LEU B 2 95  ? -3.890  -0.896  -6.927  1.00 0.00 ? 195 LEU B HD23 4  
ATOM   8738  N  N    . LYS B 2 96  ? -3.628  -0.637  -1.078  1.00 0.00 ? 196 LYS B N    4  
ATOM   8739  C  CA   . LYS B 2 96  ? -3.450  -1.579  0.018   1.00 0.00 ? 196 LYS B CA   4  
ATOM   8740  C  C    . LYS B 2 96  ? -3.465  -0.859  1.365   1.00 0.00 ? 196 LYS B C    4  
ATOM   8741  O  O    . LYS B 2 96  ? -2.458  -0.821  2.072   1.00 0.00 ? 196 LYS B O    4  
ATOM   8742  C  CB   . LYS B 2 96  ? -2.138  -2.349  -0.153  1.00 0.00 ? 196 LYS B CB   4  
ATOM   8743  C  CG   . LYS B 2 96  ? -2.311  -3.702  -0.824  1.00 0.00 ? 196 LYS B CG   4  
ATOM   8744  C  CD   . LYS B 2 96  ? -1.373  -4.742  -0.232  1.00 0.00 ? 196 LYS B CD   4  
ATOM   8745  C  CE   . LYS B 2 96  ? -0.976  -5.785  -1.263  1.00 0.00 ? 196 LYS B CE   4  
ATOM   8746  N  NZ   . LYS B 2 96  ? -0.883  -7.147  -0.668  1.00 0.00 ? 196 LYS B NZ   4  
ATOM   8747  H  H    . LYS B 2 96  ? -3.437  0.313   -0.930  1.00 0.00 ? 196 LYS B H    4  
ATOM   8748  H  HA   . LYS B 2 96  ? -4.272  -2.276  -0.013  1.00 0.00 ? 196 LYS B HA   4  
ATOM   8749  H  HB2  . LYS B 2 96  ? -1.463  -1.758  -0.752  1.00 0.00 ? 196 LYS B HB2  4  
ATOM   8750  H  HB3  . LYS B 2 96  ? -1.697  -2.508  0.820   1.00 0.00 ? 196 LYS B HB3  4  
ATOM   8751  H  HG2  . LYS B 2 96  ? -3.330  -4.034  -0.689  1.00 0.00 ? 196 LYS B HG2  4  
ATOM   8752  H  HG3  . LYS B 2 96  ? -2.100  -3.599  -1.879  1.00 0.00 ? 196 LYS B HG3  4  
ATOM   8753  H  HD2  . LYS B 2 96  ? -0.483  -4.247  0.126   1.00 0.00 ? 196 LYS B HD2  4  
ATOM   8754  H  HD3  . LYS B 2 96  ? -1.870  -5.233  0.591   1.00 0.00 ? 196 LYS B HD3  4  
ATOM   8755  H  HE2  . LYS B 2 96  ? -1.714  -5.795  -2.050  1.00 0.00 ? 196 LYS B HE2  4  
ATOM   8756  H  HE3  . LYS B 2 96  ? -0.015  -5.516  -1.677  1.00 0.00 ? 196 LYS B HE3  4  
ATOM   8757  H  HZ1  . LYS B 2 96  ? -1.599  -7.261  0.077   1.00 0.00 ? 196 LYS B HZ1  4  
ATOM   8758  H  HZ2  . LYS B 2 96  ? 0.059   -7.293  -0.251  1.00 0.00 ? 196 LYS B HZ2  4  
ATOM   8759  H  HZ3  . LYS B 2 96  ? -1.040  -7.869  -1.400  1.00 0.00 ? 196 LYS B HZ3  4  
ATOM   8760  N  N    . ASN B 2 97  ? -4.616  -0.284  1.711   1.00 0.00 ? 197 ASN B N    4  
ATOM   8761  C  CA   . ASN B 2 97  ? -4.777  0.441   2.964   1.00 0.00 ? 197 ASN B CA   4  
ATOM   8762  C  C    . ASN B 2 97  ? -4.145  -0.310  4.135   1.00 0.00 ? 197 ASN B C    4  
ATOM   8763  O  O    . ASN B 2 97  ? -4.301  -1.525  4.261   1.00 0.00 ? 197 ASN B O    4  
ATOM   8764  C  CB   . ASN B 2 97  ? -6.261  0.687   3.245   1.00 0.00 ? 197 ASN B CB   4  
ATOM   8765  C  CG   . ASN B 2 97  ? -6.483  1.614   4.424   1.00 0.00 ? 197 ASN B CG   4  
ATOM   8766  O  OD1  . ASN B 2 97  ? -5.613  1.765   5.283   1.00 0.00 ? 197 ASN B OD1  4  
ATOM   8767  N  ND2  . ASN B 2 97  ? -7.653  2.241   4.473   1.00 0.00 ? 197 ASN B ND2  4  
ATOM   8768  H  H    . ASN B 2 97  ? -5.377  -0.343  1.103   1.00 0.00 ? 197 ASN B H    4  
ATOM   8769  H  HA   . ASN B 2 97  ? -4.285  1.390   2.851   1.00 0.00 ? 197 ASN B HA   4  
ATOM   8770  H  HB2  . ASN B 2 97  ? -6.718  1.130   2.373   1.00 0.00 ? 197 ASN B HB2  4  
ATOM   8771  H  HB3  . ASN B 2 97  ? -6.741  -0.258  3.457   1.00 0.00 ? 197 ASN B HB3  4  
ATOM   8772  H  HD21 . ASN B 2 97  ? -8.299  2.071   3.756   1.00 0.00 ? 197 ASN B HD21 4  
ATOM   8773  H  HD22 . ASN B 2 97  ? -7.823  2.845   5.225   1.00 0.00 ? 197 ASN B HD22 4  
ATOM   8774  N  N    . ALA B 2 98  ? -3.435  0.422   4.986   1.00 0.00 ? 198 ALA B N    4  
ATOM   8775  C  CA   . ALA B 2 98  ? -2.782  -0.173  6.146   1.00 0.00 ? 198 ALA B CA   4  
ATOM   8776  C  C    . ALA B 2 98  ? -3.799  -0.835  7.068   1.00 0.00 ? 198 ALA B C    4  
ATOM   8777  O  O    . ALA B 2 98  ? -4.991  -0.534  7.014   1.00 0.00 ? 198 ALA B O    4  
ATOM   8778  C  CB   . ALA B 2 98  ? -1.991  0.884   6.903   1.00 0.00 ? 198 ALA B CB   4  
ATOM   8779  H  H    . ALA B 2 98  ? -3.350  1.386   4.832   1.00 0.00 ? 198 ALA B H    4  
ATOM   8780  H  HA   . ALA B 2 98  ? -2.089  -0.922  5.792   1.00 0.00 ? 198 ALA B HA   4  
ATOM   8781  H  HB1  . ALA B 2 98  ? -2.673  1.546   7.416   1.00 0.00 ? 198 ALA B HB1  4  
ATOM   8782  H  HB2  . ALA B 2 98  ? -1.392  1.452   6.207   1.00 0.00 ? 198 ALA B HB2  4  
ATOM   8783  H  HB3  . ALA B 2 98  ? -1.346  0.404   7.624   1.00 0.00 ? 198 ALA B HB3  4  
ATOM   8784  N  N    . GLY B 2 99  ? -3.320  -1.740  7.916   1.00 0.00 ? 199 GLY B N    4  
ATOM   8785  C  CA   . GLY B 2 99  ? -4.202  -2.432  8.840   1.00 0.00 ? 199 GLY B CA   4  
ATOM   8786  C  C    . GLY B 2 99  ? -4.724  -1.523  9.935   1.00 0.00 ? 199 GLY B C    4  
ATOM   8787  O  O    . GLY B 2 99  ? -5.066  -0.368  9.682   1.00 0.00 ? 199 GLY B O    4  
ATOM   8788  H  H    . GLY B 2 99  ? -2.361  -1.940  7.915   1.00 0.00 ? 199 GLY B H    4  
ATOM   8789  H  HA2  . GLY B 2 99  ? -5.040  -2.830  8.288   1.00 0.00 ? 199 GLY B HA2  4  
ATOM   8790  H  HA3  . GLY B 2 99  ? -3.660  -3.248  9.293   1.00 0.00 ? 199 GLY B HA3  4  
ATOM   8791  N  N    . ASP B 2 100 ? -4.786  -2.046  11.156  1.00 0.00 ? 200 ASP B N    4  
ATOM   8792  C  CA   . ASP B 2 100 ? -5.272  -1.275  12.294  1.00 0.00 ? 200 ASP B CA   4  
ATOM   8793  C  C    . ASP B 2 100 ? -4.236  -1.251  13.415  1.00 0.00 ? 200 ASP B C    4  
ATOM   8794  O  O    . ASP B 2 100 ? -4.584  -1.185  14.594  1.00 0.00 ? 200 ASP B O    4  
ATOM   8795  C  CB   . ASP B 2 100 ? -6.585  -1.862  12.812  1.00 0.00 ? 200 ASP B CB   4  
ATOM   8796  C  CG   . ASP B 2 100 ? -7.798  -1.263  12.127  1.00 0.00 ? 200 ASP B CG   4  
ATOM   8797  O  OD1  . ASP B 2 100 ? -7.950  -0.025  12.165  1.00 0.00 ? 200 ASP B OD1  4  
ATOM   8798  O  OD2  . ASP B 2 100 ? -8.595  -2.034  11.551  1.00 0.00 ? 200 ASP B OD2  4  
ATOM   8799  H  H    . ASP B 2 100 ? -4.499  -2.973  11.293  1.00 0.00 ? 200 ASP B H    4  
ATOM   8800  H  HA   . ASP B 2 100 ? -5.446  -0.263  11.960  1.00 0.00 ? 200 ASP B HA   4  
ATOM   8801  H  HB2  . ASP B 2 100 ? -6.589  -2.928  12.640  1.00 0.00 ? 200 ASP B HB2  4  
ATOM   8802  H  HB3  . ASP B 2 100 ? -6.664  -1.673  13.873  1.00 0.00 ? 200 ASP B HB3  4  
ATOM   8803  N  N    . LYS B 2 101 ? -2.962  -1.304  13.038  1.00 0.00 ? 201 LYS B N    4  
ATOM   8804  C  CA   . LYS B 2 101 ? -1.877  -1.289  14.012  1.00 0.00 ? 201 LYS B CA   4  
ATOM   8805  C  C    . LYS B 2 101 ? -1.065  -0.003  13.904  1.00 0.00 ? 201 LYS B C    4  
ATOM   8806  O  O    . LYS B 2 101 ? -1.603  0.993   13.375  1.00 0.00 ? 201 LYS B O    4  
ATOM   8807  C  CB   . LYS B 2 101 ? -0.966  -2.501  13.809  1.00 0.00 ? 201 LYS B CB   4  
ATOM   8808  C  CG   . LYS B 2 101 ? -1.705  -3.830  13.828  1.00 0.00 ? 201 LYS B CG   4  
ATOM   8809  C  CD   . LYS B 2 101 ? -1.339  -4.657  15.052  1.00 0.00 ? 201 LYS B CD   4  
ATOM   8810  C  CE   . LYS B 2 101 ? -1.958  -4.086  16.318  1.00 0.00 ? 201 LYS B CE   4  
ATOM   8811  N  NZ   . LYS B 2 101 ? -0.924  -3.713  17.322  1.00 0.00 ? 201 LYS B NZ   4  
ATOM   8812  O  OXT  . LYS B 2 101 ? 0.101   -0.001  14.351  1.00 0.00 ? 201 LYS B OXT  4  
ATOM   8813  H  H    . LYS B 2 101 ? -2.747  -1.357  12.084  1.00 0.00 ? 201 LYS B H    4  
ATOM   8814  H  HA   . LYS B 2 101 ? -2.315  -1.343  14.997  1.00 0.00 ? 201 LYS B HA   4  
ATOM   8815  H  HB2  . LYS B 2 101 ? -0.467  -2.405  12.855  1.00 0.00 ? 201 LYS B HB2  4  
ATOM   8816  H  HB3  . LYS B 2 101 ? -0.223  -2.513  14.592  1.00 0.00 ? 201 LYS B HB3  4  
ATOM   8817  H  HG2  . LYS B 2 101 ? -2.767  -3.639  13.840  1.00 0.00 ? 201 LYS B HG2  4  
ATOM   8818  H  HG3  . LYS B 2 101 ? -1.447  -4.387  12.939  1.00 0.00 ? 201 LYS B HG3  4  
ATOM   8819  H  HD2  . LYS B 2 101 ? -1.697  -5.666  14.912  1.00 0.00 ? 201 LYS B HD2  4  
ATOM   8820  H  HD3  . LYS B 2 101 ? -0.264  -4.666  15.159  1.00 0.00 ? 201 LYS B HD3  4  
ATOM   8821  H  HE2  . LYS B 2 101 ? -2.531  -3.207  16.062  1.00 0.00 ? 201 LYS B HE2  4  
ATOM   8822  H  HE3  . LYS B 2 101 ? -2.614  -4.829  16.749  1.00 0.00 ? 201 LYS B HE3  4  
ATOM   8823  H  HZ1  . LYS B 2 101 ? -0.040  -3.446  16.843  1.00 0.00 ? 201 LYS B HZ1  4  
ATOM   8824  H  HZ2  . LYS B 2 101 ? -0.733  -4.516  17.955  1.00 0.00 ? 201 LYS B HZ2  4  
ATOM   8825  H  HZ3  . LYS B 2 101 ? -1.252  -2.908  17.893  1.00 0.00 ? 201 LYS B HZ3  4  
HETATM 8826  ZN ZN   . ZN  C 3 .   ? 0.755   -10.804 -16.637 1.00 0.00 ? 202 ZN  B ZN   4  
HETATM 8827  ZN ZN   . ZN  D 3 .   ? 16.363  2.323   -18.268 1.00 0.00 ? 203 ZN  B ZN   4  
HETATM 8828  ZN ZN   . ZN  E 3 .   ? 2.950   5.422   -1.388  1.00 0.00 ? 204 ZN  B ZN   4  
ATOM   8829  N  N    . GLY A 1 1   ? 0.711   0.830   -40.781 1.00 0.00 ? 1   GLY A N    5  
ATOM   8830  C  CA   . GLY A 1 1   ? -0.100  -0.382  -40.481 1.00 0.00 ? 1   GLY A CA   5  
ATOM   8831  C  C    . GLY A 1 1   ? 0.745   -1.640  -40.405 1.00 0.00 ? 1   GLY A C    5  
ATOM   8832  O  O    . GLY A 1 1   ? 1.482   -1.957  -41.338 1.00 0.00 ? 1   GLY A O    5  
ATOM   8833  H  H1   . GLY A 1 1   ? 0.106   1.573   -41.188 1.00 0.00 ? 1   GLY A H1   5  
ATOM   8834  H  H2   . GLY A 1 1   ? 1.461   0.599   -41.464 1.00 0.00 ? 1   GLY A H2   5  
ATOM   8835  H  H3   . GLY A 1 1   ? 1.151   1.192   -39.911 1.00 0.00 ? 1   GLY A H3   5  
ATOM   8836  H  HA2  . GLY A 1 1   ? -0.600  -0.241  -39.535 1.00 0.00 ? 1   GLY A HA2  5  
ATOM   8837  H  HA3  . GLY A 1 1   ? -0.842  -0.507  -41.255 1.00 0.00 ? 1   GLY A HA3  5  
ATOM   8838  N  N    . SER A 1 2   ? 0.635   -2.357  -39.291 1.00 0.00 ? 2   SER A N    5  
ATOM   8839  C  CA   . SER A 1 2   ? 1.395   -3.587  -39.097 1.00 0.00 ? 2   SER A CA   5  
ATOM   8840  C  C    . SER A 1 2   ? 0.819   -4.407  -37.947 1.00 0.00 ? 2   SER A C    5  
ATOM   8841  O  O    . SER A 1 2   ? 0.218   -5.459  -38.161 1.00 0.00 ? 2   SER A O    5  
ATOM   8842  C  CB   . SER A 1 2   ? 2.865   -3.266  -38.825 1.00 0.00 ? 2   SER A CB   5  
ATOM   8843  O  OG   . SER A 1 2   ? 2.996   -2.335  -37.765 1.00 0.00 ? 2   SER A OG   5  
ATOM   8844  H  H    . SER A 1 2   ? 0.030   -2.053  -38.583 1.00 0.00 ? 2   SER A H    5  
ATOM   8845  H  HA   . SER A 1 2   ? 1.324   -4.166  -40.006 1.00 0.00 ? 2   SER A HA   5  
ATOM   8846  H  HB2  . SER A 1 2   ? 3.386   -4.172  -38.557 1.00 0.00 ? 2   SER A HB2  5  
ATOM   8847  H  HB3  . SER A 1 2   ? 3.310   -2.845  -39.714 1.00 0.00 ? 2   SER A HB3  5  
ATOM   8848  H  HG   . SER A 1 2   ? 2.639   -1.487  -38.038 1.00 0.00 ? 2   SER A HG   5  
ATOM   8849  N  N    . MET A 1 3   ? 1.010   -3.919  -36.726 1.00 0.00 ? 3   MET A N    5  
ATOM   8850  C  CA   . MET A 1 3   ? 0.512   -4.606  -35.540 1.00 0.00 ? 3   MET A CA   5  
ATOM   8851  C  C    . MET A 1 3   ? -0.280  -3.653  -34.651 1.00 0.00 ? 3   MET A C    5  
ATOM   8852  O  O    . MET A 1 3   ? -0.110  -3.638  -33.431 1.00 0.00 ? 3   MET A O    5  
ATOM   8853  C  CB   . MET A 1 3   ? 1.674   -5.215  -34.752 1.00 0.00 ? 3   MET A CB   5  
ATOM   8854  C  CG   . MET A 1 3   ? 2.669   -5.969  -35.619 1.00 0.00 ? 3   MET A CG   5  
ATOM   8855  S  SD   . MET A 1 3   ? 1.960   -7.454  -36.357 1.00 0.00 ? 3   MET A SD   5  
ATOM   8856  C  CE   . MET A 1 3   ? 3.269   -7.931  -37.483 1.00 0.00 ? 3   MET A CE   5  
ATOM   8857  H  H    . MET A 1 3   ? 1.499   -3.076  -36.618 1.00 0.00 ? 3   MET A H    5  
ATOM   8858  H  HA   . MET A 1 3   ? -0.143  -5.401  -35.869 1.00 0.00 ? 3   MET A HA   5  
ATOM   8859  H  HB2  . MET A 1 3   ? 2.202   -4.423  -34.243 1.00 0.00 ? 3   MET A HB2  5  
ATOM   8860  H  HB3  . MET A 1 3   ? 1.277   -5.901  -34.018 1.00 0.00 ? 3   MET A HB3  5  
ATOM   8861  H  HG2  . MET A 1 3   ? 3.003   -5.316  -36.412 1.00 0.00 ? 3   MET A HG2  5  
ATOM   8862  H  HG3  . MET A 1 3   ? 3.514   -6.255  -35.010 1.00 0.00 ? 3   MET A HG3  5  
ATOM   8863  H  HE1  . MET A 1 3   ? 3.476   -8.985  -37.369 1.00 0.00 ? 3   MET A HE1  5  
ATOM   8864  H  HE2  . MET A 1 3   ? 4.160   -7.363  -37.259 1.00 0.00 ? 3   MET A HE2  5  
ATOM   8865  H  HE3  . MET A 1 3   ? 2.961   -7.731  -38.498 1.00 0.00 ? 3   MET A HE3  5  
ATOM   8866  N  N    . ASP A 1 4   ? -1.148  -2.859  -35.268 1.00 0.00 ? 4   ASP A N    5  
ATOM   8867  C  CA   . ASP A 1 4   ? -1.967  -1.902  -34.533 1.00 0.00 ? 4   ASP A CA   5  
ATOM   8868  C  C    . ASP A 1 4   ? -1.093  -0.890  -33.799 1.00 0.00 ? 4   ASP A C    5  
ATOM   8869  O  O    . ASP A 1 4   ? 0.133   -0.930  -33.893 1.00 0.00 ? 4   ASP A O    5  
ATOM   8870  C  CB   . ASP A 1 4   ? -2.869  -2.631  -33.536 1.00 0.00 ? 4   ASP A CB   5  
ATOM   8871  C  CG   . ASP A 1 4   ? -3.670  -3.742  -34.185 1.00 0.00 ? 4   ASP A CG   5  
ATOM   8872  O  OD1  . ASP A 1 4   ? -3.915  -3.661  -35.408 1.00 0.00 ? 4   ASP A OD1  5  
ATOM   8873  O  OD2  . ASP A 1 4   ? -4.052  -4.694  -33.473 1.00 0.00 ? 4   ASP A OD2  5  
ATOM   8874  H  H    . ASP A 1 4   ? -1.240  -2.916  -36.243 1.00 0.00 ? 4   ASP A H    5  
ATOM   8875  H  HA   . ASP A 1 4   ? -2.584  -1.377  -35.245 1.00 0.00 ? 4   ASP A HA   5  
ATOM   8876  H  HB2  . ASP A 1 4   ? -2.259  -3.062  -32.756 1.00 0.00 ? 4   ASP A HB2  5  
ATOM   8877  H  HB3  . ASP A 1 4   ? -3.558  -1.924  -33.098 1.00 0.00 ? 4   ASP A HB3  5  
ATOM   8878  N  N    . GLU A 1 5   ? -1.733  0.018   -33.068 1.00 0.00 ? 5   GLU A N    5  
ATOM   8879  C  CA   . GLU A 1 5   ? -1.014  1.041   -32.317 1.00 0.00 ? 5   GLU A CA   5  
ATOM   8880  C  C    . GLU A 1 5   ? -0.464  0.474   -31.013 1.00 0.00 ? 5   GLU A C    5  
ATOM   8881  O  O    . GLU A 1 5   ? -1.042  -0.445  -30.431 1.00 0.00 ? 5   GLU A O    5  
ATOM   8882  C  CB   . GLU A 1 5   ? -1.933  2.228   -32.023 1.00 0.00 ? 5   GLU A CB   5  
ATOM   8883  C  CG   . GLU A 1 5   ? -1.222  3.397   -31.362 1.00 0.00 ? 5   GLU A CG   5  
ATOM   8884  C  CD   . GLU A 1 5   ? -2.074  4.650   -31.321 1.00 0.00 ? 5   GLU A CD   5  
ATOM   8885  O  OE1  . GLU A 1 5   ? -3.265  4.547   -30.961 1.00 0.00 ? 5   GLU A OE1  5  
ATOM   8886  O  OE2  . GLU A 1 5   ? -1.550  5.735   -31.652 1.00 0.00 ? 5   GLU A OE2  5  
ATOM   8887  H  H    . GLU A 1 5   ? -2.712  -0.002  -33.032 1.00 0.00 ? 5   GLU A H    5  
ATOM   8888  H  HA   . GLU A 1 5   ? -0.188  1.378   -32.926 1.00 0.00 ? 5   GLU A HA   5  
ATOM   8889  H  HB2  . GLU A 1 5   ? -2.363  2.574   -32.952 1.00 0.00 ? 5   GLU A HB2  5  
ATOM   8890  H  HB3  . GLU A 1 5   ? -2.727  1.900   -31.369 1.00 0.00 ? 5   GLU A HB3  5  
ATOM   8891  H  HG2  . GLU A 1 5   ? -0.969  3.121   -30.349 1.00 0.00 ? 5   GLU A HG2  5  
ATOM   8892  H  HG3  . GLU A 1 5   ? -0.318  3.611   -31.912 1.00 0.00 ? 5   GLU A HG3  5  
ATOM   8893  N  N    . SER A 1 6   ? 0.656   1.027   -30.559 1.00 0.00 ? 6   SER A N    5  
ATOM   8894  C  CA   . SER A 1 6   ? 1.284   0.576   -29.322 1.00 0.00 ? 6   SER A CA   5  
ATOM   8895  C  C    . SER A 1 6   ? 2.004   1.727   -28.629 1.00 0.00 ? 6   SER A C    5  
ATOM   8896  O  O    . SER A 1 6   ? 2.394   2.705   -29.268 1.00 0.00 ? 6   SER A O    5  
ATOM   8897  C  CB   . SER A 1 6   ? 2.269   -0.559  -29.610 1.00 0.00 ? 6   SER A CB   5  
ATOM   8898  O  OG   . SER A 1 6   ? 3.125   -0.230  -30.690 1.00 0.00 ? 6   SER A OG   5  
ATOM   8899  H  H    . SER A 1 6   ? 1.068   1.756   -31.067 1.00 0.00 ? 6   SER A H    5  
ATOM   8900  H  HA   . SER A 1 6   ? 0.506   0.209   -28.670 1.00 0.00 ? 6   SER A HA   5  
ATOM   8901  H  HB2  . SER A 1 6   ? 2.872   -0.741  -28.733 1.00 0.00 ? 6   SER A HB2  5  
ATOM   8902  H  HB3  . SER A 1 6   ? 1.719   -1.454  -29.862 1.00 0.00 ? 6   SER A HB3  5  
ATOM   8903  H  HG   . SER A 1 6   ? 3.959   0.100   -30.349 1.00 0.00 ? 6   SER A HG   5  
ATOM   8904  N  N    . GLY A 1 7   ? 2.178   1.604   -27.317 1.00 0.00 ? 7   GLY A N    5  
ATOM   8905  C  CA   . GLY A 1 7   ? 2.852   2.642   -26.559 1.00 0.00 ? 7   GLY A CA   5  
ATOM   8906  C  C    . GLY A 1 7   ? 2.359   2.725   -25.128 1.00 0.00 ? 7   GLY A C    5  
ATOM   8907  O  O    . GLY A 1 7   ? 1.341   3.359   -24.851 1.00 0.00 ? 7   GLY A O    5  
ATOM   8908  H  H    . GLY A 1 7   ? 1.847   0.804   -26.859 1.00 0.00 ? 7   GLY A H    5  
ATOM   8909  H  HA2  . GLY A 1 7   ? 3.912   2.437   -26.552 1.00 0.00 ? 7   GLY A HA2  5  
ATOM   8910  H  HA3  . GLY A 1 7   ? 2.682   3.593   -27.041 1.00 0.00 ? 7   GLY A HA3  5  
ATOM   8911  N  N    . LEU A 1 8   ? 3.082   2.082   -24.217 1.00 0.00 ? 8   LEU A N    5  
ATOM   8912  C  CA   . LEU A 1 8   ? 2.715   2.083   -22.810 1.00 0.00 ? 8   LEU A CA   5  
ATOM   8913  C  C    . LEU A 1 8   ? 2.802   3.483   -22.222 1.00 0.00 ? 8   LEU A C    5  
ATOM   8914  O  O    . LEU A 1 8   ? 3.809   4.170   -22.385 1.00 0.00 ? 8   LEU A O    5  
ATOM   8915  C  CB   . LEU A 1 8   ? 3.636   1.150   -22.022 1.00 0.00 ? 8   LEU A CB   5  
ATOM   8916  C  CG   . LEU A 1 8   ? 3.120   0.762   -20.637 1.00 0.00 ? 8   LEU A CG   5  
ATOM   8917  C  CD1  . LEU A 1 8   ? 2.948   -0.743  -20.528 1.00 0.00 ? 8   LEU A CD1  5  
ATOM   8918  C  CD2  . LEU A 1 8   ? 4.050   1.274   -19.549 1.00 0.00 ? 8   LEU A CD2  5  
ATOM   8919  H  H    . LEU A 1 8   ? 3.880   1.592   -24.497 1.00 0.00 ? 8   LEU A H    5  
ATOM   8920  H  HA   . LEU A 1 8   ? 1.698   1.729   -22.728 1.00 0.00 ? 8   LEU A HA   5  
ATOM   8921  H  HB2  . LEU A 1 8   ? 3.784   0.252   -22.599 1.00 0.00 ? 8   LEU A HB2  5  
ATOM   8922  H  HB3  . LEU A 1 8   ? 4.591   1.640   -21.902 1.00 0.00 ? 8   LEU A HB3  5  
ATOM   8923  H  HG   . LEU A 1 8   ? 2.156   1.217   -20.491 1.00 0.00 ? 8   LEU A HG   5  
ATOM   8924  H  HD11 . LEU A 1 8   ? 2.480   -0.983  -19.586 1.00 0.00 ? 8   LEU A HD11 5  
ATOM   8925  H  HD12 . LEU A 1 8   ? 3.917   -1.218  -20.582 1.00 0.00 ? 8   LEU A HD12 5  
ATOM   8926  H  HD13 . LEU A 1 8   ? 2.329   -1.093  -21.340 1.00 0.00 ? 8   LEU A HD13 5  
ATOM   8927  H  HD21 . LEU A 1 8   ? 3.934   2.343   -19.448 1.00 0.00 ? 8   LEU A HD21 5  
ATOM   8928  H  HD22 . LEU A 1 8   ? 5.073   1.046   -19.813 1.00 0.00 ? 8   LEU A HD22 5  
ATOM   8929  H  HD23 . LEU A 1 8   ? 3.805   0.796   -18.612 1.00 0.00 ? 8   LEU A HD23 5  
ATOM   8930  N  N    . PRO A 1 9   ? 1.752   3.922   -21.512 1.00 0.00 ? 9   PRO A N    5  
ATOM   8931  C  CA   . PRO A 1 9   ? 1.738   5.243   -20.889 1.00 0.00 ? 9   PRO A CA   5  
ATOM   8932  C  C    . PRO A 1 9   ? 2.917   5.412   -19.941 1.00 0.00 ? 9   PRO A C    5  
ATOM   8933  O  O    . PRO A 1 9   ? 2.932   4.850   -18.846 1.00 0.00 ? 9   PRO A O    5  
ATOM   8934  C  CB   . PRO A 1 9   ? 0.412   5.277   -20.116 1.00 0.00 ? 9   PRO A CB   5  
ATOM   8935  C  CG   . PRO A 1 9   ? -0.051  3.859   -20.045 1.00 0.00 ? 9   PRO A CG   5  
ATOM   8936  C  CD   . PRO A 1 9   ? 0.516   3.171   -21.251 1.00 0.00 ? 9   PRO A CD   5  
ATOM   8937  H  HA   . PRO A 1 9   ? 1.753   6.031   -21.628 1.00 0.00 ? 9   PRO A HA   5  
ATOM   8938  H  HB2  . PRO A 1 9   ? 0.581   5.682   -19.130 1.00 0.00 ? 9   PRO A HB2  5  
ATOM   8939  H  HB3  . PRO A 1 9   ? -0.296  5.893   -20.646 1.00 0.00 ? 9   PRO A HB3  5  
ATOM   8940  H  HG2  . PRO A 1 9   ? 0.320   3.398   -19.142 1.00 0.00 ? 9   PRO A HG2  5  
ATOM   8941  H  HG3  . PRO A 1 9   ? -1.131  3.826   -20.068 1.00 0.00 ? 9   PRO A HG3  5  
ATOM   8942  H  HD2  . PRO A 1 9   ? 0.731   2.138   -21.028 1.00 0.00 ? 9   PRO A HD2  5  
ATOM   8943  H  HD3  . PRO A 1 9   ? -0.161  3.243   -22.089 1.00 0.00 ? 9   PRO A HD3  5  
ATOM   8944  N  N    . GLN A 1 10  ? 3.912   6.174   -20.377 1.00 0.00 ? 10  GLN A N    5  
ATOM   8945  C  CA   . GLN A 1 10  ? 5.104   6.401   -19.572 1.00 0.00 ? 10  GLN A CA   5  
ATOM   8946  C  C    . GLN A 1 10  ? 4.950   7.639   -18.694 1.00 0.00 ? 10  GLN A C    5  
ATOM   8947  O  O    . GLN A 1 10  ? 4.712   8.740   -19.191 1.00 0.00 ? 10  GLN A O    5  
ATOM   8948  C  CB   . GLN A 1 10  ? 6.330   6.545   -20.477 1.00 0.00 ? 10  GLN A CB   5  
ATOM   8949  C  CG   . GLN A 1 10  ? 6.350   7.833   -21.283 1.00 0.00 ? 10  GLN A CG   5  
ATOM   8950  C  CD   . GLN A 1 10  ? 6.973   7.653   -22.654 1.00 0.00 ? 10  GLN A CD   5  
ATOM   8951  O  OE1  . GLN A 1 10  ? 8.045   7.063   -22.789 1.00 0.00 ? 10  GLN A OE1  5  
ATOM   8952  N  NE2  . GLN A 1 10  ? 6.302   8.162   -23.681 1.00 0.00 ? 10  GLN A NE2  5  
ATOM   8953  H  H    . GLN A 1 10  ? 3.847   6.585   -21.264 1.00 0.00 ? 10  GLN A H    5  
ATOM   8954  H  HA   . GLN A 1 10  ? 5.238   5.536   -18.939 1.00 0.00 ? 10  GLN A HA   5  
ATOM   8955  H  HB2  . GLN A 1 10  ? 7.218   6.515   -19.864 1.00 0.00 ? 10  GLN A HB2  5  
ATOM   8956  H  HB3  . GLN A 1 10  ? 6.353   5.714   -21.166 1.00 0.00 ? 10  GLN A HB3  5  
ATOM   8957  H  HG2  . GLN A 1 10  ? 5.335   8.180   -21.409 1.00 0.00 ? 10  GLN A HG2  5  
ATOM   8958  H  HG3  . GLN A 1 10  ? 6.918   8.575   -20.740 1.00 0.00 ? 10  GLN A HG3  5  
ATOM   8959  H  HE21 . GLN A 1 10  ? 5.454   8.620   -23.499 1.00 0.00 ? 10  GLN A HE21 5  
ATOM   8960  H  HE22 . GLN A 1 10  ? 6.681   8.059   -24.578 1.00 0.00 ? 10  GLN A HE22 5  
ATOM   8961  N  N    . LEU A 1 11  ? 5.090   7.451   -17.385 1.00 0.00 ? 11  LEU A N    5  
ATOM   8962  C  CA   . LEU A 1 11  ? 4.968   8.553   -16.438 1.00 0.00 ? 11  LEU A CA   5  
ATOM   8963  C  C    . LEU A 1 11  ? 6.223   9.419   -16.452 1.00 0.00 ? 11  LEU A C    5  
ATOM   8964  O  O    . LEU A 1 11  ? 7.318   8.938   -16.741 1.00 0.00 ? 11  LEU A O    5  
ATOM   8965  C  CB   . LEU A 1 11  ? 4.720   8.015   -15.027 1.00 0.00 ? 11  LEU A CB   5  
ATOM   8966  C  CG   . LEU A 1 11  ? 3.710   6.869   -14.940 1.00 0.00 ? 11  LEU A CG   5  
ATOM   8967  C  CD1  . LEU A 1 11  ? 3.500   6.451   -13.492 1.00 0.00 ? 11  LEU A CD1  5  
ATOM   8968  C  CD2  . LEU A 1 11  ? 2.390   7.276   -15.578 1.00 0.00 ? 11  LEU A CD2  5  
ATOM   8969  H  H    . LEU A 1 11  ? 5.279   6.553   -17.049 1.00 0.00 ? 11  LEU A H    5  
ATOM   8970  H  HA   . LEU A 1 11  ? 4.125   9.155   -16.738 1.00 0.00 ? 11  LEU A HA   5  
ATOM   8971  H  HB2  . LEU A 1 11  ? 5.662   7.668   -14.626 1.00 0.00 ? 11  LEU A HB2  5  
ATOM   8972  H  HB3  . LEU A 1 11  ? 4.363   8.827   -14.414 1.00 0.00 ? 11  LEU A HB3  5  
ATOM   8973  H  HG   . LEU A 1 11  ? 4.094   6.017   -15.481 1.00 0.00 ? 11  LEU A HG   5  
ATOM   8974  H  HD11 . LEU A 1 11  ? 3.457   5.374   -13.432 1.00 0.00 ? 11  LEU A HD11 5  
ATOM   8975  H  HD12 . LEU A 1 11  ? 2.574   6.869   -13.127 1.00 0.00 ? 11  LEU A HD12 5  
ATOM   8976  H  HD13 . LEU A 1 11  ? 4.320   6.813   -12.890 1.00 0.00 ? 11  LEU A HD13 5  
ATOM   8977  H  HD21 . LEU A 1 11  ? 1.576   6.786   -15.064 1.00 0.00 ? 11  LEU A HD21 5  
ATOM   8978  H  HD22 . LEU A 1 11  ? 2.387   6.984   -16.617 1.00 0.00 ? 11  LEU A HD22 5  
ATOM   8979  H  HD23 . LEU A 1 11  ? 2.269   8.347   -15.504 1.00 0.00 ? 11  LEU A HD23 5  
ATOM   8980  N  N    . THR A 1 12  ? 6.057   10.701  -16.137 1.00 0.00 ? 12  THR A N    5  
ATOM   8981  C  CA   . THR A 1 12  ? 7.174   11.632  -16.114 1.00 0.00 ? 12  THR A CA   5  
ATOM   8982  C  C    . THR A 1 12  ? 7.865   11.621  -14.757 1.00 0.00 ? 12  THR A C    5  
ATOM   8983  O  O    . THR A 1 12  ? 7.229   11.400  -13.726 1.00 0.00 ? 12  THR A O    5  
ATOM   8984  C  CB   . THR A 1 12  ? 6.683   13.043  -16.429 1.00 0.00 ? 12  THR A CB   5  
ATOM   8985  O  OG1  . THR A 1 12  ? 5.940   13.058  -17.635 1.00 0.00 ? 12  THR A OG1  5  
ATOM   8986  C  CG2  . THR A 1 12  ? 7.802   14.053  -16.565 1.00 0.00 ? 12  THR A CG2  5  
ATOM   8987  H  H    . THR A 1 12  ? 5.161   11.030  -15.915 1.00 0.00 ? 12  THR A H    5  
ATOM   8988  H  HA   . THR A 1 12  ? 7.882   11.329  -16.868 1.00 0.00 ? 12  THR A HA   5  
ATOM   8989  H  HB   . THR A 1 12  ? 6.038   13.368  -15.627 1.00 0.00 ? 12  THR A HB   5  
ATOM   8990  H  HG1  . THR A 1 12  ? 5.125   12.564  -17.515 1.00 0.00 ? 12  THR A HG1  5  
ATOM   8991  H  HG21 . THR A 1 12  ? 8.238   13.976  -17.550 1.00 0.00 ? 12  THR A HG21 5  
ATOM   8992  H  HG22 . THR A 1 12  ? 8.559   13.855  -15.820 1.00 0.00 ? 12  THR A HG22 5  
ATOM   8993  H  HG23 . THR A 1 12  ? 7.408   15.049  -16.422 1.00 0.00 ? 12  THR A HG23 5  
ATOM   8994  N  N    . SER A 1 13  ? 9.172   11.864  -14.765 1.00 0.00 ? 13  SER A N    5  
ATOM   8995  C  CA   . SER A 1 13  ? 9.957   11.888  -13.544 1.00 0.00 ? 13  SER A CA   5  
ATOM   8996  C  C    . SER A 1 13  ? 9.284   12.736  -12.465 1.00 0.00 ? 13  SER A C    5  
ATOM   8997  O  O    . SER A 1 13  ? 9.534   12.549  -11.275 1.00 0.00 ? 13  SER A O    5  
ATOM   8998  C  CB   . SER A 1 13  ? 11.360  12.427  -13.828 1.00 0.00 ? 13  SER A CB   5  
ATOM   8999  O  OG   . SER A 1 13  ? 11.742  12.174  -15.170 1.00 0.00 ? 13  SER A OG   5  
ATOM   9000  H  H    . SER A 1 13  ? 9.621   12.028  -15.613 1.00 0.00 ? 13  SER A H    5  
ATOM   9001  H  HA   . SER A 1 13  ? 10.038  10.876  -13.198 1.00 0.00 ? 13  SER A HA   5  
ATOM   9002  H  HB2  . SER A 1 13  ? 11.375  13.493  -13.659 1.00 0.00 ? 13  SER A HB2  5  
ATOM   9003  H  HB3  . SER A 1 13  ? 12.067  11.948  -13.168 1.00 0.00 ? 13  SER A HB3  5  
ATOM   9004  H  HG   . SER A 1 13  ? 11.615  12.967  -15.694 1.00 0.00 ? 13  SER A HG   5  
ATOM   9005  N  N    . TYR A 1 14  ? 8.431   13.669  -12.887 1.00 0.00 ? 14  TYR A N    5  
ATOM   9006  C  CA   . TYR A 1 14  ? 7.731   14.540  -11.948 1.00 0.00 ? 14  TYR A CA   5  
ATOM   9007  C  C    . TYR A 1 14  ? 6.367   13.966  -11.586 1.00 0.00 ? 14  TYR A C    5  
ATOM   9008  O  O    . TYR A 1 14  ? 5.972   13.968  -10.420 1.00 0.00 ? 14  TYR A O    5  
ATOM   9009  C  CB   . TYR A 1 14  ? 7.570   15.941  -12.541 1.00 0.00 ? 14  TYR A CB   5  
ATOM   9010  C  CG   . TYR A 1 14  ? 7.273   17.006  -11.507 1.00 0.00 ? 14  TYR A CG   5  
ATOM   9011  C  CD1  . TYR A 1 14  ? 8.029   17.103  -10.345 1.00 0.00 ? 14  TYR A CD1  5  
ATOM   9012  C  CD2  . TYR A 1 14  ? 6.238   17.913  -11.695 1.00 0.00 ? 14  TYR A CD2  5  
ATOM   9013  C  CE1  . TYR A 1 14  ? 7.760   18.074  -9.400  1.00 0.00 ? 14  TYR A CE1  5  
ATOM   9014  C  CE2  . TYR A 1 14  ? 5.964   18.887  -10.753 1.00 0.00 ? 14  TYR A CE2  5  
ATOM   9015  C  CZ   . TYR A 1 14  ? 6.728   18.964  -9.608  1.00 0.00 ? 14  TYR A CZ   5  
ATOM   9016  O  OH   . TYR A 1 14  ? 6.458   19.932  -8.668  1.00 0.00 ? 14  TYR A OH   5  
ATOM   9017  H  H    . TYR A 1 14  ? 8.270   13.776  -13.850 1.00 0.00 ? 14  TYR A H    5  
ATOM   9018  H  HA   . TYR A 1 14  ? 8.328   14.604  -11.051 1.00 0.00 ? 14  TYR A HA   5  
ATOM   9019  H  HB2  . TYR A 1 14  ? 8.482   16.217  -13.047 1.00 0.00 ? 14  TYR A HB2  5  
ATOM   9020  H  HB3  . TYR A 1 14  ? 6.757   15.932  -13.252 1.00 0.00 ? 14  TYR A HB3  5  
ATOM   9021  H  HD1  . TYR A 1 14  ? 8.838   16.406  -10.185 1.00 0.00 ? 14  TYR A HD1  5  
ATOM   9022  H  HD2  . TYR A 1 14  ? 5.641   17.850  -12.592 1.00 0.00 ? 14  TYR A HD2  5  
ATOM   9023  H  HE1  . TYR A 1 14  ? 8.359   18.134  -8.502  1.00 0.00 ? 14  TYR A HE1  5  
ATOM   9024  H  HE2  . TYR A 1 14  ? 5.154   19.583  -10.917 1.00 0.00 ? 14  TYR A HE2  5  
ATOM   9025  H  HH   . TYR A 1 14  ? 6.549   20.800  -9.068  1.00 0.00 ? 14  TYR A HH   5  
ATOM   9026  N  N    . ASP A 1 15  ? 5.650   13.468  -12.589 1.00 0.00 ? 15  ASP A N    5  
ATOM   9027  C  CA   . ASP A 1 15  ? 4.331   12.885  -12.369 1.00 0.00 ? 15  ASP A CA   5  
ATOM   9028  C  C    . ASP A 1 15  ? 4.397   11.772  -11.326 1.00 0.00 ? 15  ASP A C    5  
ATOM   9029  O  O    . ASP A 1 15  ? 3.397   11.448  -10.686 1.00 0.00 ? 15  ASP A O    5  
ATOM   9030  C  CB   . ASP A 1 15  ? 3.764   12.340  -13.681 1.00 0.00 ? 15  ASP A CB   5  
ATOM   9031  C  CG   . ASP A 1 15  ? 3.386   13.442  -14.650 1.00 0.00 ? 15  ASP A CG   5  
ATOM   9032  O  OD1  . ASP A 1 15  ? 3.075   14.560  -14.186 1.00 0.00 ? 15  ASP A OD1  5  
ATOM   9033  O  OD2  . ASP A 1 15  ? 3.400   13.189  -15.873 1.00 0.00 ? 15  ASP A OD2  5  
ATOM   9034  H  H    . ASP A 1 15  ? 6.018   13.490  -13.497 1.00 0.00 ? 15  ASP A H    5  
ATOM   9035  H  HA   . ASP A 1 15  ? 3.681   13.666  -12.002 1.00 0.00 ? 15  ASP A HA   5  
ATOM   9036  H  HB2  . ASP A 1 15  ? 4.505   11.711  -14.152 1.00 0.00 ? 15  ASP A HB2  5  
ATOM   9037  H  HB3  . ASP A 1 15  ? 2.883   11.754  -13.468 1.00 0.00 ? 15  ASP A HB3  5  
ATOM   9038  N  N    . CYS A 1 16  ? 5.582   11.193  -11.159 1.00 0.00 ? 16  CYS A N    5  
ATOM   9039  C  CA   . CYS A 1 16  ? 5.783   10.121  -10.197 1.00 0.00 ? 16  CYS A CA   5  
ATOM   9040  C  C    . CYS A 1 16  ? 6.215   10.678  -8.849  1.00 0.00 ? 16  CYS A C    5  
ATOM   9041  O  O    . CYS A 1 16  ? 5.668   10.316  -7.809  1.00 0.00 ? 16  CYS A O    5  
ATOM   9042  C  CB   . CYS A 1 16  ? 6.843   9.153   -10.714 1.00 0.00 ? 16  CYS A CB   5  
ATOM   9043  S  SG   . CYS A 1 16  ? 6.785   7.515   -9.951  1.00 0.00 ? 16  CYS A SG   5  
ATOM   9044  H  H    . CYS A 1 16  ? 6.341   11.491  -11.697 1.00 0.00 ? 16  CYS A H    5  
ATOM   9045  H  HA   . CYS A 1 16  ? 4.849   9.597   -10.080 1.00 0.00 ? 16  CYS A HA   5  
ATOM   9046  H  HB2  . CYS A 1 16  ? 6.715   9.027   -11.776 1.00 0.00 ? 16  CYS A HB2  5  
ATOM   9047  H  HB3  . CYS A 1 16  ? 7.820   9.571   -10.524 1.00 0.00 ? 16  CYS A HB3  5  
ATOM   9048  H  HG   . CYS A 1 16  ? 6.996   6.866   -10.626 1.00 0.00 ? 16  CYS A HG   5  
ATOM   9049  N  N    . GLU A 1 17  ? 7.206   11.560  -8.879  1.00 0.00 ? 17  GLU A N    5  
ATOM   9050  C  CA   . GLU A 1 17  ? 7.723   12.172  -7.663  1.00 0.00 ? 17  GLU A CA   5  
ATOM   9051  C  C    . GLU A 1 17  ? 6.630   12.944  -6.934  1.00 0.00 ? 17  GLU A C    5  
ATOM   9052  O  O    . GLU A 1 17  ? 6.541   12.909  -5.707  1.00 0.00 ? 17  GLU A O    5  
ATOM   9053  C  CB   . GLU A 1 17  ? 8.880   13.109  -8.007  1.00 0.00 ? 17  GLU A CB   5  
ATOM   9054  C  CG   . GLU A 1 17  ? 10.003  13.095  -6.983  1.00 0.00 ? 17  GLU A CG   5  
ATOM   9055  C  CD   . GLU A 1 17  ? 10.329  14.476  -6.450  1.00 0.00 ? 17  GLU A CD   5  
ATOM   9056  O  OE1  . GLU A 1 17  ? 9.388   15.200  -6.061  1.00 0.00 ? 17  GLU A OE1  5  
ATOM   9057  O  OE2  . GLU A 1 17  ? 11.524  14.836  -6.423  1.00 0.00 ? 17  GLU A OE2  5  
ATOM   9058  H  H    . GLU A 1 17  ? 7.602   11.804  -9.742  1.00 0.00 ? 17  GLU A H    5  
ATOM   9059  H  HA   . GLU A 1 17  ? 8.087   11.386  -7.020  1.00 0.00 ? 17  GLU A HA   5  
ATOM   9060  H  HB2  . GLU A 1 17  ? 9.287   12.820  -8.963  1.00 0.00 ? 17  GLU A HB2  5  
ATOM   9061  H  HB3  . GLU A 1 17  ? 8.499   14.116  -8.080  1.00 0.00 ? 17  GLU A HB3  5  
ATOM   9062  H  HG2  . GLU A 1 17  ? 9.710   12.467  -6.155  1.00 0.00 ? 17  GLU A HG2  5  
ATOM   9063  H  HG3  . GLU A 1 17  ? 10.890  12.686  -7.447  1.00 0.00 ? 17  GLU A HG3  5  
ATOM   9064  N  N    . VAL A 1 18  ? 5.805   13.647  -7.702  1.00 0.00 ? 18  VAL A N    5  
ATOM   9065  C  CA   . VAL A 1 18  ? 4.720   14.439  -7.137  1.00 0.00 ? 18  VAL A CA   5  
ATOM   9066  C  C    . VAL A 1 18  ? 3.613   13.556  -6.563  1.00 0.00 ? 18  VAL A C    5  
ATOM   9067  O  O    . VAL A 1 18  ? 3.117   13.809  -5.465  1.00 0.00 ? 18  VAL A O    5  
ATOM   9068  C  CB   . VAL A 1 18  ? 4.106   15.383  -8.189  1.00 0.00 ? 18  VAL A CB   5  
ATOM   9069  C  CG1  . VAL A 1 18  ? 3.121   16.341  -7.537  1.00 0.00 ? 18  VAL A CG1  5  
ATOM   9070  C  CG2  . VAL A 1 18  ? 5.195   16.146  -8.928  1.00 0.00 ? 18  VAL A CG2  5  
ATOM   9071  H  H    . VAL A 1 18  ? 5.935   13.637  -8.673  1.00 0.00 ? 18  VAL A H    5  
ATOM   9072  H  HA   . VAL A 1 18  ? 5.129   15.044  -6.342  1.00 0.00 ? 18  VAL A HA   5  
ATOM   9073  H  HB   . VAL A 1 18  ? 3.565   14.783  -8.908  1.00 0.00 ? 18  VAL A HB   5  
ATOM   9074  H  HG11 . VAL A 1 18  ? 3.171   17.300  -8.030  1.00 0.00 ? 18  VAL A HG11 5  
ATOM   9075  H  HG12 . VAL A 1 18  ? 3.373   16.459  -6.492  1.00 0.00 ? 18  VAL A HG12 5  
ATOM   9076  H  HG13 . VAL A 1 18  ? 2.120   15.943  -7.623  1.00 0.00 ? 18  VAL A HG13 5  
ATOM   9077  H  HG21 . VAL A 1 18  ? 5.014   16.092  -9.992  1.00 0.00 ? 18  VAL A HG21 5  
ATOM   9078  H  HG22 . VAL A 1 18  ? 6.158   15.710  -8.705  1.00 0.00 ? 18  VAL A HG22 5  
ATOM   9079  H  HG23 . VAL A 1 18  ? 5.188   17.180  -8.615  1.00 0.00 ? 18  VAL A HG23 5  
ATOM   9080  N  N    . ASN A 1 19  ? 3.220   12.531  -7.313  1.00 0.00 ? 19  ASN A N    5  
ATOM   9081  C  CA   . ASN A 1 19  ? 2.159   11.630  -6.870  1.00 0.00 ? 19  ASN A CA   5  
ATOM   9082  C  C    . ASN A 1 19  ? 2.662   10.644  -5.820  1.00 0.00 ? 19  ASN A C    5  
ATOM   9083  O  O    . ASN A 1 19  ? 1.949   10.317  -4.871  1.00 0.00 ? 19  ASN A O    5  
ATOM   9084  C  CB   . ASN A 1 19  ? 1.571   10.873  -8.063  1.00 0.00 ? 19  ASN A CB   5  
ATOM   9085  C  CG   . ASN A 1 19  ? 0.068   11.041  -8.170  1.00 0.00 ? 19  ASN A CG   5  
ATOM   9086  O  OD1  . ASN A 1 19  ? -0.697  10.204  -7.692  1.00 0.00 ? 19  ASN A OD1  5  
ATOM   9087  N  ND2  . ASN A 1 19  ? -0.362  12.129  -8.799  1.00 0.00 ? 19  ASN A ND2  5  
ATOM   9088  H  H    . ASN A 1 19  ? 3.644   12.382  -8.185  1.00 0.00 ? 19  ASN A H    5  
ATOM   9089  H  HA   . ASN A 1 19  ? 1.384   12.233  -6.427  1.00 0.00 ? 19  ASN A HA   5  
ATOM   9090  H  HB2  . ASN A 1 19  ? 2.020   11.245  -8.972  1.00 0.00 ? 19  ASN A HB2  5  
ATOM   9091  H  HB3  . ASN A 1 19  ? 1.792   9.821   -7.961  1.00 0.00 ? 19  ASN A HB3  5  
ATOM   9092  H  HD21 . ASN A 1 19  ? 0.305   12.751  -9.155  1.00 0.00 ? 19  ASN A HD21 5  
ATOM   9093  H  HD22 . ASN A 1 19  ? -1.329  12.263  -8.883  1.00 0.00 ? 19  ASN A HD22 5  
ATOM   9094  N  N    . ALA A 1 20  ? 3.890   10.170  -5.995  1.00 0.00 ? 20  ALA A N    5  
ATOM   9095  C  CA   . ALA A 1 20  ? 4.479   9.221   -5.062  1.00 0.00 ? 20  ALA A CA   5  
ATOM   9096  C  C    . ALA A 1 20  ? 5.922   9.588   -4.737  1.00 0.00 ? 20  ALA A C    5  
ATOM   9097  O  O    . ALA A 1 20  ? 6.862   8.946   -5.207  1.00 0.00 ? 20  ALA A O    5  
ATOM   9098  C  CB   . ALA A 1 20  ? 4.398   7.808   -5.617  1.00 0.00 ? 20  ALA A CB   5  
ATOM   9099  H  H    . ALA A 1 20  ? 4.408   10.466  -6.768  1.00 0.00 ? 20  ALA A H    5  
ATOM   9100  H  HA   . ALA A 1 20  ? 3.904   9.261   -4.150  1.00 0.00 ? 20  ALA A HA   5  
ATOM   9101  H  HB1  . ALA A 1 20  ? 4.247   7.111   -4.806  1.00 0.00 ? 20  ALA A HB1  5  
ATOM   9102  H  HB2  . ALA A 1 20  ? 5.317   7.569   -6.130  1.00 0.00 ? 20  ALA A HB2  5  
ATOM   9103  H  HB3  . ALA A 1 20  ? 3.571   7.740   -6.309  1.00 0.00 ? 20  ALA A HB3  5  
ATOM   9104  N  N    . PRO A 1 21  ? 6.107   10.628  -3.914  1.00 0.00 ? 21  PRO A N    5  
ATOM   9105  C  CA   . PRO A 1 21  ? 7.431   11.091  -3.501  1.00 0.00 ? 21  PRO A CA   5  
ATOM   9106  C  C    . PRO A 1 21  ? 8.117   10.101  -2.566  1.00 0.00 ? 21  PRO A C    5  
ATOM   9107  O  O    . PRO A 1 21  ? 7.462   9.444   -1.757  1.00 0.00 ? 21  PRO A O    5  
ATOM   9108  C  CB   . PRO A 1 21  ? 7.159   12.409  -2.759  1.00 0.00 ? 21  PRO A CB   5  
ATOM   9109  C  CG   . PRO A 1 21  ? 5.707   12.712  -2.952  1.00 0.00 ? 21  PRO A CG   5  
ATOM   9110  C  CD   . PRO A 1 21  ? 5.030   11.421  -3.316  1.00 0.00 ? 21  PRO A CD   5  
ATOM   9111  H  HA   . PRO A 1 21  ? 8.067   11.279  -4.354  1.00 0.00 ? 21  PRO A HA   5  
ATOM   9112  H  HB2  . PRO A 1 21  ? 7.394   12.287  -1.712  1.00 0.00 ? 21  PRO A HB2  5  
ATOM   9113  H  HB3  . PRO A 1 21  ? 7.779   13.189  -3.177  1.00 0.00 ? 21  PRO A HB3  5  
ATOM   9114  H  HG2  . PRO A 1 21  ? 5.292   13.101  -2.034  1.00 0.00 ? 21  PRO A HG2  5  
ATOM   9115  H  HG3  . PRO A 1 21  ? 5.589   13.431  -3.749  1.00 0.00 ? 21  PRO A HG3  5  
ATOM   9116  H  HD2  . PRO A 1 21  ? 4.636   10.932  -2.439  1.00 0.00 ? 21  PRO A HD2  5  
ATOM   9117  H  HD3  . PRO A 1 21  ? 4.243   11.599  -4.033  1.00 0.00 ? 21  PRO A HD3  5  
ATOM   9118  N  N    . ILE A 1 22  ? 9.437   10.003  -2.675  1.00 0.00 ? 22  ILE A N    5  
ATOM   9119  C  CA   . ILE A 1 22  ? 10.203  9.096   -1.827  1.00 0.00 ? 22  ILE A CA   5  
ATOM   9120  C  C    . ILE A 1 22  ? 10.544  9.752   -0.489  1.00 0.00 ? 22  ILE A C    5  
ATOM   9121  O  O    . ILE A 1 22  ? 10.955  9.078   0.454   1.00 0.00 ? 22  ILE A O    5  
ATOM   9122  C  CB   . ILE A 1 22  ? 11.500  8.631   -2.525  1.00 0.00 ? 22  ILE A CB   5  
ATOM   9123  C  CG1  . ILE A 1 22  ? 11.167  7.975   -3.865  1.00 0.00 ? 22  ILE A CG1  5  
ATOM   9124  C  CG2  . ILE A 1 22  ? 12.275  7.671   -1.635  1.00 0.00 ? 22  ILE A CG2  5  
ATOM   9125  C  CD1  . ILE A 1 22  ? 12.378  7.427   -4.585  1.00 0.00 ? 22  ILE A CD1  5  
ATOM   9126  H  H    . ILE A 1 22  ? 9.906   10.556  -3.334  1.00 0.00 ? 22  ILE A H    5  
ATOM   9127  H  HA   . ILE A 1 22  ? 9.590   8.226   -1.640  1.00 0.00 ? 22  ILE A HA   5  
ATOM   9128  H  HB   . ILE A 1 22  ? 12.122  9.493   -2.703  1.00 0.00 ? 22  ILE A HB   5  
ATOM   9129  H  HG12 . ILE A 1 22  ? 10.484  7.157   -3.699  1.00 0.00 ? 22  ILE A HG12 5  
ATOM   9130  H  HG13 . ILE A 1 22  ? 10.699  8.704   -4.510  1.00 0.00 ? 22  ILE A HG13 5  
ATOM   9131  H  HG21 . ILE A 1 22  ? 13.151  7.324   -2.162  1.00 0.00 ? 22  ILE A HG21 5  
ATOM   9132  H  HG22 . ILE A 1 22  ? 11.650  6.829   -1.380  1.00 0.00 ? 22  ILE A HG22 5  
ATOM   9133  H  HG23 . ILE A 1 22  ? 12.578  8.183   -0.735  1.00 0.00 ? 22  ILE A HG23 5  
ATOM   9134  H  HD11 . ILE A 1 22  ? 13.019  8.243   -4.883  1.00 0.00 ? 22  ILE A HD11 5  
ATOM   9135  H  HD12 . ILE A 1 22  ? 12.059  6.879   -5.459  1.00 0.00 ? 22  ILE A HD12 5  
ATOM   9136  H  HD13 . ILE A 1 22  ? 12.918  6.767   -3.924  1.00 0.00 ? 22  ILE A HD13 5  
ATOM   9137  N  N    . GLN A 1 23  ? 10.366  11.070  -0.409  1.00 0.00 ? 23  GLN A N    5  
ATOM   9138  C  CA   . GLN A 1 23  ? 10.651  11.810  0.816   1.00 0.00 ? 23  GLN A CA   5  
ATOM   9139  C  C    . GLN A 1 23  ? 12.146  11.804  1.122   1.00 0.00 ? 23  GLN A C    5  
ATOM   9140  O  O    . GLN A 1 23  ? 12.559  11.625  2.267   1.00 0.00 ? 23  GLN A O    5  
ATOM   9141  C  CB   . GLN A 1 23  ? 9.863   11.219  1.990   1.00 0.00 ? 23  GLN A CB   5  
ATOM   9142  C  CG   . GLN A 1 23  ? 8.866   12.190  2.602   1.00 0.00 ? 23  GLN A CG   5  
ATOM   9143  C  CD   . GLN A 1 23  ? 7.427   11.763  2.384   1.00 0.00 ? 23  GLN A CD   5  
ATOM   9144  O  OE1  . GLN A 1 23  ? 6.802   12.129  1.389   1.00 0.00 ? 23  GLN A OE1  5  
ATOM   9145  N  NE2  . GLN A 1 23  ? 6.893   10.986  3.319   1.00 0.00 ? 23  GLN A NE2  5  
ATOM   9146  H  H    . GLN A 1 23  ? 10.032  11.556  -1.192  1.00 0.00 ? 23  GLN A H    5  
ATOM   9147  H  HA   . GLN A 1 23  ? 10.335  12.831  0.663   1.00 0.00 ? 23  GLN A HA   5  
ATOM   9148  H  HB2  . GLN A 1 23  ? 9.324   10.351  1.643   1.00 0.00 ? 23  GLN A HB2  5  
ATOM   9149  H  HB3  . GLN A 1 23  ? 10.556  10.916  2.761   1.00 0.00 ? 23  GLN A HB3  5  
ATOM   9150  H  HG2  . GLN A 1 23  ? 9.049   12.253  3.663   1.00 0.00 ? 23  GLN A HG2  5  
ATOM   9151  H  HG3  . GLN A 1 23  ? 9.009   13.162  2.153   1.00 0.00 ? 23  GLN A HG3  5  
ATOM   9152  H  HE21 . GLN A 1 23  ? 7.449   10.735  4.085   1.00 0.00 ? 23  GLN A HE21 5  
ATOM   9153  H  HE22 . GLN A 1 23  ? 5.964   10.696  3.205   1.00 0.00 ? 23  GLN A HE22 5  
ATOM   9154  N  N    . GLY A 1 24  ? 12.950  12.000  0.084   1.00 0.00 ? 24  GLY A N    5  
ATOM   9155  C  CA   . GLY A 1 24  ? 14.388  12.016  0.249   1.00 0.00 ? 24  GLY A CA   5  
ATOM   9156  C  C    . GLY A 1 24  ? 15.119  11.938  -1.076  1.00 0.00 ? 24  GLY A C    5  
ATOM   9157  O  O    . GLY A 1 24  ? 14.490  11.859  -2.132  1.00 0.00 ? 24  GLY A O    5  
ATOM   9158  H  H    . GLY A 1 24  ? 12.563  12.136  -0.801  1.00 0.00 ? 24  GLY A H    5  
ATOM   9159  H  HA2  . GLY A 1 24  ? 14.672  12.927  0.754   1.00 0.00 ? 24  GLY A HA2  5  
ATOM   9160  H  HA3  . GLY A 1 24  ? 14.677  11.173  0.857   1.00 0.00 ? 24  GLY A HA3  5  
ATOM   9161  N  N    . SER A 1 25  ? 16.447  11.956  -1.024  1.00 0.00 ? 25  SER A N    5  
ATOM   9162  C  CA   . SER A 1 25  ? 17.257  11.882  -2.236  1.00 0.00 ? 25  SER A CA   5  
ATOM   9163  C  C    . SER A 1 25  ? 16.844  10.685  -3.087  1.00 0.00 ? 25  SER A C    5  
ATOM   9164  O  O    . SER A 1 25  ? 16.137  10.833  -4.084  1.00 0.00 ? 25  SER A O    5  
ATOM   9165  C  CB   . SER A 1 25  ? 18.742  11.786  -1.879  1.00 0.00 ? 25  SER A CB   5  
ATOM   9166  O  OG   . SER A 1 25  ? 19.343  13.067  -1.845  1.00 0.00 ? 25  SER A OG   5  
ATOM   9167  H  H    . SER A 1 25  ? 16.892  12.018  -0.154  1.00 0.00 ? 25  SER A H    5  
ATOM   9168  H  HA   . SER A 1 25  ? 17.090  12.787  -2.803  1.00 0.00 ? 25  SER A HA   5  
ATOM   9169  H  HB2  . SER A 1 25  ? 18.847  11.326  -0.907  1.00 0.00 ? 25  SER A HB2  5  
ATOM   9170  H  HB3  . SER A 1 25  ? 19.249  11.184  -2.619  1.00 0.00 ? 25  SER A HB3  5  
ATOM   9171  H  HG   . SER A 1 25  ? 19.129  13.544  -2.649  1.00 0.00 ? 25  SER A HG   5  
ATOM   9172  N  N    . ARG A 1 26  ? 17.283  9.498   -2.682  1.00 0.00 ? 26  ARG A N    5  
ATOM   9173  C  CA   . ARG A 1 26  ? 16.953  8.277   -3.398  1.00 0.00 ? 26  ARG A CA   5  
ATOM   9174  C  C    . ARG A 1 26  ? 16.295  7.270   -2.474  1.00 0.00 ? 26  ARG A C    5  
ATOM   9175  O  O    . ARG A 1 26  ? 15.874  7.597   -1.365  1.00 0.00 ? 26  ARG A O    5  
ATOM   9176  C  CB   . ARG A 1 26  ? 18.210  7.665   -4.017  1.00 0.00 ? 26  ARG A CB   5  
ATOM   9177  C  CG   . ARG A 1 26  ? 18.142  7.532   -5.529  1.00 0.00 ? 26  ARG A CG   5  
ATOM   9178  C  CD   . ARG A 1 26  ? 19.322  6.744   -6.073  1.00 0.00 ? 26  ARG A CD   5  
ATOM   9179  N  NE   . ARG A 1 26  ? 20.580  7.470   -5.926  1.00 0.00 ? 26  ARG A NE   5  
ATOM   9180  C  CZ   . ARG A 1 26  ? 20.912  8.533   -6.657  1.00 0.00 ? 26  ARG A CZ   5  
ATOM   9181  N  NH1  . ARG A 1 26  ? 20.082  8.992   -7.586  1.00 0.00 ? 26  ARG A NH1  5  
ATOM   9182  N  NH2  . ARG A 1 26  ? 22.075  9.136   -6.460  1.00 0.00 ? 26  ARG A NH2  5  
ATOM   9183  H  H    . ARG A 1 26  ? 17.840  9.441   -1.879  1.00 0.00 ? 26  ARG A H    5  
ATOM   9184  H  HA   . ARG A 1 26  ? 16.261  8.520   -4.186  1.00 0.00 ? 26  ARG A HA   5  
ATOM   9185  H  HB2  . ARG A 1 26  ? 19.051  8.280   -3.768  1.00 0.00 ? 26  ARG A HB2  5  
ATOM   9186  H  HB3  . ARG A 1 26  ? 18.362  6.685   -3.597  1.00 0.00 ? 26  ARG A HB3  5  
ATOM   9187  H  HG2  . ARG A 1 26  ? 17.227  7.024   -5.796  1.00 0.00 ? 26  ARG A HG2  5  
ATOM   9188  H  HG3  . ARG A 1 26  ? 18.148  8.520   -5.967  1.00 0.00 ? 26  ARG A HG3  5  
ATOM   9189  H  HD2  . ARG A 1 26  ? 19.392  5.809   -5.535  1.00 0.00 ? 26  ARG A HD2  5  
ATOM   9190  H  HD3  . ARG A 1 26  ? 19.151  6.542   -7.121  1.00 0.00 ? 26  ARG A HD3  5  
ATOM   9191  H  HE   . ARG A 1 26  ? 21.211  7.150   -5.249  1.00 0.00 ? 26  ARG A HE   5  
ATOM   9192  H  HH11 . ARG A 1 26  ? 19.204  8.542   -7.741  1.00 0.00 ? 26  ARG A HH11 5  
ATOM   9193  H  HH12 . ARG A 1 26  ? 20.338  9.791   -8.131  1.00 0.00 ? 26  ARG A HH12 5  
ATOM   9194  H  HH21 . ARG A 1 26  ? 22.704  8.794   -5.761  1.00 0.00 ? 26  ARG A HH21 5  
ATOM   9195  H  HH22 . ARG A 1 26  ? 22.324  9.934   -7.008  1.00 0.00 ? 26  ARG A HH22 5  
ATOM   9196  N  N    . ASN A 1 27  ? 16.214  6.045   -2.953  1.00 0.00 ? 27  ASN A N    5  
ATOM   9197  C  CA   . ASN A 1 27  ? 15.609  4.961   -2.200  1.00 0.00 ? 27  ASN A CA   5  
ATOM   9198  C  C    . ASN A 1 27  ? 16.492  3.715   -2.233  1.00 0.00 ? 27  ASN A C    5  
ATOM   9199  O  O    . ASN A 1 27  ? 17.441  3.631   -3.013  1.00 0.00 ? 27  ASN A O    5  
ATOM   9200  C  CB   . ASN A 1 27  ? 14.216  4.669   -2.754  1.00 0.00 ? 27  ASN A CB   5  
ATOM   9201  C  CG   . ASN A 1 27  ? 13.520  3.514   -2.063  1.00 0.00 ? 27  ASN A CG   5  
ATOM   9202  O  OD1  . ASN A 1 27  ? 13.134  2.540   -2.705  1.00 0.00 ? 27  ASN A OD1  5  
ATOM   9203  N  ND2  . ASN A 1 27  ? 13.344  3.624   -0.752  1.00 0.00 ? 27  ASN A ND2  5  
ATOM   9204  H  H    . ASN A 1 27  ? 16.569  5.870   -3.843  1.00 0.00 ? 27  ASN A H    5  
ATOM   9205  H  HA   . ASN A 1 27  ? 15.517  5.290   -1.179  1.00 0.00 ? 27  ASN A HA   5  
ATOM   9206  H  HB2  . ASN A 1 27  ? 13.609  5.544   -2.626  1.00 0.00 ? 27  ASN A HB2  5  
ATOM   9207  H  HB3  . ASN A 1 27  ? 14.296  4.445   -3.803  1.00 0.00 ? 27  ASN A HB3  5  
ATOM   9208  H  HD21 . ASN A 1 27  ? 13.671  4.434   -0.309  1.00 0.00 ? 27  ASN A HD21 5  
ATOM   9209  H  HD22 . ASN A 1 27  ? 12.897  2.890   -0.282  1.00 0.00 ? 27  ASN A HD22 5  
ATOM   9210  N  N    . LEU A 1 28  ? 16.183  2.764   -1.362  1.00 0.00 ? 28  LEU A N    5  
ATOM   9211  C  CA   . LEU A 1 28  ? 16.942  1.534   -1.249  1.00 0.00 ? 28  LEU A CA   5  
ATOM   9212  C  C    . LEU A 1 28  ? 16.919  0.710   -2.539  1.00 0.00 ? 28  LEU A C    5  
ATOM   9213  O  O    . LEU A 1 28  ? 17.832  0.808   -3.359  1.00 0.00 ? 28  LEU A O    5  
ATOM   9214  C  CB   . LEU A 1 28  ? 16.392  0.722   -0.079  1.00 0.00 ? 28  LEU A CB   5  
ATOM   9215  C  CG   . LEU A 1 28  ? 17.274  0.708   1.167   1.00 0.00 ? 28  LEU A CG   5  
ATOM   9216  C  CD1  . LEU A 1 28  ? 16.619  -0.097  2.279   1.00 0.00 ? 28  LEU A CD1  5  
ATOM   9217  C  CD2  . LEU A 1 28  ? 18.652  0.151   0.840   1.00 0.00 ? 28  LEU A CD2  5  
ATOM   9218  H  H    . LEU A 1 28  ? 15.432  2.900   -0.759  1.00 0.00 ? 28  LEU A H    5  
ATOM   9219  H  HA   . LEU A 1 28  ? 17.963  1.801   -1.029  1.00 0.00 ? 28  LEU A HA   5  
ATOM   9220  H  HB2  . LEU A 1 28  ? 15.429  1.133   0.193   1.00 0.00 ? 28  LEU A HB2  5  
ATOM   9221  H  HB3  . LEU A 1 28  ? 16.248  -0.288  -0.406  1.00 0.00 ? 28  LEU A HB3  5  
ATOM   9222  H  HG   . LEU A 1 28  ? 17.397  1.723   1.517   1.00 0.00 ? 28  LEU A HG   5  
ATOM   9223  H  HD11 . LEU A 1 28  ? 17.066  0.167   3.226   1.00 0.00 ? 28  LEU A HD11 5  
ATOM   9224  H  HD12 . LEU A 1 28  ? 16.768  -1.151  2.094   1.00 0.00 ? 28  LEU A HD12 5  
ATOM   9225  H  HD13 . LEU A 1 28  ? 15.563  0.119   2.306   1.00 0.00 ? 28  LEU A HD13 5  
ATOM   9226  H  HD21 . LEU A 1 28  ? 18.545  -0.786  0.314   1.00 0.00 ? 28  LEU A HD21 5  
ATOM   9227  H  HD22 . LEU A 1 28  ? 19.201  -0.011  1.755   1.00 0.00 ? 28  LEU A HD22 5  
ATOM   9228  H  HD23 . LEU A 1 28  ? 19.186  0.854   0.218   1.00 0.00 ? 28  LEU A HD23 5  
ATOM   9229  N  N    . LEU A 1 29  ? 15.884  -0.112  -2.711  1.00 0.00 ? 29  LEU A N    5  
ATOM   9230  C  CA   . LEU A 1 29  ? 15.767  -0.958  -3.894  1.00 0.00 ? 29  LEU A CA   5  
ATOM   9231  C  C    . LEU A 1 29  ? 15.859  -0.124  -5.168  1.00 0.00 ? 29  LEU A C    5  
ATOM   9232  O  O    . LEU A 1 29  ? 15.274  0.955   -5.262  1.00 0.00 ? 29  LEU A O    5  
ATOM   9233  C  CB   . LEU A 1 29  ? 14.456  -1.762  -3.871  1.00 0.00 ? 29  LEU A CB   5  
ATOM   9234  C  CG   . LEU A 1 29  ? 13.559  -1.555  -2.641  1.00 0.00 ? 29  LEU A CG   5  
ATOM   9235  C  CD1  . LEU A 1 29  ? 14.278  -1.953  -1.355  1.00 0.00 ? 29  LEU A CD1  5  
ATOM   9236  C  CD2  . LEU A 1 29  ? 13.063  -0.117  -2.575  1.00 0.00 ? 29  LEU A CD2  5  
ATOM   9237  H  H    . LEU A 1 29  ? 15.189  -0.159  -2.025  1.00 0.00 ? 29  LEU A H    5  
ATOM   9238  H  HA   . LEU A 1 29  ? 16.597  -1.650  -3.879  1.00 0.00 ? 29  LEU A HA   5  
ATOM   9239  H  HB2  . LEU A 1 29  ? 13.884  -1.502  -4.750  1.00 0.00 ? 29  LEU A HB2  5  
ATOM   9240  H  HB3  . LEU A 1 29  ? 14.705  -2.812  -3.929  1.00 0.00 ? 29  LEU A HB3  5  
ATOM   9241  H  HG   . LEU A 1 29  ? 12.706  -2.183  -2.733  1.00 0.00 ? 29  LEU A HG   5  
ATOM   9242  H  HD11 . LEU A 1 29  ? 15.308  -2.189  -1.577  1.00 0.00 ? 29  LEU A HD11 5  
ATOM   9243  H  HD12 . LEU A 1 29  ? 13.794  -2.815  -0.923  1.00 0.00 ? 29  LEU A HD12 5  
ATOM   9244  H  HD13 . LEU A 1 29  ? 14.240  -1.133  -0.652  1.00 0.00 ? 29  LEU A HD13 5  
ATOM   9245  H  HD21 . LEU A 1 29  ? 12.011  -0.087  -2.820  1.00 0.00 ? 29  LEU A HD21 5  
ATOM   9246  H  HD22 . LEU A 1 29  ? 13.614  0.486   -3.281  1.00 0.00 ? 29  LEU A HD22 5  
ATOM   9247  H  HD23 . LEU A 1 29  ? 13.211  0.271   -1.578  1.00 0.00 ? 29  LEU A HD23 5  
ATOM   9248  N  N    . GLN A 1 30  ? 16.615  -0.626  -6.141  1.00 0.00 ? 30  GLN A N    5  
ATOM   9249  C  CA   . GLN A 1 30  ? 16.805  0.075   -7.402  1.00 0.00 ? 30  GLN A CA   5  
ATOM   9250  C  C    . GLN A 1 30  ? 16.798  -0.890  -8.588  1.00 0.00 ? 30  GLN A C    5  
ATOM   9251  O  O    . GLN A 1 30  ? 16.164  -0.625  -9.609  1.00 0.00 ? 30  GLN A O    5  
ATOM   9252  C  CB   . GLN A 1 30  ? 18.125  0.840   -7.364  1.00 0.00 ? 30  GLN A CB   5  
ATOM   9253  C  CG   . GLN A 1 30  ? 17.997  2.283   -7.808  1.00 0.00 ? 30  GLN A CG   5  
ATOM   9254  C  CD   . GLN A 1 30  ? 19.153  2.731   -8.682  1.00 0.00 ? 30  GLN A CD   5  
ATOM   9255  O  OE1  . GLN A 1 30  ? 20.071  3.406   -8.218  1.00 0.00 ? 30  GLN A OE1  5  
ATOM   9256  N  NE2  . GLN A 1 30  ? 19.113  2.355   -9.955  1.00 0.00 ? 30  GLN A NE2  5  
ATOM   9257  H  H    . GLN A 1 30  ? 17.066  -1.479  -6.001  1.00 0.00 ? 30  GLN A H    5  
ATOM   9258  H  HA   . GLN A 1 30  ? 15.995  0.778   -7.518  1.00 0.00 ? 30  GLN A HA   5  
ATOM   9259  H  HB2  . GLN A 1 30  ? 18.505  0.828   -6.353  1.00 0.00 ? 30  GLN A HB2  5  
ATOM   9260  H  HB3  . GLN A 1 30  ? 18.833  0.345   -8.009  1.00 0.00 ? 30  GLN A HB3  5  
ATOM   9261  H  HG2  . GLN A 1 30  ? 17.080  2.393   -8.366  1.00 0.00 ? 30  GLN A HG2  5  
ATOM   9262  H  HG3  . GLN A 1 30  ? 17.962  2.911   -6.930  1.00 0.00 ? 30  GLN A HG3  5  
ATOM   9263  H  HE21 . GLN A 1 30  ? 18.350  1.817   -10.254 1.00 0.00 ? 30  GLN A HE21 5  
ATOM   9264  H  HE22 . GLN A 1 30  ? 19.847  2.631   -10.542 1.00 0.00 ? 30  GLN A HE22 5  
ATOM   9265  N  N    . GLY A 1 31  ? 17.512  -2.004  -8.452  1.00 0.00 ? 31  GLY A N    5  
ATOM   9266  C  CA   . GLY A 1 31  ? 17.576  -2.977  -9.518  1.00 0.00 ? 31  GLY A CA   5  
ATOM   9267  C  C    . GLY A 1 31  ? 17.237  -4.378  -9.051  1.00 0.00 ? 31  GLY A C    5  
ATOM   9268  O  O    . GLY A 1 31  ? 16.065  -4.737  -8.944  1.00 0.00 ? 31  GLY A O    5  
ATOM   9269  H  H    . GLY A 1 31  ? 17.999  -2.162  -7.628  1.00 0.00 ? 31  GLY A H    5  
ATOM   9270  H  HA2  . GLY A 1 31  ? 16.880  -2.688  -10.280 1.00 0.00 ? 31  GLY A HA2  5  
ATOM   9271  H  HA3  . GLY A 1 31  ? 18.572  -2.978  -9.936  1.00 0.00 ? 31  GLY A HA3  5  
ATOM   9272  N  N    . GLU A 1 32  ? 18.262  -5.173  -8.769  1.00 0.00 ? 32  GLU A N    5  
ATOM   9273  C  CA   . GLU A 1 32  ? 18.053  -6.539  -8.306  1.00 0.00 ? 32  GLU A CA   5  
ATOM   9274  C  C    . GLU A 1 32  ? 17.355  -6.537  -6.953  1.00 0.00 ? 32  GLU A C    5  
ATOM   9275  O  O    . GLU A 1 32  ? 16.578  -7.439  -6.642  1.00 0.00 ? 32  GLU A O    5  
ATOM   9276  C  CB   . GLU A 1 32  ? 19.385  -7.285  -8.213  1.00 0.00 ? 32  GLU A CB   5  
ATOM   9277  C  CG   . GLU A 1 32  ? 19.739  -8.056  -9.475  1.00 0.00 ? 32  GLU A CG   5  
ATOM   9278  C  CD   . GLU A 1 32  ? 18.925  -9.326  -9.629  1.00 0.00 ? 32  GLU A CD   5  
ATOM   9279  O  OE1  . GLU A 1 32  ? 18.967  -10.172 -8.712  1.00 0.00 ? 32  GLU A OE1  5  
ATOM   9280  O  OE2  . GLU A 1 32  ? 18.245  -9.472  -10.666 1.00 0.00 ? 32  GLU A OE2  5  
ATOM   9281  H  H    . GLU A 1 32  ? 19.176  -4.836  -8.870  1.00 0.00 ? 32  GLU A H    5  
ATOM   9282  H  HA   . GLU A 1 32  ? 17.416  -7.037  -9.021  1.00 0.00 ? 32  GLU A HA   5  
ATOM   9283  H  HB2  . GLU A 1 32  ? 20.173  -6.571  -8.021  1.00 0.00 ? 32  GLU A HB2  5  
ATOM   9284  H  HB3  . GLU A 1 32  ? 19.337  -7.985  -7.392  1.00 0.00 ? 32  GLU A HB3  5  
ATOM   9285  H  HG2  . GLU A 1 32  ? 19.555  -7.422  -10.330 1.00 0.00 ? 32  GLU A HG2  5  
ATOM   9286  H  HG3  . GLU A 1 32  ? 20.786  -8.318  -9.440  1.00 0.00 ? 32  GLU A HG3  5  
ATOM   9287  N  N    . GLU A 1 33  ? 17.625  -5.506  -6.159  1.00 0.00 ? 33  GLU A N    5  
ATOM   9288  C  CA   . GLU A 1 33  ? 17.006  -5.380  -4.848  1.00 0.00 ? 33  GLU A CA   5  
ATOM   9289  C  C    . GLU A 1 33  ? 15.553  -4.960  -4.989  1.00 0.00 ? 33  GLU A C    5  
ATOM   9290  O  O    . GLU A 1 33  ? 14.730  -5.219  -4.113  1.00 0.00 ? 33  GLU A O    5  
ATOM   9291  C  CB   . GLU A 1 33  ? 17.770  -4.373  -3.985  1.00 0.00 ? 33  GLU A CB   5  
ATOM   9292  C  CG   . GLU A 1 33  ? 19.272  -4.607  -3.963  1.00 0.00 ? 33  GLU A CG   5  
ATOM   9293  C  CD   . GLU A 1 33  ? 19.813  -4.816  -2.562  1.00 0.00 ? 33  GLU A CD   5  
ATOM   9294  O  OE1  . GLU A 1 33  ? 19.215  -5.612  -1.808  1.00 0.00 ? 33  GLU A OE1  5  
ATOM   9295  O  OE2  . GLU A 1 33  ? 20.833  -4.182  -2.219  1.00 0.00 ? 33  GLU A OE2  5  
ATOM   9296  H  H    . GLU A 1 33  ? 18.243  -4.811  -6.467  1.00 0.00 ? 33  GLU A H    5  
ATOM   9297  H  HA   . GLU A 1 33  ? 17.034  -6.344  -4.379  1.00 0.00 ? 33  GLU A HA   5  
ATOM   9298  H  HB2  . GLU A 1 33  ? 17.587  -3.379  -4.365  1.00 0.00 ? 33  GLU A HB2  5  
ATOM   9299  H  HB3  . GLU A 1 33  ? 17.403  -4.434  -2.971  1.00 0.00 ? 33  GLU A HB3  5  
ATOM   9300  H  HG2  . GLU A 1 33  ? 19.495  -5.484  -4.552  1.00 0.00 ? 33  GLU A HG2  5  
ATOM   9301  H  HG3  . GLU A 1 33  ? 19.763  -3.748  -4.398  1.00 0.00 ? 33  GLU A HG3  5  
ATOM   9302  N  N    . LEU A 1 34  ? 15.245  -4.327  -6.110  1.00 0.00 ? 34  LEU A N    5  
ATOM   9303  C  CA   . LEU A 1 34  ? 13.903  -3.885  -6.396  1.00 0.00 ? 34  LEU A CA   5  
ATOM   9304  C  C    . LEU A 1 34  ? 12.984  -5.085  -6.554  1.00 0.00 ? 34  LEU A C    5  
ATOM   9305  O  O    . LEU A 1 34  ? 11.835  -5.063  -6.121  1.00 0.00 ? 34  LEU A O    5  
ATOM   9306  C  CB   . LEU A 1 34  ? 13.908  -3.047  -7.669  1.00 0.00 ? 34  LEU A CB   5  
ATOM   9307  C  CG   . LEU A 1 34  ? 13.640  -1.562  -7.463  1.00 0.00 ? 34  LEU A CG   5  
ATOM   9308  C  CD1  . LEU A 1 34  ? 13.602  -0.834  -8.798  1.00 0.00 ? 34  LEU A CD1  5  
ATOM   9309  C  CD2  . LEU A 1 34  ? 12.342  -1.348  -6.697  1.00 0.00 ? 34  LEU A CD2  5  
ATOM   9310  H  H    . LEU A 1 34  ? 15.939  -4.163  -6.771  1.00 0.00 ? 34  LEU A H    5  
ATOM   9311  H  HA   . LEU A 1 34  ? 13.559  -3.281  -5.571  1.00 0.00 ? 34  LEU A HA   5  
ATOM   9312  H  HB2  . LEU A 1 34  ? 14.877  -3.151  -8.134  1.00 0.00 ? 34  LEU A HB2  5  
ATOM   9313  H  HB3  . LEU A 1 34  ? 13.168  -3.440  -8.338  1.00 0.00 ? 34  LEU A HB3  5  
ATOM   9314  H  HG   . LEU A 1 34  ? 14.447  -1.148  -6.879  1.00 0.00 ? 34  LEU A HG   5  
ATOM   9315  H  HD11 . LEU A 1 34  ? 14.127  0.106   -8.711  1.00 0.00 ? 34  LEU A HD11 5  
ATOM   9316  H  HD12 . LEU A 1 34  ? 12.575  -0.648  -9.077  1.00 0.00 ? 34  LEU A HD12 5  
ATOM   9317  H  HD13 . LEU A 1 34  ? 14.076  -1.442  -9.554  1.00 0.00 ? 34  LEU A HD13 5  
ATOM   9318  H  HD21 . LEU A 1 34  ? 12.009  -2.287  -6.281  1.00 0.00 ? 34  LEU A HD21 5  
ATOM   9319  H  HD22 . LEU A 1 34  ? 11.588  -0.967  -7.369  1.00 0.00 ? 34  LEU A HD22 5  
ATOM   9320  H  HD23 . LEU A 1 34  ? 12.507  -0.639  -5.900  1.00 0.00 ? 34  LEU A HD23 5  
ATOM   9321  N  N    . LEU A 1 35  ? 13.506  -6.139  -7.170  1.00 0.00 ? 35  LEU A N    5  
ATOM   9322  C  CA   . LEU A 1 35  ? 12.730  -7.352  -7.372  1.00 0.00 ? 35  LEU A CA   5  
ATOM   9323  C  C    . LEU A 1 35  ? 12.640  -8.141  -6.076  1.00 0.00 ? 35  LEU A C    5  
ATOM   9324  O  O    . LEU A 1 35  ? 11.587  -8.682  -5.738  1.00 0.00 ? 35  LEU A O    5  
ATOM   9325  C  CB   . LEU A 1 35  ? 13.353  -8.212  -8.476  1.00 0.00 ? 35  LEU A CB   5  
ATOM   9326  C  CG   . LEU A 1 35  ? 13.651  -7.482  -9.790  1.00 0.00 ? 35  LEU A CG   5  
ATOM   9327  C  CD1  . LEU A 1 35  ? 13.946  -8.483  -10.896 1.00 0.00 ? 35  LEU A CD1  5  
ATOM   9328  C  CD2  . LEU A 1 35  ? 12.490  -6.578  -10.184 1.00 0.00 ? 35  LEU A CD2  5  
ATOM   9329  H  H    . LEU A 1 35  ? 14.435  -6.103  -7.489  1.00 0.00 ? 35  LEU A H    5  
ATOM   9330  H  HA   . LEU A 1 35  ? 11.734  -7.058  -7.665  1.00 0.00 ? 35  LEU A HA   5  
ATOM   9331  H  HB2  . LEU A 1 35  ? 14.279  -8.622  -8.100  1.00 0.00 ? 35  LEU A HB2  5  
ATOM   9332  H  HB3  . LEU A 1 35  ? 12.680  -9.028  -8.687  1.00 0.00 ? 35  LEU A HB3  5  
ATOM   9333  H  HG   . LEU A 1 35  ? 14.528  -6.865  -9.658  1.00 0.00 ? 35  LEU A HG   5  
ATOM   9334  H  HD11 . LEU A 1 35  ? 14.673  -8.065  -11.576 1.00 0.00 ? 35  LEU A HD11 5  
ATOM   9335  H  HD12 . LEU A 1 35  ? 13.036  -8.704  -11.434 1.00 0.00 ? 35  LEU A HD12 5  
ATOM   9336  H  HD13 . LEU A 1 35  ? 14.338  -9.392  -10.464 1.00 0.00 ? 35  LEU A HD13 5  
ATOM   9337  H  HD21 . LEU A 1 35  ? 12.283  -6.696  -11.238 1.00 0.00 ? 35  LEU A HD21 5  
ATOM   9338  H  HD22 . LEU A 1 35  ? 12.751  -5.549  -9.983  1.00 0.00 ? 35  LEU A HD22 5  
ATOM   9339  H  HD23 . LEU A 1 35  ? 11.614  -6.845  -9.613  1.00 0.00 ? 35  LEU A HD23 5  
ATOM   9340  N  N    . ARG A 1 36  ? 13.743  -8.187  -5.340  1.00 0.00 ? 36  ARG A N    5  
ATOM   9341  C  CA   . ARG A 1 36  ? 13.771  -8.891  -4.068  1.00 0.00 ? 36  ARG A CA   5  
ATOM   9342  C  C    . ARG A 1 36  ? 12.975  -8.111  -3.029  1.00 0.00 ? 36  ARG A C    5  
ATOM   9343  O  O    . ARG A 1 36  ? 12.455  -8.680  -2.069  1.00 0.00 ? 36  ARG A O    5  
ATOM   9344  C  CB   . ARG A 1 36  ? 15.213  -9.082  -3.593  1.00 0.00 ? 36  ARG A CB   5  
ATOM   9345  C  CG   . ARG A 1 36  ? 15.466  -10.435 -2.944  1.00 0.00 ? 36  ARG A CG   5  
ATOM   9346  C  CD   . ARG A 1 36  ? 15.861  -10.292 -1.482  1.00 0.00 ? 36  ARG A CD   5  
ATOM   9347  N  NE   . ARG A 1 36  ? 16.919  -11.226 -1.108  1.00 0.00 ? 36  ARG A NE   5  
ATOM   9348  C  CZ   . ARG A 1 36  ? 16.761  -12.547 -1.065  1.00 0.00 ? 36  ARG A CZ   5  
ATOM   9349  N  NH1  . ARG A 1 36  ? 15.591  -13.092 -1.370  1.00 0.00 ? 36  ARG A NH1  5  
ATOM   9350  N  NH2  . ARG A 1 36  ? 17.777  -13.325 -0.718  1.00 0.00 ? 36  ARG A NH2  5  
ATOM   9351  H  H    . ARG A 1 36  ? 14.550  -7.720  -5.651  1.00 0.00 ? 36  ARG A H    5  
ATOM   9352  H  HA   . ARG A 1 36  ? 13.311  -9.858  -4.211  1.00 0.00 ? 36  ARG A HA   5  
ATOM   9353  H  HB2  . ARG A 1 36  ? 15.874  -8.985  -4.441  1.00 0.00 ? 36  ARG A HB2  5  
ATOM   9354  H  HB3  . ARG A 1 36  ? 15.448  -8.311  -2.874  1.00 0.00 ? 36  ARG A HB3  5  
ATOM   9355  H  HG2  . ARG A 1 36  ? 14.565  -11.026 -3.007  1.00 0.00 ? 36  ARG A HG2  5  
ATOM   9356  H  HG3  . ARG A 1 36  ? 16.263  -10.934 -3.476  1.00 0.00 ? 36  ARG A HG3  5  
ATOM   9357  H  HD2  . ARG A 1 36  ? 16.208  -9.284  -1.313  1.00 0.00 ? 36  ARG A HD2  5  
ATOM   9358  H  HD3  . ARG A 1 36  ? 14.992  -10.481 -0.869  1.00 0.00 ? 36  ARG A HD3  5  
ATOM   9359  H  HE   . ARG A 1 36  ? 17.794  -10.850 -0.875  1.00 0.00 ? 36  ARG A HE   5  
ATOM   9360  H  HH11 . ARG A 1 36  ? 14.820  -12.511 -1.633  1.00 0.00 ? 36  ARG A HH11 5  
ATOM   9361  H  HH12 . ARG A 1 36  ? 15.479  -14.085 -1.337  1.00 0.00 ? 36  ARG A HH12 5  
ATOM   9362  H  HH21 . ARG A 1 36  ? 18.662  -12.920 -0.489  1.00 0.00 ? 36  ARG A HH21 5  
ATOM   9363  H  HH22 . ARG A 1 36  ? 17.658  -14.318 -0.686  1.00 0.00 ? 36  ARG A HH22 5  
ATOM   9364  N  N    . ALA A 1 37  ? 12.891  -6.799  -3.234  1.00 0.00 ? 37  ALA A N    5  
ATOM   9365  C  CA   . ALA A 1 37  ? 12.171  -5.926  -2.332  1.00 0.00 ? 37  ALA A CA   5  
ATOM   9366  C  C    . ALA A 1 37  ? 10.702  -5.788  -2.727  1.00 0.00 ? 37  ALA A C    5  
ATOM   9367  O  O    . ALA A 1 37  ? 9.813   -6.007  -1.905  1.00 0.00 ? 37  ALA A O    5  
ATOM   9368  C  CB   . ALA A 1 37  ? 12.834  -4.561  -2.287  1.00 0.00 ? 37  ALA A CB   5  
ATOM   9369  H  H    . ALA A 1 37  ? 13.330  -6.410  -4.008  1.00 0.00 ? 37  ALA A H    5  
ATOM   9370  H  HA   . ALA A 1 37  ? 12.230  -6.356  -1.353  1.00 0.00 ? 37  ALA A HA   5  
ATOM   9371  H  HB1  . ALA A 1 37  ? 12.279  -3.913  -1.626  1.00 0.00 ? 37  ALA A HB1  5  
ATOM   9372  H  HB2  . ALA A 1 37  ? 12.850  -4.136  -3.280  1.00 0.00 ? 37  ALA A HB2  5  
ATOM   9373  H  HB3  . ALA A 1 37  ? 13.845  -4.665  -1.923  1.00 0.00 ? 37  ALA A HB3  5  
ATOM   9374  N  N    . LEU A 1 38  ? 10.445  -5.418  -3.984  1.00 0.00 ? 38  LEU A N    5  
ATOM   9375  C  CA   . LEU A 1 38  ? 9.069   -5.253  -4.448  1.00 0.00 ? 38  LEU A CA   5  
ATOM   9376  C  C    . LEU A 1 38  ? 8.282   -6.557  -4.316  1.00 0.00 ? 38  LEU A C    5  
ATOM   9377  O  O    . LEU A 1 38  ? 7.050   -6.549  -4.308  1.00 0.00 ? 38  LEU A O    5  
ATOM   9378  C  CB   . LEU A 1 38  ? 9.030   -4.742  -5.898  1.00 0.00 ? 38  LEU A CB   5  
ATOM   9379  C  CG   . LEU A 1 38  ? 8.953   -5.815  -6.987  1.00 0.00 ? 38  LEU A CG   5  
ATOM   9380  C  CD1  . LEU A 1 38  ? 7.518   -6.283  -7.174  1.00 0.00 ? 38  LEU A CD1  5  
ATOM   9381  C  CD2  . LEU A 1 38  ? 9.505   -5.282  -8.299  1.00 0.00 ? 38  LEU A CD2  5  
ATOM   9382  H  H    . LEU A 1 38  ? 11.193  -5.249  -4.606  1.00 0.00 ? 38  LEU A H    5  
ATOM   9383  H  HA   . LEU A 1 38  ? 8.604   -4.514  -3.811  1.00 0.00 ? 38  LEU A HA   5  
ATOM   9384  H  HB2  . LEU A 1 38  ? 8.169   -4.099  -6.002  1.00 0.00 ? 38  LEU A HB2  5  
ATOM   9385  H  HB3  . LEU A 1 38  ? 9.915   -4.150  -6.070  1.00 0.00 ? 38  LEU A HB3  5  
ATOM   9386  H  HG   . LEU A 1 38  ? 9.549   -6.666  -6.691  1.00 0.00 ? 38  LEU A HG   5  
ATOM   9387  H  HD11 . LEU A 1 38  ? 6.843   -5.477  -6.923  1.00 0.00 ? 38  LEU A HD11 5  
ATOM   9388  H  HD12 . LEU A 1 38  ? 7.327   -7.127  -6.531  1.00 0.00 ? 38  LEU A HD12 5  
ATOM   9389  H  HD13 . LEU A 1 38  ? 7.365   -6.571  -8.204  1.00 0.00 ? 38  LEU A HD13 5  
ATOM   9390  H  HD21 . LEU A 1 38  ? 9.929   -6.094  -8.868  1.00 0.00 ? 38  LEU A HD21 5  
ATOM   9391  H  HD22 . LEU A 1 38  ? 10.268  -4.546  -8.097  1.00 0.00 ? 38  LEU A HD22 5  
ATOM   9392  H  HD23 . LEU A 1 38  ? 8.706   -4.825  -8.865  1.00 0.00 ? 38  LEU A HD23 5  
ATOM   9393  N  N    . ASP A 1 39  ? 8.995   -7.674  -4.207  1.00 0.00 ? 39  ASP A N    5  
ATOM   9394  C  CA   . ASP A 1 39  ? 8.355   -8.976  -4.071  1.00 0.00 ? 39  ASP A CA   5  
ATOM   9395  C  C    . ASP A 1 39  ? 8.267   -9.377  -2.604  1.00 0.00 ? 39  ASP A C    5  
ATOM   9396  O  O    . ASP A 1 39  ? 8.562   -10.515 -2.237  1.00 0.00 ? 39  ASP A O    5  
ATOM   9397  C  CB   . ASP A 1 39  ? 9.120   -10.037 -4.865  1.00 0.00 ? 39  ASP A CB   5  
ATOM   9398  C  CG   . ASP A 1 39  ? 8.228   -11.177 -5.315  1.00 0.00 ? 39  ASP A CG   5  
ATOM   9399  O  OD1  . ASP A 1 39  ? 7.462   -11.698 -4.478  1.00 0.00 ? 39  ASP A OD1  5  
ATOM   9400  O  OD2  . ASP A 1 39  ? 8.296   -11.549 -6.505  1.00 0.00 ? 39  ASP A OD2  5  
ATOM   9401  H  H    . ASP A 1 39  ? 9.970   -7.624  -4.216  1.00 0.00 ? 39  ASP A H    5  
ATOM   9402  H  HA   . ASP A 1 39  ? 7.354   -8.893  -4.465  1.00 0.00 ? 39  ASP A HA   5  
ATOM   9403  H  HB2  . ASP A 1 39  ? 9.555   -9.578  -5.739  1.00 0.00 ? 39  ASP A HB2  5  
ATOM   9404  H  HB3  . ASP A 1 39  ? 9.908   -10.442 -4.246  1.00 0.00 ? 39  ASP A HB3  5  
ATOM   9405  N  N    . GLN A 1 40  ? 7.854   -8.430  -1.774  1.00 0.00 ? 40  GLN A N    5  
ATOM   9406  C  CA   . GLN A 1 40  ? 7.715   -8.668  -0.343  1.00 0.00 ? 40  GLN A CA   5  
ATOM   9407  C  C    . GLN A 1 40  ? 6.299   -8.347  0.112   1.00 0.00 ? 40  GLN A C    5  
ATOM   9408  O  O    . GLN A 1 40  ? 6.090   -7.627  1.088   1.00 0.00 ? 40  GLN A O    5  
ATOM   9409  C  CB   . GLN A 1 40  ? 8.726   -7.827  0.438   1.00 0.00 ? 40  GLN A CB   5  
ATOM   9410  C  CG   . GLN A 1 40  ? 8.752   -8.132  1.927   1.00 0.00 ? 40  GLN A CG   5  
ATOM   9411  C  CD   . GLN A 1 40  ? 10.024  -7.654  2.598   1.00 0.00 ? 40  GLN A CD   5  
ATOM   9412  O  OE1  . GLN A 1 40  ? 10.817  -6.925  2.003   1.00 0.00 ? 40  GLN A OE1  5  
ATOM   9413  N  NE2  . GLN A 1 40  ? 10.226  -8.066  3.845   1.00 0.00 ? 40  GLN A NE2  5  
ATOM   9414  H  H    . GLN A 1 40  ? 7.630   -7.547  -2.135  1.00 0.00 ? 40  GLN A H    5  
ATOM   9415  H  HA   . GLN A 1 40  ? 7.908   -9.713  -0.162  1.00 0.00 ? 40  GLN A HA   5  
ATOM   9416  H  HB2  . GLN A 1 40  ? 9.712   -8.008  0.039   1.00 0.00 ? 40  GLN A HB2  5  
ATOM   9417  H  HB3  . GLN A 1 40  ? 8.482   -6.782  0.312   1.00 0.00 ? 40  GLN A HB3  5  
ATOM   9418  H  HG2  . GLN A 1 40  ? 7.911   -7.644  2.397   1.00 0.00 ? 40  GLN A HG2  5  
ATOM   9419  H  HG3  . GLN A 1 40  ? 8.669   -9.201  2.064   1.00 0.00 ? 40  GLN A HG3  5  
ATOM   9420  H  HE21 . GLN A 1 40  ? 9.552   -8.647  4.256   1.00 0.00 ? 40  GLN A HE21 5  
ATOM   9421  H  HE22 . GLN A 1 40  ? 11.041  -7.772  4.303   1.00 0.00 ? 40  GLN A HE22 5  
ATOM   9422  N  N    . VAL A 1 41  ? 5.329   -8.891  -0.613  1.00 0.00 ? 41  VAL A N    5  
ATOM   9423  C  CA   . VAL A 1 41  ? 3.919   -8.675  -0.304  1.00 0.00 ? 41  VAL A CA   5  
ATOM   9424  C  C    . VAL A 1 41  ? 3.625   -8.927  1.173   1.00 0.00 ? 41  VAL A C    5  
ATOM   9425  O  O    . VAL A 1 41  ? 2.830   -8.216  1.786   1.00 0.00 ? 41  VAL A O    5  
ATOM   9426  C  CB   . VAL A 1 41  ? 3.014   -9.585  -1.156  1.00 0.00 ? 41  VAL A CB   5  
ATOM   9427  C  CG1  . VAL A 1 41  ? 1.550   -9.220  -0.962  1.00 0.00 ? 41  VAL A CG1  5  
ATOM   9428  C  CG2  . VAL A 1 41  ? 3.403   -9.499  -2.625  1.00 0.00 ? 41  VAL A CG2  5  
ATOM   9429  H  H    . VAL A 1 41  ? 5.571   -9.453  -1.379  1.00 0.00 ? 41  VAL A H    5  
ATOM   9430  H  HA   . VAL A 1 41  ? 3.680   -7.648  -0.537  1.00 0.00 ? 41  VAL A HA   5  
ATOM   9431  H  HB   . VAL A 1 41  ? 3.154   -10.606 -0.829  1.00 0.00 ? 41  VAL A HB   5  
ATOM   9432  H  HG11 . VAL A 1 41  ? 1.308   -8.366  -1.577  1.00 0.00 ? 41  VAL A HG11 5  
ATOM   9433  H  HG12 . VAL A 1 41  ? 1.375   -8.979  0.075   1.00 0.00 ? 41  VAL A HG12 5  
ATOM   9434  H  HG13 . VAL A 1 41  ? 0.930   -10.057 -1.247  1.00 0.00 ? 41  VAL A HG13 5  
ATOM   9435  H  HG21 . VAL A 1 41  ? 4.297   -10.080 -2.796  1.00 0.00 ? 41  VAL A HG21 5  
ATOM   9436  H  HG22 . VAL A 1 41  ? 3.587   -8.468  -2.888  1.00 0.00 ? 41  VAL A HG22 5  
ATOM   9437  H  HG23 . VAL A 1 41  ? 2.599   -9.888  -3.233  1.00 0.00 ? 41  VAL A HG23 5  
ATOM   9438  N  N    . ASN A 1 42  ? 4.272   -9.941  1.735   1.00 0.00 ? 42  ASN A N    5  
ATOM   9439  C  CA   . ASN A 1 42  ? 4.079   -10.284 3.140   1.00 0.00 ? 42  ASN A CA   5  
ATOM   9440  C  C    . ASN A 1 42  ? 5.413   -10.586 3.815   1.00 0.00 ? 42  ASN A C    5  
ATOM   9441  O  O    . ASN A 1 42  ? 5.789   -9.838  4.743   1.00 0.00 ? 42  ASN A O    5  
ATOM   9442  C  CB   . ASN A 1 42  ? 3.146   -11.488 3.269   1.00 0.00 ? 42  ASN A CB   5  
ATOM   9443  C  CG   . ASN A 1 42  ? 1.685   -11.084 3.317   1.00 0.00 ? 42  ASN A CG   5  
ATOM   9444  O  OD1  . ASN A 1 42  ? 0.879   -11.526 2.498   1.00 0.00 ? 42  ASN A OD1  5  
ATOM   9445  N  ND2  . ASN A 1 42  ? 1.336   -10.239 4.282   1.00 0.00 ? 42  ASN A ND2  5  
ATOM   9446  O  OXT  . ASN A 1 42  ? 6.070   -11.568 3.412   1.00 0.00 ? 42  ASN A OXT  5  
ATOM   9447  H  H    . ASN A 1 42  ? 4.894   -10.472 1.196   1.00 0.00 ? 42  ASN A H    5  
ATOM   9448  H  HA   . ASN A 1 42  ? 3.627   -9.434  3.629   1.00 0.00 ? 42  ASN A HA   5  
ATOM   9449  H  HB2  . ASN A 1 42  ? 3.291   -12.142 2.423   1.00 0.00 ? 42  ASN A HB2  5  
ATOM   9450  H  HB3  . ASN A 1 42  ? 3.383   -12.024 4.177   1.00 0.00 ? 42  ASN A HB3  5  
ATOM   9451  H  HD21 . ASN A 1 42  ? 2.031   -9.930  4.899   1.00 0.00 ? 42  ASN A HD21 5  
ATOM   9452  H  HD22 . ASN A 1 42  ? 0.398   -9.961  4.335   1.00 0.00 ? 42  ASN A HD22 5  
ATOM   9453  N  N    . MET B 2 1   ? 15.181  31.228  -5.191  1.00 0.00 ? 101 MET B N    5  
ATOM   9454  C  CA   . MET B 2 1   ? 13.867  31.800  -4.793  1.00 0.00 ? 101 MET B CA   5  
ATOM   9455  C  C    . MET B 2 1   ? 13.053  32.216  -6.014  1.00 0.00 ? 101 MET B C    5  
ATOM   9456  O  O    . MET B 2 1   ? 13.555  32.904  -6.902  1.00 0.00 ? 101 MET B O    5  
ATOM   9457  C  CB   . MET B 2 1   ? 14.117  33.008  -3.888  1.00 0.00 ? 101 MET B CB   5  
ATOM   9458  C  CG   . MET B 2 1   ? 14.521  32.635  -2.472  1.00 0.00 ? 101 MET B CG   5  
ATOM   9459  S  SD   . MET B 2 1   ? 15.505  33.915  -1.670  1.00 0.00 ? 101 MET B SD   5  
ATOM   9460  C  CE   . MET B 2 1   ? 17.163  33.314  -1.984  1.00 0.00 ? 101 MET B CE   5  
ATOM   9461  H  H1   . MET B 2 1   ? 15.712  31.017  -4.323  1.00 0.00 ? 101 MET B H1   5  
ATOM   9462  H  H2   . MET B 2 1   ? 15.673  31.939  -5.770  1.00 0.00 ? 101 MET B H2   5  
ATOM   9463  H  H3   . MET B 2 1   ? 14.998  30.362  -5.736  1.00 0.00 ? 101 MET B H3   5  
ATOM   9464  H  HA   . MET B 2 1   ? 13.319  31.050  -4.242  1.00 0.00 ? 101 MET B HA   5  
ATOM   9465  H  HB2  . MET B 2 1   ? 14.905  33.608  -4.318  1.00 0.00 ? 101 MET B HB2  5  
ATOM   9466  H  HB3  . MET B 2 1   ? 13.213  33.598  -3.838  1.00 0.00 ? 101 MET B HB3  5  
ATOM   9467  H  HG2  . MET B 2 1   ? 13.627  32.471  -1.887  1.00 0.00 ? 101 MET B HG2  5  
ATOM   9468  H  HG3  . MET B 2 1   ? 15.100  31.723  -2.504  1.00 0.00 ? 101 MET B HG3  5  
ATOM   9469  H  HE1  . MET B 2 1   ? 17.751  33.389  -1.080  1.00 0.00 ? 101 MET B HE1  5  
ATOM   9470  H  HE2  . MET B 2 1   ? 17.621  33.909  -2.761  1.00 0.00 ? 101 MET B HE2  5  
ATOM   9471  H  HE3  . MET B 2 1   ? 17.119  32.283  -2.301  1.00 0.00 ? 101 MET B HE3  5  
ATOM   9472  N  N    . GLY B 2 2   ? 11.794  31.793  -6.051  1.00 0.00 ? 102 GLY B N    5  
ATOM   9473  C  CA   . GLY B 2 2   ? 10.929  32.131  -7.167  1.00 0.00 ? 102 GLY B CA   5  
ATOM   9474  C  C    . GLY B 2 2   ? 10.104  30.951  -7.640  1.00 0.00 ? 102 GLY B C    5  
ATOM   9475  O  O    . GLY B 2 2   ? 8.879   31.034  -7.717  1.00 0.00 ? 102 GLY B O    5  
ATOM   9476  H  H    . GLY B 2 2   ? 11.447  31.247  -5.314  1.00 0.00 ? 102 GLY B H    5  
ATOM   9477  H  HA2  . GLY B 2 2   ? 10.262  32.924  -6.863  1.00 0.00 ? 102 GLY B HA2  5  
ATOM   9478  H  HA3  . GLY B 2 2   ? 11.540  32.482  -7.986  1.00 0.00 ? 102 GLY B HA3  5  
ATOM   9479  N  N    . SER B 2 3   ? 10.777  29.850  -7.958  1.00 0.00 ? 103 SER B N    5  
ATOM   9480  C  CA   . SER B 2 3   ? 10.098  28.647  -8.426  1.00 0.00 ? 103 SER B CA   5  
ATOM   9481  C  C    . SER B 2 3   ? 9.295   28.003  -7.302  1.00 0.00 ? 103 SER B C    5  
ATOM   9482  O  O    . SER B 2 3   ? 9.858   27.542  -6.307  1.00 0.00 ? 103 SER B O    5  
ATOM   9483  C  CB   . SER B 2 3   ? 11.112  27.647  -8.983  1.00 0.00 ? 103 SER B CB   5  
ATOM   9484  O  OG   . SER B 2 3   ? 11.939  27.133  -7.953  1.00 0.00 ? 103 SER B OG   5  
ATOM   9485  H  H    . SER B 2 3   ? 11.754  29.846  -7.875  1.00 0.00 ? 103 SER B H    5  
ATOM   9486  H  HA   . SER B 2 3   ? 9.421   28.936  -9.216  1.00 0.00 ? 103 SER B HA   5  
ATOM   9487  H  HB2  . SER B 2 3   ? 10.588  26.826  -9.448  1.00 0.00 ? 103 SER B HB2  5  
ATOM   9488  H  HB3  . SER B 2 3   ? 11.735  28.139  -9.715  1.00 0.00 ? 103 SER B HB3  5  
ATOM   9489  H  HG   . SER B 2 3   ? 12.668  27.738  -7.795  1.00 0.00 ? 103 SER B HG   5  
ATOM   9490  N  N    . GLY B 2 4   ? 7.975   27.974  -7.464  1.00 0.00 ? 104 GLY B N    5  
ATOM   9491  C  CA   . GLY B 2 4   ? 7.117   27.383  -6.455  1.00 0.00 ? 104 GLY B CA   5  
ATOM   9492  C  C    . GLY B 2 4   ? 5.799   26.897  -7.026  1.00 0.00 ? 104 GLY B C    5  
ATOM   9493  O  O    . GLY B 2 4   ? 4.784   27.588  -6.936  1.00 0.00 ? 104 GLY B O    5  
ATOM   9494  H  H    . GLY B 2 4   ? 7.584   28.356  -8.276  1.00 0.00 ? 104 GLY B H    5  
ATOM   9495  H  HA2  . GLY B 2 4   ? 7.632   26.547  -6.004  1.00 0.00 ? 104 GLY B HA2  5  
ATOM   9496  H  HA3  . GLY B 2 4   ? 6.916   28.121  -5.693  1.00 0.00 ? 104 GLY B HA3  5  
ATOM   9497  N  N    . ALA B 2 5   ? 5.814   25.707  -7.616  1.00 0.00 ? 105 ALA B N    5  
ATOM   9498  C  CA   . ALA B 2 5   ? 4.612   25.129  -8.203  1.00 0.00 ? 105 ALA B CA   5  
ATOM   9499  C  C    . ALA B 2 5   ? 4.429   23.680  -7.767  1.00 0.00 ? 105 ALA B C    5  
ATOM   9500  O  O    . ALA B 2 5   ? 5.183   22.798  -8.180  1.00 0.00 ? 105 ALA B O    5  
ATOM   9501  C  CB   . ALA B 2 5   ? 4.669   25.225  -9.720  1.00 0.00 ? 105 ALA B CB   5  
ATOM   9502  H  H    . ALA B 2 5   ? 6.655   25.204  -7.656  1.00 0.00 ? 105 ALA B H    5  
ATOM   9503  H  HA   . ALA B 2 5   ? 3.765   25.707  -7.862  1.00 0.00 ? 105 ALA B HA   5  
ATOM   9504  H  HB1  . ALA B 2 5   ? 4.309   26.193  -10.035 1.00 0.00 ? 105 ALA B HB1  5  
ATOM   9505  H  HB2  . ALA B 2 5   ? 4.049   24.453  -10.153 1.00 0.00 ? 105 ALA B HB2  5  
ATOM   9506  H  HB3  . ALA B 2 5   ? 5.688   25.095  -10.051 1.00 0.00 ? 105 ALA B HB3  5  
ATOM   9507  N  N    . HIS B 2 6   ? 3.425   23.441  -6.931  1.00 0.00 ? 106 HIS B N    5  
ATOM   9508  C  CA   . HIS B 2 6   ? 3.143   22.097  -6.440  1.00 0.00 ? 106 HIS B CA   5  
ATOM   9509  C  C    . HIS B 2 6   ? 2.544   21.230  -7.543  1.00 0.00 ? 106 HIS B C    5  
ATOM   9510  O  O    . HIS B 2 6   ? 3.140   20.234  -7.954  1.00 0.00 ? 106 HIS B O    5  
ATOM   9511  C  CB   . HIS B 2 6   ? 2.190   22.157  -5.244  1.00 0.00 ? 106 HIS B CB   5  
ATOM   9512  C  CG   . HIS B 2 6   ? 2.810   21.698  -3.960  1.00 0.00 ? 106 HIS B CG   5  
ATOM   9513  N  ND1  . HIS B 2 6   ? 2.086   21.128  -2.934  1.00 0.00 ? 106 HIS B ND1  5  
ATOM   9514  C  CD2  . HIS B 2 6   ? 4.097   21.726  -3.539  1.00 0.00 ? 106 HIS B CD2  5  
ATOM   9515  C  CE1  . HIS B 2 6   ? 2.900   20.825  -1.939  1.00 0.00 ? 106 HIS B CE1  5  
ATOM   9516  N  NE2  . HIS B 2 6   ? 4.125   21.178  -2.281  1.00 0.00 ? 106 HIS B NE2  5  
ATOM   9517  H  H    . HIS B 2 6   ? 2.859   24.185  -6.638  1.00 0.00 ? 106 HIS B H    5  
ATOM   9518  H  HA   . HIS B 2 6   ? 4.077   21.659  -6.122  1.00 0.00 ? 106 HIS B HA   5  
ATOM   9519  H  HB2  . HIS B 2 6   ? 1.861   23.177  -5.105  1.00 0.00 ? 106 HIS B HB2  5  
ATOM   9520  H  HB3  . HIS B 2 6   ? 1.331   21.531  -5.441  1.00 0.00 ? 106 HIS B HB3  5  
ATOM   9521  H  HD1  . HIS B 2 6   ? 1.119   20.968  -2.937  1.00 0.00 ? 106 HIS B HD1  5  
ATOM   9522  H  HD2  . HIS B 2 6   ? 4.944   22.108  -4.090  1.00 0.00 ? 106 HIS B HD2  5  
ATOM   9523  H  HE1  . HIS B 2 6   ? 2.611   20.367  -1.004  1.00 0.00 ? 106 HIS B HE1  5  
ATOM   9524  H  HE2  . HIS B 2 6   ? 4.933   20.988  -1.759  1.00 0.00 ? 106 HIS B HE2  5  
ATOM   9525  N  N    . THR B 2 7   ? 1.364   21.618  -8.018  1.00 0.00 ? 107 THR B N    5  
ATOM   9526  C  CA   . THR B 2 7   ? 0.678   20.880  -9.074  1.00 0.00 ? 107 THR B CA   5  
ATOM   9527  C  C    . THR B 2 7   ? 0.342   19.462  -8.622  1.00 0.00 ? 107 THR B C    5  
ATOM   9528  O  O    . THR B 2 7   ? 1.114   18.829  -7.901  1.00 0.00 ? 107 THR B O    5  
ATOM   9529  C  CB   . THR B 2 7   ? 1.535   20.836  -10.344 1.00 0.00 ? 107 THR B CB   5  
ATOM   9530  O  OG1  . THR B 2 7   ? 2.487   19.789  -10.275 1.00 0.00 ? 107 THR B OG1  5  
ATOM   9531  C  CG2  . THR B 2 7   ? 2.287   22.123  -10.610 1.00 0.00 ? 107 THR B CG2  5  
ATOM   9532  H  H    . THR B 2 7   ? 0.943   22.421  -7.647  1.00 0.00 ? 107 THR B H    5  
ATOM   9533  H  HA   . THR B 2 7   ? -0.243  21.400  -9.293  1.00 0.00 ? 107 THR B HA   5  
ATOM   9534  H  HB   . THR B 2 7   ? 0.890   20.650  -11.192 1.00 0.00 ? 107 THR B HB   5  
ATOM   9535  H  HG1  . THR B 2 7   ? 2.684   19.478  -11.162 1.00 0.00 ? 107 THR B HG1  5  
ATOM   9536  H  HG21 . THR B 2 7   ? 2.868   22.386  -9.739  1.00 0.00 ? 107 THR B HG21 5  
ATOM   9537  H  HG22 . THR B 2 7   ? 1.583   22.914  -10.825 1.00 0.00 ? 107 THR B HG22 5  
ATOM   9538  H  HG23 . THR B 2 7   ? 2.946   21.988  -11.454 1.00 0.00 ? 107 THR B HG23 5  
ATOM   9539  N  N    . ALA B 2 8   ? -0.815  18.967  -9.053  1.00 0.00 ? 108 ALA B N    5  
ATOM   9540  C  CA   . ALA B 2 8   ? -1.255  17.624  -8.697  1.00 0.00 ? 108 ALA B CA   5  
ATOM   9541  C  C    . ALA B 2 8   ? -2.632  17.325  -9.282  1.00 0.00 ? 108 ALA B C    5  
ATOM   9542  O  O    . ALA B 2 8   ? -3.590  18.062  -9.048  1.00 0.00 ? 108 ALA B O    5  
ATOM   9543  C  CB   . ALA B 2 8   ? -1.276  17.453  -7.185  1.00 0.00 ? 108 ALA B CB   5  
ATOM   9544  H  H    . ALA B 2 8   ? -1.385  19.519  -9.626  1.00 0.00 ? 108 ALA B H    5  
ATOM   9545  H  HA   . ALA B 2 8   ? -0.543  16.924  -9.105  1.00 0.00 ? 108 ALA B HA   5  
ATOM   9546  H  HB1  . ALA B 2 8   ? -1.584  18.379  -6.721  1.00 0.00 ? 108 ALA B HB1  5  
ATOM   9547  H  HB2  . ALA B 2 8   ? -0.287  17.188  -6.838  1.00 0.00 ? 108 ALA B HB2  5  
ATOM   9548  H  HB3  . ALA B 2 8   ? -1.972  16.671  -6.920  1.00 0.00 ? 108 ALA B HB3  5  
ATOM   9549  N  N    . ASP B 2 9   ? -2.722  16.240  -10.043 1.00 0.00 ? 109 ASP B N    5  
ATOM   9550  C  CA   . ASP B 2 9   ? -3.981  15.842  -10.662 1.00 0.00 ? 109 ASP B CA   5  
ATOM   9551  C  C    . ASP B 2 9   ? -4.327  14.396  -10.308 1.00 0.00 ? 109 ASP B C    5  
ATOM   9552  O  O    . ASP B 2 9   ? -3.697  13.462  -10.804 1.00 0.00 ? 109 ASP B O    5  
ATOM   9553  C  CB   . ASP B 2 9   ? -3.898  16.002  -12.181 1.00 0.00 ? 109 ASP B CB   5  
ATOM   9554  C  CG   . ASP B 2 9   ? -5.230  16.382  -12.795 1.00 0.00 ? 109 ASP B CG   5  
ATOM   9555  O  OD1  . ASP B 2 9   ? -6.272  16.153  -12.144 1.00 0.00 ? 109 ASP B OD1  5  
ATOM   9556  O  OD2  . ASP B 2 9   ? -5.233  16.910  -13.927 1.00 0.00 ? 109 ASP B OD2  5  
ATOM   9557  H  H    . ASP B 2 9   ? -1.922  15.693  -10.192 1.00 0.00 ? 109 ASP B H    5  
ATOM   9558  H  HA   . ASP B 2 9   ? -4.755  16.492  -10.284 1.00 0.00 ? 109 ASP B HA   5  
ATOM   9559  H  HB2  . ASP B 2 9   ? -3.180  16.772  -12.417 1.00 0.00 ? 109 ASP B HB2  5  
ATOM   9560  H  HB3  . ASP B 2 9   ? -3.575  15.068  -12.617 1.00 0.00 ? 109 ASP B HB3  5  
ATOM   9561  N  N    . PRO B 2 10  ? -5.339  14.187  -9.445  1.00 0.00 ? 110 PRO B N    5  
ATOM   9562  C  CA   . PRO B 2 10  ? -5.759  12.843  -9.033  1.00 0.00 ? 110 PRO B CA   5  
ATOM   9563  C  C    . PRO B 2 10  ? -5.995  11.916  -10.222 1.00 0.00 ? 110 PRO B C    5  
ATOM   9564  O  O    . PRO B 2 10  ? -5.915  10.694  -10.094 1.00 0.00 ? 110 PRO B O    5  
ATOM   9565  C  CB   . PRO B 2 10  ? -7.068  13.094  -8.284  1.00 0.00 ? 110 PRO B CB   5  
ATOM   9566  C  CG   . PRO B 2 10  ? -6.949  14.487  -7.772  1.00 0.00 ? 110 PRO B CG   5  
ATOM   9567  C  CD   . PRO B 2 10  ? -6.149  15.239  -8.801  1.00 0.00 ? 110 PRO B CD   5  
ATOM   9568  H  HA   . PRO B 2 10  ? -5.040  12.392  -8.365  1.00 0.00 ? 110 PRO B HA   5  
ATOM   9569  H  HB2  . PRO B 2 10  ? -7.901  12.991  -8.964  1.00 0.00 ? 110 PRO B HB2  5  
ATOM   9570  H  HB3  . PRO B 2 10  ? -7.166  12.385  -7.475  1.00 0.00 ? 110 PRO B HB3  5  
ATOM   9571  H  HG2  . PRO B 2 10  ? -7.931  14.925  -7.667  1.00 0.00 ? 110 PRO B HG2  5  
ATOM   9572  H  HG3  . PRO B 2 10  ? -6.433  14.488  -6.824  1.00 0.00 ? 110 PRO B HG3  5  
ATOM   9573  H  HD2  . PRO B 2 10  ? -6.805  15.712  -9.517  1.00 0.00 ? 110 PRO B HD2  5  
ATOM   9574  H  HD3  . PRO B 2 10  ? -5.517  15.974  -8.325  1.00 0.00 ? 110 PRO B HD3  5  
ATOM   9575  N  N    . GLU B 2 11  ? -6.290  12.504  -11.378 1.00 0.00 ? 111 GLU B N    5  
ATOM   9576  C  CA   . GLU B 2 11  ? -6.544  11.734  -12.589 1.00 0.00 ? 111 GLU B CA   5  
ATOM   9577  C  C    . GLU B 2 11  ? -5.387  10.793  -12.907 1.00 0.00 ? 111 GLU B C    5  
ATOM   9578  O  O    . GLU B 2 11  ? -5.556  9.803   -13.619 1.00 0.00 ? 111 GLU B O    5  
ATOM   9579  C  CB   . GLU B 2 11  ? -6.798  12.670  -13.771 1.00 0.00 ? 111 GLU B CB   5  
ATOM   9580  C  CG   . GLU B 2 11  ? -7.703  12.072  -14.835 1.00 0.00 ? 111 GLU B CG   5  
ATOM   9581  C  CD   . GLU B 2 11  ? -6.937  11.603  -16.057 1.00 0.00 ? 111 GLU B CD   5  
ATOM   9582  O  OE1  . GLU B 2 11  ? -6.129  12.393  -16.590 1.00 0.00 ? 111 GLU B OE1  5  
ATOM   9583  O  OE2  . GLU B 2 11  ? -7.145  10.447  -16.480 1.00 0.00 ? 111 GLU B OE2  5  
ATOM   9584  H  H    . GLU B 2 11  ? -6.347  13.477  -11.418 1.00 0.00 ? 111 GLU B H    5  
ATOM   9585  H  HA   . GLU B 2 11  ? -7.422  11.148  -12.413 1.00 0.00 ? 111 GLU B HA   5  
ATOM   9586  H  HB2  . GLU B 2 11  ? -7.259  13.576  -13.405 1.00 0.00 ? 111 GLU B HB2  5  
ATOM   9587  H  HB3  . GLU B 2 11  ? -5.852  12.916  -14.230 1.00 0.00 ? 111 GLU B HB3  5  
ATOM   9588  H  HG2  . GLU B 2 11  ? -8.227  11.227  -14.412 1.00 0.00 ? 111 GLU B HG2  5  
ATOM   9589  H  HG3  . GLU B 2 11  ? -8.419  12.821  -15.143 1.00 0.00 ? 111 GLU B HG3  5  
ATOM   9590  N  N    . LYS B 2 12  ? -4.216  11.109  -12.376 1.00 0.00 ? 112 LYS B N    5  
ATOM   9591  C  CA   . LYS B 2 12  ? -3.027  10.293  -12.601 1.00 0.00 ? 112 LYS B CA   5  
ATOM   9592  C  C    . LYS B 2 12  ? -2.919  9.187   -11.558 1.00 0.00 ? 112 LYS B C    5  
ATOM   9593  O  O    . LYS B 2 12  ? -2.345  8.130   -11.820 1.00 0.00 ? 112 LYS B O    5  
ATOM   9594  C  CB   . LYS B 2 12  ? -1.770  11.166  -12.572 1.00 0.00 ? 112 LYS B CB   5  
ATOM   9595  C  CG   . LYS B 2 12  ? -0.711  10.745  -13.577 1.00 0.00 ? 112 LYS B CG   5  
ATOM   9596  C  CD   . LYS B 2 12  ? -1.071  11.190  -14.986 1.00 0.00 ? 112 LYS B CD   5  
ATOM   9597  C  CE   . LYS B 2 12  ? 0.112   11.841  -15.687 1.00 0.00 ? 112 LYS B CE   5  
ATOM   9598  N  NZ   . LYS B 2 12  ? 1.042   10.829  -16.261 1.00 0.00 ? 112 LYS B NZ   5  
ATOM   9599  H  H    . LYS B 2 12  ? -4.150  11.908  -11.820 1.00 0.00 ? 112 LYS B H    5  
ATOM   9600  H  HA   . LYS B 2 12  ? -3.116  9.839   -13.577 1.00 0.00 ? 112 LYS B HA   5  
ATOM   9601  H  HB2  . LYS B 2 12  ? -2.050  12.188  -12.783 1.00 0.00 ? 112 LYS B HB2  5  
ATOM   9602  H  HB3  . LYS B 2 12  ? -1.336  11.119  -11.583 1.00 0.00 ? 112 LYS B HB3  5  
ATOM   9603  H  HG2  . LYS B 2 12  ? 0.232   11.189  -13.299 1.00 0.00 ? 112 LYS B HG2  5  
ATOM   9604  H  HG3  . LYS B 2 12  ? -0.622  9.668   -13.561 1.00 0.00 ? 112 LYS B HG3  5  
ATOM   9605  H  HD2  . LYS B 2 12  ? -1.383  10.328  -15.558 1.00 0.00 ? 112 LYS B HD2  5  
ATOM   9606  H  HD3  . LYS B 2 12  ? -1.882  11.902  -14.933 1.00 0.00 ? 112 LYS B HD3  5  
ATOM   9607  H  HE2  . LYS B 2 12  ? -0.259  12.469  -16.482 1.00 0.00 ? 112 LYS B HE2  5  
ATOM   9608  H  HE3  . LYS B 2 12  ? 0.648   12.445  -14.970 1.00 0.00 ? 112 LYS B HE3  5  
ATOM   9609  H  HZ1  . LYS B 2 12  ? 0.969   9.936   -15.733 1.00 0.00 ? 112 LYS B HZ1  5  
ATOM   9610  H  HZ2  . LYS B 2 12  ? 2.022   11.173  -16.206 1.00 0.00 ? 112 LYS B HZ2  5  
ATOM   9611  H  HZ3  . LYS B 2 12  ? 0.805   10.651  -17.258 1.00 0.00 ? 112 LYS B HZ3  5  
ATOM   9612  N  N    . ARG B 2 13  ? -3.476  9.431   -10.375 1.00 0.00 ? 113 ARG B N    5  
ATOM   9613  C  CA   . ARG B 2 13  ? -3.442  8.446   -9.299  1.00 0.00 ? 113 ARG B CA   5  
ATOM   9614  C  C    . ARG B 2 13  ? -4.036  7.119   -9.755  1.00 0.00 ? 113 ARG B C    5  
ATOM   9615  O  O    . ARG B 2 13  ? -3.742  6.066   -9.189  1.00 0.00 ? 113 ARG B O    5  
ATOM   9616  C  CB   . ARG B 2 13  ? -4.196  8.967   -8.075  1.00 0.00 ? 113 ARG B CB   5  
ATOM   9617  C  CG   . ARG B 2 13  ? -4.178  8.008   -6.894  1.00 0.00 ? 113 ARG B CG   5  
ATOM   9618  C  CD   . ARG B 2 13  ? -3.520  8.629   -5.670  1.00 0.00 ? 113 ARG B CD   5  
ATOM   9619  N  NE   . ARG B 2 13  ? -4.454  8.757   -4.553  1.00 0.00 ? 113 ARG B NE   5  
ATOM   9620  C  CZ   . ARG B 2 13  ? -5.379  9.710   -4.466  1.00 0.00 ? 113 ARG B CZ   5  
ATOM   9621  N  NH1  . ARG B 2 13  ? -5.500  10.618  -5.427  1.00 0.00 ? 113 ARG B NH1  5  
ATOM   9622  N  NH2  . ARG B 2 13  ? -6.186  9.756   -3.416  1.00 0.00 ? 113 ARG B NH2  5  
ATOM   9623  H  H    . ARG B 2 13  ? -3.921  10.290  -10.222 1.00 0.00 ? 113 ARG B H    5  
ATOM   9624  H  HA   . ARG B 2 13  ? -2.411  8.287   -9.035  1.00 0.00 ? 113 ARG B HA   5  
ATOM   9625  H  HB2  . ARG B 2 13  ? -3.752  9.901   -7.763  1.00 0.00 ? 113 ARG B HB2  5  
ATOM   9626  H  HB3  . ARG B 2 13  ? -5.226  9.145   -8.351  1.00 0.00 ? 113 ARG B HB3  5  
ATOM   9627  H  HG2  . ARG B 2 13  ? -5.194  7.741   -6.645  1.00 0.00 ? 113 ARG B HG2  5  
ATOM   9628  H  HG3  . ARG B 2 13  ? -3.630  7.120   -7.174  1.00 0.00 ? 113 ARG B HG3  5  
ATOM   9629  H  HD2  . ARG B 2 13  ? -2.695  8.002   -5.365  1.00 0.00 ? 113 ARG B HD2  5  
ATOM   9630  H  HD3  . ARG B 2 13  ? -3.149  9.608   -5.932  1.00 0.00 ? 113 ARG B HD3  5  
ATOM   9631  H  HE   . ARG B 2 13  ? -4.387  8.101   -3.829  1.00 0.00 ? 113 ARG B HE   5  
ATOM   9632  H  HH11 . ARG B 2 13  ? -4.895  10.589  -6.223  1.00 0.00 ? 113 ARG B HH11 5  
ATOM   9633  H  HH12 . ARG B 2 13  ? -6.198  11.331  -5.357  1.00 0.00 ? 113 ARG B HH12 5  
ATOM   9634  H  HH21 . ARG B 2 13  ? -6.100  9.075   -2.688  1.00 0.00 ? 113 ARG B HH21 5  
ATOM   9635  H  HH22 . ARG B 2 13  ? -6.881  10.472  -3.349  1.00 0.00 ? 113 ARG B HH22 5  
ATOM   9636  N  N    . LYS B 2 14  ? -4.867  7.178   -10.787 1.00 0.00 ? 114 LYS B N    5  
ATOM   9637  C  CA   . LYS B 2 14  ? -5.501  5.984   -11.330 1.00 0.00 ? 114 LYS B CA   5  
ATOM   9638  C  C    . LYS B 2 14  ? -4.505  5.178   -12.157 1.00 0.00 ? 114 LYS B C    5  
ATOM   9639  O  O    . LYS B 2 14  ? -4.438  3.954   -12.045 1.00 0.00 ? 114 LYS B O    5  
ATOM   9640  C  CB   . LYS B 2 14  ? -6.708  6.365   -12.189 1.00 0.00 ? 114 LYS B CB   5  
ATOM   9641  C  CG   . LYS B 2 14  ? -7.462  5.167   -12.747 1.00 0.00 ? 114 LYS B CG   5  
ATOM   9642  C  CD   . LYS B 2 14  ? -7.206  4.988   -14.236 1.00 0.00 ? 114 LYS B CD   5  
ATOM   9643  C  CE   . LYS B 2 14  ? -8.381  5.479   -15.066 1.00 0.00 ? 114 LYS B CE   5  
ATOM   9644  N  NZ   . LYS B 2 14  ? -8.851  6.822   -14.625 1.00 0.00 ? 114 LYS B NZ   5  
ATOM   9645  H  H    . LYS B 2 14  ? -5.056  8.046   -11.196 1.00 0.00 ? 114 LYS B H    5  
ATOM   9646  H  HA   . LYS B 2 14  ? -5.836  5.379   -10.500 1.00 0.00 ? 114 LYS B HA   5  
ATOM   9647  H  HB2  . LYS B 2 14  ? -7.394  6.945   -11.589 1.00 0.00 ? 114 LYS B HB2  5  
ATOM   9648  H  HB3  . LYS B 2 14  ? -6.369  6.969   -13.018 1.00 0.00 ? 114 LYS B HB3  5  
ATOM   9649  H  HG2  . LYS B 2 14  ? -7.137  4.277   -12.228 1.00 0.00 ? 114 LYS B HG2  5  
ATOM   9650  H  HG3  . LYS B 2 14  ? -8.520  5.313   -12.588 1.00 0.00 ? 114 LYS B HG3  5  
ATOM   9651  H  HD2  . LYS B 2 14  ? -6.325  5.549   -14.512 1.00 0.00 ? 114 LYS B HD2  5  
ATOM   9652  H  HD3  . LYS B 2 14  ? -7.045  3.940   -14.441 1.00 0.00 ? 114 LYS B HD3  5  
ATOM   9653  H  HE2  . LYS B 2 14  ? -8.076  5.537   -16.101 1.00 0.00 ? 114 LYS B HE2  5  
ATOM   9654  H  HE3  . LYS B 2 14  ? -9.193  4.773   -14.971 1.00 0.00 ? 114 LYS B HE3  5  
ATOM   9655  H  HZ1  . LYS B 2 14  ? -9.561  6.722   -13.872 1.00 0.00 ? 114 LYS B HZ1  5  
ATOM   9656  H  HZ2  . LYS B 2 14  ? -9.279  7.332   -15.424 1.00 0.00 ? 114 LYS B HZ2  5  
ATOM   9657  H  HZ3  . LYS B 2 14  ? -8.051  7.378   -14.261 1.00 0.00 ? 114 LYS B HZ3  5  
ATOM   9658  N  N    . LEU B 2 15  ? -3.730  5.873   -12.985 1.00 0.00 ? 115 LEU B N    5  
ATOM   9659  C  CA   . LEU B 2 15  ? -2.736  5.217   -13.826 1.00 0.00 ? 115 LEU B CA   5  
ATOM   9660  C  C    . LEU B 2 15  ? -1.543  4.762   -12.997 1.00 0.00 ? 115 LEU B C    5  
ATOM   9661  O  O    . LEU B 2 15  ? -0.884  3.775   -13.324 1.00 0.00 ? 115 LEU B O    5  
ATOM   9662  C  CB   . LEU B 2 15  ? -2.276  6.153   -14.945 1.00 0.00 ? 115 LEU B CB   5  
ATOM   9663  C  CG   . LEU B 2 15  ? -3.085  6.062   -16.239 1.00 0.00 ? 115 LEU B CG   5  
ATOM   9664  C  CD1  . LEU B 2 15  ? -2.687  7.173   -17.197 1.00 0.00 ? 115 LEU B CD1  5  
ATOM   9665  C  CD2  . LEU B 2 15  ? -2.894  4.701   -16.890 1.00 0.00 ? 115 LEU B CD2  5  
ATOM   9666  H  H    . LEU B 2 15  ? -3.826  6.849   -13.029 1.00 0.00 ? 115 LEU B H    5  
ATOM   9667  H  HA   . LEU B 2 15  ? -3.199  4.348   -14.262 1.00 0.00 ? 115 LEU B HA   5  
ATOM   9668  H  HB2  . LEU B 2 15  ? -2.331  7.169   -14.580 1.00 0.00 ? 115 LEU B HB2  5  
ATOM   9669  H  HB3  . LEU B 2 15  ? -1.245  5.928   -15.175 1.00 0.00 ? 115 LEU B HB3  5  
ATOM   9670  H  HG   . LEU B 2 15  ? -4.134  6.179   -16.008 1.00 0.00 ? 115 LEU B HG   5  
ATOM   9671  H  HD11 . LEU B 2 15  ? -3.504  7.376   -17.874 1.00 0.00 ? 115 LEU B HD11 5  
ATOM   9672  H  HD12 . LEU B 2 15  ? -1.820  6.867   -17.763 1.00 0.00 ? 115 LEU B HD12 5  
ATOM   9673  H  HD13 . LEU B 2 15  ? -2.455  8.067   -16.637 1.00 0.00 ? 115 LEU B HD13 5  
ATOM   9674  H  HD21 . LEU B 2 15  ? -3.392  4.686   -17.847 1.00 0.00 ? 115 LEU B HD21 5  
ATOM   9675  H  HD22 . LEU B 2 15  ? -3.313  3.936   -16.254 1.00 0.00 ? 115 LEU B HD22 5  
ATOM   9676  H  HD23 . LEU B 2 15  ? -1.840  4.513   -17.029 1.00 0.00 ? 115 LEU B HD23 5  
ATOM   9677  N  N    . ILE B 2 16  ? -1.281  5.481   -11.916 1.00 0.00 ? 116 ILE B N    5  
ATOM   9678  C  CA   . ILE B 2 16  ? -0.177  5.148   -11.029 1.00 0.00 ? 116 ILE B CA   5  
ATOM   9679  C  C    . ILE B 2 16  ? -0.526  3.925   -10.188 1.00 0.00 ? 116 ILE B C    5  
ATOM   9680  O  O    . ILE B 2 16  ? 0.342   3.117   -9.857  1.00 0.00 ? 116 ILE B O    5  
ATOM   9681  C  CB   . ILE B 2 16  ? 0.175   6.328   -10.101 1.00 0.00 ? 116 ILE B CB   5  
ATOM   9682  C  CG1  . ILE B 2 16  ? 0.522   7.564   -10.931 1.00 0.00 ? 116 ILE B CG1  5  
ATOM   9683  C  CG2  . ILE B 2 16  ? 1.332   5.960   -9.182  1.00 0.00 ? 116 ILE B CG2  5  
ATOM   9684  C  CD1  . ILE B 2 16  ? 0.463   8.857   -10.147 1.00 0.00 ? 116 ILE B CD1  5  
ATOM   9685  H  H    . ILE B 2 16  ? -1.851  6.249   -11.707 1.00 0.00 ? 116 ILE B H    5  
ATOM   9686  H  HA   . ILE B 2 16  ? 0.686   4.922   -11.638 1.00 0.00 ? 116 ILE B HA   5  
ATOM   9687  H  HB   . ILE B 2 16  ? -0.686  6.545   -9.487  1.00 0.00 ? 116 ILE B HB   5  
ATOM   9688  H  HG12 . ILE B 2 16  ? 1.525   7.460   -11.320 1.00 0.00 ? 116 ILE B HG12 5  
ATOM   9689  H  HG13 . ILE B 2 16  ? -0.171  7.643   -11.755 1.00 0.00 ? 116 ILE B HG13 5  
ATOM   9690  H  HG21 . ILE B 2 16  ? 2.170   5.622   -9.774  1.00 0.00 ? 116 ILE B HG21 5  
ATOM   9691  H  HG22 . ILE B 2 16  ? 1.024   5.170   -8.513  1.00 0.00 ? 116 ILE B HG22 5  
ATOM   9692  H  HG23 . ILE B 2 16  ? 1.624   6.825   -8.606  1.00 0.00 ? 116 ILE B HG23 5  
ATOM   9693  H  HD11 . ILE B 2 16  ? -0.314  9.488   -10.553 1.00 0.00 ? 116 ILE B HD11 5  
ATOM   9694  H  HD12 . ILE B 2 16  ? 1.415   9.365   -10.219 1.00 0.00 ? 116 ILE B HD12 5  
ATOM   9695  H  HD13 . ILE B 2 16  ? 0.248   8.640   -9.112  1.00 0.00 ? 116 ILE B HD13 5  
ATOM   9696  N  N    . GLN B 2 17  ? -1.807  3.792   -9.859  1.00 0.00 ? 117 GLN B N    5  
ATOM   9697  C  CA   . GLN B 2 17  ? -2.279  2.663   -9.070  1.00 0.00 ? 117 GLN B CA   5  
ATOM   9698  C  C    . GLN B 2 17  ? -2.185  1.374   -9.879  1.00 0.00 ? 117 GLN B C    5  
ATOM   9699  O  O    . GLN B 2 17  ? -1.754  0.340   -9.369  1.00 0.00 ? 117 GLN B O    5  
ATOM   9700  C  CB   . GLN B 2 17  ? -3.723  2.895   -8.616  1.00 0.00 ? 117 GLN B CB   5  
ATOM   9701  C  CG   . GLN B 2 17  ? -3.890  2.908   -7.105  1.00 0.00 ? 117 GLN B CG   5  
ATOM   9702  C  CD   . GLN B 2 17  ? -4.353  4.253   -6.580  1.00 0.00 ? 117 GLN B CD   5  
ATOM   9703  O  OE1  . GLN B 2 17  ? -5.522  4.616   -6.714  1.00 0.00 ? 117 GLN B OE1  5  
ATOM   9704  N  NE2  . GLN B 2 17  ? -3.435  5.000   -5.978  1.00 0.00 ? 117 GLN B NE2  5  
ATOM   9705  H  H    . GLN B 2 17  ? -2.451  4.467   -10.161 1.00 0.00 ? 117 GLN B H    5  
ATOM   9706  H  HA   . GLN B 2 17  ? -1.646  2.576   -8.200  1.00 0.00 ? 117 GLN B HA   5  
ATOM   9707  H  HB2  . GLN B 2 17  ? -4.061  3.844   -9.003  1.00 0.00 ? 117 GLN B HB2  5  
ATOM   9708  H  HB3  . GLN B 2 17  ? -4.347  2.110   -9.018  1.00 0.00 ? 117 GLN B HB3  5  
ATOM   9709  H  HG2  . GLN B 2 17  ? -4.621  2.162   -6.830  1.00 0.00 ? 117 GLN B HG2  5  
ATOM   9710  H  HG3  . GLN B 2 17  ? -2.942  2.666   -6.649  1.00 0.00 ? 117 GLN B HG3  5  
ATOM   9711  H  HE21 . GLN B 2 17  ? -2.524  4.646   -5.909  1.00 0.00 ? 117 GLN B HE21 5  
ATOM   9712  H  HE22 . GLN B 2 17  ? -3.707  5.874   -5.628  1.00 0.00 ? 117 GLN B HE22 5  
ATOM   9713  N  N    . GLN B 2 18  ? -2.584  1.445   -11.146 1.00 0.00 ? 118 GLN B N    5  
ATOM   9714  C  CA   . GLN B 2 18  ? -2.532  0.283   -12.022 1.00 0.00 ? 118 GLN B CA   5  
ATOM   9715  C  C    . GLN B 2 18  ? -1.095  -0.101  -12.309 1.00 0.00 ? 118 GLN B C    5  
ATOM   9716  O  O    . GLN B 2 18  ? -0.750  -1.279  -12.339 1.00 0.00 ? 118 GLN B O    5  
ATOM   9717  C  CB   . GLN B 2 18  ? -3.281  0.557   -13.329 1.00 0.00 ? 118 GLN B CB   5  
ATOM   9718  C  CG   . GLN B 2 18  ? -4.692  -0.008  -13.351 1.00 0.00 ? 118 GLN B CG   5  
ATOM   9719  C  CD   . GLN B 2 18  ? -5.711  0.946   -12.760 1.00 0.00 ? 118 GLN B CD   5  
ATOM   9720  O  OE1  . GLN B 2 18  ? -5.575  1.390   -11.620 1.00 0.00 ? 118 GLN B OE1  5  
ATOM   9721  N  NE2  . GLN B 2 18  ? -6.741  1.266   -13.535 1.00 0.00 ? 118 GLN B NE2  5  
ATOM   9722  H  H    . GLN B 2 18  ? -2.913  2.299   -11.501 1.00 0.00 ? 118 GLN B H    5  
ATOM   9723  H  HA   . GLN B 2 18  ? -3.002  -0.537  -11.512 1.00 0.00 ? 118 GLN B HA   5  
ATOM   9724  H  HB2  . GLN B 2 18  ? -3.341  1.626   -13.477 1.00 0.00 ? 118 GLN B HB2  5  
ATOM   9725  H  HB3  . GLN B 2 18  ? -2.728  0.120   -14.147 1.00 0.00 ? 118 GLN B HB3  5  
ATOM   9726  H  HG2  . GLN B 2 18  ? -4.967  -0.215  -14.375 1.00 0.00 ? 118 GLN B HG2  5  
ATOM   9727  H  HG3  . GLN B 2 18  ? -4.706  -0.926  -12.782 1.00 0.00 ? 118 GLN B HG3  5  
ATOM   9728  H  HE21 . GLN B 2 18  ? -6.784  0.874   -14.432 1.00 0.00 ? 118 GLN B HE21 5  
ATOM   9729  H  HE22 . GLN B 2 18  ? -7.415  1.881   -13.177 1.00 0.00 ? 118 GLN B HE22 5  
ATOM   9730  N  N    . GLN B 2 19  ? -0.259  0.903   -12.499 1.00 0.00 ? 119 GLN B N    5  
ATOM   9731  C  CA   . GLN B 2 19  ? 1.153   0.672   -12.766 1.00 0.00 ? 119 GLN B CA   5  
ATOM   9732  C  C    . GLN B 2 19  ? 1.805   -0.010  -11.573 1.00 0.00 ? 119 GLN B C    5  
ATOM   9733  O  O    . GLN B 2 19  ? 2.755   -0.778  -11.720 1.00 0.00 ? 119 GLN B O    5  
ATOM   9734  C  CB   . GLN B 2 19  ? 1.867   1.990   -13.081 1.00 0.00 ? 119 GLN B CB   5  
ATOM   9735  C  CG   . GLN B 2 19  ? 2.132   2.200   -14.563 1.00 0.00 ? 119 GLN B CG   5  
ATOM   9736  C  CD   . GLN B 2 19  ? 0.867   2.145   -15.397 1.00 0.00 ? 119 GLN B CD   5  
ATOM   9737  O  OE1  . GLN B 2 19  ? -0.226  1.924   -14.875 1.00 0.00 ? 119 GLN B OE1  5  
ATOM   9738  N  NE2  . GLN B 2 19  ? 1.010   2.345   -16.702 1.00 0.00 ? 119 GLN B NE2  5  
ATOM   9739  H  H    . GLN B 2 19  ? -0.599  1.817   -12.446 1.00 0.00 ? 119 GLN B H    5  
ATOM   9740  H  HA   . GLN B 2 19  ? 1.224   0.016   -13.616 1.00 0.00 ? 119 GLN B HA   5  
ATOM   9741  H  HB2  . GLN B 2 19  ? 1.257   2.808   -12.727 1.00 0.00 ? 119 GLN B HB2  5  
ATOM   9742  H  HB3  . GLN B 2 19  ? 2.813   2.008   -12.562 1.00 0.00 ? 119 GLN B HB3  5  
ATOM   9743  H  HG2  . GLN B 2 19  ? 2.592   3.167   -14.699 1.00 0.00 ? 119 GLN B HG2  5  
ATOM   9744  H  HG3  . GLN B 2 19  ? 2.808   1.431   -14.907 1.00 0.00 ? 119 GLN B HG3  5  
ATOM   9745  H  HE21 . GLN B 2 19  ? 1.911   2.514   -17.049 1.00 0.00 ? 119 GLN B HE21 5  
ATOM   9746  H  HE22 . GLN B 2 19  ? 0.208   2.314   -17.266 1.00 0.00 ? 119 GLN B HE22 5  
ATOM   9747  N  N    . LEU B 2 20  ? 1.268   0.265   -10.393 1.00 0.00 ? 120 LEU B N    5  
ATOM   9748  C  CA   . LEU B 2 20  ? 1.769   -0.328  -9.163  1.00 0.00 ? 120 LEU B CA   5  
ATOM   9749  C  C    . LEU B 2 20  ? 1.316   -1.779  -9.063  1.00 0.00 ? 120 LEU B C    5  
ATOM   9750  O  O    . LEU B 2 20  ? 2.056   -2.644  -8.597  1.00 0.00 ? 120 LEU B O    5  
ATOM   9751  C  CB   . LEU B 2 20  ? 1.264   0.458   -7.950  1.00 0.00 ? 120 LEU B CB   5  
ATOM   9752  C  CG   . LEU B 2 20  ? 2.316   0.775   -6.880  1.00 0.00 ? 120 LEU B CG   5  
ATOM   9753  C  CD1  . LEU B 2 20  ? 3.259   -0.402  -6.678  1.00 0.00 ? 120 LEU B CD1  5  
ATOM   9754  C  CD2  . LEU B 2 20  ? 3.093   2.028   -7.254  1.00 0.00 ? 120 LEU B CD2  5  
ATOM   9755  H  H    . LEU B 2 20  ? 0.503   0.874   -10.352 1.00 0.00 ? 120 LEU B H    5  
ATOM   9756  H  HA   . LEU B 2 20  ? 2.848   -0.294  -9.187  1.00 0.00 ? 120 LEU B HA   5  
ATOM   9757  H  HB2  . LEU B 2 20  ? 0.850   1.392   -8.303  1.00 0.00 ? 120 LEU B HB2  5  
ATOM   9758  H  HB3  . LEU B 2 20  ? 0.472   -0.111  -7.486  1.00 0.00 ? 120 LEU B HB3  5  
ATOM   9759  H  HG   . LEU B 2 20  ? 1.815   0.962   -5.942  1.00 0.00 ? 120 LEU B HG   5  
ATOM   9760  H  HD11 . LEU B 2 20  ? 3.716   -0.333  -5.702  1.00 0.00 ? 120 LEU B HD11 5  
ATOM   9761  H  HD12 . LEU B 2 20  ? 4.026   -0.382  -7.437  1.00 0.00 ? 120 LEU B HD12 5  
ATOM   9762  H  HD13 . LEU B 2 20  ? 2.703   -1.325  -6.751  1.00 0.00 ? 120 LEU B HD13 5  
ATOM   9763  H  HD21 . LEU B 2 20  ? 2.781   2.846   -6.621  1.00 0.00 ? 120 LEU B HD21 5  
ATOM   9764  H  HD22 . LEU B 2 20  ? 2.900   2.279   -8.287  1.00 0.00 ? 120 LEU B HD22 5  
ATOM   9765  H  HD23 . LEU B 2 20  ? 4.150   1.850   -7.118  1.00 0.00 ? 120 LEU B HD23 5  
ATOM   9766  N  N    . VAL B 2 21  ? 0.089   -2.032  -9.510  1.00 0.00 ? 121 VAL B N    5  
ATOM   9767  C  CA   . VAL B 2 21  ? -0.479  -3.373  -9.479  1.00 0.00 ? 121 VAL B CA   5  
ATOM   9768  C  C    . VAL B 2 21  ? 0.015   -4.202  -10.656 1.00 0.00 ? 121 VAL B C    5  
ATOM   9769  O  O    . VAL B 2 21  ? 0.265   -5.397  -10.511 1.00 0.00 ? 121 VAL B O    5  
ATOM   9770  C  CB   . VAL B 2 21  ? -2.020  -3.336  -9.503  1.00 0.00 ? 121 VAL B CB   5  
ATOM   9771  C  CG1  . VAL B 2 21  ? -2.592  -4.730  -9.300  1.00 0.00 ? 121 VAL B CG1  5  
ATOM   9772  C  CG2  . VAL B 2 21  ? -2.550  -2.377  -8.448  1.00 0.00 ? 121 VAL B CG2  5  
ATOM   9773  H  H    . VAL B 2 21  ? -0.448  -1.295  -9.870  1.00 0.00 ? 121 VAL B H    5  
ATOM   9774  H  HA   . VAL B 2 21  ? -0.161  -3.850  -8.560  1.00 0.00 ? 121 VAL B HA   5  
ATOM   9775  H  HB   . VAL B 2 21  ? -2.336  -2.980  -10.472 1.00 0.00 ? 121 VAL B HB   5  
ATOM   9776  H  HG11 . VAL B 2 21  ? -1.905  -5.320  -8.711  1.00 0.00 ? 121 VAL B HG11 5  
ATOM   9777  H  HG12 . VAL B 2 21  ? -2.740  -5.202  -10.261 1.00 0.00 ? 121 VAL B HG12 5  
ATOM   9778  H  HG13 . VAL B 2 21  ? -3.539  -4.659  -8.786  1.00 0.00 ? 121 VAL B HG13 5  
ATOM   9779  H  HG21 . VAL B 2 21  ? -2.736  -2.918  -7.531  1.00 0.00 ? 121 VAL B HG21 5  
ATOM   9780  H  HG22 . VAL B 2 21  ? -3.470  -1.931  -8.796  1.00 0.00 ? 121 VAL B HG22 5  
ATOM   9781  H  HG23 . VAL B 2 21  ? -1.821  -1.602  -8.266  1.00 0.00 ? 121 VAL B HG23 5  
ATOM   9782  N  N    . LEU B 2 22  ? 0.163   -3.574  -11.822 1.00 0.00 ? 122 LEU B N    5  
ATOM   9783  C  CA   . LEU B 2 22  ? 0.636   -4.280  -12.988 1.00 0.00 ? 122 LEU B CA   5  
ATOM   9784  C  C    . LEU B 2 22  ? 2.106   -4.650  -12.805 1.00 0.00 ? 122 LEU B C    5  
ATOM   9785  O  O    . LEU B 2 22  ? 2.531   -5.739  -13.189 1.00 0.00 ? 122 LEU B O    5  
ATOM   9786  C  CB   . LEU B 2 22  ? 0.417   -3.416  -14.232 1.00 0.00 ? 122 LEU B CB   5  
ATOM   9787  C  CG   . LEU B 2 22  ? 1.638   -3.214  -15.121 1.00 0.00 ? 122 LEU B CG   5  
ATOM   9788  C  CD1  . LEU B 2 22  ? 2.146   -4.544  -15.662 1.00 0.00 ? 122 LEU B CD1  5  
ATOM   9789  C  CD2  . LEU B 2 22  ? 1.312   -2.268  -16.263 1.00 0.00 ? 122 LEU B CD2  5  
ATOM   9790  H  H    . LEU B 2 22  ? -0.041  -2.618  -11.901 1.00 0.00 ? 122 LEU B H    5  
ATOM   9791  H  HA   . LEU B 2 22  ? 0.057   -5.187  -13.083 1.00 0.00 ? 122 LEU B HA   5  
ATOM   9792  H  HB2  . LEU B 2 22  ? -0.362  -3.868  -14.819 1.00 0.00 ? 122 LEU B HB2  5  
ATOM   9793  H  HB3  . LEU B 2 22  ? 0.075   -2.446  -13.910 1.00 0.00 ? 122 LEU B HB3  5  
ATOM   9794  H  HG   . LEU B 2 22  ? 2.418   -2.767  -14.524 1.00 0.00 ? 122 LEU B HG   5  
ATOM   9795  H  HD11 . LEU B 2 22  ? 3.058   -4.815  -15.152 1.00 0.00 ? 122 LEU B HD11 5  
ATOM   9796  H  HD12 . LEU B 2 22  ? 2.340   -4.454  -16.721 1.00 0.00 ? 122 LEU B HD12 5  
ATOM   9797  H  HD13 . LEU B 2 22  ? 1.401   -5.308  -15.497 1.00 0.00 ? 122 LEU B HD13 5  
ATOM   9798  H  HD21 . LEU B 2 22  ? 0.360   -2.541  -16.694 1.00 0.00 ? 122 LEU B HD21 5  
ATOM   9799  H  HD22 . LEU B 2 22  ? 2.083   -2.337  -17.017 1.00 0.00 ? 122 LEU B HD22 5  
ATOM   9800  H  HD23 . LEU B 2 22  ? 1.263   -1.257  -15.890 1.00 0.00 ? 122 LEU B HD23 5  
ATOM   9801  N  N    . LEU B 2 23  ? 2.873   -3.750  -12.193 1.00 0.00 ? 123 LEU B N    5  
ATOM   9802  C  CA   . LEU B 2 23  ? 4.280   -4.012  -11.938 1.00 0.00 ? 123 LEU B CA   5  
ATOM   9803  C  C    . LEU B 2 23  ? 4.386   -5.117  -10.906 1.00 0.00 ? 123 LEU B C    5  
ATOM   9804  O  O    . LEU B 2 23  ? 5.113   -6.094  -11.085 1.00 0.00 ? 123 LEU B O    5  
ATOM   9805  C  CB   . LEU B 2 23  ? 4.994   -2.752  -11.443 1.00 0.00 ? 123 LEU B CB   5  
ATOM   9806  C  CG   . LEU B 2 23  ? 5.603   -1.878  -12.541 1.00 0.00 ? 123 LEU B CG   5  
ATOM   9807  C  CD1  . LEU B 2 23  ? 5.811   -0.458  -12.040 1.00 0.00 ? 123 LEU B CD1  5  
ATOM   9808  C  CD2  . LEU B 2 23  ? 6.917   -2.473  -13.023 1.00 0.00 ? 123 LEU B CD2  5  
ATOM   9809  H  H    . LEU B 2 23  ? 2.478   -2.908  -11.887 1.00 0.00 ? 123 LEU B H    5  
ATOM   9810  H  HA   . LEU B 2 23  ? 4.729   -4.347  -12.860 1.00 0.00 ? 123 LEU B HA   5  
ATOM   9811  H  HB2  . LEU B 2 23  ? 4.285   -2.156  -10.888 1.00 0.00 ? 123 LEU B HB2  5  
ATOM   9812  H  HB3  . LEU B 2 23  ? 5.787   -3.053  -10.775 1.00 0.00 ? 123 LEU B HB3  5  
ATOM   9813  H  HG   . LEU B 2 23  ? 4.923   -1.840  -13.380 1.00 0.00 ? 123 LEU B HG   5  
ATOM   9814  H  HD11 . LEU B 2 23  ? 6.520   -0.464  -11.225 1.00 0.00 ? 123 LEU B HD11 5  
ATOM   9815  H  HD12 . LEU B 2 23  ? 4.870   -0.055  -11.696 1.00 0.00 ? 123 LEU B HD12 5  
ATOM   9816  H  HD13 . LEU B 2 23  ? 6.192   0.155   -12.844 1.00 0.00 ? 123 LEU B HD13 5  
ATOM   9817  H  HD21 . LEU B 2 23  ? 7.451   -2.896  -12.185 1.00 0.00 ? 123 LEU B HD21 5  
ATOM   9818  H  HD22 . LEU B 2 23  ? 7.517   -1.698  -13.478 1.00 0.00 ? 123 LEU B HD22 5  
ATOM   9819  H  HD23 . LEU B 2 23  ? 6.717   -3.246  -13.751 1.00 0.00 ? 123 LEU B HD23 5  
ATOM   9820  N  N    . LEU B 2 24  ? 3.608   -4.967  -9.841  1.00 0.00 ? 124 LEU B N    5  
ATOM   9821  C  CA   . LEU B 2 24  ? 3.553   -5.961  -8.785  1.00 0.00 ? 124 LEU B CA   5  
ATOM   9822  C  C    . LEU B 2 24  ? 3.057   -7.263  -9.382  1.00 0.00 ? 124 LEU B C    5  
ATOM   9823  O  O    . LEU B 2 24  ? 3.573   -8.343  -9.095  1.00 0.00 ? 124 LEU B O    5  
ATOM   9824  C  CB   . LEU B 2 24  ? 2.599   -5.488  -7.687  1.00 0.00 ? 124 LEU B CB   5  
ATOM   9825  C  CG   . LEU B 2 24  ? 3.252   -4.798  -6.487  1.00 0.00 ? 124 LEU B CG   5  
ATOM   9826  C  CD1  . LEU B 2 24  ? 4.271   -3.764  -6.944  1.00 0.00 ? 124 LEU B CD1  5  
ATOM   9827  C  CD2  . LEU B 2 24  ? 2.189   -4.146  -5.619  1.00 0.00 ? 124 LEU B CD2  5  
ATOM   9828  H  H    . LEU B 2 24  ? 3.029   -4.179  -9.782  1.00 0.00 ? 124 LEU B H    5  
ATOM   9829  H  HA   . LEU B 2 24  ? 4.544   -6.101  -8.389  1.00 0.00 ? 124 LEU B HA   5  
ATOM   9830  H  HB2  . LEU B 2 24  ? 1.904   -4.797  -8.134  1.00 0.00 ? 124 LEU B HB2  5  
ATOM   9831  H  HB3  . LEU B 2 24  ? 2.042   -6.339  -7.326  1.00 0.00 ? 124 LEU B HB3  5  
ATOM   9832  H  HG   . LEU B 2 24  ? 3.768   -5.536  -5.889  1.00 0.00 ? 124 LEU B HG   5  
ATOM   9833  H  HD11 . LEU B 2 24  ? 5.258   -4.198  -6.923  1.00 0.00 ? 124 LEU B HD11 5  
ATOM   9834  H  HD12 . LEU B 2 24  ? 4.239   -2.911  -6.282  1.00 0.00 ? 124 LEU B HD12 5  
ATOM   9835  H  HD13 . LEU B 2 24  ? 4.037   -3.448  -7.950  1.00 0.00 ? 124 LEU B HD13 5  
ATOM   9836  H  HD21 . LEU B 2 24  ? 1.504   -3.593  -6.246  1.00 0.00 ? 124 LEU B HD21 5  
ATOM   9837  H  HD22 . LEU B 2 24  ? 2.658   -3.470  -4.920  1.00 0.00 ? 124 LEU B HD22 5  
ATOM   9838  H  HD23 . LEU B 2 24  ? 1.647   -4.907  -5.079  1.00 0.00 ? 124 LEU B HD23 5  
ATOM   9839  N  N    . HIS B 2 25  ? 2.067   -7.124  -10.252 1.00 0.00 ? 125 HIS B N    5  
ATOM   9840  C  CA   . HIS B 2 25  ? 1.491   -8.251  -10.956 1.00 0.00 ? 125 HIS B CA   5  
ATOM   9841  C  C    . HIS B 2 25  ? 2.566   -8.929  -11.764 1.00 0.00 ? 125 HIS B C    5  
ATOM   9842  O  O    . HIS B 2 25  ? 2.995   -10.035 -11.463 1.00 0.00 ? 125 HIS B O    5  
ATOM   9843  C  CB   . HIS B 2 25  ? 0.394   -7.776  -11.909 1.00 0.00 ? 125 HIS B CB   5  
ATOM   9844  C  CG   . HIS B 2 25  ? 0.038   -8.786  -12.957 1.00 0.00 ? 125 HIS B CG   5  
ATOM   9845  N  ND1  . HIS B 2 25  ? -0.922  -9.758  -12.796 1.00 0.00 ? 125 HIS B ND1  5  
ATOM   9846  C  CD2  . HIS B 2 25  ? 0.562   -8.978  -14.197 1.00 0.00 ? 125 HIS B CD2  5  
ATOM   9847  C  CE1  . HIS B 2 25  ? -0.950  -10.496 -13.913 1.00 0.00 ? 125 HIS B CE1  5  
ATOM   9848  N  NE2  . HIS B 2 25  ? -0.070  -10.064 -14.794 1.00 0.00 ? 125 HIS B NE2  5  
ATOM   9849  H  H    . HIS B 2 25  ? 1.733   -6.226  -10.443 1.00 0.00 ? 125 HIS B H    5  
ATOM   9850  H  HA   . HIS B 2 25  ? 1.081   -8.937  -10.240 1.00 0.00 ? 125 HIS B HA   5  
ATOM   9851  H  HB2  . HIS B 2 25  ? -0.485  -7.550  -11.349 1.00 0.00 ? 125 HIS B HB2  5  
ATOM   9852  H  HB3  . HIS B 2 25  ? 0.730   -6.882  -12.412 1.00 0.00 ? 125 HIS B HB3  5  
ATOM   9853  H  HD1  . HIS B 2 25  ? -1.486  -9.887  -12.004 1.00 0.00 ? 125 HIS B HD1  5  
ATOM   9854  H  HD2  . HIS B 2 25  ? 1.344   -8.388  -14.660 1.00 0.00 ? 125 HIS B HD2  5  
ATOM   9855  H  HE1  . HIS B 2 25  ? -1.600  -11.342 -14.069 1.00 0.00 ? 125 HIS B HE1  5  
ATOM   9856  N  N    . ALA B 2 26  ? 2.984   -8.224  -12.800 1.00 0.00 ? 126 ALA B N    5  
ATOM   9857  C  CA   . ALA B 2 26  ? 4.020   -8.701  -13.704 1.00 0.00 ? 126 ALA B CA   5  
ATOM   9858  C  C    . ALA B 2 26  ? 5.121   -9.434  -12.943 1.00 0.00 ? 126 ALA B C    5  
ATOM   9859  O  O    . ALA B 2 26  ? 5.703   -10.395 -13.448 1.00 0.00 ? 126 ALA B O    5  
ATOM   9860  C  CB   . ALA B 2 26  ? 4.604   -7.542  -14.495 1.00 0.00 ? 126 ALA B CB   5  
ATOM   9861  H  H    . ALA B 2 26  ? 2.571   -7.345  -12.957 1.00 0.00 ? 126 ALA B H    5  
ATOM   9862  H  HA   . ALA B 2 26  ? 3.557   -9.386  -14.402 1.00 0.00 ? 126 ALA B HA   5  
ATOM   9863  H  HB1  . ALA B 2 26  ? 4.607   -6.652  -13.882 1.00 0.00 ? 126 ALA B HB1  5  
ATOM   9864  H  HB2  . ALA B 2 26  ? 4.003   -7.367  -15.377 1.00 0.00 ? 126 ALA B HB2  5  
ATOM   9865  H  HB3  . ALA B 2 26  ? 5.614   -7.779  -14.791 1.00 0.00 ? 126 ALA B HB3  5  
ATOM   9866  N  N    . HIS B 2 27  ? 5.397   -8.984  -11.718 1.00 0.00 ? 127 HIS B N    5  
ATOM   9867  C  CA   . HIS B 2 27  ? 6.421   -9.617  -10.897 1.00 0.00 ? 127 HIS B CA   5  
ATOM   9868  C  C    . HIS B 2 27  ? 5.947   -10.987 -10.421 1.00 0.00 ? 127 HIS B C    5  
ATOM   9869  O  O    . HIS B 2 27  ? 6.690   -11.968 -10.480 1.00 0.00 ? 127 HIS B O    5  
ATOM   9870  C  CB   . HIS B 2 27  ? 6.777   -8.733  -9.702  1.00 0.00 ? 127 HIS B CB   5  
ATOM   9871  C  CG   . HIS B 2 27  ? 8.221   -8.817  -9.321  1.00 0.00 ? 127 HIS B CG   5  
ATOM   9872  N  ND1  . HIS B 2 27  ? 9.232   -8.947  -10.250 1.00 0.00 ? 127 HIS B ND1  5  
ATOM   9873  C  CD2  . HIS B 2 27  ? 8.825   -8.798  -8.109  1.00 0.00 ? 127 HIS B CD2  5  
ATOM   9874  C  CE1  . HIS B 2 27  ? 10.394  -9.005  -9.627  1.00 0.00 ? 127 HIS B CE1  5  
ATOM   9875  N  NE2  . HIS B 2 27  ? 10.175  -8.915  -8.328  1.00 0.00 ? 127 HIS B NE2  5  
ATOM   9876  H  H    . HIS B 2 27  ? 4.895   -8.216  -11.355 1.00 0.00 ? 127 HIS B H    5  
ATOM   9877  H  HA   . HIS B 2 27  ? 7.300   -9.749  -11.511 1.00 0.00 ? 127 HIS B HA   5  
ATOM   9878  H  HB2  . HIS B 2 27  ? 6.557   -7.703  -9.945  1.00 0.00 ? 127 HIS B HB2  5  
ATOM   9879  H  HB3  . HIS B 2 27  ? 6.185   -9.031  -8.849  1.00 0.00 ? 127 HIS B HB3  5  
ATOM   9880  H  HD1  . HIS B 2 27  ? 9.115   -8.991  -11.221 1.00 0.00 ? 127 HIS B HD1  5  
ATOM   9881  H  HD2  . HIS B 2 27  ? 8.335   -8.704  -7.151  1.00 0.00 ? 127 HIS B HD2  5  
ATOM   9882  H  HE1  . HIS B 2 27  ? 11.359  -9.106  -10.101 1.00 0.00 ? 127 HIS B HE1  5  
ATOM   9883  H  HE2  . HIS B 2 27  ? 10.857  -9.028  -7.632  1.00 0.00 ? 127 HIS B HE2  5  
ATOM   9884  N  N    . LYS B 2 28  ? 4.701   -11.047 -9.965  1.00 0.00 ? 128 LYS B N    5  
ATOM   9885  C  CA   . LYS B 2 28  ? 4.113   -12.295 -9.496  1.00 0.00 ? 128 LYS B CA   5  
ATOM   9886  C  C    . LYS B 2 28  ? 3.536   -13.090 -10.666 1.00 0.00 ? 128 LYS B C    5  
ATOM   9887  O  O    . LYS B 2 28  ? 3.370   -14.306 -10.582 1.00 0.00 ? 128 LYS B O    5  
ATOM   9888  C  CB   . LYS B 2 28  ? 3.015   -12.013 -8.466  1.00 0.00 ? 128 LYS B CB   5  
ATOM   9889  C  CG   . LYS B 2 28  ? 3.395   -10.952 -7.444  1.00 0.00 ? 128 LYS B CG   5  
ATOM   9890  C  CD   . LYS B 2 28  ? 3.481   -11.531 -6.041  1.00 0.00 ? 128 LYS B CD   5  
ATOM   9891  C  CE   . LYS B 2 28  ? 4.889   -12.003 -5.719  1.00 0.00 ? 128 LYS B CE   5  
ATOM   9892  N  NZ   . LYS B 2 28  ? 4.900   -13.016 -4.629  1.00 0.00 ? 128 LYS B NZ   5  
ATOM   9893  H  H    . LYS B 2 28  ? 4.157   -10.231 -9.956  1.00 0.00 ? 128 LYS B H    5  
ATOM   9894  H  HA   . LYS B 2 28  ? 4.893   -12.877 -9.029  1.00 0.00 ? 128 LYS B HA   5  
ATOM   9895  H  HB2  . LYS B 2 28  ? 2.129   -11.680 -8.985  1.00 0.00 ? 128 LYS B HB2  5  
ATOM   9896  H  HB3  . LYS B 2 28  ? 2.789   -12.928 -7.939  1.00 0.00 ? 128 LYS B HB3  5  
ATOM   9897  H  HG2  . LYS B 2 28  ? 4.355   -10.537 -7.710  1.00 0.00 ? 128 LYS B HG2  5  
ATOM   9898  H  HG3  . LYS B 2 28  ? 2.647   -10.172 -7.457  1.00 0.00 ? 128 LYS B HG3  5  
ATOM   9899  H  HD2  . LYS B 2 28  ? 3.196   -10.769 -5.330  1.00 0.00 ? 128 LYS B HD2  5  
ATOM   9900  H  HD3  . LYS B 2 28  ? 2.802   -12.368 -5.966  1.00 0.00 ? 128 LYS B HD3  5  
ATOM   9901  H  HE2  . LYS B 2 28  ? 5.320   -12.438 -6.608  1.00 0.00 ? 128 LYS B HE2  5  
ATOM   9902  H  HE3  . LYS B 2 28  ? 5.479   -11.151 -5.413  1.00 0.00 ? 128 LYS B HE3  5  
ATOM   9903  H  HZ1  . LYS B 2 28  ? 5.790   -12.957 -4.095  1.00 0.00 ? 128 LYS B HZ1  5  
ATOM   9904  H  HZ2  . LYS B 2 28  ? 4.812   -13.973 -5.029  1.00 0.00 ? 128 LYS B HZ2  5  
ATOM   9905  H  HZ3  . LYS B 2 28  ? 4.104   -12.852 -3.979  1.00 0.00 ? 128 LYS B HZ3  5  
ATOM   9906  N  N    . CYS B 2 29  ? 3.234   -12.391 -11.759 1.00 0.00 ? 129 CYS B N    5  
ATOM   9907  C  CA   . CYS B 2 29  ? 2.682   -13.020 -12.953 1.00 0.00 ? 129 CYS B CA   5  
ATOM   9908  C  C    . CYS B 2 29  ? 3.669   -14.027 -13.526 1.00 0.00 ? 129 CYS B C    5  
ATOM   9909  O  O    . CYS B 2 29  ? 3.356   -15.209 -13.664 1.00 0.00 ? 129 CYS B O    5  
ATOM   9910  C  CB   . CYS B 2 29  ? 2.340   -11.956 -14.000 1.00 0.00 ? 129 CYS B CB   5  
ATOM   9911  S  SG   . CYS B 2 29  ? 1.126   -12.490 -15.250 1.00 0.00 ? 129 CYS B SG   5  
ATOM   9912  H  H    . CYS B 2 29  ? 3.391   -11.424 -11.764 1.00 0.00 ? 129 CYS B H    5  
ATOM   9913  H  HA   . CYS B 2 29  ? 1.781   -13.539 -12.668 1.00 0.00 ? 129 CYS B HA   5  
ATOM   9914  H  HB2  . CYS B 2 29  ? 1.935   -11.089 -13.502 1.00 0.00 ? 129 CYS B HB2  5  
ATOM   9915  H  HB3  . CYS B 2 29  ? 3.243   -11.672 -14.521 1.00 0.00 ? 129 CYS B HB3  5  
ATOM   9916  N  N    . GLN B 2 30  ? 4.868   -13.554 -13.849 1.00 0.00 ? 130 GLN B N    5  
ATOM   9917  C  CA   . GLN B 2 30  ? 5.902   -14.423 -14.390 1.00 0.00 ? 130 GLN B CA   5  
ATOM   9918  C  C    . GLN B 2 30  ? 6.395   -15.394 -13.325 1.00 0.00 ? 130 GLN B C    5  
ATOM   9919  O  O    . GLN B 2 30  ? 6.984   -16.430 -13.633 1.00 0.00 ? 130 GLN B O    5  
ATOM   9920  C  CB   . GLN B 2 30  ? 7.069   -13.593 -14.930 1.00 0.00 ? 130 GLN B CB   5  
ATOM   9921  C  CG   . GLN B 2 30  ? 7.526   -14.016 -16.317 1.00 0.00 ? 130 GLN B CG   5  
ATOM   9922  C  CD   . GLN B 2 30  ? 9.037   -14.037 -16.451 1.00 0.00 ? 130 GLN B CD   5  
ATOM   9923  O  OE1  . GLN B 2 30  ? 9.632   -15.078 -16.730 1.00 0.00 ? 130 GLN B OE1  5  
ATOM   9924  N  NE2  . GLN B 2 30  ? 9.664   -12.883 -16.253 1.00 0.00 ? 130 GLN B NE2  5  
ATOM   9925  H  H    . GLN B 2 30  ? 5.064   -12.605 -13.708 1.00 0.00 ? 130 GLN B H    5  
ATOM   9926  H  HA   . GLN B 2 30  ? 5.467   -14.985 -15.192 1.00 0.00 ? 130 GLN B HA   5  
ATOM   9927  H  HB2  . GLN B 2 30  ? 6.768   -12.557 -14.974 1.00 0.00 ? 130 GLN B HB2  5  
ATOM   9928  H  HB3  . GLN B 2 30  ? 7.906   -13.685 -14.254 1.00 0.00 ? 130 GLN B HB3  5  
ATOM   9929  H  HG2  . GLN B 2 30  ? 7.149   -15.008 -16.519 1.00 0.00 ? 130 GLN B HG2  5  
ATOM   9930  H  HG3  . GLN B 2 30  ? 7.124   -13.323 -17.041 1.00 0.00 ? 130 GLN B HG3  5  
ATOM   9931  H  HE21 . GLN B 2 30  ? 9.125   -12.096 -16.033 1.00 0.00 ? 130 GLN B HE21 5  
ATOM   9932  H  HE22 . GLN B 2 30  ? 10.640  -12.868 -16.334 1.00 0.00 ? 130 GLN B HE22 5  
ATOM   9933  N  N    . ARG B 2 31  ? 6.141   -15.046 -12.072 1.00 0.00 ? 131 ARG B N    5  
ATOM   9934  C  CA   . ARG B 2 31  ? 6.545   -15.876 -10.944 1.00 0.00 ? 131 ARG B CA   5  
ATOM   9935  C  C    . ARG B 2 31  ? 5.427   -16.824 -10.523 1.00 0.00 ? 131 ARG B C    5  
ATOM   9936  O  O    . ARG B 2 31  ? 5.629   -17.708 -9.690  1.00 0.00 ? 131 ARG B O    5  
ATOM   9937  C  CB   . ARG B 2 31  ? 6.970   -15.001 -9.762  1.00 0.00 ? 131 ARG B CB   5  
ATOM   9938  C  CG   . ARG B 2 31  ? 7.728   -15.758 -8.684  1.00 0.00 ? 131 ARG B CG   5  
ATOM   9939  C  CD   . ARG B 2 31  ? 9.215   -15.826 -8.992  1.00 0.00 ? 131 ARG B CD   5  
ATOM   9940  N  NE   . ARG B 2 31  ? 10.025  -15.884 -7.777  1.00 0.00 ? 131 ARG B NE   5  
ATOM   9941  C  CZ   . ARG B 2 31  ? 11.299  -16.271 -7.752  1.00 0.00 ? 131 ARG B CZ   5  
ATOM   9942  N  NH1  . ARG B 2 31  ? 11.910  -16.633 -8.873  1.00 0.00 ? 131 ARG B NH1  5  
ATOM   9943  N  NH2  . ARG B 2 31  ? 11.961  -16.295 -6.605  1.00 0.00 ? 131 ARG B NH2  5  
ATOM   9944  H  H    . ARG B 2 31  ? 5.665   -14.211 -11.903 1.00 0.00 ? 131 ARG B H    5  
ATOM   9945  H  HA   . ARG B 2 31  ? 7.382   -16.464 -11.263 1.00 0.00 ? 131 ARG B HA   5  
ATOM   9946  H  HB2  . ARG B 2 31  ? 7.606   -14.207 -10.126 1.00 0.00 ? 131 ARG B HB2  5  
ATOM   9947  H  HB3  . ARG B 2 31  ? 6.088   -14.566 -9.313  1.00 0.00 ? 131 ARG B HB3  5  
ATOM   9948  H  HG2  . ARG B 2 31  ? 7.590   -15.255 -7.738  1.00 0.00 ? 131 ARG B HG2  5  
ATOM   9949  H  HG3  . ARG B 2 31  ? 7.337   -16.763 -8.620  1.00 0.00 ? 131 ARG B HG3  5  
ATOM   9950  H  HD2  . ARG B 2 31  ? 9.407   -16.709 -9.583  1.00 0.00 ? 131 ARG B HD2  5  
ATOM   9951  H  HD3  . ARG B 2 31  ? 9.493   -14.948 -9.557  1.00 0.00 ? 131 ARG B HD3  5  
ATOM   9952  H  HE   . ARG B 2 31  ? 9.597   -15.621 -6.936  1.00 0.00 ? 131 ARG B HE   5  
ATOM   9953  H  HH11 . ARG B 2 31  ? 11.416  -16.616 -9.742  1.00 0.00 ? 131 ARG B HH11 5  
ATOM   9954  H  HH12 . ARG B 2 31  ? 12.867  -16.924 -8.848  1.00 0.00 ? 131 ARG B HH12 5  
ATOM   9955  H  HH21 . ARG B 2 31  ? 11.505  -16.022 -5.758  1.00 0.00 ? 131 ARG B HH21 5  
ATOM   9956  H  HH22 . ARG B 2 31  ? 12.918  -16.586 -6.586  1.00 0.00 ? 131 ARG B HH22 5  
ATOM   9957  N  N    . ARG B 2 32  ? 4.251   -16.633 -11.102 1.00 0.00 ? 132 ARG B N    5  
ATOM   9958  C  CA   . ARG B 2 32  ? 3.098   -17.470 -10.789 1.00 0.00 ? 132 ARG B CA   5  
ATOM   9959  C  C    . ARG B 2 32  ? 3.271   -18.872 -11.366 1.00 0.00 ? 132 ARG B C    5  
ATOM   9960  O  O    . ARG B 2 32  ? 2.742   -19.845 -10.829 1.00 0.00 ? 132 ARG B O    5  
ATOM   9961  C  CB   . ARG B 2 32  ? 1.814   -16.836 -11.331 1.00 0.00 ? 132 ARG B CB   5  
ATOM   9962  C  CG   . ARG B 2 32  ? 1.011   -16.090 -10.277 1.00 0.00 ? 132 ARG B CG   5  
ATOM   9963  C  CD   . ARG B 2 32  ? -0.484  -16.263 -10.489 1.00 0.00 ? 132 ARG B CD   5  
ATOM   9964  N  NE   . ARG B 2 32  ? -1.264  -15.327 -9.683  1.00 0.00 ? 132 ARG B NE   5  
ATOM   9965  C  CZ   . ARG B 2 32  ? -2.571  -15.127 -9.837  1.00 0.00 ? 132 ARG B CZ   5  
ATOM   9966  N  NH1  . ARG B 2 32  ? -3.247  -15.794 -10.765 1.00 0.00 ? 132 ARG B NH1  5  
ATOM   9967  N  NH2  . ARG B 2 32  ? -3.205  -14.256 -9.063  1.00 0.00 ? 132 ARG B NH2  5  
ATOM   9968  H  H    . ARG B 2 32  ? 4.157   -15.913 -11.757 1.00 0.00 ? 132 ARG B H    5  
ATOM   9969  H  HA   . ARG B 2 32  ? 3.025   -17.544 -9.714  1.00 0.00 ? 132 ARG B HA   5  
ATOM   9970  H  HB2  . ARG B 2 32  ? 2.073   -16.139 -12.114 1.00 0.00 ? 132 ARG B HB2  5  
ATOM   9971  H  HB3  . ARG B 2 32  ? 1.189   -17.612 -11.746 1.00 0.00 ? 132 ARG B HB3  5  
ATOM   9972  H  HG2  . ARG B 2 32  ? 1.273   -16.474 -9.302  1.00 0.00 ? 132 ARG B HG2  5  
ATOM   9973  H  HG3  . ARG B 2 32  ? 1.255   -15.039 -10.330 1.00 0.00 ? 132 ARG B HG3  5  
ATOM   9974  H  HD2  . ARG B 2 32  ? -0.708  -16.098 -11.533 1.00 0.00 ? 132 ARG B HD2  5  
ATOM   9975  H  HD3  . ARG B 2 32  ? -0.758  -17.273 -10.220 1.00 0.00 ? 132 ARG B HD3  5  
ATOM   9976  H  HE   . ARG B 2 32  ? -0.790  -14.821 -8.991  1.00 0.00 ? 132 ARG B HE   5  
ATOM   9977  H  HH11 . ARG B 2 32  ? -2.775  -16.452 -11.353 1.00 0.00 ? 132 ARG B HH11 5  
ATOM   9978  H  HH12 . ARG B 2 32  ? -4.228  -15.639 -10.876 1.00 0.00 ? 132 ARG B HH12 5  
ATOM   9979  H  HH21 . ARG B 2 32  ? -2.701  -13.751 -8.362  1.00 0.00 ? 132 ARG B HH21 5  
ATOM   9980  H  HH22 . ARG B 2 32  ? -4.187  -14.107 -9.179  1.00 0.00 ? 132 ARG B HH22 5  
ATOM   9981  N  N    . GLU B 2 33  ? 4.013   -18.967 -12.465 1.00 0.00 ? 133 GLU B N    5  
ATOM   9982  C  CA   . GLU B 2 33  ? 4.255   -20.250 -13.115 1.00 0.00 ? 133 GLU B CA   5  
ATOM   9983  C  C    . GLU B 2 33  ? 5.255   -21.085 -12.323 1.00 0.00 ? 133 GLU B C    5  
ATOM   9984  O  O    . GLU B 2 33  ? 5.177   -22.313 -12.305 1.00 0.00 ? 133 GLU B O    5  
ATOM   9985  C  CB   . GLU B 2 33  ? 4.770   -20.034 -14.540 1.00 0.00 ? 133 GLU B CB   5  
ATOM   9986  C  CG   . GLU B 2 33  ? 3.925   -19.069 -15.355 1.00 0.00 ? 133 GLU B CG   5  
ATOM   9987  C  CD   . GLU B 2 33  ? 4.219   -19.150 -16.840 1.00 0.00 ? 133 GLU B CD   5  
ATOM   9988  O  OE1  . GLU B 2 33  ? 5.314   -18.714 -17.252 1.00 0.00 ? 133 GLU B OE1  5  
ATOM   9989  O  OE2  . GLU B 2 33  ? 3.353   -19.647 -17.591 1.00 0.00 ? 133 GLU B OE2  5  
ATOM   9990  H  H    . GLU B 2 33  ? 4.408   -18.156 -12.848 1.00 0.00 ? 133 GLU B H    5  
ATOM   9991  H  HA   . GLU B 2 33  ? 3.316   -20.780 -13.158 1.00 0.00 ? 133 GLU B HA   5  
ATOM   9992  H  HB2  . GLU B 2 33  ? 5.776   -19.645 -14.490 1.00 0.00 ? 133 GLU B HB2  5  
ATOM   9993  H  HB3  . GLU B 2 33  ? 4.787   -20.985 -15.051 1.00 0.00 ? 133 GLU B HB3  5  
ATOM   9994  H  HG2  . GLU B 2 33  ? 2.883   -19.301 -15.196 1.00 0.00 ? 133 GLU B HG2  5  
ATOM   9995  H  HG3  . GLU B 2 33  ? 4.125   -18.063 -15.017 1.00 0.00 ? 133 GLU B HG3  5  
ATOM   9996  N  N    . GLN B 2 34  ? 6.196   -20.411 -11.669 1.00 0.00 ? 134 GLN B N    5  
ATOM   9997  C  CA   . GLN B 2 34  ? 7.213   -21.093 -10.876 1.00 0.00 ? 134 GLN B CA   5  
ATOM   9998  C  C    . GLN B 2 34  ? 6.575   -21.945 -9.782  1.00 0.00 ? 134 GLN B C    5  
ATOM   9999  O  O    . GLN B 2 34  ? 7.151   -22.941 -9.343  1.00 0.00 ? 134 GLN B O    5  
ATOM   10000 C  CB   . GLN B 2 34  ? 8.172   -20.074 -10.255 1.00 0.00 ? 134 GLN B CB   5  
ATOM   10001 C  CG   . GLN B 2 34  ? 9.638   -20.382 -10.515 1.00 0.00 ? 134 GLN B CG   5  
ATOM   10002 C  CD   . GLN B 2 34  ? 10.019  -21.792 -10.107 1.00 0.00 ? 134 GLN B CD   5  
ATOM   10003 O  OE1  . GLN B 2 34  ? 9.940   -22.153 -8.933  1.00 0.00 ? 134 GLN B OE1  5  
ATOM   10004 N  NE2  . GLN B 2 34  ? 10.435  -22.596 -11.078 1.00 0.00 ? 134 GLN B NE2  5  
ATOM   10005 H  H    . GLN B 2 34  ? 6.207   -19.433 -11.722 1.00 0.00 ? 134 GLN B H    5  
ATOM   10006 H  HA   . GLN B 2 34  ? 7.770   -21.738 -11.539 1.00 0.00 ? 134 GLN B HA   5  
ATOM   10007 H  HB2  . GLN B 2 34  ? 7.954   -19.097 -10.662 1.00 0.00 ? 134 GLN B HB2  5  
ATOM   10008 H  HB3  . GLN B 2 34  ? 8.015   -20.051 -9.186  1.00 0.00 ? 134 GLN B HB3  5  
ATOM   10009 H  HG2  . GLN B 2 34  ? 9.836   -20.263 -11.569 1.00 0.00 ? 134 GLN B HG2  5  
ATOM   10010 H  HG3  . GLN B 2 34  ? 10.243  -19.684 -9.955  1.00 0.00 ? 134 GLN B HG3  5  
ATOM   10011 H  HE21 . GLN B 2 34  ? 10.473  -22.241 -11.990 1.00 0.00 ? 134 GLN B HE21 5  
ATOM   10012 H  HE22 . GLN B 2 34  ? 10.688  -23.513 -10.842 1.00 0.00 ? 134 GLN B HE22 5  
ATOM   10013 N  N    . ALA B 2 35  ? 5.385   -21.548 -9.342  1.00 0.00 ? 135 ALA B N    5  
ATOM   10014 C  CA   . ALA B 2 35  ? 4.675   -22.277 -8.298  1.00 0.00 ? 135 ALA B CA   5  
ATOM   10015 C  C    . ALA B 2 35  ? 3.597   -23.179 -8.888  1.00 0.00 ? 135 ALA B C    5  
ATOM   10016 O  O    . ALA B 2 35  ? 3.367   -24.287 -8.405  1.00 0.00 ? 135 ALA B O    5  
ATOM   10017 C  CB   . ALA B 2 35  ? 4.065   -21.305 -7.298  1.00 0.00 ? 135 ALA B CB   5  
ATOM   10018 H  H    . ALA B 2 35  ? 4.974   -20.745 -9.727  1.00 0.00 ? 135 ALA B H    5  
ATOM   10019 H  HA   . ALA B 2 35  ? 5.393   -22.890 -7.774  1.00 0.00 ? 135 ALA B HA   5  
ATOM   10020 H  HB1  . ALA B 2 35  ? 4.703   -20.439 -7.204  1.00 0.00 ? 135 ALA B HB1  5  
ATOM   10021 H  HB2  . ALA B 2 35  ? 3.970   -21.789 -6.337  1.00 0.00 ? 135 ALA B HB2  5  
ATOM   10022 H  HB3  . ALA B 2 35  ? 3.089   -20.998 -7.645  1.00 0.00 ? 135 ALA B HB3  5  
ATOM   10023 N  N    . ASN B 2 36  ? 2.937   -22.698 -9.937  1.00 0.00 ? 136 ASN B N    5  
ATOM   10024 C  CA   . ASN B 2 36  ? 1.884   -23.464 -10.592 1.00 0.00 ? 136 ASN B CA   5  
ATOM   10025 C  C    . ASN B 2 36  ? 2.396   -24.111 -11.874 1.00 0.00 ? 136 ASN B C    5  
ATOM   10026 O  O    . ASN B 2 36  ? 1.633   -24.344 -12.811 1.00 0.00 ? 136 ASN B O    5  
ATOM   10027 C  CB   . ASN B 2 36  ? 0.689   -22.561 -10.905 1.00 0.00 ? 136 ASN B CB   5  
ATOM   10028 C  CG   . ASN B 2 36  ? 0.124   -21.899 -9.663  1.00 0.00 ? 136 ASN B CG   5  
ATOM   10029 O  OD1  . ASN B 2 36  ? 0.821   -21.735 -8.662  1.00 0.00 ? 136 ASN B OD1  5  
ATOM   10030 N  ND2  . ASN B 2 36  ? -1.146  -21.515 -9.721  1.00 0.00 ? 136 ASN B ND2  5  
ATOM   10031 H  H    . ASN B 2 36  ? 3.165   -21.808 -10.278 1.00 0.00 ? 136 ASN B H    5  
ATOM   10032 H  HA   . ASN B 2 36  ? 1.568   -24.240 -9.912  1.00 0.00 ? 136 ASN B HA   5  
ATOM   10033 H  HB2  . ASN B 2 36  ? 0.998   -21.789 -11.592 1.00 0.00 ? 136 ASN B HB2  5  
ATOM   10034 H  HB3  . ASN B 2 36  ? -0.091  -23.153 -11.361 1.00 0.00 ? 136 ASN B HB3  5  
ATOM   10035 H  HD21 . ASN B 2 36  ? -1.641  -21.680 -10.552 1.00 0.00 ? 136 ASN B HD21 5  
ATOM   10036 H  HD22 . ASN B 2 36  ? -1.536  -21.084 -8.933  1.00 0.00 ? 136 ASN B HD22 5  
ATOM   10037 N  N    . GLY B 2 37  ? 3.695   -24.397 -11.910 1.00 0.00 ? 137 GLY B N    5  
ATOM   10038 C  CA   . GLY B 2 37  ? 4.289   -25.014 -13.083 1.00 0.00 ? 137 GLY B CA   5  
ATOM   10039 C  C    . GLY B 2 37  ? 3.974   -24.260 -14.361 1.00 0.00 ? 137 GLY B C    5  
ATOM   10040 O  O    . GLY B 2 37  ? 3.895   -23.032 -14.361 1.00 0.00 ? 137 GLY B O    5  
ATOM   10041 H  H    . GLY B 2 37  ? 4.255   -24.188 -11.133 1.00 0.00 ? 137 GLY B H    5  
ATOM   10042 H  HA2  . GLY B 2 37  ? 5.361   -25.050 -12.955 1.00 0.00 ? 137 GLY B HA2  5  
ATOM   10043 H  HA3  . GLY B 2 37  ? 3.915   -26.024 -13.173 1.00 0.00 ? 137 GLY B HA3  5  
ATOM   10044 N  N    . GLU B 2 38  ? 3.792   -24.997 -15.452 1.00 0.00 ? 138 GLU B N    5  
ATOM   10045 C  CA   . GLU B 2 38  ? 3.483   -24.388 -16.739 1.00 0.00 ? 138 GLU B CA   5  
ATOM   10046 C  C    . GLU B 2 38  ? 2.060   -23.839 -16.752 1.00 0.00 ? 138 GLU B C    5  
ATOM   10047 O  O    . GLU B 2 38  ? 1.093   -24.597 -16.808 1.00 0.00 ? 138 GLU B O    5  
ATOM   10048 C  CB   . GLU B 2 38  ? 3.658   -25.409 -17.866 1.00 0.00 ? 138 GLU B CB   5  
ATOM   10049 C  CG   . GLU B 2 38  ? 3.474   -24.821 -19.255 1.00 0.00 ? 138 GLU B CG   5  
ATOM   10050 C  CD   . GLU B 2 38  ? 4.650   -23.965 -19.686 1.00 0.00 ? 138 GLU B CD   5  
ATOM   10051 O  OE1  . GLU B 2 38  ? 5.073   -23.095 -18.895 1.00 0.00 ? 138 GLU B OE1  5  
ATOM   10052 O  OE2  . GLU B 2 38  ? 5.148   -24.165 -20.813 1.00 0.00 ? 138 GLU B OE2  5  
ATOM   10053 H  H    . GLU B 2 38  ? 3.868   -25.970 -15.391 1.00 0.00 ? 138 GLU B H    5  
ATOM   10054 H  HA   . GLU B 2 38  ? 4.174   -23.575 -16.893 1.00 0.00 ? 138 GLU B HA   5  
ATOM   10055 H  HB2  . GLU B 2 38  ? 4.650   -25.830 -17.803 1.00 0.00 ? 138 GLU B HB2  5  
ATOM   10056 H  HB3  . GLU B 2 38  ? 2.933   -26.199 -17.735 1.00 0.00 ? 138 GLU B HB3  5  
ATOM   10057 H  HG2  . GLU B 2 38  ? 3.359   -25.628 -19.962 1.00 0.00 ? 138 GLU B HG2  5  
ATOM   10058 H  HG3  . GLU B 2 38  ? 2.583   -24.209 -19.258 1.00 0.00 ? 138 GLU B HG3  5  
ATOM   10059 N  N    . VAL B 2 39  ? 1.940   -22.517 -16.698 1.00 0.00 ? 139 VAL B N    5  
ATOM   10060 C  CA   . VAL B 2 39  ? 0.638   -21.865 -16.702 1.00 0.00 ? 139 VAL B CA   5  
ATOM   10061 C  C    . VAL B 2 39  ? 0.419   -21.083 -17.990 1.00 0.00 ? 139 VAL B C    5  
ATOM   10062 O  O    . VAL B 2 39  ? 1.372   -20.714 -18.676 1.00 0.00 ? 139 VAL B O    5  
ATOM   10063 C  CB   . VAL B 2 39  ? 0.475   -20.909 -15.509 1.00 0.00 ? 139 VAL B CB   5  
ATOM   10064 C  CG1  . VAL B 2 39  ? -0.984  -20.520 -15.329 1.00 0.00 ? 139 VAL B CG1  5  
ATOM   10065 C  CG2  . VAL B 2 39  ? 1.030   -21.533 -14.237 1.00 0.00 ? 139 VAL B CG2  5  
ATOM   10066 H  H    . VAL B 2 39  ? 2.748   -21.963 -16.653 1.00 0.00 ? 139 VAL B H    5  
ATOM   10067 H  HA   . VAL B 2 39  ? -0.119  -22.634 -16.626 1.00 0.00 ? 139 VAL B HA   5  
ATOM   10068 H  HB   . VAL B 2 39  ? 1.038   -20.014 -15.721 1.00 0.00 ? 139 VAL B HB   5  
ATOM   10069 H  HG11 . VAL B 2 39  ? -1.616  -21.328 -15.667 1.00 0.00 ? 139 VAL B HG11 5  
ATOM   10070 H  HG12 . VAL B 2 39  ? -1.194  -19.632 -15.907 1.00 0.00 ? 139 VAL B HG12 5  
ATOM   10071 H  HG13 . VAL B 2 39  ? -1.178  -20.324 -14.285 1.00 0.00 ? 139 VAL B HG13 5  
ATOM   10072 H  HG21 . VAL B 2 39  ? 2.084   -21.728 -14.362 1.00 0.00 ? 139 VAL B HG21 5  
ATOM   10073 H  HG22 . VAL B 2 39  ? 0.513   -22.461 -14.037 1.00 0.00 ? 139 VAL B HG22 5  
ATOM   10074 H  HG23 . VAL B 2 39  ? 0.884   -20.854 -13.410 1.00 0.00 ? 139 VAL B HG23 5  
ATOM   10075 N  N    . ARG B 2 40  ? -0.843  -20.833 -18.309 1.00 0.00 ? 140 ARG B N    5  
ATOM   10076 C  CA   . ARG B 2 40  ? -1.197  -20.092 -19.514 1.00 0.00 ? 140 ARG B CA   5  
ATOM   10077 C  C    . ARG B 2 40  ? -0.697  -18.654 -19.433 1.00 0.00 ? 140 ARG B C    5  
ATOM   10078 O  O    . ARG B 2 40  ? -0.762  -18.022 -18.379 1.00 0.00 ? 140 ARG B O    5  
ATOM   10079 C  CB   . ARG B 2 40  ? -2.713  -20.107 -19.719 1.00 0.00 ? 140 ARG B CB   5  
ATOM   10080 C  CG   . ARG B 2 40  ? -3.158  -19.443 -21.012 1.00 0.00 ? 140 ARG B CG   5  
ATOM   10081 C  CD   . ARG B 2 40  ? -4.381  -18.565 -20.797 1.00 0.00 ? 140 ARG B CD   5  
ATOM   10082 N  NE   . ARG B 2 40  ? -5.502  -19.315 -20.237 1.00 0.00 ? 140 ARG B NE   5  
ATOM   10083 C  CZ   . ARG B 2 40  ? -6.254  -20.160 -20.939 1.00 0.00 ? 140 ARG B CZ   5  
ATOM   10084 N  NH1  . ARG B 2 40  ? -6.007  -20.367 -22.225 1.00 0.00 ? 140 ARG B NH1  5  
ATOM   10085 N  NH2  . ARG B 2 40  ? -7.256  -20.801 -20.351 1.00 0.00 ? 140 ARG B NH2  5  
ATOM   10086 H  H    . ARG B 2 40  ? -1.555  -21.152 -17.716 1.00 0.00 ? 140 ARG B H    5  
ATOM   10087 H  HA   . ARG B 2 40  ? -0.725  -20.580 -20.353 1.00 0.00 ? 140 ARG B HA   5  
ATOM   10088 H  HB2  . ARG B 2 40  ? -3.053  -21.132 -19.731 1.00 0.00 ? 140 ARG B HB2  5  
ATOM   10089 H  HB3  . ARG B 2 40  ? -3.181  -19.590 -18.893 1.00 0.00 ? 140 ARG B HB3  5  
ATOM   10090 H  HG2  . ARG B 2 40  ? -2.351  -18.832 -21.388 1.00 0.00 ? 140 ARG B HG2  5  
ATOM   10091 H  HG3  . ARG B 2 40  ? -3.398  -20.209 -21.734 1.00 0.00 ? 140 ARG B HG3  5  
ATOM   10092 H  HD2  . ARG B 2 40  ? -4.120  -17.766 -20.119 1.00 0.00 ? 140 ARG B HD2  5  
ATOM   10093 H  HD3  . ARG B 2 40  ? -4.679  -18.147 -21.747 1.00 0.00 ? 140 ARG B HD3  5  
ATOM   10094 H  HE   . ARG B 2 40  ? -5.706  -19.182 -19.287 1.00 0.00 ? 140 ARG B HE   5  
ATOM   10095 H  HH11 . ARG B 2 40  ? -5.254  -19.888 -22.675 1.00 0.00 ? 140 ARG B HH11 5  
ATOM   10096 H  HH12 . ARG B 2 40  ? -6.575  -21.003 -22.747 1.00 0.00 ? 140 ARG B HH12 5  
ATOM   10097 H  HH21 . ARG B 2 40  ? -7.447  -20.648 -19.382 1.00 0.00 ? 140 ARG B HH21 5  
ATOM   10098 H  HH22 . ARG B 2 40  ? -7.820  -21.436 -20.878 1.00 0.00 ? 140 ARG B HH22 5  
ATOM   10099 N  N    . GLN B 2 41  ? -0.196  -18.142 -20.553 1.00 0.00 ? 141 GLN B N    5  
ATOM   10100 C  CA   . GLN B 2 41  ? 0.316   -16.779 -20.608 1.00 0.00 ? 141 GLN B CA   5  
ATOM   10101 C  C    . GLN B 2 41  ? -0.802  -15.766 -20.375 1.00 0.00 ? 141 GLN B C    5  
ATOM   10102 O  O    . GLN B 2 41  ? -1.673  -15.585 -21.225 1.00 0.00 ? 141 GLN B O    5  
ATOM   10103 C  CB   . GLN B 2 41  ? 0.984   -16.517 -21.958 1.00 0.00 ? 141 GLN B CB   5  
ATOM   10104 C  CG   . GLN B 2 41  ? 1.966   -17.602 -22.373 1.00 0.00 ? 141 GLN B CG   5  
ATOM   10105 C  CD   . GLN B 2 41  ? 3.408   -17.131 -22.337 1.00 0.00 ? 141 GLN B CD   5  
ATOM   10106 O  OE1  . GLN B 2 41  ? 3.928   -16.771 -21.281 1.00 0.00 ? 141 GLN B OE1  5  
ATOM   10107 N  NE2  . GLN B 2 41  ? 4.060   -17.133 -23.494 1.00 0.00 ? 141 GLN B NE2  5  
ATOM   10108 H  H    . GLN B 2 41  ? -0.171  -18.697 -21.362 1.00 0.00 ? 141 GLN B H    5  
ATOM   10109 H  HA   . GLN B 2 41  ? 1.053   -16.671 -19.826 1.00 0.00 ? 141 GLN B HA   5  
ATOM   10110 H  HB2  . GLN B 2 41  ? 0.219   -16.445 -22.718 1.00 0.00 ? 141 GLN B HB2  5  
ATOM   10111 H  HB3  . GLN B 2 41  ? 1.518   -15.579 -21.907 1.00 0.00 ? 141 GLN B HB3  5  
ATOM   10112 H  HG2  . GLN B 2 41  ? 1.860   -18.440 -21.701 1.00 0.00 ? 141 GLN B HG2  5  
ATOM   10113 H  HG3  . GLN B 2 41  ? 1.730   -17.917 -23.379 1.00 0.00 ? 141 GLN B HG3  5  
ATOM   10114 H  HE21 . GLN B 2 41  ? 3.581   -17.433 -24.294 1.00 0.00 ? 141 GLN B HE21 5  
ATOM   10115 H  HE22 . GLN B 2 41  ? 4.993   -16.834 -23.499 1.00 0.00 ? 141 GLN B HE22 5  
ATOM   10116 N  N    . CYS B 2 42  ? -0.772  -15.120 -19.208 1.00 0.00 ? 142 CYS B N    5  
ATOM   10117 C  CA   . CYS B 2 42  ? -1.772  -14.132 -18.837 1.00 0.00 ? 142 CYS B CA   5  
ATOM   10118 C  C    . CYS B 2 42  ? -2.184  -13.264 -20.025 1.00 0.00 ? 142 CYS B C    5  
ATOM   10119 O  O    . CYS B 2 42  ? -1.340  -12.665 -20.691 1.00 0.00 ? 142 CYS B O    5  
ATOM   10120 C  CB   . CYS B 2 42  ? -1.243  -13.247 -17.706 1.00 0.00 ? 142 CYS B CB   5  
ATOM   10121 S  SG   . CYS B 2 42  ? 0.253   -12.301 -18.142 1.00 0.00 ? 142 CYS B SG   5  
ATOM   10122 H  H    . CYS B 2 42  ? -0.064  -15.320 -18.576 1.00 0.00 ? 142 CYS B H    5  
ATOM   10123 H  HA   . CYS B 2 42  ? -2.626  -14.671 -18.481 1.00 0.00 ? 142 CYS B HA   5  
ATOM   10124 H  HB2  . CYS B 2 42  ? -2.008  -12.539 -17.426 1.00 0.00 ? 142 CYS B HB2  5  
ATOM   10125 H  HB3  . CYS B 2 42  ? -1.003  -13.868 -16.855 1.00 0.00 ? 142 CYS B HB3  5  
ATOM   10126 N  N    . ASN B 2 43  ? -3.487  -13.203 -20.283 1.00 0.00 ? 143 ASN B N    5  
ATOM   10127 C  CA   . ASN B 2 43  ? -4.012  -12.412 -21.389 1.00 0.00 ? 143 ASN B CA   5  
ATOM   10128 C  C    . ASN B 2 43  ? -3.917  -10.919 -21.088 1.00 0.00 ? 143 ASN B C    5  
ATOM   10129 O  O    . ASN B 2 43  ? -4.933  -10.238 -20.944 1.00 0.00 ? 143 ASN B O    5  
ATOM   10130 C  CB   . ASN B 2 43  ? -5.464  -12.800 -21.672 1.00 0.00 ? 143 ASN B CB   5  
ATOM   10131 C  CG   . ASN B 2 43  ? -5.652  -14.301 -21.768 1.00 0.00 ? 143 ASN B CG   5  
ATOM   10132 O  OD1  . ASN B 2 43  ? -6.614  -14.853 -21.233 1.00 0.00 ? 143 ASN B OD1  5  
ATOM   10133 N  ND2  . ASN B 2 43  ? -4.732  -14.971 -22.452 1.00 0.00 ? 143 ASN B ND2  5  
ATOM   10134 H  H    . ASN B 2 43  ? -4.110  -13.704 -19.716 1.00 0.00 ? 143 ASN B H    5  
ATOM   10135 H  HA   . ASN B 2 43  ? -3.414  -12.629 -22.262 1.00 0.00 ? 143 ASN B HA   5  
ATOM   10136 H  HB2  . ASN B 2 43  ? -6.092  -12.427 -20.877 1.00 0.00 ? 143 ASN B HB2  5  
ATOM   10137 H  HB3  . ASN B 2 43  ? -5.772  -12.356 -22.606 1.00 0.00 ? 143 ASN B HB3  5  
ATOM   10138 H  HD21 . ASN B 2 43  ? -3.993  -14.466 -22.851 1.00 0.00 ? 143 ASN B HD21 5  
ATOM   10139 H  HD22 . ASN B 2 43  ? -4.830  -15.943 -22.530 1.00 0.00 ? 143 ASN B HD22 5  
ATOM   10140 N  N    . LEU B 2 44  ? -2.690  -10.415 -20.995 1.00 0.00 ? 144 LEU B N    5  
ATOM   10141 C  CA   . LEU B 2 44  ? -2.462  -9.003  -20.714 1.00 0.00 ? 144 LEU B CA   5  
ATOM   10142 C  C    . LEU B 2 44  ? -1.100  -8.556  -21.249 1.00 0.00 ? 144 LEU B C    5  
ATOM   10143 O  O    . LEU B 2 44  ? -0.060  -9.007  -20.768 1.00 0.00 ? 144 LEU B O    5  
ATOM   10144 C  CB   . LEU B 2 44  ? -2.536  -8.740  -19.209 1.00 0.00 ? 144 LEU B CB   5  
ATOM   10145 C  CG   . LEU B 2 44  ? -3.948  -8.536  -18.654 1.00 0.00 ? 144 LEU B CG   5  
ATOM   10146 C  CD1  . LEU B 2 44  ? -4.300  -9.636  -17.663 1.00 0.00 ? 144 LEU B CD1  5  
ATOM   10147 C  CD2  . LEU B 2 44  ? -4.072  -7.168  -17.997 1.00 0.00 ? 144 LEU B CD2  5  
ATOM   10148 H  H    . LEU B 2 44  ? -1.920  -11.008 -21.122 1.00 0.00 ? 144 LEU B H    5  
ATOM   10149 H  HA   . LEU B 2 44  ? -3.237  -8.438  -21.207 1.00 0.00 ? 144 LEU B HA   5  
ATOM   10150 H  HB2  . LEU B 2 44  ? -2.086  -9.579  -18.697 1.00 0.00 ? 144 LEU B HB2  5  
ATOM   10151 H  HB3  . LEU B 2 44  ? -1.956  -7.856  -18.993 1.00 0.00 ? 144 LEU B HB3  5  
ATOM   10152 H  HG   . LEU B 2 44  ? -4.658  -8.581  -19.467 1.00 0.00 ? 144 LEU B HG   5  
ATOM   10153 H  HD11 . LEU B 2 44  ? -5.054  -9.276  -16.978 1.00 0.00 ? 144 LEU B HD11 5  
ATOM   10154 H  HD12 . LEU B 2 44  ? -3.416  -9.918  -17.110 1.00 0.00 ? 144 LEU B HD12 5  
ATOM   10155 H  HD13 . LEU B 2 44  ? -4.679  -10.494 -18.198 1.00 0.00 ? 144 LEU B HD13 5  
ATOM   10156 H  HD21 . LEU B 2 44  ? -3.519  -6.441  -18.574 1.00 0.00 ? 144 LEU B HD21 5  
ATOM   10157 H  HD22 . LEU B 2 44  ? -3.671  -7.213  -16.995 1.00 0.00 ? 144 LEU B HD22 5  
ATOM   10158 H  HD23 . LEU B 2 44  ? -5.112  -6.880  -17.956 1.00 0.00 ? 144 LEU B HD23 5  
ATOM   10159 N  N    . PRO B 2 45  ? -1.085  -7.662  -22.254 1.00 0.00 ? 145 PRO B N    5  
ATOM   10160 C  CA   . PRO B 2 45  ? 0.163   -7.165  -22.844 1.00 0.00 ? 145 PRO B CA   5  
ATOM   10161 C  C    . PRO B 2 45  ? 0.907   -6.213  -21.912 1.00 0.00 ? 145 PRO B C    5  
ATOM   10162 O  O    . PRO B 2 45  ? 2.130   -6.086  -21.986 1.00 0.00 ? 145 PRO B O    5  
ATOM   10163 C  CB   . PRO B 2 45  ? -0.311  -6.424  -24.096 1.00 0.00 ? 145 PRO B CB   5  
ATOM   10164 C  CG   . PRO B 2 45  ? -1.699  -5.993  -23.776 1.00 0.00 ? 145 PRO B CG   5  
ATOM   10165 C  CD   . PRO B 2 45  ? -2.275  -7.068  -22.895 1.00 0.00 ? 145 PRO B CD   5  
ATOM   10166 H  HA   . PRO B 2 45  ? 0.817   -7.976  -23.128 1.00 0.00 ? 145 PRO B HA   5  
ATOM   10167 H  HB2  . PRO B 2 45  ? 0.335   -5.577  -24.284 1.00 0.00 ? 145 PRO B HB2  5  
ATOM   10168 H  HB3  . PRO B 2 45  ? -0.292  -7.093  -24.943 1.00 0.00 ? 145 PRO B HB3  5  
ATOM   10169 H  HG2  . PRO B 2 45  ? -1.679  -5.048  -23.252 1.00 0.00 ? 145 PRO B HG2  5  
ATOM   10170 H  HG3  . PRO B 2 45  ? -2.276  -5.905  -24.685 1.00 0.00 ? 145 PRO B HG3  5  
ATOM   10171 H  HD2  . PRO B 2 45  ? -2.934  -6.637  -22.156 1.00 0.00 ? 145 PRO B HD2  5  
ATOM   10172 H  HD3  . PRO B 2 45  ? -2.799  -7.801  -23.489 1.00 0.00 ? 145 PRO B HD3  5  
ATOM   10173 N  N    . HIS B 2 46  ? 0.162   -5.545  -21.039 1.00 0.00 ? 146 HIS B N    5  
ATOM   10174 C  CA   . HIS B 2 46  ? 0.748   -4.601  -20.094 1.00 0.00 ? 146 HIS B CA   5  
ATOM   10175 C  C    . HIS B 2 46  ? 1.755   -5.291  -19.178 1.00 0.00 ? 146 HIS B C    5  
ATOM   10176 O  O    . HIS B 2 46  ? 2.813   -4.738  -18.877 1.00 0.00 ? 146 HIS B O    5  
ATOM   10177 C  CB   . HIS B 2 46  ? -0.348  -3.939  -19.259 1.00 0.00 ? 146 HIS B CB   5  
ATOM   10178 C  CG   . HIS B 2 46  ? -1.287  -3.095  -20.063 1.00 0.00 ? 146 HIS B CG   5  
ATOM   10179 N  ND1  . HIS B 2 46  ? -2.329  -3.621  -20.799 1.00 0.00 ? 146 HIS B ND1  5  
ATOM   10180 C  CD2  . HIS B 2 46  ? -1.339  -1.754  -20.247 1.00 0.00 ? 146 HIS B CD2  5  
ATOM   10181 C  CE1  . HIS B 2 46  ? -2.980  -2.641  -21.399 1.00 0.00 ? 146 HIS B CE1  5  
ATOM   10182 N  NE2  . HIS B 2 46  ? -2.400  -1.498  -21.080 1.00 0.00 ? 146 HIS B NE2  5  
ATOM   10183 H  H    . HIS B 2 46  ? -0.808  -5.687  -21.031 1.00 0.00 ? 146 HIS B H    5  
ATOM   10184 H  HA   . HIS B 2 46  ? 1.262   -3.840  -20.663 1.00 0.00 ? 146 HIS B HA   5  
ATOM   10185 H  HB2  . HIS B 2 46  ? -0.929  -4.705  -18.767 1.00 0.00 ? 146 HIS B HB2  5  
ATOM   10186 H  HB3  . HIS B 2 46  ? 0.111   -3.307  -18.512 1.00 0.00 ? 146 HIS B HB3  5  
ATOM   10187 H  HD1  . HIS B 2 46  ? -2.556  -4.571  -20.870 1.00 0.00 ? 146 HIS B HD1  5  
ATOM   10188 H  HD2  . HIS B 2 46  ? -0.671  -1.021  -19.816 1.00 0.00 ? 146 HIS B HD2  5  
ATOM   10189 H  HE1  . HIS B 2 46  ? -3.840  -2.754  -22.041 1.00 0.00 ? 146 HIS B HE1  5  
ATOM   10190 H  HE2  . HIS B 2 46  ? -2.731  -0.609  -21.325 1.00 0.00 ? 146 HIS B HE2  5  
ATOM   10191 N  N    . CYS B 2 47  ? 1.421   -6.499  -18.735 1.00 0.00 ? 147 CYS B N    5  
ATOM   10192 C  CA   . CYS B 2 47  ? 2.301   -7.257  -17.851 1.00 0.00 ? 147 CYS B CA   5  
ATOM   10193 C  C    . CYS B 2 47  ? 3.633   -7.543  -18.531 1.00 0.00 ? 147 CYS B C    5  
ATOM   10194 O  O    . CYS B 2 47  ? 4.683   -7.081  -18.085 1.00 0.00 ? 147 CYS B O    5  
ATOM   10195 C  CB   . CYS B 2 47  ? 1.647   -8.578  -17.434 1.00 0.00 ? 147 CYS B CB   5  
ATOM   10196 S  SG   . CYS B 2 47  ? -0.152  -8.492  -17.155 1.00 0.00 ? 147 CYS B SG   5  
ATOM   10197 H  H    . CYS B 2 47  ? 0.567   -6.889  -19.007 1.00 0.00 ? 147 CYS B H    5  
ATOM   10198 H  HA   . CYS B 2 47  ? 2.480   -6.660  -16.970 1.00 0.00 ? 147 CYS B HA   5  
ATOM   10199 H  HB2  . CYS B 2 47  ? 1.820   -9.314  -18.200 1.00 0.00 ? 147 CYS B HB2  5  
ATOM   10200 H  HB3  . CYS B 2 47  ? 2.103   -8.913  -16.521 1.00 0.00 ? 147 CYS B HB3  5  
ATOM   10201 N  N    . ARG B 2 48  ? 3.577   -8.314  -19.614 1.00 0.00 ? 148 ARG B N    5  
ATOM   10202 C  CA   . ARG B 2 48  ? 4.771   -8.681  -20.375 1.00 0.00 ? 148 ARG B CA   5  
ATOM   10203 C  C    . ARG B 2 48  ? 5.706   -7.487  -20.551 1.00 0.00 ? 148 ARG B C    5  
ATOM   10204 O  O    . ARG B 2 48  ? 6.925   -7.619  -20.439 1.00 0.00 ? 148 ARG B O    5  
ATOM   10205 C  CB   . ARG B 2 48  ? 4.372   -9.239  -21.743 1.00 0.00 ? 148 ARG B CB   5  
ATOM   10206 C  CG   . ARG B 2 48  ? 5.557   -9.602  -22.625 1.00 0.00 ? 148 ARG B CG   5  
ATOM   10207 C  CD   . ARG B 2 48  ? 5.611   -8.734  -23.873 1.00 0.00 ? 148 ARG B CD   5  
ATOM   10208 N  NE   . ARG B 2 48  ? 6.310   -9.398  -24.972 1.00 0.00 ? 148 ARG B NE   5  
ATOM   10209 C  CZ   . ARG B 2 48  ? 7.635   -9.452  -25.083 1.00 0.00 ? 148 ARG B CZ   5  
ATOM   10210 N  NH1  . ARG B 2 48  ? 8.409   -8.891  -24.163 1.00 0.00 ? 148 ARG B NH1  5  
ATOM   10211 N  NH2  . ARG B 2 48  ? 8.188   -10.073 -26.116 1.00 0.00 ? 148 ARG B NH2  5  
ATOM   10212 H  H    . ARG B 2 48  ? 2.705   -8.650  -19.908 1.00 0.00 ? 148 ARG B H    5  
ATOM   10213 H  HA   . ARG B 2 48  ? 5.291   -9.449  -19.822 1.00 0.00 ? 148 ARG B HA   5  
ATOM   10214 H  HB2  . ARG B 2 48  ? 3.776   -10.127 -21.595 1.00 0.00 ? 148 ARG B HB2  5  
ATOM   10215 H  HB3  . ARG B 2 48  ? 3.778   -8.500  -22.259 1.00 0.00 ? 148 ARG B HB3  5  
ATOM   10216 H  HG2  . ARG B 2 48  ? 6.468   -9.463  -22.062 1.00 0.00 ? 148 ARG B HG2  5  
ATOM   10217 H  HG3  . ARG B 2 48  ? 5.469   -10.638 -22.920 1.00 0.00 ? 148 ARG B HG3  5  
ATOM   10218 H  HD2  . ARG B 2 48  ? 4.602   -8.512  -24.184 1.00 0.00 ? 148 ARG B HD2  5  
ATOM   10219 H  HD3  . ARG B 2 48  ? 6.125   -7.815  -23.634 1.00 0.00 ? 148 ARG B HD3  5  
ATOM   10220 H  HE   . ARG B 2 48  ? 5.762   -9.822  -25.664 1.00 0.00 ? 148 ARG B HE   5  
ATOM   10221 H  HH11 . ARG B 2 48  ? 7.999   -8.422  -23.381 1.00 0.00 ? 148 ARG B HH11 5  
ATOM   10222 H  HH12 . ARG B 2 48  ? 9.405   -8.935  -24.253 1.00 0.00 ? 148 ARG B HH12 5  
ATOM   10223 H  HH21 . ARG B 2 48  ? 7.609   -10.498 -26.812 1.00 0.00 ? 148 ARG B HH21 5  
ATOM   10224 H  HH22 . ARG B 2 48  ? 9.183   -10.114 -26.201 1.00 0.00 ? 148 ARG B HH22 5  
ATOM   10225 N  N    . THR B 2 49  ? 5.128   -6.321  -20.822 1.00 0.00 ? 149 THR B N    5  
ATOM   10226 C  CA   . THR B 2 49  ? 5.915   -5.107  -21.005 1.00 0.00 ? 149 THR B CA   5  
ATOM   10227 C  C    . THR B 2 49  ? 6.697   -4.784  -19.738 1.00 0.00 ? 149 THR B C    5  
ATOM   10228 O  O    . THR B 2 49  ? 7.905   -4.554  -19.787 1.00 0.00 ? 149 THR B O    5  
ATOM   10229 C  CB   . THR B 2 49  ? 5.010   -3.931  -21.376 1.00 0.00 ? 149 THR B CB   5  
ATOM   10230 O  OG1  . THR B 2 49  ? 4.131   -4.288  -22.428 1.00 0.00 ? 149 THR B OG1  5  
ATOM   10231 C  CG2  . THR B 2 49  ? 5.775   -2.702  -21.815 1.00 0.00 ? 149 THR B CG2  5  
ATOM   10232 H  H    . THR B 2 49  ? 4.152   -6.275  -20.894 1.00 0.00 ? 149 THR B H    5  
ATOM   10233 H  HA   . THR B 2 49  ? 6.617   -5.282  -21.808 1.00 0.00 ? 149 THR B HA   5  
ATOM   10234 H  HB   . THR B 2 49  ? 4.416   -3.661  -20.514 1.00 0.00 ? 149 THR B HB   5  
ATOM   10235 H  HG1  . THR B 2 49  ? 4.639   -4.464  -23.224 1.00 0.00 ? 149 THR B HG1  5  
ATOM   10236 H  HG21 . THR B 2 49  ? 6.358   -2.935  -22.694 1.00 0.00 ? 149 THR B HG21 5  
ATOM   10237 H  HG22 . THR B 2 49  ? 6.433   -2.385  -21.020 1.00 0.00 ? 149 THR B HG22 5  
ATOM   10238 H  HG23 . THR B 2 49  ? 5.080   -1.908  -22.045 1.00 0.00 ? 149 THR B HG23 5  
ATOM   10239 N  N    . MET B 2 50  ? 6.007   -4.784  -18.600 1.00 0.00 ? 150 MET B N    5  
ATOM   10240 C  CA   . MET B 2 50  ? 6.656   -4.504  -17.327 1.00 0.00 ? 150 MET B CA   5  
ATOM   10241 C  C    . MET B 2 50  ? 7.717   -5.554  -17.046 1.00 0.00 ? 150 MET B C    5  
ATOM   10242 O  O    . MET B 2 50  ? 8.786   -5.244  -16.528 1.00 0.00 ? 150 MET B O    5  
ATOM   10243 C  CB   . MET B 2 50  ? 5.631   -4.459  -16.192 1.00 0.00 ? 150 MET B CB   5  
ATOM   10244 C  CG   . MET B 2 50  ? 4.865   -3.149  -16.115 1.00 0.00 ? 150 MET B CG   5  
ATOM   10245 S  SD   . MET B 2 50  ? 5.944   -1.717  -15.923 1.00 0.00 ? 150 MET B SD   5  
ATOM   10246 C  CE   . MET B 2 50  ? 5.883   -1.019  -17.572 1.00 0.00 ? 150 MET B CE   5  
ATOM   10247 H  H    . MET B 2 50  ? 5.048   -4.985  -18.619 1.00 0.00 ? 150 MET B H    5  
ATOM   10248 H  HA   . MET B 2 50  ? 7.143   -3.545  -17.408 1.00 0.00 ? 150 MET B HA   5  
ATOM   10249 H  HB2  . MET B 2 50  ? 4.920   -5.260  -16.333 1.00 0.00 ? 150 MET B HB2  5  
ATOM   10250 H  HB3  . MET B 2 50  ? 6.145   -4.607  -15.253 1.00 0.00 ? 150 MET B HB3  5  
ATOM   10251 H  HG2  . MET B 2 50  ? 4.292   -3.029  -17.022 1.00 0.00 ? 150 MET B HG2  5  
ATOM   10252 H  HG3  . MET B 2 50  ? 4.192   -3.190  -15.270 1.00 0.00 ? 150 MET B HG3  5  
ATOM   10253 H  HE1  . MET B 2 50  ? 5.461   -1.742  -18.254 1.00 0.00 ? 150 MET B HE1  5  
ATOM   10254 H  HE2  . MET B 2 50  ? 6.883   -0.764  -17.892 1.00 0.00 ? 150 MET B HE2  5  
ATOM   10255 H  HE3  . MET B 2 50  ? 5.270   -0.130  -17.563 1.00 0.00 ? 150 MET B HE3  5  
ATOM   10256 N  N    . LYS B 2 51  ? 7.434   -6.797  -17.427 1.00 0.00 ? 151 LYS B N    5  
ATOM   10257 C  CA   . LYS B 2 51  ? 8.396   -7.873  -17.246 1.00 0.00 ? 151 LYS B CA   5  
ATOM   10258 C  C    . LYS B 2 51  ? 9.685   -7.498  -17.965 1.00 0.00 ? 151 LYS B C    5  
ATOM   10259 O  O    . LYS B 2 51  ? 10.788  -7.777  -17.495 1.00 0.00 ? 151 LYS B O    5  
ATOM   10260 C  CB   . LYS B 2 51  ? 7.846   -9.186  -17.806 1.00 0.00 ? 151 LYS B CB   5  
ATOM   10261 C  CG   . LYS B 2 51  ? 7.208   -10.078 -16.754 1.00 0.00 ? 151 LYS B CG   5  
ATOM   10262 C  CD   . LYS B 2 51  ? 5.690   -9.992  -16.794 1.00 0.00 ? 151 LYS B CD   5  
ATOM   10263 C  CE   . LYS B 2 51  ? 5.052   -11.372 -16.748 1.00 0.00 ? 151 LYS B CE   5  
ATOM   10264 N  NZ   . LYS B 2 51  ? 3.648   -11.352 -17.245 1.00 0.00 ? 151 LYS B NZ   5  
ATOM   10265 H  H    . LYS B 2 51  ? 6.577   -6.986  -17.861 1.00 0.00 ? 151 LYS B H    5  
ATOM   10266 H  HA   . LYS B 2 51  ? 8.592   -7.981  -16.191 1.00 0.00 ? 151 LYS B HA   5  
ATOM   10267 H  HB2  . LYS B 2 51  ? 7.101   -8.960  -18.555 1.00 0.00 ? 151 LYS B HB2  5  
ATOM   10268 H  HB3  . LYS B 2 51  ? 8.654   -9.732  -18.268 1.00 0.00 ? 151 LYS B HB3  5  
ATOM   10269 H  HG2  . LYS B 2 51  ? 7.507   -11.100 -16.933 1.00 0.00 ? 151 LYS B HG2  5  
ATOM   10270 H  HG3  . LYS B 2 51  ? 7.550   -9.768  -15.777 1.00 0.00 ? 151 LYS B HG3  5  
ATOM   10271 H  HD2  . LYS B 2 51  ? 5.347   -9.421  -15.946 1.00 0.00 ? 151 LYS B HD2  5  
ATOM   10272 H  HD3  . LYS B 2 51  ? 5.390   -9.498  -17.708 1.00 0.00 ? 151 LYS B HD3  5  
ATOM   10273 H  HE2  . LYS B 2 51  ? 5.632   -12.045 -17.362 1.00 0.00 ? 151 LYS B HE2  5  
ATOM   10274 H  HE3  . LYS B 2 51  ? 5.058   -11.723 -15.726 1.00 0.00 ? 151 LYS B HE3  5  
ATOM   10275 H  HZ1  . LYS B 2 51  ? 3.576   -10.744 -18.086 1.00 0.00 ? 151 LYS B HZ1  5  
ATOM   10276 H  HZ2  . LYS B 2 51  ? 3.013   -10.984 -16.509 1.00 0.00 ? 151 LYS B HZ2  5  
ATOM   10277 H  HZ3  . LYS B 2 51  ? 3.346   -12.314 -17.500 1.00 0.00 ? 151 LYS B HZ3  5  
ATOM   10278 N  N    . ASN B 2 52  ? 9.515   -6.833  -19.105 1.00 0.00 ? 152 ASN B N    5  
ATOM   10279 C  CA   . ASN B 2 52  ? 10.630  -6.373  -19.910 1.00 0.00 ? 152 ASN B CA   5  
ATOM   10280 C  C    . ASN B 2 52  ? 11.285  -5.161  -19.255 1.00 0.00 ? 152 ASN B C    5  
ATOM   10281 O  O    . ASN B 2 52  ? 12.510  -5.089  -19.139 1.00 0.00 ? 152 ASN B O    5  
ATOM   10282 C  CB   . ASN B 2 52  ? 10.144  -6.012  -21.317 1.00 0.00 ? 152 ASN B CB   5  
ATOM   10283 C  CG   . ASN B 2 52  ? 11.149  -6.382  -22.389 1.00 0.00 ? 152 ASN B CG   5  
ATOM   10284 O  OD1  . ASN B 2 52  ? 12.309  -6.672  -22.098 1.00 0.00 ? 152 ASN B OD1  5  
ATOM   10285 N  ND2  . ASN B 2 52  ? 10.707  -6.375  -23.642 1.00 0.00 ? 152 ASN B ND2  5  
ATOM   10286 H  H    . ASN B 2 52  ? 8.606   -6.636  -19.403 1.00 0.00 ? 152 ASN B H    5  
ATOM   10287 H  HA   . ASN B 2 52  ? 11.348  -7.173  -19.975 1.00 0.00 ? 152 ASN B HA   5  
ATOM   10288 H  HB2  . ASN B 2 52  ? 9.221   -6.535  -21.516 1.00 0.00 ? 152 ASN B HB2  5  
ATOM   10289 H  HB3  . ASN B 2 52  ? 9.965   -4.948  -21.367 1.00 0.00 ? 152 ASN B HB3  5  
ATOM   10290 H  HD21 . ASN B 2 52  ? 9.771   -6.135  -23.800 1.00 0.00 ? 152 ASN B HD21 5  
ATOM   10291 H  HD22 . ASN B 2 52  ? 11.335  -6.612  -24.356 1.00 0.00 ? 152 ASN B HD22 5  
ATOM   10292 N  N    . VAL B 2 53  ? 10.457  -4.216  -18.814 1.00 0.00 ? 153 VAL B N    5  
ATOM   10293 C  CA   . VAL B 2 53  ? 10.956  -3.016  -18.157 1.00 0.00 ? 153 VAL B CA   5  
ATOM   10294 C  C    . VAL B 2 53  ? 11.620  -3.375  -16.836 1.00 0.00 ? 153 VAL B C    5  
ATOM   10295 O  O    . VAL B 2 53  ? 12.586  -2.739  -16.417 1.00 0.00 ? 153 VAL B O    5  
ATOM   10296 C  CB   . VAL B 2 53  ? 9.829   -1.995  -17.905 1.00 0.00 ? 153 VAL B CB   5  
ATOM   10297 C  CG1  . VAL B 2 53  ? 10.388  -0.710  -17.313 1.00 0.00 ? 153 VAL B CG1  5  
ATOM   10298 C  CG2  . VAL B 2 53  ? 9.070   -1.707  -19.192 1.00 0.00 ? 153 VAL B CG2  5  
ATOM   10299 H  H    . VAL B 2 53  ? 9.487   -4.334  -18.924 1.00 0.00 ? 153 VAL B H    5  
ATOM   10300 H  HA   . VAL B 2 53  ? 11.692  -2.561  -18.805 1.00 0.00 ? 153 VAL B HA   5  
ATOM   10301 H  HB   . VAL B 2 53  ? 9.137   -2.421  -17.193 1.00 0.00 ? 153 VAL B HB   5  
ATOM   10302 H  HG11 . VAL B 2 53  ? 9.699   -0.322  -16.578 1.00 0.00 ? 153 VAL B HG11 5  
ATOM   10303 H  HG12 . VAL B 2 53  ? 10.525  0.019   -18.099 1.00 0.00 ? 153 VAL B HG12 5  
ATOM   10304 H  HG13 . VAL B 2 53  ? 11.339  -0.913  -16.842 1.00 0.00 ? 153 VAL B HG13 5  
ATOM   10305 H  HG21 . VAL B 2 53  ? 8.733   -0.680  -19.191 1.00 0.00 ? 153 VAL B HG21 5  
ATOM   10306 H  HG22 . VAL B 2 53  ? 8.216   -2.364  -19.262 1.00 0.00 ? 153 VAL B HG22 5  
ATOM   10307 H  HG23 . VAL B 2 53  ? 9.720   -1.871  -20.039 1.00 0.00 ? 153 VAL B HG23 5  
ATOM   10308 N  N    . LEU B 2 54  ? 11.099  -4.409  -16.188 1.00 0.00 ? 154 LEU B N    5  
ATOM   10309 C  CA   . LEU B 2 54  ? 11.634  -4.870  -14.931 1.00 0.00 ? 154 LEU B CA   5  
ATOM   10310 C  C    . LEU B 2 54  ? 13.051  -5.388  -15.122 1.00 0.00 ? 154 LEU B C    5  
ATOM   10311 O  O    . LEU B 2 54  ? 13.955  -5.059  -14.356 1.00 0.00 ? 154 LEU B O    5  
ATOM   10312 C  CB   . LEU B 2 54  ? 10.729  -5.966  -14.384 1.00 0.00 ? 154 LEU B CB   5  
ATOM   10313 C  CG   . LEU B 2 54  ? 9.702   -5.500  -13.354 1.00 0.00 ? 154 LEU B CG   5  
ATOM   10314 C  CD1  . LEU B 2 54  ? 8.912   -6.683  -12.813 1.00 0.00 ? 154 LEU B CD1  5  
ATOM   10315 C  CD2  . LEU B 2 54  ? 10.383  -4.747  -12.221 1.00 0.00 ? 154 LEU B CD2  5  
ATOM   10316 H  H    . LEU B 2 54  ? 10.334  -4.884  -16.566 1.00 0.00 ? 154 LEU B H    5  
ATOM   10317 H  HA   . LEU B 2 54  ? 11.652  -4.042  -14.247 1.00 0.00 ? 154 LEU B HA   5  
ATOM   10318 H  HB2  . LEU B 2 54  ? 10.196  -6.406  -15.215 1.00 0.00 ? 154 LEU B HB2  5  
ATOM   10319 H  HB3  . LEU B 2 54  ? 11.343  -6.718  -13.941 1.00 0.00 ? 154 LEU B HB3  5  
ATOM   10320 H  HG   . LEU B 2 54  ? 9.008   -4.826  -13.837 1.00 0.00 ? 154 LEU B HG   5  
ATOM   10321 H  HD11 . LEU B 2 54  ? 7.919   -6.356  -12.538 1.00 0.00 ? 154 LEU B HD11 5  
ATOM   10322 H  HD12 . LEU B 2 54  ? 9.413   -7.082  -11.944 1.00 0.00 ? 154 LEU B HD12 5  
ATOM   10323 H  HD13 . LEU B 2 54  ? 8.843   -7.447  -13.572 1.00 0.00 ? 154 LEU B HD13 5  
ATOM   10324 H  HD21 . LEU B 2 54  ? 11.411  -5.069  -12.141 1.00 0.00 ? 154 LEU B HD21 5  
ATOM   10325 H  HD22 . LEU B 2 54  ? 9.869   -4.950  -11.293 1.00 0.00 ? 154 LEU B HD22 5  
ATOM   10326 H  HD23 . LEU B 2 54  ? 10.352  -3.687  -12.424 1.00 0.00 ? 154 LEU B HD23 5  
ATOM   10327 N  N    . ASN B 2 55  ? 13.238  -6.183  -16.168 1.00 0.00 ? 155 ASN B N    5  
ATOM   10328 C  CA   . ASN B 2 55  ? 14.551  -6.730  -16.485 1.00 0.00 ? 155 ASN B CA   5  
ATOM   10329 C  C    . ASN B 2 55  ? 15.543  -5.591  -16.677 1.00 0.00 ? 155 ASN B C    5  
ATOM   10330 O  O    . ASN B 2 55  ? 16.704  -5.682  -16.279 1.00 0.00 ? 155 ASN B O    5  
ATOM   10331 C  CB   . ASN B 2 55  ? 14.481  -7.591  -17.749 1.00 0.00 ? 155 ASN B CB   5  
ATOM   10332 C  CG   . ASN B 2 55  ? 15.061  -8.976  -17.538 1.00 0.00 ? 155 ASN B CG   5  
ATOM   10333 O  OD1  . ASN B 2 55  ? 14.370  -9.889  -17.083 1.00 0.00 ? 155 ASN B OD1  5  
ATOM   10334 N  ND2  . ASN B 2 55  ? 16.337  -9.141  -17.867 1.00 0.00 ? 155 ASN B ND2  5  
ATOM   10335 H  H    . ASN B 2 55  ? 12.477  -6.390  -16.747 1.00 0.00 ? 155 ASN B H    5  
ATOM   10336 H  HA   . ASN B 2 55  ? 14.871  -7.339  -15.653 1.00 0.00 ? 155 ASN B HA   5  
ATOM   10337 H  HB2  . ASN B 2 55  ? 13.449  -7.697  -18.048 1.00 0.00 ? 155 ASN B HB2  5  
ATOM   10338 H  HB3  . ASN B 2 55  ? 15.034  -7.106  -18.540 1.00 0.00 ? 155 ASN B HB3  5  
ATOM   10339 H  HD21 . ASN B 2 55  ? 16.826  -8.370  -18.224 1.00 0.00 ? 155 ASN B HD21 5  
ATOM   10340 H  HD22 . ASN B 2 55  ? 16.737  -10.026 -17.742 1.00 0.00 ? 155 ASN B HD22 5  
ATOM   10341 N  N    . HIS B 2 56  ? 15.056  -4.508  -17.274 1.00 0.00 ? 156 HIS B N    5  
ATOM   10342 C  CA   . HIS B 2 56  ? 15.870  -3.324  -17.508 1.00 0.00 ? 156 HIS B CA   5  
ATOM   10343 C  C    . HIS B 2 56  ? 16.285  -2.710  -16.185 1.00 0.00 ? 156 HIS B C    5  
ATOM   10344 O  O    . HIS B 2 56  ? 17.465  -2.667  -15.840 1.00 0.00 ? 156 HIS B O    5  
ATOM   10345 C  CB   . HIS B 2 56  ? 15.068  -2.297  -18.305 1.00 0.00 ? 156 HIS B CB   5  
ATOM   10346 C  CG   . HIS B 2 56  ? 15.780  -0.998  -18.521 1.00 0.00 ? 156 HIS B CG   5  
ATOM   10347 N  ND1  . HIS B 2 56  ? 17.069  -0.743  -18.104 1.00 0.00 ? 156 HIS B ND1  5  
ATOM   10348 C  CD2  . HIS B 2 56  ? 15.344  0.145   -19.104 1.00 0.00 ? 156 HIS B CD2  5  
ATOM   10349 C  CE1  . HIS B 2 56  ? 17.363  0.521   -18.434 1.00 0.00 ? 156 HIS B CE1  5  
ATOM   10350 N  NE2  . HIS B 2 56  ? 16.352  1.102   -19.045 1.00 0.00 ? 156 HIS B NE2  5  
ATOM   10351 H  H    . HIS B 2 56  ? 14.115  -4.499  -17.551 1.00 0.00 ? 156 HIS B H    5  
ATOM   10352 H  HA   . HIS B 2 56  ? 16.747  -3.611  -18.067 1.00 0.00 ? 156 HIS B HA   5  
ATOM   10353 H  HB2  . HIS B 2 56  ? 14.827  -2.711  -19.262 1.00 0.00 ? 156 HIS B HB2  5  
ATOM   10354 H  HB3  . HIS B 2 56  ? 14.152  -2.086  -17.775 1.00 0.00 ? 156 HIS B HB3  5  
ATOM   10355 H  HD1  . HIS B 2 56  ? 17.667  -1.374  -17.652 1.00 0.00 ? 156 HIS B HD1  5  
ATOM   10356 H  HD2  . HIS B 2 56  ? 14.370  0.301   -19.544 1.00 0.00 ? 156 HIS B HD2  5  
ATOM   10357 H  HE1  . HIS B 2 56  ? 18.299  1.007   -18.215 1.00 0.00 ? 156 HIS B HE1  5  
ATOM   10358 N  N    . MET B 2 57  ? 15.289  -2.231  -15.456 1.00 0.00 ? 157 MET B N    5  
ATOM   10359 C  CA   . MET B 2 57  ? 15.508  -1.602  -14.155 1.00 0.00 ? 157 MET B CA   5  
ATOM   10360 C  C    . MET B 2 57  ? 16.474  -2.420  -13.299 1.00 0.00 ? 157 MET B C    5  
ATOM   10361 O  O    . MET B 2 57  ? 17.332  -1.865  -12.612 1.00 0.00 ? 157 MET B O    5  
ATOM   10362 C  CB   . MET B 2 57  ? 14.174  -1.442  -13.422 1.00 0.00 ? 157 MET B CB   5  
ATOM   10363 C  CG   . MET B 2 57  ? 14.154  -0.290  -12.431 1.00 0.00 ? 157 MET B CG   5  
ATOM   10364 S  SD   . MET B 2 57  ? 12.530  -0.046  -11.686 1.00 0.00 ? 157 MET B SD   5  
ATOM   10365 C  CE   . MET B 2 57  ? 12.083  -1.731  -11.273 1.00 0.00 ? 157 MET B CE   5  
ATOM   10366 H  H    . MET B 2 57  ? 14.374  -2.300  -15.811 1.00 0.00 ? 157 MET B H    5  
ATOM   10367 H  HA   . MET B 2 57  ? 15.935  -0.625  -14.328 1.00 0.00 ? 157 MET B HA   5  
ATOM   10368 H  HB2  . MET B 2 57  ? 13.395  -1.275  -14.150 1.00 0.00 ? 157 MET B HB2  5  
ATOM   10369 H  HB3  . MET B 2 57  ? 13.961  -2.355  -12.885 1.00 0.00 ? 157 MET B HB3  5  
ATOM   10370 H  HG2  . MET B 2 57  ? 14.867  -0.497  -11.647 1.00 0.00 ? 157 MET B HG2  5  
ATOM   10371 H  HG3  . MET B 2 57  ? 14.439  0.615   -12.946 1.00 0.00 ? 157 MET B HG3  5  
ATOM   10372 H  HE1  . MET B 2 57  ? 12.969  -2.279  -10.987 1.00 0.00 ? 157 MET B HE1  5  
ATOM   10373 H  HE2  . MET B 2 57  ? 11.629  -2.204  -12.131 1.00 0.00 ? 157 MET B HE2  5  
ATOM   10374 H  HE3  . MET B 2 57  ? 11.382  -1.727  -10.451 1.00 0.00 ? 157 MET B HE3  5  
ATOM   10375 N  N    . THR B 2 58  ? 16.327  -3.740  -13.346 1.00 0.00 ? 158 THR B N    5  
ATOM   10376 C  CA   . THR B 2 58  ? 17.184  -4.636  -12.575 1.00 0.00 ? 158 THR B CA   5  
ATOM   10377 C  C    . THR B 2 58  ? 18.647  -4.509  -12.999 1.00 0.00 ? 158 THR B C    5  
ATOM   10378 O  O    . THR B 2 58  ? 19.548  -4.931  -12.276 1.00 0.00 ? 158 THR B O    5  
ATOM   10379 C  CB   . THR B 2 58  ? 16.722  -6.084  -12.737 1.00 0.00 ? 158 THR B CB   5  
ATOM   10380 O  OG1  . THR B 2 58  ? 15.315  -6.180  -12.604 1.00 0.00 ? 158 THR B OG1  5  
ATOM   10381 C  CG2  . THR B 2 58  ? 17.345  -7.026  -11.731 1.00 0.00 ? 158 THR B CG2  5  
ATOM   10382 H  H    . THR B 2 58  ? 15.623  -4.122  -13.912 1.00 0.00 ? 158 THR B H    5  
ATOM   10383 H  HA   . THR B 2 58  ? 17.101  -4.357  -11.535 1.00 0.00 ? 158 THR B HA   5  
ATOM   10384 H  HB   . THR B 2 58  ? 16.994  -6.428  -13.726 1.00 0.00 ? 158 THR B HB   5  
ATOM   10385 H  HG1  . THR B 2 58  ? 15.049  -5.821  -11.755 1.00 0.00 ? 158 THR B HG1  5  
ATOM   10386 H  HG21 . THR B 2 58  ? 16.567  -7.581  -11.227 1.00 0.00 ? 158 THR B HG21 5  
ATOM   10387 H  HG22 . THR B 2 58  ? 17.910  -6.458  -11.007 1.00 0.00 ? 158 THR B HG22 5  
ATOM   10388 H  HG23 . THR B 2 58  ? 18.004  -7.714  -12.241 1.00 0.00 ? 158 THR B HG23 5  
ATOM   10389 N  N    . HIS B 2 59  ? 18.877  -3.926  -14.172 1.00 0.00 ? 159 HIS B N    5  
ATOM   10390 C  CA   . HIS B 2 59  ? 20.227  -3.745  -14.685 1.00 0.00 ? 159 HIS B CA   5  
ATOM   10391 C  C    . HIS B 2 59  ? 20.463  -2.298  -15.111 1.00 0.00 ? 159 HIS B C    5  
ATOM   10392 O  O    . HIS B 2 59  ? 21.404  -2.004  -15.849 1.00 0.00 ? 159 HIS B O    5  
ATOM   10393 C  CB   . HIS B 2 59  ? 20.478  -4.686  -15.865 1.00 0.00 ? 159 HIS B CB   5  
ATOM   10394 C  CG   . HIS B 2 59  ? 21.879  -5.206  -15.928 1.00 0.00 ? 159 HIS B CG   5  
ATOM   10395 N  ND1  . HIS B 2 59  ? 22.273  -6.384  -15.327 1.00 0.00 ? 159 HIS B ND1  5  
ATOM   10396 C  CD2  . HIS B 2 59  ? 22.984  -4.705  -16.528 1.00 0.00 ? 159 HIS B CD2  5  
ATOM   10397 C  CE1  . HIS B 2 59  ? 23.559  -6.582  -15.554 1.00 0.00 ? 159 HIS B CE1  5  
ATOM   10398 N  NE2  . HIS B 2 59  ? 24.014  -5.578  -16.281 1.00 0.00 ? 159 HIS B NE2  5  
ATOM   10399 H  H    . HIS B 2 59  ? 18.125  -3.607  -14.704 1.00 0.00 ? 159 HIS B H    5  
ATOM   10400 H  HA   . HIS B 2 59  ? 20.910  -3.988  -13.892 1.00 0.00 ? 159 HIS B HA   5  
ATOM   10401 H  HB2  . HIS B 2 59  ? 19.812  -5.533  -15.789 1.00 0.00 ? 159 HIS B HB2  5  
ATOM   10402 H  HB3  . HIS B 2 59  ? 20.276  -4.158  -16.785 1.00 0.00 ? 159 HIS B HB3  5  
ATOM   10403 H  HD1  . HIS B 2 59  ? 21.696  -6.984  -14.810 1.00 0.00 ? 159 HIS B HD1  5  
ATOM   10404 H  HD2  . HIS B 2 59  ? 23.044  -3.786  -17.096 1.00 0.00 ? 159 HIS B HD2  5  
ATOM   10405 H  HE1  . HIS B 2 59  ? 24.140  -7.423  -15.206 1.00 0.00 ? 159 HIS B HE1  5  
ATOM   10406 H  HE2  . HIS B 2 59  ? 24.953  -5.434  -16.522 1.00 0.00 ? 159 HIS B HE2  5  
ATOM   10407 N  N    . CYS B 2 60  ? 19.604  -1.400  -14.639 1.00 0.00 ? 160 CYS B N    5  
ATOM   10408 C  CA   . CYS B 2 60  ? 19.719  0.014   -14.966 1.00 0.00 ? 160 CYS B CA   5  
ATOM   10409 C  C    . CYS B 2 60  ? 20.512  0.750   -13.890 1.00 0.00 ? 160 CYS B C    5  
ATOM   10410 O  O    . CYS B 2 60  ? 19.939  1.326   -12.965 1.00 0.00 ? 160 CYS B O    5  
ATOM   10411 C  CB   . CYS B 2 60  ? 18.328  0.632   -15.115 1.00 0.00 ? 160 CYS B CB   5  
ATOM   10412 S  SG   . CYS B 2 60  ? 18.338  2.413   -15.504 1.00 0.00 ? 160 CYS B SG   5  
ATOM   10413 H  H    . CYS B 2 60  ? 18.878  -1.694  -14.054 1.00 0.00 ? 160 CYS B H    5  
ATOM   10414 H  HA   . CYS B 2 60  ? 20.245  0.098   -15.905 1.00 0.00 ? 160 CYS B HA   5  
ATOM   10415 H  HB2  . CYS B 2 60  ? 17.801  0.125   -15.909 1.00 0.00 ? 160 CYS B HB2  5  
ATOM   10416 H  HB3  . CYS B 2 60  ? 17.785  0.498   -14.193 1.00 0.00 ? 160 CYS B HB3  5  
ATOM   10417 N  N    . GLN B 2 61  ? 21.836  0.714   -14.012 1.00 0.00 ? 161 GLN B N    5  
ATOM   10418 C  CA   . GLN B 2 61  ? 22.719  1.363   -13.048 1.00 0.00 ? 161 GLN B CA   5  
ATOM   10419 C  C    . GLN B 2 61  ? 22.665  2.887   -13.160 1.00 0.00 ? 161 GLN B C    5  
ATOM   10420 O  O    . GLN B 2 61  ? 23.226  3.594   -12.324 1.00 0.00 ? 161 GLN B O    5  
ATOM   10421 C  CB   . GLN B 2 61  ? 24.157  0.881   -13.251 1.00 0.00 ? 161 GLN B CB   5  
ATOM   10422 C  CG   . GLN B 2 61  ? 24.662  -0.016  -12.132 1.00 0.00 ? 161 GLN B CG   5  
ATOM   10423 C  CD   . GLN B 2 61  ? 25.816  0.600   -11.366 1.00 0.00 ? 161 GLN B CD   5  
ATOM   10424 O  OE1  . GLN B 2 61  ? 26.055  1.806   -11.443 1.00 0.00 ? 161 GLN B OE1  5  
ATOM   10425 N  NE2  . GLN B 2 61  ? 26.540  -0.226  -10.620 1.00 0.00 ? 161 GLN B NE2  5  
ATOM   10426 H  H    . GLN B 2 61  ? 22.230  0.230   -14.768 1.00 0.00 ? 161 GLN B H    5  
ATOM   10427 H  HA   . GLN B 2 61  ? 22.394  1.077   -12.060 1.00 0.00 ? 161 GLN B HA   5  
ATOM   10428 H  HB2  . GLN B 2 61  ? 24.209  0.328   -14.178 1.00 0.00 ? 161 GLN B HB2  5  
ATOM   10429 H  HB3  . GLN B 2 61  ? 24.808  1.740   -13.319 1.00 0.00 ? 161 GLN B HB3  5  
ATOM   10430 H  HG2  . GLN B 2 61  ? 23.851  -0.201  -11.443 1.00 0.00 ? 161 GLN B HG2  5  
ATOM   10431 H  HG3  . GLN B 2 61  ? 24.991  -0.952  -12.560 1.00 0.00 ? 161 GLN B HG3  5  
ATOM   10432 H  HE21 . GLN B 2 61  ? 26.293  -1.174  -10.606 1.00 0.00 ? 161 GLN B HE21 5  
ATOM   10433 H  HE22 . GLN B 2 61  ? 27.292  0.145   -10.114 1.00 0.00 ? 161 GLN B HE22 5  
ATOM   10434 N  N    . SER B 2 62  ? 21.992  3.390   -14.190 1.00 0.00 ? 162 SER B N    5  
ATOM   10435 C  CA   . SER B 2 62  ? 21.879  4.828   -14.390 1.00 0.00 ? 162 SER B CA   5  
ATOM   10436 C  C    . SER B 2 62  ? 21.107  5.467   -13.244 1.00 0.00 ? 162 SER B C    5  
ATOM   10437 O  O    . SER B 2 62  ? 21.664  6.230   -12.453 1.00 0.00 ? 162 SER B O    5  
ATOM   10438 C  CB   . SER B 2 62  ? 21.185  5.127   -15.719 1.00 0.00 ? 162 SER B CB   5  
ATOM   10439 O  OG   . SER B 2 62  ? 21.851  4.492   -16.797 1.00 0.00 ? 162 SER B OG   5  
ATOM   10440 H  H    . SER B 2 62  ? 21.562  2.786   -14.826 1.00 0.00 ? 162 SER B H    5  
ATOM   10441 H  HA   . SER B 2 62  ? 22.877  5.240   -14.412 1.00 0.00 ? 162 SER B HA   5  
ATOM   10442 H  HB2  . SER B 2 62  ? 20.167  4.767   -15.681 1.00 0.00 ? 162 SER B HB2  5  
ATOM   10443 H  HB3  . SER B 2 62  ? 21.184  6.193   -15.890 1.00 0.00 ? 162 SER B HB3  5  
ATOM   10444 H  HG   . SER B 2 62  ? 22.251  5.157   -17.363 1.00 0.00 ? 162 SER B HG   5  
ATOM   10445 N  N    . GLY B 2 63  ? 19.820  5.153   -13.164 1.00 0.00 ? 163 GLY B N    5  
ATOM   10446 C  CA   . GLY B 2 63  ? 18.986  5.702   -12.120 1.00 0.00 ? 163 GLY B CA   5  
ATOM   10447 C  C    . GLY B 2 63  ? 17.677  6.227   -12.648 1.00 0.00 ? 163 GLY B C    5  
ATOM   10448 O  O    . GLY B 2 63  ? 16.759  5.468   -12.959 1.00 0.00 ? 163 GLY B O    5  
ATOM   10449 H  H    . GLY B 2 63  ? 19.435  4.547   -13.824 1.00 0.00 ? 163 GLY B H    5  
ATOM   10450 H  HA2  . GLY B 2 63  ? 18.785  4.946   -11.391 1.00 0.00 ? 163 GLY B HA2  5  
ATOM   10451 H  HA3  . GLY B 2 63  ? 19.516  6.512   -11.645 1.00 0.00 ? 163 GLY B HA3  5  
ATOM   10452 N  N    . LYS B 2 64  ? 17.608  7.534   -12.745 1.00 0.00 ? 164 LYS B N    5  
ATOM   10453 C  CA   . LYS B 2 64  ? 16.418  8.220   -13.236 1.00 0.00 ? 164 LYS B CA   5  
ATOM   10454 C  C    . LYS B 2 64  ? 16.681  8.868   -14.594 1.00 0.00 ? 164 LYS B C    5  
ATOM   10455 O  O    . LYS B 2 64  ? 15.752  9.132   -15.356 1.00 0.00 ? 164 LYS B O    5  
ATOM   10456 C  CB   . LYS B 2 64  ? 15.960  9.279   -12.230 1.00 0.00 ? 164 LYS B CB   5  
ATOM   10457 C  CG   . LYS B 2 64  ? 16.952  10.417  -12.049 1.00 0.00 ? 164 LYS B CG   5  
ATOM   10458 C  CD   . LYS B 2 64  ? 16.244  11.753  -11.873 1.00 0.00 ? 164 LYS B CD   5  
ATOM   10459 C  CE   . LYS B 2 64  ? 16.366  12.266  -10.447 1.00 0.00 ? 164 LYS B CE   5  
ATOM   10460 N  NZ   . LYS B 2 64  ? 17.472  13.252  -10.304 1.00 0.00 ? 164 LYS B NZ   5  
ATOM   10461 H  H    . LYS B 2 64  ? 18.387  8.052   -12.475 1.00 0.00 ? 164 LYS B H    5  
ATOM   10462 H  HA   . LYS B 2 64  ? 15.638  7.484   -13.350 1.00 0.00 ? 164 LYS B HA   5  
ATOM   10463 H  HB2  . LYS B 2 64  ? 15.022  9.696   -12.567 1.00 0.00 ? 164 LYS B HB2  5  
ATOM   10464 H  HB3  . LYS B 2 64  ? 15.809  8.805   -11.271 1.00 0.00 ? 164 LYS B HB3  5  
ATOM   10465 H  HG2  . LYS B 2 64  ? 17.552  10.221  -11.173 1.00 0.00 ? 164 LYS B HG2  5  
ATOM   10466 H  HG3  . LYS B 2 64  ? 17.587  10.469  -12.920 1.00 0.00 ? 164 LYS B HG3  5  
ATOM   10467 H  HD2  . LYS B 2 64  ? 16.687  12.474  -12.543 1.00 0.00 ? 164 LYS B HD2  5  
ATOM   10468 H  HD3  . LYS B 2 64  ? 15.198  11.630  -12.114 1.00 0.00 ? 164 LYS B HD3  5  
ATOM   10469 H  HE2  . LYS B 2 64  ? 15.436  12.738  -10.167 1.00 0.00 ? 164 LYS B HE2  5  
ATOM   10470 H  HE3  . LYS B 2 64  ? 16.556  11.428  -9.792  1.00 0.00 ? 164 LYS B HE3  5  
ATOM   10471 H  HZ1  . LYS B 2 64  ? 18.324  12.906  -10.791 1.00 0.00 ? 164 LYS B HZ1  5  
ATOM   10472 H  HZ2  . LYS B 2 64  ? 17.695  13.397  -9.300  1.00 0.00 ? 164 LYS B HZ2  5  
ATOM   10473 H  HZ3  . LYS B 2 64  ? 17.194  14.165  -10.722 1.00 0.00 ? 164 LYS B HZ3  5  
ATOM   10474 N  N    . SER B 2 65  ? 17.951  9.121   -14.891 1.00 0.00 ? 165 SER B N    5  
ATOM   10475 C  CA   . SER B 2 65  ? 18.331  9.733   -16.158 1.00 0.00 ? 165 SER B CA   5  
ATOM   10476 C  C    . SER B 2 65  ? 18.777  8.671   -17.159 1.00 0.00 ? 165 SER B C    5  
ATOM   10477 O  O    . SER B 2 65  ? 19.576  8.944   -18.055 1.00 0.00 ? 165 SER B O    5  
ATOM   10478 C  CB   . SER B 2 65  ? 19.452  10.752  -15.943 1.00 0.00 ? 165 SER B CB   5  
ATOM   10479 O  OG   . SER B 2 65  ? 18.926  12.042  -15.683 1.00 0.00 ? 165 SER B OG   5  
ATOM   10480 H  H    . SER B 2 65  ? 18.650  8.888   -14.246 1.00 0.00 ? 165 SER B H    5  
ATOM   10481 H  HA   . SER B 2 65  ? 17.464  10.242  -16.553 1.00 0.00 ? 165 SER B HA   5  
ATOM   10482 H  HB2  . SER B 2 65  ? 20.057  10.447  -15.102 1.00 0.00 ? 165 SER B HB2  5  
ATOM   10483 H  HB3  . SER B 2 65  ? 20.068  10.798  -16.830 1.00 0.00 ? 165 SER B HB3  5  
ATOM   10484 H  HG   . SER B 2 65  ? 19.564  12.553  -15.179 1.00 0.00 ? 165 SER B HG   5  
ATOM   10485 N  N    . CYS B 2 66  ? 18.250  7.461   -17.002 1.00 0.00 ? 166 CYS B N    5  
ATOM   10486 C  CA   . CYS B 2 66  ? 18.587  6.357   -17.887 1.00 0.00 ? 166 CYS B CA   5  
ATOM   10487 C  C    . CYS B 2 66  ? 18.087  6.632   -19.303 1.00 0.00 ? 166 CYS B C    5  
ATOM   10488 O  O    . CYS B 2 66  ? 17.447  7.653   -19.555 1.00 0.00 ? 166 CYS B O    5  
ATOM   10489 C  CB   . CYS B 2 66  ? 17.981  5.061   -17.352 1.00 0.00 ? 166 CYS B CB   5  
ATOM   10490 S  SG   . CYS B 2 66  ? 18.943  3.564   -17.745 1.00 0.00 ? 166 CYS B SG   5  
ATOM   10491 H  H    . CYS B 2 66  ? 17.617  7.303   -16.272 1.00 0.00 ? 166 CYS B H    5  
ATOM   10492 H  HA   . CYS B 2 66  ? 19.661  6.263   -17.907 1.00 0.00 ? 166 CYS B HA   5  
ATOM   10493 H  HB2  . CYS B 2 66  ? 17.907  5.127   -16.276 1.00 0.00 ? 166 CYS B HB2  5  
ATOM   10494 H  HB3  . CYS B 2 66  ? 16.993  4.939   -17.765 1.00 0.00 ? 166 CYS B HB3  5  
ATOM   10495 N  N    . GLN B 2 67  ? 18.388  5.724   -20.224 1.00 0.00 ? 167 GLN B N    5  
ATOM   10496 C  CA   . GLN B 2 67  ? 17.974  5.882   -21.612 1.00 0.00 ? 167 GLN B CA   5  
ATOM   10497 C  C    . GLN B 2 67  ? 16.586  5.293   -21.860 1.00 0.00 ? 167 GLN B C    5  
ATOM   10498 O  O    . GLN B 2 67  ? 16.170  5.140   -23.009 1.00 0.00 ? 167 GLN B O    5  
ATOM   10499 C  CB   . GLN B 2 67  ? 18.991  5.221   -22.544 1.00 0.00 ? 167 GLN B CB   5  
ATOM   10500 C  CG   . GLN B 2 67  ? 19.271  3.766   -22.206 1.00 0.00 ? 167 GLN B CG   5  
ATOM   10501 C  CD   . GLN B 2 67  ? 19.979  3.033   -23.327 1.00 0.00 ? 167 GLN B CD   5  
ATOM   10502 O  OE1  . GLN B 2 67  ? 19.439  2.090   -23.906 1.00 0.00 ? 167 GLN B OE1  5  
ATOM   10503 N  NE2  . GLN B 2 67  ? 21.195  3.463   -23.641 1.00 0.00 ? 167 GLN B NE2  5  
ATOM   10504 H  H    . GLN B 2 67  ? 18.908  4.934   -19.967 1.00 0.00 ? 167 GLN B H    5  
ATOM   10505 H  HA   . GLN B 2 67  ? 17.944  6.939   -21.827 1.00 0.00 ? 167 GLN B HA   5  
ATOM   10506 H  HB2  . GLN B 2 67  ? 18.619  5.267   -23.556 1.00 0.00 ? 167 GLN B HB2  5  
ATOM   10507 H  HB3  . GLN B 2 67  ? 19.921  5.766   -22.486 1.00 0.00 ? 167 GLN B HB3  5  
ATOM   10508 H  HG2  . GLN B 2 67  ? 19.892  3.727   -21.323 1.00 0.00 ? 167 GLN B HG2  5  
ATOM   10509 H  HG3  . GLN B 2 67  ? 18.332  3.270   -22.007 1.00 0.00 ? 167 GLN B HG3  5  
ATOM   10510 H  HE21 . GLN B 2 67  ? 21.563  4.219   -23.137 1.00 0.00 ? 167 GLN B HE21 5  
ATOM   10511 H  HE22 . GLN B 2 67  ? 21.676  3.007   -24.362 1.00 0.00 ? 167 GLN B HE22 5  
ATOM   10512 N  N    . VAL B 2 68  ? 15.865  4.964   -20.789 1.00 0.00 ? 168 VAL B N    5  
ATOM   10513 C  CA   . VAL B 2 68  ? 14.542  4.404   -20.911 1.00 0.00 ? 168 VAL B CA   5  
ATOM   10514 C  C    . VAL B 2 68  ? 13.563  5.170   -20.036 1.00 0.00 ? 168 VAL B C    5  
ATOM   10515 O  O    . VAL B 2 68  ? 13.852  5.502   -18.887 1.00 0.00 ? 168 VAL B O    5  
ATOM   10516 C  CB   . VAL B 2 68  ? 14.541  2.925   -20.510 1.00 0.00 ? 168 VAL B CB   5  
ATOM   10517 C  CG1  . VAL B 2 68  ? 13.128  2.350   -20.524 1.00 0.00 ? 168 VAL B CG1  5  
ATOM   10518 C  CG2  . VAL B 2 68  ? 15.456  2.131   -21.430 1.00 0.00 ? 168 VAL B CG2  5  
ATOM   10519 H  H    . VAL B 2 68  ? 16.226  5.100   -19.896 1.00 0.00 ? 168 VAL B H    5  
ATOM   10520 H  HA   . VAL B 2 68  ? 14.234  4.481   -21.942 1.00 0.00 ? 168 VAL B HA   5  
ATOM   10521 H  HB   . VAL B 2 68  ? 14.929  2.860   -19.505 1.00 0.00 ? 168 VAL B HB   5  
ATOM   10522 H  HG11 . VAL B 2 68  ? 13.088  1.508   -21.199 1.00 0.00 ? 168 VAL B HG11 5  
ATOM   10523 H  HG12 . VAL B 2 68  ? 12.433  3.108   -20.854 1.00 0.00 ? 168 VAL B HG12 5  
ATOM   10524 H  HG13 . VAL B 2 68  ? 12.860  2.027   -19.530 1.00 0.00 ? 168 VAL B HG13 5  
ATOM   10525 H  HG21 . VAL B 2 68  ? 15.174  1.089   -21.407 1.00 0.00 ? 168 VAL B HG21 5  
ATOM   10526 H  HG22 . VAL B 2 68  ? 16.479  2.234   -21.098 1.00 0.00 ? 168 VAL B HG22 5  
ATOM   10527 H  HG23 . VAL B 2 68  ? 15.366  2.506   -22.438 1.00 0.00 ? 168 VAL B HG23 5  
ATOM   10528 N  N    . ALA B 2 69  ? 12.410  5.447   -20.604 1.00 0.00 ? 169 ALA B N    5  
ATOM   10529 C  CA   . ALA B 2 69  ? 11.360  6.181   -19.911 1.00 0.00 ? 169 ALA B CA   5  
ATOM   10530 C  C    . ALA B 2 69  ? 10.709  5.327   -18.832 1.00 0.00 ? 169 ALA B C    5  
ATOM   10531 O  O    . ALA B 2 69  ? 10.597  5.742   -17.679 1.00 0.00 ? 169 ALA B O    5  
ATOM   10532 C  CB   . ALA B 2 69  ? 10.312  6.655   -20.906 1.00 0.00 ? 169 ALA B CB   5  
ATOM   10533 H  H    . ALA B 2 69  ? 12.264  5.150   -21.520 1.00 0.00 ? 169 ALA B H    5  
ATOM   10534 H  HA   . ALA B 2 69  ? 11.806  7.052   -19.452 1.00 0.00 ? 169 ALA B HA   5  
ATOM   10535 H  HB1  . ALA B 2 69  ? 9.389   6.863   -20.386 1.00 0.00 ? 169 ALA B HB1  5  
ATOM   10536 H  HB2  . ALA B 2 69  ? 10.143  5.883   -21.644 1.00 0.00 ? 169 ALA B HB2  5  
ATOM   10537 H  HB3  . ALA B 2 69  ? 10.660  7.551   -21.398 1.00 0.00 ? 169 ALA B HB3  5  
ATOM   10538 N  N    . HIS B 2 70  ? 10.270  4.138   -19.221 1.00 0.00 ? 170 HIS B N    5  
ATOM   10539 C  CA   . HIS B 2 70  ? 9.615   3.225   -18.302 1.00 0.00 ? 170 HIS B CA   5  
ATOM   10540 C  C    . HIS B 2 70  ? 10.565  2.743   -17.208 1.00 0.00 ? 170 HIS B C    5  
ATOM   10541 O  O    . HIS B 2 70  ? 10.121  2.217   -16.187 1.00 0.00 ? 170 HIS B O    5  
ATOM   10542 C  CB   . HIS B 2 70  ? 9.037   2.036   -19.066 1.00 0.00 ? 170 HIS B CB   5  
ATOM   10543 C  CG   . HIS B 2 70  ? 7.924   2.421   -19.989 1.00 0.00 ? 170 HIS B CG   5  
ATOM   10544 N  ND1  . HIS B 2 70  ? 6.754   3.006   -19.553 1.00 0.00 ? 170 HIS B ND1  5  
ATOM   10545 C  CD2  . HIS B 2 70  ? 7.810   2.313   -21.334 1.00 0.00 ? 170 HIS B CD2  5  
ATOM   10546 C  CE1  . HIS B 2 70  ? 5.969   3.243   -20.589 1.00 0.00 ? 170 HIS B CE1  5  
ATOM   10547 N  NE2  . HIS B 2 70  ? 6.588   2.832   -21.681 1.00 0.00 ? 170 HIS B NE2  5  
ATOM   10548 H  H    . HIS B 2 70  ? 10.376  3.871   -20.152 1.00 0.00 ? 170 HIS B H    5  
ATOM   10549 H  HA   . HIS B 2 70  ? 8.808   3.764   -17.844 1.00 0.00 ? 170 HIS B HA   5  
ATOM   10550 H  HB2  . HIS B 2 70  ? 9.816   1.579   -19.656 1.00 0.00 ? 170 HIS B HB2  5  
ATOM   10551 H  HB3  . HIS B 2 70  ? 8.653   1.314   -18.361 1.00 0.00 ? 170 HIS B HB3  5  
ATOM   10552 H  HD1  . HIS B 2 70  ? 6.532   3.217   -18.622 1.00 0.00 ? 170 HIS B HD1  5  
ATOM   10553 H  HD2  . HIS B 2 70  ? 8.545   1.899   -22.007 1.00 0.00 ? 170 HIS B HD2  5  
ATOM   10554 H  HE1  . HIS B 2 70  ? 4.987   3.690   -20.549 1.00 0.00 ? 170 HIS B HE1  5  
ATOM   10555 H  HE2  . HIS B 2 70  ? 6.209   2.844   -22.585 1.00 0.00 ? 170 HIS B HE2  5  
ATOM   10556 N  N    . CYS B 2 71  ? 11.869  2.928   -17.410 1.00 0.00 ? 171 CYS B N    5  
ATOM   10557 C  CA   . CYS B 2 71  ? 12.847  2.508   -16.416 1.00 0.00 ? 171 CYS B CA   5  
ATOM   10558 C  C    . CYS B 2 71  ? 12.897  3.504   -15.274 1.00 0.00 ? 171 CYS B C    5  
ATOM   10559 O  O    . CYS B 2 71  ? 12.480  3.213   -14.152 1.00 0.00 ? 171 CYS B O    5  
ATOM   10560 C  CB   . CYS B 2 71  ? 14.231  2.377   -17.046 1.00 0.00 ? 171 CYS B CB   5  
ATOM   10561 S  SG   . CYS B 2 71  ? 15.351  1.261   -16.140 1.00 0.00 ? 171 CYS B SG   5  
ATOM   10562 H  H    . CYS B 2 71  ? 12.179  3.360   -18.237 1.00 0.00 ? 171 CYS B H    5  
ATOM   10563 H  HA   . CYS B 2 71  ? 12.542  1.549   -16.031 1.00 0.00 ? 171 CYS B HA   5  
ATOM   10564 H  HB2  . CYS B 2 71  ? 14.122  2.000   -18.044 1.00 0.00 ? 171 CYS B HB2  5  
ATOM   10565 H  HB3  . CYS B 2 71  ? 14.697  3.348   -17.090 1.00 0.00 ? 171 CYS B HB3  5  
ATOM   10566 N  N    . ALA B 2 72  ? 13.408  4.685   -15.575 1.00 0.00 ? 172 ALA B N    5  
ATOM   10567 C  CA   . ALA B 2 72  ? 13.518  5.749   -14.583 1.00 0.00 ? 172 ALA B CA   5  
ATOM   10568 C  C    . ALA B 2 72  ? 12.175  6.012   -13.909 1.00 0.00 ? 172 ALA B C    5  
ATOM   10569 O  O    . ALA B 2 72  ? 12.095  6.129   -12.687 1.00 0.00 ? 172 ALA B O    5  
ATOM   10570 C  CB   . ALA B 2 72  ? 14.040  7.022   -15.231 1.00 0.00 ? 172 ALA B CB   5  
ATOM   10571 H  H    . ALA B 2 72  ? 13.718  4.844   -16.493 1.00 0.00 ? 172 ALA B H    5  
ATOM   10572 H  HA   . ALA B 2 72  ? 14.228  5.434   -13.834 1.00 0.00 ? 172 ALA B HA   5  
ATOM   10573 H  HB1  . ALA B 2 72  ? 15.093  6.911   -15.446 1.00 0.00 ? 172 ALA B HB1  5  
ATOM   10574 H  HB2  . ALA B 2 72  ? 13.897  7.854   -14.556 1.00 0.00 ? 172 ALA B HB2  5  
ATOM   10575 H  HB3  . ALA B 2 72  ? 13.502  7.206   -16.149 1.00 0.00 ? 172 ALA B HB3  5  
ATOM   10576 N  N    . SER B 2 73  ? 11.120  6.096   -14.714 1.00 0.00 ? 173 SER B N    5  
ATOM   10577 C  CA   . SER B 2 73  ? 9.781   6.337   -14.193 1.00 0.00 ? 173 SER B CA   5  
ATOM   10578 C  C    . SER B 2 73  ? 9.377   5.235   -13.220 1.00 0.00 ? 173 SER B C    5  
ATOM   10579 O  O    . SER B 2 73  ? 9.036   5.502   -12.069 1.00 0.00 ? 173 SER B O    5  
ATOM   10580 C  CB   . SER B 2 73  ? 8.770   6.419   -15.338 1.00 0.00 ? 173 SER B CB   5  
ATOM   10581 O  OG   . SER B 2 73  ? 8.539   5.142   -15.906 1.00 0.00 ? 173 SER B OG   5  
ATOM   10582 H  H    . SER B 2 73  ? 11.246  5.989   -15.681 1.00 0.00 ? 173 SER B H    5  
ATOM   10583 H  HA   . SER B 2 73  ? 9.795   7.280   -13.666 1.00 0.00 ? 173 SER B HA   5  
ATOM   10584 H  HB2  . SER B 2 73  ? 7.834   6.806   -14.962 1.00 0.00 ? 173 SER B HB2  5  
ATOM   10585 H  HB3  . SER B 2 73  ? 9.150   7.078   -16.104 1.00 0.00 ? 173 SER B HB3  5  
ATOM   10586 H  HG   . SER B 2 73  ? 7.617   4.901   -15.788 1.00 0.00 ? 173 SER B HG   5  
ATOM   10587 N  N    . SER B 2 74  ? 9.425   3.993   -13.693 1.00 0.00 ? 174 SER B N    5  
ATOM   10588 C  CA   . SER B 2 74  ? 9.069   2.843   -12.868 1.00 0.00 ? 174 SER B CA   5  
ATOM   10589 C  C    . SER B 2 74  ? 9.902   2.807   -11.593 1.00 0.00 ? 174 SER B C    5  
ATOM   10590 O  O    . SER B 2 74  ? 9.419   2.398   -10.537 1.00 0.00 ? 174 SER B O    5  
ATOM   10591 C  CB   . SER B 2 74  ? 9.263   1.546   -13.655 1.00 0.00 ? 174 SER B CB   5  
ATOM   10592 O  OG   . SER B 2 74  ? 8.851   0.422   -12.897 1.00 0.00 ? 174 SER B OG   5  
ATOM   10593 H  H    . SER B 2 74  ? 9.709   3.846   -14.620 1.00 0.00 ? 174 SER B H    5  
ATOM   10594 H  HA   . SER B 2 74  ? 8.027   2.939   -12.600 1.00 0.00 ? 174 SER B HA   5  
ATOM   10595 H  HB2  . SER B 2 74  ? 8.678   1.587   -14.562 1.00 0.00 ? 174 SER B HB2  5  
ATOM   10596 H  HB3  . SER B 2 74  ? 10.307  1.433   -13.906 1.00 0.00 ? 174 SER B HB3  5  
ATOM   10597 H  HG   . SER B 2 74  ? 9.623   -0.045  -12.571 1.00 0.00 ? 174 SER B HG   5  
ATOM   10598 N  N    . ARG B 2 75  ? 11.156  3.240   -11.693 1.00 0.00 ? 175 ARG B N    5  
ATOM   10599 C  CA   . ARG B 2 75  ? 12.047  3.257   -10.539 1.00 0.00 ? 175 ARG B CA   5  
ATOM   10600 C  C    . ARG B 2 75  ? 11.458  4.104   -9.416  1.00 0.00 ? 175 ARG B C    5  
ATOM   10601 O  O    . ARG B 2 75  ? 11.418  3.679   -8.261  1.00 0.00 ? 175 ARG B O    5  
ATOM   10602 C  CB   . ARG B 2 75  ? 13.423  3.794   -10.936 1.00 0.00 ? 175 ARG B CB   5  
ATOM   10603 C  CG   . ARG B 2 75  ? 14.440  3.751   -9.807  1.00 0.00 ? 175 ARG B CG   5  
ATOM   10604 C  CD   . ARG B 2 75  ? 15.268  5.024   -9.752  1.00 0.00 ? 175 ARG B CD   5  
ATOM   10605 N  NE   . ARG B 2 75  ? 14.634  6.056   -8.936  1.00 0.00 ? 175 ARG B NE   5  
ATOM   10606 C  CZ   . ARG B 2 75  ? 15.268  7.133   -8.478  1.00 0.00 ? 175 ARG B CZ   5  
ATOM   10607 N  NH1  . ARG B 2 75  ? 16.552  7.322   -8.751  1.00 0.00 ? 175 ARG B NH1  5  
ATOM   10608 N  NH2  . ARG B 2 75  ? 14.613  8.023   -7.745  1.00 0.00 ? 175 ARG B NH2  5  
ATOM   10609 H  H    . ARG B 2 75  ? 11.487  3.558   -12.559 1.00 0.00 ? 175 ARG B H    5  
ATOM   10610 H  HA   . ARG B 2 75  ? 12.154  2.240   -10.190 1.00 0.00 ? 175 ARG B HA   5  
ATOM   10611 H  HB2  . ARG B 2 75  ? 13.804  3.206   -11.758 1.00 0.00 ? 175 ARG B HB2  5  
ATOM   10612 H  HB3  . ARG B 2 75  ? 13.316  4.820   -11.258 1.00 0.00 ? 175 ARG B HB3  5  
ATOM   10613 H  HG2  . ARG B 2 75  ? 13.918  3.634   -8.869  1.00 0.00 ? 175 ARG B HG2  5  
ATOM   10614 H  HG3  . ARG B 2 75  ? 15.098  2.909   -9.962  1.00 0.00 ? 175 ARG B HG3  5  
ATOM   10615 H  HD2  . ARG B 2 75  ? 16.236  4.791   -9.332  1.00 0.00 ? 175 ARG B HD2  5  
ATOM   10616 H  HD3  . ARG B 2 75  ? 15.395  5.399   -10.757 1.00 0.00 ? 175 ARG B HD3  5  
ATOM   10617 H  HE   . ARG B 2 75  ? 13.685  5.940   -8.719  1.00 0.00 ? 175 ARG B HE   5  
ATOM   10618 H  HH11 . ARG B 2 75  ? 17.051  6.654   -9.304  1.00 0.00 ? 175 ARG B HH11 5  
ATOM   10619 H  HH12 . ARG B 2 75  ? 17.023  8.133   -8.402  1.00 0.00 ? 175 ARG B HH12 5  
ATOM   10620 H  HH21 . ARG B 2 75  ? 13.645  7.885   -7.536  1.00 0.00 ? 175 ARG B HH21 5  
ATOM   10621 H  HH22 . ARG B 2 75  ? 15.088  8.833   -7.401  1.00 0.00 ? 175 ARG B HH22 5  
ATOM   10622 N  N    . GLN B 2 76  ? 10.998  5.301   -9.765  1.00 0.00 ? 176 GLN B N    5  
ATOM   10623 C  CA   . GLN B 2 76  ? 10.407  6.207   -8.786  1.00 0.00 ? 176 GLN B CA   5  
ATOM   10624 C  C    . GLN B 2 76  ? 9.144   5.604   -8.179  1.00 0.00 ? 176 GLN B C    5  
ATOM   10625 O  O    . GLN B 2 76  ? 8.876   5.767   -6.989  1.00 0.00 ? 176 GLN B O    5  
ATOM   10626 C  CB   . GLN B 2 76  ? 10.079  7.551   -9.440  1.00 0.00 ? 176 GLN B CB   5  
ATOM   10627 C  CG   . GLN B 2 76  ? 11.261  8.505   -9.496  1.00 0.00 ? 176 GLN B CG   5  
ATOM   10628 C  CD   . GLN B 2 76  ? 11.378  9.363   -8.252  1.00 0.00 ? 176 GLN B CD   5  
ATOM   10629 O  OE1  . GLN B 2 76  ? 12.441  9.437   -7.633  1.00 0.00 ? 176 GLN B OE1  5  
ATOM   10630 N  NE2  . GLN B 2 76  ? 10.285  10.019  -7.877  1.00 0.00 ? 176 GLN B NE2  5  
ATOM   10631 H  H    . GLN B 2 76  ? 11.055  5.580   -10.702 1.00 0.00 ? 176 GLN B H    5  
ATOM   10632 H  HA   . GLN B 2 76  ? 11.130  6.365   -8.001  1.00 0.00 ? 176 GLN B HA   5  
ATOM   10633 H  HB2  . GLN B 2 76  ? 9.738   7.374   -10.449 1.00 0.00 ? 176 GLN B HB2  5  
ATOM   10634 H  HB3  . GLN B 2 76  ? 9.286   8.025   -8.880  1.00 0.00 ? 176 GLN B HB3  5  
ATOM   10635 H  HG2  . GLN B 2 76  ? 12.167  7.928   -9.603  1.00 0.00 ? 176 GLN B HG2  5  
ATOM   10636 H  HG3  . GLN B 2 76  ? 11.144  9.152   -10.352 1.00 0.00 ? 176 GLN B HG3  5  
ATOM   10637 H  HE21 . GLN B 2 76  ? 9.475   9.915   -8.418  1.00 0.00 ? 176 GLN B HE21 5  
ATOM   10638 H  HE22 . GLN B 2 76  ? 10.335  10.581  -7.076  1.00 0.00 ? 176 GLN B HE22 5  
ATOM   10639 N  N    . ILE B 2 77  ? 8.373   4.907   -9.006  1.00 0.00 ? 177 ILE B N    5  
ATOM   10640 C  CA   . ILE B 2 77  ? 7.136   4.279   -8.553  1.00 0.00 ? 177 ILE B CA   5  
ATOM   10641 C  C    . ILE B 2 77  ? 7.410   3.287   -7.426  1.00 0.00 ? 177 ILE B C    5  
ATOM   10642 O  O    . ILE B 2 77  ? 6.985   3.490   -6.286  1.00 0.00 ? 177 ILE B O    5  
ATOM   10643 C  CB   . ILE B 2 77  ? 6.424   3.546   -9.710  1.00 0.00 ? 177 ILE B CB   5  
ATOM   10644 C  CG1  . ILE B 2 77  ? 6.170   4.506   -10.874 1.00 0.00 ? 177 ILE B CG1  5  
ATOM   10645 C  CG2  . ILE B 2 77  ? 5.114   2.937   -9.231  1.00 0.00 ? 177 ILE B CG2  5  
ATOM   10646 C  CD1  . ILE B 2 77  ? 5.596   3.829   -12.100 1.00 0.00 ? 177 ILE B CD1  5  
ATOM   10647 H  H    . ILE B 2 77  ? 8.640   4.813   -9.944  1.00 0.00 ? 177 ILE B H    5  
ATOM   10648 H  HA   . ILE B 2 77  ? 6.481   5.055   -8.187  1.00 0.00 ? 177 ILE B HA   5  
ATOM   10649 H  HB   . ILE B 2 77  ? 7.063   2.745   -10.047 1.00 0.00 ? 177 ILE B HB   5  
ATOM   10650 H  HG12 . ILE B 2 77  ? 5.472   5.267   -10.559 1.00 0.00 ? 177 ILE B HG12 5  
ATOM   10651 H  HG13 . ILE B 2 77  ? 7.101   4.972   -11.158 1.00 0.00 ? 177 ILE B HG13 5  
ATOM   10652 H  HG21 . ILE B 2 77  ? 4.655   3.593   -8.506  1.00 0.00 ? 177 ILE B HG21 5  
ATOM   10653 H  HG22 . ILE B 2 77  ? 5.311   1.977   -8.774  1.00 0.00 ? 177 ILE B HG22 5  
ATOM   10654 H  HG23 . ILE B 2 77  ? 4.450   2.806   -10.072 1.00 0.00 ? 177 ILE B HG23 5  
ATOM   10655 H  HD11 . ILE B 2 77  ? 4.526   3.978   -12.124 1.00 0.00 ? 177 ILE B HD11 5  
ATOM   10656 H  HD12 . ILE B 2 77  ? 5.811   2.772   -12.061 1.00 0.00 ? 177 ILE B HD12 5  
ATOM   10657 H  HD13 . ILE B 2 77  ? 6.039   4.256   -12.987 1.00 0.00 ? 177 ILE B HD13 5  
ATOM   10658 N  N    . ILE B 2 78  ? 8.116   2.213   -7.755  1.00 0.00 ? 178 ILE B N    5  
ATOM   10659 C  CA   . ILE B 2 78  ? 8.444   1.184   -6.776  1.00 0.00 ? 178 ILE B CA   5  
ATOM   10660 C  C    . ILE B 2 78  ? 9.320   1.739   -5.657  1.00 0.00 ? 178 ILE B C    5  
ATOM   10661 O  O    . ILE B 2 78  ? 9.191   1.339   -4.500  1.00 0.00 ? 178 ILE B O    5  
ATOM   10662 C  CB   . ILE B 2 78  ? 9.162   -0.011  -7.432  1.00 0.00 ? 178 ILE B CB   5  
ATOM   10663 C  CG1  . ILE B 2 78  ? 8.398   -0.476  -8.674  1.00 0.00 ? 178 ILE B CG1  5  
ATOM   10664 C  CG2  . ILE B 2 78  ? 9.308   -1.150  -6.432  1.00 0.00 ? 178 ILE B CG2  5  
ATOM   10665 C  CD1  . ILE B 2 78  ? 8.981   -1.715  -9.318  1.00 0.00 ? 178 ILE B CD1  5  
ATOM   10666 H  H    . ILE B 2 78  ? 8.424   2.109   -8.680  1.00 0.00 ? 178 ILE B H    5  
ATOM   10667 H  HA   . ILE B 2 78  ? 7.518   0.828   -6.348  1.00 0.00 ? 178 ILE B HA   5  
ATOM   10668 H  HB   . ILE B 2 78  ? 10.151  0.309   -7.724  1.00 0.00 ? 178 ILE B HB   5  
ATOM   10669 H  HG12 . ILE B 2 78  ? 7.377   -0.696  -8.398  1.00 0.00 ? 178 ILE B HG12 5  
ATOM   10670 H  HG13 . ILE B 2 78  ? 8.404   0.314   -9.409  1.00 0.00 ? 178 ILE B HG13 5  
ATOM   10671 H  HG21 . ILE B 2 78  ? 9.830   -1.972  -6.899  1.00 0.00 ? 178 ILE B HG21 5  
ATOM   10672 H  HG22 . ILE B 2 78  ? 8.330   -1.478  -6.115  1.00 0.00 ? 178 ILE B HG22 5  
ATOM   10673 H  HG23 . ILE B 2 78  ? 9.869   -0.808  -5.575  1.00 0.00 ? 178 ILE B HG23 5  
ATOM   10674 H  HD11 . ILE B 2 78  ? 8.994   -1.590  -10.391 1.00 0.00 ? 178 ILE B HD11 5  
ATOM   10675 H  HD12 . ILE B 2 78  ? 8.375   -2.573  -9.063  1.00 0.00 ? 178 ILE B HD12 5  
ATOM   10676 H  HD13 . ILE B 2 78  ? 9.989   -1.866  -8.961  1.00 0.00 ? 178 ILE B HD13 5  
ATOM   10677 N  N    . SER B 2 79  ? 10.212  2.663   -6.006  1.00 0.00 ? 179 SER B N    5  
ATOM   10678 C  CA   . SER B 2 79  ? 11.106  3.270   -5.023  1.00 0.00 ? 179 SER B CA   5  
ATOM   10679 C  C    . SER B 2 79  ? 10.310  3.896   -3.882  1.00 0.00 ? 179 SER B C    5  
ATOM   10680 O  O    . SER B 2 79  ? 10.478  3.528   -2.720  1.00 0.00 ? 179 SER B O    5  
ATOM   10681 C  CB   . SER B 2 79  ? 11.991  4.329   -5.683  1.00 0.00 ? 179 SER B CB   5  
ATOM   10682 O  OG   . SER B 2 79  ? 13.054  3.728   -6.403  1.00 0.00 ? 179 SER B OG   5  
ATOM   10683 H  H    . SER B 2 79  ? 10.270  2.945   -6.943  1.00 0.00 ? 179 SER B H    5  
ATOM   10684 H  HA   . SER B 2 79  ? 11.733  2.488   -4.620  1.00 0.00 ? 179 SER B HA   5  
ATOM   10685 H  HB2  . SER B 2 79  ? 11.397  4.916   -6.368  1.00 0.00 ? 179 SER B HB2  5  
ATOM   10686 H  HB3  . SER B 2 79  ? 12.405  4.972   -4.922  1.00 0.00 ? 179 SER B HB3  5  
ATOM   10687 H  HG   . SER B 2 79  ? 13.887  4.121   -6.131  1.00 0.00 ? 179 SER B HG   5  
ATOM   10688 N  N    . HIS B 2 80  ? 9.436   4.837   -4.225  1.00 0.00 ? 180 HIS B N    5  
ATOM   10689 C  CA   . HIS B 2 80  ? 8.604   5.511   -3.235  1.00 0.00 ? 180 HIS B CA   5  
ATOM   10690 C  C    . HIS B 2 80  ? 7.895   4.490   -2.347  1.00 0.00 ? 180 HIS B C    5  
ATOM   10691 O  O    . HIS B 2 80  ? 7.912   4.593   -1.121  1.00 0.00 ? 180 HIS B O    5  
ATOM   10692 C  CB   . HIS B 2 80  ? 7.575   6.406   -3.945  1.00 0.00 ? 180 HIS B CB   5  
ATOM   10693 C  CG   . HIS B 2 80  ? 6.240   6.490   -3.257  1.00 0.00 ? 180 HIS B CG   5  
ATOM   10694 N  ND1  . HIS B 2 80  ? 5.779   7.617   -2.616  1.00 0.00 ? 180 HIS B ND1  5  
ATOM   10695 C  CD2  . HIS B 2 80  ? 5.261   5.553   -3.121  1.00 0.00 ? 180 HIS B CD2  5  
ATOM   10696 C  CE1  . HIS B 2 80  ? 4.565   7.341   -2.120  1.00 0.00 ? 180 HIS B CE1  5  
ATOM   10697 N  NE2  . HIS B 2 80  ? 4.204   6.102   -2.400  1.00 0.00 ? 180 HIS B NE2  5  
ATOM   10698 H  H    . HIS B 2 80  ? 9.344   5.083   -5.169  1.00 0.00 ? 180 HIS B H    5  
ATOM   10699 H  HA   . HIS B 2 80  ? 9.246   6.126   -2.623  1.00 0.00 ? 180 HIS B HA   5  
ATOM   10700 H  HB2  . HIS B 2 80  ? 7.973   7.405   -4.015  1.00 0.00 ? 180 HIS B HB2  5  
ATOM   10701 H  HB3  . HIS B 2 80  ? 7.411   6.023   -4.942  1.00 0.00 ? 180 HIS B HB3  5  
ATOM   10702 H  HD1  . HIS B 2 80  ? 6.253   8.470   -2.535  1.00 0.00 ? 180 HIS B HD1  5  
ATOM   10703 H  HD2  . HIS B 2 80  ? 5.289   4.541   -3.507  1.00 0.00 ? 180 HIS B HD2  5  
ATOM   10704 H  HE1  . HIS B 2 80  ? 3.958   8.044   -1.569  1.00 0.00 ? 180 HIS B HE1  5  
ATOM   10705 N  N    . TRP B 2 81  ? 7.267   3.515   -2.992  1.00 0.00 ? 181 TRP B N    5  
ATOM   10706 C  CA   . TRP B 2 81  ? 6.531   2.462   -2.298  1.00 0.00 ? 181 TRP B CA   5  
ATOM   10707 C  C    . TRP B 2 81  ? 7.283   1.945   -1.076  1.00 0.00 ? 181 TRP B C    5  
ATOM   10708 O  O    . TRP B 2 81  ? 6.786   2.010   0.047   1.00 0.00 ? 181 TRP B O    5  
ATOM   10709 C  CB   . TRP B 2 81  ? 6.280   1.306   -3.258  1.00 0.00 ? 181 TRP B CB   5  
ATOM   10710 C  CG   . TRP B 2 81  ? 5.400   0.239   -2.687  1.00 0.00 ? 181 TRP B CG   5  
ATOM   10711 C  CD1  . TRP B 2 81  ? 5.784   -0.813  -1.908  1.00 0.00 ? 181 TRP B CD1  5  
ATOM   10712 C  CD2  . TRP B 2 81  ? 3.984   0.124   -2.851  1.00 0.00 ? 181 TRP B CD2  5  
ATOM   10713 N  NE1  . TRP B 2 81  ? 4.691   -1.578  -1.577  1.00 0.00 ? 181 TRP B NE1  5  
ATOM   10714 C  CE2  . TRP B 2 81  ? 3.574   -1.022  -2.145  1.00 0.00 ? 181 TRP B CE2  5  
ATOM   10715 C  CE3  . TRP B 2 81  ? 3.025   0.881   -3.526  1.00 0.00 ? 181 TRP B CE3  5  
ATOM   10716 C  CZ2  . TRP B 2 81  ? 2.243   -1.428  -2.096  1.00 0.00 ? 181 TRP B CZ2  5  
ATOM   10717 C  CZ3  . TRP B 2 81  ? 1.705   0.477   -3.478  1.00 0.00 ? 181 TRP B CZ3  5  
ATOM   10718 C  CH2  . TRP B 2 81  ? 1.325   -0.668  -2.767  1.00 0.00 ? 181 TRP B CH2  5  
ATOM   10719 H  H    . TRP B 2 81  ? 7.292   3.505   -3.973  1.00 0.00 ? 181 TRP B H    5  
ATOM   10720 H  HA   . TRP B 2 81  ? 5.582   2.866   -1.983  1.00 0.00 ? 181 TRP B HA   5  
ATOM   10721 H  HB2  . TRP B 2 81  ? 5.813   1.686   -4.149  1.00 0.00 ? 181 TRP B HB2  5  
ATOM   10722 H  HB3  . TRP B 2 81  ? 7.223   0.859   -3.518  1.00 0.00 ? 181 TRP B HB3  5  
ATOM   10723 H  HD1  . TRP B 2 81  ? 6.802   -1.007  -1.604  1.00 0.00 ? 181 TRP B HD1  5  
ATOM   10724 H  HE1  . TRP B 2 81  ? 4.708   -2.388  -1.025  1.00 0.00 ? 181 TRP B HE1  5  
ATOM   10725 H  HE3  . TRP B 2 81  ? 3.300   1.767   -4.079  1.00 0.00 ? 181 TRP B HE3  5  
ATOM   10726 H  HZ2  . TRP B 2 81  ? 1.933   -2.308  -1.553  1.00 0.00 ? 181 TRP B HZ2  5  
ATOM   10727 H  HZ3  . TRP B 2 81  ? 0.950   1.047   -3.996  1.00 0.00 ? 181 TRP B HZ3  5  
ATOM   10728 H  HH2  . TRP B 2 81  ? 0.283   -0.945  -2.757  1.00 0.00 ? 181 TRP B HH2  5  
ATOM   10729 N  N    . LYS B 2 82  ? 8.473   1.416   -1.311  1.00 0.00 ? 182 LYS B N    5  
ATOM   10730 C  CA   . LYS B 2 82  ? 9.291   0.866   -0.233  1.00 0.00 ? 182 LYS B CA   5  
ATOM   10731 C  C    . LYS B 2 82  ? 9.618   1.925   0.816   1.00 0.00 ? 182 LYS B C    5  
ATOM   10732 O  O    . LYS B 2 82  ? 9.400   1.714   2.009   1.00 0.00 ? 182 LYS B O    5  
ATOM   10733 C  CB   . LYS B 2 82  ? 10.585  0.278   -0.798  1.00 0.00 ? 182 LYS B CB   5  
ATOM   10734 C  CG   . LYS B 2 82  ? 11.275  -0.692  0.150   1.00 0.00 ? 182 LYS B CG   5  
ATOM   10735 C  CD   . LYS B 2 82  ? 11.160  -2.128  -0.338  1.00 0.00 ? 182 LYS B CD   5  
ATOM   10736 C  CE   . LYS B 2 82  ? 9.866   -2.775  0.125   1.00 0.00 ? 182 LYS B CE   5  
ATOM   10737 N  NZ   . LYS B 2 82  ? 10.111  -3.857  1.119   1.00 0.00 ? 182 LYS B NZ   5  
ATOM   10738 H  H    . LYS B 2 82  ? 8.803   1.381   -2.234  1.00 0.00 ? 182 LYS B H    5  
ATOM   10739 H  HA   . LYS B 2 82  ? 8.726   0.076   0.237   1.00 0.00 ? 182 LYS B HA   5  
ATOM   10740 H  HB2  . LYS B 2 82  ? 10.358  -0.246  -1.715  1.00 0.00 ? 182 LYS B HB2  5  
ATOM   10741 H  HB3  . LYS B 2 82  ? 11.269  1.085   -1.014  1.00 0.00 ? 182 LYS B HB3  5  
ATOM   10742 H  HG2  . LYS B 2 82  ? 12.320  -0.428  0.219   1.00 0.00 ? 182 LYS B HG2  5  
ATOM   10743 H  HG3  . LYS B 2 82  ? 10.817  -0.614  1.125   1.00 0.00 ? 182 LYS B HG3  5  
ATOM   10744 H  HD2  . LYS B 2 82  ? 11.187  -2.134  -1.416  1.00 0.00 ? 182 LYS B HD2  5  
ATOM   10745 H  HD3  . LYS B 2 82  ? 11.995  -2.695  0.048   1.00 0.00 ? 182 LYS B HD3  5  
ATOM   10746 H  HE2  . LYS B 2 82  ? 9.239   -2.020  0.577   1.00 0.00 ? 182 LYS B HE2  5  
ATOM   10747 H  HE3  . LYS B 2 82  ? 9.361   -3.195  -0.733  1.00 0.00 ? 182 LYS B HE3  5  
ATOM   10748 H  HZ1  . LYS B 2 82  ? 10.958  -3.640  1.682   1.00 0.00 ? 182 LYS B HZ1  5  
ATOM   10749 H  HZ2  . LYS B 2 82  ? 10.254  -4.764  0.632   1.00 0.00 ? 182 LYS B HZ2  5  
ATOM   10750 H  HZ3  . LYS B 2 82  ? 9.295   -3.946  1.759   1.00 0.00 ? 182 LYS B HZ3  5  
ATOM   10751 N  N    . ASN B 2 83  ? 10.143  3.060   0.371   1.00 0.00 ? 183 ASN B N    5  
ATOM   10752 C  CA   . ASN B 2 83  ? 10.499  4.145   1.281   1.00 0.00 ? 183 ASN B CA   5  
ATOM   10753 C  C    . ASN B 2 83  ? 9.277   4.649   2.044   1.00 0.00 ? 183 ASN B C    5  
ATOM   10754 O  O    . ASN B 2 83  ? 9.397   5.180   3.148   1.00 0.00 ? 183 ASN B O    5  
ATOM   10755 C  CB   . ASN B 2 83  ? 11.141  5.298   0.509   1.00 0.00 ? 183 ASN B CB   5  
ATOM   10756 C  CG   . ASN B 2 83  ? 12.365  5.852   1.209   1.00 0.00 ? 183 ASN B CG   5  
ATOM   10757 O  OD1  . ASN B 2 83  ? 13.246  5.103   1.631   1.00 0.00 ? 183 ASN B OD1  5  
ATOM   10758 N  ND2  . ASN B 2 83  ? 12.427  7.172   1.337   1.00 0.00 ? 183 ASN B ND2  5  
ATOM   10759 H  H    . ASN B 2 83  ? 10.296  3.173   -0.591  1.00 0.00 ? 183 ASN B H    5  
ATOM   10760 H  HA   . ASN B 2 83  ? 11.214  3.758   1.991   1.00 0.00 ? 183 ASN B HA   5  
ATOM   10761 H  HB2  . ASN B 2 83  ? 11.437  4.948   -0.469  1.00 0.00 ? 183 ASN B HB2  5  
ATOM   10762 H  HB3  . ASN B 2 83  ? 10.420  6.095   0.398   1.00 0.00 ? 183 ASN B HB3  5  
ATOM   10763 H  HD21 . ASN B 2 83  ? 11.688  7.706   0.978   1.00 0.00 ? 183 ASN B HD21 5  
ATOM   10764 H  HD22 . ASN B 2 83  ? 13.211  7.558   1.778   1.00 0.00 ? 183 ASN B HD22 5  
ATOM   10765 N  N    . CYS B 2 84  ? 8.102   4.481   1.447   1.00 0.00 ? 184 CYS B N    5  
ATOM   10766 C  CA   . CYS B 2 84  ? 6.859   4.924   2.066   1.00 0.00 ? 184 CYS B CA   5  
ATOM   10767 C  C    . CYS B 2 84  ? 6.644   4.243   3.415   1.00 0.00 ? 184 CYS B C    5  
ATOM   10768 O  O    . CYS B 2 84  ? 6.818   3.032   3.546   1.00 0.00 ? 184 CYS B O    5  
ATOM   10769 C  CB   . CYS B 2 84  ? 5.676   4.632   1.142   1.00 0.00 ? 184 CYS B CB   5  
ATOM   10770 S  SG   . CYS B 2 84  ? 4.075   5.231   1.771   1.00 0.00 ? 184 CYS B SG   5  
ATOM   10771 H  H    . CYS B 2 84  ? 8.070   4.054   0.566   1.00 0.00 ? 184 CYS B H    5  
ATOM   10772 H  HA   . CYS B 2 84  ? 6.927   5.989   2.222   1.00 0.00 ? 184 CYS B HA   5  
ATOM   10773 H  HB2  . CYS B 2 84  ? 5.849   5.104   0.186   1.00 0.00 ? 184 CYS B HB2  5  
ATOM   10774 H  HB3  . CYS B 2 84  ? 5.593   3.565   1.000   1.00 0.00 ? 184 CYS B HB3  5  
ATOM   10775 N  N    . THR B 2 85  ? 6.261   5.033   4.413   1.00 0.00 ? 185 THR B N    5  
ATOM   10776 C  CA   . THR B 2 85  ? 6.018   4.512   5.752   1.00 0.00 ? 185 THR B CA   5  
ATOM   10777 C  C    . THR B 2 85  ? 4.888   5.277   6.433   1.00 0.00 ? 185 THR B C    5  
ATOM   10778 O  O    . THR B 2 85  ? 4.657   6.450   6.143   1.00 0.00 ? 185 THR B O    5  
ATOM   10779 C  CB   . THR B 2 85  ? 7.290   4.598   6.597   1.00 0.00 ? 185 THR B CB   5  
ATOM   10780 O  OG1  . THR B 2 85  ? 7.012   4.303   7.955   1.00 0.00 ? 185 THR B OG1  5  
ATOM   10781 C  CG2  . THR B 2 85  ? 7.949   5.959   6.550   1.00 0.00 ? 185 THR B CG2  5  
ATOM   10782 H  H    . THR B 2 85  ? 6.136   5.991   4.244   1.00 0.00 ? 185 THR B H    5  
ATOM   10783 H  HA   . THR B 2 85  ? 5.729   3.475   5.658   1.00 0.00 ? 185 THR B HA   5  
ATOM   10784 H  HB   . THR B 2 85  ? 8.002   3.872   6.232   1.00 0.00 ? 185 THR B HB   5  
ATOM   10785 H  HG1  . THR B 2 85  ? 6.487   5.010   8.336   1.00 0.00 ? 185 THR B HG1  5  
ATOM   10786 H  HG21 . THR B 2 85  ? 7.239   6.713   6.854   1.00 0.00 ? 185 THR B HG21 5  
ATOM   10787 H  HG22 . THR B 2 85  ? 8.281   6.163   5.543   1.00 0.00 ? 185 THR B HG22 5  
ATOM   10788 H  HG23 . THR B 2 85  ? 8.798   5.971   7.219   1.00 0.00 ? 185 THR B HG23 5  
ATOM   10789 N  N    . ARG B 2 86  ? 4.184   4.604   7.339   1.00 0.00 ? 186 ARG B N    5  
ATOM   10790 C  CA   . ARG B 2 86  ? 3.077   5.222   8.060   1.00 0.00 ? 186 ARG B CA   5  
ATOM   10791 C  C    . ARG B 2 86  ? 1.997   5.698   7.093   1.00 0.00 ? 186 ARG B C    5  
ATOM   10792 O  O    . ARG B 2 86  ? 2.065   5.435   5.892   1.00 0.00 ? 186 ARG B O    5  
ATOM   10793 C  CB   . ARG B 2 86  ? 3.582   6.396   8.901   1.00 0.00 ? 186 ARG B CB   5  
ATOM   10794 C  CG   . ARG B 2 86  ? 2.950   6.470   10.282  1.00 0.00 ? 186 ARG B CG   5  
ATOM   10795 C  CD   . ARG B 2 86  ? 3.900   5.970   11.358  1.00 0.00 ? 186 ARG B CD   5  
ATOM   10796 N  NE   . ARG B 2 86  ? 3.347   6.140   12.699  1.00 0.00 ? 186 ARG B NE   5  
ATOM   10797 C  CZ   . ARG B 2 86  ? 2.356   5.401   13.193  1.00 0.00 ? 186 ARG B CZ   5  
ATOM   10798 N  NH1  . ARG B 2 86  ? 1.803   4.444   12.457  1.00 0.00 ? 186 ARG B NH1  5  
ATOM   10799 N  NH2  . ARG B 2 86  ? 1.916   5.619   14.424  1.00 0.00 ? 186 ARG B NH2  5  
ATOM   10800 H  H    . ARG B 2 86  ? 4.415   3.671   7.526   1.00 0.00 ? 186 ARG B H    5  
ATOM   10801 H  HA   . ARG B 2 86  ? 2.653   4.477   8.716   1.00 0.00 ? 186 ARG B HA   5  
ATOM   10802 H  HB2  . ARG B 2 86  ? 4.651   6.304   9.022   1.00 0.00 ? 186 ARG B HB2  5  
ATOM   10803 H  HB3  . ARG B 2 86  ? 3.365   7.317   8.380   1.00 0.00 ? 186 ARG B HB3  5  
ATOM   10804 H  HG2  . ARG B 2 86  ? 2.691   7.497   10.494  1.00 0.00 ? 186 ARG B HG2  5  
ATOM   10805 H  HG3  . ARG B 2 86  ? 2.056   5.863   10.291  1.00 0.00 ? 186 ARG B HG3  5  
ATOM   10806 H  HD2  . ARG B 2 86  ? 4.092   4.920   11.189  1.00 0.00 ? 186 ARG B HD2  5  
ATOM   10807 H  HD3  . ARG B 2 86  ? 4.826   6.521   11.287  1.00 0.00 ? 186 ARG B HD3  5  
ATOM   10808 H  HE   . ARG B 2 86  ? 3.735   6.842   13.263  1.00 0.00 ? 186 ARG B HE   5  
ATOM   10809 H  HH11 . ARG B 2 86  ? 2.129   4.274   11.527  1.00 0.00 ? 186 ARG B HH11 5  
ATOM   10810 H  HH12 . ARG B 2 86  ? 1.059   3.891   12.834  1.00 0.00 ? 186 ARG B HH12 5  
ATOM   10811 H  HH21 . ARG B 2 86  ? 2.329   6.339   14.982  1.00 0.00 ? 186 ARG B HH21 5  
ATOM   10812 H  HH22 . ARG B 2 86  ? 1.172   5.063   14.795  1.00 0.00 ? 186 ARG B HH22 5  
ATOM   10813 N  N    . HIS B 2 87  ? 1.003   6.403   7.624   1.00 0.00 ? 187 HIS B N    5  
ATOM   10814 C  CA   . HIS B 2 87  ? -0.090  6.916   6.806   1.00 0.00 ? 187 HIS B CA   5  
ATOM   10815 C  C    . HIS B 2 87  ? 0.268   8.276   6.215   1.00 0.00 ? 187 HIS B C    5  
ATOM   10816 O  O    . HIS B 2 87  ? -0.070  9.317   6.779   1.00 0.00 ? 187 HIS B O    5  
ATOM   10817 C  CB   . HIS B 2 87  ? -1.368  7.030   7.639   1.00 0.00 ? 187 HIS B CB   5  
ATOM   10818 C  CG   . HIS B 2 87  ? -2.208  5.791   7.621   1.00 0.00 ? 187 HIS B CG   5  
ATOM   10819 N  ND1  . HIS B 2 87  ? -1.720  4.554   7.251   1.00 0.00 ? 187 HIS B ND1  5  
ATOM   10820 C  CD2  . HIS B 2 87  ? -3.512  5.600   7.932   1.00 0.00 ? 187 HIS B CD2  5  
ATOM   10821 C  CE1  . HIS B 2 87  ? -2.688  3.658   7.334   1.00 0.00 ? 187 HIS B CE1  5  
ATOM   10822 N  NE2  . HIS B 2 87  ? -3.785  4.267   7.746   1.00 0.00 ? 187 HIS B NE2  5  
ATOM   10823 H  H    . HIS B 2 87  ? 1.004   6.581   8.588   1.00 0.00 ? 187 HIS B H    5  
ATOM   10824 H  HA   . HIS B 2 87  ? -0.258  6.218   6.000   1.00 0.00 ? 187 HIS B HA   5  
ATOM   10825 H  HB2  . HIS B 2 87  ? -1.104  7.236   8.666   1.00 0.00 ? 187 HIS B HB2  5  
ATOM   10826 H  HB3  . HIS B 2 87  ? -1.967  7.844   7.257   1.00 0.00 ? 187 HIS B HB3  5  
ATOM   10827 H  HD1  . HIS B 2 87  ? -0.802  4.363   6.969   1.00 0.00 ? 187 HIS B HD1  5  
ATOM   10828 H  HD2  . HIS B 2 87  ? -4.209  6.356   8.266   1.00 0.00 ? 187 HIS B HD2  5  
ATOM   10829 H  HE1  . HIS B 2 87  ? -2.597  2.607   7.104   1.00 0.00 ? 187 HIS B HE1  5  
ATOM   10830 H  HE2  . HIS B 2 87  ? -4.623  3.819   7.984   1.00 0.00 ? 187 HIS B HE2  5  
ATOM   10831 N  N    . ASP B 2 88  ? 0.952   8.260   5.075   1.00 0.00 ? 188 ASP B N    5  
ATOM   10832 C  CA   . ASP B 2 88  ? 1.354   9.494   4.410   1.00 0.00 ? 188 ASP B CA   5  
ATOM   10833 C  C    . ASP B 2 88  ? 1.560   9.267   2.914   1.00 0.00 ? 188 ASP B C    5  
ATOM   10834 O  O    . ASP B 2 88  ? 2.466   9.840   2.310   1.00 0.00 ? 188 ASP B O    5  
ATOM   10835 C  CB   . ASP B 2 88  ? 2.638   10.041  5.036   1.00 0.00 ? 188 ASP B CB   5  
ATOM   10836 C  CG   . ASP B 2 88  ? 3.002   11.414  4.506   1.00 0.00 ? 188 ASP B CG   5  
ATOM   10837 O  OD1  . ASP B 2 88  ? 2.089   12.134  4.047   1.00 0.00 ? 188 ASP B OD1  5  
ATOM   10838 O  OD2  . ASP B 2 88  ? 4.198   11.770  4.549   1.00 0.00 ? 188 ASP B OD2  5  
ATOM   10839 H  H    . ASP B 2 88  ? 1.192   7.399   4.673   1.00 0.00 ? 188 ASP B H    5  
ATOM   10840 H  HA   . ASP B 2 88  ? 0.562   10.216  4.546   1.00 0.00 ? 188 ASP B HA   5  
ATOM   10841 H  HB2  . ASP B 2 88  ? 2.508   10.112  6.106   1.00 0.00 ? 188 ASP B HB2  5  
ATOM   10842 H  HB3  . ASP B 2 88  ? 3.453   9.365   4.821   1.00 0.00 ? 188 ASP B HB3  5  
ATOM   10843 N  N    . CYS B 2 89  ? 0.714   8.428   2.324   1.00 0.00 ? 189 CYS B N    5  
ATOM   10844 C  CA   . CYS B 2 89  ? 0.806   8.129   0.899   1.00 0.00 ? 189 CYS B CA   5  
ATOM   10845 C  C    . CYS B 2 89  ? -0.582  7.959   0.287   1.00 0.00 ? 189 CYS B C    5  
ATOM   10846 O  O    . CYS B 2 89  ? -1.414  7.224   0.817   1.00 0.00 ? 189 CYS B O    5  
ATOM   10847 C  CB   . CYS B 2 89  ? 1.627   6.860   0.676   1.00 0.00 ? 189 CYS B CB   5  
ATOM   10848 S  SG   . CYS B 2 89  ? 3.424   7.090   0.871   1.00 0.00 ? 189 CYS B SG   5  
ATOM   10849 H  H    . CYS B 2 89  ? 0.012   8.003   2.859   1.00 0.00 ? 189 CYS B H    5  
ATOM   10850 H  HA   . CYS B 2 89  ? 1.303   8.958   0.420   1.00 0.00 ? 189 CYS B HA   5  
ATOM   10851 H  HB2  . CYS B 2 89  ? 1.316   6.108   1.385   1.00 0.00 ? 189 CYS B HB2  5  
ATOM   10852 H  HB3  . CYS B 2 89  ? 1.449   6.497   -0.325  1.00 0.00 ? 189 CYS B HB3  5  
ATOM   10853 N  N    . PRO B 2 90  ? -0.854  8.637   -0.842  1.00 0.00 ? 190 PRO B N    5  
ATOM   10854 C  CA   . PRO B 2 90  ? -2.146  8.554   -1.520  1.00 0.00 ? 190 PRO B CA   5  
ATOM   10855 C  C    . PRO B 2 90  ? -2.226  7.380   -2.492  1.00 0.00 ? 190 PRO B C    5  
ATOM   10856 O  O    . PRO B 2 90  ? -3.309  7.012   -2.946  1.00 0.00 ? 190 PRO B O    5  
ATOM   10857 C  CB   . PRO B 2 90  ? -2.197  9.875   -2.279  1.00 0.00 ? 190 PRO B CB   5  
ATOM   10858 C  CG   . PRO B 2 90  ? -0.776  10.155  -2.638  1.00 0.00 ? 190 PRO B CG   5  
ATOM   10859 C  CD   . PRO B 2 90  ? 0.074   9.542   -1.549  1.00 0.00 ? 190 PRO B CD   5  
ATOM   10860 H  HA   . PRO B 2 90  ? -2.964  8.504   -0.818  1.00 0.00 ? 190 PRO B HA   5  
ATOM   10861 H  HB2  . PRO B 2 90  ? -2.816  9.764   -3.159  1.00 0.00 ? 190 PRO B HB2  5  
ATOM   10862 H  HB3  . PRO B 2 90  ? -2.601  10.646  -1.641  1.00 0.00 ? 190 PRO B HB3  5  
ATOM   10863 H  HG2  . PRO B 2 90  ? -0.544  9.701   -3.591  1.00 0.00 ? 190 PRO B HG2  5  
ATOM   10864 H  HG3  . PRO B 2 90  ? -0.614  11.221  -2.682  1.00 0.00 ? 190 PRO B HG3  5  
ATOM   10865 H  HD2  . PRO B 2 90  ? 0.895   8.989   -1.980  1.00 0.00 ? 190 PRO B HD2  5  
ATOM   10866 H  HD3  . PRO B 2 90  ? 0.443   10.309  -0.885  1.00 0.00 ? 190 PRO B HD3  5  
ATOM   10867 N  N    . VAL B 2 91  ? -1.073  6.802   -2.819  1.00 0.00 ? 191 VAL B N    5  
ATOM   10868 C  CA   . VAL B 2 91  ? -1.015  5.681   -3.747  1.00 0.00 ? 191 VAL B CA   5  
ATOM   10869 C  C    . VAL B 2 91  ? -1.081  4.338   -3.021  1.00 0.00 ? 191 VAL B C    5  
ATOM   10870 O  O    . VAL B 2 91  ? -2.005  3.552   -3.234  1.00 0.00 ? 191 VAL B O    5  
ATOM   10871 C  CB   . VAL B 2 91  ? 0.270   5.729   -4.597  1.00 0.00 ? 191 VAL B CB   5  
ATOM   10872 C  CG1  . VAL B 2 91  ? 0.223   4.685   -5.700  1.00 0.00 ? 191 VAL B CG1  5  
ATOM   10873 C  CG2  . VAL B 2 91  ? 0.472   7.120   -5.179  1.00 0.00 ? 191 VAL B CG2  5  
ATOM   10874 H  H    . VAL B 2 91  ? -0.239  7.145   -2.433  1.00 0.00 ? 191 VAL B H    5  
ATOM   10875 H  HA   . VAL B 2 91  ? -1.861  5.759   -4.413  1.00 0.00 ? 191 VAL B HA   5  
ATOM   10876 H  HB   . VAL B 2 91  ? 1.113   5.506   -3.955  1.00 0.00 ? 191 VAL B HB   5  
ATOM   10877 H  HG11 . VAL B 2 91  ? -0.239  3.784   -5.324  1.00 0.00 ? 191 VAL B HG11 5  
ATOM   10878 H  HG12 . VAL B 2 91  ? 1.228   4.464   -6.031  1.00 0.00 ? 191 VAL B HG12 5  
ATOM   10879 H  HG13 . VAL B 2 91  ? -0.354  5.064   -6.530  1.00 0.00 ? 191 VAL B HG13 5  
ATOM   10880 H  HG21 . VAL B 2 91  ? 1.472   7.202   -5.577  1.00 0.00 ? 191 VAL B HG21 5  
ATOM   10881 H  HG22 . VAL B 2 91  ? 0.330   7.859   -4.405  1.00 0.00 ? 191 VAL B HG22 5  
ATOM   10882 H  HG23 . VAL B 2 91  ? -0.245  7.284   -5.971  1.00 0.00 ? 191 VAL B HG23 5  
ATOM   10883 N  N    . CYS B 2 92  ? -0.092  4.077   -2.174  1.00 0.00 ? 192 CYS B N    5  
ATOM   10884 C  CA   . CYS B 2 92  ? -0.034  2.821   -1.429  1.00 0.00 ? 192 CYS B CA   5  
ATOM   10885 C  C    . CYS B 2 92  ? -1.272  2.631   -0.555  1.00 0.00 ? 192 CYS B C    5  
ATOM   10886 O  O    . CYS B 2 92  ? -1.726  1.505   -0.348  1.00 0.00 ? 192 CYS B O    5  
ATOM   10887 C  CB   . CYS B 2 92  ? 1.224   2.769   -0.558  1.00 0.00 ? 192 CYS B CB   5  
ATOM   10888 S  SG   . CYS B 2 92  ? 2.739   3.344   -1.393  1.00 0.00 ? 192 CYS B SG   5  
ATOM   10889 H  H    . CYS B 2 92  ? 0.619   4.738   -2.052  1.00 0.00 ? 192 CYS B H    5  
ATOM   10890 H  HA   . CYS B 2 92  ? 0.007   2.015   -2.147  1.00 0.00 ? 192 CYS B HA   5  
ATOM   10891 H  HB2  . CYS B 2 92  ? 1.075   3.389   0.311   1.00 0.00 ? 192 CYS B HB2  5  
ATOM   10892 H  HB3  . CYS B 2 92  ? 1.390   1.750   -0.242  1.00 0.00 ? 192 CYS B HB3  5  
ATOM   10893 N  N    . LEU B 2 93  ? -1.811  3.731   -0.038  1.00 0.00 ? 193 LEU B N    5  
ATOM   10894 C  CA   . LEU B 2 93  ? -2.991  3.672   0.820   1.00 0.00 ? 193 LEU B CA   5  
ATOM   10895 C  C    . LEU B 2 93  ? -4.141  2.936   0.132   1.00 0.00 ? 193 LEU B C    5  
ATOM   10896 O  O    . LEU B 2 93  ? -4.573  1.879   0.592   1.00 0.00 ? 193 LEU B O    5  
ATOM   10897 C  CB   . LEU B 2 93  ? -3.433  5.082   1.219   1.00 0.00 ? 193 LEU B CB   5  
ATOM   10898 C  CG   . LEU B 2 93  ? -2.987  5.533   2.612   1.00 0.00 ? 193 LEU B CG   5  
ATOM   10899 C  CD1  . LEU B 2 93  ? -1.488  5.331   2.786   1.00 0.00 ? 193 LEU B CD1  5  
ATOM   10900 C  CD2  . LEU B 2 93  ? -3.363  6.990   2.847   1.00 0.00 ? 193 LEU B CD2  5  
ATOM   10901 H  H    . LEU B 2 93  ? -1.403  4.601   -0.233  1.00 0.00 ? 193 LEU B H    5  
ATOM   10902 H  HA   . LEU B 2 93  ? -2.720  3.128   1.712   1.00 0.00 ? 193 LEU B HA   5  
ATOM   10903 H  HB2  . LEU B 2 93  ? -3.040  5.778   0.493   1.00 0.00 ? 193 LEU B HB2  5  
ATOM   10904 H  HB3  . LEU B 2 93  ? -4.512  5.124   1.182   1.00 0.00 ? 193 LEU B HB3  5  
ATOM   10905 H  HG   . LEU B 2 93  ? -3.491  4.933   3.355   1.00 0.00 ? 193 LEU B HG   5  
ATOM   10906 H  HD11 . LEU B 2 93  ? -1.071  6.169   3.324   1.00 0.00 ? 193 LEU B HD11 5  
ATOM   10907 H  HD12 . LEU B 2 93  ? -1.019  5.258   1.816   1.00 0.00 ? 193 LEU B HD12 5  
ATOM   10908 H  HD13 . LEU B 2 93  ? -1.310  4.422   3.341   1.00 0.00 ? 193 LEU B HD13 5  
ATOM   10909 H  HD21 . LEU B 2 93  ? -4.112  7.289   2.128   1.00 0.00 ? 193 LEU B HD21 5  
ATOM   10910 H  HD22 . LEU B 2 93  ? -2.487  7.611   2.736   1.00 0.00 ? 193 LEU B HD22 5  
ATOM   10911 H  HD23 . LEU B 2 93  ? -3.758  7.101   3.846   1.00 0.00 ? 193 LEU B HD23 5  
ATOM   10912 N  N    . PRO B 2 94  ? -4.655  3.482   -0.983  1.00 0.00 ? 194 PRO B N    5  
ATOM   10913 C  CA   . PRO B 2 94  ? -5.759  2.864   -1.724  1.00 0.00 ? 194 PRO B CA   5  
ATOM   10914 C  C    . PRO B 2 94  ? -5.362  1.532   -2.355  1.00 0.00 ? 194 PRO B C    5  
ATOM   10915 O  O    . PRO B 2 94  ? -6.217  0.715   -2.693  1.00 0.00 ? 194 PRO B O    5  
ATOM   10916 C  CB   . PRO B 2 94  ? -6.086  3.892   -2.812  1.00 0.00 ? 194 PRO B CB   5  
ATOM   10917 C  CG   . PRO B 2 94  ? -4.838  4.690   -2.970  1.00 0.00 ? 194 PRO B CG   5  
ATOM   10918 C  CD   . PRO B 2 94  ? -4.206  4.740   -1.609  1.00 0.00 ? 194 PRO B CD   5  
ATOM   10919 H  HA   . PRO B 2 94  ? -6.624  2.716   -1.094  1.00 0.00 ? 194 PRO B HA   5  
ATOM   10920 H  HB2  . PRO B 2 94  ? -6.347  3.381   -3.727  1.00 0.00 ? 194 PRO B HB2  5  
ATOM   10921 H  HB3  . PRO B 2 94  ? -6.910  4.510   -2.490  1.00 0.00 ? 194 PRO B HB3  5  
ATOM   10922 H  HG2  . PRO B 2 94  ? -4.178  4.204   -3.674  1.00 0.00 ? 194 PRO B HG2  5  
ATOM   10923 H  HG3  . PRO B 2 94  ? -5.081  5.687   -3.308  1.00 0.00 ? 194 PRO B HG3  5  
ATOM   10924 H  HD2  . PRO B 2 94  ? -3.129  4.766   -1.692  1.00 0.00 ? 194 PRO B HD2  5  
ATOM   10925 H  HD3  . PRO B 2 94  ? -4.565  5.595   -1.055  1.00 0.00 ? 194 PRO B HD3  5  
ATOM   10926 N  N    . LEU B 2 95  ? -4.058  1.323   -2.518  1.00 0.00 ? 195 LEU B N    5  
ATOM   10927 C  CA   . LEU B 2 95  ? -3.551  0.100   -3.114  1.00 0.00 ? 195 LEU B CA   5  
ATOM   10928 C  C    . LEU B 2 95  ? -3.473  -1.029  -2.088  1.00 0.00 ? 195 LEU B C    5  
ATOM   10929 O  O    . LEU B 2 95  ? -3.754  -2.185  -2.404  1.00 0.00 ? 195 LEU B O    5  
ATOM   10930 C  CB   . LEU B 2 95  ? -2.169  0.356   -3.712  1.00 0.00 ? 195 LEU B CB   5  
ATOM   10931 C  CG   . LEU B 2 95  ? -2.101  0.296   -5.237  1.00 0.00 ? 195 LEU B CG   5  
ATOM   10932 C  CD1  . LEU B 2 95  ? -0.840  0.981   -5.735  1.00 0.00 ? 195 LEU B CD1  5  
ATOM   10933 C  CD2  . LEU B 2 95  ? -2.159  -1.147  -5.719  1.00 0.00 ? 195 LEU B CD2  5  
ATOM   10934 H  H    . LEU B 2 95  ? -3.422  2.010   -2.237  1.00 0.00 ? 195 LEU B H    5  
ATOM   10935 H  HA   . LEU B 2 95  ? -4.225  -0.190  -3.902  1.00 0.00 ? 195 LEU B HA   5  
ATOM   10936 H  HB2  . LEU B 2 95  ? -1.841  1.336   -3.397  1.00 0.00 ? 195 LEU B HB2  5  
ATOM   10937 H  HB3  . LEU B 2 95  ? -1.487  -0.374  -3.314  1.00 0.00 ? 195 LEU B HB3  5  
ATOM   10938 H  HG   . LEU B 2 95  ? -2.950  0.823   -5.649  1.00 0.00 ? 195 LEU B HG   5  
ATOM   10939 H  HD11 . LEU B 2 95  ? -0.665  1.876   -5.158  1.00 0.00 ? 195 LEU B HD11 5  
ATOM   10940 H  HD12 . LEU B 2 95  ? -0.958  1.240   -6.777  1.00 0.00 ? 195 LEU B HD12 5  
ATOM   10941 H  HD13 . LEU B 2 95  ? -0.001  0.310   -5.623  1.00 0.00 ? 195 LEU B HD13 5  
ATOM   10942 H  HD21 . LEU B 2 95  ? -2.116  -1.813  -4.871  1.00 0.00 ? 195 LEU B HD21 5  
ATOM   10943 H  HD22 . LEU B 2 95  ? -1.322  -1.342  -6.373  1.00 0.00 ? 195 LEU B HD22 5  
ATOM   10944 H  HD23 . LEU B 2 95  ? -3.081  -1.309  -6.259  1.00 0.00 ? 195 LEU B HD23 5  
ATOM   10945 N  N    . LYS B 2 96  ? -3.085  -0.691  -0.863  1.00 0.00 ? 196 LYS B N    5  
ATOM   10946 C  CA   . LYS B 2 96  ? -2.967  -1.684  0.200   1.00 0.00 ? 196 LYS B CA   5  
ATOM   10947 C  C    . LYS B 2 96  ? -3.401  -1.105  1.545   1.00 0.00 ? 196 LYS B C    5  
ATOM   10948 O  O    . LYS B 2 96  ? -2.697  -1.234  2.547   1.00 0.00 ? 196 LYS B O    5  
ATOM   10949 C  CB   . LYS B 2 96  ? -1.526  -2.198  0.283   1.00 0.00 ? 196 LYS B CB   5  
ATOM   10950 C  CG   . LYS B 2 96  ? -1.337  -3.582  -0.319  1.00 0.00 ? 196 LYS B CG   5  
ATOM   10951 C  CD   . LYS B 2 96  ? -0.017  -4.201  0.110   1.00 0.00 ? 196 LYS B CD   5  
ATOM   10952 C  CE   . LYS B 2 96  ? 0.059   -4.358  1.621   1.00 0.00 ? 196 LYS B CE   5  
ATOM   10953 N  NZ   . LYS B 2 96  ? 0.957   -5.479  2.017   1.00 0.00 ? 196 LYS B NZ   5  
ATOM   10954 H  H    . LYS B 2 96  ? -2.869  0.246   -0.669  1.00 0.00 ? 196 LYS B H    5  
ATOM   10955 H  HA   . LYS B 2 96  ? -3.620  -2.507  -0.046  1.00 0.00 ? 196 LYS B HA   5  
ATOM   10956 H  HB2  . LYS B 2 96  ? -0.880  -1.511  -0.243  1.00 0.00 ? 196 LYS B HB2  5  
ATOM   10957 H  HB3  . LYS B 2 96  ? -1.225  -2.238  1.319   1.00 0.00 ? 196 LYS B HB3  5  
ATOM   10958 H  HG2  . LYS B 2 96  ? -2.146  -4.219  0.008   1.00 0.00 ? 196 LYS B HG2  5  
ATOM   10959 H  HG3  . LYS B 2 96  ? -1.353  -3.500  -1.396  1.00 0.00 ? 196 LYS B HG3  5  
ATOM   10960 H  HD2  . LYS B 2 96  ? 0.079   -5.175  -0.348  1.00 0.00 ? 196 LYS B HD2  5  
ATOM   10961 H  HD3  . LYS B 2 96  ? 0.791   -3.564  -0.219  1.00 0.00 ? 196 LYS B HD3  5  
ATOM   10962 H  HE2  . LYS B 2 96  ? 0.435   -3.440  2.047   1.00 0.00 ? 196 LYS B HE2  5  
ATOM   10963 H  HE3  . LYS B 2 96  ? -0.933  -4.551  2.000   1.00 0.00 ? 196 LYS B HE3  5  
ATOM   10964 H  HZ1  . LYS B 2 96  ? 1.940   -5.144  2.081   1.00 0.00 ? 196 LYS B HZ1  5  
ATOM   10965 H  HZ2  . LYS B 2 96  ? 0.907   -6.243  1.315   1.00 0.00 ? 196 LYS B HZ2  5  
ATOM   10966 H  HZ3  . LYS B 2 96  ? 0.670   -5.855  2.943   1.00 0.00 ? 196 LYS B HZ3  5  
ATOM   10967 N  N    . ASN B 2 97  ? -4.564  -0.463  1.556   1.00 0.00 ? 197 ASN B N    5  
ATOM   10968 C  CA   . ASN B 2 97  ? -5.101  0.142   2.766   1.00 0.00 ? 197 ASN B CA   5  
ATOM   10969 C  C    . ASN B 2 97  ? -4.996  -0.808  3.957   1.00 0.00 ? 197 ASN B C    5  
ATOM   10970 O  O    . ASN B 2 97  ? -5.178  -2.017  3.817   1.00 0.00 ? 197 ASN B O    5  
ATOM   10971 C  CB   . ASN B 2 97  ? -6.560  0.548   2.552   1.00 0.00 ? 197 ASN B CB   5  
ATOM   10972 C  CG   . ASN B 2 97  ? -6.980  1.689   3.459   1.00 0.00 ? 197 ASN B CG   5  
ATOM   10973 O  OD1  . ASN B 2 97  ? -6.143  2.340   4.083   1.00 0.00 ? 197 ASN B OD1  5  
ATOM   10974 N  ND2  . ASN B 2 97  ? -8.282  1.936   3.534   1.00 0.00 ? 197 ASN B ND2  5  
ATOM   10975 H  H    . ASN B 2 97  ? -5.072  -0.387  0.728   1.00 0.00 ? 197 ASN B H    5  
ATOM   10976 H  HA   . ASN B 2 97  ? -4.521  1.024   2.967   1.00 0.00 ? 197 ASN B HA   5  
ATOM   10977 H  HB2  . ASN B 2 97  ? -6.695  0.859   1.527   1.00 0.00 ? 197 ASN B HB2  5  
ATOM   10978 H  HB3  . ASN B 2 97  ? -7.196  -0.301  2.753   1.00 0.00 ? 197 ASN B HB3  5  
ATOM   10979 H  HD21 . ASN B 2 97  ? -8.891  1.376   3.009   1.00 0.00 ? 197 ASN B HD21 5  
ATOM   10980 H  HD22 . ASN B 2 97  ? -8.582  2.668   4.113   1.00 0.00 ? 197 ASN B HD22 5  
ATOM   10981 N  N    . ALA B 2 98  ? -4.703  -0.250  5.127   1.00 0.00 ? 198 ALA B N    5  
ATOM   10982 C  CA   . ALA B 2 98  ? -4.575  -1.048  6.341   1.00 0.00 ? 198 ALA B CA   5  
ATOM   10983 C  C    . ALA B 2 98  ? -5.913  -1.665  6.735   1.00 0.00 ? 198 ALA B C    5  
ATOM   10984 O  O    . ALA B 2 98  ? -6.717  -1.038  7.427   1.00 0.00 ? 198 ALA B O    5  
ATOM   10985 C  CB   . ALA B 2 98  ? -4.031  -0.194  7.476   1.00 0.00 ? 198 ALA B CB   5  
ATOM   10986 H  H    . ALA B 2 98  ? -4.570  0.720   5.175   1.00 0.00 ? 198 ALA B H    5  
ATOM   10987 H  HA   . ALA B 2 98  ? -3.868  -1.840  6.146   1.00 0.00 ? 198 ALA B HA   5  
ATOM   10988 H  HB1  . ALA B 2 98  ? -4.355  -0.603  8.421   1.00 0.00 ? 198 ALA B HB1  5  
ATOM   10989 H  HB2  . ALA B 2 98  ? -4.399  0.817   7.376   1.00 0.00 ? 198 ALA B HB2  5  
ATOM   10990 H  HB3  . ALA B 2 98  ? -2.951  -0.189  7.437   1.00 0.00 ? 198 ALA B HB3  5  
ATOM   10991 N  N    . GLY B 2 99  ? -6.145  -2.895  6.291   1.00 0.00 ? 199 GLY B N    5  
ATOM   10992 C  CA   . GLY B 2 99  ? -7.388  -3.574  6.608   1.00 0.00 ? 199 GLY B CA   5  
ATOM   10993 C  C    . GLY B 2 99  ? -7.397  -5.018  6.143   1.00 0.00 ? 199 GLY B C    5  
ATOM   10994 O  O    . GLY B 2 99  ? -6.460  -5.471  5.484   1.00 0.00 ? 199 GLY B O    5  
ATOM   10995 H  H    . GLY B 2 99  ? -5.469  -3.345  5.743   1.00 0.00 ? 199 GLY B H    5  
ATOM   10996 H  HA2  . GLY B 2 99  ? -7.535  -3.552  7.678   1.00 0.00 ? 199 GLY B HA2  5  
ATOM   10997 H  HA3  . GLY B 2 99  ? -8.204  -3.051  6.133   1.00 0.00 ? 199 GLY B HA3  5  
ATOM   10998 N  N    . ASP B 2 100 ? -8.457  -5.742  6.488   1.00 0.00 ? 200 ASP B N    5  
ATOM   10999 C  CA   . ASP B 2 100 ? -8.585  -7.142  6.102   1.00 0.00 ? 200 ASP B CA   5  
ATOM   11000 C  C    . ASP B 2 100 ? -9.620  -7.311  4.994   1.00 0.00 ? 200 ASP B C    5  
ATOM   11001 O  O    . ASP B 2 100 ? -10.116 -6.330  4.441   1.00 0.00 ? 200 ASP B O    5  
ATOM   11002 C  CB   . ASP B 2 100 ? -8.974  -7.993  7.313   1.00 0.00 ? 200 ASP B CB   5  
ATOM   11003 C  CG   . ASP B 2 100 ? -8.040  -7.787  8.489   1.00 0.00 ? 200 ASP B CG   5  
ATOM   11004 O  OD1  . ASP B 2 100 ? -6.884  -7.372  8.263   1.00 0.00 ? 200 ASP B OD1  5  
ATOM   11005 O  OD2  . ASP B 2 100 ? -8.465  -8.040  9.637   1.00 0.00 ? 200 ASP B OD2  5  
ATOM   11006 H  H    . ASP B 2 100 ? -9.171  -5.325  7.013   1.00 0.00 ? 200 ASP B H    5  
ATOM   11007 H  HA   . ASP B 2 100 ? -7.625  -7.475  5.735   1.00 0.00 ? 200 ASP B HA   5  
ATOM   11008 H  HB2  . ASP B 2 100 ? -9.975  -7.729  7.623   1.00 0.00 ? 200 ASP B HB2  5  
ATOM   11009 H  HB3  . ASP B 2 100 ? -8.951  -9.036  7.037   1.00 0.00 ? 200 ASP B HB3  5  
ATOM   11010 N  N    . LYS B 2 101 ? -9.942  -8.561  4.676   1.00 0.00 ? 201 LYS B N    5  
ATOM   11011 C  CA   . LYS B 2 101 ? -10.918 -8.858  3.634   1.00 0.00 ? 201 LYS B CA   5  
ATOM   11012 C  C    . LYS B 2 101 ? -12.294 -8.317  4.009   1.00 0.00 ? 201 LYS B C    5  
ATOM   11013 O  O    . LYS B 2 101 ? -13.216 -8.417  3.172   1.00 0.00 ? 201 LYS B O    5  
ATOM   11014 C  CB   . LYS B 2 101 ? -10.998 -10.368 3.397   1.00 0.00 ? 201 LYS B CB   5  
ATOM   11015 C  CG   . LYS B 2 101 ? -9.642  -11.027 3.197   1.00 0.00 ? 201 LYS B CG   5  
ATOM   11016 C  CD   . LYS B 2 101 ? -9.582  -12.391 3.865   1.00 0.00 ? 201 LYS B CD   5  
ATOM   11017 C  CE   . LYS B 2 101 ? -8.202  -12.668 4.440   1.00 0.00 ? 201 LYS B CE   5  
ATOM   11018 N  NZ   . LYS B 2 101 ? -8.094  -14.050 4.984   1.00 0.00 ? 201 LYS B NZ   5  
ATOM   11019 O  OXT  . LYS B 2 101 ? -12.438 -7.799  5.136   1.00 0.00 ? 201 LYS B OXT  5  
ATOM   11020 H  H    . LYS B 2 101 ? -9.512  -9.301  5.153   1.00 0.00 ? 201 LYS B H    5  
ATOM   11021 H  HA   . LYS B 2 101 ? -10.591 -8.376  2.725   1.00 0.00 ? 201 LYS B HA   5  
ATOM   11022 H  HB2  . LYS B 2 101 ? -11.477 -10.828 4.248   1.00 0.00 ? 201 LYS B HB2  5  
ATOM   11023 H  HB3  . LYS B 2 101 ? -11.597 -10.550 2.516   1.00 0.00 ? 201 LYS B HB3  5  
ATOM   11024 H  HG2  . LYS B 2 101 ? -9.465  -11.147 2.139   1.00 0.00 ? 201 LYS B HG2  5  
ATOM   11025 H  HG3  . LYS B 2 101 ? -8.879  -10.392 3.622   1.00 0.00 ? 201 LYS B HG3  5  
ATOM   11026 H  HD2  . LYS B 2 101 ? -10.306 -12.422 4.665   1.00 0.00 ? 201 LYS B HD2  5  
ATOM   11027 H  HD3  . LYS B 2 101 ? -9.817  -13.150 3.134   1.00 0.00 ? 201 LYS B HD3  5  
ATOM   11028 H  HE2  . LYS B 2 101 ? -7.468  -12.541 3.658   1.00 0.00 ? 201 LYS B HE2  5  
ATOM   11029 H  HE3  . LYS B 2 101 ? -8.008  -11.961 5.234   1.00 0.00 ? 201 LYS B HE3  5  
ATOM   11030 H  HZ1  . LYS B 2 101 ? -7.679  -14.684 4.271   1.00 0.00 ? 201 LYS B HZ1  5  
ATOM   11031 H  HZ2  . LYS B 2 101 ? -9.036  -14.406 5.243   1.00 0.00 ? 201 LYS B HZ2  5  
ATOM   11032 H  HZ3  . LYS B 2 101 ? -7.490  -14.055 5.831   1.00 0.00 ? 201 LYS B HZ3  5  
HETATM 11033 ZN ZN   . ZN  C 3 .   ? 0.740   -10.598 -16.597 1.00 0.00 ? 202 ZN  B ZN   5  
HETATM 11034 ZN ZN   . ZN  D 3 .   ? 17.055  2.194   -17.460 1.00 0.00 ? 203 ZN  B ZN   5  
HETATM 11035 ZN ZN   . ZN  E 3 .   ? 3.807   5.269   -0.566  1.00 0.00 ? 204 ZN  B ZN   5  
ATOM   11036 N  N    . GLY A 1 1   ? 10.242  -5.225  -35.487 1.00 0.00 ? 1   GLY A N    6  
ATOM   11037 C  CA   . GLY A 1 1   ? 11.483  -4.584  -34.971 1.00 0.00 ? 1   GLY A CA   6  
ATOM   11038 C  C    . GLY A 1 1   ? 11.361  -3.075  -34.879 1.00 0.00 ? 1   GLY A C    6  
ATOM   11039 O  O    . GLY A 1 1   ? 11.845  -2.352  -35.750 1.00 0.00 ? 1   GLY A O    6  
ATOM   11040 H  H1   . GLY A 1 1   ? 10.255  -6.244  -35.281 1.00 0.00 ? 1   GLY A H1   6  
ATOM   11041 H  H2   . GLY A 1 1   ? 10.171  -5.091  -36.515 1.00 0.00 ? 1   GLY A H2   6  
ATOM   11042 H  H3   . GLY A 1 1   ? 9.407   -4.800  -35.034 1.00 0.00 ? 1   GLY A H3   6  
ATOM   11043 H  HA2  . GLY A 1 1   ? 11.697  -4.977  -33.988 1.00 0.00 ? 1   GLY A HA2  6  
ATOM   11044 H  HA3  . GLY A 1 1   ? 12.303  -4.828  -35.631 1.00 0.00 ? 1   GLY A HA3  6  
ATOM   11045 N  N    . SER A 1 2   ? 10.714  -2.600  -33.819 1.00 0.00 ? 2   SER A N    6  
ATOM   11046 C  CA   . SER A 1 2   ? 10.530  -1.167  -33.616 1.00 0.00 ? 2   SER A CA   6  
ATOM   11047 C  C    . SER A 1 2   ? 11.082  -0.735  -32.261 1.00 0.00 ? 2   SER A C    6  
ATOM   11048 O  O    . SER A 1 2   ? 10.825  -1.377  -31.242 1.00 0.00 ? 2   SER A O    6  
ATOM   11049 C  CB   . SER A 1 2   ? 9.047   -0.804  -33.715 1.00 0.00 ? 2   SER A CB   6  
ATOM   11050 O  OG   . SER A 1 2   ? 8.317   -1.334  -32.623 1.00 0.00 ? 2   SER A OG   6  
ATOM   11051 H  H    . SER A 1 2   ? 10.353  -3.227  -33.159 1.00 0.00 ? 2   SER A H    6  
ATOM   11052 H  HA   . SER A 1 2   ? 11.072  -0.649  -34.392 1.00 0.00 ? 2   SER A HA   6  
ATOM   11053 H  HB2  . SER A 1 2   ? 8.941   0.271   -33.714 1.00 0.00 ? 2   SER A HB2  6  
ATOM   11054 H  HB3  . SER A 1 2   ? 8.642   -1.205  -34.632 1.00 0.00 ? 2   SER A HB3  6  
ATOM   11055 H  HG   . SER A 1 2   ? 7.559   -0.772  -32.440 1.00 0.00 ? 2   SER A HG   6  
ATOM   11056 N  N    . MET A 1 3   ? 11.841  0.356   -32.258 1.00 0.00 ? 3   MET A N    6  
ATOM   11057 C  CA   . MET A 1 3   ? 12.430  0.873   -31.027 1.00 0.00 ? 3   MET A CA   6  
ATOM   11058 C  C    . MET A 1 3   ? 11.416  1.705   -30.247 1.00 0.00 ? 3   MET A C    6  
ATOM   11059 O  O    . MET A 1 3   ? 10.674  2.499   -30.825 1.00 0.00 ? 3   MET A O    6  
ATOM   11060 C  CB   . MET A 1 3   ? 13.669  1.714   -31.345 1.00 0.00 ? 3   MET A CB   6  
ATOM   11061 C  CG   . MET A 1 3   ? 14.945  1.178   -30.718 1.00 0.00 ? 3   MET A CG   6  
ATOM   11062 S  SD   . MET A 1 3   ? 15.727  -0.102  -31.720 1.00 0.00 ? 3   MET A SD   6  
ATOM   11063 C  CE   . MET A 1 3   ? 17.358  0.601   -31.954 1.00 0.00 ? 3   MET A CE   6  
ATOM   11064 H  H    . MET A 1 3   ? 12.010  0.823   -33.102 1.00 0.00 ? 3   MET A H    6  
ATOM   11065 H  HA   . MET A 1 3   ? 12.725  0.029   -30.422 1.00 0.00 ? 3   MET A HA   6  
ATOM   11066 H  HB2  . MET A 1 3   ? 13.805  1.741   -32.417 1.00 0.00 ? 3   MET A HB2  6  
ATOM   11067 H  HB3  . MET A 1 3   ? 13.512  2.720   -30.986 1.00 0.00 ? 3   MET A HB3  6  
ATOM   11068 H  HG2  . MET A 1 3   ? 15.641  1.995   -30.597 1.00 0.00 ? 3   MET A HG2  6  
ATOM   11069 H  HG3  . MET A 1 3   ? 14.707  0.763   -29.749 1.00 0.00 ? 3   MET A HG3  6  
ATOM   11070 H  HE1  . MET A 1 3   ? 18.051  -0.181  -32.228 1.00 0.00 ? 3   MET A HE1  6  
ATOM   11071 H  HE2  . MET A 1 3   ? 17.685  1.065   -31.035 1.00 0.00 ? 3   MET A HE2  6  
ATOM   11072 H  HE3  . MET A 1 3   ? 17.322  1.341   -32.739 1.00 0.00 ? 3   MET A HE3  6  
ATOM   11073 N  N    . ASP A 1 4   ? 11.394  1.518   -28.931 1.00 0.00 ? 4   ASP A N    6  
ATOM   11074 C  CA   . ASP A 1 4   ? 10.473  2.253   -28.070 1.00 0.00 ? 4   ASP A CA   6  
ATOM   11075 C  C    . ASP A 1 4   ? 9.024   1.922   -28.411 1.00 0.00 ? 4   ASP A C    6  
ATOM   11076 O  O    . ASP A 1 4   ? 8.579   2.129   -29.540 1.00 0.00 ? 4   ASP A O    6  
ATOM   11077 C  CB   . ASP A 1 4   ? 10.709  3.759   -28.200 1.00 0.00 ? 4   ASP A CB   6  
ATOM   11078 C  CG   . ASP A 1 4   ? 12.126  4.156   -27.835 1.00 0.00 ? 4   ASP A CG   6  
ATOM   11079 O  OD1  . ASP A 1 4   ? 13.068  3.660   -28.487 1.00 0.00 ? 4   ASP A OD1  6  
ATOM   11080 O  OD2  . ASP A 1 4   ? 12.293  4.964   -26.898 1.00 0.00 ? 4   ASP A OD2  6  
ATOM   11081 H  H    . ASP A 1 4   ? 12.011  0.873   -28.530 1.00 0.00 ? 4   ASP A H    6  
ATOM   11082 H  HA   . ASP A 1 4   ? 10.667  1.955   -27.051 1.00 0.00 ? 4   ASP A HA   6  
ATOM   11083 H  HB2  . ASP A 1 4   ? 10.523  4.059   -29.221 1.00 0.00 ? 4   ASP A HB2  6  
ATOM   11084 H  HB3  . ASP A 1 4   ? 10.028  4.281   -27.545 1.00 0.00 ? 4   ASP A HB3  6  
ATOM   11085 N  N    . GLU A 1 5   ? 8.293   1.407   -27.428 1.00 0.00 ? 5   GLU A N    6  
ATOM   11086 C  CA   . GLU A 1 5   ? 6.893   1.049   -27.624 1.00 0.00 ? 5   GLU A CA   6  
ATOM   11087 C  C    . GLU A 1 5   ? 6.027   2.297   -27.761 1.00 0.00 ? 5   GLU A C    6  
ATOM   11088 O  O    . GLU A 1 5   ? 6.396   3.375   -27.297 1.00 0.00 ? 5   GLU A O    6  
ATOM   11089 C  CB   . GLU A 1 5   ? 6.398   0.190   -26.458 1.00 0.00 ? 5   GLU A CB   6  
ATOM   11090 C  CG   . GLU A 1 5   ? 5.850   -1.162  -26.887 1.00 0.00 ? 5   GLU A CG   6  
ATOM   11091 C  CD   . GLU A 1 5   ? 6.853   -2.284  -26.703 1.00 0.00 ? 5   GLU A CD   6  
ATOM   11092 O  OE1  . GLU A 1 5   ? 8.042   -1.986  -26.462 1.00 0.00 ? 5   GLU A OE1  6  
ATOM   11093 O  OE2  . GLU A 1 5   ? 6.450   -3.462  -26.800 1.00 0.00 ? 5   GLU A OE2  6  
ATOM   11094 H  H    . GLU A 1 5   ? 8.704   1.266   -26.549 1.00 0.00 ? 5   GLU A H    6  
ATOM   11095 H  HA   . GLU A 1 5   ? 6.823   0.476   -28.536 1.00 0.00 ? 5   GLU A HA   6  
ATOM   11096 H  HB2  . GLU A 1 5   ? 7.218   0.021   -25.777 1.00 0.00 ? 5   GLU A HB2  6  
ATOM   11097 H  HB3  . GLU A 1 5   ? 5.615   0.722   -25.937 1.00 0.00 ? 5   GLU A HB3  6  
ATOM   11098 H  HG2  . GLU A 1 5   ? 4.973   -1.385  -26.299 1.00 0.00 ? 5   GLU A HG2  6  
ATOM   11099 H  HG3  . GLU A 1 5   ? 5.578   -1.110  -27.932 1.00 0.00 ? 5   GLU A HG3  6  
ATOM   11100 N  N    . SER A 1 6   ? 4.871   2.142   -28.400 1.00 0.00 ? 6   SER A N    6  
ATOM   11101 C  CA   . SER A 1 6   ? 3.952   3.257   -28.597 1.00 0.00 ? 6   SER A CA   6  
ATOM   11102 C  C    . SER A 1 6   ? 2.549   2.895   -28.119 1.00 0.00 ? 6   SER A C    6  
ATOM   11103 O  O    . SER A 1 6   ? 1.736   2.379   -28.884 1.00 0.00 ? 6   SER A O    6  
ATOM   11104 C  CB   . SER A 1 6   ? 3.913   3.657   -30.073 1.00 0.00 ? 6   SER A CB   6  
ATOM   11105 O  OG   . SER A 1 6   ? 2.919   4.639   -30.309 1.00 0.00 ? 6   SER A OG   6  
ATOM   11106 H  H    . SER A 1 6   ? 4.632   1.257   -28.748 1.00 0.00 ? 6   SER A H    6  
ATOM   11107 H  HA   . SER A 1 6   ? 4.314   4.092   -28.017 1.00 0.00 ? 6   SER A HA   6  
ATOM   11108 H  HB2  . SER A 1 6   ? 4.873   4.059   -30.362 1.00 0.00 ? 6   SER A HB2  6  
ATOM   11109 H  HB3  . SER A 1 6   ? 3.691   2.787   -30.675 1.00 0.00 ? 6   SER A HB3  6  
ATOM   11110 H  HG   . SER A 1 6   ? 2.262   4.292   -30.918 1.00 0.00 ? 6   SER A HG   6  
ATOM   11111 N  N    . GLY A 1 7   ? 2.275   3.170   -26.848 1.00 0.00 ? 7   GLY A N    6  
ATOM   11112 C  CA   . GLY A 1 7   ? 0.971   2.867   -26.288 1.00 0.00 ? 7   GLY A CA   6  
ATOM   11113 C  C    . GLY A 1 7   ? 1.004   2.738   -24.778 1.00 0.00 ? 7   GLY A C    6  
ATOM   11114 O  O    . GLY A 1 7   ? 0.020   3.036   -24.101 1.00 0.00 ? 7   GLY A O    6  
ATOM   11115 H  H    . GLY A 1 7   ? 2.964   3.582   -26.285 1.00 0.00 ? 7   GLY A H    6  
ATOM   11116 H  HA2  . GLY A 1 7   ? 0.285   3.657   -26.557 1.00 0.00 ? 7   GLY A HA2  6  
ATOM   11117 H  HA3  . GLY A 1 7   ? 0.617   1.939   -26.711 1.00 0.00 ? 7   GLY A HA3  6  
ATOM   11118 N  N    . LEU A 1 8   ? 2.138   2.288   -24.250 1.00 0.00 ? 8   LEU A N    6  
ATOM   11119 C  CA   . LEU A 1 8   ? 2.300   2.114   -22.817 1.00 0.00 ? 8   LEU A CA   6  
ATOM   11120 C  C    . LEU A 1 8   ? 2.227   3.447   -22.085 1.00 0.00 ? 8   LEU A C    6  
ATOM   11121 O  O    . LEU A 1 8   ? 2.896   4.409   -22.464 1.00 0.00 ? 8   LEU A O    6  
ATOM   11122 C  CB   . LEU A 1 8   ? 3.650   1.463   -22.533 1.00 0.00 ? 8   LEU A CB   6  
ATOM   11123 C  CG   . LEU A 1 8   ? 3.704   0.561   -21.303 1.00 0.00 ? 8   LEU A CG   6  
ATOM   11124 C  CD1  . LEU A 1 8   ? 3.640   1.380   -20.020 1.00 0.00 ? 8   LEU A CD1  6  
ATOM   11125 C  CD2  . LEU A 1 8   ? 2.585   -0.470  -21.338 1.00 0.00 ? 8   LEU A CD2  6  
ATOM   11126 H  H    . LEU A 1 8   ? 2.887   2.062   -24.839 1.00 0.00 ? 8   LEU A H    6  
ATOM   11127 H  HA   . LEU A 1 8   ? 1.512   1.469   -22.464 1.00 0.00 ? 8   LEU A HA   6  
ATOM   11128 H  HB2  . LEU A 1 8   ? 3.928   0.876   -23.394 1.00 0.00 ? 8   LEU A HB2  6  
ATOM   11129 H  HB3  . LEU A 1 8   ? 4.381   2.247   -22.406 1.00 0.00 ? 8   LEU A HB3  6  
ATOM   11130 H  HG   . LEU A 1 8   ? 4.642   0.036   -21.311 1.00 0.00 ? 8   LEU A HG   6  
ATOM   11131 H  HD11 . LEU A 1 8   ? 2.822   1.030   -19.407 1.00 0.00 ? 8   LEU A HD11 6  
ATOM   11132 H  HD12 . LEU A 1 8   ? 3.488   2.421   -20.261 1.00 0.00 ? 8   LEU A HD12 6  
ATOM   11133 H  HD13 . LEU A 1 8   ? 4.567   1.269   -19.476 1.00 0.00 ? 8   LE