data_1L3X
# 
_entry.id   1L3X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1L3X         
RCSB  RCSB015623   
WWPDB D_1000015623 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2004-03-02 
_pdbx_database_PDB_obs_spr.pdb_id           1L3X 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1IQ2 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1LAZ 
_pdbx_database_related.details        '1LAZ is minimized average structure' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1L3X 
_pdbx_database_status.recvd_initial_deposition_date   2002-03-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shin, J.' 1 
'Lee, W.'  2 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of a novel disintegrin, salmosin, from Agkistrondon halys venom' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            42 
_citation.page_first                14408 
_citation.page_last                 14415 
_citation.year                      2003 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14661951 
_citation.pdbx_database_id_DOI      10.1021/bi0300276 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Shin, J.'   1 
primary 'Hong, S.Y.' 2 
primary 'Chung, K.'  3 
primary 'Kang, I.'   4 
primary 'Jang, Y.'   5 
primary 'Kim, D.S.'  6 
primary 'Lee, W.'    7 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 nat 
_entity.pdbx_description           'platelet aggregation inhibitor disintegrin' 
_entity.formula_weight             7774.694 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'residues 1-73' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        salmosin 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA 
_entity_poly.pdbx_seq_one_letter_code_can   EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLU n 
1 2  ALA n 
1 3  GLY n 
1 4  GLU n 
1 5  GLU n 
1 6  CYS n 
1 7  ASP n 
1 8  CYS n 
1 9  GLY n 
1 10 SER n 
1 11 PRO n 
1 12 GLY n 
1 13 ASN n 
1 14 PRO n 
1 15 CYS n 
1 16 CYS n 
1 17 ASP n 
1 18 ALA n 
1 19 ALA n 
1 20 THR n 
1 21 CYS n 
1 22 LYS n 
1 23 LEU n 
1 24 ARG n 
1 25 GLN n 
1 26 GLY n 
1 27 ALA n 
1 28 GLN n 
1 29 CYS n 
1 30 ALA n 
1 31 GLU n 
1 32 GLY n 
1 33 LEU n 
1 34 CYS n 
1 35 CYS n 
1 36 ASP n 
1 37 GLN n 
1 38 CYS n 
1 39 ARG n 
1 40 PHE n 
1 41 MET n 
1 42 LYS n 
1 43 GLU n 
1 44 GLY n 
1 45 THR n 
1 46 ILE n 
1 47 CYS n 
1 48 ARG n 
1 49 ARG n 
1 50 ALA n 
1 51 ARG n 
1 52 GLY n 
1 53 ASP n 
1 54 ASP n 
1 55 LEU n 
1 56 ASP n 
1 57 ASP n 
1 58 TYR n 
1 59 CYS n 
1 60 ASN n 
1 61 GLY n 
1 62 ILE n 
1 63 SER n 
1 64 ALA n 
1 65 GLY n 
1 66 CYS n 
1 67 PRO n 
1 68 ARG n 
1 69 ASN n 
1 70 PRO n 
1 71 PHE n 
1 72 HIS n 
1 73 ALA n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Gloydius blomhoffi brevicaudus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      259325 
_entity_src_nat.genus                      Gloydius 
_entity_src_nat.species                    'Gloydius blomhoffi' 
_entity_src_nat.strain                     brevicaudus 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q90WC0_AGKHB 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA 
_struct_ref.pdbx_align_begin           33 
_struct_ref.pdbx_db_accession          Q90WC0 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1L3X 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 73 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q90WC0 
_struct_ref_seq.db_align_beg                  33 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  105 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       73 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D NOESY' 
2 1 1 DQF-COSY   
3 2 1 '2D NOESY' 
4 2 1 DQF-COSY   
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  7 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '50mM phosphate' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1mM Salmosin; 50mM phosphate buffer NA; 90% H2O, 10% D2O' '90% H2O/10% D2O' 
2 '1mM Salmosin; 50mM phosphate buffer NA; 100% D2O'         '100% D2O'        
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker DRX 500 
2 ? Bruker DRX 600 
# 
_pdbx_nmr_refine.entry_id           1L3X 
_pdbx_nmr_refine.method             'distance geometry, simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1L3X 
_pdbx_nmr_ensemble.conformers_calculated_total_number            90 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XWINNMR 2.6 collection      Bruker     1 
XWINNMR 2.6 processing      Bruker     2 
NMRPipe 1.8 processing      Delaglio,F 3 
Sparky  3.1 'data analysis' James,T    4 
CNS     1.0 refinement      Brunger    5 
# 
_exptl.entry_id          1L3X 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.crystal_id             1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1L3X 
_struct.title                     'Solution Structure of Novel Disintegrin Salmosin' 
_struct.pdbx_descriptor           'platelet aggregation inhibitor disintegrin' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1L3X 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            'Disintegrin, Snake Venome, RGD, PROTEIN BINDING' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 6  SG ? ? ? 1_555 A CYS 15 SG ? ? A CYS 6  A CYS 15 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf2 disulf ? ? A CYS 8  SG ? ? ? 1_555 A CYS 16 SG ? ? A CYS 8  A CYS 16 1_555 ? ? ? ? ? ? ? 2.049 ? 
disulf3 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 21 A CYS 35 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf4 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 59 SG ? ? A CYS 29 A CYS 59 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf5 disulf ? ? A CYS 34 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 34 A CYS 38 1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf6 disulf ? ? A CYS 47 SG ? ? ? 1_555 A CYS 66 SG ? ? A CYS 47 A CYS 66 1_555 ? ? ? ? ? ? ? 2.028 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1L3X 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1L3X 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLU A 1 1  ? -0.830  12.178  -0.991  1.00 0.00 ? 1  GLU A N    1  
ATOM 2     C CA   . GLU A 1 1  ? -1.439  11.653  0.259   1.00 0.00 ? 1  GLU A CA   1  
ATOM 3     C C    . GLU A 1 1  ? -2.831  11.086  0.000   1.00 0.00 ? 1  GLU A C    1  
ATOM 4     O O    . GLU A 1 1  ? -3.717  11.787  -0.486  1.00 0.00 ? 1  GLU A O    1  
ATOM 5     C CB   . GLU A 1 1  ? -1.513  12.790  1.279   1.00 0.00 ? 1  GLU A CB   1  
ATOM 6     C CG   . GLU A 1 1  ? -0.968  12.417  2.648   1.00 0.00 ? 1  GLU A CG   1  
ATOM 7     C CD   . GLU A 1 1  ? -0.782  13.621  3.550   1.00 0.00 ? 1  GLU A CD   1  
ATOM 8     O OE1  . GLU A 1 1  ? -0.982  14.758  3.072   1.00 0.00 ? 1  GLU A OE1  1  
ATOM 9     O OE2  . GLU A 1 1  ? -0.437  13.428  4.735   1.00 0.00 ? 1  GLU A OE2  1  
ATOM 10    H H1   . GLU A 1 1  ? -1.549  12.750  -1.477  1.00 0.00 ? 1  GLU A H1   1  
ATOM 11    H H2   . GLU A 1 1  ? -0.544  11.362  -1.570  1.00 0.00 ? 1  GLU A H2   1  
ATOM 12    H H3   . GLU A 1 1  ? -0.009  12.757  -0.726  1.00 0.00 ? 1  GLU A H3   1  
ATOM 13    H HA   . GLU A 1 1  ? -0.805  10.869  0.647   1.00 0.00 ? 1  GLU A HA   1  
ATOM 14    H HB2  . GLU A 1 1  ? -0.945  13.630  0.906   1.00 0.00 ? 1  GLU A HB2  1  
ATOM 15    H HB3  . GLU A 1 1  ? -2.545  13.088  1.396   1.00 0.00 ? 1  GLU A HB3  1  
ATOM 16    H HG2  . GLU A 1 1  ? -1.657  11.735  3.122   1.00 0.00 ? 1  GLU A HG2  1  
ATOM 17    H HG3  . GLU A 1 1  ? -0.012  11.931  2.520   1.00 0.00 ? 1  GLU A HG3  1  
ATOM 18    N N    . ALA A 1 2  ? -3.014  9.811   0.328   1.00 0.00 ? 2  ALA A N    1  
ATOM 19    C CA   . ALA A 1 2  ? -4.297  9.147   0.132   1.00 0.00 ? 2  ALA A CA   1  
ATOM 20    C C    . ALA A 1 2  ? -4.922  8.758   1.467   1.00 0.00 ? 2  ALA A C    1  
ATOM 21    O O    . ALA A 1 2  ? -5.888  9.375   1.916   1.00 0.00 ? 2  ALA A O    1  
ATOM 22    C CB   . ALA A 1 2  ? -4.125  7.921   -0.751  1.00 0.00 ? 2  ALA A CB   1  
ATOM 23    H H    . ALA A 1 2  ? -2.269  9.304   0.712   1.00 0.00 ? 2  ALA A H    1  
ATOM 24    H HA   . ALA A 1 2  ? -4.956  9.837   -0.375  1.00 0.00 ? 2  ALA A HA   1  
ATOM 25    H HB1  . ALA A 1 2  ? -3.307  8.084   -1.437  1.00 0.00 ? 2  ALA A HB1  1  
ATOM 26    H HB2  . ALA A 1 2  ? -5.034  7.747   -1.308  1.00 0.00 ? 2  ALA A HB2  1  
ATOM 27    H HB3  . ALA A 1 2  ? -3.910  7.061   -0.135  1.00 0.00 ? 2  ALA A HB3  1  
ATOM 28    N N    . GLY A 1 3  ? -4.362  7.731   2.098   1.00 0.00 ? 3  GLY A N    1  
ATOM 29    C CA   . GLY A 1 3  ? -4.875  7.278   3.377   1.00 0.00 ? 3  GLY A CA   1  
ATOM 30    C C    . GLY A 1 3  ? -3.916  7.565   4.515   1.00 0.00 ? 3  GLY A C    1  
ATOM 31    O O    . GLY A 1 3  ? -4.267  8.249   5.476   1.00 0.00 ? 3  GLY A O    1  
ATOM 32    H H    . GLY A 1 3  ? -3.593  7.279   1.693   1.00 0.00 ? 3  GLY A H    1  
ATOM 33    H HA2  . GLY A 1 3  ? -5.812  7.778   3.576   1.00 0.00 ? 3  GLY A HA2  1  
ATOM 34    H HA3  . GLY A 1 3  ? -5.050  6.214   3.327   1.00 0.00 ? 3  GLY A HA3  1  
ATOM 35    N N    . GLU A 1 4  ? -2.699  7.042   4.404   1.00 0.00 ? 4  GLU A N    1  
ATOM 36    C CA   . GLU A 1 4  ? -1.684  7.247   5.430   1.00 0.00 ? 4  GLU A CA   1  
ATOM 37    C C    . GLU A 1 4  ? -0.589  8.186   4.932   1.00 0.00 ? 4  GLU A C    1  
ATOM 38    O O    . GLU A 1 4  ? -0.524  8.505   3.745   1.00 0.00 ? 4  GLU A O    1  
ATOM 39    C CB   . GLU A 1 4  ? -1.072  5.910   5.850   1.00 0.00 ? 4  GLU A CB   1  
ATOM 40    C CG   . GLU A 1 4  ? -1.931  5.132   6.834   1.00 0.00 ? 4  GLU A CG   1  
ATOM 41    C CD   . GLU A 1 4  ? -1.106  4.377   7.859   1.00 0.00 ? 4  GLU A CD   1  
ATOM 42    O OE1  . GLU A 1 4  ? -0.364  5.031   8.621   1.00 0.00 ? 4  GLU A OE1  1  
ATOM 43    O OE2  . GLU A 1 4  ? -1.204  3.133   7.899   1.00 0.00 ? 4  GLU A OE2  1  
ATOM 44    H H    . GLU A 1 4  ? -2.479  6.506   3.612   1.00 0.00 ? 4  GLU A H    1  
ATOM 45    H HA   . GLU A 1 4  ? -2.164  7.697   6.286   1.00 0.00 ? 4  GLU A HA   1  
ATOM 46    H HB2  . GLU A 1 4  ? -0.928  5.300   4.970   1.00 0.00 ? 4  GLU A HB2  1  
ATOM 47    H HB3  . GLU A 1 4  ? -0.113  6.095   6.311   1.00 0.00 ? 4  GLU A HB3  1  
ATOM 48    H HG2  . GLU A 1 4  ? -2.577  5.824   7.354   1.00 0.00 ? 4  GLU A HG2  1  
ATOM 49    H HG3  . GLU A 1 4  ? -2.532  4.423   6.284   1.00 0.00 ? 4  GLU A HG3  1  
ATOM 50    N N    . GLU A 1 5  ? 0.268   8.625   5.847   1.00 0.00 ? 5  GLU A N    1  
ATOM 51    C CA   . GLU A 1 5  ? 1.361   9.527   5.502   1.00 0.00 ? 5  GLU A CA   1  
ATOM 52    C C    . GLU A 1 5  ? 2.413   8.807   4.666   1.00 0.00 ? 5  GLU A C    1  
ATOM 53    O O    . GLU A 1 5  ? 3.052   7.865   5.134   1.00 0.00 ? 5  GLU A O    1  
ATOM 54    C CB   . GLU A 1 5  ? 2.001   10.091  6.771   1.00 0.00 ? 5  GLU A CB   1  
ATOM 55    C CG   . GLU A 1 5  ? 0.996   10.439  7.856   1.00 0.00 ? 5  GLU A CG   1  
ATOM 56    C CD   . GLU A 1 5  ? 1.597   11.293  8.956   1.00 0.00 ? 5  GLU A CD   1  
ATOM 57    O OE1  . GLU A 1 5  ? 1.989   12.443  8.667   1.00 0.00 ? 5  GLU A OE1  1  
ATOM 58    O OE2  . GLU A 1 5  ? 1.676   10.811  10.105  1.00 0.00 ? 5  GLU A OE2  1  
ATOM 59    H H    . GLU A 1 5  ? 0.164   8.335   6.778   1.00 0.00 ? 5  GLU A H    1  
ATOM 60    H HA   . GLU A 1 5  ? 0.950   10.341  4.923   1.00 0.00 ? 5  GLU A HA   1  
ATOM 61    H HB2  . GLU A 1 5  ? 2.689   9.359   7.169   1.00 0.00 ? 5  GLU A HB2  1  
ATOM 62    H HB3  . GLU A 1 5  ? 2.549   10.986  6.517   1.00 0.00 ? 5  GLU A HB3  1  
ATOM 63    H HG2  . GLU A 1 5  ? 0.175   10.980  7.409   1.00 0.00 ? 5  GLU A HG2  1  
ATOM 64    H HG3  . GLU A 1 5  ? 0.625   9.523   8.293   1.00 0.00 ? 5  GLU A HG3  1  
ATOM 65    N N    . CYS A 1 6  ? 2.586   9.253   3.425   1.00 0.00 ? 6  CYS A N    1  
ATOM 66    C CA   . CYS A 1 6  ? 3.559   8.643   2.526   1.00 0.00 ? 6  CYS A CA   1  
ATOM 67    C C    . CYS A 1 6  ? 3.242   8.978   1.072   1.00 0.00 ? 6  CYS A C    1  
ATOM 68    O O    . CYS A 1 6  ? 2.225   8.542   0.532   1.00 0.00 ? 6  CYS A O    1  
ATOM 69    C CB   . CYS A 1 6  ? 3.573   7.128   2.727   1.00 0.00 ? 6  CYS A CB   1  
ATOM 70    S SG   . CYS A 1 6  ? 4.294   6.184   1.347   1.00 0.00 ? 6  CYS A SG   1  
ATOM 71    H H    . CYS A 1 6  ? 2.045   10.006  3.106   1.00 0.00 ? 6  CYS A H    1  
ATOM 72    H HA   . CYS A 1 6  ? 4.533   9.040   2.771   1.00 0.00 ? 6  CYS A HA   1  
ATOM 73    H HB2  . CYS A 1 6  ? 4.145   6.898   3.613   1.00 0.00 ? 6  CYS A HB2  1  
ATOM 74    H HB3  . CYS A 1 6  ? 2.560   6.787   2.865   1.00 0.00 ? 6  CYS A HB3  1  
ATOM 75    N N    . ASP A 1 7  ? 4.117   9.757   0.445   1.00 0.00 ? 7  ASP A N    1  
ATOM 76    C CA   . ASP A 1 7  ? 3.929   10.153  -0.946  1.00 0.00 ? 7  ASP A CA   1  
ATOM 77    C C    . ASP A 1 7  ? 4.153   8.973   -1.887  1.00 0.00 ? 7  ASP A C    1  
ATOM 78    O O    . ASP A 1 7  ? 3.495   8.858   -2.920  1.00 0.00 ? 7  ASP A O    1  
ATOM 79    C CB   . ASP A 1 7  ? 4.881   11.295  -1.305  1.00 0.00 ? 7  ASP A CB   1  
ATOM 80    C CG   . ASP A 1 7  ? 5.010   12.312  -0.188  1.00 0.00 ? 7  ASP A CG   1  
ATOM 81    O OD1  . ASP A 1 7  ? 5.829   12.087  0.728   1.00 0.00 ? 7  ASP A OD1  1  
ATOM 82    O OD2  . ASP A 1 7  ? 4.293   13.334  -0.229  1.00 0.00 ? 7  ASP A OD2  1  
ATOM 83    H H    . ASP A 1 7  ? 4.907   10.074  0.930   1.00 0.00 ? 7  ASP A H    1  
ATOM 84    H HA   . ASP A 1 7  ? 2.912   10.497  -1.056  1.00 0.00 ? 7  ASP A HA   1  
ATOM 85    H HB2  . ASP A 1 7  ? 5.860   10.889  -1.511  1.00 0.00 ? 7  ASP A HB2  1  
ATOM 86    H HB3  . ASP A 1 7  ? 4.512   11.800  -2.186  1.00 0.00 ? 7  ASP A HB3  1  
ATOM 87    N N    . CYS A 1 8  ? 5.086   8.099   -1.523  1.00 0.00 ? 8  CYS A N    1  
ATOM 88    C CA   . CYS A 1 8  ? 5.395   6.929   -2.338  1.00 0.00 ? 8  CYS A CA   1  
ATOM 89    C C    . CYS A 1 8  ? 4.404   5.787   -2.088  1.00 0.00 ? 8  CYS A C    1  
ATOM 90    O O    . CYS A 1 8  ? 4.661   4.653   -2.482  1.00 0.00 ? 8  CYS A O    1  
ATOM 91    C CB   . CYS A 1 8  ? 6.776   6.375   -2.007  1.00 0.00 ? 8  CYS A CB   1  
ATOM 92    S SG   . CYS A 1 8  ? 8.142   7.551   -1.760  1.00 0.00 ? 8  CYS A SG   1  
ATOM 93    H H    . CYS A 1 8  ? 5.578   8.244   -0.688  1.00 0.00 ? 8  CYS A H    1  
ATOM 94    H HA   . CYS A 1 8  ? 5.363   7.214   -3.378  1.00 0.00 ? 8  CYS A HA   1  
ATOM 95    H HB2  . CYS A 1 8  ? 6.683   5.835   -1.092  1.00 0.00 ? 8  CYS A HB2  1  
ATOM 96    H HB3  . CYS A 1 8  ? 7.069   5.693   -2.792  1.00 0.00 ? 8  CYS A HB3  1  
ATOM 97    N N    . GLY A 1 9  ? 3.297   6.068   -1.414  1.00 0.00 ? 9  GLY A N    1  
ATOM 98    C CA   . GLY A 1 9  ? 2.336   5.031   -1.113  1.00 0.00 ? 9  GLY A CA   1  
ATOM 99    C C    . GLY A 1 9  ? 1.434   4.732   -2.277  1.00 0.00 ? 9  GLY A C    1  
ATOM 100   O O    . GLY A 1 9  ? 0.339   5.285   -2.382  1.00 0.00 ? 9  GLY A O    1  
ATOM 101   H H    . GLY A 1 9  ? 3.135   6.968   -1.110  1.00 0.00 ? 9  GLY A H    1  
ATOM 102   H HA2  . GLY A 1 9  ? 2.866   4.130   -0.842  1.00 0.00 ? 9  GLY A HA2  1  
ATOM 103   H HA3  . GLY A 1 9  ? 1.732   5.346   -0.275  1.00 0.00 ? 9  GLY A HA3  1  
ATOM 104   N N    . SER A 1 10 ? 1.887   3.857   -3.159  1.00 0.00 ? 10 SER A N    1  
ATOM 105   C CA   . SER A 1 10 ? 1.095   3.502   -4.313  1.00 0.00 ? 10 SER A CA   1  
ATOM 106   C C    . SER A 1 10 ? 1.137   2.003   -4.576  1.00 0.00 ? 10 SER A C    1  
ATOM 107   O O    . SER A 1 10 ? 2.197   1.381   -4.508  1.00 0.00 ? 10 SER A O    1  
ATOM 108   C CB   . SER A 1 10 ? 1.571   4.268   -5.548  1.00 0.00 ? 10 SER A CB   1  
ATOM 109   O OG   . SER A 1 10 ? 1.059   5.589   -5.559  1.00 0.00 ? 10 SER A OG   1  
ATOM 110   H H    . SER A 1 10 ? 2.766   3.444   -3.028  1.00 0.00 ? 10 SER A H    1  
ATOM 111   H HA   . SER A 1 10 ? 0.088   3.791   -4.091  1.00 0.00 ? 10 SER A HA   1  
ATOM 112   H HB2  . SER A 1 10 ? 2.650   4.315   -5.546  1.00 0.00 ? 10 SER A HB2  1  
ATOM 113   H HB3  . SER A 1 10 ? 1.235   3.757   -6.438  1.00 0.00 ? 10 SER A HB3  1  
ATOM 114   H HG   . SER A 1 10 ? 0.831   5.837   -6.458  1.00 0.00 ? 10 SER A HG   1  
ATOM 115   N N    . PRO A 1 11 ? -0.019  1.402   -4.898  1.00 0.00 ? 11 PRO A N    1  
ATOM 116   C CA   . PRO A 1 11 ? -0.106  -0.029  -5.190  1.00 0.00 ? 11 PRO A CA   1  
ATOM 117   C C    . PRO A 1 11 ? 0.852   -0.413  -6.307  1.00 0.00 ? 11 PRO A C    1  
ATOM 118   O O    . PRO A 1 11 ? 0.506   -0.356  -7.487  1.00 0.00 ? 11 PRO A O    1  
ATOM 119   C CB   . PRO A 1 11 ? -1.563  -0.234  -5.625  1.00 0.00 ? 11 PRO A CB   1  
ATOM 120   C CG   . PRO A 1 11 ? -2.089  1.134   -5.910  1.00 0.00 ? 11 PRO A CG   1  
ATOM 121   C CD   . PRO A 1 11 ? -1.321  2.069   -5.021  1.00 0.00 ? 11 PRO A CD   1  
ATOM 122   H HA   . PRO A 1 11 ? 0.105   -0.624  -4.313  1.00 0.00 ? 11 PRO A HA   1  
ATOM 123   H HB2  . PRO A 1 11 ? -1.591  -0.858  -6.507  1.00 0.00 ? 11 PRO A HB2  1  
ATOM 124   H HB3  . PRO A 1 11 ? -2.115  -0.709  -4.827  1.00 0.00 ? 11 PRO A HB3  1  
ATOM 125   H HG2  . PRO A 1 11 ? -1.923  1.382   -6.947  1.00 0.00 ? 11 PRO A HG2  1  
ATOM 126   H HG3  . PRO A 1 11 ? -3.142  1.177   -5.677  1.00 0.00 ? 11 PRO A HG3  1  
ATOM 127   H HD2  . PRO A 1 11 ? -1.218  3.037   -5.488  1.00 0.00 ? 11 PRO A HD2  1  
ATOM 128   H HD3  . PRO A 1 11 ? -1.801  2.159   -4.058  1.00 0.00 ? 11 PRO A HD3  1  
ATOM 129   N N    . GLY A 1 12 ? 2.069   -0.772  -5.924  1.00 0.00 ? 12 GLY A N    1  
ATOM 130   C CA   . GLY A 1 12 ? 3.082   -1.125  -6.899  1.00 0.00 ? 12 GLY A CA   1  
ATOM 131   C C    . GLY A 1 12 ? 4.333   -0.297  -6.702  1.00 0.00 ? 12 GLY A C    1  
ATOM 132   O O    . GLY A 1 12 ? 5.400   -0.623  -7.222  1.00 0.00 ? 12 GLY A O    1  
ATOM 133   H H    . GLY A 1 12 ? 2.292   -0.775  -4.965  1.00 0.00 ? 12 GLY A H    1  
ATOM 134   H HA2  . GLY A 1 12 ? 3.327   -2.172  -6.791  1.00 0.00 ? 12 GLY A HA2  1  
ATOM 135   H HA3  . GLY A 1 12 ? 2.696   -0.951  -7.891  1.00 0.00 ? 12 GLY A HA3  1  
ATOM 136   N N    . ASN A 1 13 ? 4.189   0.775   -5.925  1.00 0.00 ? 13 ASN A N    1  
ATOM 137   C CA   . ASN A 1 13 ? 5.294   1.668   -5.612  1.00 0.00 ? 13 ASN A CA   1  
ATOM 138   C C    . ASN A 1 13 ? 5.517   1.681   -4.105  1.00 0.00 ? 13 ASN A C    1  
ATOM 139   O O    . ASN A 1 13 ? 5.415   2.717   -3.453  1.00 0.00 ? 13 ASN A O    1  
ATOM 140   C CB   . ASN A 1 13 ? 5.006   3.083   -6.117  1.00 0.00 ? 13 ASN A CB   1  
ATOM 141   C CG   . ASN A 1 13 ? 4.335   3.086   -7.477  1.00 0.00 ? 13 ASN A CG   1  
ATOM 142   O OD1  . ASN A 1 13 ? 3.967   2.035   -8.003  1.00 0.00 ? 13 ASN A OD1  1  
ATOM 143   N ND2  . ASN A 1 13 ? 4.172   4.271   -8.054  1.00 0.00 ? 13 ASN A ND2  1  
ATOM 144   H H    . ASN A 1 13 ? 3.311   0.963   -5.537  1.00 0.00 ? 13 ASN A H    1  
ATOM 145   H HA   . ASN A 1 13 ? 6.182   1.288   -6.097  1.00 0.00 ? 13 ASN A HA   1  
ATOM 146   H HB2  . ASN A 1 13 ? 4.357   3.583   -5.415  1.00 0.00 ? 13 ASN A HB2  1  
ATOM 147   H HB3  . ASN A 1 13 ? 5.936   3.627   -6.193  1.00 0.00 ? 13 ASN A HB3  1  
ATOM 148   H HD21 . ASN A 1 13 ? 4.490   5.066   -7.577  1.00 0.00 ? 13 ASN A HD21 1  
ATOM 149   H HD22 . ASN A 1 13 ? 3.741   4.302   -8.934  1.00 0.00 ? 13 ASN A HD22 1  
ATOM 150   N N    . PRO A 1 14 ? 5.830   0.509   -3.546  1.00 0.00 ? 14 PRO A N    1  
ATOM 151   C CA   . PRO A 1 14 ? 6.084   0.303   -2.129  1.00 0.00 ? 14 PRO A CA   1  
ATOM 152   C C    . PRO A 1 14 ? 6.596   1.544   -1.411  1.00 0.00 ? 14 PRO A C    1  
ATOM 153   O O    . PRO A 1 14 ? 7.803   1.749   -1.340  1.00 0.00 ? 14 PRO A O    1  
ATOM 154   C CB   . PRO A 1 14 ? 7.167   -0.791  -2.154  1.00 0.00 ? 14 PRO A CB   1  
ATOM 155   C CG   . PRO A 1 14 ? 7.197   -1.313  -3.568  1.00 0.00 ? 14 PRO A CG   1  
ATOM 156   C CD   . PRO A 1 14 ? 5.988   -0.748  -4.254  1.00 0.00 ? 14 PRO A CD   1  
ATOM 157   H HA   . PRO A 1 14 ? 5.210   -0.070  -1.619  1.00 0.00 ? 14 PRO A HA   1  
ATOM 158   H HB2  . PRO A 1 14 ? 8.118   -0.360  -1.877  1.00 0.00 ? 14 PRO A HB2  1  
ATOM 159   H HB3  . PRO A 1 14 ? 6.909   -1.569  -1.457  1.00 0.00 ? 14 PRO A HB3  1  
ATOM 160   H HG2  . PRO A 1 14 ? 8.093   -0.973  -4.061  1.00 0.00 ? 14 PRO A HG2  1  
ATOM 161   H HG3  . PRO A 1 14 ? 7.157   -2.390  -3.567  1.00 0.00 ? 14 PRO A HG3  1  
ATOM 162   H HD2  . PRO A 1 14 ? 6.183   -0.587  -5.301  1.00 0.00 ? 14 PRO A HD2  1  
ATOM 163   H HD3  . PRO A 1 14 ? 5.129   -1.387  -4.111  1.00 0.00 ? 14 PRO A HD3  1  
ATOM 164   N N    . CYS A 1 15 ? 5.661   2.346   -0.861  1.00 0.00 ? 15 CYS A N    1  
ATOM 165   C CA   . CYS A 1 15 ? 5.990   3.574   -0.122  1.00 0.00 ? 15 CYS A CA   1  
ATOM 166   C C    . CYS A 1 15 ? 7.434   3.978   -0.307  1.00 0.00 ? 15 CYS A C    1  
ATOM 167   O O    . CYS A 1 15 ? 8.140   4.243   0.663   1.00 0.00 ? 15 CYS A O    1  
ATOM 168   C CB   . CYS A 1 15 ? 5.678   3.463   1.374   1.00 0.00 ? 15 CYS A CB   1  
ATOM 169   S SG   . CYS A 1 15 ? 5.717   5.059   2.255   1.00 0.00 ? 15 CYS A SG   1  
ATOM 170   H H    . CYS A 1 15 ? 4.716   2.100   -0.951  1.00 0.00 ? 15 CYS A H    1  
ATOM 171   H HA   . CYS A 1 15 ? 5.374   4.359   -0.533  1.00 0.00 ? 15 CYS A HA   1  
ATOM 172   H HB2  . CYS A 1 15 ? 4.697   3.037   1.505   1.00 0.00 ? 15 CYS A HB2  1  
ATOM 173   H HB3  . CYS A 1 15 ? 6.409   2.830   1.845   1.00 0.00 ? 15 CYS A HB3  1  
ATOM 174   N N    . CYS A 1 16 ? 7.819   4.071   -1.578  1.00 0.00 ? 16 CYS A N    1  
ATOM 175   C CA   . CYS A 1 16 ? 9.144   4.502   -1.996  1.00 0.00 ? 16 CYS A CA   1  
ATOM 176   C C    . CYS A 1 16 ? 9.946   3.377   -2.641  1.00 0.00 ? 16 CYS A C    1  
ATOM 177   O O    . CYS A 1 16 ? 9.882   2.223   -2.224  1.00 0.00 ? 16 CYS A O    1  
ATOM 178   C CB   . CYS A 1 16 ? 9.925   5.145   -0.850  1.00 0.00 ? 16 CYS A CB   1  
ATOM 179   S SG   . CYS A 1 16 ? 9.207   6.719   -0.220  1.00 0.00 ? 16 CYS A SG   1  
ATOM 180   H H    . CYS A 1 16 ? 7.157   3.876   -2.274  1.00 0.00 ? 16 CYS A H    1  
ATOM 181   H HA   . CYS A 1 16 ? 8.981   5.244   -2.743  1.00 0.00 ? 16 CYS A HA   1  
ATOM 182   H HB2  . CYS A 1 16 ? 9.979   4.447   -0.024  1.00 0.00 ? 16 CYS A HB2  1  
ATOM 183   H HB3  . CYS A 1 16 ? 10.927  5.352   -1.188  1.00 0.00 ? 16 CYS A HB3  1  
ATOM 184   N N    . ASP A 1 17 ? 10.697  3.741   -3.678  1.00 0.00 ? 17 ASP A N    1  
ATOM 185   C CA   . ASP A 1 17 ? 11.526  2.791   -4.418  1.00 0.00 ? 17 ASP A CA   1  
ATOM 186   C C    . ASP A 1 17 ? 12.442  3.523   -5.402  1.00 0.00 ? 17 ASP A C    1  
ATOM 187   O O    . ASP A 1 17 ? 13.561  3.081   -5.670  1.00 0.00 ? 17 ASP A O    1  
ATOM 188   C CB   . ASP A 1 17 ? 10.649  1.788   -5.169  1.00 0.00 ? 17 ASP A CB   1  
ATOM 189   C CG   . ASP A 1 17 ? 9.425   2.437   -5.785  1.00 0.00 ? 17 ASP A CG   1  
ATOM 190   O OD1  . ASP A 1 17 ? 8.480   2.757   -5.033  1.00 0.00 ? 17 ASP A OD1  1  
ATOM 191   O OD2  . ASP A 1 17 ? 9.411   2.626   -7.020  1.00 0.00 ? 17 ASP A OD2  1  
ATOM 192   H H    . ASP A 1 17 ? 10.691  4.679   -3.953  1.00 0.00 ? 17 ASP A H    1  
ATOM 193   H HA   . ASP A 1 17 ? 12.137  2.259   -3.705  1.00 0.00 ? 17 ASP A HA   1  
ATOM 194   H HB2  . ASP A 1 17 ? 11.228  1.333   -5.959  1.00 0.00 ? 17 ASP A HB2  1  
ATOM 195   H HB3  . ASP A 1 17 ? 10.321  1.021   -4.482  1.00 0.00 ? 17 ASP A HB3  1  
ATOM 196   N N    . ALA A 1 18 ? 11.948  4.641   -5.943  1.00 0.00 ? 18 ALA A N    1  
ATOM 197   C CA   . ALA A 1 18 ? 12.701  5.456   -6.899  1.00 0.00 ? 18 ALA A CA   1  
ATOM 198   C C    . ALA A 1 18 ? 13.495  4.610   -7.890  1.00 0.00 ? 18 ALA A C    1  
ATOM 199   O O    . ALA A 1 18 ? 14.472  5.080   -8.474  1.00 0.00 ? 18 ALA A O    1  
ATOM 200   C CB   . ALA A 1 18 ? 13.632  6.402   -6.156  1.00 0.00 ? 18 ALA A CB   1  
ATOM 201   H H    . ALA A 1 18 ? 11.047  4.928   -5.694  1.00 0.00 ? 18 ALA A H    1  
ATOM 202   H HA   . ALA A 1 18 ? 11.992  6.057   -7.449  1.00 0.00 ? 18 ALA A HA   1  
ATOM 203   H HB1  . ALA A 1 18 ? 14.657  6.171   -6.409  1.00 0.00 ? 18 ALA A HB1  1  
ATOM 204   H HB2  . ALA A 1 18 ? 13.490  6.285   -5.091  1.00 0.00 ? 18 ALA A HB2  1  
ATOM 205   H HB3  . ALA A 1 18 ? 13.412  7.420   -6.439  1.00 0.00 ? 18 ALA A HB3  1  
ATOM 206   N N    . ALA A 1 19 ? 13.074  3.368   -8.085  1.00 0.00 ? 19 ALA A N    1  
ATOM 207   C CA   . ALA A 1 19 ? 13.746  2.472   -9.011  1.00 0.00 ? 19 ALA A CA   1  
ATOM 208   C C    . ALA A 1 19 ? 12.951  1.187   -9.168  1.00 0.00 ? 19 ALA A C    1  
ATOM 209   O O    . ALA A 1 19 ? 12.553  0.813   -10.271 1.00 0.00 ? 19 ALA A O    1  
ATOM 210   C CB   . ALA A 1 19 ? 15.157  2.171   -8.529  1.00 0.00 ? 19 ALA A CB   1  
ATOM 211   H H    . ALA A 1 19 ? 12.285  3.048   -7.604  1.00 0.00 ? 19 ALA A H    1  
ATOM 212   H HA   . ALA A 1 19 ? 13.811  2.966   -9.969  1.00 0.00 ? 19 ALA A HA   1  
ATOM 213   H HB1  . ALA A 1 19 ? 15.200  1.162   -8.147  1.00 0.00 ? 19 ALA A HB1  1  
ATOM 214   H HB2  . ALA A 1 19 ? 15.426  2.865   -7.746  1.00 0.00 ? 19 ALA A HB2  1  
ATOM 215   H HB3  . ALA A 1 19 ? 15.848  2.273   -9.353  1.00 0.00 ? 19 ALA A HB3  1  
ATOM 216   N N    . THR A 1 20 ? 12.725  0.519   -8.043  1.00 0.00 ? 20 THR A N    1  
ATOM 217   C CA   . THR A 1 20 ? 11.975  -0.730  -8.028  1.00 0.00 ? 20 THR A CA   1  
ATOM 218   C C    . THR A 1 20 ? 11.682  -1.158  -6.595  1.00 0.00 ? 20 THR A C    1  
ATOM 219   O O    . THR A 1 20 ? 12.451  -0.856  -5.684  1.00 0.00 ? 20 THR A O    1  
ATOM 220   C CB   . THR A 1 20 ? 12.756  -1.828  -8.751  1.00 0.00 ? 20 THR A CB   1  
ATOM 221   O OG1  . THR A 1 20 ? 14.105  -1.442  -8.941  1.00 0.00 ? 20 THR A OG1  1  
ATOM 222   C CG2  . THR A 1 20 ? 12.183  -2.176  -10.108 1.00 0.00 ? 20 THR A CG2  1  
ATOM 223   H H    . THR A 1 20 ? 13.071  0.883   -7.196  1.00 0.00 ? 20 THR A H    1  
ATOM 224   H HA   . THR A 1 20 ? 11.040  -0.564  -8.542  1.00 0.00 ? 20 THR A HA   1  
ATOM 225   H HB   . THR A 1 20 ? 12.741  -2.724  -8.147  1.00 0.00 ? 20 THR A HB   1  
ATOM 226   H HG1  . THR A 1 20 ? 14.406  -0.945  -8.177  1.00 0.00 ? 20 THR A HG1  1  
ATOM 227   H HG21 . THR A 1 20 ? 11.165  -2.519  -9.992  1.00 0.00 ? 20 THR A HG21 1  
ATOM 228   H HG22 . THR A 1 20 ? 12.777  -2.956  -10.561 1.00 0.00 ? 20 THR A HG22 1  
ATOM 229   H HG23 . THR A 1 20 ? 12.197  -1.300  -10.740 1.00 0.00 ? 20 THR A HG23 1  
ATOM 230   N N    . CYS A 1 21 ? 10.573  -1.864  -6.401  1.00 0.00 ? 21 CYS A N    1  
ATOM 231   C CA   . CYS A 1 21 ? 10.194  -2.333  -5.075  1.00 0.00 ? 21 CYS A CA   1  
ATOM 232   C C    . CYS A 1 21 ? 11.412  -2.876  -4.331  1.00 0.00 ? 21 CYS A C    1  
ATOM 233   O O    . CYS A 1 21 ? 11.736  -4.060  -4.432  1.00 0.00 ? 21 CYS A O    1  
ATOM 234   C CB   . CYS A 1 21 ? 9.112   -3.412  -5.189  1.00 0.00 ? 21 CYS A CB   1  
ATOM 235   S SG   . CYS A 1 21 ? 7.615   -2.868  -6.077  1.00 0.00 ? 21 CYS A SG   1  
ATOM 236   H H    . CYS A 1 21 ? 9.998   -2.078  -7.167  1.00 0.00 ? 21 CYS A H    1  
ATOM 237   H HA   . CYS A 1 21 ? 9.798   -1.493  -4.526  1.00 0.00 ? 21 CYS A HA   1  
ATOM 238   H HB2  . CYS A 1 21 ? 9.516   -4.262  -5.718  1.00 0.00 ? 21 CYS A HB2  1  
ATOM 239   H HB3  . CYS A 1 21 ? 8.814   -3.720  -4.199  1.00 0.00 ? 21 CYS A HB3  1  
ATOM 240   N N    . LYS A 1 22 ? 12.091  -1.999  -3.592  1.00 0.00 ? 22 LYS A N    1  
ATOM 241   C CA   . LYS A 1 22 ? 13.282  -2.389  -2.844  1.00 0.00 ? 22 LYS A CA   1  
ATOM 242   C C    . LYS A 1 22 ? 13.729  -1.283  -1.891  1.00 0.00 ? 22 LYS A C    1  
ATOM 243   O O    . LYS A 1 22 ? 14.925  -1.050  -1.717  1.00 0.00 ? 22 LYS A O    1  
ATOM 244   C CB   . LYS A 1 22 ? 14.418  -2.727  -3.812  1.00 0.00 ? 22 LYS A CB   1  
ATOM 245   C CG   . LYS A 1 22 ? 15.098  -1.502  -4.402  1.00 0.00 ? 22 LYS A CG   1  
ATOM 246   C CD   . LYS A 1 22 ? 16.607  -1.567  -4.235  1.00 0.00 ? 22 LYS A CD   1  
ATOM 247   C CE   . LYS A 1 22 ? 17.329  -1.109  -5.492  1.00 0.00 ? 22 LYS A CE   1  
ATOM 248   N NZ   . LYS A 1 22 ? 18.109  0.138   -5.262  1.00 0.00 ? 22 LYS A NZ   1  
ATOM 249   H H    . LYS A 1 22 ? 11.789  -1.068  -3.558  1.00 0.00 ? 22 LYS A H    1  
ATOM 250   H HA   . LYS A 1 22 ? 13.042  -3.269  -2.269  1.00 0.00 ? 22 LYS A HA   1  
ATOM 251   H HB2  . LYS A 1 22 ? 15.161  -3.307  -3.287  1.00 0.00 ? 22 LYS A HB2  1  
ATOM 252   H HB3  . LYS A 1 22 ? 14.019  -3.317  -4.624  1.00 0.00 ? 22 LYS A HB3  1  
ATOM 253   H HG2  . LYS A 1 22 ? 14.865  -1.445  -5.455  1.00 0.00 ? 22 LYS A HG2  1  
ATOM 254   H HG3  . LYS A 1 22 ? 14.726  -0.619  -3.902  1.00 0.00 ? 22 LYS A HG3  1  
ATOM 255   H HD2  . LYS A 1 22 ? 16.897  -0.928  -3.414  1.00 0.00 ? 22 LYS A HD2  1  
ATOM 256   H HD3  . LYS A 1 22 ? 16.892  -2.586  -4.018  1.00 0.00 ? 22 LYS A HD3  1  
ATOM 257   H HE2  . LYS A 1 22 ? 18.002  -1.890  -5.810  1.00 0.00 ? 22 LYS A HE2  1  
ATOM 258   H HE3  . LYS A 1 22 ? 16.597  -0.928  -6.266  1.00 0.00 ? 22 LYS A HE3  1  
ATOM 259   H HZ1  . LYS A 1 22 ? 19.093  0.007   -5.574  1.00 0.00 ? 22 LYS A HZ1  1  
ATOM 260   H HZ2  . LYS A 1 22 ? 18.108  0.379   -4.250  1.00 0.00 ? 22 LYS A HZ2  1  
ATOM 261   H HZ3  . LYS A 1 22 ? 17.689  0.927   -5.794  1.00 0.00 ? 22 LYS A HZ3  1  
ATOM 262   N N    . LEU A 1 23 ? 12.766  -0.600  -1.278  1.00 0.00 ? 23 LEU A N    1  
ATOM 263   C CA   . LEU A 1 23 ? 13.078  0.484   -0.347  1.00 0.00 ? 23 LEU A CA   1  
ATOM 264   C C    . LEU A 1 23 ? 13.706  -0.048  0.936   1.00 0.00 ? 23 LEU A C    1  
ATOM 265   O O    . LEU A 1 23 ? 13.230  -1.021  1.521   1.00 0.00 ? 23 LEU A O    1  
ATOM 266   C CB   . LEU A 1 23 ? 11.826  1.311   -0.023  1.00 0.00 ? 23 LEU A CB   1  
ATOM 267   C CG   . LEU A 1 23 ? 10.762  0.633   0.850   1.00 0.00 ? 23 LEU A CG   1  
ATOM 268   C CD1  . LEU A 1 23 ? 9.451   1.397   0.760   1.00 0.00 ? 23 LEU A CD1  1  
ATOM 269   C CD2  . LEU A 1 23 ? 10.554  -0.815  0.438   1.00 0.00 ? 23 LEU A CD2  1  
ATOM 270   H H    . LEU A 1 23 ? 11.832  -0.824  -1.460  1.00 0.00 ? 23 LEU A H    1  
ATOM 271   H HA   . LEU A 1 23 ? 13.797  1.127   -0.833  1.00 0.00 ? 23 LEU A HA   1  
ATOM 272   H HB2  . LEU A 1 23 ? 12.143  2.211   0.482   1.00 0.00 ? 23 LEU A HB2  1  
ATOM 273   H HB3  . LEU A 1 23 ? 11.365  1.590   -0.954  1.00 0.00 ? 23 LEU A HB3  1  
ATOM 274   H HG   . LEU A 1 23 ? 11.082  0.648   1.882   1.00 0.00 ? 23 LEU A HG   1  
ATOM 275   H HD11 . LEU A 1 23 ? 9.597   2.296   0.179   1.00 0.00 ? 23 LEU A HD11 1  
ATOM 276   H HD12 . LEU A 1 23 ? 9.117   1.661   1.752   1.00 0.00 ? 23 LEU A HD12 1  
ATOM 277   H HD13 . LEU A 1 23 ? 8.708   0.777   0.282   1.00 0.00 ? 23 LEU A HD13 1  
ATOM 278   H HD21 . LEU A 1 23 ? 9.935   -1.313  1.169   1.00 0.00 ? 23 LEU A HD21 1  
ATOM 279   H HD22 . LEU A 1 23 ? 11.509  -1.314  0.374   1.00 0.00 ? 23 LEU A HD22 1  
ATOM 280   H HD23 . LEU A 1 23 ? 10.067  -0.847  -0.526  1.00 0.00 ? 23 LEU A HD23 1  
ATOM 281   N N    . ARG A 1 24 ? 14.785  0.601   1.365   1.00 0.00 ? 24 ARG A N    1  
ATOM 282   C CA   . ARG A 1 24 ? 15.491  0.199   2.576   1.00 0.00 ? 24 ARG A CA   1  
ATOM 283   C C    . ARG A 1 24 ? 14.612  0.391   3.805   1.00 0.00 ? 24 ARG A C    1  
ATOM 284   O O    . ARG A 1 24 ? 14.923  -0.104  4.889   1.00 0.00 ? 24 ARG A O    1  
ATOM 285   C CB   . ARG A 1 24 ? 16.785  1.000   2.729   1.00 0.00 ? 24 ARG A CB   1  
ATOM 286   C CG   . ARG A 1 24 ? 17.779  0.771   1.602   1.00 0.00 ? 24 ARG A CG   1  
ATOM 287   C CD   . ARG A 1 24 ? 19.162  0.438   2.139   1.00 0.00 ? 24 ARG A CD   1  
ATOM 288   N NE   . ARG A 1 24 ? 19.121  -0.627  3.137   1.00 0.00 ? 24 ARG A NE   1  
ATOM 289   C CZ   . ARG A 1 24 ? 18.979  -1.913  2.836   1.00 0.00 ? 24 ARG A CZ   1  
ATOM 290   N NH1  . ARG A 1 24 ? 18.864  -2.291  1.571   1.00 0.00 ? 24 ARG A NH1  1  
ATOM 291   N NH2  . ARG A 1 24 ? 18.952  -2.823  3.801   1.00 0.00 ? 24 ARG A NH2  1  
ATOM 292   H H    . ARG A 1 24 ? 15.115  1.369   0.852   1.00 0.00 ? 24 ARG A H    1  
ATOM 293   H HA   . ARG A 1 24 ? 15.732  -0.846  2.485   1.00 0.00 ? 24 ARG A HA   1  
ATOM 294   H HB2  . ARG A 1 24 ? 16.544  2.052   2.759   1.00 0.00 ? 24 ARG A HB2  1  
ATOM 295   H HB3  . ARG A 1 24 ? 17.259  0.722   3.660   1.00 0.00 ? 24 ARG A HB3  1  
ATOM 296   H HG2  . ARG A 1 24 ? 17.434  -0.050  0.992   1.00 0.00 ? 24 ARG A HG2  1  
ATOM 297   H HG3  . ARG A 1 24 ? 17.841  1.667   1.003   1.00 0.00 ? 24 ARG A HG3  1  
ATOM 298   H HD2  . ARG A 1 24 ? 19.787  0.123   1.317   1.00 0.00 ? 24 ARG A HD2  1  
ATOM 299   H HD3  . ARG A 1 24 ? 19.582  1.325   2.589   1.00 0.00 ? 24 ARG A HD3  1  
ATOM 300   H HE   . ARG A 1 24 ? 19.203  -0.369  4.079   1.00 0.00 ? 24 ARG A HE   1  
ATOM 301   H HH11 . ARG A 1 24 ? 18.883  -1.608  0.841   1.00 0.00 ? 24 ARG A HH11 1  
ATOM 302   H HH12 . ARG A 1 24 ? 18.757  -3.260  1.346   1.00 0.00 ? 24 ARG A HH12 1  
ATOM 303   H HH21 . ARG A 1 24 ? 19.038  -2.541  4.756   1.00 0.00 ? 24 ARG A HH21 1  
ATOM 304   H HH22 . ARG A 1 24 ? 18.845  -3.791  3.572   1.00 0.00 ? 24 ARG A HH22 1  
ATOM 305   N N    . GLN A 1 25 ? 13.512  1.108   3.626   1.00 0.00 ? 25 GLN A N    1  
ATOM 306   C CA   . GLN A 1 25 ? 12.580  1.363   4.716   1.00 0.00 ? 25 GLN A CA   1  
ATOM 307   C C    . GLN A 1 25 ? 11.646  0.179   4.905   1.00 0.00 ? 25 GLN A C    1  
ATOM 308   O O    . GLN A 1 25 ? 11.928  -0.736  5.678   1.00 0.00 ? 25 GLN A O    1  
ATOM 309   C CB   . GLN A 1 25 ? 11.772  2.633   4.441   1.00 0.00 ? 25 GLN A CB   1  
ATOM 310   C CG   . GLN A 1 25 ? 12.351  3.875   5.099   1.00 0.00 ? 25 GLN A CG   1  
ATOM 311   C CD   . GLN A 1 25 ? 11.708  4.179   6.438   1.00 0.00 ? 25 GLN A CD   1  
ATOM 312   O OE1  . GLN A 1 25 ? 11.121  5.244   6.631   1.00 0.00 ? 25 GLN A OE1  1  
ATOM 313   N NE2  . GLN A 1 25 ? 11.816  3.241   7.372   1.00 0.00 ? 25 GLN A NE2  1  
ATOM 314   H H    . GLN A 1 25 ? 13.319  1.471   2.737   1.00 0.00 ? 25 GLN A H    1  
ATOM 315   H HA   . GLN A 1 25 ? 13.147  1.498   5.615   1.00 0.00 ? 25 GLN A HA   1  
ATOM 316   H HB2  . GLN A 1 25 ? 11.736  2.800   3.374   1.00 0.00 ? 25 GLN A HB2  1  
ATOM 317   H HB3  . GLN A 1 25 ? 10.766  2.493   4.808   1.00 0.00 ? 25 GLN A HB3  1  
ATOM 318   H HG2  . GLN A 1 25 ? 13.409  3.726   5.251   1.00 0.00 ? 25 GLN A HG2  1  
ATOM 319   H HG3  . GLN A 1 25 ? 12.198  4.719   4.442   1.00 0.00 ? 25 GLN A HG3  1  
ATOM 320   H HE21 . GLN A 1 25 ? 12.297  2.417   7.148   1.00 0.00 ? 25 GLN A HE21 1  
ATOM 321   H HE22 . GLN A 1 25 ? 11.409  3.411   8.248   1.00 0.00 ? 25 GLN A HE22 1  
ATOM 322   N N    . GLY A 1 26 ? 10.538  0.207   4.187   1.00 0.00 ? 26 GLY A N    1  
ATOM 323   C CA   . GLY A 1 26 ? 9.569   -0.867  4.272   1.00 0.00 ? 26 GLY A CA   1  
ATOM 324   C C    . GLY A 1 26 ? 8.143   -0.376  4.138   1.00 0.00 ? 26 GLY A C    1  
ATOM 325   O O    . GLY A 1 26 ? 7.441   -0.203  5.134   1.00 0.00 ? 26 GLY A O    1  
ATOM 326   H H    . GLY A 1 26 ? 10.381  0.964   3.591   1.00 0.00 ? 26 GLY A H    1  
ATOM 327   H HA2  . GLY A 1 26 ? 9.768   -1.578  3.483   1.00 0.00 ? 26 GLY A HA2  1  
ATOM 328   H HA3  . GLY A 1 26 ? 9.680   -1.362  5.225   1.00 0.00 ? 26 GLY A HA3  1  
ATOM 329   N N    . ALA A 1 27 ? 7.721   -0.134  2.902   1.00 0.00 ? 27 ALA A N    1  
ATOM 330   C CA   . ALA A 1 27 ? 6.378   0.360   2.615   1.00 0.00 ? 27 ALA A CA   1  
ATOM 331   C C    . ALA A 1 27 ? 5.251   -0.639  2.937   1.00 0.00 ? 27 ALA A C    1  
ATOM 332   O O    . ALA A 1 27 ? 4.273   -0.712  2.196   1.00 0.00 ? 27 ALA A O    1  
ATOM 333   C CB   . ALA A 1 27 ? 6.302   0.734   1.151   1.00 0.00 ? 27 ALA A CB   1  
ATOM 334   H H    . ALA A 1 27 ? 8.341   -0.270  2.151   1.00 0.00 ? 27 ALA A H    1  
ATOM 335   H HA   . ALA A 1 27 ? 6.228   1.259   3.191   1.00 0.00 ? 27 ALA A HA   1  
ATOM 336   H HB1  . ALA A 1 27 ? 7.095   1.433   0.913   1.00 0.00 ? 27 ALA A HB1  1  
ATOM 337   H HB2  . ALA A 1 27 ? 5.348   1.194   0.945   1.00 0.00 ? 27 ALA A HB2  1  
ATOM 338   H HB3  . ALA A 1 27 ? 6.414   -0.150  0.542   1.00 0.00 ? 27 ALA A HB3  1  
ATOM 339   N N    . GLN A 1 28 ? 5.368   -1.405  4.021   1.00 0.00 ? 28 GLN A N    1  
ATOM 340   C CA   . GLN A 1 28 ? 4.331   -2.373  4.374   1.00 0.00 ? 28 GLN A CA   1  
ATOM 341   C C    . GLN A 1 28 ? 2.976   -1.714  4.616   1.00 0.00 ? 28 GLN A C    1  
ATOM 342   O O    . GLN A 1 28 ? 2.635   -1.367  5.747   1.00 0.00 ? 28 GLN A O    1  
ATOM 343   C CB   . GLN A 1 28 ? 4.729   -3.174  5.607   1.00 0.00 ? 28 GLN A CB   1  
ATOM 344   C CG   . GLN A 1 28 ? 6.223   -3.347  5.761   1.00 0.00 ? 28 GLN A CG   1  
ATOM 345   C CD   . GLN A 1 28 ? 6.845   -2.294  6.657   1.00 0.00 ? 28 GLN A CD   1  
ATOM 346   O OE1  . GLN A 1 28 ? 6.204   -1.305  7.010   1.00 0.00 ? 28 GLN A OE1  1  
ATOM 347   N NE2  . GLN A 1 28 ? 8.102   -2.504  7.032   1.00 0.00 ? 28 GLN A NE2  1  
ATOM 348   H H    . GLN A 1 28 ? 6.156   -1.329  4.586   1.00 0.00 ? 28 GLN A H    1  
ATOM 349   H HA   . GLN A 1 28 ? 4.235   -3.048  3.547   1.00 0.00 ? 28 GLN A HA   1  
ATOM 350   H HB2  . GLN A 1 28 ? 4.352   -2.673  6.485   1.00 0.00 ? 28 GLN A HB2  1  
ATOM 351   H HB3  . GLN A 1 28 ? 4.280   -4.155  5.542   1.00 0.00 ? 28 GLN A HB3  1  
ATOM 352   H HG2  . GLN A 1 28 ? 6.412   -4.320  6.186   1.00 0.00 ? 28 GLN A HG2  1  
ATOM 353   H HG3  . GLN A 1 28 ? 6.679   -3.285  4.783   1.00 0.00 ? 28 GLN A HG3  1  
ATOM 354   H HE21 . GLN A 1 28 ? 8.551   -3.314  6.713   1.00 0.00 ? 28 GLN A HE21 1  
ATOM 355   H HE22 . GLN A 1 28 ? 8.529   -1.839  7.612   1.00 0.00 ? 28 GLN A HE22 1  
ATOM 356   N N    . CYS A 1 29 ? 2.202   -1.562  3.548   1.00 0.00 ? 29 CYS A N    1  
ATOM 357   C CA   . CYS A 1 29 ? 0.875   -0.965  3.637   1.00 0.00 ? 29 CYS A CA   1  
ATOM 358   C C    . CYS A 1 29 ? 0.961   0.466   4.125   1.00 0.00 ? 29 CYS A C    1  
ATOM 359   O O    . CYS A 1 29 ? 0.359   0.828   5.136   1.00 0.00 ? 29 CYS A O    1  
ATOM 360   C CB   . CYS A 1 29 ? -0.026  -1.775  4.570   1.00 0.00 ? 29 CYS A CB   1  
ATOM 361   S SG   . CYS A 1 29 ? -0.694  -3.297  3.826   1.00 0.00 ? 29 CYS A SG   1  
ATOM 362   H H    . CYS A 1 29 ? 2.530   -1.862  2.679   1.00 0.00 ? 29 CYS A H    1  
ATOM 363   H HA   . CYS A 1 29 ? 0.445   -0.968  2.646   1.00 0.00 ? 29 CYS A HA   1  
ATOM 364   H HB2  . CYS A 1 29 ? 0.534   -2.057  5.447   1.00 0.00 ? 29 CYS A HB2  1  
ATOM 365   H HB3  . CYS A 1 29 ? -0.865  -1.161  4.868   1.00 0.00 ? 29 CYS A HB3  1  
ATOM 366   N N    . ALA A 1 30 ? 1.705   1.280   3.397   1.00 0.00 ? 30 ALA A N    1  
ATOM 367   C CA   . ALA A 1 30 ? 1.855   2.678   3.758   1.00 0.00 ? 30 ALA A CA   1  
ATOM 368   C C    . ALA A 1 30 ? 0.706   3.491   3.181   1.00 0.00 ? 30 ALA A C    1  
ATOM 369   O O    . ALA A 1 30 ? -0.388  2.965   2.977   1.00 0.00 ? 30 ALA A O    1  
ATOM 370   C CB   . ALA A 1 30 ? 3.191   3.218   3.273   1.00 0.00 ? 30 ALA A CB   1  
ATOM 371   H H    . ALA A 1 30 ? 2.153   0.933   2.594   1.00 0.00 ? 30 ALA A H    1  
ATOM 372   H HA   . ALA A 1 30 ? 1.832   2.741   4.834   1.00 0.00 ? 30 ALA A HA   1  
ATOM 373   H HB1  . ALA A 1 30 ? 3.065   3.672   2.302   1.00 0.00 ? 30 ALA A HB1  1  
ATOM 374   H HB2  . ALA A 1 30 ? 3.902   2.408   3.202   1.00 0.00 ? 30 ALA A HB2  1  
ATOM 375   H HB3  . ALA A 1 30 ? 3.556   3.957   3.972   1.00 0.00 ? 30 ALA A HB3  1  
ATOM 376   N N    . GLU A 1 31 ? 0.952   4.765   2.897   1.00 0.00 ? 31 GLU A N    1  
ATOM 377   C CA   . GLU A 1 31 ? -0.083  5.613   2.317   1.00 0.00 ? 31 GLU A CA   1  
ATOM 378   C C    . GLU A 1 31 ? -0.832  4.820   1.256   1.00 0.00 ? 31 GLU A C    1  
ATOM 379   O O    . GLU A 1 31 ? -2.026  5.015   1.030   1.00 0.00 ? 31 GLU A O    1  
ATOM 380   C CB   . GLU A 1 31 ? 0.530   6.874   1.703   1.00 0.00 ? 31 GLU A CB   1  
ATOM 381   C CG   . GLU A 1 31 ? -0.452  7.684   0.872   1.00 0.00 ? 31 GLU A CG   1  
ATOM 382   C CD   . GLU A 1 31 ? -0.001  7.855   -0.565  1.00 0.00 ? 31 GLU A CD   1  
ATOM 383   O OE1  . GLU A 1 31 ? 1.002   7.220   -0.953  1.00 0.00 ? 31 GLU A OE1  1  
ATOM 384   O OE2  . GLU A 1 31 ? -0.651  8.625   -1.304  1.00 0.00 ? 31 GLU A OE2  1  
ATOM 385   H H    . GLU A 1 31 ? 1.843   5.132   3.062   1.00 0.00 ? 31 GLU A H    1  
ATOM 386   H HA   . GLU A 1 31 ? -0.771  5.892   3.102   1.00 0.00 ? 31 GLU A HA   1  
ATOM 387   H HB2  . GLU A 1 31 ? 0.899   7.503   2.498   1.00 0.00 ? 31 GLU A HB2  1  
ATOM 388   H HB3  . GLU A 1 31 ? 1.356   6.587   1.068   1.00 0.00 ? 31 GLU A HB3  1  
ATOM 389   H HG2  . GLU A 1 31 ? -1.408  7.181   0.875   1.00 0.00 ? 31 GLU A HG2  1  
ATOM 390   H HG3  . GLU A 1 31 ? -0.561  8.662   1.319   1.00 0.00 ? 31 GLU A HG3  1  
ATOM 391   N N    . GLY A 1 32 ? -0.103  3.904   0.629   1.00 0.00 ? 32 GLY A N    1  
ATOM 392   C CA   . GLY A 1 32 ? -0.668  3.046   -0.388  1.00 0.00 ? 32 GLY A CA   1  
ATOM 393   C C    . GLY A 1 32 ? 0.013   1.692   -0.395  1.00 0.00 ? 32 GLY A C    1  
ATOM 394   O O    . GLY A 1 32 ? 1.178   1.580   -0.014  1.00 0.00 ? 32 GLY A O    1  
ATOM 395   H H    . GLY A 1 32 ? 0.839   3.798   0.876   1.00 0.00 ? 32 GLY A H    1  
ATOM 396   H HA2  . GLY A 1 32 ? -1.722  2.912   -0.189  1.00 0.00 ? 32 GLY A HA2  1  
ATOM 397   H HA3  . GLY A 1 32 ? -0.543  3.509   -1.354  1.00 0.00 ? 32 GLY A HA3  1  
ATOM 398   N N    . LEU A 1 33 ? -0.711  0.661   -0.805  1.00 0.00 ? 33 LEU A N    1  
ATOM 399   C CA   . LEU A 1 33 ? -0.161  -0.688  -0.832  1.00 0.00 ? 33 LEU A CA   1  
ATOM 400   C C    . LEU A 1 33 ? 1.308   -0.689  -1.259  1.00 0.00 ? 33 LEU A C    1  
ATOM 401   O O    . LEU A 1 33 ? 1.799   0.277   -1.843  1.00 0.00 ? 33 LEU A O    1  
ATOM 402   C CB   . LEU A 1 33 ? -0.978  -1.577  -1.767  1.00 0.00 ? 33 LEU A CB   1  
ATOM 403   C CG   . LEU A 1 33 ? -1.314  -2.959  -1.206  1.00 0.00 ? 33 LEU A CG   1  
ATOM 404   C CD1  . LEU A 1 33 ? -0.128  -3.897  -1.363  1.00 0.00 ? 33 LEU A CD1  1  
ATOM 405   C CD2  . LEU A 1 33 ? -1.723  -2.855  0.256   1.00 0.00 ? 33 LEU A CD2  1  
ATOM 406   H H    . LEU A 1 33 ? -1.639  0.807   -1.084  1.00 0.00 ? 33 LEU A H    1  
ATOM 407   H HA   . LEU A 1 33 ? -0.229  -1.084  0.170   1.00 0.00 ? 33 LEU A HA   1  
ATOM 408   H HB2  . LEU A 1 33 ? -1.903  -1.069  -1.998  1.00 0.00 ? 33 LEU A HB2  1  
ATOM 409   H HB3  . LEU A 1 33 ? -0.422  -1.711  -2.683  1.00 0.00 ? 33 LEU A HB3  1  
ATOM 410   H HG   . LEU A 1 33 ? -2.144  -3.371  -1.760  1.00 0.00 ? 33 LEU A HG   1  
ATOM 411   H HD11 . LEU A 1 33 ? 0.342   -4.045  -0.401  1.00 0.00 ? 33 LEU A HD11 1  
ATOM 412   H HD12 . LEU A 1 33 ? 0.585   -3.464  -2.049  1.00 0.00 ? 33 LEU A HD12 1  
ATOM 413   H HD13 . LEU A 1 33 ? -0.468  -4.846  -1.747  1.00 0.00 ? 33 LEU A HD13 1  
ATOM 414   H HD21 . LEU A 1 33 ? -2.615  -3.440  0.423   1.00 0.00 ? 33 LEU A HD21 1  
ATOM 415   H HD22 . LEU A 1 33 ? -1.918  -1.822  0.503   1.00 0.00 ? 33 LEU A HD22 1  
ATOM 416   H HD23 . LEU A 1 33 ? -0.924  -3.229  0.880   1.00 0.00 ? 33 LEU A HD23 1  
ATOM 417   N N    . CYS A 1 34 ? 2.000   -1.788  -0.963  1.00 0.00 ? 34 CYS A N    1  
ATOM 418   C CA   . CYS A 1 34 ? 3.412   -1.937  -1.309  1.00 0.00 ? 34 CYS A CA   1  
ATOM 419   C C    . CYS A 1 34 ? 3.629   -3.199  -2.135  1.00 0.00 ? 34 CYS A C    1  
ATOM 420   O O    . CYS A 1 34 ? 2.760   -4.069  -2.198  1.00 0.00 ? 34 CYS A O    1  
ATOM 421   C CB   . CYS A 1 34 ? 4.272   -1.963  -0.032  1.00 0.00 ? 34 CYS A CB   1  
ATOM 422   S SG   . CYS A 1 34 ? 5.654   -3.157  -0.035  1.00 0.00 ? 34 CYS A SG   1  
ATOM 423   H H    . CYS A 1 34 ? 1.548   -2.520  -0.502  1.00 0.00 ? 34 CYS A H    1  
ATOM 424   H HA   . CYS A 1 34 ? 3.694   -1.086  -1.905  1.00 0.00 ? 34 CYS A HA   1  
ATOM 425   H HB2  . CYS A 1 34 ? 4.697   -0.987  0.117   1.00 0.00 ? 34 CYS A HB2  1  
ATOM 426   H HB3  . CYS A 1 34 ? 3.639   -2.201  0.810   1.00 0.00 ? 34 CYS A HB3  1  
ATOM 427   N N    . CYS A 1 35 ? 4.790   -3.289  -2.773  1.00 0.00 ? 35 CYS A N    1  
ATOM 428   C CA   . CYS A 1 35 ? 5.107   -4.446  -3.599  1.00 0.00 ? 35 CYS A CA   1  
ATOM 429   C C    . CYS A 1 35 ? 6.492   -5.014  -3.277  1.00 0.00 ? 35 CYS A C    1  
ATOM 430   O O    . CYS A 1 35 ? 6.860   -6.083  -3.764  1.00 0.00 ? 35 CYS A O    1  
ATOM 431   C CB   . CYS A 1 35 ? 5.000   -4.068  -5.090  1.00 0.00 ? 35 CYS A CB   1  
ATOM 432   S SG   . CYS A 1 35 ? 6.438   -4.523  -6.126  1.00 0.00 ? 35 CYS A SG   1  
ATOM 433   H H    . CYS A 1 35 ? 5.439   -2.562  -2.692  1.00 0.00 ? 35 CYS A H    1  
ATOM 434   H HA   . CYS A 1 35 ? 4.370   -5.195  -3.376  1.00 0.00 ? 35 CYS A HA   1  
ATOM 435   H HB2  . CYS A 1 35 ? 4.136   -4.556  -5.511  1.00 0.00 ? 35 CYS A HB2  1  
ATOM 436   H HB3  . CYS A 1 35 ? 4.869   -2.998  -5.167  1.00 0.00 ? 35 CYS A HB3  1  
ATOM 437   N N    . ASP A 1 36 ? 7.256   -4.292  -2.472  1.00 0.00 ? 36 ASP A N    1  
ATOM 438   C CA   . ASP A 1 36 ? 8.599   -4.719  -2.102  1.00 0.00 ? 36 ASP A CA   1  
ATOM 439   C C    . ASP A 1 36 ? 8.575   -5.611  -0.869  1.00 0.00 ? 36 ASP A C    1  
ATOM 440   O O    . ASP A 1 36 ? 7.556   -5.718  -0.185  1.00 0.00 ? 36 ASP A O    1  
ATOM 441   C CB   . ASP A 1 36 ? 9.478   -3.494  -1.835  1.00 0.00 ? 36 ASP A CB   1  
ATOM 442   C CG   . ASP A 1 36 ? 10.918  -3.862  -1.547  1.00 0.00 ? 36 ASP A CG   1  
ATOM 443   O OD1  . ASP A 1 36 ? 11.430  -4.804  -2.189  1.00 0.00 ? 36 ASP A OD1  1  
ATOM 444   O OD2  . ASP A 1 36 ? 11.535  -3.211  -0.678  1.00 0.00 ? 36 ASP A OD2  1  
ATOM 445   H H    . ASP A 1 36 ? 6.914   -3.449  -2.123  1.00 0.00 ? 36 ASP A H    1  
ATOM 446   H HA   . ASP A 1 36 ? 9.013   -5.274  -2.930  1.00 0.00 ? 36 ASP A HA   1  
ATOM 447   H HB2  . ASP A 1 36 ? 9.459   -2.847  -2.700  1.00 0.00 ? 36 ASP A HB2  1  
ATOM 448   H HB3  . ASP A 1 36 ? 9.085   -2.958  -0.983  1.00 0.00 ? 36 ASP A HB3  1  
ATOM 449   N N    . GLN A 1 37 ? 9.713   -6.238  -0.577  1.00 0.00 ? 37 GLN A N    1  
ATOM 450   C CA   . GLN A 1 37 ? 9.827   -7.103  0.587   1.00 0.00 ? 37 GLN A CA   1  
ATOM 451   C C    . GLN A 1 37 ? 9.193   -6.438  1.803   1.00 0.00 ? 37 GLN A C    1  
ATOM 452   O O    . GLN A 1 37 ? 8.789   -7.118  2.745   1.00 0.00 ? 37 GLN A O    1  
ATOM 453   C CB   . GLN A 1 37 ? 11.295  -7.425  0.871   1.00 0.00 ? 37 GLN A CB   1  
ATOM 454   C CG   . GLN A 1 37 ? 12.096  -7.759  -0.376  1.00 0.00 ? 37 GLN A CG   1  
ATOM 455   C CD   . GLN A 1 37 ? 11.398  -8.771  -1.264  1.00 0.00 ? 37 GLN A CD   1  
ATOM 456   O OE1  . GLN A 1 37 ? 10.231  -8.604  -1.616  1.00 0.00 ? 37 GLN A OE1  1  
ATOM 457   N NE2  . GLN A 1 37 ? 12.113  -9.828  -1.630  1.00 0.00 ? 37 GLN A NE2  1  
ATOM 458   H H    . GLN A 1 37 ? 10.494  -6.106  -1.151  1.00 0.00 ? 37 GLN A H    1  
ATOM 459   H HA   . GLN A 1 37 ? 9.298   -8.019  0.373   1.00 0.00 ? 37 GLN A HA   1  
ATOM 460   H HB2  . GLN A 1 37 ? 11.752  -6.571  1.349   1.00 0.00 ? 37 GLN A HB2  1  
ATOM 461   H HB3  . GLN A 1 37 ? 11.343  -8.270  1.541   1.00 0.00 ? 37 GLN A HB3  1  
ATOM 462   H HG2  . GLN A 1 37 ? 12.251  -6.853  -0.943  1.00 0.00 ? 37 GLN A HG2  1  
ATOM 463   H HG3  . GLN A 1 37 ? 13.052  -8.163  -0.077  1.00 0.00 ? 37 GLN A HG3  1  
ATOM 464   H HE21 . GLN A 1 37 ? 13.037  -9.895  -1.312  1.00 0.00 ? 37 GLN A HE21 1  
ATOM 465   H HE22 . GLN A 1 37 ? 11.687  -10.498 -2.204  1.00 0.00 ? 37 GLN A HE22 1  
ATOM 466   N N    . CYS A 1 38 ? 9.118   -5.101  1.758   1.00 0.00 ? 38 CYS A N    1  
ATOM 467   C CA   . CYS A 1 38 ? 8.538   -4.294  2.831   1.00 0.00 ? 38 CYS A CA   1  
ATOM 468   C C    . CYS A 1 38 ? 7.712   -5.132  3.800   1.00 0.00 ? 38 CYS A C    1  
ATOM 469   O O    . CYS A 1 38 ? 7.930   -5.070  5.007   1.00 0.00 ? 38 CYS A O    1  
ATOM 470   C CB   . CYS A 1 38 ? 7.692   -3.158  2.233   1.00 0.00 ? 38 CYS A CB   1  
ATOM 471   S SG   . CYS A 1 38 ? 5.945   -3.578  1.926   1.00 0.00 ? 38 CYS A SG   1  
ATOM 472   H H    . CYS A 1 38 ? 9.472   -4.638  0.972   1.00 0.00 ? 38 CYS A H    1  
ATOM 473   H HA   . CYS A 1 38 ? 9.347   -3.852  3.383   1.00 0.00 ? 38 CYS A HA   1  
ATOM 474   H HB2  . CYS A 1 38 ? 7.706   -2.320  2.910   1.00 0.00 ? 38 CYS A HB2  1  
ATOM 475   H HB3  . CYS A 1 38 ? 8.127   -2.856  1.291   1.00 0.00 ? 38 CYS A HB3  1  
ATOM 476   N N    . ARG A 1 39 ? 6.771   -5.906  3.257   1.00 0.00 ? 39 ARG A N    1  
ATOM 477   C CA   . ARG A 1 39 ? 5.887   -6.762  4.056   1.00 0.00 ? 39 ARG A CA   1  
ATOM 478   C C    . ARG A 1 39 ? 4.514   -6.118  4.143   1.00 0.00 ? 39 ARG A C    1  
ATOM 479   O O    . ARG A 1 39 ? 4.288   -5.073  3.541   1.00 0.00 ? 39 ARG A O    1  
ATOM 480   C CB   . ARG A 1 39 ? 6.447   -7.014  5.459   1.00 0.00 ? 39 ARG A CB   1  
ATOM 481   C CG   . ARG A 1 39 ? 5.918   -8.283  6.106   1.00 0.00 ? 39 ARG A CG   1  
ATOM 482   C CD   . ARG A 1 39 ? 7.037   -9.087  6.750   1.00 0.00 ? 39 ARG A CD   1  
ATOM 483   N NE   . ARG A 1 39 ? 6.522   -10.151 7.607   1.00 0.00 ? 39 ARG A NE   1  
ATOM 484   C CZ   . ARG A 1 39 ? 5.927   -9.930  8.775   1.00 0.00 ? 39 ARG A CZ   1  
ATOM 485   N NH1  . ARG A 1 39 ? 5.775   -8.690  9.220   1.00 0.00 ? 39 ARG A NH1  1  
ATOM 486   N NH2  . ARG A 1 39 ? 5.483   -10.949 9.498   1.00 0.00 ? 39 ARG A NH2  1  
ATOM 487   H H    . ARG A 1 39 ? 6.659   -5.895  2.278   1.00 0.00 ? 39 ARG A H    1  
ATOM 488   H HA   . ARG A 1 39 ? 5.791   -7.707  3.539   1.00 0.00 ? 39 ARG A HA   1  
ATOM 489   H HB2  . ARG A 1 39 ? 7.522   -7.089  5.397   1.00 0.00 ? 39 ARG A HB2  1  
ATOM 490   H HB3  . ARG A 1 39 ? 6.189   -6.178  6.093   1.00 0.00 ? 39 ARG A HB3  1  
ATOM 491   H HG2  . ARG A 1 39 ? 5.198   -8.017  6.865   1.00 0.00 ? 39 ARG A HG2  1  
ATOM 492   H HG3  . ARG A 1 39 ? 5.441   -8.889  5.350   1.00 0.00 ? 39 ARG A HG3  1  
ATOM 493   H HD2  . ARG A 1 39 ? 7.641   -9.528  5.971   1.00 0.00 ? 39 ARG A HD2  1  
ATOM 494   H HD3  . ARG A 1 39 ? 7.645   -8.421  7.344   1.00 0.00 ? 39 ARG A HD3  1  
ATOM 495   H HE   . ARG A 1 39 ? 6.624   -11.075 7.297   1.00 0.00 ? 39 ARG A HE   1  
ATOM 496   H HH11 . ARG A 1 39 ? 6.109   -7.920  8.676   1.00 0.00 ? 39 ARG A HH11 1  
ATOM 497   H HH12 . ARG A 1 39 ? 5.328   -8.526  10.099  1.00 0.00 ? 39 ARG A HH12 1  
ATOM 498   H HH21 . ARG A 1 39 ? 5.596   -11.885 9.165   1.00 0.00 ? 39 ARG A HH21 1  
ATOM 499   H HH22 . ARG A 1 39 ? 5.037   -10.781 10.377  1.00 0.00 ? 39 ARG A HH22 1  
ATOM 500   N N    . PHE A 1 40 ? 3.582   -6.738  4.859   1.00 0.00 ? 40 PHE A N    1  
ATOM 501   C CA   . PHE A 1 40 ? 2.239   -6.178  4.953   1.00 0.00 ? 40 PHE A CA   1  
ATOM 502   C C    . PHE A 1 40 ? 1.496   -6.658  6.194   1.00 0.00 ? 40 PHE A C    1  
ATOM 503   O O    . PHE A 1 40 ? 1.622   -7.809  6.611   1.00 0.00 ? 40 PHE A O    1  
ATOM 504   C CB   . PHE A 1 40 ? 1.464   -6.513  3.678   1.00 0.00 ? 40 PHE A CB   1  
ATOM 505   C CG   . PHE A 1 40 ? 2.256   -6.181  2.450   1.00 0.00 ? 40 PHE A CG   1  
ATOM 506   C CD1  . PHE A 1 40 ? 3.181   -7.079  1.938   1.00 0.00 ? 40 PHE A CD1  1  
ATOM 507   C CD2  . PHE A 1 40 ? 2.119   -4.948  1.839   1.00 0.00 ? 40 PHE A CD2  1  
ATOM 508   C CE1  . PHE A 1 40 ? 3.952   -6.751  0.844   1.00 0.00 ? 40 PHE A CE1  1  
ATOM 509   C CE2  . PHE A 1 40 ? 2.878   -4.621  0.740   1.00 0.00 ? 40 PHE A CE2  1  
ATOM 510   C CZ   . PHE A 1 40 ? 3.799   -5.519  0.242   1.00 0.00 ? 40 PHE A CZ   1  
ATOM 511   H H    . PHE A 1 40 ? 3.793   -7.583  5.309   1.00 0.00 ? 40 PHE A H    1  
ATOM 512   H HA   . PHE A 1 40 ? 2.343   -5.104  5.014   1.00 0.00 ? 40 PHE A HA   1  
ATOM 513   H HB2  . PHE A 1 40 ? 1.234   -7.568  3.661   1.00 0.00 ? 40 PHE A HB2  1  
ATOM 514   H HB3  . PHE A 1 40 ? 0.550   -5.941  3.653   1.00 0.00 ? 40 PHE A HB3  1  
ATOM 515   H HD1  . PHE A 1 40 ? 3.296   -8.044  2.403   1.00 0.00 ? 40 PHE A HD1  1  
ATOM 516   H HD2  . PHE A 1 40 ? 1.398   -4.240  2.221   1.00 0.00 ? 40 PHE A HD2  1  
ATOM 517   H HE1  . PHE A 1 40 ? 4.672   -7.457  0.461   1.00 0.00 ? 40 PHE A HE1  1  
ATOM 518   H HE2  . PHE A 1 40 ? 2.755   -3.664  0.273   1.00 0.00 ? 40 PHE A HE2  1  
ATOM 519   H HZ   . PHE A 1 40 ? 4.405   -5.254  -0.609  1.00 0.00 ? 40 PHE A HZ   1  
ATOM 520   N N    . MET A 1 41 ? 0.733   -5.743  6.784   1.00 0.00 ? 41 MET A N    1  
ATOM 521   C CA   . MET A 1 41 ? -0.034  -6.020  7.991   1.00 0.00 ? 41 MET A CA   1  
ATOM 522   C C    . MET A 1 41 ? -0.814  -7.328  7.890   1.00 0.00 ? 41 MET A C    1  
ATOM 523   O O    . MET A 1 41 ? -0.310  -8.381  8.273   1.00 0.00 ? 41 MET A O    1  
ATOM 524   C CB   . MET A 1 41 ? -0.994  -4.862  8.275   1.00 0.00 ? 41 MET A CB   1  
ATOM 525   C CG   . MET A 1 41 ? -0.516  -3.934  9.379   1.00 0.00 ? 41 MET A CG   1  
ATOM 526   S SD   . MET A 1 41 ? 0.675   -2.713  8.795   1.00 0.00 ? 41 MET A SD   1  
ATOM 527   C CE   . MET A 1 41 ? 1.048   -1.848  10.318  1.00 0.00 ? 41 MET A CE   1  
ATOM 528   H H    . MET A 1 41 ? 0.695   -4.843  6.399   1.00 0.00 ? 41 MET A H    1  
ATOM 529   H HA   . MET A 1 41 ? 0.664   -6.097  8.810   1.00 0.00 ? 41 MET A HA   1  
ATOM 530   H HB2  . MET A 1 41 ? -1.117  -4.281  7.371   1.00 0.00 ? 41 MET A HB2  1  
ATOM 531   H HB3  . MET A 1 41 ? -1.954  -5.266  8.563   1.00 0.00 ? 41 MET A HB3  1  
ATOM 532   H HG2  . MET A 1 41 ? -1.369  -3.415  9.790   1.00 0.00 ? 41 MET A HG2  1  
ATOM 533   H HG3  . MET A 1 41 ? -0.052  -4.528  10.153  1.00 0.00 ? 41 MET A HG3  1  
ATOM 534   H HE1  . MET A 1 41 ? 0.625   -2.389  11.152  1.00 0.00 ? 41 MET A HE1  1  
ATOM 535   H HE2  . MET A 1 41 ? 0.624   -0.855  10.281  1.00 0.00 ? 41 MET A HE2  1  
ATOM 536   H HE3  . MET A 1 41 ? 2.119   -1.779  10.440  1.00 0.00 ? 41 MET A HE3  1  
ATOM 537   N N    . LYS A 1 42 ? -2.050  -7.227  7.388   1.00 0.00 ? 42 LYS A N    1  
ATOM 538   C CA   . LYS A 1 42 ? -2.964  -8.364  7.232   1.00 0.00 ? 42 LYS A CA   1  
ATOM 539   C C    . LYS A 1 42 ? -4.353  -7.966  7.711   1.00 0.00 ? 42 LYS A C    1  
ATOM 540   O O    . LYS A 1 42 ? -5.349  -8.608  7.381   1.00 0.00 ? 42 LYS A O    1  
ATOM 541   C CB   . LYS A 1 42 ? -2.494  -9.602  8.002   1.00 0.00 ? 42 LYS A CB   1  
ATOM 542   C CG   . LYS A 1 42 ? -1.522  -10.474 7.222   1.00 0.00 ? 42 LYS A CG   1  
ATOM 543   C CD   . LYS A 1 42 ? -2.173  -11.059 5.981   1.00 0.00 ? 42 LYS A CD   1  
ATOM 544   C CE   . LYS A 1 42 ? -1.167  -11.831 5.141   1.00 0.00 ? 42 LYS A CE   1  
ATOM 545   N NZ   . LYS A 1 42 ? -0.911  -13.191 5.691   1.00 0.00 ? 42 LYS A NZ   1  
ATOM 546   H H    . LYS A 1 42 ? -2.371  -6.341  7.117   1.00 0.00 ? 42 LYS A H    1  
ATOM 547   H HA   . LYS A 1 42 ? -3.019  -8.597  6.182   1.00 0.00 ? 42 LYS A HA   1  
ATOM 548   H HB2  . LYS A 1 42 ? -2.017  -9.289  8.918   1.00 0.00 ? 42 LYS A HB2  1  
ATOM 549   H HB3  . LYS A 1 42 ? -3.358  -10.202 8.249   1.00 0.00 ? 42 LYS A HB3  1  
ATOM 550   H HG2  . LYS A 1 42 ? -0.675  -9.879  6.920   1.00 0.00 ? 42 LYS A HG2  1  
ATOM 551   H HG3  . LYS A 1 42 ? -1.189  -11.282 7.857   1.00 0.00 ? 42 LYS A HG3  1  
ATOM 552   H HD2  . LYS A 1 42 ? -2.967  -11.726 6.280   1.00 0.00 ? 42 LYS A HD2  1  
ATOM 553   H HD3  . LYS A 1 42 ? -2.581  -10.253 5.387   1.00 0.00 ? 42 LYS A HD3  1  
ATOM 554   H HE2  . LYS A 1 42 ? -1.552  -11.927 4.137   1.00 0.00 ? 42 LYS A HE2  1  
ATOM 555   H HE3  . LYS A 1 42 ? -0.239  -11.280 5.118   1.00 0.00 ? 42 LYS A HE3  1  
ATOM 556   H HZ1  . LYS A 1 42 ? -1.797  -13.733 5.732   1.00 0.00 ? 42 LYS A HZ1  1  
ATOM 557   H HZ2  . LYS A 1 42 ? -0.516  -13.120 6.651   1.00 0.00 ? 42 LYS A HZ2  1  
ATOM 558   H HZ3  . LYS A 1 42 ? -0.233  -13.699 5.087   1.00 0.00 ? 42 LYS A HZ3  1  
ATOM 559   N N    . GLU A 1 43 ? -4.402  -6.888  8.485   1.00 0.00 ? 43 GLU A N    1  
ATOM 560   C CA   . GLU A 1 43 ? -5.657  -6.370  9.009   1.00 0.00 ? 43 GLU A CA   1  
ATOM 561   C C    . GLU A 1 43 ? -5.926  -4.992  8.430   1.00 0.00 ? 43 GLU A C    1  
ATOM 562   O O    . GLU A 1 43 ? -5.020  -4.168  8.332   1.00 0.00 ? 43 GLU A O    1  
ATOM 563   C CB   . GLU A 1 43 ? -5.622  -6.299  10.532  1.00 0.00 ? 43 GLU A CB   1  
ATOM 564   C CG   . GLU A 1 43 ? -6.654  -5.350  11.121  1.00 0.00 ? 43 GLU A CG   1  
ATOM 565   C CD   . GLU A 1 43 ? -6.481  -5.153  12.614  1.00 0.00 ? 43 GLU A CD   1  
ATOM 566   O OE1  . GLU A 1 43 ? -5.358  -5.369  13.116  1.00 0.00 ? 43 GLU A OE1  1  
ATOM 567   O OE2  . GLU A 1 43 ? -7.470  -4.784  13.283  1.00 0.00 ? 43 GLU A OE2  1  
ATOM 568   H H    . GLU A 1 43 ? -3.571  -6.421  8.700   1.00 0.00 ? 43 GLU A H    1  
ATOM 569   H HA   . GLU A 1 43 ? -6.448  -7.039  8.703   1.00 0.00 ? 43 GLU A HA   1  
ATOM 570   H HB2  . GLU A 1 43 ? -5.803  -7.285  10.929  1.00 0.00 ? 43 GLU A HB2  1  
ATOM 571   H HB3  . GLU A 1 43 ? -4.643  -5.968  10.840  1.00 0.00 ? 43 GLU A HB3  1  
ATOM 572   H HG2  . GLU A 1 43 ? -6.561  -4.391  10.635  1.00 0.00 ? 43 GLU A HG2  1  
ATOM 573   H HG3  . GLU A 1 43 ? -7.639  -5.753  10.937  1.00 0.00 ? 43 GLU A HG3  1  
ATOM 574   N N    . GLY A 1 44 ? -7.171  -4.772  8.029   1.00 0.00 ? 44 GLY A N    1  
ATOM 575   C CA   . GLY A 1 44 ? -7.581  -3.515  7.428   1.00 0.00 ? 44 GLY A CA   1  
ATOM 576   C C    . GLY A 1 44 ? -6.661  -2.350  7.692   1.00 0.00 ? 44 GLY A C    1  
ATOM 577   O O    . GLY A 1 44 ? -6.960  -1.496  8.527   1.00 0.00 ? 44 GLY A O    1  
ATOM 578   H H    . GLY A 1 44 ? -7.830  -5.489  8.127   1.00 0.00 ? 44 GLY A H    1  
ATOM 579   H HA2  . GLY A 1 44 ? -7.636  -3.658  6.363   1.00 0.00 ? 44 GLY A HA2  1  
ATOM 580   H HA3  . GLY A 1 44 ? -8.565  -3.265  7.793   1.00 0.00 ? 44 GLY A HA3  1  
ATOM 581   N N    . THR A 1 45 ? -5.551  -2.289  6.966   1.00 0.00 ? 45 THR A N    1  
ATOM 582   C CA   . THR A 1 45 ? -4.624  -1.185  7.137   1.00 0.00 ? 45 THR A CA   1  
ATOM 583   C C    . THR A 1 45 ? -4.840  -0.140  6.047   1.00 0.00 ? 45 THR A C    1  
ATOM 584   O O    . THR A 1 45 ? -5.448  0.902   6.285   1.00 0.00 ? 45 THR A O    1  
ATOM 585   C CB   . THR A 1 45 ? -3.187  -1.690  7.142   1.00 0.00 ? 45 THR A CB   1  
ATOM 586   O OG1  . THR A 1 45 ? -3.090  -2.911  7.854   1.00 0.00 ? 45 THR A OG1  1  
ATOM 587   C CG2  . THR A 1 45 ? -2.220  -0.714  7.767   1.00 0.00 ? 45 THR A CG2  1  
ATOM 588   H H    . THR A 1 45 ? -5.357  -2.997  6.295   1.00 0.00 ? 45 THR A H    1  
ATOM 589   H HA   . THR A 1 45 ? -4.833  -0.728  8.082   1.00 0.00 ? 45 THR A HA   1  
ATOM 590   H HB   . THR A 1 45 ? -2.876  -1.866  6.129   1.00 0.00 ? 45 THR A HB   1  
ATOM 591   H HG1  . THR A 1 45 ? -3.815  -3.488  7.599   1.00 0.00 ? 45 THR A HG1  1  
ATOM 592   H HG21 . THR A 1 45 ? -2.476  0.289   7.460   1.00 0.00 ? 45 THR A HG21 1  
ATOM 593   H HG22 . THR A 1 45 ? -1.217  -0.946  7.445   1.00 0.00 ? 45 THR A HG22 1  
ATOM 594   H HG23 . THR A 1 45 ? -2.281  -0.788  8.842   1.00 0.00 ? 45 THR A HG23 1  
ATOM 595   N N    . ILE A 1 46 ? -4.360  -0.440  4.853   1.00 0.00 ? 46 ILE A N    1  
ATOM 596   C CA   . ILE A 1 46 ? -4.511  0.451   3.708   1.00 0.00 ? 46 ILE A CA   1  
ATOM 597   C C    . ILE A 1 46 ? -4.081  -0.241  2.408   1.00 0.00 ? 46 ILE A C    1  
ATOM 598   O O    . ILE A 1 46 ? -2.893  -0.323  2.097   1.00 0.00 ? 46 ILE A O    1  
ATOM 599   C CB   . ILE A 1 46 ? -3.731  1.786   3.912   1.00 0.00 ? 46 ILE A CB   1  
ATOM 600   C CG1  . ILE A 1 46 ? -4.713  2.922   4.208   1.00 0.00 ? 46 ILE A CG1  1  
ATOM 601   C CG2  . ILE A 1 46 ? -2.870  2.147   2.703   1.00 0.00 ? 46 ILE A CG2  1  
ATOM 602   C CD1  . ILE A 1 46 ? -4.796  3.290   5.673   1.00 0.00 ? 46 ILE A CD1  1  
ATOM 603   H H    . ILE A 1 46 ? -3.908  -1.287  4.738   1.00 0.00 ? 46 ILE A H    1  
ATOM 604   H HA   . ILE A 1 46 ? -5.559  0.691   3.630   1.00 0.00 ? 46 ILE A HA   1  
ATOM 605   H HB   . ILE A 1 46 ? -3.074  1.666   4.757   1.00 0.00 ? 46 ILE A HB   1  
ATOM 606   H HG12 . ILE A 1 46 ? -4.409  3.803   3.664   1.00 0.00 ? 46 ILE A HG12 1  
ATOM 607   H HG13 . ILE A 1 46 ? -5.700  2.628   3.883   1.00 0.00 ? 46 ILE A HG13 1  
ATOM 608   H HG21 . ILE A 1 46 ? -3.407  1.913   1.796   1.00 0.00 ? 46 ILE A HG21 1  
ATOM 609   H HG22 . ILE A 1 46 ? -1.951  1.580   2.734   1.00 0.00 ? 46 ILE A HG22 1  
ATOM 610   H HG23 . ILE A 1 46 ? -2.643  3.203   2.725   1.00 0.00 ? 46 ILE A HG23 1  
ATOM 611   H HD11 . ILE A 1 46 ? -5.811  3.159   6.020   1.00 0.00 ? 46 ILE A HD11 1  
ATOM 612   H HD12 . ILE A 1 46 ? -4.502  4.321   5.803   1.00 0.00 ? 46 ILE A HD12 1  
ATOM 613   H HD13 . ILE A 1 46 ? -4.136  2.652   6.242   1.00 0.00 ? 46 ILE A HD13 1  
ATOM 614   N N    . CYS A 1 47 ? -5.063  -0.721  1.647   1.00 0.00 ? 47 CYS A N    1  
ATOM 615   C CA   . CYS A 1 47 ? -4.793  -1.382  0.373   1.00 0.00 ? 47 CYS A CA   1  
ATOM 616   C C    . CYS A 1 47 ? -4.888  -0.371  -0.772  1.00 0.00 ? 47 CYS A C    1  
ATOM 617   O O    . CYS A 1 47 ? -4.719  -0.726  -1.938  1.00 0.00 ? 47 CYS A O    1  
ATOM 618   C CB   . CYS A 1 47 ? -5.772  -2.552  0.168   1.00 0.00 ? 47 CYS A CB   1  
ATOM 619   S SG   . CYS A 1 47 ? -6.399  -2.774  -1.536  1.00 0.00 ? 47 CYS A SG   1  
ATOM 620   H H    . CYS A 1 47 ? -5.992  -0.616  1.942   1.00 0.00 ? 47 CYS A H    1  
ATOM 621   H HA   . CYS A 1 47 ? -3.786  -1.769  0.410   1.00 0.00 ? 47 CYS A HA   1  
ATOM 622   H HB2  . CYS A 1 47 ? -5.280  -3.469  0.451   1.00 0.00 ? 47 CYS A HB2  1  
ATOM 623   H HB3  . CYS A 1 47 ? -6.626  -2.400  0.811   1.00 0.00 ? 47 CYS A HB3  1  
ATOM 624   N N    . ARG A 1 48 ? -5.152  0.892   -0.411  1.00 0.00 ? 48 ARG A N    1  
ATOM 625   C CA   . ARG A 1 48 ? -5.283  1.995   -1.373  1.00 0.00 ? 48 ARG A CA   1  
ATOM 626   C C    . ARG A 1 48 ? -4.921  1.568   -2.791  1.00 0.00 ? 48 ARG A C    1  
ATOM 627   O O    . ARG A 1 48 ? -3.751  1.570   -3.175  1.00 0.00 ? 48 ARG A O    1  
ATOM 628   C CB   . ARG A 1 48 ? -4.380  3.156   -0.955  1.00 0.00 ? 48 ARG A CB   1  
ATOM 629   C CG   . ARG A 1 48 ? -4.545  3.573   0.498   1.00 0.00 ? 48 ARG A CG   1  
ATOM 630   C CD   . ARG A 1 48 ? -5.154  4.960   0.616   1.00 0.00 ? 48 ARG A CD   1  
ATOM 631   N NE   . ARG A 1 48 ? -6.279  4.988   1.545   1.00 0.00 ? 48 ARG A NE   1  
ATOM 632   C CZ   . ARG A 1 48 ? -7.254  5.890   1.495   1.00 0.00 ? 48 ARG A CZ   1  
ATOM 633   N NH1  . ARG A 1 48 ? -7.245  6.826   0.556   1.00 0.00 ? 48 ARG A NH1  1  
ATOM 634   N NH2  . ARG A 1 48 ? -8.239  5.855   2.381   1.00 0.00 ? 48 ARG A NH2  1  
ATOM 635   H H    . ARG A 1 48 ? -5.271  1.090   0.541   1.00 0.00 ? 48 ARG A H    1  
ATOM 636   H HA   . ARG A 1 48 ? -6.308  2.328   -1.360  1.00 0.00 ? 48 ARG A HA   1  
ATOM 637   H HB2  . ARG A 1 48 ? -3.351  2.863   -1.106  1.00 0.00 ? 48 ARG A HB2  1  
ATOM 638   H HB3  . ARG A 1 48 ? -4.598  4.007   -1.579  1.00 0.00 ? 48 ARG A HB3  1  
ATOM 639   H HG2  . ARG A 1 48 ? -5.189  2.866   0.997   1.00 0.00 ? 48 ARG A HG2  1  
ATOM 640   H HG3  . ARG A 1 48 ? -3.574  3.574   0.973   1.00 0.00 ? 48 ARG A HG3  1  
ATOM 641   H HD2  . ARG A 1 48 ? -4.394  5.643   0.967   1.00 0.00 ? 48 ARG A HD2  1  
ATOM 642   H HD3  . ARG A 1 48 ? -5.495  5.274   -0.360  1.00 0.00 ? 48 ARG A HD3  1  
ATOM 643   H HE   . ARG A 1 48 ? -6.308  4.301   2.244   1.00 0.00 ? 48 ARG A HE   1  
ATOM 644   H HH11 . ARG A 1 48 ? -6.505  6.854   -0.116  1.00 0.00 ? 48 ARG A HH11 1  
ATOM 645   H HH12 . ARG A 1 48 ? -7.980  7.504   0.519   1.00 0.00 ? 48 ARG A HH12 1  
ATOM 646   H HH21 . ARG A 1 48 ? -8.250  5.149   3.090   1.00 0.00 ? 48 ARG A HH21 1  
ATOM 647   H HH22 . ARG A 1 48 ? -8.971  6.535   2.342   1.00 0.00 ? 48 ARG A HH22 1  
ATOM 648   N N    . ARG A 1 49 ? -5.936  1.186   -3.560  1.00 0.00 ? 49 ARG A N    1  
ATOM 649   C CA   . ARG A 1 49 ? -5.730  0.736   -4.932  1.00 0.00 ? 49 ARG A CA   1  
ATOM 650   C C    . ARG A 1 49 ? -5.355  1.888   -5.858  1.00 0.00 ? 49 ARG A C    1  
ATOM 651   O O    . ARG A 1 49 ? -4.825  1.670   -6.948  1.00 0.00 ? 49 ARG A O    1  
ATOM 652   C CB   . ARG A 1 49 ? -6.986  0.034   -5.446  1.00 0.00 ? 49 ARG A CB   1  
ATOM 653   C CG   . ARG A 1 49 ? -7.732  -0.727  -4.364  1.00 0.00 ? 49 ARG A CG   1  
ATOM 654   C CD   . ARG A 1 49 ? -8.125  -2.120  -4.831  1.00 0.00 ? 49 ARG A CD   1  
ATOM 655   N NE   . ARG A 1 49 ? -8.762  -2.098  -6.145  1.00 0.00 ? 49 ARG A NE   1  
ATOM 656   C CZ   . ARG A 1 49 ? -10.063 -1.895  -6.330  1.00 0.00 ? 49 ARG A CZ   1  
ATOM 657   N NH1  . ARG A 1 49 ? -10.859 -1.695  -5.288  1.00 0.00 ? 49 ARG A NH1  1  
ATOM 658   N NH2  . ARG A 1 49 ? -10.568 -1.892  -7.556  1.00 0.00 ? 49 ARG A NH2  1  
ATOM 659   H H    . ARG A 1 49 ? -6.848  1.195   -3.189  1.00 0.00 ? 49 ARG A H    1  
ATOM 660   H HA   . ARG A 1 49 ? -4.919  0.031   -4.922  1.00 0.00 ? 49 ARG A HA   1  
ATOM 661   H HB2  . ARG A 1 49 ? -7.653  0.773   -5.865  1.00 0.00 ? 49 ARG A HB2  1  
ATOM 662   H HB3  . ARG A 1 49 ? -6.704  -0.665  -6.220  1.00 0.00 ? 49 ARG A HB3  1  
ATOM 663   H HG2  . ARG A 1 49 ? -7.094  -0.816  -3.497  1.00 0.00 ? 49 ARG A HG2  1  
ATOM 664   H HG3  . ARG A 1 49 ? -8.624  -0.178  -4.102  1.00 0.00 ? 49 ARG A HG3  1  
ATOM 665   H HD2  . ARG A 1 49 ? -7.237  -2.732  -4.884  1.00 0.00 ? 49 ARG A HD2  1  
ATOM 666   H HD3  . ARG A 1 49 ? -8.813  -2.545  -4.115  1.00 0.00 ? 49 ARG A HD3  1  
ATOM 667   H HE   . ARG A 1 49 ? -8.192  -2.243  -6.929  1.00 0.00 ? 49 ARG A HE   1  
ATOM 668   H HH11 . ARG A 1 49 ? -10.482 -1.696  -4.362  1.00 0.00 ? 49 ARG A HH11 1  
ATOM 669   H HH12 . ARG A 1 49 ? -11.838 -1.542  -5.429  1.00 0.00 ? 49 ARG A HH12 1  
ATOM 670   H HH21 . ARG A 1 49 ? -9.970  -2.043  -8.343  1.00 0.00 ? 49 ARG A HH21 1  
ATOM 671   H HH22 . ARG A 1 49 ? -11.547 -1.740  -7.693  1.00 0.00 ? 49 ARG A HH22 1  
ATOM 672   N N    . ALA A 1 50 ? -5.627  3.108   -5.423  1.00 0.00 ? 50 ALA A N    1  
ATOM 673   C CA   . ALA A 1 50 ? -5.307  4.287   -6.223  1.00 0.00 ? 50 ALA A CA   1  
ATOM 674   C C    . ALA A 1 50 ? -5.500  5.574   -5.428  1.00 0.00 ? 50 ALA A C    1  
ATOM 675   O O    . ALA A 1 50 ? -5.758  5.541   -4.224  1.00 0.00 ? 50 ALA A O    1  
ATOM 676   C CB   . ALA A 1 50 ? -6.153  4.312   -7.487  1.00 0.00 ? 50 ALA A CB   1  
ATOM 677   H H    . ALA A 1 50 ? -6.045  3.219   -4.545  1.00 0.00 ? 50 ALA A H    1  
ATOM 678   H HA   . ALA A 1 50 ? -4.270  4.214   -6.517  1.00 0.00 ? 50 ALA A HA   1  
ATOM 679   H HB1  . ALA A 1 50 ? -6.653  5.266   -7.567  1.00 0.00 ? 50 ALA A HB1  1  
ATOM 680   H HB2  . ALA A 1 50 ? -6.888  3.523   -7.445  1.00 0.00 ? 50 ALA A HB2  1  
ATOM 681   H HB3  . ALA A 1 50 ? -5.518  4.166   -8.348  1.00 0.00 ? 50 ALA A HB3  1  
ATOM 682   N N    . ARG A 1 51 ? -5.373  6.707   -6.112  1.00 0.00 ? 51 ARG A N    1  
ATOM 683   C CA   . ARG A 1 51 ? -5.533  8.010   -5.477  1.00 0.00 ? 51 ARG A CA   1  
ATOM 684   C C    . ARG A 1 51 ? -6.287  8.974   -6.388  1.00 0.00 ? 51 ARG A C    1  
ATOM 685   O O    . ARG A 1 51 ? -7.507  9.108   -6.290  1.00 0.00 ? 51 ARG A O    1  
ATOM 686   C CB   . ARG A 1 51 ? -4.166  8.597   -5.118  1.00 0.00 ? 51 ARG A CB   1  
ATOM 687   C CG   . ARG A 1 51 ? -3.901  8.650   -3.623  1.00 0.00 ? 51 ARG A CG   1  
ATOM 688   C CD   . ARG A 1 51 ? -3.790  10.084  -3.129  1.00 0.00 ? 51 ARG A CD   1  
ATOM 689   N NE   . ARG A 1 51 ? -4.765  10.960  -3.770  1.00 0.00 ? 51 ARG A NE   1  
ATOM 690   C CZ   . ARG A 1 51 ? -6.050  11.005  -3.432  1.00 0.00 ? 51 ARG A CZ   1  
ATOM 691   N NH1  . ARG A 1 51 ? -6.510  10.226  -2.463  1.00 0.00 ? 51 ARG A NH1  1  
ATOM 692   N NH2  . ARG A 1 51 ? -6.875  11.829  -4.063  1.00 0.00 ? 51 ARG A NH2  1  
ATOM 693   H H    . ARG A 1 51 ? -5.167  6.666   -7.070  1.00 0.00 ? 51 ARG A H    1  
ATOM 694   H HA   . ARG A 1 51 ? -6.103  7.870   -4.571  1.00 0.00 ? 51 ARG A HA   1  
ATOM 695   H HB2  . ARG A 1 51 ? -3.397  7.994   -5.577  1.00 0.00 ? 51 ARG A HB2  1  
ATOM 696   H HB3  . ARG A 1 51 ? -4.105  9.602   -5.508  1.00 0.00 ? 51 ARG A HB3  1  
ATOM 697   H HG2  . ARG A 1 51 ? -4.714  8.164   -3.105  1.00 0.00 ? 51 ARG A HG2  1  
ATOM 698   H HG3  . ARG A 1 51 ? -2.977  8.133   -3.412  1.00 0.00 ? 51 ARG A HG3  1  
ATOM 699   H HD2  . ARG A 1 51 ? -3.955  10.097  -2.062  1.00 0.00 ? 51 ARG A HD2  1  
ATOM 700   H HD3  . ARG A 1 51 ? -2.796  10.448  -3.343  1.00 0.00 ? 51 ARG A HD3  1  
ATOM 701   H HE   . ARG A 1 51 ? -4.446  11.545  -4.489  1.00 0.00 ? 51 ARG A HE   1  
ATOM 702   H HH11 . ARG A 1 51 ? -5.890  9.603   -1.985  1.00 0.00 ? 51 ARG A HH11 1  
ATOM 703   H HH12 . ARG A 1 51 ? -7.477  10.260  -2.210  1.00 0.00 ? 51 ARG A HH12 1  
ATOM 704   H HH21 . ARG A 1 51 ? -6.531  12.418  -4.794  1.00 0.00 ? 51 ARG A HH21 1  
ATOM 705   H HH22 . ARG A 1 51 ? -7.841  11.862  -3.807  1.00 0.00 ? 51 ARG A HH22 1  
ATOM 706   N N    . GLY A 1 52 ? -5.554  9.642   -7.274  1.00 0.00 ? 52 GLY A N    1  
ATOM 707   C CA   . GLY A 1 52 ? -6.170  10.585  -8.190  1.00 0.00 ? 52 GLY A CA   1  
ATOM 708   C C    . GLY A 1 52 ? -7.332  11.329  -7.562  1.00 0.00 ? 52 GLY A C    1  
ATOM 709   O O    . GLY A 1 52 ? -7.134  12.228  -6.745  1.00 0.00 ? 52 GLY A O    1  
ATOM 710   H H    . GLY A 1 52 ? -4.586  9.493   -7.306  1.00 0.00 ? 52 GLY A H    1  
ATOM 711   H HA2  . GLY A 1 52 ? -5.426  11.302  -8.505  1.00 0.00 ? 52 GLY A HA2  1  
ATOM 712   H HA3  . GLY A 1 52 ? -6.527  10.048  -9.056  1.00 0.00 ? 52 GLY A HA3  1  
ATOM 713   N N    . ASP A 1 53 ? -8.548  10.951  -7.942  1.00 0.00 ? 53 ASP A N    1  
ATOM 714   C CA   . ASP A 1 53 ? -9.747  11.585  -7.410  1.00 0.00 ? 53 ASP A CA   1  
ATOM 715   C C    . ASP A 1 53 ? -10.460 10.657  -6.432  1.00 0.00 ? 53 ASP A C    1  
ATOM 716   O O    . ASP A 1 53 ? -11.291 11.095  -5.636  1.00 0.00 ? 53 ASP A O    1  
ATOM 717   C CB   . ASP A 1 53 ? -10.694 11.970  -8.547  1.00 0.00 ? 53 ASP A CB   1  
ATOM 718   C CG   . ASP A 1 53 ? -10.375 13.333  -9.129  1.00 0.00 ? 53 ASP A CG   1  
ATOM 719   O OD1  . ASP A 1 53 ? -9.242  13.517  -9.623  1.00 0.00 ? 53 ASP A OD1  1  
ATOM 720   O OD2  . ASP A 1 53 ? -11.257 14.216  -9.091  1.00 0.00 ? 53 ASP A OD2  1  
ATOM 721   H H    . ASP A 1 53 ? -8.640  10.226  -8.596  1.00 0.00 ? 53 ASP A H    1  
ATOM 722   H HA   . ASP A 1 53 ? -9.445  12.479  -6.885  1.00 0.00 ? 53 ASP A HA   1  
ATOM 723   H HB2  . ASP A 1 53 ? -10.617 11.236  -9.336  1.00 0.00 ? 53 ASP A HB2  1  
ATOM 724   H HB3  . ASP A 1 53 ? -11.708 11.986  -8.174  1.00 0.00 ? 53 ASP A HB3  1  
ATOM 725   N N    . ASP A 1 54 ? -10.128 9.372   -6.498  1.00 0.00 ? 54 ASP A N    1  
ATOM 726   C CA   . ASP A 1 54 ? -10.733 8.377   -5.622  1.00 0.00 ? 54 ASP A CA   1  
ATOM 727   C C    . ASP A 1 54 ? -9.886  7.108   -5.579  1.00 0.00 ? 54 ASP A C    1  
ATOM 728   O O    . ASP A 1 54 ? -8.667  7.161   -5.741  1.00 0.00 ? 54 ASP A O    1  
ATOM 729   C CB   . ASP A 1 54 ? -12.150 8.047   -6.097  1.00 0.00 ? 54 ASP A CB   1  
ATOM 730   C CG   . ASP A 1 54 ? -12.904 9.276   -6.567  1.00 0.00 ? 54 ASP A CG   1  
ATOM 731   O OD1  . ASP A 1 54 ? -13.434 10.012  -5.708  1.00 0.00 ? 54 ASP A OD1  1  
ATOM 732   O OD2  . ASP A 1 54 ? -12.964 9.503   -7.793  1.00 0.00 ? 54 ASP A OD2  1  
ATOM 733   H H    . ASP A 1 54 ? -9.458  9.086   -7.155  1.00 0.00 ? 54 ASP A H    1  
ATOM 734   H HA   . ASP A 1 54 ? -10.784 8.797   -4.628  1.00 0.00 ? 54 ASP A HA   1  
ATOM 735   H HB2  . ASP A 1 54 ? -12.094 7.348   -6.918  1.00 0.00 ? 54 ASP A HB2  1  
ATOM 736   H HB3  . ASP A 1 54 ? -12.701 7.598   -5.284  1.00 0.00 ? 54 ASP A HB3  1  
ATOM 737   N N    . LEU A 1 55 ? -10.536 5.969   -5.360  1.00 0.00 ? 55 LEU A N    1  
ATOM 738   C CA   . LEU A 1 55 ? -9.840  4.689   -5.300  1.00 0.00 ? 55 LEU A CA   1  
ATOM 739   C C    . LEU A 1 55 ? -9.075  4.540   -3.988  1.00 0.00 ? 55 LEU A C    1  
ATOM 740   O O    . LEU A 1 55 ? -8.223  5.362   -3.654  1.00 0.00 ? 55 LEU A O    1  
ATOM 741   C CB   . LEU A 1 55 ? -8.879  4.546   -6.482  1.00 0.00 ? 55 LEU A CB   1  
ATOM 742   C CG   . LEU A 1 55 ? -9.502  4.793   -7.857  1.00 0.00 ? 55 LEU A CG   1  
ATOM 743   C CD1  . LEU A 1 55 ? -10.950 4.330   -7.878  1.00 0.00 ? 55 LEU A CD1  1  
ATOM 744   C CD2  . LEU A 1 55 ? -9.406  6.265   -8.229  1.00 0.00 ? 55 LEU A CD2  1  
ATOM 745   H H    . LEU A 1 55 ? -11.508 5.988   -5.238  1.00 0.00 ? 55 LEU A H    1  
ATOM 746   H HA   . LEU A 1 55 ? -10.582 3.908   -5.357  1.00 0.00 ? 55 LEU A HA   1  
ATOM 747   H HB2  . LEU A 1 55 ? -8.067  5.244   -6.345  1.00 0.00 ? 55 LEU A HB2  1  
ATOM 748   H HB3  . LEU A 1 55 ? -8.477  3.544   -6.470  1.00 0.00 ? 55 LEU A HB3  1  
ATOM 749   H HG   . LEU A 1 55 ? -8.960  4.224   -8.598  1.00 0.00 ? 55 LEU A HG   1  
ATOM 750   H HD11 . LEU A 1 55 ? -11.597 5.159   -7.628  1.00 0.00 ? 55 LEU A HD11 1  
ATOM 751   H HD12 . LEU A 1 55 ? -11.086 3.538   -7.156  1.00 0.00 ? 55 LEU A HD12 1  
ATOM 752   H HD13 . LEU A 1 55 ? -11.198 3.965   -8.863  1.00 0.00 ? 55 LEU A HD13 1  
ATOM 753   H HD21 . LEU A 1 55 ? -8.518  6.692   -7.785  1.00 0.00 ? 55 LEU A HD21 1  
ATOM 754   H HD22 . LEU A 1 55 ? -10.278 6.787   -7.863  1.00 0.00 ? 55 LEU A HD22 1  
ATOM 755   H HD23 . LEU A 1 55 ? -9.353  6.362   -9.304  1.00 0.00 ? 55 LEU A HD23 1  
ATOM 756   N N    . ASP A 1 56 ? -9.392  3.481   -3.253  1.00 0.00 ? 56 ASP A N    1  
ATOM 757   C CA   . ASP A 1 56 ? -8.748  3.203   -1.975  1.00 0.00 ? 56 ASP A CA   1  
ATOM 758   C C    . ASP A 1 56 ? -9.002  1.762   -1.562  1.00 0.00 ? 56 ASP A C    1  
ATOM 759   O O    . ASP A 1 56 ? -9.352  0.925   -2.393  1.00 0.00 ? 56 ASP A O    1  
ATOM 760   C CB   . ASP A 1 56 ? -9.274  4.152   -0.895  1.00 0.00 ? 56 ASP A CB   1  
ATOM 761   C CG   . ASP A 1 56 ? -9.445  5.570   -1.402  1.00 0.00 ? 56 ASP A CG   1  
ATOM 762   O OD1  . ASP A 1 56 ? -8.429  6.289   -1.509  1.00 0.00 ? 56 ASP A OD1  1  
ATOM 763   O OD2  . ASP A 1 56 ? -10.594 5.963   -1.693  1.00 0.00 ? 56 ASP A OD2  1  
ATOM 764   H H    . ASP A 1 56 ? -10.081 2.866   -3.580  1.00 0.00 ? 56 ASP A H    1  
ATOM 765   H HA   . ASP A 1 56 ? -7.687  3.350   -2.088  1.00 0.00 ? 56 ASP A HA   1  
ATOM 766   H HB2  . ASP A 1 56 ? -10.233 3.797   -0.549  1.00 0.00 ? 56 ASP A HB2  1  
ATOM 767   H HB3  . ASP A 1 56 ? -8.580  4.166   -0.068  1.00 0.00 ? 56 ASP A HB3  1  
ATOM 768   N N    . ASP A 1 57 ? -8.833  1.487   -0.275  1.00 0.00 ? 57 ASP A N    1  
ATOM 769   C CA   . ASP A 1 57 ? -9.058  0.147   0.263   1.00 0.00 ? 57 ASP A CA   1  
ATOM 770   C C    . ASP A 1 57 ? -8.272  -0.081  1.550   1.00 0.00 ? 57 ASP A C    1  
ATOM 771   O O    . ASP A 1 57 ? -7.461  0.752   1.957   1.00 0.00 ? 57 ASP A O    1  
ATOM 772   C CB   . ASP A 1 57 ? -8.684  -0.924  -0.760  1.00 0.00 ? 57 ASP A CB   1  
ATOM 773   C CG   . ASP A 1 57 ? -9.884  -1.428  -1.538  1.00 0.00 ? 57 ASP A CG   1  
ATOM 774   O OD1  . ASP A 1 57 ? -10.832 -1.936  -0.905  1.00 0.00 ? 57 ASP A OD1  1  
ATOM 775   O OD2  . ASP A 1 57 ? -9.875  -1.315  -2.782  1.00 0.00 ? 57 ASP A OD2  1  
ATOM 776   H H    . ASP A 1 57 ? -8.557  2.207   0.328   1.00 0.00 ? 57 ASP A H    1  
ATOM 777   H HA   . ASP A 1 57 ? -10.110 0.061   0.483   1.00 0.00 ? 57 ASP A HA   1  
ATOM 778   H HB2  . ASP A 1 57 ? -7.968  -0.516  -1.458  1.00 0.00 ? 57 ASP A HB2  1  
ATOM 779   H HB3  . ASP A 1 57 ? -8.241  -1.759  -0.239  1.00 0.00 ? 57 ASP A HB3  1  
ATOM 780   N N    . TYR A 1 58 ? -8.523  -1.226  2.182   1.00 0.00 ? 58 TYR A N    1  
ATOM 781   C CA   . TYR A 1 58 ? -7.852  -1.591  3.425   1.00 0.00 ? 58 TYR A CA   1  
ATOM 782   C C    . TYR A 1 58 ? -6.977  -2.827  3.235   1.00 0.00 ? 58 TYR A C    1  
ATOM 783   O O    . TYR A 1 58 ? -7.226  -3.651  2.355   1.00 0.00 ? 58 TYR A O    1  
ATOM 784   C CB   . TYR A 1 58 ? -8.878  -1.837  4.528   1.00 0.00 ? 58 TYR A CB   1  
ATOM 785   C CG   . TYR A 1 58 ? -9.385  -0.569  5.176   1.00 0.00 ? 58 TYR A CG   1  
ATOM 786   C CD1  . TYR A 1 58 ? -9.972  0.433   4.415   1.00 0.00 ? 58 TYR A CD1  1  
ATOM 787   C CD2  . TYR A 1 58 ? -9.274  -0.374  6.547   1.00 0.00 ? 58 TYR A CD2  1  
ATOM 788   C CE1  . TYR A 1 58 ? -10.435 1.595   5.002   1.00 0.00 ? 58 TYR A CE1  1  
ATOM 789   C CE2  . TYR A 1 58 ? -9.736  0.785   7.141   1.00 0.00 ? 58 TYR A CE2  1  
ATOM 790   C CZ   . TYR A 1 58 ? -10.315 1.766   6.365   1.00 0.00 ? 58 TYR A CZ   1  
ATOM 791   O OH   . TYR A 1 58 ? -10.775 2.922   6.952   1.00 0.00 ? 58 TYR A OH   1  
ATOM 792   H H    . TYR A 1 58 ? -9.178  -1.843  1.799   1.00 0.00 ? 58 TYR A H    1  
ATOM 793   H HA   . TYR A 1 58 ? -7.222  -0.763  3.714   1.00 0.00 ? 58 TYR A HA   1  
ATOM 794   H HB2  . TYR A 1 58 ? -9.727  -2.359  4.111   1.00 0.00 ? 58 TYR A HB2  1  
ATOM 795   H HB3  . TYR A 1 58 ? -8.431  -2.446  5.295   1.00 0.00 ? 58 TYR A HB3  1  
ATOM 796   H HD1  . TYR A 1 58 ? -10.064 0.295   3.349   1.00 0.00 ? 58 TYR A HD1  1  
ATOM 797   H HD2  . TYR A 1 58 ? -8.819  -1.144  7.153   1.00 0.00 ? 58 TYR A HD2  1  
ATOM 798   H HE1  . TYR A 1 58 ? -10.889 2.363   4.393   1.00 0.00 ? 58 TYR A HE1  1  
ATOM 799   H HE2  . TYR A 1 58 ? -9.641  0.919   8.209   1.00 0.00 ? 58 TYR A HE2  1  
ATOM 800   H HH   . TYR A 1 58 ? -11.431 2.704   7.619   1.00 0.00 ? 58 TYR A HH   1  
ATOM 801   N N    . CYS A 1 59 ? -5.935  -2.934  4.053   1.00 0.00 ? 59 CYS A N    1  
ATOM 802   C CA   . CYS A 1 59 ? -4.995  -4.049  3.962   1.00 0.00 ? 59 CYS A CA   1  
ATOM 803   C C    . CYS A 1 59 ? -5.464  -5.303  4.697   1.00 0.00 ? 59 CYS A C    1  
ATOM 804   O O    . CYS A 1 59 ? -5.706  -5.286  5.902   1.00 0.00 ? 59 CYS A O    1  
ATOM 805   C CB   . CYS A 1 59 ? -3.638  -3.633  4.503   1.00 0.00 ? 59 CYS A CB   1  
ATOM 806   S SG   . CYS A 1 59 ? -2.580  -2.775  3.287   1.00 0.00 ? 59 CYS A SG   1  
ATOM 807   H H    . CYS A 1 59 ? -5.780  -2.232  4.717   1.00 0.00 ? 59 CYS A H    1  
ATOM 808   H HA   . CYS A 1 59 ? -4.886  -4.284  2.925   1.00 0.00 ? 59 CYS A HA   1  
ATOM 809   H HB2  . CYS A 1 59 ? -3.794  -2.978  5.330   1.00 0.00 ? 59 CYS A HB2  1  
ATOM 810   H HB3  . CYS A 1 59 ? -3.110  -4.509  4.846   1.00 0.00 ? 59 CYS A HB3  1  
ATOM 811   N N    . ASN A 1 60 ? -5.553  -6.397  3.948   1.00 0.00 ? 60 ASN A N    1  
ATOM 812   C CA   . ASN A 1 60 ? -5.948  -7.700  4.470   1.00 0.00 ? 60 ASN A CA   1  
ATOM 813   C C    . ASN A 1 60 ? -5.331  -8.773  3.588   1.00 0.00 ? 60 ASN A C    1  
ATOM 814   O O    . ASN A 1 60 ? -5.427  -8.692  2.364   1.00 0.00 ? 60 ASN A O    1  
ATOM 815   C CB   . ASN A 1 60 ? -7.468  -7.847  4.492   1.00 0.00 ? 60 ASN A CB   1  
ATOM 816   C CG   . ASN A 1 60 ? -8.095  -7.130  5.667   1.00 0.00 ? 60 ASN A CG   1  
ATOM 817   O OD1  . ASN A 1 60 ? -8.597  -7.760  6.597   1.00 0.00 ? 60 ASN A OD1  1  
ATOM 818   N ND2  . ASN A 1 60 ? -8.071  -5.805  5.630   1.00 0.00 ? 60 ASN A ND2  1  
ATOM 819   H H    . ASN A 1 60 ? -5.318  -6.332  3.004   1.00 0.00 ? 60 ASN A H    1  
ATOM 820   H HA   . ASN A 1 60 ? -5.559  -7.795  5.472   1.00 0.00 ? 60 ASN A HA   1  
ATOM 821   H HB2  . ASN A 1 60 ? -7.877  -7.435  3.582   1.00 0.00 ? 60 ASN A HB2  1  
ATOM 822   H HB3  . ASN A 1 60 ? -7.721  -8.895  4.555   1.00 0.00 ? 60 ASN A HB3  1  
ATOM 823   H HD21 . ASN A 1 60 ? -7.660  -5.367  4.858   1.00 0.00 ? 60 ASN A HD21 1  
ATOM 824   H HD22 . ASN A 1 60 ? -8.459  -5.321  6.379   1.00 0.00 ? 60 ASN A HD22 1  
ATOM 825   N N    . GLY A 1 61 ? -4.658  -9.753  4.185   1.00 0.00 ? 61 GLY A N    1  
ATOM 826   C CA   . GLY A 1 61 ? -4.013  -10.767 3.370   1.00 0.00 ? 61 GLY A CA   1  
ATOM 827   C C    . GLY A 1 61 ? -3.303  -10.100 2.214   1.00 0.00 ? 61 GLY A C    1  
ATOM 828   O O    . GLY A 1 61 ? -3.235  -10.631 1.106   1.00 0.00 ? 61 GLY A O    1  
ATOM 829   H H    . GLY A 1 61 ? -4.573  -9.766  5.159   1.00 0.00 ? 61 GLY A H    1  
ATOM 830   H HA2  . GLY A 1 61 ? -3.300  -11.312 3.969   1.00 0.00 ? 61 GLY A HA2  1  
ATOM 831   H HA3  . GLY A 1 61 ? -4.756  -11.448 2.985   1.00 0.00 ? 61 GLY A HA3  1  
ATOM 832   N N    . ILE A 1 62 ? -2.841  -8.882  2.493   1.00 0.00 ? 62 ILE A N    1  
ATOM 833   C CA   . ILE A 1 62 ? -2.184  -8.029  1.508   1.00 0.00 ? 62 ILE A CA   1  
ATOM 834   C C    . ILE A 1 62 ? -0.672  -8.194  1.422   1.00 0.00 ? 62 ILE A C    1  
ATOM 835   O O    . ILE A 1 62 ? 0.057   -7.222  1.619   1.00 0.00 ? 62 ILE A O    1  
ATOM 836   C CB   . ILE A 1 62 ? -2.447  -6.543  1.810   1.00 0.00 ? 62 ILE A CB   1  
ATOM 837   C CG1  . ILE A 1 62 ? -2.467  -6.251  3.319   1.00 0.00 ? 62 ILE A CG1  1  
ATOM 838   C CG2  . ILE A 1 62 ? -3.758  -6.103  1.192   1.00 0.00 ? 62 ILE A CG2  1  
ATOM 839   C CD1  . ILE A 1 62 ? -1.454  -7.001  4.161   1.00 0.00 ? 62 ILE A CD1  1  
ATOM 840   H H    . ILE A 1 62 ? -2.997  -8.527  3.389   1.00 0.00 ? 62 ILE A H    1  
ATOM 841   H HA   . ILE A 1 62 ? -2.613  -8.247  0.543   1.00 0.00 ? 62 ILE A HA   1  
ATOM 842   H HB   . ILE A 1 62 ? -1.657  -5.966  1.354   1.00 0.00 ? 62 ILE A HB   1  
ATOM 843   H HG12 . ILE A 1 62 ? -2.274  -5.208  3.459   1.00 0.00 ? 62 ILE A HG12 1  
ATOM 844   H HG13 . ILE A 1 62 ? -3.445  -6.481  3.705   1.00 0.00 ? 62 ILE A HG13 1  
ATOM 845   H HG21 . ILE A 1 62 ? -3.567  -5.610  0.254   1.00 0.00 ? 62 ILE A HG21 1  
ATOM 846   H HG22 . ILE A 1 62 ? -4.252  -5.419  1.857   1.00 0.00 ? 62 ILE A HG22 1  
ATOM 847   H HG23 . ILE A 1 62 ? -4.387  -6.963  1.030   1.00 0.00 ? 62 ILE A HG23 1  
ATOM 848   H HD11 . ILE A 1 62 ? -0.685  -7.407  3.536   1.00 0.00 ? 62 ILE A HD11 1  
ATOM 849   H HD12 . ILE A 1 62 ? -1.948  -7.799  4.693   1.00 0.00 ? 62 ILE A HD12 1  
ATOM 850   H HD13 . ILE A 1 62 ? -1.013  -6.319  4.873   1.00 0.00 ? 62 ILE A HD13 1  
ATOM 851   N N    . SER A 1 63 ? -0.180  -9.371  1.083   1.00 0.00 ? 63 SER A N    1  
ATOM 852   C CA   . SER A 1 63 ? 1.256   -9.533  0.940   1.00 0.00 ? 63 SER A CA   1  
ATOM 853   C C    . SER A 1 63 ? 1.700   -8.807  -0.322  1.00 0.00 ? 63 SER A C    1  
ATOM 854   O O    . SER A 1 63 ? 2.173   -9.419  -1.280  1.00 0.00 ? 63 SER A O    1  
ATOM 855   C CB   . SER A 1 63 ? 1.637   -11.004 0.874   1.00 0.00 ? 63 SER A CB   1  
ATOM 856   O OG   . SER A 1 63 ? 0.944   -11.669 -0.167  1.00 0.00 ? 63 SER A OG   1  
ATOM 857   H H    . SER A 1 63 ? -0.778  -10.120 0.891   1.00 0.00 ? 63 SER A H    1  
ATOM 858   H HA   . SER A 1 63 ? 1.732   -9.075  1.795   1.00 0.00 ? 63 SER A HA   1  
ATOM 859   H HB2  . SER A 1 63 ? 2.698   -11.083 0.694   1.00 0.00 ? 63 SER A HB2  1  
ATOM 860   H HB3  . SER A 1 63 ? 1.392   -11.472 1.814   1.00 0.00 ? 63 SER A HB3  1  
ATOM 861   H HG   . SER A 1 63 ? 0.469   -12.421 0.194   1.00 0.00 ? 63 SER A HG   1  
ATOM 862   N N    . ALA A 1 64 ? 1.500   -7.493  -0.317  1.00 0.00 ? 64 ALA A N    1  
ATOM 863   C CA   . ALA A 1 64 ? 1.825   -6.653  -1.454  1.00 0.00 ? 64 ALA A CA   1  
ATOM 864   C C    . ALA A 1 64 ? 0.710   -6.728  -2.489  1.00 0.00 ? 64 ALA A C    1  
ATOM 865   O O    . ALA A 1 64 ? 0.922   -6.489  -3.677  1.00 0.00 ? 64 ALA A O    1  
ATOM 866   C CB   . ALA A 1 64 ? 3.164   -7.040  -2.056  1.00 0.00 ? 64 ALA A CB   1  
ATOM 867   H H    . ALA A 1 64 ? 1.097   -7.078  0.471   1.00 0.00 ? 64 ALA A H    1  
ATOM 868   H HA   . ALA A 1 64 ? 1.896   -5.641  -1.098  1.00 0.00 ? 64 ALA A HA   1  
ATOM 869   H HB1  . ALA A 1 64 ? 3.029   -7.316  -3.089  1.00 0.00 ? 64 ALA A HB1  1  
ATOM 870   H HB2  . ALA A 1 64 ? 3.580   -7.869  -1.507  1.00 0.00 ? 64 ALA A HB2  1  
ATOM 871   H HB3  . ALA A 1 64 ? 3.836   -6.200  -1.996  1.00 0.00 ? 64 ALA A HB3  1  
ATOM 872   N N    . GLY A 1 65 ? -0.488  -7.059  -2.008  1.00 0.00 ? 65 GLY A N    1  
ATOM 873   C CA   . GLY A 1 65 ? -1.649  -7.161  -2.872  1.00 0.00 ? 65 GLY A CA   1  
ATOM 874   C C    . GLY A 1 65 ? -2.864  -6.481  -2.268  1.00 0.00 ? 65 GLY A C    1  
ATOM 875   O O    . GLY A 1 65 ? -2.769  -5.353  -1.788  1.00 0.00 ? 65 GLY A O    1  
ATOM 876   H H    . GLY A 1 65 ? -0.584  -7.229  -1.048  1.00 0.00 ? 65 GLY A H    1  
ATOM 877   H HA2  . GLY A 1 65 ? -1.423  -6.699  -3.821  1.00 0.00 ? 65 GLY A HA2  1  
ATOM 878   H HA3  . GLY A 1 65 ? -1.876  -8.204  -3.034  1.00 0.00 ? 65 GLY A HA3  1  
ATOM 879   N N    . CYS A 1 66 ? -4.006  -7.164  -2.284  1.00 0.00 ? 66 CYS A N    1  
ATOM 880   C CA   . CYS A 1 66 ? -5.236  -6.604  -1.727  1.00 0.00 ? 66 CYS A CA   1  
ATOM 881   C C    . CYS A 1 66 ? -6.296  -7.678  -1.501  1.00 0.00 ? 66 CYS A C    1  
ATOM 882   O O    . CYS A 1 66 ? -6.443  -8.601  -2.301  1.00 0.00 ? 66 CYS A O    1  
ATOM 883   C CB   . CYS A 1 66 ? -5.789  -5.518  -2.648  1.00 0.00 ? 66 CYS A CB   1  
ATOM 884   S SG   . CYS A 1 66 ? -4.981  -3.898  -2.452  1.00 0.00 ? 66 CYS A SG   1  
ATOM 885   H H    . CYS A 1 66 ? -4.021  -8.061  -2.675  1.00 0.00 ? 66 CYS A H    1  
ATOM 886   H HA   . CYS A 1 66 ? -4.994  -6.158  -0.777  1.00 0.00 ? 66 CYS A HA   1  
ATOM 887   H HB2  . CYS A 1 66 ? -5.660  -5.827  -3.675  1.00 0.00 ? 66 CYS A HB2  1  
ATOM 888   H HB3  . CYS A 1 66 ? -6.842  -5.387  -2.447  1.00 0.00 ? 66 CYS A HB3  1  
ATOM 889   N N    . PRO A 1 67 ? -7.058  -7.558  -0.399  1.00 0.00 ? 67 PRO A N    1  
ATOM 890   C CA   . PRO A 1 67 ? -8.122  -8.508  -0.056  1.00 0.00 ? 67 PRO A CA   1  
ATOM 891   C C    . PRO A 1 67 ? -9.199  -8.583  -1.133  1.00 0.00 ? 67 PRO A C    1  
ATOM 892   O O    . PRO A 1 67 ? -8.979  -8.179  -2.275  1.00 0.00 ? 67 PRO A O    1  
ATOM 893   C CB   . PRO A 1 67 ? -8.712  -7.937  1.242   1.00 0.00 ? 67 PRO A CB   1  
ATOM 894   C CG   . PRO A 1 67 ? -8.293  -6.507  1.257   1.00 0.00 ? 67 PRO A CG   1  
ATOM 895   C CD   . PRO A 1 67 ? -6.948  -6.480  0.599   1.00 0.00 ? 67 PRO A CD   1  
ATOM 896   H HA   . PRO A 1 67 ? -7.727  -9.497  0.128   1.00 0.00 ? 67 PRO A HA   1  
ATOM 897   H HB2  . PRO A 1 67 ? -9.788  -8.033  1.225   1.00 0.00 ? 67 PRO A HB2  1  
ATOM 898   H HB3  . PRO A 1 67 ? -8.311  -8.474  2.089   1.00 0.00 ? 67 PRO A HB3  1  
ATOM 899   H HG2  . PRO A 1 67 ? -8.998  -5.909  0.698   1.00 0.00 ? 67 PRO A HG2  1  
ATOM 900   H HG3  . PRO A 1 67 ? -8.220  -6.152  2.274   1.00 0.00 ? 67 PRO A HG3  1  
ATOM 901   H HD2  . PRO A 1 67 ? -6.774  -5.525  0.127   1.00 0.00 ? 67 PRO A HD2  1  
ATOM 902   H HD3  . PRO A 1 67 ? -6.174  -6.697  1.319   1.00 0.00 ? 67 PRO A HD3  1  
ATOM 903   N N    . ARG A 1 68 ? -10.365 -9.100  -0.760  1.00 0.00 ? 68 ARG A N    1  
ATOM 904   C CA   . ARG A 1 68 ? -11.481 -9.224  -1.690  1.00 0.00 ? 68 ARG A CA   1  
ATOM 905   C C    . ARG A 1 68 ? -12.760 -8.663  -1.079  1.00 0.00 ? 68 ARG A C    1  
ATOM 906   O O    . ARG A 1 68 ? -13.854 -8.869  -1.606  1.00 0.00 ? 68 ARG A O    1  
ATOM 907   C CB   . ARG A 1 68 ? -11.689 -10.689 -2.078  1.00 0.00 ? 68 ARG A CB   1  
ATOM 908   C CG   . ARG A 1 68 ? -10.727 -11.179 -3.148  1.00 0.00 ? 68 ARG A CG   1  
ATOM 909   C CD   . ARG A 1 68 ? -11.395 -12.176 -4.081  1.00 0.00 ? 68 ARG A CD   1  
ATOM 910   N NE   . ARG A 1 68 ? -11.920 -13.333 -3.361  1.00 0.00 ? 68 ARG A NE   1  
ATOM 911   C CZ   . ARG A 1 68 ? -12.942 -14.066 -3.791  1.00 0.00 ? 68 ARG A CZ   1  
ATOM 912   N NH1  . ARG A 1 68 ? -13.544 -13.764 -4.933  1.00 0.00 ? 68 ARG A NH1  1  
ATOM 913   N NH2  . ARG A 1 68 ? -13.362 -15.103 -3.079  1.00 0.00 ? 68 ARG A NH2  1  
ATOM 914   H H    . ARG A 1 68 ? -10.479 -9.402  0.165   1.00 0.00 ? 68 ARG A H    1  
ATOM 915   H HA   . ARG A 1 68 ? -11.239 -8.657  -2.576  1.00 0.00 ? 68 ARG A HA   1  
ATOM 916   H HB2  . ARG A 1 68 ? -11.560 -11.304 -1.199  1.00 0.00 ? 68 ARG A HB2  1  
ATOM 917   H HB3  . ARG A 1 68 ? -12.697 -10.812 -2.447  1.00 0.00 ? 68 ARG A HB3  1  
ATOM 918   H HG2  . ARG A 1 68 ? -10.385 -10.334 -3.726  1.00 0.00 ? 68 ARG A HG2  1  
ATOM 919   H HG3  . ARG A 1 68 ? -9.884  -11.656 -2.669  1.00 0.00 ? 68 ARG A HG3  1  
ATOM 920   H HD2  . ARG A 1 68 ? -12.208 -11.683 -4.592  1.00 0.00 ? 68 ARG A HD2  1  
ATOM 921   H HD3  . ARG A 1 68 ? -10.668 -12.514 -4.805  1.00 0.00 ? 68 ARG A HD3  1  
ATOM 922   H HE   . ARG A 1 68 ? -11.490 -13.574 -2.514  1.00 0.00 ? 68 ARG A HE   1  
ATOM 923   H HH11 . ARG A 1 68 ? -13.229 -12.983 -5.473  1.00 0.00 ? 68 ARG A HH11 1  
ATOM 924   H HH12 . ARG A 1 68 ? -14.312 -14.317 -5.256  1.00 0.00 ? 68 ARG A HH12 1  
ATOM 925   H HH21 . ARG A 1 68 ? -12.910 -15.334 -2.217  1.00 0.00 ? 68 ARG A HH21 1  
ATOM 926   H HH22 . ARG A 1 68 ? -14.131 -15.654 -3.404  1.00 0.00 ? 68 ARG A HH22 1  
ATOM 927   N N    . ASN A 1 69 ? -12.617 -7.954  0.037   1.00 0.00 ? 69 ASN A N    1  
ATOM 928   C CA   . ASN A 1 69 ? -13.762 -7.365  0.721   1.00 0.00 ? 69 ASN A CA   1  
ATOM 929   C C    . ASN A 1 69 ? -13.917 -5.892  0.356   1.00 0.00 ? 69 ASN A C    1  
ATOM 930   O O    . ASN A 1 69 ? -12.948 -5.226  -0.008  1.00 0.00 ? 69 ASN A O    1  
ATOM 931   C CB   . ASN A 1 69 ? -13.608 -7.512  2.236   1.00 0.00 ? 69 ASN A CB   1  
ATOM 932   C CG   . ASN A 1 69 ? -13.032 -8.858  2.631   1.00 0.00 ? 69 ASN A CG   1  
ATOM 933   O OD1  . ASN A 1 69 ? -11.964 -8.935  3.239   1.00 0.00 ? 69 ASN A OD1  1  
ATOM 934   N ND2  . ASN A 1 69 ? -13.737 -9.929  2.284   1.00 0.00 ? 69 ASN A ND2  1  
ATOM 935   H H    . ASN A 1 69 ? -11.720 -7.826  0.410   1.00 0.00 ? 69 ASN A H    1  
ATOM 936   H HA   . ASN A 1 69 ? -14.647 -7.897  0.405   1.00 0.00 ? 69 ASN A HA   1  
ATOM 937   H HB2  . ASN A 1 69 ? -12.949 -6.739  2.602   1.00 0.00 ? 69 ASN A HB2  1  
ATOM 938   H HB3  . ASN A 1 69 ? -14.576 -7.405  2.702   1.00 0.00 ? 69 ASN A HB3  1  
ATOM 939   H HD21 . ASN A 1 69 ? -14.578 -9.793  1.800   1.00 0.00 ? 69 ASN A HD21 1  
ATOM 940   H HD22 . ASN A 1 69 ? -13.387 -10.812 2.526   1.00 0.00 ? 69 ASN A HD22 1  
ATOM 941   N N    . PRO A 1 70 ? -15.147 -5.367  0.449   1.00 0.00 ? 70 PRO A N    1  
ATOM 942   C CA   . PRO A 1 70 ? -15.439 -3.968  0.128   1.00 0.00 ? 70 PRO A CA   1  
ATOM 943   C C    . PRO A 1 70 ? -14.919 -3.006  1.192   1.00 0.00 ? 70 PRO A C    1  
ATOM 944   O O    . PRO A 1 70 ? -15.169 -3.188  2.383   1.00 0.00 ? 70 PRO A O    1  
ATOM 945   C CB   . PRO A 1 70 ? -16.967 -3.932  0.077   1.00 0.00 ? 70 PRO A CB   1  
ATOM 946   C CG   . PRO A 1 70 ? -17.400 -5.029  0.986   1.00 0.00 ? 70 PRO A CG   1  
ATOM 947   C CD   . PRO A 1 70 ? -16.351 -6.103  0.874   1.00 0.00 ? 70 PRO A CD   1  
ATOM 948   H HA   . PRO A 1 70 ? -15.037 -3.690  -0.835  1.00 0.00 ? 70 PRO A HA   1  
ATOM 949   H HB2  . PRO A 1 70 ? -17.319 -2.970  0.421   1.00 0.00 ? 70 PRO A HB2  1  
ATOM 950   H HB3  . PRO A 1 70 ? -17.301 -4.104  -0.935  1.00 0.00 ? 70 PRO A HB3  1  
ATOM 951   H HG2  . PRO A 1 70 ? -17.455 -4.664  2.001   1.00 0.00 ? 70 PRO A HG2  1  
ATOM 952   H HG3  . PRO A 1 70 ? -18.360 -5.409  0.671   1.00 0.00 ? 70 PRO A HG3  1  
ATOM 953   H HD2  . PRO A 1 70 ? -16.194 -6.577  1.832   1.00 0.00 ? 70 PRO A HD2  1  
ATOM 954   H HD3  . PRO A 1 70 ? -16.638 -6.834  0.133   1.00 0.00 ? 70 PRO A HD3  1  
ATOM 955   N N    . PHE A 1 71 ? -14.195 -1.982  0.752   1.00 0.00 ? 71 PHE A N    1  
ATOM 956   C CA   . PHE A 1 71 ? -13.640 -0.989  1.665   1.00 0.00 ? 71 PHE A CA   1  
ATOM 957   C C    . PHE A 1 71 ? -13.887 0.423   1.146   1.00 0.00 ? 71 PHE A C    1  
ATOM 958   O O    . PHE A 1 71 ? -14.544 1.230   1.803   1.00 0.00 ? 71 PHE A O    1  
ATOM 959   C CB   . PHE A 1 71 ? -12.140 -1.222  1.855   1.00 0.00 ? 71 PHE A CB   1  
ATOM 960   C CG   . PHE A 1 71 ? -11.818 -2.512  2.555   1.00 0.00 ? 71 PHE A CG   1  
ATOM 961   C CD1  . PHE A 1 71 ? -12.153 -2.695  3.886   1.00 0.00 ? 71 PHE A CD1  1  
ATOM 962   C CD2  . PHE A 1 71 ? -11.180 -3.540  1.880   1.00 0.00 ? 71 PHE A CD2  1  
ATOM 963   C CE1  . PHE A 1 71 ? -11.859 -3.880  4.533   1.00 0.00 ? 71 PHE A CE1  1  
ATOM 964   C CE2  . PHE A 1 71 ? -10.883 -4.728  2.522   1.00 0.00 ? 71 PHE A CE2  1  
ATOM 965   C CZ   . PHE A 1 71 ? -11.223 -4.898  3.850   1.00 0.00 ? 71 PHE A CZ   1  
ATOM 966   H H    . PHE A 1 71 ? -14.031 -1.890  -0.209  1.00 0.00 ? 71 PHE A H    1  
ATOM 967   H HA   . PHE A 1 71 ? -14.136 -1.101  2.618   1.00 0.00 ? 71 PHE A HA   1  
ATOM 968   H HB2  . PHE A 1 71 ? -11.661 -1.240  0.889   1.00 0.00 ? 71 PHE A HB2  1  
ATOM 969   H HB3  . PHE A 1 71 ? -11.729 -0.413  2.441   1.00 0.00 ? 71 PHE A HB3  1  
ATOM 970   H HD1  . PHE A 1 71 ? -12.652 -1.899  4.421   1.00 0.00 ? 71 PHE A HD1  1  
ATOM 971   H HD2  . PHE A 1 71 ? -10.913 -3.408  0.842   1.00 0.00 ? 71 PHE A HD2  1  
ATOM 972   H HE1  . PHE A 1 71 ? -12.126 -4.010  5.571   1.00 0.00 ? 71 PHE A HE1  1  
ATOM 973   H HE2  . PHE A 1 71 ? -10.385 -5.522  1.985   1.00 0.00 ? 71 PHE A HE2  1  
ATOM 974   H HZ   . PHE A 1 71 ? -10.992 -5.825  4.353   1.00 0.00 ? 71 PHE A HZ   1  
ATOM 975   N N    . HIS A 1 72 ? -13.358 0.715   -0.039  1.00 0.00 ? 72 HIS A N    1  
ATOM 976   C CA   . HIS A 1 72 ? -13.525 2.030   -0.646  1.00 0.00 ? 72 HIS A CA   1  
ATOM 977   C C    . HIS A 1 72 ? -14.971 2.246   -1.081  1.00 0.00 ? 72 HIS A C    1  
ATOM 978   O O    . HIS A 1 72 ? -15.531 1.446   -1.831  1.00 0.00 ? 72 HIS A O    1  
ATOM 979   C CB   . HIS A 1 72 ? -12.590 2.182   -1.848  1.00 0.00 ? 72 HIS A CB   1  
ATOM 980   C CG   . HIS A 1 72 ? -12.995 3.276   -2.787  1.00 0.00 ? 72 HIS A CG   1  
ATOM 981   N ND1  . HIS A 1 72 ? -12.767 4.612   -2.532  1.00 0.00 ? 72 HIS A ND1  1  
ATOM 982   C CD2  . HIS A 1 72 ? -13.617 3.226   -3.989  1.00 0.00 ? 72 HIS A CD2  1  
ATOM 983   C CE1  . HIS A 1 72 ? -13.233 5.336   -3.534  1.00 0.00 ? 72 HIS A CE1  1  
ATOM 984   N NE2  . HIS A 1 72 ? -13.752 4.519   -4.431  1.00 0.00 ? 72 HIS A NE2  1  
ATOM 985   H H    . HIS A 1 72 ? -12.846 0.029   -0.516  1.00 0.00 ? 72 HIS A H    1  
ATOM 986   H HA   . HIS A 1 72 ? -13.269 2.772   0.095   1.00 0.00 ? 72 HIS A HA   1  
ATOM 987   H HB2  . HIS A 1 72 ? -11.594 2.402   -1.494  1.00 0.00 ? 72 HIS A HB2  1  
ATOM 988   H HB3  . HIS A 1 72 ? -12.574 1.255   -2.402  1.00 0.00 ? 72 HIS A HB3  1  
ATOM 989   H HD1  . HIS A 1 72 ? -12.331 4.976   -1.733  1.00 0.00 ? 72 HIS A HD1  1  
ATOM 990   H HD2  . HIS A 1 72 ? -13.947 2.334   -4.504  1.00 0.00 ? 72 HIS A HD2  1  
ATOM 991   H HE1  . HIS A 1 72 ? -13.193 6.413   -3.608  1.00 0.00 ? 72 HIS A HE1  1  
ATOM 992   H HE2  . HIS A 1 72 ? -14.241 4.798   -5.234  1.00 0.00 ? 72 HIS A HE2  1  
ATOM 993   N N    . ALA A 1 73 ? -15.572 3.331   -0.604  1.00 0.00 ? 73 ALA A N    1  
ATOM 994   C CA   . ALA A 1 73 ? -16.953 3.651   -0.943  1.00 0.00 ? 73 ALA A CA   1  
ATOM 995   C C    . ALA A 1 73 ? -17.019 4.752   -1.996  1.00 0.00 ? 73 ALA A C    1  
ATOM 996   O O    . ALA A 1 73 ? -17.442 4.456   -3.134  1.00 0.00 ? 73 ALA A O    1  
ATOM 997   C CB   . ALA A 1 73 ? -17.719 4.065   0.304   1.00 0.00 ? 73 ALA A CB   1  
ATOM 998   O OXT  . ALA A 1 73 ? -16.648 5.900   -1.675  1.00 0.00 ? 73 ALA A OXT  1  
ATOM 999   H H    . ALA A 1 73 ? -15.074 3.931   -0.010  1.00 0.00 ? 73 ALA A H    1  
ATOM 1000  H HA   . ALA A 1 73 ? -17.414 2.758   -1.340  1.00 0.00 ? 73 ALA A HA   1  
ATOM 1001  H HB1  . ALA A 1 73 ? -17.961 3.188   0.886   1.00 0.00 ? 73 ALA A HB1  1  
ATOM 1002  H HB2  . ALA A 1 73 ? -18.630 4.569   0.016   1.00 0.00 ? 73 ALA A HB2  1  
ATOM 1003  H HB3  . ALA A 1 73 ? -17.110 4.733   0.895   1.00 0.00 ? 73 ALA A HB3  1  
ATOM 1004  N N    . GLU A 1 1  ? -0.316  12.239  3.533   1.00 0.00 ? 1  GLU A N    2  
ATOM 1005  C CA   . GLU A 1 1  ? -0.867  11.693  4.801   1.00 0.00 ? 1  GLU A CA   2  
ATOM 1006  C C    . GLU A 1 1  ? -2.016  10.726  4.533   1.00 0.00 ? 1  GLU A C    2  
ATOM 1007  O O    . GLU A 1 1  ? -2.897  10.545  5.373   1.00 0.00 ? 1  GLU A O    2  
ATOM 1008  C CB   . GLU A 1 1  ? -1.349  12.859  5.666   1.00 0.00 ? 1  GLU A CB   2  
ATOM 1009  C CG   . GLU A 1 1  ? -1.204  12.610  7.159   1.00 0.00 ? 1  GLU A CG   2  
ATOM 1010  C CD   . GLU A 1 1  ? 0.139   13.063  7.697   1.00 0.00 ? 1  GLU A CD   2  
ATOM 1011  O OE1  . GLU A 1 1  ? 1.102   12.270  7.637   1.00 0.00 ? 1  GLU A OE1  2  
ATOM 1012  O OE2  . GLU A 1 1  ? 0.227   14.212  8.181   1.00 0.00 ? 1  GLU A OE2  2  
ATOM 1013  H H1   . GLU A 1 1  ? -1.118  12.483  2.918   1.00 0.00 ? 1  GLU A H1   2  
ATOM 1014  H H2   . GLU A 1 1  ? 0.278   11.501  3.102   1.00 0.00 ? 1  GLU A H2   2  
ATOM 1015  H H3   . GLU A 1 1  ? 0.244   13.083  3.769   1.00 0.00 ? 1  GLU A H3   2  
ATOM 1016  H HA   . GLU A 1 1  ? -0.079  11.167  5.320   1.00 0.00 ? 1  GLU A HA   2  
ATOM 1017  H HB2  . GLU A 1 1  ? -0.777  13.740  5.413   1.00 0.00 ? 1  GLU A HB2  2  
ATOM 1018  H HB3  . GLU A 1 1  ? -2.391  13.043  5.453   1.00 0.00 ? 1  GLU A HB3  2  
ATOM 1019  H HG2  . GLU A 1 1  ? -1.983  13.148  7.678   1.00 0.00 ? 1  GLU A HG2  2  
ATOM 1020  H HG3  . GLU A 1 1  ? -1.312  11.551  7.346   1.00 0.00 ? 1  GLU A HG3  2  
ATOM 1021  N N    . ALA A 1 2  ? -2.000  10.107  3.357   1.00 0.00 ? 2  ALA A N    2  
ATOM 1022  C CA   . ALA A 1 2  ? -3.041  9.158   2.979   1.00 0.00 ? 2  ALA A CA   2  
ATOM 1023  C C    . ALA A 1 2  ? -2.934  7.874   3.794   1.00 0.00 ? 2  ALA A C    2  
ATOM 1024  O O    . ALA A 1 2  ? -1.847  7.316   3.951   1.00 0.00 ? 2  ALA A O    2  
ATOM 1025  C CB   . ALA A 1 2  ? -2.960  8.850   1.492   1.00 0.00 ? 2  ALA A CB   2  
ATOM 1026  H H    . ALA A 1 2  ? -1.271  10.292  2.729   1.00 0.00 ? 2  ALA A H    2  
ATOM 1027  H HA   . ALA A 1 2  ? -3.999  9.618   3.176   1.00 0.00 ? 2  ALA A HA   2  
ATOM 1028  H HB1  . ALA A 1 2  ? -2.801  7.792   1.351   1.00 0.00 ? 2  ALA A HB1  2  
ATOM 1029  H HB2  . ALA A 1 2  ? -2.139  9.399   1.055   1.00 0.00 ? 2  ALA A HB2  2  
ATOM 1030  H HB3  . ALA A 1 2  ? -3.883  9.142   1.013   1.00 0.00 ? 2  ALA A HB3  2  
ATOM 1031  N N    . GLY A 1 3  ? -4.066  7.410   4.311   1.00 0.00 ? 3  GLY A N    2  
ATOM 1032  C CA   . GLY A 1 3  ? -4.076  6.195   5.104   1.00 0.00 ? 3  GLY A CA   2  
ATOM 1033  C C    . GLY A 1 3  ? -3.088  6.248   6.252   1.00 0.00 ? 3  GLY A C    2  
ATOM 1034  O O    . GLY A 1 3  ? -3.454  6.573   7.381   1.00 0.00 ? 3  GLY A O    2  
ATOM 1035  H H    . GLY A 1 3  ? -4.902  7.897   4.153   1.00 0.00 ? 3  GLY A H    2  
ATOM 1036  H HA2  . GLY A 1 3  ? -5.068  6.046   5.503   1.00 0.00 ? 3  GLY A HA2  2  
ATOM 1037  H HA3  . GLY A 1 3  ? -3.826  5.360   4.466   1.00 0.00 ? 3  GLY A HA3  2  
ATOM 1038  N N    . GLU A 1 4  ? -1.831  5.928   5.962   1.00 0.00 ? 4  GLU A N    2  
ATOM 1039  C CA   . GLU A 1 4  ? -0.785  5.941   6.979   1.00 0.00 ? 4  GLU A CA   2  
ATOM 1040  C C    . GLU A 1 4  ? 0.293   6.963   6.635   1.00 0.00 ? 4  GLU A C    2  
ATOM 1041  O O    . GLU A 1 4  ? 0.150   7.733   5.685   1.00 0.00 ? 4  GLU A O    2  
ATOM 1042  C CB   . GLU A 1 4  ? -0.159  4.551   7.114   1.00 0.00 ? 4  GLU A CB   2  
ATOM 1043  C CG   . GLU A 1 4  ? -1.035  3.557   7.859   1.00 0.00 ? 4  GLU A CG   2  
ATOM 1044  C CD   . GLU A 1 4  ? -0.279  2.812   8.942   1.00 0.00 ? 4  GLU A CD   2  
ATOM 1045  O OE1  . GLU A 1 4  ? 0.573   1.966   8.597   1.00 0.00 ? 4  GLU A OE1  2  
ATOM 1046  O OE2  . GLU A 1 4  ? -0.539  3.074   10.135  1.00 0.00 ? 4  GLU A OE2  2  
ATOM 1047  H H    . GLU A 1 4  ? -1.601  5.677   5.041   1.00 0.00 ? 4  GLU A H    2  
ATOM 1048  H HA   . GLU A 1 4  ? -1.239  6.215   7.919   1.00 0.00 ? 4  GLU A HA   2  
ATOM 1049  H HB2  . GLU A 1 4  ? 0.033   4.159   6.127   1.00 0.00 ? 4  GLU A HB2  2  
ATOM 1050  H HB3  . GLU A 1 4  ? 0.778   4.641   7.645   1.00 0.00 ? 4  GLU A HB3  2  
ATOM 1051  H HG2  . GLU A 1 4  ? -1.855  4.090   8.316   1.00 0.00 ? 4  GLU A HG2  2  
ATOM 1052  H HG3  . GLU A 1 4  ? -1.422  2.839   7.152   1.00 0.00 ? 4  GLU A HG3  2  
ATOM 1053  N N    . GLU A 1 5  ? 1.376   6.961   7.406   1.00 0.00 ? 5  GLU A N    2  
ATOM 1054  C CA   . GLU A 1 5  ? 2.479   7.884   7.173   1.00 0.00 ? 5  GLU A CA   2  
ATOM 1055  C C    . GLU A 1 5  ? 3.207   7.516   5.884   1.00 0.00 ? 5  GLU A C    2  
ATOM 1056  O O    . GLU A 1 5  ? 2.595   7.000   4.951   1.00 0.00 ? 5  GLU A O    2  
ATOM 1057  C CB   . GLU A 1 5  ? 3.451   7.862   8.355   1.00 0.00 ? 5  GLU A CB   2  
ATOM 1058  C CG   . GLU A 1 5  ? 2.762   7.782   9.708   1.00 0.00 ? 5  GLU A CG   2  
ATOM 1059  C CD   . GLU A 1 5  ? 3.612   8.347   10.829  1.00 0.00 ? 5  GLU A CD   2  
ATOM 1060  O OE1  . GLU A 1 5  ? 4.819   8.027   10.878  1.00 0.00 ? 5  GLU A OE1  2  
ATOM 1061  O OE2  . GLU A 1 5  ? 3.072   9.110   11.657  1.00 0.00 ? 5  GLU A OE2  2  
ATOM 1062  H H    . GLU A 1 5  ? 1.436   6.320   8.146   1.00 0.00 ? 5  GLU A H    2  
ATOM 1063  H HA   . GLU A 1 5  ? 2.067   8.877   7.071   1.00 0.00 ? 5  GLU A HA   2  
ATOM 1064  H HB2  . GLU A 1 5  ? 4.101   7.006   8.256   1.00 0.00 ? 5  GLU A HB2  2  
ATOM 1065  H HB3  . GLU A 1 5  ? 4.048   8.761   8.332   1.00 0.00 ? 5  GLU A HB3  2  
ATOM 1066  H HG2  . GLU A 1 5  ? 1.839   8.340   9.661   1.00 0.00 ? 5  GLU A HG2  2  
ATOM 1067  H HG3  . GLU A 1 5  ? 2.545   6.747   9.926   1.00 0.00 ? 5  GLU A HG3  2  
ATOM 1068  N N    . CYS A 1 6  ? 4.512   7.774   5.835   1.00 0.00 ? 6  CYS A N    2  
ATOM 1069  C CA   . CYS A 1 6  ? 5.302   7.453   4.651   1.00 0.00 ? 6  CYS A CA   2  
ATOM 1070  C C    . CYS A 1 6  ? 4.880   8.317   3.466   1.00 0.00 ? 6  CYS A C    2  
ATOM 1071  O O    . CYS A 1 6  ? 3.700   8.625   3.298   1.00 0.00 ? 6  CYS A O    2  
ATOM 1072  C CB   . CYS A 1 6  ? 5.138   5.970   4.309   1.00 0.00 ? 6  CYS A CB   2  
ATOM 1073  S SG   . CYS A 1 6  ? 5.984   5.437   2.783   1.00 0.00 ? 6  CYS A SG   2  
ATOM 1074  H H    . CYS A 1 6  ? 4.952   8.183   6.609   1.00 0.00 ? 6  CYS A H    2  
ATOM 1075  H HA   . CYS A 1 6  ? 6.339   7.650   4.878   1.00 0.00 ? 6  CYS A HA   2  
ATOM 1076  H HB2  . CYS A 1 6  ? 5.532   5.378   5.121   1.00 0.00 ? 6  CYS A HB2  2  
ATOM 1077  H HB3  . CYS A 1 6  ? 4.089   5.754   4.194   1.00 0.00 ? 6  CYS A HB3  2  
ATOM 1078  N N    . ASP A 1 7  ? 5.851   8.706   2.647   1.00 0.00 ? 7  ASP A N    2  
ATOM 1079  C CA   . ASP A 1 7  ? 5.579   9.534   1.478   1.00 0.00 ? 7  ASP A CA   2  
ATOM 1080  C C    . ASP A 1 7  ? 5.678   8.710   0.199   1.00 0.00 ? 7  ASP A C    2  
ATOM 1081  O O    . ASP A 1 7  ? 4.952   8.949   -0.766  1.00 0.00 ? 7  ASP A O    2  
ATOM 1082  C CB   . ASP A 1 7  ? 6.558   10.708  1.419   1.00 0.00 ? 7  ASP A CB   2  
ATOM 1083  C CG   . ASP A 1 7  ? 6.317   11.718  2.523   1.00 0.00 ? 7  ASP A CG   2  
ATOM 1084  O OD1  . ASP A 1 7  ? 6.268   11.308  3.702   1.00 0.00 ? 7  ASP A OD1  2  
ATOM 1085  O OD2  . ASP A 1 7  ? 6.177   12.919  2.209   1.00 0.00 ? 7  ASP A OD2  2  
ATOM 1086  H H    . ASP A 1 7  ? 6.773   8.429   2.833   1.00 0.00 ? 7  ASP A H    2  
ATOM 1087  H HA   . ASP A 1 7  ? 4.574   9.918   1.569   1.00 0.00 ? 7  ASP A HA   2  
ATOM 1088  H HB2  . ASP A 1 7  ? 7.566   10.333  1.514   1.00 0.00 ? 7  ASP A HB2  2  
ATOM 1089  H HB3  . ASP A 1 7  ? 6.453   11.209  0.467   1.00 0.00 ? 7  ASP A HB3  2  
ATOM 1090  N N    . CYS A 1 8  ? 6.581   7.736   0.204   1.00 0.00 ? 8  CYS A N    2  
ATOM 1091  C CA   . CYS A 1 8  ? 6.780   6.868   -0.951  1.00 0.00 ? 8  CYS A CA   2  
ATOM 1092  C C    . CYS A 1 8  ? 5.794   5.699   -0.937  1.00 0.00 ? 8  CYS A C    2  
ATOM 1093  O O    . CYS A 1 8  ? 6.144   4.595   -1.343  1.00 0.00 ? 8  CYS A O    2  
ATOM 1094  C CB   . CYS A 1 8  ? 8.196   6.286   -0.947  1.00 0.00 ? 8  CYS A CB   2  
ATOM 1095  S SG   . CYS A 1 8  ? 9.565   7.486   -0.870  1.00 0.00 ? 8  CYS A SG   2  
ATOM 1096  H H    . CYS A 1 8  ? 7.127   7.596   1.005   1.00 0.00 ? 8  CYS A H    2  
ATOM 1097  H HA   . CYS A 1 8  ? 6.635   7.451   -1.847  1.00 0.00 ? 8  CYS A HA   2  
ATOM 1098  H HB2  . CYS A 1 8  ? 8.298   5.641   -0.090  1.00 0.00 ? 8  CYS A HB2  2  
ATOM 1099  H HB3  . CYS A 1 8  ? 8.323   5.702   -1.844  1.00 0.00 ? 8  CYS A HB3  2  
ATOM 1100  N N    . GLY A 1 9  ? 4.572   5.925   -0.467  1.00 0.00 ? 9  GLY A N    2  
ATOM 1101  C CA   . GLY A 1 9  ? 3.609   4.846   -0.412  1.00 0.00 ? 9  GLY A CA   2  
ATOM 1102  C C    . GLY A 1 9  ? 2.558   4.945   -1.487  1.00 0.00 ? 9  GLY A C    2  
ATOM 1103  O O    . GLY A 1 9  ? 1.606   5.717   -1.368  1.00 0.00 ? 9  GLY A O    2  
ATOM 1104  H H    . GLY A 1 9  ? 4.323   6.814   -0.154  1.00 0.00 ? 9  GLY A H    2  
ATOM 1105  H HA2  . GLY A 1 9  ? 4.132   3.908   -0.525  1.00 0.00 ? 9  GLY A HA2  2  
ATOM 1106  H HA3  . GLY A 1 9  ? 3.125   4.859   0.553   1.00 0.00 ? 9  GLY A HA3  2  
ATOM 1107  N N    . SER A 1 10 ? 2.725   4.157   -2.537  1.00 0.00 ? 10 SER A N    2  
ATOM 1108  C CA   . SER A 1 10 ? 1.775   4.156   -3.631  1.00 0.00 ? 10 SER A CA   2  
ATOM 1109  C C    . SER A 1 10 ? 1.692   2.778   -4.279  1.00 0.00 ? 10 SER A C    2  
ATOM 1110  O O    . SER A 1 10 ? 2.710   2.112   -4.465  1.00 0.00 ? 10 SER A O    2  
ATOM 1111  C CB   . SER A 1 10 ? 2.163   5.205   -4.675  1.00 0.00 ? 10 SER A CB   2  
ATOM 1112  O OG   . SER A 1 10 ? 1.755   6.501   -4.273  1.00 0.00 ? 10 SER A OG   2  
ATOM 1113  H H    . SER A 1 10 ? 3.500   3.559   -2.572  1.00 0.00 ? 10 SER A H    2  
ATOM 1114  H HA   . SER A 1 10 ? 0.818   4.412   -3.217  1.00 0.00 ? 10 SER A HA   2  
ATOM 1115  H HB2  . SER A 1 10 ? 3.235   5.204   -4.802  1.00 0.00 ? 10 SER A HB2  2  
ATOM 1116  H HB3  . SER A 1 10 ? 1.689   4.966   -5.615  1.00 0.00 ? 10 SER A HB3  2  
ATOM 1117  H HG   . SER A 1 10 ? 2.471   7.123   -4.420  1.00 0.00 ? 10 SER A HG   2  
ATOM 1118  N N    . PRO A 1 11 ? 0.478   2.330   -4.639  1.00 0.00 ? 11 PRO A N    2  
ATOM 1119  C CA   . PRO A 1 11 ? 0.285   1.025   -5.278  1.00 0.00 ? 11 PRO A CA   2  
ATOM 1120  C C    . PRO A 1 11 ? 1.210   0.857   -6.476  1.00 0.00 ? 11 PRO A C    2  
ATOM 1121  O O    . PRO A 1 11 ? 0.856   1.195   -7.605  1.00 0.00 ? 11 PRO A O    2  
ATOM 1122  C CB   . PRO A 1 11 ? -1.180  1.054   -5.717  1.00 0.00 ? 11 PRO A CB   2  
ATOM 1123  C CG   . PRO A 1 11 ? -1.833  2.025   -4.793  1.00 0.00 ? 11 PRO A CG   2  
ATOM 1124  C CD   . PRO A 1 11 ? -0.789  3.058   -4.463  1.00 0.00 ? 11 PRO A CD   2  
ATOM 1125  H HA   . PRO A 1 11 ? 0.445   0.215   -4.582  1.00 0.00 ? 11 PRO A HA   2  
ATOM 1126  H HB2  . PRO A 1 11 ? -1.245  1.378   -6.745  1.00 0.00 ? 11 PRO A HB2  2  
ATOM 1127  H HB3  . PRO A 1 11 ? -1.607  0.067   -5.616  1.00 0.00 ? 11 PRO A HB3  2  
ATOM 1128  H HG2  . PRO A 1 11 ? -2.676  2.488   -5.284  1.00 0.00 ? 11 PRO A HG2  2  
ATOM 1129  H HG3  . PRO A 1 11 ? -2.153  1.517   -3.896  1.00 0.00 ? 11 PRO A HG3  2  
ATOM 1130  H HD2  . PRO A 1 11 ? -0.853  3.891   -5.147  1.00 0.00 ? 11 PRO A HD2  2  
ATOM 1131  H HD3  . PRO A 1 11 ? -0.901  3.395   -3.443  1.00 0.00 ? 11 PRO A HD3  2  
ATOM 1132  N N    . GLY A 1 12 ? 2.410   0.360   -6.207  1.00 0.00 ? 12 GLY A N    2  
ATOM 1133  C CA   . GLY A 1 12 ? 3.400   0.180   -7.251  1.00 0.00 ? 12 GLY A CA   2  
ATOM 1134  C C    . GLY A 1 12 ? 4.715   0.796   -6.834  1.00 0.00 ? 12 GLY A C    2  
ATOM 1135  O O    . GLY A 1 12 ? 5.786   0.380   -7.275  1.00 0.00 ? 12 GLY A O    2  
ATOM 1136  H H    . GLY A 1 12 ? 2.638   0.132   -5.277  1.00 0.00 ? 12 GLY A H    2  
ATOM 1137  H HA2  . GLY A 1 12 ? 3.539   -0.876  -7.433  1.00 0.00 ? 12 GLY A HA2  2  
ATOM 1138  H HA3  . GLY A 1 12 ? 3.057   0.657   -8.156  1.00 0.00 ? 12 GLY A HA3  2  
ATOM 1139  N N    . ASN A 1 13 ? 4.610   1.780   -5.948  1.00 0.00 ? 13 ASN A N    2  
ATOM 1140  C CA   . ASN A 1 13 ? 5.765   2.472   -5.401  1.00 0.00 ? 13 ASN A CA   2  
ATOM 1141  C C    . ASN A 1 13 ? 5.804   2.248   -3.895  1.00 0.00 ? 13 ASN A C    2  
ATOM 1142  O O    . ASN A 1 13 ? 5.689   3.183   -3.107  1.00 0.00 ? 13 ASN A O    2  
ATOM 1143  C CB   . ASN A 1 13 ? 5.697   3.968   -5.714  1.00 0.00 ? 13 ASN A CB   2  
ATOM 1144  C CG   . ASN A 1 13 ? 6.126   4.282   -7.134  1.00 0.00 ? 13 ASN A CG   2  
ATOM 1145  O OD1  . ASN A 1 13 ? 5.568   3.753   -8.095  1.00 0.00 ? 13 ASN A OD1  2  
ATOM 1146  N ND2  . ASN A 1 13 ? 7.125   5.147   -7.273  1.00 0.00 ? 13 ASN A ND2  2  
ATOM 1147  H H    . ASN A 1 13 ? 3.719   2.035   -5.634  1.00 0.00 ? 13 ASN A H    2  
ATOM 1148  H HA   . ASN A 1 13 ? 6.654   2.050   -5.846  1.00 0.00 ? 13 ASN A HA   2  
ATOM 1149  H HB2  . ASN A 1 13 ? 4.682   4.311   -5.581  1.00 0.00 ? 13 ASN A HB2  2  
ATOM 1150  H HB3  . ASN A 1 13 ? 6.345   4.501   -5.035  1.00 0.00 ? 13 ASN A HB3  2  
ATOM 1151  H HD21 . ASN A 1 13 ? 7.523   5.528   -6.463  1.00 0.00 ? 13 ASN A HD21 2  
ATOM 1152  H HD22 . ASN A 1 13 ? 7.423   5.368   -8.180  1.00 0.00 ? 13 ASN A HD22 2  
ATOM 1153  N N    . PRO A 1 14 ? 5.957   0.980   -3.493  1.00 0.00 ? 14 PRO A N    2  
ATOM 1154  C CA   . PRO A 1 14 ? 6.008   0.553   -2.092  1.00 0.00 ? 14 PRO A CA   2  
ATOM 1155  C C    . PRO A 1 14 ? 6.842   1.460   -1.210  1.00 0.00 ? 14 PRO A C    2  
ATOM 1156  O O    . PRO A 1 14 ? 8.064   1.454   -1.322  1.00 0.00 ? 14 PRO A O    2  
ATOM 1157  C CB   . PRO A 1 14 ? 6.678   -0.832  -2.175  1.00 0.00 ? 14 PRO A CB   2  
ATOM 1158  C CG   . PRO A 1 14 ? 7.081   -0.991  -3.609  1.00 0.00 ? 14 PRO A CG   2  
ATOM 1159  C CD   . PRO A 1 14 ? 6.099   -0.168  -4.377  1.00 0.00 ? 14 PRO A CD   2  
ATOM 1160  H HA   . PRO A 1 14 ? 5.021   0.449   -1.671  1.00 0.00 ? 14 PRO A HA   2  
ATOM 1161  H HB2  . PRO A 1 14 ? 7.537   -0.856  -1.521  1.00 0.00 ? 14 PRO A HB2  2  
ATOM 1162  H HB3  . PRO A 1 14 ? 5.975   -1.589  -1.877  1.00 0.00 ? 14 PRO A HB3  2  
ATOM 1163  H HG2  . PRO A 1 14 ? 8.083   -0.614  -3.753  1.00 0.00 ? 14 PRO A HG2  2  
ATOM 1164  H HG3  . PRO A 1 14 ? 7.023   -2.027  -3.904  1.00 0.00 ? 14 PRO A HG3  2  
ATOM 1165  H HD2  . PRO A 1 14 ? 6.502   0.120   -5.334  1.00 0.00 ? 14 PRO A HD2  2  
ATOM 1166  H HD3  . PRO A 1 14 ? 5.160   -0.691  -4.489  1.00 0.00 ? 14 PRO A HD3  2  
ATOM 1167  N N    . CYS A 1 15 ? 6.166   2.196   -0.306  1.00 0.00 ? 15 CYS A N    2  
ATOM 1168  C CA   . CYS A 1 15 ? 6.826   3.097   0.652   1.00 0.00 ? 15 CYS A CA   2  
ATOM 1169  C C    . CYS A 1 15 ? 8.275   3.313   0.298   1.00 0.00 ? 15 CYS A C    2  
ATOM 1170  O O    . CYS A 1 15 ? 9.162   3.151   1.136   1.00 0.00 ? 15 CYS A O    2  
ATOM 1171  C CB   . CYS A 1 15 ? 6.740   2.557   2.077   1.00 0.00 ? 15 CYS A CB   2  
ATOM 1172  S SG   . CYS A 1 15 ? 7.032   3.803   3.379   1.00 0.00 ? 15 CYS A SG   2  
ATOM 1173  H H    . CYS A 1 15 ? 5.191   2.107   -0.267  1.00 0.00 ? 15 CYS A H    2  
ATOM 1174  H HA   . CYS A 1 15 ? 6.316   4.046   0.617   1.00 0.00 ? 15 CYS A HA   2  
ATOM 1175  H HB2  . CYS A 1 15 ? 5.763   2.132   2.233   1.00 0.00 ? 15 CYS A HB2  2  
ATOM 1176  H HB3  . CYS A 1 15 ? 7.484   1.783   2.201   1.00 0.00 ? 15 CYS A HB3  2  
ATOM 1177  N N    . CYS A 1 16 ? 8.493   3.686   -0.949  1.00 0.00 ? 16 CYS A N    2  
ATOM 1178  C CA   . CYS A 1 16 ? 9.815   3.960   -1.455  1.00 0.00 ? 16 CYS A CA   2  
ATOM 1179  C C    . CYS A 1 16 ? 10.512  2.730   -2.009  1.00 0.00 ? 16 CYS A C    2  
ATOM 1180  O O    . CYS A 1 16 ? 10.385  1.634   -1.487  1.00 0.00 ? 16 CYS A O    2  
ATOM 1181  C CB   . CYS A 1 16 ? 10.653  4.651   -0.381  1.00 0.00 ? 16 CYS A CB   2  
ATOM 1182  S SG   . CYS A 1 16 ? 11.242  6.318   -0.854  1.00 0.00 ? 16 CYS A SG   2  
ATOM 1183  H H    . CYS A 1 16 ? 7.727   3.796   -1.550  1.00 0.00 ? 16 CYS A H    2  
ATOM 1184  H HA   . CYS A 1 16 ? 9.686   4.625   -2.262  1.00 0.00 ? 16 CYS A HA   2  
ATOM 1185  H HB2  . CYS A 1 16 ? 10.057  4.761   0.512   1.00 0.00 ? 16 CYS A HB2  2  
ATOM 1186  H HB3  . CYS A 1 16 ? 11.513  4.035   -0.158  1.00 0.00 ? 16 CYS A HB3  2  
ATOM 1187  N N    . ASP A 1 17 ? 11.231  2.933   -3.107  1.00 0.00 ? 17 ASP A N    2  
ATOM 1188  C CA   . ASP A 1 17 ? 11.939  1.843   -3.770  1.00 0.00 ? 17 ASP A CA   2  
ATOM 1189  C C    . ASP A 1 17 ? 13.247  2.301   -4.429  1.00 0.00 ? 17 ASP A C    2  
ATOM 1190  O O    . ASP A 1 17 ? 14.010  1.472   -4.929  1.00 0.00 ? 17 ASP A O    2  
ATOM 1191  C CB   . ASP A 1 17 ? 11.030  1.211   -4.822  1.00 0.00 ? 17 ASP A CB   2  
ATOM 1192  C CG   . ASP A 1 17 ? 10.753  2.144   -5.984  1.00 0.00 ? 17 ASP A CG   2  
ATOM 1193  O OD1  . ASP A 1 17 ? 10.487  3.339   -5.736  1.00 0.00 ? 17 ASP A OD1  2  
ATOM 1194  O OD2  . ASP A 1 17 ? 10.802  1.681   -7.143  1.00 0.00 ? 17 ASP A OD2  2  
ATOM 1195  H H    . ASP A 1 17 ? 11.265  3.831   -3.490  1.00 0.00 ? 17 ASP A H    2  
ATOM 1196  H HA   . ASP A 1 17 ? 12.170  1.100   -3.023  1.00 0.00 ? 17 ASP A HA   2  
ATOM 1197  H HB2  . ASP A 1 17 ? 11.502  0.322   -5.205  1.00 0.00 ? 17 ASP A HB2  2  
ATOM 1198  H HB3  . ASP A 1 17 ? 10.089  0.946   -4.364  1.00 0.00 ? 17 ASP A HB3  2  
ATOM 1199  N N    . ALA A 1 18 ? 13.502  3.612   -4.455  1.00 0.00 ? 18 ALA A N    2  
ATOM 1200  C CA   . ALA A 1 18 ? 14.713  4.143   -5.073  1.00 0.00 ? 18 ALA A CA   2  
ATOM 1201  C C    . ALA A 1 18 ? 14.543  4.264   -6.584  1.00 0.00 ? 18 ALA A C    2  
ATOM 1202  O O    . ALA A 1 18 ? 14.963  5.247   -7.194  1.00 0.00 ? 18 ALA A O    2  
ATOM 1203  C CB   . ALA A 1 18 ? 15.906  3.260   -4.742  1.00 0.00 ? 18 ALA A CB   2  
ATOM 1204  H H    . ALA A 1 18 ? 12.866  4.234   -4.066  1.00 0.00 ? 18 ALA A H    2  
ATOM 1205  H HA   . ALA A 1 18 ? 14.895  5.125   -4.661  1.00 0.00 ? 18 ALA A HA   2  
ATOM 1206  H HB1  . ALA A 1 18 ? 15.986  2.472   -5.477  1.00 0.00 ? 18 ALA A HB1  2  
ATOM 1207  H HB2  . ALA A 1 18 ? 15.772  2.825   -3.763  1.00 0.00 ? 18 ALA A HB2  2  
ATOM 1208  H HB3  . ALA A 1 18 ? 16.808  3.854   -4.752  1.00 0.00 ? 18 ALA A HB3  2  
ATOM 1209  N N    . ALA A 1 19 ? 13.924  3.251   -7.177  1.00 0.00 ? 19 ALA A N    2  
ATOM 1210  C CA   . ALA A 1 19 ? 13.687  3.216   -8.609  1.00 0.00 ? 19 ALA A CA   2  
ATOM 1211  C C    . ALA A 1 19 ? 12.759  2.060   -8.961  1.00 0.00 ? 19 ALA A C    2  
ATOM 1212  O O    . ALA A 1 19 ? 11.927  2.165   -9.862  1.00 0.00 ? 19 ALA A O    2  
ATOM 1213  C CB   . ALA A 1 19 ? 15.004  3.090   -9.350  1.00 0.00 ? 19 ALA A CB   2  
ATOM 1214  H H    . ALA A 1 19 ? 13.618  2.504   -6.634  1.00 0.00 ? 19 ALA A H    2  
ATOM 1215  H HA   . ALA A 1 19 ? 13.220  4.147   -8.897  1.00 0.00 ? 19 ALA A HA   2  
ATOM 1216  H HB1  . ALA A 1 19 ? 15.543  4.023   -9.283  1.00 0.00 ? 19 ALA A HB1  2  
ATOM 1217  H HB2  . ALA A 1 19 ? 14.813  2.856   -10.385 1.00 0.00 ? 19 ALA A HB2  2  
ATOM 1218  H HB3  . ALA A 1 19 ? 15.592  2.302   -8.903  1.00 0.00 ? 19 ALA A HB3  2  
ATOM 1219  N N    . THR A 1 20 ? 12.907  0.957   -8.231  1.00 0.00 ? 20 THR A N    2  
ATOM 1220  C CA   . THR A 1 20 ? 12.086  -0.227  -8.444  1.00 0.00 ? 20 THR A CA   2  
ATOM 1221  C C    . THR A 1 20 ? 11.826  -0.924  -7.113  1.00 0.00 ? 20 THR A C    2  
ATOM 1222  O O    . THR A 1 20 ? 12.767  -1.358  -6.450  1.00 0.00 ? 20 THR A O    2  
ATOM 1223  C CB   . THR A 1 20 ? 12.776  -1.186  -9.415  1.00 0.00 ? 20 THR A CB   2  
ATOM 1224  O OG1  . THR A 1 20 ? 12.709  -0.691  -10.741 1.00 0.00 ? 20 THR A OG1  2  
ATOM 1225  C CG2  . THR A 1 20 ? 12.176  -2.575  -9.413  1.00 0.00 ? 20 THR A CG2  2  
ATOM 1226  H H    . THR A 1 20 ? 13.586  0.941   -7.522  1.00 0.00 ? 20 THR A H    2  
ATOM 1227  H HA   . THR A 1 20 ? 11.144  0.089   -8.865  1.00 0.00 ? 20 THR A HA   2  
ATOM 1228  H HB   . THR A 1 20 ? 13.817  -1.275  -9.139  1.00 0.00 ? 20 THR A HB   2  
ATOM 1229  H HG1  . THR A 1 20 ? 13.359  0.007   -10.856 1.00 0.00 ? 20 THR A HG1  2  
ATOM 1230  H HG21 . THR A 1 20 ? 11.158  -2.527  -9.768  1.00 0.00 ? 20 THR A HG21 2  
ATOM 1231  H HG22 . THR A 1 20 ? 12.190  -2.971  -8.409  1.00 0.00 ? 20 THR A HG22 2  
ATOM 1232  H HG23 . THR A 1 20 ? 12.754  -3.217  -10.062 1.00 0.00 ? 20 THR A HG23 2  
ATOM 1233  N N    . CYS A 1 21 ? 10.546  -1.003  -6.732  1.00 0.00 ? 21 CYS A N    2  
ATOM 1234  C CA   . CYS A 1 21 ? 10.121  -1.624  -5.470  1.00 0.00 ? 21 CYS A CA   2  
ATOM 1235  C C    . CYS A 1 21 ? 11.265  -2.357  -4.767  1.00 0.00 ? 21 CYS A C    2  
ATOM 1236  O O    . CYS A 1 21 ? 11.519  -3.531  -5.034  1.00 0.00 ? 21 CYS A O    2  
ATOM 1237  C CB   . CYS A 1 21 ? 8.963   -2.593  -5.731  1.00 0.00 ? 21 CYS A CB   2  
ATOM 1238  S SG   . CYS A 1 21 ? 7.517   -1.819  -6.530  1.00 0.00 ? 21 CYS A SG   2  
ATOM 1239  H H    . CYS A 1 21 ? 9.859   -0.618  -7.316  1.00 0.00 ? 21 CYS A H    2  
ATOM 1240  H HA   . CYS A 1 21 ? 9.770   -0.837  -4.821  1.00 0.00 ? 21 CYS A HA   2  
ATOM 1241  H HB2  . CYS A 1 21 ? 9.307   -3.389  -6.376  1.00 0.00 ? 21 CYS A HB2  2  
ATOM 1242  H HB3  . CYS A 1 21 ? 8.635   -3.013  -4.792  1.00 0.00 ? 21 CYS A HB3  2  
ATOM 1243  N N    . LYS A 1 22 ? 11.958  -1.652  -3.868  1.00 0.00 ? 22 LYS A N    2  
ATOM 1244  C CA   . LYS A 1 22 ? 13.073  -2.241  -3.132  1.00 0.00 ? 22 LYS A CA   2  
ATOM 1245  C C    . LYS A 1 22 ? 13.583  -1.313  -2.026  1.00 0.00 ? 22 LYS A C    2  
ATOM 1246  O O    . LYS A 1 22 ? 14.766  -0.976  -1.996  1.00 0.00 ? 22 LYS A O    2  
ATOM 1247  C CB   . LYS A 1 22 ? 14.217  -2.582  -4.088  1.00 0.00 ? 22 LYS A CB   2  
ATOM 1248  C CG   . LYS A 1 22 ? 14.240  -4.041  -4.514  1.00 0.00 ? 22 LYS A CG   2  
ATOM 1249  C CD   . LYS A 1 22 ? 14.590  -4.186  -5.986  1.00 0.00 ? 22 LYS A CD   2  
ATOM 1250  C CE   . LYS A 1 22 ? 16.060  -4.522  -6.178  1.00 0.00 ? 22 LYS A CE   2  
ATOM 1251  N NZ   . LYS A 1 22 ? 16.949  -3.450  -5.651  1.00 0.00 ? 22 LYS A NZ   2  
ATOM 1252  H H    . LYS A 1 22 ? 11.713  -0.720  -3.697  1.00 0.00 ? 22 LYS A H    2  
ATOM 1253  H HA   . LYS A 1 22 ? 12.718  -3.154  -2.678  1.00 0.00 ? 22 LYS A HA   2  
ATOM 1254  H HB2  . LYS A 1 22 ? 14.125  -1.972  -4.974  1.00 0.00 ? 22 LYS A HB2  2  
ATOM 1255  H HB3  . LYS A 1 22 ? 15.155  -2.356  -3.603  1.00 0.00 ? 22 LYS A HB3  2  
ATOM 1256  H HG2  . LYS A 1 22 ? 14.978  -4.565  -3.926  1.00 0.00 ? 22 LYS A HG2  2  
ATOM 1257  H HG3  . LYS A 1 22 ? 13.265  -4.472  -4.340  1.00 0.00 ? 22 LYS A HG3  2  
ATOM 1258  H HD2  . LYS A 1 22 ? 13.992  -4.977  -6.412  1.00 0.00 ? 22 LYS A HD2  2  
ATOM 1259  H HD3  . LYS A 1 22 ? 14.373  -3.256  -6.491  1.00 0.00 ? 22 LYS A HD3  2  
ATOM 1260  H HE2  . LYS A 1 22 ? 16.276  -5.444  -5.658  1.00 0.00 ? 22 LYS A HE2  2  
ATOM 1261  H HE3  . LYS A 1 22 ? 16.251  -4.651  -7.233  1.00 0.00 ? 22 LYS A HE3  2  
ATOM 1262  H HZ1  . LYS A 1 22 ? 17.151  -2.754  -6.398  1.00 0.00 ? 22 LYS A HZ1  2  
ATOM 1263  H HZ2  . LYS A 1 22 ? 17.846  -3.859  -5.322  1.00 0.00 ? 22 LYS A HZ2  2  
ATOM 1264  H HZ3  . LYS A 1 22 ? 16.489  -2.964  -4.855  1.00 0.00 ? 22 LYS A HZ3  2  
ATOM 1265  N N    . LEU A 1 23 ? 12.697  -0.898  -1.121  1.00 0.00 ? 23 LEU A N    2  
ATOM 1266  C CA   . LEU A 1 23 ? 13.102  -0.006  -0.028  1.00 0.00 ? 23 LEU A CA   2  
ATOM 1267  C C    . LEU A 1 23 ? 14.025  -0.716  0.958   1.00 0.00 ? 23 LEU A C    2  
ATOM 1268  O O    . LEU A 1 23 ? 14.354  -1.890  0.785   1.00 0.00 ? 23 LEU A O    2  
ATOM 1269  C CB   . LEU A 1 23 ? 11.896  0.570   0.739   1.00 0.00 ? 23 LEU A CB   2  
ATOM 1270  C CG   . LEU A 1 23 ? 10.717  -0.376  1.043   1.00 0.00 ? 23 LEU A CG   2  
ATOM 1271  C CD1  . LEU A 1 23 ? 9.508   -0.005  0.203   1.00 0.00 ? 23 LEU A CD1  2  
ATOM 1272  C CD2  . LEU A 1 23 ? 11.073  -1.838  0.829   1.00 0.00 ? 23 LEU A CD2  2  
ATOM 1273  H H    . LEU A 1 23 ? 11.767  -1.186  -1.196  1.00 0.00 ? 23 LEU A H    2  
ATOM 1274  H HA   . LEU A 1 23 ? 13.649  0.814   -0.471  1.00 0.00 ? 23 LEU A HA   2  
ATOM 1275  H HB2  . LEU A 1 23 ? 12.261  0.943   1.684   1.00 0.00 ? 23 LEU A HB2  2  
ATOM 1276  H HB3  . LEU A 1 23 ? 11.517  1.407   0.180   1.00 0.00 ? 23 LEU A HB3  2  
ATOM 1277  H HG   . LEU A 1 23 ? 10.439  -0.254  2.081   1.00 0.00 ? 23 LEU A HG   2  
ATOM 1278  H HD11 . LEU A 1 23 ? 9.296   1.048   0.322   1.00 0.00 ? 23 LEU A HD11 2  
ATOM 1279  H HD12 . LEU A 1 23 ? 8.657   -0.583  0.522   1.00 0.00 ? 23 LEU A HD12 2  
ATOM 1280  H HD13 . LEU A 1 23 ? 9.714   -0.214  -0.837  1.00 0.00 ? 23 LEU A HD13 2  
ATOM 1281  H HD21 . LEU A 1 23 ? 10.678  -2.424  1.642   1.00 0.00 ? 23 LEU A HD21 2  
ATOM 1282  H HD22 . LEU A 1 23 ? 12.140  -1.953  0.788   1.00 0.00 ? 23 LEU A HD22 2  
ATOM 1283  H HD23 . LEU A 1 23 ? 10.639  -2.177  -0.100  1.00 0.00 ? 23 LEU A HD23 2  
ATOM 1284  N N    . ARG A 1 24 ? 14.433  0.008   1.995   1.00 0.00 ? 24 ARG A N    2  
ATOM 1285  C CA   . ARG A 1 24 ? 15.312  -0.544  3.018   1.00 0.00 ? 24 ARG A CA   2  
ATOM 1286  C C    . ARG A 1 24 ? 14.516  -0.950  4.255   1.00 0.00 ? 24 ARG A C    2  
ATOM 1287  O O    . ARG A 1 24 ? 15.052  -1.569  5.174   1.00 0.00 ? 24 ARG A O    2  
ATOM 1288  C CB   . ARG A 1 24 ? 16.387  0.476   3.401   1.00 0.00 ? 24 ARG A CB   2  
ATOM 1289  C CG   . ARG A 1 24 ? 17.524  0.568   2.397   1.00 0.00 ? 24 ARG A CG   2  
ATOM 1290  C CD   . ARG A 1 24 ? 18.762  1.198   3.015   1.00 0.00 ? 24 ARG A CD   2  
ATOM 1291  N NE   . ARG A 1 24 ? 19.879  0.261   3.081   1.00 0.00 ? 24 ARG A NE   2  
ATOM 1292  C CZ   . ARG A 1 24 ? 20.654  -0.035  2.043   1.00 0.00 ? 24 ARG A CZ   2  
ATOM 1293  N NH1  . ARG A 1 24 ? 20.433  0.534   0.866   1.00 0.00 ? 24 ARG A NH1  2  
ATOM 1294  N NH2  . ARG A 1 24 ? 21.650  -0.899  2.181   1.00 0.00 ? 24 ARG A NH2  2  
ATOM 1295  H H    . ARG A 1 24 ? 14.131  0.937   2.076   1.00 0.00 ? 24 ARG A H    2  
ATOM 1296  H HA   . ARG A 1 24 ? 15.788  -1.420  2.608   1.00 0.00 ? 24 ARG A HA   2  
ATOM 1297  H HB2  . ARG A 1 24 ? 15.929  1.450   3.483   1.00 0.00 ? 24 ARG A HB2  2  
ATOM 1298  H HB3  . ARG A 1 24 ? 16.802  0.201   4.359   1.00 0.00 ? 24 ARG A HB3  2  
ATOM 1299  H HG2  . ARG A 1 24 ? 17.772  -0.426  2.056   1.00 0.00 ? 24 ARG A HG2  2  
ATOM 1300  H HG3  . ARG A 1 24 ? 17.204  1.169   1.559   1.00 0.00 ? 24 ARG A HG3  2  
ATOM 1301  H HD2  . ARG A 1 24 ? 19.053  2.049   2.417   1.00 0.00 ? 24 ARG A HD2  2  
ATOM 1302  H HD3  . ARG A 1 24 ? 18.521  1.528   4.015   1.00 0.00 ? 24 ARG A HD3  2  
ATOM 1303  H HE   . ARG A 1 24 ? 20.059  -0.170  3.943   1.00 0.00 ? 24 ARG A HE   2  
ATOM 1304  H HH11 . ARG A 1 24 ? 19.683  1.186   0.758   1.00 0.00 ? 24 ARG A HH11 2  
ATOM 1305  H HH12 . ARG A 1 24 ? 21.018  0.311   0.086   1.00 0.00 ? 24 ARG A HH12 2  
ATOM 1306  H HH21 . ARG A 1 24 ? 21.819  -1.329  3.068   1.00 0.00 ? 24 ARG A HH21 2  
ATOM 1307  H HH22 . ARG A 1 24 ? 22.232  -1.120  1.399   1.00 0.00 ? 24 ARG A HH22 2  
ATOM 1308  N N    . GLN A 1 25 ? 13.235  -0.598  4.270   1.00 0.00 ? 25 GLN A N    2  
ATOM 1309  C CA   . GLN A 1 25 ? 12.364  -0.926  5.392   1.00 0.00 ? 25 GLN A CA   2  
ATOM 1310  C C    . GLN A 1 25 ? 11.343  -1.988  4.998   1.00 0.00 ? 25 GLN A C    2  
ATOM 1311  O O    . GLN A 1 25 ? 11.645  -3.181  4.998   1.00 0.00 ? 25 GLN A O    2  
ATOM 1312  C CB   . GLN A 1 25 ? 11.657  0.333   5.901   1.00 0.00 ? 25 GLN A CB   2  
ATOM 1313  C CG   . GLN A 1 25 ? 12.453  1.096   6.947   1.00 0.00 ? 25 GLN A CG   2  
ATOM 1314  C CD   . GLN A 1 25 ? 13.067  2.369   6.397   1.00 0.00 ? 25 GLN A CD   2  
ATOM 1315  O OE1  . GLN A 1 25 ? 12.392  3.169   5.750   1.00 0.00 ? 25 GLN A OE1  2  
ATOM 1316  N NE2  . GLN A 1 25 ? 14.356  2.561   6.652   1.00 0.00 ? 25 GLN A NE2  2  
ATOM 1317  H H    . GLN A 1 25 ? 12.866  -0.107  3.508   1.00 0.00 ? 25 GLN A H    2  
ATOM 1318  H HA   . GLN A 1 25 ? 12.976  -1.321  6.181   1.00 0.00 ? 25 GLN A HA   2  
ATOM 1319  H HB2  . GLN A 1 25 ? 11.476  0.993   5.066   1.00 0.00 ? 25 GLN A HB2  2  
ATOM 1320  H HB3  . GLN A 1 25 ? 10.710  0.050   6.337   1.00 0.00 ? 25 GLN A HB3  2  
ATOM 1321  H HG2  . GLN A 1 25 ? 11.796  1.356   7.763   1.00 0.00 ? 25 GLN A HG2  2  
ATOM 1322  H HG3  . GLN A 1 25 ? 13.246  0.460   7.313   1.00 0.00 ? 25 GLN A HG3  2  
ATOM 1323  H HE21 . GLN A 1 25 ? 14.832  1.881   7.174   1.00 0.00 ? 25 GLN A HE21 2  
ATOM 1324  H HE22 . GLN A 1 25 ? 14.779  3.376   6.309   1.00 0.00 ? 25 GLN A HE22 2  
ATOM 1325  N N    . GLY A 1 26 ? 10.138  -1.550  4.661   1.00 0.00 ? 26 GLY A N    2  
ATOM 1326  C CA   . GLY A 1 26 ? 9.096   -2.479  4.268   1.00 0.00 ? 26 GLY A CA   2  
ATOM 1327  C C    . GLY A 1 26 ? 7.759   -1.800  4.036   1.00 0.00 ? 26 GLY A C    2  
ATOM 1328  O O    . GLY A 1 26 ? 6.843   -1.927  4.848   1.00 0.00 ? 26 GLY A O    2  
ATOM 1329  H H    . GLY A 1 26 ? 9.957   -0.591  4.678   1.00 0.00 ? 26 GLY A H    2  
ATOM 1330  H HA2  . GLY A 1 26 ? 9.397   -2.974  3.356   1.00 0.00 ? 26 GLY A HA2  2  
ATOM 1331  H HA3  . GLY A 1 26 ? 8.980   -3.220  5.044   1.00 0.00 ? 26 GLY A HA3  2  
ATOM 1332  N N    . ALA A 1 27 ? 7.656   -1.068  2.929   1.00 0.00 ? 27 ALA A N    2  
ATOM 1333  C CA   . ALA A 1 27 ? 6.437   -0.353  2.579   1.00 0.00 ? 27 ALA A CA   2  
ATOM 1334  C C    . ALA A 1 27 ? 5.167   -1.131  2.916   1.00 0.00 ? 27 ALA A C    2  
ATOM 1335  O O    . ALA A 1 27 ? 4.121   -0.536  3.166   1.00 0.00 ? 27 ALA A O    2  
ATOM 1336  C CB   . ALA A 1 27 ? 6.472   -0.006  1.099   1.00 0.00 ? 27 ALA A CB   2  
ATOM 1337  H H    . ALA A 1 27 ? 8.431   -0.992  2.328   1.00 0.00 ? 27 ALA A H    2  
ATOM 1338  H HA   . ALA A 1 27 ? 6.428   0.556   3.140   1.00 0.00 ? 27 ALA A HA   2  
ATOM 1339  H HB1  . ALA A 1 27 ? 7.322   0.635   0.895   1.00 0.00 ? 27 ALA A HB1  2  
ATOM 1340  H HB2  . ALA A 1 27 ? 5.565   0.510   0.829   1.00 0.00 ? 27 ALA A HB2  2  
ATOM 1341  H HB3  . ALA A 1 27 ? 6.562   -0.906  0.513   1.00 0.00 ? 27 ALA A HB3  2  
ATOM 1342  N N    . GLN A 1 28 ? 5.280   -2.448  2.907   1.00 0.00 ? 28 GLN A N    2  
ATOM 1343  C CA   . GLN A 1 28 ? 4.166   -3.361  3.196   1.00 0.00 ? 28 GLN A CA   2  
ATOM 1344  C C    . GLN A 1 28 ? 2.927   -2.645  3.715   1.00 0.00 ? 28 GLN A C    2  
ATOM 1345  O O    . GLN A 1 28 ? 2.653   -2.651  4.915   1.00 0.00 ? 28 GLN A O    2  
ATOM 1346  C CB   . GLN A 1 28 ? 4.586   -4.405  4.222   1.00 0.00 ? 28 GLN A CB   2  
ATOM 1347  C CG   . GLN A 1 28 ? 6.047   -4.772  4.155   1.00 0.00 ? 28 GLN A CG   2  
ATOM 1348  C CD   . GLN A 1 28 ? 6.519   -5.530  5.380   1.00 0.00 ? 28 GLN A CD   2  
ATOM 1349  O OE1  . GLN A 1 28 ? 7.435   -5.096  6.078   1.00 0.00 ? 28 GLN A OE1  2  
ATOM 1350  N NE2  . GLN A 1 28 ? 5.895   -6.672  5.646   1.00 0.00 ? 28 GLN A NE2  2  
ATOM 1351  H H    . GLN A 1 28 ? 6.146   -2.825  2.685   1.00 0.00 ? 28 GLN A H    2  
ATOM 1352  H HA   . GLN A 1 28 ? 3.915   -3.867  2.281   1.00 0.00 ? 28 GLN A HA   2  
ATOM 1353  H HB2  . GLN A 1 28 ? 4.373   -4.030  5.203   1.00 0.00 ? 28 GLN A HB2  2  
ATOM 1354  H HB3  . GLN A 1 28 ? 4.012   -5.297  4.058   1.00 0.00 ? 28 GLN A HB3  2  
ATOM 1355  H HG2  . GLN A 1 28 ? 6.193   -5.386  3.290   1.00 0.00 ? 28 GLN A HG2  2  
ATOM 1356  H HG3  . GLN A 1 28 ? 6.628   -3.871  4.057   1.00 0.00 ? 28 GLN A HG3  2  
ATOM 1357  H HE21 . GLN A 1 28 ? 5.174   -6.956  5.046   1.00 0.00 ? 28 GLN A HE21 2  
ATOM 1358  H HE22 . GLN A 1 28 ? 6.180   -7.183  6.432   1.00 0.00 ? 28 GLN A HE22 2  
ATOM 1359  N N    . CYS A 1 29 ? 2.181   -2.037  2.804   1.00 0.00 ? 29 CYS A N    2  
ATOM 1360  C CA   . CYS A 1 29 ? 0.963   -1.324  3.164   1.00 0.00 ? 29 CYS A CA   2  
ATOM 1361  C C    . CYS A 1 29 ? 1.290   -0.063  3.937   1.00 0.00 ? 29 CYS A C    2  
ATOM 1362  O O    . CYS A 1 29 ? 0.819   0.136   5.057   1.00 0.00 ? 29 CYS A O    2  
ATOM 1363  C CB   . CYS A 1 29 ? 0.038   -2.214  3.991   1.00 0.00 ? 29 CYS A CB   2  
ATOM 1364  S SG   . CYS A 1 29 ? -0.628  -3.634  3.072   1.00 0.00 ? 29 CYS A SG   2  
ATOM 1365  H H    . CYS A 1 29 ? 2.458   -2.068  1.866   1.00 0.00 ? 29 CYS A H    2  
ATOM 1366  H HA   . CYS A 1 29 ? 0.459   -1.051  2.249   1.00 0.00 ? 29 CYS A HA   2  
ATOM 1367  H HB2  . CYS A 1 29 ? 0.579   -2.598  4.841   1.00 0.00 ? 29 CYS A HB2  2  
ATOM 1368  H HB3  . CYS A 1 29 ? -0.799  -1.626  4.339   1.00 0.00 ? 29 CYS A HB3  2  
ATOM 1369  N N    . ALA A 1 30 ? 2.096   0.786   3.329   1.00 0.00 ? 30 ALA A N    2  
ATOM 1370  C CA   . ALA A 1 30 ? 2.485   2.039   3.959   1.00 0.00 ? 30 ALA A CA   2  
ATOM 1371  C C    . ALA A 1 30 ? 1.539   3.154   3.534   1.00 0.00 ? 30 ALA A C    2  
ATOM 1372  O O    . ALA A 1 30 ? 0.339   2.924   3.381   1.00 0.00 ? 30 ALA A O    2  
ATOM 1373  C CB   . ALA A 1 30 ? 3.924   2.382   3.611   1.00 0.00 ? 30 ALA A CB   2  
ATOM 1374  H H    . ALA A 1 30 ? 2.431   0.566   2.428   1.00 0.00 ? 30 ALA A H    2  
ATOM 1375  H HA   . ALA A 1 30 ? 2.416   1.904   5.027   1.00 0.00 ? 30 ALA A HA   2  
ATOM 1376  H HB1  . ALA A 1 30 ? 4.527   1.487   3.650   1.00 0.00 ? 30 ALA A HB1  2  
ATOM 1377  H HB2  . ALA A 1 30 ? 4.304   3.103   4.320   1.00 0.00 ? 30 ALA A HB2  2  
ATOM 1378  H HB3  . ALA A 1 30 ? 3.964   2.800   2.616   1.00 0.00 ? 30 ALA A HB3  2  
ATOM 1379  N N    . GLU A 1 31 ? 2.070   4.356   3.312   1.00 0.00 ? 31 GLU A N    2  
ATOM 1380  C CA   . GLU A 1 31 ? 1.234   5.465   2.872   1.00 0.00 ? 31 GLU A CA   2  
ATOM 1381  C C    . GLU A 1 31 ? 0.289   4.953   1.801   1.00 0.00 ? 31 GLU A C    2  
ATOM 1382  O O    . GLU A 1 31 ? -0.837  5.427   1.650   1.00 0.00 ? 31 GLU A O    2  
ATOM 1383  C CB   . GLU A 1 31 ? 2.094   6.604   2.322   1.00 0.00 ? 31 GLU A CB   2  
ATOM 1384  C CG   . GLU A 1 31 ? 1.387   7.949   2.310   1.00 0.00 ? 31 GLU A CG   2  
ATOM 1385  C CD   . GLU A 1 31 ? 1.865   8.849   1.187   1.00 0.00 ? 31 GLU A CD   2  
ATOM 1386  O OE1  . GLU A 1 31 ? 2.702   8.395   0.378   1.00 0.00 ? 31 GLU A OE1  2  
ATOM 1387  O OE2  . GLU A 1 31 ? 1.402   10.007  1.116   1.00 0.00 ? 31 GLU A OE2  2  
ATOM 1388  H H    . GLU A 1 31 ? 3.030   4.491   3.424   1.00 0.00 ? 31 GLU A H    2  
ATOM 1389  H HA   . GLU A 1 31 ? 0.658   5.816   3.714   1.00 0.00 ? 31 GLU A HA   2  
ATOM 1390  H HB2  . GLU A 1 31 ? 2.985   6.692   2.925   1.00 0.00 ? 31 GLU A HB2  2  
ATOM 1391  H HB3  . GLU A 1 31 ? 2.381   6.366   1.309   1.00 0.00 ? 31 GLU A HB3  2  
ATOM 1392  H HG2  . GLU A 1 31 ? 0.327   7.783   2.190   1.00 0.00 ? 31 GLU A HG2  2  
ATOM 1393  H HG3  . GLU A 1 31 ? 1.569   8.446   3.252   1.00 0.00 ? 31 GLU A HG3  2  
ATOM 1394  N N    . GLY A 1 32 ? 0.771   3.948   1.081   1.00 0.00 ? 32 GLY A N    2  
ATOM 1395  C CA   . GLY A 1 32 ? -0.005  3.318   0.043   1.00 0.00 ? 32 GLY A CA   2  
ATOM 1396  C C    . GLY A 1 32 ? 0.455   1.894   -0.191  1.00 0.00 ? 32 GLY A C    2  
ATOM 1397  O O    . GLY A 1 32 ? 1.423   1.443   0.420   1.00 0.00 ? 32 GLY A O    2  
ATOM 1398  H H    . GLY A 1 32 ? 1.671   3.614   1.275   1.00 0.00 ? 32 GLY A H    2  
ATOM 1399  H HA2  . GLY A 1 32 ? -1.043  3.308   0.344   1.00 0.00 ? 32 GLY A HA2  2  
ATOM 1400  H HA3  . GLY A 1 32 ? 0.096   3.880   -0.870  1.00 0.00 ? 32 GLY A HA3  2  
ATOM 1401  N N    . LEU A 1 33 ? -0.246  1.177   -1.052  1.00 0.00 ? 33 LEU A N    2  
ATOM 1402  C CA   . LEU A 1 33 ? 0.091   -0.215  -1.334  1.00 0.00 ? 33 LEU A CA   2  
ATOM 1403  C C    . LEU A 1 33 ? 1.518   -0.388  -1.857  1.00 0.00 ? 33 LEU A C    2  
ATOM 1404  O O    . LEU A 1 33 ? 2.066   0.480   -2.537  1.00 0.00 ? 33 LEU A O    2  
ATOM 1405  C CB   . LEU A 1 33 ? -0.909  -0.801  -2.326  1.00 0.00 ? 33 LEU A CB   2  
ATOM 1406  C CG   . LEU A 1 33 ? -1.368  -2.222  -2.013  1.00 0.00 ? 33 LEU A CG   2  
ATOM 1407  C CD1  . LEU A 1 33 ? -0.381  -3.228  -2.576  1.00 0.00 ? 33 LEU A CD1  2  
ATOM 1408  C CD2  . LEU A 1 33 ? -1.538  -2.419  -0.512  1.00 0.00 ? 33 LEU A CD2  2  
ATOM 1409  H H    . LEU A 1 33 ? -1.024  1.584   -1.496  1.00 0.00 ? 33 LEU A H    2  
ATOM 1410  H HA   . LEU A 1 33 ? 0.013   -0.757  -0.405  1.00 0.00 ? 33 LEU A HA   2  
ATOM 1411  H HB2  . LEU A 1 33 ? -1.778  -0.160  -2.350  1.00 0.00 ? 33 LEU A HB2  2  
ATOM 1412  H HB3  . LEU A 1 33 ? -0.455  -0.802  -3.305  1.00 0.00 ? 33 LEU A HB3  2  
ATOM 1413  H HG   . LEU A 1 33 ? -2.322  -2.391  -2.483  1.00 0.00 ? 33 LEU A HG   2  
ATOM 1414  H HD11 . LEU A 1 33 ? -0.608  -4.210  -2.191  1.00 0.00 ? 33 LEU A HD11 2  
ATOM 1415  H HD12 . LEU A 1 33 ? 0.620   -2.950  -2.288  1.00 0.00 ? 33 LEU A HD12 2  
ATOM 1416  H HD13 . LEU A 1 33 ? -0.454  -3.236  -3.653  1.00 0.00 ? 33 LEU A HD13 2  
ATOM 1417  H HD21 . LEU A 1 33 ? -1.655  -1.457  -0.034  1.00 0.00 ? 33 LEU A HD21 2  
ATOM 1418  H HD22 . LEU A 1 33 ? -0.665  -2.913  -0.112  1.00 0.00 ? 33 LEU A HD22 2  
ATOM 1419  H HD23 . LEU A 1 33 ? -2.413  -3.022  -0.323  1.00 0.00 ? 33 LEU A HD23 2  
ATOM 1420  N N    . CYS A 1 34 ? 2.104   -1.534  -1.508  1.00 0.00 ? 34 CYS A N    2  
ATOM 1421  C CA   . CYS A 1 34 ? 3.469   -1.891  -1.897  1.00 0.00 ? 34 CYS A CA   2  
ATOM 1422  C C    . CYS A 1 34 ? 3.483   -2.884  -3.065  1.00 0.00 ? 34 CYS A C    2  
ATOM 1423  O O    . CYS A 1 34 ? 2.455   -3.454  -3.427  1.00 0.00 ? 34 CYS A O    2  
ATOM 1424  C CB   . CYS A 1 34 ? 4.201   -2.486  -0.677  1.00 0.00 ? 34 CYS A CB   2  
ATOM 1425  S SG   . CYS A 1 34 ? 5.348   -3.860  -1.043  1.00 0.00 ? 34 CYS A SG   2  
ATOM 1426  H H    . CYS A 1 34 ? 1.599   -2.160  -0.958  1.00 0.00 ? 34 CYS A H    2  
ATOM 1427  H HA   . CYS A 1 34 ? 3.971   -0.994  -2.204  1.00 0.00 ? 34 CYS A HA   2  
ATOM 1428  H HB2  . CYS A 1 34 ? 4.774   -1.709  -0.203  1.00 0.00 ? 34 CYS A HB2  2  
ATOM 1429  H HB3  . CYS A 1 34 ? 3.464   -2.856  0.021   1.00 0.00 ? 34 CYS A HB3  2  
ATOM 1430  N N    . CYS A 1 35 ? 4.671   -3.081  -3.638  1.00 0.00 ? 35 CYS A N    2  
ATOM 1431  C CA   . CYS A 1 35 ? 4.853   -4.002  -4.757  1.00 0.00 ? 35 CYS A CA   2  
ATOM 1432  C C    . CYS A 1 35 ? 6.135   -4.834  -4.623  1.00 0.00 ? 35 CYS A C    2  
ATOM 1433  O O    . CYS A 1 35 ? 6.366   -5.748  -5.414  1.00 0.00 ? 35 CYS A O    2  
ATOM 1434  C CB   . CYS A 1 35 ? 4.847   -3.221  -6.087  1.00 0.00 ? 35 CYS A CB   2  
ATOM 1435  S SG   . CYS A 1 35 ? 6.359   -3.385  -7.107  1.00 0.00 ? 35 CYS A SG   2  
ATOM 1436  H H    . CYS A 1 35 ? 5.439   -2.596  -3.296  1.00 0.00 ? 35 CYS A H    2  
ATOM 1437  H HA   . CYS A 1 35 ? 4.023   -4.677  -4.746  1.00 0.00 ? 35 CYS A HA   2  
ATOM 1438  H HB2  . CYS A 1 35 ? 4.017   -3.562  -6.686  1.00 0.00 ? 35 CYS A HB2  2  
ATOM 1439  H HB3  . CYS A 1 35 ? 4.713   -2.170  -5.871  1.00 0.00 ? 35 CYS A HB3  2  
ATOM 1440  N N    . ASP A 1 36 ? 6.969   -4.513  -3.643  1.00 0.00 ? 36 ASP A N    2  
ATOM 1441  C CA   . ASP A 1 36 ? 8.221   -5.240  -3.453  1.00 0.00 ? 36 ASP A CA   2  
ATOM 1442  C C    . ASP A 1 36 ? 8.076   -6.392  -2.469  1.00 0.00 ? 36 ASP A C    2  
ATOM 1443  O O    . ASP A 1 36 ? 6.996   -6.650  -1.930  1.00 0.00 ? 36 ASP A O    2  
ATOM 1444  C CB   . ASP A 1 36 ? 9.332   -4.307  -2.968  1.00 0.00 ? 36 ASP A CB   2  
ATOM 1445  C CG   . ASP A 1 36 ? 8.812   -3.073  -2.258  1.00 0.00 ? 36 ASP A CG   2  
ATOM 1446  O OD1  . ASP A 1 36 ? 7.984   -3.222  -1.337  1.00 0.00 ? 36 ASP A OD1  2  
ATOM 1447  O OD2  . ASP A 1 36 ? 9.240   -1.957  -2.620  1.00 0.00 ? 36 ASP A OD2  2  
ATOM 1448  H H    . ASP A 1 36 ? 6.749   -3.774  -3.050  1.00 0.00 ? 36 ASP A H    2  
ATOM 1449  H HA   . ASP A 1 36 ? 8.508   -5.645  -4.411  1.00 0.00 ? 36 ASP A HA   2  
ATOM 1450  H HB2  . ASP A 1 36 ? 9.967   -4.847  -2.282  1.00 0.00 ? 36 ASP A HB2  2  
ATOM 1451  H HB3  . ASP A 1 36 ? 9.914   -3.993  -3.815  1.00 0.00 ? 36 ASP A HB3  2  
ATOM 1452  N N    . GLN A 1 37 ? 9.193   -7.074  -2.235  1.00 0.00 ? 37 GLN A N    2  
ATOM 1453  C CA   . GLN A 1 37 ? 9.235   -8.198  -1.316  1.00 0.00 ? 37 GLN A CA   2  
ATOM 1454  C C    . GLN A 1 37 ? 8.578   -7.841  0.011   1.00 0.00 ? 37 GLN A C    2  
ATOM 1455  O O    . GLN A 1 37 ? 8.197   -8.733  0.769   1.00 0.00 ? 37 GLN A O    2  
ATOM 1456  C CB   . GLN A 1 37 ? 10.681  -8.637  -1.079  1.00 0.00 ? 37 GLN A CB   2  
ATOM 1457  C CG   . GLN A 1 37 ? 11.415  -9.028  -2.351  1.00 0.00 ? 37 GLN A CG   2  
ATOM 1458  C CD   . GLN A 1 37 ? 12.878  -9.341  -2.107  1.00 0.00 ? 37 GLN A CD   2  
ATOM 1459  O OE1  . GLN A 1 37 ? 13.216  -10.148 -1.240  1.00 0.00 ? 37 GLN A OE1  2  
ATOM 1460  N NE2  . GLN A 1 37 ? 13.756  -8.702  -2.871  1.00 0.00 ? 37 GLN A NE2  2  
ATOM 1461  H H    . GLN A 1 37 ? 10.016  -6.807  -2.693  1.00 0.00 ? 37 GLN A H    2  
ATOM 1462  H HA   . GLN A 1 37 ? 8.691   -9.013  -1.767  1.00 0.00 ? 37 GLN A HA   2  
ATOM 1463  H HB2  . GLN A 1 37 ? 11.220  -7.824  -0.615  1.00 0.00 ? 37 GLN A HB2  2  
ATOM 1464  H HB3  . GLN A 1 37 ? 10.683  -9.486  -0.412  1.00 0.00 ? 37 GLN A HB3  2  
ATOM 1465  H HG2  . GLN A 1 37 ? 10.941  -9.903  -2.770  1.00 0.00 ? 37 GLN A HG2  2  
ATOM 1466  H HG3  . GLN A 1 37 ? 11.349  -8.212  -3.055  1.00 0.00 ? 37 GLN A HG3  2  
ATOM 1467  H HE21 . GLN A 1 37 ? 13.414  -8.073  -3.541  1.00 0.00 ? 37 GLN A HE21 2  
ATOM 1468  H HE22 . GLN A 1 37 ? 14.709  -8.886  -2.735  1.00 0.00 ? 37 GLN A HE22 2  
ATOM 1469  N N    . CYS A 1 38 ? 8.460   -6.532  0.283   1.00 0.00 ? 38 CYS A N    2  
ATOM 1470  C CA   . CYS A 1 38 ? 7.854   -6.038  1.520   1.00 0.00 ? 38 CYS A CA   2  
ATOM 1471  C C    . CYS A 1 38 ? 6.971   -7.109  2.167   1.00 0.00 ? 38 CYS A C    2  
ATOM 1472  O O    . CYS A 1 38 ? 7.165   -7.438  3.337   1.00 0.00 ? 38 CYS A O    2  
ATOM 1473  C CB   . CYS A 1 38 ? 7.081   -4.742  1.251   1.00 0.00 ? 38 CYS A CB   2  
ATOM 1474  S SG   . CYS A 1 38 ? 5.382   -4.976  0.647   1.00 0.00 ? 38 CYS A SG   2  
ATOM 1475  H H    . CYS A 1 38 ? 8.797   -5.882  -0.365  1.00 0.00 ? 38 CYS A H    2  
ATOM 1476  H HA   . CYS A 1 38 ? 8.656   -5.814  2.204   1.00 0.00 ? 38 CYS A HA   2  
ATOM 1477  H HB2  . CYS A 1 38 ? 7.031   -4.172  2.160   1.00 0.00 ? 38 CYS A HB2  2  
ATOM 1478  H HB3  . CYS A 1 38 ? 7.613   -4.160  0.509   1.00 0.00 ? 38 CYS A HB3  2  
ATOM 1479  N N    . ARG A 1 39 ? 6.045   -7.680  1.389   1.00 0.00 ? 39 ARG A N    2  
ATOM 1480  C CA   . ARG A 1 39 ? 5.175   -8.774  1.886   1.00 0.00 ? 39 ARG A CA   2  
ATOM 1481  C C    . ARG A 1 39 ? 3.779   -8.322  2.329   1.00 0.00 ? 39 ARG A C    2  
ATOM 1482  O O    . ARG A 1 39 ? 2.826   -9.098  2.243   1.00 0.00 ? 39 ARG A O    2  
ATOM 1483  C CB   . ARG A 1 39 ? 5.850   -9.532  3.032   1.00 0.00 ? 39 ARG A CB   2  
ATOM 1484  C CG   . ARG A 1 39 ? 5.428   -10.988 3.131   1.00 0.00 ? 39 ARG A CG   2  
ATOM 1485  C CD   . ARG A 1 39 ? 4.162   -11.146 3.957   1.00 0.00 ? 39 ARG A CD   2  
ATOM 1486  N NE   . ARG A 1 39 ? 3.307   -12.215 3.450   1.00 0.00 ? 39 ARG A NE   2  
ATOM 1487  C CZ   . ARG A 1 39 ? 2.348   -12.794 4.166   1.00 0.00 ? 39 ARG A CZ   2  
ATOM 1488  N NH1  . ARG A 1 39 ? 2.127   -12.409 5.415   1.00 0.00 ? 39 ARG A NH1  2  
ATOM 1489  N NH2  . ARG A 1 39 ? 1.610   -13.758 3.633   1.00 0.00 ? 39 ARG A NH2  2  
ATOM 1490  H H    . ARG A 1 39 ? 5.970   -7.387  0.440   1.00 0.00 ? 39 ARG A H    2  
ATOM 1491  H HA   . ARG A 1 39 ? 5.048   -9.462  1.066   1.00 0.00 ? 39 ARG A HA   2  
ATOM 1492  H HB2  . ARG A 1 39 ? 6.920   -9.498  2.889   1.00 0.00 ? 39 ARG A HB2  2  
ATOM 1493  H HB3  . ARG A 1 39 ? 5.605   -9.044  3.964   1.00 0.00 ? 39 ARG A HB3  2  
ATOM 1494  H HG2  . ARG A 1 39 ? 5.247   -11.369 2.137   1.00 0.00 ? 39 ARG A HG2  2  
ATOM 1495  H HG3  . ARG A 1 39 ? 6.223   -11.553 3.596   1.00 0.00 ? 39 ARG A HG3  2  
ATOM 1496  H HD2  . ARG A 1 39 ? 4.438   -11.372 4.976   1.00 0.00 ? 39 ARG A HD2  2  
ATOM 1497  H HD3  . ARG A 1 39 ? 3.613   -10.216 3.932   1.00 0.00 ? 39 ARG A HD3  2  
ATOM 1498  H HE   . ARG A 1 39 ? 3.454   -12.516 2.529   1.00 0.00 ? 39 ARG A HE   2  
ATOM 1499  H HH11 . ARG A 1 39 ? 2.683   -11.683 5.821   1.00 0.00 ? 39 ARG A HH11 2  
ATOM 1500  H HH12 . ARG A 1 39 ? 1.405   -12.845 5.952   1.00 0.00 ? 39 ARG A HH12 2  
ATOM 1501  H HH21 . ARG A 1 39 ? 1.774   -14.050 2.691   1.00 0.00 ? 39 ARG A HH21 2  
ATOM 1502  H HH22 . ARG A 1 39 ? 0.889   -14.192 4.173   1.00 0.00 ? 39 ARG A HH22 2  
ATOM 1503  N N    . PHE A 1 40 ? 3.640   -7.086  2.782   1.00 0.00 ? 40 PHE A N    2  
ATOM 1504  C CA   . PHE A 1 40 ? 2.324   -6.578  3.199   1.00 0.00 ? 40 PHE A CA   2  
ATOM 1505  C C    . PHE A 1 40 ? 1.838   -7.182  4.509   1.00 0.00 ? 40 PHE A C    2  
ATOM 1506  O O    . PHE A 1 40 ? 2.342   -8.207  4.969   1.00 0.00 ? 40 PHE A O    2  
ATOM 1507  C CB   . PHE A 1 40 ? 1.322   -6.837  2.086   1.00 0.00 ? 40 PHE A CB   2  
ATOM 1508  C CG   . PHE A 1 40 ? 1.903   -6.451  0.773   1.00 0.00 ? 40 PHE A CG   2  
ATOM 1509  C CD1  . PHE A 1 40 ? 1.833   -5.145  0.347   1.00 0.00 ? 40 PHE A CD1  2  
ATOM 1510  C CD2  . PHE A 1 40 ? 2.584   -7.372  0.003   1.00 0.00 ? 40 PHE A CD2  2  
ATOM 1511  C CE1  . PHE A 1 40 ? 2.417   -4.766  -0.833  1.00 0.00 ? 40 PHE A CE1  2  
ATOM 1512  C CE2  . PHE A 1 40 ? 3.181   -6.999  -1.173  1.00 0.00 ? 40 PHE A CE2  2  
ATOM 1513  C CZ   . PHE A 1 40 ? 3.096   -5.691  -1.598  1.00 0.00 ? 40 PHE A CZ   2  
ATOM 1514  H H    . PHE A 1 40 ? 4.422   -6.499  2.819   1.00 0.00 ? 40 PHE A H    2  
ATOM 1515  H HA   . PHE A 1 40 ? 2.411   -5.511  3.329   1.00 0.00 ? 40 PHE A HA   2  
ATOM 1516  H HB2  . PHE A 1 40 ? 1.070   -7.887  2.058   1.00 0.00 ? 40 PHE A HB2  2  
ATOM 1517  H HB3  . PHE A 1 40 ? 0.432   -6.249  2.251   1.00 0.00 ? 40 PHE A HB3  2  
ATOM 1518  H HD1  . PHE A 1 40 ? 1.301   -4.416  0.943   1.00 0.00 ? 40 PHE A HD1  2  
ATOM 1519  H HD2  . PHE A 1 40 ? 2.636   -8.397  0.324   1.00 0.00 ? 40 PHE A HD2  2  
ATOM 1520  H HE1  . PHE A 1 40 ? 2.349   -3.750  -1.150  1.00 0.00 ? 40 PHE A HE1  2  
ATOM 1521  H HE2  . PHE A 1 40 ? 3.720   -7.727  -1.751  1.00 0.00 ? 40 PHE A HE2  2  
ATOM 1522  H HZ   . PHE A 1 40 ? 3.565   -5.390  -2.524  1.00 0.00 ? 40 PHE A HZ   2  
ATOM 1523  N N    . MET A 1 41 ? 0.855   -6.514  5.108   1.00 0.00 ? 41 MET A N    2  
ATOM 1524  C CA   . MET A 1 41 ? 0.280   -6.938  6.371   1.00 0.00 ? 41 MET A CA   2  
ATOM 1525  C C    . MET A 1 41 ? -0.618  -8.164  6.203   1.00 0.00 ? 41 MET A C    2  
ATOM 1526  O O    . MET A 1 41 ? -0.128  -9.292  6.151   1.00 0.00 ? 41 MET A O    2  
ATOM 1527  C CB   . MET A 1 41 ? -0.510  -5.783  6.994   1.00 0.00 ? 41 MET A CB   2  
ATOM 1528  C CG   . MET A 1 41 ? 0.319   -4.910  7.921   1.00 0.00 ? 41 MET A CG   2  
ATOM 1529  S SD   . MET A 1 41 ? -0.260  -4.963  9.628   1.00 0.00 ? 41 MET A SD   2  
ATOM 1530  C CE   . MET A 1 41 ? 0.076   -6.672  10.046  1.00 0.00 ? 41 MET A CE   2  
ATOM 1531  H H    . MET A 1 41 ? 0.515   -5.703  4.689   1.00 0.00 ? 41 MET A H    2  
ATOM 1532  H HA   . MET A 1 41 ? 1.094   -7.191  7.025   1.00 0.00 ? 41 MET A HA   2  
ATOM 1533  H HB2  . MET A 1 41 ? -0.901  -5.161  6.201   1.00 0.00 ? 41 MET A HB2  2  
ATOM 1534  H HB3  . MET A 1 41 ? -1.336  -6.189  7.559   1.00 0.00 ? 41 MET A HB3  2  
ATOM 1535  H HG2  . MET A 1 41 ? 1.343   -5.249  7.893   1.00 0.00 ? 41 MET A HG2  2  
ATOM 1536  H HG3  . MET A 1 41 ? 0.270   -3.889  7.571   1.00 0.00 ? 41 MET A HG3  2  
ATOM 1537  H HE1  . MET A 1 41 ? 0.450   -6.728  11.057  1.00 0.00 ? 41 MET A HE1  2  
ATOM 1538  H HE2  . MET A 1 41 ? 0.815   -7.070  9.366   1.00 0.00 ? 41 MET A HE2  2  
ATOM 1539  H HE3  . MET A 1 41 ? -0.834  -7.248  9.966   1.00 0.00 ? 41 MET A HE3  2  
ATOM 1540  N N    . LYS A 1 42 ? -1.933  -7.929  6.122   1.00 0.00 ? 42 LYS A N    2  
ATOM 1541  C CA   . LYS A 1 42 ? -2.917  -8.997  5.969   1.00 0.00 ? 42 LYS A CA   2  
ATOM 1542  C C    . LYS A 1 42 ? -4.221  -8.609  6.651   1.00 0.00 ? 42 LYS A C    2  
ATOM 1543  O O    . LYS A 1 42 ? -5.280  -9.167  6.365   1.00 0.00 ? 42 LYS A O    2  
ATOM 1544  C CB   . LYS A 1 42 ? -2.408  -10.316 6.551   1.00 0.00 ? 42 LYS A CB   2  
ATOM 1545  C CG   . LYS A 1 42 ? -1.799  -11.237 5.509   1.00 0.00 ? 42 LYS A CG   2  
ATOM 1546  C CD   . LYS A 1 42 ? -2.866  -11.848 4.615   1.00 0.00 ? 42 LYS A CD   2  
ATOM 1547  C CE   . LYS A 1 42 ? -2.698  -13.354 4.494   1.00 0.00 ? 42 LYS A CE   2  
ATOM 1548  N NZ   . LYS A 1 42 ? -1.296  -13.732 4.166   1.00 0.00 ? 42 LYS A NZ   2  
ATOM 1549  H H    . LYS A 1 42 ? -2.255  -7.005  6.165   1.00 0.00 ? 42 LYS A H    2  
ATOM 1550  H HA   . LYS A 1 42 ? -3.100  -9.123  4.918   1.00 0.00 ? 42 LYS A HA   2  
ATOM 1551  H HB2  . LYS A 1 42 ? -1.659  -10.104 7.300   1.00 0.00 ? 42 LYS A HB2  2  
ATOM 1552  H HB3  . LYS A 1 42 ? -3.234  -10.832 7.017   1.00 0.00 ? 42 LYS A HB3  2  
ATOM 1553  H HG2  . LYS A 1 42 ? -1.114  -10.669 4.898   1.00 0.00 ? 42 LYS A HG2  2  
ATOM 1554  H HG3  . LYS A 1 42 ? -1.265  -12.030 6.011   1.00 0.00 ? 42 LYS A HG3  2  
ATOM 1555  H HD2  . LYS A 1 42 ? -3.838  -11.637 5.035   1.00 0.00 ? 42 LYS A HD2  2  
ATOM 1556  H HD3  . LYS A 1 42 ? -2.794  -11.406 3.632   1.00 0.00 ? 42 LYS A HD3  2  
ATOM 1557  H HE2  . LYS A 1 42 ? -2.974  -13.810 5.433   1.00 0.00 ? 42 LYS A HE2  2  
ATOM 1558  H HE3  . LYS A 1 42 ? -3.352  -13.714 3.714   1.00 0.00 ? 42 LYS A HE3  2  
ATOM 1559  H HZ1  . LYS A 1 42 ? -0.738  -13.827 5.038   1.00 0.00 ? 42 LYS A HZ1  2  
ATOM 1560  H HZ2  . LYS A 1 42 ? -0.860  -13.003 3.566   1.00 0.00 ? 42 LYS A HZ2  2  
ATOM 1561  H HZ3  . LYS A 1 42 ? -1.280  -14.639 3.656   1.00 0.00 ? 42 LYS A HZ3  2  
ATOM 1562  N N    . GLU A 1 43 ? -4.128  -7.641  7.553   1.00 0.00 ? 43 GLU A N    2  
ATOM 1563  C CA   . GLU A 1 43 ? -5.288  -7.153  8.287   1.00 0.00 ? 43 GLU A CA   2  
ATOM 1564  C C    . GLU A 1 43 ? -5.500  -5.670  8.016   1.00 0.00 ? 43 GLU A C    2  
ATOM 1565  O O    . GLU A 1 43 ? -4.582  -4.869  8.182   1.00 0.00 ? 43 GLU A O    2  
ATOM 1566  C CB   . GLU A 1 43 ? -5.112  -7.391  9.786   1.00 0.00 ? 43 GLU A CB   2  
ATOM 1567  C CG   . GLU A 1 43 ? -6.291  -6.918  10.620  1.00 0.00 ? 43 GLU A CG   2  
ATOM 1568  C CD   . GLU A 1 43 ? -7.012  -8.059  11.311  1.00 0.00 ? 43 GLU A CD   2  
ATOM 1569  O OE1  . GLU A 1 43 ? -6.436  -8.638  12.256  1.00 0.00 ? 43 GLU A OE1  2  
ATOM 1570  O OE2  . GLU A 1 43 ? -8.150  -8.374  10.906  1.00 0.00 ? 43 GLU A OE2  2  
ATOM 1571  H H    . GLU A 1 43 ? -3.252  -7.240  7.726   1.00 0.00 ? 43 GLU A H    2  
ATOM 1572  H HA   . GLU A 1 43 ? -6.153  -7.699  7.942   1.00 0.00 ? 43 GLU A HA   2  
ATOM 1573  H HB2  . GLU A 1 43 ? -4.979  -8.448  9.957   1.00 0.00 ? 43 GLU A HB2  2  
ATOM 1574  H HB3  . GLU A 1 43 ? -4.229  -6.866  10.119  1.00 0.00 ? 43 GLU A HB3  2  
ATOM 1575  H HG2  . GLU A 1 43 ? -5.931  -6.232  11.372  1.00 0.00 ? 43 GLU A HG2  2  
ATOM 1576  H HG3  . GLU A 1 43 ? -6.991  -6.407  9.974   1.00 0.00 ? 43 GLU A HG3  2  
ATOM 1577  N N    . GLY A 1 44 ? -6.715  -5.333  7.585   1.00 0.00 ? 44 GLY A N    2  
ATOM 1578  C CA   . GLY A 1 44 ? -7.079  -3.960  7.265   1.00 0.00 ? 44 GLY A CA   2  
ATOM 1579  C C    . GLY A 1 44 ? -6.025  -2.930  7.589   1.00 0.00 ? 44 GLY A C    2  
ATOM 1580  O O    . GLY A 1 44 ? -6.185  -2.142  8.521   1.00 0.00 ? 44 GLY A O    2  
ATOM 1581  H H    . GLY A 1 44 ? -7.385  -6.038  7.471   1.00 0.00 ? 44 GLY A H    2  
ATOM 1582  H HA2  . GLY A 1 44 ? -7.278  -3.902  6.210   1.00 0.00 ? 44 GLY A HA2  2  
ATOM 1583  H HA3  . GLY A 1 44 ? -7.980  -3.709  7.801   1.00 0.00 ? 44 GLY A HA3  2  
ATOM 1584  N N    . THR A 1 45 ? -4.951  -2.918  6.810   1.00 0.00 ? 45 THR A N    2  
ATOM 1585  C CA   . THR A 1 45 ? -3.890  -1.952  7.024   1.00 0.00 ? 45 THR A CA   2  
ATOM 1586  C C    . THR A 1 45 ? -4.083  -0.735  6.123   1.00 0.00 ? 45 THR A C    2  
ATOM 1587  O O    . THR A 1 45 ? -4.611  0.288   6.557   1.00 0.00 ? 45 THR A O    2  
ATOM 1588  C CB   . THR A 1 45 ? -2.527  -2.603  6.806   1.00 0.00 ? 45 THR A CB   2  
ATOM 1589  O OG1  . THR A 1 45 ? -2.512  -3.919  7.332   1.00 0.00 ? 45 THR A OG1  2  
ATOM 1590  C CG2  . THR A 1 45 ? -1.401  -1.838  7.457   1.00 0.00 ? 45 THR A CG2  2  
ATOM 1591  H H    . THR A 1 45 ? -4.875  -3.567  6.069   1.00 0.00 ? 45 THR A H    2  
ATOM 1592  H HA   . THR A 1 45 ? -3.954  -1.624  8.041   1.00 0.00 ? 45 THR A HA   2  
ATOM 1593  H HB   . THR A 1 45 ? -2.325  -2.660  5.754   1.00 0.00 ? 45 THR A HB   2  
ATOM 1594  H HG1  . THR A 1 45 ? -3.336  -4.363  7.112   1.00 0.00 ? 45 THR A HG1  2  
ATOM 1595  H HG21 . THR A 1 45 ? -1.057  -2.378  8.327   1.00 0.00 ? 45 THR A HG21 2  
ATOM 1596  H HG22 . THR A 1 45 ? -1.757  -0.863  7.755   1.00 0.00 ? 45 THR A HG22 2  
ATOM 1597  H HG23 . THR A 1 45 ? -0.589  -1.728  6.756   1.00 0.00 ? 45 THR A HG23 2  
ATOM 1598  N N    . ILE A 1 46 ? -3.676  -0.856  4.870   1.00 0.00 ? 46 ILE A N    2  
ATOM 1599  C CA   . ILE A 1 46 ? -3.824  0.229   3.906   1.00 0.00 ? 46 ILE A CA   2  
ATOM 1600  C C    . ILE A 1 46 ? -3.551  -0.246  2.473   1.00 0.00 ? 46 ILE A C    2  
ATOM 1601  O O    . ILE A 1 46 ? -2.401  -0.317  2.039   1.00 0.00 ? 46 ILE A O    2  
ATOM 1602  C CB   . ILE A 1 46 ? -2.909  1.441   4.268   1.00 0.00 ? 46 ILE A CB   2  
ATOM 1603  C CG1  . ILE A 1 46 ? -3.746  2.560   4.888   1.00 0.00 ? 46 ILE A CG1  2  
ATOM 1604  C CG2  . ILE A 1 46 ? -2.147  1.981   3.059   1.00 0.00 ? 46 ILE A CG2  2  
ATOM 1605  C CD1  . ILE A 1 46 ? -3.627  2.646   6.394   1.00 0.00 ? 46 ILE A CD1  2  
ATOM 1606  H H    . ILE A 1 46 ? -3.281  -1.693  4.587   1.00 0.00 ? 46 ILE A H    2  
ATOM 1607  H HA   . ILE A 1 46 ? -4.850  0.565   3.959   1.00 0.00 ? 46 ILE A HA   2  
ATOM 1608  H HB   . ILE A 1 46 ? -2.183  1.109   4.991   1.00 0.00 ? 46 ILE A HB   2  
ATOM 1609  H HG12 . ILE A 1 46 ? -3.428  3.506   4.476   1.00 0.00 ? 46 ILE A HG12 2  
ATOM 1610  H HG13 . ILE A 1 46 ? -4.786  2.398   4.643   1.00 0.00 ? 46 ILE A HG13 2  
ATOM 1611  H HG21 . ILE A 1 46 ? -1.853  3.003   3.247   1.00 0.00 ? 46 ILE A HG21 2  
ATOM 1612  H HG22 . ILE A 1 46 ? -2.781  1.944   2.186   1.00 0.00 ? 46 ILE A HG22 2  
ATOM 1613  H HG23 . ILE A 1 46 ? -1.267  1.379   2.890   1.00 0.00 ? 46 ILE A HG23 2  
ATOM 1614  H HD11 . ILE A 1 46 ? -3.101  3.550   6.662   1.00 0.00 ? 46 ILE A HD11 2  
ATOM 1615  H HD12 . ILE A 1 46 ? -3.082  1.790   6.762   1.00 0.00 ? 46 ILE A HD12 2  
ATOM 1616  H HD13 . ILE A 1 46 ? -4.614  2.661   6.832   1.00 0.00 ? 46 ILE A HD13 2  
ATOM 1617  N N    . CYS A 1 47 ? -4.618  -0.539  1.732   1.00 0.00 ? 47 CYS A N    2  
ATOM 1618  C CA   . CYS A 1 47 ? -4.481  -0.956  0.341   1.00 0.00 ? 47 CYS A CA   2  
ATOM 1619  C C    . CYS A 1 47 ? -4.633  0.266   -0.567  1.00 0.00 ? 47 CYS A C    2  
ATOM 1620  O O    . CYS A 1 47 ? -4.735  0.137   -1.787  1.00 0.00 ? 47 CYS A O    2  
ATOM 1621  C CB   . CYS A 1 47 ? -5.496  -2.065  -0.004  1.00 0.00 ? 47 CYS A CB   2  
ATOM 1622  S SG   . CYS A 1 47 ? -6.733  -1.652  -1.288  1.00 0.00 ? 47 CYS A SG   2  
ATOM 1623  H H    . CYS A 1 47 ? -5.513  -0.445  2.118   1.00 0.00 ? 47 CYS A H    2  
ATOM 1624  H HA   . CYS A 1 47 ? -3.482  -1.348  0.219   1.00 0.00 ? 47 CYS A HA   2  
ATOM 1625  H HB2  . CYS A 1 47 ? -4.956  -2.932  -0.351  1.00 0.00 ? 47 CYS A HB2  2  
ATOM 1626  H HB3  . CYS A 1 47 ? -6.035  -2.328  0.892   1.00 0.00 ? 47 CYS A HB3  2  
ATOM 1627  N N    . ARG A 1 48 ? -4.639  1.452   0.067   1.00 0.00 ? 48 ARG A N    2  
ATOM 1628  C CA   . ARG A 1 48 ? -4.772  2.741   -0.621  1.00 0.00 ? 48 ARG A CA   2  
ATOM 1629  C C    . ARG A 1 48 ? -4.695  2.603   -2.136  1.00 0.00 ? 48 ARG A C    2  
ATOM 1630  O O    . ARG A 1 48 ? -3.618  2.426   -2.703  1.00 0.00 ? 48 ARG A O    2  
ATOM 1631  C CB   . ARG A 1 48 ? -3.687  3.705   -0.130  1.00 0.00 ? 48 ARG A CB   2  
ATOM 1632  C CG   . ARG A 1 48 ? -3.713  3.933   1.372   1.00 0.00 ? 48 ARG A CG   2  
ATOM 1633  C CD   . ARG A 1 48 ? -4.383  5.251   1.724   1.00 0.00 ? 48 ARG A CD   2  
ATOM 1634  N NE   . ARG A 1 48 ? -5.312  5.111   2.842   1.00 0.00 ? 48 ARG A NE   2  
ATOM 1635  C CZ   . ARG A 1 48 ? -6.177  6.053   3.203   1.00 0.00 ? 48 ARG A CZ   2  
ATOM 1636  N NH1  . ARG A 1 48 ? -6.228  7.199   2.539   1.00 0.00 ? 48 ARG A NH1  2  
ATOM 1637  N NH2  . ARG A 1 48 ? -6.992  5.849   4.229   1.00 0.00 ? 48 ARG A NH2  2  
ATOM 1638  H H    . ARG A 1 48 ? -4.556  1.460   1.044   1.00 0.00 ? 48 ARG A H    2  
ATOM 1639  H HA   . ARG A 1 48 ? -5.730  3.151   -0.364  1.00 0.00 ? 48 ARG A HA   2  
ATOM 1640  H HB2  . ARG A 1 48 ? -2.721  3.305   -0.394  1.00 0.00 ? 48 ARG A HB2  2  
ATOM 1641  H HB3  . ARG A 1 48 ? -3.818  4.659   -0.618  1.00 0.00 ? 48 ARG A HB3  2  
ATOM 1642  H HG2  . ARG A 1 48 ? -4.259  3.127   1.840   1.00 0.00 ? 48 ARG A HG2  2  
ATOM 1643  H HG3  . ARG A 1 48 ? -2.698  3.945   1.742   1.00 0.00 ? 48 ARG A HG3  2  
ATOM 1644  H HD2  . ARG A 1 48 ? -3.621  5.968   1.990   1.00 0.00 ? 48 ARG A HD2  2  
ATOM 1645  H HD3  . ARG A 1 48 ? -4.925  5.607   0.860   1.00 0.00 ? 48 ARG A HD3  2  
ATOM 1646  H HE   . ARG A 1 48 ? -5.290  4.272   3.349   1.00 0.00 ? 48 ARG A HE   2  
ATOM 1647  H HH11 . ARG A 1 48 ? -5.615  7.357   1.765   1.00 0.00 ? 48 ARG A HH11 2  
ATOM 1648  H HH12 . ARG A 1 48 ? -6.880  7.907   2.812   1.00 0.00 ? 48 ARG A HH12 2  
ATOM 1649  H HH21 . ARG A 1 48 ? -6.956  4.986   4.733   1.00 0.00 ? 48 ARG A HH21 2  
ATOM 1650  H HH22 . ARG A 1 48 ? -7.642  6.559   4.500   1.00 0.00 ? 48 ARG A HH22 2  
ATOM 1651  N N    . ARG A 1 49 ? -5.854  2.688   -2.785  1.00 0.00 ? 49 ARG A N    2  
ATOM 1652  C CA   . ARG A 1 49 ? -5.928  2.574   -4.237  1.00 0.00 ? 49 ARG A CA   2  
ATOM 1653  C C    . ARG A 1 49 ? -7.318  2.947   -4.743  1.00 0.00 ? 49 ARG A C    2  
ATOM 1654  O O    . ARG A 1 49 ? -7.812  2.372   -5.713  1.00 0.00 ? 49 ARG A O    2  
ATOM 1655  C CB   . ARG A 1 49 ? -5.578  1.151   -4.676  1.00 0.00 ? 49 ARG A CB   2  
ATOM 1656  C CG   . ARG A 1 49 ? -4.607  1.097   -5.844  1.00 0.00 ? 49 ARG A CG   2  
ATOM 1657  C CD   . ARG A 1 49 ? -5.112  0.180   -6.946  1.00 0.00 ? 49 ARG A CD   2  
ATOM 1658  N NE   . ARG A 1 49 ? -5.451  0.917   -8.160  1.00 0.00 ? 49 ARG A NE   2  
ATOM 1659  C CZ   . ARG A 1 49 ? -5.833  0.335   -9.292  1.00 0.00 ? 49 ARG A CZ   2  
ATOM 1660  N NH1  . ARG A 1 49 ? -5.925  -0.986  -9.361  1.00 0.00 ? 49 ARG A NH1  2  
ATOM 1661  N NH2  . ARG A 1 49 ? -6.124  1.072   -10.355 1.00 0.00 ? 49 ARG A NH2  2  
ATOM 1662  H H    . ARG A 1 49 ? -6.680  2.832   -2.274  1.00 0.00 ? 49 ARG A H    2  
ATOM 1663  H HA   . ARG A 1 49 ? -5.208  3.259   -4.660  1.00 0.00 ? 49 ARG A HA   2  
ATOM 1664  H HB2  . ARG A 1 49 ? -5.135  0.628   -3.842  1.00 0.00 ? 49 ARG A HB2  2  
ATOM 1665  H HB3  . ARG A 1 49 ? -6.486  0.644   -4.967  1.00 0.00 ? 49 ARG A HB3  2  
ATOM 1666  H HG2  . ARG A 1 49 ? -4.485  2.091   -6.245  1.00 0.00 ? 49 ARG A HG2  2  
ATOM 1667  H HG3  . ARG A 1 49 ? -3.655  0.729   -5.490  1.00 0.00 ? 49 ARG A HG3  2  
ATOM 1668  H HD2  . ARG A 1 49 ? -4.342  -0.541  -7.178  1.00 0.00 ? 49 ARG A HD2  2  
ATOM 1669  H HD3  . ARG A 1 49 ? -5.992  -0.337  -6.592  1.00 0.00 ? 49 ARG A HD3  2  
ATOM 1670  H HE   . ARG A 1 49 ? -5.390  1.895   -8.129  1.00 0.00 ? 49 ARG A HE   2  
ATOM 1671  H HH11 . ARG A 1 49 ? -5.707  -1.545  -8.562  1.00 0.00 ? 49 ARG A HH11 2  
ATOM 1672  H HH12 . ARG A 1 49 ? -6.213  -1.423  -10.214 1.00 0.00 ? 49 ARG A HH12 2  
ATOM 1673  H HH21 . ARG A 1 49 ? -6.057  2.068   -10.306 1.00 0.00 ? 49 ARG A HH21 2  
ATOM 1674  H HH22 . ARG A 1 49 ? -6.411  0.631   -11.205 1.00 0.00 ? 49 ARG A HH22 2  
ATOM 1675  N N    . ALA A 1 50 ? -7.944  3.914   -4.079  1.00 0.00 ? 50 ALA A N    2  
ATOM 1676  C CA   . ALA A 1 50 ? -9.277  4.363   -4.462  1.00 0.00 ? 50 ALA A CA   2  
ATOM 1677  C C    . ALA A 1 50 ? -9.204  5.576   -5.382  1.00 0.00 ? 50 ALA A C    2  
ATOM 1678  O O    . ALA A 1 50 ? -8.195  5.800   -6.052  1.00 0.00 ? 50 ALA A O    2  
ATOM 1679  C CB   . ALA A 1 50 ? -10.101 4.685   -3.225  1.00 0.00 ? 50 ALA A CB   2  
ATOM 1680  H H    . ALA A 1 50 ? -7.499  4.335   -3.314  1.00 0.00 ? 50 ALA A H    2  
ATOM 1681  H HA   . ALA A 1 50 ? -9.763  3.554   -4.988  1.00 0.00 ? 50 ALA A HA   2  
ATOM 1682  H HB1  . ALA A 1 50 ? -9.565  4.367   -2.343  1.00 0.00 ? 50 ALA A HB1  2  
ATOM 1683  H HB2  . ALA A 1 50 ? -11.047 4.167   -3.277  1.00 0.00 ? 50 ALA A HB2  2  
ATOM 1684  H HB3  . ALA A 1 50 ? -10.275 5.750   -3.176  1.00 0.00 ? 50 ALA A HB3  2  
ATOM 1685  N N    . ARG A 1 51 ? -10.278 6.358   -5.409  1.00 0.00 ? 51 ARG A N    2  
ATOM 1686  C CA   . ARG A 1 51 ? -10.334 7.550   -6.247  1.00 0.00 ? 51 ARG A CA   2  
ATOM 1687  C C    . ARG A 1 51 ? -11.478 8.465   -5.815  1.00 0.00 ? 51 ARG A C    2  
ATOM 1688  O O    . ARG A 1 51 ? -11.309 9.308   -4.935  1.00 0.00 ? 51 ARG A O    2  
ATOM 1689  C CB   . ARG A 1 51 ? -10.500 7.159   -7.717  1.00 0.00 ? 51 ARG A CB   2  
ATOM 1690  C CG   . ARG A 1 51 ? -11.323 5.898   -7.922  1.00 0.00 ? 51 ARG A CG   2  
ATOM 1691  C CD   . ARG A 1 51 ? -10.440 4.703   -8.244  1.00 0.00 ? 51 ARG A CD   2  
ATOM 1692  N NE   . ARG A 1 51 ? -9.674  4.903   -9.471  1.00 0.00 ? 51 ARG A NE   2  
ATOM 1693  C CZ   . ARG A 1 51 ? -10.161 4.681   -10.687 1.00 0.00 ? 51 ARG A CZ   2  
ATOM 1694  N NH1  . ARG A 1 51 ? -11.407 4.253   -10.837 1.00 0.00 ? 51 ARG A NH1  2  
ATOM 1695  N NH2  . ARG A 1 51 ? -9.403  4.886   -11.755 1.00 0.00 ? 51 ARG A NH2  2  
ATOM 1696  H H    . ARG A 1 51 ? -11.051 6.128   -4.852  1.00 0.00 ? 51 ARG A H    2  
ATOM 1697  H HA   . ARG A 1 51 ? -9.402  8.081   -6.128  1.00 0.00 ? 51 ARG A HA   2  
ATOM 1698  H HB2  . ARG A 1 51 ? -10.986 7.969   -8.240  1.00 0.00 ? 51 ARG A HB2  2  
ATOM 1699  H HB3  . ARG A 1 51 ? -9.523  7.000   -8.147  1.00 0.00 ? 51 ARG A HB3  2  
ATOM 1700  H HG2  . ARG A 1 51 ? -11.877 5.690   -7.019  1.00 0.00 ? 51 ARG A HG2  2  
ATOM 1701  H HG3  . ARG A 1 51 ? -12.010 6.057   -8.740  1.00 0.00 ? 51 ARG A HG3  2  
ATOM 1702  H HD2  . ARG A 1 51 ? -9.754  4.547   -7.425  1.00 0.00 ? 51 ARG A HD2  2  
ATOM 1703  H HD3  . ARG A 1 51 ? -11.066 3.830   -8.360  1.00 0.00 ? 51 ARG A HD3  2  
ATOM 1704  H HE   . ARG A 1 51 ? -8.751  5.220   -9.383  1.00 0.00 ? 51 ARG A HE   2  
ATOM 1705  H HH11 . ARG A 1 51 ? -11.982 4.097   -10.033 1.00 0.00 ? 51 ARG A HH11 2  
ATOM 1706  H HH12 . ARG A 1 51 ? -11.772 4.086   -11.753 1.00 0.00 ? 51 ARG A HH12 2  
ATOM 1707  H HH21 . ARG A 1 51 ? -8.463  5.209   -11.646 1.00 0.00 ? 51 ARG A HH21 2  
ATOM 1708  H HH22 . ARG A 1 51 ? -9.770  4.718   -12.669 1.00 0.00 ? 51 ARG A HH22 2  
ATOM 1709  N N    . GLY A 1 52 ? -12.640 8.291   -6.439  1.00 0.00 ? 52 GLY A N    2  
ATOM 1710  C CA   . GLY A 1 52 ? -13.793 9.108   -6.105  1.00 0.00 ? 52 GLY A CA   2  
ATOM 1711  C C    . GLY A 1 52 ? -13.413 10.532  -5.748  1.00 0.00 ? 52 GLY A C    2  
ATOM 1712  O O    . GLY A 1 52 ? -13.215 11.368  -6.629  1.00 0.00 ? 52 GLY A O    2  
ATOM 1713  H H    . GLY A 1 52 ? -12.716 7.603   -7.132  1.00 0.00 ? 52 GLY A H    2  
ATOM 1714  H HA2  . GLY A 1 52 ? -14.463 9.127   -6.952  1.00 0.00 ? 52 GLY A HA2  2  
ATOM 1715  H HA3  . GLY A 1 52 ? -14.304 8.662   -5.265  1.00 0.00 ? 52 GLY A HA3  2  
ATOM 1716  N N    . ASP A 1 53 ? -13.310 10.806  -4.452  1.00 0.00 ? 53 ASP A N    2  
ATOM 1717  C CA   . ASP A 1 53 ? -12.950 12.137  -3.978  1.00 0.00 ? 53 ASP A CA   2  
ATOM 1718  C C    . ASP A 1 53 ? -11.661 12.093  -3.163  1.00 0.00 ? 53 ASP A C    2  
ATOM 1719  O O    . ASP A 1 53 ? -11.079 13.131  -2.846  1.00 0.00 ? 53 ASP A O    2  
ATOM 1720  C CB   . ASP A 1 53 ? -14.082 12.724  -3.134  1.00 0.00 ? 53 ASP A CB   2  
ATOM 1721  C CG   . ASP A 1 53 ? -15.342 12.963  -3.943  1.00 0.00 ? 53 ASP A CG   2  
ATOM 1722  O OD1  . ASP A 1 53 ? -15.312 12.731  -5.170  1.00 0.00 ? 53 ASP A OD1  2  
ATOM 1723  O OD2  . ASP A 1 53 ? -16.357 13.383  -3.350  1.00 0.00 ? 53 ASP A OD2  2  
ATOM 1724  H H    . ASP A 1 53 ? -13.478 10.095  -3.798  1.00 0.00 ? 53 ASP A H    2  
ATOM 1725  H HA   . ASP A 1 53 ? -12.794 12.765  -4.842  1.00 0.00 ? 53 ASP A HA   2  
ATOM 1726  H HB2  . ASP A 1 53 ? -14.316 12.041  -2.331  1.00 0.00 ? 53 ASP A HB2  2  
ATOM 1727  H HB3  . ASP A 1 53 ? -13.759 13.666  -2.716  1.00 0.00 ? 53 ASP A HB3  2  
ATOM 1728  N N    . ASP A 1 54 ? -11.218 10.885  -2.828  1.00 0.00 ? 54 ASP A N    2  
ATOM 1729  C CA   . ASP A 1 54 ? -9.997  10.705  -2.051  1.00 0.00 ? 54 ASP A CA   2  
ATOM 1730  C C    . ASP A 1 54 ? -9.263  9.441   -2.484  1.00 0.00 ? 54 ASP A C    2  
ATOM 1731  O O    . ASP A 1 54 ? -9.392  8.998   -3.625  1.00 0.00 ? 54 ASP A O    2  
ATOM 1732  C CB   . ASP A 1 54 ? -10.321 10.636  -0.558  1.00 0.00 ? 54 ASP A CB   2  
ATOM 1733  C CG   . ASP A 1 54 ? -11.392 11.629  -0.152  1.00 0.00 ? 54 ASP A CG   2  
ATOM 1734  O OD1  . ASP A 1 54 ? -11.147 12.848  -0.269  1.00 0.00 ? 54 ASP A OD1  2  
ATOM 1735  O OD2  . ASP A 1 54 ? -12.476 11.188  0.285   1.00 0.00 ? 54 ASP A OD2  2  
ATOM 1736  H H    . ASP A 1 54 ? -11.724 10.095  -3.111  1.00 0.00 ? 54 ASP A H    2  
ATOM 1737  H HA   . ASP A 1 54 ? -9.360  11.558  -2.233  1.00 0.00 ? 54 ASP A HA   2  
ATOM 1738  H HB2  . ASP A 1 54 ? -10.668 9.642   -0.317  1.00 0.00 ? 54 ASP A HB2  2  
ATOM 1739  H HB3  . ASP A 1 54 ? -9.426  10.847  0.008   1.00 0.00 ? 54 ASP A HB3  2  
ATOM 1740  N N    . LEU A 1 55 ? -8.492  8.865   -1.567  1.00 0.00 ? 55 LEU A N    2  
ATOM 1741  C CA   . LEU A 1 55 ? -7.737  7.652   -1.860  1.00 0.00 ? 55 LEU A CA   2  
ATOM 1742  C C    . LEU A 1 55 ? -7.565  6.799   -0.606  1.00 0.00 ? 55 LEU A C    2  
ATOM 1743  O O    . LEU A 1 55 ? -6.508  6.811   0.024   1.00 0.00 ? 55 LEU A O    2  
ATOM 1744  C CB   . LEU A 1 55 ? -6.367  8.008   -2.440  1.00 0.00 ? 55 LEU A CB   2  
ATOM 1745  C CG   . LEU A 1 55 ? -6.366  9.177   -3.425  1.00 0.00 ? 55 LEU A CG   2  
ATOM 1746  C CD1  . LEU A 1 55 ? -4.944  9.632   -3.711  1.00 0.00 ? 55 LEU A CD1  2  
ATOM 1747  C CD2  . LEU A 1 55 ? -7.073  8.788   -4.714  1.00 0.00 ? 55 LEU A CD2  2  
ATOM 1748  H H    . LEU A 1 55 ? -8.428  9.265   -0.675  1.00 0.00 ? 55 LEU A H    2  
ATOM 1749  H HA   . LEU A 1 55 ? -8.292  7.085   -2.592  1.00 0.00 ? 55 LEU A HA   2  
ATOM 1750  H HB2  . LEU A 1 55 ? -5.706  8.252   -1.621  1.00 0.00 ? 55 LEU A HB2  2  
ATOM 1751  H HB3  . LEU A 1 55 ? -5.978  7.138   -2.948  1.00 0.00 ? 55 LEU A HB3  2  
ATOM 1752  H HG   . LEU A 1 55 ? -6.900  10.008  -2.987  1.00 0.00 ? 55 LEU A HG   2  
ATOM 1753  H HD11 . LEU A 1 55 ? -4.708  10.485  -3.092  1.00 0.00 ? 55 LEU A HD11 2  
ATOM 1754  H HD12 . LEU A 1 55 ? -4.857  9.907   -4.751  1.00 0.00 ? 55 LEU A HD12 2  
ATOM 1755  H HD13 . LEU A 1 55 ? -4.258  8.828   -3.492  1.00 0.00 ? 55 LEU A HD13 2  
ATOM 1756  H HD21 . LEU A 1 55 ? -6.344  8.462   -5.441  1.00 0.00 ? 55 LEU A HD21 2  
ATOM 1757  H HD22 . LEU A 1 55 ? -7.610  9.642   -5.102  1.00 0.00 ? 55 LEU A HD22 2  
ATOM 1758  H HD23 . LEU A 1 55 ? -7.768  7.986   -4.516  1.00 0.00 ? 55 LEU A HD23 2  
ATOM 1759  N N    . ASP A 1 56 ? -8.610  6.059   -0.252  1.00 0.00 ? 56 ASP A N    2  
ATOM 1760  C CA   . ASP A 1 56 ? -8.574  5.198   0.925   1.00 0.00 ? 56 ASP A CA   2  
ATOM 1761  C C    . ASP A 1 56 ? -8.544  3.728   0.519   1.00 0.00 ? 56 ASP A C    2  
ATOM 1762  O O    . ASP A 1 56 ? -8.695  3.399   -0.660  1.00 0.00 ? 56 ASP A O    2  
ATOM 1763  C CB   . ASP A 1 56 ? -9.785  5.468   1.819   1.00 0.00 ? 56 ASP A CB   2  
ATOM 1764  C CG   . ASP A 1 56 ? -9.615  6.717   2.662   1.00 0.00 ? 56 ASP A CG   2  
ATOM 1765  O OD1  . ASP A 1 56 ? -8.743  7.546   2.325   1.00 0.00 ? 56 ASP A OD1  2  
ATOM 1766  O OD2  . ASP A 1 56 ? -10.353 6.866   3.659   1.00 0.00 ? 56 ASP A OD2  2  
ATOM 1767  H H    . ASP A 1 56 ? -9.425  6.091   -0.795  1.00 0.00 ? 56 ASP A H    2  
ATOM 1768  H HA   . ASP A 1 56 ? -7.673  5.425   1.475   1.00 0.00 ? 56 ASP A HA   2  
ATOM 1769  H HB2  . ASP A 1 56 ? -10.661 5.592   1.200   1.00 0.00 ? 56 ASP A HB2  2  
ATOM 1770  H HB3  . ASP A 1 56 ? -9.932  4.627   2.480   1.00 0.00 ? 56 ASP A HB3  2  
ATOM 1771  N N    . ASP A 1 57 ? -8.348  2.850   1.501   1.00 0.00 ? 57 ASP A N    2  
ATOM 1772  C CA   . ASP A 1 57 ? -8.298  1.413   1.249   1.00 0.00 ? 57 ASP A CA   2  
ATOM 1773  C C    . ASP A 1 57 ? -7.544  0.685   2.361   1.00 0.00 ? 57 ASP A C    2  
ATOM 1774  O O    . ASP A 1 57 ? -6.519  1.167   2.844   1.00 0.00 ? 57 ASP A O    2  
ATOM 1775  C CB   . ASP A 1 57 ? -7.628  1.136   -0.092  1.00 0.00 ? 57 ASP A CB   2  
ATOM 1776  C CG   . ASP A 1 57 ? -8.609  0.650   -1.141  1.00 0.00 ? 57 ASP A CG   2  
ATOM 1777  O OD1  . ASP A 1 57 ? -9.800  0.480   -0.806  1.00 0.00 ? 57 ASP A OD1  2  
ATOM 1778  O OD2  . ASP A 1 57 ? -8.187  0.442   -2.298  1.00 0.00 ? 57 ASP A OD2  2  
ATOM 1779  H H    . ASP A 1 57 ? -8.235  3.177   2.418   1.00 0.00 ? 57 ASP A H    2  
ATOM 1780  H HA   . ASP A 1 57 ? -9.313  1.046   1.218   1.00 0.00 ? 57 ASP A HA   2  
ATOM 1781  H HB2  . ASP A 1 57 ? -7.165  2.040   -0.451  1.00 0.00 ? 57 ASP A HB2  2  
ATOM 1782  H HB3  . ASP A 1 57 ? -6.872  0.385   0.049   1.00 0.00 ? 57 ASP A HB3  2  
ATOM 1783  N N    . TYR A 1 58 ? -8.061  -0.477  2.761   1.00 0.00 ? 58 TYR A N    2  
ATOM 1784  C CA   . TYR A 1 58 ? -7.444  -1.272  3.822   1.00 0.00 ? 58 TYR A CA   2  
ATOM 1785  C C    . TYR A 1 58 ? -6.816  -2.559  3.283   1.00 0.00 ? 58 TYR A C    2  
ATOM 1786  O O    . TYR A 1 58 ? -7.296  -3.144  2.313   1.00 0.00 ? 58 TYR A O    2  
ATOM 1787  C CB   . TYR A 1 58 ? -8.475  -1.605  4.900   1.00 0.00 ? 58 TYR A CB   2  
ATOM 1788  C CG   . TYR A 1 58 ? -8.716  -0.472  5.870   1.00 0.00 ? 58 TYR A CG   2  
ATOM 1789  C CD1  . TYR A 1 58 ? -7.655  0.149   6.516   1.00 0.00 ? 58 TYR A CD1  2  
ATOM 1790  C CD2  . TYR A 1 58 ? -10.002 -0.021  6.135   1.00 0.00 ? 58 TYR A CD2  2  
ATOM 1791  C CE1  . TYR A 1 58 ? -7.869  1.189   7.400   1.00 0.00 ? 58 TYR A CE1  2  
ATOM 1792  C CE2  . TYR A 1 58 ? -10.225 1.018   7.019   1.00 0.00 ? 58 TYR A CE2  2  
ATOM 1793  C CZ   . TYR A 1 58 ? -9.156  1.620   7.648   1.00 0.00 ? 58 TYR A CZ   2  
ATOM 1794  O OH   . TYR A 1 58 ? -9.374  2.655   8.528   1.00 0.00 ? 58 TYR A OH   2  
ATOM 1795  H H    . TYR A 1 58 ? -8.878  -0.805  2.335   1.00 0.00 ? 58 TYR A H    2  
ATOM 1796  H HA   . TYR A 1 58 ? -6.664  -0.672  4.266   1.00 0.00 ? 58 TYR A HA   2  
ATOM 1797  H HB2  . TYR A 1 58 ? -9.416  -1.844  4.428   1.00 0.00 ? 58 TYR A HB2  2  
ATOM 1798  H HB3  . TYR A 1 58 ? -8.134  -2.459  5.464   1.00 0.00 ? 58 TYR A HB3  2  
ATOM 1799  H HD1  . TYR A 1 58 ? -6.649  -0.191  6.320   1.00 0.00 ? 58 TYR A HD1  2  
ATOM 1800  H HD2  . TYR A 1 58 ? -10.837 -0.497  5.642   1.00 0.00 ? 58 TYR A HD2  2  
ATOM 1801  H HE1  . TYR A 1 58 ? -7.031  1.660   7.892   1.00 0.00 ? 58 TYR A HE1  2  
ATOM 1802  H HE2  . TYR A 1 58 ? -11.232 1.355   7.212   1.00 0.00 ? 58 TYR A HE2  2  
ATOM 1803  H HH   . TYR A 1 58 ? -10.229 3.053   8.349   1.00 0.00 ? 58 TYR A HH   2  
ATOM 1804  N N    . CYS A 1 59 ? -5.730  -2.977  3.928   1.00 0.00 ? 59 CYS A N    2  
ATOM 1805  C CA   . CYS A 1 59 ? -4.989  -4.179  3.540   1.00 0.00 ? 59 CYS A CA   2  
ATOM 1806  C C    . CYS A 1 59 ? -5.519  -5.436  4.224   1.00 0.00 ? 59 CYS A C    2  
ATOM 1807  O O    . CYS A 1 59 ? -5.632  -5.483  5.446   1.00 0.00 ? 59 CYS A O    2  
ATOM 1808  C CB   . CYS A 1 59 ? -3.527  -3.995  3.911   1.00 0.00 ? 59 CYS A CB   2  
ATOM 1809  S SG   . CYS A 1 59 ? -2.543  -3.090  2.667   1.00 0.00 ? 59 CYS A SG   2  
ATOM 1810  H H    . CYS A 1 59 ? -5.405  -2.451  4.688   1.00 0.00 ? 59 CYS A H    2  
ATOM 1811  H HA   . CYS A 1 59 ? -5.066  -4.296  2.474   1.00 0.00 ? 59 CYS A HA   2  
ATOM 1812  H HB2  . CYS A 1 59 ? -3.482  -3.447  4.830   1.00 0.00 ? 59 CYS A HB2  2  
ATOM 1813  H HB3  . CYS A 1 59 ? -3.076  -4.959  4.062   1.00 0.00 ? 59 CYS A HB3  2  
ATOM 1814  N N    . ASN A 1 60 ? -5.819  -6.461  3.428   1.00 0.00 ? 60 ASN A N    2  
ATOM 1815  C CA   . ASN A 1 60 ? -6.317  -7.738  3.946   1.00 0.00 ? 60 ASN A CA   2  
ATOM 1816  C C    . ASN A 1 60 ? -5.638  -8.879  3.205   1.00 0.00 ? 60 ASN A C    2  
ATOM 1817  O O    . ASN A 1 60 ? -4.723  -9.518  3.717   1.00 0.00 ? 60 ASN A O    2  
ATOM 1818  C CB   . ASN A 1 60 ? -7.839  -7.824  3.794   1.00 0.00 ? 60 ASN A CB   2  
ATOM 1819  C CG   . ASN A 1 60 ? -8.518  -6.500  4.077   1.00 0.00 ? 60 ASN A CG   2  
ATOM 1820  O OD1  . ASN A 1 60 ? -9.496  -6.138  3.424   1.00 0.00 ? 60 ASN A OD1  2  
ATOM 1821  N ND2  . ASN A 1 60 ? -8.001  -5.768  5.056   1.00 0.00 ? 60 ASN A ND2  2  
ATOM 1822  H H    . ASN A 1 60 ? -5.684  -6.365  2.468   1.00 0.00 ? 60 ASN A H    2  
ATOM 1823  H HA   . ASN A 1 60 ? -6.058  -7.800  4.981   1.00 0.00 ? 60 ASN A HA   2  
ATOM 1824  H HB2  . ASN A 1 60 ? -8.083  -8.123  2.787   1.00 0.00 ? 60 ASN A HB2  2  
ATOM 1825  H HB3  . ASN A 1 60 ? -8.223  -8.559  4.487   1.00 0.00 ? 60 ASN A HB3  2  
ATOM 1826  H HD21 . ASN A 1 60 ? -7.224  -6.122  5.542   1.00 0.00 ? 60 ASN A HD21 2  
ATOM 1827  H HD22 . ASN A 1 60 ? -8.401  -4.895  5.239   1.00 0.00 ? 60 ASN A HD22 2  
ATOM 1828  N N    . GLY A 1 61 ? -6.053  -9.076  1.970   1.00 0.00 ? 61 GLY A N    2  
ATOM 1829  C CA   . GLY A 1 61 ? -5.441  -10.080 1.122   1.00 0.00 ? 61 GLY A CA   2  
ATOM 1830  C C    . GLY A 1 61 ? -4.477  -9.390  0.185   1.00 0.00 ? 61 GLY A C    2  
ATOM 1831  O O    . GLY A 1 61 ? -4.298  -9.779  -0.968  1.00 0.00 ? 61 GLY A O    2  
ATOM 1832  H H    . GLY A 1 61 ? -6.750  -8.495  1.613   1.00 0.00 ? 61 GLY A H    2  
ATOM 1833  H HA2  . GLY A 1 61 ? -4.910  -10.797 1.733   1.00 0.00 ? 61 GLY A HA2  2  
ATOM 1834  H HA3  . GLY A 1 61 ? -6.202  -10.584 0.545   1.00 0.00 ? 61 GLY A HA3  2  
ATOM 1835  N N    . ILE A 1 62 ? -3.907  -8.313  0.713   1.00 0.00 ? 62 ILE A N    2  
ATOM 1836  C CA   . ILE A 1 62 ? -2.988  -7.444  -0.004  1.00 0.00 ? 62 ILE A CA   2  
ATOM 1837  C C    . ILE A 1 62 ? -1.584  -8.008  -0.191  1.00 0.00 ? 62 ILE A C    2  
ATOM 1838  O O    . ILE A 1 62 ? -0.688  -7.751  0.612   1.00 0.00 ? 62 ILE A O    2  
ATOM 1839  C CB   . ILE A 1 62 ? -2.855  -6.107  0.737   1.00 0.00 ? 62 ILE A CB   2  
ATOM 1840  C CG1  . ILE A 1 62 ? -2.735  -6.317  2.254   1.00 0.00 ? 62 ILE A CG1  2  
ATOM 1841  C CG2  . ILE A 1 62 ? -4.050  -5.217  0.437   1.00 0.00 ? 62 ILE A CG2  2  
ATOM 1842  C CD1  . ILE A 1 62 ? -2.077  -7.606  2.704   1.00 0.00 ? 62 ILE A CD1  2  
ATOM 1843  H H    . ILE A 1 62 ? -4.148  -8.067  1.628   1.00 0.00 ? 62 ILE A H    2  
ATOM 1844  H HA   . ILE A 1 62 ? -3.413  -7.240  -0.974  1.00 0.00 ? 62 ILE A HA   2  
ATOM 1845  H HB   . ILE A 1 62 ? -1.967  -5.609  0.379   1.00 0.00 ? 62 ILE A HB   2  
ATOM 1846  H HG12 . ILE A 1 62 ? -2.149  -5.519  2.657   1.00 0.00 ? 62 ILE A HG12 2  
ATOM 1847  H HG13 . ILE A 1 62 ? -3.723  -6.282  2.691   1.00 0.00 ? 62 ILE A HG13 2  
ATOM 1848  H HG21 . ILE A 1 62 ? -4.877  -5.505  1.069   1.00 0.00 ? 62 ILE A HG21 2  
ATOM 1849  H HG22 . ILE A 1 62 ? -4.333  -5.329  -0.597  1.00 0.00 ? 62 ILE A HG22 2  
ATOM 1850  H HG23 . ILE A 1 62 ? -3.792  -4.187  0.633   1.00 0.00 ? 62 ILE A HG23 2  
ATOM 1851  H HD11 . ILE A 1 62 ? -2.486  -7.897  3.660   1.00 0.00 ? 62 ILE A HD11 2  
ATOM 1852  H HD12 . ILE A 1 62 ? -1.015  -7.446  2.805   1.00 0.00 ? 62 ILE A HD12 2  
ATOM 1853  H HD13 . ILE A 1 62 ? -2.253  -8.385  1.988   1.00 0.00 ? 62 ILE A HD13 2  
ATOM 1854  N N    . SER A 1 63 ? -1.367  -8.705  -1.288  1.00 0.00 ? 63 SER A N    2  
ATOM 1855  C CA   . SER A 1 63 ? -0.042  -9.210  -1.593  1.00 0.00 ? 63 SER A CA   2  
ATOM 1856  C C    . SER A 1 63 ? 0.590   -8.279  -2.610  1.00 0.00 ? 63 SER A C    2  
ATOM 1857  O O    . SER A 1 63 ? 1.275   -8.706  -3.540  1.00 0.00 ? 63 SER A O    2  
ATOM 1858  C CB   . SER A 1 63 ? -0.104  -10.630 -2.130  1.00 0.00 ? 63 SER A CB   2  
ATOM 1859  O OG   . SER A 1 63 ? -1.063  -10.747 -3.168  1.00 0.00 ? 63 SER A OG   2  
ATOM 1860  H H    . SER A 1 63 ? -2.093  -8.834  -1.932  1.00 0.00 ? 63 SER A H    2  
ATOM 1861  H HA   . SER A 1 63 ? 0.544   -9.192  -0.684  1.00 0.00 ? 63 SER A HA   2  
ATOM 1862  H HB2  . SER A 1 63 ? 0.865   -10.901 -2.517  1.00 0.00 ? 63 SER A HB2  2  
ATOM 1863  H HB3  . SER A 1 63 ? -0.374  -11.296 -1.326  1.00 0.00 ? 63 SER A HB3  2  
ATOM 1864  H HG   . SER A 1 63 ? -1.159  -9.901  -3.612  1.00 0.00 ? 63 SER A HG   2  
ATOM 1865  N N    . ALA A 1 64 ? 0.298   -6.995  -2.419  1.00 0.00 ? 64 ALA A N    2  
ATOM 1866  C CA   . ALA A 1 64 ? 0.758   -5.928  -3.291  1.00 0.00 ? 64 ALA A CA   2  
ATOM 1867  C C    . ALA A 1 64 ? -0.374  -5.499  -4.214  1.00 0.00 ? 64 ALA A C    2  
ATOM 1868  O O    . ALA A 1 64 ? -0.152  -4.891  -5.261  1.00 0.00 ? 64 ALA A O    2  
ATOM 1869  C CB   . ALA A 1 64 ? 1.984   -6.336  -4.085  1.00 0.00 ? 64 ALA A CB   2  
ATOM 1870  H H    . ALA A 1 64 ? -0.279  -6.758  -1.665  1.00 0.00 ? 64 ALA A H    2  
ATOM 1871  H HA   . ALA A 1 64 ? 1.029   -5.092  -2.664  1.00 0.00 ? 64 ALA A HA   2  
ATOM 1872  H HB1  . ALA A 1 64 ? 2.525   -5.451  -4.369  1.00 0.00 ? 64 ALA A HB1  2  
ATOM 1873  H HB2  . ALA A 1 64 ? 1.681   -6.871  -4.968  1.00 0.00 ? 64 ALA A HB2  2  
ATOM 1874  H HB3  . ALA A 1 64 ? 2.616   -6.964  -3.477  1.00 0.00 ? 64 ALA A HB3  2  
ATOM 1875  N N    . GLY A 1 65 ? -1.598  -5.817  -3.794  1.00 0.00 ? 65 GLY A N    2  
ATOM 1876  C CA   . GLY A 1 65 ? -2.778  -5.464  -4.557  1.00 0.00 ? 65 GLY A CA   2  
ATOM 1877  C C    . GLY A 1 65 ? -3.856  -4.874  -3.668  1.00 0.00 ? 65 GLY A C    2  
ATOM 1878  O O    . GLY A 1 65 ? -3.662  -3.816  -3.080  1.00 0.00 ? 65 GLY A O    2  
ATOM 1879  H H    . GLY A 1 65 ? -1.700  -6.294  -2.944  1.00 0.00 ? 65 GLY A H    2  
ATOM 1880  H HA2  . GLY A 1 65 ? -2.507  -4.741  -5.312  1.00 0.00 ? 65 GLY A HA2  2  
ATOM 1881  H HA3  . GLY A 1 65 ? -3.166  -6.350  -5.038  1.00 0.00 ? 65 GLY A HA3  2  
ATOM 1882  N N    . CYS A 1 66 ? -4.987  -5.563  -3.558  1.00 0.00 ? 66 CYS A N    2  
ATOM 1883  C CA   . CYS A 1 66 ? -6.091  -5.097  -2.719  1.00 0.00 ? 66 CYS A CA   2  
ATOM 1884  C C    . CYS A 1 66 ? -7.121  -6.199  -2.490  1.00 0.00 ? 66 CYS A C    2  
ATOM 1885  O O    . CYS A 1 66 ? -7.409  -6.992  -3.386  1.00 0.00 ? 66 CYS A O    2  
ATOM 1886  C CB   . CYS A 1 66 ? -6.766  -3.874  -3.344  1.00 0.00 ? 66 CYS A CB   2  
ATOM 1887  S SG   . CYS A 1 66 ? -5.904  -2.302  -3.023  1.00 0.00 ? 66 CYS A SG   2  
ATOM 1888  H H    . CYS A 1 66 ? -5.079  -6.409  -4.042  1.00 0.00 ? 66 CYS A H    2  
ATOM 1889  H HA   . CYS A 1 66 ? -5.677  -4.812  -1.764  1.00 0.00 ? 66 CYS A HA   2  
ATOM 1890  H HB2  . CYS A 1 66 ? -6.816  -4.008  -4.414  1.00 0.00 ? 66 CYS A HB2  2  
ATOM 1891  H HB3  . CYS A 1 66 ? -7.768  -3.786  -2.950  1.00 0.00 ? 66 CYS A HB3  2  
ATOM 1892  N N    . PRO A 1 67 ? -7.691  -6.255  -1.275  1.00 0.00 ? 67 PRO A N    2  
ATOM 1893  C CA   . PRO A 1 67 ? -8.697  -7.259  -0.914  1.00 0.00 ? 67 PRO A CA   2  
ATOM 1894  C C    . PRO A 1 67 ? -9.905  -7.227  -1.846  1.00 0.00 ? 67 PRO A C    2  
ATOM 1895  O O    . PRO A 1 67 ? -9.771  -6.970  -3.043  1.00 0.00 ? 67 PRO A O    2  
ATOM 1896  C CB   . PRO A 1 67 ? -9.111  -6.865  0.508   1.00 0.00 ? 67 PRO A CB   2  
ATOM 1897  C CG   . PRO A 1 67 ? -7.979  -6.048  1.030   1.00 0.00 ? 67 PRO A CG   2  
ATOM 1898  C CD   . PRO A 1 67 ? -7.396  -5.341  -0.159  1.00 0.00 ? 67 PRO A CD   2  
ATOM 1899  H HA   . PRO A 1 67 ? -8.277  -8.254  -0.907  1.00 0.00 ? 67 PRO A HA   2  
ATOM 1900  H HB2  . PRO A 1 67 ? -10.026 -6.293  0.473   1.00 0.00 ? 67 PRO A HB2  2  
ATOM 1901  H HB3  . PRO A 1 67 ? -9.260  -7.755  1.102   1.00 0.00 ? 67 PRO A HB3  2  
ATOM 1902  H HG2  . PRO A 1 67 ? -8.344  -5.329  1.749   1.00 0.00 ? 67 PRO A HG2  2  
ATOM 1903  H HG3  . PRO A 1 67 ? -7.239  -6.690  1.483   1.00 0.00 ? 67 PRO A HG3  2  
ATOM 1904  H HD2  . PRO A 1 67 ? -7.877  -4.386  -0.302  1.00 0.00 ? 67 PRO A HD2  2  
ATOM 1905  H HD3  . PRO A 1 67 ? -6.332  -5.214  -0.036  1.00 0.00 ? 67 PRO A HD3  2  
ATOM 1906  N N    . ARG A 1 68 ? -11.084 -7.489  -1.290  1.00 0.00 ? 68 ARG A N    2  
ATOM 1907  C CA   . ARG A 1 68 ? -12.315 -7.489  -2.073  1.00 0.00 ? 68 ARG A CA   2  
ATOM 1908  C C    . ARG A 1 68 ? -13.484 -6.958  -1.249  1.00 0.00 ? 68 ARG A C    2  
ATOM 1909  O O    . ARG A 1 68 ? -14.633 -7.347  -1.461  1.00 0.00 ? 68 ARG A O    2  
ATOM 1910  C CB   . ARG A 1 68 ? -12.628 -8.901  -2.572  1.00 0.00 ? 68 ARG A CB   2  
ATOM 1911  C CG   . ARG A 1 68 ? -11.568 -9.466  -3.503  1.00 0.00 ? 68 ARG A CG   2  
ATOM 1912  C CD   . ARG A 1 68 ? -11.086 -10.830 -3.036  1.00 0.00 ? 68 ARG A CD   2  
ATOM 1913  N NE   . ARG A 1 68 ? -12.196 -11.720 -2.708  1.00 0.00 ? 68 ARG A NE   2  
ATOM 1914  C CZ   . ARG A 1 68 ? -12.037 -12.966 -2.274  1.00 0.00 ? 68 ARG A CZ   2  
ATOM 1915  N NH1  . ARG A 1 68 ? -10.819 -13.464 -2.117  1.00 0.00 ? 68 ARG A NH1  2  
ATOM 1916  N NH2  . ARG A 1 68 ? -13.096 -13.714 -1.997  1.00 0.00 ? 68 ARG A NH2  2  
ATOM 1917  H H    . ARG A 1 68 ? -11.128 -7.687  -0.332  1.00 0.00 ? 68 ARG A H    2  
ATOM 1918  H HA   . ARG A 1 68 ? -12.166 -6.841  -2.924  1.00 0.00 ? 68 ARG A HA   2  
ATOM 1919  H HB2  . ARG A 1 68 ? -12.716 -9.560  -1.721  1.00 0.00 ? 68 ARG A HB2  2  
ATOM 1920  H HB3  . ARG A 1 68 ? -13.569 -8.883  -3.102  1.00 0.00 ? 68 ARG A HB3  2  
ATOM 1921  H HG2  . ARG A 1 68 ? -11.987 -9.564  -4.493  1.00 0.00 ? 68 ARG A HG2  2  
ATOM 1922  H HG3  . ARG A 1 68 ? -10.728 -8.787  -3.532  1.00 0.00 ? 68 ARG A HG3  2  
ATOM 1923  H HD2  . ARG A 1 68 ? -10.497 -11.279 -3.822  1.00 0.00 ? 68 ARG A HD2  2  
ATOM 1924  H HD3  . ARG A 1 68 ? -10.471 -10.698 -2.158  1.00 0.00 ? 68 ARG A HD3  2  
ATOM 1925  H HE   . ARG A 1 68 ? -13.105 -11.371 -2.817  1.00 0.00 ? 68 ARG A HE   2  
ATOM 1926  H HH11 . ARG A 1 68 ? -10.018 -12.903 -2.324  1.00 0.00 ? 68 ARG A HH11 2  
ATOM 1927  H HH12 . ARG A 1 68 ? -10.701 -14.402 -1.790  1.00 0.00 ? 68 ARG A HH12 2  
ATOM 1928  H HH21 . ARG A 1 68 ? -14.016 -13.340 -2.114  1.00 0.00 ? 68 ARG A HH21 2  
ATOM 1929  H HH22 . ARG A 1 68 ? -12.975 -14.651 -1.671  1.00 0.00 ? 68 ARG A HH22 2  
ATOM 1930  N N    . ASN A 1 69 ? -13.184 -6.068  -0.309  1.00 0.00 ? 69 ASN A N    2  
ATOM 1931  C CA   . ASN A 1 69 ? -14.210 -5.483  0.546   1.00 0.00 ? 69 ASN A CA   2  
ATOM 1932  C C    . ASN A 1 69 ? -14.187 -3.961  0.461   1.00 0.00 ? 69 ASN A C    2  
ATOM 1933  O O    . ASN A 1 69 ? -13.185 -3.366  0.063   1.00 0.00 ? 69 ASN A O    2  
ATOM 1934  C CB   . ASN A 1 69 ? -14.008 -5.927  1.996   1.00 0.00 ? 69 ASN A CB   2  
ATOM 1935  C CG   . ASN A 1 69 ? -14.340 -7.391  2.204   1.00 0.00 ? 69 ASN A CG   2  
ATOM 1936  O OD1  . ASN A 1 69 ? -15.483 -7.746  2.493   1.00 0.00 ? 69 ASN A OD1  2  
ATOM 1937  N ND2  . ASN A 1 69 ? -13.339 -8.252  2.058   1.00 0.00 ? 69 ASN A ND2  2  
ATOM 1938  H H    . ASN A 1 69 ? -12.250 -5.797  -0.189  1.00 0.00 ? 69 ASN A H    2  
ATOM 1939  H HA   . ASN A 1 69 ? -15.170 -5.837  0.201   1.00 0.00 ? 69 ASN A HA   2  
ATOM 1940  H HB2  . ASN A 1 69 ? -12.977 -5.768  2.275   1.00 0.00 ? 69 ASN A HB2  2  
ATOM 1941  H HB3  . ASN A 1 69 ? -14.645 -5.337  2.639   1.00 0.00 ? 69 ASN A HB3  2  
ATOM 1942  H HD21 . ASN A 1 69 ? -12.454 -7.898  1.828   1.00 0.00 ? 69 ASN A HD21 2  
ATOM 1943  H HD22 . ASN A 1 69 ? -13.525 -9.205  2.187   1.00 0.00 ? 69 ASN A HD22 2  
ATOM 1944  N N    . PRO A 1 70 ? -15.298 -3.310  0.837   1.00 0.00 ? 70 PRO A N    2  
ATOM 1945  C CA   . PRO A 1 70 ? -15.409 -1.848  0.805   1.00 0.00 ? 70 PRO A CA   2  
ATOM 1946  C C    . PRO A 1 70 ? -14.493 -1.178  1.823   1.00 0.00 ? 70 PRO A C    2  
ATOM 1947  O O    . PRO A 1 70 ? -14.218 -1.734  2.886   1.00 0.00 ? 70 PRO A O    2  
ATOM 1948  C CB   . PRO A 1 70 ? -16.878 -1.592  1.154   1.00 0.00 ? 70 PRO A CB   2  
ATOM 1949  C CG   . PRO A 1 70 ? -17.309 -2.803  1.906   1.00 0.00 ? 70 PRO A CG   2  
ATOM 1950  C CD   . PRO A 1 70 ? -16.531 -3.950  1.323   1.00 0.00 ? 70 PRO A CD   2  
ATOM 1951  H HA   . PRO A 1 70 ? -15.196 -1.458  -0.180  1.00 0.00 ? 70 PRO A HA   2  
ATOM 1952  H HB2  . PRO A 1 70 ? -16.955 -0.701  1.761   1.00 0.00 ? 70 PRO A HB2  2  
ATOM 1953  H HB3  . PRO A 1 70 ? -17.449 -1.467  0.247   1.00 0.00 ? 70 PRO A HB3  2  
ATOM 1954  H HG2  . PRO A 1 70 ? -17.078 -2.687  2.954   1.00 0.00 ? 70 PRO A HG2  2  
ATOM 1955  H HG3  . PRO A 1 70 ? -18.369 -2.962  1.769   1.00 0.00 ? 70 PRO A HG3  2  
ATOM 1956  H HD2  . PRO A 1 70 ? -16.311 -4.683  2.086   1.00 0.00 ? 70 PRO A HD2  2  
ATOM 1957  H HD3  . PRO A 1 70 ? -17.078 -4.402  0.509   1.00 0.00 ? 70 PRO A HD3  2  
ATOM 1958  N N    . PHE A 1 71 ? -14.022 0.019   1.490   1.00 0.00 ? 71 PHE A N    2  
ATOM 1959  C CA   . PHE A 1 71 ? -13.135 0.765   2.375   1.00 0.00 ? 71 PHE A CA   2  
ATOM 1960  C C    . PHE A 1 71 ? -13.392 2.265   2.263   1.00 0.00 ? 71 PHE A C    2  
ATOM 1961  O O    . PHE A 1 71 ? -13.995 2.869   3.151   1.00 0.00 ? 71 PHE A O    2  
ATOM 1962  C CB   . PHE A 1 71 ? -11.675 0.457   2.041   1.00 0.00 ? 71 PHE A CB   2  
ATOM 1963  C CG   . PHE A 1 71 ? -11.359 -1.011  2.038   1.00 0.00 ? 71 PHE A CG   2  
ATOM 1964  C CD1  . PHE A 1 71 ? -11.409 -1.745  3.213   1.00 0.00 ? 71 PHE A CD1  2  
ATOM 1965  C CD2  . PHE A 1 71 ? -11.014 -1.658  0.863   1.00 0.00 ? 71 PHE A CD2  2  
ATOM 1966  C CE1  . PHE A 1 71 ? -11.120 -3.097  3.214   1.00 0.00 ? 71 PHE A CE1  2  
ATOM 1967  C CE2  . PHE A 1 71 ? -10.723 -3.009  0.858   1.00 0.00 ? 71 PHE A CE2  2  
ATOM 1968  C CZ   . PHE A 1 71 ? -10.776 -3.729  2.036   1.00 0.00 ? 71 PHE A CZ   2  
ATOM 1969  H H    . PHE A 1 71 ? -14.277 0.410   0.628   1.00 0.00 ? 71 PHE A H    2  
ATOM 1970  H HA   . PHE A 1 71 ? -13.337 0.452   3.388   1.00 0.00 ? 71 PHE A HA   2  
ATOM 1971  H HB2  . PHE A 1 71 ? -11.447 0.848   1.060   1.00 0.00 ? 71 PHE A HB2  2  
ATOM 1972  H HB3  . PHE A 1 71 ? -11.038 0.935   2.771   1.00 0.00 ? 71 PHE A HB3  2  
ATOM 1973  H HD1  . PHE A 1 71 ? -11.677 -1.251  4.135   1.00 0.00 ? 71 PHE A HD1  2  
ATOM 1974  H HD2  . PHE A 1 71 ? -10.972 -1.096  -0.058  1.00 0.00 ? 71 PHE A HD2  2  
ATOM 1975  H HE1  . PHE A 1 71 ? -11.162 -3.657  4.136   1.00 0.00 ? 71 PHE A HE1  2  
ATOM 1976  H HE2  . PHE A 1 71 ? -10.456 -3.502  -0.065  1.00 0.00 ? 71 PHE A HE2  2  
ATOM 1977  H HZ   . PHE A 1 71 ? -10.550 -4.785  2.034   1.00 0.00 ? 71 PHE A HZ   2  
ATOM 1978  N N    . HIS A 1 72 ? -12.932 2.860   1.168   1.00 0.00 ? 72 HIS A N    2  
ATOM 1979  C CA   . HIS A 1 72 ? -13.115 4.289   0.942   1.00 0.00 ? 72 HIS A CA   2  
ATOM 1980  C C    . HIS A 1 72 ? -14.595 4.633   0.813   1.00 0.00 ? 72 HIS A C    2  
ATOM 1981  O O    . HIS A 1 72 ? -15.067 5.614   1.389   1.00 0.00 ? 72 HIS A O    2  
ATOM 1982  C CB   . HIS A 1 72 ? -12.366 4.728   -0.318  1.00 0.00 ? 72 HIS A CB   2  
ATOM 1983  C CG   . HIS A 1 72 ? -12.473 6.195   -0.596  1.00 0.00 ? 72 HIS A CG   2  
ATOM 1984  N ND1  . HIS A 1 72 ? -12.858 6.704   -1.819  1.00 0.00 ? 72 HIS A ND1  2  
ATOM 1985  C CD2  . HIS A 1 72 ? -12.242 7.267   0.199   1.00 0.00 ? 72 HIS A CD2  2  
ATOM 1986  C CE1  . HIS A 1 72 ? -12.859 8.024   -1.763  1.00 0.00 ? 72 HIS A CE1  2  
ATOM 1987  N NE2  . HIS A 1 72 ? -12.490 8.391   -0.550  1.00 0.00 ? 72 HIS A NE2  2  
ATOM 1988  H H    . HIS A 1 72 ? -12.460 2.326   0.495   1.00 0.00 ? 72 HIS A H    2  
ATOM 1989  H HA   . HIS A 1 72 ? -12.707 4.814   1.793   1.00 0.00 ? 72 HIS A HA   2  
ATOM 1990  H HB2  . HIS A 1 72 ? -11.320 4.486   -0.210  1.00 0.00 ? 72 HIS A HB2  2  
ATOM 1991  H HB3  . HIS A 1 72 ? -12.767 4.197   -1.170  1.00 0.00 ? 72 HIS A HB3  2  
ATOM 1992  H HD1  . HIS A 1 72 ? -13.095 6.176   -2.609  1.00 0.00 ? 72 HIS A HD1  2  
ATOM 1993  H HD2  . HIS A 1 72 ? -11.923 7.242   1.232   1.00 0.00 ? 72 HIS A HD2  2  
ATOM 1994  H HE1  . HIS A 1 72 ? -13.119 8.690   -2.573  1.00 0.00 ? 72 HIS A HE1  2  
ATOM 1995  H HE2  . HIS A 1 72 ? -12.508 9.309   -0.208  1.00 0.00 ? 72 HIS A HE2  2  
ATOM 1996  N N    . ALA A 1 73 ? -15.322 3.820   0.055   1.00 0.00 ? 73 ALA A N    2  
ATOM 1997  C CA   . ALA A 1 73 ? -16.749 4.038   -0.150  1.00 0.00 ? 73 ALA A CA   2  
ATOM 1998  C C    . ALA A 1 73 ? -17.564 3.447   0.996   1.00 0.00 ? 73 ALA A C    2  
ATOM 1999  O O    . ALA A 1 73 ? -17.802 4.170   1.986   1.00 0.00 ? 73 ALA A O    2  
ATOM 2000  C CB   . ALA A 1 73 ? -17.189 3.439   -1.477  1.00 0.00 ? 73 ALA A CB   2  
ATOM 2001  O OXT  . ALA A 1 73 ? -17.957 2.266   0.893   1.00 0.00 ? 73 ALA A OXT  2  
ATOM 2002  H H    . ALA A 1 73 ? -14.889 3.055   -0.378  1.00 0.00 ? 73 ALA A H    2  
ATOM 2003  H HA   . ALA A 1 73 ? -16.921 5.104   -0.188  1.00 0.00 ? 73 ALA A HA   2  
ATOM 2004  H HB1  . ALA A 1 73 ? -16.319 3.198   -2.069  1.00 0.00 ? 73 ALA A HB1  2  
ATOM 2005  H HB2  . ALA A 1 73 ? -17.801 4.152   -2.009  1.00 0.00 ? 73 ALA A HB2  2  
ATOM 2006  H HB3  . ALA A 1 73 ? -17.761 2.541   -1.294  1.00 0.00 ? 73 ALA A HB3  2  
ATOM 2007  N N    . GLU A 1 1  ? -3.525  3.730   11.255  1.00 0.00 ? 1  GLU A N    3  
ATOM 2008  C CA   . GLU A 1 1  ? -2.082  3.971   11.519  1.00 0.00 ? 1  GLU A CA   3  
ATOM 2009  C C    . GLU A 1 1  ? -1.305  4.140   10.217  1.00 0.00 ? 1  GLU A C    3  
ATOM 2010  O O    . GLU A 1 1  ? -1.183  5.249   9.696   1.00 0.00 ? 1  GLU A O    3  
ATOM 2011  C CB   . GLU A 1 1  ? -1.528  2.790   12.319  1.00 0.00 ? 1  GLU A CB   3  
ATOM 2012  C CG   . GLU A 1 1  ? -2.098  2.687   13.725  1.00 0.00 ? 1  GLU A CG   3  
ATOM 2013  C CD   . GLU A 1 1  ? -1.636  1.438   14.451  1.00 0.00 ? 1  GLU A CD   3  
ATOM 2014  O OE1  . GLU A 1 1  ? -1.320  0.440   13.771  1.00 0.00 ? 1  GLU A OE1  3  
ATOM 2015  O OE2  . GLU A 1 1  ? -1.593  1.459   15.699  1.00 0.00 ? 1  GLU A OE2  3  
ATOM 2016  H H1   . GLU A 1 1  ? -3.958  3.398   12.139  1.00 0.00 ? 1  GLU A H1   3  
ATOM 2017  H H2   . GLU A 1 1  ? -3.593  3.008   10.509  1.00 0.00 ? 1  GLU A H2   3  
ATOM 2018  H H3   . GLU A 1 1  ? -3.945  4.630   10.948  1.00 0.00 ? 1  GLU A H3   3  
ATOM 2019  H HA   . GLU A 1 1  ? -1.986  4.873   12.106  1.00 0.00 ? 1  GLU A HA   3  
ATOM 2020  H HB2  . GLU A 1 1  ? -1.758  1.875   11.793  1.00 0.00 ? 1  GLU A HB2  3  
ATOM 2021  H HB3  . GLU A 1 1  ? -0.456  2.893   12.395  1.00 0.00 ? 1  GLU A HB3  3  
ATOM 2022  H HG2  . GLU A 1 1  ? -1.783  3.550   14.292  1.00 0.00 ? 1  GLU A HG2  3  
ATOM 2023  H HG3  . GLU A 1 1  ? -3.176  2.672   13.663  1.00 0.00 ? 1  GLU A HG3  3  
ATOM 2024  N N    . ALA A 1 2  ? -0.784  3.035   9.693   1.00 0.00 ? 2  ALA A N    3  
ATOM 2025  C CA   . ALA A 1 2  ? -0.023  3.066   8.449   1.00 0.00 ? 2  ALA A CA   3  
ATOM 2026  C C    . ALA A 1 2  ? -0.936  3.343   7.261   1.00 0.00 ? 2  ALA A C    3  
ATOM 2027  O O    . ALA A 1 2  ? -1.394  2.419   6.588   1.00 0.00 ? 2  ALA A O    3  
ATOM 2028  C CB   . ALA A 1 2  ? 0.720   1.753   8.253   1.00 0.00 ? 2  ALA A CB   3  
ATOM 2029  H H    . ALA A 1 2  ? -0.916  2.179   10.151  1.00 0.00 ? 2  ALA A H    3  
ATOM 2030  H HA   . ALA A 1 2  ? 0.706   3.859   8.524   1.00 0.00 ? 2  ALA A HA   3  
ATOM 2031  H HB1  . ALA A 1 2  ? 0.488   1.351   7.278   1.00 0.00 ? 2  ALA A HB1  3  
ATOM 2032  H HB2  . ALA A 1 2  ? 0.416   1.050   9.014   1.00 0.00 ? 2  ALA A HB2  3  
ATOM 2033  H HB3  . ALA A 1 2  ? 1.783   1.927   8.327   1.00 0.00 ? 2  ALA A HB3  3  
ATOM 2034  N N    . GLY A 1 3  ? -1.202  4.621   7.010   1.00 0.00 ? 3  GLY A N    3  
ATOM 2035  C CA   . GLY A 1 3  ? -2.065  4.996   5.906   1.00 0.00 ? 3  GLY A CA   3  
ATOM 2036  C C    . GLY A 1 3  ? -1.939  6.468   5.544   1.00 0.00 ? 3  GLY A C    3  
ATOM 2037  O O    . GLY A 1 3  ? -2.185  7.333   6.384   1.00 0.00 ? 3  GLY A O    3  
ATOM 2038  H H    . GLY A 1 3  ? -0.812  5.314   7.583   1.00 0.00 ? 3  GLY A H    3  
ATOM 2039  H HA2  . GLY A 1 3  ? -1.812  4.395   5.046   1.00 0.00 ? 3  GLY A HA2  3  
ATOM 2040  H HA3  . GLY A 1 3  ? -3.089  4.791   6.186   1.00 0.00 ? 3  GLY A HA3  3  
ATOM 2041  N N    . GLU A 1 4  ? -1.555  6.756   4.296   1.00 0.00 ? 4  GLU A N    3  
ATOM 2042  C CA   . GLU A 1 4  ? -1.402  8.135   3.839   1.00 0.00 ? 4  GLU A CA   3  
ATOM 2043  C C    . GLU A 1 4  ? 0.004   8.652   4.121   1.00 0.00 ? 4  GLU A C    3  
ATOM 2044  O O    . GLU A 1 4  ? 0.450   9.626   3.515   1.00 0.00 ? 4  GLU A O    3  
ATOM 2045  C CB   . GLU A 1 4  ? -2.439  9.041   4.508   1.00 0.00 ? 4  GLU A CB   3  
ATOM 2046  C CG   . GLU A 1 4  ? -3.813  8.402   4.634   1.00 0.00 ? 4  GLU A CG   3  
ATOM 2047  C CD   . GLU A 1 4  ? -4.926  9.320   4.169   1.00 0.00 ? 4  GLU A CD   3  
ATOM 2048  O OE1  . GLU A 1 4  ? -5.089  10.405  4.765   1.00 0.00 ? 4  GLU A OE1  3  
ATOM 2049  O OE2  . GLU A 1 4  ? -5.635  8.954   3.209   1.00 0.00 ? 4  GLU A OE2  3  
ATOM 2050  H H    . GLU A 1 4  ? -1.369  6.027   3.666   1.00 0.00 ? 4  GLU A H    3  
ATOM 2051  H HA   . GLU A 1 4  ? -1.566  8.147   2.772   1.00 0.00 ? 4  GLU A HA   3  
ATOM 2052  H HB2  . GLU A 1 4  ? -2.091  9.295   5.499   1.00 0.00 ? 4  GLU A HB2  3  
ATOM 2053  H HB3  . GLU A 1 4  ? -2.538  9.946   3.927   1.00 0.00 ? 4  GLU A HB3  3  
ATOM 2054  H HG2  . GLU A 1 4  ? -3.835  7.504   4.036   1.00 0.00 ? 4  GLU A HG2  3  
ATOM 2055  H HG3  . GLU A 1 4  ? -3.984  8.148   5.670   1.00 0.00 ? 4  GLU A HG3  3  
ATOM 2056  N N    . GLU A 1 5  ? 0.701   7.993   5.041   1.00 0.00 ? 5  GLU A N    3  
ATOM 2057  C CA   . GLU A 1 5  ? 2.059   8.387   5.397   1.00 0.00 ? 5  GLU A CA   3  
ATOM 2058  C C    . GLU A 1 5  ? 3.033   8.024   4.281   1.00 0.00 ? 5  GLU A C    3  
ATOM 2059  O O    . GLU A 1 5  ? 2.713   7.219   3.407   1.00 0.00 ? 5  GLU A O    3  
ATOM 2060  C CB   . GLU A 1 5  ? 2.485   7.713   6.702   1.00 0.00 ? 5  GLU A CB   3  
ATOM 2061  C CG   . GLU A 1 5  ? 1.561   8.013   7.871   1.00 0.00 ? 5  GLU A CG   3  
ATOM 2062  C CD   . GLU A 1 5  ? 2.302   8.108   9.190   1.00 0.00 ? 5  GLU A CD   3  
ATOM 2063  O OE1  . GLU A 1 5  ? 3.523   8.371   9.168   1.00 0.00 ? 5  GLU A OE1  3  
ATOM 2064  O OE2  . GLU A 1 5  ? 1.661   7.921   10.246  1.00 0.00 ? 5  GLU A OE2  3  
ATOM 2065  H H    . GLU A 1 5  ? 0.294   7.222   5.489   1.00 0.00 ? 5  GLU A H    3  
ATOM 2066  H HA   . GLU A 1 5  ? 2.069   9.458   5.533   1.00 0.00 ? 5  GLU A HA   3  
ATOM 2067  H HB2  . GLU A 1 5  ? 2.505   6.644   6.552   1.00 0.00 ? 5  GLU A HB2  3  
ATOM 2068  H HB3  . GLU A 1 5  ? 3.478   8.050   6.960   1.00 0.00 ? 5  GLU A HB3  3  
ATOM 2069  H HG2  . GLU A 1 5  ? 1.062   8.952   7.687   1.00 0.00 ? 5  GLU A HG2  3  
ATOM 2070  H HG3  . GLU A 1 5  ? 0.826   7.224   7.943   1.00 0.00 ? 5  GLU A HG3  3  
ATOM 2071  N N    . CYS A 1 6  ? 4.220   8.621   4.314   1.00 0.00 ? 6  CYS A N    3  
ATOM 2072  C CA   . CYS A 1 6  ? 5.236   8.357   3.301   1.00 0.00 ? 6  CYS A CA   3  
ATOM 2073  C C    . CYS A 1 6  ? 4.793   8.881   1.938   1.00 0.00 ? 6  CYS A C    3  
ATOM 2074  O O    . CYS A 1 6  ? 3.599   9.012   1.672   1.00 0.00 ? 6  CYS A O    3  
ATOM 2075  C CB   . CYS A 1 6  ? 5.525   6.856   3.219   1.00 0.00 ? 6  CYS A CB   3  
ATOM 2076  S SG   . CYS A 1 6  ? 6.303   6.328   1.658   1.00 0.00 ? 6  CYS A SG   3  
ATOM 2077  H H    . CYS A 1 6  ? 4.417   9.255   5.035   1.00 0.00 ? 6  CYS A H    3  
ATOM 2078  H HA   . CYS A 1 6  ? 6.138   8.872   3.595   1.00 0.00 ? 6  CYS A HA   3  
ATOM 2079  H HB2  . CYS A 1 6  ? 6.189   6.582   4.024   1.00 0.00 ? 6  CYS A HB2  3  
ATOM 2080  H HB3  . CYS A 1 6  ? 4.598   6.312   3.325   1.00 0.00 ? 6  CYS A HB3  3  
ATOM 2081  N N    . ASP A 1 7  ? 5.763   9.181   1.079   1.00 0.00 ? 7  ASP A N    3  
ATOM 2082  C CA   . ASP A 1 7  ? 5.469   9.694   -0.255  1.00 0.00 ? 7  ASP A CA   3  
ATOM 2083  C C    . ASP A 1 7  ? 6.482   9.183   -1.275  1.00 0.00 ? 7  ASP A C    3  
ATOM 2084  O O    . ASP A 1 7  ? 7.242   9.961   -1.852  1.00 0.00 ? 7  ASP A O    3  
ATOM 2085  C CB   . ASP A 1 7  ? 5.464   11.223  -0.245  1.00 0.00 ? 7  ASP A CB   3  
ATOM 2086  C CG   . ASP A 1 7  ? 4.610   11.792  0.871   1.00 0.00 ? 7  ASP A CG   3  
ATOM 2087  O OD1  . ASP A 1 7  ? 5.132   11.955  1.994   1.00 0.00 ? 7  ASP A OD1  3  
ATOM 2088  O OD2  . ASP A 1 7  ? 3.419   12.073  0.623   1.00 0.00 ? 7  ASP A OD2  3  
ATOM 2089  H H    . ASP A 1 7  ? 6.697   9.057   1.349   1.00 0.00 ? 7  ASP A H    3  
ATOM 2090  H HA   . ASP A 1 7  ? 4.487   9.342   -0.534  1.00 0.00 ? 7  ASP A HA   3  
ATOM 2091  H HB2  . ASP A 1 7  ? 6.475   11.580  -0.117  1.00 0.00 ? 7  ASP A HB2  3  
ATOM 2092  H HB3  . ASP A 1 7  ? 5.077   11.581  -1.188  1.00 0.00 ? 7  ASP A HB3  3  
ATOM 2093  N N    . CYS A 1 8  ? 6.485   7.872   -1.493  1.00 0.00 ? 8  CYS A N    3  
ATOM 2094  C CA   . CYS A 1 8  ? 7.402   7.256   -2.446  1.00 0.00 ? 8  CYS A CA   3  
ATOM 2095  C C    . CYS A 1 8  ? 6.652   6.353   -3.427  1.00 0.00 ? 8  CYS A C    3  
ATOM 2096  O O    . CYS A 1 8  ? 7.256   5.756   -4.318  1.00 0.00 ? 8  CYS A O    3  
ATOM 2097  C CB   . CYS A 1 8  ? 8.453   6.421   -1.715  1.00 0.00 ? 8  CYS A CB   3  
ATOM 2098  S SG   . CYS A 1 8  ? 9.739   7.370   -0.841  1.00 0.00 ? 8  CYS A SG   3  
ATOM 2099  H H    . CYS A 1 8  ? 5.854   7.305   -1.002  1.00 0.00 ? 8  CYS A H    3  
ATOM 2100  H HA   . CYS A 1 8  ? 7.895   8.043   -2.996  1.00 0.00 ? 8  CYS A HA   3  
ATOM 2101  H HB2  . CYS A 1 8  ? 7.959   5.800   -0.985  1.00 0.00 ? 8  CYS A HB2  3  
ATOM 2102  H HB3  . CYS A 1 8  ? 8.947   5.792   -2.437  1.00 0.00 ? 8  CYS A HB3  3  
ATOM 2103  N N    . GLY A 1 9  ? 5.340   6.240   -3.243  1.00 0.00 ? 9  GLY A N    3  
ATOM 2104  C CA   . GLY A 1 9  ? 4.536   5.390   -4.106  1.00 0.00 ? 9  GLY A CA   3  
ATOM 2105  C C    . GLY A 1 9  ? 3.739   4.379   -3.306  1.00 0.00 ? 9  GLY A C    3  
ATOM 2106  O O    . GLY A 1 9  ? 3.851   4.337   -2.081  1.00 0.00 ? 9  GLY A O    3  
ATOM 2107  H H    . GLY A 1 9  ? 4.915   6.726   -2.508  1.00 0.00 ? 9  GLY A H    3  
ATOM 2108  H HA2  . GLY A 1 9  ? 3.854   6.009   -4.672  1.00 0.00 ? 9  GLY A HA2  3  
ATOM 2109  H HA3  . GLY A 1 9  ? 5.185   4.865   -4.789  1.00 0.00 ? 9  GLY A HA3  3  
ATOM 2110  N N    . SER A 1 10 ? 2.923   3.568   -3.977  1.00 0.00 ? 10 SER A N    3  
ATOM 2111  C CA   . SER A 1 10 ? 2.119   2.586   -3.271  1.00 0.00 ? 10 SER A CA   3  
ATOM 2112  C C    . SER A 1 10 ? 1.862   1.319   -4.098  1.00 0.00 ? 10 SER A C    3  
ATOM 2113  O O    . SER A 1 10 ? 2.615   0.352   -3.983  1.00 0.00 ? 10 SER A O    3  
ATOM 2114  C CB   . SER A 1 10 ? 0.830   3.244   -2.794  1.00 0.00 ? 10 SER A CB   3  
ATOM 2115  O OG   . SER A 1 10 ? 1.076   4.053   -1.660  1.00 0.00 ? 10 SER A OG   3  
ATOM 2116  H H    . SER A 1 10 ? 2.852   3.642   -4.948  1.00 0.00 ? 10 SER A H    3  
ATOM 2117  H HA   . SER A 1 10 ? 2.676   2.289   -2.408  1.00 0.00 ? 10 SER A HA   3  
ATOM 2118  H HB2  . SER A 1 10 ? 0.433   3.870   -3.578  1.00 0.00 ? 10 SER A HB2  3  
ATOM 2119  H HB3  . SER A 1 10 ? 0.111   2.485   -2.534  1.00 0.00 ? 10 SER A HB3  3  
ATOM 2120  H HG   . SER A 1 10 ? 1.898   3.781   -1.245  1.00 0.00 ? 10 SER A HG   3  
ATOM 2121  N N    . PRO A 1 11 ? 0.813   1.279   -4.938  1.00 0.00 ? 11 PRO A N    3  
ATOM 2122  C CA   . PRO A 1 11 ? 0.517   0.094   -5.745  1.00 0.00 ? 11 PRO A CA   3  
ATOM 2123  C C    . PRO A 1 11 ? 1.477   -0.048  -6.916  1.00 0.00 ? 11 PRO A C    3  
ATOM 2124  O O    . PRO A 1 11 ? 1.324   0.610   -7.944  1.00 0.00 ? 11 PRO A O    3  
ATOM 2125  C CB   . PRO A 1 11 ? -0.903  0.356   -6.229  1.00 0.00 ? 11 PRO A CB   3  
ATOM 2126  C CG   . PRO A 1 11 ? -0.993  1.838   -6.314  1.00 0.00 ? 11 PRO A CG   3  
ATOM 2127  C CD   . PRO A 1 11 ? -0.159  2.359   -5.175  1.00 0.00 ? 11 PRO A CD   3  
ATOM 2128  H HA   . PRO A 1 11 ? 0.540   -0.806  -5.149  1.00 0.00 ? 11 PRO A HA   3  
ATOM 2129  H HB2  . PRO A 1 11 ? -1.051  -0.110  -7.190  1.00 0.00 ? 11 PRO A HB2  3  
ATOM 2130  H HB3  . PRO A 1 11 ? -1.606  -0.041  -5.513  1.00 0.00 ? 11 PRO A HB3  3  
ATOM 2131  H HG2  . PRO A 1 11 ? -0.595  2.178   -7.259  1.00 0.00 ? 11 PRO A HG2  3  
ATOM 2132  H HG3  . PRO A 1 11 ? -2.019  2.153   -6.201  1.00 0.00 ? 11 PRO A HG3  3  
ATOM 2133  H HD2  . PRO A 1 11 ? 0.347   3.271   -5.456  1.00 0.00 ? 11 PRO A HD2  3  
ATOM 2134  H HD3  . PRO A 1 11 ? -0.771  2.519   -4.301  1.00 0.00 ? 11 PRO A HD3  3  
ATOM 2135  N N    . GLY A 1 12 ? 2.487   -0.891  -6.737  1.00 0.00 ? 12 GLY A N    3  
ATOM 2136  C CA   . GLY A 1 12 ? 3.483   -1.081  -7.773  1.00 0.00 ? 12 GLY A CA   3  
ATOM 2137  C C    . GLY A 1 12 ? 4.742   -0.324  -7.428  1.00 0.00 ? 12 GLY A C    3  
ATOM 2138  O O    . GLY A 1 12 ? 5.849   -0.717  -7.797  1.00 0.00 ? 12 GLY A O    3  
ATOM 2139  H H    . GLY A 1 12 ? 2.572   -1.369  -5.880  1.00 0.00 ? 12 GLY A H    3  
ATOM 2140  H HA2  . GLY A 1 12 ? 3.710   -2.134  -7.862  1.00 0.00 ? 12 GLY A HA2  3  
ATOM 2141  H HA3  . GLY A 1 12 ? 3.097   -0.716  -8.712  1.00 0.00 ? 12 GLY A HA3  3  
ATOM 2142  N N    . ASN A 1 13 ? 4.552   0.754   -6.678  1.00 0.00 ? 13 ASN A N    3  
ATOM 2143  C CA   . ASN A 1 13 ? 5.647   1.588   -6.215  1.00 0.00 ? 13 ASN A CA   3  
ATOM 2144  C C    . ASN A 1 13 ? 5.637   1.606   -4.693  1.00 0.00 ? 13 ASN A C    3  
ATOM 2145  O O    . ASN A 1 13 ? 5.554   2.662   -4.067  1.00 0.00 ? 13 ASN A O    3  
ATOM 2146  C CB   . ASN A 1 13 ? 5.513   3.010   -6.763  1.00 0.00 ? 13 ASN A CB   3  
ATOM 2147  C CG   . ASN A 1 13 ? 5.701   3.072   -8.266  1.00 0.00 ? 13 ASN A CG   3  
ATOM 2148  O OD1  . ASN A 1 13 ? 4.876   3.638   -8.984  1.00 0.00 ? 13 ASN A OD1  3  
ATOM 2149  N ND2  . ASN A 1 13 ? 6.791   2.489   -8.751  1.00 0.00 ? 13 ASN A ND2  3  
ATOM 2150  H H    . ASN A 1 13 ? 3.639   0.983   -6.406  1.00 0.00 ? 13 ASN A H    3  
ATOM 2151  H HA   . ASN A 1 13 ? 6.573   1.153   -6.560  1.00 0.00 ? 13 ASN A HA   3  
ATOM 2152  H HB2  . ASN A 1 13 ? 4.530   3.389   -6.526  1.00 0.00 ? 13 ASN A HB2  3  
ATOM 2153  H HB3  . ASN A 1 13 ? 6.258   3.640   -6.299  1.00 0.00 ? 13 ASN A HB3  3  
ATOM 2154  H HD21 . ASN A 1 13 ? 7.404   2.057   -8.120  1.00 0.00 ? 13 ASN A HD21 3  
ATOM 2155  H HD22 . ASN A 1 13 ? 6.937   2.514   -9.719  1.00 0.00 ? 13 ASN A HD22 3  
ATOM 2156  N N    . PRO A 1 14 ? 5.717   0.413   -4.084  1.00 0.00 ? 14 PRO A N    3  
ATOM 2157  C CA   . PRO A 1 14 ? 5.714   0.235   -2.635  1.00 0.00 ? 14 PRO A CA   3  
ATOM 2158  C C    . PRO A 1 14 ? 6.514   1.312   -1.919  1.00 0.00 ? 14 PRO A C    3  
ATOM 2159  O O    . PRO A 1 14 ? 7.744   1.279   -1.909  1.00 0.00 ? 14 PRO A O    3  
ATOM 2160  C CB   . PRO A 1 14 ? 6.350   -1.159  -2.452  1.00 0.00 ? 14 PRO A CB   3  
ATOM 2161  C CG   . PRO A 1 14 ? 6.751   -1.596  -3.825  1.00 0.00 ? 14 PRO A CG   3  
ATOM 2162  C CD   . PRO A 1 14 ? 5.827   -0.876  -4.754  1.00 0.00 ? 14 PRO A CD   3  
ATOM 2163  H HA   . PRO A 1 14 ? 4.707   0.224   -2.245  1.00 0.00 ? 14 PRO A HA   3  
ATOM 2164  H HB2  . PRO A 1 14 ? 7.205   -1.092  -1.796  1.00 0.00 ? 14 PRO A HB2  3  
ATOM 2165  H HB3  . PRO A 1 14 ? 5.619   -1.832  -2.028  1.00 0.00 ? 14 PRO A HB3  3  
ATOM 2166  H HG2  . PRO A 1 14 ? 7.773   -1.307  -4.016  1.00 0.00 ? 14 PRO A HG2  3  
ATOM 2167  H HG3  . PRO A 1 14 ? 6.636   -2.663  -3.928  1.00 0.00 ? 14 PRO A HG3  3  
ATOM 2168  H HD2  . PRO A 1 14 ? 6.267   -0.778  -5.734  1.00 0.00 ? 14 PRO A HD2  3  
ATOM 2169  H HD3  . PRO A 1 14 ? 4.868   -1.372  -4.805  1.00 0.00 ? 14 PRO A HD3  3  
ATOM 2170  N N    . CYS A 1 15 ? 5.781   2.265   -1.333  1.00 0.00 ? 15 CYS A N    3  
ATOM 2171  C CA   . CYS A 1 15 ? 6.359   3.395   -0.602  1.00 0.00 ? 15 CYS A CA   3  
ATOM 2172  C C    . CYS A 1 15 ? 7.883   3.347   -0.563  1.00 0.00 ? 15 CYS A C    3  
ATOM 2173  O O    . CYS A 1 15 ? 8.482   2.932   0.429   1.00 0.00 ? 15 CYS A O    3  
ATOM 2174  C CB   . CYS A 1 15 ? 5.792   3.451   0.820   1.00 0.00 ? 15 CYS A CB   3  
ATOM 2175  S SG   . CYS A 1 15 ? 6.809   4.393   2.005   1.00 0.00 ? 15 CYS A SG   3  
ATOM 2176  H H    . CYS A 1 15 ? 4.805   2.208   -1.402  1.00 0.00 ? 15 CYS A H    3  
ATOM 2177  H HA   . CYS A 1 15 ? 6.064   4.295   -1.120  1.00 0.00 ? 15 CYS A HA   3  
ATOM 2178  H HB2  . CYS A 1 15 ? 4.818   3.912   0.789   1.00 0.00 ? 15 CYS A HB2  3  
ATOM 2179  H HB3  . CYS A 1 15 ? 5.692   2.448   1.198   1.00 0.00 ? 15 CYS A HB3  3  
ATOM 2180  N N    . CYS A 1 16 ? 8.498   3.793   -1.650  1.00 0.00 ? 16 CYS A N    3  
ATOM 2181  C CA   . CYS A 1 16 ? 9.950   3.832   -1.752  1.00 0.00 ? 16 CYS A CA   3  
ATOM 2182  C C    . CYS A 1 16 ? 10.534  2.454   -2.029  1.00 0.00 ? 16 CYS A C    3  
ATOM 2183  O O    . CYS A 1 16 ? 10.265  1.495   -1.310  1.00 0.00 ? 16 CYS A O    3  
ATOM 2184  C CB   . CYS A 1 16 ? 10.550  4.431   -0.478  1.00 0.00 ? 16 CYS A CB   3  
ATOM 2185  S SG   . CYS A 1 16 ? 11.309  6.077   -0.716  1.00 0.00 ? 16 CYS A SG   3  
ATOM 2186  H H    . CYS A 1 16 ? 7.960   4.122   -2.400  1.00 0.00 ? 16 CYS A H    3  
ATOM 2187  H HA   . CYS A 1 16 ? 10.196  4.471   -2.581  1.00 0.00 ? 16 CYS A HA   3  
ATOM 2188  H HB2  . CYS A 1 16 ? 9.772   4.533   0.265   1.00 0.00 ? 16 CYS A HB2  3  
ATOM 2189  H HB3  . CYS A 1 16 ? 11.313  3.765   -0.101  1.00 0.00 ? 16 CYS A HB3  3  
ATOM 2190  N N    . ASP A 1 17 ? 11.328  2.370   -3.091  1.00 0.00 ? 17 ASP A N    3  
ATOM 2191  C CA   . ASP A 1 17 ? 11.952  1.110   -3.485  1.00 0.00 ? 17 ASP A CA   3  
ATOM 2192  C C    . ASP A 1 17 ? 13.392  1.305   -3.974  1.00 0.00 ? 17 ASP A C    3  
ATOM 2193  O O    . ASP A 1 17 ? 14.183  0.359   -3.971  1.00 0.00 ? 17 ASP A O    3  
ATOM 2194  C CB   . ASP A 1 17 ? 11.120  0.434   -4.573  1.00 0.00 ? 17 ASP A CB   3  
ATOM 2195  C CG   . ASP A 1 17 ? 10.966  1.300   -5.808  1.00 0.00 ? 17 ASP A CG   3  
ATOM 2196  O OD1  . ASP A 1 17 ? 11.999  1.711   -6.378  1.00 0.00 ? 17 ASP A OD1  3  
ATOM 2197  O OD2  . ASP A 1 17 ? 9.813   1.568   -6.205  1.00 0.00 ? 17 ASP A OD2  3  
ATOM 2198  H H    . ASP A 1 17 ? 11.486  3.172   -3.625  1.00 0.00 ? 17 ASP A H    3  
ATOM 2199  H HA   . ASP A 1 17 ? 11.968  0.470   -2.616  1.00 0.00 ? 17 ASP A HA   3  
ATOM 2200  H HB2  . ASP A 1 17 ? 11.601  -0.489  -4.860  1.00 0.00 ? 17 ASP A HB2  3  
ATOM 2201  H HB3  . ASP A 1 17 ? 10.137  0.217   -4.181  1.00 0.00 ? 17 ASP A HB3  3  
ATOM 2202  N N    . ALA A 1 18 ? 13.731  2.520   -4.411  1.00 0.00 ? 18 ALA A N    3  
ATOM 2203  C CA   . ALA A 1 18 ? 15.072  2.812   -4.905  1.00 0.00 ? 18 ALA A CA   3  
ATOM 2204  C C    . ALA A 1 18 ? 15.222  2.398   -6.364  1.00 0.00 ? 18 ALA A C    3  
ATOM 2205  O O    . ALA A 1 18 ? 15.846  3.099   -7.161  1.00 0.00 ? 18 ALA A O    3  
ATOM 2206  C CB   . ALA A 1 18 ? 16.114  2.111   -4.047  1.00 0.00 ? 18 ALA A CB   3  
ATOM 2207  H H    . ALA A 1 18 ? 13.067  3.232   -4.412  1.00 0.00 ? 18 ALA A H    3  
ATOM 2208  H HA   . ALA A 1 18 ? 15.232  3.878   -4.826  1.00 0.00 ? 18 ALA A HA   3  
ATOM 2209  H HB1  . ALA A 1 18 ? 16.221  1.088   -4.374  1.00 0.00 ? 18 ALA A HB1  3  
ATOM 2210  H HB2  . ALA A 1 18 ? 15.800  2.129   -3.014  1.00 0.00 ? 18 ALA A HB2  3  
ATOM 2211  H HB3  . ALA A 1 18 ? 17.062  2.620   -4.144  1.00 0.00 ? 18 ALA A HB3  3  
ATOM 2212  N N    . ALA A 1 19 ? 14.647  1.253   -6.701  1.00 0.00 ? 19 ALA A N    3  
ATOM 2213  C CA   . ALA A 1 19 ? 14.708  0.727   -8.054  1.00 0.00 ? 19 ALA A CA   3  
ATOM 2214  C C    . ALA A 1 19 ? 13.776  -0.470  -8.210  1.00 0.00 ? 19 ALA A C    3  
ATOM 2215  O O    . ALA A 1 19 ? 13.202  -0.688  -9.277  1.00 0.00 ? 19 ALA A O    3  
ATOM 2216  C CB   . ALA A 1 19 ? 16.136  0.341   -8.396  1.00 0.00 ? 19 ALA A CB   3  
ATOM 2217  H H    . ALA A 1 19 ? 14.170  0.747   -6.021  1.00 0.00 ? 19 ALA A H    3  
ATOM 2218  H HA   . ALA A 1 19 ? 14.396  1.508   -8.732  1.00 0.00 ? 19 ALA A HA   3  
ATOM 2219  H HB1  . ALA A 1 19 ? 16.794  0.664   -7.602  1.00 0.00 ? 19 ALA A HB1  3  
ATOM 2220  H HB2  . ALA A 1 19 ? 16.425  0.818   -9.320  1.00 0.00 ? 19 ALA A HB2  3  
ATOM 2221  H HB3  . ALA A 1 19 ? 16.202  -0.731  -8.505  1.00 0.00 ? 19 ALA A HB3  3  
ATOM 2222  N N    . THR A 1 20 ? 13.625  -1.241  -7.134  1.00 0.00 ? 20 THR A N    3  
ATOM 2223  C CA   . THR A 1 20 ? 12.758  -2.412  -7.146  1.00 0.00 ? 20 THR A CA   3  
ATOM 2224  C C    . THR A 1 20 ? 12.080  -2.579  -5.793  1.00 0.00 ? 20 THR A C    3  
ATOM 2225  O O    . THR A 1 20 ? 12.756  -2.709  -4.774  1.00 0.00 ? 20 THR A O    3  
ATOM 2226  C CB   . THR A 1 20 ? 13.561  -3.667  -7.492  1.00 0.00 ? 20 THR A CB   3  
ATOM 2227  O OG1  . THR A 1 20 ? 12.726  -4.652  -8.074  1.00 0.00 ? 20 THR A OG1  3  
ATOM 2228  C CG2  . THR A 1 20 ? 14.245  -4.293  -6.295  1.00 0.00 ? 20 THR A CG2  3  
ATOM 2229  H H    . THR A 1 20 ? 14.105  -1.015  -6.308  1.00 0.00 ? 20 THR A H    3  
ATOM 2230  H HA   . THR A 1 20 ? 12.001  -2.258  -7.900  1.00 0.00 ? 20 THR A HA   3  
ATOM 2231  H HB   . THR A 1 20 ? 14.326  -3.404  -8.209  1.00 0.00 ? 20 THR A HB   3  
ATOM 2232  H HG1  . THR A 1 20 ? 12.000  -4.225  -8.534  1.00 0.00 ? 20 THR A HG1  3  
ATOM 2233  H HG21 . THR A 1 20 ? 13.526  -4.869  -5.731  1.00 0.00 ? 20 THR A HG21 3  
ATOM 2234  H HG22 . THR A 1 20 ? 14.654  -3.515  -5.667  1.00 0.00 ? 20 THR A HG22 3  
ATOM 2235  H HG23 . THR A 1 20 ? 15.041  -4.940  -6.632  1.00 0.00 ? 20 THR A HG23 3  
ATOM 2236  N N    . CYS A 1 21 ? 10.745  -2.561  -5.805  1.00 0.00 ? 21 CYS A N    3  
ATOM 2237  C CA   . CYS A 1 21 ? 9.931   -2.696  -4.593  1.00 0.00 ? 21 CYS A CA   3  
ATOM 2238  C C    . CYS A 1 21 ? 10.747  -3.181  -3.393  1.00 0.00 ? 21 CYS A C    3  
ATOM 2239  O O    . CYS A 1 21 ? 10.711  -4.356  -3.035  1.00 0.00 ? 21 CYS A O    3  
ATOM 2240  C CB   . CYS A 1 21 ? 8.760   -3.649  -4.856  1.00 0.00 ? 21 CYS A CB   3  
ATOM 2241  S SG   . CYS A 1 21 ? 7.656   -3.111  -6.207  1.00 0.00 ? 21 CYS A SG   3  
ATOM 2242  H H    . CYS A 1 21 ? 10.286  -2.443  -6.663  1.00 0.00 ? 21 CYS A H    3  
ATOM 2243  H HA   . CYS A 1 21 ? 9.536   -1.720  -4.361  1.00 0.00 ? 21 CYS A HA   3  
ATOM 2244  H HB2  . CYS A 1 21 ? 9.149   -4.621  -5.118  1.00 0.00 ? 21 CYS A HB2  3  
ATOM 2245  H HB3  . CYS A 1 21 ? 8.166   -3.735  -3.958  1.00 0.00 ? 21 CYS A HB3  3  
ATOM 2246  N N    . LYS A 1 22 ? 11.484  -2.259  -2.779  1.00 0.00 ? 22 LYS A N    3  
ATOM 2247  C CA   . LYS A 1 22 ? 12.313  -2.578  -1.621  1.00 0.00 ? 22 LYS A CA   3  
ATOM 2248  C C    . LYS A 1 22 ? 12.862  -1.306  -0.985  1.00 0.00 ? 22 LYS A C    3  
ATOM 2249  O O    . LYS A 1 22 ? 13.608  -0.558  -1.616  1.00 0.00 ? 22 LYS A O    3  
ATOM 2250  C CB   . LYS A 1 22 ? 13.463  -3.501  -2.028  1.00 0.00 ? 22 LYS A CB   3  
ATOM 2251  C CG   . LYS A 1 22 ? 14.671  -2.761  -2.579  1.00 0.00 ? 22 LYS A CG   3  
ATOM 2252  C CD   . LYS A 1 22 ? 15.734  -3.726  -3.080  1.00 0.00 ? 22 LYS A CD   3  
ATOM 2253  C CE   . LYS A 1 22 ? 17.067  -3.027  -3.292  1.00 0.00 ? 22 LYS A CE   3  
ATOM 2254  N NZ   . LYS A 1 22 ? 17.001  -2.026  -4.392  1.00 0.00 ? 22 LYS A NZ   3  
ATOM 2255  H H    . LYS A 1 22 ? 11.471  -1.339  -3.112  1.00 0.00 ? 22 LYS A H    3  
ATOM 2256  H HA   . LYS A 1 22 ? 11.692  -3.086  -0.900  1.00 0.00 ? 22 LYS A HA   3  
ATOM 2257  H HB2  . LYS A 1 22 ? 13.779  -4.066  -1.163  1.00 0.00 ? 22 LYS A HB2  3  
ATOM 2258  H HB3  . LYS A 1 22 ? 13.110  -4.185  -2.785  1.00 0.00 ? 22 LYS A HB3  3  
ATOM 2259  H HG2  . LYS A 1 22 ? 14.354  -2.134  -3.399  1.00 0.00 ? 22 LYS A HG2  3  
ATOM 2260  H HG3  . LYS A 1 22 ? 15.094  -2.148  -1.797  1.00 0.00 ? 22 LYS A HG3  3  
ATOM 2261  H HD2  . LYS A 1 22 ? 15.863  -4.513  -2.352  1.00 0.00 ? 22 LYS A HD2  3  
ATOM 2262  H HD3  . LYS A 1 22 ? 15.407  -4.151  -4.018  1.00 0.00 ? 22 LYS A HD3  3  
ATOM 2263  H HE2  . LYS A 1 22 ? 17.344  -2.524  -2.377  1.00 0.00 ? 22 LYS A HE2  3  
ATOM 2264  H HE3  . LYS A 1 22 ? 17.813  -3.769  -3.535  1.00 0.00 ? 22 LYS A HE3  3  
ATOM 2265  H HZ1  . LYS A 1 22 ? 16.228  -2.266  -5.047  1.00 0.00 ? 22 LYS A HZ1  3  
ATOM 2266  H HZ2  . LYS A 1 22 ? 17.896  -2.016  -4.920  1.00 0.00 ? 22 LYS A HZ2  3  
ATOM 2267  H HZ3  . LYS A 1 22 ? 16.830  -1.077  -4.003  1.00 0.00 ? 22 LYS A HZ3  3  
ATOM 2268  N N    . LEU A 1 23 ? 12.483  -1.060  0.265   1.00 0.00 ? 23 LEU A N    3  
ATOM 2269  C CA   . LEU A 1 23 ? 12.933  0.128   0.978   1.00 0.00 ? 23 LEU A CA   3  
ATOM 2270  C C    . LEU A 1 23 ? 13.591  -0.239  2.305   1.00 0.00 ? 23 LEU A C    3  
ATOM 2271  O O    . LEU A 1 23 ? 13.447  -1.360  2.792   1.00 0.00 ? 23 LEU A O    3  
ATOM 2272  C CB   . LEU A 1 23 ? 11.755  1.072   1.224   1.00 0.00 ? 23 LEU A CB   3  
ATOM 2273  C CG   . LEU A 1 23 ? 10.449  0.392   1.643   1.00 0.00 ? 23 LEU A CG   3  
ATOM 2274  C CD1  . LEU A 1 23 ? 9.504   1.403   2.269   1.00 0.00 ? 23 LEU A CD1  3  
ATOM 2275  C CD2  . LEU A 1 23 ? 9.791   -0.287  0.451   1.00 0.00 ? 23 LEU A CD2  3  
ATOM 2276  H H    . LEU A 1 23 ? 11.881  -1.688  0.716   1.00 0.00 ? 23 LEU A H    3  
ATOM 2277  H HA   . LEU A 1 23 ? 13.660  0.631   0.358   1.00 0.00 ? 23 LEU A HA   3  
ATOM 2278  H HB2  . LEU A 1 23 ? 12.036  1.770   1.998   1.00 0.00 ? 23 LEU A HB2  3  
ATOM 2279  H HB3  . LEU A 1 23 ? 11.569  1.624   0.316   1.00 0.00 ? 23 LEU A HB3  3  
ATOM 2280  H HG   . LEU A 1 23 ? 10.665  -0.364  2.384   1.00 0.00 ? 23 LEU A HG   3  
ATOM 2281  H HD11 . LEU A 1 23 ? 8.497   1.212   1.930   1.00 0.00 ? 23 LEU A HD11 3  
ATOM 2282  H HD12 . LEU A 1 23 ? 9.799   2.400   1.977   1.00 0.00 ? 23 LEU A HD12 3  
ATOM 2283  H HD13 . LEU A 1 23 ? 9.545   1.317   3.343   1.00 0.00 ? 23 LEU A HD13 3  
ATOM 2284  H HD21 . LEU A 1 23 ? 10.505  -0.381  -0.352  1.00 0.00 ? 23 LEU A HD21 3  
ATOM 2285  H HD22 . LEU A 1 23 ? 8.954   0.307   0.117   1.00 0.00 ? 23 LEU A HD22 3  
ATOM 2286  H HD23 . LEU A 1 23 ? 9.443   -1.268  0.741   1.00 0.00 ? 23 LEU A HD23 3  
ATOM 2287  N N    . ARG A 1 24 ? 14.313  0.716   2.884   1.00 0.00 ? 24 ARG A N    3  
ATOM 2288  C CA   . ARG A 1 24 ? 14.993  0.497   4.156   1.00 0.00 ? 24 ARG A CA   3  
ATOM 2289  C C    . ARG A 1 24 ? 14.002  0.521   5.314   1.00 0.00 ? 24 ARG A C    3  
ATOM 2290  O O    . ARG A 1 24 ? 14.331  0.134   6.436   1.00 0.00 ? 24 ARG A O    3  
ATOM 2291  C CB   . ARG A 1 24 ? 16.075  1.557   4.371   1.00 0.00 ? 24 ARG A CB   3  
ATOM 2292  C CG   . ARG A 1 24 ? 16.856  1.894   3.112   1.00 0.00 ? 24 ARG A CG   3  
ATOM 2293  C CD   . ARG A 1 24 ? 18.352  1.948   3.381   1.00 0.00 ? 24 ARG A CD   3  
ATOM 2294  N NE   . ARG A 1 24 ? 18.999  3.043   2.664   1.00 0.00 ? 24 ARG A NE   3  
ATOM 2295  C CZ   . ARG A 1 24 ? 19.059  4.289   3.122   1.00 0.00 ? 24 ARG A CZ   3  
ATOM 2296  N NH1  . ARG A 1 24 ? 18.514  4.595   4.291   1.00 0.00 ? 24 ARG A NH1  3  
ATOM 2297  N NH2  . ARG A 1 24 ? 19.665  5.230   2.411   1.00 0.00 ? 24 ARG A NH2  3  
ATOM 2298  H H    . ARG A 1 24 ? 14.389  1.589   2.447   1.00 0.00 ? 24 ARG A H    3  
ATOM 2299  H HA   . ARG A 1 24 ? 15.456  -0.475  4.118   1.00 0.00 ? 24 ARG A HA   3  
ATOM 2300  H HB2  . ARG A 1 24 ? 15.609  2.462   4.732   1.00 0.00 ? 24 ARG A HB2  3  
ATOM 2301  H HB3  . ARG A 1 24 ? 16.771  1.199   5.116   1.00 0.00 ? 24 ARG A HB3  3  
ATOM 2302  H HG2  . ARG A 1 24 ? 16.662  1.138   2.366   1.00 0.00 ? 24 ARG A HG2  3  
ATOM 2303  H HG3  . ARG A 1 24 ? 16.531  2.856   2.744   1.00 0.00 ? 24 ARG A HG3  3  
ATOM 2304  H HD2  . ARG A 1 24 ? 18.509  2.083   4.441   1.00 0.00 ? 24 ARG A HD2  3  
ATOM 2305  H HD3  . ARG A 1 24 ? 18.795  1.013   3.069   1.00 0.00 ? 24 ARG A HD3  3  
ATOM 2306  H HE   . ARG A 1 24 ? 19.409  2.839   1.797   1.00 0.00 ? 24 ARG A HE   3  
ATOM 2307  H HH11 . ARG A 1 24 ? 18.057  3.888   4.830   1.00 0.00 ? 24 ARG A HH11 3  
ATOM 2308  H HH12 . ARG A 1 24 ? 18.561  5.534   4.634   1.00 0.00 ? 24 ARG A HH12 3  
ATOM 2309  H HH21 . ARG A 1 24 ? 20.078  5.002   1.529   1.00 0.00 ? 24 ARG A HH21 3  
ATOM 2310  H HH22 . ARG A 1 24 ? 19.709  6.167   2.756   1.00 0.00 ? 24 ARG A HH22 3  
ATOM 2311  N N    . GLN A 1 25 ? 12.787  0.972   5.032   1.00 0.00 ? 25 GLN A N    3  
ATOM 2312  C CA   . GLN A 1 25 ? 11.741  1.043   6.044   1.00 0.00 ? 25 GLN A CA   3  
ATOM 2313  C C    . GLN A 1 25 ? 10.691  -0.041  5.806   1.00 0.00 ? 25 GLN A C    3  
ATOM 2314  O O    . GLN A 1 25 ? 10.953  -1.223  6.029   1.00 0.00 ? 25 GLN A O    3  
ATOM 2315  C CB   . GLN A 1 25 ? 11.099  2.434   6.050   1.00 0.00 ? 25 GLN A CB   3  
ATOM 2316  C CG   . GLN A 1 25 ? 11.914  3.477   6.797   1.00 0.00 ? 25 GLN A CG   3  
ATOM 2317  C CD   . GLN A 1 25 ? 12.340  3.008   8.174   1.00 0.00 ? 25 GLN A CD   3  
ATOM 2318  O OE1  . GLN A 1 25 ? 11.686  3.305   9.174   1.00 0.00 ? 25 GLN A OE1  3  
ATOM 2319  N NE2  . GLN A 1 25 ? 13.443  2.271   8.234   1.00 0.00 ? 25 GLN A NE2  3  
ATOM 2320  H H    . GLN A 1 25 ? 12.587  1.261   4.118   1.00 0.00 ? 25 GLN A H    3  
ATOM 2321  H HA   . GLN A 1 25 ? 12.197  0.868   7.003   1.00 0.00 ? 25 GLN A HA   3  
ATOM 2322  H HB2  . GLN A 1 25 ? 10.979  2.766   5.029   1.00 0.00 ? 25 GLN A HB2  3  
ATOM 2323  H HB3  . GLN A 1 25 ? 10.127  2.367   6.515   1.00 0.00 ? 25 GLN A HB3  3  
ATOM 2324  H HG2  . GLN A 1 25 ? 12.799  3.704   6.222   1.00 0.00 ? 25 GLN A HG2  3  
ATOM 2325  H HG3  . GLN A 1 25 ? 11.318  4.371   6.905   1.00 0.00 ? 25 GLN A HG3  3  
ATOM 2326  H HE21 . GLN A 1 25 ? 13.913  2.074   7.397   1.00 0.00 ? 25 GLN A HE21 3  
ATOM 2327  H HE22 . GLN A 1 25 ? 13.741  1.954   9.112   1.00 0.00 ? 25 GLN A HE22 3  
ATOM 2328  N N    . GLY A 1 26 ? 9.507   0.356   5.351   1.00 0.00 ? 26 GLY A N    3  
ATOM 2329  C CA   . GLY A 1 26 ? 8.457   -0.610  5.094   1.00 0.00 ? 26 GLY A CA   3  
ATOM 2330  C C    . GLY A 1 26 ? 7.280   -0.016  4.345   1.00 0.00 ? 26 GLY A C    3  
ATOM 2331  O O    . GLY A 1 26 ? 6.417   0.628   4.941   1.00 0.00 ? 26 GLY A O    3  
ATOM 2332  H H    . GLY A 1 26 ? 9.347   1.305   5.188   1.00 0.00 ? 26 GLY A H    3  
ATOM 2333  H HA2  . GLY A 1 26 ? 8.867   -1.421  4.509   1.00 0.00 ? 26 GLY A HA2  3  
ATOM 2334  H HA3  . GLY A 1 26 ? 8.108   -1.003  6.037   1.00 0.00 ? 26 GLY A HA3  3  
ATOM 2335  N N    . ALA A 1 27 ? 7.243   -0.237  3.034   1.00 0.00 ? 27 ALA A N    3  
ATOM 2336  C CA   . ALA A 1 27 ? 6.168   0.274   2.198   1.00 0.00 ? 27 ALA A CA   3  
ATOM 2337  C C    . ALA A 1 27 ? 4.933   -0.622  2.271   1.00 0.00 ? 27 ALA A C    3  
ATOM 2338  O O    . ALA A 1 27 ? 4.007   -0.479  1.473   1.00 0.00 ? 27 ALA A O    3  
ATOM 2339  C CB   . ALA A 1 27 ? 6.640   0.400   0.756   1.00 0.00 ? 27 ALA A CB   3  
ATOM 2340  H H    . ALA A 1 27 ? 7.957   -0.755  2.618   1.00 0.00 ? 27 ALA A H    3  
ATOM 2341  H HA   . ALA A 1 27 ? 5.912   1.257   2.557   1.00 0.00 ? 27 ALA A HA   3  
ATOM 2342  H HB1  . ALA A 1 27 ? 7.169   1.333   0.629   1.00 0.00 ? 27 ALA A HB1  3  
ATOM 2343  H HB2  . ALA A 1 27 ? 5.787   0.381   0.094   1.00 0.00 ? 27 ALA A HB2  3  
ATOM 2344  H HB3  . ALA A 1 27 ? 7.299   -0.421  0.518   1.00 0.00 ? 27 ALA A HB3  3  
ATOM 2345  N N    . GLN A 1 28 ? 4.926   -1.548  3.226   1.00 0.00 ? 28 GLN A N    3  
ATOM 2346  C CA   . GLN A 1 28 ? 3.803   -2.465  3.388   1.00 0.00 ? 28 GLN A CA   3  
ATOM 2347  C C    . GLN A 1 28 ? 2.522   -1.716  3.704   1.00 0.00 ? 28 GLN A C    3  
ATOM 2348  O O    . GLN A 1 28 ? 2.281   -1.334  4.849   1.00 0.00 ? 28 GLN A O    3  
ATOM 2349  C CB   . GLN A 1 28 ? 4.079   -3.465  4.501   1.00 0.00 ? 28 GLN A CB   3  
ATOM 2350  C CG   . GLN A 1 28 ? 5.535   -3.845  4.626   1.00 0.00 ? 28 GLN A CG   3  
ATOM 2351  C CD   . GLN A 1 28 ? 6.172   -3.320  5.898   1.00 0.00 ? 28 GLN A CD   3  
ATOM 2352  O OE1  . GLN A 1 28 ? 5.650   -2.406  6.536   1.00 0.00 ? 28 GLN A OE1  3  
ATOM 2353  N NE2  . GLN A 1 28 ? 7.308   -3.897  6.273   1.00 0.00 ? 28 GLN A NE2  3  
ATOM 2354  H H    . GLN A 1 28 ? 5.692   -1.620  3.830   1.00 0.00 ? 28 GLN A H    3  
ATOM 2355  H HA   . GLN A 1 28 ? 3.677   -3.000  2.460   1.00 0.00 ? 28 GLN A HA   3  
ATOM 2356  H HB2  . GLN A 1 28 ? 3.757   -3.041  5.437   1.00 0.00 ? 28 GLN A HB2  3  
ATOM 2357  H HB3  . GLN A 1 28 ? 3.513   -4.359  4.310   1.00 0.00 ? 28 GLN A HB3  3  
ATOM 2358  H HG2  . GLN A 1 28 ? 5.603   -4.920  4.622   1.00 0.00 ? 28 GLN A HG2  3  
ATOM 2359  H HG3  . GLN A 1 28 ? 6.069   -3.444  3.777   1.00 0.00 ? 28 GLN A HG3  3  
ATOM 2360  H HE21 . GLN A 1 28 ? 7.666   -4.619  5.715   1.00 0.00 ? 28 GLN A HE21 3  
ATOM 2361  H HE22 . GLN A 1 28 ? 7.741   -3.577  7.091   1.00 0.00 ? 28 GLN A HE22 3  
ATOM 2362  N N    . CYS A 1 29 ? 1.708   -1.501  2.687   1.00 0.00 ? 29 CYS A N    3  
ATOM 2363  C CA   . CYS A 1 29 ? 0.456   -0.786  2.872   1.00 0.00 ? 29 CYS A CA   3  
ATOM 2364  C C    . CYS A 1 29 ? 0.760   0.596   3.419   1.00 0.00 ? 29 CYS A C    3  
ATOM 2365  O O    . CYS A 1 29 ? 0.065   1.105   4.299   1.00 0.00 ? 29 CYS A O    3  
ATOM 2366  C CB   . CYS A 1 29 ? -0.461  -1.542  3.835   1.00 0.00 ? 29 CYS A CB   3  
ATOM 2367  S SG   . CYS A 1 29 ? -1.021  -3.160  3.214   1.00 0.00 ? 29 CYS A SG   3  
ATOM 2368  H H    . CYS A 1 29 ? 1.961   -1.816  1.796   1.00 0.00 ? 29 CYS A H    3  
ATOM 2369  H HA   . CYS A 1 29 ? -0.027  -0.696  1.910   1.00 0.00 ? 29 CYS A HA   3  
ATOM 2370  H HB2  . CYS A 1 29 ? 0.065   -1.711  4.762   1.00 0.00 ? 29 CYS A HB2  3  
ATOM 2371  H HB3  . CYS A 1 29 ? -1.338  -0.942  4.030   1.00 0.00 ? 29 CYS A HB3  3  
ATOM 2372  N N    . ALA A 1 30 ? 1.822   1.184   2.890   1.00 0.00 ? 30 ALA A N    3  
ATOM 2373  C CA   . ALA A 1 30 ? 2.260   2.512   3.320   1.00 0.00 ? 30 ALA A CA   3  
ATOM 2374  C C    . ALA A 1 30 ? 1.256   3.566   2.872   1.00 0.00 ? 30 ALA A C    3  
ATOM 2375  O O    . ALA A 1 30 ? 0.050   3.333   2.953   1.00 0.00 ? 30 ALA A O    3  
ATOM 2376  C CB   . ALA A 1 30 ? 3.648   2.809   2.775   1.00 0.00 ? 30 ALA A CB   3  
ATOM 2377  H H    . ALA A 1 30 ? 2.325   0.704   2.189   1.00 0.00 ? 30 ALA A H    3  
ATOM 2378  H HA   . ALA A 1 30 ? 2.311   2.510   4.398   1.00 0.00 ? 30 ALA A HA   3  
ATOM 2379  H HB1  . ALA A 1 30 ? 3.974   3.777   3.126   1.00 0.00 ? 30 ALA A HB1  3  
ATOM 2380  H HB2  . ALA A 1 30 ? 3.619   2.808   1.696   1.00 0.00 ? 30 ALA A HB2  3  
ATOM 2381  H HB3  . ALA A 1 30 ? 4.336   2.052   3.117   1.00 0.00 ? 30 ALA A HB3  3  
ATOM 2382  N N    . GLU A 1 31 ? 1.735   4.710   2.361   1.00 0.00 ? 31 GLU A N    3  
ATOM 2383  C CA   . GLU A 1 31 ? 0.823   5.742   1.868   1.00 0.00 ? 31 GLU A CA   3  
ATOM 2384  C C    . GLU A 1 31 ? -0.293  5.044   1.111   1.00 0.00 ? 31 GLU A C    3  
ATOM 2385  O O    . GLU A 1 31 ? -1.447  5.471   1.105   1.00 0.00 ? 31 GLU A O    3  
ATOM 2386  C CB   . GLU A 1 31 ? 1.557   6.720   0.946   1.00 0.00 ? 31 GLU A CB   3  
ATOM 2387  C CG   . GLU A 1 31 ? 0.847   8.054   0.784   1.00 0.00 ? 31 GLU A CG   3  
ATOM 2388  C CD   . GLU A 1 31 ? 0.653   8.438   -0.670  1.00 0.00 ? 31 GLU A CD   3  
ATOM 2389  O OE1  . GLU A 1 31 ? 1.604   8.979   -1.273  1.00 0.00 ? 31 GLU A OE1  3  
ATOM 2390  O OE2  . GLU A 1 31 ? -0.450  8.198   -1.205  1.00 0.00 ? 31 GLU A OE2  3  
ATOM 2391  H H    . GLU A 1 31 ? 2.701   4.846   2.287   1.00 0.00 ? 31 GLU A H    3  
ATOM 2392  H HA   . GLU A 1 31 ? 0.409   6.271   2.714   1.00 0.00 ? 31 GLU A HA   3  
ATOM 2393  H HB2  . GLU A 1 31 ? 2.542   6.906   1.346   1.00 0.00 ? 31 GLU A HB2  3  
ATOM 2394  H HB3  . GLU A 1 31 ? 1.656   6.270   -0.031  1.00 0.00 ? 31 GLU A HB3  3  
ATOM 2395  H HG2  . GLU A 1 31 ? -0.122  7.991   1.256   1.00 0.00 ? 31 GLU A HG2  3  
ATOM 2396  H HG3  . GLU A 1 31 ? 1.434   8.821   1.269   1.00 0.00 ? 31 GLU A HG3  3  
ATOM 2397  N N    . GLY A 1 32 ? 0.095   3.927   0.512   1.00 0.00 ? 32 GLY A N    3  
ATOM 2398  C CA   . GLY A 1 32 ? -0.811  3.084   -0.222  1.00 0.00 ? 32 GLY A CA   3  
ATOM 2399  C C    . GLY A 1 32 ? -0.325  1.654   -0.182  1.00 0.00 ? 32 GLY A C    3  
ATOM 2400  O O    . GLY A 1 32 ? 0.303   1.241   0.792   1.00 0.00 ? 32 GLY A O    3  
ATOM 2401  H H    . GLY A 1 32 ? 1.030   3.652   0.593   1.00 0.00 ? 32 GLY A H    3  
ATOM 2402  H HA2  . GLY A 1 32 ? -1.785  3.139   0.233   1.00 0.00 ? 32 GLY A HA2  3  
ATOM 2403  H HA3  . GLY A 1 32 ? -0.870  3.415   -1.245  1.00 0.00 ? 32 GLY A HA3  3  
ATOM 2404  N N    . LEU A 1 33 ? -0.614  0.886   -1.216  1.00 0.00 ? 33 LEU A N    3  
ATOM 2405  C CA   . LEU A 1 33 ? -0.191  -0.509  -1.242  1.00 0.00 ? 33 LEU A CA   3  
ATOM 2406  C C    . LEU A 1 33 ? 1.308   -0.670  -1.555  1.00 0.00 ? 33 LEU A C    3  
ATOM 2407  O O    . LEU A 1 33 ? 2.030   0.310   -1.736  1.00 0.00 ? 33 LEU A O    3  
ATOM 2408  C CB   . LEU A 1 33 ? -1.035  -1.287  -2.252  1.00 0.00 ? 33 LEU A CB   3  
ATOM 2409  C CG   . LEU A 1 33 ? -1.447  -2.699  -1.830  1.00 0.00 ? 33 LEU A CG   3  
ATOM 2410  C CD1  . LEU A 1 33 ? -0.600  -3.721  -2.557  1.00 0.00 ? 33 LEU A CD1  3  
ATOM 2411  C CD2  . LEU A 1 33 ? -1.339  -2.886  -0.321  1.00 0.00 ? 33 LEU A CD2  3  
ATOM 2412  H H    . LEU A 1 33 ? -1.136  1.254   -1.964  1.00 0.00 ? 33 LEU A H    3  
ATOM 2413  H HA   . LEU A 1 33 ? -0.371  -0.903  -0.259  1.00 0.00 ? 33 LEU A HA   3  
ATOM 2414  H HB2  . LEU A 1 33 ? -1.933  -0.719  -2.448  1.00 0.00 ? 33 LEU A HB2  3  
ATOM 2415  H HB3  . LEU A 1 33 ? -0.473  -1.363  -3.171  1.00 0.00 ? 33 LEU A HB3  3  
ATOM 2416  H HG   . LEU A 1 33 ? -2.474  -2.860  -2.116  1.00 0.00 ? 33 LEU A HG   3  
ATOM 2417  H HD11 . LEU A 1 33 ? -0.264  -4.473  -1.860  1.00 0.00 ? 33 LEU A HD11 3  
ATOM 2418  H HD12 . LEU A 1 33 ? 0.255   -3.227  -2.996  1.00 0.00 ? 33 LEU A HD12 3  
ATOM 2419  H HD13 . LEU A 1 33 ? -1.187  -4.181  -3.334  1.00 0.00 ? 33 LEU A HD13 3  
ATOM 2420  H HD21 . LEU A 1 33 ? -1.838  -2.067  0.179   1.00 0.00 ? 33 LEU A HD21 3  
ATOM 2421  H HD22 . LEU A 1 33 ? -0.297  -2.897  -0.033  1.00 0.00 ? 33 LEU A HD22 3  
ATOM 2422  H HD23 . LEU A 1 33 ? -1.801  -3.818  -0.037  1.00 0.00 ? 33 LEU A HD23 3  
ATOM 2423  N N    . CYS A 1 34 ? 1.753   -1.933  -1.601  1.00 0.00 ? 34 CYS A N    3  
ATOM 2424  C CA   . CYS A 1 34 ? 3.154   -2.289  -1.878  1.00 0.00 ? 34 CYS A CA   3  
ATOM 2425  C C    . CYS A 1 34 ? 3.214   -3.410  -2.909  1.00 0.00 ? 34 CYS A C    3  
ATOM 2426  O O    . CYS A 1 34 ? 2.179   -3.945  -3.305  1.00 0.00 ? 34 CYS A O    3  
ATOM 2427  C CB   . CYS A 1 34 ? 3.860   -2.698  -0.570  1.00 0.00 ? 34 CYS A CB   3  
ATOM 2428  S SG   . CYS A 1 34 ? 5.028   -4.103  -0.681  1.00 0.00 ? 34 CYS A SG   3  
ATOM 2429  H H    . CYS A 1 34 ? 1.117   -2.651  -1.441  1.00 0.00 ? 34 CYS A H    3  
ATOM 2430  H HA   . CYS A 1 34 ? 3.642   -1.424  -2.289  1.00 0.00 ? 34 CYS A HA   3  
ATOM 2431  H HB2  . CYS A 1 34 ? 4.413   -1.856  -0.202  1.00 0.00 ? 34 CYS A HB2  3  
ATOM 2432  H HB3  . CYS A 1 34 ? 3.103   -2.966  0.152   1.00 0.00 ? 34 CYS A HB3  3  
ATOM 2433  N N    . CYS A 1 35 ? 4.414   -3.760  -3.365  1.00 0.00 ? 35 CYS A N    3  
ATOM 2434  C CA   . CYS A 1 35 ? 4.534   -4.804  -4.363  1.00 0.00 ? 35 CYS A CA   3  
ATOM 2435  C C    . CYS A 1 35 ? 5.564   -5.873  -4.014  1.00 0.00 ? 35 CYS A C    3  
ATOM 2436  O O    . CYS A 1 35 ? 5.522   -6.969  -4.572  1.00 0.00 ? 35 CYS A O    3  
ATOM 2437  C CB   . CYS A 1 35 ? 4.836   -4.184  -5.742  1.00 0.00 ? 35 CYS A CB   3  
ATOM 2438  S SG   . CYS A 1 35 ? 6.420   -4.695  -6.507  1.00 0.00 ? 35 CYS A SG   3  
ATOM 2439  H H    . CYS A 1 35 ? 5.212   -3.304  -3.037  1.00 0.00 ? 35 CYS A H    3  
ATOM 2440  H HA   . CYS A 1 35 ? 3.580   -5.280  -4.403  1.00 0.00 ? 35 CYS A HA   3  
ATOM 2441  H HB2  . CYS A 1 35 ? 4.047   -4.456  -6.426  1.00 0.00 ? 35 CYS A HB2  3  
ATOM 2442  H HB3  . CYS A 1 35 ? 4.856   -3.108  -5.641  1.00 0.00 ? 35 CYS A HB3  3  
ATOM 2443  N N    . ASP A 1 36 ? 6.497   -5.573  -3.129  1.00 0.00 ? 36 ASP A N    3  
ATOM 2444  C CA   . ASP A 1 36 ? 7.512   -6.568  -2.798  1.00 0.00 ? 36 ASP A CA   3  
ATOM 2445  C C    . ASP A 1 36 ? 8.102   -6.404  -1.393  1.00 0.00 ? 36 ASP A C    3  
ATOM 2446  O O    . ASP A 1 36 ? 7.376   -6.104  -0.446  1.00 0.00 ? 36 ASP A O    3  
ATOM 2447  C CB   . ASP A 1 36 ? 8.613   -6.544  -3.860  1.00 0.00 ? 36 ASP A CB   3  
ATOM 2448  C CG   . ASP A 1 36 ? 9.223   -7.913  -4.090  1.00 0.00 ? 36 ASP A CG   3  
ATOM 2449  O OD1  . ASP A 1 36 ? 9.212   -8.734  -3.149  1.00 0.00 ? 36 ASP A OD1  3  
ATOM 2450  O OD2  . ASP A 1 36 ? 9.711   -8.165  -5.213  1.00 0.00 ? 36 ASP A OD2  3  
ATOM 2451  H H    . ASP A 1 36 ? 6.512   -4.686  -2.717  1.00 0.00 ? 36 ASP A H    3  
ATOM 2452  H HA   . ASP A 1 36 ? 7.027   -7.523  -2.841  1.00 0.00 ? 36 ASP A HA   3  
ATOM 2453  H HB2  . ASP A 1 36 ? 8.198   -6.195  -4.793  1.00 0.00 ? 36 ASP A HB2  3  
ATOM 2454  H HB3  . ASP A 1 36 ? 9.394   -5.872  -3.544  1.00 0.00 ? 36 ASP A HB3  3  
ATOM 2455  N N    . GLN A 1 37 ? 9.422   -6.647  -1.279  1.00 0.00 ? 37 GLN A N    3  
ATOM 2456  C CA   . GLN A 1 37 ? 10.155  -6.578  -0.009  1.00 0.00 ? 37 GLN A CA   3  
ATOM 2457  C C    . GLN A 1 37 ? 9.308   -6.022  1.126   1.00 0.00 ? 37 GLN A C    3  
ATOM 2458  O O    . GLN A 1 37 ? 9.096   -6.699  2.132   1.00 0.00 ? 37 GLN A O    3  
ATOM 2459  C CB   . GLN A 1 37 ? 11.413  -5.727  -0.179  1.00 0.00 ? 37 GLN A CB   3  
ATOM 2460  C CG   . GLN A 1 37 ? 12.553  -6.458  -0.870  1.00 0.00 ? 37 GLN A CG   3  
ATOM 2461  C CD   . GLN A 1 37 ? 13.704  -6.765  0.069   1.00 0.00 ? 37 GLN A CD   3  
ATOM 2462  O OE1  . GLN A 1 37 ? 14.668  -6.005  0.156   1.00 0.00 ? 37 GLN A OE1  3  
ATOM 2463  N NE2  . GLN A 1 37 ? 13.609  -7.885  0.776   1.00 0.00 ? 37 GLN A NE2  3  
ATOM 2464  H H    . GLN A 1 37 ? 9.921   -6.909  -2.078  1.00 0.00 ? 37 GLN A H    3  
ATOM 2465  H HA   . GLN A 1 37 ? 10.453  -7.582  0.248   1.00 0.00 ? 37 GLN A HA   3  
ATOM 2466  H HB2  . GLN A 1 37 ? 11.166  -4.855  -0.765  1.00 0.00 ? 37 GLN A HB2  3  
ATOM 2467  H HB3  . GLN A 1 37 ? 11.755  -5.411  0.796   1.00 0.00 ? 37 GLN A HB3  3  
ATOM 2468  H HG2  . GLN A 1 37 ? 12.177  -7.388  -1.269  1.00 0.00 ? 37 GLN A HG2  3  
ATOM 2469  H HG3  . GLN A 1 37 ? 12.920  -5.843  -1.678  1.00 0.00 ? 37 GLN A HG3  3  
ATOM 2470  H HE21 . GLN A 1 37 ? 12.812  -8.443  0.655   1.00 0.00 ? 37 GLN A HE21 3  
ATOM 2471  H HE22 . GLN A 1 37 ? 14.339  -8.108  1.390   1.00 0.00 ? 37 GLN A HE22 3  
ATOM 2472  N N    . CYS A 1 38 ? 8.832   -4.793  0.962   1.00 0.00 ? 38 CYS A N    3  
ATOM 2473  C CA   . CYS A 1 38 ? 8.005   -4.151  1.979   1.00 0.00 ? 38 CYS A CA   3  
ATOM 2474  C C    . CYS A 1 38 ? 7.181   -5.180  2.749   1.00 0.00 ? 38 CYS A C    3  
ATOM 2475  O O    . CYS A 1 38 ? 7.435   -5.419  3.928   1.00 0.00 ? 38 CYS A O    3  
ATOM 2476  C CB   . CYS A 1 38 ? 7.071   -3.111  1.345   1.00 0.00 ? 38 CYS A CB   3  
ATOM 2477  S SG   . CYS A 1 38 ? 6.869   -3.280  -0.457  1.00 0.00 ? 38 CYS A SG   3  
ATOM 2478  H H    . CYS A 1 38 ? 9.043   -4.307  0.138   1.00 0.00 ? 38 CYS A H    3  
ATOM 2479  H HA   . CYS A 1 38 ? 8.663   -3.649  2.671   1.00 0.00 ? 38 CYS A HA   3  
ATOM 2480  H HB2  . CYS A 1 38 ? 6.092   -3.194  1.791   1.00 0.00 ? 38 CYS A HB2  3  
ATOM 2481  H HB3  . CYS A 1 38 ? 7.462   -2.124  1.536   1.00 0.00 ? 38 CYS A HB3  3  
ATOM 2482  N N    . ARG A 1 39 ? 6.193   -5.764  2.063   1.00 0.00 ? 39 ARG A N    3  
ATOM 2483  C CA   . ARG A 1 39 ? 5.286   -6.762  2.643   1.00 0.00 ? 39 ARG A CA   3  
ATOM 2484  C C    . ARG A 1 39 ? 3.926   -6.118  2.893   1.00 0.00 ? 39 ARG A C    3  
ATOM 2485  O O    . ARG A 1 39 ? 3.616   -5.089  2.294   1.00 0.00 ? 39 ARG A O    3  
ATOM 2486  C CB   . ARG A 1 39 ? 5.845   -7.374  3.933   1.00 0.00 ? 39 ARG A CB   3  
ATOM 2487  C CG   . ARG A 1 39 ? 5.350   -8.787  4.197   1.00 0.00 ? 39 ARG A CG   3  
ATOM 2488  C CD   . ARG A 1 39 ? 5.066   -9.012  5.673   1.00 0.00 ? 39 ARG A CD   3  
ATOM 2489  N NE   . ARG A 1 39 ? 5.523   -10.324 6.123   1.00 0.00 ? 39 ARG A NE   3  
ATOM 2490  C CZ   . ARG A 1 39 ? 6.783   -10.739 6.027   1.00 0.00 ? 39 ARG A CZ   3  
ATOM 2491  N NH1  . ARG A 1 39 ? 7.707   -9.944  5.505   1.00 0.00 ? 39 ARG A NH1  3  
ATOM 2492  N NH2  . ARG A 1 39 ? 7.119   -11.948 6.455   1.00 0.00 ? 39 ARG A NH2  3  
ATOM 2493  H H    . ARG A 1 39 ? 6.059   -5.503  1.126   1.00 0.00 ? 39 ARG A H    3  
ATOM 2494  H HA   . ARG A 1 39 ? 5.160   -7.546  1.909   1.00 0.00 ? 39 ARG A HA   3  
ATOM 2495  H HB2  . ARG A 1 39 ? 6.921   -7.405  3.867   1.00 0.00 ? 39 ARG A HB2  3  
ATOM 2496  H HB3  . ARG A 1 39 ? 5.559   -6.755  4.769   1.00 0.00 ? 39 ARG A HB3  3  
ATOM 2497  H HG2  . ARG A 1 39 ? 4.442   -8.952  3.636   1.00 0.00 ? 39 ARG A HG2  3  
ATOM 2498  H HG3  . ARG A 1 39 ? 6.106   -9.488  3.874   1.00 0.00 ? 39 ARG A HG3  3  
ATOM 2499  H HD2  . ARG A 1 39 ? 5.574   -8.250  6.244   1.00 0.00 ? 39 ARG A HD2  3  
ATOM 2500  H HD3  . ARG A 1 39 ? 4.001   -8.936  5.837   1.00 0.00 ? 39 ARG A HD3  3  
ATOM 2501  H HE   . ARG A 1 39 ? 4.857   -10.927 6.514   1.00 0.00 ? 39 ARG A HE   3  
ATOM 2502  H HH11 . ARG A 1 39 ? 7.458   -9.031  5.183   1.00 0.00 ? 39 ARG A HH11 3  
ATOM 2503  H HH12 . ARG A 1 39 ? 8.654   -10.258 5.434   1.00 0.00 ? 39 ARG A HH12 3  
ATOM 2504  H HH21 . ARG A 1 39 ? 6.425   -12.549 6.851   1.00 0.00 ? 39 ARG A HH21 3  
ATOM 2505  H HH22 . ARG A 1 39 ? 8.067   -12.258 6.382   1.00 0.00 ? 39 ARG A HH22 3  
ATOM 2506  N N    . PHE A 1 40 ? 3.100   -6.712  3.757   1.00 0.00 ? 40 PHE A N    3  
ATOM 2507  C CA   . PHE A 1 40 ? 1.774   -6.148  4.022   1.00 0.00 ? 40 PHE A CA   3  
ATOM 2508  C C    . PHE A 1 40 ? 1.192   -6.619  5.348   1.00 0.00 ? 40 PHE A C    3  
ATOM 2509  O O    . PHE A 1 40 ? 1.479   -7.720  5.818   1.00 0.00 ? 40 PHE A O    3  
ATOM 2510  C CB   . PHE A 1 40 ? 0.835   -6.491  2.869   1.00 0.00 ? 40 PHE A CB   3  
ATOM 2511  C CG   . PHE A 1 40 ? 1.511   -6.346  1.543   1.00 0.00 ? 40 PHE A CG   3  
ATOM 2512  C CD1  . PHE A 1 40 ? 2.270   -7.380  1.019   1.00 0.00 ? 40 PHE A CD1  3  
ATOM 2513  C CD2  . PHE A 1 40 ? 1.435   -5.157  0.843   1.00 0.00 ? 40 PHE A CD2  3  
ATOM 2514  C CE1  . PHE A 1 40 ? 2.935   -7.228  -0.174  1.00 0.00 ? 40 PHE A CE1  3  
ATOM 2515  C CE2  . PHE A 1 40 ? 2.091   -5.005  -0.353  1.00 0.00 ? 40 PHE A CE2  3  
ATOM 2516  C CZ   . PHE A 1 40 ? 2.844   -6.039  -0.863  1.00 0.00 ? 40 PHE A CZ   3  
ATOM 2517  H H    . PHE A 1 40 ? 3.376   -7.536  4.207   1.00 0.00 ? 40 PHE A H    3  
ATOM 2518  H HA   . PHE A 1 40 ? 1.879   -5.076  4.063   1.00 0.00 ? 40 PHE A HA   3  
ATOM 2519  H HB2  . PHE A 1 40 ? 0.500   -7.511  2.971   1.00 0.00 ? 40 PHE A HB2  3  
ATOM 2520  H HB3  . PHE A 1 40 ? -0.016  -5.825  2.888   1.00 0.00 ? 40 PHE A HB3  3  
ATOM 2521  H HD1  . PHE A 1 40 ? 2.338   -8.314  1.551   1.00 0.00 ? 40 PHE A HD1  3  
ATOM 2522  H HD2  . PHE A 1 40 ? 0.846   -4.343  1.234   1.00 0.00 ? 40 PHE A HD2  3  
ATOM 2523  H HE1  . PHE A 1 40 ? 3.528   -8.037  -0.566  1.00 0.00 ? 40 PHE A HE1  3  
ATOM 2524  H HE2  . PHE A 1 40 ? 2.022   -4.075  -0.885  1.00 0.00 ? 40 PHE A HE2  3  
ATOM 2525  H HZ   . PHE A 1 40 ? 3.369   -5.912  -1.797  1.00 0.00 ? 40 PHE A HZ   3  
ATOM 2526  N N    . MET A 1 41 ? 0.374   -5.756  5.943   1.00 0.00 ? 41 MET A N    3  
ATOM 2527  C CA   . MET A 1 41 ? -0.263  -6.037  7.220   1.00 0.00 ? 41 MET A CA   3  
ATOM 2528  C C    . MET A 1 41 ? -1.049  -7.346  7.182   1.00 0.00 ? 41 MET A C    3  
ATOM 2529  O O    . MET A 1 41 ? -0.498  -8.412  7.453   1.00 0.00 ? 41 MET A O    3  
ATOM 2530  C CB   . MET A 1 41 ? -1.191  -4.882  7.604   1.00 0.00 ? 41 MET A CB   3  
ATOM 2531  C CG   . MET A 1 41 ? -0.574  -3.907  8.594   1.00 0.00 ? 41 MET A CG   3  
ATOM 2532  S SD   . MET A 1 41 ? -0.910  -4.352  10.308  1.00 0.00 ? 41 MET A SD   3  
ATOM 2533  C CE   . MET A 1 41 ? 0.221   -3.263  11.169  1.00 0.00 ? 41 MET A CE   3  
ATOM 2534  H H    . MET A 1 41 ? 0.200   -4.897  5.511   1.00 0.00 ? 41 MET A H    3  
ATOM 2535  H HA   . MET A 1 41 ? 0.514   -6.120  7.961   1.00 0.00 ? 41 MET A HA   3  
ATOM 2536  H HB2  . MET A 1 41 ? -1.455  -4.335  6.709   1.00 0.00 ? 41 MET A HB2  3  
ATOM 2537  H HB3  . MET A 1 41 ? -2.091  -5.287  8.043   1.00 0.00 ? 41 MET A HB3  3  
ATOM 2538  H HG2  . MET A 1 41 ? 0.495   -3.892  8.444   1.00 0.00 ? 41 MET A HG2  3  
ATOM 2539  H HG3  . MET A 1 41 ? -0.976  -2.922  8.406   1.00 0.00 ? 41 MET A HG3  3  
ATOM 2540  H HE1  . MET A 1 41 ? 0.962   -3.851  11.689  1.00 0.00 ? 41 MET A HE1  3  
ATOM 2541  H HE2  . MET A 1 41 ? -0.328  -2.664  11.881  1.00 0.00 ? 41 MET A HE2  3  
ATOM 2542  H HE3  . MET A 1 41 ? 0.710   -2.615  10.456  1.00 0.00 ? 41 MET A HE3  3  
ATOM 2543  N N    . LYS A 1 42 ? -2.340  -7.241  6.852   1.00 0.00 ? 42 LYS A N    3  
ATOM 2544  C CA   . LYS A 1 42 ? -3.240  -8.390  6.780   1.00 0.00 ? 42 LYS A CA   3  
ATOM 2545  C C    . LYS A 1 42 ? -4.619  -7.994  7.288   1.00 0.00 ? 42 LYS A C    3  
ATOM 2546  O O    . LYS A 1 42 ? -5.624  -8.631  6.971   1.00 0.00 ? 42 LYS A O    3  
ATOM 2547  C CB   . LYS A 1 42 ? -2.709  -9.573  7.595   1.00 0.00 ? 42 LYS A CB   3  
ATOM 2548  C CG   . LYS A 1 42 ? -3.727  -10.685 7.788   1.00 0.00 ? 42 LYS A CG   3  
ATOM 2549  C CD   . LYS A 1 42 ? -4.091  -11.341 6.466   1.00 0.00 ? 42 LYS A CD   3  
ATOM 2550  C CE   . LYS A 1 42 ? -3.300  -12.620 6.243   1.00 0.00 ? 42 LYS A CE   3  
ATOM 2551  N NZ   . LYS A 1 42 ? -2.013  -12.363 5.540   1.00 0.00 ? 42 LYS A NZ   3  
ATOM 2552  H H    . LYS A 1 42 ? -2.705  -6.353  6.650   1.00 0.00 ? 42 LYS A H    3  
ATOM 2553  H HA   . LYS A 1 42 ? -3.321  -8.677  5.748   1.00 0.00 ? 42 LYS A HA   3  
ATOM 2554  H HB2  . LYS A 1 42 ? -1.849  -9.985  7.091   1.00 0.00 ? 42 LYS A HB2  3  
ATOM 2555  H HB3  . LYS A 1 42 ? -2.408  -9.217  8.570   1.00 0.00 ? 42 LYS A HB3  3  
ATOM 2556  H HG2  . LYS A 1 42 ? -3.310  -11.432 8.446   1.00 0.00 ? 42 LYS A HG2  3  
ATOM 2557  H HG3  . LYS A 1 42 ? -4.620  -10.269 8.231   1.00 0.00 ? 42 LYS A HG3  3  
ATOM 2558  H HD2  . LYS A 1 42 ? -5.144  -11.578 6.470   1.00 0.00 ? 42 LYS A HD2  3  
ATOM 2559  H HD3  . LYS A 1 42 ? -3.877  -10.652 5.662   1.00 0.00 ? 42 LYS A HD3  3  
ATOM 2560  H HE2  . LYS A 1 42 ? -3.092  -13.071 7.202   1.00 0.00 ? 42 LYS A HE2  3  
ATOM 2561  H HE3  . LYS A 1 42 ? -3.896  -13.298 5.649   1.00 0.00 ? 42 LYS A HE3  3  
ATOM 2562  H HZ1  . LYS A 1 42 ? -2.150  -12.421 4.510   1.00 0.00 ? 42 LYS A HZ1  3  
ATOM 2563  H HZ2  . LYS A 1 42 ? -1.303  -13.067 5.824   1.00 0.00 ? 42 LYS A HZ2  3  
ATOM 2564  H HZ3  . LYS A 1 42 ? -1.659  -11.414 5.779   1.00 0.00 ? 42 LYS A HZ3  3  
ATOM 2565  N N    . GLU A 1 43 ? -4.647  -6.926  8.072   1.00 0.00 ? 43 GLU A N    3  
ATOM 2566  C CA   . GLU A 1 43 ? -5.887  -6.406  8.633   1.00 0.00 ? 43 GLU A CA   3  
ATOM 2567  C C    . GLU A 1 43 ? -6.110  -4.973  8.167   1.00 0.00 ? 43 GLU A C    3  
ATOM 2568  O O    . GLU A 1 43 ? -5.221  -4.133  8.298   1.00 0.00 ? 43 GLU A O    3  
ATOM 2569  C CB   . GLU A 1 43 ? -5.847  -6.462  10.161  1.00 0.00 ? 43 GLU A CB   3  
ATOM 2570  C CG   . GLU A 1 43 ? -7.083  -5.874  10.823  1.00 0.00 ? 43 GLU A CG   3  
ATOM 2571  C CD   . GLU A 1 43 ? -6.757  -4.702  11.728  1.00 0.00 ? 43 GLU A CD   3  
ATOM 2572  O OE1  . GLU A 1 43 ? -5.923  -3.861  11.333  1.00 0.00 ? 43 GLU A OE1  3  
ATOM 2573  O OE2  . GLU A 1 43 ? -7.335  -4.626  12.832  1.00 0.00 ? 43 GLU A OE2  3  
ATOM 2574  H H    . GLU A 1 43 ? -3.807  -6.467  8.272   1.00 0.00 ? 43 GLU A H    3  
ATOM 2575  H HA   . GLU A 1 43 ? -6.699  -7.022  8.276   1.00 0.00 ? 43 GLU A HA   3  
ATOM 2576  H HB2  . GLU A 1 43 ? -5.756  -7.493  10.470  1.00 0.00 ? 43 GLU A HB2  3  
ATOM 2577  H HB3  . GLU A 1 43 ? -4.984  -5.913  10.507  1.00 0.00 ? 43 GLU A HB3  3  
ATOM 2578  H HG2  . GLU A 1 43 ? -7.762  -5.537  10.055  1.00 0.00 ? 43 GLU A HG2  3  
ATOM 2579  H HG3  . GLU A 1 43 ? -7.560  -6.644  11.413  1.00 0.00 ? 43 GLU A HG3  3  
ATOM 2580  N N    . GLY A 1 44 ? -7.297  -4.720  7.611   1.00 0.00 ? 44 GLY A N    3  
ATOM 2581  C CA   . GLY A 1 44 ? -7.653  -3.402  7.102   1.00 0.00 ? 44 GLY A CA   3  
ATOM 2582  C C    . GLY A 1 44 ? -6.674  -2.311  7.455   1.00 0.00 ? 44 GLY A C    3  
ATOM 2583  O O    . GLY A 1 44 ? -6.938  -1.490  8.333   1.00 0.00 ? 44 GLY A O    3  
ATOM 2584  H H    . GLY A 1 44 ? -7.945  -5.449  7.534   1.00 0.00 ? 44 GLY A H    3  
ATOM 2585  H HA2  . GLY A 1 44 ? -7.712  -3.456  6.028   1.00 0.00 ? 44 GLY A HA2  3  
ATOM 2586  H HA3  . GLY A 1 44 ? -8.622  -3.133  7.490   1.00 0.00 ? 44 GLY A HA3  3  
ATOM 2587  N N    . THR A 1 45 ? -5.546  -2.291  6.759   1.00 0.00 ? 45 THR A N    3  
ATOM 2588  C CA   . THR A 1 45 ? -4.540  -1.276  7.001   1.00 0.00 ? 45 THR A CA   3  
ATOM 2589  C C    . THR A 1 45 ? -4.724  -0.109  6.040   1.00 0.00 ? 45 THR A C    3  
ATOM 2590  O O    . THR A 1 45 ? -5.285  0.923   6.402   1.00 0.00 ? 45 THR A O    3  
ATOM 2591  C CB   . THR A 1 45 ? -3.146  -1.880  6.883   1.00 0.00 ? 45 THR A CB   3  
ATOM 2592  O OG1  . THR A 1 45 ? -3.077  -3.111  7.582   1.00 0.00 ? 45 THR A OG1  3  
ATOM 2593  C CG2  . THR A 1 45 ? -2.066  -0.980  7.428   1.00 0.00 ? 45 THR A CG2  3  
ATOM 2594  H H    . THR A 1 45 ? -5.391  -2.971  6.059   1.00 0.00 ? 45 THR A H    3  
ATOM 2595  H HA   . THR A 1 45 ? -4.676  -0.913  7.999   1.00 0.00 ? 45 THR A HA   3  
ATOM 2596  H HB   . THR A 1 45 ? -2.930  -2.069  5.847   1.00 0.00 ? 45 THR A HB   3  
ATOM 2597  H HG1  . THR A 1 45 ? -3.923  -3.564  7.518   1.00 0.00 ? 45 THR A HG1  3  
ATOM 2598  H HG21 . THR A 1 45 ? -1.959  -1.151  8.489   1.00 0.00 ? 45 THR A HG21 3  
ATOM 2599  H HG22 . THR A 1 45 ? -2.339  0.051   7.255   1.00 0.00 ? 45 THR A HG22 3  
ATOM 2600  H HG23 . THR A 1 45 ? -1.134  -1.196  6.931   1.00 0.00 ? 45 THR A HG23 3  
ATOM 2601  N N    . ILE A 1 46 ? -4.272  -0.292  4.812   1.00 0.00 ? 46 ILE A N    3  
ATOM 2602  C CA   . ILE A 1 46 ? -4.404  0.728   3.778   1.00 0.00 ? 46 ILE A CA   3  
ATOM 2603  C C    . ILE A 1 46 ? -3.900  0.200   2.432   1.00 0.00 ? 46 ILE A C    3  
ATOM 2604  O O    . ILE A 1 46 ? -2.700  0.188   2.156   1.00 0.00 ? 46 ILE A O    3  
ATOM 2605  C CB   . ILE A 1 46 ? -3.688  2.054   4.178   1.00 0.00 ? 46 ILE A CB   3  
ATOM 2606  C CG1  . ILE A 1 46 ? -4.732  3.139   4.458   1.00 0.00 ? 46 ILE A CG1  3  
ATOM 2607  C CG2  . ILE A 1 46 ? -2.709  2.534   3.110   1.00 0.00 ? 46 ILE A CG2  3  
ATOM 2608  C CD1  . ILE A 1 46 ? -4.956  3.405   5.930   1.00 0.00 ? 46 ILE A CD1  3  
ATOM 2609  H H    . ILE A 1 46 ? -3.856  -1.144  4.591   1.00 0.00 ? 46 ILE A H    3  
ATOM 2610  H HA   . ILE A 1 46 ? -5.460  0.942   3.677   1.00 0.00 ? 46 ILE A HA   3  
ATOM 2611  H HB   . ILE A 1 46 ? -3.128  1.872   5.081   1.00 0.00 ? 46 ILE A HB   3  
ATOM 2612  H HG12 . ILE A 1 46 ? -4.413  4.062   4.000   1.00 0.00 ? 46 ILE A HG12 3  
ATOM 2613  H HG13 . ILE A 1 46 ? -5.676  2.838   4.027   1.00 0.00 ? 46 ILE A HG13 3  
ATOM 2614  H HG21 . ILE A 1 46 ? -3.149  2.402   2.133   1.00 0.00 ? 46 ILE A HG21 3  
ATOM 2615  H HG22 . ILE A 1 46 ? -1.796  1.961   3.174   1.00 0.00 ? 46 ILE A HG22 3  
ATOM 2616  H HG23 . ILE A 1 46 ? -2.489  3.580   3.268   1.00 0.00 ? 46 ILE A HG23 3  
ATOM 2617  H HD11 . ILE A 1 46 ? -4.145  2.980   6.501   1.00 0.00 ? 46 ILE A HD11 3  
ATOM 2618  H HD12 . ILE A 1 46 ? -5.889  2.955   6.238   1.00 0.00 ? 46 ILE A HD12 3  
ATOM 2619  H HD13 . ILE A 1 46 ? -4.998  4.471   6.101   1.00 0.00 ? 46 ILE A HD13 3  
ATOM 2620  N N    . CYS A 1 47 ? -4.839  -0.248  1.608   1.00 0.00 ? 47 CYS A N    3  
ATOM 2621  C CA   . CYS A 1 47 ? -4.524  -0.791  0.293   1.00 0.00 ? 47 CYS A CA   3  
ATOM 2622  C C    . CYS A 1 47 ? -4.604  0.274   -0.791  1.00 0.00 ? 47 CYS A C    3  
ATOM 2623  O O    . CYS A 1 47 ? -4.510  -0.044  -1.976  1.00 0.00 ? 47 CYS A O    3  
ATOM 2624  C CB   . CYS A 1 47 ? -5.478  -1.922  -0.045  1.00 0.00 ? 47 CYS A CB   3  
ATOM 2625  S SG   . CYS A 1 47 ? -4.741  -3.158  -1.140  1.00 0.00 ? 47 CYS A SG   3  
ATOM 2626  H H    . CYS A 1 47 ? -5.771  -0.223  1.897   1.00 0.00 ? 47 CYS A H    3  
ATOM 2627  H HA   . CYS A 1 47 ? -3.522  -1.188  0.320   1.00 0.00 ? 47 CYS A HA   3  
ATOM 2628  H HB2  . CYS A 1 47 ? -5.774  -2.419  0.864   1.00 0.00 ? 47 CYS A HB2  3  
ATOM 2629  H HB3  . CYS A 1 47 ? -6.350  -1.521  -0.537  1.00 0.00 ? 47 CYS A HB3  3  
ATOM 2630  N N    . ARG A 1 48 ? -4.792  1.527   -0.370  1.00 0.00 ? 48 ARG A N    3  
ATOM 2631  C CA   . ARG A 1 48 ? -4.907  2.669   -1.287  1.00 0.00 ? 48 ARG A CA   3  
ATOM 2632  C C    . ARG A 1 48 ? -4.585  2.293   -2.730  1.00 0.00 ? 48 ARG A C    3  
ATOM 2633  O O    . ARG A 1 48 ? -3.419  2.204   -3.116  1.00 0.00 ? 48 ARG A O    3  
ATOM 2634  C CB   . ARG A 1 48 ? -3.990  3.806   -0.837  1.00 0.00 ? 48 ARG A CB   3  
ATOM 2635  C CG   . ARG A 1 48 ? -4.107  4.134   0.643   1.00 0.00 ? 48 ARG A CG   3  
ATOM 2636  C CD   . ARG A 1 48 ? -4.553  5.571   0.860   1.00 0.00 ? 48 ARG A CD   3  
ATOM 2637  N NE   . ARG A 1 48 ? -3.692  6.522   0.164   1.00 0.00 ? 48 ARG A NE   3  
ATOM 2638  C CZ   . ARG A 1 48 ? -3.949  7.823   0.079   1.00 0.00 ? 48 ARG A CZ   3  
ATOM 2639  N NH1  . ARG A 1 48 ? -5.038  8.324   0.646   1.00 0.00 ? 48 ARG A NH1  3  
ATOM 2640  N NH2  . ARG A 1 48 ? -3.117  8.624   -0.573  1.00 0.00 ? 48 ARG A NH2  3  
ATOM 2641  H H    . ARG A 1 48 ? -4.875  1.688   0.595   1.00 0.00 ? 48 ARG A H    3  
ATOM 2642  H HA   . ARG A 1 48 ? -5.921  3.012   -1.248  1.00 0.00 ? 48 ARG A HA   3  
ATOM 2643  H HB2  . ARG A 1 48 ? -2.969  3.531   -1.048  1.00 0.00 ? 48 ARG A HB2  3  
ATOM 2644  H HB3  . ARG A 1 48 ? -4.235  4.693   -1.400  1.00 0.00 ? 48 ARG A HB3  3  
ATOM 2645  H HG2  . ARG A 1 48 ? -4.830  3.472   1.093   1.00 0.00 ? 48 ARG A HG2  3  
ATOM 2646  H HG3  . ARG A 1 48 ? -3.145  3.991   1.113   1.00 0.00 ? 48 ARG A HG3  3  
ATOM 2647  H HD2  . ARG A 1 48 ? -5.563  5.680   0.494   1.00 0.00 ? 48 ARG A HD2  3  
ATOM 2648  H HD3  . ARG A 1 48 ? -4.530  5.786   1.918   1.00 0.00 ? 48 ARG A HD3  3  
ATOM 2649  H HE   . ARG A 1 48 ? -2.881  6.173   -0.262  1.00 0.00 ? 48 ARG A HE   3  
ATOM 2650  H HH11 . ARG A 1 48 ? -5.667  7.723   1.139   1.00 0.00 ? 48 ARG A HH11 3  
ATOM 2651  H HH12 . ARG A 1 48 ? -5.229  9.304   0.581   1.00 0.00 ? 48 ARG A HH12 3  
ATOM 2652  H HH21 . ARG A 1 48 ? -2.295  8.250   -1.001  1.00 0.00 ? 48 ARG A HH21 3  
ATOM 2653  H HH22 . ARG A 1 48 ? -3.312  9.603   -0.636  1.00 0.00 ? 48 ARG A HH22 3  
ATOM 2654  N N    . ARG A 1 49 ? -5.633  2.069   -3.520  1.00 0.00 ? 49 ARG A N    3  
ATOM 2655  C CA   . ARG A 1 49 ? -5.469  1.695   -4.920  1.00 0.00 ? 49 ARG A CA   3  
ATOM 2656  C C    . ARG A 1 49 ? -6.683  2.111   -5.745  1.00 0.00 ? 49 ARG A C    3  
ATOM 2657  O O    . ARG A 1 49 ? -6.915  1.583   -6.833  1.00 0.00 ? 49 ARG A O    3  
ATOM 2658  C CB   . ARG A 1 49 ? -5.255  0.185   -5.041  1.00 0.00 ? 49 ARG A CB   3  
ATOM 2659  C CG   . ARG A 1 49 ? -3.938  -0.194  -5.696  1.00 0.00 ? 49 ARG A CG   3  
ATOM 2660  C CD   . ARG A 1 49 ? -4.142  -1.203  -6.814  1.00 0.00 ? 49 ARG A CD   3  
ATOM 2661  N NE   . ARG A 1 49 ? -4.284  -0.556  -8.116  1.00 0.00 ? 49 ARG A NE   3  
ATOM 2662  C CZ   . ARG A 1 49 ? -3.983  -1.147  -9.268  1.00 0.00 ? 49 ARG A CZ   3  
ATOM 2663  N NH1  . ARG A 1 49 ? -3.527  -2.392  -9.277  1.00 0.00 ? 49 ARG A NH1  3  
ATOM 2664  N NH2  . ARG A 1 49 ? -4.139  -0.494  -10.411 1.00 0.00 ? 49 ARG A NH2  3  
ATOM 2665  H H    . ARG A 1 49 ? -6.538  2.153   -3.149  1.00 0.00 ? 49 ARG A H    3  
ATOM 2666  H HA   . ARG A 1 49 ? -4.597  2.205   -5.300  1.00 0.00 ? 49 ARG A HA   3  
ATOM 2667  H HB2  . ARG A 1 49 ? -5.279  -0.250  -4.053  1.00 0.00 ? 49 ARG A HB2  3  
ATOM 2668  H HB3  . ARG A 1 49 ? -6.058  -0.234  -5.629  1.00 0.00 ? 49 ARG A HB3  3  
ATOM 2669  H HG2  . ARG A 1 49 ? -3.481  0.695   -6.105  1.00 0.00 ? 49 ARG A HG2  3  
ATOM 2670  H HG3  . ARG A 1 49 ? -3.287  -0.625  -4.949  1.00 0.00 ? 49 ARG A HG3  3  
ATOM 2671  H HD2  . ARG A 1 49 ? -3.290  -1.866  -6.844  1.00 0.00 ? 49 ARG A HD2  3  
ATOM 2672  H HD3  . ARG A 1 49 ? -5.035  -1.774  -6.607  1.00 0.00 ? 49 ARG A HD3  3  
ATOM 2673  H HE   . ARG A 1 49 ? -4.620  0.364   -8.132  1.00 0.00 ? 49 ARG A HE   3  
ATOM 2674  H HH11 . ARG A 1 49 ? -3.409  -2.888  -8.417  1.00 0.00 ? 49 ARG A HH11 3  
ATOM 2675  H HH12 . ARG A 1 49 ? -3.301  -2.835  -10.145 1.00 0.00 ? 49 ARG A HH12 3  
ATOM 2676  H HH21 . ARG A 1 49 ? -4.483  0.445   -10.408 1.00 0.00 ? 49 ARG A HH21 3  
ATOM 2677  H HH22 . ARG A 1 49 ? -3.911  -0.940  -11.277 1.00 0.00 ? 49 ARG A HH22 3  
ATOM 2678  N N    . ALA A 1 50 ? -7.455  3.059   -5.224  1.00 0.00 ? 50 ALA A N    3  
ATOM 2679  C CA   . ALA A 1 50 ? -8.643  3.540   -5.918  1.00 0.00 ? 50 ALA A CA   3  
ATOM 2680  C C    . ALA A 1 50 ? -8.280  4.590   -6.962  1.00 0.00 ? 50 ALA A C    3  
ATOM 2681  O O    . ALA A 1 50 ? -7.113  4.741   -7.324  1.00 0.00 ? 50 ALA A O    3  
ATOM 2682  C CB   . ALA A 1 50 ? -9.644  4.106   -4.922  1.00 0.00 ? 50 ALA A CB   3  
ATOM 2683  H H    . ALA A 1 50 ? -7.220  3.443   -4.354  1.00 0.00 ? 50 ALA A H    3  
ATOM 2684  H HA   . ALA A 1 50 ? -9.103  2.698   -6.415  1.00 0.00 ? 50 ALA A HA   3  
ATOM 2685  H HB1  . ALA A 1 50 ? -9.418  3.734   -3.934  1.00 0.00 ? 50 ALA A HB1  3  
ATOM 2686  H HB2  . ALA A 1 50 ? -10.642 3.802   -5.202  1.00 0.00 ? 50 ALA A HB2  3  
ATOM 2687  H HB3  . ALA A 1 50 ? -9.583  5.185   -4.924  1.00 0.00 ? 50 ALA A HB3  3  
ATOM 2688  N N    . ARG A 1 51 ? -9.286  5.313   -7.443  1.00 0.00 ? 51 ARG A N    3  
ATOM 2689  C CA   . ARG A 1 51 ? -9.068  6.350   -8.445  1.00 0.00 ? 51 ARG A CA   3  
ATOM 2690  C C    . ARG A 1 51 ? -9.895  7.596   -8.127  1.00 0.00 ? 51 ARG A C    3  
ATOM 2691  O O    . ARG A 1 51 ? -9.501  8.409   -7.291  1.00 0.00 ? 51 ARG A O    3  
ATOM 2692  C CB   . ARG A 1 51 ? -9.411  5.823   -9.841  1.00 0.00 ? 51 ARG A CB   3  
ATOM 2693  C CG   . ARG A 1 51 ? -10.490 4.752   -9.839  1.00 0.00 ? 51 ARG A CG   3  
ATOM 2694  C CD   . ARG A 1 51 ? -10.715 4.187   -11.233 1.00 0.00 ? 51 ARG A CD   3  
ATOM 2695  N NE   . ARG A 1 51 ? -11.648 3.064   -11.225 1.00 0.00 ? 51 ARG A NE   3  
ATOM 2696  C CZ   . ARG A 1 51 ? -11.734 2.172   -12.207 1.00 0.00 ? 51 ARG A CZ   3  
ATOM 2697  N NH1  . ARG A 1 51 ? -10.945 2.272   -13.268 1.00 0.00 ? 51 ARG A NH1  3  
ATOM 2698  N NH2  . ARG A 1 51 ? -12.609 1.178   -12.129 1.00 0.00 ? 51 ARG A NH2  3  
ATOM 2699  H H    . ARG A 1 51 ? -10.194 5.147   -7.116  1.00 0.00 ? 51 ARG A H    3  
ATOM 2700  H HA   . ARG A 1 51 ? -8.022  6.616   -8.420  1.00 0.00 ? 51 ARG A HA   3  
ATOM 2701  H HB2  . ARG A 1 51 ? -9.752  6.646   -10.450 1.00 0.00 ? 51 ARG A HB2  3  
ATOM 2702  H HB3  . ARG A 1 51 ? -8.519  5.404   -10.283 1.00 0.00 ? 51 ARG A HB3  3  
ATOM 2703  H HG2  . ARG A 1 51 ? -10.188 3.950   -9.182  1.00 0.00 ? 51 ARG A HG2  3  
ATOM 2704  H HG3  . ARG A 1 51 ? -11.413 5.185   -9.482  1.00 0.00 ? 51 ARG A HG3  3  
ATOM 2705  H HD2  . ARG A 1 51 ? -11.113 4.968   -11.864 1.00 0.00 ? 51 ARG A HD2  3  
ATOM 2706  H HD3  . ARG A 1 51 ? -9.768  3.853   -11.630 1.00 0.00 ? 51 ARG A HD3  3  
ATOM 2707  H HE   . ARG A 1 51 ? -12.240 2.970   -10.450 1.00 0.00 ? 51 ARG A HE   3  
ATOM 2708  H HH11 . ARG A 1 51 ? -10.284 3.020   -13.330 1.00 0.00 ? 51 ARG A HH11 3  
ATOM 2709  H HH12 . ARG A 1 51 ? -11.011 1.600   -14.006 1.00 0.00 ? 51 ARG A HH12 3  
ATOM 2710  H HH21 . ARG A 1 51 ? -13.205 1.099   -11.330 1.00 0.00 ? 51 ARG A HH21 3  
ATOM 2711  H HH22 . ARG A 1 51 ? -12.672 0.508   -12.869 1.00 0.00 ? 51 ARG A HH22 3  
ATOM 2712  N N    . GLY A 1 52 ? -11.042 7.739   -8.792  1.00 0.00 ? 52 GLY A N    3  
ATOM 2713  C CA   . GLY A 1 52 ? -11.902 8.888   -8.560  1.00 0.00 ? 52 GLY A CA   3  
ATOM 2714  C C    . GLY A 1 52 ? -11.123 10.143  -8.219  1.00 0.00 ? 52 GLY A C    3  
ATOM 2715  O O    . GLY A 1 52 ? -10.245 10.563  -8.972  1.00 0.00 ? 52 GLY A O    3  
ATOM 2716  H H    . GLY A 1 52 ? -11.310 7.059   -9.443  1.00 0.00 ? 52 GLY A H    3  
ATOM 2717  H HA2  . GLY A 1 52 ? -12.485 9.071   -9.451  1.00 0.00 ? 52 GLY A HA2  3  
ATOM 2718  H HA3  . GLY A 1 52 ? -12.573 8.661   -7.745  1.00 0.00 ? 52 GLY A HA3  3  
ATOM 2719  N N    . ASP A 1 53 ? -11.445 10.741  -7.076  1.00 0.00 ? 53 ASP A N    3  
ATOM 2720  C CA   . ASP A 1 53 ? -10.770 11.954  -6.629  1.00 0.00 ? 53 ASP A CA   3  
ATOM 2721  C C    . ASP A 1 53 ? -10.205 11.768  -5.225  1.00 0.00 ? 53 ASP A C    3  
ATOM 2722  O O    . ASP A 1 53 ? -10.071 12.726  -4.464  1.00 0.00 ? 53 ASP A O    3  
ATOM 2723  C CB   . ASP A 1 53 ? -11.738 13.139  -6.650  1.00 0.00 ? 53 ASP A CB   3  
ATOM 2724  C CG   . ASP A 1 53 ? -11.482 14.073  -7.816  1.00 0.00 ? 53 ASP A CG   3  
ATOM 2725  O OD1  . ASP A 1 53 ? -11.848 13.715  -8.955  1.00 0.00 ? 53 ASP A OD1  3  
ATOM 2726  O OD2  . ASP A 1 53 ? -10.916 15.163  -7.590  1.00 0.00 ? 53 ASP A OD2  3  
ATOM 2727  H H    . ASP A 1 53 ? -12.152 10.355  -6.518  1.00 0.00 ? 53 ASP A H    3  
ATOM 2728  H HA   . ASP A 1 53 ? -9.956  12.152  -7.310  1.00 0.00 ? 53 ASP A HA   3  
ATOM 2729  H HB2  . ASP A 1 53 ? -12.749 12.768  -6.725  1.00 0.00 ? 53 ASP A HB2  3  
ATOM 2730  H HB3  . ASP A 1 53 ? -11.631 13.699  -5.732  1.00 0.00 ? 53 ASP A HB3  3  
ATOM 2731  N N    . ASP A 1 54 ? -9.879  10.524  -4.889  1.00 0.00 ? 54 ASP A N    3  
ATOM 2732  C CA   . ASP A 1 54 ? -9.331  10.200  -3.577  1.00 0.00 ? 54 ASP A CA   3  
ATOM 2733  C C    . ASP A 1 54 ? -8.188  9.204   -3.696  1.00 0.00 ? 54 ASP A C    3  
ATOM 2734  O O    . ASP A 1 54 ? -7.021  9.559   -3.537  1.00 0.00 ? 54 ASP A O    3  
ATOM 2735  C CB   . ASP A 1 54 ? -10.417 9.615   -2.683  1.00 0.00 ? 54 ASP A CB   3  
ATOM 2736  C CG   . ASP A 1 54 ? -11.309 10.681  -2.076  1.00 0.00 ? 54 ASP A CG   3  
ATOM 2737  O OD1  . ASP A 1 54 ? -11.762 11.572  -2.825  1.00 0.00 ? 54 ASP A OD1  3  
ATOM 2738  O OD2  . ASP A 1 54 ? -11.554 10.623  -0.853  1.00 0.00 ? 54 ASP A OD2  3  
ATOM 2739  H H    . ASP A 1 54 ? -10.012 9.804   -5.540  1.00 0.00 ? 54 ASP A H    3  
ATOM 2740  H HA   . ASP A 1 54 ? -8.960  11.112  -3.133  1.00 0.00 ? 54 ASP A HA   3  
ATOM 2741  H HB2  . ASP A 1 54 ? -11.029 8.947   -3.270  1.00 0.00 ? 54 ASP A HB2  3  
ATOM 2742  H HB3  . ASP A 1 54 ? -9.950  9.060   -1.884  1.00 0.00 ? 54 ASP A HB3  3  
ATOM 2743  N N    . LEU A 1 55 ? -8.536  7.951   -3.978  1.00 0.00 ? 55 LEU A N    3  
ATOM 2744  C CA   . LEU A 1 55 ? -7.541  6.897   -4.125  1.00 0.00 ? 55 LEU A CA   3  
ATOM 2745  C C    . LEU A 1 55 ? -7.160  6.308   -2.772  1.00 0.00 ? 55 LEU A C    3  
ATOM 2746  O O    . LEU A 1 55 ? -6.163  6.704   -2.168  1.00 0.00 ? 55 LEU A O    3  
ATOM 2747  C CB   . LEU A 1 55 ? -6.305  7.454   -4.826  1.00 0.00 ? 55 LEU A CB   3  
ATOM 2748  C CG   . LEU A 1 55 ? -6.613  8.435   -5.956  1.00 0.00 ? 55 LEU A CG   3  
ATOM 2749  C CD1  . LEU A 1 55 ? -5.813  9.716   -5.785  1.00 0.00 ? 55 LEU A CD1  3  
ATOM 2750  C CD2  . LEU A 1 55 ? -6.331  7.796   -7.305  1.00 0.00 ? 55 LEU A CD2  3  
ATOM 2751  H H    . LEU A 1 55 ? -9.484  7.733   -4.093  1.00 0.00 ? 55 LEU A H    3  
ATOM 2752  H HA   . LEU A 1 55 ? -7.970  6.119   -4.737  1.00 0.00 ? 55 LEU A HA   3  
ATOM 2753  H HB2  . LEU A 1 55 ? -5.694  7.958   -4.090  1.00 0.00 ? 55 LEU A HB2  3  
ATOM 2754  H HB3  . LEU A 1 55 ? -5.744  6.629   -5.236  1.00 0.00 ? 55 LEU A HB3  3  
ATOM 2755  H HG   . LEU A 1 55 ? -7.661  8.693   -5.921  1.00 0.00 ? 55 LEU A HG   3  
ATOM 2756  H HD11 . LEU A 1 55 ? -6.470  10.508  -5.454  1.00 0.00 ? 55 LEU A HD11 3  
ATOM 2757  H HD12 . LEU A 1 55 ? -5.365  9.990   -6.727  1.00 0.00 ? 55 LEU A HD12 3  
ATOM 2758  H HD13 . LEU A 1 55 ? -5.039  9.561   -5.047  1.00 0.00 ? 55 LEU A HD13 3  
ATOM 2759  H HD21 . LEU A 1 55 ? -6.427  6.724   -7.220  1.00 0.00 ? 55 LEU A HD21 3  
ATOM 2760  H HD22 . LEU A 1 55 ? -5.329  8.045   -7.619  1.00 0.00 ? 55 LEU A HD22 3  
ATOM 2761  H HD23 . LEU A 1 55 ? -7.040  8.165   -8.031  1.00 0.00 ? 55 LEU A HD23 3  
ATOM 2762  N N    . ASP A 1 56 ? -7.962  5.358   -2.302  1.00 0.00 ? 56 ASP A N    3  
ATOM 2763  C CA   . ASP A 1 56 ? -7.711  4.711   -1.020  1.00 0.00 ? 56 ASP A CA   3  
ATOM 2764  C C    . ASP A 1 56 ? -8.231  3.277   -1.025  1.00 0.00 ? 56 ASP A C    3  
ATOM 2765  O O    . ASP A 1 56 ? -8.822  2.826   -2.005  1.00 0.00 ? 56 ASP A O    3  
ATOM 2766  C CB   . ASP A 1 56 ? -8.369  5.502   0.112   1.00 0.00 ? 56 ASP A CB   3  
ATOM 2767  C CG   . ASP A 1 56 ? -7.714  6.851   0.332   1.00 0.00 ? 56 ASP A CG   3  
ATOM 2768  O OD1  . ASP A 1 56 ? -7.832  7.720   -0.557  1.00 0.00 ? 56 ASP A OD1  3  
ATOM 2769  O OD2  . ASP A 1 56 ? -7.081  7.038   1.392   1.00 0.00 ? 56 ASP A OD2  3  
ATOM 2770  H H    . ASP A 1 56 ? -8.741  5.086   -2.830  1.00 0.00 ? 56 ASP A H    3  
ATOM 2771  H HA   . ASP A 1 56 ? -6.643  4.694   -0.862  1.00 0.00 ? 56 ASP A HA   3  
ATOM 2772  H HB2  . ASP A 1 56 ? -9.410  5.663   -0.127  1.00 0.00 ? 56 ASP A HB2  3  
ATOM 2773  H HB3  . ASP A 1 56 ? -8.298  4.934   1.028   1.00 0.00 ? 56 ASP A HB3  3  
ATOM 2774  N N    . ASP A 1 57 ? -8.001  2.572   0.080   1.00 0.00 ? 57 ASP A N    3  
ATOM 2775  C CA   . ASP A 1 57 ? -8.437  1.185   0.227   1.00 0.00 ? 57 ASP A CA   3  
ATOM 2776  C C    . ASP A 1 57 ? -7.874  0.591   1.516   1.00 0.00 ? 57 ASP A C    3  
ATOM 2777  O O    . ASP A 1 57 ? -6.976  1.169   2.130   1.00 0.00 ? 57 ASP A O    3  
ATOM 2778  C CB   . ASP A 1 57 ? -7.988  0.346   -0.974  1.00 0.00 ? 57 ASP A CB   3  
ATOM 2779  C CG   . ASP A 1 57 ? -8.660  -1.013  -1.021  1.00 0.00 ? 57 ASP A CG   3  
ATOM 2780  O OD1  . ASP A 1 57 ? -8.383  -1.846  -0.133  1.00 0.00 ? 57 ASP A OD1  3  
ATOM 2781  O OD2  . ASP A 1 57 ? -9.462  -1.244  -1.949  1.00 0.00 ? 57 ASP A OD2  3  
ATOM 2782  H H    . ASP A 1 57 ? -7.522  2.998   0.822   1.00 0.00 ? 57 ASP A H    3  
ATOM 2783  H HA   . ASP A 1 57 ? -9.516  1.179   0.280   1.00 0.00 ? 57 ASP A HA   3  
ATOM 2784  H HB2  . ASP A 1 57 ? -8.226  0.871   -1.885  1.00 0.00 ? 57 ASP A HB2  3  
ATOM 2785  H HB3  . ASP A 1 57 ? -6.922  0.198   -0.920  1.00 0.00 ? 57 ASP A HB3  3  
ATOM 2786  N N    . TYR A 1 58 ? -8.398  -0.564  1.920   1.00 0.00 ? 58 TYR A N    3  
ATOM 2787  C CA   . TYR A 1 58 ? -7.937  -1.229  3.140   1.00 0.00 ? 58 TYR A CA   3  
ATOM 2788  C C    . TYR A 1 58 ? -7.163  -2.508  2.833   1.00 0.00 ? 58 TYR A C    3  
ATOM 2789  O O    . TYR A 1 58 ? -7.428  -3.192  1.843   1.00 0.00 ? 58 TYR A O    3  
ATOM 2790  C CB   . TYR A 1 58 ? -9.116  -1.541  4.062   1.00 0.00 ? 58 TYR A CB   3  
ATOM 2791  C CG   . TYR A 1 58 ? -9.558  -0.356  4.890   1.00 0.00 ? 58 TYR A CG   3  
ATOM 2792  C CD1  . TYR A 1 58 ? -9.903  0.846   4.287   1.00 0.00 ? 58 TYR A CD1  3  
ATOM 2793  C CD2  . TYR A 1 58 ? -9.625  -0.439  6.275   1.00 0.00 ? 58 TYR A CD2  3  
ATOM 2794  C CE1  . TYR A 1 58 ? -10.304 1.933   5.039   1.00 0.00 ? 58 TYR A CE1  3  
ATOM 2795  C CE2  . TYR A 1 58 ? -10.025 0.644   7.035   1.00 0.00 ? 58 TYR A CE2  3  
ATOM 2796  C CZ   . TYR A 1 58 ? -10.364 1.827   6.413   1.00 0.00 ? 58 TYR A CZ   3  
ATOM 2797  O OH   . TYR A 1 58 ? -10.762 2.907   7.166   1.00 0.00 ? 58 TYR A OH   3  
ATOM 2798  H H    . TYR A 1 58 ? -9.105  -0.979  1.387   1.00 0.00 ? 58 TYR A H    3  
ATOM 2799  H HA   . TYR A 1 58 ? -7.275  -0.545  3.649   1.00 0.00 ? 58 TYR A HA   3  
ATOM 2800  H HB2  . TYR A 1 58 ? -9.957  -1.862  3.465   1.00 0.00 ? 58 TYR A HB2  3  
ATOM 2801  H HB3  . TYR A 1 58 ? -8.835  -2.335  4.739   1.00 0.00 ? 58 TYR A HB3  3  
ATOM 2802  H HD1  . TYR A 1 58 ? -9.854  0.925   3.211   1.00 0.00 ? 58 TYR A HD1  3  
ATOM 2803  H HD2  . TYR A 1 58 ? -9.358  -1.367  6.760   1.00 0.00 ? 58 TYR A HD2  3  
ATOM 2804  H HE1  . TYR A 1 58 ? -10.569 2.859   4.551   1.00 0.00 ? 58 TYR A HE1  3  
ATOM 2805  H HE2  . TYR A 1 58 ? -10.070 0.561   8.111   1.00 0.00 ? 58 TYR A HE2  3  
ATOM 2806  H HH   . TYR A 1 58 ? -11.169 2.598   7.979   1.00 0.00 ? 58 TYR A HH   3  
ATOM 2807  N N    . CYS A 1 59 ? -6.197  -2.812  3.696   1.00 0.00 ? 59 CYS A N    3  
ATOM 2808  C CA   . CYS A 1 59 ? -5.351  -3.993  3.544   1.00 0.00 ? 59 CYS A CA   3  
ATOM 2809  C C    . CYS A 1 59 ? -5.855  -5.164  4.385   1.00 0.00 ? 59 CYS A C    3  
ATOM 2810  O O    . CYS A 1 59 ? -5.996  -5.049  5.601   1.00 0.00 ? 59 CYS A O    3  
ATOM 2811  C CB   . CYS A 1 59 ? -3.928  -3.642  3.960   1.00 0.00 ? 59 CYS A CB   3  
ATOM 2812  S SG   . CYS A 1 59 ? -2.945  -2.828  2.657   1.00 0.00 ? 59 CYS A SG   3  
ATOM 2813  H H    . CYS A 1 59 ? -6.041  -2.216  4.458   1.00 0.00 ? 59 CYS A H    3  
ATOM 2814  H HA   . CYS A 1 59 ? -5.352  -4.279  2.506   1.00 0.00 ? 59 CYS A HA   3  
ATOM 2815  H HB2  . CYS A 1 59 ? -3.976  -2.974  4.798   1.00 0.00 ? 59 CYS A HB2  3  
ATOM 2816  H HB3  . CYS A 1 59 ? -3.411  -4.540  4.257   1.00 0.00 ? 59 CYS A HB3  3  
ATOM 2817  N N    . ASN A 1 60 ? -6.111  -6.293  3.730   1.00 0.00 ? 60 ASN A N    3  
ATOM 2818  C CA   . ASN A 1 60 ? -6.586  -7.501  4.409   1.00 0.00 ? 60 ASN A CA   3  
ATOM 2819  C C    . ASN A 1 60 ? -5.817  -8.704  3.888   1.00 0.00 ? 60 ASN A C    3  
ATOM 2820  O O    . ASN A 1 60 ? -4.896  -9.199  4.532   1.00 0.00 ? 60 ASN A O    3  
ATOM 2821  C CB   . ASN A 1 60 ? -8.092  -7.681  4.193   1.00 0.00 ? 60 ASN A CB   3  
ATOM 2822  C CG   . ASN A 1 60 ? -8.831  -6.361  4.251   1.00 0.00 ? 60 ASN A CG   3  
ATOM 2823  O OD1  . ASN A 1 60 ? -9.789  -6.137  3.511   1.00 0.00 ? 60 ASN A OD1  3  
ATOM 2824  N ND2  . ASN A 1 60 ? -8.386  -5.478  5.135   1.00 0.00 ? 60 ASN A ND2  3  
ATOM 2825  H H    . ASN A 1 60 ? -5.964  -6.322  2.765   1.00 0.00 ? 60 ASN A H    3  
ATOM 2826  H HA   . ASN A 1 60 ? -6.388  -7.393  5.454   1.00 0.00 ? 60 ASN A HA   3  
ATOM 2827  H HB2  . ASN A 1 60 ? -8.267  -8.128  3.227   1.00 0.00 ? 60 ASN A HB2  3  
ATOM 2828  H HB3  . ASN A 1 60 ? -8.486  -8.328  4.963   1.00 0.00 ? 60 ASN A HB3  3  
ATOM 2829  H HD21 . ASN A 1 60 ? -7.621  -5.728  5.696   1.00 0.00 ? 60 ASN A HD21 3  
ATOM 2830  H HD22 . ASN A 1 60 ? -8.828  -4.607  5.181   1.00 0.00 ? 60 ASN A HD22 3  
ATOM 2831  N N    . GLY A 1 61 ? -6.162  -9.117  2.687   1.00 0.00 ? 61 GLY A N    3  
ATOM 2832  C CA   . GLY A 1 61 ? -5.459  -10.205 2.038   1.00 0.00 ? 61 GLY A CA   3  
ATOM 2833  C C    . GLY A 1 61 ? -4.479  -9.620  1.050   1.00 0.00 ? 61 GLY A C    3  
ATOM 2834  O O    . GLY A 1 61 ? -4.202  -10.188 -0.005  1.00 0.00 ? 61 GLY A O    3  
ATOM 2835  H H    . GLY A 1 61 ? -6.867  -8.641  2.213   1.00 0.00 ? 61 GLY A H    3  
ATOM 2836  H HA2  . GLY A 1 61 ? -4.929  -10.788 2.780   1.00 0.00 ? 61 GLY A HA2  3  
ATOM 2837  H HA3  . GLY A 1 61 ? -6.163  -10.833 1.515   1.00 0.00 ? 61 GLY A HA3  3  
ATOM 2838  N N    . ILE A 1 62 ? -4.005  -8.431  1.411   1.00 0.00 ? 62 ILE A N    3  
ATOM 2839  C CA   . ILE A 1 62 ? -3.090  -7.644  0.601   1.00 0.00 ? 62 ILE A CA   3  
ATOM 2840  C C    . ILE A 1 62 ? -1.659  -8.175  0.571   1.00 0.00 ? 62 ILE A C    3  
ATOM 2841  O O    . ILE A 1 62 ? -0.827  -7.796  1.392   1.00 0.00 ? 62 ILE A O    3  
ATOM 2842  C CB   . ILE A 1 62 ? -3.066  -6.191  1.109   1.00 0.00 ? 62 ILE A CB   3  
ATOM 2843  C CG1  . ILE A 1 62 ? -2.963  -6.103  2.644   1.00 0.00 ? 62 ILE A CG1  3  
ATOM 2844  C CG2  . ILE A 1 62 ? -4.324  -5.472  0.658   1.00 0.00 ? 62 ILE A CG2  3  
ATOM 2845  C CD1  . ILE A 1 62 ? -2.343  -7.292  3.355   1.00 0.00 ? 62 ILE A CD1  3  
ATOM 2846  H H    . ILE A 1 62 ? -4.314  -8.046  2.255   1.00 0.00 ? 62 ILE A H    3  
ATOM 2847  H HA   . ILE A 1 62 ? -3.474  -7.631  -0.407  1.00 0.00 ? 62 ILE A HA   3  
ATOM 2848  H HB   . ILE A 1 62 ? -2.216  -5.691  0.667   1.00 0.00 ? 62 ILE A HB   3  
ATOM 2849  H HG12 . ILE A 1 62 ? -2.367  -5.244  2.896   1.00 0.00 ? 62 ILE A HG12 3  
ATOM 2850  H HG13 . ILE A 1 62 ? -3.957  -5.964  3.046   1.00 0.00 ? 62 ILE A HG13 3  
ATOM 2851  H HG21 . ILE A 1 62 ? -5.185  -5.936  1.117   1.00 0.00 ? 62 ILE A HG21 3  
ATOM 2852  H HG22 . ILE A 1 62 ? -4.411  -5.533  -0.415  1.00 0.00 ? 62 ILE A HG22 3  
ATOM 2853  H HG23 . ILE A 1 62 ? -4.274  -4.436  0.961   1.00 0.00 ? 62 ILE A HG23 3  
ATOM 2854  H HD11 . ILE A 1 62 ? -2.875  -7.469  4.278   1.00 0.00 ? 62 ILE A HD11 3  
ATOM 2855  H HD12 . ILE A 1 62 ? -1.310  -7.075  3.577   1.00 0.00 ? 62 ILE A HD12 3  
ATOM 2856  H HD13 . ILE A 1 62 ? -2.397  -8.168  2.739   1.00 0.00 ? 62 ILE A HD13 3  
ATOM 2857  N N    . SER A 1 63 ? -1.360  -9.010  -0.410  1.00 0.00 ? 63 SER A N    3  
ATOM 2858  C CA   . SER A 1 63 ? -0.012  -9.535  -0.565  1.00 0.00 ? 63 SER A CA   3  
ATOM 2859  C C    . SER A 1 63 ? 0.708   -8.763  -1.659  1.00 0.00 ? 63 SER A C    3  
ATOM 2860  O O    . SER A 1 63 ? 1.613   -9.281  -2.313  1.00 0.00 ? 63 SER A O    3  
ATOM 2861  C CB   . SER A 1 63 ? -0.049  -11.019 -0.898  1.00 0.00 ? 63 SER A CB   3  
ATOM 2862  O OG   . SER A 1 63 ? -0.575  -11.241 -2.195  1.00 0.00 ? 63 SER A OG   3  
ATOM 2863  H H    . SER A 1 63 ? -2.047  -9.251  -1.065  1.00 0.00 ? 63 SER A H    3  
ATOM 2864  H HA   . SER A 1 63 ? 0.511   -9.392  0.369   1.00 0.00 ? 63 SER A HA   3  
ATOM 2865  H HB2  . SER A 1 63 ? 0.954   -11.413 -0.856  1.00 0.00 ? 63 SER A HB2  3  
ATOM 2866  H HB3  . SER A 1 63 ? -0.669  -11.526 -0.177  1.00 0.00 ? 63 SER A HB3  3  
ATOM 2867  H HG   . SER A 1 63 ? -1.454  -10.860 -2.254  1.00 0.00 ? 63 SER A HG   3  
ATOM 2868  N N    . ALA A 1 64 ? 0.264   -7.519  -1.838  1.00 0.00 ? 64 ALA A N    3  
ATOM 2869  C CA   . ALA A 1 64 ? 0.793   -6.596  -2.838  1.00 0.00 ? 64 ALA A CA   3  
ATOM 2870  C C    . ALA A 1 64 ? -0.282  -6.241  -3.856  1.00 0.00 ? 64 ALA A C    3  
ATOM 2871  O O    . ALA A 1 64 ? -0.002  -5.648  -4.897  1.00 0.00 ? 64 ALA A O    3  
ATOM 2872  C CB   . ALA A 1 64 ? 2.025   -7.135  -3.537  1.00 0.00 ? 64 ALA A CB   3  
ATOM 2873  H H    . ALA A 1 64 ? -0.468  -7.206  -1.267  1.00 0.00 ? 64 ALA A H    3  
ATOM 2874  H HA   . ALA A 1 64 ? 1.073   -5.697  -2.319  1.00 0.00 ? 64 ALA A HA   3  
ATOM 2875  H HB1  . ALA A 1 64 ? 2.821   -7.269  -2.820  1.00 0.00 ? 64 ALA A HB1  3  
ATOM 2876  H HB2  . ALA A 1 64 ? 2.335   -6.433  -4.290  1.00 0.00 ? 64 ALA A HB2  3  
ATOM 2877  H HB3  . ALA A 1 64 ? 1.794   -8.076  -3.999  1.00 0.00 ? 64 ALA A HB3  3  
ATOM 2878  N N    . GLY A 1 65 ? -1.520  -6.590  -3.526  1.00 0.00 ? 65 GLY A N    3  
ATOM 2879  C CA   . GLY A 1 65 ? -2.644  -6.289  -4.387  1.00 0.00 ? 65 GLY A CA   3  
ATOM 2880  C C    . GLY A 1 65 ? -3.699  -5.516  -3.629  1.00 0.00 ? 65 GLY A C    3  
ATOM 2881  O O    . GLY A 1 65 ? -3.401  -4.470  -3.067  1.00 0.00 ? 65 GLY A O    3  
ATOM 2882  H H    . GLY A 1 65 ? -1.678  -7.041  -2.672  1.00 0.00 ? 65 GLY A H    3  
ATOM 2883  H HA2  . GLY A 1 65 ? -2.302  -5.700  -5.226  1.00 0.00 ? 65 GLY A HA2  3  
ATOM 2884  H HA3  . GLY A 1 65 ? -3.073  -7.211  -4.748  1.00 0.00 ? 65 GLY A HA3  3  
ATOM 2885  N N    . CYS A 1 66 ? -4.917  -6.047  -3.589  1.00 0.00 ? 66 CYS A N    3  
ATOM 2886  C CA   . CYS A 1 66 ? -6.023  -5.418  -2.862  1.00 0.00 ? 66 CYS A CA   3  
ATOM 2887  C C    . CYS A 1 66 ? -7.234  -6.341  -2.796  1.00 0.00 ? 66 CYS A C    3  
ATOM 2888  O O    . CYS A 1 66 ? -7.602  -6.977  -3.783  1.00 0.00 ? 66 CYS A O    3  
ATOM 2889  C CB   . CYS A 1 66 ? -6.427  -4.075  -3.489  1.00 0.00 ? 66 CYS A CB   3  
ATOM 2890  S SG   . CYS A 1 66 ? -5.398  -2.654  -2.993  1.00 0.00 ? 66 CYS A SG   3  
ATOM 2891  H H    . CYS A 1 66 ? -5.073  -6.899  -4.041  1.00 0.00 ? 66 CYS A H    3  
ATOM 2892  H HA   . CYS A 1 66 ? -5.685  -5.245  -1.854  1.00 0.00 ? 66 CYS A HA   3  
ATOM 2893  H HB2  . CYS A 1 66 ? -6.365  -4.157  -4.561  1.00 0.00 ? 66 CYS A HB2  3  
ATOM 2894  H HB3  . CYS A 1 66 ? -7.446  -3.852  -3.209  1.00 0.00 ? 66 CYS A HB3  3  
ATOM 2895  N N    . PRO A 1 67 ? -7.874  -6.416  -1.617  1.00 0.00 ? 67 PRO A N    3  
ATOM 2896  C CA   . PRO A 1 67 ? -9.057  -7.256  -1.402  1.00 0.00 ? 67 PRO A CA   3  
ATOM 2897  C C    . PRO A 1 67 ? -10.170 -6.955  -2.401  1.00 0.00 ? 67 PRO A C    3  
ATOM 2898  O O    . PRO A 1 67 ? -9.939  -6.319  -3.429  1.00 0.00 ? 67 PRO A O    3  
ATOM 2899  C CB   . PRO A 1 67 ? -9.507  -6.897  0.023   1.00 0.00 ? 67 PRO A CB   3  
ATOM 2900  C CG   . PRO A 1 67 ? -8.790  -5.631  0.357   1.00 0.00 ? 67 PRO A CG   3  
ATOM 2901  C CD   . PRO A 1 67 ? -7.498  -5.685  -0.400  1.00 0.00 ? 67 PRO A CD   3  
ATOM 2902  H HA   . PRO A 1 67 ? -8.809  -8.306  -1.450  1.00 0.00 ? 67 PRO A HA   3  
ATOM 2903  H HB2  . PRO A 1 67 ? -10.578 -6.760  0.040   1.00 0.00 ? 67 PRO A HB2  3  
ATOM 2904  H HB3  . PRO A 1 67 ? -9.233  -7.693  0.700   1.00 0.00 ? 67 PRO A HB3  3  
ATOM 2905  H HG2  . PRO A 1 67 ? -9.376  -4.781  0.038   1.00 0.00 ? 67 PRO A HG2  3  
ATOM 2906  H HG3  . PRO A 1 67 ? -8.601  -5.582  1.419   1.00 0.00 ? 67 PRO A HG3  3  
ATOM 2907  H HD2  . PRO A 1 67 ? -7.151  -4.689  -0.632  1.00 0.00 ? 67 PRO A HD2  3  
ATOM 2908  H HD3  . PRO A 1 67 ? -6.753  -6.228  0.163   1.00 0.00 ? 67 PRO A HD3  3  
ATOM 2909  N N    . ARG A 1 68 ? -11.378 -7.414  -2.089  1.00 0.00 ? 68 ARG A N    3  
ATOM 2910  C CA   . ARG A 1 68 ? -12.528 -7.193  -2.958  1.00 0.00 ? 68 ARG A CA   3  
ATOM 2911  C C    . ARG A 1 68 ? -13.748 -6.767  -2.146  1.00 0.00 ? 68 ARG A C    3  
ATOM 2912  O O    . ARG A 1 68 ? -14.694 -7.536  -1.978  1.00 0.00 ? 68 ARG A O    3  
ATOM 2913  C CB   . ARG A 1 68 ? -12.847 -8.462  -3.750  1.00 0.00 ? 68 ARG A CB   3  
ATOM 2914  C CG   . ARG A 1 68 ? -11.645 -9.048  -4.471  1.00 0.00 ? 68 ARG A CG   3  
ATOM 2915  C CD   . ARG A 1 68 ? -11.564 -10.555 -4.285  1.00 0.00 ? 68 ARG A CD   3  
ATOM 2916  N NE   . ARG A 1 68 ? -12.752 -11.234 -4.793  1.00 0.00 ? 68 ARG A NE   3  
ATOM 2917  C CZ   . ARG A 1 68 ? -13.006 -11.403 -6.087  1.00 0.00 ? 68 ARG A CZ   3  
ATOM 2918  N NH1  . ARG A 1 68 ? -12.159 -10.943 -6.997  1.00 0.00 ? 68 ARG A NH1  3  
ATOM 2919  N NH2  . ARG A 1 68 ? -14.108 -12.033 -6.471  1.00 0.00 ? 68 ARG A NH2  3  
ATOM 2920  H H    . ARG A 1 68 ? -11.498 -7.913  -1.254  1.00 0.00 ? 68 ARG A H    3  
ATOM 2921  H HA   . ARG A 1 68 ? -12.275 -6.402  -3.648  1.00 0.00 ? 68 ARG A HA   3  
ATOM 2922  H HB2  . ARG A 1 68 ? -13.232 -9.209  -3.072  1.00 0.00 ? 68 ARG A HB2  3  
ATOM 2923  H HB3  . ARG A 1 68 ? -13.604 -8.233  -4.486  1.00 0.00 ? 68 ARG A HB3  3  
ATOM 2924  H HG2  . ARG A 1 68 ? -11.727 -8.830  -5.525  1.00 0.00 ? 68 ARG A HG2  3  
ATOM 2925  H HG3  . ARG A 1 68 ? -10.746 -8.597  -4.078  1.00 0.00 ? 68 ARG A HG3  3  
ATOM 2926  H HD2  . ARG A 1 68 ? -10.697 -10.924 -4.813  1.00 0.00 ? 68 ARG A HD2  3  
ATOM 2927  H HD3  . ARG A 1 68 ? -11.461 -10.769 -3.231  1.00 0.00 ? 68 ARG A HD3  3  
ATOM 2928  H HE   . ARG A 1 68 ? -13.393 -11.580 -4.138  1.00 0.00 ? 68 ARG A HE   3  
ATOM 2929  H HH11 . ARG A 1 68 ? -11.327 -10.468 -6.710  1.00 0.00 ? 68 ARG A HH11 3  
ATOM 2930  H HH12 . ARG A 1 68 ? -12.351 -11.072 -7.970  1.00 0.00 ? 68 ARG A HH12 3  
ATOM 2931  H HH21 . ARG A 1 68 ? -14.750 -12.381 -5.787  1.00 0.00 ? 68 ARG A HH21 3  
ATOM 2932  H HH22 . ARG A 1 68 ? -14.298 -12.159 -7.445  1.00 0.00 ? 68 ARG A HH22 3  
ATOM 2933  N N    . ASN A 1 69 ? -13.718 -5.536  -1.646  1.00 0.00 ? 69 ASN A N    3  
ATOM 2934  C CA   . ASN A 1 69 ? -14.821 -5.007  -0.852  1.00 0.00 ? 69 ASN A CA   3  
ATOM 2935  C C    . ASN A 1 69 ? -14.908 -3.490  -0.986  1.00 0.00 ? 69 ASN A C    3  
ATOM 2936  O O    . ASN A 1 69 ? -13.963 -2.839  -1.430  1.00 0.00 ? 69 ASN A O    3  
ATOM 2937  C CB   . ASN A 1 69 ? -14.648 -5.391  0.619   1.00 0.00 ? 69 ASN A CB   3  
ATOM 2938  C CG   . ASN A 1 69 ? -14.271 -6.849  0.795   1.00 0.00 ? 69 ASN A CG   3  
ATOM 2939  O OD1  . ASN A 1 69 ? -13.145 -7.251  0.504   1.00 0.00 ? 69 ASN A OD1  3  
ATOM 2940  N ND2  . ASN A 1 69 ? -15.216 -7.650  1.274   1.00 0.00 ? 69 ASN A ND2  3  
ATOM 2941  H H    . ASN A 1 69 ? -12.936 -4.970  -1.815  1.00 0.00 ? 69 ASN A H    3  
ATOM 2942  H HA   . ASN A 1 69 ? -15.736 -5.443  -1.223  1.00 0.00 ? 69 ASN A HA   3  
ATOM 2943  H HB2  . ASN A 1 69 ? -13.869 -4.782  1.054   1.00 0.00 ? 69 ASN A HB2  3  
ATOM 2944  H HB3  . ASN A 1 69 ? -15.575 -5.211  1.143   1.00 0.00 ? 69 ASN A HB3  3  
ATOM 2945  H HD21 . ASN A 1 69 ? -16.091 -7.261  1.483   1.00 0.00 ? 69 ASN A HD21 3  
ATOM 2946  H HD22 . ASN A 1 69 ? -15.000 -8.598  1.398   1.00 0.00 ? 69 ASN A HD22 3  
ATOM 2947  N N    . PRO A 1 70 ? -16.055 -2.909  -0.604  1.00 0.00 ? 70 PRO A N    3  
ATOM 2948  C CA   . PRO A 1 70 ? -16.277 -1.461  -0.682  1.00 0.00 ? 70 PRO A CA   3  
ATOM 2949  C C    . PRO A 1 70 ? -15.323 -0.678  0.215   1.00 0.00 ? 70 PRO A C    3  
ATOM 2950  O O    . PRO A 1 70 ? -15.504 -0.621  1.431   1.00 0.00 ? 70 PRO A O    3  
ATOM 2951  C CB   . PRO A 1 70 ? -17.724 -1.285  -0.199  1.00 0.00 ? 70 PRO A CB   3  
ATOM 2952  C CG   . PRO A 1 70 ? -18.340 -2.639  -0.301  1.00 0.00 ? 70 PRO A CG   3  
ATOM 2953  C CD   . PRO A 1 70 ? -17.226 -3.617  -0.071  1.00 0.00 ? 70 PRO A CD   3  
ATOM 2954  H HA   . PRO A 1 70 ? -16.188 -1.103  -1.697  1.00 0.00 ? 70 PRO A HA   3  
ATOM 2955  H HB2  . PRO A 1 70 ? -17.723 -0.928  0.820   1.00 0.00 ? 70 PRO A HB2  3  
ATOM 2956  H HB3  . PRO A 1 70 ? -18.232 -0.573  -0.833  1.00 0.00 ? 70 PRO A HB3  3  
ATOM 2957  H HG2  . PRO A 1 70 ? -19.103 -2.754  0.455   1.00 0.00 ? 70 PRO A HG2  3  
ATOM 2958  H HG3  . PRO A 1 70 ? -18.763 -2.777  -1.285  1.00 0.00 ? 70 PRO A HG3  3  
ATOM 2959  H HD2  . PRO A 1 70 ? -17.110 -3.818  0.984   1.00 0.00 ? 70 PRO A HD2  3  
ATOM 2960  H HD3  . PRO A 1 70 ? -17.405 -4.532  -0.616  1.00 0.00 ? 70 PRO A HD3  3  
ATOM 2961  N N    . PHE A 1 71 ? -14.310 -0.070  -0.395  1.00 0.00 ? 71 PHE A N    3  
ATOM 2962  C CA   . PHE A 1 71 ? -13.330 0.715   0.347   1.00 0.00 ? 71 PHE A CA   3  
ATOM 2963  C C    . PHE A 1 71 ? -13.391 2.183   -0.067  1.00 0.00 ? 71 PHE A C    3  
ATOM 2964  O O    . PHE A 1 71 ? -14.433 2.669   -0.507  1.00 0.00 ? 71 PHE A O    3  
ATOM 2965  C CB   . PHE A 1 71 ? -11.921 0.164   0.119   1.00 0.00 ? 71 PHE A CB   3  
ATOM 2966  C CG   . PHE A 1 71 ? -11.812 -1.319  0.335   1.00 0.00 ? 71 PHE A CG   3  
ATOM 2967  C CD1  . PHE A 1 71 ? -11.936 -1.858  1.606   1.00 0.00 ? 71 PHE A CD1  3  
ATOM 2968  C CD2  . PHE A 1 71 ? -11.581 -2.172  -0.731  1.00 0.00 ? 71 PHE A CD2  3  
ATOM 2969  C CE1  . PHE A 1 71 ? -11.832 -3.221  1.808   1.00 0.00 ? 71 PHE A CE1  3  
ATOM 2970  C CE2  . PHE A 1 71 ? -11.476 -3.536  -0.535  1.00 0.00 ? 71 PHE A CE2  3  
ATOM 2971  C CZ   . PHE A 1 71 ? -11.602 -4.061  0.736   1.00 0.00 ? 71 PHE A CZ   3  
ATOM 2972  H H    . PHE A 1 71 ? -14.222 -0.149  -1.368  1.00 0.00 ? 71 PHE A H    3  
ATOM 2973  H HA   . PHE A 1 71 ? -13.572 0.640   1.397   1.00 0.00 ? 71 PHE A HA   3  
ATOM 2974  H HB2  . PHE A 1 71 ? -11.619 0.374   -0.896  1.00 0.00 ? 71 PHE A HB2  3  
ATOM 2975  H HB3  . PHE A 1 71 ? -11.238 0.649   0.800   1.00 0.00 ? 71 PHE A HB3  3  
ATOM 2976  H HD1  . PHE A 1 71 ? -12.117 -1.202  2.444   1.00 0.00 ? 71 PHE A HD1  3  
ATOM 2977  H HD2  . PHE A 1 71 ? -11.483 -1.763  -1.726  1.00 0.00 ? 71 PHE A HD2  3  
ATOM 2978  H HE1  . PHE A 1 71 ? -11.931 -3.629  2.803   1.00 0.00 ? 71 PHE A HE1  3  
ATOM 2979  H HE2  . PHE A 1 71 ? -11.295 -4.191  -1.375  1.00 0.00 ? 71 PHE A HE2  3  
ATOM 2980  H HZ   . PHE A 1 71 ? -11.520 -5.127  0.892   1.00 0.00 ? 71 PHE A HZ   3  
ATOM 2981  N N    . HIS A 1 72 ? -12.271 2.885   0.074   1.00 0.00 ? 72 HIS A N    3  
ATOM 2982  C CA   . HIS A 1 72 ? -12.204 4.296   -0.287  1.00 0.00 ? 72 HIS A CA   3  
ATOM 2983  C C    . HIS A 1 72 ? -13.216 5.111   0.513   1.00 0.00 ? 72 HIS A C    3  
ATOM 2984  O O    . HIS A 1 72 ? -12.861 5.770   1.490   1.00 0.00 ? 72 HIS A O    3  
ATOM 2985  C CB   . HIS A 1 72 ? -12.458 4.471   -1.786  1.00 0.00 ? 72 HIS A CB   3  
ATOM 2986  C CG   . HIS A 1 72 ? -12.865 5.861   -2.167  1.00 0.00 ? 72 HIS A CG   3  
ATOM 2987  N ND1  . HIS A 1 72 ? -12.544 6.971   -1.415  1.00 0.00 ? 72 HIS A ND1  3  
ATOM 2988  C CD2  . HIS A 1 72 ? -13.572 6.319   -3.228  1.00 0.00 ? 72 HIS A CD2  3  
ATOM 2989  C CE1  . HIS A 1 72 ? -13.036 8.051   -1.996  1.00 0.00 ? 72 HIS A CE1  3  
ATOM 2990  N NE2  . HIS A 1 72 ? -13.663 7.683   -3.098  1.00 0.00 ? 72 HIS A NE2  3  
ATOM 2991  H H    . HIS A 1 72 ? -11.472 2.445   0.429   1.00 0.00 ? 72 HIS A H    3  
ATOM 2992  H HA   . HIS A 1 72 ? -11.211 4.650   -0.056  1.00 0.00 ? 72 HIS A HA   3  
ATOM 2993  H HB2  . HIS A 1 72 ? -11.556 4.230   -2.328  1.00 0.00 ? 72 HIS A HB2  3  
ATOM 2994  H HB3  . HIS A 1 72 ? -13.246 3.798   -2.092  1.00 0.00 ? 72 HIS A HB3  3  
ATOM 2995  H HD1  . HIS A 1 72 ? -12.033 6.968   -0.579  1.00 0.00 ? 72 HIS A HD1  3  
ATOM 2996  H HD2  . HIS A 1 72 ? -13.987 5.722   -4.028  1.00 0.00 ? 72 HIS A HD2  3  
ATOM 2997  H HE1  . HIS A 1 72 ? -12.941 9.063   -1.632  1.00 0.00 ? 72 HIS A HE1  3  
ATOM 2998  H HE2  . HIS A 1 72 ? -14.033 8.295   -3.768  1.00 0.00 ? 72 HIS A HE2  3  
ATOM 2999  N N    . ALA A 1 73 ? -14.475 5.060   0.093   1.00 0.00 ? 73 ALA A N    3  
ATOM 3000  C CA   . ALA A 1 73 ? -15.537 5.793   0.772   1.00 0.00 ? 73 ALA A CA   3  
ATOM 3001  C C    . ALA A 1 73 ? -15.062 7.177   1.198   1.00 0.00 ? 73 ALA A C    3  
ATOM 3002  O O    . ALA A 1 73 ? -14.707 7.340   2.385   1.00 0.00 ? 73 ALA A O    3  
ATOM 3003  C CB   . ALA A 1 73 ? -16.032 5.008   1.977   1.00 0.00 ? 73 ALA A CB   3  
ATOM 3004  O OXT  . ALA A 1 73 ? -15.048 8.087   0.343   1.00 0.00 ? 73 ALA A OXT  3  
ATOM 3005  H H    . ALA A 1 73 ? -14.696 4.516   -0.692  1.00 0.00 ? 73 ALA A H    3  
ATOM 3006  H HA   . ALA A 1 73 ? -16.360 5.903   0.081   1.00 0.00 ? 73 ALA A HA   3  
ATOM 3007  H HB1  . ALA A 1 73 ? -16.246 3.991   1.681   1.00 0.00 ? 73 ALA A HB1  3  
ATOM 3008  H HB2  . ALA A 1 73 ? -16.931 5.468   2.362   1.00 0.00 ? 73 ALA A HB2  3  
ATOM 3009  H HB3  . ALA A 1 73 ? -15.272 5.007   2.743   1.00 0.00 ? 73 ALA A HB3  3  
ATOM 3010  N N    . GLU A 1 1  ? -5.189  3.876   11.099  1.00 0.00 ? 1  GLU A N    4  
ATOM 3011  C CA   . GLU A 1 1  ? -5.624  5.276   10.856  1.00 0.00 ? 1  GLU A CA   4  
ATOM 3012  C C    . GLU A 1 1  ? -5.861  5.531   9.371   1.00 0.00 ? 1  GLU A C    4  
ATOM 3013  O O    . GLU A 1 1  ? -5.831  4.606   8.559   1.00 0.00 ? 1  GLU A O    4  
ATOM 3014  C CB   . GLU A 1 1  ? -4.544  6.221   11.387  1.00 0.00 ? 1  GLU A CB   4  
ATOM 3015  C CG   . GLU A 1 1  ? -5.097  7.386   12.193  1.00 0.00 ? 1  GLU A CG   4  
ATOM 3016  C CD   . GLU A 1 1  ? -4.008  8.302   12.715  1.00 0.00 ? 1  GLU A CD   4  
ATOM 3017  O OE1  . GLU A 1 1  ? -3.483  8.033   13.816  1.00 0.00 ? 1  GLU A OE1  4  
ATOM 3018  O OE2  . GLU A 1 1  ? -3.680  9.289   12.023  1.00 0.00 ? 1  GLU A OE2  4  
ATOM 3019  H H1   . GLU A 1 1  ? -5.052  3.759   12.123  1.00 0.00 ? 1  GLU A H1   4  
ATOM 3020  H H2   . GLU A 1 1  ? -4.299  3.727   10.581  1.00 0.00 ? 1  GLU A H2   4  
ATOM 3021  H H3   . GLU A 1 1  ? -5.937  3.246   10.748  1.00 0.00 ? 1  GLU A H3   4  
ATOM 3022  H HA   . GLU A 1 1  ? -6.544  5.449   11.394  1.00 0.00 ? 1  GLU A HA   4  
ATOM 3023  H HB2  . GLU A 1 1  ? -3.871  5.661   12.019  1.00 0.00 ? 1  GLU A HB2  4  
ATOM 3024  H HB3  . GLU A 1 1  ? -3.990  6.621   10.551  1.00 0.00 ? 1  GLU A HB3  4  
ATOM 3025  H HG2  . GLU A 1 1  ? -5.758  7.961   11.562  1.00 0.00 ? 1  GLU A HG2  4  
ATOM 3026  H HG3  . GLU A 1 1  ? -5.652  6.994   13.033  1.00 0.00 ? 1  GLU A HG3  4  
ATOM 3027  N N    . ALA A 1 2  ? -6.096  6.792   9.022   1.00 0.00 ? 2  ALA A N    4  
ATOM 3028  C CA   . ALA A 1 2  ? -6.339  7.169   7.635   1.00 0.00 ? 2  ALA A CA   4  
ATOM 3029  C C    . ALA A 1 2  ? -5.030  7.256   6.854   1.00 0.00 ? 2  ALA A C    4  
ATOM 3030  O O    . ALA A 1 2  ? -4.064  6.562   7.170   1.00 0.00 ? 2  ALA A O    4  
ATOM 3031  C CB   . ALA A 1 2  ? -7.083  8.495   7.574   1.00 0.00 ? 2  ALA A CB   4  
ATOM 3032  H H    . ALA A 1 2  ? -6.107  7.485   9.715   1.00 0.00 ? 2  ALA A H    4  
ATOM 3033  H HA   . ALA A 1 2  ? -6.964  6.411   7.187   1.00 0.00 ? 2  ALA A HA   4  
ATOM 3034  H HB1  . ALA A 1 2  ? -6.372  9.305   7.510   1.00 0.00 ? 2  ALA A HB1  4  
ATOM 3035  H HB2  . ALA A 1 2  ? -7.683  8.611   8.464   1.00 0.00 ? 2  ALA A HB2  4  
ATOM 3036  H HB3  . ALA A 1 2  ? -7.723  8.508   6.704   1.00 0.00 ? 2  ALA A HB3  4  
ATOM 3037  N N    . GLY A 1 3  ? -5.007  8.111   5.834   1.00 0.00 ? 3  GLY A N    4  
ATOM 3038  C CA   . GLY A 1 3  ? -3.812  8.271   5.025   1.00 0.00 ? 3  GLY A CA   4  
ATOM 3039  C C    . GLY A 1 3  ? -2.538  8.129   5.837   1.00 0.00 ? 3  GLY A C    4  
ATOM 3040  O O    . GLY A 1 3  ? -2.151  9.048   6.559   1.00 0.00 ? 3  GLY A O    4  
ATOM 3041  H H    . GLY A 1 3  ? -5.808  8.637   5.629   1.00 0.00 ? 3  GLY A H    4  
ATOM 3042  H HA2  . GLY A 1 3  ? -3.816  7.526   4.244   1.00 0.00 ? 3  GLY A HA2  4  
ATOM 3043  H HA3  . GLY A 1 3  ? -3.829  9.252   4.571   1.00 0.00 ? 3  GLY A HA3  4  
ATOM 3044  N N    . GLU A 1 4  ? -1.884  6.974   5.725   1.00 0.00 ? 4  GLU A N    4  
ATOM 3045  C CA   . GLU A 1 4  ? -0.651  6.724   6.463   1.00 0.00 ? 4  GLU A CA   4  
ATOM 3046  C C    . GLU A 1 4  ? 0.485   7.604   5.951   1.00 0.00 ? 4  GLU A C    4  
ATOM 3047  O O    . GLU A 1 4  ? 0.335   8.316   4.958   1.00 0.00 ? 4  GLU A O    4  
ATOM 3048  C CB   . GLU A 1 4  ? -0.256  5.249   6.353   1.00 0.00 ? 4  GLU A CB   4  
ATOM 3049  C CG   . GLU A 1 4  ? -1.023  4.341   7.301   1.00 0.00 ? 4  GLU A CG   4  
ATOM 3050  C CD   . GLU A 1 4  ? -0.607  2.888   7.179   1.00 0.00 ? 4  GLU A CD   4  
ATOM 3051  O OE1  . GLU A 1 4  ? 0.565   2.633   6.834   1.00 0.00 ? 4  GLU A OE1  4  
ATOM 3052  O OE2  . GLU A 1 4  ? -1.455  2.006   7.431   1.00 0.00 ? 4  GLU A OE2  4  
ATOM 3053  H H    . GLU A 1 4  ? -2.240  6.273   5.136   1.00 0.00 ? 4  GLU A H    4  
ATOM 3054  H HA   . GLU A 1 4  ? -0.833  6.960   7.501   1.00 0.00 ? 4  GLU A HA   4  
ATOM 3055  H HB2  . GLU A 1 4  ? -0.438  4.915   5.343   1.00 0.00 ? 4  GLU A HB2  4  
ATOM 3056  H HB3  . GLU A 1 4  ? 0.797   5.154   6.571   1.00 0.00 ? 4  GLU A HB3  4  
ATOM 3057  H HG2  . GLU A 1 4  ? -0.843  4.667   8.315   1.00 0.00 ? 4  GLU A HG2  4  
ATOM 3058  H HG3  . GLU A 1 4  ? -2.077  4.420   7.080   1.00 0.00 ? 4  GLU A HG3  4  
ATOM 3059  N N    . GLU A 1 5  ? 1.623   7.544   6.636   1.00 0.00 ? 5  GLU A N    4  
ATOM 3060  C CA   . GLU A 1 5  ? 2.791   8.329   6.253   1.00 0.00 ? 5  GLU A CA   4  
ATOM 3061  C C    . GLU A 1 5  ? 3.385   7.801   4.947   1.00 0.00 ? 5  GLU A C    4  
ATOM 3062  O O    . GLU A 1 5  ? 2.646   7.445   4.030   1.00 0.00 ? 5  GLU A O    4  
ATOM 3063  C CB   . GLU A 1 5  ? 3.833   8.296   7.374   1.00 0.00 ? 5  GLU A CB   4  
ATOM 3064  C CG   . GLU A 1 5  ? 3.262   8.618   8.745   1.00 0.00 ? 5  GLU A CG   4  
ATOM 3065  C CD   . GLU A 1 5  ? 3.173   10.109  9.004   1.00 0.00 ? 5  GLU A CD   4  
ATOM 3066  O OE1  . GLU A 1 5  ? 4.234   10.767  9.054   1.00 0.00 ? 5  GLU A OE1  4  
ATOM 3067  O OE2  . GLU A 1 5  ? 2.043   10.619  9.157   1.00 0.00 ? 5  GLU A OE2  4  
ATOM 3068  H H    . GLU A 1 5  ? 1.680   6.954   7.416   1.00 0.00 ? 5  GLU A H    4  
ATOM 3069  H HA   . GLU A 1 5  ? 2.471   9.349   6.100   1.00 0.00 ? 5  GLU A HA   4  
ATOM 3070  H HB2  . GLU A 1 5  ? 4.271   7.309   7.412   1.00 0.00 ? 5  GLU A HB2  4  
ATOM 3071  H HB3  . GLU A 1 5  ? 4.607   9.015   7.152   1.00 0.00 ? 5  GLU A HB3  4  
ATOM 3072  H HG2  . GLU A 1 5  ? 2.271   8.196   8.817   1.00 0.00 ? 5  GLU A HG2  4  
ATOM 3073  H HG3  . GLU A 1 5  ? 3.896   8.173   9.498   1.00 0.00 ? 5  GLU A HG3  4  
ATOM 3074  N N    . CYS A 1 6  ? 4.714   7.751   4.862   1.00 0.00 ? 6  CYS A N    4  
ATOM 3075  C CA   . CYS A 1 6  ? 5.381   7.261   3.661   1.00 0.00 ? 6  CYS A CA   4  
ATOM 3076  C C    . CYS A 1 6  ? 5.162   8.212   2.487   1.00 0.00 ? 6  CYS A C    4  
ATOM 3077  O O    . CYS A 1 6  ? 4.092   8.805   2.349   1.00 0.00 ? 6  CYS A O    4  
ATOM 3078  C CB   . CYS A 1 6  ? 4.874   5.859   3.315   1.00 0.00 ? 6  CYS A CB   4  
ATOM 3079  S SG   . CYS A 1 6  ? 5.147   5.372   1.584   1.00 0.00 ? 6  CYS A SG   4  
ATOM 3080  H H    . CYS A 1 6  ? 5.259   8.048   5.618   1.00 0.00 ? 6  CYS A H    4  
ATOM 3081  H HA   . CYS A 1 6  ? 6.437   7.208   3.871   1.00 0.00 ? 6  CYS A HA   4  
ATOM 3082  H HB2  . CYS A 1 6  ? 5.383   5.140   3.939   1.00 0.00 ? 6  CYS A HB2  4  
ATOM 3083  H HB3  . CYS A 1 6  ? 3.815   5.807   3.510   1.00 0.00 ? 6  CYS A HB3  4  
ATOM 3084  N N    . ASP A 1 7  ? 6.188   8.366   1.650   1.00 0.00 ? 7  ASP A N    4  
ATOM 3085  C CA   . ASP A 1 7  ? 6.100   9.264   0.501   1.00 0.00 ? 7  ASP A CA   4  
ATOM 3086  C C    . ASP A 1 7  ? 6.606   8.615   -0.790  1.00 0.00 ? 7  ASP A C    4  
ATOM 3087  O O    . ASP A 1 7  ? 6.348   9.125   -1.881  1.00 0.00 ? 7  ASP A O    4  
ATOM 3088  C CB   . ASP A 1 7  ? 6.890   10.545  0.775   1.00 0.00 ? 7  ASP A CB   4  
ATOM 3089  C CG   . ASP A 1 7  ? 6.119   11.525  1.638   1.00 0.00 ? 7  ASP A CG   4  
ATOM 3090  O OD1  . ASP A 1 7  ? 4.889   11.639  1.454   1.00 0.00 ? 7  ASP A OD1  4  
ATOM 3091  O OD2  . ASP A 1 7  ? 6.746   12.179  2.498   1.00 0.00 ? 7  ASP A OD2  4  
ATOM 3092  H H    . ASP A 1 7  ? 7.020   7.879   1.817   1.00 0.00 ? 7  ASP A H    4  
ATOM 3093  H HA   . ASP A 1 7  ? 5.061   9.523   0.369   1.00 0.00 ? 7  ASP A HA   4  
ATOM 3094  H HB2  . ASP A 1 7  ? 7.808   10.292  1.283   1.00 0.00 ? 7  ASP A HB2  4  
ATOM 3095  H HB3  . ASP A 1 7  ? 7.123   11.025  -0.164  1.00 0.00 ? 7  ASP A HB3  4  
ATOM 3096  N N    . CYS A 1 8  ? 7.327   7.501   -0.678  1.00 0.00 ? 8  CYS A N    4  
ATOM 3097  C CA   . CYS A 1 8  ? 7.852   6.825   -1.862  1.00 0.00 ? 8  CYS A CA   4  
ATOM 3098  C C    . CYS A 1 8  ? 6.736   6.186   -2.683  1.00 0.00 ? 8  CYS A C    4  
ATOM 3099  O O    . CYS A 1 8  ? 6.987   5.647   -3.761  1.00 0.00 ? 8  CYS A O    4  
ATOM 3100  C CB   . CYS A 1 8  ? 8.803   5.704   -1.490  1.00 0.00 ? 8  CYS A CB   4  
ATOM 3101  S SG   . CYS A 1 8  ? 10.288  6.137   -0.541  1.00 0.00 ? 8  CYS A SG   4  
ATOM 3102  H H    . CYS A 1 8  ? 7.515   7.130   0.209   1.00 0.00 ? 8  CYS A H    4  
ATOM 3103  H HA   . CYS A 1 8  ? 8.374   7.549   -2.467  1.00 0.00 ? 8  CYS A HA   4  
ATOM 3104  H HB2  . CYS A 1 8  ? 8.259   4.986   -0.902  1.00 0.00 ? 8  CYS A HB2  4  
ATOM 3105  H HB3  . CYS A 1 8  ? 9.130   5.234   -2.403  1.00 0.00 ? 8  CYS A HB3  4  
ATOM 3106  N N    . GLY A 1 9  ? 5.522   6.192   -2.146  1.00 0.00 ? 9  GLY A N    4  
ATOM 3107  C CA   . GLY A 1 9  ? 4.406   5.570   -2.826  1.00 0.00 ? 9  GLY A CA   4  
ATOM 3108  C C    . GLY A 1 9  ? 3.912   4.369   -2.056  1.00 0.00 ? 9  GLY A C    4  
ATOM 3109  O O    . GLY A 1 9  ? 4.255   4.206   -0.885  1.00 0.00 ? 9  GLY A O    4  
ATOM 3110  H H    . GLY A 1 9  ? 5.389   6.586   -1.262  1.00 0.00 ? 9  GLY A H    4  
ATOM 3111  H HA2  . GLY A 1 9  ? 3.604   6.287   -2.922  1.00 0.00 ? 9  GLY A HA2  4  
ATOM 3112  H HA3  . GLY A 1 9  ? 4.720   5.254   -3.810  1.00 0.00 ? 9  GLY A HA3  4  
ATOM 3113  N N    . SER A 1 10 ? 3.116   3.518   -2.687  1.00 0.00 ? 10 SER A N    4  
ATOM 3114  C CA   . SER A 1 10 ? 2.616   2.345   -1.995  1.00 0.00 ? 10 SER A CA   4  
ATOM 3115  C C    . SER A 1 10 ? 1.956   1.337   -2.929  1.00 0.00 ? 10 SER A C    4  
ATOM 3116  O O    . SER A 1 10 ? 2.514   0.273   -3.198  1.00 0.00 ? 10 SER A O    4  
ATOM 3117  C CB   . SER A 1 10 ? 1.663   2.765   -0.880  1.00 0.00 ? 10 SER A CB   4  
ATOM 3118  O OG   . SER A 1 10 ? 2.377   3.170   0.275   1.00 0.00 ? 10 SER A OG   4  
ATOM 3119  H H    . SER A 1 10 ? 2.865   3.680   -3.619  1.00 0.00 ? 10 SER A H    4  
ATOM 3120  H HA   . SER A 1 10 ? 3.457   1.867   -1.548  1.00 0.00 ? 10 SER A HA   4  
ATOM 3121  H HB2  . SER A 1 10 ? 1.059   3.593   -1.216  1.00 0.00 ? 10 SER A HB2  4  
ATOM 3122  H HB3  . SER A 1 10 ? 1.032   1.936   -0.626  1.00 0.00 ? 10 SER A HB3  4  
ATOM 3123  H HG   . SER A 1 10 ? 3.303   2.940   0.176   1.00 0.00 ? 10 SER A HG   4  
ATOM 3124  N N    . PRO A 1 11 ? 0.759   1.647   -3.426  1.00 0.00 ? 11 PRO A N    4  
ATOM 3125  C CA   . PRO A 1 11 ? 0.022   0.753   -4.322  1.00 0.00 ? 11 PRO A CA   4  
ATOM 3126  C C    . PRO A 1 11 ? 0.626   0.707   -5.719  1.00 0.00 ? 11 PRO A C    4  
ATOM 3127  O O    . PRO A 1 11 ? 0.390   1.593   -6.540  1.00 0.00 ? 11 PRO A O    4  
ATOM 3128  C CB   . PRO A 1 11 ? -1.365  1.380   -4.354  1.00 0.00 ? 11 PRO A CB   4  
ATOM 3129  C CG   . PRO A 1 11 ? -1.107  2.831   -4.145  1.00 0.00 ? 11 PRO A CG   4  
ATOM 3130  C CD   . PRO A 1 11 ? 0.019   2.888   -3.153  1.00 0.00 ? 11 PRO A CD   4  
ATOM 3131  H HA   . PRO A 1 11 ? -0.040  -0.248  -3.922  1.00 0.00 ? 11 PRO A HA   4  
ATOM 3132  H HB2  . PRO A 1 11 ? -1.828  1.187   -5.307  1.00 0.00 ? 11 PRO A HB2  4  
ATOM 3133  H HB3  . PRO A 1 11 ? -1.963  0.966   -3.557  1.00 0.00 ? 11 PRO A HB3  4  
ATOM 3134  H HG2  . PRO A 1 11 ? -0.812  3.291   -5.077  1.00 0.00 ? 11 PRO A HG2  4  
ATOM 3135  H HG3  . PRO A 1 11 ? -1.985  3.313   -3.746  1.00 0.00 ? 11 PRO A HG3  4  
ATOM 3136  H HD2  . PRO A 1 11 ? 0.642   3.754   -3.328  1.00 0.00 ? 11 PRO A HD2  4  
ATOM 3137  H HD3  . PRO A 1 11 ? -0.363  2.891   -2.143  1.00 0.00 ? 11 PRO A HD3  4  
ATOM 3138  N N    . GLY A 1 12 ? 1.419   -0.326  -5.974  1.00 0.00 ? 12 GLY A N    4  
ATOM 3139  C CA   . GLY A 1 12 ? 2.063   -0.464  -7.266  1.00 0.00 ? 12 GLY A CA   4  
ATOM 3140  C C    . GLY A 1 12 ? 3.473   0.075   -7.229  1.00 0.00 ? 12 GLY A C    4  
ATOM 3141  O O    . GLY A 1 12 ? 4.368   -0.435  -7.904  1.00 0.00 ? 12 GLY A O    4  
ATOM 3142  H H    . GLY A 1 12 ? 1.580   -0.992  -5.273  1.00 0.00 ? 12 GLY A H    4  
ATOM 3143  H HA2  . GLY A 1 12 ? 2.088   -1.509  -7.538  1.00 0.00 ? 12 GLY A HA2  4  
ATOM 3144  H HA3  . GLY A 1 12 ? 1.496   0.082   -8.005  1.00 0.00 ? 12 GLY A HA3  4  
ATOM 3145  N N    . ASN A 1 13 ? 3.667   1.103   -6.414  1.00 0.00 ? 13 ASN A N    4  
ATOM 3146  C CA   . ASN A 1 13 ? 4.971   1.722   -6.248  1.00 0.00 ? 13 ASN A CA   4  
ATOM 3147  C C    . ASN A 1 13 ? 5.451   1.527   -4.816  1.00 0.00 ? 13 ASN A C    4  
ATOM 3148  O O    . ASN A 1 13 ? 5.729   2.491   -4.104  1.00 0.00 ? 13 ASN A O    4  
ATOM 3149  C CB   . ASN A 1 13 ? 4.903   3.213   -6.582  1.00 0.00 ? 13 ASN A CB   4  
ATOM 3150  C CG   . ASN A 1 13 ? 4.597   3.464   -8.046  1.00 0.00 ? 13 ASN A CG   4  
ATOM 3151  O OD1  . ASN A 1 13 ? 5.346   3.047   -8.929  1.00 0.00 ? 13 ASN A OD1  4  
ATOM 3152  N ND2  . ASN A 1 13 ? 3.491   4.150   -8.311  1.00 0.00 ? 13 ASN A ND2  4  
ATOM 3153  H H    . ASN A 1 13 ? 2.910   1.447   -5.896  1.00 0.00 ? 13 ASN A H    4  
ATOM 3154  H HA   . ASN A 1 13 ? 5.661   1.236   -6.921  1.00 0.00 ? 13 ASN A HA   4  
ATOM 3155  H HB2  . ASN A 1 13 ? 4.128   3.675   -5.988  1.00 0.00 ? 13 ASN A HB2  4  
ATOM 3156  H HB3  . ASN A 1 13 ? 5.852   3.672   -6.348  1.00 0.00 ? 13 ASN A HB3  4  
ATOM 3157  H HD21 . ASN A 1 13 ? 2.942   4.452   -7.557  1.00 0.00 ? 13 ASN A HD21 4  
ATOM 3158  H HD22 . ASN A 1 13 ? 3.269   4.327   -9.249  1.00 0.00 ? 13 ASN A HD22 4  
ATOM 3159  N N    . PRO A 1 14 ? 5.550   0.259   -4.382  1.00 0.00 ? 14 PRO A N    4  
ATOM 3160  C CA   . PRO A 1 14 ? 5.990   -0.112  -3.051  1.00 0.00 ? 14 PRO A CA   4  
ATOM 3161  C C    . PRO A 1 14 ? 6.828   0.960   -2.374  1.00 0.00 ? 14 PRO A C    4  
ATOM 3162  O O    . PRO A 1 14 ? 8.014   1.100   -2.668  1.00 0.00 ? 14 PRO A O    4  
ATOM 3163  C CB   . PRO A 1 14 ? 6.819   -1.352  -3.358  1.00 0.00 ? 14 PRO A CB   4  
ATOM 3164  C CG   . PRO A 1 14 ? 6.103   -2.009  -4.498  1.00 0.00 ? 14 PRO A CG   4  
ATOM 3165  C CD   . PRO A 1 14 ? 5.249   -0.946  -5.163  1.00 0.00 ? 14 PRO A CD   4  
ATOM 3166  H HA   . PRO A 1 14 ? 5.160   -0.379  -2.416  1.00 0.00 ? 14 PRO A HA   4  
ATOM 3167  H HB2  . PRO A 1 14 ? 7.820   -1.059  -3.637  1.00 0.00 ? 14 PRO A HB2  4  
ATOM 3168  H HB3  . PRO A 1 14 ? 6.855   -1.994  -2.494  1.00 0.00 ? 14 PRO A HB3  4  
ATOM 3169  H HG2  . PRO A 1 14 ? 6.823   -2.398  -5.198  1.00 0.00 ? 14 PRO A HG2  4  
ATOM 3170  H HG3  . PRO A 1 14 ? 5.478   -2.806  -4.123  1.00 0.00 ? 14 PRO A HG3  4  
ATOM 3171  H HD2  . PRO A 1 14 ? 5.536   -0.820  -6.195  1.00 0.00 ? 14 PRO A HD2  4  
ATOM 3172  H HD3  . PRO A 1 14 ? 4.202   -1.202  -5.087  1.00 0.00 ? 14 PRO A HD3  4  
ATOM 3173  N N    . CYS A 1 15 ? 6.189   1.702   -1.464  1.00 0.00 ? 15 CYS A N    4  
ATOM 3174  C CA   . CYS A 1 15 ? 6.836   2.771   -0.708  1.00 0.00 ? 15 CYS A CA   4  
ATOM 3175  C C    . CYS A 1 15 ? 8.350   2.679   -0.770  1.00 0.00 ? 15 CYS A C    4  
ATOM 3176  O O    . CYS A 1 15 ? 8.989   2.187   0.158   1.00 0.00 ? 15 CYS A O    4  
ATOM 3177  C CB   . CYS A 1 15 ? 6.397   2.737   0.754   1.00 0.00 ? 15 CYS A CB   4  
ATOM 3178  S SG   . CYS A 1 15 ? 6.827   4.243   1.681   1.00 0.00 ? 15 CYS A SG   4  
ATOM 3179  H H    . CYS A 1 15 ? 5.244   1.520   -1.291  1.00 0.00 ? 15 CYS A H    4  
ATOM 3180  H HA   . CYS A 1 15 ? 6.529   3.711   -1.139  1.00 0.00 ? 15 CYS A HA   4  
ATOM 3181  H HB2  . CYS A 1 15 ? 5.326   2.608   0.803   1.00 0.00 ? 15 CYS A HB2  4  
ATOM 3182  H HB3  . CYS A 1 15 ? 6.876   1.906   1.247   1.00 0.00 ? 15 CYS A HB3  4  
ATOM 3183  N N    . CYS A 1 16 ? 8.901   3.185   -1.865  1.00 0.00 ? 16 CYS A N    4  
ATOM 3184  C CA   . CYS A 1 16 ? 10.341  3.214   -2.088  1.00 0.00 ? 16 CYS A CA   4  
ATOM 3185  C C    . CYS A 1 16 ? 10.769  2.094   -3.027  1.00 0.00 ? 16 CYS A C    4  
ATOM 3186  O O    . CYS A 1 16 ? 10.750  0.919   -2.668  1.00 0.00 ? 16 CYS A O    4  
ATOM 3187  C CB   . CYS A 1 16 ? 11.128  3.153   -0.770  1.00 0.00 ? 16 CYS A CB   4  
ATOM 3188  S SG   . CYS A 1 16 ? 10.668  4.415   0.486   1.00 0.00 ? 16 CYS A SG   4  
ATOM 3189  H H    . CYS A 1 16 ? 8.310   3.580   -2.549  1.00 0.00 ? 16 CYS A H    4  
ATOM 3190  H HA   . CYS A 1 16 ? 10.559  4.144   -2.570  1.00 0.00 ? 16 CYS A HA   4  
ATOM 3191  H HB2  . CYS A 1 16 ? 10.983  2.182   -0.321  1.00 0.00 ? 16 CYS A HB2  4  
ATOM 3192  H HB3  . CYS A 1 16 ? 12.177  3.280   -0.988  1.00 0.00 ? 16 CYS A HB3  4  
ATOM 3193  N N    . ASP A 1 17 ? 11.144  2.476   -4.243  1.00 0.00 ? 17 ASP A N    4  
ATOM 3194  C CA   . ASP A 1 17 ? 11.570  1.520   -5.256  1.00 0.00 ? 17 ASP A CA   4  
ATOM 3195  C C    . ASP A 1 17 ? 12.290  2.228   -6.394  1.00 0.00 ? 17 ASP A C    4  
ATOM 3196  O O    . ASP A 1 17 ? 11.870  2.150   -7.549  1.00 0.00 ? 17 ASP A O    4  
ATOM 3197  C CB   . ASP A 1 17 ? 10.364  0.763   -5.803  1.00 0.00 ? 17 ASP A CB   4  
ATOM 3198  C CG   . ASP A 1 17 ? 9.149   1.653   -5.970  1.00 0.00 ? 17 ASP A CG   4  
ATOM 3199  O OD1  . ASP A 1 17 ? 9.322   2.888   -6.038  1.00 0.00 ? 17 ASP A OD1  4  
ATOM 3200  O OD2  . ASP A 1 17 ? 8.023   1.116   -6.034  1.00 0.00 ? 17 ASP A OD2  4  
ATOM 3201  H H    . ASP A 1 17 ? 11.127  3.430   -4.467  1.00 0.00 ? 17 ASP A H    4  
ATOM 3202  H HA   . ASP A 1 17 ? 12.247  0.819   -4.792  1.00 0.00 ? 17 ASP A HA   4  
ATOM 3203  H HB2  . ASP A 1 17 ? 10.618  0.356   -6.767  1.00 0.00 ? 17 ASP A HB2  4  
ATOM 3204  H HB3  . ASP A 1 17 ? 10.114  -0.041  -5.128  1.00 0.00 ? 17 ASP A HB3  4  
ATOM 3205  N N    . ALA A 1 18 ? 13.370  2.921   -6.047  1.00 0.00 ? 18 ALA A N    4  
ATOM 3206  C CA   . ALA A 1 18 ? 14.171  3.668   -7.011  1.00 0.00 ? 18 ALA A CA   4  
ATOM 3207  C C    . ALA A 1 18 ? 14.096  3.078   -8.416  1.00 0.00 ? 18 ALA A C    4  
ATOM 3208  O O    . ALA A 1 18 ? 14.131  3.813   -9.402  1.00 0.00 ? 18 ALA A O    4  
ATOM 3209  C CB   . ALA A 1 18 ? 15.618  3.730   -6.547  1.00 0.00 ? 18 ALA A CB   4  
ATOM 3210  H H    . ALA A 1 18 ? 13.636  2.935   -5.105  1.00 0.00 ? 18 ALA A H    4  
ATOM 3211  H HA   . ALA A 1 18 ? 13.791  4.678   -7.040  1.00 0.00 ? 18 ALA A HA   4  
ATOM 3212  H HB1  . ALA A 1 18 ? 16.271  3.758   -7.407  1.00 0.00 ? 18 ALA A HB1  4  
ATOM 3213  H HB2  . ALA A 1 18 ? 15.843  2.857   -5.952  1.00 0.00 ? 18 ALA A HB2  4  
ATOM 3214  H HB3  . ALA A 1 18 ? 15.767  4.619   -5.952  1.00 0.00 ? 18 ALA A HB3  4  
ATOM 3215  N N    . ALA A 1 19 ? 14.009  1.755   -8.513  1.00 0.00 ? 19 ALA A N    4  
ATOM 3216  C CA   . ALA A 1 19 ? 13.952  1.106   -9.815  1.00 0.00 ? 19 ALA A CA   4  
ATOM 3217  C C    . ALA A 1 19 ? 12.698  0.256   -9.998  1.00 0.00 ? 19 ALA A C    4  
ATOM 3218  O O    . ALA A 1 19 ? 12.131  0.209   -11.091 1.00 0.00 ? 19 ALA A O    4  
ATOM 3219  C CB   . ALA A 1 19 ? 15.196  0.261   -10.028 1.00 0.00 ? 19 ALA A CB   4  
ATOM 3220  H H    . ALA A 1 19 ? 13.997  1.210   -7.699  1.00 0.00 ? 19 ALA A H    4  
ATOM 3221  H HA   . ALA A 1 19 ? 13.948  1.882   -10.562 1.00 0.00 ? 19 ALA A HA   4  
ATOM 3222  H HB1  . ALA A 1 19 ? 15.406  -0.302  -9.130  1.00 0.00 ? 19 ALA A HB1  4  
ATOM 3223  H HB2  . ALA A 1 19 ? 16.034  0.905   -10.253 1.00 0.00 ? 19 ALA A HB2  4  
ATOM 3224  H HB3  . ALA A 1 19 ? 15.033  -0.419  -10.850 1.00 0.00 ? 19 ALA A HB3  4  
ATOM 3225  N N    . THR A 1 20 ? 12.269  -0.423  -8.943  1.00 0.00 ? 20 THR A N    4  
ATOM 3226  C CA   . THR A 1 20 ? 11.087  -1.272  -9.024  1.00 0.00 ? 20 THR A CA   4  
ATOM 3227  C C    . THR A 1 20 ? 10.693  -1.777  -7.647  1.00 0.00 ? 20 THR A C    4  
ATOM 3228  O O    . THR A 1 20 ? 11.411  -1.562  -6.673  1.00 0.00 ? 20 THR A O    4  
ATOM 3229  C CB   . THR A 1 20 ? 11.344  -2.453  -9.960  1.00 0.00 ? 20 THR A CB   4  
ATOM 3230  O OG1  . THR A 1 20 ? 12.711  -2.518  -10.323 1.00 0.00 ? 20 THR A OG1  4  
ATOM 3231  C CG2  . THR A 1 20 ? 10.532  -2.391  -11.236 1.00 0.00 ? 20 THR A CG2  4  
ATOM 3232  H H    . THR A 1 20 ? 12.751  -0.354  -8.092  1.00 0.00 ? 20 THR A H    4  
ATOM 3233  H HA   . THR A 1 20 ? 10.279  -0.677  -9.421  1.00 0.00 ? 20 THR A HA   4  
ATOM 3234  H HB   . THR A 1 20 ? 11.084  -3.368  -9.447  1.00 0.00 ? 20 THR A HB   4  
ATOM 3235  H HG1  . THR A 1 20 ? 13.204  -2.969  -9.633  1.00 0.00 ? 20 THR A HG1  4  
ATOM 3236  H HG21 . THR A 1 20 ? 10.501  -3.370  -11.691 1.00 0.00 ? 20 THR A HG21 4  
ATOM 3237  H HG22 . THR A 1 20 ? 10.990  -1.691  -11.920 1.00 0.00 ? 20 THR A HG22 4  
ATOM 3238  H HG23 . THR A 1 20 ? 9.527   -2.068  -11.008 1.00 0.00 ? 20 THR A HG23 4  
ATOM 3239  N N    . CYS A 1 21 ? 9.550   -2.449  -7.576  1.00 0.00 ? 21 CYS A N    4  
ATOM 3240  C CA   . CYS A 1 21 ? 9.049   -2.991  -6.319  1.00 0.00 ? 21 CYS A CA   4  
ATOM 3241  C C    . CYS A 1 21 ? 10.183  -3.580  -5.475  1.00 0.00 ? 21 CYS A C    4  
ATOM 3242  O O    . CYS A 1 21 ? 10.440  -4.782  -5.530  1.00 0.00 ? 21 CYS A O    4  
ATOM 3243  C CB   . CYS A 1 21 ? 7.993   -4.072  -6.601  1.00 0.00 ? 21 CYS A CB   4  
ATOM 3244  S SG   . CYS A 1 21 ? 6.471   -3.465  -7.406  1.00 0.00 ? 21 CYS A SG   4  
ATOM 3245  H H    . CYS A 1 21 ? 9.026   -2.584  -8.394  1.00 0.00 ? 21 CYS A H    4  
ATOM 3246  H HA   . CYS A 1 21 ? 8.592   -2.182  -5.774  1.00 0.00 ? 21 CYS A HA   4  
ATOM 3247  H HB2  . CYS A 1 21 ? 8.424   -4.820  -7.249  1.00 0.00 ? 21 CYS A HB2  4  
ATOM 3248  H HB3  . CYS A 1 21 ? 7.706   -4.538  -5.672  1.00 0.00 ? 21 CYS A HB3  4  
ATOM 3249  N N    . LYS A 1 22 ? 10.859  -2.734  -4.692  1.00 0.00 ? 22 LYS A N    4  
ATOM 3250  C CA   . LYS A 1 22 ? 11.955  -3.201  -3.845  1.00 0.00 ? 22 LYS A CA   4  
ATOM 3251  C C    . LYS A 1 22 ? 12.477  -2.105  -2.909  1.00 0.00 ? 22 LYS A C    4  
ATOM 3252  O O    . LYS A 1 22 ? 12.921  -1.051  -3.364  1.00 0.00 ? 22 LYS A O    4  
ATOM 3253  C CB   . LYS A 1 22 ? 13.100  -3.727  -4.712  1.00 0.00 ? 22 LYS A CB   4  
ATOM 3254  C CG   . LYS A 1 22 ? 14.235  -4.344  -3.912  1.00 0.00 ? 22 LYS A CG   4  
ATOM 3255  C CD   . LYS A 1 22 ? 15.551  -4.280  -4.671  1.00 0.00 ? 22 LYS A CD   4  
ATOM 3256  C CE   . LYS A 1 22 ? 16.421  -5.492  -4.381  1.00 0.00 ? 22 LYS A CE   4  
ATOM 3257  N NZ   . LYS A 1 22 ? 17.425  -5.726  -5.455  1.00 0.00 ? 22 LYS A NZ   4  
ATOM 3258  H H    . LYS A 1 22 ? 10.614  -1.786  -4.683  1.00 0.00 ? 22 LYS A H    4  
ATOM 3259  H HA   . LYS A 1 22 ? 11.578  -4.014  -3.243  1.00 0.00 ? 22 LYS A HA   4  
ATOM 3260  H HB2  . LYS A 1 22 ? 12.712  -4.478  -5.384  1.00 0.00 ? 22 LYS A HB2  4  
ATOM 3261  H HB3  . LYS A 1 22 ? 13.501  -2.909  -5.293  1.00 0.00 ? 22 LYS A HB3  4  
ATOM 3262  H HG2  . LYS A 1 22 ? 14.342  -3.805  -2.982  1.00 0.00 ? 22 LYS A HG2  4  
ATOM 3263  H HG3  . LYS A 1 22 ? 13.998  -5.377  -3.707  1.00 0.00 ? 22 LYS A HG3  4  
ATOM 3264  H HD2  . LYS A 1 22 ? 15.343  -4.244  -5.730  1.00 0.00 ? 22 LYS A HD2  4  
ATOM 3265  H HD3  . LYS A 1 22 ? 16.083  -3.387  -4.376  1.00 0.00 ? 22 LYS A HD3  4  
ATOM 3266  H HE2  . LYS A 1 22 ? 16.938  -5.333  -3.446  1.00 0.00 ? 22 LYS A HE2  4  
ATOM 3267  H HE3  . LYS A 1 22 ? 15.787  -6.363  -4.297  1.00 0.00 ? 22 LYS A HE3  4  
ATOM 3268  H HZ1  . LYS A 1 22 ? 17.014  -5.500  -6.384  1.00 0.00 ? 22 LYS A HZ1  4  
ATOM 3269  H HZ2  . LYS A 1 22 ? 17.725  -6.721  -5.454  1.00 0.00 ? 22 LYS A HZ2  4  
ATOM 3270  H HZ3  . LYS A 1 22 ? 18.259  -5.124  -5.301  1.00 0.00 ? 22 LYS A HZ3  4  
ATOM 3271  N N    . LEU A 1 23 ? 12.458  -2.378  -1.604  1.00 0.00 ? 23 LEU A N    4  
ATOM 3272  C CA   . LEU A 1 23 ? 12.968  -1.433  -0.610  1.00 0.00 ? 23 LEU A CA   4  
ATOM 3273  C C    . LEU A 1 23 ? 13.475  -2.168  0.628   1.00 0.00 ? 23 LEU A C    4  
ATOM 3274  O O    . LEU A 1 23 ? 12.793  -3.038  1.169   1.00 0.00 ? 23 LEU A O    4  
ATOM 3275  C CB   . LEU A 1 23 ? 11.913  -0.396  -0.207  1.00 0.00 ? 23 LEU A CB   4  
ATOM 3276  C CG   . LEU A 1 23 ? 10.511  -0.927  0.078   1.00 0.00 ? 23 LEU A CG   4  
ATOM 3277  C CD1  . LEU A 1 23 ? 9.890   -0.149  1.224   1.00 0.00 ? 23 LEU A CD1  4  
ATOM 3278  C CD2  . LEU A 1 23 ? 9.648   -0.830  -1.169  1.00 0.00 ? 23 LEU A CD2  4  
ATOM 3279  H H    . LEU A 1 23 ? 12.117  -3.245  -1.304  1.00 0.00 ? 23 LEU A H    4  
ATOM 3280  H HA   . LEU A 1 23 ? 13.804  -0.916  -1.060  1.00 0.00 ? 23 LEU A HA   4  
ATOM 3281  H HB2  . LEU A 1 23 ? 12.263  0.105   0.683   1.00 0.00 ? 23 LEU A HB2  4  
ATOM 3282  H HB3  . LEU A 1 23 ? 11.840  0.332   -0.998  1.00 0.00 ? 23 LEU A HB3  4  
ATOM 3283  H HG   . LEU A 1 23 ? 10.565  -1.962  0.374   1.00 0.00 ? 23 LEU A HG   4  
ATOM 3284  H HD11 . LEU A 1 23 ? 8.928   0.229   0.923   1.00 0.00 ? 23 LEU A HD11 4  
ATOM 3285  H HD12 . LEU A 1 23 ? 10.534  0.676   1.489   1.00 0.00 ? 23 LEU A HD12 4  
ATOM 3286  H HD13 . LEU A 1 23 ? 9.770   -0.799  2.075   1.00 0.00 ? 23 LEU A HD13 4  
ATOM 3287  H HD21 . LEU A 1 23 ? 8.794   -1.477  -1.066  1.00 0.00 ? 23 LEU A HD21 4  
ATOM 3288  H HD22 . LEU A 1 23 ? 10.226  -1.132  -2.031  1.00 0.00 ? 23 LEU A HD22 4  
ATOM 3289  H HD23 . LEU A 1 23 ? 9.315   0.189   -1.298  1.00 0.00 ? 23 LEU A HD23 4  
ATOM 3290  N N    . ARG A 1 24 ? 14.682  -1.813  1.065   1.00 0.00 ? 24 ARG A N    4  
ATOM 3291  C CA   . ARG A 1 24 ? 15.292  -2.440  2.234   1.00 0.00 ? 24 ARG A CA   4  
ATOM 3292  C C    . ARG A 1 24 ? 14.449  -2.217  3.483   1.00 0.00 ? 24 ARG A C    4  
ATOM 3293  O O    . ARG A 1 24 ? 14.654  -2.868  4.508   1.00 0.00 ? 24 ARG A O    4  
ATOM 3294  C CB   . ARG A 1 24 ? 16.703  -1.893  2.455   1.00 0.00 ? 24 ARG A CB   4  
ATOM 3295  C CG   . ARG A 1 24 ? 17.684  -2.275  1.360   1.00 0.00 ? 24 ARG A CG   4  
ATOM 3296  C CD   . ARG A 1 24 ? 18.968  -1.465  1.455   1.00 0.00 ? 24 ARG A CD   4  
ATOM 3297  N NE   . ARG A 1 24 ? 19.438  -1.345  2.832   1.00 0.00 ? 24 ARG A NE   4  
ATOM 3298  C CZ   . ARG A 1 24 ? 20.505  -0.636  3.186   1.00 0.00 ? 24 ARG A CZ   4  
ATOM 3299  N NH1  . ARG A 1 24 ? 21.209  0.010   2.267   1.00 0.00 ? 24 ARG A NH1  4  
ATOM 3300  N NH2  . ARG A 1 24 ? 20.870  -0.574  4.460   1.00 0.00 ? 24 ARG A NH2  4  
ATOM 3301  H H    . ARG A 1 24 ? 15.176  -1.116  0.586   1.00 0.00 ? 24 ARG A H    4  
ATOM 3302  H HA   . ARG A 1 24 ? 15.352  -3.498  2.044   1.00 0.00 ? 24 ARG A HA   4  
ATOM 3303  H HB2  . ARG A 1 24 ? 16.654  -0.815  2.505   1.00 0.00 ? 24 ARG A HB2  4  
ATOM 3304  H HB3  . ARG A 1 24 ? 17.080  -2.271  3.394   1.00 0.00 ? 24 ARG A HB3  4  
ATOM 3305  H HG2  . ARG A 1 24 ? 17.924  -3.323  1.454   1.00 0.00 ? 24 ARG A HG2  4  
ATOM 3306  H HG3  . ARG A 1 24 ? 17.225  -2.093  0.399   1.00 0.00 ? 24 ARG A HG3  4  
ATOM 3307  H HD2  . ARG A 1 24 ? 19.730  -1.953  0.866   1.00 0.00 ? 24 ARG A HD2  4  
ATOM 3308  H HD3  . ARG A 1 24 ? 18.785  -0.477  1.059   1.00 0.00 ? 24 ARG A HD3  4  
ATOM 3309  H HE   . ARG A 1 24 ? 18.933  -1.815  3.528   1.00 0.00 ? 24 ARG A HE   4  
ATOM 3310  H HH11 . ARG A 1 24 ? 20.937  -0.034  1.306   1.00 0.00 ? 24 ARG A HH11 4  
ATOM 3311  H HH12 . ARG A 1 24 ? 22.012  0.543   2.535   1.00 0.00 ? 24 ARG A HH12 4  
ATOM 3312  H HH21 . ARG A 1 24 ? 20.341  -1.060  5.156   1.00 0.00 ? 24 ARG A HH21 4  
ATOM 3313  H HH22 . ARG A 1 24 ? 21.674  -0.041  4.724   1.00 0.00 ? 24 ARG A HH22 4  
ATOM 3314  N N    . GLN A 1 25 ? 13.502  -1.295  3.391   1.00 0.00 ? 25 GLN A N    4  
ATOM 3315  C CA   . GLN A 1 25 ? 12.626  -0.986  4.514   1.00 0.00 ? 25 GLN A CA   4  
ATOM 3316  C C    . GLN A 1 25 ? 11.378  -1.867  4.483   1.00 0.00 ? 25 GLN A C    4  
ATOM 3317  O O    . GLN A 1 25 ? 11.451  -3.065  4.757   1.00 0.00 ? 25 GLN A O    4  
ATOM 3318  C CB   . GLN A 1 25 ? 12.250  0.498   4.499   1.00 0.00 ? 25 GLN A CB   4  
ATOM 3319  C CG   . GLN A 1 25 ? 13.437  1.429   4.679   1.00 0.00 ? 25 GLN A CG   4  
ATOM 3320  C CD   . GLN A 1 25 ? 13.034  2.891   4.693   1.00 0.00 ? 25 GLN A CD   4  
ATOM 3321  O OE1  . GLN A 1 25 ? 12.498  3.408   3.713   1.00 0.00 ? 25 GLN A OE1  4  
ATOM 3322  N NE2  . GLN A 1 25 ? 13.291  3.565   5.808   1.00 0.00 ? 25 GLN A NE2  4  
ATOM 3323  H H    . GLN A 1 25 ? 13.389  -0.813  2.546   1.00 0.00 ? 25 GLN A H    4  
ATOM 3324  H HA   . GLN A 1 25 ? 13.167  -1.197  5.420   1.00 0.00 ? 25 GLN A HA   4  
ATOM 3325  H HB2  . GLN A 1 25 ? 11.778  0.728   3.556   1.00 0.00 ? 25 GLN A HB2  4  
ATOM 3326  H HB3  . GLN A 1 25 ? 11.547  0.687   5.298   1.00 0.00 ? 25 GLN A HB3  4  
ATOM 3327  H HG2  . GLN A 1 25 ? 13.923  1.197   5.615   1.00 0.00 ? 25 GLN A HG2  4  
ATOM 3328  H HG3  . GLN A 1 25 ? 14.130  1.270   3.865   1.00 0.00 ? 25 GLN A HG3  4  
ATOM 3329  H HE21 . GLN A 1 25 ? 13.720  3.089   6.549   1.00 0.00 ? 25 GLN A HE21 4  
ATOM 3330  H HE22 . GLN A 1 25 ? 13.041  4.512   5.844   1.00 0.00 ? 25 GLN A HE22 4  
ATOM 3331  N N    . GLY A 1 26 ? 10.238  -1.277  4.144   1.00 0.00 ? 26 GLY A N    4  
ATOM 3332  C CA   . GLY A 1 26 ? 9.004   -2.036  4.081   1.00 0.00 ? 26 GLY A CA   4  
ATOM 3333  C C    . GLY A 1 26 ? 7.835   -1.211  3.597   1.00 0.00 ? 26 GLY A C    4  
ATOM 3334  O O    . GLY A 1 26 ? 7.116   -0.612  4.396   1.00 0.00 ? 26 GLY A O    4  
ATOM 3335  H H    . GLY A 1 26 ? 10.233  -0.325  3.931   1.00 0.00 ? 26 GLY A H    4  
ATOM 3336  H HA2  . GLY A 1 26 ? 9.137   -2.871  3.408   1.00 0.00 ? 26 GLY A HA2  4  
ATOM 3337  H HA3  . GLY A 1 26 ? 8.773   -2.417  5.065   1.00 0.00 ? 26 GLY A HA3  4  
ATOM 3338  N N    . ALA A 1 27 ? 7.619   -1.207  2.285   1.00 0.00 ? 27 ALA A N    4  
ATOM 3339  C CA   . ALA A 1 27 ? 6.504   -0.482  1.706   1.00 0.00 ? 27 ALA A CA   4  
ATOM 3340  C C    . ALA A 1 27 ? 5.211   -1.274  1.904   1.00 0.00 ? 27 ALA A C    4  
ATOM 3341  O O    . ALA A 1 27 ? 4.151   -0.905  1.399   1.00 0.00 ? 27 ALA A O    4  
ATOM 3342  C CB   . ALA A 1 27 ? 6.750   -0.229  0.224   1.00 0.00 ? 27 ALA A CB   4  
ATOM 3343  H H    . ALA A 1 27 ? 8.207   -1.724  1.699   1.00 0.00 ? 27 ALA A H    4  
ATOM 3344  H HA   . ALA A 1 27 ? 6.426   0.463   2.210   1.00 0.00 ? 27 ALA A HA   4  
ATOM 3345  H HB1  . ALA A 1 27 ? 5.807   -0.065  -0.274  1.00 0.00 ? 27 ALA A HB1  4  
ATOM 3346  H HB2  . ALA A 1 27 ? 7.239   -1.085  -0.211  1.00 0.00 ? 27 ALA A HB2  4  
ATOM 3347  H HB3  . ALA A 1 27 ? 7.377   0.642   0.096   1.00 0.00 ? 27 ALA A HB3  4  
ATOM 3348  N N    . GLN A 1 28 ? 5.330   -2.385  2.628   1.00 0.00 ? 28 GLN A N    4  
ATOM 3349  C CA   . GLN A 1 28 ? 4.225   -3.282  2.902   1.00 0.00 ? 28 GLN A CA   4  
ATOM 3350  C C    . GLN A 1 28 ? 3.048   -2.555  3.546   1.00 0.00 ? 28 GLN A C    4  
ATOM 3351  O O    . GLN A 1 28 ? 3.023   -2.334  4.757   1.00 0.00 ? 28 GLN A O    4  
ATOM 3352  C CB   . GLN A 1 28 ? 4.741   -4.420  3.787   1.00 0.00 ? 28 GLN A CB   4  
ATOM 3353  C CG   . GLN A 1 28 ? 3.806   -4.849  4.897   1.00 0.00 ? 28 GLN A CG   4  
ATOM 3354  C CD   . GLN A 1 28 ? 4.172   -4.246  6.239   1.00 0.00 ? 28 GLN A CD   4  
ATOM 3355  O OE1  . GLN A 1 28 ? 5.046   -3.384  6.327   1.00 0.00 ? 28 GLN A OE1  4  
ATOM 3356  N NE2  . GLN A 1 28 ? 3.502   -4.698  7.292   1.00 0.00 ? 28 GLN A NE2  4  
ATOM 3357  H H    . GLN A 1 28 ? 6.205   -2.623  2.982   1.00 0.00 ? 28 GLN A H    4  
ATOM 3358  H HA   . GLN A 1 28 ? 3.901   -3.702  1.962   1.00 0.00 ? 28 GLN A HA   4  
ATOM 3359  H HB2  . GLN A 1 28 ? 4.925   -5.275  3.163   1.00 0.00 ? 28 GLN A HB2  4  
ATOM 3360  H HB3  . GLN A 1 28 ? 5.673   -4.111  4.234   1.00 0.00 ? 28 GLN A HB3  4  
ATOM 3361  H HG2  . GLN A 1 28 ? 2.807   -4.545  4.643   1.00 0.00 ? 28 GLN A HG2  4  
ATOM 3362  H HG3  . GLN A 1 28 ? 3.848   -5.924  4.976   1.00 0.00 ? 28 GLN A HG3  4  
ATOM 3363  H HE21 . GLN A 1 28 ? 2.819   -5.386  7.147   1.00 0.00 ? 28 GLN A HE21 4  
ATOM 3364  H HE22 . GLN A 1 28 ? 3.718   -4.326  8.173   1.00 0.00 ? 28 GLN A HE22 4  
ATOM 3365  N N    . CYS A 1 29 ? 2.077   -2.187  2.720   1.00 0.00 ? 29 CYS A N    4  
ATOM 3366  C CA   . CYS A 1 29 ? 0.891   -1.484  3.191   1.00 0.00 ? 29 CYS A CA   4  
ATOM 3367  C C    . CYS A 1 29 ? 1.301   -0.182  3.859   1.00 0.00 ? 29 CYS A C    4  
ATOM 3368  O O    . CYS A 1 29 ? 0.826   0.158   4.943   1.00 0.00 ? 29 CYS A O    4  
ATOM 3369  C CB   . CYS A 1 29 ? 0.085   -2.362  4.158   1.00 0.00 ? 29 CYS A CB   4  
ATOM 3370  S SG   . CYS A 1 29 ? -0.444  -3.956  3.441   1.00 0.00 ? 29 CYS A SG   4  
ATOM 3371  H H    . CYS A 1 29 ? 2.165   -2.387  1.768   1.00 0.00 ? 29 CYS A H    4  
ATOM 3372  H HA   . CYS A 1 29 ? 0.280   -1.257  2.330   1.00 0.00 ? 29 CYS A HA   4  
ATOM 3373  H HB2  . CYS A 1 29 ? 0.688   -2.576  5.028   1.00 0.00 ? 29 CYS A HB2  4  
ATOM 3374  H HB3  . CYS A 1 29 ? -0.803  -1.827  4.463   1.00 0.00 ? 29 CYS A HB3  4  
ATOM 3375  N N    . ALA A 1 30 ? 2.194   0.539   3.191   1.00 0.00 ? 30 ALA A N    4  
ATOM 3376  C CA   . ALA A 1 30 ? 2.691   1.815   3.702   1.00 0.00 ? 30 ALA A CA   4  
ATOM 3377  C C    . ALA A 1 30 ? 1.630   2.900   3.534   1.00 0.00 ? 30 ALA A C    4  
ATOM 3378  O O    . ALA A 1 30 ? 0.451   2.645   3.777   1.00 0.00 ? 30 ALA A O    4  
ATOM 3379  C CB   . ALA A 1 30 ? 3.983   2.198   2.995   1.00 0.00 ? 30 ALA A CB   4  
ATOM 3380  H H    . ALA A 1 30 ? 2.525   0.201   2.328   1.00 0.00 ? 30 ALA A H    4  
ATOM 3381  H HA   . ALA A 1 30 ? 2.903   1.686   4.752   1.00 0.00 ? 30 ALA A HA   4  
ATOM 3382  H HB1  . ALA A 1 30 ? 4.544   2.881   3.616   1.00 0.00 ? 30 ALA A HB1  4  
ATOM 3383  H HB2  . ALA A 1 30 ? 3.751   2.675   2.055   1.00 0.00 ? 30 ALA A HB2  4  
ATOM 3384  H HB3  . ALA A 1 30 ? 4.571   1.311   2.813   1.00 0.00 ? 30 ALA A HB3  4  
ATOM 3385  N N    . GLU A 1 31 ? 2.029   4.102   3.087   1.00 0.00 ? 31 GLU A N    4  
ATOM 3386  C CA   . GLU A 1 31 ? 1.056   5.174   2.865   1.00 0.00 ? 31 GLU A CA   4  
ATOM 3387  C C    . GLU A 1 31 ? -0.177  4.567   2.232   1.00 0.00 ? 31 GLU A C    4  
ATOM 3388  O O    . GLU A 1 31 ? -1.306  4.996   2.465   1.00 0.00 ? 31 GLU A O    4  
ATOM 3389  C CB   . GLU A 1 31 ? 1.634   6.258   1.951   1.00 0.00 ? 31 GLU A CB   4  
ATOM 3390  C CG   . GLU A 1 31 ? 0.913   7.591   2.059   1.00 0.00 ? 31 GLU A CG   4  
ATOM 3391  C CD   . GLU A 1 31 ? 0.039   7.880   0.854   1.00 0.00 ? 31 GLU A CD   4  
ATOM 3392  O OE1  . GLU A 1 31 ? 0.257   7.249   -0.202  1.00 0.00 ? 31 GLU A OE1  4  
ATOM 3393  O OE2  . GLU A 1 31 ? -0.864  8.735   0.966   1.00 0.00 ? 31 GLU A OE2  4  
ATOM 3394  H H    . GLU A 1 31 ? 2.973   4.258   2.882   1.00 0.00 ? 31 GLU A H    4  
ATOM 3395  H HA   . GLU A 1 31 ? 0.789   5.602   3.817   1.00 0.00 ? 31 GLU A HA   4  
ATOM 3396  H HB2  . GLU A 1 31 ? 2.672   6.413   2.203   1.00 0.00 ? 31 GLU A HB2  4  
ATOM 3397  H HB3  . GLU A 1 31 ? 1.569   5.921   0.928   1.00 0.00 ? 31 GLU A HB3  4  
ATOM 3398  H HG2  . GLU A 1 31 ? 0.290   7.579   2.941   1.00 0.00 ? 31 GLU A HG2  4  
ATOM 3399  H HG3  . GLU A 1 31 ? 1.648   8.378   2.149   1.00 0.00 ? 31 GLU A HG3  4  
ATOM 3400  N N    . GLY A 1 32 ? 0.079   3.526   1.457   1.00 0.00 ? 32 GLY A N    4  
ATOM 3401  C CA   . GLY A 1 32 ? -0.962  2.786   0.799   1.00 0.00 ? 32 GLY A CA   4  
ATOM 3402  C C    . GLY A 1 32 ? -0.638  1.318   0.811   1.00 0.00 ? 32 GLY A C    4  
ATOM 3403  O O    . GLY A 1 32 ? -0.312  0.763   1.860   1.00 0.00 ? 32 GLY A O    4  
ATOM 3404  H H    . GLY A 1 32 ? 1.008   3.238   1.346   1.00 0.00 ? 32 GLY A H    4  
ATOM 3405  H HA2  . GLY A 1 32 ? -1.897  2.950   1.312   1.00 0.00 ? 32 GLY A HA2  4  
ATOM 3406  H HA3  . GLY A 1 32 ? -1.044  3.120   -0.222  1.00 0.00 ? 32 GLY A HA3  4  
ATOM 3407  N N    . LEU A 1 33 ? -0.694  0.681   -0.345  1.00 0.00 ? 33 LEU A N    4  
ATOM 3408  C CA   . LEU A 1 33 ? -0.362  -0.727  -0.404  1.00 0.00 ? 33 LEU A CA   4  
ATOM 3409  C C    . LEU A 1 33 ? 1.103   -0.951  -0.815  1.00 0.00 ? 33 LEU A C    4  
ATOM 3410  O O    . LEU A 1 33 ? 1.966   -0.123  -0.521  1.00 0.00 ? 33 LEU A O    4  
ATOM 3411  C CB   . LEU A 1 33 ? -1.301  -1.482  -1.339  1.00 0.00 ? 33 LEU A CB   4  
ATOM 3412  C CG   . LEU A 1 33 ? -1.605  -2.924  -0.919  1.00 0.00 ? 33 LEU A CG   4  
ATOM 3413  C CD1  . LEU A 1 33 ? -1.386  -3.868  -2.083  1.00 0.00 ? 33 LEU A CD1  4  
ATOM 3414  C CD2  . LEU A 1 33 ? -0.761  -3.346  0.276   1.00 0.00 ? 33 LEU A CD2  4  
ATOM 3415  H H    . LEU A 1 33 ? -0.948  1.166   -1.161  1.00 0.00 ? 33 LEU A H    4  
ATOM 3416  H HA   . LEU A 1 33 ? -0.497  -1.103  0.595   1.00 0.00 ? 33 LEU A HA   4  
ATOM 3417  H HB2  . LEU A 1 33 ? -2.233  -0.939  -1.395  1.00 0.00 ? 33 LEU A HB2  4  
ATOM 3418  H HB3  . LEU A 1 33 ? -0.856  -1.504  -2.322  1.00 0.00 ? 33 LEU A HB3  4  
ATOM 3419  H HG   . LEU A 1 33 ? -2.637  -2.994  -0.627  1.00 0.00 ? 33 LEU A HG   4  
ATOM 3420  H HD11 . LEU A 1 33 ? -0.644  -3.453  -2.749  1.00 0.00 ? 33 LEU A HD11 4  
ATOM 3421  H HD12 . LEU A 1 33 ? -2.315  -4.000  -2.617  1.00 0.00 ? 33 LEU A HD12 4  
ATOM 3422  H HD13 . LEU A 1 33 ? -1.044  -4.821  -1.710  1.00 0.00 ? 33 LEU A HD13 4  
ATOM 3423  H HD21 . LEU A 1 33 ? 0.281   -3.148  0.074   1.00 0.00 ? 33 LEU A HD21 4  
ATOM 3424  H HD22 . LEU A 1 33 ? -0.899  -4.396  0.456   1.00 0.00 ? 33 LEU A HD22 4  
ATOM 3425  H HD23 . LEU A 1 33 ? -1.069  -2.787  1.148   1.00 0.00 ? 33 LEU A HD23 4  
ATOM 3426  N N    . CYS A 1 34 ? 1.381   -2.079  -1.482  1.00 0.00 ? 34 CYS A N    4  
ATOM 3427  C CA   . CYS A 1 34 ? 2.746   -2.410  -1.914  1.00 0.00 ? 34 CYS A CA   4  
ATOM 3428  C C    . CYS A 1 34 ? 2.742   -3.344  -3.122  1.00 0.00 ? 34 CYS A C    4  
ATOM 3429  O O    . CYS A 1 34 ? 1.767   -3.405  -3.871  1.00 0.00 ? 34 CYS A O    4  
ATOM 3430  C CB   . CYS A 1 34 ? 3.521   -3.064  -0.765  1.00 0.00 ? 34 CYS A CB   4  
ATOM 3431  S SG   . CYS A 1 34 ? 5.292   -2.651  -0.704  1.00 0.00 ? 34 CYS A SG   4  
ATOM 3432  H H    . CYS A 1 34 ? 0.658   -2.706  -1.681  1.00 0.00 ? 34 CYS A H    4  
ATOM 3433  H HA   . CYS A 1 34 ? 3.236   -1.496  -2.192  1.00 0.00 ? 34 CYS A HA   4  
ATOM 3434  H HB2  . CYS A 1 34 ? 3.084   -2.762  0.172   1.00 0.00 ? 34 CYS A HB2  4  
ATOM 3435  H HB3  . CYS A 1 34 ? 3.446   -4.134  -0.863  1.00 0.00 ? 34 CYS A HB3  4  
ATOM 3436  N N    . CYS A 1 35 ? 3.848   -4.068  -3.305  1.00 0.00 ? 35 CYS A N    4  
ATOM 3437  C CA   . CYS A 1 35 ? 3.981   -4.998  -4.422  1.00 0.00 ? 35 CYS A CA   4  
ATOM 3438  C C    . CYS A 1 35 ? 5.225   -5.872  -4.274  1.00 0.00 ? 35 CYS A C    4  
ATOM 3439  O O    . CYS A 1 35 ? 5.233   -7.033  -4.681  1.00 0.00 ? 35 CYS A O    4  
ATOM 3440  C CB   . CYS A 1 35 ? 4.019   -4.221  -5.752  1.00 0.00 ? 35 CYS A CB   4  
ATOM 3441  S SG   . CYS A 1 35 ? 5.108   -4.930  -7.040  1.00 0.00 ? 35 CYS A SG   4  
ATOM 3442  H H    . CYS A 1 35 ? 4.587   -3.973  -2.675  1.00 0.00 ? 35 CYS A H    4  
ATOM 3443  H HA   . CYS A 1 35 ? 3.120   -5.634  -4.410  1.00 0.00 ? 35 CYS A HA   4  
ATOM 3444  H HB2  . CYS A 1 35 ? 3.021   -4.182  -6.160  1.00 0.00 ? 35 CYS A HB2  4  
ATOM 3445  H HB3  . CYS A 1 35 ? 4.357   -3.213  -5.557  1.00 0.00 ? 35 CYS A HB3  4  
ATOM 3446  N N    . ASP A 1 36 ? 6.271   -5.298  -3.707  1.00 0.00 ? 36 ASP A N    4  
ATOM 3447  C CA   . ASP A 1 36 ? 7.533   -6.009  -3.520  1.00 0.00 ? 36 ASP A CA   4  
ATOM 3448  C C    . ASP A 1 36 ? 7.507   -6.892  -2.274  1.00 0.00 ? 36 ASP A C    4  
ATOM 3449  O O    . ASP A 1 36 ? 6.498   -6.969  -1.574  1.00 0.00 ? 36 ASP A O    4  
ATOM 3450  C CB   . ASP A 1 36 ? 8.685   -5.006  -3.438  1.00 0.00 ? 36 ASP A CB   4  
ATOM 3451  C CG   . ASP A 1 36 ? 8.895   -4.457  -2.046  1.00 0.00 ? 36 ASP A CG   4  
ATOM 3452  O OD1  . ASP A 1 36 ? 9.590   -5.116  -1.245  1.00 0.00 ? 36 ASP A OD1  4  
ATOM 3453  O OD2  . ASP A 1 36 ? 8.365   -3.366  -1.757  1.00 0.00 ? 36 ASP A OD2  4  
ATOM 3454  H H    . ASP A 1 36 ? 6.198   -4.369  -3.420  1.00 0.00 ? 36 ASP A H    4  
ATOM 3455  H HA   . ASP A 1 36 ? 7.684   -6.638  -4.383  1.00 0.00 ? 36 ASP A HA   4  
ATOM 3456  H HB2  . ASP A 1 36 ? 9.597   -5.487  -3.754  1.00 0.00 ? 36 ASP A HB2  4  
ATOM 3457  H HB3  . ASP A 1 36 ? 8.472   -4.179  -4.093  1.00 0.00 ? 36 ASP A HB3  4  
ATOM 3458  N N    . GLN A 1 37 ? 8.629   -7.559  -2.009  1.00 0.00 ? 37 GLN A N    4  
ATOM 3459  C CA   . GLN A 1 37 ? 8.748   -8.443  -0.854  1.00 0.00 ? 37 GLN A CA   4  
ATOM 3460  C C    . GLN A 1 37 ? 8.253   -7.755  0.413   1.00 0.00 ? 37 GLN A C    4  
ATOM 3461  O O    . GLN A 1 37 ? 7.894   -8.416  1.387   1.00 0.00 ? 37 GLN A O    4  
ATOM 3462  C CB   . GLN A 1 37 ? 10.201  -8.887  -0.671  1.00 0.00 ? 37 GLN A CB   4  
ATOM 3463  C CG   . GLN A 1 37 ? 10.716  -9.763  -1.801  1.00 0.00 ? 37 GLN A CG   4  
ATOM 3464  C CD   . GLN A 1 37 ? 11.285  -11.078 -1.305  1.00 0.00 ? 37 GLN A CD   4  
ATOM 3465  O OE1  . GLN A 1 37 ? 12.501  -11.242 -1.202  1.00 0.00 ? 37 GLN A OE1  4  
ATOM 3466  N NE2  . GLN A 1 37 ? 10.406  -12.024 -0.994  1.00 0.00 ? 37 GLN A NE2  4  
ATOM 3467  H H    . GLN A 1 37 ? 9.396   -7.457  -2.608  1.00 0.00 ? 37 GLN A H    4  
ATOM 3468  H HA   . GLN A 1 37 ? 8.137   -9.312  -1.040  1.00 0.00 ? 37 GLN A HA   4  
ATOM 3469  H HB2  . GLN A 1 37 ? 10.828  -8.009  -0.611  1.00 0.00 ? 37 GLN A HB2  4  
ATOM 3470  H HB3  . GLN A 1 37 ? 10.282  -9.441  0.252   1.00 0.00 ? 37 GLN A HB3  4  
ATOM 3471  H HG2  . GLN A 1 37 ? 9.901   -9.974  -2.477  1.00 0.00 ? 37 GLN A HG2  4  
ATOM 3472  H HG3  . GLN A 1 37 ? 11.492  -9.229  -2.329  1.00 0.00 ? 37 GLN A HG3  4  
ATOM 3473  H HE21 . GLN A 1 37 ? 9.453   -11.823 -1.101  1.00 0.00 ? 37 GLN A HE21 4  
ATOM 3474  H HE22 . GLN A 1 37 ? 10.747  -12.884 -0.671  1.00 0.00 ? 37 GLN A HE22 4  
ATOM 3475  N N    . CYS A 1 38 ? 8.246   -6.424  0.383   1.00 0.00 ? 38 CYS A N    4  
ATOM 3476  C CA   . CYS A 1 38 ? 7.801   -5.612  1.510   1.00 0.00 ? 38 CYS A CA   4  
ATOM 3477  C C    . CYS A 1 38 ? 6.789   -6.363  2.366   1.00 0.00 ? 38 CYS A C    4  
ATOM 3478  O O    . CYS A 1 38 ? 6.821   -6.282  3.594   1.00 0.00 ? 38 CYS A O    4  
ATOM 3479  C CB   . CYS A 1 38 ? 7.187   -4.300  1.008   1.00 0.00 ? 38 CYS A CB   4  
ATOM 3480  S SG   . CYS A 1 38 ? 6.196   -4.462  -0.514  1.00 0.00 ? 38 CYS A SG   4  
ATOM 3481  H H    . CYS A 1 38 ? 8.552   -5.975  -0.423  1.00 0.00 ? 38 CYS A H    4  
ATOM 3482  H HA   . CYS A 1 38 ? 8.663   -5.382  2.115   1.00 0.00 ? 38 CYS A HA   4  
ATOM 3483  H HB2  . CYS A 1 38 ? 6.541   -3.908  1.769   1.00 0.00 ? 38 CYS A HB2  4  
ATOM 3484  H HB3  . CYS A 1 38 ? 7.976   -3.587  0.813   1.00 0.00 ? 38 CYS A HB3  4  
ATOM 3485  N N    . ARG A 1 39 ? 5.893   -7.092  1.704   1.00 0.00 ? 39 ARG A N    4  
ATOM 3486  C CA   . ARG A 1 39 ? 4.862   -7.867  2.392   1.00 0.00 ? 39 ARG A CA   4  
ATOM 3487  C C    . ARG A 1 39 ? 3.595   -7.040  2.572   1.00 0.00 ? 39 ARG A C    4  
ATOM 3488  O O    . ARG A 1 39 ? 3.385   -6.058  1.859   1.00 0.00 ? 39 ARG A O    4  
ATOM 3489  C CB   . ARG A 1 39 ? 5.365   -8.357  3.752   1.00 0.00 ? 39 ARG A CB   4  
ATOM 3490  C CG   . ARG A 1 39 ? 4.868   -9.744  4.120   1.00 0.00 ? 39 ARG A CG   4  
ATOM 3491  C CD   . ARG A 1 39 ? 5.951   -10.794 3.926   1.00 0.00 ? 39 ARG A CD   4  
ATOM 3492  N NE   . ARG A 1 39 ? 5.538   -11.840 2.995   1.00 0.00 ? 39 ARG A NE   4  
ATOM 3493  C CZ   . ARG A 1 39 ? 6.390   -12.560 2.271   1.00 0.00 ? 39 ARG A CZ   4  
ATOM 3494  N NH1  . ARG A 1 39 ? 7.694   -12.345 2.371   1.00 0.00 ? 39 ARG A NH1  4  
ATOM 3495  N NH2  . ARG A 1 39 ? 5.937   -13.495 1.448   1.00 0.00 ? 39 ARG A NH2  4  
ATOM 3496  H H    . ARG A 1 39 ? 5.925   -7.106  0.723   1.00 0.00 ? 39 ARG A H    4  
ATOM 3497  H HA   . ARG A 1 39 ? 4.630   -8.723  1.776   1.00 0.00 ? 39 ARG A HA   4  
ATOM 3498  H HB2  . ARG A 1 39 ? 6.445   -8.376  3.737   1.00 0.00 ? 39 ARG A HB2  4  
ATOM 3499  H HB3  . ARG A 1 39 ? 5.038   -7.666  4.514   1.00 0.00 ? 39 ARG A HB3  4  
ATOM 3500  H HG2  . ARG A 1 39 ? 4.564   -9.744  5.156   1.00 0.00 ? 39 ARG A HG2  4  
ATOM 3501  H HG3  . ARG A 1 39 ? 4.023   -9.991  3.494   1.00 0.00 ? 39 ARG A HG3  4  
ATOM 3502  H HD2  . ARG A 1 39 ? 6.837   -10.311 3.540   1.00 0.00 ? 39 ARG A HD2  4  
ATOM 3503  H HD3  . ARG A 1 39 ? 6.175   -11.243 4.882   1.00 0.00 ? 39 ARG A HD3  4  
ATOM 3504  H HE   . ARG A 1 39 ? 4.578   -12.015 2.905   1.00 0.00 ? 39 ARG A HE   4  
ATOM 3505  H HH11 . ARG A 1 39 ? 8.039   -11.640 2.990   1.00 0.00 ? 39 ARG A HH11 4  
ATOM 3506  H HH12 . ARG A 1 39 ? 8.334   -12.887 1.826   1.00 0.00 ? 39 ARG A HH12 4  
ATOM 3507  H HH21 . ARG A 1 39 ? 4.954   -13.660 1.370   1.00 0.00 ? 39 ARG A HH21 4  
ATOM 3508  H HH22 . ARG A 1 39 ? 6.579   -14.036 0.904   1.00 0.00 ? 39 ARG A HH22 4  
ATOM 3509  N N    . PHE A 1 40 ? 2.757   -7.435  3.525   1.00 0.00 ? 40 PHE A N    4  
ATOM 3510  C CA   . PHE A 1 40 ? 1.513   -6.721  3.784   1.00 0.00 ? 40 PHE A CA   4  
ATOM 3511  C C    . PHE A 1 40 ? 0.950   -7.041  5.166   1.00 0.00 ? 40 PHE A C    4  
ATOM 3512  O O    . PHE A 1 40 ? 0.949   -8.192  5.602   1.00 0.00 ? 40 PHE A O    4  
ATOM 3513  C CB   . PHE A 1 40 ? 0.493   -7.058  2.701   1.00 0.00 ? 40 PHE A CB   4  
ATOM 3514  C CG   . PHE A 1 40 ? 1.026   -6.832  1.323   1.00 0.00 ? 40 PHE A CG   4  
ATOM 3515  C CD1  . PHE A 1 40 ? 1.059   -5.559  0.796   1.00 0.00 ? 40 PHE A CD1  4  
ATOM 3516  C CD2  . PHE A 1 40 ? 1.508   -7.882  0.563   1.00 0.00 ? 40 PHE A CD2  4  
ATOM 3517  C CE1  . PHE A 1 40 ? 1.554   -5.327  -0.463  1.00 0.00 ? 40 PHE A CE1  4  
ATOM 3518  C CE2  . PHE A 1 40 ? 2.009   -7.659  -0.702  1.00 0.00 ? 40 PHE A CE2  4  
ATOM 3519  C CZ   . PHE A 1 40 ? 2.032   -6.379  -1.219  1.00 0.00 ? 40 PHE A CZ   4  
ATOM 3520  H H    . PHE A 1 40 ? 2.980   -8.221  4.062   1.00 0.00 ? 40 PHE A H    4  
ATOM 3521  H HA   . PHE A 1 40 ? 1.726   -5.667  3.735   1.00 0.00 ? 40 PHE A HA   4  
ATOM 3522  H HB2  . PHE A 1 40 ? 0.208   -8.094  2.785   1.00 0.00 ? 40 PHE A HB2  4  
ATOM 3523  H HB3  . PHE A 1 40 ? -0.377  -6.432  2.827   1.00 0.00 ? 40 PHE A HB3  4  
ATOM 3524  H HD1  . PHE A 1 40 ? 0.693   -4.737  1.383   1.00 0.00 ? 40 PHE A HD1  4  
ATOM 3525  H HD2  . PHE A 1 40 ? 1.486   -8.884  0.965   1.00 0.00 ? 40 PHE A HD2  4  
ATOM 3526  H HE1  . PHE A 1 40 ? 1.569   -4.321  -0.856  1.00 0.00 ? 40 PHE A HE1  4  
ATOM 3527  H HE2  . PHE A 1 40 ? 2.386   -8.483  -1.282  1.00 0.00 ? 40 PHE A HE2  4  
ATOM 3528  H HZ   . PHE A 1 40 ? 2.424   -6.201  -2.210  1.00 0.00 ? 40 PHE A HZ   4  
ATOM 3529  N N    . MET A 1 41 ? 0.474   -6.002  5.847   1.00 0.00 ? 41 MET A N    4  
ATOM 3530  C CA   . MET A 1 41 ? -0.096  -6.139  7.184   1.00 0.00 ? 41 MET A CA   4  
ATOM 3531  C C    . MET A 1 41 ? -1.005  -7.360  7.283   1.00 0.00 ? 41 MET A C    4  
ATOM 3532  O O    . MET A 1 41 ? -0.628  -8.378  7.863   1.00 0.00 ? 41 MET A O    4  
ATOM 3533  C CB   . MET A 1 41 ? -0.886  -4.880  7.545   1.00 0.00 ? 41 MET A CB   4  
ATOM 3534  C CG   . MET A 1 41 ? -0.265  -4.074  8.675   1.00 0.00 ? 41 MET A CG   4  
ATOM 3535  S SD   . MET A 1 41 ? 1.084   -3.017  8.113   1.00 0.00 ? 41 MET A SD   4  
ATOM 3536  C CE   . MET A 1 41 ? 1.879   -2.626  9.670   1.00 0.00 ? 41 MET A CE   4  
ATOM 3537  H H    . MET A 1 41 ? 0.510   -5.113  5.439   1.00 0.00 ? 41 MET A H    4  
ATOM 3538  H HA   . MET A 1 41 ? 0.719   -6.253  7.882   1.00 0.00 ? 41 MET A HA   4  
ATOM 3539  H HB2  . MET A 1 41 ? -0.950  -4.246  6.672   1.00 0.00 ? 41 MET A HB2  4  
ATOM 3540  H HB3  . MET A 1 41 ? -1.883  -5.168  7.843   1.00 0.00 ? 41 MET A HB3  4  
ATOM 3541  H HG2  . MET A 1 41 ? -1.029  -3.452  9.117   1.00 0.00 ? 41 MET A HG2  4  
ATOM 3542  H HG3  . MET A 1 41 ? 0.117   -4.757  9.419   1.00 0.00 ? 41 MET A HG3  4  
ATOM 3543  H HE1  . MET A 1 41 ? 1.277   -2.999  10.485  1.00 0.00 ? 41 MET A HE1  4  
ATOM 3544  H HE2  . MET A 1 41 ? 1.985   -1.555  9.761   1.00 0.00 ? 41 MET A HE2  4  
ATOM 3545  H HE3  . MET A 1 41 ? 2.854   -3.088  9.702   1.00 0.00 ? 41 MET A HE3  4  
ATOM 3546  N N    . LYS A 1 42 ? -2.206  -7.241  6.720   1.00 0.00 ? 42 LYS A N    4  
ATOM 3547  C CA   . LYS A 1 42 ? -3.188  -8.322  6.743   1.00 0.00 ? 42 LYS A CA   4  
ATOM 3548  C C    . LYS A 1 42 ? -4.097  -8.203  7.958   1.00 0.00 ? 42 LYS A C    4  
ATOM 3549  O O    . LYS A 1 42 ? -4.023  -9.007  8.887   1.00 0.00 ? 42 LYS A O    4  
ATOM 3550  C CB   . LYS A 1 42 ? -2.502  -9.690  6.731   1.00 0.00 ? 42 LYS A CB   4  
ATOM 3551  C CG   . LYS A 1 42 ? -1.394  -9.804  5.697   1.00 0.00 ? 42 LYS A CG   4  
ATOM 3552  C CD   . LYS A 1 42 ? -1.879  -10.504 4.439   1.00 0.00 ? 42 LYS A CD   4  
ATOM 3553  C CE   . LYS A 1 42 ? -1.288  -11.899 4.313   1.00 0.00 ? 42 LYS A CE   4  
ATOM 3554  N NZ   . LYS A 1 42 ? -2.093  -12.912 5.051   1.00 0.00 ? 42 LYS A NZ   4  
ATOM 3555  H H    . LYS A 1 42 ? -2.443  -6.397  6.279   1.00 0.00 ? 42 LYS A H    4  
ATOM 3556  H HA   . LYS A 1 42 ? -3.793  -8.226  5.860   1.00 0.00 ? 42 LYS A HA   4  
ATOM 3557  H HB2  . LYS A 1 42 ? -2.078  -9.877  7.706   1.00 0.00 ? 42 LYS A HB2  4  
ATOM 3558  H HB3  . LYS A 1 42 ? -3.241  -10.447 6.519   1.00 0.00 ? 42 LYS A HB3  4  
ATOM 3559  H HG2  . LYS A 1 42 ? -1.053  -8.814  5.438   1.00 0.00 ? 42 LYS A HG2  4  
ATOM 3560  H HG3  . LYS A 1 42 ? -0.577  -10.370 6.121   1.00 0.00 ? 42 LYS A HG3  4  
ATOM 3561  H HD2  . LYS A 1 42 ? -2.956  -10.583 4.474   1.00 0.00 ? 42 LYS A HD2  4  
ATOM 3562  H HD3  . LYS A 1 42 ? -1.588  -9.920  3.578   1.00 0.00 ? 42 LYS A HD3  4  
ATOM 3563  H HE2  . LYS A 1 42 ? -1.255  -12.170 3.269   1.00 0.00 ? 42 LYS A HE2  4  
ATOM 3564  H HE3  . LYS A 1 42 ? -0.285  -11.888 4.713   1.00 0.00 ? 42 LYS A HE3  4  
ATOM 3565  H HZ1  . LYS A 1 42 ? -1.956  -12.800 6.076   1.00 0.00 ? 42 LYS A HZ1  4  
ATOM 3566  H HZ2  . LYS A 1 42 ? -1.799  -13.871 4.777   1.00 0.00 ? 42 LYS A HZ2  4  
ATOM 3567  H HZ3  . LYS A 1 42 ? -3.103  -12.795 4.832   1.00 0.00 ? 42 LYS A HZ3  4  
ATOM 3568  N N    . GLU A 1 43 ? -4.953  -7.189  7.942   1.00 0.00 ? 43 GLU A N    4  
ATOM 3569  C CA   . GLU A 1 43 ? -5.881  -6.948  9.038   1.00 0.00 ? 43 GLU A CA   4  
ATOM 3570  C C    . GLU A 1 43 ? -6.362  -5.503  9.017   1.00 0.00 ? 43 GLU A C    4  
ATOM 3571  O O    . GLU A 1 43 ? -5.851  -4.660  9.754   1.00 0.00 ? 43 GLU A O    4  
ATOM 3572  C CB   . GLU A 1 43 ? -5.218  -7.258  10.378  1.00 0.00 ? 43 GLU A CB   4  
ATOM 3573  C CG   . GLU A 1 43 ? -5.911  -6.605  11.563  1.00 0.00 ? 43 GLU A CG   4  
ATOM 3574  C CD   . GLU A 1 43 ? -5.596  -7.294  12.876  1.00 0.00 ? 43 GLU A CD   4  
ATOM 3575  O OE1  . GLU A 1 43 ? -5.496  -8.539  12.884  1.00 0.00 ? 43 GLU A OE1  4  
ATOM 3576  O OE2  . GLU A 1 43 ? -5.449  -6.589  13.896  1.00 0.00 ? 43 GLU A OE2  4  
ATOM 3577  H H    . GLU A 1 43 ? -4.958  -6.583  7.172   1.00 0.00 ? 43 GLU A H    4  
ATOM 3578  H HA   . GLU A 1 43 ? -6.731  -7.601  8.904   1.00 0.00 ? 43 GLU A HA   4  
ATOM 3579  H HB2  . GLU A 1 43 ? -5.222  -8.327  10.530  1.00 0.00 ? 43 GLU A HB2  4  
ATOM 3580  H HB3  . GLU A 1 43 ? -4.196  -6.910  10.350  1.00 0.00 ? 43 GLU A HB3  4  
ATOM 3581  H HG2  . GLU A 1 43 ? -5.590  -5.576  11.628  1.00 0.00 ? 43 GLU A HG2  4  
ATOM 3582  H HG3  . GLU A 1 43 ? -6.979  -6.639  11.401  1.00 0.00 ? 43 GLU A HG3  4  
ATOM 3583  N N    . GLY A 1 44 ? -7.340  -5.218  8.167   1.00 0.00 ? 44 GLY A N    4  
ATOM 3584  C CA   . GLY A 1 44 ? -7.855  -3.867  8.075   1.00 0.00 ? 44 GLY A CA   4  
ATOM 3585  C C    . GLY A 1 44 ? -6.753  -2.835  8.125   1.00 0.00 ? 44 GLY A C    4  
ATOM 3586  O O    . GLY A 1 44 ? -6.669  -2.063  9.081   1.00 0.00 ? 44 GLY A O    4  
ATOM 3587  H H    . GLY A 1 44 ? -7.710  -5.925  7.599   1.00 0.00 ? 44 GLY A H    4  
ATOM 3588  H HA2  . GLY A 1 44 ? -8.399  -3.753  7.154   1.00 0.00 ? 44 GLY A HA2  4  
ATOM 3589  H HA3  . GLY A 1 44 ? -8.527  -3.694  8.901   1.00 0.00 ? 44 GLY A HA3  4  
ATOM 3590  N N    . THR A 1 45 ? -5.894  -2.815  7.108   1.00 0.00 ? 45 THR A N    4  
ATOM 3591  C CA   . THR A 1 45 ? -4.800  -1.856  7.089   1.00 0.00 ? 45 THR A CA   4  
ATOM 3592  C C    . THR A 1 45 ? -5.040  -0.771  6.037   1.00 0.00 ? 45 THR A C    4  
ATOM 3593  O O    . THR A 1 45 ? -6.105  -0.154  6.022   1.00 0.00 ? 45 THR A O    4  
ATOM 3594  C CB   . THR A 1 45 ? -3.477  -2.580  6.864   1.00 0.00 ? 45 THR A CB   4  
ATOM 3595  O OG1  . THR A 1 45 ? -3.478  -3.839  7.515   1.00 0.00 ? 45 THR A OG1  4  
ATOM 3596  C CG2  . THR A 1 45 ? -2.284  -1.803  7.369   1.00 0.00 ? 45 THR A CG2  4  
ATOM 3597  H H    . THR A 1 45 ? -5.993  -3.459  6.359   1.00 0.00 ? 45 THR A H    4  
ATOM 3598  H HA   . THR A 1 45 ? -4.772  -1.384  8.061   1.00 0.00 ? 45 THR A HA   4  
ATOM 3599  H HB   . THR A 1 45 ? -3.344  -2.746  5.812   1.00 0.00 ? 45 THR A HB   4  
ATOM 3600  H HG1  . THR A 1 45 ? -4.296  -4.302  7.320   1.00 0.00 ? 45 THR A HG1  4  
ATOM 3601  H HG21 . THR A 1 45 ? -2.215  -1.909  8.441   1.00 0.00 ? 45 THR A HG21 4  
ATOM 3602  H HG22 . THR A 1 45 ? -2.404  -0.760  7.117   1.00 0.00 ? 45 THR A HG22 4  
ATOM 3603  H HG23 . THR A 1 45 ? -1.385  -2.185  6.910   1.00 0.00 ? 45 THR A HG23 4  
ATOM 3604  N N    . ILE A 1 46 ? -4.061  -0.518  5.167   1.00 0.00 ? 46 ILE A N    4  
ATOM 3605  C CA   . ILE A 1 46 ? -4.221  0.512   4.154   1.00 0.00 ? 46 ILE A CA   4  
ATOM 3606  C C    . ILE A 1 46 ? -3.693  0.065   2.784   1.00 0.00 ? 46 ILE A C    4  
ATOM 3607  O O    . ILE A 1 46 ? -2.494  0.146   2.514   1.00 0.00 ? 46 ILE A O    4  
ATOM 3608  C CB   . ILE A 1 46 ? -3.531  1.828   4.610   1.00 0.00 ? 46 ILE A CB   4  
ATOM 3609  C CG1  . ILE A 1 46 ? -4.574  2.793   5.171   1.00 0.00 ? 46 ILE A CG1  4  
ATOM 3610  C CG2  . ILE A 1 46 ? -2.747  2.495   3.484   1.00 0.00 ? 46 ILE A CG2  4  
ATOM 3611  C CD1  . ILE A 1 46 ? -5.509  3.354   4.122   1.00 0.00 ? 46 ILE A CD1  4  
ATOM 3612  H H    . ILE A 1 46 ? -3.223  -1.014  5.213   1.00 0.00 ? 46 ILE A H    4  
ATOM 3613  H HA   . ILE A 1 46 ? -5.276  0.710   4.064   1.00 0.00 ? 46 ILE A HA   4  
ATOM 3614  H HB   . ILE A 1 46 ? -2.833  1.582   5.395   1.00 0.00 ? 46 ILE A HB   4  
ATOM 3615  H HG12 . ILE A 1 46 ? -5.174  2.276   5.903   1.00 0.00 ? 46 ILE A HG12 4  
ATOM 3616  H HG13 . ILE A 1 46 ? -4.070  3.622   5.643   1.00 0.00 ? 46 ILE A HG13 4  
ATOM 3617  H HG21 . ILE A 1 46 ? -1.763  2.055   3.422   1.00 0.00 ? 46 ILE A HG21 4  
ATOM 3618  H HG22 . ILE A 1 46 ? -2.656  3.552   3.686   1.00 0.00 ? 46 ILE A HG22 4  
ATOM 3619  H HG23 . ILE A 1 46 ? -3.266  2.350   2.549   1.00 0.00 ? 46 ILE A HG23 4  
ATOM 3620  H HD11 . ILE A 1 46 ? -5.503  2.711   3.257   1.00 0.00 ? 46 ILE A HD11 4  
ATOM 3621  H HD12 . ILE A 1 46 ? -5.180  4.343   3.839   1.00 0.00 ? 46 ILE A HD12 4  
ATOM 3622  H HD13 . ILE A 1 46 ? -6.510  3.408   4.524   1.00 0.00 ? 46 ILE A HD13 4  
ATOM 3623  N N    . CYS A 1 47 ? -4.600  -0.380  1.914   1.00 0.00 ? 47 CYS A N    4  
ATOM 3624  C CA   . CYS A 1 47 ? -4.222  -0.800  0.569   1.00 0.00 ? 47 CYS A CA   4  
ATOM 3625  C C    . CYS A 1 47 ? -4.332  0.370   -0.407  1.00 0.00 ? 47 CYS A C    4  
ATOM 3626  O O    . CYS A 1 47 ? -4.238  0.183   -1.619  1.00 0.00 ? 47 CYS A O    4  
ATOM 3627  C CB   . CYS A 1 47 ? -5.102  -1.950  0.088   1.00 0.00 ? 47 CYS A CB   4  
ATOM 3628  S SG   . CYS A 1 47 ? -4.763  -2.455  -1.630  1.00 0.00 ? 47 CYS A SG   4  
ATOM 3629  H H    . CYS A 1 47 ? -5.546  -0.409  2.176   1.00 0.00 ? 47 CYS A H    4  
ATOM 3630  H HA   . CYS A 1 47 ? -3.200  -1.135  0.596   1.00 0.00 ? 47 CYS A HA   4  
ATOM 3631  H HB2  . CYS A 1 47 ? -4.941  -2.808  0.723   1.00 0.00 ? 47 CYS A HB2  4  
ATOM 3632  H HB3  . CYS A 1 47 ? -6.139  -1.652  0.147   1.00 0.00 ? 47 CYS A HB3  4  
ATOM 3633  N N    . ARG A 1 48 ? -4.539  1.573   0.140   1.00 0.00 ? 48 ARG A N    4  
ATOM 3634  C CA   . ARG A 1 48 ? -4.679  2.799   -0.659  1.00 0.00 ? 48 ARG A CA   4  
ATOM 3635  C C    . ARG A 1 48 ? -4.336  2.578   -2.127  1.00 0.00 ? 48 ARG A C    4  
ATOM 3636  O O    . ARG A 1 48 ? -3.203  2.239   -2.461  1.00 0.00 ? 48 ARG A O    4  
ATOM 3637  C CB   . ARG A 1 48 ? -3.797  3.909   -0.092  1.00 0.00 ? 48 ARG A CB   4  
ATOM 3638  C CG   . ARG A 1 48 ? -4.056  4.205   1.371   1.00 0.00 ? 48 ARG A CG   4  
ATOM 3639  C CD   . ARG A 1 48 ? -4.645  5.594   1.559   1.00 0.00 ? 48 ARG A CD   4  
ATOM 3640  N NE   . ARG A 1 48 ? -3.706  6.496   2.226   1.00 0.00 ? 48 ARG A NE   4  
ATOM 3641  C CZ   . ARG A 1 48 ? -3.573  7.789   1.932   1.00 0.00 ? 48 ARG A CZ   4  
ATOM 3642  N NH1  . ARG A 1 48 ? -4.319  8.349   0.989   1.00 0.00 ? 48 ARG A NH1  4  
ATOM 3643  N NH2  . ARG A 1 48 ? -2.688  8.527   2.589   1.00 0.00 ? 48 ARG A NH2  4  
ATOM 3644  H H    . ARG A 1 48 ? -4.609  1.638   1.118   1.00 0.00 ? 48 ARG A H    4  
ATOM 3645  H HA   . ARG A 1 48 ? -5.702  3.110   -0.595  1.00 0.00 ? 48 ARG A HA   4  
ATOM 3646  H HB2  . ARG A 1 48 ? -2.770  3.621   -0.201  1.00 0.00 ? 48 ARG A HB2  4  
ATOM 3647  H HB3  . ARG A 1 48 ? -3.964  4.812   -0.652  1.00 0.00 ? 48 ARG A HB3  4  
ATOM 3648  H HG2  . ARG A 1 48 ? -4.745  3.472   1.759   1.00 0.00 ? 48 ARG A HG2  4  
ATOM 3649  H HG3  . ARG A 1 48 ? -3.124  4.145   1.909   1.00 0.00 ? 48 ARG A HG3  4  
ATOM 3650  H HD2  . ARG A 1 48 ? -4.893  5.995   0.589   1.00 0.00 ? 48 ARG A HD2  4  
ATOM 3651  H HD3  . ARG A 1 48 ? -5.541  5.514   2.156   1.00 0.00 ? 48 ARG A HD3  4  
ATOM 3652  H HE   . ARG A 1 48 ? -3.141  6.116   2.930   1.00 0.00 ? 48 ARG A HE   4  
ATOM 3653  H HH11 . ARG A 1 48 ? -4.989  7.804   0.489   1.00 0.00 ? 48 ARG A HH11 4  
ATOM 3654  H HH12 . ARG A 1 48 ? -4.211  9.321   0.779   1.00 0.00 ? 48 ARG A HH12 4  
ATOM 3655  H HH21 . ARG A 1 48 ? -2.123  8.113   3.303   1.00 0.00 ? 48 ARG A HH21 4  
ATOM 3656  H HH22 . ARG A 1 48 ? -2.586  9.497   2.370   1.00 0.00 ? 48 ARG A HH22 4  
ATOM 3657  N N    . ARG A 1 49 ? -5.324  2.762   -2.999  1.00 0.00 ? 49 ARG A N    4  
ATOM 3658  C CA   . ARG A 1 49 ? -5.120  2.571   -4.432  1.00 0.00 ? 49 ARG A CA   4  
ATOM 3659  C C    . ARG A 1 49 ? -5.996  3.515   -5.252  1.00 0.00 ? 49 ARG A C    4  
ATOM 3660  O O    . ARG A 1 49 ? -6.167  3.324   -6.456  1.00 0.00 ? 49 ARG A O    4  
ATOM 3661  C CB   . ARG A 1 49 ? -5.415  1.121   -4.818  1.00 0.00 ? 49 ARG A CB   4  
ATOM 3662  C CG   . ARG A 1 49 ? -4.187  0.351   -5.272  1.00 0.00 ? 49 ARG A CG   4  
ATOM 3663  C CD   . ARG A 1 49 ? -4.568  -0.899  -6.049  1.00 0.00 ? 49 ARG A CD   4  
ATOM 3664  N NE   . ARG A 1 49 ? -4.874  -0.602  -7.445  1.00 0.00 ? 49 ARG A NE   4  
ATOM 3665  C CZ   . ARG A 1 49 ? -5.238  -1.524  -8.330  1.00 0.00 ? 49 ARG A CZ   4  
ATOM 3666  N NH1  . ARG A 1 49 ? -5.341  -2.794  -7.964  1.00 0.00 ? 49 ARG A NH1  4  
ATOM 3667  N NH2  . ARG A 1 49 ? -5.500  -1.176  -9.583  1.00 0.00 ? 49 ARG A NH2  4  
ATOM 3668  H H    . ARG A 1 49 ? -6.212  3.024   -2.670  1.00 0.00 ? 49 ARG A H    4  
ATOM 3669  H HA   . ARG A 1 49 ? -4.084  2.785   -4.647  1.00 0.00 ? 49 ARG A HA   4  
ATOM 3670  H HB2  . ARG A 1 49 ? -5.838  0.612   -3.965  1.00 0.00 ? 49 ARG A HB2  4  
ATOM 3671  H HB3  . ARG A 1 49 ? -6.135  1.115   -5.623  1.00 0.00 ? 49 ARG A HB3  4  
ATOM 3672  H HG2  . ARG A 1 49 ? -3.589  0.988   -5.907  1.00 0.00 ? 49 ARG A HG2  4  
ATOM 3673  H HG3  . ARG A 1 49 ? -3.613  0.064   -4.403  1.00 0.00 ? 49 ARG A HG3  4  
ATOM 3674  H HD2  . ARG A 1 49 ? -3.745  -1.596  -6.011  1.00 0.00 ? 49 ARG A HD2  4  
ATOM 3675  H HD3  . ARG A 1 49 ? -5.437  -1.343  -5.586  1.00 0.00 ? 49 ARG A HD3  4  
ATOM 3676  H HE   . ARG A 1 49 ? -4.804  0.330   -7.737  1.00 0.00 ? 49 ARG A HE   4  
ATOM 3677  H HH11 . ARG A 1 49 ? -5.144  -3.060  -7.020  1.00 0.00 ? 49 ARG A HH11 4  
ATOM 3678  H HH12 . ARG A 1 49 ? -5.616  -3.486  -8.631  1.00 0.00 ? 49 ARG A HH12 4  
ATOM 3679  H HH21 . ARG A 1 49 ? -5.423  -0.219  -9.862  1.00 0.00 ? 49 ARG A HH21 4  
ATOM 3680  H HH22 . ARG A 1 49 ? -5.774  -1.871  -10.248 1.00 0.00 ? 49 ARG A HH22 4  
ATOM 3681  N N    . ALA A 1 50 ? -6.545  4.533   -4.598  1.00 0.00 ? 50 ALA A N    4  
ATOM 3682  C CA   . ALA A 1 50 ? -7.399  5.502   -5.277  1.00 0.00 ? 50 ALA A CA   4  
ATOM 3683  C C    . ALA A 1 50 ? -6.596  6.720   -5.720  1.00 0.00 ? 50 ALA A C    4  
ATOM 3684  O O    . ALA A 1 50 ? -5.439  6.885   -5.333  1.00 0.00 ? 50 ALA A O    4  
ATOM 3685  C CB   . ALA A 1 50 ? -8.544  5.923   -4.369  1.00 0.00 ? 50 ALA A CB   4  
ATOM 3686  H H    . ALA A 1 50 ? -6.372  4.636   -3.639  1.00 0.00 ? 50 ALA A H    4  
ATOM 3687  H HA   . ALA A 1 50 ? -7.819  5.023   -6.149  1.00 0.00 ? 50 ALA A HA   4  
ATOM 3688  H HB1  . ALA A 1 50 ? -9.485  5.716   -4.857  1.00 0.00 ? 50 ALA A HB1  4  
ATOM 3689  H HB2  . ALA A 1 50 ? -8.471  6.981   -4.164  1.00 0.00 ? 50 ALA A HB2  4  
ATOM 3690  H HB3  . ALA A 1 50 ? -8.491  5.372   -3.442  1.00 0.00 ? 50 ALA A HB3  4  
ATOM 3691  N N    . ARG A 1 51 ? -7.213  7.572   -6.534  1.00 0.00 ? 51 ARG A N    4  
ATOM 3692  C CA   . ARG A 1 51 ? -6.547  8.774   -7.024  1.00 0.00 ? 51 ARG A CA   4  
ATOM 3693  C C    . ARG A 1 51 ? -7.440  10.002  -6.857  1.00 0.00 ? 51 ARG A C    4  
ATOM 3694  O O    . ARG A 1 51 ? -7.250  10.783  -5.925  1.00 0.00 ? 51 ARG A O    4  
ATOM 3695  C CB   . ARG A 1 51 ? -6.140  8.605   -8.492  1.00 0.00 ? 51 ARG A CB   4  
ATOM 3696  C CG   . ARG A 1 51 ? -6.119  7.158   -8.960  1.00 0.00 ? 51 ARG A CG   4  
ATOM 3697  C CD   . ARG A 1 51 ? -4.887  6.864   -9.800  1.00 0.00 ? 51 ARG A CD   4  
ATOM 3698  N NE   . ARG A 1 51 ? -3.696  6.678   -8.975  1.00 0.00 ? 51 ARG A NE   4  
ATOM 3699  C CZ   . ARG A 1 51 ? -2.455  6.750   -9.446  1.00 0.00 ? 51 ARG A CZ   4  
ATOM 3700  N NH1  . ARG A 1 51 ? -2.244  7.002   -10.730 1.00 0.00 ? 51 ARG A NH1  4  
ATOM 3701  N NH2  . ARG A 1 51 ? -1.424  6.570   -8.631  1.00 0.00 ? 51 ARG A NH2  4  
ATOM 3702  H H    . ARG A 1 51 ? -8.136  7.390   -6.809  1.00 0.00 ? 51 ARG A H    4  
ATOM 3703  H HA   . ARG A 1 51 ? -5.655  8.916   -6.431  1.00 0.00 ? 51 ARG A HA   4  
ATOM 3704  H HB2  . ARG A 1 51 ? -6.832  9.152   -9.113  1.00 0.00 ? 51 ARG A HB2  4  
ATOM 3705  H HB3  . ARG A 1 51 ? -5.151  9.017   -8.627  1.00 0.00 ? 51 ARG A HB3  4  
ATOM 3706  H HG2  . ARG A 1 51 ? -6.116  6.510   -8.097  1.00 0.00 ? 51 ARG A HG2  4  
ATOM 3707  H HG3  . ARG A 1 51 ? -7.002  6.969   -9.553  1.00 0.00 ? 51 ARG A HG3  4  
ATOM 3708  H HD2  . ARG A 1 51 ? -5.062  5.963   -10.370 1.00 0.00 ? 51 ARG A HD2  4  
ATOM 3709  H HD3  . ARG A 1 51 ? -4.721  7.690   -10.475 1.00 0.00 ? 51 ARG A HD3  4  
ATOM 3710  H HE   . ARG A 1 51 ? -3.828  6.491   -8.022  1.00 0.00 ? 51 ARG A HE   4  
ATOM 3711  H HH11 . ARG A 1 51 ? -3.019  7.139   -11.347 1.00 0.00 ? 51 ARG A HH11 4  
ATOM 3712  H HH12 . ARG A 1 51 ? -1.309  7.056   -11.082 1.00 0.00 ? 51 ARG A HH12 4  
ATOM 3713  H HH21 . ARG A 1 51 ? -1.580  6.380   -7.662  1.00 0.00 ? 51 ARG A HH21 4  
ATOM 3714  H HH22 . ARG A 1 51 ? -0.491  6.624   -8.986  1.00 0.00 ? 51 ARG A HH22 4  
ATOM 3715  N N    . GLY A 1 52 ? -8.412  10.159  -7.762  1.00 0.00 ? 52 GLY A N    4  
ATOM 3716  C CA   . GLY A 1 52 ? -9.330  11.291  -7.706  1.00 0.00 ? 52 GLY A CA   4  
ATOM 3717  C C    . GLY A 1 52 ? -8.759  12.481  -6.959  1.00 0.00 ? 52 GLY A C    4  
ATOM 3718  O O    . GLY A 1 52 ? -7.790  13.097  -7.403  1.00 0.00 ? 52 GLY A O    4  
ATOM 3719  H H    . GLY A 1 52 ? -8.510  9.495   -8.475  1.00 0.00 ? 52 GLY A H    4  
ATOM 3720  H HA2  . GLY A 1 52 ? -9.567  11.596  -8.715  1.00 0.00 ? 52 GLY A HA2  4  
ATOM 3721  H HA3  . GLY A 1 52 ? -10.239 10.976  -7.216  1.00 0.00 ? 52 GLY A HA3  4  
ATOM 3722  N N    . ASP A 1 53 ? -9.355  12.795  -5.814  1.00 0.00 ? 53 ASP A N    4  
ATOM 3723  C CA   . ASP A 1 53 ? -8.895  13.906  -4.990  1.00 0.00 ? 53 ASP A CA   4  
ATOM 3724  C C    . ASP A 1 53 ? -8.042  13.387  -3.837  1.00 0.00 ? 53 ASP A C    4  
ATOM 3725  O O    . ASP A 1 53 ? -7.291  14.139  -3.216  1.00 0.00 ? 53 ASP A O    4  
ATOM 3726  C CB   . ASP A 1 53 ? -10.086 14.698  -4.447  1.00 0.00 ? 53 ASP A CB   4  
ATOM 3727  C CG   . ASP A 1 53 ? -9.683  16.067  -3.936  1.00 0.00 ? 53 ASP A CG   4  
ATOM 3728  O OD1  . ASP A 1 53 ? -9.385  16.948  -4.770  1.00 0.00 ? 53 ASP A OD1  4  
ATOM 3729  O OD2  . ASP A 1 53 ? -9.666  16.259  -2.702  1.00 0.00 ? 53 ASP A OD2  4  
ATOM 3730  H H    . ASP A 1 53 ? -10.116 12.258  -5.509  1.00 0.00 ? 53 ASP A H    4  
ATOM 3731  H HA   . ASP A 1 53 ? -8.291  14.553  -5.609  1.00 0.00 ? 53 ASP A HA   4  
ATOM 3732  H HB2  . ASP A 1 53 ? -10.813 14.828  -5.234  1.00 0.00 ? 53 ASP A HB2  4  
ATOM 3733  H HB3  . ASP A 1 53 ? -10.535 14.148  -3.634  1.00 0.00 ? 53 ASP A HB3  4  
ATOM 3734  N N    . ASP A 1 54 ? -8.166  12.092  -3.565  1.00 0.00 ? 54 ASP A N    4  
ATOM 3735  C CA   . ASP A 1 54 ? -7.412  11.451  -2.495  1.00 0.00 ? 54 ASP A CA   4  
ATOM 3736  C C    . ASP A 1 54 ? -7.206  9.971   -2.803  1.00 0.00 ? 54 ASP A C    4  
ATOM 3737  O O    . ASP A 1 54 ? -7.320  9.548   -3.953  1.00 0.00 ? 54 ASP A O    4  
ATOM 3738  C CB   . ASP A 1 54 ? -8.138  11.614  -1.159  1.00 0.00 ? 54 ASP A CB   4  
ATOM 3739  C CG   . ASP A 1 54 ? -8.485  13.060  -0.861  1.00 0.00 ? 54 ASP A CG   4  
ATOM 3740  O OD1  . ASP A 1 54 ? -7.603  13.791  -0.363  1.00 0.00 ? 54 ASP A OD1  4  
ATOM 3741  O OD2  . ASP A 1 54 ? -9.638  13.460  -1.126  1.00 0.00 ? 54 ASP A OD2  4  
ATOM 3742  H H    . ASP A 1 54 ? -8.781  11.549  -4.102  1.00 0.00 ? 54 ASP A H    4  
ATOM 3743  H HA   . ASP A 1 54 ? -6.447  11.932  -2.434  1.00 0.00 ? 54 ASP A HA   4  
ATOM 3744  H HB2  . ASP A 1 54 ? -9.054  11.042  -1.181  1.00 0.00 ? 54 ASP A HB2  4  
ATOM 3745  H HB3  . ASP A 1 54 ? -7.507  11.243  -0.365  1.00 0.00 ? 54 ASP A HB3  4  
ATOM 3746  N N    . LEU A 1 55 ? -6.905  9.187   -1.775  1.00 0.00 ? 55 LEU A N    4  
ATOM 3747  C CA   . LEU A 1 55 ? -6.687  7.755   -1.951  1.00 0.00 ? 55 LEU A CA   4  
ATOM 3748  C C    . LEU A 1 55 ? -6.967  6.997   -0.658  1.00 0.00 ? 55 LEU A C    4  
ATOM 3749  O O    . LEU A 1 55 ? -6.481  7.372   0.408   1.00 0.00 ? 55 LEU A O    4  
ATOM 3750  C CB   . LEU A 1 55 ? -5.250  7.489   -2.405  1.00 0.00 ? 55 LEU A CB   4  
ATOM 3751  C CG   . LEU A 1 55 ? -4.696  8.485   -3.426  1.00 0.00 ? 55 LEU A CG   4  
ATOM 3752  C CD1  . LEU A 1 55 ? -4.400  9.821   -2.762  1.00 0.00 ? 55 LEU A CD1  4  
ATOM 3753  C CD2  . LEU A 1 55 ? -3.445  7.927   -4.087  1.00 0.00 ? 55 LEU A CD2  4  
ATOM 3754  H H    . LEU A 1 55 ? -6.828  9.577   -0.879  1.00 0.00 ? 55 LEU A H    4  
ATOM 3755  H HA   . LEU A 1 55 ? -7.367  7.407   -2.714  1.00 0.00 ? 55 LEU A HA   4  
ATOM 3756  H HB2  . LEU A 1 55 ? -4.611  7.505   -1.534  1.00 0.00 ? 55 LEU A HB2  4  
ATOM 3757  H HB3  . LEU A 1 55 ? -5.210  6.503   -2.842  1.00 0.00 ? 55 LEU A HB3  4  
ATOM 3758  H HG   . LEU A 1 55 ? -5.436  8.652   -4.195  1.00 0.00 ? 55 LEU A HG   4  
ATOM 3759  H HD11 . LEU A 1 55 ? -4.903  10.610  -3.301  1.00 0.00 ? 55 LEU A HD11 4  
ATOM 3760  H HD12 . LEU A 1 55 ? -3.335  10.000  -2.774  1.00 0.00 ? 55 LEU A HD12 4  
ATOM 3761  H HD13 . LEU A 1 55 ? -4.751  9.802   -1.741  1.00 0.00 ? 55 LEU A HD13 4  
ATOM 3762  H HD21 . LEU A 1 55 ? -2.574  8.235   -3.527  1.00 0.00 ? 55 LEU A HD21 4  
ATOM 3763  H HD22 . LEU A 1 55 ? -3.374  8.302   -5.097  1.00 0.00 ? 55 LEU A HD22 4  
ATOM 3764  H HD23 . LEU A 1 55 ? -3.498  6.849   -4.105  1.00 0.00 ? 55 LEU A HD23 4  
ATOM 3765  N N    . ASP A 1 56 ? -7.748  5.926   -0.758  1.00 0.00 ? 56 ASP A N    4  
ATOM 3766  C CA   . ASP A 1 56 ? -8.079  5.122   0.407   1.00 0.00 ? 56 ASP A CA   4  
ATOM 3767  C C    . ASP A 1 56 ? -8.200  3.649   0.033   1.00 0.00 ? 56 ASP A C    4  
ATOM 3768  O O    . ASP A 1 56 ? -8.321  3.302   -1.143  1.00 0.00 ? 56 ASP A O    4  
ATOM 3769  C CB   . ASP A 1 56 ? -9.378  5.613   1.046   1.00 0.00 ? 56 ASP A CB   4  
ATOM 3770  C CG   . ASP A 1 56 ? -9.166  6.835   1.918   1.00 0.00 ? 56 ASP A CG   4  
ATOM 3771  O OD1  . ASP A 1 56 ? -8.047  6.998   2.450   1.00 0.00 ? 56 ASP A OD1  4  
ATOM 3772  O OD2  . ASP A 1 56 ? -10.118 7.629   2.069   1.00 0.00 ? 56 ASP A OD2  4  
ATOM 3773  H H    . ASP A 1 56 ? -8.108  5.670   -1.633  1.00 0.00 ? 56 ASP A H    4  
ATOM 3774  H HA   . ASP A 1 56 ? -7.276  5.231   1.121   1.00 0.00 ? 56 ASP A HA   4  
ATOM 3775  H HB2  . ASP A 1 56 ? -10.080 5.868   0.268   1.00 0.00 ? 56 ASP A HB2  4  
ATOM 3776  H HB3  . ASP A 1 56 ? -9.792  4.825   1.657   1.00 0.00 ? 56 ASP A HB3  4  
ATOM 3777  N N    . ASP A 1 57 ? -8.159  2.792   1.043   1.00 0.00 ? 57 ASP A N    4  
ATOM 3778  C CA   . ASP A 1 57 ? -8.256  1.352   0.844   1.00 0.00 ? 57 ASP A CA   4  
ATOM 3779  C C    . ASP A 1 57 ? -7.621  0.623   2.019   1.00 0.00 ? 57 ASP A C    4  
ATOM 3780  O O    . ASP A 1 57 ? -6.674  1.121   2.618   1.00 0.00 ? 57 ASP A O    4  
ATOM 3781  C CB   . ASP A 1 57 ? -7.572  0.940   -0.461  1.00 0.00 ? 57 ASP A CB   4  
ATOM 3782  C CG   . ASP A 1 57 ? -8.567  0.606   -1.554  1.00 0.00 ? 57 ASP A CG   4  
ATOM 3783  O OD1  . ASP A 1 57 ? -9.261  -0.425  -1.431  1.00 0.00 ? 57 ASP A OD1  4  
ATOM 3784  O OD2  . ASP A 1 57 ? -8.653  1.376   -2.534  1.00 0.00 ? 57 ASP A OD2  4  
ATOM 3785  H H    . ASP A 1 57 ? -8.056  3.138   1.954   1.00 0.00 ? 57 ASP A H    4  
ATOM 3786  H HA   . ASP A 1 57 ? -9.301  1.094   0.792   1.00 0.00 ? 57 ASP A HA   4  
ATOM 3787  H HB2  . ASP A 1 57 ? -6.947  1.749   -0.805  1.00 0.00 ? 57 ASP A HB2  4  
ATOM 3788  H HB3  . ASP A 1 57 ? -6.959  0.069   -0.279  1.00 0.00 ? 57 ASP A HB3  4  
ATOM 3789  N N    . TYR A 1 58 ? -8.142  -0.551  2.351   1.00 0.00 ? 58 TYR A N    4  
ATOM 3790  C CA   . TYR A 1 58 ? -7.607  -1.326  3.465   1.00 0.00 ? 58 TYR A CA   4  
ATOM 3791  C C    . TYR A 1 58 ? -6.695  -2.443  2.972   1.00 0.00 ? 58 TYR A C    4  
ATOM 3792  O O    . TYR A 1 58 ? -6.771  -2.853  1.814   1.00 0.00 ? 58 TYR A O    4  
ATOM 3793  C CB   . TYR A 1 58 ? -8.744  -1.878  4.323   1.00 0.00 ? 58 TYR A CB   4  
ATOM 3794  C CG   . TYR A 1 58 ? -9.292  -0.851  5.286   1.00 0.00 ? 58 TYR A CG   4  
ATOM 3795  C CD1  . TYR A 1 58 ? -9.143  0.507   5.030   1.00 0.00 ? 58 TYR A CD1  4  
ATOM 3796  C CD2  . TYR A 1 58 ? -9.944  -1.231  6.452   1.00 0.00 ? 58 TYR A CD2  4  
ATOM 3797  C CE1  . TYR A 1 58 ? -9.630  1.457   5.906   1.00 0.00 ? 58 TYR A CE1  4  
ATOM 3798  C CE2  . TYR A 1 58 ? -10.435 -0.286  7.333   1.00 0.00 ? 58 TYR A CE2  4  
ATOM 3799  C CZ   . TYR A 1 58 ? -10.275 1.056   7.056   1.00 0.00 ? 58 TYR A CZ   4  
ATOM 3800  O OH   . TYR A 1 58 ? -10.762 1.999   7.933   1.00 0.00 ? 58 TYR A OH   4  
ATOM 3801  H H    . TYR A 1 58 ? -8.900  -0.902  1.840   1.00 0.00 ? 58 TYR A H    4  
ATOM 3802  H HA   . TYR A 1 58 ? -7.018  -0.652  4.070   1.00 0.00 ? 58 TYR A HA   4  
ATOM 3803  H HB2  . TYR A 1 58 ? -9.552  -2.199  3.680   1.00 0.00 ? 58 TYR A HB2  4  
ATOM 3804  H HB3  . TYR A 1 58 ? -8.385  -2.719  4.896   1.00 0.00 ? 58 TYR A HB3  4  
ATOM 3805  H HD1  . TYR A 1 58 ? -8.638  0.818   4.128   1.00 0.00 ? 58 TYR A HD1  4  
ATOM 3806  H HD2  . TYR A 1 58 ? -10.067 -2.282  6.666   1.00 0.00 ? 58 TYR A HD2  4  
ATOM 3807  H HE1  . TYR A 1 58 ? -9.502  2.508   5.687   1.00 0.00 ? 58 TYR A HE1  4  
ATOM 3808  H HE2  . TYR A 1 58 ? -10.939 -0.600  8.234   1.00 0.00 ? 58 TYR A HE2  4  
ATOM 3809  H HH   . TYR A 1 58 ? -10.207 2.025   8.716   1.00 0.00 ? 58 TYR A HH   4  
ATOM 3810  N N    . CYS A 1 59 ? -5.809  -2.911  3.849   1.00 0.00 ? 59 CYS A N    4  
ATOM 3811  C CA   . CYS A 1 59 ? -4.858  -3.953  3.485   1.00 0.00 ? 59 CYS A CA   4  
ATOM 3812  C C    . CYS A 1 59 ? -5.028  -5.217  4.340   1.00 0.00 ? 59 CYS A C    4  
ATOM 3813  O O    . CYS A 1 59 ? -4.490  -5.324  5.442   1.00 0.00 ? 59 CYS A O    4  
ATOM 3814  C CB   . CYS A 1 59 ? -3.426  -3.377  3.555   1.00 0.00 ? 59 CYS A CB   4  
ATOM 3815  S SG   . CYS A 1 59 ? -2.179  -4.411  4.397   1.00 0.00 ? 59 CYS A SG   4  
ATOM 3816  H H    . CYS A 1 59 ? -5.781  -2.533  4.749   1.00 0.00 ? 59 CYS A H    4  
ATOM 3817  H HA   . CYS A 1 59 ? -5.063  -4.218  2.464   1.00 0.00 ? 59 CYS A HA   4  
ATOM 3818  H HB2  . CYS A 1 59 ? -3.074  -3.218  2.547   1.00 0.00 ? 59 CYS A HB2  4  
ATOM 3819  H HB3  . CYS A 1 59 ? -3.461  -2.425  4.058   1.00 0.00 ? 59 CYS A HB3  4  
ATOM 3820  N N    . ASN A 1 60 ? -5.808  -6.169  3.811   1.00 0.00 ? 60 ASN A N    4  
ATOM 3821  C CA   . ASN A 1 60 ? -6.087  -7.436  4.492   1.00 0.00 ? 60 ASN A CA   4  
ATOM 3822  C C    . ASN A 1 60 ? -5.393  -8.594  3.767   1.00 0.00 ? 60 ASN A C    4  
ATOM 3823  O O    . ASN A 1 60 ? -4.217  -8.866  4.000   1.00 0.00 ? 60 ASN A O    4  
ATOM 3824  C CB   . ASN A 1 60 ? -7.603  -7.652  4.573   1.00 0.00 ? 60 ASN A CB   4  
ATOM 3825  C CG   . ASN A 1 60 ? -8.332  -6.352  4.831   1.00 0.00 ? 60 ASN A CG   4  
ATOM 3826  O OD1  . ASN A 1 60 ? -9.494  -6.193  4.458   1.00 0.00 ? 60 ASN A OD1  4  
ATOM 3827  N ND2  . ASN A 1 60 ? -7.649  -5.413  5.472   1.00 0.00 ? 60 ASN A ND2  4  
ATOM 3828  H H    . ASN A 1 60 ? -6.215  -6.007  2.943   1.00 0.00 ? 60 ASN A H    4  
ATOM 3829  H HA   . ASN A 1 60 ? -5.692  -7.367  5.479   1.00 0.00 ? 60 ASN A HA   4  
ATOM 3830  H HB2  . ASN A 1 60 ? -7.966  -8.061  3.648   1.00 0.00 ? 60 ASN A HB2  4  
ATOM 3831  H HB3  . ASN A 1 60 ? -7.824  -8.334  5.380   1.00 0.00 ? 60 ASN A HB3  4  
ATOM 3832  H HD21 . ASN A 1 60 ? -6.734  -5.615  5.753   1.00 0.00 ? 60 ASN A HD21 4  
ATOM 3833  H HD22 . ASN A 1 60 ? -8.076  -4.549  5.609   1.00 0.00 ? 60 ASN A HD22 4  
ATOM 3834  N N    . GLY A 1 61 ? -6.093  -9.234  2.845   1.00 0.00 ? 61 GLY A N    4  
ATOM 3835  C CA   . GLY A 1 61 ? -5.482  -10.299 2.070   1.00 0.00 ? 61 GLY A CA   4  
ATOM 3836  C C    . GLY A 1 61 ? -4.687  -9.722  0.910   1.00 0.00 ? 61 GLY A C    4  
ATOM 3837  O O    . GLY A 1 61 ? -4.239  -10.443 0.018   1.00 0.00 ? 61 GLY A O    4  
ATOM 3838  H H    . GLY A 1 61 ? -7.003  -8.956  2.657   1.00 0.00 ? 61 GLY A H    4  
ATOM 3839  H HA2  . GLY A 1 61 ? -4.823  -10.870 2.708   1.00 0.00 ? 61 GLY A HA2  4  
ATOM 3840  H HA3  . GLY A 1 61 ? -6.254  -10.946 1.682   1.00 0.00 ? 61 GLY A HA3  4  
ATOM 3841  N N    . ILE A 1 62 ? -4.538  -8.399  0.939   1.00 0.00 ? 62 ILE A N    4  
ATOM 3842  C CA   . ILE A 1 62 ? -3.828  -7.642  -0.077  1.00 0.00 ? 62 ILE A CA   4  
ATOM 3843  C C    . ILE A 1 62 ? -2.366  -8.045  -0.236  1.00 0.00 ? 62 ILE A C    4  
ATOM 3844  O O    . ILE A 1 62 ? -1.489  -7.555  0.476   1.00 0.00 ? 62 ILE A O    4  
ATOM 3845  C CB   . ILE A 1 62 ? -3.869  -6.144  0.265   1.00 0.00 ? 62 ILE A CB   4  
ATOM 3846  C CG1  . ILE A 1 62 ? -3.030  -5.845  1.511   1.00 0.00 ? 62 ILE A CG1  4  
ATOM 3847  C CG2  . ILE A 1 62 ? -5.301  -5.689  0.489   1.00 0.00 ? 62 ILE A CG2  4  
ATOM 3848  C CD1  . ILE A 1 62 ? -2.954  -6.977  2.518   1.00 0.00 ? 62 ILE A CD1  4  
ATOM 3849  H H    . ILE A 1 62 ? -4.935  -7.901  1.675   1.00 0.00 ? 62 ILE A H    4  
ATOM 3850  H HA   . ILE A 1 62 ? -4.336  -7.785  -1.017  1.00 0.00 ? 62 ILE A HA   4  
ATOM 3851  H HB   . ILE A 1 62 ? -3.467  -5.593  -0.572  1.00 0.00 ? 62 ILE A HB   4  
ATOM 3852  H HG12 . ILE A 1 62 ? -2.027  -5.608  1.216   1.00 0.00 ? 62 ILE A HG12 4  
ATOM 3853  H HG13 . ILE A 1 62 ? -3.456  -4.998  2.010   1.00 0.00 ? 62 ILE A HG13 4  
ATOM 3854  H HG21 . ILE A 1 62 ? -5.725  -6.244  1.308   1.00 0.00 ? 62 ILE A HG21 4  
ATOM 3855  H HG22 . ILE A 1 62 ? -5.885  -5.864  -0.398  1.00 0.00 ? 62 ILE A HG22 4  
ATOM 3856  H HG23 . ILE A 1 62 ? -5.313  -4.636  0.726   1.00 0.00 ? 62 ILE A HG23 4  
ATOM 3857  H HD11 . ILE A 1 62 ? -3.884  -7.035  3.052   1.00 0.00 ? 62 ILE A HD11 4  
ATOM 3858  H HD12 . ILE A 1 62 ? -2.153  -6.785  3.213   1.00 0.00 ? 62 ILE A HD12 4  
ATOM 3859  H HD13 . ILE A 1 62 ? -2.769  -7.912  2.016   1.00 0.00 ? 62 ILE A HD13 4  
ATOM 3860  N N    . SER A 1 63 ? -2.090  -8.890  -1.204  1.00 0.00 ? 63 SER A N    4  
ATOM 3861  C CA   . SER A 1 63 ? -0.721  -9.283  -1.465  1.00 0.00 ? 63 SER A CA   4  
ATOM 3862  C C    . SER A 1 63 ? -0.186  -8.433  -2.604  1.00 0.00 ? 63 SER A C    4  
ATOM 3863  O O    . SER A 1 63 ? 0.455   -8.923  -3.533  1.00 0.00 ? 63 SER A O    4  
ATOM 3864  C CB   . SER A 1 63 ? -0.645  -10.760 -1.793  1.00 0.00 ? 63 SER A CB   4  
ATOM 3865  O OG   . SER A 1 63 ? -0.996  -11.011 -3.143  1.00 0.00 ? 63 SER A OG   4  
ATOM 3866  H H    . SER A 1 63 ? -2.810  -9.224  -1.778  1.00 0.00 ? 63 SER A H    4  
ATOM 3867  H HA   . SER A 1 63 ? -0.142  -9.082  -0.576  1.00 0.00 ? 63 SER A HA   4  
ATOM 3868  H HB2  . SER A 1 63 ? 0.360   -11.104 -1.619  1.00 0.00 ? 63 SER A HB2  4  
ATOM 3869  H HB3  . SER A 1 63 ? -1.328  -11.292 -1.148  1.00 0.00 ? 63 SER A HB3  4  
ATOM 3870  H HG   . SER A 1 63 ? -1.885  -11.373 -3.181  1.00 0.00 ? 63 SER A HG   4  
ATOM 3871  N N    . ALA A 1 64 ? -0.504  -7.145  -2.501  1.00 0.00 ? 64 ALA A N    4  
ATOM 3872  C CA   . ALA A 1 64 ? -0.137  -6.131  -3.476  1.00 0.00 ? 64 ALA A CA   4  
ATOM 3873  C C    . ALA A 1 64 ? -1.384  -5.663  -4.230  1.00 0.00 ? 64 ALA A C    4  
ATOM 3874  O O    . ALA A 1 64 ? -1.295  -5.023  -5.278  1.00 0.00 ? 64 ALA A O    4  
ATOM 3875  C CB   . ALA A 1 64 ? 0.938   -6.618  -4.435  1.00 0.00 ? 64 ALA A CB   4  
ATOM 3876  H H    . ALA A 1 64 ? -1.036  -6.864  -1.729  1.00 0.00 ? 64 ALA A H    4  
ATOM 3877  H HA   . ALA A 1 64 ? 0.265   -5.299  -2.920  1.00 0.00 ? 64 ALA A HA   4  
ATOM 3878  H HB1  . ALA A 1 64 ? 1.796   -6.954  -3.871  1.00 0.00 ? 64 ALA A HB1  4  
ATOM 3879  H HB2  . ALA A 1 64 ? 1.233   -5.806  -5.085  1.00 0.00 ? 64 ALA A HB2  4  
ATOM 3880  H HB3  . ALA A 1 64 ? 0.553   -7.432  -5.026  1.00 0.00 ? 64 ALA A HB3  4  
ATOM 3881  N N    . GLY A 1 65 ? -2.549  -5.990  -3.662  1.00 0.00 ? 65 GLY A N    4  
ATOM 3882  C CA   . GLY A 1 65 ? -3.829  -5.610  -4.241  1.00 0.00 ? 65 GLY A CA   4  
ATOM 3883  C C    . GLY A 1 65 ? -4.885  -5.452  -3.161  1.00 0.00 ? 65 GLY A C    4  
ATOM 3884  O O    . GLY A 1 65 ? -4.791  -6.088  -2.118  1.00 0.00 ? 65 GLY A O    4  
ATOM 3885  H H    . GLY A 1 65 ? -2.539  -6.492  -2.822  1.00 0.00 ? 65 GLY A H    4  
ATOM 3886  H HA2  . GLY A 1 65 ? -3.716  -4.674  -4.769  1.00 0.00 ? 65 GLY A HA2  4  
ATOM 3887  H HA3  . GLY A 1 65 ? -4.146  -6.374  -4.935  1.00 0.00 ? 65 GLY A HA3  4  
ATOM 3888  N N    . CYS A 1 66 ? -5.876  -4.592  -3.386  1.00 0.00 ? 66 CYS A N    4  
ATOM 3889  C CA   . CYS A 1 66 ? -6.919  -4.353  -2.383  1.00 0.00 ? 66 CYS A CA   4  
ATOM 3890  C C    . CYS A 1 66 ? -8.023  -5.404  -2.412  1.00 0.00 ? 66 CYS A C    4  
ATOM 3891  O O    . CYS A 1 66 ? -8.342  -5.960  -3.462  1.00 0.00 ? 66 CYS A O    4  
ATOM 3892  C CB   . CYS A 1 66 ? -7.531  -2.966  -2.580  1.00 0.00 ? 66 CYS A CB   4  
ATOM 3893  S SG   . CYS A 1 66 ? -6.294  -1.647  -2.673  1.00 0.00 ? 66 CYS A SG   4  
ATOM 3894  H H    . CYS A 1 66 ? -5.896  -4.093  -4.229  1.00 0.00 ? 66 CYS A H    4  
ATOM 3895  H HA   . CYS A 1 66 ? -6.447  -4.383  -1.412  1.00 0.00 ? 66 CYS A HA   4  
ATOM 3896  H HB2  . CYS A 1 66 ? -8.098  -2.951  -3.495  1.00 0.00 ? 66 CYS A HB2  4  
ATOM 3897  H HB3  . CYS A 1 66 ? -8.182  -2.745  -1.747  1.00 0.00 ? 66 CYS A HB3  4  
ATOM 3898  N N    . PRO A 1 67 ? -8.623  -5.673  -1.235  1.00 0.00 ? 67 PRO A N    4  
ATOM 3899  C CA   . PRO A 1 67 ? -9.715  -6.642  -1.072  1.00 0.00 ? 67 PRO A CA   4  
ATOM 3900  C C    . PRO A 1 67 ? -10.822 -6.469  -2.111  1.00 0.00 ? 67 PRO A C    4  
ATOM 3901  O O    . PRO A 1 67 ? -10.610 -5.893  -3.177  1.00 0.00 ? 67 PRO A O    4  
ATOM 3902  C CB   . PRO A 1 67 ? -10.264 -6.329  0.335   1.00 0.00 ? 67 PRO A CB   4  
ATOM 3903  C CG   . PRO A 1 67 ? -9.607  -5.048  0.744   1.00 0.00 ? 67 PRO A CG   4  
ATOM 3904  C CD   . PRO A 1 67 ? -8.286  -5.049  0.051   1.00 0.00 ? 67 PRO A CD   4  
ATOM 3905  H HA   . PRO A 1 67 ? -9.351  -7.658  -1.100  1.00 0.00 ? 67 PRO A HA   4  
ATOM 3906  H HB2  . PRO A 1 67 ? -11.338 -6.222  0.288   1.00 0.00 ? 67 PRO A HB2  4  
ATOM 3907  H HB3  . PRO A 1 67 ? -10.009 -7.133  1.009   1.00 0.00 ? 67 PRO A HB3  4  
ATOM 3908  H HG2  . PRO A 1 67 ? -10.199 -4.204  0.420   1.00 0.00 ? 67 PRO A HG2  4  
ATOM 3909  H HG3  . PRO A 1 67 ? -9.469  -5.024  1.815   1.00 0.00 ? 67 PRO A HG3  4  
ATOM 3910  H HD2  . PRO A 1 67 ? -7.918  -4.043  -0.077  1.00 0.00 ? 67 PRO A HD2  4  
ATOM 3911  H HD3  . PRO A 1 67 ? -7.580  -5.652  0.601   1.00 0.00 ? 67 PRO A HD3  4  
ATOM 3912  N N    . ARG A 1 68 ? -12.010 -6.972  -1.789  1.00 0.00 ? 68 ARG A N    4  
ATOM 3913  C CA   . ARG A 1 68 ? -13.151 -6.874  -2.691  1.00 0.00 ? 68 ARG A CA   4  
ATOM 3914  C C    . ARG A 1 68 ? -14.278 -6.063  -2.060  1.00 0.00 ? 68 ARG A C    4  
ATOM 3915  O O    . ARG A 1 68 ? -15.435 -6.484  -2.062  1.00 0.00 ? 68 ARG A O    4  
ATOM 3916  C CB   . ARG A 1 68 ? -13.657 -8.269  -3.059  1.00 0.00 ? 68 ARG A CB   4  
ATOM 3917  C CG   . ARG A 1 68 ? -12.557 -9.217  -3.507  1.00 0.00 ? 68 ARG A CG   4  
ATOM 3918  C CD   . ARG A 1 68 ? -13.009 -10.085 -4.670  1.00 0.00 ? 68 ARG A CD   4  
ATOM 3919  N NE   . ARG A 1 68 ? -14.350 -10.623 -4.462  1.00 0.00 ? 68 ARG A NE   4  
ATOM 3920  C CZ   . ARG A 1 68 ? -14.604 -11.702 -3.730  1.00 0.00 ? 68 ARG A CZ   4  
ATOM 3921  N NH1  . ARG A 1 68 ? -13.612 -12.354 -3.139  1.00 0.00 ? 68 ARG A NH1  4  
ATOM 3922  N NH2  . ARG A 1 68 ? -15.851 -12.130 -3.587  1.00 0.00 ? 68 ARG A NH2  4  
ATOM 3923  H H    . ARG A 1 68 ? -12.122 -7.417  -0.923  1.00 0.00 ? 68 ARG A H    4  
ATOM 3924  H HA   . ARG A 1 68 ? -12.822 -6.372  -3.588  1.00 0.00 ? 68 ARG A HA   4  
ATOM 3925  H HB2  . ARG A 1 68 ? -14.147 -8.701  -2.199  1.00 0.00 ? 68 ARG A HB2  4  
ATOM 3926  H HB3  . ARG A 1 68 ? -14.374 -8.179  -3.862  1.00 0.00 ? 68 ARG A HB3  4  
ATOM 3927  H HG2  . ARG A 1 68 ? -11.699 -8.637  -3.816  1.00 0.00 ? 68 ARG A HG2  4  
ATOM 3928  H HG3  . ARG A 1 68 ? -12.284 -9.854  -2.678  1.00 0.00 ? 68 ARG A HG3  4  
ATOM 3929  H HD2  . ARG A 1 68 ? -13.006 -9.488  -5.570  1.00 0.00 ? 68 ARG A HD2  4  
ATOM 3930  H HD3  . ARG A 1 68 ? -12.315 -10.905 -4.781  1.00 0.00 ? 68 ARG A HD3  4  
ATOM 3931  H HE   . ARG A 1 68 ? -15.098 -10.156 -4.890  1.00 0.00 ? 68 ARG A HE   4  
ATOM 3932  H HH11 . ARG A 1 68 ? -12.671 -12.034 -3.245  1.00 0.00 ? 68 ARG A HH11 4  
ATOM 3933  H HH12 . ARG A 1 68 ? -13.805 -13.166 -2.589  1.00 0.00 ? 68 ARG A HH12 4  
ATOM 3934  H HH21 . ARG A 1 68 ? -16.602 -11.641 -4.031  1.00 0.00 ? 68 ARG A HH21 4  
ATOM 3935  H HH22 . ARG A 1 68 ? -16.041 -12.943 -3.036  1.00 0.00 ? 68 ARG A HH22 4  
ATOM 3936  N N    . ASN A 1 69 ? -13.932 -4.899  -1.522  1.00 0.00 ? 69 ASN A N    4  
ATOM 3937  C CA   . ASN A 1 69 ? -14.916 -4.029  -0.888  1.00 0.00 ? 69 ASN A CA   4  
ATOM 3938  C C    . ASN A 1 69 ? -14.431 -2.584  -0.872  1.00 0.00 ? 69 ASN A C    4  
ATOM 3939  O O    . ASN A 1 69 ? -13.522 -2.232  -0.122  1.00 0.00 ? 69 ASN A O    4  
ATOM 3940  C CB   . ASN A 1 69 ? -15.200 -4.500  0.539   1.00 0.00 ? 69 ASN A CB   4  
ATOM 3941  C CG   . ASN A 1 69 ? -15.902 -5.843  0.576   1.00 0.00 ? 69 ASN A CG   4  
ATOM 3942  O OD1  . ASN A 1 69 ? -15.261 -6.887  0.702   1.00 0.00 ? 69 ASN A OD1  4  
ATOM 3943  N ND2  . ASN A 1 69 ? -17.225 -5.824  0.465   1.00 0.00 ? 69 ASN A ND2  4  
ATOM 3944  H H    . ASN A 1 69 ? -12.994 -4.618  -1.552  1.00 0.00 ? 69 ASN A H    4  
ATOM 3945  H HA   . ASN A 1 69 ? -15.827 -4.085  -1.465  1.00 0.00 ? 69 ASN A HA   4  
ATOM 3946  H HB2  . ASN A 1 69 ? -14.268 -4.587  1.076   1.00 0.00 ? 69 ASN A HB2  4  
ATOM 3947  H HB3  . ASN A 1 69 ? -15.828 -3.772  1.032   1.00 0.00 ? 69 ASN A HB3  4  
ATOM 3948  H HD21 . ASN A 1 69 ? -17.668 -4.955  0.367   1.00 0.00 ? 69 ASN A HD21 4  
ATOM 3949  H HD22 . ASN A 1 69 ? -17.704 -6.678  0.486   1.00 0.00 ? 69 ASN A HD22 4  
ATOM 3950  N N    . PRO A 1 70 ? -15.038 -1.726  -1.705  1.00 0.00 ? 70 PRO A N    4  
ATOM 3951  C CA   . PRO A 1 70 ? -14.671 -0.312  -1.789  1.00 0.00 ? 70 PRO A CA   4  
ATOM 3952  C C    . PRO A 1 70 ? -14.509 0.328   -0.414  1.00 0.00 ? 70 PRO A C    4  
ATOM 3953  O O    . PRO A 1 70 ? -15.464 0.859   0.152   1.00 0.00 ? 70 PRO A O    4  
ATOM 3954  C CB   . PRO A 1 70 ? -15.851 0.307   -2.536  1.00 0.00 ? 70 PRO A CB   4  
ATOM 3955  C CG   . PRO A 1 70 ? -16.367 -0.795  -3.395  1.00 0.00 ? 70 PRO A CG   4  
ATOM 3956  C CD   . PRO A 1 70 ? -16.134 -2.071  -2.629  1.00 0.00 ? 70 PRO A CD   4  
ATOM 3957  H HA   . PRO A 1 70 ? -13.765 -0.171  -2.360  1.00 0.00 ? 70 PRO A HA   4  
ATOM 3958  H HB2  . PRO A 1 70 ? -16.595 0.640   -1.827  1.00 0.00 ? 70 PRO A HB2  4  
ATOM 3959  H HB3  . PRO A 1 70 ? -15.509 1.142   -3.128  1.00 0.00 ? 70 PRO A HB3  4  
ATOM 3960  H HG2  . PRO A 1 70 ? -17.423 -0.654  -3.576  1.00 0.00 ? 70 PRO A HG2  4  
ATOM 3961  H HG3  . PRO A 1 70 ? -15.826 -0.815  -4.330  1.00 0.00 ? 70 PRO A HG3  4  
ATOM 3962  H HD2  . PRO A 1 70 ? -17.023 -2.351  -2.084  1.00 0.00 ? 70 PRO A HD2  4  
ATOM 3963  H HD3  . PRO A 1 70 ? -15.836 -2.864  -3.300  1.00 0.00 ? 70 PRO A HD3  4  
ATOM 3964  N N    . PHE A 1 71 ? -13.292 0.272   0.117   1.00 0.00 ? 71 PHE A N    4  
ATOM 3965  C CA   . PHE A 1 71 ? -13.000 0.844   1.426   1.00 0.00 ? 71 PHE A CA   4  
ATOM 3966  C C    . PHE A 1 71 ? -13.051 2.369   1.378   1.00 0.00 ? 71 PHE A C    4  
ATOM 3967  O O    . PHE A 1 71 ? -13.795 2.996   2.133   1.00 0.00 ? 71 PHE A O    4  
ATOM 3968  C CB   . PHE A 1 71 ? -11.632 0.370   1.916   1.00 0.00 ? 71 PHE A CB   4  
ATOM 3969  C CG   . PHE A 1 71 ? -11.660 -1.008  2.513   1.00 0.00 ? 71 PHE A CG   4  
ATOM 3970  C CD1  . PHE A 1 71 ? -11.629 -2.130  1.701   1.00 0.00 ? 71 PHE A CD1  4  
ATOM 3971  C CD2  . PHE A 1 71 ? -11.723 -1.181  3.887   1.00 0.00 ? 71 PHE A CD2  4  
ATOM 3972  C CE1  . PHE A 1 71 ? -11.660 -3.399  2.247   1.00 0.00 ? 71 PHE A CE1  4  
ATOM 3973  C CE2  . PHE A 1 71 ? -11.753 -2.448  4.438   1.00 0.00 ? 71 PHE A CE2  4  
ATOM 3974  C CZ   . PHE A 1 71 ? -11.722 -3.558  3.617   1.00 0.00 ? 71 PHE A CZ   4  
ATOM 3975  H H    . PHE A 1 71 ? -12.572 -0.166  -0.383  1.00 0.00 ? 71 PHE A H    4  
ATOM 3976  H HA   . PHE A 1 71 ? -13.755 0.495   2.115   1.00 0.00 ? 71 PHE A HA   4  
ATOM 3977  H HB2  . PHE A 1 71 ? -10.948 0.356   1.083   1.00 0.00 ? 71 PHE A HB2  4  
ATOM 3978  H HB3  . PHE A 1 71 ? -11.267 1.055   2.667   1.00 0.00 ? 71 PHE A HB3  4  
ATOM 3979  H HD1  . PHE A 1 71 ? -11.579 -2.006  0.629   1.00 0.00 ? 71 PHE A HD1  4  
ATOM 3980  H HD2  . PHE A 1 71 ? -11.747 -0.314  4.530   1.00 0.00 ? 71 PHE A HD2  4  
ATOM 3981  H HE1  . PHE A 1 71 ? -11.638 -4.266  1.602   1.00 0.00 ? 71 PHE A HE1  4  
ATOM 3982  H HE2  . PHE A 1 71 ? -11.801 -2.570  5.510   1.00 0.00 ? 71 PHE A HE2  4  
ATOM 3983  H HZ   . PHE A 1 71 ? -11.746 -4.549  4.046   1.00 0.00 ? 71 PHE A HZ   4  
ATOM 3984  N N    . HIS A 1 72 ? -12.262 2.964   0.486   1.00 0.00 ? 72 HIS A N    4  
ATOM 3985  C CA   . HIS A 1 72 ? -12.230 4.415   0.346   1.00 0.00 ? 72 HIS A CA   4  
ATOM 3986  C C    . HIS A 1 72 ? -13.619 5.013   0.551   1.00 0.00 ? 72 HIS A C    4  
ATOM 3987  O O    . HIS A 1 72 ? -13.772 6.036   1.218   1.00 0.00 ? 72 HIS A O    4  
ATOM 3988  C CB   . HIS A 1 72 ? -11.696 4.803   -1.034  1.00 0.00 ? 72 HIS A CB   4  
ATOM 3989  C CG   . HIS A 1 72 ? -11.848 6.259   -1.347  1.00 0.00 ? 72 HIS A CG   4  
ATOM 3990  N ND1  . HIS A 1 72 ? -11.766 6.767   -2.626  1.00 0.00 ? 72 HIS A ND1  4  
ATOM 3991  C CD2  . HIS A 1 72 ? -12.081 7.320   -0.538  1.00 0.00 ? 72 HIS A CD2  4  
ATOM 3992  C CE1  . HIS A 1 72 ? -11.940 8.076   -2.591  1.00 0.00 ? 72 HIS A CE1  4  
ATOM 3993  N NE2  . HIS A 1 72 ? -12.134 8.436   -1.336  1.00 0.00 ? 72 HIS A NE2  4  
ATOM 3994  H H    . HIS A 1 72 ? -11.689 2.417   -0.093  1.00 0.00 ? 72 HIS A H    4  
ATOM 3995  H HA   . HIS A 1 72 ? -11.569 4.807   1.102   1.00 0.00 ? 72 HIS A HA   4  
ATOM 3996  H HB2  . HIS A 1 72 ? -10.645 4.562   -1.086  1.00 0.00 ? 72 HIS A HB2  4  
ATOM 3997  H HB3  . HIS A 1 72 ? -12.227 4.242   -1.789  1.00 0.00 ? 72 HIS A HB3  4  
ATOM 3998  H HD1  . HIS A 1 72 ? -11.603 6.245   -3.440  1.00 0.00 ? 72 HIS A HD1  4  
ATOM 3999  H HD2  . HIS A 1 72 ? -12.202 7.293   0.536   1.00 0.00 ? 72 HIS A HD2  4  
ATOM 4000  H HE1  . HIS A 1 72 ? -11.928 8.738   -3.444  1.00 0.00 ? 72 HIS A HE1  4  
ATOM 4001  H HE2  . HIS A 1 72 ? -12.211 9.360   -1.018  1.00 0.00 ? 72 HIS A HE2  4  
ATOM 4002  N N    . ALA A 1 73 ? -14.626 4.369   -0.028  1.00 0.00 ? 73 ALA A N    4  
ATOM 4003  C CA   . ALA A 1 73 ? -16.001 4.838   0.091   1.00 0.00 ? 73 ALA A CA   4  
ATOM 4004  C C    . ALA A 1 73 ? -16.831 3.893   0.953   1.00 0.00 ? 73 ALA A C    4  
ATOM 4005  O O    . ALA A 1 73 ? -16.574 3.827   2.173   1.00 0.00 ? 73 ALA A O    4  
ATOM 4006  C CB   . ALA A 1 73 ? -16.628 4.987   -1.287  1.00 0.00 ? 73 ALA A CB   4  
ATOM 4007  O OXT  . ALA A 1 73 ? -17.732 3.227   0.401   1.00 0.00 ? 73 ALA A OXT  4  
ATOM 4008  H H    . ALA A 1 73 ? -14.441 3.559   -0.548  1.00 0.00 ? 73 ALA A H    4  
ATOM 4009  H HA   . ALA A 1 73 ? -15.982 5.812   0.558   1.00 0.00 ? 73 ALA A HA   4  
ATOM 4010  H HB1  . ALA A 1 73 ? -16.121 5.770   -1.831  1.00 0.00 ? 73 ALA A HB1  4  
ATOM 4011  H HB2  . ALA A 1 73 ? -17.673 5.241   -1.182  1.00 0.00 ? 73 ALA A HB2  4  
ATOM 4012  H HB3  . ALA A 1 73 ? -16.537 4.056   -1.827  1.00 0.00 ? 73 ALA A HB3  4  
ATOM 4013  N N    . GLU A 1 1  ? -1.937  1.739   13.539  1.00 0.00 ? 1  GLU A N    5  
ATOM 4014  C CA   . GLU A 1 1  ? -2.423  2.456   12.331  1.00 0.00 ? 1  GLU A CA   5  
ATOM 4015  C C    . GLU A 1 1  ? -1.287  2.709   11.345  1.00 0.00 ? 1  GLU A C    5  
ATOM 4016  O O    . GLU A 1 1  ? -0.125  2.823   11.737  1.00 0.00 ? 1  GLU A O    5  
ATOM 4017  C CB   . GLU A 1 1  ? -3.046  3.782   12.770  1.00 0.00 ? 1  GLU A CB   5  
ATOM 4018  C CG   . GLU A 1 1  ? -2.034  4.783   13.303  1.00 0.00 ? 1  GLU A CG   5  
ATOM 4019  C CD   . GLU A 1 1  ? -1.639  5.819   12.270  1.00 0.00 ? 1  GLU A CD   5  
ATOM 4020  O OE1  . GLU A 1 1  ? -2.469  6.703   11.968  1.00 0.00 ? 1  GLU A OE1  5  
ATOM 4021  O OE2  . GLU A 1 1  ? -0.501  5.747   11.762  1.00 0.00 ? 1  GLU A OE2  5  
ATOM 4022  H H1   . GLU A 1 1  ? -2.747  1.604   14.175  1.00 0.00 ? 1  GLU A H1   5  
ATOM 4023  H H2   . GLU A 1 1  ? -1.204  2.330   13.983  1.00 0.00 ? 1  GLU A H2   5  
ATOM 4024  H H3   . GLU A 1 1  ? -1.547  0.826   13.230  1.00 0.00 ? 1  GLU A H3   5  
ATOM 4025  H HA   . GLU A 1 1  ? -3.177  1.850   11.852  1.00 0.00 ? 1  GLU A HA   5  
ATOM 4026  H HB2  . GLU A 1 1  ? -3.550  4.228   11.925  1.00 0.00 ? 1  GLU A HB2  5  
ATOM 4027  H HB3  . GLU A 1 1  ? -3.770  3.587   13.547  1.00 0.00 ? 1  GLU A HB3  5  
ATOM 4028  H HG2  . GLU A 1 1  ? -2.463  5.291   14.154  1.00 0.00 ? 1  GLU A HG2  5  
ATOM 4029  H HG3  . GLU A 1 1  ? -1.148  4.249   13.614  1.00 0.00 ? 1  GLU A HG3  5  
ATOM 4030  N N    . ALA A 1 2  ? -1.630  2.794   10.064  1.00 0.00 ? 2  ALA A N    5  
ATOM 4031  C CA   . ALA A 1 2  ? -0.639  3.032   9.021   1.00 0.00 ? 2  ALA A CA   5  
ATOM 4032  C C    . ALA A 1 2  ? -1.265  3.736   7.822   1.00 0.00 ? 2  ALA A C    5  
ATOM 4033  O O    . ALA A 1 2  ? -2.369  4.272   7.912   1.00 0.00 ? 2  ALA A O    5  
ATOM 4034  C CB   . ALA A 1 2  ? -0.002  1.719   8.591   1.00 0.00 ? 2  ALA A CB   5  
ATOM 4035  H H    . ALA A 1 2  ? -2.572  2.694   9.814   1.00 0.00 ? 2  ALA A H    5  
ATOM 4036  H HA   . ALA A 1 2  ? 0.135   3.662   9.434   1.00 0.00 ? 2  ALA A HA   5  
ATOM 4037  H HB1  . ALA A 1 2  ? -0.508  0.897   9.076   1.00 0.00 ? 2  ALA A HB1  5  
ATOM 4038  H HB2  . ALA A 1 2  ? 1.041   1.716   8.872   1.00 0.00 ? 2  ALA A HB2  5  
ATOM 4039  H HB3  . ALA A 1 2  ? -0.087  1.612   7.520   1.00 0.00 ? 2  ALA A HB3  5  
ATOM 4040  N N    . GLY A 1 3  ? -0.553  3.730   6.700   1.00 0.00 ? 3  GLY A N    5  
ATOM 4041  C CA   . GLY A 1 3  ? -1.058  4.371   5.500   1.00 0.00 ? 3  GLY A CA   5  
ATOM 4042  C C    . GLY A 1 3  ? -1.204  5.881   5.672   1.00 0.00 ? 3  GLY A C    5  
ATOM 4043  O O    . GLY A 1 3  ? -1.193  6.370   6.802   1.00 0.00 ? 3  GLY A O    5  
ATOM 4044  H H    . GLY A 1 3  ? 0.320   3.286   6.686   1.00 0.00 ? 3  GLY A H    5  
ATOM 4045  H HA2  . GLY A 1 3  ? -0.378  4.164   4.688   1.00 0.00 ? 3  GLY A HA2  5  
ATOM 4046  H HA3  . GLY A 1 3  ? -2.024  3.944   5.267   1.00 0.00 ? 3  GLY A HA3  5  
ATOM 4047  N N    . GLU A 1 4  ? -1.339  6.631   4.567   1.00 0.00 ? 4  GLU A N    5  
ATOM 4048  C CA   . GLU A 1 4  ? -1.483  8.082   4.649   1.00 0.00 ? 4  GLU A CA   5  
ATOM 4049  C C    . GLU A 1 4  ? -0.120  8.761   4.724   1.00 0.00 ? 4  GLU A C    5  
ATOM 4050  O O    . GLU A 1 4  ? 0.164   9.688   3.965   1.00 0.00 ? 4  GLU A O    5  
ATOM 4051  C CB   . GLU A 1 4  ? -2.326  8.468   5.865   1.00 0.00 ? 4  GLU A CB   5  
ATOM 4052  C CG   . GLU A 1 4  ? -3.523  7.558   6.090   1.00 0.00 ? 4  GLU A CG   5  
ATOM 4053  C CD   . GLU A 1 4  ? -4.839  8.310   6.068   1.00 0.00 ? 4  GLU A CD   5  
ATOM 4054  O OE1  . GLU A 1 4  ? -4.833  9.506   5.710   1.00 0.00 ? 4  GLU A OE1  5  
ATOM 4055  O OE2  . GLU A 1 4  ? -5.875  7.703   6.410   1.00 0.00 ? 4  GLU A OE2  5  
ATOM 4056  H H    . GLU A 1 4  ? -1.342  6.208   3.680   1.00 0.00 ? 4  GLU A H    5  
ATOM 4057  H HA   . GLU A 1 4  ? -1.988  8.414   3.754   1.00 0.00 ? 4  GLU A HA   5  
ATOM 4058  H HB2  . GLU A 1 4  ? -1.703  8.431   6.747   1.00 0.00 ? 4  GLU A HB2  5  
ATOM 4059  H HB3  . GLU A 1 4  ? -2.688  9.477   5.733   1.00 0.00 ? 4  GLU A HB3  5  
ATOM 4060  H HG2  . GLU A 1 4  ? -3.541  6.810   5.311   1.00 0.00 ? 4  GLU A HG2  5  
ATOM 4061  H HG3  . GLU A 1 4  ? -3.416  7.075   7.050   1.00 0.00 ? 4  GLU A HG3  5  
ATOM 4062  N N    . GLU A 1 5  ? 0.719   8.295   5.642   1.00 0.00 ? 5  GLU A N    5  
ATOM 4063  C CA   . GLU A 1 5  ? 2.053   8.860   5.813   1.00 0.00 ? 5  GLU A CA   5  
ATOM 4064  C C    . GLU A 1 5  ? 2.942   8.509   4.625   1.00 0.00 ? 5  GLU A C    5  
ATOM 4065  O O    . GLU A 1 5  ? 2.523   7.792   3.716   1.00 0.00 ? 5  GLU A O    5  
ATOM 4066  C CB   . GLU A 1 5  ? 2.685   8.350   7.109   1.00 0.00 ? 5  GLU A CB   5  
ATOM 4067  C CG   . GLU A 1 5  ? 2.024   8.899   8.363   1.00 0.00 ? 5  GLU A CG   5  
ATOM 4068  C CD   . GLU A 1 5  ? 2.238   10.391  8.528   1.00 0.00 ? 5  GLU A CD   5  
ATOM 4069  O OE1  . GLU A 1 5  ? 1.423   11.171  7.991   1.00 0.00 ? 5  GLU A OE1  5  
ATOM 4070  O OE2  . GLU A 1 5  ? 3.220   10.780  9.194   1.00 0.00 ? 5  GLU A OE2  5  
ATOM 4071  H H    . GLU A 1 5  ? 0.436   7.554   6.218   1.00 0.00 ? 5  GLU A H    5  
ATOM 4072  H HA   . GLU A 1 5  ? 1.954   9.933   5.868   1.00 0.00 ? 5  GLU A HA   5  
ATOM 4073  H HB2  . GLU A 1 5  ? 2.612   7.272   7.132   1.00 0.00 ? 5  GLU A HB2  5  
ATOM 4074  H HB3  . GLU A 1 5  ? 3.727   8.632   7.124   1.00 0.00 ? 5  GLU A HB3  5  
ATOM 4075  H HG2  . GLU A 1 5  ? 0.963   8.707   8.309   1.00 0.00 ? 5  GLU A HG2  5  
ATOM 4076  H HG3  . GLU A 1 5  ? 2.437   8.393   9.223   1.00 0.00 ? 5  GLU A HG3  5  
ATOM 4077  N N    . CYS A 1 6  ? 4.168   9.021   4.633   1.00 0.00 ? 6  CYS A N    5  
ATOM 4078  C CA   . CYS A 1 6  ? 5.108   8.760   3.550   1.00 0.00 ? 6  CYS A CA   5  
ATOM 4079  C C    . CYS A 1 6  ? 4.504   9.167   2.210   1.00 0.00 ? 6  CYS A C    5  
ATOM 4080  O O    . CYS A 1 6  ? 3.285   9.265   2.074   1.00 0.00 ? 6  CYS A O    5  
ATOM 4081  C CB   . CYS A 1 6  ? 5.492   7.279   3.528   1.00 0.00 ? 6  CYS A CB   5  
ATOM 4082  S SG   . CYS A 1 6  ? 6.218   6.717   1.953   1.00 0.00 ? 6  CYS A SG   5  
ATOM 4083  H H    . CYS A 1 6  ? 4.446   9.588   5.383   1.00 0.00 ? 6  CYS A H    5  
ATOM 4084  H HA   . CYS A 1 6  ? 5.994   9.352   3.728   1.00 0.00 ? 6  CYS A HA   5  
ATOM 4085  H HB2  . CYS A 1 6  ? 6.216   7.091   4.306   1.00 0.00 ? 6  CYS A HB2  5  
ATOM 4086  H HB3  . CYS A 1 6  ? 4.610   6.684   3.714   1.00 0.00 ? 6  CYS A HB3  5  
ATOM 4087  N N    . ASP A 1 7  ? 5.360   9.407   1.223   1.00 0.00 ? 7  ASP A N    5  
ATOM 4088  C CA   . ASP A 1 7  ? 4.899   9.806   -0.102  1.00 0.00 ? 7  ASP A CA   5  
ATOM 4089  C C    . ASP A 1 7  ? 5.919   9.435   -1.173  1.00 0.00 ? 7  ASP A C    5  
ATOM 4090  O O    . ASP A 1 7  ? 6.673   10.285  -1.646  1.00 0.00 ? 7  ASP A O    5  
ATOM 4091  C CB   . ASP A 1 7  ? 4.632   11.312  -0.138  1.00 0.00 ? 7  ASP A CB   5  
ATOM 4092  C CG   . ASP A 1 7  ? 3.932   11.806  1.112   1.00 0.00 ? 7  ASP A CG   5  
ATOM 4093  O OD1  . ASP A 1 7  ? 4.543   11.740  2.200   1.00 0.00 ? 7  ASP A OD1  5  
ATOM 4094  O OD2  . ASP A 1 7  ? 2.773   12.259  1.004   1.00 0.00 ? 7  ASP A OD2  5  
ATOM 4095  H H    . ASP A 1 7  ? 6.322   9.316   1.389   1.00 0.00 ? 7  ASP A H    5  
ATOM 4096  H HA   . ASP A 1 7  ? 3.977   9.283   -0.304  1.00 0.00 ? 7  ASP A HA   5  
ATOM 4097  H HB2  . ASP A 1 7  ? 5.572   11.836  -0.232  1.00 0.00 ? 7  ASP A HB2  5  
ATOM 4098  H HB3  . ASP A 1 7  ? 4.011   11.541  -0.992  1.00 0.00 ? 7  ASP A HB3  5  
ATOM 4099  N N    . CYS A 1 8  ? 5.937   8.161   -1.551  1.00 0.00 ? 8  CYS A N    5  
ATOM 4100  C CA   . CYS A 1 8  ? 6.866   7.684   -2.568  1.00 0.00 ? 8  CYS A CA   5  
ATOM 4101  C C    . CYS A 1 8  ? 6.178   6.744   -3.558  1.00 0.00 ? 8  CYS A C    5  
ATOM 4102  O O    . CYS A 1 8  ? 6.825   6.197   -4.451  1.00 0.00 ? 8  CYS A O    5  
ATOM 4103  C CB   . CYS A 1 8  ? 8.038   6.949   -1.922  1.00 0.00 ? 8  CYS A CB   5  
ATOM 4104  S SG   . CYS A 1 8  ? 9.323   8.015   -1.195  1.00 0.00 ? 8  CYS A SG   5  
ATOM 4105  H H    . CYS A 1 8  ? 5.312   7.530   -1.137  1.00 0.00 ? 8  CYS A H    5  
ATOM 4106  H HA   . CYS A 1 8  ? 7.242   8.541   -3.104  1.00 0.00 ? 8  CYS A HA   5  
ATOM 4107  H HB2  . CYS A 1 8  ? 7.663   6.312   -1.137  1.00 0.00 ? 8  CYS A HB2  5  
ATOM 4108  H HB3  . CYS A 1 8  ? 8.510   6.340   -2.676  1.00 0.00 ? 8  CYS A HB3  5  
ATOM 4109  N N    . GLY A 1 9  ? 4.871   6.548   -3.397  1.00 0.00 ? 9  GLY A N    5  
ATOM 4110  C CA   . GLY A 1 9  ? 4.144   5.664   -4.295  1.00 0.00 ? 9  GLY A CA   5  
ATOM 4111  C C    . GLY A 1 9  ? 2.925   5.031   -3.649  1.00 0.00 ? 9  GLY A C    5  
ATOM 4112  O O    . GLY A 1 9  ? 2.389   5.559   -2.674  1.00 0.00 ? 9  GLY A O    5  
ATOM 4113  H H    . GLY A 1 9  ? 4.399   7.001   -2.668  1.00 0.00 ? 9  GLY A H    5  
ATOM 4114  H HA2  . GLY A 1 9  ? 3.824   6.231   -5.156  1.00 0.00 ? 9  GLY A HA2  5  
ATOM 4115  H HA3  . GLY A 1 9  ? 4.810   4.880   -4.623  1.00 0.00 ? 9  GLY A HA3  5  
ATOM 4116  N N    . SER A 1 10 ? 2.483   3.898   -4.195  1.00 0.00 ? 10 SER A N    5  
ATOM 4117  C CA   . SER A 1 10 ? 1.318   3.201   -3.665  1.00 0.00 ? 10 SER A CA   5  
ATOM 4118  C C    . SER A 1 10 ? 1.254   1.750   -4.206  1.00 0.00 ? 10 SER A C    5  
ATOM 4119  O O    . SER A 1 10 ? 2.216   1.010   -4.001  1.00 0.00 ? 10 SER A O    5  
ATOM 4120  C CB   . SER A 1 10 ? 0.067   4.038   -3.943  1.00 0.00 ? 10 SER A CB   5  
ATOM 4121  O OG   . SER A 1 10 ? 0.153   5.296   -3.298  1.00 0.00 ? 10 SER A OG   5  
ATOM 4122  H H    . SER A 1 10 ? 2.950   3.525   -4.972  1.00 0.00 ? 10 SER A H    5  
ATOM 4123  H HA   . SER A 1 10 ? 1.454   3.136   -2.597  1.00 0.00 ? 10 SER A HA   5  
ATOM 4124  H HB2  . SER A 1 10 ? -0.026  4.206   -5.003  1.00 0.00 ? 10 SER A HB2  5  
ATOM 4125  H HB3  . SER A 1 10 ? -0.803  3.523   -3.572  1.00 0.00 ? 10 SER A HB3  5  
ATOM 4126  H HG   . SER A 1 10 ? 0.532   5.940   -3.900  1.00 0.00 ? 10 SER A HG   5  
ATOM 4127  N N    . PRO A 1 11 ? 0.175   1.271   -4.890  1.00 0.00 ? 11 PRO A N    5  
ATOM 4128  C CA   . PRO A 1 11 ? 0.160   -0.113  -5.375  1.00 0.00 ? 11 PRO A CA   5  
ATOM 4129  C C    . PRO A 1 11 ? 1.118   -0.319  -6.537  1.00 0.00 ? 11 PRO A C    5  
ATOM 4130  O O    . PRO A 1 11 ? 0.809   0.009   -7.683  1.00 0.00 ? 11 PRO A O    5  
ATOM 4131  C CB   . PRO A 1 11 ? -1.287  -0.334  -5.811  1.00 0.00 ? 11 PRO A CB   5  
ATOM 4132  C CG   . PRO A 1 11 ? -1.776  1.020   -6.174  1.00 0.00 ? 11 PRO A CG   5  
ATOM 4133  C CD   . PRO A 1 11 ? -1.075  1.977   -5.249  1.00 0.00 ? 11 PRO A CD   5  
ATOM 4134  H HA   . PRO A 1 11 ? 0.410   -0.804  -4.584  1.00 0.00 ? 11 PRO A HA   5  
ATOM 4135  H HB2  . PRO A 1 11 ? -1.312  -1.007  -6.656  1.00 0.00 ? 11 PRO A HB2  5  
ATOM 4136  H HB3  . PRO A 1 11 ? -1.853  -0.752  -4.992  1.00 0.00 ? 11 PRO A HB3  5  
ATOM 4137  H HG2  . PRO A 1 11 ? -1.523  1.239   -7.201  1.00 0.00 ? 11 PRO A HG2  5  
ATOM 4138  H HG3  . PRO A 1 11 ? -2.844  1.075   -6.030  1.00 0.00 ? 11 PRO A HG3  5  
ATOM 4139  H HD2  . PRO A 1 11 ? -0.865  2.897   -5.764  1.00 0.00 ? 11 PRO A HD2  5  
ATOM 4140  H HD3  . PRO A 1 11 ? -1.678  2.159   -4.374  1.00 0.00 ? 11 PRO A HD3  5  
ATOM 4141  N N    . GLY A 1 12 ? 2.293   -0.847  -6.223  1.00 0.00 ? 12 GLY A N    5  
ATOM 4142  C CA   . GLY A 1 12 ? 3.305   -1.074  -7.235  1.00 0.00 ? 12 GLY A CA   5  
ATOM 4143  C C    . GLY A 1 12 ? 4.573   -0.323  -6.904  1.00 0.00 ? 12 GLY A C    5  
ATOM 4144  O O    . GLY A 1 12 ? 5.677   -0.758  -7.233  1.00 0.00 ? 12 GLY A O    5  
ATOM 4145  H H    . GLY A 1 12 ? 2.483   -1.071  -5.284  1.00 0.00 ? 12 GLY A H    5  
ATOM 4146  H HA2  . GLY A 1 12 ? 3.521   -2.131  -7.291  1.00 0.00 ? 12 GLY A HA2  5  
ATOM 4147  H HA3  . GLY A 1 12 ? 2.934   -0.736  -8.191  1.00 0.00 ? 12 GLY A HA3  5  
ATOM 4148  N N    . ASN A 1 13 ? 4.400   0.804   -6.225  1.00 0.00 ? 13 ASN A N    5  
ATOM 4149  C CA   . ASN A 1 13 ? 5.515   1.635   -5.804  1.00 0.00 ? 13 ASN A CA   5  
ATOM 4150  C C    . ASN A 1 13 ? 5.558   1.690   -4.282  1.00 0.00 ? 13 ASN A C    5  
ATOM 4151  O O    . ASN A 1 13 ? 5.355   2.743   -3.678  1.00 0.00 ? 13 ASN A O    5  
ATOM 4152  C CB   . ASN A 1 13 ? 5.383   3.046   -6.380  1.00 0.00 ? 13 ASN A CB   5  
ATOM 4153  C CG   . ASN A 1 13 ? 5.798   3.117   -7.836  1.00 0.00 ? 13 ASN A CG   5  
ATOM 4154  O OD1  . ASN A 1 13 ? 6.969   3.334   -8.150  1.00 0.00 ? 13 ASN A OD1  5  
ATOM 4155  N ND2  . ASN A 1 13 ? 4.838   2.934   -8.735  1.00 0.00 ? 13 ASN A ND2  5  
ATOM 4156  H H    . ASN A 1 13 ? 3.490   1.077   -5.984  1.00 0.00 ? 13 ASN A H    5  
ATOM 4157  H HA   . ASN A 1 13 ? 6.427   1.184   -6.166  1.00 0.00 ? 13 ASN A HA   5  
ATOM 4158  H HB2  . ASN A 1 13 ? 4.354   3.365   -6.303  1.00 0.00 ? 13 ASN A HB2  5  
ATOM 4159  H HB3  . ASN A 1 13 ? 6.008   3.720   -5.813  1.00 0.00 ? 13 ASN A HB3  5  
ATOM 4160  H HD21 . ASN A 1 13 ? 3.928   2.765   -8.413  1.00 0.00 ? 13 ASN A HD21 5  
ATOM 4161  H HD22 . ASN A 1 13 ? 5.079   2.974   -9.684  1.00 0.00 ? 13 ASN A HD22 5  
ATOM 4162  N N    . PRO A 1 14 ? 5.824   0.540   -3.648  1.00 0.00 ? 14 PRO A N    5  
ATOM 4163  C CA   . PRO A 1 14 ? 5.902   0.409   -2.198  1.00 0.00 ? 14 PRO A CA   5  
ATOM 4164  C C    . PRO A 1 14 ? 6.557   1.605   -1.539  1.00 0.00 ? 14 PRO A C    5  
ATOM 4165  O O    . PRO A 1 14 ? 7.752   1.577   -1.258  1.00 0.00 ? 14 PRO A O    5  
ATOM 4166  C CB   . PRO A 1 14 ? 6.766   -0.852  -2.001  1.00 0.00 ? 14 PRO A CB   5  
ATOM 4167  C CG   . PRO A 1 14 ? 7.147   -1.296  -3.382  1.00 0.00 ? 14 PRO A CG   5  
ATOM 4168  C CD   . PRO A 1 14 ? 6.087   -0.744  -4.285  1.00 0.00 ? 14 PRO A CD   5  
ATOM 4169  H HA   . PRO A 1 14 ? 4.930   0.253   -1.761  1.00 0.00 ? 14 PRO A HA   5  
ATOM 4170  H HB2  . PRO A 1 14 ? 7.638   -0.604  -1.413  1.00 0.00 ? 14 PRO A HB2  5  
ATOM 4171  H HB3  . PRO A 1 14 ? 6.189   -1.609  -1.491  1.00 0.00 ? 14 PRO A HB3  5  
ATOM 4172  H HG2  . PRO A 1 14 ? 8.112   -0.889  -3.644  1.00 0.00 ? 14 PRO A HG2  5  
ATOM 4173  H HG3  . PRO A 1 14 ? 7.165   -2.374  -3.434  1.00 0.00 ? 14 PRO A HG3  5  
ATOM 4174  H HD2  . PRO A 1 14 ? 6.462   -0.618  -5.289  1.00 0.00 ? 14 PRO A HD2  5  
ATOM 4175  H HD3  . PRO A 1 14 ? 5.207   -1.371  -4.274  1.00 0.00 ? 14 PRO A HD3  5  
ATOM 4176  N N    . CYS A 1 15 ? 5.756   2.644   -1.284  1.00 0.00 ? 15 CYS A N    5  
ATOM 4177  C CA   . CYS A 1 15 ? 6.233   3.871   -0.641  1.00 0.00 ? 15 CYS A CA   5  
ATOM 4178  C C    . CYS A 1 15 ? 7.751   3.971   -0.682  1.00 0.00 ? 15 CYS A C    5  
ATOM 4179  O O    . CYS A 1 15 ? 8.428   3.714   0.313   1.00 0.00 ? 15 CYS A O    5  
ATOM 4180  C CB   . CYS A 1 15 ? 5.740   3.941   0.806   1.00 0.00 ? 15 CYS A CB   5  
ATOM 4181  S SG   . CYS A 1 15 ? 4.813   5.461   1.197   1.00 0.00 ? 15 CYS A SG   5  
ATOM 4182  H H    . CYS A 1 15 ? 4.810   2.579   -1.529  1.00 0.00 ? 15 CYS A H    5  
ATOM 4183  H HA   . CYS A 1 15 ? 5.820   4.706   -1.187  1.00 0.00 ? 15 CYS A HA   5  
ATOM 4184  H HB2  . CYS A 1 15 ? 5.090   3.100   0.996   1.00 0.00 ? 15 CYS A HB2  5  
ATOM 4185  H HB3  . CYS A 1 15 ? 6.589   3.889   1.474   1.00 0.00 ? 15 CYS A HB3  5  
ATOM 4186  N N    . CYS A 1 16 ? 8.270   4.336   -1.848  1.00 0.00 ? 16 CYS A N    5  
ATOM 4187  C CA   . CYS A 1 16 ? 9.706   4.474   -2.055  1.00 0.00 ? 16 CYS A CA   5  
ATOM 4188  C C    . CYS A 1 16 ? 10.354  3.126   -2.323  1.00 0.00 ? 16 CYS A C    5  
ATOM 4189  O O    . CYS A 1 16 ? 9.931   2.105   -1.786  1.00 0.00 ? 16 CYS A O    5  
ATOM 4190  C CB   . CYS A 1 16 ? 10.372  5.158   -0.855  1.00 0.00 ? 16 CYS A CB   5  
ATOM 4191  S SG   . CYS A 1 16 ? 10.989  6.842   -1.205  1.00 0.00 ? 16 CYS A SG   5  
ATOM 4192  H H    . CYS A 1 16 ? 7.665   4.517   -2.600  1.00 0.00 ? 16 CYS A H    5  
ATOM 4193  H HA   . CYS A 1 16 ? 9.844   5.091   -2.924  1.00 0.00 ? 16 CYS A HA   5  
ATOM 4194  H HB2  . CYS A 1 16 ? 9.663   5.233   -0.048  1.00 0.00 ? 16 CYS A HB2  5  
ATOM 4195  H HB3  . CYS A 1 16 ? 11.213  4.557   -0.533  1.00 0.00 ? 16 CYS A HB3  5  
ATOM 4196  N N    . ASP A 1 17 ? 11.372  3.132   -3.175  1.00 0.00 ? 17 ASP A N    5  
ATOM 4197  C CA   . ASP A 1 17 ? 12.076  1.902   -3.530  1.00 0.00 ? 17 ASP A CA   5  
ATOM 4198  C C    . ASP A 1 17 ? 13.358  2.162   -4.330  1.00 0.00 ? 17 ASP A C    5  
ATOM 4199  O O    . ASP A 1 17 ? 13.930  1.229   -4.895  1.00 0.00 ? 17 ASP A O    5  
ATOM 4200  C CB   . ASP A 1 17 ? 11.150  0.997   -4.345  1.00 0.00 ? 17 ASP A CB   5  
ATOM 4201  C CG   . ASP A 1 17 ? 10.307  1.776   -5.336  1.00 0.00 ? 17 ASP A CG   5  
ATOM 4202  O OD1  . ASP A 1 17 ? 10.886  2.361   -6.276  1.00 0.00 ? 17 ASP A OD1  5  
ATOM 4203  O OD2  . ASP A 1 17 ? 9.070   1.802   -5.172  1.00 0.00 ? 17 ASP A OD2  5  
ATOM 4204  H H    . ASP A 1 17 ? 11.641  3.977   -3.581  1.00 0.00 ? 17 ASP A H    5  
ATOM 4205  H HA   . ASP A 1 17 ? 12.335  1.395   -2.614  1.00 0.00 ? 17 ASP A HA   5  
ATOM 4206  H HB2  . ASP A 1 17 ? 11.746  0.283   -4.894  1.00 0.00 ? 17 ASP A HB2  5  
ATOM 4207  H HB3  . ASP A 1 17 ? 10.489  0.470   -3.674  1.00 0.00 ? 17 ASP A HB3  5  
ATOM 4208  N N    . ALA A 1 18 ? 13.807  3.417   -4.403  1.00 0.00 ? 18 ALA A N    5  
ATOM 4209  C CA   . ALA A 1 18 ? 15.007  3.752   -5.159  1.00 0.00 ? 18 ALA A CA   5  
ATOM 4210  C C    . ALA A 1 18 ? 14.684  3.871   -6.645  1.00 0.00 ? 18 ALA A C    5  
ATOM 4211  O O    . ALA A 1 18 ? 15.130  4.799   -7.320  1.00 0.00 ? 18 ALA A O    5  
ATOM 4212  C CB   . ALA A 1 18 ? 16.086  2.705   -4.932  1.00 0.00 ? 18 ALA A CB   5  
ATOM 4213  H H    . ALA A 1 18 ? 13.323  4.130   -3.957  1.00 0.00 ? 18 ALA A H    5  
ATOM 4214  H HA   . ALA A 1 18 ? 15.375  4.703   -4.801  1.00 0.00 ? 18 ALA A HA   5  
ATOM 4215  H HB1  . ALA A 1 18 ? 16.097  2.419   -3.892  1.00 0.00 ? 18 ALA A HB1  5  
ATOM 4216  H HB2  . ALA A 1 18 ? 17.047  3.114   -5.202  1.00 0.00 ? 18 ALA A HB2  5  
ATOM 4217  H HB3  . ALA A 1 18 ? 15.881  1.838   -5.540  1.00 0.00 ? 18 ALA A HB3  5  
ATOM 4218  N N    . ALA A 1 19 ? 13.900  2.921   -7.140  1.00 0.00 ? 19 ALA A N    5  
ATOM 4219  C CA   . ALA A 1 19 ? 13.498  2.894   -8.536  1.00 0.00 ? 19 ALA A CA   5  
ATOM 4220  C C    . ALA A 1 19 ? 12.424  1.833   -8.768  1.00 0.00 ? 19 ALA A C    5  
ATOM 4221  O O    . ALA A 1 19 ? 11.540  2.002   -9.608  1.00 0.00 ? 19 ALA A O    5  
ATOM 4222  C CB   . ALA A 1 19 ? 14.705  2.637   -9.417  1.00 0.00 ? 19 ALA A CB   5  
ATOM 4223  H H    . ALA A 1 19 ? 13.582  2.218   -6.549  1.00 0.00 ? 19 ALA A H    5  
ATOM 4224  H HA   . ALA A 1 19 ? 13.094  3.864   -8.786  1.00 0.00 ? 19 ALA A HA   5  
ATOM 4225  H HB1  . ALA A 1 19 ? 14.540  3.075   -10.389 1.00 0.00 ? 19 ALA A HB1  5  
ATOM 4226  H HB2  . ALA A 1 19 ? 14.853  1.572   -9.520  1.00 0.00 ? 19 ALA A HB2  5  
ATOM 4227  H HB3  . ALA A 1 19 ? 15.580  3.080   -8.964  1.00 0.00 ? 19 ALA A HB3  5  
ATOM 4228  N N    . THR A 1 20 ? 12.507  0.742   -8.009  1.00 0.00 ? 20 THR A N    5  
ATOM 4229  C CA   . THR A 1 20 ? 11.552  -0.347  -8.112  1.00 0.00 ? 20 THR A CA   5  
ATOM 4230  C C    . THR A 1 20 ? 11.527  -1.128  -6.805  1.00 0.00 ? 20 THR A C    5  
ATOM 4231  O O    . THR A 1 20 ? 12.579  -1.397  -6.226  1.00 0.00 ? 20 THR A O    5  
ATOM 4232  C CB   . THR A 1 20 ? 11.917  -1.273  -9.273  1.00 0.00 ? 20 THR A CB   5  
ATOM 4233  O OG1  . THR A 1 20 ? 12.224  -0.523  -10.435 1.00 0.00 ? 20 THR A OG1  5  
ATOM 4234  C CG2  . THR A 1 20 ? 10.814  -2.244  -9.631  1.00 0.00 ? 20 THR A CG2  5  
ATOM 4235  H H    . THR A 1 20 ? 13.229  0.667   -7.354  1.00 0.00 ? 20 THR A H    5  
ATOM 4236  H HA   . THR A 1 20 ? 10.575  0.078   -8.287  1.00 0.00 ? 20 THR A HA   5  
ATOM 4237  H HB   . THR A 1 20 ? 12.789  -1.849  -9.000  1.00 0.00 ? 20 THR A HB   5  
ATOM 4238  H HG1  . THR A 1 20 ? 11.750  0.311   -10.413 1.00 0.00 ? 20 THR A HG1  5  
ATOM 4239  H HG21 . THR A 1 20 ? 10.816  -2.413  -10.698 1.00 0.00 ? 20 THR A HG21 5  
ATOM 4240  H HG22 . THR A 1 20 ? 9.861   -1.832  -9.334  1.00 0.00 ? 20 THR A HG22 5  
ATOM 4241  H HG23 . THR A 1 20 ? 10.978  -3.180  -9.118  1.00 0.00 ? 20 THR A HG23 5  
ATOM 4242  N N    . CYS A 1 21 ? 10.321  -1.469  -6.351  1.00 0.00 ? 21 CYS A N    5  
ATOM 4243  C CA   . CYS A 1 21 ? 10.118  -2.211  -5.103  1.00 0.00 ? 21 CYS A CA   5  
ATOM 4244  C C    . CYS A 1 21 ? 11.425  -2.750  -4.521  1.00 0.00 ? 21 CYS A C    5  
ATOM 4245  O O    . CYS A 1 21 ? 11.850  -3.857  -4.852  1.00 0.00 ? 21 CYS A O    5  
ATOM 4246  C CB   . CYS A 1 21 ? 9.135   -3.360  -5.345  1.00 0.00 ? 21 CYS A CB   5  
ATOM 4247  S SG   . CYS A 1 21 ? 7.492   -2.819  -5.920  1.00 0.00 ? 21 CYS A SG   5  
ATOM 4248  H H    . CYS A 1 21 ? 9.531   -1.206  -6.870  1.00 0.00 ? 21 CYS A H    5  
ATOM 4249  H HA   . CYS A 1 21 ? 9.687   -1.527  -4.393  1.00 0.00 ? 21 CYS A HA   5  
ATOM 4250  H HB2  . CYS A 1 21 ? 9.543   -4.019  -6.096  1.00 0.00 ? 21 CYS A HB2  5  
ATOM 4251  H HB3  . CYS A 1 21 ? 8.998   -3.912  -4.428  1.00 0.00 ? 21 CYS A HB3  5  
ATOM 4252  N N    . LYS A 1 22 ? 12.063  -1.956  -3.655  1.00 0.00 ? 22 LYS A N    5  
ATOM 4253  C CA   . LYS A 1 22 ? 13.323  -2.360  -3.037  1.00 0.00 ? 22 LYS A CA   5  
ATOM 4254  C C    . LYS A 1 22 ? 13.756  -1.396  -1.926  1.00 0.00 ? 22 LYS A C    5  
ATOM 4255  O O    . LYS A 1 22 ? 14.949  -1.254  -1.660  1.00 0.00 ? 22 LYS A O    5  
ATOM 4256  C CB   . LYS A 1 22 ? 14.422  -2.443  -4.098  1.00 0.00 ? 22 LYS A CB   5  
ATOM 4257  C CG   . LYS A 1 22 ? 14.559  -3.820  -4.728  1.00 0.00 ? 22 LYS A CG   5  
ATOM 4258  C CD   . LYS A 1 22 ? 15.954  -4.039  -5.290  1.00 0.00 ? 22 LYS A CD   5  
ATOM 4259  C CE   . LYS A 1 22 ? 16.087  -3.462  -6.691  1.00 0.00 ? 22 LYS A CE   5  
ATOM 4260  N NZ   . LYS A 1 22 ? 15.005  -3.943  -7.594  1.00 0.00 ? 22 LYS A NZ   5  
ATOM 4261  H H    . LYS A 1 22 ? 11.679  -1.085  -3.432  1.00 0.00 ? 22 LYS A H    5  
ATOM 4262  H HA   . LYS A 1 22 ? 13.182  -3.340  -2.610  1.00 0.00 ? 22 LYS A HA   5  
ATOM 4263  H HB2  . LYS A 1 22 ? 14.204  -1.733  -4.882  1.00 0.00 ? 22 LYS A HB2  5  
ATOM 4264  H HB3  . LYS A 1 22 ? 15.367  -2.184  -3.643  1.00 0.00 ? 22 LYS A HB3  5  
ATOM 4265  H HG2  . LYS A 1 22 ? 14.363  -4.570  -3.977  1.00 0.00 ? 22 LYS A HG2  5  
ATOM 4266  H HG3  . LYS A 1 22 ? 13.840  -3.912  -5.528  1.00 0.00 ? 22 LYS A HG3  5  
ATOM 4267  H HD2  . LYS A 1 22 ? 16.672  -3.556  -4.644  1.00 0.00 ? 22 LYS A HD2  5  
ATOM 4268  H HD3  . LYS A 1 22 ? 16.155  -5.099  -5.326  1.00 0.00 ? 22 LYS A HD3  5  
ATOM 4269  H HE2  . LYS A 1 22 ? 16.040  -2.385  -6.629  1.00 0.00 ? 22 LYS A HE2  5  
ATOM 4270  H HE3  . LYS A 1 22 ? 17.043  -3.757  -7.099  1.00 0.00 ? 22 LYS A HE3  5  
ATOM 4271  H HZ1  . LYS A 1 22 ? 14.715  -4.904  -7.324  1.00 0.00 ? 22 LYS A HZ1  5  
ATOM 4272  H HZ2  . LYS A 1 22 ? 15.341  -3.958  -8.578  1.00 0.00 ? 22 LYS A HZ2  5  
ATOM 4273  H HZ3  . LYS A 1 22 ? 14.181  -3.312  -7.531  1.00 0.00 ? 22 LYS A HZ3  5  
ATOM 4274  N N    . LEU A 1 23 ? 12.798  -0.728  -1.281  1.00 0.00 ? 23 LEU A N    5  
ATOM 4275  C CA   . LEU A 1 23 ? 13.125  0.216   -0.214  1.00 0.00 ? 23 LEU A CA   5  
ATOM 4276  C C    . LEU A 1 23 ? 13.532  -0.496  1.066   1.00 0.00 ? 23 LEU A C    5  
ATOM 4277  O O    . LEU A 1 23 ? 13.068  -1.598  1.358   1.00 0.00 ? 23 LEU A O    5  
ATOM 4278  C CB   . LEU A 1 23 ? 11.954  1.161   0.076   1.00 0.00 ? 23 LEU A CB   5  
ATOM 4279  C CG   . LEU A 1 23 ? 10.723  0.538   0.747   1.00 0.00 ? 23 LEU A CG   5  
ATOM 4280  C CD1  . LEU A 1 23 ? 9.752   1.628   1.168   1.00 0.00 ? 23 LEU A CD1  5  
ATOM 4281  C CD2  . LEU A 1 23 ? 10.039  -0.451  -0.184  1.00 0.00 ? 23 LEU A CD2  5  
ATOM 4282  H H    . LEU A 1 23 ? 11.863  -0.864  -1.528  1.00 0.00 ? 23 LEU A H    5  
ATOM 4283  H HA   . LEU A 1 23 ? 13.964  0.806   -0.553  1.00 0.00 ? 23 LEU A HA   5  
ATOM 4284  H HB2  . LEU A 1 23 ? 12.315  1.950   0.720   1.00 0.00 ? 23 LEU A HB2  5  
ATOM 4285  H HB3  . LEU A 1 23 ? 11.644  1.599   -0.854  1.00 0.00 ? 23 LEU A HB3  5  
ATOM 4286  H HG   . LEU A 1 23 ? 11.028  0.008   1.637   1.00 0.00 ? 23 LEU A HG   5  
ATOM 4287  H HD11 . LEU A 1 23 ? 9.401   1.431   2.170   1.00 0.00 ? 23 LEU A HD11 5  
ATOM 4288  H HD12 . LEU A 1 23 ? 8.913   1.645   0.489   1.00 0.00 ? 23 LEU A HD12 5  
ATOM 4289  H HD13 . LEU A 1 23 ? 10.252  2.585   1.144   1.00 0.00 ? 23 LEU A HD13 5  
ATOM 4290  H HD21 . LEU A 1 23 ? 10.126  -0.105  -1.204  1.00 0.00 ? 23 LEU A HD21 5  
ATOM 4291  H HD22 . LEU A 1 23 ? 8.994   -0.531  0.081   1.00 0.00 ? 23 LEU A HD22 5  
ATOM 4292  H HD23 . LEU A 1 23 ? 10.510  -1.419  -0.091  1.00 0.00 ? 23 LEU A HD23 5  
ATOM 4293  N N    . ARG A 1 24 ? 14.396  0.159   1.831   1.00 0.00 ? 24 ARG A N    5  
ATOM 4294  C CA   . ARG A 1 24 ? 14.868  -0.385  3.095   1.00 0.00 ? 24 ARG A CA   5  
ATOM 4295  C C    . ARG A 1 24 ? 14.114  0.251   4.258   1.00 0.00 ? 24 ARG A C    5  
ATOM 4296  O O    . ARG A 1 24 ? 14.427  0.007   5.423   1.00 0.00 ? 24 ARG A O    5  
ATOM 4297  C CB   . ARG A 1 24 ? 16.371  -0.147  3.251   1.00 0.00 ? 24 ARG A CB   5  
ATOM 4298  C CG   . ARG A 1 24 ? 17.213  -0.879  2.218   1.00 0.00 ? 24 ARG A CG   5  
ATOM 4299  C CD   . ARG A 1 24 ? 18.579  -0.233  2.054   1.00 0.00 ? 24 ARG A CD   5  
ATOM 4300  N NE   . ARG A 1 24 ? 19.581  -1.185  1.585   1.00 0.00 ? 24 ARG A NE   5  
ATOM 4301  C CZ   . ARG A 1 24 ? 20.744  -0.826  1.051   1.00 0.00 ? 24 ARG A CZ   5  
ATOM 4302  N NH1  . ARG A 1 24 ? 21.049  0.459   0.921   1.00 0.00 ? 24 ARG A NH1  5  
ATOM 4303  N NH2  . ARG A 1 24 ? 21.605  -1.750  0.647   1.00 0.00 ? 24 ARG A NH2  5  
ATOM 4304  H H    . ARG A 1 24 ? 14.715  1.040   1.542   1.00 0.00 ? 24 ARG A H    5  
ATOM 4305  H HA   . ARG A 1 24 ? 14.676  -1.448  3.093   1.00 0.00 ? 24 ARG A HA   5  
ATOM 4306  H HB2  . ARG A 1 24 ? 16.568  0.911   3.161   1.00 0.00 ? 24 ARG A HB2  5  
ATOM 4307  H HB3  . ARG A 1 24 ? 16.676  -0.479  4.233   1.00 0.00 ? 24 ARG A HB3  5  
ATOM 4308  H HG2  . ARG A 1 24 ? 17.345  -1.902  2.535   1.00 0.00 ? 24 ARG A HG2  5  
ATOM 4309  H HG3  . ARG A 1 24 ? 16.698  -0.857  1.269   1.00 0.00 ? 24 ARG A HG3  5  
ATOM 4310  H HD2  . ARG A 1 24 ? 18.499  0.573   1.339   1.00 0.00 ? 24 ARG A HD2  5  
ATOM 4311  H HD3  . ARG A 1 24 ? 18.892  0.164   3.009   1.00 0.00 ? 24 ARG A HD3  5  
ATOM 4312  H HE   . ARG A 1 24 ? 19.377  -2.139  1.671   1.00 0.00 ? 24 ARG A HE   5  
ATOM 4313  H HH11 . ARG A 1 24 ? 20.402  1.159   1.225   1.00 0.00 ? 24 ARG A HH11 5  
ATOM 4314  H HH12 . ARG A 1 24 ? 21.924  0.727   0.520   1.00 0.00 ? 24 ARG A HH12 5  
ATOM 4315  H HH21 . ARG A 1 24 ? 21.379  -2.720  0.744   1.00 0.00 ? 24 ARG A HH21 5  
ATOM 4316  H HH22 . ARG A 1 24 ? 22.479  -1.478  0.246   1.00 0.00 ? 24 ARG A HH22 5  
ATOM 4317  N N    . GLN A 1 25 ? 13.111  1.065   3.931   1.00 0.00 ? 25 GLN A N    5  
ATOM 4318  C CA   . GLN A 1 25 ? 12.305  1.731   4.947   1.00 0.00 ? 25 GLN A CA   5  
ATOM 4319  C C    . GLN A 1 25 ? 11.041  0.933   5.226   1.00 0.00 ? 25 GLN A C    5  
ATOM 4320  O O    . GLN A 1 25 ? 10.400  1.095   6.265   1.00 0.00 ? 25 GLN A O    5  
ATOM 4321  C CB   . GLN A 1 25 ? 11.946  3.150   4.500   1.00 0.00 ? 25 GLN A CB   5  
ATOM 4322  C CG   . GLN A 1 25 ? 13.105  3.898   3.863   1.00 0.00 ? 25 GLN A CG   5  
ATOM 4323  C CD   . GLN A 1 25 ? 13.352  5.248   4.507   1.00 0.00 ? 25 GLN A CD   5  
ATOM 4324  O OE1  . GLN A 1 25 ? 13.023  6.290   3.939   1.00 0.00 ? 25 GLN A OE1  5  
ATOM 4325  N NE2  . GLN A 1 25 ? 13.934  5.237   5.700   1.00 0.00 ? 25 GLN A NE2  5  
ATOM 4326  H H    . GLN A 1 25 ? 12.903  1.215   2.983   1.00 0.00 ? 25 GLN A H    5  
ATOM 4327  H HA   . GLN A 1 25 ? 12.889  1.782   5.850   1.00 0.00 ? 25 GLN A HA   5  
ATOM 4328  H HB2  . GLN A 1 25 ? 11.142  3.095   3.781   1.00 0.00 ? 25 GLN A HB2  5  
ATOM 4329  H HB3  . GLN A 1 25 ? 11.611  3.712   5.359   1.00 0.00 ? 25 GLN A HB3  5  
ATOM 4330  H HG2  . GLN A 1 25 ? 14.000  3.302   3.961   1.00 0.00 ? 25 GLN A HG2  5  
ATOM 4331  H HG3  . GLN A 1 25 ? 12.888  4.049   2.816   1.00 0.00 ? 25 GLN A HG3  5  
ATOM 4332  H HE21 . GLN A 1 25 ? 14.169  4.371   6.093   1.00 0.00 ? 25 GLN A HE21 5  
ATOM 4333  H HE22 . GLN A 1 25 ? 14.106  6.096   6.140   1.00 0.00 ? 25 GLN A HE22 5  
ATOM 4334  N N    . GLY A 1 26 ? 10.703  0.059   4.290   1.00 0.00 ? 26 GLY A N    5  
ATOM 4335  C CA   . GLY A 1 26 ? 9.530   -0.778  4.434   1.00 0.00 ? 26 GLY A CA   5  
ATOM 4336  C C    . GLY A 1 26 ? 8.228   -0.026  4.239   1.00 0.00 ? 26 GLY A C    5  
ATOM 4337  O O    . GLY A 1 26 ? 7.591   0.395   5.205   1.00 0.00 ? 26 GLY A O    5  
ATOM 4338  H H    . GLY A 1 26 ? 11.265  -0.025  3.494   1.00 0.00 ? 26 GLY A H    5  
ATOM 4339  H HA2  . GLY A 1 26 ? 9.584   -1.569  3.701   1.00 0.00 ? 26 GLY A HA2  5  
ATOM 4340  H HA3  . GLY A 1 26 ? 9.537   -1.215  5.419   1.00 0.00 ? 26 GLY A HA3  5  
ATOM 4341  N N    . ALA A 1 27 ? 7.832   0.132   2.983   1.00 0.00 ? 27 ALA A N    5  
ATOM 4342  C CA   . ALA A 1 27 ? 6.604   0.819   2.631   1.00 0.00 ? 27 ALA A CA   5  
ATOM 4343  C C    . ALA A 1 27 ? 5.376   -0.089  2.784   1.00 0.00 ? 27 ALA A C    5  
ATOM 4344  O O    . ALA A 1 27 ? 4.482   -0.076  1.938   1.00 0.00 ? 27 ALA A O    5  
ATOM 4345  C CB   . ALA A 1 27 ? 6.717   1.308   1.201   1.00 0.00 ? 27 ALA A CB   5  
ATOM 4346  H H    . ALA A 1 27 ? 8.386   -0.228  2.262   1.00 0.00 ? 27 ALA A H    5  
ATOM 4347  H HA   . ALA A 1 27 ? 6.504   1.677   3.275   1.00 0.00 ? 27 ALA A HA   5  
ATOM 4348  H HB1  . ALA A 1 27 ? 5.733   1.454   0.788   1.00 0.00 ? 27 ALA A HB1  5  
ATOM 4349  H HB2  . ALA A 1 27 ? 7.246   0.572   0.612   1.00 0.00 ? 27 ALA A HB2  5  
ATOM 4350  H HB3  . ALA A 1 27 ? 7.263   2.235   1.180   1.00 0.00 ? 27 ALA A HB3  5  
ATOM 4351  N N    . GLN A 1 28 ? 5.344   -0.885  3.852   1.00 0.00 ? 28 GLN A N    5  
ATOM 4352  C CA   . GLN A 1 28 ? 4.233   -1.808  4.097   1.00 0.00 ? 28 GLN A CA   5  
ATOM 4353  C C    . GLN A 1 28 ? 2.908   -1.087  4.323   1.00 0.00 ? 28 GLN A C    5  
ATOM 4354  O O    . GLN A 1 28 ? 2.625   -0.624  5.428   1.00 0.00 ? 28 GLN A O    5  
ATOM 4355  C CB   . GLN A 1 28 ? 4.522   -2.674  5.314   1.00 0.00 ? 28 GLN A CB   5  
ATOM 4356  C CG   . GLN A 1 28 ? 5.991   -2.962  5.514   1.00 0.00 ? 28 GLN A CG   5  
ATOM 4357  C CD   . GLN A 1 28 ? 6.646   -2.012  6.497   1.00 0.00 ? 28 GLN A CD   5  
ATOM 4358  O OE1  . GLN A 1 28 ? 6.234   -0.860  6.634   1.00 0.00 ? 28 GLN A OE1  5  
ATOM 4359  N NE2  . GLN A 1 28 ? 7.674   -2.492  7.187   1.00 0.00 ? 28 GLN A NE2  5  
ATOM 4360  H H    . GLN A 1 28 ? 6.089   -0.866  4.484   1.00 0.00 ? 28 GLN A H    5  
ATOM 4361  H HA   . GLN A 1 28 ? 4.145   -2.449  3.233   1.00 0.00 ? 28 GLN A HA   5  
ATOM 4362  H HB2  . GLN A 1 28 ? 4.152   -2.173  6.194   1.00 0.00 ? 28 GLN A HB2  5  
ATOM 4363  H HB3  . GLN A 1 28 ? 4.004   -3.614  5.203   1.00 0.00 ? 28 GLN A HB3  5  
ATOM 4364  H HG2  . GLN A 1 28 ? 6.092   -3.966  5.884   1.00 0.00 ? 28 GLN A HG2  5  
ATOM 4365  H HG3  . GLN A 1 28 ? 6.490   -2.874  4.560   1.00 0.00 ? 28 GLN A HG3  5  
ATOM 4366  H HE21 . GLN A 1 28 ? 7.948   -3.418  7.026   1.00 0.00 ? 28 GLN A HE21 5  
ATOM 4367  H HE22 . GLN A 1 28 ? 8.117   -1.899  7.831   1.00 0.00 ? 28 GLN A HE22 5  
ATOM 4368  N N    . CYS A 1 29 ? 2.095   -1.007  3.280   1.00 0.00 ? 29 CYS A N    5  
ATOM 4369  C CA   . CYS A 1 29 ? 0.793   -0.356  3.379   1.00 0.00 ? 29 CYS A CA   5  
ATOM 4370  C C    . CYS A 1 29 ? 0.968   1.069   3.858   1.00 0.00 ? 29 CYS A C    5  
ATOM 4371  O O    . CYS A 1 29 ? 0.307   1.512   4.797   1.00 0.00 ? 29 CYS A O    5  
ATOM 4372  C CB   . CYS A 1 29 ? -0.125  -1.114  4.343   1.00 0.00 ? 29 CYS A CB   5  
ATOM 4373  S SG   . CYS A 1 29 ? -0.712  -2.723  3.720   1.00 0.00 ? 29 CYS A SG   5  
ATOM 4374  H H    . CYS A 1 29 ? 2.376   -1.392  2.429   1.00 0.00 ? 29 CYS A H    5  
ATOM 4375  H HA   . CYS A 1 29 ? 0.347   -0.345  2.395   1.00 0.00 ? 29 CYS A HA   5  
ATOM 4376  H HB2  . CYS A 1 29 ? 0.407   -1.297  5.264   1.00 0.00 ? 29 CYS A HB2  5  
ATOM 4377  H HB3  . CYS A 1 29 ? -0.994  -0.506  4.551   1.00 0.00 ? 29 CYS A HB3  5  
ATOM 4378  N N    . ALA A 1 30 ? 1.870   1.779   3.206   1.00 0.00 ? 30 ALA A N    5  
ATOM 4379  C CA   . ALA A 1 30 ? 2.145   3.161   3.565   1.00 0.00 ? 30 ALA A CA   5  
ATOM 4380  C C    . ALA A 1 30 ? 1.200   4.096   2.819   1.00 0.00 ? 30 ALA A C    5  
ATOM 4381  O O    . ALA A 1 30 ? 0.023   3.778   2.654   1.00 0.00 ? 30 ALA A O    5  
ATOM 4382  C CB   . ALA A 1 30 ? 3.597   3.500   3.272   1.00 0.00 ? 30 ALA A CB   5  
ATOM 4383  H H    . ALA A 1 30 ? 2.360   1.360   2.464   1.00 0.00 ? 30 ALA A H    5  
ATOM 4384  H HA   . ALA A 1 30 ? 1.980   3.258   4.624   1.00 0.00 ? 30 ALA A HA   5  
ATOM 4385  H HB1  . ALA A 1 30 ? 3.808   4.504   3.608   1.00 0.00 ? 30 ALA A HB1  5  
ATOM 4386  H HB2  . ALA A 1 30 ? 3.770   3.430   2.212   1.00 0.00 ? 30 ALA A HB2  5  
ATOM 4387  H HB3  . ALA A 1 30 ? 4.241   2.804   3.790   1.00 0.00 ? 30 ALA A HB3  5  
ATOM 4388  N N    . GLU A 1 31 ? 1.709   5.237   2.340   1.00 0.00 ? 31 GLU A N    5  
ATOM 4389  C CA   . GLU A 1 31 ? 0.873   6.167   1.585   1.00 0.00 ? 31 GLU A CA   5  
ATOM 4390  C C    . GLU A 1 31 ? -0.022  5.363   0.656   1.00 0.00 ? 31 GLU A C    5  
ATOM 4391  O O    . GLU A 1 31 ? -1.157  5.737   0.362   1.00 0.00 ? 31 GLU A O    5  
ATOM 4392  C CB   . GLU A 1 31 ? 1.738   7.134   0.774   1.00 0.00 ? 31 GLU A CB   5  
ATOM 4393  C CG   . GLU A 1 31 ? 1.010   8.404   0.364   1.00 0.00 ? 31 GLU A CG   5  
ATOM 4394  C CD   . GLU A 1 31 ? 0.349   8.284   -0.995  1.00 0.00 ? 31 GLU A CD   5  
ATOM 4395  O OE1  . GLU A 1 31 ? -0.428  7.327   -1.195  1.00 0.00 ? 31 GLU A OE1  5  
ATOM 4396  O OE2  . GLU A 1 31 ? 0.609   9.147   -1.860  1.00 0.00 ? 31 GLU A OE2  5  
ATOM 4397  H H    . GLU A 1 31 ? 2.655   5.443   2.476   1.00 0.00 ? 31 GLU A H    5  
ATOM 4398  H HA   . GLU A 1 31 ? 0.261   6.721   2.282   1.00 0.00 ? 31 GLU A HA   5  
ATOM 4399  H HB2  . GLU A 1 31 ? 2.599   7.412   1.363   1.00 0.00 ? 31 GLU A HB2  5  
ATOM 4400  H HB3  . GLU A 1 31 ? 2.074   6.633   -0.123  1.00 0.00 ? 31 GLU A HB3  5  
ATOM 4401  H HG2  . GLU A 1 31 ? 0.249   8.621   1.099   1.00 0.00 ? 31 GLU A HG2  5  
ATOM 4402  H HG3  . GLU A 1 31 ? 1.721   9.217   0.332   1.00 0.00 ? 31 GLU A HG3  5  
ATOM 4403  N N    . GLY A 1 32 ? 0.519   4.229   0.230   1.00 0.00 ? 32 GLY A N    5  
ATOM 4404  C CA   . GLY A 1 32 ? -0.189  3.316   -0.634  1.00 0.00 ? 32 GLY A CA   5  
ATOM 4405  C C    . GLY A 1 32 ? 0.399   1.924   -0.529  1.00 0.00 ? 32 GLY A C    5  
ATOM 4406  O O    . GLY A 1 32 ? 1.516   1.757   -0.039  1.00 0.00 ? 32 GLY A O    5  
ATOM 4407  H H    . GLY A 1 32 ? 1.423   3.998   0.527   1.00 0.00 ? 32 GLY A H    5  
ATOM 4408  H HA2  . GLY A 1 32 ? -1.230  3.286   -0.340  1.00 0.00 ? 32 GLY A HA2  5  
ATOM 4409  H HA3  . GLY A 1 32 ? -0.116  3.657   -1.652  1.00 0.00 ? 32 GLY A HA3  5  
ATOM 4410  N N    . LEU A 1 33 ? -0.347  0.923   -0.962  1.00 0.00 ? 33 LEU A N    5  
ATOM 4411  C CA   . LEU A 1 33 ? 0.118   -0.457  -0.883  1.00 0.00 ? 33 LEU A CA   5  
ATOM 4412  C C    . LEU A 1 33 ? 1.592   -0.587  -1.278  1.00 0.00 ? 33 LEU A C    5  
ATOM 4413  O O    . LEU A 1 33 ? 2.201   0.359   -1.775  1.00 0.00 ? 33 LEU A O    5  
ATOM 4414  C CB   . LEU A 1 33 ? -0.746  -1.356  -1.767  1.00 0.00 ? 33 LEU A CB   5  
ATOM 4415  C CG   . LEU A 1 33 ? -1.231  -2.648  -1.108  1.00 0.00 ? 33 LEU A CG   5  
ATOM 4416  C CD1  . LEU A 1 33 ? -0.210  -3.756  -1.298  1.00 0.00 ? 33 LEU A CD1  5  
ATOM 4417  C CD2  . LEU A 1 33 ? -1.510  -2.427  0.371   1.00 0.00 ? 33 LEU A CD2  5  
ATOM 4418  H H    . LEU A 1 33 ? -1.238  1.110   -1.329  1.00 0.00 ? 33 LEU A H    5  
ATOM 4419  H HA   . LEU A 1 33 ? 0.014   -0.768  0.142   1.00 0.00 ? 33 LEU A HA   5  
ATOM 4420  H HB2  . LEU A 1 33 ? -1.611  -0.790  -2.081  1.00 0.00 ? 33 LEU A HB2  5  
ATOM 4421  H HB3  . LEU A 1 33 ? -0.173  -1.620  -2.643  1.00 0.00 ? 33 LEU A HB3  5  
ATOM 4422  H HG   . LEU A 1 33 ? -2.151  -2.957  -1.579  1.00 0.00 ? 33 LEU A HG   5  
ATOM 4423  H HD11 . LEU A 1 33 ? 0.375   -3.863  -0.396  1.00 0.00 ? 33 LEU A HD11 5  
ATOM 4424  H HD12 . LEU A 1 33 ? 0.443   -3.505  -2.121  1.00 0.00 ? 33 LEU A HD12 5  
ATOM 4425  H HD13 . LEU A 1 33 ? -0.719  -4.682  -1.510  1.00 0.00 ? 33 LEU A HD13 5  
ATOM 4426  H HD21 . LEU A 1 33 ? -0.652  -2.738  0.950   1.00 0.00 ? 33 LEU A HD21 5  
ATOM 4427  H HD22 . LEU A 1 33 ? -2.373  -3.006  0.666   1.00 0.00 ? 33 LEU A HD22 5  
ATOM 4428  H HD23 . LEU A 1 33 ? -1.703  -1.378  0.549   1.00 0.00 ? 33 LEU A HD23 5  
ATOM 4429  N N    . CYS A 1 34 ? 2.155   -1.776  -1.047  1.00 0.00 ? 34 CYS A N    5  
ATOM 4430  C CA   . CYS A 1 34 ? 3.552   -2.052  -1.370  1.00 0.00 ? 34 CYS A CA   5  
ATOM 4431  C C    . CYS A 1 34 ? 3.678   -3.330  -2.183  1.00 0.00 ? 34 CYS A C    5  
ATOM 4432  O O    . CYS A 1 34 ? 2.781   -4.173  -2.194  1.00 0.00 ? 34 CYS A O    5  
ATOM 4433  C CB   . CYS A 1 34 ? 4.398   -2.154  -0.082  1.00 0.00 ? 34 CYS A CB   5  
ATOM 4434  S SG   . CYS A 1 34 ? 5.466   -3.640  0.055   1.00 0.00 ? 34 CYS A SG   5  
ATOM 4435  H H    . CYS A 1 34 ? 1.616   -2.484  -0.650  1.00 0.00 ? 34 CYS A H    5  
ATOM 4436  H HA   . CYS A 1 34 ? 3.917   -1.234  -1.965  1.00 0.00 ? 34 CYS A HA   5  
ATOM 4437  H HB2  . CYS A 1 34 ? 5.040   -1.295  -0.020  1.00 0.00 ? 34 CYS A HB2  5  
ATOM 4438  H HB3  . CYS A 1 34 ? 3.730   -2.160  0.766   1.00 0.00 ? 34 CYS A HB3  5  
ATOM 4439  N N    . CYS A 1 35 ? 4.814   -3.464  -2.844  1.00 0.00 ? 35 CYS A N    5  
ATOM 4440  C CA   . CYS A 1 35 ? 5.096   -4.636  -3.648  1.00 0.00 ? 35 CYS A CA   5  
ATOM 4441  C C    . CYS A 1 35 ? 6.492   -5.187  -3.333  1.00 0.00 ? 35 CYS A C    5  
ATOM 4442  O O    . CYS A 1 35 ? 6.888   -6.229  -3.854  1.00 0.00 ? 35 CYS A O    5  
ATOM 4443  C CB   . CYS A 1 35 ? 4.955   -4.299  -5.145  1.00 0.00 ? 35 CYS A CB   5  
ATOM 4444  S SG   . CYS A 1 35 ? 6.458   -4.549  -6.157  1.00 0.00 ? 35 CYS A SG   5  
ATOM 4445  H H    . CYS A 1 35 ? 5.481   -2.757  -2.780  1.00 0.00 ? 35 CYS A H    5  
ATOM 4446  H HA   . CYS A 1 35 ? 4.362   -5.381  -3.383  1.00 0.00 ? 35 CYS A HA   5  
ATOM 4447  H HB2  . CYS A 1 35 ? 4.178   -4.915  -5.569  1.00 0.00 ? 35 CYS A HB2  5  
ATOM 4448  H HB3  . CYS A 1 35 ? 4.669   -3.260  -5.241  1.00 0.00 ? 35 CYS A HB3  5  
ATOM 4449  N N    . ASP A 1 36 ? 7.233   -4.477  -2.483  1.00 0.00 ? 36 ASP A N    5  
ATOM 4450  C CA   . ASP A 1 36 ? 8.579   -4.890  -2.107  1.00 0.00 ? 36 ASP A CA   5  
ATOM 4451  C C    . ASP A 1 36 ? 8.567   -5.621  -0.770  1.00 0.00 ? 36 ASP A C    5  
ATOM 4452  O O    . ASP A 1 36 ? 7.538   -5.695  -0.096  1.00 0.00 ? 36 ASP A O    5  
ATOM 4453  C CB   . ASP A 1 36 ? 9.504   -3.670  -2.021  1.00 0.00 ? 36 ASP A CB   5  
ATOM 4454  C CG   . ASP A 1 36 ? 10.970  -4.051  -2.000  1.00 0.00 ? 36 ASP A CG   5  
ATOM 4455  O OD1  . ASP A 1 36 ? 11.378  -4.893  -2.827  1.00 0.00 ? 36 ASP A OD1  5  
ATOM 4456  O OD2  . ASP A 1 36 ? 11.708  -3.513  -1.149  1.00 0.00 ? 36 ASP A OD2  5  
ATOM 4457  H H    . ASP A 1 36 ? 6.868   -3.655  -2.101  1.00 0.00 ? 36 ASP A H    5  
ATOM 4458  H HA   . ASP A 1 36 ? 8.947   -5.559  -2.870  1.00 0.00 ? 36 ASP A HA   5  
ATOM 4459  H HB2  . ASP A 1 36 ? 9.330   -3.030  -2.871  1.00 0.00 ? 36 ASP A HB2  5  
ATOM 4460  H HB3  . ASP A 1 36 ? 9.284   -3.124  -1.118  1.00 0.00 ? 36 ASP A HB3  5  
ATOM 4461  N N    . GLN A 1 37 ? 9.723   -6.153  -0.388  1.00 0.00 ? 37 GLN A N    5  
ATOM 4462  C CA   . GLN A 1 37 ? 9.857   -6.871  0.869   1.00 0.00 ? 37 GLN A CA   5  
ATOM 4463  C C    . GLN A 1 37 ? 9.171   -6.125  2.010   1.00 0.00 ? 37 GLN A C    5  
ATOM 4464  O O    . GLN A 1 37 ? 8.836   -6.732  3.027   1.00 0.00 ? 37 GLN A O    5  
ATOM 4465  C CB   . GLN A 1 37 ? 11.335  -7.085  1.201   1.00 0.00 ? 37 GLN A CB   5  
ATOM 4466  C CG   . GLN A 1 37 ? 12.104  -7.815  0.112   1.00 0.00 ? 37 GLN A CG   5  
ATOM 4467  C CD   . GLN A 1 37 ? 12.536  -9.205  0.534   1.00 0.00 ? 37 GLN A CD   5  
ATOM 4468  O OE1  . GLN A 1 37 ? 11.877  -9.852  1.348   1.00 0.00 ? 37 GLN A OE1  5  
ATOM 4469  N NE2  . GLN A 1 37 ? 13.649  -9.673  -0.020  1.00 0.00 ? 37 GLN A NE2  5  
ATOM 4470  H H    . GLN A 1 37 ? 10.507  -6.058  -0.965  1.00 0.00 ? 37 GLN A H    5  
ATOM 4471  H HA   . GLN A 1 37 ? 9.384   -7.834  0.750   1.00 0.00 ? 37 GLN A HA   5  
ATOM 4472  H HB2  . GLN A 1 37 ? 11.800  -6.123  1.358   1.00 0.00 ? 37 GLN A HB2  5  
ATOM 4473  H HB3  . GLN A 1 37 ? 11.408  -7.663  2.111   1.00 0.00 ? 37 GLN A HB3  5  
ATOM 4474  H HG2  . GLN A 1 37 ? 11.473  -7.900  -0.761  1.00 0.00 ? 37 GLN A HG2  5  
ATOM 4475  H HG3  . GLN A 1 37 ? 12.984  -7.240  -0.137  1.00 0.00 ? 37 GLN A HG3  5  
ATOM 4476  H HE21 . GLN A 1 37 ? 14.122  -9.102  -0.661  1.00 0.00 ? 37 GLN A HE21 5  
ATOM 4477  H HE22 . GLN A 1 37 ? 13.951  -10.570 0.235   1.00 0.00 ? 37 GLN A HE22 5  
ATOM 4478  N N    . CYS A 1 38 ? 8.979   -4.807  1.839   1.00 0.00 ? 38 CYS A N    5  
ATOM 4479  C CA   . CYS A 1 38 ? 8.339   -3.970  2.860   1.00 0.00 ? 38 CYS A CA   5  
ATOM 4480  C C    . CYS A 1 38 ? 7.497   -4.801  3.815   1.00 0.00 ? 38 CYS A C    5  
ATOM 4481  O O    . CYS A 1 38 ? 7.731   -4.793  5.020   1.00 0.00 ? 38 CYS A O    5  
ATOM 4482  C CB   . CYS A 1 38 ? 7.462   -2.875  2.223   1.00 0.00 ? 38 CYS A CB   5  
ATOM 4483  S SG   . CYS A 1 38 ? 7.337   -2.932  0.405   1.00 0.00 ? 38 CYS A SG   5  
ATOM 4484  H H    . CYS A 1 38 ? 9.285   -4.386  1.011   1.00 0.00 ? 38 CYS A H    5  
ATOM 4485  H HA   . CYS A 1 38 ? 9.121   -3.492  3.428   1.00 0.00 ? 38 CYS A HA   5  
ATOM 4486  H HB2  . CYS A 1 38 ? 6.460   -2.945  2.616   1.00 0.00 ? 38 CYS A HB2  5  
ATOM 4487  H HB3  . CYS A 1 38 ? 7.868   -1.917  2.487   1.00 0.00 ? 38 CYS A HB3  5  
ATOM 4488  N N    . ARG A 1 39 ? 6.515   -5.495  3.249   1.00 0.00 ? 39 ARG A N    5  
ATOM 4489  C CA   . ARG A 1 39 ? 5.583   -6.339  4.000   1.00 0.00 ? 39 ARG A CA   5  
ATOM 4490  C C    . ARG A 1 39 ? 4.242   -5.630  4.088   1.00 0.00 ? 39 ARG A C    5  
ATOM 4491  O O    . ARG A 1 39 ? 4.021   -4.645  3.382   1.00 0.00 ? 39 ARG A O    5  
ATOM 4492  C CB   . ARG A 1 39 ? 6.102   -6.688  5.401   1.00 0.00 ? 39 ARG A CB   5  
ATOM 4493  C CG   . ARG A 1 39 ? 7.441   -7.410  5.396   1.00 0.00 ? 39 ARG A CG   5  
ATOM 4494  C CD   . ARG A 1 39 ? 7.464   -8.548  6.403   1.00 0.00 ? 39 ARG A CD   5  
ATOM 4495  N NE   . ARG A 1 39 ? 6.510   -9.600  6.064   1.00 0.00 ? 39 ARG A NE   5  
ATOM 4496  C CZ   . ARG A 1 39 ? 6.518   -10.808 6.620   1.00 0.00 ? 39 ARG A CZ   5  
ATOM 4497  N NH1  . ARG A 1 39 ? 7.427   -11.112 7.536   1.00 0.00 ? 39 ARG A NH1  5  
ATOM 4498  N NH2  . ARG A 1 39 ? 5.617   -11.711 6.261   1.00 0.00 ? 39 ARG A NH2  5  
ATOM 4499  H H    . ARG A 1 39 ? 6.401   -5.425  2.277   1.00 0.00 ? 39 ARG A H    5  
ATOM 4500  H HA   . ARG A 1 39 ? 5.449   -7.252  3.437   1.00 0.00 ? 39 ARG A HA   5  
ATOM 4501  H HB2  . ARG A 1 39 ? 6.204   -5.784  5.977   1.00 0.00 ? 39 ARG A HB2  5  
ATOM 4502  H HB3  . ARG A 1 39 ? 5.379   -7.328  5.886   1.00 0.00 ? 39 ARG A HB3  5  
ATOM 4503  H HG2  . ARG A 1 39 ? 7.619   -7.812  4.410   1.00 0.00 ? 39 ARG A HG2  5  
ATOM 4504  H HG3  . ARG A 1 39 ? 8.222   -6.707  5.646   1.00 0.00 ? 39 ARG A HG3  5  
ATOM 4505  H HD2  . ARG A 1 39 ? 8.457   -8.971  6.427   1.00 0.00 ? 39 ARG A HD2  5  
ATOM 4506  H HD3  . ARG A 1 39 ? 7.218   -8.154  7.378   1.00 0.00 ? 39 ARG A HD3  5  
ATOM 4507  H HE   . ARG A 1 39 ? 5.830   -9.397  5.389   1.00 0.00 ? 39 ARG A HE   5  
ATOM 4508  H HH11 . ARG A 1 39 ? 8.108   -10.432 7.809   1.00 0.00 ? 39 ARG A HH11 5  
ATOM 4509  H HH12 . ARG A 1 39 ? 7.432   -12.020 7.954   1.00 0.00 ? 39 ARG A HH12 5  
ATOM 4510  H HH21 . ARG A 1 39 ? 4.929   -11.485 5.571   1.00 0.00 ? 39 ARG A HH21 5  
ATOM 4511  H HH22 . ARG A 1 39 ? 5.625   -12.619 6.681   1.00 0.00 ? 39 ARG A HH22 5  
ATOM 4512  N N    . PHE A 1 40 ? 3.334   -6.122  4.925   1.00 0.00 ? 40 PHE A N    5  
ATOM 4513  C CA   . PHE A 1 40 ? 2.019   -5.497  5.034   1.00 0.00 ? 40 PHE A CA   5  
ATOM 4514  C C    . PHE A 1 40 ? 1.325   -5.827  6.353   1.00 0.00 ? 40 PHE A C    5  
ATOM 4515  O O    . PHE A 1 40 ? 1.543   -6.886  6.942   1.00 0.00 ? 40 PHE A O    5  
ATOM 4516  C CB   . PHE A 1 40 ? 1.167   -5.923  3.840   1.00 0.00 ? 40 PHE A CB   5  
ATOM 4517  C CG   . PHE A 1 40 ? 1.945   -5.880  2.560   1.00 0.00 ? 40 PHE A CG   5  
ATOM 4518  C CD1  . PHE A 1 40 ? 2.691   -6.975  2.155   1.00 0.00 ? 40 PHE A CD1  5  
ATOM 4519  C CD2  . PHE A 1 40 ? 1.977   -4.731  1.788   1.00 0.00 ? 40 PHE A CD2  5  
ATOM 4520  C CE1  . PHE A 1 40 ? 3.443   -6.928  1.005   1.00 0.00 ? 40 PHE A CE1  5  
ATOM 4521  C CE2  . PHE A 1 40 ? 2.734   -4.677  0.643   1.00 0.00 ? 40 PHE A CE2  5  
ATOM 4522  C CZ   . PHE A 1 40 ? 3.467   -5.778  0.249   1.00 0.00 ? 40 PHE A CZ   5  
ATOM 4523  H H    . PHE A 1 40 ? 3.543   -6.915  5.459   1.00 0.00 ? 40 PHE A H    5  
ATOM 4524  H HA   . PHE A 1 40 ? 2.164   -4.429  4.986   1.00 0.00 ? 40 PHE A HA   5  
ATOM 4525  H HB2  . PHE A 1 40 ? 0.820   -6.935  3.991   1.00 0.00 ? 40 PHE A HB2  5  
ATOM 4526  H HB3  . PHE A 1 40 ? 0.320   -5.259  3.744   1.00 0.00 ? 40 PHE A HB3  5  
ATOM 4527  H HD1  . PHE A 1 40 ? 2.674   -7.878  2.740   1.00 0.00 ? 40 PHE A HD1  5  
ATOM 4528  H HD2  . PHE A 1 40 ? 1.403   -3.869  2.086   1.00 0.00 ? 40 PHE A HD2  5  
ATOM 4529  H HE1  . PHE A 1 40 ? 4.018   -7.787  0.704   1.00 0.00 ? 40 PHE A HE1  5  
ATOM 4530  H HE2  . PHE A 1 40 ? 2.751   -3.775  0.055   1.00 0.00 ? 40 PHE A HE2  5  
ATOM 4531  H HZ   . PHE A 1 40 ? 4.064   -5.735  -0.648  1.00 0.00 ? 40 PHE A HZ   5  
ATOM 4532  N N    . MET A 1 41 ? 0.501   -4.888  6.811   1.00 0.00 ? 41 MET A N    5  
ATOM 4533  C CA   . MET A 1 41 ? -0.227  -5.027  8.065   1.00 0.00 ? 41 MET A CA   5  
ATOM 4534  C C    . MET A 1 41 ? -1.129  -6.258  8.079   1.00 0.00 ? 41 MET A C    5  
ATOM 4535  O O    . MET A 1 41 ? -0.766  -7.286  8.648   1.00 0.00 ? 41 MET A O    5  
ATOM 4536  C CB   . MET A 1 41 ? -1.065  -3.776  8.323   1.00 0.00 ? 41 MET A CB   5  
ATOM 4537  C CG   . MET A 1 41 ? -0.670  -3.028  9.585   1.00 0.00 ? 41 MET A CG   5  
ATOM 4538  S SD   . MET A 1 41 ? -1.952  -3.079  10.852  1.00 0.00 ? 41 MET A SD   5  
ATOM 4539  C CE   . MET A 1 41 ? -1.370  -4.433  11.869  1.00 0.00 ? 41 MET A CE   5  
ATOM 4540  H H    . MET A 1 41 ? 0.391   -4.066  6.295   1.00 0.00 ? 41 MET A H    5  
ATOM 4541  H HA   . MET A 1 41 ? 0.501   -5.122  8.853   1.00 0.00 ? 41 MET A HA   5  
ATOM 4542  H HB2  . MET A 1 41 ? -0.956  -3.106  7.483   1.00 0.00 ? 41 MET A HB2  5  
ATOM 4543  H HB3  . MET A 1 41 ? -2.103  -4.064  8.410   1.00 0.00 ? 41 MET A HB3  5  
ATOM 4544  H HG2  . MET A 1 41 ? 0.229   -3.474  9.986   1.00 0.00 ? 41 MET A HG2  5  
ATOM 4545  H HG3  . MET A 1 41 ? -0.475  -1.997  9.330   1.00 0.00 ? 41 MET A HG3  5  
ATOM 4546  H HE1  . MET A 1 41 ? -0.632  -4.068  12.568  1.00 0.00 ? 41 MET A HE1  5  
ATOM 4547  H HE2  . MET A 1 41 ? -0.927  -5.191  11.241  1.00 0.00 ? 41 MET A HE2  5  
ATOM 4548  H HE3  . MET A 1 41 ? -2.201  -4.858  12.413  1.00 0.00 ? 41 MET A HE3  5  
ATOM 4549  N N    . LYS A 1 42 ? -2.311  -6.128  7.468   1.00 0.00 ? 42 LYS A N    5  
ATOM 4550  C CA   . LYS A 1 42 ? -3.294  -7.212  7.416   1.00 0.00 ? 42 LYS A CA   5  
ATOM 4551  C C    . LYS A 1 42 ? -4.339  -7.043  8.513   1.00 0.00 ? 42 LYS A C    5  
ATOM 4552  O O    . LYS A 1 42 ? -4.342  -7.781  9.498   1.00 0.00 ? 42 LYS A O    5  
ATOM 4553  C CB   . LYS A 1 42 ? -2.620  -8.582  7.545   1.00 0.00 ? 42 LYS A CB   5  
ATOM 4554  C CG   . LYS A 1 42 ? -3.536  -9.751  7.220   1.00 0.00 ? 42 LYS A CG   5  
ATOM 4555  C CD   . LYS A 1 42 ? -3.173  -10.392 5.891   1.00 0.00 ? 42 LYS A CD   5  
ATOM 4556  C CE   . LYS A 1 42 ? -2.230  -11.569 6.080   1.00 0.00 ? 42 LYS A CE   5  
ATOM 4557  N NZ   . LYS A 1 42 ? -0.959  -11.390 5.326   1.00 0.00 ? 42 LYS A NZ   5  
ATOM 4558  H H    . LYS A 1 42 ? -2.537  -5.270  7.048   1.00 0.00 ? 42 LYS A H    5  
ATOM 4559  H HA   . LYS A 1 42 ? -3.792  -7.154  6.462   1.00 0.00 ? 42 LYS A HA   5  
ATOM 4560  H HB2  . LYS A 1 42 ? -1.773  -8.620  6.876   1.00 0.00 ? 42 LYS A HB2  5  
ATOM 4561  H HB3  . LYS A 1 42 ? -2.271  -8.703  8.560   1.00 0.00 ? 42 LYS A HB3  5  
ATOM 4562  H HG2  . LYS A 1 42 ? -3.448  -10.492 8.000   1.00 0.00 ? 42 LYS A HG2  5  
ATOM 4563  H HG3  . LYS A 1 42 ? -4.555  -9.395  7.174   1.00 0.00 ? 42 LYS A HG3  5  
ATOM 4564  H HD2  . LYS A 1 42 ? -4.075  -10.740 5.411   1.00 0.00 ? 42 LYS A HD2  5  
ATOM 4565  H HD3  . LYS A 1 42 ? -2.692  -9.654  5.266   1.00 0.00 ? 42 LYS A HD3  5  
ATOM 4566  H HE2  . LYS A 1 42 ? -2.003  -11.667 7.131   1.00 0.00 ? 42 LYS A HE2  5  
ATOM 4567  H HE3  . LYS A 1 42 ? -2.721  -12.467 5.733   1.00 0.00 ? 42 LYS A HE3  5  
ATOM 4568  H HZ1  . LYS A 1 42 ? -1.012  -10.537 4.732   1.00 0.00 ? 42 LYS A HZ1  5  
ATOM 4569  H HZ2  . LYS A 1 42 ? -0.786  -12.213 4.715   1.00 0.00 ? 42 LYS A HZ2  5  
ATOM 4570  H HZ3  . LYS A 1 42 ? -0.162  -11.290 5.987   1.00 0.00 ? 42 LYS A HZ3  5  
ATOM 4571  N N    . GLU A 1 43 ? -5.231  -6.071  8.333   1.00 0.00 ? 43 GLU A N    5  
ATOM 4572  C CA   . GLU A 1 43 ? -6.282  -5.819  9.312   1.00 0.00 ? 43 GLU A CA   5  
ATOM 4573  C C    . GLU A 1 43 ? -7.174  -4.655  8.904   1.00 0.00 ? 43 GLU A C    5  
ATOM 4574  O O    . GLU A 1 43 ? -8.357  -4.618  9.243   1.00 0.00 ? 43 GLU A O    5  
ATOM 4575  C CB   . GLU A 1 43 ? -5.675  -5.554  10.691  1.00 0.00 ? 43 GLU A CB   5  
ATOM 4576  C CG   . GLU A 1 43 ? -6.676  -5.026  11.705  1.00 0.00 ? 43 GLU A CG   5  
ATOM 4577  C CD   . GLU A 1 43 ? -6.008  -4.401  12.914  1.00 0.00 ? 43 GLU A CD   5  
ATOM 4578  O OE1  . GLU A 1 43 ? -4.837  -4.741  13.187  1.00 0.00 ? 43 GLU A OE1  5  
ATOM 4579  O OE2  . GLU A 1 43 ? -6.654  -3.572  13.587  1.00 0.00 ? 43 GLU A OE2  5  
ATOM 4580  H H    . GLU A 1 43 ? -5.182  -5.518  7.526   1.00 0.00 ? 43 GLU A H    5  
ATOM 4581  H HA   . GLU A 1 43 ? -6.886  -6.698  9.362   1.00 0.00 ? 43 GLU A HA   5  
ATOM 4582  H HB2  . GLU A 1 43 ? -5.261  -6.476  11.072  1.00 0.00 ? 43 GLU A HB2  5  
ATOM 4583  H HB3  . GLU A 1 43 ? -4.882  -4.829  10.589  1.00 0.00 ? 43 GLU A HB3  5  
ATOM 4584  H HG2  . GLU A 1 43 ? -7.293  -4.279  11.228  1.00 0.00 ? 43 GLU A HG2  5  
ATOM 4585  H HG3  . GLU A 1 43 ? -7.297  -5.845  12.038  1.00 0.00 ? 43 GLU A HG3  5  
ATOM 4586  N N    . GLY A 1 44 ? -6.605  -3.708  8.182   1.00 0.00 ? 44 GLY A N    5  
ATOM 4587  C CA   . GLY A 1 44 ? -7.355  -2.558  7.743   1.00 0.00 ? 44 GLY A CA   5  
ATOM 4588  C C    . GLY A 1 44 ? -6.490  -1.342  7.646   1.00 0.00 ? 44 GLY A C    5  
ATOM 4589  O O    . GLY A 1 44 ? -6.902  -0.240  8.011   1.00 0.00 ? 44 GLY A O    5  
ATOM 4590  H H    . GLY A 1 44 ? -5.662  -3.788  7.945   1.00 0.00 ? 44 GLY A H    5  
ATOM 4591  H HA2  . GLY A 1 44 ? -7.774  -2.759  6.773   1.00 0.00 ? 44 GLY A HA2  5  
ATOM 4592  H HA3  . GLY A 1 44 ? -8.148  -2.364  8.444   1.00 0.00 ? 44 GLY A HA3  5  
ATOM 4593  N N    . THR A 1 45 ? -5.279  -1.539  7.161   1.00 0.00 ? 45 THR A N    5  
ATOM 4594  C CA   . THR A 1 45 ? -4.354  -0.432  7.033   1.00 0.00 ? 45 THR A CA   5  
ATOM 4595  C C    . THR A 1 45 ? -4.669  0.411   5.801   1.00 0.00 ? 45 THR A C    5  
ATOM 4596  O O    . THR A 1 45 ? -5.535  1.284   5.857   1.00 0.00 ? 45 THR A O    5  
ATOM 4597  C CB   . THR A 1 45 ? -2.917  -0.933  7.042   1.00 0.00 ? 45 THR A CB   5  
ATOM 4598  O OG1  . THR A 1 45 ? -2.731  -1.857  8.098   1.00 0.00 ? 45 THR A OG1  5  
ATOM 4599  C CG2  . THR A 1 45 ? -1.918  0.177   7.222   1.00 0.00 ? 45 THR A CG2  5  
ATOM 4600  H H    . THR A 1 45 ? -5.002  -2.454  6.890   1.00 0.00 ? 45 THR A H    5  
ATOM 4601  H HA   . THR A 1 45 ? -4.494  0.195   7.893   1.00 0.00 ? 45 THR A HA   5  
ATOM 4602  H HB   . THR A 1 45 ? -2.700  -1.432  6.117   1.00 0.00 ? 45 THR A HB   5  
ATOM 4603  H HG1  . THR A 1 45 ? -3.550  -2.339  8.252   1.00 0.00 ? 45 THR A HG1  5  
ATOM 4604  H HG21 . THR A 1 45 ? -1.998  0.867   6.396   1.00 0.00 ? 45 THR A HG21 5  
ATOM 4605  H HG22 . THR A 1 45 ? -0.923  -0.237  7.254   1.00 0.00 ? 45 THR A HG22 5  
ATOM 4606  H HG23 . THR A 1 45 ? -2.126  0.696   8.146   1.00 0.00 ? 45 THR A HG23 5  
ATOM 4607  N N    . ILE A 1 46 ? -3.983  0.168   4.695   1.00 0.00 ? 46 ILE A N    5  
ATOM 4608  C CA   . ILE A 1 46 ? -4.238  0.942   3.488   1.00 0.00 ? 46 ILE A CA   5  
ATOM 4609  C C    . ILE A 1 46 ? -3.802  0.217   2.209   1.00 0.00 ? 46 ILE A C    5  
ATOM 4610  O O    . ILE A 1 46 ? -2.612  0.108   1.915   1.00 0.00 ? 46 ILE A O    5  
ATOM 4611  C CB   . ILE A 1 46 ? -3.569  2.344   3.582   1.00 0.00 ? 46 ILE A CB   5  
ATOM 4612  C CG1  . ILE A 1 46 ? -4.647  3.426   3.664   1.00 0.00 ? 46 ILE A CG1  5  
ATOM 4613  C CG2  . ILE A 1 46 ? -2.624  2.622   2.414   1.00 0.00 ? 46 ILE A CG2  5  
ATOM 4614  C CD1  . ILE A 1 46 ? -4.722  4.103   5.015   1.00 0.00 ? 46 ILE A CD1  5  
ATOM 4615  H H    . ILE A 1 46 ? -3.304  -0.528  4.692   1.00 0.00 ? 46 ILE A H    5  
ATOM 4616  H HA   . ILE A 1 46 ? -5.305  1.098   3.434   1.00 0.00 ? 46 ILE A HA   5  
ATOM 4617  H HB   . ILE A 1 46 ? -2.983  2.372   4.486   1.00 0.00 ? 46 ILE A HB   5  
ATOM 4618  H HG12 . ILE A 1 46 ? -4.444  4.186   2.924   1.00 0.00 ? 46 ILE A HG12 5  
ATOM 4619  H HG13 . ILE A 1 46 ? -5.610  2.981   3.461   1.00 0.00 ? 46 ILE A HG13 5  
ATOM 4620  H HG21 . ILE A 1 46 ? -1.711  2.061   2.549   1.00 0.00 ? 46 ILE A HG21 5  
ATOM 4621  H HG22 . ILE A 1 46 ? -2.396  3.677   2.380   1.00 0.00 ? 46 ILE A HG22 5  
ATOM 4622  H HG23 . ILE A 1 46 ? -3.096  2.325   1.490   1.00 0.00 ? 46 ILE A HG23 5  
ATOM 4623  H HD11 . ILE A 1 46 ? -3.860  3.828   5.604   1.00 0.00 ? 46 ILE A HD11 5  
ATOM 4624  H HD12 . ILE A 1 46 ? -5.621  3.789   5.525   1.00 0.00 ? 46 ILE A HD12 5  
ATOM 4625  H HD13 . ILE A 1 46 ? -4.740  5.174   4.881   1.00 0.00 ? 46 ILE A HD13 5  
ATOM 4626  N N    . CYS A 1 47 ? -4.789  -0.228  1.435   1.00 0.00 ? 47 CYS A N    5  
ATOM 4627  C CA   . CYS A 1 47 ? -4.535  -0.888  0.159   1.00 0.00 ? 47 CYS A CA   5  
ATOM 4628  C C    . CYS A 1 47 ? -4.623  0.149   -0.968  1.00 0.00 ? 47 CYS A C    5  
ATOM 4629  O O    . CYS A 1 47 ? -4.523  -0.182  -2.148  1.00 0.00 ? 47 CYS A O    5  
ATOM 4630  C CB   . CYS A 1 47 ? -5.537  -2.041  -0.048  1.00 0.00 ? 47 CYS A CB   5  
ATOM 4631  S SG   . CYS A 1 47 ? -6.394  -2.075  -1.662  1.00 0.00 ? 47 CYS A SG   5  
ATOM 4632  H H    . CYS A 1 47 ? -5.714  -0.078  1.713   1.00 0.00 ? 47 CYS A H    5  
ATOM 4633  H HA   . CYS A 1 47 ? -3.533  -1.288  0.186   1.00 0.00 ? 47 CYS A HA   5  
ATOM 4634  H HB2  . CYS A 1 47 ? -5.014  -2.978  0.056   1.00 0.00 ? 47 CYS A HB2  5  
ATOM 4635  H HB3  . CYS A 1 47 ? -6.294  -1.978  0.719   1.00 0.00 ? 47 CYS A HB3  5  
ATOM 4636  N N    . ARG A 1 48 ? -4.806  1.411   -0.563  1.00 0.00 ? 48 ARG A N    5  
ATOM 4637  C CA   . ARG A 1 48 ? -4.921  2.554   -1.476  1.00 0.00 ? 48 ARG A CA   5  
ATOM 4638  C C    . ARG A 1 48 ? -4.644  2.200   -2.934  1.00 0.00 ? 48 ARG A C    5  
ATOM 4639  O O    . ARG A 1 48 ? -3.492  2.113   -3.355  1.00 0.00 ? 48 ARG A O    5  
ATOM 4640  C CB   . ARG A 1 48 ? -3.945  3.646   -1.050  1.00 0.00 ? 48 ARG A CB   5  
ATOM 4641  C CG   . ARG A 1 48 ? -4.122  4.108   0.387   1.00 0.00 ? 48 ARG A CG   5  
ATOM 4642  C CD   . ARG A 1 48 ? -4.988  5.355   0.470   1.00 0.00 ? 48 ARG A CD   5  
ATOM 4643  N NE   . ARG A 1 48 ? -4.653  6.177   1.629   1.00 0.00 ? 48 ARG A NE   5  
ATOM 4644  C CZ   . ARG A 1 48 ? -5.482  7.067   2.165   1.00 0.00 ? 48 ARG A CZ   5  
ATOM 4645  N NH1  . ARG A 1 48 ? -6.690  7.246   1.648   1.00 0.00 ? 48 ARG A NH1  5  
ATOM 4646  N NH2  . ARG A 1 48 ? -5.105  7.777   3.219   1.00 0.00 ? 48 ARG A NH2  5  
ATOM 4647  H H    . ARG A 1 48 ? -4.876  1.585   0.399   1.00 0.00 ? 48 ARG A H    5  
ATOM 4648  H HA   . ARG A 1 48 ? -5.923  2.940   -1.397  1.00 0.00 ? 48 ARG A HA   5  
ATOM 4649  H HB2  . ARG A 1 48 ? -2.938  3.269   -1.160  1.00 0.00 ? 48 ARG A HB2  5  
ATOM 4650  H HB3  . ARG A 1 48 ? -4.073  4.498   -1.699  1.00 0.00 ? 48 ARG A HB3  5  
ATOM 4651  H HG2  . ARG A 1 48 ? -4.590  3.318   0.955   1.00 0.00 ? 48 ARG A HG2  5  
ATOM 4652  H HG3  . ARG A 1 48 ? -3.150  4.326   0.804   1.00 0.00 ? 48 ARG A HG3  5  
ATOM 4653  H HD2  . ARG A 1 48 ? -4.844  5.938   -0.427  1.00 0.00 ? 48 ARG A HD2  5  
ATOM 4654  H HD3  . ARG A 1 48 ? -6.023  5.054   0.540   1.00 0.00 ? 48 ARG A HD3  5  
ATOM 4655  H HE   . ARG A 1 48 ? -3.765  6.061   2.027   1.00 0.00 ? 48 ARG A HE   5  
ATOM 4656  H HH11 . ARG A 1 48 ? -6.978  6.712   0.853   1.00 0.00 ? 48 ARG A HH11 5  
ATOM 4657  H HH12 . ARG A 1 48 ? -7.313  7.916   2.053   1.00 0.00 ? 48 ARG A HH12 5  
ATOM 4658  H HH21 . ARG A 1 48 ? -4.195  7.644   3.612   1.00 0.00 ? 48 ARG A HH21 5  
ATOM 4659  H HH22 . ARG A 1 48 ? -5.730  8.446   3.621   1.00 0.00 ? 48 ARG A HH22 5  
ATOM 4660  N N    . ARG A 1 49 ? -5.714  2.024   -3.704  1.00 0.00 ? 49 ARG A N    5  
ATOM 4661  C CA   . ARG A 1 49 ? -5.595  1.711   -5.125  1.00 0.00 ? 49 ARG A CA   5  
ATOM 4662  C C    . ARG A 1 49 ? -6.958  1.754   -5.812  1.00 0.00 ? 49 ARG A C    5  
ATOM 4663  O O    . ARG A 1 49 ? -7.186  1.054   -6.799  1.00 0.00 ? 49 ARG A O    5  
ATOM 4664  C CB   . ARG A 1 49 ? -4.964  0.337   -5.315  1.00 0.00 ? 49 ARG A CB   5  
ATOM 4665  C CG   . ARG A 1 49 ? -5.832  -0.788  -4.796  1.00 0.00 ? 49 ARG A CG   5  
ATOM 4666  C CD   . ARG A 1 49 ? -5.590  -2.079  -5.561  1.00 0.00 ? 49 ARG A CD   5  
ATOM 4667  N NE   . ARG A 1 49 ? -6.672  -3.041  -5.372  1.00 0.00 ? 49 ARG A NE   5  
ATOM 4668  C CZ   . ARG A 1 49 ? -6.739  -4.207  -6.005  1.00 0.00 ? 49 ARG A CZ   5  
ATOM 4669  N NH1  . ARG A 1 49 ? -5.789  -4.553  -6.864  1.00 0.00 ? 49 ARG A NH1  5  
ATOM 4670  N NH2  . ARG A 1 49 ? -7.755  -5.029  -5.780  1.00 0.00 ? 49 ARG A NH2  5  
ATOM 4671  H H    . ARG A 1 49 ? -6.605  2.125   -3.310  1.00 0.00 ? 49 ARG A H    5  
ATOM 4672  H HA   . ARG A 1 49 ? -4.956  2.455   -5.575  1.00 0.00 ? 49 ARG A HA   5  
ATOM 4673  H HB2  . ARG A 1 49 ? -4.789  0.174   -6.369  1.00 0.00 ? 49 ARG A HB2  5  
ATOM 4674  H HB3  . ARG A 1 49 ? -4.021  0.308   -4.791  1.00 0.00 ? 49 ARG A HB3  5  
ATOM 4675  H HG2  . ARG A 1 49 ? -5.606  -0.945  -3.755  1.00 0.00 ? 49 ARG A HG2  5  
ATOM 4676  H HG3  . ARG A 1 49 ? -6.869  -0.505  -4.901  1.00 0.00 ? 49 ARG A HG3  5  
ATOM 4677  H HD2  . ARG A 1 49 ? -5.506  -1.849  -6.613  1.00 0.00 ? 49 ARG A HD2  5  
ATOM 4678  H HD3  . ARG A 1 49 ? -4.666  -2.519  -5.215  1.00 0.00 ? 49 ARG A HD3  5  
ATOM 4679  H HE   . ARG A 1 49 ? -7.384  -2.805  -4.742  1.00 0.00 ? 49 ARG A HE   5  
ATOM 4680  H HH11 . ARG A 1 49 ? -5.022  -3.936  -7.035  1.00 0.00 ? 49 ARG A HH11 5  
ATOM 4681  H HH12 . ARG A 1 49 ? -5.841  -5.432  -7.339  1.00 0.00 ? 49 ARG A HH12 5  
ATOM 4682  H HH21 . ARG A 1 49 ? -8.473  -4.771  -5.133  1.00 0.00 ? 49 ARG A HH21 5  
ATOM 4683  H HH22 . ARG A 1 49 ? -7.804  -5.906  -6.257  1.00 0.00 ? 49 ARG A HH22 5  
ATOM 4684  N N    . ALA A 1 50 ? -7.864  2.569   -5.282  1.00 0.00 ? 50 ALA A N    5  
ATOM 4685  C CA   . ALA A 1 50 ? -9.205  2.688   -5.844  1.00 0.00 ? 50 ALA A CA   5  
ATOM 4686  C C    . ALA A 1 50 ? -9.193  3.480   -7.146  1.00 0.00 ? 50 ALA A C    5  
ATOM 4687  O O    . ALA A 1 50 ? -8.163  3.586   -7.812  1.00 0.00 ? 50 ALA A O    5  
ATOM 4688  C CB   . ALA A 1 50 ? -10.142 3.338   -4.838  1.00 0.00 ? 50 ALA A CB   5  
ATOM 4689  H H    . ALA A 1 50 ? -7.630  3.099   -4.492  1.00 0.00 ? 50 ALA A H    5  
ATOM 4690  H HA   . ALA A 1 50 ? -9.569  1.691   -6.046  1.00 0.00 ? 50 ALA A HA   5  
ATOM 4691  H HB1  . ALA A 1 50 ? -9.994  2.890   -3.866  1.00 0.00 ? 50 ALA A HB1  5  
ATOM 4692  H HB2  . ALA A 1 50 ? -11.165 3.188   -5.151  1.00 0.00 ? 50 ALA A HB2  5  
ATOM 4693  H HB3  . ALA A 1 50 ? -9.934  4.396   -4.783  1.00 0.00 ? 50 ALA A HB3  5  
ATOM 4694  N N    . ARG A 1 51 ? -10.347 4.034   -7.501  1.00 0.00 ? 51 ARG A N    5  
ATOM 4695  C CA   . ARG A 1 51 ? -10.477 4.819   -8.722  1.00 0.00 ? 51 ARG A CA   5  
ATOM 4696  C C    . ARG A 1 51 ? -11.588 5.858   -8.580  1.00 0.00 ? 51 ARG A C    5  
ATOM 4697  O O    . ARG A 1 51 ? -11.360 6.949   -8.058  1.00 0.00 ? 51 ARG A O    5  
ATOM 4698  C CB   . ARG A 1 51 ? -10.757 3.903   -9.915  1.00 0.00 ? 51 ARG A CB   5  
ATOM 4699  C CG   . ARG A 1 51 ? -11.599 2.687   -9.565  1.00 0.00 ? 51 ARG A CG   5  
ATOM 4700  C CD   . ARG A 1 51 ? -10.824 1.395   -9.769  1.00 0.00 ? 51 ARG A CD   5  
ATOM 4701  N NE   . ARG A 1 51 ? -11.370 0.597   -10.863 1.00 0.00 ? 51 ARG A NE   5  
ATOM 4702  C CZ   . ARG A 1 51 ? -12.376 -0.260  -10.719 1.00 0.00 ? 51 ARG A CZ   5  
ATOM 4703  N NH1  . ARG A 1 51 ? -12.942 -0.427  -9.532  1.00 0.00 ? 51 ARG A NH1  5  
ATOM 4704  N NH2  . ARG A 1 51 ? -12.816 -0.950  -11.762 1.00 0.00 ? 51 ARG A NH2  5  
ATOM 4705  H H    . ARG A 1 51 ? -11.132 3.912   -6.926  1.00 0.00 ? 51 ARG A H    5  
ATOM 4706  H HA   . ARG A 1 51 ? -9.541  5.332   -8.885  1.00 0.00 ? 51 ARG A HA   5  
ATOM 4707  H HB2  . ARG A 1 51 ? -11.279 4.469   -10.674 1.00 0.00 ? 51 ARG A HB2  5  
ATOM 4708  H HB3  . ARG A 1 51 ? -9.817  3.559   -10.319 1.00 0.00 ? 51 ARG A HB3  5  
ATOM 4709  H HG2  . ARG A 1 51 ? -11.899 2.755   -8.530  1.00 0.00 ? 51 ARG A HG2  5  
ATOM 4710  H HG3  . ARG A 1 51 ? -12.476 2.674   -10.196 1.00 0.00 ? 51 ARG A HG3  5  
ATOM 4711  H HD2  . ARG A 1 51 ? -9.796  1.638   -9.992  1.00 0.00 ? 51 ARG A HD2  5  
ATOM 4712  H HD3  . ARG A 1 51 ? -10.867 0.817   -8.857  1.00 0.00 ? 51 ARG A HD3  5  
ATOM 4713  H HE   . ARG A 1 51 ? -10.966 0.705   -11.749 1.00 0.00 ? 51 ARG A HE   5  
ATOM 4714  H HH11 . ARG A 1 51 ? -12.613 0.092   -8.743  1.00 0.00 ? 51 ARG A HH11 5  
ATOM 4715  H HH12 . ARG A 1 51 ? -13.699 -1.072  -9.425  1.00 0.00 ? 51 ARG A HH12 5  
ATOM 4716  H HH21 . ARG A 1 51 ? -12.391 -0.826  -12.659 1.00 0.00 ? 51 ARG A HH21 5  
ATOM 4717  H HH22 . ARG A 1 51 ? -13.573 -1.594  -11.652 1.00 0.00 ? 51 ARG A HH22 5  
ATOM 4718  N N    . GLY A 1 52 ? -12.788 5.509   -9.041  1.00 0.00 ? 52 GLY A N    5  
ATOM 4719  C CA   . GLY A 1 52 ? -13.918 6.420   -8.953  1.00 0.00 ? 52 GLY A CA   5  
ATOM 4720  C C    . GLY A 1 52 ? -13.508 7.875   -9.064  1.00 0.00 ? 52 GLY A C    5  
ATOM 4721  O O    . GLY A 1 52 ? -13.439 8.427   -10.162 1.00 0.00 ? 52 GLY A O    5  
ATOM 4722  H H    . GLY A 1 52 ? -12.910 4.624   -9.442  1.00 0.00 ? 52 GLY A H    5  
ATOM 4723  H HA2  . GLY A 1 52 ? -14.611 6.192   -9.749  1.00 0.00 ? 52 GLY A HA2  5  
ATOM 4724  H HA3  . GLY A 1 52 ? -14.414 6.268   -8.006  1.00 0.00 ? 52 GLY A HA3  5  
ATOM 4725  N N    . ASP A 1 53 ? -13.233 8.496   -7.921  1.00 0.00 ? 53 ASP A N    5  
ATOM 4726  C CA   . ASP A 1 53 ? -12.825 9.895   -7.889  1.00 0.00 ? 53 ASP A CA   5  
ATOM 4727  C C    . ASP A 1 53 ? -11.385 10.027  -7.403  1.00 0.00 ? 53 ASP A C    5  
ATOM 4728  O O    . ASP A 1 53 ? -10.687 10.980  -7.748  1.00 0.00 ? 53 ASP A O    5  
ATOM 4729  C CB   . ASP A 1 53 ? -13.757 10.700  -6.981  1.00 0.00 ? 53 ASP A CB   5  
ATOM 4730  C CG   . ASP A 1 53 ? -13.749 12.180  -7.310  1.00 0.00 ? 53 ASP A CG   5  
ATOM 4731  O OD1  . ASP A 1 53 ? -14.376 12.567  -8.318  1.00 0.00 ? 53 ASP A OD1  5  
ATOM 4732  O OD2  . ASP A 1 53 ? -13.116 12.951  -6.559  1.00 0.00 ? 53 ASP A OD2  5  
ATOM 4733  H H    . ASP A 1 53 ? -13.305 8.000   -7.079  1.00 0.00 ? 53 ASP A H    5  
ATOM 4734  H HA   . ASP A 1 53 ? -12.891 10.284  -8.894  1.00 0.00 ? 53 ASP A HA   5  
ATOM 4735  H HB2  . ASP A 1 53 ? -14.766 10.331  -7.094  1.00 0.00 ? 53 ASP A HB2  5  
ATOM 4736  H HB3  . ASP A 1 53 ? -13.446 10.575  -5.955  1.00 0.00 ? 53 ASP A HB3  5  
ATOM 4737  N N    . ASP A 1 54 ? -10.947 9.061   -6.602  1.00 0.00 ? 54 ASP A N    5  
ATOM 4738  C CA   . ASP A 1 54 ? -9.590  9.065   -6.070  1.00 0.00 ? 54 ASP A CA   5  
ATOM 4739  C C    . ASP A 1 54 ? -9.053  7.644   -5.938  1.00 0.00 ? 54 ASP A C    5  
ATOM 4740  O O    . ASP A 1 54 ? -9.514  6.731   -6.623  1.00 0.00 ? 54 ASP A O    5  
ATOM 4741  C CB   . ASP A 1 54 ? -9.553  9.764   -4.710  1.00 0.00 ? 54 ASP A CB   5  
ATOM 4742  C CG   . ASP A 1 54 ? -10.438 10.994  -4.667  1.00 0.00 ? 54 ASP A CG   5  
ATOM 4743  O OD1  . ASP A 1 54 ? -11.677 10.834  -4.686  1.00 0.00 ? 54 ASP A OD1  5  
ATOM 4744  O OD2  . ASP A 1 54 ? -9.894  12.116  -4.612  1.00 0.00 ? 54 ASP A OD2  5  
ATOM 4745  H H    . ASP A 1 54 ? -11.551 8.327   -6.365  1.00 0.00 ? 54 ASP A H    5  
ATOM 4746  H HA   . ASP A 1 54 ? -8.964  9.610   -6.761  1.00 0.00 ? 54 ASP A HA   5  
ATOM 4747  H HB2  . ASP A 1 54 ? -9.888  9.075   -3.949  1.00 0.00 ? 54 ASP A HB2  5  
ATOM 4748  H HB3  . ASP A 1 54 ? -8.538  10.065  -4.494  1.00 0.00 ? 54 ASP A HB3  5  
ATOM 4749  N N    . LEU A 1 55 ? -8.078  7.464   -5.053  1.00 0.00 ? 55 LEU A N    5  
ATOM 4750  C CA   . LEU A 1 55 ? -7.478  6.154   -4.832  1.00 0.00 ? 55 LEU A CA   5  
ATOM 4751  C C    . LEU A 1 55 ? -7.294  5.884   -3.341  1.00 0.00 ? 55 LEU A C    5  
ATOM 4752  O O    . LEU A 1 55 ? -6.537  6.579   -2.665  1.00 0.00 ? 55 LEU A O    5  
ATOM 4753  C CB   . LEU A 1 55 ? -6.128  6.064   -5.546  1.00 0.00 ? 55 LEU A CB   5  
ATOM 4754  C CG   . LEU A 1 55 ? -6.081  6.716   -6.929  1.00 0.00 ? 55 LEU A CG   5  
ATOM 4755  C CD1  . LEU A 1 55 ? -7.172  6.149   -7.823  1.00 0.00 ? 55 LEU A CD1  5  
ATOM 4756  C CD2  . LEU A 1 55 ? -6.217  8.226   -6.810  1.00 0.00 ? 55 LEU A CD2  5  
ATOM 4757  H H    . LEU A 1 55 ? -7.754  8.232   -4.536  1.00 0.00 ? 55 LEU A H    5  
ATOM 4758  H HA   . LEU A 1 55 ? -8.143  5.409   -5.242  1.00 0.00 ? 55 LEU A HA   5  
ATOM 4759  H HB2  . LEU A 1 55 ? -5.383  6.537   -4.922  1.00 0.00 ? 55 LEU A HB2  5  
ATOM 4760  H HB3  . LEU A 1 55 ? -5.871  5.021   -5.656  1.00 0.00 ? 55 LEU A HB3  5  
ATOM 4761  H HG   . LEU A 1 55 ? -5.128  6.501   -7.388  1.00 0.00 ? 55 LEU A HG   5  
ATOM 4762  H HD11 . LEU A 1 55 ? -6.728  5.509   -8.571  1.00 0.00 ? 55 LEU A HD11 5  
ATOM 4763  H HD12 . LEU A 1 55 ? -7.697  6.959   -8.308  1.00 0.00 ? 55 LEU A HD12 5  
ATOM 4764  H HD13 . LEU A 1 55 ? -7.866  5.578   -7.226  1.00 0.00 ? 55 LEU A HD13 5  
ATOM 4765  H HD21 . LEU A 1 55 ? -5.451  8.705   -7.401  1.00 0.00 ? 55 LEU A HD21 5  
ATOM 4766  H HD22 . LEU A 1 55 ? -6.108  8.518   -5.775  1.00 0.00 ? 55 LEU A HD22 5  
ATOM 4767  H HD23 . LEU A 1 55 ? -7.190  8.530   -7.168  1.00 0.00 ? 55 LEU A HD23 5  
ATOM 4768  N N    . ASP A 1 56 ? -7.990  4.871   -2.834  1.00 0.00 ? 56 ASP A N    5  
ATOM 4769  C CA   . ASP A 1 56 ? -7.897  4.515   -1.424  1.00 0.00 ? 56 ASP A CA   5  
ATOM 4770  C C    . ASP A 1 56 ? -8.363  3.081   -1.188  1.00 0.00 ? 56 ASP A C    5  
ATOM 4771  O O    . ASP A 1 56 ? -8.885  2.430   -2.092  1.00 0.00 ? 56 ASP A O    5  
ATOM 4772  C CB   . ASP A 1 56 ? -8.730  5.480   -0.578  1.00 0.00 ? 56 ASP A CB   5  
ATOM 4773  C CG   . ASP A 1 56 ? -8.620  6.913   -1.059  1.00 0.00 ? 56 ASP A CG   5  
ATOM 4774  O OD1  . ASP A 1 56 ? -9.214  7.233   -2.110  1.00 0.00 ? 56 ASP A OD1  5  
ATOM 4775  O OD2  . ASP A 1 56 ? -7.941  7.716   -0.385  1.00 0.00 ? 56 ASP A OD2  5  
ATOM 4776  H H    . ASP A 1 56 ? -8.578  4.351   -3.421  1.00 0.00 ? 56 ASP A H    5  
ATOM 4777  H HA   . ASP A 1 56 ? -6.861  4.596   -1.130  1.00 0.00 ? 56 ASP A HA   5  
ATOM 4778  H HB2  . ASP A 1 56 ? -9.767  5.184   -0.620  1.00 0.00 ? 56 ASP A HB2  5  
ATOM 4779  H HB3  . ASP A 1 56 ? -8.389  5.436   0.446   1.00 0.00 ? 56 ASP A HB3  5  
ATOM 4780  N N    . ASP A 1 57 ? -8.168  2.600   0.036   1.00 0.00 ? 57 ASP A N    5  
ATOM 4781  C CA   . ASP A 1 57 ? -8.564  1.245   0.406   1.00 0.00 ? 57 ASP A CA   5  
ATOM 4782  C C    . ASP A 1 57 ? -7.854  0.812   1.685   1.00 0.00 ? 57 ASP A C    5  
ATOM 4783  O O    . ASP A 1 57 ? -6.898  1.457   2.118   1.00 0.00 ? 57 ASP A O    5  
ATOM 4784  C CB   . ASP A 1 57 ? -8.249  0.264   -0.721  1.00 0.00 ? 57 ASP A CB   5  
ATOM 4785  C CG   . ASP A 1 57 ? -9.455  -0.024  -1.594  1.00 0.00 ? 57 ASP A CG   5  
ATOM 4786  O OD1  . ASP A 1 57 ? -10.425 0.762   -1.546  1.00 0.00 ? 57 ASP A OD1  5  
ATOM 4787  O OD2  . ASP A 1 57 ? -9.430  -1.037  -2.325  1.00 0.00 ? 57 ASP A OD2  5  
ATOM 4788  H H    . ASP A 1 57 ? -7.746  3.173   0.710   1.00 0.00 ? 57 ASP A H    5  
ATOM 4789  H HA   . ASP A 1 57 ? -9.629  1.248   0.583   1.00 0.00 ? 57 ASP A HA   5  
ATOM 4790  H HB2  . ASP A 1 57 ? -7.468  0.676   -1.343  1.00 0.00 ? 57 ASP A HB2  5  
ATOM 4791  H HB3  . ASP A 1 57 ? -7.910  -0.665  -0.290  1.00 0.00 ? 57 ASP A HB3  5  
ATOM 4792  N N    . TYR A 1 58 ? -8.323  -0.279  2.287   1.00 0.00 ? 58 TYR A N    5  
ATOM 4793  C CA   . TYR A 1 58 ? -7.728  -0.784  3.522   1.00 0.00 ? 58 TYR A CA   5  
ATOM 4794  C C    . TYR A 1 58 ? -6.930  -2.060  3.291   1.00 0.00 ? 58 TYR A C    5  
ATOM 4795  O O    . TYR A 1 58 ? -7.203  -2.828  2.369   1.00 0.00 ? 58 TYR A O    5  
ATOM 4796  C CB   . TYR A 1 58 ? -8.803  -1.030  4.577   1.00 0.00 ? 58 TYR A CB   5  
ATOM 4797  C CG   . TYR A 1 58 ? -9.241  0.232   5.276   1.00 0.00 ? 58 TYR A CG   5  
ATOM 4798  C CD1  . TYR A 1 58 ? -9.386  1.415   4.566   1.00 0.00 ? 58 TYR A CD1  5  
ATOM 4799  C CD2  . TYR A 1 58 ? -9.505  0.246   6.639   1.00 0.00 ? 58 TYR A CD2  5  
ATOM 4800  C CE1  . TYR A 1 58 ? -9.783  2.579   5.191   1.00 0.00 ? 58 TYR A CE1  5  
ATOM 4801  C CE2  . TYR A 1 58 ? -9.903  1.407   7.273   1.00 0.00 ? 58 TYR A CE2  5  
ATOM 4802  C CZ   . TYR A 1 58 ? -10.041 2.571   6.545   1.00 0.00 ? 58 TYR A CZ   5  
ATOM 4803  O OH   . TYR A 1 58 ? -10.438 3.729   7.174   1.00 0.00 ? 58 TYR A OH   5  
ATOM 4804  H H    . TYR A 1 58 ? -9.086  -0.750  1.895   1.00 0.00 ? 58 TYR A H    5  
ATOM 4805  H HA   . TYR A 1 58 ? -7.054  -0.024  3.890   1.00 0.00 ? 58 TYR A HA   5  
ATOM 4806  H HB2  . TYR A 1 58 ? -9.669  -1.470  4.107   1.00 0.00 ? 58 TYR A HB2  5  
ATOM 4807  H HB3  . TYR A 1 58 ? -8.418  -1.709  5.324   1.00 0.00 ? 58 TYR A HB3  5  
ATOM 4808  H HD1  . TYR A 1 58 ? -9.182  1.416   3.508   1.00 0.00 ? 58 TYR A HD1  5  
ATOM 4809  H HD2  . TYR A 1 58 ? -9.392  -0.669  7.206   1.00 0.00 ? 58 TYR A HD2  5  
ATOM 4810  H HE1  . TYR A 1 58 ? -9.889  3.489   4.617   1.00 0.00 ? 58 TYR A HE1  5  
ATOM 4811  H HE2  . TYR A 1 58 ? -10.104 1.400   8.332   1.00 0.00 ? 58 TYR A HE2  5  
ATOM 4812  H HH   . TYR A 1 58 ? -11.306 3.986   6.855   1.00 0.00 ? 58 TYR A HH   5  
ATOM 4813  N N    . CYS A 1 59 ? -5.936  -2.266  4.144   1.00 0.00 ? 59 CYS A N    5  
ATOM 4814  C CA   . CYS A 1 59 ? -5.064  -3.428  4.063   1.00 0.00 ? 59 CYS A CA   5  
ATOM 4815  C C    . CYS A 1 59 ? -5.551  -4.562  4.962   1.00 0.00 ? 59 CYS A C    5  
ATOM 4816  O O    . CYS A 1 59 ? -5.495  -4.463  6.185   1.00 0.00 ? 59 CYS A O    5  
ATOM 4817  C CB   . CYS A 1 59 ? -3.661  -3.017  4.479   1.00 0.00 ? 59 CYS A CB   5  
ATOM 4818  S SG   . CYS A 1 59 ? -2.624  -2.365  3.125   1.00 0.00 ? 59 CYS A SG   5  
ATOM 4819  H H    . CYS A 1 59 ? -5.778  -1.606  4.851   1.00 0.00 ? 59 CYS A H    5  
ATOM 4820  H HA   . CYS A 1 59 ? -5.044  -3.766  3.042   1.00 0.00 ? 59 CYS A HA   5  
ATOM 4821  H HB2  . CYS A 1 59 ? -3.753  -2.246  5.216   1.00 0.00 ? 59 CYS A HB2  5  
ATOM 4822  H HB3  . CYS A 1 59 ? -3.157  -3.862  4.915   1.00 0.00 ? 59 CYS A HB3  5  
ATOM 4823  N N    . ASN A 1 60 ? -6.010  -5.643  4.345   1.00 0.00 ? 60 ASN A N    5  
ATOM 4824  C CA   . ASN A 1 60 ? -6.494  -6.811  5.079   1.00 0.00 ? 60 ASN A CA   5  
ATOM 4825  C C    . ASN A 1 60 ? -5.727  -8.040  4.622   1.00 0.00 ? 60 ASN A C    5  
ATOM 4826  O O    . ASN A 1 60 ? -4.821  -8.516  5.301   1.00 0.00 ? 60 ASN A O    5  
ATOM 4827  C CB   . ASN A 1 60 ? -7.998  -6.992  4.860   1.00 0.00 ? 60 ASN A CB   5  
ATOM 4828  C CG   . ASN A 1 60 ? -8.732  -5.666  4.840   1.00 0.00 ? 60 ASN A CG   5  
ATOM 4829  O OD1  . ASN A 1 60 ? -9.722  -5.502  4.126   1.00 0.00 ? 60 ASN A OD1  5  
ATOM 4830  N ND2  . ASN A 1 60 ? -8.250  -4.708  5.625   1.00 0.00 ? 60 ASN A ND2  5  
ATOM 4831  H H    . ASN A 1 60 ? -6.010  -5.663  3.369   1.00 0.00 ? 60 ASN A H    5  
ATOM 4832  H HA   . ASN A 1 60 ? -6.303  -6.653  6.118   1.00 0.00 ? 60 ASN A HA   5  
ATOM 4833  H HB2  . ASN A 1 60 ? -8.168  -7.490  3.919   1.00 0.00 ? 60 ASN A HB2  5  
ATOM 4834  H HB3  . ASN A 1 60 ? -8.403  -7.594  5.660   1.00 0.00 ? 60 ASN A HB3  5  
ATOM 4835  H HD21 . ASN A 1 60 ? -7.461  -4.909  6.173   1.00 0.00 ? 60 ASN A HD21 5  
ATOM 4836  H HD22 . ASN A 1 60 ? -8.694  -3.836  5.616   1.00 0.00 ? 60 ASN A HD22 5  
ATOM 4837  N N    . GLY A 1 61 ? -6.053  -8.500  3.433   1.00 0.00 ? 61 GLY A N    5  
ATOM 4838  C CA   . GLY A 1 61 ? -5.347  -9.619  2.844   1.00 0.00 ? 61 GLY A CA   5  
ATOM 4839  C C    . GLY A 1 61 ? -4.311  -9.078  1.888   1.00 0.00 ? 61 GLY A C    5  
ATOM 4840  O O    . GLY A 1 61 ? -4.112  -9.594  0.789   1.00 0.00 ? 61 GLY A O    5  
ATOM 4841  H H    . GLY A 1 61 ? -6.747  -8.040  2.927   1.00 0.00 ? 61 GLY A H    5  
ATOM 4842  H HA2  . GLY A 1 61 ? -4.863  -10.194 3.622   1.00 0.00 ? 61 GLY A HA2  5  
ATOM 4843  H HA3  . GLY A 1 61 ? -6.040  -10.245 2.304   1.00 0.00 ? 61 GLY A HA3  5  
ATOM 4844  N N    . ILE A 1 62 ? -3.706  -7.975  2.319   1.00 0.00 ? 62 ILE A N    5  
ATOM 4845  C CA   . ILE A 1 62 ? -2.721  -7.238  1.542   1.00 0.00 ? 62 ILE A CA   5  
ATOM 4846  C C    . ILE A 1 62 ? -1.299  -7.787  1.622   1.00 0.00 ? 62 ILE A C    5  
ATOM 4847  O O    . ILE A 1 62 ? -0.463  -7.264  2.357   1.00 0.00 ? 62 ILE A O    5  
ATOM 4848  C CB   . ILE A 1 62 ? -2.686  -5.769  2.000   1.00 0.00 ? 62 ILE A CB   5  
ATOM 4849  C CG1  . ILE A 1 62 ? -2.662  -5.651  3.532   1.00 0.00 ? 62 ILE A CG1  5  
ATOM 4850  C CG2  . ILE A 1 62 ? -3.889  -5.020  1.454   1.00 0.00 ? 62 ILE A CG2  5  
ATOM 4851  C CD1  . ILE A 1 62 ? -2.023  -6.806  4.277   1.00 0.00 ? 62 ILE A CD1  5  
ATOM 4852  H H    . ILE A 1 62 ? -3.967  -7.614  3.190   1.00 0.00 ? 62 ILE A H    5  
ATOM 4853  H HA   . ILE A 1 62 ? -3.040  -7.250  0.512   1.00 0.00 ? 62 ILE A HA   5  
ATOM 4854  H HB   . ILE A 1 62 ? -1.795  -5.311  1.597   1.00 0.00 ? 62 ILE A HB   5  
ATOM 4855  H HG12 . ILE A 1 62 ? -2.111  -4.766  3.793   1.00 0.00 ? 62 ILE A HG12 5  
ATOM 4856  H HG13 . ILE A 1 62 ? -3.678  -5.549  3.888   1.00 0.00 ? 62 ILE A HG13 5  
ATOM 4857  H HG21 . ILE A 1 62 ? -4.767  -5.295  2.021   1.00 0.00 ? 62 ILE A HG21 5  
ATOM 4858  H HG22 . ILE A 1 62 ? -4.033  -5.276  0.419   1.00 0.00 ? 62 ILE A HG22 5  
ATOM 4859  H HG23 . ILE A 1 62 ? -3.723  -3.957  1.544   1.00 0.00 ? 62 ILE A HG23 5  
ATOM 4860  H HD11 . ILE A 1 62 ? -2.448  -6.870  5.265   1.00 0.00 ? 62 ILE A HD11 5  
ATOM 4861  H HD12 . ILE A 1 62 ? -0.965  -6.635  4.359   1.00 0.00 ? 62 ILE A HD12 5  
ATOM 4862  H HD13 . ILE A 1 62 ? -2.195  -7.729  3.755   1.00 0.00 ? 62 ILE A HD13 5  
ATOM 4863  N N    . SER A 1 63 ? -0.996  -8.783  0.808   1.00 0.00 ? 63 SER A N    5  
ATOM 4864  C CA   . SER A 1 63 ? 0.355   -9.313  0.755   1.00 0.00 ? 63 SER A CA   5  
ATOM 4865  C C    . SER A 1 63 ? 1.066   -8.648  -0.410  1.00 0.00 ? 63 SER A C    5  
ATOM 4866  O O    . SER A 1 63 ? 1.741   -9.295  -1.211  1.00 0.00 ? 63 SER A O    5  
ATOM 4867  C CB   . SER A 1 63 ? 0.349   -10.825 0.584   1.00 0.00 ? 63 SER A CB   5  
ATOM 4868  O OG   . SER A 1 63 ? -0.662  -11.236 -0.320  1.00 0.00 ? 63 SER A OG   5  
ATOM 4869  H H    . SER A 1 63 ? -1.674  -9.129  0.193   1.00 0.00 ? 63 SER A H    5  
ATOM 4870  H HA   . SER A 1 63 ? 0.859   -9.052  1.675   1.00 0.00 ? 63 SER A HA   5  
ATOM 4871  H HB2  . SER A 1 63 ? 1.308   -11.139 0.202   1.00 0.00 ? 63 SER A HB2  5  
ATOM 4872  H HB3  . SER A 1 63 ? 0.172   -11.287 1.542   1.00 0.00 ? 63 SER A HB3  5  
ATOM 4873  H HG   . SER A 1 63 ? -0.476  -10.879 -1.192  1.00 0.00 ? 63 SER A HG   5  
ATOM 4874  N N    . ALA A 1 64 ? 0.850   -7.342  -0.503  1.00 0.00 ? 64 ALA A N    5  
ATOM 4875  C CA   . ALA A 1 64 ? 1.392   -6.523  -1.568  1.00 0.00 ? 64 ALA A CA   5  
ATOM 4876  C C    . ALA A 1 64 ? 0.363   -6.392  -2.683  1.00 0.00 ? 64 ALA A C    5  
ATOM 4877  O O    . ALA A 1 64 ? 0.680   -5.999  -3.806  1.00 0.00 ? 64 ALA A O    5  
ATOM 4878  C CB   . ALA A 1 64 ? 2.705   -7.079  -2.085  1.00 0.00 ? 64 ALA A CB   5  
ATOM 4879  H H    . ALA A 1 64 ? 0.271   -6.916  0.161   1.00 0.00 ? 64 ALA A H    5  
ATOM 4880  H HA   . ALA A 1 64 ? 1.579   -5.545  -1.160  1.00 0.00 ? 64 ALA A HA   5  
ATOM 4881  H HB1  . ALA A 1 64 ? 3.384   -6.263  -2.262  1.00 0.00 ? 64 ALA A HB1  5  
ATOM 4882  H HB2  . ALA A 1 64 ? 2.538   -7.613  -3.003  1.00 0.00 ? 64 ALA A HB2  5  
ATOM 4883  H HB3  . ALA A 1 64 ? 3.131   -7.741  -1.348  1.00 0.00 ? 64 ALA A HB3  5  
ATOM 4884  N N    . GLY A 1 65 ? -0.884  -6.714  -2.340  1.00 0.00 ? 65 GLY A N    5  
ATOM 4885  C CA   . GLY A 1 65 ? -1.981  -6.624  -3.280  1.00 0.00 ? 65 GLY A CA   5  
ATOM 4886  C C    . GLY A 1 65 ? -3.138  -5.843  -2.692  1.00 0.00 ? 65 GLY A C    5  
ATOM 4887  O O    . GLY A 1 65 ? -2.990  -4.667  -2.381  1.00 0.00 ? 65 GLY A O    5  
ATOM 4888  H H    . GLY A 1 65 ? -1.064  -7.006  -1.423  1.00 0.00 ? 65 GLY A H    5  
ATOM 4889  H HA2  . GLY A 1 65 ? -1.638  -6.129  -4.177  1.00 0.00 ? 65 GLY A HA2  5  
ATOM 4890  H HA3  . GLY A 1 65 ? -2.317  -7.619  -3.529  1.00 0.00 ? 65 GLY A HA3  5  
ATOM 4891  N N    . CYS A 1 66 ? -4.282  -6.502  -2.520  1.00 0.00 ? 66 CYS A N    5  
ATOM 4892  C CA   . CYS A 1 66 ? -5.468  -5.860  -1.947  1.00 0.00 ? 66 CYS A CA   5  
ATOM 4893  C C    . CYS A 1 66 ? -6.554  -6.877  -1.614  1.00 0.00 ? 66 CYS A C    5  
ATOM 4894  O O    . CYS A 1 66 ? -6.747  -7.853  -2.338  1.00 0.00 ? 66 CYS A O    5  
ATOM 4895  C CB   . CYS A 1 66 ? -6.034  -4.812  -2.905  1.00 0.00 ? 66 CYS A CB   5  
ATOM 4896  S SG   . CYS A 1 66 ? -5.187  -3.204  -2.838  1.00 0.00 ? 66 CYS A SG   5  
ATOM 4897  H H    . CYS A 1 66 ? -4.328  -7.446  -2.773  1.00 0.00 ? 66 CYS A H    5  
ATOM 4898  H HA   . CYS A 1 66 ? -5.166  -5.368  -1.035  1.00 0.00 ? 66 CYS A HA   5  
ATOM 4899  H HB2  . CYS A 1 66 ? -5.955  -5.181  -3.917  1.00 0.00 ? 66 CYS A HB2  5  
ATOM 4900  H HB3  . CYS A 1 66 ? -7.075  -4.646  -2.669  1.00 0.00 ? 66 CYS A HB3  5  
ATOM 4901  N N    . PRO A 1 67 ? -7.282  -6.650  -0.505  1.00 0.00 ? 67 PRO A N    5  
ATOM 4902  C CA   . PRO A 1 67 ? -8.365  -7.540  -0.065  1.00 0.00 ? 67 PRO A CA   5  
ATOM 4903  C C    . PRO A 1 67 ? -9.397  -7.791  -1.165  1.00 0.00 ? 67 PRO A C    5  
ATOM 4904  O O    . PRO A 1 67 ? -9.054  -7.894  -2.342  1.00 0.00 ? 67 PRO A O    5  
ATOM 4905  C CB   . PRO A 1 67 ? -9.009  -6.774  1.094   1.00 0.00 ? 67 PRO A CB   5  
ATOM 4906  C CG   . PRO A 1 67 ? -7.943  -5.867  1.599   1.00 0.00 ? 67 PRO A CG   5  
ATOM 4907  C CD   . PRO A 1 67 ? -7.098  -5.506  0.410   1.00 0.00 ? 67 PRO A CD   5  
ATOM 4908  H HA   . PRO A 1 67 ? -7.982  -8.484  0.291   1.00 0.00 ? 67 PRO A HA   5  
ATOM 4909  H HB2  . PRO A 1 67 ? -9.861  -6.218  0.731   1.00 0.00 ? 67 PRO A HB2  5  
ATOM 4910  H HB3  . PRO A 1 67 ? -9.326  -7.471  1.856   1.00 0.00 ? 67 PRO A HB3  5  
ATOM 4911  H HG2  . PRO A 1 67 ? -8.387  -4.980  2.025   1.00 0.00 ? 67 PRO A HG2  5  
ATOM 4912  H HG3  . PRO A 1 67 ? -7.348  -6.380  2.337   1.00 0.00 ? 67 PRO A HG3  5  
ATOM 4913  H HD2  . PRO A 1 67 ? -7.451  -4.589  -0.037  1.00 0.00 ? 67 PRO A HD2  5  
ATOM 4914  H HD3  . PRO A 1 67 ? -6.063  -5.409  0.702   1.00 0.00 ? 67 PRO A HD3  5  
ATOM 4915  N N    . ARG A 1 68 ? -10.665 -7.889  -0.773  1.00 0.00 ? 68 ARG A N    5  
ATOM 4916  C CA   . ARG A 1 68 ? -11.742 -8.127  -1.726  1.00 0.00 ? 68 ARG A CA   5  
ATOM 4917  C C    . ARG A 1 68 ? -12.441 -6.823  -2.099  1.00 0.00 ? 68 ARG A C    5  
ATOM 4918  O O    . ARG A 1 68 ? -12.398 -6.392  -3.251  1.00 0.00 ? 68 ARG A O    5  
ATOM 4919  C CB   . ARG A 1 68 ? -12.756 -9.114  -1.146  1.00 0.00 ? 68 ARG A CB   5  
ATOM 4920  C CG   . ARG A 1 68 ? -12.180 -10.497 -0.887  1.00 0.00 ? 68 ARG A CG   5  
ATOM 4921  C CD   . ARG A 1 68 ? -12.852 -11.552 -1.751  1.00 0.00 ? 68 ARG A CD   5  
ATOM 4922  N NE   . ARG A 1 68 ? -14.013 -12.142 -1.090  1.00 0.00 ? 68 ARG A NE   5  
ATOM 4923  C CZ   . ARG A 1 68 ? -14.463 -13.365 -1.347  1.00 0.00 ? 68 ARG A CZ   5  
ATOM 4924  N NH1  . ARG A 1 68 ? -13.852 -14.125 -2.246  1.00 0.00 ? 68 ARG A NH1  5  
ATOM 4925  N NH2  . ARG A 1 68 ? -15.526 -13.831 -0.705  1.00 0.00 ? 68 ARG A NH2  5  
ATOM 4926  H H    . ARG A 1 68 ? -10.881 -7.798  0.179   1.00 0.00 ? 68 ARG A H    5  
ATOM 4927  H HA   . ARG A 1 68 ? -11.307 -8.555  -2.617  1.00 0.00 ? 68 ARG A HA   5  
ATOM 4928  H HB2  . ARG A 1 68 ? -13.129 -8.722  -0.211  1.00 0.00 ? 68 ARG A HB2  5  
ATOM 4929  H HB3  . ARG A 1 68 ? -13.580 -9.215  -1.837  1.00 0.00 ? 68 ARG A HB3  5  
ATOM 4930  H HG2  . ARG A 1 68 ? -11.124 -10.484 -1.109  1.00 0.00 ? 68 ARG A HG2  5  
ATOM 4931  H HG3  . ARG A 1 68 ? -12.328 -10.748 0.154   1.00 0.00 ? 68 ARG A HG3  5  
ATOM 4932  H HD2  . ARG A 1 68 ? -13.171 -11.093 -2.675  1.00 0.00 ? 68 ARG A HD2  5  
ATOM 4933  H HD3  . ARG A 1 68 ? -12.136 -12.332 -1.965  1.00 0.00 ? 68 ARG A HD3  5  
ATOM 4934  H HE   . ARG A 1 68 ? -14.480 -11.598 -0.422  1.00 0.00 ? 68 ARG A HE   5  
ATOM 4935  H HH11 . ARG A 1 68 ? -13.050 -13.777 -2.732  1.00 0.00 ? 68 ARG A HH11 5  
ATOM 4936  H HH12 . ARG A 1 68 ? -14.192 -15.045 -2.438  1.00 0.00 ? 68 ARG A HH12 5  
ATOM 4937  H HH21 . ARG A 1 68 ? -15.990 -13.262 -0.026  1.00 0.00 ? 68 ARG A HH21 5  
ATOM 4938  H HH22 . ARG A 1 68 ? -15.864 -14.752 -0.900  1.00 0.00 ? 68 ARG A HH22 5  
ATOM 4939  N N    . ASN A 1 69 ? -13.085 -6.200  -1.117  1.00 0.00 ? 69 ASN A N    5  
ATOM 4940  C CA   . ASN A 1 69 ? -13.794 -4.945  -1.344  1.00 0.00 ? 69 ASN A CA   5  
ATOM 4941  C C    . ASN A 1 69 ? -12.938 -3.752  -0.931  1.00 0.00 ? 69 ASN A C    5  
ATOM 4942  O O    . ASN A 1 69 ? -12.155 -3.832  0.015   1.00 0.00 ? 69 ASN A O    5  
ATOM 4943  C CB   . ASN A 1 69 ? -15.113 -4.934  -0.569  1.00 0.00 ? 69 ASN A CB   5  
ATOM 4944  C CG   . ASN A 1 69 ? -16.031 -6.071  -0.973  1.00 0.00 ? 69 ASN A CG   5  
ATOM 4945  O OD1  . ASN A 1 69 ? -16.597 -6.759  -0.124  1.00 0.00 ? 69 ASN A OD1  5  
ATOM 4946  N ND2  . ASN A 1 69 ? -16.182 -6.275  -2.277  1.00 0.00 ? 69 ASN A ND2  5  
ATOM 4947  H H    . ASN A 1 69 ? -13.084 -6.593  -0.220  1.00 0.00 ? 69 ASN A H    5  
ATOM 4948  H HA   . ASN A 1 69 ? -14.007 -4.872  -2.400  1.00 0.00 ? 69 ASN A HA   5  
ATOM 4949  H HB2  . ASN A 1 69 ? -14.904 -5.023  0.486   1.00 0.00 ? 69 ASN A HB2  5  
ATOM 4950  H HB3  . ASN A 1 69 ? -15.623 -4.000  -0.754  1.00 0.00 ? 69 ASN A HB3  5  
ATOM 4951  H HD21 . ASN A 1 69 ? -15.699 -5.689  -2.896  1.00 0.00 ? 69 ASN A HD21 5  
ATOM 4952  H HD22 . ASN A 1 69 ? -16.770 -7.004  -2.566  1.00 0.00 ? 69 ASN A HD22 5  
ATOM 4953  N N    . PRO A 1 70 ? -13.080 -2.624  -1.644  1.00 0.00 ? 70 PRO A N    5  
ATOM 4954  C CA   . PRO A 1 70 ? -12.321 -1.403  -1.358  1.00 0.00 ? 70 PRO A CA   5  
ATOM 4955  C C    . PRO A 1 70 ? -12.779 -0.721  -0.072  1.00 0.00 ? 70 PRO A C    5  
ATOM 4956  O O    . PRO A 1 70 ? -13.692 -1.195  0.603   1.00 0.00 ? 70 PRO A O    5  
ATOM 4957  C CB   . PRO A 1 70 ? -12.613 -0.515  -2.568  1.00 0.00 ? 70 PRO A CB   5  
ATOM 4958  C CG   . PRO A 1 70 ? -13.938 -0.978  -3.066  1.00 0.00 ? 70 PRO A CG   5  
ATOM 4959  C CD   . PRO A 1 70 ? -13.994 -2.455  -2.787  1.00 0.00 ? 70 PRO A CD   5  
ATOM 4960  H HA   . PRO A 1 70 ? -11.261 -1.602  -1.300  1.00 0.00 ? 70 PRO A HA   5  
ATOM 4961  H HB2  . PRO A 1 70 ? -12.645 0.520   -2.259  1.00 0.00 ? 70 PRO A HB2  5  
ATOM 4962  H HB3  . PRO A 1 70 ? -11.843 -0.651  -3.312  1.00 0.00 ? 70 PRO A HB3  5  
ATOM 4963  H HG2  . PRO A 1 70 ? -14.728 -0.466  -2.537  1.00 0.00 ? 70 PRO A HG2  5  
ATOM 4964  H HG3  . PRO A 1 70 ? -14.016 -0.794  -4.127  1.00 0.00 ? 70 PRO A HG3  5  
ATOM 4965  H HD2  . PRO A 1 70 ? -14.999 -2.751  -2.525  1.00 0.00 ? 70 PRO A HD2  5  
ATOM 4966  H HD3  . PRO A 1 70 ? -13.647 -3.014  -3.644  1.00 0.00 ? 70 PRO A HD3  5  
ATOM 4967  N N    . PHE A 1 71 ? -12.136 0.394   0.259   1.00 0.00 ? 71 PHE A N    5  
ATOM 4968  C CA   . PHE A 1 71 ? -12.473 1.145   1.464   1.00 0.00 ? 71 PHE A CA   5  
ATOM 4969  C C    . PHE A 1 71 ? -12.480 2.645   1.187   1.00 0.00 ? 71 PHE A C    5  
ATOM 4970  O O    . PHE A 1 71 ? -12.568 3.456   2.110   1.00 0.00 ? 71 PHE A O    5  
ATOM 4971  C CB   . PHE A 1 71 ? -11.483 0.820   2.582   1.00 0.00 ? 71 PHE A CB   5  
ATOM 4972  C CG   . PHE A 1 71 ? -11.555 -0.607  3.043   1.00 0.00 ? 71 PHE A CG   5  
ATOM 4973  C CD1  . PHE A 1 71 ? -11.230 -1.644  2.183   1.00 0.00 ? 71 PHE A CD1  5  
ATOM 4974  C CD2  . PHE A 1 71 ? -11.948 -0.913  4.337   1.00 0.00 ? 71 PHE A CD2  5  
ATOM 4975  C CE1  . PHE A 1 71 ? -11.296 -2.959  2.604   1.00 0.00 ? 71 PHE A CE1  5  
ATOM 4976  C CE2  . PHE A 1 71 ? -12.016 -2.226  4.763   1.00 0.00 ? 71 PHE A CE2  5  
ATOM 4977  C CZ   . PHE A 1 71 ? -11.689 -3.250  3.896   1.00 0.00 ? 71 PHE A CZ   5  
ATOM 4978  H H    . PHE A 1 71 ? -11.416 0.720   -0.320  1.00 0.00 ? 71 PHE A H    5  
ATOM 4979  H HA   . PHE A 1 71 ? -13.461 0.845   1.777   1.00 0.00 ? 71 PHE A HA   5  
ATOM 4980  H HB2  . PHE A 1 71 ? -10.479 1.005   2.230   1.00 0.00 ? 71 PHE A HB2  5  
ATOM 4981  H HB3  . PHE A 1 71 ? -11.686 1.457   3.430   1.00 0.00 ? 71 PHE A HB3  5  
ATOM 4982  H HD1  . PHE A 1 71 ? -10.921 -1.418  1.173   1.00 0.00 ? 71 PHE A HD1  5  
ATOM 4983  H HD2  . PHE A 1 71 ? -12.204 -0.113  5.015   1.00 0.00 ? 71 PHE A HD2  5  
ATOM 4984  H HE1  . PHE A 1 71 ? -11.040 -3.758  1.924   1.00 0.00 ? 71 PHE A HE1  5  
ATOM 4985  H HE2  . PHE A 1 71 ? -12.324 -2.451  5.773   1.00 0.00 ? 71 PHE A HE2  5  
ATOM 4986  H HZ   . PHE A 1 71 ? -11.741 -4.277  4.227   1.00 0.00 ? 71 PHE A HZ   5  
ATOM 4987  N N    . HIS A 1 72 ? -12.390 3.009   -0.089  1.00 0.00 ? 72 HIS A N    5  
ATOM 4988  C CA   . HIS A 1 72 ? -12.390 4.412   -0.487  1.00 0.00 ? 72 HIS A CA   5  
ATOM 4989  C C    . HIS A 1 72 ? -13.795 5.000   -0.400  1.00 0.00 ? 72 HIS A C    5  
ATOM 4990  O O    . HIS A 1 72 ? -14.716 4.535   -1.071  1.00 0.00 ? 72 HIS A O    5  
ATOM 4991  C CB   . HIS A 1 72 ? -11.853 4.558   -1.912  1.00 0.00 ? 72 HIS A CB   5  
ATOM 4992  C CG   . HIS A 1 72 ? -12.018 5.936   -2.475  1.00 0.00 ? 72 HIS A CG   5  
ATOM 4993  N ND1  . HIS A 1 72 ? -12.188 7.056   -1.688  1.00 0.00 ? 72 HIS A ND1  5  
ATOM 4994  C CD2  . HIS A 1 72 ? -12.039 6.373   -3.756  1.00 0.00 ? 72 HIS A CD2  5  
ATOM 4995  C CE1  . HIS A 1 72 ? -12.307 8.121   -2.460  1.00 0.00 ? 72 HIS A CE1  5  
ATOM 4996  N NE2  . HIS A 1 72 ? -12.219 7.734   -3.719  1.00 0.00 ? 72 HIS A NE2  5  
ATOM 4997  H H    . HIS A 1 72 ? -12.325 2.317   -0.780  1.00 0.00 ? 72 HIS A H    5  
ATOM 4998  H HA   . HIS A 1 72 ? -11.744 4.949   0.190   1.00 0.00 ? 72 HIS A HA   5  
ATOM 4999  H HB2  . HIS A 1 72 ? -10.800 4.322   -1.919  1.00 0.00 ? 72 HIS A HB2  5  
ATOM 5000  H HB3  . HIS A 1 72 ? -12.375 3.869   -2.559  1.00 0.00 ? 72 HIS A HB3  5  
ATOM 5001  H HD1  . HIS A 1 72 ? -12.217 7.068   -0.708  1.00 0.00 ? 72 HIS A HD1  5  
ATOM 5002  H HD2  . HIS A 1 72 ? -11.933 5.764   -4.643  1.00 0.00 ? 72 HIS A HD2  5  
ATOM 5003  H HE1  . HIS A 1 72 ? -12.450 9.136   -2.120  1.00 0.00 ? 72 HIS A HE1  5  
ATOM 5004  H HE2  . HIS A 1 72 ? -12.362 8.310   -4.499  1.00 0.00 ? 72 HIS A HE2  5  
ATOM 5005  N N    . ALA A 1 73 ? -13.952 6.025   0.431   1.00 0.00 ? 73 ALA A N    5  
ATOM 5006  C CA   . ALA A 1 73 ? -15.245 6.676   0.605   1.00 0.00 ? 73 ALA A CA   5  
ATOM 5007  C C    . ALA A 1 73 ? -15.220 7.642   1.784   1.00 0.00 ? 73 ALA A C    5  
ATOM 5008  O O    . ALA A 1 73 ? -14.534 7.338   2.783   1.00 0.00 ? 73 ALA A O    5  
ATOM 5009  C CB   . ALA A 1 73 ? -16.337 5.635   0.796   1.00 0.00 ? 73 ALA A CB   5  
ATOM 5010  O OXT  . ALA A 1 73 ? -15.886 8.695   1.700   1.00 0.00 ? 73 ALA A OXT  5  
ATOM 5011  H H    . ALA A 1 73 ? -13.180 6.352   0.940   1.00 0.00 ? 73 ALA A H    5  
ATOM 5012  H HA   . ALA A 1 73 ? -15.462 7.230   -0.297  1.00 0.00 ? 73 ALA A HA   5  
ATOM 5013  H HB1  . ALA A 1 73 ? -16.869 5.496   -0.134  1.00 0.00 ? 73 ALA A HB1  5  
ATOM 5014  H HB2  . ALA A 1 73 ? -17.025 5.970   1.558   1.00 0.00 ? 73 ALA A HB2  5  
ATOM 5015  H HB3  . ALA A 1 73 ? -15.892 4.698   1.099   1.00 0.00 ? 73 ALA A HB3  5  
ATOM 5016  N N    . GLU A 1 1  ? -1.397  6.235   11.483  1.00 0.00 ? 1  GLU A N    6  
ATOM 5017  C CA   . GLU A 1 1  ? -0.740  4.997   11.979  1.00 0.00 ? 1  GLU A CA   6  
ATOM 5018  C C    . GLU A 1 1  ? -0.853  3.870   10.959  1.00 0.00 ? 1  GLU A C    6  
ATOM 5019  O O    . GLU A 1 1  ? 0.065   3.063   10.804  1.00 0.00 ? 1  GLU A O    6  
ATOM 5020  C CB   . GLU A 1 1  ? -1.402  4.587   13.295  1.00 0.00 ? 1  GLU A CB   6  
ATOM 5021  C CG   . GLU A 1 1  ? -0.411  4.283   14.405  1.00 0.00 ? 1  GLU A CG   6  
ATOM 5022  C CD   . GLU A 1 1  ? -0.762  3.023   15.171  1.00 0.00 ? 1  GLU A CD   6  
ATOM 5023  O OE1  . GLU A 1 1  ? -1.231  2.054   14.536  1.00 0.00 ? 1  GLU A OE1  6  
ATOM 5024  O OE2  . GLU A 1 1  ? -0.569  3.004   16.405  1.00 0.00 ? 1  GLU A OE2  6  
ATOM 5025  H H1   . GLU A 1 1  ? -1.176  6.327   10.471  1.00 0.00 ? 1  GLU A H1   6  
ATOM 5026  H H2   . GLU A 1 1  ? -1.014  7.036   12.026  1.00 0.00 ? 1  GLU A H2   6  
ATOM 5027  H H3   . GLU A 1 1  ? -2.420  6.133   11.635  1.00 0.00 ? 1  GLU A H3   6  
ATOM 5028  H HA   . GLU A 1 1  ? 0.304   5.209   12.156  1.00 0.00 ? 1  GLU A HA   6  
ATOM 5029  H HB2  . GLU A 1 1  ? -2.046  5.390   13.625  1.00 0.00 ? 1  GLU A HB2  6  
ATOM 5030  H HB3  . GLU A 1 1  ? -2.001  3.705   13.124  1.00 0.00 ? 1  GLU A HB3  6  
ATOM 5031  H HG2  . GLU A 1 1  ? 0.570   4.160   13.971  1.00 0.00 ? 1  GLU A HG2  6  
ATOM 5032  H HG3  . GLU A 1 1  ? -0.397  5.114   15.095  1.00 0.00 ? 1  GLU A HG3  6  
ATOM 5033  N N    . ALA A 1 2  ? -1.984  3.822   10.264  1.00 0.00 ? 2  ALA A N    6  
ATOM 5034  C CA   . ALA A 1 2  ? -2.220  2.798   9.256   1.00 0.00 ? 2  ALA A CA   6  
ATOM 5035  C C    . ALA A 1 2  ? -1.431  3.092   7.984   1.00 0.00 ? 2  ALA A C    6  
ATOM 5036  O O    . ALA A 1 2  ? -1.237  2.214   7.144   1.00 0.00 ? 2  ALA A O    6  
ATOM 5037  C CB   . ALA A 1 2  ? -3.707  2.698   8.949   1.00 0.00 ? 2  ALA A CB   6  
ATOM 5038  H H    . ALA A 1 2  ? -2.676  4.495   10.433  1.00 0.00 ? 2  ALA A H    6  
ATOM 5039  H HA   . ALA A 1 2  ? -1.895  1.850   9.660   1.00 0.00 ? 2  ALA A HA   6  
ATOM 5040  H HB1  . ALA A 1 2  ? -4.229  2.323   9.817   1.00 0.00 ? 2  ALA A HB1  6  
ATOM 5041  H HB2  . ALA A 1 2  ? -3.859  2.025   8.119   1.00 0.00 ? 2  ALA A HB2  6  
ATOM 5042  H HB3  . ALA A 1 2  ? -4.088  3.676   8.695   1.00 0.00 ? 2  ALA A HB3  6  
ATOM 5043  N N    . GLY A 1 3  ? -0.977  4.334   7.854   1.00 0.00 ? 3  GLY A N    6  
ATOM 5044  C CA   . GLY A 1 3  ? -0.211  4.729   6.686   1.00 0.00 ? 3  GLY A CA   6  
ATOM 5045  C C    . GLY A 1 3  ? -0.328  6.216   6.396   1.00 0.00 ? 3  GLY A C    6  
ATOM 5046  O O    . GLY A 1 3  ? 0.202   7.038   7.144   1.00 0.00 ? 3  GLY A O    6  
ATOM 5047  H H    . GLY A 1 3  ? -1.163  4.989   8.558   1.00 0.00 ? 3  GLY A H    6  
ATOM 5048  H HA2  . GLY A 1 3  ? 0.829   4.485   6.855   1.00 0.00 ? 3  GLY A HA2  6  
ATOM 5049  H HA3  . GLY A 1 3  ? -0.565  4.174   5.831   1.00 0.00 ? 3  GLY A HA3  6  
ATOM 5050  N N    . GLU A 1 4  ? -1.027  6.566   5.313   1.00 0.00 ? 4  GLU A N    6  
ATOM 5051  C CA   . GLU A 1 4  ? -1.212  7.966   4.935   1.00 0.00 ? 4  GLU A CA   6  
ATOM 5052  C C    . GLU A 1 4  ? 0.000   8.810   5.318   1.00 0.00 ? 4  GLU A C    6  
ATOM 5053  O O    . GLU A 1 4  ? -0.143  9.932   5.804   1.00 0.00 ? 4  GLU A O    6  
ATOM 5054  C CB   . GLU A 1 4  ? -2.468  8.535   5.598   1.00 0.00 ? 4  GLU A CB   6  
ATOM 5055  C CG   . GLU A 1 4  ? -3.643  7.570   5.611   1.00 0.00 ? 4  GLU A CG   6  
ATOM 5056  C CD   . GLU A 1 4  ? -4.973  8.278   5.781   1.00 0.00 ? 4  GLU A CD   6  
ATOM 5057  O OE1  . GLU A 1 4  ? -4.969  9.459   6.187   1.00 0.00 ? 4  GLU A OE1  6  
ATOM 5058  O OE2  . GLU A 1 4  ? -6.018  7.652   5.506   1.00 0.00 ? 4  GLU A OE2  6  
ATOM 5059  H H    . GLU A 1 4  ? -1.433  5.868   4.754   1.00 0.00 ? 4  GLU A H    6  
ATOM 5060  H HA   . GLU A 1 4  ? -1.335  8.004   3.864   1.00 0.00 ? 4  GLU A HA   6  
ATOM 5061  H HB2  . GLU A 1 4  ? -2.235  8.798   6.619   1.00 0.00 ? 4  GLU A HB2  6  
ATOM 5062  H HB3  . GLU A 1 4  ? -2.768  9.425   5.066   1.00 0.00 ? 4  GLU A HB3  6  
ATOM 5063  H HG2  . GLU A 1 4  ? -3.658  7.027   4.678   1.00 0.00 ? 4  GLU A HG2  6  
ATOM 5064  H HG3  . GLU A 1 4  ? -3.514  6.877   6.429   1.00 0.00 ? 4  GLU A HG3  6  
ATOM 5065  N N    . GLU A 1 5  ? 1.192   8.267   5.097   1.00 0.00 ? 5  GLU A N    6  
ATOM 5066  C CA   . GLU A 1 5  ? 2.425   8.975   5.420   1.00 0.00 ? 5  GLU A CA   6  
ATOM 5067  C C    . GLU A 1 5  ? 3.559   8.538   4.499   1.00 0.00 ? 5  GLU A C    6  
ATOM 5068  O O    . GLU A 1 5  ? 4.324   7.631   4.827   1.00 0.00 ? 5  GLU A O    6  
ATOM 5069  C CB   . GLU A 1 5  ? 2.814   8.728   6.879   1.00 0.00 ? 5  GLU A CB   6  
ATOM 5070  C CG   . GLU A 1 5  ? 1.864   9.369   7.879   1.00 0.00 ? 5  GLU A CG   6  
ATOM 5071  C CD   . GLU A 1 5  ? 2.576   9.874   9.119   1.00 0.00 ? 5  GLU A CD   6  
ATOM 5072  O OE1  . GLU A 1 5  ? 3.739   10.313  8.998   1.00 0.00 ? 5  GLU A OE1  6  
ATOM 5073  O OE2  . GLU A 1 5  ? 1.971   9.829   10.210  1.00 0.00 ? 5  GLU A OE2  6  
ATOM 5074  H H    . GLU A 1 5  ? 1.244   7.369   4.707   1.00 0.00 ? 5  GLU A H    6  
ATOM 5075  H HA   . GLU A 1 5  ? 2.248   10.031  5.277   1.00 0.00 ? 5  GLU A HA   6  
ATOM 5076  H HB2  . GLU A 1 5  ? 2.829   7.664   7.060   1.00 0.00 ? 5  GLU A HB2  6  
ATOM 5077  H HB3  . GLU A 1 5  ? 3.803   9.128   7.048   1.00 0.00 ? 5  GLU A HB3  6  
ATOM 5078  H HG2  . GLU A 1 5  ? 1.368   10.202  7.403   1.00 0.00 ? 5  GLU A HG2  6  
ATOM 5079  H HG3  . GLU A 1 5  ? 1.128   8.636   8.177   1.00 0.00 ? 5  GLU A HG3  6  
ATOM 5080  N N    . CYS A 1 6  ? 3.663   9.189   3.344   1.00 0.00 ? 6  CYS A N    6  
ATOM 5081  C CA   . CYS A 1 6  ? 4.705   8.865   2.377   1.00 0.00 ? 6  CYS A CA   6  
ATOM 5082  C C    . CYS A 1 6  ? 4.538   9.674   1.095   1.00 0.00 ? 6  CYS A C    6  
ATOM 5083  O O    . CYS A 1 6  ? 3.468   10.221  0.829   1.00 0.00 ? 6  CYS A O    6  
ATOM 5084  C CB   . CYS A 1 6  ? 4.680   7.373   2.052   1.00 0.00 ? 6  CYS A CB   6  
ATOM 5085  S SG   . CYS A 1 6  ? 5.936   6.863   0.842   1.00 0.00 ? 6  CYS A SG   6  
ATOM 5086  H H    . CYS A 1 6  ? 3.024   9.903   3.137   1.00 0.00 ? 6  CYS A H    6  
ATOM 5087  H HA   . CYS A 1 6  ? 5.658   9.110   2.822   1.00 0.00 ? 6  CYS A HA   6  
ATOM 5088  H HB2  . CYS A 1 6  ? 4.850   6.811   2.958   1.00 0.00 ? 6  CYS A HB2  6  
ATOM 5089  H HB3  . CYS A 1 6  ? 3.713   7.115   1.650   1.00 0.00 ? 6  CYS A HB3  6  
ATOM 5090  N N    . ASP A 1 7  ? 5.606   9.752   0.306   1.00 0.00 ? 7  ASP A N    6  
ATOM 5091  C CA   . ASP A 1 7  ? 5.575   10.503  -0.945  1.00 0.00 ? 7  ASP A CA   6  
ATOM 5092  C C    . ASP A 1 7  ? 6.132   9.690   -2.116  1.00 0.00 ? 7  ASP A C    6  
ATOM 5093  O O    . ASP A 1 7  ? 5.932   10.053  -3.275  1.00 0.00 ? 7  ASP A O    6  
ATOM 5094  C CB   . ASP A 1 7  ? 6.363   11.804  -0.794  1.00 0.00 ? 7  ASP A CB   6  
ATOM 5095  C CG   . ASP A 1 7  ? 5.601   12.854  -0.009  1.00 0.00 ? 7  ASP A CG   6  
ATOM 5096  O OD1  . ASP A 1 7  ? 4.554   13.321  -0.504  1.00 0.00 ? 7  ASP A OD1  6  
ATOM 5097  O OD2  . ASP A 1 7  ? 6.052   13.208  1.101   1.00 0.00 ? 7  ASP A OD2  6  
ATOM 5098  H H    . ASP A 1 7  ? 6.433   9.303   0.576   1.00 0.00 ? 7  ASP A H    6  
ATOM 5099  H HA   . ASP A 1 7  ? 4.544   10.745  -1.154  1.00 0.00 ? 7  ASP A HA   6  
ATOM 5100  H HB2  . ASP A 1 7  ? 7.290   11.599  -0.280  1.00 0.00 ? 7  ASP A HB2  6  
ATOM 5101  H HB3  . ASP A 1 7  ? 6.581   12.201  -1.775  1.00 0.00 ? 7  ASP A HB3  6  
ATOM 5102  N N    . CYS A 1 8  ? 6.836   8.598   -1.819  1.00 0.00 ? 8  CYS A N    6  
ATOM 5103  C CA   . CYS A 1 8  ? 7.417   7.761   -2.865  1.00 0.00 ? 8  CYS A CA   6  
ATOM 5104  C C    . CYS A 1 8  ? 6.352   6.991   -3.644  1.00 0.00 ? 8  CYS A C    6  
ATOM 5105  O O    . CYS A 1 8  ? 6.687   6.201   -4.529  1.00 0.00 ? 8  CYS A O    6  
ATOM 5106  C CB   . CYS A 1 8  ? 8.367   6.733   -2.281  1.00 0.00 ? 8  CYS A CB   6  
ATOM 5107  S SG   . CYS A 1 8  ? 9.900   7.361   -1.527  1.00 0.00 ? 8  CYS A SG   6  
ATOM 5108  H H    . CYS A 1 8  ? 6.976   8.352   -0.882  1.00 0.00 ? 8  CYS A H    6  
ATOM 5109  H HA   . CYS A 1 8  ? 7.961   8.399   -3.544  1.00 0.00 ? 8  CYS A HA   6  
ATOM 5110  H HB2  . CYS A 1 8  ? 7.845   6.174   -1.523  1.00 0.00 ? 8  CYS A HB2  6  
ATOM 5111  H HB3  . CYS A 1 8  ? 8.646   6.067   -3.078  1.00 0.00 ? 8  CYS A HB3  6  
ATOM 5112  N N    . GLY A 1 9  ? 5.086   7.173   -3.287  1.00 0.00 ? 9  GLY A N    6  
ATOM 5113  C CA   . GLY A 1 9  ? 4.022   6.451   -3.954  1.00 0.00 ? 9  GLY A CA   6  
ATOM 5114  C C    . GLY A 1 9  ? 3.656   5.198   -3.198  1.00 0.00 ? 9  GLY A C    6  
ATOM 5115  O O    . GLY A 1 9  ? 4.284   4.881   -2.188  1.00 0.00 ? 9  GLY A O    6  
ATOM 5116  H H    . GLY A 1 9  ? 4.874   7.770   -2.547  1.00 0.00 ? 9  GLY A H    6  
ATOM 5117  H HA2  . GLY A 1 9  ? 3.152   7.089   -4.024  1.00 0.00 ? 9  GLY A HA2  6  
ATOM 5118  H HA3  . GLY A 1 9  ? 4.344   6.181   -4.948  1.00 0.00 ? 9  GLY A HA3  6  
ATOM 5119  N N    . SER A 1 10 ? 2.643   4.481   -3.659  1.00 0.00 ? 10 SER A N    6  
ATOM 5120  C CA   . SER A 1 10 ? 2.237   3.274   -2.967  1.00 0.00 ? 10 SER A CA   6  
ATOM 5121  C C    . SER A 1 10 ? 1.871   2.137   -3.915  1.00 0.00 ? 10 SER A C    6  
ATOM 5122  O O    . SER A 1 10 ? 2.639   1.189   -4.078  1.00 0.00 ? 10 SER A O    6  
ATOM 5123  C CB   . SER A 1 10 ? 1.092   3.583   -2.003  1.00 0.00 ? 10 SER A CB   6  
ATOM 5124  O OG   . SER A 1 10 ? 1.583   4.140   -0.796  1.00 0.00 ? 10 SER A OG   6  
ATOM 5125  H H    . SER A 1 10 ? 2.160   4.770   -4.460  1.00 0.00 ? 10 SER A H    6  
ATOM 5126  H HA   . SER A 1 10 ? 3.076   2.953   -2.393  1.00 0.00 ? 10 SER A HA   6  
ATOM 5127  H HB2  . SER A 1 10 ? 0.420   4.293   -2.458  1.00 0.00 ? 10 SER A HB2  6  
ATOM 5128  H HB3  . SER A 1 10 ? 0.562   2.676   -1.778  1.00 0.00 ? 10 SER A HB3  6  
ATOM 5129  H HG   . SER A 1 10 ? 1.294   5.053   -0.724  1.00 0.00 ? 10 SER A HG   6  
ATOM 5130  N N    . PRO A 1 11 ? 0.696   2.199   -4.540  1.00 0.00 ? 11 PRO A N    6  
ATOM 5131  C CA   . PRO A 1 11 ? 0.241   1.153   -5.457  1.00 0.00 ? 11 PRO A CA   6  
ATOM 5132  C C    . PRO A 1 11 ? 1.105   1.064   -6.706  1.00 0.00 ? 11 PRO A C    6  
ATOM 5133  O O    . PRO A 1 11 ? 0.965   1.869   -7.626  1.00 0.00 ? 11 PRO A O    6  
ATOM 5134  C CB   . PRO A 1 11 ? -1.180  1.586   -5.810  1.00 0.00 ? 11 PRO A CB   6  
ATOM 5135  C CG   . PRO A 1 11 ? -1.211  3.053   -5.556  1.00 0.00 ? 11 PRO A CG   6  
ATOM 5136  C CD   . PRO A 1 11 ? -0.282  3.284   -4.401  1.00 0.00 ? 11 PRO A CD   6  
ATOM 5137  H HA   . PRO A 1 11 ? 0.215   0.188   -4.971  1.00 0.00 ? 11 PRO A HA   6  
ATOM 5138  H HB2  . PRO A 1 11 ? -1.377  1.360   -6.844  1.00 0.00 ? 11 PRO A HB2  6  
ATOM 5139  H HB3  . PRO A 1 11 ? -1.879  1.064   -5.177  1.00 0.00 ? 11 PRO A HB3  6  
ATOM 5140  H HG2  . PRO A 1 11 ? -0.864  3.586   -6.430  1.00 0.00 ? 11 PRO A HG2  6  
ATOM 5141  H HG3  . PRO A 1 11 ? -2.213  3.362   -5.299  1.00 0.00 ? 11 PRO A HG3  6  
ATOM 5142  H HD2  . PRO A 1 11 ? 0.200   4.248   -4.486  1.00 0.00 ? 11 PRO A HD2  6  
ATOM 5143  H HD3  . PRO A 1 11 ? -0.811  3.205   -3.463  1.00 0.00 ? 11 PRO A HD3  6  
ATOM 5144  N N    . GLY A 1 12 ? 2.016   0.093   -6.729  1.00 0.00 ? 12 GLY A N    6  
ATOM 5145  C CA   . GLY A 1 12 ? 2.897   -0.050  -7.873  1.00 0.00 ? 12 GLY A CA   6  
ATOM 5146  C C    . GLY A 1 12 ? 4.175   0.730   -7.672  1.00 0.00 ? 12 GLY A C    6  
ATOM 5147  O O    . GLY A 1 12 ? 5.190   0.470   -8.318  1.00 0.00 ? 12 GLY A O    6  
ATOM 5148  H H    . GLY A 1 12 ? 2.104   -0.519  -5.956  1.00 0.00 ? 12 GLY A H    6  
ATOM 5149  H HA2  . GLY A 1 12 ? 3.136   -1.095  -8.008  1.00 0.00 ? 12 GLY A HA2  6  
ATOM 5150  H HA3  . GLY A 1 12 ? 2.395   0.316   -8.756  1.00 0.00 ? 12 GLY A HA3  6  
ATOM 5151  N N    . ASN A 1 13 ? 4.117   1.676   -6.741  1.00 0.00 ? 13 ASN A N    6  
ATOM 5152  C CA   . ASN A 1 13 ? 5.261   2.504   -6.392  1.00 0.00 ? 13 ASN A CA   6  
ATOM 5153  C C    . ASN A 1 13 ? 5.489   2.416   -4.889  1.00 0.00 ? 13 ASN A C    6  
ATOM 5154  O O    . ASN A 1 13 ? 5.600   3.428   -4.198  1.00 0.00 ? 13 ASN A O    6  
ATOM 5155  C CB   . ASN A 1 13 ? 5.023   3.955   -6.812  1.00 0.00 ? 13 ASN A CB   6  
ATOM 5156  C CG   . ASN A 1 13 ? 4.801   4.096   -8.305  1.00 0.00 ? 13 ASN A CG   6  
ATOM 5157  O OD1  . ASN A 1 13 ? 5.607   3.631   -9.110  1.00 0.00 ? 13 ASN A OD1  6  
ATOM 5158  N ND2  . ASN A 1 13 ? 3.702   4.741   -8.682  1.00 0.00 ? 13 ASN A ND2  6  
ATOM 5159  H H    . ASN A 1 13 ? 3.278   1.809   -6.255  1.00 0.00 ? 13 ASN A H    6  
ATOM 5160  H HA   . ASN A 1 13 ? 6.128   2.116   -6.906  1.00 0.00 ? 13 ASN A HA   6  
ATOM 5161  H HB2  . ASN A 1 13 ? 4.150   4.333   -6.300  1.00 0.00 ? 13 ASN A HB2  6  
ATOM 5162  H HB3  . ASN A 1 13 ? 5.882   4.549   -6.536  1.00 0.00 ? 13 ASN A HB3  6  
ATOM 5163  H HD21 . ASN A 1 13 ? 3.105   5.085   -7.986  1.00 0.00 ? 13 ASN A HD21 6  
ATOM 5164  H HD22 . ASN A 1 13 ? 3.534   4.845   -9.642  1.00 0.00 ? 13 ASN A HD22 6  
ATOM 5165  N N    . PRO A 1 14 ? 5.544   1.179   -4.373  1.00 0.00 ? 14 PRO A N    6  
ATOM 5166  C CA   . PRO A 1 14 ? 5.738   0.889   -2.964  1.00 0.00 ? 14 PRO A CA   6  
ATOM 5167  C C    . PRO A 1 14 ? 6.575   1.936   -2.253  1.00 0.00 ? 14 PRO A C    6  
ATOM 5168  O O    . PRO A 1 14 ? 7.803   1.897   -2.312  1.00 0.00 ? 14 PRO A O    6  
ATOM 5169  C CB   . PRO A 1 14 ? 6.462   -0.466  -2.986  1.00 0.00 ? 14 PRO A CB   6  
ATOM 5170  C CG   . PRO A 1 14 ? 6.349   -0.979  -4.395  1.00 0.00 ? 14 PRO A CG   6  
ATOM 5171  C CD   . PRO A 1 14 ? 5.416   -0.059  -5.129  1.00 0.00 ? 14 PRO A CD   6  
ATOM 5172  H HA   . PRO A 1 14 ? 4.794   0.781   -2.452  1.00 0.00 ? 14 PRO A HA   6  
ATOM 5173  H HB2  . PRO A 1 14 ? 7.494   -0.324  -2.704  1.00 0.00 ? 14 PRO A HB2  6  
ATOM 5174  H HB3  . PRO A 1 14 ? 5.986   -1.137  -2.287  1.00 0.00 ? 14 PRO A HB3  6  
ATOM 5175  H HG2  . PRO A 1 14 ? 7.321   -0.969  -4.865  1.00 0.00 ? 14 PRO A HG2  6  
ATOM 5176  H HG3  . PRO A 1 14 ? 5.951   -1.979  -4.390  1.00 0.00 ? 14 PRO A HG3  6  
ATOM 5177  H HD2  . PRO A 1 14 ? 5.742   0.072   -6.146  1.00 0.00 ? 14 PRO A HD2  6  
ATOM 5178  H HD3  . PRO A 1 14 ? 4.403   -0.434  -5.092  1.00 0.00 ? 14 PRO A HD3  6  
ATOM 5179  N N    . CYS A 1 15 ? 5.882   2.854   -1.571  1.00 0.00 ? 15 CYS A N    6  
ATOM 5180  C CA   . CYS A 1 15 ? 6.507   3.936   -0.810  1.00 0.00 ? 15 CYS A CA   6  
ATOM 5181  C C    . CYS A 1 15 ? 8.021   3.938   -0.918  1.00 0.00 ? 15 CYS A C    6  
ATOM 5182  O O    . CYS A 1 15 ? 8.708   3.764   0.085   1.00 0.00 ? 15 CYS A O    6  
ATOM 5183  C CB   . CYS A 1 15 ? 6.108   3.853   0.664   1.00 0.00 ? 15 CYS A CB   6  
ATOM 5184  S SG   . CYS A 1 15 ? 6.757   5.213   1.682   1.00 0.00 ? 15 CYS A SG   6  
ATOM 5185  H H    . CYS A 1 15 ? 4.904   2.797   -1.575  1.00 0.00 ? 15 CYS A H    6  
ATOM 5186  H HA   . CYS A 1 15 ? 6.138   4.867   -1.210  1.00 0.00 ? 15 CYS A HA   6  
ATOM 5187  H HB2  . CYS A 1 15 ? 5.036   3.872   0.734   1.00 0.00 ? 15 CYS A HB2  6  
ATOM 5188  H HB3  . CYS A 1 15 ? 6.474   2.933   1.085   1.00 0.00 ? 15 CYS A HB3  6  
ATOM 5189  N N    . CYS A 1 16 ? 8.516   4.177   -2.135  1.00 0.00 ? 16 CYS A N    6  
ATOM 5190  C CA   . CYS A 1 16 ? 9.954   4.258   -2.415  1.00 0.00 ? 16 CYS A CA   6  
ATOM 5191  C C    . CYS A 1 16 ? 10.456  3.073   -3.232  1.00 0.00 ? 16 CYS A C    6  
ATOM 5192  O O    . CYS A 1 16 ? 10.294  1.914   -2.851  1.00 0.00 ? 16 CYS A O    6  
ATOM 5193  C CB   . CYS A 1 16 ? 10.779  4.423   -1.135  1.00 0.00 ? 16 CYS A CB   6  
ATOM 5194  S SG   . CYS A 1 16 ? 10.377  5.923   -0.160  1.00 0.00 ? 16 CYS A SG   6  
ATOM 5195  H H    . CYS A 1 16 ? 7.885   4.340   -2.876  1.00 0.00 ? 16 CYS A H    6  
ATOM 5196  H HA   . CYS A 1 16 ? 10.098  5.134   -3.012  1.00 0.00 ? 16 CYS A HA   6  
ATOM 5197  H HB2  . CYS A 1 16 ? 10.622  3.563   -0.501  1.00 0.00 ? 16 CYS A HB2  6  
ATOM 5198  H HB3  . CYS A 1 16 ? 11.823  4.475   -1.399  1.00 0.00 ? 16 CYS A HB3  6  
ATOM 5199  N N    . ASP A 1 17 ? 11.071  3.396   -4.370  1.00 0.00 ? 17 ASP A N    6  
ATOM 5200  C CA   . ASP A 1 17 ? 11.621  2.402   -5.284  1.00 0.00 ? 17 ASP A CA   6  
ATOM 5201  C C    . ASP A 1 17 ? 12.456  3.093   -6.361  1.00 0.00 ? 17 ASP A C    6  
ATOM 5202  O O    . ASP A 1 17 ? 12.092  3.096   -7.537  1.00 0.00 ? 17 ASP A O    6  
ATOM 5203  C CB   . ASP A 1 17 ? 10.497  1.590   -5.925  1.00 0.00 ? 17 ASP A CB   6  
ATOM 5204  C CG   . ASP A 1 17 ? 9.296   2.444   -6.281  1.00 0.00 ? 17 ASP A CG   6  
ATOM 5205  O OD1  . ASP A 1 17 ? 8.647   2.972   -5.354  1.00 0.00 ? 17 ASP A OD1  6  
ATOM 5206  O OD2  . ASP A 1 17 ? 9.003   2.582   -7.487  1.00 0.00 ? 17 ASP A OD2  6  
ATOM 5207  H H    . ASP A 1 17 ? 11.159  4.345   -4.601  1.00 0.00 ? 17 ASP A H    6  
ATOM 5208  H HA   . ASP A 1 17 ? 12.258  1.741   -4.716  1.00 0.00 ? 17 ASP A HA   6  
ATOM 5209  H HB2  . ASP A 1 17 ? 10.867  1.133   -6.828  1.00 0.00 ? 17 ASP A HB2  6  
ATOM 5210  H HB3  . ASP A 1 17 ? 10.180  0.820   -5.238  1.00 0.00 ? 17 ASP A HB3  6  
ATOM 5211  N N    . ALA A 1 18 ? 13.567  3.686   -5.927  1.00 0.00 ? 18 ALA A N    6  
ATOM 5212  C CA   . ALA A 1 18 ? 14.483  4.417   -6.799  1.00 0.00 ? 18 ALA A CA   6  
ATOM 5213  C C    . ALA A 1 18 ? 14.340  4.032   -8.263  1.00 0.00 ? 18 ALA A C    6  
ATOM 5214  O O    . ALA A 1 18 ? 14.332  4.895   -9.140  1.00 0.00 ? 18 ALA A O    6  
ATOM 5215  C CB   . ALA A 1 18 ? 15.918  4.200   -6.342  1.00 0.00 ? 18 ALA A CB   6  
ATOM 5216  H H    . ALA A 1 18 ? 13.777  3.637   -4.978  1.00 0.00 ? 18 ALA A H    6  
ATOM 5217  H HA   . ALA A 1 18 ? 14.263  5.469   -6.697  1.00 0.00 ? 18 ALA A HA   6  
ATOM 5218  H HB1  . ALA A 1 18 ? 16.335  3.348   -6.858  1.00 0.00 ? 18 ALA A HB1  6  
ATOM 5219  H HB2  . ALA A 1 18 ? 15.933  4.020   -5.278  1.00 0.00 ? 18 ALA A HB2  6  
ATOM 5220  H HB3  . ALA A 1 18 ? 16.503  5.079   -6.567  1.00 0.00 ? 18 ALA A HB3  6  
ATOM 5221  N N    . ALA A 1 19 ? 14.255  2.739   -8.529  1.00 0.00 ? 19 ALA A N    6  
ATOM 5222  C CA   . ALA A 1 19 ? 14.145  2.267   -9.899  1.00 0.00 ? 19 ALA A CA   6  
ATOM 5223  C C    . ALA A 1 19 ? 13.029  1.242   -10.079 1.00 0.00 ? 19 ALA A C    6  
ATOM 5224  O O    . ALA A 1 19 ? 12.487  1.093   -11.174 1.00 0.00 ? 19 ALA A O    6  
ATOM 5225  C CB   . ALA A 1 19 ? 15.474  1.679   -10.326 1.00 0.00 ? 19 ALA A CB   6  
ATOM 5226  H H    . ALA A 1 19 ? 14.288  2.092   -7.794  1.00 0.00 ? 19 ALA A H    6  
ATOM 5227  H HA   . ALA A 1 19 ? 13.940  3.119   -10.528 1.00 0.00 ? 19 ALA A HA   6  
ATOM 5228  H HB1  . ALA A 1 19 ? 15.641  0.752   -9.798  1.00 0.00 ? 19 ALA A HB1  6  
ATOM 5229  H HB2  . ALA A 1 19 ? 16.265  2.375   -10.088 1.00 0.00 ? 19 ALA A HB2  6  
ATOM 5230  H HB3  . ALA A 1 19 ? 15.462  1.494   -11.388 1.00 0.00 ? 19 ALA A HB3  6  
ATOM 5231  N N    . THR A 1 20 ? 12.692  0.537   -9.010  1.00 0.00 ? 20 THR A N    6  
ATOM 5232  C CA   . THR A 1 20 ? 11.645  -0.472  -9.063  1.00 0.00 ? 20 THR A CA   6  
ATOM 5233  C C    . THR A 1 20 ? 11.325  -0.967  -7.664  1.00 0.00 ? 20 THR A C    6  
ATOM 5234  O O    . THR A 1 20 ? 12.119  -0.778  -6.745  1.00 0.00 ? 20 THR A O    6  
ATOM 5235  C CB   . THR A 1 20 ? 12.073  -1.641  -9.951  1.00 0.00 ? 20 THR A CB   6  
ATOM 5236  O OG1  . THR A 1 20 ? 11.149  -2.710  -9.852  1.00 0.00 ? 20 THR A OG1  6  
ATOM 5237  C CG2  . THR A 1 20 ? 13.443  -2.185  -9.607  1.00 0.00 ? 20 THR A CG2  6  
ATOM 5238  H H    . THR A 1 20 ? 13.154  0.699   -8.162  1.00 0.00 ? 20 THR A H    6  
ATOM 5239  H HA   . THR A 1 20 ? 10.762  -0.014  -9.483  1.00 0.00 ? 20 THR A HA   6  
ATOM 5240  H HB   . THR A 1 20 ? 12.099  -1.309  -10.979 1.00 0.00 ? 20 THR A HB   6  
ATOM 5241  H HG1  . THR A 1 20 ? 11.252  -3.145  -9.002  1.00 0.00 ? 20 THR A HG1  6  
ATOM 5242  H HG21 . THR A 1 20 ? 14.155  -1.865  -10.352 1.00 0.00 ? 20 THR A HG21 6  
ATOM 5243  H HG22 . THR A 1 20 ? 13.406  -3.265  -9.584  1.00 0.00 ? 20 THR A HG22 6  
ATOM 5244  H HG23 . THR A 1 20 ? 13.744  -1.815  -8.638  1.00 0.00 ? 20 THR A HG23 6  
ATOM 5245  N N    . CYS A 1 21 ? 10.162  -1.589  -7.508  1.00 0.00 ? 21 CYS A N    6  
ATOM 5246  C CA   . CYS A 1 21 ? 9.731   -2.105  -6.215  1.00 0.00 ? 21 CYS A CA   6  
ATOM 5247  C C    . CYS A 1 21 ? 10.918  -2.557  -5.360  1.00 0.00 ? 21 CYS A C    6  
ATOM 5248  O O    . CYS A 1 21 ? 11.296  -3.729  -5.371  1.00 0.00 ? 21 CYS A O    6  
ATOM 5249  C CB   . CYS A 1 21 ? 8.749   -3.262  -6.423  1.00 0.00 ? 21 CYS A CB   6  
ATOM 5250  S SG   . CYS A 1 21 ? 7.151   -2.756  -7.144  1.00 0.00 ? 21 CYS A SG   6  
ATOM 5251  H H    . CYS A 1 21 ? 9.571   -1.700  -8.283  1.00 0.00 ? 21 CYS A H    6  
ATOM 5252  H HA   . CYS A 1 21 ? 9.223   -1.305  -5.701  1.00 0.00 ? 21 CYS A HA   6  
ATOM 5253  H HB2  . CYS A 1 21 ? 9.193   -3.986  -7.090  1.00 0.00 ? 21 CYS A HB2  6  
ATOM 5254  H HB3  . CYS A 1 21 ? 8.547   -3.732  -5.475  1.00 0.00 ? 21 CYS A HB3  6  
ATOM 5255  N N    . LYS A 1 22 ? 11.493  -1.613  -4.613  1.00 0.00 ? 22 LYS A N    6  
ATOM 5256  C CA   . LYS A 1 22 ? 12.628  -1.900  -3.738  1.00 0.00 ? 22 LYS A CA   6  
ATOM 5257  C C    . LYS A 1 22 ? 12.957  -0.689  -2.864  1.00 0.00 ? 22 LYS A C    6  
ATOM 5258  O O    . LYS A 1 22 ? 13.169  0.411   -3.374  1.00 0.00 ? 22 LYS A O    6  
ATOM 5259  C CB   . LYS A 1 22 ? 13.854  -2.293  -4.564  1.00 0.00 ? 22 LYS A CB   6  
ATOM 5260  C CG   . LYS A 1 22 ? 15.152  -2.255  -3.775  1.00 0.00 ? 22 LYS A CG   6  
ATOM 5261  C CD   . LYS A 1 22 ? 16.114  -3.340  -4.229  1.00 0.00 ? 22 LYS A CD   6  
ATOM 5262  C CE   . LYS A 1 22 ? 17.548  -3.001  -3.859  1.00 0.00 ? 22 LYS A CE   6  
ATOM 5263  N NZ   . LYS A 1 22 ? 18.196  -2.136  -4.883  1.00 0.00 ? 22 LYS A NZ   6  
ATOM 5264  H H    . LYS A 1 22 ? 11.138  -0.700  -4.645  1.00 0.00 ? 22 LYS A H    6  
ATOM 5265  H HA   . LYS A 1 22 ? 12.354  -2.726  -3.100  1.00 0.00 ? 22 LYS A HA   6  
ATOM 5266  H HB2  . LYS A 1 22 ? 13.715  -3.296  -4.939  1.00 0.00 ? 22 LYS A HB2  6  
ATOM 5267  H HB3  . LYS A 1 22 ? 13.945  -1.615  -5.399  1.00 0.00 ? 22 LYS A HB3  6  
ATOM 5268  H HG2  . LYS A 1 22 ? 15.620  -1.292  -3.917  1.00 0.00 ? 22 LYS A HG2  6  
ATOM 5269  H HG3  . LYS A 1 22 ? 14.930  -2.398  -2.728  1.00 0.00 ? 22 LYS A HG3  6  
ATOM 5270  H HD2  . LYS A 1 22 ? 15.841  -4.271  -3.755  1.00 0.00 ? 22 LYS A HD2  6  
ATOM 5271  H HD3  . LYS A 1 22 ? 16.043  -3.446  -5.302  1.00 0.00 ? 22 LYS A HD3  6  
ATOM 5272  H HE2  . LYS A 1 22 ? 17.549  -2.484  -2.911  1.00 0.00 ? 22 LYS A HE2  6  
ATOM 5273  H HE3  . LYS A 1 22 ? 18.110  -3.919  -3.768  1.00 0.00 ? 22 LYS A HE3  6  
ATOM 5274  H HZ1  . LYS A 1 22 ? 17.793  -1.177  -4.847  1.00 0.00 ? 22 LYS A HZ1  6  
ATOM 5275  H HZ2  . LYS A 1 22 ? 18.041  -2.529  -5.833  1.00 0.00 ? 22 LYS A HZ2  6  
ATOM 5276  H HZ3  . LYS A 1 22 ? 19.219  -2.077  -4.706  1.00 0.00 ? 22 LYS A HZ3  6  
ATOM 5277  N N    . LEU A 1 23 ? 13.000  -0.889  -1.548  1.00 0.00 ? 23 LEU A N    6  
ATOM 5278  C CA   . LEU A 1 23 ? 13.306  0.203   -0.627  1.00 0.00 ? 23 LEU A CA   6  
ATOM 5279  C C    . LEU A 1 23 ? 13.738  -0.311  0.740   1.00 0.00 ? 23 LEU A C    6  
ATOM 5280  O O    . LEU A 1 23 ? 13.384  -1.419  1.142   1.00 0.00 ? 23 LEU A O    6  
ATOM 5281  C CB   . LEU A 1 23 ? 12.086  1.105   -0.452  1.00 0.00 ? 23 LEU A CB   6  
ATOM 5282  C CG   . LEU A 1 23 ? 10.917  0.472   0.301   1.00 0.00 ? 23 LEU A CG   6  
ATOM 5283  C CD1  . LEU A 1 23 ? 9.730   1.415   0.319   1.00 0.00 ? 23 LEU A CD1  6  
ATOM 5284  C CD2  . LEU A 1 23 ? 10.539  -0.859  -0.328  1.00 0.00 ? 23 LEU A CD2  6  
ATOM 5285  H H    . LEU A 1 23 ? 12.823  -1.782  -1.191  1.00 0.00 ? 23 LEU A H    6  
ATOM 5286  H HA   . LEU A 1 23 ? 14.110  0.783   -1.053  1.00 0.00 ? 23 LEU A HA   6  
ATOM 5287  H HB2  . LEU A 1 23 ? 12.393  1.990   0.087   1.00 0.00 ? 23 LEU A HB2  6  
ATOM 5288  H HB3  . LEU A 1 23 ? 11.737  1.400   -1.428  1.00 0.00 ? 23 LEU A HB3  6  
ATOM 5289  H HG   . LEU A 1 23 ? 11.208  0.289   1.325   1.00 0.00 ? 23 LEU A HG   6  
ATOM 5290  H HD11 . LEU A 1 23 ? 8.909   0.945   0.835   1.00 0.00 ? 23 LEU A HD11 6  
ATOM 5291  H HD12 . LEU A 1 23 ? 9.436   1.646   -0.694  1.00 0.00 ? 23 LEU A HD12 6  
ATOM 5292  H HD13 . LEU A 1 23 ? 10.004  2.324   0.832   1.00 0.00 ? 23 LEU A HD13 6  
ATOM 5293  H HD21 . LEU A 1 23 ? 9.579   -1.177  0.051   1.00 0.00 ? 23 LEU A HD21 6  
ATOM 5294  H HD22 . LEU A 1 23 ? 11.286  -1.599  -0.082  1.00 0.00 ? 23 LEU A HD22 6  
ATOM 5295  H HD23 . LEU A 1 23 ? 10.483  -0.747  -1.401  1.00 0.00 ? 23 LEU A HD23 6  
ATOM 5296  N N    . ARG A 1 24 ? 14.483  0.522   1.461   1.00 0.00 ? 24 ARG A N    6  
ATOM 5297  C CA   . ARG A 1 24 ? 14.940  0.176   2.800   1.00 0.00 ? 24 ARG A CA   6  
ATOM 5298  C C    . ARG A 1 24 ? 13.873  0.551   3.822   1.00 0.00 ? 24 ARG A C    6  
ATOM 5299  O O    . ARG A 1 24 ? 13.904  0.103   4.968   1.00 0.00 ? 24 ARG A O    6  
ATOM 5300  C CB   . ARG A 1 24 ? 16.254  0.890   3.124   1.00 0.00 ? 24 ARG A CB   6  
ATOM 5301  C CG   . ARG A 1 24 ? 17.393  0.526   2.185   1.00 0.00 ? 24 ARG A CG   6  
ATOM 5302  C CD   . ARG A 1 24 ? 17.518  -0.979  2.019   1.00 0.00 ? 24 ARG A CD   6  
ATOM 5303  N NE   . ARG A 1 24 ? 18.908  -1.398  1.867   1.00 0.00 ? 24 ARG A NE   6  
ATOM 5304  C CZ   . ARG A 1 24 ? 19.544  -1.429  0.701   1.00 0.00 ? 24 ARG A CZ   6  
ATOM 5305  N NH1  . ARG A 1 24 ? 18.913  -1.071  -0.410  1.00 0.00 ? 24 ARG A NH1  6  
ATOM 5306  N NH2  . ARG A 1 24 ? 20.810  -1.817  0.643   1.00 0.00 ? 24 ARG A NH2  6  
ATOM 5307  H H    . ARG A 1 24 ? 14.711  1.401   1.091   1.00 0.00 ? 24 ARG A H    6  
ATOM 5308  H HA   . ARG A 1 24 ? 15.095  -0.889  2.832   1.00 0.00 ? 24 ARG A HA   6  
ATOM 5309  H HB2  . ARG A 1 24 ? 16.095  1.957   3.065   1.00 0.00 ? 24 ARG A HB2  6  
ATOM 5310  H HB3  . ARG A 1 24 ? 16.550  0.634   4.130   1.00 0.00 ? 24 ARG A HB3  6  
ATOM 5311  H HG2  . ARG A 1 24 ? 17.206  0.970   1.219   1.00 0.00 ? 24 ARG A HG2  6  
ATOM 5312  H HG3  . ARG A 1 24 ? 18.317  0.913   2.590   1.00 0.00 ? 24 ARG A HG3  6  
ATOM 5313  H HD2  . ARG A 1 24 ? 17.101  -1.461  2.891   1.00 0.00 ? 24 ARG A HD2  6  
ATOM 5314  H HD3  . ARG A 1 24 ? 16.963  -1.279  1.143   1.00 0.00 ? 24 ARG A HD3  6  
ATOM 5315  H HE   . ARG A 1 24 ? 19.392  -1.668  2.675   1.00 0.00 ? 24 ARG A HE   6  
ATOM 5316  H HH11 . ARG A 1 24 ? 17.958  -0.777  -0.370  1.00 0.00 ? 24 ARG A HH11 6  
ATOM 5317  H HH12 . ARG A 1 24 ? 19.392  -1.094  -1.287  1.00 0.00 ? 24 ARG A HH12 6  
ATOM 5318  H HH21 . ARG A 1 24 ? 21.288  -2.088  1.479   1.00 0.00 ? 24 ARG A HH21 6  
ATOM 5319  H HH22 . ARG A 1 24 ? 21.287  -1.841  -0.235  1.00 0.00 ? 24 ARG A HH22 6  
ATOM 5320  N N    . GLN A 1 25 ? 12.921  1.368   3.383   1.00 0.00 ? 25 GLN A N    6  
ATOM 5321  C CA   . GLN A 1 25 ? 11.821  1.806   4.233   1.00 0.00 ? 25 GLN A CA   6  
ATOM 5322  C C    . GLN A 1 25 ? 10.534  1.110   3.809   1.00 0.00 ? 25 GLN A C    6  
ATOM 5323  O O    . GLN A 1 25 ? 9.633   1.735   3.248   1.00 0.00 ? 25 GLN A O    6  
ATOM 5324  C CB   . GLN A 1 25 ? 11.653  3.324   4.153   1.00 0.00 ? 25 GLN A CB   6  
ATOM 5325  C CG   . GLN A 1 25 ? 11.284  3.964   5.481   1.00 0.00 ? 25 GLN A CG   6  
ATOM 5326  C CD   . GLN A 1 25 ? 10.308  3.122   6.280   1.00 0.00 ? 25 GLN A CD   6  
ATOM 5327  O OE1  . GLN A 1 25 ? 9.096   3.330   6.219   1.00 0.00 ? 25 GLN A OE1  6  
ATOM 5328  N NE2  . GLN A 1 25 ? 10.833  2.164   7.035   1.00 0.00 ? 25 GLN A NE2  6  
ATOM 5329  H H    . GLN A 1 25 ? 12.952  1.675   2.454   1.00 0.00 ? 25 GLN A H    6  
ATOM 5330  H HA   . GLN A 1 25 ? 12.053  1.526   5.250   1.00 0.00 ? 25 GLN A HA   6  
ATOM 5331  H HB2  . GLN A 1 25 ? 12.580  3.761   3.813   1.00 0.00 ? 25 GLN A HB2  6  
ATOM 5332  H HB3  . GLN A 1 25 ? 10.875  3.552   3.440   1.00 0.00 ? 25 GLN A HB3  6  
ATOM 5333  H HG2  . GLN A 1 25 ? 12.183  4.096   6.065   1.00 0.00 ? 25 GLN A HG2  6  
ATOM 5334  H HG3  . GLN A 1 25 ? 10.834  4.927   5.290   1.00 0.00 ? 25 GLN A HG3  6  
ATOM 5335  H HE21 . GLN A 1 25 ? 11.807  2.056   7.035   1.00 0.00 ? 25 GLN A HE21 6  
ATOM 5336  H HE22 . GLN A 1 25 ? 10.225  1.604   7.562   1.00 0.00 ? 25 GLN A HE22 6  
ATOM 5337  N N    . GLY A 1 26 ? 10.482  -0.193  4.068   1.00 0.00 ? 26 GLY A N    6  
ATOM 5338  C CA   . GLY A 1 26 ? 9.335   -1.010  3.708   1.00 0.00 ? 26 GLY A CA   6  
ATOM 5339  C C    . GLY A 1 26 ? 8.061   -0.226  3.451   1.00 0.00 ? 26 GLY A C    6  
ATOM 5340  O O    . GLY A 1 26 ? 7.461   0.330   4.371   1.00 0.00 ? 26 GLY A O    6  
ATOM 5341  H H    . GLY A 1 26 ? 11.251  -0.617  4.504   1.00 0.00 ? 26 GLY A H    6  
ATOM 5342  H HA2  . GLY A 1 26 ? 9.579   -1.561  2.812   1.00 0.00 ? 26 GLY A HA2  6  
ATOM 5343  H HA3  . GLY A 1 26 ? 9.153   -1.715  4.504   1.00 0.00 ? 26 GLY A HA3  6  
ATOM 5344  N N    . ALA A 1 27 ? 7.653   -0.198  2.187   1.00 0.00 ? 27 ALA A N    6  
ATOM 5345  C CA   . ALA A 1 27 ? 6.451   0.496   1.761   1.00 0.00 ? 27 ALA A CA   6  
ATOM 5346  C C    . ALA A 1 27 ? 5.198   -0.359  1.985   1.00 0.00 ? 27 ALA A C    6  
ATOM 5347  O O    . ALA A 1 27 ? 4.173   -0.145  1.339   1.00 0.00 ? 27 ALA A O    6  
ATOM 5348  C CB   . ALA A 1 27 ? 6.581   0.856   0.286   1.00 0.00 ? 27 ALA A CB   6  
ATOM 5349  H H    . ALA A 1 27 ? 8.180   -0.658  1.514   1.00 0.00 ? 27 ALA A H    6  
ATOM 5350  H HA   . ALA A 1 27 ? 6.371   1.410   2.327   1.00 0.00 ? 27 ALA A HA   6  
ATOM 5351  H HB1  . ALA A 1 27 ? 5.639   1.236   -0.080  1.00 0.00 ? 27 ALA A HB1  6  
ATOM 5352  H HB2  . ALA A 1 27 ? 6.858   -0.021  -0.279  1.00 0.00 ? 27 ALA A HB2  6  
ATOM 5353  H HB3  . ALA A 1 27 ? 7.343   1.614   0.162   1.00 0.00 ? 27 ALA A HB3  6  
ATOM 5354  N N    . GLN A 1 28 ? 5.288   -1.338  2.890   1.00 0.00 ? 28 GLN A N    6  
ATOM 5355  C CA   . GLN A 1 28 ? 4.160   -2.227  3.172   1.00 0.00 ? 28 GLN A CA   6  
ATOM 5356  C C    . GLN A 1 28 ? 2.906   -1.455  3.538   1.00 0.00 ? 28 GLN A C    6  
ATOM 5357  O O    . GLN A 1 28 ? 2.798   -0.912  4.637   1.00 0.00 ? 28 GLN A O    6  
ATOM 5358  C CB   . GLN A 1 28 ? 4.485   -3.182  4.313   1.00 0.00 ? 28 GLN A CB   6  
ATOM 5359  C CG   . GLN A 1 28 ? 5.934   -3.595  4.369   1.00 0.00 ? 28 GLN A CG   6  
ATOM 5360  C CD   . GLN A 1 28 ? 6.693   -2.926  5.497   1.00 0.00 ? 28 GLN A CD   6  
ATOM 5361  O OE1  . GLN A 1 28 ? 7.213   -1.821  5.342   1.00 0.00 ? 28 GLN A OE1  6  
ATOM 5362  N NE2  . GLN A 1 28 ? 6.762   -3.595  6.642   1.00 0.00 ? 28 GLN A NE2  6  
ATOM 5363  H H    . GLN A 1 28 ? 6.130   -1.473  3.367   1.00 0.00 ? 28 GLN A H    6  
ATOM 5364  H HA   . GLN A 1 28 ? 3.968   -2.804  2.281   1.00 0.00 ? 28 GLN A HA   6  
ATOM 5365  H HB2  . GLN A 1 28 ? 4.232   -2.707  5.248   1.00 0.00 ? 28 GLN A HB2  6  
ATOM 5366  H HB3  . GLN A 1 28 ? 3.887   -4.072  4.198   1.00 0.00 ? 28 GLN A HB3  6  
ATOM 5367  H HG2  . GLN A 1 28 ? 5.972   -4.663  4.511   1.00 0.00 ? 28 GLN A HG2  6  
ATOM 5368  H HG3  . GLN A 1 28 ? 6.401   -3.335  3.432   1.00 0.00 ? 28 GLN A HG3  6  
ATOM 5369  H HE21 . GLN A 1 28 ? 6.325   -4.470  6.694   1.00 0.00 ? 28 GLN A HE21 6  
ATOM 5370  H HE22 . GLN A 1 28 ? 7.249   -3.186  7.389   1.00 0.00 ? 28 GLN A HE22 6  
ATOM 5371  N N    . CYS A 1 29 ? 1.959   -1.413  2.618   1.00 0.00 ? 29 CYS A N    6  
ATOM 5372  C CA   . CYS A 1 29 ? 0.711   -0.705  2.864   1.00 0.00 ? 29 CYS A CA   6  
ATOM 5373  C C    . CYS A 1 29 ? 1.038   0.678   3.387   1.00 0.00 ? 29 CYS A C    6  
ATOM 5374  O O    . CYS A 1 29 ? 0.393   1.186   4.304   1.00 0.00 ? 29 CYS A O    6  
ATOM 5375  C CB   . CYS A 1 29 ? -0.150  -1.459  3.884   1.00 0.00 ? 29 CYS A CB   6  
ATOM 5376  S SG   . CYS A 1 29 ? -0.829  -3.038  3.279   1.00 0.00 ? 29 CYS A SG   6  
ATOM 5377  H H    . CYS A 1 29 ? 2.108   -1.857  1.761   1.00 0.00 ? 29 CYS A H    6  
ATOM 5378  H HA   . CYS A 1 29 ? 0.176   -0.622  1.931   1.00 0.00 ? 29 CYS A HA   6  
ATOM 5379  H HB2  . CYS A 1 29 ? 0.449   -1.675  4.756   1.00 0.00 ? 29 CYS A HB2  6  
ATOM 5380  H HB3  . CYS A 1 29 ? -0.981  -0.832  4.173   1.00 0.00 ? 29 CYS A HB3  6  
ATOM 5381  N N    . ALA A 1 30 ? 2.065   1.270   2.799   1.00 0.00 ? 30 ALA A N    6  
ATOM 5382  C CA   . ALA A 1 30 ? 2.515   2.596   3.205   1.00 0.00 ? 30 ALA A CA   6  
ATOM 5383  C C    . ALA A 1 30 ? 1.398   3.612   3.016   1.00 0.00 ? 30 ALA A C    6  
ATOM 5384  O O    . ALA A 1 30 ? 0.235   3.298   3.268   1.00 0.00 ? 30 ALA A O    6  
ATOM 5385  C CB   . ALA A 1 30 ? 3.751   2.991   2.419   1.00 0.00 ? 30 ALA A CB   6  
ATOM 5386  H H    . ALA A 1 30 ? 2.534   0.794   2.072   1.00 0.00 ? 30 ALA A H    6  
ATOM 5387  H HA   . ALA A 1 30 ? 2.778   2.547   4.250   1.00 0.00 ? 30 ALA A HA   6  
ATOM 5388  H HB1  . ALA A 1 30 ? 4.119   3.940   2.779   1.00 0.00 ? 30 ALA A HB1  6  
ATOM 5389  H HB2  . ALA A 1 30 ? 3.496   3.076   1.373   1.00 0.00 ? 30 ALA A HB2  6  
ATOM 5390  H HB3  . ALA A 1 30 ? 4.514   2.238   2.544   1.00 0.00 ? 30 ALA A HB3  6  
ATOM 5391  N N    . GLU A 1 31 ? 1.729   4.821   2.536   1.00 0.00 ? 31 GLU A N    6  
ATOM 5392  C CA   . GLU A 1 31 ? 0.696   5.826   2.289   1.00 0.00 ? 31 GLU A CA   6  
ATOM 5393  C C    . GLU A 1 31 ? -0.486  5.126   1.651   1.00 0.00 ? 31 GLU A C    6  
ATOM 5394  O O    . GLU A 1 31 ? -1.646  5.484   1.858   1.00 0.00 ? 31 GLU A O    6  
ATOM 5395  C CB   . GLU A 1 31 ? 1.216   6.931   1.366   1.00 0.00 ? 31 GLU A CB   6  
ATOM 5396  C CG   . GLU A 1 31 ? 0.124   7.855   0.851   1.00 0.00 ? 31 GLU A CG   6  
ATOM 5397  C CD   . GLU A 1 31 ? 0.204   9.243   1.457   1.00 0.00 ? 31 GLU A CD   6  
ATOM 5398  O OE1  . GLU A 1 31 ? 0.077   9.359   2.694   1.00 0.00 ? 31 GLU A OE1  6  
ATOM 5399  O OE2  . GLU A 1 31 ? 0.395   10.213  0.694   1.00 0.00 ? 31 GLU A OE2  6  
ATOM 5400  H H    . GLU A 1 31 ? 2.662   5.023   2.322   1.00 0.00 ? 31 GLU A H    6  
ATOM 5401  H HA   . GLU A 1 31 ? 0.392   6.248   3.234   1.00 0.00 ? 31 GLU A HA   6  
ATOM 5402  H HB2  . GLU A 1 31 ? 1.934   7.528   1.907   1.00 0.00 ? 31 GLU A HB2  6  
ATOM 5403  H HB3  . GLU A 1 31 ? 1.704   6.477   0.516   1.00 0.00 ? 31 GLU A HB3  6  
ATOM 5404  H HG2  . GLU A 1 31 ? 0.219   7.941   -0.221  1.00 0.00 ? 31 GLU A HG2  6  
ATOM 5405  H HG3  . GLU A 1 31 ? -0.837  7.427   1.094   1.00 0.00 ? 31 GLU A HG3  6  
ATOM 5406  N N    . GLY A 1 32 ? -0.151  4.085   0.903   1.00 0.00 ? 32 GLY A N    6  
ATOM 5407  C CA   . GLY A 1 32 ? -1.133  3.266   0.252   1.00 0.00 ? 32 GLY A CA   6  
ATOM 5408  C C    . GLY A 1 32 ? -0.666  1.832   0.191   1.00 0.00 ? 32 GLY A C    6  
ATOM 5409  O O    . GLY A 1 32 ? -0.207  1.282   1.190   1.00 0.00 ? 32 GLY A O    6  
ATOM 5410  H H    . GLY A 1 32 ? 0.796   3.854   0.812   1.00 0.00 ? 32 GLY A H    6  
ATOM 5411  H HA2  . GLY A 1 32 ? -2.054  3.315   0.811   1.00 0.00 ? 32 GLY A HA2  6  
ATOM 5412  H HA3  . GLY A 1 32 ? -1.297  3.630   -0.751  1.00 0.00 ? 32 GLY A HA3  6  
ATOM 5413  N N    . LEU A 1 33 ? -0.772  1.227   -0.977  1.00 0.00 ? 33 LEU A N    6  
ATOM 5414  C CA   . LEU A 1 33 ? -0.345  -0.150  -1.158  1.00 0.00 ? 33 LEU A CA   6  
ATOM 5415  C C    . LEU A 1 33 ? 1.149   -0.228  -1.548  1.00 0.00 ? 33 LEU A C    6  
ATOM 5416  O O    . LEU A 1 33 ? 1.788   0.799   -1.765  1.00 0.00 ? 33 LEU A O    6  
ATOM 5417  C CB   . LEU A 1 33 ? -1.222  -0.795  -2.230  1.00 0.00 ? 33 LEU A CB   6  
ATOM 5418  C CG   . LEU A 1 33 ? -1.286  -2.314  -2.197  1.00 0.00 ? 33 LEU A CG   6  
ATOM 5419  C CD1  . LEU A 1 33 ? -0.225  -2.883  -3.112  1.00 0.00 ? 33 LEU A CD1  6  
ATOM 5420  C CD2  . LEU A 1 33 ? -1.127  -2.833  -0.768  1.00 0.00 ? 33 LEU A CD2  6  
ATOM 5421  H H    . LEU A 1 33 ? -1.146  1.720   -1.739  1.00 0.00 ? 33 LEU A H    6  
ATOM 5422  H HA   . LEU A 1 33 ? -0.497  -0.660  -0.220  1.00 0.00 ? 33 LEU A HA   6  
ATOM 5423  H HB2  . LEU A 1 33 ? -2.226  -0.412  -2.119  1.00 0.00 ? 33 LEU A HB2  6  
ATOM 5424  H HB3  . LEU A 1 33 ? -0.847  -0.495  -3.197  1.00 0.00 ? 33 LEU A HB3  6  
ATOM 5425  H HG   . LEU A 1 33 ? -2.247  -2.634  -2.568  1.00 0.00 ? 33 LEU A HG   6  
ATOM 5426  H HD11 . LEU A 1 33 ? 0.350   -2.074  -3.540  1.00 0.00 ? 33 LEU A HD11 6  
ATOM 5427  H HD12 . LEU A 1 33 ? -0.693  -3.448  -3.900  1.00 0.00 ? 33 LEU A HD12 6  
ATOM 5428  H HD13 . LEU A 1 33 ? 0.427   -3.521  -2.545  1.00 0.00 ? 33 LEU A HD13 6  
ATOM 5429  H HD21 . LEU A 1 33 ? -1.094  -3.912  -0.778  1.00 0.00 ? 33 LEU A HD21 6  
ATOM 5430  H HD22 . LEU A 1 33 ? -1.966  -2.505  -0.171  1.00 0.00 ? 33 LEU A HD22 6  
ATOM 5431  H HD23 . LEU A 1 33 ? -0.215  -2.451  -0.338  1.00 0.00 ? 33 LEU A HD23 6  
ATOM 5432  N N    . CYS A 1 34 ? 1.701   -1.451  -1.634  1.00 0.00 ? 34 CYS A N    6  
ATOM 5433  C CA   . CYS A 1 34 ? 3.110   -1.657  -2.001  1.00 0.00 ? 34 CYS A CA   6  
ATOM 5434  C C    . CYS A 1 34 ? 3.252   -2.796  -3.006  1.00 0.00 ? 34 CYS A C    6  
ATOM 5435  O O    . CYS A 1 34 ? 2.260   -3.312  -3.515  1.00 0.00 ? 34 CYS A O    6  
ATOM 5436  C CB   . CYS A 1 34 ? 3.971   -1.912  -0.748  1.00 0.00 ? 34 CYS A CB   6  
ATOM 5437  S SG   . CYS A 1 34 ? 4.658   -3.598  -0.540  1.00 0.00 ? 34 CYS A SG   6  
ATOM 5438  H H    . CYS A 1 34 ? 1.152   -2.226  -1.448  1.00 0.00 ? 34 CYS A H    6  
ATOM 5439  H HA   . CYS A 1 34 ? 3.452   -0.751  -2.475  1.00 0.00 ? 34 CYS A HA   6  
ATOM 5440  H HB2  . CYS A 1 34 ? 4.804   -1.239  -0.768  1.00 0.00 ? 34 CYS A HB2  6  
ATOM 5441  H HB3  . CYS A 1 34 ? 3.367   -1.706  0.119   1.00 0.00 ? 34 CYS A HB3  6  
ATOM 5442  N N    . CYS A 1 35 ? 4.488   -3.185  -3.296  1.00 0.00 ? 35 CYS A N    6  
ATOM 5443  C CA   . CYS A 1 35 ? 4.726   -4.261  -4.246  1.00 0.00 ? 35 CYS A CA   6  
ATOM 5444  C C    . CYS A 1 35 ? 6.060   -4.959  -3.999  1.00 0.00 ? 35 CYS A C    6  
ATOM 5445  O O    . CYS A 1 35 ? 6.189   -6.168  -4.192  1.00 0.00 ? 35 CYS A O    6  
ATOM 5446  C CB   . CYS A 1 35 ? 4.660   -3.713  -5.686  1.00 0.00 ? 35 CYS A CB   6  
ATOM 5447  S SG   . CYS A 1 35 ? 5.935   -4.353  -6.831  1.00 0.00 ? 35 CYS A SG   6  
ATOM 5448  H H    . CYS A 1 35 ? 5.246   -2.741  -2.865  1.00 0.00 ? 35 CYS A H    6  
ATOM 5449  H HA   . CYS A 1 35 ? 3.942   -4.971  -4.107  1.00 0.00 ? 35 CYS A HA   6  
ATOM 5450  H HB2  . CYS A 1 35 ? 3.699   -3.959  -6.109  1.00 0.00 ? 35 CYS A HB2  6  
ATOM 5451  H HB3  . CYS A 1 35 ? 4.762   -2.638  -5.655  1.00 0.00 ? 35 CYS A HB3  6  
ATOM 5452  N N    . ASP A 1 36 ? 7.048   -4.183  -3.608  1.00 0.00 ? 36 ASP A N    6  
ATOM 5453  C CA   . ASP A 1 36 ? 8.387   -4.696  -3.368  1.00 0.00 ? 36 ASP A CA   6  
ATOM 5454  C C    . ASP A 1 36 ? 8.457   -5.576  -2.130  1.00 0.00 ? 36 ASP A C    6  
ATOM 5455  O O    . ASP A 1 36 ? 7.440   -5.881  -1.503  1.00 0.00 ? 36 ASP A O    6  
ATOM 5456  C CB   . ASP A 1 36 ? 9.365   -3.529  -3.249  1.00 0.00 ? 36 ASP A CB   6  
ATOM 5457  C CG   . ASP A 1 36 ? 9.336   -2.853  -1.896  1.00 0.00 ? 36 ASP A CG   6  
ATOM 5458  O OD1  . ASP A 1 36 ? 10.009  -3.349  -0.969  1.00 0.00 ? 36 ASP A OD1  6  
ATOM 5459  O OD2  . ASP A 1 36 ? 8.644   -1.820  -1.766  1.00 0.00 ? 36 ASP A OD2  6  
ATOM 5460  H H    . ASP A 1 36 ? 6.879   -3.231  -3.498  1.00 0.00 ? 36 ASP A H    6  
ATOM 5461  H HA   . ASP A 1 36 ? 8.666   -5.290  -4.225  1.00 0.00 ? 36 ASP A HA   6  
ATOM 5462  H HB2  . ASP A 1 36 ? 10.365  -3.886  -3.425  1.00 0.00 ? 36 ASP A HB2  6  
ATOM 5463  H HB3  . ASP A 1 36 ? 9.110   -2.793  -3.992  1.00 0.00 ? 36 ASP A HB3  6  
ATOM 5464  N N    . GLN A 1 37 ? 9.675   -5.978  -1.780  1.00 0.00 ? 37 GLN A N    6  
ATOM 5465  C CA   . GLN A 1 37 ? 9.893   -6.815  -0.615  1.00 0.00 ? 37 GLN A CA   6  
ATOM 5466  C C    . GLN A 1 37 ? 9.165   -6.234  0.587   1.00 0.00 ? 37 GLN A C    6  
ATOM 5467  O O    . GLN A 1 37 ? 8.880   -6.944  1.551   1.00 0.00 ? 37 GLN A O    6  
ATOM 5468  C CB   . GLN A 1 37 ? 11.390  -6.938  -0.320  1.00 0.00 ? 37 GLN A CB   6  
ATOM 5469  C CG   . GLN A 1 37 ? 12.161  -7.684  -1.397  1.00 0.00 ? 37 GLN A CG   6  
ATOM 5470  C CD   . GLN A 1 37 ? 11.396  -8.875  -1.941  1.00 0.00 ? 37 GLN A CD   6  
ATOM 5471  O OE1  . GLN A 1 37 ? 10.895  -8.845  -3.065  1.00 0.00 ? 37 GLN A OE1  6  
ATOM 5472  N NE2  . GLN A 1 37 ? 11.303  -9.933  -1.144  1.00 0.00 ? 37 GLN A NE2  6  
ATOM 5473  H H    . GLN A 1 37 ? 10.443  -5.699  -2.318  1.00 0.00 ? 37 GLN A H    6  
ATOM 5474  H HA   . GLN A 1 37 ? 9.493   -7.793  -0.830  1.00 0.00 ? 37 GLN A HA   6  
ATOM 5475  H HB2  . GLN A 1 37 ? 11.809  -5.947  -0.229  1.00 0.00 ? 37 GLN A HB2  6  
ATOM 5476  H HB3  . GLN A 1 37 ? 11.519  -7.463  0.615   1.00 0.00 ? 37 GLN A HB3  6  
ATOM 5477  H HG2  . GLN A 1 37 ? 12.365  -7.006  -2.211  1.00 0.00 ? 37 GLN A HG2  6  
ATOM 5478  H HG3  . GLN A 1 37 ? 13.093  -8.034  -0.977  1.00 0.00 ? 37 GLN A HG3  6  
ATOM 5479  H HE21 . GLN A 1 37 ? 11.727  -9.886  -0.261  1.00 0.00 ? 37 GLN A HE21 6  
ATOM 5480  H HE22 . GLN A 1 37 ? 10.815  -10.717 -1.471  1.00 0.00 ? 37 GLN A HE22 6  
ATOM 5481  N N    . CYS A 1 38 ? 8.873   -4.931  0.509   1.00 0.00 ? 38 CYS A N    6  
ATOM 5482  C CA   . CYS A 1 38 ? 8.174   -4.214  1.569   1.00 0.00 ? 38 CYS A CA   6  
ATOM 5483  C C    . CYS A 1 38 ? 7.350   -5.164  2.415   1.00 0.00 ? 38 CYS A C    6  
ATOM 5484  O O    . CYS A 1 38 ? 7.625   -5.343  3.600   1.00 0.00 ? 38 CYS A O    6  
ATOM 5485  C CB   . CYS A 1 38 ? 7.269   -3.106  0.985   1.00 0.00 ? 38 CYS A CB   6  
ATOM 5486  S SG   . CYS A 1 38 ? 6.673   -3.396  -0.717  1.00 0.00 ? 38 CYS A SG   6  
ATOM 5487  H H    . CYS A 1 38 ? 9.139   -4.440  -0.285  1.00 0.00 ? 38 CYS A H    6  
ATOM 5488  H HA   . CYS A 1 38 ? 8.919   -3.753  2.200   1.00 0.00 ? 38 CYS A HA   6  
ATOM 5489  H HB2  . CYS A 1 38 ? 6.401   -2.985  1.614   1.00 0.00 ? 38 CYS A HB2  6  
ATOM 5490  H HB3  . CYS A 1 38 ? 7.821   -2.184  0.975   1.00 0.00 ? 38 CYS A HB3  6  
ATOM 5491  N N    . ARG A 1 39 ? 6.348   -5.766  1.784   1.00 0.00 ? 39 ARG A N    6  
ATOM 5492  C CA   . ARG A 1 39 ? 5.447   -6.708  2.454   1.00 0.00 ? 39 ARG A CA   6  
ATOM 5493  C C    . ARG A 1 39 ? 4.147   -6.003  2.830   1.00 0.00 ? 39 ARG A C    6  
ATOM 5494  O O    . ARG A 1 39 ? 3.829   -4.954  2.270   1.00 0.00 ? 39 ARG A O    6  
ATOM 5495  C CB   . ARG A 1 39 ? 6.098   -7.327  3.695   1.00 0.00 ? 39 ARG A CB   6  
ATOM 5496  C CG   . ARG A 1 39 ? 5.584   -8.720  4.022   1.00 0.00 ? 39 ARG A CG   6  
ATOM 5497  C CD   . ARG A 1 39 ? 6.724   -9.697  4.257   1.00 0.00 ? 39 ARG A CD   6  
ATOM 5498  N NE   . ARG A 1 39 ? 6.266   -10.924 4.903   1.00 0.00 ? 39 ARG A NE   6  
ATOM 5499  C CZ   . ARG A 1 39 ? 7.048   -11.702 5.643   1.00 0.00 ? 39 ARG A CZ   6  
ATOM 5500  N NH1  . ARG A 1 39 ? 8.321   -11.382 5.827   1.00 0.00 ? 39 ARG A NH1  6  
ATOM 5501  N NH2  . ARG A 1 39 ? 6.558   -12.802 6.199   1.00 0.00 ? 39 ARG A NH2  6  
ATOM 5502  H H    . ARG A 1 39 ? 6.209   -5.567  0.827   1.00 0.00 ? 39 ARG A H    6  
ATOM 5503  H HA   . ARG A 1 39 ? 5.217   -7.495  1.749   1.00 0.00 ? 39 ARG A HA   6  
ATOM 5504  H HB2  . ARG A 1 39 ? 7.164   -7.390  3.535   1.00 0.00 ? 39 ARG A HB2  6  
ATOM 5505  H HB3  . ARG A 1 39 ? 5.908   -6.688  4.545   1.00 0.00 ? 39 ARG A HB3  6  
ATOM 5506  H HG2  . ARG A 1 39 ? 4.977   -8.669  4.914   1.00 0.00 ? 39 ARG A HG2  6  
ATOM 5507  H HG3  . ARG A 1 39 ? 4.983   -9.073  3.196   1.00 0.00 ? 39 ARG A HG3  6  
ATOM 5508  H HD2  . ARG A 1 39 ? 7.170   -9.947  3.306   1.00 0.00 ? 39 ARG A HD2  6  
ATOM 5509  H HD3  . ARG A 1 39 ? 7.462   -9.223  4.887   1.00 0.00 ? 39 ARG A HD3  6  
ATOM 5510  H HE   . ARG A 1 39 ? 5.327   -11.179 4.780   1.00 0.00 ? 39 ARG A HE   6  
ATOM 5511  H HH11 . ARG A 1 39 ? 8.693   -10.553 5.409   1.00 0.00 ? 39 ARG A HH11 6  
ATOM 5512  H HH12 . ARG A 1 39 ? 8.909   -11.969 6.383   1.00 0.00 ? 39 ARG A HH12 6  
ATOM 5513  H HH21 . ARG A 1 39 ? 5.598   -13.046 6.062   1.00 0.00 ? 39 ARG A HH21 6  
ATOM 5514  H HH22 . ARG A 1 39 ? 7.148   -13.387 6.755   1.00 0.00 ? 39 ARG A HH22 6  
ATOM 5515  N N    . PHE A 1 40 ? 3.380   -6.578  3.755   1.00 0.00 ? 40 PHE A N    6  
ATOM 5516  C CA   . PHE A 1 40 ? 2.110   -5.973  4.146   1.00 0.00 ? 40 PHE A CA   6  
ATOM 5517  C C    . PHE A 1 40 ? 1.648   -6.424  5.527   1.00 0.00 ? 40 PHE A C    6  
ATOM 5518  O O    . PHE A 1 40 ? 2.154   -7.397  6.086   1.00 0.00 ? 40 PHE A O    6  
ATOM 5519  C CB   . PHE A 1 40 ? 1.057   -6.292  3.089   1.00 0.00 ? 40 PHE A CB   6  
ATOM 5520  C CG   . PHE A 1 40 ? 1.586   -6.085  1.704   1.00 0.00 ? 40 PHE A CG   6  
ATOM 5521  C CD1  . PHE A 1 40 ? 2.294   -7.090  1.062   1.00 0.00 ? 40 PHE A CD1  6  
ATOM 5522  C CD2  . PHE A 1 40 ? 1.417   -4.873  1.059   1.00 0.00 ? 40 PHE A CD2  6  
ATOM 5523  C CE1  . PHE A 1 40 ? 2.816   -6.890  -0.193  1.00 0.00 ? 40 PHE A CE1  6  
ATOM 5524  C CE2  . PHE A 1 40 ? 1.942   -4.670  -0.192  1.00 0.00 ? 40 PHE A CE2  6  
ATOM 5525  C CZ   . PHE A 1 40 ? 2.642   -5.678  -0.820  1.00 0.00 ? 40 PHE A CZ   6  
ATOM 5526  H H    . PHE A 1 40 ? 3.661   -7.422  4.164   1.00 0.00 ? 40 PHE A H    6  
ATOM 5527  H HA   . PHE A 1 40 ? 2.253   -4.905  4.170   1.00 0.00 ? 40 PHE A HA   6  
ATOM 5528  H HB2  . PHE A 1 40 ? 0.750   -7.323  3.186   1.00 0.00 ? 40 PHE A HB2  6  
ATOM 5529  H HB3  . PHE A 1 40 ? 0.203   -5.645  3.225   1.00 0.00 ? 40 PHE A HB3  6  
ATOM 5530  H HD1  . PHE A 1 40 ? 2.430   -8.039  1.551   1.00 0.00 ? 40 PHE A HD1  6  
ATOM 5531  H HD2  . PHE A 1 40 ? 0.869   -4.079  1.543   1.00 0.00 ? 40 PHE A HD2  6  
ATOM 5532  H HE1  . PHE A 1 40 ? 3.368   -7.679  -0.680  1.00 0.00 ? 40 PHE A HE1  6  
ATOM 5533  H HE2  . PHE A 1 40 ? 1.811   -3.720  -0.680  1.00 0.00 ? 40 PHE A HE2  6  
ATOM 5534  H HZ   . PHE A 1 40 ? 3.059   -5.509  -1.798  1.00 0.00 ? 40 PHE A HZ   6  
ATOM 5535  N N    . MET A 1 41 ? 0.690   -5.680  6.072   1.00 0.00 ? 41 MET A N    6  
ATOM 5536  C CA   . MET A 1 41 ? 0.147   -5.950  7.392   1.00 0.00 ? 41 MET A CA   6  
ATOM 5537  C C    . MET A 1 41 ? -0.581  -7.295  7.454   1.00 0.00 ? 41 MET A C    6  
ATOM 5538  O O    . MET A 1 41 ? 0.050   -8.344  7.579   1.00 0.00 ? 41 MET A O    6  
ATOM 5539  C CB   . MET A 1 41 ? -0.798  -4.817  7.801   1.00 0.00 ? 41 MET A CB   6  
ATOM 5540  C CG   . MET A 1 41 ? -1.438  -5.018  9.165   1.00 0.00 ? 41 MET A CG   6  
ATOM 5541  S SD   . MET A 1 41 ? -0.798  -3.880  10.408  1.00 0.00 ? 41 MET A SD   6  
ATOM 5542  C CE   . MET A 1 41 ? 0.357   -4.941  11.274  1.00 0.00 ? 41 MET A CE   6  
ATOM 5543  H H    . MET A 1 41 ? 0.350   -4.912  5.575   1.00 0.00 ? 41 MET A H    6  
ATOM 5544  H HA   . MET A 1 41 ? 0.973   -5.973  8.081   1.00 0.00 ? 41 MET A HA   6  
ATOM 5545  H HB2  . MET A 1 41 ? -0.245  -3.890  7.818   1.00 0.00 ? 41 MET A HB2  6  
ATOM 5546  H HB3  . MET A 1 41 ? -1.587  -4.738  7.064   1.00 0.00 ? 41 MET A HB3  6  
ATOM 5547  H HG2  . MET A 1 41 ? -2.503  -4.868  9.075   1.00 0.00 ? 41 MET A HG2  6  
ATOM 5548  H HG3  . MET A 1 41 ? -1.246  -6.030  9.491   1.00 0.00 ? 41 MET A HG3  6  
ATOM 5549  H HE1  . MET A 1 41 ? 1.366   -4.680  10.991  1.00 0.00 ? 41 MET A HE1  6  
ATOM 5550  H HE2  . MET A 1 41 ? 0.164   -5.971  11.014  1.00 0.00 ? 41 MET A HE2  6  
ATOM 5551  H HE3  . MET A 1 41 ? 0.236   -4.810  12.339  1.00 0.00 ? 41 MET A HE3  6  
ATOM 5552  N N    . LYS A 1 42 ? -1.912  -7.253  7.374   1.00 0.00 ? 42 LYS A N    6  
ATOM 5553  C CA   . LYS A 1 42 ? -2.734  -8.454  7.433   1.00 0.00 ? 42 LYS A CA   6  
ATOM 5554  C C    . LYS A 1 42 ? -4.130  -8.099  7.919   1.00 0.00 ? 42 LYS A C    6  
ATOM 5555  O O    . LYS A 1 42 ? -5.105  -8.793  7.631   1.00 0.00 ? 42 LYS A O    6  
ATOM 5556  C CB   . LYS A 1 42 ? -2.107  -9.502  8.355   1.00 0.00 ? 42 LYS A CB   6  
ATOM 5557  C CG   . LYS A 1 42 ? -1.459  -10.655 7.607   1.00 0.00 ? 42 LYS A CG   6  
ATOM 5558  C CD   . LYS A 1 42 ? -2.413  -11.264 6.591   1.00 0.00 ? 42 LYS A CD   6  
ATOM 5559  C CE   . LYS A 1 42 ? -1.876  -12.573 6.038   1.00 0.00 ? 42 LYS A CE   6  
ATOM 5560  N NZ   . LYS A 1 42 ? -0.909  -13.215 6.969   1.00 0.00 ? 42 LYS A NZ   6  
ATOM 5561  H H    . LYS A 1 42 ? -2.359  -6.389  7.277   1.00 0.00 ? 42 LYS A H    6  
ATOM 5562  H HA   . LYS A 1 42 ? -2.804  -8.851  6.440   1.00 0.00 ? 42 LYS A HA   6  
ATOM 5563  H HB2  . LYS A 1 42 ? -1.354  -9.026  8.966   1.00 0.00 ? 42 LYS A HB2  6  
ATOM 5564  H HB3  . LYS A 1 42 ? -2.876  -9.905  8.997   1.00 0.00 ? 42 LYS A HB3  6  
ATOM 5565  H HG2  . LYS A 1 42 ? -0.584  -10.291 7.091   1.00 0.00 ? 42 LYS A HG2  6  
ATOM 5566  H HG3  . LYS A 1 42 ? -1.170  -11.416 8.318   1.00 0.00 ? 42 LYS A HG3  6  
ATOM 5567  H HD2  . LYS A 1 42 ? -3.363  -11.449 7.069   1.00 0.00 ? 42 LYS A HD2  6  
ATOM 5568  H HD3  . LYS A 1 42 ? -2.548  -10.568 5.776   1.00 0.00 ? 42 LYS A HD3  6  
ATOM 5569  H HE2  . LYS A 1 42 ? -2.704  -13.246 5.872   1.00 0.00 ? 42 LYS A HE2  6  
ATOM 5570  H HE3  . LYS A 1 42 ? -1.381  -12.376 5.098   1.00 0.00 ? 42 LYS A HE3  6  
ATOM 5571  H HZ1  . LYS A 1 42 ? -0.032  -12.658 7.014   1.00 0.00 ? 42 LYS A HZ1  6  
ATOM 5572  H HZ2  . LYS A 1 42 ? -0.680  -14.175 6.642   1.00 0.00 ? 42 LYS A HZ2  6  
ATOM 5573  H HZ3  . LYS A 1 42 ? -1.318  -13.275 7.924   1.00 0.00 ? 42 LYS A HZ3  6  
ATOM 5574  N N    . GLU A 1 43 ? -4.207  -6.995  8.648   1.00 0.00 ? 43 GLU A N    6  
ATOM 5575  C CA   . GLU A 1 43 ? -5.469  -6.499  9.179   1.00 0.00 ? 43 GLU A CA   6  
ATOM 5576  C C    . GLU A 1 43 ? -5.744  -5.101  8.640   1.00 0.00 ? 43 GLU A C    6  
ATOM 5577  O O    . GLU A 1 43 ? -4.895  -4.218  8.747   1.00 0.00 ? 43 GLU A O    6  
ATOM 5578  C CB   . GLU A 1 43 ? -5.438  -6.474  10.708  1.00 0.00 ? 43 GLU A CB   6  
ATOM 5579  C CG   . GLU A 1 43 ? -6.702  -5.903  11.329  1.00 0.00 ? 43 GLU A CG   6  
ATOM 5580  C CD   . GLU A 1 43 ? -6.440  -5.212  12.653  1.00 0.00 ? 43 GLU A CD   6  
ATOM 5581  O OE1  . GLU A 1 43 ? -5.695  -4.210  12.663  1.00 0.00 ? 43 GLU A OE1  6  
ATOM 5582  O OE2  . GLU A 1 43 ? -6.982  -5.673  13.680  1.00 0.00 ? 43 GLU A OE2  6  
ATOM 5583  H H    . GLU A 1 43 ? -3.387  -6.492  8.823   1.00 0.00 ? 43 GLU A H    6  
ATOM 5584  H HA   . GLU A 1 43 ? -6.254  -7.163  8.850   1.00 0.00 ? 43 GLU A HA   6  
ATOM 5585  H HB2  . GLU A 1 43 ? -5.307  -7.483  11.071  1.00 0.00 ? 43 GLU A HB2  6  
ATOM 5586  H HB3  . GLU A 1 43 ? -4.600  -5.873  11.030  1.00 0.00 ? 43 GLU A HB3  6  
ATOM 5587  H HG2  . GLU A 1 43 ? -7.131  -5.186  10.646  1.00 0.00 ? 43 GLU A HG2  6  
ATOM 5588  H HG3  . GLU A 1 43 ? -7.403  -6.708  11.492  1.00 0.00 ? 43 GLU A HG3  6  
ATOM 5589  N N    . GLY A 1 44 ? -6.929  -4.928  8.052   1.00 0.00 ? 44 GLY A N    6  
ATOM 5590  C CA   . GLY A 1 44 ? -7.333  -3.653  7.473   1.00 0.00 ? 44 GLY A CA   6  
ATOM 5591  C C    . GLY A 1 44 ? -6.418  -2.503  7.802   1.00 0.00 ? 44 GLY A C    6  
ATOM 5592  O O    . GLY A 1 44 ? -6.743  -1.658  8.635   1.00 0.00 ? 44 GLY A O    6  
ATOM 5593  H H    . GLY A 1 44 ? -7.543  -5.690  8.000   1.00 0.00 ? 44 GLY A H    6  
ATOM 5594  H HA2  . GLY A 1 44 ? -7.358  -3.756  6.401   1.00 0.00 ? 44 GLY A HA2  6  
ATOM 5595  H HA3  . GLY A 1 44 ? -8.325  -3.414  7.821   1.00 0.00 ? 44 GLY A HA3  6  
ATOM 5596  N N    . THR A 1 45 ? -5.272  -2.463  7.137   1.00 0.00 ? 45 THR A N    6  
ATOM 5597  C CA   . THR A 1 45 ? -4.318  -1.396  7.362   1.00 0.00 ? 45 THR A CA   6  
ATOM 5598  C C    . THR A 1 45 ? -4.566  -0.249  6.396   1.00 0.00 ? 45 THR A C    6  
ATOM 5599  O O    . THR A 1 45 ? -5.086  0.799   6.779   1.00 0.00 ? 45 THR A O    6  
ATOM 5600  C CB   . THR A 1 45 ? -2.899  -1.926  7.224   1.00 0.00 ? 45 THR A CB   6  
ATOM 5601  O OG1  . THR A 1 45 ? -2.783  -3.196  7.840   1.00 0.00 ? 45 THR A OG1  6  
ATOM 5602  C CG2  . THR A 1 45 ? -1.867  -1.017  7.845   1.00 0.00 ? 45 THR A CG2  6  
ATOM 5603  H H    . THR A 1 45 ? -5.066  -3.166  6.475   1.00 0.00 ? 45 THR A H    6  
ATOM 5604  H HA   . THR A 1 45 ? -4.459  -1.034  8.358   1.00 0.00 ? 45 THR A HA   6  
ATOM 5605  H HB   . THR A 1 45 ? -2.665  -2.034  6.180   1.00 0.00 ? 45 THR A HB   6  
ATOM 5606  H HG1  . THR A 1 45 ? -3.551  -3.732  7.621   1.00 0.00 ? 45 THR A HG1  6  
ATOM 5607  H HG21 . THR A 1 45 ? -0.927  -1.137  7.331   1.00 0.00 ? 45 THR A HG21 6  
ATOM 5608  H HG22 . THR A 1 45 ? -1.746  -1.273  8.887   1.00 0.00 ? 45 THR A HG22 6  
ATOM 5609  H HG23 . THR A 1 45 ? -2.197  0.008   7.762   1.00 0.00 ? 45 THR A HG23 6  
ATOM 5610  N N    . ILE A 1 46 ? -4.208  -0.460  5.143   1.00 0.00 ? 46 ILE A N    6  
ATOM 5611  C CA   . ILE A 1 46 ? -4.409  0.551   4.116   1.00 0.00 ? 46 ILE A CA   6  
ATOM 5612  C C    . ILE A 1 46 ? -3.817  0.120   2.766   1.00 0.00 ? 46 ILE A C    6  
ATOM 5613  O O    . ILE A 1 46 ? -2.615  0.243   2.526   1.00 0.00 ? 46 ILE A O    6  
ATOM 5614  C CB   . ILE A 1 46 ? -3.848  1.929   4.579   1.00 0.00 ? 46 ILE A CB   6  
ATOM 5615  C CG1  . ILE A 1 46 ? -4.998  2.920   4.763   1.00 0.00 ? 46 ILE A CG1  6  
ATOM 5616  C CG2  . ILE A 1 46 ? -2.812  2.501   3.616   1.00 0.00 ? 46 ILE A CG2  6  
ATOM 5617  C CD1  . ILE A 1 46 ? -5.206  3.342   6.201   1.00 0.00 ? 46 ILE A CD1  6  
ATOM 5618  H H    . ILE A 1 46 ? -3.812  -1.316  4.906   1.00 0.00 ? 46 ILE A H    6  
ATOM 5619  H HA   . ILE A 1 46 ? -5.476  0.661   3.990   1.00 0.00 ? 46 ILE A HA   6  
ATOM 5620  H HB   . ILE A 1 46 ? -3.365  1.785   5.532   1.00 0.00 ? 46 ILE A HB   6  
ATOM 5621  H HG12 . ILE A 1 46 ? -4.797  3.808   4.183   1.00 0.00 ? 46 ILE A HG12 6  
ATOM 5622  H HG13 . ILE A 1 46 ? -5.915  2.467   4.414   1.00 0.00 ? 46 ILE A HG13 6  
ATOM 5623  H HG21 . ILE A 1 46 ? -3.131  2.330   2.599   1.00 0.00 ? 46 ILE A HG21 6  
ATOM 5624  H HG22 . ILE A 1 46 ? -1.861  2.016   3.780   1.00 0.00 ? 46 ILE A HG22 6  
ATOM 5625  H HG23 . ILE A 1 46 ? -2.709  3.562   3.788   1.00 0.00 ? 46 ILE A HG23 6  
ATOM 5626  H HD11 . ILE A 1 46 ? -5.974  2.729   6.649   1.00 0.00 ? 46 ILE A HD11 6  
ATOM 5627  H HD12 . ILE A 1 46 ? -5.509  4.378   6.232   1.00 0.00 ? 46 ILE A HD12 6  
ATOM 5628  H HD13 . ILE A 1 46 ? -4.284  3.221   6.748   1.00 0.00 ? 46 ILE A HD13 6  
ATOM 5629  N N    . CYS A 1 47 ? -4.681  -0.381  1.884   1.00 0.00 ? 47 CYS A N    6  
ATOM 5630  C CA   . CYS A 1 47 ? -4.266  -0.814  0.554   1.00 0.00 ? 47 CYS A CA   6  
ATOM 5631  C C    . CYS A 1 47 ? -4.489  0.301   -0.470  1.00 0.00 ? 47 CYS A C    6  
ATOM 5632  O O    . CYS A 1 47 ? -4.466  0.067   -1.678  1.00 0.00 ? 47 CYS A O    6  
ATOM 5633  C CB   . CYS A 1 47 ? -5.029  -2.066  0.143   1.00 0.00 ? 47 CYS A CB   6  
ATOM 5634  S SG   . CYS A 1 47 ? -4.447  -2.784  -1.419  1.00 0.00 ? 47 CYS A SG   6  
ATOM 5635  H H    . CYS A 1 47 ? -5.625  -0.456  2.133   1.00 0.00 ? 47 CYS A H    6  
ATOM 5636  H HA   . CYS A 1 47 ? -3.217  -1.048  0.587   1.00 0.00 ? 47 CYS A HA   6  
ATOM 5637  H HB2  . CYS A 1 47 ? -4.915  -2.815  0.910   1.00 0.00 ? 47 CYS A HB2  6  
ATOM 5638  H HB3  . CYS A 1 47 ? -6.075  -1.826  0.028   1.00 0.00 ? 47 CYS A HB3  6  
ATOM 5639  N N    . ARG A 1 48 ? -4.715  1.511   0.042   1.00 0.00 ? 48 ARG A N    6  
ATOM 5640  C CA   . ARG A 1 48 ? -4.961  2.702   -0.783  1.00 0.00 ? 48 ARG A CA   6  
ATOM 5641  C C    . ARG A 1 48 ? -4.466  2.555   -2.219  1.00 0.00 ? 48 ARG A C    6  
ATOM 5642  O O    . ARG A 1 48 ? -3.267  2.431   -2.467  1.00 0.00 ? 48 ARG A O    6  
ATOM 5643  C CB   . ARG A 1 48 ? -4.295  3.929   -0.165  1.00 0.00 ? 48 ARG A CB   6  
ATOM 5644  C CG   . ARG A 1 48 ? -4.467  4.044   1.341   1.00 0.00 ? 48 ARG A CG   6  
ATOM 5645  C CD   . ARG A 1 48 ? -5.078  5.381   1.729   1.00 0.00 ? 48 ARG A CD   6  
ATOM 5646  N NE   . ARG A 1 48 ? -4.068  6.429   1.854   1.00 0.00 ? 48 ARG A NE   6  
ATOM 5647  C CZ   . ARG A 1 48 ? -4.289  7.596   2.452   1.00 0.00 ? 48 ARG A CZ   6  
ATOM 5648  N NH1  . ARG A 1 48 ? -5.478  7.861   2.974   1.00 0.00 ? 48 ARG A NH1  6  
ATOM 5649  N NH2  . ARG A 1 48 ? -3.320  8.498   2.528   1.00 0.00 ? 48 ARG A NH2  6  
ATOM 5650  H H    . ARG A 1 48 ? -4.728  1.608   1.017   1.00 0.00 ? 48 ARG A H    6  
ATOM 5651  H HA   . ARG A 1 48 ? -6.021  2.867   -0.805  1.00 0.00 ? 48 ARG A HA   6  
ATOM 5652  H HB2  . ARG A 1 48 ? -3.242  3.894   -0.386  1.00 0.00 ? 48 ARG A HB2  6  
ATOM 5653  H HB3  . ARG A 1 48 ? -4.712  4.812   -0.619  1.00 0.00 ? 48 ARG A HB3  6  
ATOM 5654  H HG2  . ARG A 1 48 ? -5.114  3.253   1.684   1.00 0.00 ? 48 ARG A HG2  6  
ATOM 5655  H HG3  . ARG A 1 48 ? -3.499  3.952   1.810   1.00 0.00 ? 48 ARG A HG3  6  
ATOM 5656  H HD2  . ARG A 1 48 ? -5.790  5.670   0.971   1.00 0.00 ? 48 ARG A HD2  6  
ATOM 5657  H HD3  . ARG A 1 48 ? -5.585  5.269   2.676   1.00 0.00 ? 48 ARG A HD3  6  
ATOM 5658  H HE   . ARG A 1 48 ? -3.182  6.254   1.473   1.00 0.00 ? 48 ARG A HE   6  
ATOM 5659  H HH11 . ARG A 1 48 ? -6.211  7.183   2.917   1.00 0.00 ? 48 ARG A HH11 6  
ATOM 5660  H HH12 . ARG A 1 48 ? -5.642  8.738   3.424   1.00 0.00 ? 48 ARG A HH12 6  
ATOM 5661  H HH21 . ARG A 1 48 ? -2.421  8.301   2.135   1.00 0.00 ? 48 ARG A HH21 6  
ATOM 5662  H HH22 . ARG A 1 48 ? -3.487  9.375   2.978   1.00 0.00 ? 48 ARG A HH22 6  
ATOM 5663  N N    . ARG A 1 49 ? -5.403  2.609   -3.161  1.00 0.00 ? 49 ARG A N    6  
ATOM 5664  C CA   . ARG A 1 49 ? -5.074  2.523   -4.580  1.00 0.00 ? 49 ARG A CA   6  
ATOM 5665  C C    . ARG A 1 49 ? -6.302  2.805   -5.440  1.00 0.00 ? 49 ARG A C    6  
ATOM 5666  O O    . ARG A 1 49 ? -6.433  2.277   -6.544  1.00 0.00 ? 49 ARG A O    6  
ATOM 5667  C CB   . ARG A 1 49 ? -4.497  1.152   -4.921  1.00 0.00 ? 49 ARG A CB   6  
ATOM 5668  C CG   . ARG A 1 49 ? -5.419  0.006   -4.567  1.00 0.00 ? 49 ARG A CG   6  
ATOM 5669  C CD   . ARG A 1 49 ? -6.543  -0.144  -5.580  1.00 0.00 ? 49 ARG A CD   6  
ATOM 5670  N NE   . ARG A 1 49 ? -6.052  -0.091  -6.954  1.00 0.00 ? 49 ARG A NE   6  
ATOM 5671  C CZ   . ARG A 1 49 ? -5.524  -1.134  -7.587  1.00 0.00 ? 49 ARG A CZ   6  
ATOM 5672  N NH1  . ARG A 1 49 ? -5.425  -2.305  -6.973  1.00 0.00 ? 49 ARG A NH1  6  
ATOM 5673  N NH2  . ARG A 1 49 ? -5.097  -1.007  -8.836  1.00 0.00 ? 49 ARG A NH2  6  
ATOM 5674  H H    . ARG A 1 49 ? -6.339  2.734   -2.894  1.00 0.00 ? 49 ARG A H    6  
ATOM 5675  H HA   . ARG A 1 49 ? -4.328  3.276   -4.789  1.00 0.00 ? 49 ARG A HA   6  
ATOM 5676  H HB2  . ARG A 1 49 ? -4.297  1.111   -5.982  1.00 0.00 ? 49 ARG A HB2  6  
ATOM 5677  H HB3  . ARG A 1 49 ? -3.571  1.021   -4.383  1.00 0.00 ? 49 ARG A HB3  6  
ATOM 5678  H HG2  . ARG A 1 49 ? -4.844  -0.906  -4.545  1.00 0.00 ? 49 ARG A HG2  6  
ATOM 5679  H HG3  . ARG A 1 49 ? -5.846  0.191   -3.591  1.00 0.00 ? 49 ARG A HG3  6  
ATOM 5680  H HD2  . ARG A 1 49 ? -7.031  -1.094  -5.420  1.00 0.00 ? 49 ARG A HD2  6  
ATOM 5681  H HD3  . ARG A 1 49 ? -7.254  0.655   -5.431  1.00 0.00 ? 49 ARG A HD3  6  
ATOM 5682  H HE   . ARG A 1 49 ? -6.117  0.765   -7.427  1.00 0.00 ? 49 ARG A HE   6  
ATOM 5683  H HH11 . ARG A 1 49 ? -5.747  -2.405  -6.032  1.00 0.00 ? 49 ARG A HH11 6  
ATOM 5684  H HH12 . ARG A 1 49 ? -5.028  -3.088  -7.452  1.00 0.00 ? 49 ARG A HH12 6  
ATOM 5685  H HH21 . ARG A 1 49 ? -5.172  -0.125  -9.303  1.00 0.00 ? 49 ARG A HH21 6  
ATOM 5686  H HH22 . ARG A 1 49 ? -4.701  -1.792  -9.311  1.00 0.00 ? 49 ARG A HH22 6  
ATOM 5687  N N    . ALA A 1 50 ? -7.203  3.636   -4.925  1.00 0.00 ? 50 ALA A N    6  
ATOM 5688  C CA   . ALA A 1 50 ? -8.422  3.981   -5.646  1.00 0.00 ? 50 ALA A CA   6  
ATOM 5689  C C    . ALA A 1 50 ? -8.265  5.296   -6.399  1.00 0.00 ? 50 ALA A C    6  
ATOM 5690  O O    . ALA A 1 50 ? -7.195  5.906   -6.389  1.00 0.00 ? 50 ALA A O    6  
ATOM 5691  C CB   . ALA A 1 50 ? -9.598  4.060   -4.684  1.00 0.00 ? 50 ALA A CB   6  
ATOM 5692  H H    . ALA A 1 50 ? -7.045  4.024   -4.039  1.00 0.00 ? 50 ALA A H    6  
ATOM 5693  H HA   . ALA A 1 50 ? -8.622  3.193   -6.357  1.00 0.00 ? 50 ALA A HA   6  
ATOM 5694  H HB1  . ALA A 1 50 ? -10.510 3.824   -5.211  1.00 0.00 ? 50 ALA A HB1  6  
ATOM 5695  H HB2  . ALA A 1 50 ? -9.664  5.058   -4.277  1.00 0.00 ? 50 ALA A HB2  6  
ATOM 5696  H HB3  . ALA A 1 50 ? -9.453  3.353   -3.880  1.00 0.00 ? 50 ALA A HB3  6  
ATOM 5697  N N    . ARG A 1 51 ? -9.338  5.727   -7.053  1.00 0.00 ? 51 ARG A N    6  
ATOM 5698  C CA   . ARG A 1 51 ? -9.322  6.969   -7.814  1.00 0.00 ? 51 ARG A CA   6  
ATOM 5699  C C    . ARG A 1 51 ? -10.572 7.796   -7.530  1.00 0.00 ? 51 ARG A C    6  
ATOM 5700  O O    . ARG A 1 51 ? -10.574 8.649   -6.642  1.00 0.00 ? 51 ARG A O    6  
ATOM 5701  C CB   . ARG A 1 51 ? -9.221  6.671   -9.310  1.00 0.00 ? 51 ARG A CB   6  
ATOM 5702  C CG   . ARG A 1 51 ? -9.617  7.843   -10.191 1.00 0.00 ? 51 ARG A CG   6  
ATOM 5703  C CD   . ARG A 1 51 ? -9.040  7.707   -11.591 1.00 0.00 ? 51 ARG A CD   6  
ATOM 5704  N NE   . ARG A 1 51 ? -9.208  6.357   -12.122 1.00 0.00 ? 51 ARG A NE   6  
ATOM 5705  C CZ   . ARG A 1 51 ? -10.380 5.855   -12.496 1.00 0.00 ? 51 ARG A CZ   6  
ATOM 5706  N NH1  . ARG A 1 51 ? -11.480 6.587   -12.395 1.00 0.00 ? 51 ARG A NH1  6  
ATOM 5707  N NH2  . ARG A 1 51 ? -10.452 4.619   -12.971 1.00 0.00 ? 51 ARG A NH2  6  
ATOM 5708  H H    . ARG A 1 51 ? -10.161 5.196   -7.024  1.00 0.00 ? 51 ARG A H    6  
ATOM 5709  H HA   . ARG A 1 51 ? -8.454  7.534   -7.508  1.00 0.00 ? 51 ARG A HA   6  
ATOM 5710  H HB2  . ARG A 1 51 ? -8.201  6.402   -9.544  1.00 0.00 ? 51 ARG A HB2  6  
ATOM 5711  H HB3  . ARG A 1 51 ? -9.866  5.838   -9.544  1.00 0.00 ? 51 ARG A HB3  6  
ATOM 5712  H HG2  . ARG A 1 51 ? -10.694 7.882   -10.259 1.00 0.00 ? 51 ARG A HG2  6  
ATOM 5713  H HG3  . ARG A 1 51 ? -9.249  8.755   -9.746  1.00 0.00 ? 51 ARG A HG3  6  
ATOM 5714  H HD2  . ARG A 1 51 ? -9.541  8.405   -12.243 1.00 0.00 ? 51 ARG A HD2  6  
ATOM 5715  H HD3  . ARG A 1 51 ? -7.986  7.941   -11.555 1.00 0.00 ? 51 ARG A HD3  6  
ATOM 5716  H HE   . ARG A 1 51 ? -8.407  5.798   -12.204 1.00 0.00 ? 51 ARG A HE   6  
ATOM 5717  H HH11 . ARG A 1 51 ? -11.429 7.519   -12.036 1.00 0.00 ? 51 ARG A HH11 6  
ATOM 5718  H HH12 . ARG A 1 51 ? -12.361 6.208   -12.678 1.00 0.00 ? 51 ARG A HH12 6  
ATOM 5719  H HH21 . ARG A 1 51 ? -9.624  4.063   -13.048 1.00 0.00 ? 51 ARG A HH21 6  
ATOM 5720  H HH22 . ARG A 1 51 ? -11.335 4.243   -13.253 1.00 0.00 ? 51 ARG A HH22 6  
ATOM 5721  N N    . GLY A 1 52 ? -11.633 7.535   -8.288  1.00 0.00 ? 52 GLY A N    6  
ATOM 5722  C CA   . GLY A 1 52 ? -12.876 8.262   -8.104  1.00 0.00 ? 52 GLY A CA   6  
ATOM 5723  C C    . GLY A 1 52 ? -12.650 9.707   -7.707  1.00 0.00 ? 52 GLY A C    6  
ATOM 5724  O O    . GLY A 1 52 ? -12.288 10.538  -8.540  1.00 0.00 ? 52 GLY A O    6  
ATOM 5725  H H    . GLY A 1 52 ? -11.571 6.842   -8.979  1.00 0.00 ? 52 GLY A H    6  
ATOM 5726  H HA2  . GLY A 1 52 ? -13.435 8.237   -9.028  1.00 0.00 ? 52 GLY A HA2  6  
ATOM 5727  H HA3  . GLY A 1 52 ? -13.454 7.774   -7.333  1.00 0.00 ? 52 GLY A HA3  6  
ATOM 5728  N N    . ASP A 1 53 ? -12.859 10.005  -6.430  1.00 0.00 ? 53 ASP A N    6  
ATOM 5729  C CA   . ASP A 1 53 ? -12.672 11.358  -5.920  1.00 0.00 ? 53 ASP A CA   6  
ATOM 5730  C C    . ASP A 1 53 ? -11.452 11.425  -5.007  1.00 0.00 ? 53 ASP A C    6  
ATOM 5731  O O    . ASP A 1 53 ? -10.930 12.504  -4.728  1.00 0.00 ? 53 ASP A O    6  
ATOM 5732  C CB   . ASP A 1 53 ? -13.918 11.818  -5.161  1.00 0.00 ? 53 ASP A CB   6  
ATOM 5733  C CG   . ASP A 1 53 ? -14.057 13.328  -5.139  1.00 0.00 ? 53 ASP A CG   6  
ATOM 5734  O OD1  . ASP A 1 53 ? -13.079 14.009  -4.767  1.00 0.00 ? 53 ASP A OD1  6  
ATOM 5735  O OD2  . ASP A 1 53 ? -15.145 13.828  -5.495  1.00 0.00 ? 53 ASP A OD2  6  
ATOM 5736  H H    . ASP A 1 53 ? -13.144 9.298   -5.814  1.00 0.00 ? 53 ASP A H    6  
ATOM 5737  H HA   . ASP A 1 53 ? -12.512 12.012  -6.764  1.00 0.00 ? 53 ASP A HA   6  
ATOM 5738  H HB2  . ASP A 1 53 ? -14.794 11.401  -5.634  1.00 0.00 ? 53 ASP A HB2  6  
ATOM 5739  H HB3  . ASP A 1 53 ? -13.861 11.465  -4.142  1.00 0.00 ? 53 ASP A HB3  6  
ATOM 5740  N N    . ASP A 1 54 ? -11.005 10.261  -4.547  1.00 0.00 ? 54 ASP A N    6  
ATOM 5741  C CA   . ASP A 1 54 ? -9.846  10.179  -3.666  1.00 0.00 ? 54 ASP A CA   6  
ATOM 5742  C C    . ASP A 1 54 ? -9.194  8.803   -3.758  1.00 0.00 ? 54 ASP A C    6  
ATOM 5743  O O    . ASP A 1 54 ? -9.544  7.997   -4.621  1.00 0.00 ? 54 ASP A O    6  
ATOM 5744  C CB   . ASP A 1 54 ? -10.256 10.468  -2.220  1.00 0.00 ? 54 ASP A CB   6  
ATOM 5745  C CG   . ASP A 1 54 ? -11.260 11.600  -2.119  1.00 0.00 ? 54 ASP A CG   6  
ATOM 5746  O OD1  . ASP A 1 54 ? -12.417 11.407  -2.549  1.00 0.00 ? 54 ASP A OD1  6  
ATOM 5747  O OD2  . ASP A 1 54 ? -10.890 12.679  -1.610  1.00 0.00 ? 54 ASP A OD2  6  
ATOM 5748  H H    . ASP A 1 54 ? -11.465 9.437   -4.807  1.00 0.00 ? 54 ASP A H    6  
ATOM 5749  H HA   . ASP A 1 54 ? -9.133  10.925  -3.985  1.00 0.00 ? 54 ASP A HA   6  
ATOM 5750  H HB2  . ASP A 1 54 ? -10.699 9.580   -1.794  1.00 0.00 ? 54 ASP A HB2  6  
ATOM 5751  H HB3  . ASP A 1 54 ? -9.379  10.737  -1.651  1.00 0.00 ? 54 ASP A HB3  6  
ATOM 5752  N N    . LEU A 1 55 ? -8.246  8.540   -2.865  1.00 0.00 ? 55 LEU A N    6  
ATOM 5753  C CA   . LEU A 1 55 ? -7.546  7.260   -2.849  1.00 0.00 ? 55 LEU A CA   6  
ATOM 5754  C C    . LEU A 1 55 ? -7.666  6.592   -1.483  1.00 0.00 ? 55 LEU A C    6  
ATOM 5755  O O    . LEU A 1 55 ? -7.136  7.091   -0.491  1.00 0.00 ? 55 LEU A O    6  
ATOM 5756  C CB   . LEU A 1 55 ? -6.070  7.457   -3.204  1.00 0.00 ? 55 LEU A CB   6  
ATOM 5757  C CG   . LEU A 1 55 ? -5.801  8.472   -4.315  1.00 0.00 ? 55 LEU A CG   6  
ATOM 5758  C CD1  . LEU A 1 55 ? -4.451  8.209   -4.964  1.00 0.00 ? 55 LEU A CD1  6  
ATOM 5759  C CD2  . LEU A 1 55 ? -6.911  8.430   -5.355  1.00 0.00 ? 55 LEU A CD2  6  
ATOM 5760  H H    . LEU A 1 55 ? -8.010  9.222   -2.202  1.00 0.00 ? 55 LEU A H    6  
ATOM 5761  H HA   . LEU A 1 55 ? -8.003  6.622   -3.591  1.00 0.00 ? 55 LEU A HA   6  
ATOM 5762  H HB2  . LEU A 1 55 ? -5.549  7.781   -2.314  1.00 0.00 ? 55 LEU A HB2  6  
ATOM 5763  H HB3  . LEU A 1 55 ? -5.665  6.505   -3.511  1.00 0.00 ? 55 LEU A HB3  6  
ATOM 5764  H HG   . LEU A 1 55 ? -5.778  9.465   -3.889  1.00 0.00 ? 55 LEU A HG   6  
ATOM 5765  H HD11 . LEU A 1 55 ? -4.490  7.280   -5.512  1.00 0.00 ? 55 LEU A HD11 6  
ATOM 5766  H HD12 . LEU A 1 55 ? -3.691  8.144   -4.199  1.00 0.00 ? 55 LEU A HD12 6  
ATOM 5767  H HD13 . LEU A 1 55 ? -4.213  9.017   -5.640  1.00 0.00 ? 55 LEU A HD13 6  
ATOM 5768  H HD21 . LEU A 1 55 ? -6.479  8.345   -6.341  1.00 0.00 ? 55 LEU A HD21 6  
ATOM 5769  H HD22 . LEU A 1 55 ? -7.495  9.338   -5.295  1.00 0.00 ? 55 LEU A HD22 6  
ATOM 5770  H HD23 . LEU A 1 55 ? -7.549  7.579   -5.167  1.00 0.00 ? 55 LEU A HD23 6  
ATOM 5771  N N    . ASP A 1 56 ? -8.366  5.462   -1.437  1.00 0.00 ? 56 ASP A N    6  
ATOM 5772  C CA   . ASP A 1 56 ? -8.552  4.734   -0.188  1.00 0.00 ? 56 ASP A CA   6  
ATOM 5773  C C    . ASP A 1 56 ? -8.516  3.225   -0.418  1.00 0.00 ? 56 ASP A C    6  
ATOM 5774  O O    . ASP A 1 56 ? -8.598  2.756   -1.554  1.00 0.00 ? 56 ASP A O    6  
ATOM 5775  C CB   . ASP A 1 56 ? -9.878  5.131   0.462   1.00 0.00 ? 56 ASP A CB   6  
ATOM 5776  C CG   . ASP A 1 56 ? -9.785  6.448   1.209   1.00 0.00 ? 56 ASP A CG   6  
ATOM 5777  O OD1  . ASP A 1 56 ? -9.719  7.503   0.544   1.00 0.00 ? 56 ASP A OD1  6  
ATOM 5778  O OD2  . ASP A 1 56 ? -9.779  6.423   2.457   1.00 0.00 ? 56 ASP A OD2  6  
ATOM 5779  H H    . ASP A 1 56 ? -8.767  5.112   -2.260  1.00 0.00 ? 56 ASP A H    6  
ATOM 5780  H HA   . ASP A 1 56 ? -7.743  5.003   0.474   1.00 0.00 ? 56 ASP A HA   6  
ATOM 5781  H HB2  . ASP A 1 56 ? -10.633 5.226   -0.303  1.00 0.00 ? 56 ASP A HB2  6  
ATOM 5782  H HB3  . ASP A 1 56 ? -10.173 4.362   1.161   1.00 0.00 ? 56 ASP A HB3  6  
ATOM 5783  N N    . ASP A 1 57 ? -8.394  2.474   0.674   1.00 0.00 ? 57 ASP A N    6  
ATOM 5784  C CA   . ASP A 1 57 ? -8.347  1.015   0.617   1.00 0.00 ? 57 ASP A CA   6  
ATOM 5785  C C    . ASP A 1 57 ? -7.722  0.454   1.891   1.00 0.00 ? 57 ASP A C    6  
ATOM 5786  O O    . ASP A 1 57 ? -6.868  1.096   2.503   1.00 0.00 ? 57 ASP A O    6  
ATOM 5787  C CB   . ASP A 1 57 ? -7.554  0.545   -0.604  1.00 0.00 ? 57 ASP A CB   6  
ATOM 5788  C CG   . ASP A 1 57 ? -8.427  -0.163  -1.622  1.00 0.00 ? 57 ASP A CG   6  
ATOM 5789  O OD1  . ASP A 1 57 ? -9.181  0.528   -2.340  1.00 0.00 ? 57 ASP A OD1  6  
ATOM 5790  O OD2  . ASP A 1 57 ? -8.357  -1.407  -1.702  1.00 0.00 ? 57 ASP A OD2  6  
ATOM 5791  H H    . ASP A 1 57 ? -8.334  2.916   1.547   1.00 0.00 ? 57 ASP A H    6  
ATOM 5792  H HA   . ASP A 1 57 ? -9.361  0.655   0.538   1.00 0.00 ? 57 ASP A HA   6  
ATOM 5793  H HB2  . ASP A 1 57 ? -7.096  1.396   -1.081  1.00 0.00 ? 57 ASP A HB2  6  
ATOM 5794  H HB3  . ASP A 1 57 ? -6.783  -0.138  -0.282  1.00 0.00 ? 57 ASP A HB3  6  
ATOM 5795  N N    . TYR A 1 58 ? -8.150  -0.745  2.287   1.00 0.00 ? 58 TYR A N    6  
ATOM 5796  C CA   . TYR A 1 58 ? -7.631  -1.388  3.496   1.00 0.00 ? 58 TYR A CA   6  
ATOM 5797  C C    . TYR A 1 58 ? -6.705  -2.559  3.163   1.00 0.00 ? 58 TYR A C    6  
ATOM 5798  O O    . TYR A 1 58 ? -6.651  -3.015  2.021   1.00 0.00 ? 58 TYR A O    6  
ATOM 5799  C CB   . TYR A 1 58 ? -8.786  -1.869  4.376   1.00 0.00 ? 58 TYR A CB   6  
ATOM 5800  C CG   . TYR A 1 58 ? -9.399  -0.775  5.222   1.00 0.00 ? 58 TYR A CG   6  
ATOM 5801  C CD1  . TYR A 1 58 ? -8.684  -0.195  6.263   1.00 0.00 ? 58 TYR A CD1  6  
ATOM 5802  C CD2  . TYR A 1 58 ? -10.689 -0.322  4.980   1.00 0.00 ? 58 TYR A CD2  6  
ATOM 5803  C CE1  . TYR A 1 58 ? -9.239  0.806   7.039   1.00 0.00 ? 58 TYR A CE1  6  
ATOM 5804  C CE2  . TYR A 1 58 ? -11.251 0.679   5.752   1.00 0.00 ? 58 TYR A CE2  6  
ATOM 5805  C CZ   . TYR A 1 58 ? -10.522 1.238   6.780   1.00 0.00 ? 58 TYR A CZ   6  
ATOM 5806  O OH   . TYR A 1 58 ? -11.077 2.235   7.550   1.00 0.00 ? 58 TYR A OH   6  
ATOM 5807  H H    . TYR A 1 58 ? -8.831  -1.206  1.756   1.00 0.00 ? 58 TYR A H    6  
ATOM 5808  H HA   . TYR A 1 58 ? -7.065  -0.648  4.042   1.00 0.00 ? 58 TYR A HA   6  
ATOM 5809  H HB2  . TYR A 1 58 ? -9.564  -2.275  3.746   1.00 0.00 ? 58 TYR A HB2  6  
ATOM 5810  H HB3  . TYR A 1 58 ? -8.427  -2.642  5.039   1.00 0.00 ? 58 TYR A HB3  6  
ATOM 5811  H HD1  . TYR A 1 58 ? -7.679  -0.537  6.465   1.00 0.00 ? 58 TYR A HD1  6  
ATOM 5812  H HD2  . TYR A 1 58 ? -11.258 -0.764  4.175   1.00 0.00 ? 58 TYR A HD2  6  
ATOM 5813  H HE1  . TYR A 1 58 ? -8.667  1.244   7.844   1.00 0.00 ? 58 TYR A HE1  6  
ATOM 5814  H HE2  . TYR A 1 58 ? -12.256 1.017   5.548   1.00 0.00 ? 58 TYR A HE2  6  
ATOM 5815  H HH   . TYR A 1 58 ? -10.887 3.089   7.156   1.00 0.00 ? 58 TYR A HH   6  
ATOM 5816  N N    . CYS A 1 59 ? -5.973  -3.033  4.173   1.00 0.00 ? 59 CYS A N    6  
ATOM 5817  C CA   . CYS A 1 59 ? -5.032  -4.144  3.999   1.00 0.00 ? 59 CYS A CA   6  
ATOM 5818  C C    . CYS A 1 59 ? -5.404  -5.354  4.860   1.00 0.00 ? 59 CYS A C    6  
ATOM 5819  O O    . CYS A 1 59 ? -5.538  -5.245  6.079   1.00 0.00 ? 59 CYS A O    6  
ATOM 5820  C CB   . CYS A 1 59 ? -3.615  -3.688  4.347   1.00 0.00 ? 59 CYS A CB   6  
ATOM 5821  S SG   . CYS A 1 59 ? -2.816  -2.671  3.056   1.00 0.00 ? 59 CYS A SG   6  
ATOM 5822  H H    . CYS A 1 59 ? -6.062  -2.619  5.055   1.00 0.00 ? 59 CYS A H    6  
ATOM 5823  H HA   . CYS A 1 59 ? -5.054  -4.433  2.967   1.00 0.00 ? 59 CYS A HA   6  
ATOM 5824  H HB2  . CYS A 1 59 ? -3.656  -3.105  5.247   1.00 0.00 ? 59 CYS A HB2  6  
ATOM 5825  H HB3  . CYS A 1 59 ? -2.996  -4.553  4.517   1.00 0.00 ? 59 CYS A HB3  6  
ATOM 5826  N N    . ASN A 1 60 ? -5.550  -6.513  4.214   1.00 0.00 ? 60 ASN A N    6  
ATOM 5827  C CA   . ASN A 1 60 ? -5.884  -7.766  4.898   1.00 0.00 ? 60 ASN A CA   6  
ATOM 5828  C C    . ASN A 1 60 ? -5.036  -8.888  4.311   1.00 0.00 ? 60 ASN A C    6  
ATOM 5829  O O    . ASN A 1 60 ? -3.991  -9.242  4.846   1.00 0.00 ? 60 ASN A O    6  
ATOM 5830  C CB   . ASN A 1 60 ? -7.380  -8.085  4.757   1.00 0.00 ? 60 ASN A CB   6  
ATOM 5831  C CG   . ASN A 1 60 ? -8.243  -6.846  4.858   1.00 0.00 ? 60 ASN A CG   6  
ATOM 5832  O OD1  . ASN A 1 60 ? -9.253  -6.719  4.165   1.00 0.00 ? 60 ASN A OD1  6  
ATOM 5833  N ND2  . ASN A 1 60 ? -7.848  -5.923  5.721   1.00 0.00 ? 60 ASN A ND2  6  
ATOM 5834  H H    . ASN A 1 60 ? -5.412  -6.532  3.249   1.00 0.00 ? 60 ASN A H    6  
ATOM 5835  H HA   . ASN A 1 60 ? -5.639  -7.657  5.935   1.00 0.00 ? 60 ASN A HA   6  
ATOM 5836  H HB2  . ASN A 1 60 ? -7.564  -8.547  3.803   1.00 0.00 ? 60 ASN A HB2  6  
ATOM 5837  H HB3  . ASN A 1 60 ? -7.671  -8.766  5.543   1.00 0.00 ? 60 ASN A HB3  6  
ATOM 5838  H HD21 . ASN A 1 60 ? -7.036  -6.095  6.241   1.00 0.00 ? 60 ASN A HD21 6  
ATOM 5839  H HD22 . ASN A 1 60 ? -8.375  -5.102  5.793   1.00 0.00 ? 60 ASN A HD22 6  
ATOM 5840  N N    . GLY A 1 61 ? -5.457  -9.385  3.166   1.00 0.00 ? 61 GLY A N    6  
ATOM 5841  C CA   . GLY A 1 61 ? -4.693  -10.401 2.466   1.00 0.00 ? 61 GLY A CA   6  
ATOM 5842  C C    . GLY A 1 61 ? -3.853  -9.735  1.399   1.00 0.00 ? 61 GLY A C    6  
ATOM 5843  O O    . GLY A 1 61 ? -3.511  -10.329 0.377   1.00 0.00 ? 61 GLY A O    6  
ATOM 5844  H H    . GLY A 1 61 ? -6.260  -9.019  2.764   1.00 0.00 ? 61 GLY A H    6  
ATOM 5845  H HA2  . GLY A 1 61 ? -4.052  -10.917 3.166   1.00 0.00 ? 61 GLY A HA2  6  
ATOM 5846  H HA3  . GLY A 1 61 ? -5.367  -11.104 2.002   1.00 0.00 ? 61 GLY A HA3  6  
ATOM 5847  N N    . ILE A 1 62 ? -3.569  -8.461  1.656   1.00 0.00 ? 62 ILE A N    6  
ATOM 5848  C CA   . ILE A 1 62 ? -2.812  -7.598  0.763   1.00 0.00 ? 62 ILE A CA   6  
ATOM 5849  C C    . ILE A 1 62 ? -1.346  -7.993  0.594   1.00 0.00 ? 62 ILE A C    6  
ATOM 5850  O O    . ILE A 1 62 ? -0.484  -7.560  1.357   1.00 0.00 ? 62 ILE A O    6  
ATOM 5851  C CB   . ILE A 1 62 ? -2.871  -6.147  1.275   1.00 0.00 ? 62 ILE A CB   6  
ATOM 5852  C CG1  . ILE A 1 62 ? -2.670  -6.051  2.801   1.00 0.00 ? 62 ILE A CG1  6  
ATOM 5853  C CG2  . ILE A 1 62 ? -4.211  -5.531  0.914   1.00 0.00 ? 62 ILE A CG2  6  
ATOM 5854  C CD1  . ILE A 1 62 ? -1.994  -7.232  3.484   1.00 0.00 ? 62 ILE A CD1  6  
ATOM 5855  H H    . ILE A 1 62 ? -3.910  -8.070  2.483   1.00 0.00 ? 62 ILE A H    6  
ATOM 5856  H HA   . ILE A 1 62 ? -3.291  -7.624  -0.203  1.00 0.00 ? 62 ILE A HA   6  
ATOM 5857  H HB   . ILE A 1 62 ? -2.097  -5.582  0.779   1.00 0.00 ? 62 ILE A HB   6  
ATOM 5858  H HG12 . ILE A 1 62 ? -2.070  -5.182  3.011   1.00 0.00 ? 62 ILE A HG12 6  
ATOM 5859  H HG13 . ILE A 1 62 ? -3.638  -5.918  3.264   1.00 0.00 ? 62 ILE A HG13 6  
ATOM 5860  H HG21 . ILE A 1 62 ? -4.905  -5.689  1.722   1.00 0.00 ? 62 ILE A HG21 6  
ATOM 5861  H HG22 . ILE A 1 62 ? -4.595  -6.000  0.025   1.00 0.00 ? 62 ILE A HG22 6  
ATOM 5862  H HG23 . ILE A 1 62 ? -4.090  -4.472  0.746   1.00 0.00 ? 62 ILE A HG23 6  
ATOM 5863  H HD11 . ILE A 1 62 ? -2.611  -7.564  4.306   1.00 0.00 ? 62 ILE A HD11 6  
ATOM 5864  H HD12 . ILE A 1 62 ? -1.035  -6.924  3.864   1.00 0.00 ? 62 ILE A HD12 6  
ATOM 5865  H HD13 . ILE A 1 62 ? -1.857  -8.042  2.797   1.00 0.00 ? 62 ILE A HD13 6  
ATOM 5866  N N    . SER A 1 63 ? -1.059  -8.769  -0.439  1.00 0.00 ? 63 SER A N    6  
ATOM 5867  C CA   . SER A 1 63 ? 0.311   -9.162  -0.728  1.00 0.00 ? 63 SER A CA   6  
ATOM 5868  C C    . SER A 1 63 ? 0.843   -8.293  -1.855  1.00 0.00 ? 63 SER A C    6  
ATOM 5869  O O    . SER A 1 63 ? 1.606   -8.738  -2.712  1.00 0.00 ? 63 SER A O    6  
ATOM 5870  C CB   . SER A 1 63 ? 0.379   -10.632 -1.105  1.00 0.00 ? 63 SER A CB   6  
ATOM 5871  O OG   . SER A 1 63 ? 0.008   -10.835 -2.457  1.00 0.00 ? 63 SER A OG   6  
ATOM 5872  H H    . SER A 1 63 ? -1.778  -9.054  -1.041  1.00 0.00 ? 63 SER A H    6  
ATOM 5873  H HA   . SER A 1 63 ? 0.904   -8.990  0.159   1.00 0.00 ? 63 SER A HA   6  
ATOM 5874  H HB2  . SER A 1 63 ? 1.387   -10.983 -0.961  1.00 0.00 ? 63 SER A HB2  6  
ATOM 5875  H HB3  . SER A 1 63 ? -0.294  -11.186 -0.470  1.00 0.00 ? 63 SER A HB3  6  
ATOM 5876  H HG   . SER A 1 63 ? -0.181  -11.765 -2.602  1.00 0.00 ? 63 SER A HG   6  
ATOM 5877  N N    . ALA A 1 64 ? 0.385   -7.049  -1.831  1.00 0.00 ? 64 ALA A N    6  
ATOM 5878  C CA   . ALA A 1 64 ? 0.725   -6.036  -2.817  1.00 0.00 ? 64 ALA A CA   6  
ATOM 5879  C C    . ALA A 1 64 ? -0.478  -5.762  -3.707  1.00 0.00 ? 64 ALA A C    6  
ATOM 5880  O O    . ALA A 1 64 ? -0.353  -5.284  -4.835  1.00 0.00 ? 64 ALA A O    6  
ATOM 5881  C CB   . ALA A 1 64 ? 1.945   -6.403  -3.639  1.00 0.00 ? 64 ALA A CB   6  
ATOM 5882  H H    . ALA A 1 64 ? -0.235  -6.802  -1.114  1.00 0.00 ? 64 ALA A H    6  
ATOM 5883  H HA   . ALA A 1 64 ? 0.955   -5.141  -2.271  1.00 0.00 ? 64 ALA A HA   6  
ATOM 5884  H HB1  . ALA A 1 64 ? 2.726   -6.767  -2.988  1.00 0.00 ? 64 ALA A HB1  6  
ATOM 5885  H HB2  . ALA A 1 64 ? 2.291   -5.523  -4.159  1.00 0.00 ? 64 ALA A HB2  6  
ATOM 5886  H HB3  . ALA A 1 64 ? 1.685   -7.162  -4.353  1.00 0.00 ? 64 ALA A HB3  6  
ATOM 5887  N N    . GLY A 1 65 ? -1.648  -6.062  -3.157  1.00 0.00 ? 65 GLY A N    6  
ATOM 5888  C CA   . GLY A 1 65 ? -2.905  -5.848  -3.839  1.00 0.00 ? 65 GLY A CA   6  
ATOM 5889  C C    . GLY A 1 65 ? -3.975  -5.500  -2.831  1.00 0.00 ? 65 GLY A C    6  
ATOM 5890  O O    . GLY A 1 65 ? -3.668  -5.368  -1.650  1.00 0.00 ? 65 GLY A O    6  
ATOM 5891  H H    . GLY A 1 65 ? -1.659  -6.426  -2.248  1.00 0.00 ? 65 GLY A H    6  
ATOM 5892  H HA2  . GLY A 1 65 ? -2.797  -5.038  -4.547  1.00 0.00 ? 65 GLY A HA2  6  
ATOM 5893  H HA3  . GLY A 1 65 ? -3.189  -6.749  -4.362  1.00 0.00 ? 65 GLY A HA3  6  
ATOM 5894  N N    . CYS A 1 66 ? -5.219  -5.351  -3.265  1.00 0.00 ? 66 CYS A N    6  
ATOM 5895  C CA   . CYS A 1 66 ? -6.294  -5.014  -2.335  1.00 0.00 ? 66 CYS A CA   6  
ATOM 5896  C C    . CYS A 1 66 ? -7.325  -6.132  -2.238  1.00 0.00 ? 66 CYS A C    6  
ATOM 5897  O O    . CYS A 1 66 ? -7.806  -6.642  -3.251  1.00 0.00 ? 66 CYS A O    6  
ATOM 5898  C CB   . CYS A 1 66 ? -6.981  -3.714  -2.747  1.00 0.00 ? 66 CYS A CB   6  
ATOM 5899  S SG   . CYS A 1 66 ? -5.886  -2.269  -2.743  1.00 0.00 ? 66 CYS A SG   6  
ATOM 5900  H H    . CYS A 1 66 ? -5.419  -5.467  -4.217  1.00 0.00 ? 66 CYS A H    6  
ATOM 5901  H HA   . CYS A 1 66 ? -5.846  -4.873  -1.362  1.00 0.00 ? 66 CYS A HA   6  
ATOM 5902  H HB2  . CYS A 1 66 ? -7.375  -3.821  -3.743  1.00 0.00 ? 66 CYS A HB2  6  
ATOM 5903  H HB3  . CYS A 1 66 ? -7.789  -3.511  -2.060  1.00 0.00 ? 66 CYS A HB3  6  
ATOM 5904  N N    . PRO A 1 67 ? -7.681  -6.519  -1.004  1.00 0.00 ? 67 PRO A N    6  
ATOM 5905  C CA   . PRO A 1 67 ? -8.665  -7.573  -0.746  1.00 0.00 ? 67 PRO A CA   6  
ATOM 5906  C C    . PRO A 1 67 ? -9.948  -7.368  -1.543  1.00 0.00 ? 67 PRO A C    6  
ATOM 5907  O O    . PRO A 1 67 ? -10.007 -6.525  -2.438  1.00 0.00 ? 67 PRO A O    6  
ATOM 5908  C CB   . PRO A 1 67 ? -8.947  -7.449  0.763   1.00 0.00 ? 67 PRO A CB   6  
ATOM 5909  C CG   . PRO A 1 67 ? -8.291  -6.175  1.195   1.00 0.00 ? 67 PRO A CG   6  
ATOM 5910  C CD   . PRO A 1 67 ? -7.159  -5.956  0.243   1.00 0.00 ? 67 PRO A CD   6  
ATOM 5911  H HA   . PRO A 1 67 ? -8.261  -8.551  -0.961  1.00 0.00 ? 67 PRO A HA   6  
ATOM 5912  H HB2  . PRO A 1 67 ? -10.013 -7.417  0.928   1.00 0.00 ? 67 PRO A HB2  6  
ATOM 5913  H HB3  . PRO A 1 67 ? -8.526  -8.300  1.278   1.00 0.00 ? 67 PRO A HB3  6  
ATOM 5914  H HG2  . PRO A 1 67 ? -8.993  -5.357  1.134   1.00 0.00 ? 67 PRO A HG2  6  
ATOM 5915  H HG3  . PRO A 1 67 ? -7.917  -6.274  2.203   1.00 0.00 ? 67 PRO A HG3  6  
ATOM 5916  H HD2  . PRO A 1 67 ? -6.946  -4.902  0.138   1.00 0.00 ? 67 PRO A HD2  6  
ATOM 5917  H HD3  . PRO A 1 67 ? -6.285  -6.494  0.571   1.00 0.00 ? 67 PRO A HD3  6  
ATOM 5918  N N    . ARG A 1 68 ? -10.976 -8.140  -1.207  1.00 0.00 ? 68 ARG A N    6  
ATOM 5919  C CA   . ARG A 1 68 ? -12.262 -8.039  -1.887  1.00 0.00 ? 68 ARG A CA   6  
ATOM 5920  C C    . ARG A 1 68 ? -13.310 -7.407  -0.976  1.00 0.00 ? 68 ARG A C    6  
ATOM 5921  O O    . ARG A 1 68 ? -14.494 -7.362  -1.312  1.00 0.00 ? 68 ARG A O    6  
ATOM 5922  C CB   . ARG A 1 68 ? -12.732 -9.421  -2.342  1.00 0.00 ? 68 ARG A CB   6  
ATOM 5923  C CG   . ARG A 1 68 ? -11.660 -10.221 -3.064  1.00 0.00 ? 68 ARG A CG   6  
ATOM 5924  C CD   . ARG A 1 68 ? -11.851 -11.715 -2.863  1.00 0.00 ? 68 ARG A CD   6  
ATOM 5925  N NE   . ARG A 1 68 ? -12.509 -12.341 -4.006  1.00 0.00 ? 68 ARG A NE   6  
ATOM 5926  C CZ   . ARG A 1 68 ? -13.828 -12.384 -4.163  1.00 0.00 ? 68 ARG A CZ   6  
ATOM 5927  N NH1  . ARG A 1 68 ? -14.625 -11.840 -3.253  1.00 0.00 ? 68 ARG A NH1  6  
ATOM 5928  N NH2  . ARG A 1 68 ? -14.351 -12.971 -5.230  1.00 0.00 ? 68 ARG A NH2  6  
ATOM 5929  H H    . ARG A 1 68 ? -10.869 -8.790  -0.481  1.00 0.00 ? 68 ARG A H    6  
ATOM 5930  H HA   . ARG A 1 68 ? -12.130 -7.410  -2.754  1.00 0.00 ? 68 ARG A HA   6  
ATOM 5931  H HB2  . ARG A 1 68 ? -13.050 -9.984  -1.477  1.00 0.00 ? 68 ARG A HB2  6  
ATOM 5932  H HB3  . ARG A 1 68 ? -13.572 -9.301  -3.011  1.00 0.00 ? 68 ARG A HB3  6  
ATOM 5933  H HG2  . ARG A 1 68 ? -11.709 -10.001 -4.119  1.00 0.00 ? 68 ARG A HG2  6  
ATOM 5934  H HG3  . ARG A 1 68 ? -10.692 -9.935  -2.679  1.00 0.00 ? 68 ARG A HG3  6  
ATOM 5935  H HD2  . ARG A 1 68 ? -10.884 -12.173 -2.721  1.00 0.00 ? 68 ARG A HD2  6  
ATOM 5936  H HD3  . ARG A 1 68 ? -12.455 -11.872 -1.981  1.00 0.00 ? 68 ARG A HD3  6  
ATOM 5937  H HE   . ARG A 1 68 ? -11.939 -12.749 -4.690  1.00 0.00 ? 68 ARG A HE   6  
ATOM 5938  H HH11 . ARG A 1 68 ? -14.234 -11.396 -2.447  1.00 0.00 ? 68 ARG A HH11 6  
ATOM 5939  H HH12 . ARG A 1 68 ? -15.617 -11.873 -3.373  1.00 0.00 ? 68 ARG A HH12 6  
ATOM 5940  H HH21 . ARG A 1 68 ? -13.754 -13.382 -5.919  1.00 0.00 ? 68 ARG A HH21 6  
ATOM 5941  H HH22 . ARG A 1 68 ? -15.344 -13.003 -5.347  1.00 0.00 ? 68 ARG A HH22 6  
ATOM 5942  N N    . ASN A 1 69 ? -12.868 -6.917  0.179   1.00 0.00 ? 69 ASN A N    6  
ATOM 5943  C CA   . ASN A 1 69 ? -13.767 -6.287  1.138   1.00 0.00 ? 69 ASN A CA   6  
ATOM 5944  C C    . ASN A 1 69 ? -14.148 -4.882  0.683   1.00 0.00 ? 69 ASN A C    6  
ATOM 5945  O O    . ASN A 1 69 ? -13.369 -4.202  0.015   1.00 0.00 ? 69 ASN A O    6  
ATOM 5946  C CB   . ASN A 1 69 ? -13.110 -6.225  2.518   1.00 0.00 ? 69 ASN A CB   6  
ATOM 5947  C CG   . ASN A 1 69 ? -12.735 -7.596  3.043   1.00 0.00 ? 69 ASN A CG   6  
ATOM 5948  O OD1  . ASN A 1 69 ? -11.889 -8.283  2.472   1.00 0.00 ? 69 ASN A OD1  6  
ATOM 5949  N ND2  . ASN A 1 69 ? -13.367 -8.003  4.138   1.00 0.00 ? 69 ASN A ND2  6  
ATOM 5950  H H    . ASN A 1 69 ? -11.914 -6.981  0.392   1.00 0.00 ? 69 ASN A H    6  
ATOM 5951  H HA   . ASN A 1 69 ? -14.661 -6.888  1.201   1.00 0.00 ? 69 ASN A HA   6  
ATOM 5952  H HB2  . ASN A 1 69 ? -12.212 -5.628  2.456   1.00 0.00 ? 69 ASN A HB2  6  
ATOM 5953  H HB3  . ASN A 1 69 ? -13.794 -5.766  3.216   1.00 0.00 ? 69 ASN A HB3  6  
ATOM 5954  H HD21 . ASN A 1 69 ? -14.029 -7.403  4.540   1.00 0.00 ? 69 ASN A HD21 6  
ATOM 5955  H HD22 . ASN A 1 69 ? -13.144 -8.886  4.500   1.00 0.00 ? 69 ASN A HD22 6  
ATOM 5956  N N    . PRO A 1 70 ? -15.358 -4.429  1.043   1.00 0.00 ? 70 PRO A N    6  
ATOM 5957  C CA   . PRO A 1 70 ? -15.846 -3.097  0.673   1.00 0.00 ? 70 PRO A CA   6  
ATOM 5958  C C    . PRO A 1 70 ? -14.898 -1.991  1.123   1.00 0.00 ? 70 PRO A C    6  
ATOM 5959  O O    . PRO A 1 70 ? -14.737 -1.746  2.318   1.00 0.00 ? 70 PRO A O    6  
ATOM 5960  C CB   . PRO A 1 70 ? -17.186 -2.987  1.409   1.00 0.00 ? 70 PRO A CB   6  
ATOM 5961  C CG   . PRO A 1 70 ? -17.609 -4.396  1.645   1.00 0.00 ? 70 PRO A CG   6  
ATOM 5962  C CD   . PRO A 1 70 ? -16.342 -5.180  1.840   1.00 0.00 ? 70 PRO A CD   6  
ATOM 5963  H HA   . PRO A 1 70 ? -16.009 -3.019  -0.392  1.00 0.00 ? 70 PRO A HA   6  
ATOM 5964  H HB2  . PRO A 1 70 ? -17.045 -2.455  2.338   1.00 0.00 ? 70 PRO A HB2  6  
ATOM 5965  H HB3  . PRO A 1 70 ? -17.897 -2.461  0.790   1.00 0.00 ? 70 PRO A HB3  6  
ATOM 5966  H HG2  . PRO A 1 70 ? -18.225 -4.451  2.531   1.00 0.00 ? 70 PRO A HG2  6  
ATOM 5967  H HG3  . PRO A 1 70 ? -18.150 -4.766  0.787   1.00 0.00 ? 70 PRO A HG3  6  
ATOM 5968  H HD2  . PRO A 1 70 ? -16.064 -5.195  2.884   1.00 0.00 ? 70 PRO A HD2  6  
ATOM 5969  H HD3  . PRO A 1 70 ? -16.457 -6.185  1.464   1.00 0.00 ? 70 PRO A HD3  6  
ATOM 5970  N N    . PHE A 1 71 ? -14.270 -1.328  0.157   1.00 0.00 ? 71 PHE A N    6  
ATOM 5971  C CA   . PHE A 1 71 ? -13.336 -0.249  0.453   1.00 0.00 ? 71 PHE A CA   6  
ATOM 5972  C C    . PHE A 1 71 ? -13.903 1.093   -0.011  1.00 0.00 ? 71 PHE A C    6  
ATOM 5973  O O    . PHE A 1 71 ? -15.111 1.317   0.063   1.00 0.00 ? 71 PHE A O    6  
ATOM 5974  C CB   . PHE A 1 71 ? -11.990 -0.523  -0.219  1.00 0.00 ? 71 PHE A CB   6  
ATOM 5975  C CG   . PHE A 1 71 ? -11.583 -1.966  -0.172  1.00 0.00 ? 71 PHE A CG   6  
ATOM 5976  C CD1  . PHE A 1 71 ? -11.298 -2.579  1.037   1.00 0.00 ? 71 PHE A CD1  6  
ATOM 5977  C CD2  . PHE A 1 71 ? -11.488 -2.710  -1.337  1.00 0.00 ? 71 PHE A CD2  6  
ATOM 5978  C CE1  . PHE A 1 71 ? -10.926 -3.909  1.083   1.00 0.00 ? 71 PHE A CE1  6  
ATOM 5979  C CE2  . PHE A 1 71 ? -11.117 -4.040  -1.297  1.00 0.00 ? 71 PHE A CE2  6  
ATOM 5980  C CZ   . PHE A 1 71 ? -10.836 -4.640  -0.085  1.00 0.00 ? 71 PHE A CZ   6  
ATOM 5981  H H    . PHE A 1 71 ? -14.439 -1.571  -0.777  1.00 0.00 ? 71 PHE A H    6  
ATOM 5982  H HA   . PHE A 1 71 ? -13.195 -0.216  1.524   1.00 0.00 ? 71 PHE A HA   6  
ATOM 5983  H HB2  . PHE A 1 71 ? -12.044 -0.227  -1.255  1.00 0.00 ? 71 PHE A HB2  6  
ATOM 5984  H HB3  . PHE A 1 71 ? -11.223 0.056   0.276   1.00 0.00 ? 71 PHE A HB3  6  
ATOM 5985  H HD1  . PHE A 1 71 ? -11.369 -2.008  1.951   1.00 0.00 ? 71 PHE A HD1  6  
ATOM 5986  H HD2  . PHE A 1 71 ? -11.707 -2.241  -2.284  1.00 0.00 ? 71 PHE A HD2  6  
ATOM 5987  H HE1  . PHE A 1 71 ? -10.707 -4.376  2.032   1.00 0.00 ? 71 PHE A HE1  6  
ATOM 5988  H HE2  . PHE A 1 71 ? -11.047 -4.610  -2.212  1.00 0.00 ? 71 PHE A HE2  6  
ATOM 5989  H HZ   . PHE A 1 71 ? -10.546 -5.679  -0.051  1.00 0.00 ? 71 PHE A HZ   6  
ATOM 5990  N N    . HIS A 1 72 ? -13.033 1.983   -0.488  1.00 0.00 ? 72 HIS A N    6  
ATOM 5991  C CA   . HIS A 1 72 ? -13.467 3.293   -0.959  1.00 0.00 ? 72 HIS A CA   6  
ATOM 5992  C C    . HIS A 1 72 ? -14.824 3.200   -1.649  1.00 0.00 ? 72 HIS A C    6  
ATOM 5993  O O    . HIS A 1 72 ? -15.002 2.427   -2.590  1.00 0.00 ? 72 HIS A O    6  
ATOM 5994  C CB   . HIS A 1 72 ? -12.435 3.883   -1.920  1.00 0.00 ? 72 HIS A CB   6  
ATOM 5995  C CG   . HIS A 1 72 ? -12.819 5.226   -2.457  1.00 0.00 ? 72 HIS A CG   6  
ATOM 5996  N ND1  . HIS A 1 72 ? -13.538 6.150   -1.730  1.00 0.00 ? 72 HIS A ND1  6  
ATOM 5997  C CD2  . HIS A 1 72 ? -12.580 5.801   -3.660  1.00 0.00 ? 72 HIS A CD2  6  
ATOM 5998  C CE1  . HIS A 1 72 ? -13.727 7.234   -2.461  1.00 0.00 ? 72 HIS A CE1  6  
ATOM 5999  N NE2  . HIS A 1 72 ? -13.155 7.048   -3.636  1.00 0.00 ? 72 HIS A NE2  6  
ATOM 6000  H H    . HIS A 1 72 ? -12.080 1.756   -0.524  1.00 0.00 ? 72 HIS A H    6  
ATOM 6001  H HA   . HIS A 1 72 ? -13.557 3.941   -0.099  1.00 0.00 ? 72 HIS A HA   6  
ATOM 6002  H HB2  . HIS A 1 72 ? -11.492 3.988   -1.405  1.00 0.00 ? 72 HIS A HB2  6  
ATOM 6003  H HB3  . HIS A 1 72 ? -12.309 3.212   -2.758  1.00 0.00 ? 72 HIS A HB3  6  
ATOM 6004  H HD1  . HIS A 1 72 ? -13.863 6.030   -0.813  1.00 0.00 ? 72 HIS A HD1  6  
ATOM 6005  H HD2  . HIS A 1 72 ? -12.038 5.360   -4.485  1.00 0.00 ? 72 HIS A HD2  6  
ATOM 6006  H HE1  . HIS A 1 72 ? -14.258 8.122   -2.151  1.00 0.00 ? 72 HIS A HE1  6  
ATOM 6007  H HE2  . HIS A 1 72 ? -13.232 7.653   -4.403  1.00 0.00 ? 72 HIS A HE2  6  
ATOM 6008  N N    . ALA A 1 73 ? -15.779 3.992   -1.173  1.00 0.00 ? 73 ALA A N    6  
ATOM 6009  C CA   . ALA A 1 73 ? -17.121 3.998   -1.742  1.00 0.00 ? 73 ALA A CA   6  
ATOM 6010  C C    . ALA A 1 73 ? -17.979 5.091   -1.113  1.00 0.00 ? 73 ALA A C    6  
ATOM 6011  O O    . ALA A 1 73 ? -17.720 5.446   0.056   1.00 0.00 ? 73 ALA A O    6  
ATOM 6012  C CB   . ALA A 1 73 ? -17.777 2.638   -1.559  1.00 0.00 ? 73 ALA A CB   6  
ATOM 6013  O OXT  . ALA A 1 73 ? -18.902 5.583   -1.795  1.00 0.00 ? 73 ALA A OXT  6  
ATOM 6014  H H    . ALA A 1 73 ? -15.577 4.586   -0.420  1.00 0.00 ? 73 ALA A H    6  
ATOM 6015  H HA   . ALA A 1 73 ? -17.032 4.189   -2.802  1.00 0.00 ? 73 ALA A HA   6  
ATOM 6016  H HB1  . ALA A 1 73 ? -18.826 2.708   -1.808  1.00 0.00 ? 73 ALA A HB1  6  
ATOM 6017  H HB2  . ALA A 1 73 ? -17.672 2.323   -0.531  1.00 0.00 ? 73 ALA A HB2  6  
ATOM 6018  H HB3  . ALA A 1 73 ? -17.300 1.918   -2.207  1.00 0.00 ? 73 ALA A HB3  6  
ATOM 6019  N N    . GLU A 1 1  ? -3.517  14.609  3.692   1.00 0.00 ? 1  GLU A N    7  
ATOM 6020  C CA   . GLU A 1 1  ? -4.275  13.500  4.328   1.00 0.00 ? 1  GLU A CA   7  
ATOM 6021  C C    . GLU A 1 1  ? -4.755  12.494  3.288   1.00 0.00 ? 1  GLU A C    7  
ATOM 6022  O O    . GLU A 1 1  ? -5.795  12.685  2.658   1.00 0.00 ? 1  GLU A O    7  
ATOM 6023  C CB   . GLU A 1 1  ? -5.469  14.094  5.079   1.00 0.00 ? 1  GLU A CB   7  
ATOM 6024  C CG   . GLU A 1 1  ? -5.540  13.675  6.538   1.00 0.00 ? 1  GLU A CG   7  
ATOM 6025  C CD   . GLU A 1 1  ? -5.157  14.795  7.485   1.00 0.00 ? 1  GLU A CD   7  
ATOM 6026  O OE1  . GLU A 1 1  ? -4.074  15.386  7.298   1.00 0.00 ? 1  GLU A OE1  7  
ATOM 6027  O OE2  . GLU A 1 1  ? -5.942  15.081  8.414   1.00 0.00 ? 1  GLU A OE2  7  
ATOM 6028  H H1   . GLU A 1 1  ? -3.345  15.333  4.418   1.00 0.00 ? 1  GLU A H1   7  
ATOM 6029  H H2   . GLU A 1 1  ? -4.098  14.985  2.915   1.00 0.00 ? 1  GLU A H2   7  
ATOM 6030  H H3   . GLU A 1 1  ? -2.621  14.218  3.336   1.00 0.00 ? 1  GLU A H3   7  
ATOM 6031  H HA   . GLU A 1 1  ? -3.627  12.999  5.031   1.00 0.00 ? 1  GLU A HA   7  
ATOM 6032  H HB2  . GLU A 1 1  ? -5.404  15.172  5.039   1.00 0.00 ? 1  GLU A HB2  7  
ATOM 6033  H HB3  . GLU A 1 1  ? -6.379  13.779  4.591   1.00 0.00 ? 1  GLU A HB3  7  
ATOM 6034  H HG2  . GLU A 1 1  ? -6.550  13.365  6.761   1.00 0.00 ? 1  GLU A HG2  7  
ATOM 6035  H HG3  . GLU A 1 1  ? -4.867  12.844  6.694   1.00 0.00 ? 1  GLU A HG3  7  
ATOM 6036  N N    . ALA A 1 2  ? -3.990  11.421  3.113   1.00 0.00 ? 2  ALA A N    7  
ATOM 6037  C CA   . ALA A 1 2  ? -4.336  10.384  2.148   1.00 0.00 ? 2  ALA A CA   7  
ATOM 6038  C C    . ALA A 1 2  ? -3.984  9.000   2.682   1.00 0.00 ? 2  ALA A C    7  
ATOM 6039  O O    . ALA A 1 2  ? -2.913  8.466   2.392   1.00 0.00 ? 2  ALA A O    7  
ATOM 6040  C CB   . ALA A 1 2  ? -3.629  10.638  0.826   1.00 0.00 ? 2  ALA A CB   7  
ATOM 6041  H H    . ALA A 1 2  ? -3.173  11.325  3.645   1.00 0.00 ? 2  ALA A H    7  
ATOM 6042  H HA   . ALA A 1 2  ? -5.402  10.432  1.975   1.00 0.00 ? 2  ALA A HA   7  
ATOM 6043  H HB1  . ALA A 1 2  ? -4.347  10.973  0.092   1.00 0.00 ? 2  ALA A HB1  7  
ATOM 6044  H HB2  . ALA A 1 2  ? -3.165  9.724   0.484   1.00 0.00 ? 2  ALA A HB2  7  
ATOM 6045  H HB3  . ALA A 1 2  ? -2.872  11.397  0.962   1.00 0.00 ? 2  ALA A HB3  7  
ATOM 6046  N N    . GLY A 1 3  ? -4.891  8.423   3.463   1.00 0.00 ? 3  GLY A N    7  
ATOM 6047  C CA   . GLY A 1 3  ? -4.656  7.106   4.026   1.00 0.00 ? 3  GLY A CA   7  
ATOM 6048  C C    . GLY A 1 3  ? -3.464  7.081   4.964   1.00 0.00 ? 3  GLY A C    7  
ATOM 6049  O O    . GLY A 1 3  ? -3.586  7.427   6.139   1.00 0.00 ? 3  GLY A O    7  
ATOM 6050  H H    . GLY A 1 3  ? -5.726  8.896   3.661   1.00 0.00 ? 3  GLY A H    7  
ATOM 6051  H HA2  . GLY A 1 3  ? -5.537  6.798   4.572   1.00 0.00 ? 3  GLY A HA2  7  
ATOM 6052  H HA3  . GLY A 1 3  ? -4.483  6.407   3.221   1.00 0.00 ? 3  GLY A HA3  7  
ATOM 6053  N N    . GLU A 1 4  ? -2.308  6.675   4.446   1.00 0.00 ? 4  GLU A N    7  
ATOM 6054  C CA   . GLU A 1 4  ? -1.094  6.612   5.251   1.00 0.00 ? 4  GLU A CA   7  
ATOM 6055  C C    . GLU A 1 4  ? -0.033  7.567   4.714   1.00 0.00 ? 4  GLU A C    7  
ATOM 6056  O O    . GLU A 1 4  ? -0.192  8.148   3.641   1.00 0.00 ? 4  GLU A O    7  
ATOM 6057  C CB   . GLU A 1 4  ? -0.545  5.185   5.280   1.00 0.00 ? 4  GLU A CB   7  
ATOM 6058  C CG   . GLU A 1 4  ? -1.260  4.280   6.269   1.00 0.00 ? 4  GLU A CG   7  
ATOM 6059  C CD   . GLU A 1 4  ? -0.318  3.315   6.962   1.00 0.00 ? 4  GLU A CD   7  
ATOM 6060  O OE1  . GLU A 1 4  ? 0.569   3.784   7.707   1.00 0.00 ? 4  GLU A OE1  7  
ATOM 6061  O OE2  . GLU A 1 4  ? -0.467  2.091   6.762   1.00 0.00 ? 4  GLU A OE2  7  
ATOM 6062  H H    . GLU A 1 4  ? -2.271  6.413   3.501   1.00 0.00 ? 4  GLU A H    7  
ATOM 6063  H HA   . GLU A 1 4  ? -1.350  6.909   6.257   1.00 0.00 ? 4  GLU A HA   7  
ATOM 6064  H HB2  . GLU A 1 4  ? -0.643  4.754   4.294   1.00 0.00 ? 4  GLU A HB2  7  
ATOM 6065  H HB3  . GLU A 1 4  ? 0.501   5.219   5.546   1.00 0.00 ? 4  GLU A HB3  7  
ATOM 6066  H HG2  . GLU A 1 4  ? -1.737  4.893   7.019   1.00 0.00 ? 4  GLU A HG2  7  
ATOM 6067  H HG3  . GLU A 1 4  ? -2.010  3.711   5.740   1.00 0.00 ? 4  GLU A HG3  7  
ATOM 6068  N N    . GLU A 1 5  ? 1.049   7.723   5.469   1.00 0.00 ? 5  GLU A N    7  
ATOM 6069  C CA   . GLU A 1 5  ? 2.139   8.606   5.071   1.00 0.00 ? 5  GLU A CA   7  
ATOM 6070  C C    . GLU A 1 5  ? 2.897   8.030   3.880   1.00 0.00 ? 5  GLU A C    7  
ATOM 6071  O O    . GLU A 1 5  ? 2.416   7.116   3.210   1.00 0.00 ? 5  GLU A O    7  
ATOM 6072  C CB   . GLU A 1 5  ? 3.095   8.829   6.243   1.00 0.00 ? 5  GLU A CB   7  
ATOM 6073  C CG   . GLU A 1 5  ? 2.388   9.058   7.569   1.00 0.00 ? 5  GLU A CG   7  
ATOM 6074  C CD   . GLU A 1 5  ? 2.652   10.438  8.140   1.00 0.00 ? 5  GLU A CD   7  
ATOM 6075  O OE1  . GLU A 1 5  ? 3.837   10.783  8.333   1.00 0.00 ? 5  GLU A OE1  7  
ATOM 6076  O OE2  . GLU A 1 5  ? 1.674   11.173  8.392   1.00 0.00 ? 5  GLU A OE2  7  
ATOM 6077  H H    . GLU A 1 5  ? 1.118   7.232   6.314   1.00 0.00 ? 5  GLU A H    7  
ATOM 6078  H HA   . GLU A 1 5  ? 1.708   9.554   4.784   1.00 0.00 ? 5  GLU A HA   7  
ATOM 6079  H HB2  . GLU A 1 5  ? 3.731   7.961   6.344   1.00 0.00 ? 5  GLU A HB2  7  
ATOM 6080  H HB3  . GLU A 1 5  ? 3.709   9.692   6.033   1.00 0.00 ? 5  GLU A HB3  7  
ATOM 6081  H HG2  . GLU A 1 5  ? 1.325   8.945   7.420   1.00 0.00 ? 5  GLU A HG2  7  
ATOM 6082  H HG3  . GLU A 1 5  ? 2.732   8.319   8.278   1.00 0.00 ? 5  GLU A HG3  7  
ATOM 6083  N N    . CYS A 1 6  ? 4.083   8.570   3.620   1.00 0.00 ? 6  CYS A N    7  
ATOM 6084  C CA   . CYS A 1 6  ? 4.904   8.108   2.506   1.00 0.00 ? 6  CYS A CA   7  
ATOM 6085  C C    . CYS A 1 6  ? 4.110   8.122   1.206   1.00 0.00 ? 6  CYS A C    7  
ATOM 6086  O O    . CYS A 1 6  ? 3.195   7.320   1.018   1.00 0.00 ? 6  CYS A O    7  
ATOM 6087  C CB   . CYS A 1 6  ? 5.427   6.697   2.778   1.00 0.00 ? 6  CYS A CB   7  
ATOM 6088  S SG   . CYS A 1 6  ? 6.236   5.917   1.344   1.00 0.00 ? 6  CYS A SG   7  
ATOM 6089  H H    . CYS A 1 6  ? 4.413   9.297   4.188   1.00 0.00 ? 6  CYS A H    7  
ATOM 6090  H HA   . CYS A 1 6  ? 5.742   8.782   2.410   1.00 0.00 ? 6  CYS A HA   7  
ATOM 6091  H HB2  . CYS A 1 6  ? 6.149   6.737   3.581   1.00 0.00 ? 6  CYS A HB2  7  
ATOM 6092  H HB3  . CYS A 1 6  ? 4.602   6.066   3.074   1.00 0.00 ? 6  CYS A HB3  7  
ATOM 6093  N N    . ASP A 1 7  ? 4.463   9.038   0.312   1.00 0.00 ? 7  ASP A N    7  
ATOM 6094  C CA   . ASP A 1 7  ? 3.780   9.156   -0.971  1.00 0.00 ? 7  ASP A CA   7  
ATOM 6095  C C    . ASP A 1 7  ? 4.720   8.823   -2.124  1.00 0.00 ? 7  ASP A C    7  
ATOM 6096  O O    . ASP A 1 7  ? 4.934   9.643   -3.017  1.00 0.00 ? 7  ASP A O    7  
ATOM 6097  C CB   . ASP A 1 7  ? 3.224   10.570  -1.147  1.00 0.00 ? 7  ASP A CB   7  
ATOM 6098  C CG   . ASP A 1 7  ? 2.564   11.094  0.113   1.00 0.00 ? 7  ASP A CG   7  
ATOM 6099  O OD1  . ASP A 1 7  ? 1.378   10.773  0.339   1.00 0.00 ? 7  ASP A OD1  7  
ATOM 6100  O OD2  . ASP A 1 7  ? 3.232   11.826  0.873   1.00 0.00 ? 7  ASP A OD2  7  
ATOM 6101  H H    . ASP A 1 7  ? 5.199   9.651   0.519   1.00 0.00 ? 7  ASP A H    7  
ATOM 6102  H HA   . ASP A 1 7  ? 2.960   8.454   -0.976  1.00 0.00 ? 7  ASP A HA   7  
ATOM 6103  H HB2  . ASP A 1 7  ? 4.032   11.236  -1.411  1.00 0.00 ? 7  ASP A HB2  7  
ATOM 6104  H HB3  . ASP A 1 7  ? 2.493   10.566  -1.942  1.00 0.00 ? 7  ASP A HB3  7  
ATOM 6105  N N    . CYS A 1 8  ? 5.281   7.618   -2.102  1.00 0.00 ? 8  CYS A N    7  
ATOM 6106  C CA   . CYS A 1 8  ? 6.197   7.189   -3.152  1.00 0.00 ? 8  CYS A CA   7  
ATOM 6107  C C    . CYS A 1 8  ? 5.508   6.266   -4.161  1.00 0.00 ? 8  CYS A C    7  
ATOM 6108  O O    . CYS A 1 8  ? 6.100   5.915   -5.181  1.00 0.00 ? 8  CYS A O    7  
ATOM 6109  C CB   . CYS A 1 8  ? 7.391   6.436   -2.574  1.00 0.00 ? 8  CYS A CB   7  
ATOM 6110  S SG   . CYS A 1 8  ? 8.705   7.445   -1.818  1.00 0.00 ? 8  CYS A SG   7  
ATOM 6111  H H    . CYS A 1 8  ? 5.074   7.006   -1.366  1.00 0.00 ? 8  CYS A H    7  
ATOM 6112  H HA   . CYS A 1 8  ? 6.552   8.069   -3.666  1.00 0.00 ? 8  CYS A HA   7  
ATOM 6113  H HB2  . CYS A 1 8  ? 7.041   5.755   -1.820  1.00 0.00 ? 8  CYS A HB2  7  
ATOM 6114  H HB3  . CYS A 1 8  ? 7.838   5.881   -3.375  1.00 0.00 ? 8  CYS A HB3  7  
ATOM 6115  N N    . GLY A 1 9  ? 4.273   5.850   -3.875  1.00 0.00 ? 9  GLY A N    7  
ATOM 6116  C CA   . GLY A 1 9  ? 3.579   4.958   -4.794  1.00 0.00 ? 9  GLY A CA   7  
ATOM 6117  C C    . GLY A 1 9  ? 2.257   4.428   -4.261  1.00 0.00 ? 9  GLY A C    7  
ATOM 6118  O O    . GLY A 1 9  ? 1.558   5.114   -3.516  1.00 0.00 ? 9  GLY A O    7  
ATOM 6119  H H    . GLY A 1 9  ? 3.842   6.137   -3.043  1.00 0.00 ? 9  GLY A H    7  
ATOM 6120  H HA2  . GLY A 1 9  ? 3.388   5.492   -5.713  1.00 0.00 ? 9  GLY A HA2  7  
ATOM 6121  H HA3  . GLY A 1 9  ? 4.225   4.120   -5.012  1.00 0.00 ? 9  GLY A HA3  7  
ATOM 6122  N N    . SER A 1 10 ? 1.912   3.201   -4.664  1.00 0.00 ? 10 SER A N    7  
ATOM 6123  C CA   . SER A 1 10 ? 0.667   2.567   -4.251  1.00 0.00 ? 10 SER A CA   7  
ATOM 6124  C C    . SER A 1 10 ? 0.683   1.093   -4.672  1.00 0.00 ? 10 SER A C    7  
ATOM 6125  O O    . SER A 1 10 ? 1.742   0.563   -5.006  1.00 0.00 ? 10 SER A O    7  
ATOM 6126  C CB   . SER A 1 10 ? -0.516  3.313   -4.878  1.00 0.00 ? 10 SER A CB   7  
ATOM 6127  O OG   . SER A 1 10 ? -0.279  4.710   -4.897  1.00 0.00 ? 10 SER A OG   7  
ATOM 6128  H H    . SER A 1 10 ? 2.508   2.710   -5.264  1.00 0.00 ? 10 SER A H    7  
ATOM 6129  H HA   . SER A 1 10 ? 0.600   2.620   -3.177  1.00 0.00 ? 10 SER A HA   7  
ATOM 6130  H HB2  . SER A 1 10 ? -0.664  2.970   -5.891  1.00 0.00 ? 10 SER A HB2  7  
ATOM 6131  H HB3  . SER A 1 10 ? -1.407  3.128   -4.299  1.00 0.00 ? 10 SER A HB3  7  
ATOM 6132  H HG   . SER A 1 10 ? -0.263  5.044   -3.997  1.00 0.00 ? 10 SER A HG   7  
ATOM 6133  N N    . PRO A 1 11 ? -0.471  0.397   -4.666  1.00 0.00 ? 11 PRO A N    7  
ATOM 6134  C CA   . PRO A 1 11 ? -0.516  -1.013  -5.052  1.00 0.00 ? 11 PRO A CA   7  
ATOM 6135  C C    . PRO A 1 11 ? 0.121   -1.252  -6.412  1.00 0.00 ? 11 PRO A C    7  
ATOM 6136  O O    . PRO A 1 11 ? -0.515  -1.079  -7.452  1.00 0.00 ? 11 PRO A O    7  
ATOM 6137  C CB   . PRO A 1 11 ? -2.008  -1.343  -5.091  1.00 0.00 ? 11 PRO A CB   7  
ATOM 6138  C CG   . PRO A 1 11 ? -2.655  -0.325  -4.219  1.00 0.00 ? 11 PRO A CG   7  
ATOM 6139  C CD   . PRO A 1 11 ? -1.797  0.909   -4.286  1.00 0.00 ? 11 PRO A CD   7  
ATOM 6140  H HA   . PRO A 1 11 ? -0.023  -1.630  -4.317  1.00 0.00 ? 11 PRO A HA   7  
ATOM 6141  H HB2  . PRO A 1 11 ? -2.366  -1.278  -6.107  1.00 0.00 ? 11 PRO A HB2  7  
ATOM 6142  H HB3  . PRO A 1 11 ? -2.166  -2.342  -4.711  1.00 0.00 ? 11 PRO A HB3  7  
ATOM 6143  H HG2  . PRO A 1 11 ? -3.647  -0.108  -4.587  1.00 0.00 ? 11 PRO A HG2  7  
ATOM 6144  H HG3  . PRO A 1 11 ? -2.706  -0.689  -3.206  1.00 0.00 ? 11 PRO A HG3  7  
ATOM 6145  H HD2  . PRO A 1 11 ? -2.175  1.588   -5.036  1.00 0.00 ? 11 PRO A HD2  7  
ATOM 6146  H HD3  . PRO A 1 11 ? -1.761  1.395   -3.323  1.00 0.00 ? 11 PRO A HD3  7  
ATOM 6147  N N    . GLY A 1 12 ? 1.389   -1.635  -6.391  1.00 0.00 ? 12 GLY A N    7  
ATOM 6148  C CA   . GLY A 1 12 ? 2.118   -1.878  -7.621  1.00 0.00 ? 12 GLY A CA   7  
ATOM 6149  C C    . GLY A 1 12 ? 3.407   -1.094  -7.641  1.00 0.00 ? 12 GLY A C    7  
ATOM 6150  O O    . GLY A 1 12 ? 4.388   -1.492  -8.269  1.00 0.00 ? 12 GLY A O    7  
ATOM 6151  H H    . GLY A 1 12 ? 1.844   -1.740  -5.524  1.00 0.00 ? 12 GLY A H    7  
ATOM 6152  H HA2  . GLY A 1 12 ? 2.340   -2.932  -7.700  1.00 0.00 ? 12 GLY A HA2  7  
ATOM 6153  H HA3  . GLY A 1 12 ? 1.509   -1.578  -8.460  1.00 0.00 ? 12 GLY A HA3  7  
ATOM 6154  N N    . ASN A 1 13 ? 3.397   0.019   -6.920  1.00 0.00 ? 13 ASN A N    7  
ATOM 6155  C CA   . ASN A 1 13 ? 4.559   0.881   -6.804  1.00 0.00 ? 13 ASN A CA   7  
ATOM 6156  C C    . ASN A 1 13 ? 4.909   1.053   -5.332  1.00 0.00 ? 13 ASN A C    7  
ATOM 6157  O O    . ASN A 1 13 ? 4.981   2.171   -4.822  1.00 0.00 ? 13 ASN A O    7  
ATOM 6158  C CB   . ASN A 1 13 ? 4.287   2.243   -7.445  1.00 0.00 ? 13 ASN A CB   7  
ATOM 6159  C CG   . ASN A 1 13 ? 4.420   2.208   -8.955  1.00 0.00 ? 13 ASN A CG   7  
ATOM 6160  O OD1  . ASN A 1 13 ? 4.209   1.172   -9.585  1.00 0.00 ? 13 ASN A OD1  7  
ATOM 6161  N ND2  . ASN A 1 13 ? 4.772   3.345   -9.545  1.00 0.00 ? 13 ASN A ND2  7  
ATOM 6162  H H    . ASN A 1 13 ? 2.581   0.258   -6.433  1.00 0.00 ? 13 ASN A H    7  
ATOM 6163  H HA   . ASN A 1 13 ? 5.385   0.404   -7.310  1.00 0.00 ? 13 ASN A HA   7  
ATOM 6164  H HB2  . ASN A 1 13 ? 3.283   2.557   -7.199  1.00 0.00 ? 13 ASN A HB2  7  
ATOM 6165  H HB3  . ASN A 1 13 ? 4.991   2.964   -7.056  1.00 0.00 ? 13 ASN A HB3  7  
ATOM 6166  H HD21 . ASN A 1 13 ? 4.924   4.132   -8.980  1.00 0.00 ? 13 ASN A HD21 7  
ATOM 6167  H HD22 . ASN A 1 13 ? 4.866   3.351   -10.520 1.00 0.00 ? 13 ASN A HD22 7  
ATOM 6168  N N    . PRO A 1 14 ? 5.129   -0.069  -4.632  1.00 0.00 ? 14 PRO A N    7  
ATOM 6169  C CA   . PRO A 1 14 ? 5.470   -0.099  -3.227  1.00 0.00 ? 14 PRO A CA   7  
ATOM 6170  C C    . PRO A 1 14 ? 6.128   1.178   -2.744  1.00 0.00 ? 14 PRO A C    7  
ATOM 6171  O O    . PRO A 1 14 ? 7.342   1.340   -2.863  1.00 0.00 ? 14 PRO A O    7  
ATOM 6172  C CB   . PRO A 1 14 ? 6.435   -1.293  -3.146  1.00 0.00 ? 14 PRO A CB   7  
ATOM 6173  C CG   . PRO A 1 14 ? 6.264   -2.045  -4.442  1.00 0.00 ? 14 PRO A CG   7  
ATOM 6174  C CD   . PRO A 1 14 ? 5.080   -1.430  -5.142  1.00 0.00 ? 14 PRO A CD   7  
ATOM 6175  H HA   . PRO A 1 14 ? 4.605   -0.298  -2.618  1.00 0.00 ? 14 PRO A HA   7  
ATOM 6176  H HB2  . PRO A 1 14 ? 7.446   -0.931  -3.034  1.00 0.00 ? 14 PRO A HB2  7  
ATOM 6177  H HB3  . PRO A 1 14 ? 6.175   -1.910  -2.299  1.00 0.00 ? 14 PRO A HB3  7  
ATOM 6178  H HG2  . PRO A 1 14 ? 7.150   -1.932  -5.046  1.00 0.00 ? 14 PRO A HG2  7  
ATOM 6179  H HG3  . PRO A 1 14 ? 6.081   -3.089  -4.242  1.00 0.00 ? 14 PRO A HG3  7  
ATOM 6180  H HD2  . PRO A 1 14 ? 5.210   -1.457  -6.211  1.00 0.00 ? 14 PRO A HD2  7  
ATOM 6181  H HD3  . PRO A 1 14 ? 4.163   -1.923  -4.848  1.00 0.00 ? 14 PRO A HD3  7  
ATOM 6182  N N    . CYS A 1 15 ? 5.298   2.062   -2.179  1.00 0.00 ? 15 CYS A N    7  
ATOM 6183  C CA   . CYS A 1 15 ? 5.740   3.342   -1.626  1.00 0.00 ? 15 CYS A CA   7  
ATOM 6184  C C    . CYS A 1 15 ? 7.250   3.496   -1.692  1.00 0.00 ? 15 CYS A C    7  
ATOM 6185  O O    . CYS A 1 15 ? 7.937   3.325   -0.692  1.00 0.00 ? 15 CYS A O    7  
ATOM 6186  C CB   . CYS A 1 15 ? 5.272   3.477   -0.173  1.00 0.00 ? 15 CYS A CB   7  
ATOM 6187  S SG   . CYS A 1 15 ? 4.693   5.145   0.274   1.00 0.00 ? 15 CYS A SG   7  
ATOM 6188  H H    . CYS A 1 15 ? 4.347   1.832   -2.116  1.00 0.00 ? 15 CYS A H    7  
ATOM 6189  H HA   . CYS A 1 15 ? 5.286   4.127   -2.211  1.00 0.00 ? 15 CYS A HA   7  
ATOM 6190  H HB2  . CYS A 1 15 ? 4.459   2.788   0.002   1.00 0.00 ? 15 CYS A HB2  7  
ATOM 6191  H HB3  . CYS A 1 15 ? 6.093   3.229   0.486   1.00 0.00 ? 15 CYS A HB3  7  
ATOM 6192  N N    . CYS A 1 16 ? 7.727   3.835   -2.887  1.00 0.00 ? 16 CYS A N    7  
ATOM 6193  C CA   . CYS A 1 16 ? 9.146   4.055   -3.172  1.00 0.00 ? 16 CYS A CA   7  
ATOM 6194  C C    . CYS A 1 16 ? 9.811   2.821   -3.766  1.00 0.00 ? 16 CYS A C    7  
ATOM 6195  O O    . CYS A 1 16 ? 9.884   1.761   -3.145  1.00 0.00 ? 16 CYS A O    7  
ATOM 6196  C CB   . CYS A 1 16 ? 9.922   4.592   -1.958  1.00 0.00 ? 16 CYS A CB   7  
ATOM 6197  S SG   . CYS A 1 16 ? 10.410  6.353   -2.115  1.00 0.00 ? 16 CYS A SG   7  
ATOM 6198  H H    . CYS A 1 16 ? 7.085   3.962   -3.621  1.00 0.00 ? 16 CYS A H    7  
ATOM 6199  H HA   . CYS A 1 16 ? 9.173   4.806   -3.931  1.00 0.00 ? 16 CYS A HA   7  
ATOM 6200  H HB2  . CYS A 1 16 ? 9.325   4.502   -1.073  1.00 0.00 ? 16 CYS A HB2  7  
ATOM 6201  H HB3  . CYS A 1 16 ? 10.827  4.010   -1.835  1.00 0.00 ? 16 CYS A HB3  7  
ATOM 6202  N N    . ASP A 1 17 ? 10.281  2.991   -5.002  1.00 0.00 ? 17 ASP A N    7  
ATOM 6203  C CA   . ASP A 1 17 ? 10.939  1.933   -5.757  1.00 0.00 ? 17 ASP A CA   7  
ATOM 6204  C C    . ASP A 1 17 ? 11.664  2.528   -6.964  1.00 0.00 ? 17 ASP A C    7  
ATOM 6205  O O    . ASP A 1 17 ? 11.288  2.281   -8.110  1.00 0.00 ? 17 ASP A O    7  
ATOM 6206  C CB   . ASP A 1 17 ? 9.908   0.908   -6.222  1.00 0.00 ? 17 ASP A CB   7  
ATOM 6207  C CG   . ASP A 1 17 ? 8.611   1.555   -6.668  1.00 0.00 ? 17 ASP A CG   7  
ATOM 6208  O OD1  . ASP A 1 17 ? 8.559   2.052   -7.813  1.00 0.00 ? 17 ASP A OD1  7  
ATOM 6209  O OD2  . ASP A 1 17 ? 7.648   1.564   -5.873  1.00 0.00 ? 17 ASP A OD2  7  
ATOM 6210  H H    . ASP A 1 17 ? 10.170  3.867   -5.427  1.00 0.00 ? 17 ASP A H    7  
ATOM 6211  H HA   . ASP A 1 17 ? 11.658  1.452   -5.111  1.00 0.00 ? 17 ASP A HA   7  
ATOM 6212  H HB2  . ASP A 1 17 ? 10.313  0.360   -7.054  1.00 0.00 ? 17 ASP A HB2  7  
ATOM 6213  H HB3  . ASP A 1 17 ? 9.692   0.227   -5.413  1.00 0.00 ? 17 ASP A HB3  7  
ATOM 6214  N N    . ALA A 1 18 ? 12.693  3.324   -6.680  1.00 0.00 ? 18 ALA A N    7  
ATOM 6215  C CA   . ALA A 1 18 ? 13.490  4.000   -7.702  1.00 0.00 ? 18 ALA A CA   7  
ATOM 6216  C C    . ALA A 1 18 ? 13.403  3.327   -9.065  1.00 0.00 ? 18 ALA A C    7  
ATOM 6217  O O    . ALA A 1 18 ? 13.296  4.001   -10.089 1.00 0.00 ? 18 ALA A O    7  
ATOM 6218  C CB   . ALA A 1 18 ? 14.941  4.086   -7.255  1.00 0.00 ? 18 ALA A CB   7  
ATOM 6219  H H    . ALA A 1 18 ? 12.922  3.471   -5.745  1.00 0.00 ? 18 ALA A H    7  
ATOM 6220  H HA   . ALA A 1 18 ? 13.116  5.009   -7.793  1.00 0.00 ? 18 ALA A HA   7  
ATOM 6221  H HB1  . ALA A 1 18 ? 15.500  3.269   -7.687  1.00 0.00 ? 18 ALA A HB1  7  
ATOM 6222  H HB2  . ALA A 1 18 ? 14.990  4.025   -6.177  1.00 0.00 ? 18 ALA A HB2  7  
ATOM 6223  H HB3  . ALA A 1 18 ? 15.364  5.024   -7.581  1.00 0.00 ? 18 ALA A HB3  7  
ATOM 6224  N N    . ALA A 1 19 ? 13.476  2.005   -9.082  1.00 0.00 ? 19 ALA A N    7  
ATOM 6225  C CA   . ALA A 1 19 ? 13.433  1.271   -10.338 1.00 0.00 ? 19 ALA A CA   7  
ATOM 6226  C C    . ALA A 1 19 ? 12.441  0.112   -10.306 1.00 0.00 ? 19 ALA A C    7  
ATOM 6227  O O    . ALA A 1 19 ? 11.924  -0.301  -11.344 1.00 0.00 ? 19 ALA A O    7  
ATOM 6228  C CB   . ALA A 1 19 ? 14.824  0.765   -10.664 1.00 0.00 ? 19 ALA A CB   7  
ATOM 6229  H H    . ALA A 1 19 ? 13.583  1.518   -8.239  1.00 0.00 ? 19 ALA A H    7  
ATOM 6230  H HA   . ALA A 1 19 ? 13.138  1.959   -11.114 1.00 0.00 ? 19 ALA A HA   7  
ATOM 6231  H HB1  . ALA A 1 19 ? 15.128  0.048   -9.916  1.00 0.00 ? 19 ALA A HB1  7  
ATOM 6232  H HB2  . ALA A 1 19 ? 15.514  1.597   -10.667 1.00 0.00 ? 19 ALA A HB2  7  
ATOM 6233  H HB3  . ALA A 1 19 ? 14.818  0.296   -11.634 1.00 0.00 ? 19 ALA A HB3  7  
ATOM 6234  N N    . THR A 1 20 ? 12.183  -0.414  -9.118  1.00 0.00 ? 20 THR A N    7  
ATOM 6235  C CA   . THR A 1 20 ? 11.259  -1.529  -8.960  1.00 0.00 ? 20 THR A CA   7  
ATOM 6236  C C    . THR A 1 20 ? 10.989  -1.773  -7.486  1.00 0.00 ? 20 THR A C    7  
ATOM 6237  O O    . THR A 1 20 ? 11.761  -1.332  -6.637  1.00 0.00 ? 20 THR A O    7  
ATOM 6238  C CB   . THR A 1 20 ? 11.829  -2.792  -9.606  1.00 0.00 ? 20 THR A CB   7  
ATOM 6239  O OG1  . THR A 1 20 ? 10.803  -3.740  -9.842  1.00 0.00 ? 20 THR A OG1  7  
ATOM 6240  C CG2  . THR A 1 20 ? 12.892  -3.466  -8.766  1.00 0.00 ? 20 THR A CG2  7  
ATOM 6241  H H    . THR A 1 20 ? 12.623  -0.044  -8.325  1.00 0.00 ? 20 THR A H    7  
ATOM 6242  H HA   . THR A 1 20 ? 10.332  -1.267  -9.448  1.00 0.00 ? 20 THR A HA   7  
ATOM 6243  H HB   . THR A 1 20 ? 12.274  -2.530  -10.555 1.00 0.00 ? 20 THR A HB   7  
ATOM 6244  H HG1  . THR A 1 20 ? 10.402  -3.993  -9.007  1.00 0.00 ? 20 THR A HG1  7  
ATOM 6245  H HG21 . THR A 1 20 ? 13.710  -2.781  -8.603  1.00 0.00 ? 20 THR A HG21 7  
ATOM 6246  H HG22 . THR A 1 20 ? 13.255  -4.344  -9.281  1.00 0.00 ? 20 THR A HG22 7  
ATOM 6247  H HG23 . THR A 1 20 ? 12.470  -3.756  -7.815  1.00 0.00 ? 20 THR A HG23 7  
ATOM 6248  N N    . CYS A 1 21 ? 9.891   -2.462  -7.187  1.00 0.00 ? 21 CYS A N    7  
ATOM 6249  C CA   . CYS A 1 21 ? 9.521   -2.750  -5.804  1.00 0.00 ? 21 CYS A CA   7  
ATOM 6250  C C    . CYS A 1 21 ? 10.766  -2.935  -4.936  1.00 0.00 ? 21 CYS A C    7  
ATOM 6251  O O    . CYS A 1 21 ? 11.288  -4.042  -4.802  1.00 0.00 ? 21 CYS A O    7  
ATOM 6252  C CB   . CYS A 1 21 ? 8.626   -3.995  -5.743  1.00 0.00 ? 21 CYS A CB   7  
ATOM 6253  S SG   . CYS A 1 21 ? 7.065   -3.833  -6.677  1.00 0.00 ? 21 CYS A SG   7  
ATOM 6254  H H    . CYS A 1 21 ? 9.312   -2.778  -7.912  1.00 0.00 ? 21 CYS A H    7  
ATOM 6255  H HA   . CYS A 1 21 ? 8.967   -1.902  -5.432  1.00 0.00 ? 21 CYS A HA   7  
ATOM 6256  H HB2  . CYS A 1 21 ? 9.166   -4.838  -6.148  1.00 0.00 ? 21 CYS A HB2  7  
ATOM 6257  H HB3  . CYS A 1 21 ? 8.374   -4.198  -4.713  1.00 0.00 ? 21 CYS A HB3  7  
ATOM 6258  N N    . LYS A 1 22 ? 11.244  -1.830  -4.361  1.00 0.00 ? 22 LYS A N    7  
ATOM 6259  C CA   . LYS A 1 22 ? 12.432  -1.849  -3.514  1.00 0.00 ? 22 LYS A CA   7  
ATOM 6260  C C    . LYS A 1 22 ? 12.625  -0.506  -2.811  1.00 0.00 ? 22 LYS A C    7  
ATOM 6261  O O    . LYS A 1 22 ? 12.769  0.532   -3.458  1.00 0.00 ? 22 LYS A O    7  
ATOM 6262  C CB   . LYS A 1 22 ? 13.673  -2.186  -4.345  1.00 0.00 ? 22 LYS A CB   7  
ATOM 6263  C CG   . LYS A 1 22 ? 14.825  -2.737  -3.521  1.00 0.00 ? 22 LYS A CG   7  
ATOM 6264  C CD   . LYS A 1 22 ? 16.159  -2.166  -3.975  1.00 0.00 ? 22 LYS A CD   7  
ATOM 6265  C CE   . LYS A 1 22 ? 17.224  -2.315  -2.900  1.00 0.00 ? 22 LYS A CE   7  
ATOM 6266  N NZ   . LYS A 1 22 ? 17.410  -1.057  -2.124  1.00 0.00 ? 22 LYS A NZ   7  
ATOM 6267  H H    . LYS A 1 22 ? 10.787  -0.978  -4.518  1.00 0.00 ? 22 LYS A H    7  
ATOM 6268  H HA   . LYS A 1 22 ? 12.292  -2.615  -2.767  1.00 0.00 ? 22 LYS A HA   7  
ATOM 6269  H HB2  . LYS A 1 22 ? 13.405  -2.922  -5.088  1.00 0.00 ? 22 LYS A HB2  7  
ATOM 6270  H HB3  . LYS A 1 22 ? 14.011  -1.290  -4.844  1.00 0.00 ? 22 LYS A HB3  7  
ATOM 6271  H HG2  . LYS A 1 22 ? 14.670  -2.478  -2.484  1.00 0.00 ? 22 LYS A HG2  7  
ATOM 6272  H HG3  . LYS A 1 22 ? 14.848  -3.811  -3.626  1.00 0.00 ? 22 LYS A HG3  7  
ATOM 6273  H HD2  . LYS A 1 22 ? 16.482  -2.692  -4.861  1.00 0.00 ? 22 LYS A HD2  7  
ATOM 6274  H HD3  . LYS A 1 22 ? 16.033  -1.118  -4.202  1.00 0.00 ? 22 LYS A HD3  7  
ATOM 6275  H HE2  . LYS A 1 22 ? 16.927  -3.103  -2.224  1.00 0.00 ? 22 LYS A HE2  7  
ATOM 6276  H HE3  . LYS A 1 22 ? 18.159  -2.579  -3.371  1.00 0.00 ? 22 LYS A HE3  7  
ATOM 6277  H HZ1  . LYS A 1 22 ? 16.541  -0.828  -1.601  1.00 0.00 ? 22 LYS A HZ1  7  
ATOM 6278  H HZ2  . LYS A 1 22 ? 17.631  -0.270  -2.767  1.00 0.00 ? 22 LYS A HZ2  7  
ATOM 6279  H HZ3  . LYS A 1 22 ? 18.192  -1.167  -1.447  1.00 0.00 ? 22 LYS A HZ3  7  
ATOM 6280  N N    . LEU A 1 23 ? 12.624  -0.539  -1.484  1.00 0.00 ? 23 LEU A N    7  
ATOM 6281  C CA   . LEU A 1 23 ? 12.796  0.661   -0.675  1.00 0.00 ? 23 LEU A CA   7  
ATOM 6282  C C    . LEU A 1 23 ? 13.421  0.319   0.675   1.00 0.00 ? 23 LEU A C    7  
ATOM 6283  O O    . LEU A 1 23 ? 13.077  -0.688  1.294   1.00 0.00 ? 23 LEU A O    7  
ATOM 6284  C CB   . LEU A 1 23 ? 11.453  1.373   -0.470  1.00 0.00 ? 23 LEU A CB   7  
ATOM 6285  C CG   . LEU A 1 23 ? 10.349  0.566   0.228   1.00 0.00 ? 23 LEU A CG   7  
ATOM 6286  C CD1  . LEU A 1 23 ? 8.988   1.093   -0.177  1.00 0.00 ? 23 LEU A CD1  7  
ATOM 6287  C CD2  . LEU A 1 23 ? 10.441  -0.915  -0.100  1.00 0.00 ? 23 LEU A CD2  7  
ATOM 6288  H H    . LEU A 1 23 ? 12.503  -1.393  -1.036  1.00 0.00 ? 23 LEU A H    7  
ATOM 6289  H HA   . LEU A 1 23 ? 13.464  1.322   -1.207  1.00 0.00 ? 23 LEU A HA   7  
ATOM 6290  H HB2  . LEU A 1 23 ? 11.634  2.262   0.116   1.00 0.00 ? 23 LEU A HB2  7  
ATOM 6291  H HB3  . LEU A 1 23 ? 11.084  1.676   -1.437  1.00 0.00 ? 23 LEU A HB3  7  
ATOM 6292  H HG   . LEU A 1 23 ? 10.447  0.681   1.298   1.00 0.00 ? 23 LEU A HG   7  
ATOM 6293  H HD11 . LEU A 1 23 ? 8.619   1.765   0.583   1.00 0.00 ? 23 LEU A HD11 7  
ATOM 6294  H HD12 . LEU A 1 23 ? 8.304   0.267   -0.292  1.00 0.00 ? 23 LEU A HD12 7  
ATOM 6295  H HD13 . LEU A 1 23 ? 9.073   1.622   -1.116  1.00 0.00 ? 23 LEU A HD13 7  
ATOM 6296  H HD21 . LEU A 1 23 ? 10.521  -1.041  -1.170  1.00 0.00 ? 23 LEU A HD21 7  
ATOM 6297  H HD22 . LEU A 1 23 ? 9.553   -1.416  0.255   1.00 0.00 ? 23 LEU A HD22 7  
ATOM 6298  H HD23 . LEU A 1 23 ? 11.309  -1.337  0.379   1.00 0.00 ? 23 LEU A HD23 7  
ATOM 6299  N N    . ARG A 1 24 ? 14.347  1.161   1.122   1.00 0.00 ? 24 ARG A N    7  
ATOM 6300  C CA   . ARG A 1 24 ? 15.027  0.944   2.396   1.00 0.00 ? 24 ARG A CA   7  
ATOM 6301  C C    . ARG A 1 24 ? 14.097  1.221   3.574   1.00 0.00 ? 24 ARG A C    7  
ATOM 6302  O O    . ARG A 1 24 ? 14.482  1.052   4.731   1.00 0.00 ? 24 ARG A O    7  
ATOM 6303  C CB   . ARG A 1 24 ? 16.267  1.834   2.492   1.00 0.00 ? 24 ARG A CB   7  
ATOM 6304  C CG   . ARG A 1 24 ? 17.436  1.342   1.653   1.00 0.00 ? 24 ARG A CG   7  
ATOM 6305  C CD   . ARG A 1 24 ? 18.447  0.582   2.496   1.00 0.00 ? 24 ARG A CD   7  
ATOM 6306  N NE   . ARG A 1 24 ? 19.313  -0.264  1.682   1.00 0.00 ? 24 ARG A NE   7  
ATOM 6307  C CZ   . ARG A 1 24 ? 20.223  0.210   0.837   1.00 0.00 ? 24 ARG A CZ   7  
ATOM 6308  N NH1  . ARG A 1 24 ? 20.382  1.518   0.697   1.00 0.00 ? 24 ARG A NH1  7  
ATOM 6309  N NH2  . ARG A 1 24 ? 20.974  -0.625  0.132   1.00 0.00 ? 24 ARG A NH2  7  
ATOM 6310  H H    . ARG A 1 24 ? 14.583  1.943   0.582   1.00 0.00 ? 24 ARG A H    7  
ATOM 6311  H HA   . ARG A 1 24 ? 15.335  -0.090  2.433   1.00 0.00 ? 24 ARG A HA   7  
ATOM 6312  H HB2  . ARG A 1 24 ? 16.009  2.829   2.162   1.00 0.00 ? 24 ARG A HB2  7  
ATOM 6313  H HB3  . ARG A 1 24 ? 16.586  1.877   3.523   1.00 0.00 ? 24 ARG A HB3  7  
ATOM 6314  H HG2  . ARG A 1 24 ? 17.061  0.686   0.881   1.00 0.00 ? 24 ARG A HG2  7  
ATOM 6315  H HG3  . ARG A 1 24 ? 17.924  2.192   1.200   1.00 0.00 ? 24 ARG A HG3  7  
ATOM 6316  H HD2  . ARG A 1 24 ? 19.057  1.295   3.032   1.00 0.00 ? 24 ARG A HD2  7  
ATOM 6317  H HD3  . ARG A 1 24 ? 17.914  -0.037  3.203   1.00 0.00 ? 24 ARG A HD3  7  
ATOM 6318  H HE   . ARG A 1 24 ? 19.212  -1.235  1.770   1.00 0.00 ? 24 ARG A HE   7  
ATOM 6319  H HH11 . ARG A 1 24 ? 19.818  2.151   1.228   1.00 0.00 ? 24 ARG A HH11 7  
ATOM 6320  H HH12 . ARG A 1 24 ? 21.067  1.873   0.060   1.00 0.00 ? 24 ARG A HH12 7  
ATOM 6321  H HH21 . ARG A 1 24 ? 20.856  -1.613  0.235   1.00 0.00 ? 24 ARG A HH21 7  
ATOM 6322  H HH22 . ARG A 1 24 ? 21.657  -0.267  -0.504  1.00 0.00 ? 24 ARG A HH22 7  
ATOM 6323  N N    . GLN A 1 25 ? 12.872  1.644   3.276   1.00 0.00 ? 25 GLN A N    7  
ATOM 6324  C CA   . GLN A 1 25 ? 11.895  1.941   4.317   1.00 0.00 ? 25 GLN A CA   7  
ATOM 6325  C C    . GLN A 1 25 ? 10.892  0.800   4.466   1.00 0.00 ? 25 GLN A C    7  
ATOM 6326  O O    . GLN A 1 25 ? 11.173  -0.205  5.119   1.00 0.00 ? 25 GLN A O    7  
ATOM 6327  C CB   . GLN A 1 25 ? 11.174  3.255   4.009   1.00 0.00 ? 25 GLN A CB   7  
ATOM 6328  C CG   . GLN A 1 25 ? 12.074  4.477   4.093   1.00 0.00 ? 25 GLN A CG   7  
ATOM 6329  C CD   . GLN A 1 25 ? 12.488  4.801   5.515   1.00 0.00 ? 25 GLN A CD   7  
ATOM 6330  O OE1  . GLN A 1 25 ? 12.969  3.935   6.246   1.00 0.00 ? 25 GLN A OE1  7  
ATOM 6331  N NE2  . GLN A 1 25 ? 12.301  6.054   5.915   1.00 0.00 ? 25 GLN A NE2  7  
ATOM 6332  H H    . GLN A 1 25 ? 12.620  1.760   2.337   1.00 0.00 ? 25 GLN A H    7  
ATOM 6333  H HA   . GLN A 1 25 ? 12.425  2.047   5.245   1.00 0.00 ? 25 GLN A HA   7  
ATOM 6334  H HB2  . GLN A 1 25 ? 10.766  3.203   3.011   1.00 0.00 ? 25 GLN A HB2  7  
ATOM 6335  H HB3  . GLN A 1 25 ? 10.364  3.382   4.713   1.00 0.00 ? 25 GLN A HB3  7  
ATOM 6336  H HG2  . GLN A 1 25 ? 12.964  4.294   3.509   1.00 0.00 ? 25 GLN A HG2  7  
ATOM 6337  H HG3  . GLN A 1 25 ? 11.546  5.326   3.685   1.00 0.00 ? 25 GLN A HG3  7  
ATOM 6338  H HE21 . GLN A 1 25 ? 11.913  6.690   5.279   1.00 0.00 ? 25 GLN A HE21 7  
ATOM 6339  H HE22 . GLN A 1 25 ? 12.560  6.291   6.830   1.00 0.00 ? 25 GLN A HE22 7  
ATOM 6340  N N    . GLY A 1 26 ? 9.725   0.962   3.858   1.00 0.00 ? 26 GLY A N    7  
ATOM 6341  C CA   . GLY A 1 26 ? 8.697   -0.061  3.932   1.00 0.00 ? 26 GLY A CA   7  
ATOM 6342  C C    . GLY A 1 26 ? 7.358   0.431   3.421   1.00 0.00 ? 26 GLY A C    7  
ATOM 6343  O O    . GLY A 1 26 ? 6.583   1.033   4.164   1.00 0.00 ? 26 GLY A O    7  
ATOM 6344  H H    . GLY A 1 26 ? 9.560   1.781   3.354   1.00 0.00 ? 26 GLY A H    7  
ATOM 6345  H HA2  . GLY A 1 26 ? 9.007   -0.910  3.340   1.00 0.00 ? 26 GLY A HA2  7  
ATOM 6346  H HA3  . GLY A 1 26 ? 8.587   -0.372  4.960   1.00 0.00 ? 26 GLY A HA3  7  
ATOM 6347  N N    . ALA A 1 27 ? 7.093   0.185   2.144   1.00 0.00 ? 27 ALA A N    7  
ATOM 6348  C CA   . ALA A 1 27 ? 5.849   0.616   1.520   1.00 0.00 ? 27 ALA A CA   7  
ATOM 6349  C C    . ALA A 1 27 ? 4.716   -0.376  1.748   1.00 0.00 ? 27 ALA A C    7  
ATOM 6350  O O    . ALA A 1 27 ? 3.703   -0.334  1.051   1.00 0.00 ? 27 ALA A O    7  
ATOM 6351  C CB   . ALA A 1 27 ? 6.055   0.802   0.033   1.00 0.00 ? 27 ALA A CB   7  
ATOM 6352  H H    . ALA A 1 27 ? 7.758   -0.290  1.603   1.00 0.00 ? 27 ALA A H    7  
ATOM 6353  H HA   . ALA A 1 27 ? 5.574   1.570   1.942   1.00 0.00 ? 27 ALA A HA   7  
ATOM 6354  H HB1  . ALA A 1 27 ? 6.713   1.641   -0.144  1.00 0.00 ? 27 ALA A HB1  7  
ATOM 6355  H HB2  . ALA A 1 27 ? 5.100   0.984   -0.429  1.00 0.00 ? 27 ALA A HB2  7  
ATOM 6356  H HB3  . ALA A 1 27 ? 6.491   -0.092  -0.386  1.00 0.00 ? 27 ALA A HB3  7  
ATOM 6357  N N    . GLN A 1 28 ? 4.897   -1.268  2.711   1.00 0.00 ? 28 GLN A N    7  
ATOM 6358  C CA   . GLN A 1 28 ? 3.893   -2.282  3.023   1.00 0.00 ? 28 GLN A CA   7  
ATOM 6359  C C    . GLN A 1 28 ? 2.476   -1.790  2.725   1.00 0.00 ? 28 GLN A C    7  
ATOM 6360  O O    . GLN A 1 28 ? 1.862   -2.183  1.733   1.00 0.00 ? 28 GLN A O    7  
ATOM 6361  C CB   . GLN A 1 28 ? 4.010   -2.693  4.491   1.00 0.00 ? 28 GLN A CB   7  
ATOM 6362  C CG   . GLN A 1 28 ? 5.441   -2.890  4.949   1.00 0.00 ? 28 GLN A CG   7  
ATOM 6363  C CD   . GLN A 1 28 ? 5.911   -1.797  5.888   1.00 0.00 ? 28 GLN A CD   7  
ATOM 6364  O OE1  . GLN A 1 28 ? 5.746   -0.609  5.609   1.00 0.00 ? 28 GLN A OE1  7  
ATOM 6365  N NE2  . GLN A 1 28 ? 6.501   -2.193  7.010   1.00 0.00 ? 28 GLN A NE2  7  
ATOM 6366  H H    . GLN A 1 28 ? 5.732   -1.252  3.224   1.00 0.00 ? 28 GLN A H    7  
ATOM 6367  H HA   . GLN A 1 28 ? 4.096   -3.138  2.402   1.00 0.00 ? 28 GLN A HA   7  
ATOM 6368  H HB2  . GLN A 1 28 ? 3.562   -1.929  5.107   1.00 0.00 ? 28 GLN A HB2  7  
ATOM 6369  H HB3  . GLN A 1 28 ? 3.479   -3.617  4.639   1.00 0.00 ? 28 GLN A HB3  7  
ATOM 6370  H HG2  . GLN A 1 28 ? 5.513   -3.839  5.460   1.00 0.00 ? 28 GLN A HG2  7  
ATOM 6371  H HG3  . GLN A 1 28 ? 6.083   -2.902  4.080   1.00 0.00 ? 28 GLN A HG3  7  
ATOM 6372  H HE21 . GLN A 1 28 ? 6.599   -3.155  7.166   1.00 0.00 ? 28 GLN A HE21 7  
ATOM 6373  H HE22 . GLN A 1 28 ? 6.815   -1.506  7.635   1.00 0.00 ? 28 GLN A HE22 7  
ATOM 6374  N N    . CYS A 1 29 ? 1.975   -0.922  3.589   1.00 0.00 ? 29 CYS A N    7  
ATOM 6375  C CA   . CYS A 1 29 ? 0.644   -0.351  3.442   1.00 0.00 ? 29 CYS A CA   7  
ATOM 6376  C C    . CYS A 1 29 ? 0.727   1.161   3.616   1.00 0.00 ? 29 CYS A C    7  
ATOM 6377  O O    . CYS A 1 29 ? -0.069  1.765   4.334   1.00 0.00 ? 29 CYS A O    7  
ATOM 6378  C CB   . CYS A 1 29 ? -0.315  -0.947  4.475   1.00 0.00 ? 29 CYS A CB   7  
ATOM 6379  S SG   . CYS A 1 29 ? -0.732  -2.697  4.183   1.00 0.00 ? 29 CYS A SG   7  
ATOM 6380  H H    . CYS A 1 29 ? 2.520   -0.648  4.344   1.00 0.00 ? 29 CYS A H    7  
ATOM 6381  H HA   . CYS A 1 29 ? 0.288   -0.579  2.448   1.00 0.00 ? 29 CYS A HA   7  
ATOM 6382  H HB2  . CYS A 1 29 ? 0.133   -0.877  5.454   1.00 0.00 ? 29 CYS A HB2  7  
ATOM 6383  H HB3  . CYS A 1 29 ? -1.237  -0.383  4.466   1.00 0.00 ? 29 CYS A HB3  7  
ATOM 6384  N N    . ALA A 1 30 ? 1.716   1.755   2.959   1.00 0.00 ? 30 ALA A N    7  
ATOM 6385  C CA   . ALA A 1 30 ? 1.943   3.200   3.036   1.00 0.00 ? 30 ALA A CA   7  
ATOM 6386  C C    . ALA A 1 30 ? 0.834   3.961   2.320   1.00 0.00 ? 30 ALA A C    7  
ATOM 6387  O O    . ALA A 1 30 ? -0.328  3.558   2.383   1.00 0.00 ? 30 ALA A O    7  
ATOM 6388  C CB   . ALA A 1 30 ? 3.303   3.545   2.447   1.00 0.00 ? 30 ALA A CB   7  
ATOM 6389  H H    . ALA A 1 30 ? 2.314   1.200   2.410   1.00 0.00 ? 30 ALA A H    7  
ATOM 6390  H HA   . ALA A 1 30 ? 1.945   3.482   4.079   1.00 0.00 ? 30 ALA A HA   7  
ATOM 6391  H HB1  . ALA A 1 30 ? 3.296   3.348   1.385   1.00 0.00 ? 30 ALA A HB1  7  
ATOM 6392  H HB2  . ALA A 1 30 ? 4.064   2.943   2.920   1.00 0.00 ? 30 ALA A HB2  7  
ATOM 6393  H HB3  . ALA A 1 30 ? 3.514   4.591   2.617   1.00 0.00 ? 30 ALA A HB3  7  
ATOM 6394  N N    . GLU A 1 31 ? 1.185   5.052   1.622   1.00 0.00 ? 31 GLU A N    7  
ATOM 6395  C CA   . GLU A 1 31 ? 0.187   5.826   0.885   1.00 0.00 ? 31 GLU A CA   7  
ATOM 6396  C C    . GLU A 1 31 ? -0.819  4.871   0.268   1.00 0.00 ? 31 GLU A C    7  
ATOM 6397  O O    . GLU A 1 31 ? -2.003  5.176   0.138   1.00 0.00 ? 31 GLU A O    7  
ATOM 6398  C CB   . GLU A 1 31 ? 0.846   6.669   -0.210  1.00 0.00 ? 31 GLU A CB   7  
ATOM 6399  C CG   . GLU A 1 31 ? -0.119  7.097   -1.304  1.00 0.00 ? 31 GLU A CG   7  
ATOM 6400  C CD   . GLU A 1 31 ? 0.394   8.274   -2.110  1.00 0.00 ? 31 GLU A CD   7  
ATOM 6401  O OE1  . GLU A 1 31 ? 0.930   9.223   -1.500  1.00 0.00 ? 31 GLU A OE1  7  
ATOM 6402  O OE2  . GLU A 1 31 ? 0.260   8.246   -3.352  1.00 0.00 ? 31 GLU A OE2  7  
ATOM 6403  H H    . GLU A 1 31 ? 2.124   5.327   1.591   1.00 0.00 ? 31 GLU A H    7  
ATOM 6404  H HA   . GLU A 1 31 ? -0.322  6.475   1.583   1.00 0.00 ? 31 GLU A HA   7  
ATOM 6405  H HB2  . GLU A 1 31 ? 1.265   7.557   0.238   1.00 0.00 ? 31 GLU A HB2  7  
ATOM 6406  H HB3  . GLU A 1 31 ? 1.640   6.094   -0.663  1.00 0.00 ? 31 GLU A HB3  7  
ATOM 6407  H HG2  . GLU A 1 31 ? -0.276  6.264   -1.974  1.00 0.00 ? 31 GLU A HG2  7  
ATOM 6408  H HG3  . GLU A 1 31 ? -1.059  7.373   -0.850  1.00 0.00 ? 31 GLU A HG3  7  
ATOM 6409  N N    . GLY A 1 32 ? -0.314  3.694   -0.077  1.00 0.00 ? 32 GLY A N    7  
ATOM 6410  C CA   . GLY A 1 32 ? -1.133  2.653   -0.644  1.00 0.00 ? 32 GLY A CA   7  
ATOM 6411  C C    . GLY A 1 32 ? -0.476  1.304   -0.473  1.00 0.00 ? 32 GLY A C    7  
ATOM 6412  O O    . GLY A 1 32 ? 0.482   1.176   0.290   1.00 0.00 ? 32 GLY A O    7  
ATOM 6413  H H    . GLY A 1 32 ? 0.638   3.523   0.076   1.00 0.00 ? 32 GLY A H    7  
ATOM 6414  H HA2  . GLY A 1 32 ? -2.083  2.644   -0.131  1.00 0.00 ? 32 GLY A HA2  7  
ATOM 6415  H HA3  . GLY A 1 32 ? -1.290  2.845   -1.692  1.00 0.00 ? 32 GLY A HA3  7  
ATOM 6416  N N    . LEU A 1 33 ? -0.985  0.287   -1.150  1.00 0.00 ? 33 LEU A N    7  
ATOM 6417  C CA   . LEU A 1 33 ? -0.413  -1.044  -1.005  1.00 0.00 ? 33 LEU A CA   7  
ATOM 6418  C C    . LEU A 1 33 ? 0.970   -1.167  -1.657  1.00 0.00 ? 33 LEU A C    7  
ATOM 6419  O O    . LEU A 1 33 ? 1.323   -0.401  -2.553  1.00 0.00 ? 33 LEU A O    7  
ATOM 6420  C CB   . LEU A 1 33 ? -1.354  -2.109  -1.559  1.00 0.00 ? 33 LEU A CB   7  
ATOM 6421  C CG   . LEU A 1 33 ? -1.519  -3.329  -0.654  1.00 0.00 ? 33 LEU A CG   7  
ATOM 6422  C CD1  . LEU A 1 33 ? -0.290  -4.217  -0.711  1.00 0.00 ? 33 LEU A CD1  7  
ATOM 6423  C CD2  . LEU A 1 33 ? -1.782  -2.884  0.773   1.00 0.00 ? 33 LEU A CD2  7  
ATOM 6424  H H    . LEU A 1 33 ? -1.766  0.428   -1.730  1.00 0.00 ? 33 LEU A H    7  
ATOM 6425  H HA   . LEU A 1 33 ? -0.303  -1.207  0.052   1.00 0.00 ? 33 LEU A HA   7  
ATOM 6426  H HB2  . LEU A 1 33 ? -2.326  -1.661  -1.705  1.00 0.00 ? 33 LEU A HB2  7  
ATOM 6427  H HB3  . LEU A 1 33 ? -0.977  -2.440  -2.513  1.00 0.00 ? 33 LEU A HB3  7  
ATOM 6428  H HG   . LEU A 1 33 ? -2.361  -3.908  -0.988  1.00 0.00 ? 33 LEU A HG   7  
ATOM 6429  H HD11 . LEU A 1 33 ? -0.595  -5.251  -0.747  1.00 0.00 ? 33 LEU A HD11 7  
ATOM 6430  H HD12 . LEU A 1 33 ? 0.313   -4.052  0.170   1.00 0.00 ? 33 LEU A HD12 7  
ATOM 6431  H HD13 . LEU A 1 33 ? 0.287   -3.979  -1.593  1.00 0.00 ? 33 LEU A HD13 7  
ATOM 6432  H HD21 . LEU A 1 33 ? -0.973  -3.213  1.409   1.00 0.00 ? 33 LEU A HD21 7  
ATOM 6433  H HD22 . LEU A 1 33 ? -2.708  -3.314  1.119   1.00 0.00 ? 33 LEU A HD22 7  
ATOM 6434  H HD23 . LEU A 1 33 ? -1.852  -1.808  0.810   1.00 0.00 ? 33 LEU A HD23 7  
ATOM 6435  N N    . CYS A 1 34 ? 1.748   -2.142  -1.174  1.00 0.00 ? 34 CYS A N    7  
ATOM 6436  C CA   . CYS A 1 34 ? 3.102   -2.397  -1.665  1.00 0.00 ? 34 CYS A CA   7  
ATOM 6437  C C    . CYS A 1 34 ? 3.174   -3.683  -2.480  1.00 0.00 ? 34 CYS A C    7  
ATOM 6438  O O    . CYS A 1 34 ? 2.175   -4.372  -2.679  1.00 0.00 ? 34 CYS A O    7  
ATOM 6439  C CB   . CYS A 1 34 ? 4.077   -2.457  -0.467  1.00 0.00 ? 34 CYS A CB   7  
ATOM 6440  S SG   . CYS A 1 34 ? 5.036   -4.006  -0.251  1.00 0.00 ? 34 CYS A SG   7  
ATOM 6441  H H    . CYS A 1 34 ? 1.406   -2.698  -0.457  1.00 0.00 ? 34 CYS A H    7  
ATOM 6442  H HA   . CYS A 1 34 ? 3.379   -1.573  -2.298  1.00 0.00 ? 34 CYS A HA   7  
ATOM 6443  H HB2  . CYS A 1 34 ? 4.788   -1.662  -0.565  1.00 0.00 ? 34 CYS A HB2  7  
ATOM 6444  H HB3  . CYS A 1 34 ? 3.505   -2.313  0.435   1.00 0.00 ? 34 CYS A HB3  7  
ATOM 6445  N N    . CYS A 1 35 ? 4.379   -3.994  -2.934  1.00 0.00 ? 35 CYS A N    7  
ATOM 6446  C CA   . CYS A 1 35 ? 4.626   -5.201  -3.714  1.00 0.00 ? 35 CYS A CA   7  
ATOM 6447  C C    . CYS A 1 35 ? 5.958   -5.855  -3.332  1.00 0.00 ? 35 CYS A C    7  
ATOM 6448  O O    . CYS A 1 35 ? 6.137   -7.062  -3.493  1.00 0.00 ? 35 CYS A O    7  
ATOM 6449  C CB   . CYS A 1 35 ? 4.588   -4.877  -5.221  1.00 0.00 ? 35 CYS A CB   7  
ATOM 6450  S SG   . CYS A 1 35 ? 6.008   -5.503  -6.198  1.00 0.00 ? 35 CYS A SG   7  
ATOM 6451  H H    . CYS A 1 35 ? 5.119   -3.397  -2.726  1.00 0.00 ? 35 CYS A H    7  
ATOM 6452  H HA   . CYS A 1 35 ? 3.836   -5.888  -3.480  1.00 0.00 ? 35 CYS A HA   7  
ATOM 6453  H HB2  . CYS A 1 35 ? 3.693   -5.306  -5.646  1.00 0.00 ? 35 CYS A HB2  7  
ATOM 6454  H HB3  . CYS A 1 35 ? 4.554   -3.804  -5.345  1.00 0.00 ? 35 CYS A HB3  7  
ATOM 6455  N N    . ASP A 1 36 ? 6.888   -5.046  -2.849  1.00 0.00 ? 36 ASP A N    7  
ATOM 6456  C CA   . ASP A 1 36 ? 8.210   -5.521  -2.465  1.00 0.00 ? 36 ASP A CA   7  
ATOM 6457  C C    . ASP A 1 36 ? 8.191   -6.148  -1.075  1.00 0.00 ? 36 ASP A C    7  
ATOM 6458  O O    . ASP A 1 36 ? 7.163   -6.161  -0.399  1.00 0.00 ? 36 ASP A O    7  
ATOM 6459  C CB   . ASP A 1 36 ? 9.201   -4.344  -2.534  1.00 0.00 ? 36 ASP A CB   7  
ATOM 6460  C CG   . ASP A 1 36 ? 10.175  -4.275  -1.369  1.00 0.00 ? 36 ASP A CG   7  
ATOM 6461  O OD1  . ASP A 1 36 ? 11.217  -4.960  -1.426  1.00 0.00 ? 36 ASP A OD1  7  
ATOM 6462  O OD2  . ASP A 1 36 ? 9.893   -3.536  -0.403  1.00 0.00 ? 36 ASP A OD2  7  
ATOM 6463  H H    . ASP A 1 36 ? 6.687   -4.100  -2.760  1.00 0.00 ? 36 ASP A H    7  
ATOM 6464  H HA   . ASP A 1 36 ? 8.511   -6.271  -3.180  1.00 0.00 ? 36 ASP A HA   7  
ATOM 6465  H HB2  . ASP A 1 36 ? 9.773   -4.430  -3.440  1.00 0.00 ? 36 ASP A HB2  7  
ATOM 6466  H HB3  . ASP A 1 36 ? 8.639   -3.421  -2.560  1.00 0.00 ? 36 ASP A HB3  7  
ATOM 6467  N N    . GLN A 1 37 ? 9.346   -6.655  -0.655  1.00 0.00 ? 37 GLN A N    7  
ATOM 6468  C CA   . GLN A 1 37 ? 9.483   -7.272  0.654   1.00 0.00 ? 37 GLN A CA   7  
ATOM 6469  C C    . GLN A 1 37 ? 8.848   -6.408  1.738   1.00 0.00 ? 37 GLN A C    7  
ATOM 6470  O O    . GLN A 1 37 ? 8.540   -6.907  2.821   1.00 0.00 ? 37 GLN A O    7  
ATOM 6471  C CB   . GLN A 1 37 ? 10.960  -7.507  0.975   1.00 0.00 ? 37 GLN A CB   7  
ATOM 6472  C CG   . GLN A 1 37 ? 11.706  -8.269  -0.108  1.00 0.00 ? 37 GLN A CG   7  
ATOM 6473  C CD   . GLN A 1 37 ? 12.989  -7.580  -0.529  1.00 0.00 ? 37 GLN A CD   7  
ATOM 6474  O OE1  . GLN A 1 37 ? 13.054  -6.957  -1.589  1.00 0.00 ? 37 GLN A OE1  7  
ATOM 6475  N NE2  . GLN A 1 37 ? 14.020  -7.688  0.302   1.00 0.00 ? 37 GLN A NE2  7  
ATOM 6476  H H    . GLN A 1 37 ? 10.129  -6.606  -1.240  1.00 0.00 ? 37 GLN A H    7  
ATOM 6477  H HA   . GLN A 1 37 ? 8.976   -8.224  0.624   1.00 0.00 ? 37 GLN A HA   7  
ATOM 6478  H HB2  . GLN A 1 37 ? 11.444  -6.551  1.111   1.00 0.00 ? 37 GLN A HB2  7  
ATOM 6479  H HB3  . GLN A 1 37 ? 11.031  -8.070  1.895   1.00 0.00 ? 37 GLN A HB3  7  
ATOM 6480  H HG2  . GLN A 1 37 ? 11.949  -9.253  0.264   1.00 0.00 ? 37 GLN A HG2  7  
ATOM 6481  H HG3  . GLN A 1 37 ? 11.064  -8.361  -0.972  1.00 0.00 ? 37 GLN A HG3  7  
ATOM 6482  H HE21 . GLN A 1 37 ? 13.896  -8.200  1.128   1.00 0.00 ? 37 GLN A HE21 7  
ATOM 6483  H HE22 . GLN A 1 37 ? 14.862  -7.252  0.054   1.00 0.00 ? 37 GLN A HE22 7  
ATOM 6484  N N    . CYS A 1 38 ? 8.665   -5.110  1.443   1.00 0.00 ? 38 CYS A N    7  
ATOM 6485  C CA   . CYS A 1 38 ? 8.069   -4.165  2.394   1.00 0.00 ? 38 CYS A CA   7  
ATOM 6486  C C    . CYS A 1 38 ? 7.198   -4.891  3.413   1.00 0.00 ? 38 CYS A C    7  
ATOM 6487  O O    . CYS A 1 38 ? 7.270   -4.617  4.610   1.00 0.00 ? 38 CYS A O    7  
ATOM 6488  C CB   . CYS A 1 38 ? 7.233   -3.097  1.663   1.00 0.00 ? 38 CYS A CB   7  
ATOM 6489  S SG   . CYS A 1 38 ? 6.975   -3.405  -0.118  1.00 0.00 ? 38 CYS A SG   7  
ATOM 6490  H H    . CYS A 1 38 ? 8.948   -4.778  0.568   1.00 0.00 ? 38 CYS A H    7  
ATOM 6491  H HA   . CYS A 1 38 ? 8.877   -3.677  2.918   1.00 0.00 ? 38 CYS A HA   7  
ATOM 6492  H HB2  . CYS A 1 38 ? 6.259   -3.035  2.125   1.00 0.00 ? 38 CYS A HB2  7  
ATOM 6493  H HB3  . CYS A 1 38 ? 7.726   -2.140  1.761   1.00 0.00 ? 38 CYS A HB3  7  
ATOM 6494  N N    . ARG A 1 39 ? 6.386   -5.825  2.921   1.00 0.00 ? 39 ARG A N    7  
ATOM 6495  C CA   . ARG A 1 39 ? 5.493   -6.610  3.777   1.00 0.00 ? 39 ARG A CA   7  
ATOM 6496  C C    . ARG A 1 39 ? 4.138   -5.926  3.886   1.00 0.00 ? 39 ARG A C    7  
ATOM 6497  O O    . ARG A 1 39 ? 3.857   -5.001  3.135   1.00 0.00 ? 39 ARG A O    7  
ATOM 6498  C CB   . ARG A 1 39 ? 6.101   -6.808  5.168   1.00 0.00 ? 39 ARG A CB   7  
ATOM 6499  C CG   . ARG A 1 39 ? 5.865   -8.196  5.741   1.00 0.00 ? 39 ARG A CG   7  
ATOM 6500  C CD   . ARG A 1 39 ? 6.110   -8.229  7.241   1.00 0.00 ? 39 ARG A CD   7  
ATOM 6501  N NE   . ARG A 1 39 ? 6.993   -9.325  7.627   1.00 0.00 ? 39 ARG A NE   7  
ATOM 6502  C CZ   . ARG A 1 39 ? 8.279   -9.385  7.297   1.00 0.00 ? 39 ARG A CZ   7  
ATOM 6503  N NH1  . ARG A 1 39 ? 8.826   -8.416  6.577   1.00 0.00 ? 39 ARG A NH1  7  
ATOM 6504  N NH2  . ARG A 1 39 ? 9.018   -10.415 7.685   1.00 0.00 ? 39 ARG A NH2  7  
ATOM 6505  H H    . ARG A 1 39 ? 6.389   -5.992  1.949   1.00 0.00 ? 39 ARG A H    7  
ATOM 6506  H HA   . ARG A 1 39 ? 5.357   -7.575  3.312   1.00 0.00 ? 39 ARG A HA   7  
ATOM 6507  H HB2  . ARG A 1 39 ? 7.166   -6.644  5.110   1.00 0.00 ? 39 ARG A HB2  7  
ATOM 6508  H HB3  . ARG A 1 39 ? 5.669   -6.085  5.844   1.00 0.00 ? 39 ARG A HB3  7  
ATOM 6509  H HG2  . ARG A 1 39 ? 4.844   -8.488  5.547   1.00 0.00 ? 39 ARG A HG2  7  
ATOM 6510  H HG3  . ARG A 1 39 ? 6.538   -8.892  5.261   1.00 0.00 ? 39 ARG A HG3  7  
ATOM 6511  H HD2  . ARG A 1 39 ? 6.561   -7.294  7.540   1.00 0.00 ? 39 ARG A HD2  7  
ATOM 6512  H HD3  . ARG A 1 39 ? 5.162   -8.347  7.745   1.00 0.00 ? 39 ARG A HD3  7  
ATOM 6513  H HE   . ARG A 1 39 ? 6.609   -10.053 8.159   1.00 0.00 ? 39 ARG A HE   7  
ATOM 6514  H HH11 . ARG A 1 39 ? 8.270   -7.638  6.281   1.00 0.00 ? 39 ARG A HH11 7  
ATOM 6515  H HH12 . ARG A 1 39 ? 9.794   -8.461  6.329   1.00 0.00 ? 39 ARG A HH12 7  
ATOM 6516  H HH21 . ARG A 1 39 ? 8.609   -11.149 8.228   1.00 0.00 ? 39 ARG A HH21 7  
ATOM 6517  H HH22 . ARG A 1 39 ? 9.986   -10.458 7.436   1.00 0.00 ? 39 ARG A HH22 7  
ATOM 6518  N N    . PHE A 1 40 ? 3.293   -6.383  4.808   1.00 0.00 ? 40 PHE A N    7  
ATOM 6519  C CA   . PHE A 1 40 ? 1.968   -5.788  4.970   1.00 0.00 ? 40 PHE A CA   7  
ATOM 6520  C C    . PHE A 1 40 ? 1.377   -6.079  6.347   1.00 0.00 ? 40 PHE A C    7  
ATOM 6521  O O    . PHE A 1 40 ? 1.388   -7.213  6.825   1.00 0.00 ? 40 PHE A O    7  
ATOM 6522  C CB   . PHE A 1 40 ? 1.045   -6.274  3.851   1.00 0.00 ? 40 PHE A CB   7  
ATOM 6523  C CG   . PHE A 1 40 ? 1.733   -6.264  2.515   1.00 0.00 ? 40 PHE A CG   7  
ATOM 6524  C CD1  . PHE A 1 40 ? 2.428   -7.377  2.065   1.00 0.00 ? 40 PHE A CD1  7  
ATOM 6525  C CD2  . PHE A 1 40 ? 1.727   -5.122  1.730   1.00 0.00 ? 40 PHE A CD2  7  
ATOM 6526  C CE1  . PHE A 1 40 ? 3.101   -7.349  0.862   1.00 0.00 ? 40 PHE A CE1  7  
ATOM 6527  C CE2  . PHE A 1 40 ? 2.392   -5.095  0.525   1.00 0.00 ? 40 PHE A CE2  7  
ATOM 6528  C CZ   . PHE A 1 40 ? 3.082   -6.207  0.092   1.00 0.00 ? 40 PHE A CZ   7  
ATOM 6529  H H    . PHE A 1 40 ? 3.561   -7.131  5.381   1.00 0.00 ? 40 PHE A H    7  
ATOM 6530  H HA   . PHE A 1 40 ? 2.080   -4.721  4.875   1.00 0.00 ? 40 PHE A HA   7  
ATOM 6531  H HB2  . PHE A 1 40 ? 0.724   -7.282  4.061   1.00 0.00 ? 40 PHE A HB2  7  
ATOM 6532  H HB3  . PHE A 1 40 ? 0.184   -5.624  3.790   1.00 0.00 ? 40 PHE A HB3  7  
ATOM 6533  H HD1  . PHE A 1 40 ? 2.441   -8.274  2.662   1.00 0.00 ? 40 PHE A HD1  7  
ATOM 6534  H HD2  . PHE A 1 40 ? 1.189   -4.248  2.061   1.00 0.00 ? 40 PHE A HD2  7  
ATOM 6535  H HE1  . PHE A 1 40 ? 3.640   -8.221  0.524   1.00 0.00 ? 40 PHE A HE1  7  
ATOM 6536  H HE2  . PHE A 1 40 ? 2.381   -4.201  -0.077  1.00 0.00 ? 40 PHE A HE2  7  
ATOM 6537  H HZ   . PHE A 1 40 ? 3.614   -6.178  -0.844  1.00 0.00 ? 40 PHE A HZ   7  
ATOM 6538  N N    . MET A 1 41 ? 0.882   -5.019  6.978   1.00 0.00 ? 41 MET A N    7  
ATOM 6539  C CA   . MET A 1 41 ? 0.294   -5.087  8.314   1.00 0.00 ? 41 MET A CA   7  
ATOM 6540  C C    . MET A 1 41 ? -0.558  -6.334  8.531   1.00 0.00 ? 41 MET A C    7  
ATOM 6541  O O    . MET A 1 41 ? -0.338  -7.078  9.484   1.00 0.00 ? 41 MET A O    7  
ATOM 6542  C CB   . MET A 1 41 ? -0.562  -3.845  8.562   1.00 0.00 ? 41 MET A CB   7  
ATOM 6543  C CG   . MET A 1 41 ? -0.086  -2.999  9.732   1.00 0.00 ? 41 MET A CG   7  
ATOM 6544  S SD   . MET A 1 41 ? 1.702   -2.764  9.741   1.00 0.00 ? 41 MET A SD   7  
ATOM 6545  C CE   . MET A 1 41 ? 2.080   -3.111  11.457  1.00 0.00 ? 41 MET A CE   7  
ATOM 6546  H H    . MET A 1 41 ? 0.926   -4.147  6.532   1.00 0.00 ? 41 MET A H    7  
ATOM 6547  H HA   . MET A 1 41 ? 1.103   -5.094  9.028   1.00 0.00 ? 41 MET A HA   7  
ATOM 6548  H HB2  . MET A 1 41 ? -0.553  -3.232  7.672   1.00 0.00 ? 41 MET A HB2  7  
ATOM 6549  H HB3  . MET A 1 41 ? -1.577  -4.159  8.761   1.00 0.00 ? 41 MET A HB3  7  
ATOM 6550  H HG2  . MET A 1 41 ? -0.560  -2.031  9.675   1.00 0.00 ? 41 MET A HG2  7  
ATOM 6551  H HG3  . MET A 1 41 ? -0.375  -3.486  10.652  1.00 0.00 ? 41 MET A HG3  7  
ATOM 6552  H HE1  . MET A 1 41 ? 2.849   -2.435  11.800  1.00 0.00 ? 41 MET A HE1  7  
ATOM 6553  H HE2  . MET A 1 41 ? 2.427   -4.129  11.551  1.00 0.00 ? 41 MET A HE2  7  
ATOM 6554  H HE3  . MET A 1 41 ? 1.191   -2.977  12.055  1.00 0.00 ? 41 MET A HE3  7  
ATOM 6555  N N    . LYS A 1 42 ? -1.554  -6.528  7.669   1.00 0.00 ? 42 LYS A N    7  
ATOM 6556  C CA   . LYS A 1 42 ? -2.476  -7.658  7.784   1.00 0.00 ? 42 LYS A CA   7  
ATOM 6557  C C    . LYS A 1 42 ? -3.534  -7.364  8.840   1.00 0.00 ? 42 LYS A C    7  
ATOM 6558  O O    . LYS A 1 42 ? -3.988  -8.259  9.553   1.00 0.00 ? 42 LYS A O    7  
ATOM 6559  C CB   . LYS A 1 42 ? -1.742  -8.963  8.114   1.00 0.00 ? 42 LYS A CB   7  
ATOM 6560  C CG   . LYS A 1 42 ? -0.778  -9.406  7.028   1.00 0.00 ? 42 LYS A CG   7  
ATOM 6561  C CD   . LYS A 1 42 ? -1.509  -10.114 5.898   1.00 0.00 ? 42 LYS A CD   7  
ATOM 6562  C CE   . LYS A 1 42 ? -0.914  -11.485 5.620   1.00 0.00 ? 42 LYS A CE   7  
ATOM 6563  N NZ   . LYS A 1 42 ? -1.707  -12.573 6.257   1.00 0.00 ? 42 LYS A NZ   7  
ATOM 6564  H H    . LYS A 1 42 ? -1.691  -5.876  6.951   1.00 0.00 ? 42 LYS A H    7  
ATOM 6565  H HA   . LYS A 1 42 ? -2.972  -7.770  6.834   1.00 0.00 ? 42 LYS A HA   7  
ATOM 6566  H HB2  . LYS A 1 42 ? -1.190  -8.840  9.031   1.00 0.00 ? 42 LYS A HB2  7  
ATOM 6567  H HB3  . LYS A 1 42 ? -2.474  -9.745  8.251   1.00 0.00 ? 42 LYS A HB3  7  
ATOM 6568  H HG2  . LYS A 1 42 ? -0.273  -8.538  6.630   1.00 0.00 ? 42 LYS A HG2  7  
ATOM 6569  H HG3  . LYS A 1 42 ? -0.053  -10.083 7.457   1.00 0.00 ? 42 LYS A HG3  7  
ATOM 6570  H HD2  . LYS A 1 42 ? -2.546  -10.232 6.173   1.00 0.00 ? 42 LYS A HD2  7  
ATOM 6571  H HD3  . LYS A 1 42 ? -1.438  -9.512  5.004   1.00 0.00 ? 42 LYS A HD3  7  
ATOM 6572  H HE2  . LYS A 1 42 ? -0.894  -11.645 4.552   1.00 0.00 ? 42 LYS A HE2  7  
ATOM 6573  H HE3  . LYS A 1 42 ? 0.094   -11.512 6.007   1.00 0.00 ? 42 LYS A HE3  7  
ATOM 6574  H HZ1  . LYS A 1 42 ? -1.285  -13.499 6.038   1.00 0.00 ? 42 LYS A HZ1  7  
ATOM 6575  H HZ2  . LYS A 1 42 ? -2.684  -12.559 5.903   1.00 0.00 ? 42 LYS A HZ2  7  
ATOM 6576  H HZ3  . LYS A 1 42 ? -1.722  -12.447 7.289   1.00 0.00 ? 42 LYS A HZ3  7  
ATOM 6577  N N    . GLU A 1 43 ? -3.921  -6.095  8.923   1.00 0.00 ? 43 GLU A N    7  
ATOM 6578  C CA   . GLU A 1 43 ? -4.928  -5.652  9.879   1.00 0.00 ? 43 GLU A CA   7  
ATOM 6579  C C    . GLU A 1 43 ? -5.434  -4.262  9.509   1.00 0.00 ? 43 GLU A C    7  
ATOM 6580  O O    . GLU A 1 43 ? -4.787  -3.259  9.811   1.00 0.00 ? 43 GLU A O    7  
ATOM 6581  C CB   . GLU A 1 43 ? -4.352  -5.638  11.294  1.00 0.00 ? 43 GLU A CB   7  
ATOM 6582  C CG   . GLU A 1 43 ? -5.386  -5.347  12.369  1.00 0.00 ? 43 GLU A CG   7  
ATOM 6583  C CD   . GLU A 1 43 ? -4.760  -5.083  13.725  1.00 0.00 ? 43 GLU A CD   7  
ATOM 6584  O OE1  . GLU A 1 43 ? -3.522  -4.928  13.787  1.00 0.00 ? 43 GLU A OE1  7  
ATOM 6585  O OE2  . GLU A 1 43 ? -5.507  -5.031  14.724  1.00 0.00 ? 43 GLU A OE2  7  
ATOM 6586  H H    . GLU A 1 43 ? -3.518  -5.436  8.320   1.00 0.00 ? 43 GLU A H    7  
ATOM 6587  H HA   . GLU A 1 43 ? -5.754  -6.347  9.840   1.00 0.00 ? 43 GLU A HA   7  
ATOM 6588  H HB2  . GLU A 1 43 ? -3.912  -6.601  11.499  1.00 0.00 ? 43 GLU A HB2  7  
ATOM 6589  H HB3  . GLU A 1 43 ? -3.585  -4.880  11.348  1.00 0.00 ? 43 GLU A HB3  7  
ATOM 6590  H HG2  . GLU A 1 43 ? -5.956  -4.477  12.078  1.00 0.00 ? 43 GLU A HG2  7  
ATOM 6591  H HG3  . GLU A 1 43 ? -6.047  -6.197  12.454  1.00 0.00 ? 43 GLU A HG3  7  
ATOM 6592  N N    . GLY A 1 44 ? -6.595  -4.226  8.854   1.00 0.00 ? 44 GLY A N    7  
ATOM 6593  C CA   . GLY A 1 44 ? -7.207  -2.976  8.428   1.00 0.00 ? 44 GLY A CA   7  
ATOM 6594  C C    . GLY A 1 44 ? -6.262  -1.799  8.424   1.00 0.00 ? 44 GLY A C    7  
ATOM 6595  O O    . GLY A 1 44 ? -6.471  -0.833  9.158   1.00 0.00 ? 44 GLY A O    7  
ATOM 6596  H H    . GLY A 1 44 ? -7.048  -5.069  8.657   1.00 0.00 ? 44 GLY A H    7  
ATOM 6597  H HA2  . GLY A 1 44 ? -7.589  -3.102  7.430   1.00 0.00 ? 44 GLY A HA2  7  
ATOM 6598  H HA3  . GLY A 1 44 ? -8.029  -2.754  9.089   1.00 0.00 ? 44 GLY A HA3  7  
ATOM 6599  N N    . THR A 1 45 ? -5.222  -1.862  7.600   1.00 0.00 ? 45 THR A N    7  
ATOM 6600  C CA   . THR A 1 45 ? -4.272  -0.764  7.538   1.00 0.00 ? 45 THR A CA   7  
ATOM 6601  C C    . THR A 1 45 ? -4.616  0.198   6.403   1.00 0.00 ? 45 THR A C    7  
ATOM 6602  O O    . THR A 1 45 ? -5.265  1.218   6.625   1.00 0.00 ? 45 THR A O    7  
ATOM 6603  C CB   . THR A 1 45 ? -2.848  -1.301  7.417   1.00 0.00 ? 45 THR A CB   7  
ATOM 6604  O OG1  . THR A 1 45 ? -2.707  -2.504  8.152   1.00 0.00 ? 45 THR A OG1  7  
ATOM 6605  C CG2  . THR A 1 45 ? -1.811  -0.330  7.928   1.00 0.00 ? 45 THR A CG2  7  
ATOM 6606  H H    . THR A 1 45 ? -5.091  -2.659  7.026   1.00 0.00 ? 45 THR A H    7  
ATOM 6607  H HA   . THR A 1 45 ? -4.352  -0.223  8.458   1.00 0.00 ? 45 THR A HA   7  
ATOM 6608  H HB   . THR A 1 45 ? -2.629  -1.509  6.387   1.00 0.00 ? 45 THR A HB   7  
ATOM 6609  H HG1  . THR A 1 45 ? -3.453  -3.082  7.971   1.00 0.00 ? 45 THR A HG1  7  
ATOM 6610  H HG21 . THR A 1 45 ? -0.825  -0.717  7.725   1.00 0.00 ? 45 THR A HG21 7  
ATOM 6611  H HG22 . THR A 1 45 ? -1.937  -0.201  8.993   1.00 0.00 ? 45 THR A HG22 7  
ATOM 6612  H HG23 . THR A 1 45 ? -1.936  0.621   7.433   1.00 0.00 ? 45 THR A HG23 7  
ATOM 6613  N N    . ILE A 1 46 ? -4.197  -0.137  5.196   1.00 0.00 ? 46 ILE A N    7  
ATOM 6614  C CA   . ILE A 1 46 ? -4.475  0.691   4.027   1.00 0.00 ? 46 ILE A CA   7  
ATOM 6615  C C    . ILE A 1 46 ? -4.036  -0.008  2.742   1.00 0.00 ? 46 ILE A C    7  
ATOM 6616  O O    . ILE A 1 46 ? -2.850  -0.042  2.412   1.00 0.00 ? 46 ILE A O    7  
ATOM 6617  C CB   . ILE A 1 46 ? -3.811  2.098   4.142   1.00 0.00 ? 46 ILE A CB   7  
ATOM 6618  C CG1  . ILE A 1 46 ? -4.888  3.164   4.355   1.00 0.00 ? 46 ILE A CG1  7  
ATOM 6619  C CG2  . ILE A 1 46 ? -2.966  2.450   2.919   1.00 0.00 ? 46 ILE A CG2  7  
ATOM 6620  C CD1  . ILE A 1 46 ? -5.020  3.618   5.792   1.00 0.00 ? 46 ILE A CD1  7  
ATOM 6621  H H    . ILE A 1 46 ? -3.703  -0.962  5.086   1.00 0.00 ? 46 ILE A H    7  
ATOM 6622  H HA   . ILE A 1 46 ? -5.546  0.834   3.984   1.00 0.00 ? 46 ILE A HA   7  
ATOM 6623  H HB   . ILE A 1 46 ? -3.156  2.090   4.995   1.00 0.00 ? 46 ILE A HB   7  
ATOM 6624  H HG12 . ILE A 1 46 ? -4.650  4.030   3.756   1.00 0.00 ? 46 ILE A HG12 7  
ATOM 6625  H HG13 . ILE A 1 46 ? -5.843  2.768   4.042   1.00 0.00 ? 46 ILE A HG13 7  
ATOM 6626  H HG21 . ILE A 1 46 ? -2.802  3.517   2.890   1.00 0.00 ? 46 ILE A HG21 7  
ATOM 6627  H HG22 . ILE A 1 46 ? -3.481  2.141   2.022   1.00 0.00 ? 46 ILE A HG22 7  
ATOM 6628  H HG23 . ILE A 1 46 ? -2.014  1.942   2.981   1.00 0.00 ? 46 ILE A HG23 7  
ATOM 6629  H HD11 . ILE A 1 46 ? -4.823  4.677   5.856   1.00 0.00 ? 46 ILE A HD11 7  
ATOM 6630  H HD12 . ILE A 1 46 ? -4.312  3.081   6.406   1.00 0.00 ? 46 ILE A HD12 7  
ATOM 6631  H HD13 . ILE A 1 46 ? -6.023  3.417   6.141   1.00 0.00 ? 46 ILE A HD13 7  
ATOM 6632  N N    . CYS A 1 47 ? -5.002  -0.550  2.015   1.00 0.00 ? 47 CYS A N    7  
ATOM 6633  C CA   . CYS A 1 47 ? -4.717  -1.225  0.761   1.00 0.00 ? 47 CYS A CA   7  
ATOM 6634  C C    . CYS A 1 47 ? -4.964  -0.309  -0.424  1.00 0.00 ? 47 CYS A C    7  
ATOM 6635  O O    . CYS A 1 47 ? -4.948  -0.755  -1.571  1.00 0.00 ? 47 CYS A O    7  
ATOM 6636  C CB   . CYS A 1 47 ? -5.545  -2.478  0.614   1.00 0.00 ? 47 CYS A CB   7  
ATOM 6637  S SG   . CYS A 1 47 ? -4.763  -3.669  -0.491  1.00 0.00 ? 47 CYS A SG   7  
ATOM 6638  H H    . CYS A 1 47 ? -5.926  -0.486  2.325   1.00 0.00 ? 47 CYS A H    7  
ATOM 6639  H HA   . CYS A 1 47 ? -3.678  -1.505  0.764   1.00 0.00 ? 47 CYS A HA   7  
ATOM 6640  H HB2  . CYS A 1 47 ? -5.661  -2.943  1.579   1.00 0.00 ? 47 CYS A HB2  7  
ATOM 6641  H HB3  . CYS A 1 47 ? -6.513  -2.230  0.209   1.00 0.00 ? 47 CYS A HB3  7  
ATOM 6642  N N    . ARG A 1 48 ? -5.191  0.966   -0.121  1.00 0.00 ? 48 ARG A N    7  
ATOM 6643  C CA   . ARG A 1 48 ? -5.451  1.999   -1.129  1.00 0.00 ? 48 ARG A CA   7  
ATOM 6644  C C    . ARG A 1 48 ? -5.283  1.481   -2.553  1.00 0.00 ? 48 ARG A C    7  
ATOM 6645  O O    . ARG A 1 48 ? -4.165  1.357   -3.047  1.00 0.00 ? 48 ARG A O    7  
ATOM 6646  C CB   . ARG A 1 48 ? -4.485  3.160   -0.914  1.00 0.00 ? 48 ARG A CB   7  
ATOM 6647  C CG   . ARG A 1 48 ? -4.448  3.673   0.517   1.00 0.00 ? 48 ARG A CG   7  
ATOM 6648  C CD   . ARG A 1 48 ? -5.183  4.995   0.656   1.00 0.00 ? 48 ARG A CD   7  
ATOM 6649  N NE   . ARG A 1 48 ? -6.411  4.854   1.434   1.00 0.00 ? 48 ARG A NE   7  
ATOM 6650  C CZ   . ARG A 1 48 ? -7.002  5.859   2.070   1.00 0.00 ? 48 ARG A CZ   7  
ATOM 6651  N NH1  . ARG A 1 48 ? -6.477  7.076   2.026   1.00 0.00 ? 48 ARG A NH1  7  
ATOM 6652  N NH2  . ARG A 1 48 ? -8.119  5.649   2.754   1.00 0.00 ? 48 ARG A NH2  7  
ATOM 6653  H H    . ARG A 1 48 ? -5.199  1.222   0.825   1.00 0.00 ? 48 ARG A H    7  
ATOM 6654  H HA   . ARG A 1 48 ? -6.455  2.351   -0.999  1.00 0.00 ? 48 ARG A HA   7  
ATOM 6655  H HB2  . ARG A 1 48 ? -3.492  2.830   -1.183  1.00 0.00 ? 48 ARG A HB2  7  
ATOM 6656  H HB3  . ARG A 1 48 ? -4.767  3.973   -1.560  1.00 0.00 ? 48 ARG A HB3  7  
ATOM 6657  H HG2  . ARG A 1 48 ? -4.916  2.948   1.162   1.00 0.00 ? 48 ARG A HG2  7  
ATOM 6658  H HG3  . ARG A 1 48 ? -3.419  3.807   0.814   1.00 0.00 ? 48 ARG A HG3  7  
ATOM 6659  H HD2  . ARG A 1 48 ? -4.534  5.704   1.149   1.00 0.00 ? 48 ARG A HD2  7  
ATOM 6660  H HD3  . ARG A 1 48 ? -5.431  5.360   -0.330  1.00 0.00 ? 48 ARG A HD3  7  
ATOM 6661  H HE   . ARG A 1 48 ? -6.815  3.963   1.484   1.00 0.00 ? 48 ARG A HE   7  
ATOM 6662  H HH11 . ARG A 1 48 ? -5.635  7.238   1.512   1.00 0.00 ? 48 ARG A HH11 7  
ATOM 6663  H HH12 . ARG A 1 48 ? -6.924  7.831   2.506   1.00 0.00 ? 48 ARG A HH12 7  
ATOM 6664  H HH21 . ARG A 1 48 ? -8.517  4.732   2.792   1.00 0.00 ? 48 ARG A HH21 7  
ATOM 6665  H HH22 . ARG A 1 48 ? -8.563  6.406   3.233   1.00 0.00 ? 48 ARG A HH22 7  
ATOM 6666  N N    . ARG A 1 49 ? -6.402  1.176   -3.205  1.00 0.00 ? 49 ARG A N    7  
ATOM 6667  C CA   . ARG A 1 49 ? -6.371  0.661   -4.570  1.00 0.00 ? 49 ARG A CA   7  
ATOM 6668  C C    . ARG A 1 49 ? -5.983  1.742   -5.574  1.00 0.00 ? 49 ARG A C    7  
ATOM 6669  O O    . ARG A 1 49 ? -5.740  1.448   -6.744  1.00 0.00 ? 49 ARG A O    7  
ATOM 6670  C CB   . ARG A 1 49 ? -7.728  0.066   -4.951  1.00 0.00 ? 49 ARG A CB   7  
ATOM 6671  C CG   . ARG A 1 49 ? -8.450  -0.600  -3.791  1.00 0.00 ? 49 ARG A CG   7  
ATOM 6672  C CD   . ARG A 1 49 ? -9.542  -1.544  -4.272  1.00 0.00 ? 49 ARG A CD   7  
ATOM 6673  N NE   . ARG A 1 49 ? -9.436  -1.832  -5.700  1.00 0.00 ? 49 ARG A NE   7  
ATOM 6674  C CZ   . ARG A 1 49 ? -8.620  -2.750  -6.207  1.00 0.00 ? 49 ARG A CZ   7  
ATOM 6675  N NH1  . ARG A 1 49 ? -7.847  -3.469  -5.405  1.00 0.00 ? 49 ARG A NH1  7  
ATOM 6676  N NH2  . ARG A 1 49 ? -8.578  -2.952  -7.517  1.00 0.00 ? 49 ARG A NH2  7  
ATOM 6677  H H    . ARG A 1 49 ? -7.268  1.293   -2.756  1.00 0.00 ? 49 ARG A H    7  
ATOM 6678  H HA   . ARG A 1 49 ? -5.628  -0.119  -4.605  1.00 0.00 ? 49 ARG A HA   7  
ATOM 6679  H HB2  . ARG A 1 49 ? -8.358  0.854   -5.335  1.00 0.00 ? 49 ARG A HB2  7  
ATOM 6680  H HB3  . ARG A 1 49 ? -7.578  -0.672  -5.725  1.00 0.00 ? 49 ARG A HB3  7  
ATOM 6681  H HG2  . ARG A 1 49 ? -7.734  -1.161  -3.209  1.00 0.00 ? 49 ARG A HG2  7  
ATOM 6682  H HG3  . ARG A 1 49 ? -8.895  0.166   -3.174  1.00 0.00 ? 49 ARG A HG3  7  
ATOM 6683  H HD2  . ARG A 1 49 ? -9.466  -2.471  -3.723  1.00 0.00 ? 49 ARG A HD2  7  
ATOM 6684  H HD3  . ARG A 1 49 ? -10.503 -1.090  -4.077  1.00 0.00 ? 49 ARG A HD3  7  
ATOM 6685  H HE   . ARG A 1 49 ? -9.999  -1.313  -6.311  1.00 0.00 ? 49 ARG A HE   7  
ATOM 6686  H HH11 . ARG A 1 49 ? -7.876  -3.320  -4.416  1.00 0.00 ? 49 ARG A HH11 7  
ATOM 6687  H HH12 . ARG A 1 49 ? -7.234  -4.160  -5.788  1.00 0.00 ? 49 ARG A HH12 7  
ATOM 6688  H HH21 . ARG A 1 49 ? -9.160  -2.412  -8.125  1.00 0.00 ? 49 ARG A HH21 7  
ATOM 6689  H HH22 . ARG A 1 49 ? -7.963  -3.643  -7.897  1.00 0.00 ? 49 ARG A HH22 7  
ATOM 6690  N N    . ALA A 1 50 ? -5.931  2.990   -5.123  1.00 0.00 ? 50 ALA A N    7  
ATOM 6691  C CA   . ALA A 1 50 ? -5.576  4.091   -6.011  1.00 0.00 ? 50 ALA A CA   7  
ATOM 6692  C C    . ALA A 1 50 ? -4.449  4.956   -5.435  1.00 0.00 ? 50 ALA A C    7  
ATOM 6693  O O    . ALA A 1 50 ? -3.310  4.498   -5.336  1.00 0.00 ? 50 ALA A O    7  
ATOM 6694  C CB   . ALA A 1 50 ? -6.811  4.913   -6.343  1.00 0.00 ? 50 ALA A CB   7  
ATOM 6695  H H    . ALA A 1 50 ? -6.139  3.172   -4.182  1.00 0.00 ? 50 ALA A H    7  
ATOM 6696  H HA   . ALA A 1 50 ? -5.221  3.658   -6.932  1.00 0.00 ? 50 ALA A HA   7  
ATOM 6697  H HB1  . ALA A 1 50 ? -6.519  5.909   -6.639  1.00 0.00 ? 50 ALA A HB1  7  
ATOM 6698  H HB2  . ALA A 1 50 ? -7.448  4.962   -5.478  1.00 0.00 ? 50 ALA A HB2  7  
ATOM 6699  H HB3  . ALA A 1 50 ? -7.346  4.441   -7.154  1.00 0.00 ? 50 ALA A HB3  7  
ATOM 6700  N N    . ARG A 1 51 ? -4.747  6.208   -5.079  1.00 0.00 ? 51 ARG A N    7  
ATOM 6701  C CA   . ARG A 1 51 ? -3.717  7.102   -4.548  1.00 0.00 ? 51 ARG A CA   7  
ATOM 6702  C C    . ARG A 1 51 ? -4.212  7.932   -3.362  1.00 0.00 ? 51 ARG A C    7  
ATOM 6703  O O    . ARG A 1 51 ? -4.245  9.159   -3.432  1.00 0.00 ? 51 ARG A O    7  
ATOM 6704  C CB   . ARG A 1 51 ? -3.213  8.042   -5.646  1.00 0.00 ? 51 ARG A CB   7  
ATOM 6705  C CG   . ARG A 1 51 ? -3.178  7.415   -7.031  1.00 0.00 ? 51 ARG A CG   7  
ATOM 6706  C CD   . ARG A 1 51 ? -3.760  8.349   -8.079  1.00 0.00 ? 51 ARG A CD   7  
ATOM 6707  N NE   . ARG A 1 51 ? -3.009  9.597   -8.178  1.00 0.00 ? 51 ARG A NE   7  
ATOM 6708  C CZ   . ARG A 1 51 ? -3.338  10.593  -8.995  1.00 0.00 ? 51 ARG A CZ   7  
ATOM 6709  N NH1  . ARG A 1 51 ? -4.401  10.485  -9.780  1.00 0.00 ? 51 ARG A NH1  7  
ATOM 6710  N NH2  . ARG A 1 51 ? -2.604  11.696  -9.028  1.00 0.00 ? 51 ARG A NH2  7  
ATOM 6711  H H    . ARG A 1 51 ? -5.658  6.538   -5.190  1.00 0.00 ? 51 ARG A H    7  
ATOM 6712  H HA   . ARG A 1 51 ? -2.893  6.489   -4.217  1.00 0.00 ? 51 ARG A HA   7  
ATOM 6713  H HB2  . ARG A 1 51 ? -3.857  8.908   -5.685  1.00 0.00 ? 51 ARG A HB2  7  
ATOM 6714  H HB3  . ARG A 1 51 ? -2.212  8.363   -5.395  1.00 0.00 ? 51 ARG A HB3  7  
ATOM 6715  H HG2  . ARG A 1 51 ? -2.153  7.195   -7.290  1.00 0.00 ? 51 ARG A HG2  7  
ATOM 6716  H HG3  . ARG A 1 51 ? -3.751  6.502   -7.019  1.00 0.00 ? 51 ARG A HG3  7  
ATOM 6717  H HD2  . ARG A 1 51 ? -3.740  7.852   -9.037  1.00 0.00 ? 51 ARG A HD2  7  
ATOM 6718  H HD3  . ARG A 1 51 ? -4.783  8.575   -7.813  1.00 0.00 ? 51 ARG A HD3  7  
ATOM 6719  H HE   . ARG A 1 51 ? -2.220  9.698   -7.606  1.00 0.00 ? 51 ARG A HE   7  
ATOM 6720  H HH11 . ARG A 1 51 ? -4.957  9.654   -9.758  1.00 0.00 ? 51 ARG A HH11 7  
ATOM 6721  H HH12 . ARG A 1 51 ? -4.647  11.236  -10.394 1.00 0.00 ? 51 ARG A HH12 7  
ATOM 6722  H HH21 . ARG A 1 51 ? -1.802  11.781  -8.437  1.00 0.00 ? 51 ARG A HH21 7  
ATOM 6723  H HH22 . ARG A 1 51 ? -2.853  12.444  -9.643  1.00 0.00 ? 51 ARG A HH22 7  
ATOM 6724  N N    . GLY A 1 52 ? -4.560  7.261   -2.268  1.00 0.00 ? 52 GLY A N    7  
ATOM 6725  C CA   . GLY A 1 52 ? -5.012  7.957   -1.071  1.00 0.00 ? 52 GLY A CA   7  
ATOM 6726  C C    . GLY A 1 52 ? -6.213  8.862   -1.293  1.00 0.00 ? 52 GLY A C    7  
ATOM 6727  O O    . GLY A 1 52 ? -7.306  8.578   -0.805  1.00 0.00 ? 52 GLY A O    7  
ATOM 6728  H H    . GLY A 1 52 ? -4.488  6.283   -2.264  1.00 0.00 ? 52 GLY A H    7  
ATOM 6729  H HA2  . GLY A 1 52 ? -5.272  7.222   -0.324  1.00 0.00 ? 52 GLY A HA2  7  
ATOM 6730  H HA3  . GLY A 1 52 ? -4.194  8.554   -0.693  1.00 0.00 ? 52 GLY A HA3  7  
ATOM 6731  N N    . ASP A 1 53 ? -6.010  9.962   -2.015  1.00 0.00 ? 53 ASP A N    7  
ATOM 6732  C CA   . ASP A 1 53 ? -7.088  10.913  -2.275  1.00 0.00 ? 53 ASP A CA   7  
ATOM 6733  C C    . ASP A 1 53 ? -8.139  10.298  -3.184  1.00 0.00 ? 53 ASP A C    7  
ATOM 6734  O O    . ASP A 1 53 ? -9.336  10.520  -3.007  1.00 0.00 ? 53 ASP A O    7  
ATOM 6735  C CB   . ASP A 1 53 ? -6.532  12.192  -2.903  1.00 0.00 ? 53 ASP A CB   7  
ATOM 6736  C CG   . ASP A 1 53 ? -6.499  13.349  -1.924  1.00 0.00 ? 53 ASP A CG   7  
ATOM 6737  O OD1  . ASP A 1 53 ? -7.576  13.727  -1.415  1.00 0.00 ? 53 ASP A OD1  7  
ATOM 6738  O OD2  . ASP A 1 53 ? -5.397  13.877  -1.666  1.00 0.00 ? 53 ASP A OD2  7  
ATOM 6739  H H    . ASP A 1 53 ? -5.115  10.145  -2.369  1.00 0.00 ? 53 ASP A H    7  
ATOM 6740  H HA   . ASP A 1 53 ? -7.548  11.156  -1.333  1.00 0.00 ? 53 ASP A HA   7  
ATOM 6741  H HB2  . ASP A 1 53 ? -5.525  12.009  -3.249  1.00 0.00 ? 53 ASP A HB2  7  
ATOM 6742  H HB3  . ASP A 1 53 ? -7.151  12.472  -3.743  1.00 0.00 ? 53 ASP A HB3  7  
ATOM 6743  N N    . ASP A 1 54 ? -7.685  9.507   -4.141  1.00 0.00 ? 54 ASP A N    7  
ATOM 6744  C CA   . ASP A 1 54 ? -8.586  8.835   -5.061  1.00 0.00 ? 54 ASP A CA   7  
ATOM 6745  C C    . ASP A 1 54 ? -8.804  7.400   -4.603  1.00 0.00 ? 54 ASP A C    7  
ATOM 6746  O O    . ASP A 1 54 ? -7.846  6.650   -4.434  1.00 0.00 ? 54 ASP A O    7  
ATOM 6747  C CB   . ASP A 1 54 ? -8.014  8.864   -6.477  1.00 0.00 ? 54 ASP A CB   7  
ATOM 6748  C CG   . ASP A 1 54 ? -8.267  10.185  -7.176  1.00 0.00 ? 54 ASP A CG   7  
ATOM 6749  O OD1  . ASP A 1 54 ? -9.433  10.633  -7.195  1.00 0.00 ? 54 ASP A OD1  7  
ATOM 6750  O OD2  . ASP A 1 54 ? -7.300  10.773  -7.704  1.00 0.00 ? 54 ASP A OD2  7  
ATOM 6751  H H    . ASP A 1 54 ? -6.720  9.356   -4.220  1.00 0.00 ? 54 ASP A H    7  
ATOM 6752  H HA   . ASP A 1 54 ? -9.531  9.358   -5.046  1.00 0.00 ? 54 ASP A HA   7  
ATOM 6753  H HB2  . ASP A 1 54 ? -6.947  8.703   -6.428  1.00 0.00 ? 54 ASP A HB2  7  
ATOM 6754  H HB3  . ASP A 1 54 ? -8.468  8.075   -7.056  1.00 0.00 ? 54 ASP A HB3  7  
ATOM 6755  N N    . LEU A 1 55 ? -10.061 7.029   -4.382  1.00 0.00 ? 55 LEU A N    7  
ATOM 6756  C CA   . LEU A 1 55 ? -10.390 5.683   -3.921  1.00 0.00 ? 55 LEU A CA   7  
ATOM 6757  C C    . LEU A 1 55 ? -9.505  5.290   -2.741  1.00 0.00 ? 55 LEU A C    7  
ATOM 6758  O O    . LEU A 1 55 ? -8.614  6.041   -2.346  1.00 0.00 ? 55 LEU A O    7  
ATOM 6759  C CB   . LEU A 1 55 ? -10.229 4.668   -5.055  1.00 0.00 ? 55 LEU A CB   7  
ATOM 6760  C CG   . LEU A 1 55 ? -10.707 5.140   -6.429  1.00 0.00 ? 55 LEU A CG   7  
ATOM 6761  C CD1  . LEU A 1 55 ? -11.803 6.186   -6.286  1.00 0.00 ? 55 LEU A CD1  7  
ATOM 6762  C CD2  . LEU A 1 55 ? -9.542  5.692   -7.236  1.00 0.00 ? 55 LEU A CD2  7  
ATOM 6763  H H    . LEU A 1 55 ? -10.783 7.678   -4.518  1.00 0.00 ? 55 LEU A H    7  
ATOM 6764  H HA   . LEU A 1 55 ? -11.421 5.687   -3.596  1.00 0.00 ? 55 LEU A HA   7  
ATOM 6765  H HB2  . LEU A 1 55 ? -9.183  4.409   -5.131  1.00 0.00 ? 55 LEU A HB2  7  
ATOM 6766  H HB3  . LEU A 1 55 ? -10.783 3.778   -4.794  1.00 0.00 ? 55 LEU A HB3  7  
ATOM 6767  H HG   . LEU A 1 55 ? -11.119 4.299   -6.968  1.00 0.00 ? 55 LEU A HG   7  
ATOM 6768  H HD11 . LEU A 1 55 ? -12.465 6.132   -7.138  1.00 0.00 ? 55 LEU A HD11 7  
ATOM 6769  H HD12 . LEU A 1 55 ? -11.358 7.168   -6.236  1.00 0.00 ? 55 LEU A HD12 7  
ATOM 6770  H HD13 . LEU A 1 55 ? -12.364 5.998   -5.382  1.00 0.00 ? 55 LEU A HD13 7  
ATOM 6771  H HD21 . LEU A 1 55 ? -8.810  6.119   -6.566  1.00 0.00 ? 55 LEU A HD21 7  
ATOM 6772  H HD22 . LEU A 1 55 ? -9.900  6.456   -7.911  1.00 0.00 ? 55 LEU A HD22 7  
ATOM 6773  H HD23 . LEU A 1 55 ? -9.087  4.894   -7.804  1.00 0.00 ? 55 LEU A HD23 7  
ATOM 6774  N N    . ASP A 1 56 ? -9.755  4.112   -2.181  1.00 0.00 ? 56 ASP A N    7  
ATOM 6775  C CA   . ASP A 1 56 ? -8.976  3.628   -1.046  1.00 0.00 ? 56 ASP A CA   7  
ATOM 6776  C C    . ASP A 1 56 ? -9.175  2.131   -0.843  1.00 0.00 ? 56 ASP A C    7  
ATOM 6777  O O    . ASP A 1 56 ? -9.696  1.440   -1.717  1.00 0.00 ? 56 ASP A O    7  
ATOM 6778  C CB   . ASP A 1 56 ? -9.370  4.372   0.233   1.00 0.00 ? 56 ASP A CB   7  
ATOM 6779  C CG   . ASP A 1 56 ? -9.608  5.851   0.003   1.00 0.00 ? 56 ASP A CG   7  
ATOM 6780  O OD1  . ASP A 1 56 ? -8.631  6.627   0.069   1.00 0.00 ? 56 ASP A OD1  7  
ATOM 6781  O OD2  . ASP A 1 56 ? -10.772 6.235   -0.242  1.00 0.00 ? 56 ASP A OD2  7  
ATOM 6782  H H    . ASP A 1 56 ? -10.479 3.555   -2.536  1.00 0.00 ? 56 ASP A H    7  
ATOM 6783  H HA   . ASP A 1 56 ? -7.934  3.815   -1.252  1.00 0.00 ? 56 ASP A HA   7  
ATOM 6784  H HB2  . ASP A 1 56 ? -10.277 3.939   0.626   1.00 0.00 ? 56 ASP A HB2  7  
ATOM 6785  H HB3  . ASP A 1 56 ? -8.581  4.262   0.961   1.00 0.00 ? 56 ASP A HB3  7  
ATOM 6786  N N    . ASP A 1 57 ? -8.756  1.651   0.323   1.00 0.00 ? 57 ASP A N    7  
ATOM 6787  C CA   . ASP A 1 57 ? -8.879  0.240   0.683   1.00 0.00 ? 57 ASP A CA   7  
ATOM 6788  C C    . ASP A 1 57 ? -8.141  -0.037  1.990   1.00 0.00 ? 57 ASP A C    7  
ATOM 6789  O O    . ASP A 1 57 ? -7.306  0.762   2.420   1.00 0.00 ? 57 ASP A O    7  
ATOM 6790  C CB   . ASP A 1 57 ? -8.330  -0.661  -0.426  1.00 0.00 ? 57 ASP A CB   7  
ATOM 6791  C CG   . ASP A 1 57 ? -8.789  -2.099  -0.279  1.00 0.00 ? 57 ASP A CG   7  
ATOM 6792  O OD1  . ASP A 1 57 ? -9.412  -2.421  0.755   1.00 0.00 ? 57 ASP A OD1  7  
ATOM 6793  O OD2  . ASP A 1 57 ? -8.524  -2.903  -1.197  1.00 0.00 ? 57 ASP A OD2  7  
ATOM 6794  H H    . ASP A 1 57 ? -8.354  2.269   0.968   1.00 0.00 ? 57 ASP A H    7  
ATOM 6795  H HA   . ASP A 1 57 ? -9.928  0.026   0.825   1.00 0.00 ? 57 ASP A HA   7  
ATOM 6796  H HB2  . ASP A 1 57 ? -8.664  -0.295  -1.382  1.00 0.00 ? 57 ASP A HB2  7  
ATOM 6797  H HB3  . ASP A 1 57 ? -7.254  -0.641  -0.395  1.00 0.00 ? 57 ASP A HB3  7  
ATOM 6798  N N    . TYR A 1 58 ? -8.448  -1.171  2.615   1.00 0.00 ? 58 TYR A N    7  
ATOM 6799  C CA   . TYR A 1 58 ? -7.815  -1.551  3.879   1.00 0.00 ? 58 TYR A CA   7  
ATOM 6800  C C    . TYR A 1 58 ? -6.920  -2.776  3.725   1.00 0.00 ? 58 TYR A C    7  
ATOM 6801  O O    . TYR A 1 58 ? -7.127  -3.610  2.844   1.00 0.00 ? 58 TYR A O    7  
ATOM 6802  C CB   . TYR A 1 58 ? -8.870  -1.811  4.950   1.00 0.00 ? 58 TYR A CB   7  
ATOM 6803  C CG   . TYR A 1 58 ? -9.382  -0.546  5.600   1.00 0.00 ? 58 TYR A CG   7  
ATOM 6804  C CD1  . TYR A 1 58 ? -9.022  0.702   5.107   1.00 0.00 ? 58 TYR A CD1  7  
ATOM 6805  C CD2  . TYR A 1 58 ? -10.221 -0.598  6.706   1.00 0.00 ? 58 TYR A CD2  7  
ATOM 6806  C CE1  . TYR A 1 58 ? -9.484  1.863   5.697   1.00 0.00 ? 58 TYR A CE1  7  
ATOM 6807  C CE2  . TYR A 1 58 ? -10.688 0.559   7.301   1.00 0.00 ? 58 TYR A CE2  7  
ATOM 6808  C CZ   . TYR A 1 58 ? -10.316 1.786   6.793   1.00 0.00 ? 58 TYR A CZ   7  
ATOM 6809  O OH   . TYR A 1 58 ? -10.779 2.940   7.383   1.00 0.00 ? 58 TYR A OH   7  
ATOM 6810  H H    . TYR A 1 58 ? -9.114  -1.764  2.218   1.00 0.00 ? 58 TYR A H    7  
ATOM 6811  H HA   . TYR A 1 58 ? -7.202  -0.721  4.195   1.00 0.00 ? 58 TYR A HA   7  
ATOM 6812  H HB2  . TYR A 1 58 ? -9.709  -2.322  4.502   1.00 0.00 ? 58 TYR A HB2  7  
ATOM 6813  H HB3  . TYR A 1 58 ? -8.443  -2.436  5.721   1.00 0.00 ? 58 TYR A HB3  7  
ATOM 6814  H HD1  . TYR A 1 58 ? -8.368  0.758   4.249   1.00 0.00 ? 58 TYR A HD1  7  
ATOM 6815  H HD2  . TYR A 1 58 ? -10.508 -1.560  7.102   1.00 0.00 ? 58 TYR A HD2  7  
ATOM 6816  H HE1  . TYR A 1 58 ? -9.191  2.823   5.298   1.00 0.00 ? 58 TYR A HE1  7  
ATOM 6817  H HE2  . TYR A 1 58 ? -11.340 0.499   8.159   1.00 0.00 ? 58 TYR A HE2  7  
ATOM 6818  H HH   . TYR A 1 58 ? -11.655 2.787   7.742   1.00 0.00 ? 58 TYR A HH   7  
ATOM 6819  N N    . CYS A 1 59 ? -5.915  -2.860  4.593   1.00 0.00 ? 59 CYS A N    7  
ATOM 6820  C CA   . CYS A 1 59 ? -4.953  -3.957  4.567   1.00 0.00 ? 59 CYS A CA   7  
ATOM 6821  C C    . CYS A 1 59 ? -5.325  -5.095  5.513   1.00 0.00 ? 59 CYS A C    7  
ATOM 6822  O O    . CYS A 1 59 ? -5.267  -4.946  6.734   1.00 0.00 ? 59 CYS A O    7  
ATOM 6823  C CB   . CYS A 1 59 ? -3.578  -3.431  4.947   1.00 0.00 ? 59 CYS A CB   7  
ATOM 6824  S SG   . CYS A 1 59 ? -2.671  -2.641  3.580   1.00 0.00 ? 59 CYS A SG   7  
ATOM 6825  H H    . CYS A 1 59 ? -5.807  -2.153  5.262   1.00 0.00 ? 59 CYS A H    7  
ATOM 6826  H HA   . CYS A 1 59 ? -4.910  -4.338  3.564   1.00 0.00 ? 59 CYS A HA   7  
ATOM 6827  H HB2  . CYS A 1 59 ? -3.696  -2.705  5.728   1.00 0.00 ? 59 CYS A HB2  7  
ATOM 6828  H HB3  . CYS A 1 59 ? -2.977  -4.250  5.312   1.00 0.00 ? 59 CYS A HB3  7  
ATOM 6829  N N    . ASN A 1 60 ? -5.674  -6.242  4.939   1.00 0.00 ? 60 ASN A N    7  
ATOM 6830  C CA   . ASN A 1 60 ? -6.021  -7.430  5.712   1.00 0.00 ? 60 ASN A CA   7  
ATOM 6831  C C    . ASN A 1 60 ? -5.237  -8.615  5.174   1.00 0.00 ? 60 ASN A C    7  
ATOM 6832  O O    . ASN A 1 60 ? -4.242  -9.040  5.758   1.00 0.00 ? 60 ASN A O    7  
ATOM 6833  C CB   . ASN A 1 60 ? -7.527  -7.687  5.649   1.00 0.00 ? 60 ASN A CB   7  
ATOM 6834  C CG   . ASN A 1 60 ? -8.314  -6.398  5.756   1.00 0.00 ? 60 ASN A CG   7  
ATOM 6835  O OD1  . ASN A 1 60 ? -9.380  -6.251  5.157   1.00 0.00 ? 60 ASN A OD1  7  
ATOM 6836  N ND2  . ASN A 1 60 ? -7.784  -5.455  6.526   1.00 0.00 ? 60 ASN A ND2  7  
ATOM 6837  H H    . ASN A 1 60 ? -5.678  -6.299  3.964   1.00 0.00 ? 60 ASN A H    7  
ATOM 6838  H HA   . ASN A 1 60 ? -5.732  -7.262  6.729   1.00 0.00 ? 60 ASN A HA   7  
ATOM 6839  H HB2  . ASN A 1 60 ? -7.772  -8.163  4.712   1.00 0.00 ? 60 ASN A HB2  7  
ATOM 6840  H HB3  . ASN A 1 60 ? -7.813  -8.333  6.465   1.00 0.00 ? 60 ASN A HB3  7  
ATOM 6841  H HD21 . ASN A 1 60 ? -6.935  -5.651  6.974   1.00 0.00 ? 60 ASN A HD21 7  
ATOM 6842  H HD22 . ASN A 1 60 ? -8.253  -4.600  6.604   1.00 0.00 ? 60 ASN A HD22 7  
ATOM 6843  N N    . GLY A 1 61 ? -5.659  -9.096  4.023   1.00 0.00 ? 61 GLY A N    7  
ATOM 6844  C CA   . GLY A 1 61 ? -4.958  -10.180 3.364   1.00 0.00 ? 61 GLY A CA   7  
ATOM 6845  C C    . GLY A 1 61 ? -4.040  -9.612  2.305   1.00 0.00 ? 61 GLY A C    7  
ATOM 6846  O O    . GLY A 1 61 ? -3.757  -10.245 1.289   1.00 0.00 ? 61 GLY A O    7  
ATOM 6847  H H    . GLY A 1 61 ? -6.426  -8.676  3.593   1.00 0.00 ? 61 GLY A H    7  
ATOM 6848  H HA2  . GLY A 1 61 ? -4.377  -10.729 4.093   1.00 0.00 ? 61 GLY A HA2  7  
ATOM 6849  H HA3  . GLY A 1 61 ? -5.673  -10.841 2.899   1.00 0.00 ? 61 GLY A HA3  7  
ATOM 6850  N N    . ILE A 1 62 ? -3.616  -8.376  2.557   1.00 0.00 ? 62 ILE A N    7  
ATOM 6851  C CA   . ILE A 1 62 ? -2.757  -7.620  1.651   1.00 0.00 ? 62 ILE A CA   7  
ATOM 6852  C C    . ILE A 1 62 ? -1.316  -8.116  1.596   1.00 0.00 ? 62 ILE A C    7  
ATOM 6853  O O    . ILE A 1 62 ? -0.470  -7.679  2.371   1.00 0.00 ? 62 ILE A O    7  
ATOM 6854  C CB   . ILE A 1 62 ? -2.740  -6.129  2.039   1.00 0.00 ? 62 ILE A CB   7  
ATOM 6855  C CG1  . ILE A 1 62 ? -2.412  -5.887  3.525   1.00 0.00 ? 62 ILE A CG1  7  
ATOM 6856  C CG2  . ILE A 1 62 ? -4.086  -5.508  1.731   1.00 0.00 ? 62 ILE A CG2  7  
ATOM 6857  C CD1  . ILE A 1 62 ? -1.984  -7.088  4.351   1.00 0.00 ? 62 ILE A CD1  7  
ATOM 6858  H H    . ILE A 1 62 ? -3.917  -7.940  3.381   1.00 0.00 ? 62 ILE A H    7  
ATOM 6859  H HA   . ILE A 1 62 ? -3.182  -7.695  0.662   1.00 0.00 ? 62 ILE A HA   7  
ATOM 6860  H HB   . ILE A 1 62 ? -1.998  -5.633  1.429   1.00 0.00 ? 62 ILE A HB   7  
ATOM 6861  H HG12 . ILE A 1 62 ? -1.621  -5.158  3.591   1.00 0.00 ? 62 ILE A HG12 7  
ATOM 6862  H HG13 . ILE A 1 62 ? -3.293  -5.480  3.991   1.00 0.00 ? 62 ILE A HG13 7  
ATOM 6863  H HG21 . ILE A 1 62 ? -4.407  -5.813  0.752   1.00 0.00 ? 62 ILE A HG21 7  
ATOM 6864  H HG22 . ILE A 1 62 ? -4.006  -4.433  1.770   1.00 0.00 ? 62 ILE A HG22 7  
ATOM 6865  H HG23 . ILE A 1 62 ? -4.803  -5.837  2.463   1.00 0.00 ? 62 ILE A HG23 7  
ATOM 6866  H HD11 . ILE A 1 62 ? -1.944  -7.971  3.751   1.00 0.00 ? 62 ILE A HD11 7  
ATOM 6867  H HD12 . ILE A 1 62 ? -2.696  -7.234  5.145   1.00 0.00 ? 62 ILE A HD12 7  
ATOM 6868  H HD13 . ILE A 1 62 ? -1.011  -6.897  4.777   1.00 0.00 ? 62 ILE A HD13 7  
ATOM 6869  N N    . SER A 1 63 ? -1.025  -8.988  0.650   1.00 0.00 ? 63 SER A N    7  
ATOM 6870  C CA   . SER A 1 63 ? 0.331   -9.479  0.490   1.00 0.00 ? 63 SER A CA   7  
ATOM 6871  C C    . SER A 1 63 ? 1.057   -8.651  -0.569  1.00 0.00 ? 63 SER A C    7  
ATOM 6872  O O    . SER A 1 63 ? 2.148   -9.007  -1.015  1.00 0.00 ? 63 SER A O    7  
ATOM 6873  C CB   . SER A 1 63 ? 0.317   -10.953 0.114   1.00 0.00 ? 63 SER A CB   7  
ATOM 6874  O OG   . SER A 1 63 ? 0.062   -11.130 -1.269  1.00 0.00 ? 63 SER A OG   7  
ATOM 6875  H H    . SER A 1 63 ? -1.723  -9.281  0.028   1.00 0.00 ? 63 SER A H    7  
ATOM 6876  H HA   . SER A 1 63 ? 0.841   -9.359  1.435   1.00 0.00 ? 63 SER A HA   7  
ATOM 6877  H HB2  . SER A 1 63 ? 1.274   -11.386 0.353   1.00 0.00 ? 63 SER A HB2  7  
ATOM 6878  H HB3  . SER A 1 63 ? -0.457  -11.450 0.679   1.00 0.00 ? 63 SER A HB3  7  
ATOM 6879  H HG   . SER A 1 63 ? -0.256  -10.305 -1.644  1.00 0.00 ? 63 SER A HG   7  
ATOM 6880  N N    . ALA A 1 64 ? 0.421   -7.537  -0.947  1.00 0.00 ? 64 ALA A N    7  
ATOM 6881  C CA   . ALA A 1 64 ? 0.940   -6.600  -1.939  1.00 0.00 ? 64 ALA A CA   7  
ATOM 6882  C C    . ALA A 1 64 ? -0.183  -6.137  -2.856  1.00 0.00 ? 64 ALA A C    7  
ATOM 6883  O O    . ALA A 1 64 ? -0.088  -5.091  -3.499  1.00 0.00 ? 64 ALA A O    7  
ATOM 6884  C CB   . ALA A 1 64 ? 2.077   -7.190  -2.751  1.00 0.00 ? 64 ALA A CB   7  
ATOM 6885  H H    . ALA A 1 64 ? -0.440  -7.330  -0.532  1.00 0.00 ? 64 ALA A H    7  
ATOM 6886  H HA   . ALA A 1 64 ? 1.320   -5.747  -1.404  1.00 0.00 ? 64 ALA A HA   7  
ATOM 6887  H HB1  . ALA A 1 64 ? 1.876   -8.226  -2.953  1.00 0.00 ? 64 ALA A HB1  7  
ATOM 6888  H HB2  . ALA A 1 64 ? 2.999   -7.101  -2.199  1.00 0.00 ? 64 ALA A HB2  7  
ATOM 6889  H HB3  . ALA A 1 64 ? 2.165   -6.649  -3.682  1.00 0.00 ? 64 ALA A HB3  7  
ATOM 6890  N N    . GLY A 1 65 ? -1.255  -6.921  -2.894  1.00 0.00 ? 65 GLY A N    7  
ATOM 6891  C CA   . GLY A 1 65 ? -2.401  -6.580  -3.713  1.00 0.00 ? 65 GLY A CA   7  
ATOM 6892  C C    . GLY A 1 65 ? -3.508  -5.958  -2.888  1.00 0.00 ? 65 GLY A C    7  
ATOM 6893  O O    . GLY A 1 65 ? -3.435  -4.784  -2.548  1.00 0.00 ? 65 GLY A O    7  
ATOM 6894  H H    . GLY A 1 65 ? -1.273  -7.734  -2.347  1.00 0.00 ? 65 GLY A H    7  
ATOM 6895  H HA2  . GLY A 1 65 ? -2.092  -5.880  -4.476  1.00 0.00 ? 65 GLY A HA2  7  
ATOM 6896  H HA3  . GLY A 1 65 ? -2.776  -7.475  -4.185  1.00 0.00 ? 65 GLY A HA3  7  
ATOM 6897  N N    . CYS A 1 66 ? -4.515  -6.764  -2.552  1.00 0.00 ? 66 CYS A N    7  
ATOM 6898  C CA   . CYS A 1 66 ? -5.650  -6.324  -1.733  1.00 0.00 ? 66 CYS A CA   7  
ATOM 6899  C C    . CYS A 1 66 ? -6.560  -7.484  -1.352  1.00 0.00 ? 66 CYS A C    7  
ATOM 6900  O O    . CYS A 1 66 ? -6.739  -8.430  -2.120  1.00 0.00 ? 66 CYS A O    7  
ATOM 6901  C CB   . CYS A 1 66 ? -6.470  -5.222  -2.422  1.00 0.00 ? 66 CYS A CB   7  
ATOM 6902  S SG   . CYS A 1 66 ? -5.808  -3.539  -2.221  1.00 0.00 ? 66 CYS A SG   7  
ATOM 6903  H H    . CYS A 1 66 ? -4.480  -7.690  -2.844  1.00 0.00 ? 66 CYS A H    7  
ATOM 6904  H HA   . CYS A 1 66 ? -5.244  -5.936  -0.826  1.00 0.00 ? 66 CYS A HA   7  
ATOM 6905  H HB2  . CYS A 1 66 ? -6.513  -5.425  -3.479  1.00 0.00 ? 66 CYS A HB2  7  
ATOM 6906  H HB3  . CYS A 1 66 ? -7.471  -5.227  -2.018  1.00 0.00 ? 66 CYS A HB3  7  
ATOM 6907  N N    . PRO A 1 67 ? -7.157  -7.413  -0.148  1.00 0.00 ? 67 PRO A N    7  
ATOM 6908  C CA   . PRO A 1 67 ? -8.066  -8.445  0.356   1.00 0.00 ? 67 PRO A CA   7  
ATOM 6909  C C    . PRO A 1 67 ? -9.104  -8.858  -0.682  1.00 0.00 ? 67 PRO A C    7  
ATOM 6910  O O    . PRO A 1 67 ? -8.963  -9.890  -1.339  1.00 0.00 ? 67 PRO A O    7  
ATOM 6911  C CB   . PRO A 1 67 ? -8.752  -7.775  1.561   1.00 0.00 ? 67 PRO A CB   7  
ATOM 6912  C CG   . PRO A 1 67 ? -8.322  -6.341  1.533   1.00 0.00 ? 67 PRO A CG   7  
ATOM 6913  C CD   . PRO A 1 67 ? -7.003  -6.319  0.822   1.00 0.00 ? 67 PRO A CD   7  
ATOM 6914  H HA   . PRO A 1 67 ? -7.525  -9.319  0.687   1.00 0.00 ? 67 PRO A HA   7  
ATOM 6915  H HB2  . PRO A 1 67 ? -9.823  -7.864  1.460   1.00 0.00 ? 67 PRO A HB2  7  
ATOM 6916  H HB3  . PRO A 1 67 ? -8.433  -8.261  2.472   1.00 0.00 ? 67 PRO A HB3  7  
ATOM 6917  H HG2  . PRO A 1 67 ? -9.047  -5.749  0.995   1.00 0.00 ? 67 PRO A HG2  7  
ATOM 6918  H HG3  . PRO A 1 67 ? -8.209  -5.970  2.542   1.00 0.00 ? 67 PRO A HG3  7  
ATOM 6919  H HD2  . PRO A 1 67 ? -6.853  -5.369  0.329   1.00 0.00 ? 67 PRO A HD2  7  
ATOM 6920  H HD3  . PRO A 1 67 ? -6.199  -6.522  1.513   1.00 0.00 ? 67 PRO A HD3  7  
ATOM 6921  N N    . ARG A 1 68 ? -10.148 -8.047  -0.825  1.00 0.00 ? 68 ARG A N    7  
ATOM 6922  C CA   . ARG A 1 68 ? -11.211 -8.330  -1.783  1.00 0.00 ? 68 ARG A CA   7  
ATOM 6923  C C    . ARG A 1 68 ? -11.695 -7.049  -2.454  1.00 0.00 ? 68 ARG A C    7  
ATOM 6924  O O    . ARG A 1 68 ? -11.339 -6.763  -3.597  1.00 0.00 ? 68 ARG A O    7  
ATOM 6925  C CB   . ARG A 1 68 ? -12.381 -9.026  -1.087  1.00 0.00 ? 68 ARG A CB   7  
ATOM 6926  C CG   . ARG A 1 68 ? -12.154 -10.510 -0.852  1.00 0.00 ? 68 ARG A CG   7  
ATOM 6927  C CD   . ARG A 1 68 ? -11.818 -10.799 0.602   1.00 0.00 ? 68 ARG A CD   7  
ATOM 6928  N NE   . ARG A 1 68 ? -12.634 -11.880 1.147   1.00 0.00 ? 68 ARG A NE   7  
ATOM 6929  C CZ   . ARG A 1 68 ? -13.924 -11.753 1.441   1.00 0.00 ? 68 ARG A CZ   7  
ATOM 6930  N NH1  . ARG A 1 68 ? -14.539 -10.594 1.245   1.00 0.00 ? 68 ARG A NH1  7  
ATOM 6931  N NH2  . ARG A 1 68 ? -14.600 -12.783 1.931   1.00 0.00 ? 68 ARG A NH2  7  
ATOM 6932  H H    . ARG A 1 68 ? -10.205 -7.240  -0.272  1.00 0.00 ? 68 ARG A H    7  
ATOM 6933  H HA   . ARG A 1 68 ? -10.810 -8.989  -2.539  1.00 0.00 ? 68 ARG A HA   7  
ATOM 6934  H HB2  . ARG A 1 68 ? -12.548 -8.554  -0.130  1.00 0.00 ? 68 ARG A HB2  7  
ATOM 6935  H HB3  . ARG A 1 68 ? -13.267 -8.911  -1.694  1.00 0.00 ? 68 ARG A HB3  7  
ATOM 6936  H HG2  . ARG A 1 68 ? -13.052 -11.048 -1.117  1.00 0.00 ? 68 ARG A HG2  7  
ATOM 6937  H HG3  . ARG A 1 68 ? -11.336 -10.842 -1.475  1.00 0.00 ? 68 ARG A HG3  7  
ATOM 6938  H HD2  . ARG A 1 68 ? -10.777 -11.078 0.669   1.00 0.00 ? 68 ARG A HD2  7  
ATOM 6939  H HD3  . ARG A 1 68 ? -11.988 -9.904  1.182   1.00 0.00 ? 68 ARG A HD3  7  
ATOM 6940  H HE   . ARG A 1 68 ? -12.198 -12.745 1.301   1.00 0.00 ? 68 ARG A HE   7  
ATOM 6941  H HH11 . ARG A 1 68 ? -14.032 -9.815  0.876   1.00 0.00 ? 68 ARG A HH11 7  
ATOM 6942  H HH12 . ARG A 1 68 ? -15.510 -10.500 1.466   1.00 0.00 ? 68 ARG A HH12 7  
ATOM 6943  H HH21 . ARG A 1 68 ? -14.139 -13.658 2.080   1.00 0.00 ? 68 ARG A HH21 7  
ATOM 6944  H HH22 . ARG A 1 68 ? -15.570 -12.685 2.152   1.00 0.00 ? 68 ARG A HH22 7  
ATOM 6945  N N    . ASN A 1 69 ? -12.507 -6.281  -1.735  1.00 0.00 ? 69 ASN A N    7  
ATOM 6946  C CA   . ASN A 1 69 ? -13.039 -5.029  -2.261  1.00 0.00 ? 69 ASN A CA   7  
ATOM 6947  C C    . ASN A 1 69 ? -13.710 -4.213  -1.164  1.00 0.00 ? 69 ASN A C    7  
ATOM 6948  O O    . ASN A 1 69 ? -13.277 -3.102  -0.857  1.00 0.00 ? 69 ASN A O    7  
ATOM 6949  C CB   . ASN A 1 69 ? -14.025 -5.303  -3.398  1.00 0.00 ? 69 ASN A CB   7  
ATOM 6950  C CG   . ASN A 1 69 ? -13.327 -5.577  -4.715  1.00 0.00 ? 69 ASN A CG   7  
ATOM 6951  O OD1  . ASN A 1 69 ? -12.612 -4.723  -5.242  1.00 0.00 ? 69 ASN A OD1  7  
ATOM 6952  N ND2  . ASN A 1 69 ? -13.530 -6.772  -5.256  1.00 0.00 ? 69 ASN A ND2  7  
ATOM 6953  H H    . ASN A 1 69 ? -12.752 -6.562  -0.829  1.00 0.00 ? 69 ASN A H    7  
ATOM 6954  H HA   . ASN A 1 69 ? -12.213 -4.460  -2.646  1.00 0.00 ? 69 ASN A HA   7  
ATOM 6955  H HB2  . ASN A 1 69 ? -14.624 -6.165  -3.148  1.00 0.00 ? 69 ASN A HB2  7  
ATOM 6956  H HB3  . ASN A 1 69 ? -14.670 -4.445  -3.523  1.00 0.00 ? 69 ASN A HB3  7  
ATOM 6957  H HD21 . ASN A 1 69 ? -14.112 -7.402  -4.781  1.00 0.00 ? 69 ASN A HD21 7  
ATOM 6958  H HD22 . ASN A 1 69 ? -13.091 -6.977  -6.108  1.00 0.00 ? 69 ASN A HD22 7  
ATOM 6959  N N    . PRO A 1 70 ? -14.774 -4.753  -0.557  1.00 0.00 ? 70 PRO A N    7  
ATOM 6960  C CA   . PRO A 1 70 ? -15.503 -4.078  0.507   1.00 0.00 ? 70 PRO A CA   7  
ATOM 6961  C C    . PRO A 1 70 ? -14.600 -3.226  1.394   1.00 0.00 ? 70 PRO A C    7  
ATOM 6962  O O    . PRO A 1 70 ? -14.123 -3.685  2.432   1.00 0.00 ? 70 PRO A O    7  
ATOM 6963  C CB   . PRO A 1 70 ? -16.074 -5.249  1.294   1.00 0.00 ? 70 PRO A CB   7  
ATOM 6964  C CG   . PRO A 1 70 ? -16.334 -6.305  0.270   1.00 0.00 ? 70 PRO A CG   7  
ATOM 6965  C CD   . PRO A 1 70 ? -15.356 -6.073  -0.859  1.00 0.00 ? 70 PRO A CD   7  
ATOM 6966  H HA   . PRO A 1 70 ? -16.306 -3.473  0.118   1.00 0.00 ? 70 PRO A HA   7  
ATOM 6967  H HB2  . PRO A 1 70 ? -15.350 -5.578  2.025   1.00 0.00 ? 70 PRO A HB2  7  
ATOM 6968  H HB3  . PRO A 1 70 ? -16.983 -4.946  1.787   1.00 0.00 ? 70 PRO A HB3  7  
ATOM 6969  H HG2  . PRO A 1 70 ? -16.176 -7.280  0.704   1.00 0.00 ? 70 PRO A HG2  7  
ATOM 6970  H HG3  . PRO A 1 70 ? -17.348 -6.218  -0.092  1.00 0.00 ? 70 PRO A HG3  7  
ATOM 6971  H HD2  . PRO A 1 70 ? -14.594 -6.838  -0.859  1.00 0.00 ? 70 PRO A HD2  7  
ATOM 6972  H HD3  . PRO A 1 70 ? -15.876 -6.057  -1.804  1.00 0.00 ? 70 PRO A HD3  7  
ATOM 6973  N N    . PHE A 1 71 ? -14.372 -1.984  0.979   1.00 0.00 ? 71 PHE A N    7  
ATOM 6974  C CA   . PHE A 1 71 ? -13.527 -1.065  1.734   1.00 0.00 ? 71 PHE A CA   7  
ATOM 6975  C C    . PHE A 1 71 ? -13.736 0.371   1.265   1.00 0.00 ? 71 PHE A C    7  
ATOM 6976  O O    . PHE A 1 71 ? -14.083 1.249   2.056   1.00 0.00 ? 71 PHE A O    7  
ATOM 6977  C CB   . PHE A 1 71 ? -12.053 -1.450  1.582   1.00 0.00 ? 71 PHE A CB   7  
ATOM 6978  C CG   . PHE A 1 71 ? -11.732 -2.822  2.101   1.00 0.00 ? 71 PHE A CG   7  
ATOM 6979  C CD1  . PHE A 1 71 ? -11.673 -3.066  3.463   1.00 0.00 ? 71 PHE A CD1  7  
ATOM 6980  C CD2  . PHE A 1 71 ? -11.491 -3.869  1.225   1.00 0.00 ? 71 PHE A CD2  7  
ATOM 6981  C CE1  . PHE A 1 71 ? -11.379 -4.328  3.944   1.00 0.00 ? 71 PHE A CE1  7  
ATOM 6982  C CE2  . PHE A 1 71 ? -11.197 -5.133  1.700   1.00 0.00 ? 71 PHE A CE2  7  
ATOM 6983  C CZ   . PHE A 1 71 ? -11.140 -5.363  3.060   1.00 0.00 ? 71 PHE A CZ   7  
ATOM 6984  H H    . PHE A 1 71 ? -14.783 -1.677  0.144   1.00 0.00 ? 71 PHE A H    7  
ATOM 6985  H HA   . PHE A 1 71 ? -13.805 -1.137  2.774   1.00 0.00 ? 71 PHE A HA   7  
ATOM 6986  H HB2  . PHE A 1 71 ? -11.787 -1.420  0.536   1.00 0.00 ? 71 PHE A HB2  7  
ATOM 6987  H HB3  . PHE A 1 71 ? -11.446 -0.739  2.123   1.00 0.00 ? 71 PHE A HB3  7  
ATOM 6988  H HD1  . PHE A 1 71 ? -11.859 -2.257  4.155   1.00 0.00 ? 71 PHE A HD1  7  
ATOM 6989  H HD2  . PHE A 1 71 ? -11.534 -3.690  0.161   1.00 0.00 ? 71 PHE A HD2  7  
ATOM 6990  H HE1  . PHE A 1 71 ? -11.335 -4.505  5.008   1.00 0.00 ? 71 PHE A HE1  7  
ATOM 6991  H HE2  . PHE A 1 71 ? -11.011 -5.941  1.007   1.00 0.00 ? 71 PHE A HE2  7  
ATOM 6992  H HZ   . PHE A 1 71 ? -10.910 -6.350  3.433   1.00 0.00 ? 71 PHE A HZ   7  
ATOM 6993  N N    . HIS A 1 72 ? -13.521 0.602   -0.026  1.00 0.00 ? 72 HIS A N    7  
ATOM 6994  C CA   . HIS A 1 72 ? -13.684 1.930   -0.605  1.00 0.00 ? 72 HIS A CA   7  
ATOM 6995  C C    . HIS A 1 72 ? -15.111 2.140   -1.106  1.00 0.00 ? 72 HIS A C    7  
ATOM 6996  O O    . HIS A 1 72 ? -15.441 3.200   -1.639  1.00 0.00 ? 72 HIS A O    7  
ATOM 6997  C CB   . HIS A 1 72 ? -12.690 2.130   -1.751  1.00 0.00 ? 72 HIS A CB   7  
ATOM 6998  C CG   . HIS A 1 72 ? -13.075 3.223   -2.700  1.00 0.00 ? 72 HIS A CG   7  
ATOM 6999  N ND1  . HIS A 1 72 ? -13.363 2.997   -4.030  1.00 0.00 ? 72 HIS A ND1  7  
ATOM 7000  C CD2  . HIS A 1 72 ? -13.220 4.555   -2.507  1.00 0.00 ? 72 HIS A CD2  7  
ATOM 7001  C CE1  . HIS A 1 72 ? -13.667 4.142   -4.613  1.00 0.00 ? 72 HIS A CE1  7  
ATOM 7002  N NE2  . HIS A 1 72 ? -13.589 5.103   -3.712  1.00 0.00 ? 72 HIS A NE2  7  
ATOM 7003  H H    . HIS A 1 72 ? -13.246 -0.140  -0.604  1.00 0.00 ? 72 HIS A H    7  
ATOM 7004  H HA   . HIS A 1 72 ? -13.478 2.655   0.168   1.00 0.00 ? 72 HIS A HA   7  
ATOM 7005  H HB2  . HIS A 1 72 ? -11.722 2.375   -1.340  1.00 0.00 ? 72 HIS A HB2  7  
ATOM 7006  H HB3  . HIS A 1 72 ? -12.613 1.211   -2.315  1.00 0.00 ? 72 HIS A HB3  7  
ATOM 7007  H HD1  . HIS A 1 72 ? -13.346 2.126   -4.479  1.00 0.00 ? 72 HIS A HD1  7  
ATOM 7008  H HD2  . HIS A 1 72 ? -13.074 5.088   -1.578  1.00 0.00 ? 72 HIS A HD2  7  
ATOM 7009  H HE1  . HIS A 1 72 ? -13.936 4.270   -5.652  1.00 0.00 ? 72 HIS A HE1  7  
ATOM 7010  H HE2  . HIS A 1 72 ? -13.667 6.061   -3.900  1.00 0.00 ? 72 HIS A HE2  7  
ATOM 7011  N N    . ALA A 1 73 ? -15.954 1.126   -0.934  1.00 0.00 ? 73 ALA A N    7  
ATOM 7012  C CA   . ALA A 1 73 ? -17.343 1.206   -1.370  1.00 0.00 ? 73 ALA A CA   7  
ATOM 7013  C C    . ALA A 1 73 ? -17.473 0.857   -2.849  1.00 0.00 ? 73 ALA A C    7  
ATOM 7014  O O    . ALA A 1 73 ? -17.398 1.783   -3.684  1.00 0.00 ? 73 ALA A O    7  
ATOM 7015  C CB   . ALA A 1 73 ? -17.900 2.596   -1.103  1.00 0.00 ? 73 ALA A CB   7  
ATOM 7016  O OXT  . ALA A 1 73 ? -17.649 -0.340  -3.160  1.00 0.00 ? 73 ALA A OXT  7  
ATOM 7017  H H    . ALA A 1 73 ? -15.636 0.306   -0.503  1.00 0.00 ? 73 ALA A H    7  
ATOM 7018  H HA   . ALA A 1 73 ? -17.916 0.497   -0.791  1.00 0.00 ? 73 ALA A HA   7  
ATOM 7019  H HB1  . ALA A 1 73 ? -18.867 2.511   -0.631  1.00 0.00 ? 73 ALA A HB1  7  
ATOM 7020  H HB2  . ALA A 1 73 ? -18.000 3.129   -2.037  1.00 0.00 ? 73 ALA A HB2  7  
ATOM 7021  H HB3  . ALA A 1 73 ? -17.227 3.134   -0.452  1.00 0.00 ? 73 ALA A HB3  7  
ATOM 7022  N N    . GLU A 1 1  ? -8.109  7.586   10.324  1.00 0.00 ? 1  GLU A N    8  
ATOM 7023  C CA   . GLU A 1 1  ? -6.898  6.926   9.767   1.00 0.00 ? 1  GLU A CA   8  
ATOM 7024  C C    . GLU A 1 1  ? -7.083  6.584   8.292   1.00 0.00 ? 1  GLU A C    8  
ATOM 7025  O O    . GLU A 1 1  ? -7.828  5.668   7.946   1.00 0.00 ? 1  GLU A O    8  
ATOM 7026  C CB   . GLU A 1 1  ? -6.623  5.655   10.572  1.00 0.00 ? 1  GLU A CB   8  
ATOM 7027  C CG   . GLU A 1 1  ? -5.182  5.533   11.040  1.00 0.00 ? 1  GLU A CG   8  
ATOM 7028  C CD   . GLU A 1 1  ? -4.967  6.122   12.421  1.00 0.00 ? 1  GLU A CD   8  
ATOM 7029  O OE1  . GLU A 1 1  ? -5.930  6.138   13.216  1.00 0.00 ? 1  GLU A OE1  8  
ATOM 7030  O OE2  . GLU A 1 1  ? -3.836  6.568   12.706  1.00 0.00 ? 1  GLU A OE2  8  
ATOM 7031  H H1   . GLU A 1 1  ? -8.179  7.324   11.327  1.00 0.00 ? 1  GLU A H1   8  
ATOM 7032  H H2   . GLU A 1 1  ? -8.931  7.243   9.787   1.00 0.00 ? 1  GLU A H2   8  
ATOM 7033  H H3   . GLU A 1 1  ? -7.989  8.612   10.213  1.00 0.00 ? 1  GLU A H3   8  
ATOM 7034  H HA   . GLU A 1 1  ? -6.062  7.600   9.871   1.00 0.00 ? 1  GLU A HA   8  
ATOM 7035  H HB2  . GLU A 1 1  ? -7.264  5.646   11.441  1.00 0.00 ? 1  GLU A HB2  8  
ATOM 7036  H HB3  . GLU A 1 1  ? -6.852  4.797   9.957   1.00 0.00 ? 1  GLU A HB3  8  
ATOM 7037  H HG2  . GLU A 1 1  ? -4.912  4.488   11.065  1.00 0.00 ? 1  GLU A HG2  8  
ATOM 7038  H HG3  . GLU A 1 1  ? -4.544  6.053   10.340  1.00 0.00 ? 1  GLU A HG3  8  
ATOM 7039  N N    . ALA A 1 2  ? -6.399  7.327   7.428   1.00 0.00 ? 2  ALA A N    8  
ATOM 7040  C CA   . ALA A 1 2  ? -6.487  7.103   5.990   1.00 0.00 ? 2  ALA A CA   8  
ATOM 7041  C C    . ALA A 1 2  ? -5.352  7.811   5.256   1.00 0.00 ? 2  ALA A C    8  
ATOM 7042  O O    . ALA A 1 2  ? -4.973  8.927   5.609   1.00 0.00 ? 2  ALA A O    8  
ATOM 7043  C CB   . ALA A 1 2  ? -7.834  7.575   5.464   1.00 0.00 ? 2  ALA A CB   8  
ATOM 7044  H H    . ALA A 1 2  ? -5.821  8.043   7.766   1.00 0.00 ? 2  ALA A H    8  
ATOM 7045  H HA   . ALA A 1 2  ? -6.409  6.040   5.813   1.00 0.00 ? 2  ALA A HA   8  
ATOM 7046  H HB1  . ALA A 1 2  ? -8.409  6.723   5.131   1.00 0.00 ? 2  ALA A HB1  8  
ATOM 7047  H HB2  . ALA A 1 2  ? -7.681  8.252   4.637   1.00 0.00 ? 2  ALA A HB2  8  
ATOM 7048  H HB3  . ALA A 1 2  ? -8.370  8.084   6.252   1.00 0.00 ? 2  ALA A HB3  8  
ATOM 7049  N N    . GLY A 1 3  ? -4.813  7.154   4.234   1.00 0.00 ? 3  GLY A N    8  
ATOM 7050  C CA   . GLY A 1 3  ? -3.727  7.738   3.468   1.00 0.00 ? 3  GLY A CA   8  
ATOM 7051  C C    . GLY A 1 3  ? -2.500  8.010   4.318   1.00 0.00 ? 3  GLY A C    8  
ATOM 7052  O O    . GLY A 1 3  ? -2.427  9.032   5.001   1.00 0.00 ? 3  GLY A O    8  
ATOM 7053  H H    . GLY A 1 3  ? -5.155  6.266   3.998   1.00 0.00 ? 3  GLY A H    8  
ATOM 7054  H HA2  . GLY A 1 3  ? -3.457  7.060   2.671   1.00 0.00 ? 3  GLY A HA2  8  
ATOM 7055  H HA3  . GLY A 1 3  ? -4.066  8.668   3.035   1.00 0.00 ? 3  GLY A HA3  8  
ATOM 7056  N N    . GLU A 1 4  ? -1.535  7.095   4.281   1.00 0.00 ? 4  GLU A N    8  
ATOM 7057  C CA   . GLU A 1 4  ? -0.310  7.246   5.060   1.00 0.00 ? 4  GLU A CA   8  
ATOM 7058  C C    . GLU A 1 4  ? 0.665   8.198   4.372   1.00 0.00 ? 4  GLU A C    8  
ATOM 7059  O O    . GLU A 1 4  ? 0.376   8.732   3.302   1.00 0.00 ? 4  GLU A O    8  
ATOM 7060  C CB   . GLU A 1 4  ? 0.354   5.884   5.274   1.00 0.00 ? 4  GLU A CB   8  
ATOM 7061  C CG   . GLU A 1 4  ? -0.382  4.999   6.267   1.00 0.00 ? 4  GLU A CG   8  
ATOM 7062  C CD   . GLU A 1 4  ? -1.486  4.189   5.617   1.00 0.00 ? 4  GLU A CD   8  
ATOM 7063  O OE1  . GLU A 1 4  ? -2.528  4.781   5.265   1.00 0.00 ? 4  GLU A OE1  8  
ATOM 7064  O OE2  . GLU A 1 4  ? -1.310  2.962   5.460   1.00 0.00 ? 4  GLU A OE2  8  
ATOM 7065  H H    . GLU A 1 4  ? -1.651  6.298   3.719   1.00 0.00 ? 4  GLU A H    8  
ATOM 7066  H HA   . GLU A 1 4  ? -0.578  7.659   6.021   1.00 0.00 ? 4  GLU A HA   8  
ATOM 7067  H HB2  . GLU A 1 4  ? 0.399   5.367   4.328   1.00 0.00 ? 4  GLU A HB2  8  
ATOM 7068  H HB3  . GLU A 1 4  ? 1.359   6.039   5.639   1.00 0.00 ? 4  GLU A HB3  8  
ATOM 7069  H HG2  . GLU A 1 4  ? 0.325   4.319   6.717   1.00 0.00 ? 4  GLU A HG2  8  
ATOM 7070  H HG3  . GLU A 1 4  ? -0.817  5.624   7.033   1.00 0.00 ? 4  GLU A HG3  8  
ATOM 7071  N N    . GLU A 1 5  ? 1.821   8.406   4.997   1.00 0.00 ? 5  GLU A N    8  
ATOM 7072  C CA   . GLU A 1 5  ? 2.841   9.295   4.450   1.00 0.00 ? 5  GLU A CA   8  
ATOM 7073  C C    . GLU A 1 5  ? 3.492   8.684   3.214   1.00 0.00 ? 5  GLU A C    8  
ATOM 7074  O O    . GLU A 1 5  ? 3.018   7.679   2.684   1.00 0.00 ? 5  GLU A O    8  
ATOM 7075  C CB   . GLU A 1 5  ? 3.906   9.593   5.506   1.00 0.00 ? 5  GLU A CB   8  
ATOM 7076  C CG   . GLU A 1 5  ? 3.332   9.894   6.880   1.00 0.00 ? 5  GLU A CG   8  
ATOM 7077  C CD   . GLU A 1 5  ? 4.406   10.066  7.937   1.00 0.00 ? 5  GLU A CD   8  
ATOM 7078  O OE1  . GLU A 1 5  ? 5.154   11.063  7.865   1.00 0.00 ? 5  GLU A OE1  8  
ATOM 7079  O OE2  . GLU A 1 5  ? 4.497   9.204   8.836   1.00 0.00 ? 5  GLU A OE2  8  
ATOM 7080  H H    . GLU A 1 5  ? 1.991   7.952   5.849   1.00 0.00 ? 5  GLU A H    8  
ATOM 7081  H HA   . GLU A 1 5  ? 2.358   10.219  4.168   1.00 0.00 ? 5  GLU A HA   8  
ATOM 7082  H HB2  . GLU A 1 5  ? 4.560   8.737   5.593   1.00 0.00 ? 5  GLU A HB2  8  
ATOM 7083  H HB3  . GLU A 1 5  ? 4.485   10.446  5.187   1.00 0.00 ? 5  GLU A HB3  8  
ATOM 7084  H HG2  . GLU A 1 5  ? 2.755   10.805  6.823   1.00 0.00 ? 5  GLU A HG2  8  
ATOM 7085  H HG3  . GLU A 1 5  ? 2.687   9.078   7.173   1.00 0.00 ? 5  GLU A HG3  8  
ATOM 7086  N N    . CYS A 1 6  ? 4.582   9.296   2.759   1.00 0.00 ? 6  CYS A N    8  
ATOM 7087  C CA   . CYS A 1 6  ? 5.295   8.807   1.585   1.00 0.00 ? 6  CYS A CA   8  
ATOM 7088  C C    . CYS A 1 6  ? 4.431   8.943   0.334   1.00 0.00 ? 6  CYS A C    8  
ATOM 7089  O O    . CYS A 1 6  ? 3.280   8.511   0.316   1.00 0.00 ? 6  CYS A O    8  
ATOM 7090  C CB   . CYS A 1 6  ? 5.703   7.347   1.790   1.00 0.00 ? 6  CYS A CB   8  
ATOM 7091  S SG   . CYS A 1 6  ? 6.063   6.444   0.250   1.00 0.00 ? 6  CYS A SG   8  
ATOM 7092  H H    . CYS A 1 6  ? 4.913   10.093  3.223   1.00 0.00 ? 6  CYS A H    8  
ATOM 7093  H HA   . CYS A 1 6  ? 6.184   9.407   1.462   1.00 0.00 ? 6  CYS A HA   8  
ATOM 7094  H HB2  . CYS A 1 6  ? 6.591   7.313   2.403   1.00 0.00 ? 6  CYS A HB2  8  
ATOM 7095  H HB3  . CYS A 1 6  ? 4.904   6.827   2.297   1.00 0.00 ? 6  CYS A HB3  8  
ATOM 7096  N N    . ASP A 1 7  ? 4.989   9.552   -0.708  1.00 0.00 ? 7  ASP A N    8  
ATOM 7097  C CA   . ASP A 1 7  ? 4.258   9.747   -1.955  1.00 0.00 ? 7  ASP A CA   8  
ATOM 7098  C C    . ASP A 1 7  ? 4.941   9.029   -3.116  1.00 0.00 ? 7  ASP A C    8  
ATOM 7099  O O    . ASP A 1 7  ? 4.733   9.373   -4.279  1.00 0.00 ? 7  ASP A O    8  
ATOM 7100  C CB   . ASP A 1 7  ? 4.130   11.239  -2.267  1.00 0.00 ? 7  ASP A CB   8  
ATOM 7101  C CG   . ASP A 1 7  ? 3.357   11.987  -1.199  1.00 0.00 ? 7  ASP A CG   8  
ATOM 7102  O OD1  . ASP A 1 7  ? 3.781   11.951  -0.024  1.00 0.00 ? 7  ASP A OD1  8  
ATOM 7103  O OD2  . ASP A 1 7  ? 2.328   12.609  -1.537  1.00 0.00 ? 7  ASP A OD2  8  
ATOM 7104  H H    . ASP A 1 7  ? 5.909   9.882   -0.634  1.00 0.00 ? 7  ASP A H    8  
ATOM 7105  H HA   . ASP A 1 7  ? 3.270   9.332   -1.826  1.00 0.00 ? 7  ASP A HA   8  
ATOM 7106  H HB2  . ASP A 1 7  ? 5.117   11.671  -2.340  1.00 0.00 ? 7  ASP A HB2  8  
ATOM 7107  H HB3  . ASP A 1 7  ? 3.617   11.361  -3.209  1.00 0.00 ? 7  ASP A HB3  8  
ATOM 7108  N N    . CYS A 1 8  ? 5.755   8.029   -2.793  1.00 0.00 ? 8  CYS A N    8  
ATOM 7109  C CA   . CYS A 1 8  ? 6.465   7.262   -3.811  1.00 0.00 ? 8  CYS A CA   8  
ATOM 7110  C C    . CYS A 1 8  ? 5.523   6.321   -4.559  1.00 0.00 ? 8  CYS A C    8  
ATOM 7111  O O    . CYS A 1 8  ? 5.963   5.556   -5.419  1.00 0.00 ? 8  CYS A O    8  
ATOM 7112  C CB   . CYS A 1 8  ? 7.540   6.396   -3.184  1.00 0.00 ? 8  CYS A CB   8  
ATOM 7113  S SG   . CYS A 1 8  ? 8.947   7.246   -2.408  1.00 0.00 ? 8  CYS A SG   8  
ATOM 7114  H H    . CYS A 1 8  ? 5.880   7.800   -1.849  1.00 0.00 ? 8  CYS A H    8  
ATOM 7115  H HA   . CYS A 1 8  ? 6.918   7.949   -4.508  1.00 0.00 ? 8  CYS A HA   8  
ATOM 7116  H HB2  . CYS A 1 8  ? 7.082   5.792   -2.423  1.00 0.00 ? 8  CYS A HB2  8  
ATOM 7117  H HB3  . CYS A 1 8  ? 7.933   5.753   -3.954  1.00 0.00 ? 8  CYS A HB3  8  
ATOM 7118  N N    . GLY A 1 9  ? 4.247   6.339   -4.195  1.00 0.00 ? 9  GLY A N    8  
ATOM 7119  C CA   . GLY A 1 9  ? 3.284   5.454   -4.820  1.00 0.00 ? 9  GLY A CA   8  
ATOM 7120  C C    . GLY A 1 9  ? 2.789   4.411   -3.845  1.00 0.00 ? 9  GLY A C    8  
ATOM 7121  O O    . GLY A 1 9  ? 2.990   4.551   -2.639  1.00 0.00 ? 9  GLY A O    8  
ATOM 7122  H H    . GLY A 1 9  ? 3.961   6.932   -3.473  1.00 0.00 ? 9  GLY A H    8  
ATOM 7123  H HA2  . GLY A 1 9  ? 2.444   6.037   -5.170  1.00 0.00 ? 9  GLY A HA2  8  
ATOM 7124  H HA3  . GLY A 1 9  ? 3.748   4.960   -5.659  1.00 0.00 ? 9  GLY A HA3  8  
ATOM 7125  N N    . SER A 1 10 ? 2.135   3.366   -4.341  1.00 0.00 ? 10 SER A N    8  
ATOM 7126  C CA   . SER A 1 10 ? 1.632   2.340   -3.450  1.00 0.00 ? 10 SER A CA   8  
ATOM 7127  C C    . SER A 1 10 ? 1.386   0.998   -4.152  1.00 0.00 ? 10 SER A C    8  
ATOM 7128  O O    . SER A 1 10 ? 2.280   0.152   -4.178  1.00 0.00 ? 10 SER A O    8  
ATOM 7129  C CB   . SER A 1 10 ? 0.392   2.864   -2.743  1.00 0.00 ? 10 SER A CB   8  
ATOM 7130  O OG   . SER A 1 10 ? 0.752   3.731   -1.685  1.00 0.00 ? 10 SER A OG   8  
ATOM 7131  H H    . SER A 1 10 ? 1.985   3.291   -5.303  1.00 0.00 ? 10 SER A H    8  
ATOM 7132  H HA   . SER A 1 10 ? 2.387   2.178   -2.710  1.00 0.00 ? 10 SER A HA   8  
ATOM 7133  H HB2  . SER A 1 10 ? -0.216  3.414   -3.445  1.00 0.00 ? 10 SER A HB2  8  
ATOM 7134  H HB3  . SER A 1 10 ? -0.172  2.039   -2.344  1.00 0.00 ? 10 SER A HB3  8  
ATOM 7135  H HG   . SER A 1 10 ? 1.483   3.350   -1.193  1.00 0.00 ? 10 SER A HG   8  
ATOM 7136  N N    . PRO A 1 11 ? 0.192   0.758   -4.723  1.00 0.00 ? 11 PRO A N    8  
ATOM 7137  C CA   . PRO A 1 11 ? -0.101  -0.509  -5.396  1.00 0.00 ? 11 PRO A CA   8  
ATOM 7138  C C    . PRO A 1 11 ? 0.570   -0.598  -6.760  1.00 0.00 ? 11 PRO A C    8  
ATOM 7139  O O    . PRO A 1 11 ? 0.075   -0.055  -7.747  1.00 0.00 ? 11 PRO A O    8  
ATOM 7140  C CB   . PRO A 1 11 ? -1.618  -0.482  -5.531  1.00 0.00 ? 11 PRO A CB   8  
ATOM 7141  C CG   . PRO A 1 11 ? -1.943  0.964   -5.655  1.00 0.00 ? 11 PRO A CG   8  
ATOM 7142  C CD   . PRO A 1 11 ? -0.961  1.674   -4.763  1.00 0.00 ? 11 PRO A CD   8  
ATOM 7143  H HA   . PRO A 1 11 ? 0.197   -1.355  -4.794  1.00 0.00 ? 11 PRO A HA   8  
ATOM 7144  H HB2  . PRO A 1 11 ? -1.916  -1.037  -6.406  1.00 0.00 ? 11 PRO A HB2  8  
ATOM 7145  H HB3  . PRO A 1 11 ? -2.067  -0.913  -4.648  1.00 0.00 ? 11 PRO A HB3  8  
ATOM 7146  H HG2  . PRO A 1 11 ? -1.822  1.283   -6.680  1.00 0.00 ? 11 PRO A HG2  8  
ATOM 7147  H HG3  . PRO A 1 11 ? -2.954  1.145   -5.320  1.00 0.00 ? 11 PRO A HG3  8  
ATOM 7148  H HD2  . PRO A 1 11 ? -0.678  2.626   -5.186  1.00 0.00 ? 11 PRO A HD2  8  
ATOM 7149  H HD3  . PRO A 1 11 ? -1.378  1.806   -3.776  1.00 0.00 ? 11 PRO A HD3  8  
ATOM 7150  N N    . GLY A 1 12 ? 1.714   -1.270  -6.797  1.00 0.00 ? 12 GLY A N    8  
ATOM 7151  C CA   . GLY A 1 12 ? 2.459   -1.401  -8.034  1.00 0.00 ? 12 GLY A CA   8  
ATOM 7152  C C    . GLY A 1 12 ? 3.732   -0.589  -7.986  1.00 0.00 ? 12 GLY A C    8  
ATOM 7153  O O    . GLY A 1 12 ? 4.719   -0.908  -8.648  1.00 0.00 ? 12 GLY A O    8  
ATOM 7154  H H    . GLY A 1 12 ? 2.068   -1.665  -5.969  1.00 0.00 ? 12 GLY A H    8  
ATOM 7155  H HA2  . GLY A 1 12 ? 2.706   -2.442  -8.190  1.00 0.00 ? 12 GLY A HA2  8  
ATOM 7156  H HA3  . GLY A 1 12 ? 1.849   -1.054  -8.855  1.00 0.00 ? 12 GLY A HA3  8  
ATOM 7157  N N    . ASN A 1 13 ? 3.702   0.459   -7.171  1.00 0.00 ? 13 ASN A N    8  
ATOM 7158  C CA   . ASN A 1 13 ? 4.847   1.335   -6.986  1.00 0.00 ? 13 ASN A CA   8  
ATOM 7159  C C    . ASN A 1 13 ? 5.201   1.403   -5.506  1.00 0.00 ? 13 ASN A C    8  
ATOM 7160  O O    . ASN A 1 13 ? 5.296   2.482   -4.923  1.00 0.00 ? 13 ASN A O    8  
ATOM 7161  C CB   . ASN A 1 13 ? 4.544   2.736   -7.520  1.00 0.00 ? 13 ASN A CB   8  
ATOM 7162  C CG   . ASN A 1 13 ? 4.566   2.796   -9.035  1.00 0.00 ? 13 ASN A CG   8  
ATOM 7163  O OD1  . ASN A 1 13 ? 5.486   3.354   -9.633  1.00 0.00 ? 13 ASN A OD1  8  
ATOM 7164  N ND2  . ASN A 1 13 ? 3.549   2.218   -9.665  1.00 0.00 ? 13 ASN A ND2  8  
ATOM 7165  H H    . ASN A 1 13 ? 2.883   0.640   -6.664  1.00 0.00 ? 13 ASN A H    8  
ATOM 7166  H HA   . ASN A 1 13 ? 5.682   0.917   -7.530  1.00 0.00 ? 13 ASN A HA   8  
ATOM 7167  H HB2  . ASN A 1 13 ? 3.565   3.040   -7.181  1.00 0.00 ? 13 ASN A HB2  8  
ATOM 7168  H HB3  . ASN A 1 13 ? 5.282   3.427   -7.140  1.00 0.00 ? 13 ASN A HB3  8  
ATOM 7169  H HD21 . ASN A 1 13 ? 2.852   1.792   -9.124  1.00 0.00 ? 13 ASN A HD21 8  
ATOM 7170  H HD22 . ASN A 1 13 ? 3.538   2.242   -10.645 1.00 0.00 ? 13 ASN A HD22 8  
ATOM 7171  N N    . PRO A 1 14 ? 5.398   0.230   -4.884  1.00 0.00 ? 14 PRO A N    8  
ATOM 7172  C CA   . PRO A 1 14 ? 5.737   0.095   -3.484  1.00 0.00 ? 14 PRO A CA   8  
ATOM 7173  C C    . PRO A 1 14 ? 6.378   1.339   -2.892  1.00 0.00 ? 14 PRO A C    8  
ATOM 7174  O O    . PRO A 1 14 ? 7.600   1.483   -2.910  1.00 0.00 ? 14 PRO A O    8  
ATOM 7175  C CB   . PRO A 1 14 ? 6.720   -1.080  -3.509  1.00 0.00 ? 14 PRO A CB   8  
ATOM 7176  C CG   . PRO A 1 14 ? 6.404   -1.846  -4.768  1.00 0.00 ? 14 PRO A CG   8  
ATOM 7177  C CD   . PRO A 1 14 ? 5.314   -1.091  -5.494  1.00 0.00 ? 14 PRO A CD   8  
ATOM 7178  H HA   . PRO A 1 14 ? 4.876   -0.174  -2.895  1.00 0.00 ? 14 PRO A HA   8  
ATOM 7179  H HB2  . PRO A 1 14 ? 7.732   -0.701  -3.523  1.00 0.00 ? 14 PRO A HB2  8  
ATOM 7180  H HB3  . PRO A 1 14 ? 6.573   -1.691  -2.632  1.00 0.00 ? 14 PRO A HB3  8  
ATOM 7181  H HG2  . PRO A 1 14 ? 7.284   -1.905  -5.387  1.00 0.00 ? 14 PRO A HG2  8  
ATOM 7182  H HG3  . PRO A 1 14 ? 6.065   -2.836  -4.514  1.00 0.00 ? 14 PRO A HG3  8  
ATOM 7183  H HD2  . PRO A 1 14 ? 5.518   -1.048  -6.551  1.00 0.00 ? 14 PRO A HD2  8  
ATOM 7184  H HD3  . PRO A 1 14 ? 4.349   -1.543  -5.307  1.00 0.00 ? 14 PRO A HD3  8  
ATOM 7185  N N    . CYS A 1 15 ? 5.523   2.219   -2.356  1.00 0.00 ? 15 CYS A N    8  
ATOM 7186  C CA   . CYS A 1 15 ? 5.944   3.467   -1.721  1.00 0.00 ? 15 CYS A CA   8  
ATOM 7187  C C    . CYS A 1 15 ? 7.456   3.643   -1.730  1.00 0.00 ? 15 CYS A C    8  
ATOM 7188  O O    . CYS A 1 15 ? 8.101   3.593   -0.684  1.00 0.00 ? 15 CYS A O    8  
ATOM 7189  C CB   . CYS A 1 15 ? 5.422   3.525   -0.282  1.00 0.00 ? 15 CYS A CB   8  
ATOM 7190  S SG   . CYS A 1 15 ? 4.567   5.078   0.137   1.00 0.00 ? 15 CYS A SG   8  
ATOM 7191  H H    . CYS A 1 15 ? 4.566   2.013   -2.380  1.00 0.00 ? 15 CYS A H    8  
ATOM 7192  H HA   . CYS A 1 15 ? 5.502   4.279   -2.278  1.00 0.00 ? 15 CYS A HA   8  
ATOM 7193  H HB2  . CYS A 1 15 ? 4.724   2.714   -0.127  1.00 0.00 ? 15 CYS A HB2  8  
ATOM 7194  H HB3  . CYS A 1 15 ? 6.253   3.409   0.399   1.00 0.00 ? 15 CYS A HB3  8  
ATOM 7195  N N    . CYS A 1 16 ? 7.989   3.884   -2.928  1.00 0.00 ? 16 CYS A N    8  
ATOM 7196  C CA   . CYS A 1 16 ? 9.419   4.121   -3.145  1.00 0.00 ? 16 CYS A CA   8  
ATOM 7197  C C    . CYS A 1 16 ? 10.082  2.951   -3.862  1.00 0.00 ? 16 CYS A C    8  
ATOM 7198  O O    . CYS A 1 16 ? 10.142  1.834   -3.350  1.00 0.00 ? 16 CYS A O    8  
ATOM 7199  C CB   . CYS A 1 16 ? 10.158  4.456   -1.843  1.00 0.00 ? 16 CYS A CB   8  
ATOM 7200  S SG   . CYS A 1 16 ? 9.524   5.932   -0.957  1.00 0.00 ? 16 CYS A SG   8  
ATOM 7201  H H    . CYS A 1 16 ? 7.385   3.936   -3.706  1.00 0.00 ? 16 CYS A H    8  
ATOM 7202  H HA   . CYS A 1 16 ? 9.492   4.969   -3.792  1.00 0.00 ? 16 CYS A HA   8  
ATOM 7203  H HB2  . CYS A 1 16 ? 10.091  3.615   -1.172  1.00 0.00 ? 16 CYS A HB2  8  
ATOM 7204  H HB3  . CYS A 1 16 ? 11.198  4.637   -2.073  1.00 0.00 ? 16 CYS A HB3  8  
ATOM 7205  N N    . ASP A 1 17 ? 10.573  3.235   -5.066  1.00 0.00 ? 17 ASP A N    8  
ATOM 7206  C CA   . ASP A 1 17 ? 11.238  2.241   -5.899  1.00 0.00 ? 17 ASP A CA   8  
ATOM 7207  C C    . ASP A 1 17 ? 11.884  2.923   -7.101  1.00 0.00 ? 17 ASP A C    8  
ATOM 7208  O O    . ASP A 1 17 ? 11.265  3.029   -8.160  1.00 0.00 ? 17 ASP A O    8  
ATOM 7209  C CB   . ASP A 1 17 ? 10.234  1.188   -6.370  1.00 0.00 ? 17 ASP A CB   8  
ATOM 7210  C CG   . ASP A 1 17 ? 9.013   1.806   -7.022  1.00 0.00 ? 17 ASP A CG   8  
ATOM 7211  O OD1  . ASP A 1 17 ? 8.326   2.608   -6.356  1.00 0.00 ? 17 ASP A OD1  8  
ATOM 7212  O OD2  . ASP A 1 17 ? 8.744   1.489   -8.200  1.00 0.00 ? 17 ASP A OD2  8  
ATOM 7213  H H    . ASP A 1 17 ? 10.482  4.148   -5.409  1.00 0.00 ? 17 ASP A H    8  
ATOM 7214  H HA   . ASP A 1 17 ? 12.005  1.765   -5.308  1.00 0.00 ? 17 ASP A HA   8  
ATOM 7215  H HB2  . ASP A 1 17 ? 10.712  0.539   -7.087  1.00 0.00 ? 17 ASP A HB2  8  
ATOM 7216  H HB3  . ASP A 1 17 ? 9.909   0.604   -5.522  1.00 0.00 ? 17 ASP A HB3  8  
ATOM 7217  N N    . ALA A 1 18 ? 13.124  3.390   -6.919  1.00 0.00 ? 18 ALA A N    8  
ATOM 7218  C CA   . ALA A 1 18 ? 13.870  4.080   -7.969  1.00 0.00 ? 18 ALA A CA   8  
ATOM 7219  C C    . ALA A 1 18 ? 13.369  3.696   -9.349  1.00 0.00 ? 18 ALA A C    8  
ATOM 7220  O O    . ALA A 1 18 ? 13.183  4.547   -10.218 1.00 0.00 ? 18 ALA A O    8  
ATOM 7221  C CB   . ALA A 1 18 ? 15.355  3.777   -7.843  1.00 0.00 ? 18 ALA A CB   8  
ATOM 7222  H H    . ALA A 1 18 ? 13.547  3.269   -6.051  1.00 0.00 ? 18 ALA A H    8  
ATOM 7223  H HA   . ALA A 1 18 ? 13.733  5.143   -7.831  1.00 0.00 ? 18 ALA A HA   8  
ATOM 7224  H HB1  . ALA A 1 18 ? 15.535  3.233   -6.928  1.00 0.00 ? 18 ALA A HB1  8  
ATOM 7225  H HB2  . ALA A 1 18 ? 15.912  4.702   -7.828  1.00 0.00 ? 18 ALA A HB2  8  
ATOM 7226  H HB3  . ALA A 1 18 ? 15.673  3.179   -8.685  1.00 0.00 ? 18 ALA A HB3  8  
ATOM 7227  N N    . ALA A 1 19 ? 13.154  2.405   -9.539  1.00 0.00 ? 19 ALA A N    8  
ATOM 7228  C CA   . ALA A 1 19 ? 12.673  1.900   -10.813 1.00 0.00 ? 19 ALA A CA   8  
ATOM 7229  C C    . ALA A 1 19 ? 12.237  0.437   -10.721 1.00 0.00 ? 19 ALA A C    8  
ATOM 7230  O O    . ALA A 1 19 ? 12.126  -0.247  -11.738 1.00 0.00 ? 19 ALA A O    8  
ATOM 7231  C CB   . ALA A 1 19 ? 13.762  2.064   -11.853 1.00 0.00 ? 19 ALA A CB   8  
ATOM 7232  H H    . ALA A 1 19 ? 13.329  1.783   -8.806  1.00 0.00 ? 19 ALA A H    8  
ATOM 7233  H HA   . ALA A 1 19 ? 11.828  2.500   -11.115 1.00 0.00 ? 19 ALA A HA   8  
ATOM 7234  H HB1  . ALA A 1 19 ? 13.961  1.112   -12.319 1.00 0.00 ? 19 ALA A HB1  8  
ATOM 7235  H HB2  . ALA A 1 19 ? 14.661  2.426   -11.373 1.00 0.00 ? 19 ALA A HB2  8  
ATOM 7236  H HB3  . ALA A 1 19 ? 13.442  2.774   -12.599 1.00 0.00 ? 19 ALA A HB3  8  
ATOM 7237  N N    . THR A 1 20 ? 11.990  -0.039  -9.504  1.00 0.00 ? 20 THR A N    8  
ATOM 7238  C CA   . THR A 1 20 ? 11.567  -1.418  -9.296  1.00 0.00 ? 20 THR A CA   8  
ATOM 7239  C C    . THR A 1 20 ? 11.185  -1.648  -7.839  1.00 0.00 ? 20 THR A C    8  
ATOM 7240  O O    . THR A 1 20 ? 11.880  -1.188  -6.934  1.00 0.00 ? 20 THR A O    8  
ATOM 7241  C CB   . THR A 1 20 ? 12.681  -2.383  -9.702  1.00 0.00 ? 20 THR A CB   8  
ATOM 7242  O OG1  . THR A 1 20 ? 13.951  -1.853  -9.367  1.00 0.00 ? 20 THR A OG1  8  
ATOM 7243  C CG2  . THR A 1 20 ? 12.689  -2.695  -11.183 1.00 0.00 ? 20 THR A CG2  8  
ATOM 7244  H H    . THR A 1 20 ? 12.084  0.550   -8.728  1.00 0.00 ? 20 THR A H    8  
ATOM 7245  H HA   . THR A 1 20 ? 10.701  -1.597  -9.916  1.00 0.00 ? 20 THR A HA   8  
ATOM 7246  H HB   . THR A 1 20 ? 12.549  -3.313  -9.169  1.00 0.00 ? 20 THR A HB   8  
ATOM 7247  H HG1  . THR A 1 20 ? 13.871  -1.301  -8.585  1.00 0.00 ? 20 THR A HG1  8  
ATOM 7248  H HG21 . THR A 1 20 ? 12.992  -3.721  -11.332 1.00 0.00 ? 20 THR A HG21 8  
ATOM 7249  H HG22 . THR A 1 20 ? 13.383  -2.038  -11.685 1.00 0.00 ? 20 THR A HG22 8  
ATOM 7250  H HG23 . THR A 1 20 ? 11.698  -2.550  -11.587 1.00 0.00 ? 20 THR A HG23 8  
ATOM 7251  N N    . CYS A 1 21 ? 10.088  -2.366  -7.617  1.00 0.00 ? 21 CYS A N    8  
ATOM 7252  C CA   . CYS A 1 21 ? 9.627   -2.659  -6.266  1.00 0.00 ? 21 CYS A CA   8  
ATOM 7253  C C    . CYS A 1 21 ? 10.808  -2.840  -5.311  1.00 0.00 ? 21 CYS A C    8  
ATOM 7254  O O    . CYS A 1 21 ? 11.328  -3.944  -5.152  1.00 0.00 ? 21 CYS A O    8  
ATOM 7255  C CB   . CYS A 1 21 ? 8.751   -3.916  -6.278  1.00 0.00 ? 21 CYS A CB   8  
ATOM 7256  S SG   . CYS A 1 21 ? 7.159   -3.702  -7.141  1.00 0.00 ? 21 CYS A SG   8  
ATOM 7257  H H    . CYS A 1 21 ? 9.575   -2.712  -8.379  1.00 0.00 ? 21 CYS A H    8  
ATOM 7258  H HA   . CYS A 1 21 ? 9.037   -1.821  -5.931  1.00 0.00 ? 21 CYS A HA   8  
ATOM 7259  H HB2  . CYS A 1 21 ? 9.286   -4.713  -6.773  1.00 0.00 ? 21 CYS A HB2  8  
ATOM 7260  H HB3  . CYS A 1 21 ? 8.537   -4.212  -5.264  1.00 0.00 ? 21 CYS A HB3  8  
ATOM 7261  N N    . LYS A 1 22 ? 11.224  -1.743  -4.676  1.00 0.00 ? 22 LYS A N    8  
ATOM 7262  C CA   . LYS A 1 22 ? 12.340  -1.774  -3.734  1.00 0.00 ? 22 LYS A CA   8  
ATOM 7263  C C    . LYS A 1 22 ? 12.467  -0.444  -2.989  1.00 0.00 ? 22 LYS A C    8  
ATOM 7264  O O    . LYS A 1 22 ? 12.241  0.622   -3.562  1.00 0.00 ? 22 LYS A O    8  
ATOM 7265  C CB   . LYS A 1 22 ? 13.645  -2.085  -4.470  1.00 0.00 ? 22 LYS A CB   8  
ATOM 7266  C CG   . LYS A 1 22 ? 14.267  -3.414  -4.072  1.00 0.00 ? 22 LYS A CG   8  
ATOM 7267  C CD   . LYS A 1 22 ? 15.388  -3.809  -5.020  1.00 0.00 ? 22 LYS A CD   8  
ATOM 7268  C CE   . LYS A 1 22 ? 16.740  -3.332  -4.513  1.00 0.00 ? 22 LYS A CE   8  
ATOM 7269  N NZ   . LYS A 1 22 ? 17.286  -2.224  -5.344  1.00 0.00 ? 22 LYS A NZ   8  
ATOM 7270  H H    . LYS A 1 22 ? 10.767  -0.894  -4.845  1.00 0.00 ? 22 LYS A H    8  
ATOM 7271  H HA   . LYS A 1 22 ? 12.146  -2.557  -3.016  1.00 0.00 ? 22 LYS A HA   8  
ATOM 7272  H HB2  . LYS A 1 22 ? 13.449  -2.107  -5.532  1.00 0.00 ? 22 LYS A HB2  8  
ATOM 7273  H HB3  . LYS A 1 22 ? 14.358  -1.302  -4.261  1.00 0.00 ? 22 LYS A HB3  8  
ATOM 7274  H HG2  . LYS A 1 22 ? 14.667  -3.329  -3.073  1.00 0.00 ? 22 LYS A HG2  8  
ATOM 7275  H HG3  . LYS A 1 22 ? 13.504  -4.178  -4.093  1.00 0.00 ? 22 LYS A HG3  8  
ATOM 7276  H HD2  . LYS A 1 22 ? 15.408  -4.885  -5.110  1.00 0.00 ? 22 LYS A HD2  8  
ATOM 7277  H HD3  . LYS A 1 22 ? 15.200  -3.368  -5.988  1.00 0.00 ? 22 LYS A HD3  8  
ATOM 7278  H HE2  . LYS A 1 22 ? 16.626  -2.985  -3.497  1.00 0.00 ? 22 LYS A HE2  8  
ATOM 7279  H HE3  . LYS A 1 22 ? 17.431  -4.162  -4.534  1.00 0.00 ? 22 LYS A HE3  8  
ATOM 7280  H HZ1  . LYS A 1 22 ? 18.315  -2.153  -5.213  1.00 0.00 ? 22 LYS A HZ1  8  
ATOM 7281  H HZ2  . LYS A 1 22 ? 16.850  -1.322  -5.069  1.00 0.00 ? 22 LYS A HZ2  8  
ATOM 7282  H HZ3  . LYS A 1 22 ? 17.086  -2.400  -6.350  1.00 0.00 ? 22 LYS A HZ3  8  
ATOM 7283  N N    . LEU A 1 23 ? 12.839  -0.512  -1.712  1.00 0.00 ? 23 LEU A N    8  
ATOM 7284  C CA   . LEU A 1 23 ? 13.006  0.689   -0.893  1.00 0.00 ? 23 LEU A CA   8  
ATOM 7285  C C    . LEU A 1 23 ? 13.666  0.361   0.442   1.00 0.00 ? 23 LEU A C    8  
ATOM 7286  O O    . LEU A 1 23 ? 13.291  -0.599  1.114   1.00 0.00 ? 23 LEU A O    8  
ATOM 7287  C CB   . LEU A 1 23 ? 11.661  1.392   -0.653  1.00 0.00 ? 23 LEU A CB   8  
ATOM 7288  C CG   . LEU A 1 23 ? 10.588  0.584   0.084   1.00 0.00 ? 23 LEU A CG   8  
ATOM 7289  C CD1  . LEU A 1 23 ? 9.206   1.122   -0.251  1.00 0.00 ? 23 LEU A CD1  8  
ATOM 7290  C CD2  . LEU A 1 23 ? 10.680  -0.892  -0.264  1.00 0.00 ? 23 LEU A CD2  8  
ATOM 7291  H H    . LEU A 1 23 ? 13.011  -1.390  -1.312  1.00 0.00 ? 23 LEU A H    8  
ATOM 7292  H HA   . LEU A 1 23 ? 13.655  1.361   -1.436  1.00 0.00 ? 23 LEU A HA   8  
ATOM 7293  H HB2  . LEU A 1 23 ? 11.852  2.287   -0.080  1.00 0.00 ? 23 LEU A HB2  8  
ATOM 7294  H HB3  . LEU A 1 23 ? 11.261  1.683   -1.610  1.00 0.00 ? 23 LEU A HB3  8  
ATOM 7295  H HG   . LEU A 1 23 ? 10.734  0.689   1.150   1.00 0.00 ? 23 LEU A HG   8  
ATOM 7296  H HD11 . LEU A 1 23 ? 8.842   1.719   0.572   1.00 0.00 ? 23 LEU A HD11 8  
ATOM 7297  H HD12 . LEU A 1 23 ? 8.530   0.298   -0.425  1.00 0.00 ? 23 LEU A HD12 8  
ATOM 7298  H HD13 . LEU A 1 23 ? 9.264   1.733   -1.140  1.00 0.00 ? 23 LEU A HD13 8  
ATOM 7299  H HD21 . LEU A 1 23 ? 10.724  -1.005  -1.338  1.00 0.00 ? 23 LEU A HD21 8  
ATOM 7300  H HD22 . LEU A 1 23 ? 9.811   -1.406  0.117   1.00 0.00 ? 23 LEU A HD22 8  
ATOM 7301  H HD23 . LEU A 1 23 ? 11.570  -1.313  0.178   1.00 0.00 ? 23 LEU A HD23 8  
ATOM 7302  N N    . ARG A 1 24 ? 14.649  1.172   0.825   1.00 0.00 ? 24 ARG A N    8  
ATOM 7303  C CA   . ARG A 1 24 ? 15.354  0.969   2.086   1.00 0.00 ? 24 ARG A CA   8  
ATOM 7304  C C    . ARG A 1 24 ? 14.364  0.903   3.239   1.00 0.00 ? 24 ARG A C    8  
ATOM 7305  O O    . ARG A 1 24 ? 14.665  0.371   4.308   1.00 0.00 ? 24 ARG A O    8  
ATOM 7306  C CB   . ARG A 1 24 ? 16.365  2.093   2.322   1.00 0.00 ? 24 ARG A CB   8  
ATOM 7307  C CG   . ARG A 1 24 ? 17.539  2.068   1.356   1.00 0.00 ? 24 ARG A CG   8  
ATOM 7308  C CD   . ARG A 1 24 ? 18.867  2.136   2.093   1.00 0.00 ? 24 ARG A CD   8  
ATOM 7309  N NE   . ARG A 1 24 ? 19.946  1.513   1.332   1.00 0.00 ? 24 ARG A NE   8  
ATOM 7310  C CZ   . ARG A 1 24 ? 21.137  1.222   1.847   1.00 0.00 ? 24 ARG A CZ   8  
ATOM 7311  N NH1  . ARG A 1 24 ? 21.397  1.496   3.118   1.00 0.00 ? 24 ARG A NH1  8  
ATOM 7312  N NH2  . ARG A 1 24 ? 22.068  0.656   1.092   1.00 0.00 ? 24 ARG A NH2  8  
ATOM 7313  H H    . ARG A 1 24 ? 14.902  1.924   0.250   1.00 0.00 ? 24 ARG A H    8  
ATOM 7314  H HA   . ARG A 1 24 ? 15.876  0.031   2.024   1.00 0.00 ? 24 ARG A HA   8  
ATOM 7315  H HB2  . ARG A 1 24 ? 15.861  3.043   2.217   1.00 0.00 ? 24 ARG A HB2  8  
ATOM 7316  H HB3  . ARG A 1 24 ? 16.751  2.009   3.327   1.00 0.00 ? 24 ARG A HB3  8  
ATOM 7317  H HG2  . ARG A 1 24 ? 17.502  1.153   0.785   1.00 0.00 ? 24 ARG A HG2  8  
ATOM 7318  H HG3  . ARG A 1 24 ? 17.462  2.915   0.690   1.00 0.00 ? 24 ARG A HG3  8  
ATOM 7319  H HD2  . ARG A 1 24 ? 19.114  3.172   2.267   1.00 0.00 ? 24 ARG A HD2  8  
ATOM 7320  H HD3  . ARG A 1 24 ? 18.765  1.626   3.040   1.00 0.00 ? 24 ARG A HD3  8  
ATOM 7321  H HE   . ARG A 1 24 ? 19.775  1.302   0.391   1.00 0.00 ? 24 ARG A HE   8  
ATOM 7322  H HH11 . ARG A 1 24 ? 20.697  1.923   3.691   1.00 0.00 ? 24 ARG A HH11 8  
ATOM 7323  H HH12 . ARG A 1 24 ? 22.293  1.276   3.504   1.00 0.00 ? 24 ARG A HH12 8  
ATOM 7324  H HH21 . ARG A 1 24 ? 21.875  0.448   0.133   1.00 0.00 ? 24 ARG A HH21 8  
ATOM 7325  H HH22 . ARG A 1 24 ? 22.963  0.438   1.481   1.00 0.00 ? 24 ARG A HH22 8  
ATOM 7326  N N    . GLN A 1 25 ? 13.177  1.441   3.002   1.00 0.00 ? 25 GLN A N    8  
ATOM 7327  C CA   . GLN A 1 25 ? 12.118  1.446   4.000   1.00 0.00 ? 25 GLN A CA   8  
ATOM 7328  C C    . GLN A 1 25 ? 11.126  0.319   3.714   1.00 0.00 ? 25 GLN A C    8  
ATOM 7329  O O    . GLN A 1 25 ? 11.525  -0.774  3.313   1.00 0.00 ? 25 GLN A O    8  
ATOM 7330  C CB   . GLN A 1 25 ? 11.407  2.801   4.007   1.00 0.00 ? 25 GLN A CB   8  
ATOM 7331  C CG   . GLN A 1 25 ? 12.356  3.987   4.058   1.00 0.00 ? 25 GLN A CG   8  
ATOM 7332  C CD   . GLN A 1 25 ? 12.465  4.588   5.445   1.00 0.00 ? 25 GLN A CD   8  
ATOM 7333  O OE1  . GLN A 1 25 ? 11.519  5.196   5.947   1.00 0.00 ? 25 GLN A OE1  8  
ATOM 7334  N NE2  . GLN A 1 25 ? 13.622  4.421   6.074   1.00 0.00 ? 25 GLN A NE2  8  
ATOM 7335  H H    . GLN A 1 25 ? 13.007  1.839   2.125   1.00 0.00 ? 25 GLN A H    8  
ATOM 7336  H HA   . GLN A 1 25 ? 12.570  1.277   4.967   1.00 0.00 ? 25 GLN A HA   8  
ATOM 7337  H HB2  . GLN A 1 25 ? 10.808  2.885   3.112   1.00 0.00 ? 25 GLN A HB2  8  
ATOM 7338  H HB3  . GLN A 1 25 ? 10.758  2.850   4.869   1.00 0.00 ? 25 GLN A HB3  8  
ATOM 7339  H HG2  . GLN A 1 25 ? 13.337  3.660   3.747   1.00 0.00 ? 25 GLN A HG2  8  
ATOM 7340  H HG3  . GLN A 1 25 ? 11.999  4.747   3.379   1.00 0.00 ? 25 GLN A HG3  8  
ATOM 7341  H HE21 . GLN A 1 25 ? 14.332  3.926   5.613   1.00 0.00 ? 25 GLN A HE21 8  
ATOM 7342  H HE22 . GLN A 1 25 ? 13.720  4.799   6.973   1.00 0.00 ? 25 GLN A HE22 8  
ATOM 7343  N N    . GLY A 1 26 ? 9.837   0.581   3.915   1.00 0.00 ? 26 GLY A N    8  
ATOM 7344  C CA   . GLY A 1 26 ? 8.837   -0.438  3.660   1.00 0.00 ? 26 GLY A CA   8  
ATOM 7345  C C    . GLY A 1 26 ? 7.513   0.145   3.208   1.00 0.00 ? 26 GLY A C    8  
ATOM 7346  O O    . GLY A 1 26 ? 6.738   0.651   4.019   1.00 0.00 ? 26 GLY A O    8  
ATOM 7347  H H    . GLY A 1 26 ? 9.562   1.465   4.233   1.00 0.00 ? 26 GLY A H    8  
ATOM 7348  H HA2  . GLY A 1 26 ? 9.206   -1.099  2.889   1.00 0.00 ? 26 GLY A HA2  8  
ATOM 7349  H HA3  . GLY A 1 26 ? 8.680   -1.006  4.562   1.00 0.00 ? 26 GLY A HA3  8  
ATOM 7350  N N    . ALA A 1 27 ? 7.257   0.072   1.908   1.00 0.00 ? 27 ALA A N    8  
ATOM 7351  C CA   . ALA A 1 27 ? 6.024   0.595   1.334   1.00 0.00 ? 27 ALA A CA   8  
ATOM 7352  C C    . ALA A 1 27 ? 4.844   -0.351  1.553   1.00 0.00 ? 27 ALA A C    8  
ATOM 7353  O O    . ALA A 1 27 ? 3.759   -0.131  1.016   1.00 0.00 ? 27 ALA A O    8  
ATOM 7354  C CB   . ALA A 1 27 ? 6.216   0.841   -0.148  1.00 0.00 ? 27 ALA A CB   8  
ATOM 7355  H H    . ALA A 1 27 ? 7.918   -0.343  1.316   1.00 0.00 ? 27 ALA A H    8  
ATOM 7356  H HA   . ALA A 1 27 ? 5.812   1.542   1.807   1.00 0.00 ? 27 ALA A HA   8  
ATOM 7357  H HB1  . ALA A 1 27 ? 6.686   -0.019  -0.597  1.00 0.00 ? 27 ALA A HB1  8  
ATOM 7358  H HB2  . ALA A 1 27 ? 6.843   1.709   -0.291  1.00 0.00 ? 27 ALA A HB2  8  
ATOM 7359  H HB3  . ALA A 1 27 ? 5.255   1.006   -0.607  1.00 0.00 ? 27 ALA A HB3  8  
ATOM 7360  N N    . GLN A 1 28 ? 5.077   -1.400  2.336   1.00 0.00 ? 28 GLN A N    8  
ATOM 7361  C CA   . GLN A 1 28 ? 4.061   -2.410  2.645   1.00 0.00 ? 28 GLN A CA   8  
ATOM 7362  C C    . GLN A 1 28 ? 2.634   -1.917  2.396   1.00 0.00 ? 28 GLN A C    8  
ATOM 7363  O O    . GLN A 1 28 ? 2.019   -2.218  1.373   1.00 0.00 ? 28 GLN A O    8  
ATOM 7364  C CB   . GLN A 1 28 ? 4.203   -2.832  4.108   1.00 0.00 ? 28 GLN A CB   8  
ATOM 7365  C CG   . GLN A 1 28 ? 5.560   -3.412  4.449   1.00 0.00 ? 28 GLN A CG   8  
ATOM 7366  C CD   . GLN A 1 28 ? 6.088   -2.918  5.782   1.00 0.00 ? 28 GLN A CD   8  
ATOM 7367  O OE1  . GLN A 1 28 ? 5.687   -1.860  6.268   1.00 0.00 ? 28 GLN A OE1  8  
ATOM 7368  N NE2  . GLN A 1 28 ? 6.994   -3.683  6.379   1.00 0.00 ? 28 GLN A NE2  8  
ATOM 7369  H H    . GLN A 1 28 ? 5.970   -1.506  2.722   1.00 0.00 ? 28 GLN A H    8  
ATOM 7370  H HA   . GLN A 1 28 ? 4.248   -3.262  2.016   1.00 0.00 ? 28 GLN A HA   8  
ATOM 7371  H HB2  . GLN A 1 28 ? 4.044   -1.970  4.737   1.00 0.00 ? 28 GLN A HB2  8  
ATOM 7372  H HB3  . GLN A 1 28 ? 3.454   -3.569  4.332   1.00 0.00 ? 28 GLN A HB3  8  
ATOM 7373  H HG2  . GLN A 1 28 ? 5.479   -4.488  4.490   1.00 0.00 ? 28 GLN A HG2  8  
ATOM 7374  H HG3  . GLN A 1 28 ? 6.261   -3.134  3.676   1.00 0.00 ? 28 GLN A HG3  8  
ATOM 7375  H HE21 . GLN A 1 28 ? 7.267   -4.512  5.933   1.00 0.00 ? 28 GLN A HE21 8  
ATOM 7376  H HE22 . GLN A 1 28 ? 7.353   -3.388  7.242   1.00 0.00 ? 28 GLN A HE22 8  
ATOM 7377  N N    . CYS A 1 29 ? 2.127   -1.157  3.347   1.00 0.00 ? 29 CYS A N    8  
ATOM 7378  C CA   . CYS A 1 29 ? 0.789   -0.591  3.281   1.00 0.00 ? 29 CYS A CA   8  
ATOM 7379  C C    . CYS A 1 29 ? 0.890   0.893   3.586   1.00 0.00 ? 29 CYS A C    8  
ATOM 7380  O O    . CYS A 1 29 ? 0.045   1.471   4.269   1.00 0.00 ? 29 CYS A O    8  
ATOM 7381  C CB   . CYS A 1 29 ? -0.140  -1.277  4.286   1.00 0.00 ? 29 CYS A CB   8  
ATOM 7382  S SG   . CYS A 1 29 ? -0.663  -2.953  3.795   1.00 0.00 ? 29 CYS A SG   8  
ATOM 7383  H H    . CYS A 1 29 ? 2.677   -0.957  4.120   1.00 0.00 ? 29 CYS A H    8  
ATOM 7384  H HA   . CYS A 1 29 ? 0.408   -0.733  2.281   1.00 0.00 ? 29 CYS A HA   8  
ATOM 7385  H HB2  . CYS A 1 29 ? 0.367   -1.358  5.236   1.00 0.00 ? 29 CYS A HB2  8  
ATOM 7386  H HB3  . CYS A 1 29 ? -1.030  -0.677  4.409   1.00 0.00 ? 29 CYS A HB3  8  
ATOM 7387  N N    . ALA A 1 30 ? 1.961   1.487   3.079   1.00 0.00 ? 30 ALA A N    8  
ATOM 7388  C CA   . ALA A 1 30 ? 2.241   2.908   3.288   1.00 0.00 ? 30 ALA A CA   8  
ATOM 7389  C C    . ALA A 1 30 ? 1.088   3.761   2.784   1.00 0.00 ? 30 ALA A C    8  
ATOM 7390  O O    . ALA A 1 30 ? -0.071  3.366   2.914   1.00 0.00 ? 30 ALA A O    8  
ATOM 7391  C CB   . ALA A 1 30 ? 3.542   3.291   2.597   1.00 0.00 ? 30 ALA A CB   8  
ATOM 7392  H H    . ALA A 1 30 ? 2.587   0.942   2.550   1.00 0.00 ? 30 ALA A H    8  
ATOM 7393  H HA   . ALA A 1 30 ? 2.361   3.072   4.349   1.00 0.00 ? 30 ALA A HA   8  
ATOM 7394  H HB1  . ALA A 1 30 ? 3.856   4.267   2.935   1.00 0.00 ? 30 ALA A HB1  8  
ATOM 7395  H HB2  . ALA A 1 30 ? 3.388   3.313   1.528   1.00 0.00 ? 30 ALA A HB2  8  
ATOM 7396  H HB3  . ALA A 1 30 ? 4.304   2.565   2.836   1.00 0.00 ? 30 ALA A HB3  8  
ATOM 7397  N N    . GLU A 1 31 ? 1.395   4.919   2.183   1.00 0.00 ? 31 GLU A N    8  
ATOM 7398  C CA   . GLU A 1 31 ? 0.348   5.781   1.639   1.00 0.00 ? 31 GLU A CA   8  
ATOM 7399  C C    . GLU A 1 31 ? -0.713  4.901   1.004   1.00 0.00 ? 31 GLU A C    8  
ATOM 7400  O O    . GLU A 1 31 ? -1.903  5.202   1.022   1.00 0.00 ? 31 GLU A O    8  
ATOM 7401  C CB   . GLU A 1 31 ? 0.927   6.740   0.597   1.00 0.00 ? 31 GLU A CB   8  
ATOM 7402  C CG   . GLU A 1 31 ? 0.058   7.960   0.342   1.00 0.00 ? 31 GLU A CG   8  
ATOM 7403  C CD   . GLU A 1 31 ? 0.379   8.638   -0.975  1.00 0.00 ? 31 GLU A CD   8  
ATOM 7404  O OE1  . GLU A 1 31 ? 0.934   7.966   -1.869  1.00 0.00 ? 31 GLU A OE1  8  
ATOM 7405  O OE2  . GLU A 1 31 ? 0.075   9.842   -1.113  1.00 0.00 ? 31 GLU A OE2  8  
ATOM 7406  H H    . GLU A 1 31 ? 2.333   5.182   2.086   1.00 0.00 ? 31 GLU A H    8  
ATOM 7407  H HA   . GLU A 1 31 ? -0.090  6.344   2.452   1.00 0.00 ? 31 GLU A HA   8  
ATOM 7408  H HB2  . GLU A 1 31 ? 1.895   7.078   0.934   1.00 0.00 ? 31 GLU A HB2  8  
ATOM 7409  H HB3  . GLU A 1 31 ? 1.047   6.209   -0.337  1.00 0.00 ? 31 GLU A HB3  8  
ATOM 7410  H HG2  . GLU A 1 31 ? -0.977  7.652   0.328   1.00 0.00 ? 31 GLU A HG2  8  
ATOM 7411  H HG3  . GLU A 1 31 ? 0.211   8.670   1.142   1.00 0.00 ? 31 GLU A HG3  8  
ATOM 7412  N N    . GLY A 1 32 ? -0.234  3.785   0.477   1.00 0.00 ? 32 GLY A N    8  
ATOM 7413  C CA   . GLY A 1 32 ? -1.075  2.792   -0.143  1.00 0.00 ? 32 GLY A CA   8  
ATOM 7414  C C    . GLY A 1 32 ? -0.405  1.438   -0.077  1.00 0.00 ? 32 GLY A C    8  
ATOM 7415  O O    . GLY A 1 32 ? 0.453   1.218   0.778   1.00 0.00 ? 32 GLY A O    8  
ATOM 7416  H H    . GLY A 1 32 ? 0.730   3.620   0.528   1.00 0.00 ? 32 GLY A H    8  
ATOM 7417  H HA2  . GLY A 1 32 ? -2.014  2.746   0.384   1.00 0.00 ? 32 GLY A HA2  8  
ATOM 7418  H HA3  . GLY A 1 32 ? -1.252  3.055   -1.171  1.00 0.00 ? 32 GLY A HA3  8  
ATOM 7419  N N    . LEU A 1 33 ? -0.783  0.522   -0.950  1.00 0.00 ? 33 LEU A N    8  
ATOM 7420  C CA   . LEU A 1 33 ? -0.181  -0.806  -0.924  1.00 0.00 ? 33 LEU A CA   8  
ATOM 7421  C C    . LEU A 1 33 ? 1.269   -0.811  -1.442  1.00 0.00 ? 33 LEU A C    8  
ATOM 7422  O O    . LEU A 1 33 ? 1.838   0.237   -1.746  1.00 0.00 ? 33 LEU A O    8  
ATOM 7423  C CB   . LEU A 1 33 ? -1.029  -1.797  -1.717  1.00 0.00 ? 33 LEU A CB   8  
ATOM 7424  C CG   . LEU A 1 33 ? -1.459  -3.045  -0.942  1.00 0.00 ? 33 LEU A CG   8  
ATOM 7425  C CD1  . LEU A 1 33 ? -0.424  -4.141  -1.077  1.00 0.00 ? 33 LEU A CD1  8  
ATOM 7426  C CD2  . LEU A 1 33 ? -1.691  -2.716  0.526   1.00 0.00 ? 33 LEU A CD2  8  
ATOM 7427  H H    . LEU A 1 33 ? -1.485  0.734   -1.608  1.00 0.00 ? 33 LEU A H    8  
ATOM 7428  H HA   . LEU A 1 33 ? -0.168  -1.106  0.106   1.00 0.00 ? 33 LEU A HA   8  
ATOM 7429  H HB2  . LEU A 1 33 ? -1.918  -1.285  -2.057  1.00 0.00 ? 33 LEU A HB2  8  
ATOM 7430  H HB3  . LEU A 1 33 ? -0.464  -2.114  -2.580  1.00 0.00 ? 33 LEU A HB3  8  
ATOM 7431  H HG   . LEU A 1 33 ? -2.380  -3.412  -1.355  1.00 0.00 ? 33 LEU A HG   8  
ATOM 7432  H HD11 . LEU A 1 33 ? -0.914  -5.100  -1.118  1.00 0.00 ? 33 LEU A HD11 8  
ATOM 7433  H HD12 . LEU A 1 33 ? 0.242   -4.111  -0.226  1.00 0.00 ? 33 LEU A HD12 8  
ATOM 7434  H HD13 . LEU A 1 33 ? 0.143   -3.984  -1.982  1.00 0.00 ? 33 LEU A HD13 8  
ATOM 7435  H HD21 . LEU A 1 33 ? -0.845  -3.052  1.109   1.00 0.00 ? 33 LEU A HD21 8  
ATOM 7436  H HD22 . LEU A 1 33 ? -2.583  -3.211  0.870   1.00 0.00 ? 33 LEU A HD22 8  
ATOM 7437  H HD23 . LEU A 1 33 ? -1.805  -1.649  0.643   1.00 0.00 ? 33 LEU A HD23 8  
ATOM 7438  N N    . CYS A 1 34 ? 1.858   -2.014  -1.518  1.00 0.00 ? 34 CYS A N    8  
ATOM 7439  C CA   . CYS A 1 34 ? 3.237   -2.201  -1.975  1.00 0.00 ? 34 CYS A CA   8  
ATOM 7440  C C    . CYS A 1 34 ? 3.364   -3.448  -2.849  1.00 0.00 ? 34 CYS A C    8  
ATOM 7441  O O    . CYS A 1 34 ? 2.367   -4.078  -3.201  1.00 0.00 ? 34 CYS A O    8  
ATOM 7442  C CB   . CYS A 1 34 ? 4.181   -2.290  -0.759  1.00 0.00 ? 34 CYS A CB   8  
ATOM 7443  S SG   . CYS A 1 34 ? 4.942   -3.920  -0.424  1.00 0.00 ? 34 CYS A SG   8  
ATOM 7444  H H    . CYS A 1 34 ? 1.353   -2.794  -1.251  1.00 0.00 ? 34 CYS A H    8  
ATOM 7445  H HA   . CYS A 1 34 ? 3.505   -1.339  -2.563  1.00 0.00 ? 34 CYS A HA   8  
ATOM 7446  H HB2  . CYS A 1 34 ? 4.984   -1.596  -0.899  1.00 0.00 ? 34 CYS A HB2  8  
ATOM 7447  H HB3  . CYS A 1 34 ? 3.625   -2.016  0.119   1.00 0.00 ? 34 CYS A HB3  8  
ATOM 7448  N N    . CYS A 1 35 ? 4.603   -3.801  -3.185  1.00 0.00 ? 35 CYS A N    8  
ATOM 7449  C CA   . CYS A 1 35 ? 4.870   -4.979  -4.008  1.00 0.00 ? 35 CYS A CA   8  
ATOM 7450  C C    . CYS A 1 35 ? 6.233   -5.601  -3.691  1.00 0.00 ? 35 CYS A C    8  
ATOM 7451  O O    . CYS A 1 35 ? 6.415   -6.812  -3.816  1.00 0.00 ? 35 CYS A O    8  
ATOM 7452  C CB   . CYS A 1 35 ? 4.765   -4.620  -5.506  1.00 0.00 ? 35 CYS A CB   8  
ATOM 7453  S SG   . CYS A 1 35 ? 6.072   -5.322  -6.576  1.00 0.00 ? 35 CYS A SG   8  
ATOM 7454  H H    . CYS A 1 35 ? 5.349   -3.259  -2.864  1.00 0.00 ? 35 CYS A H    8  
ATOM 7455  H HA   . CYS A 1 35 ? 4.115   -5.701  -3.771  1.00 0.00 ? 35 CYS A HA   8  
ATOM 7456  H HB2  . CYS A 1 35 ? 3.821   -4.977  -5.884  1.00 0.00 ? 35 CYS A HB2  8  
ATOM 7457  H HB3  . CYS A 1 35 ? 4.800   -3.546  -5.614  1.00 0.00 ? 35 CYS A HB3  8  
ATOM 7458  N N    . ASP A 1 36 ? 7.185   -4.768  -3.307  1.00 0.00 ? 36 ASP A N    8  
ATOM 7459  C CA   . ASP A 1 36 ? 8.535   -5.229  -2.999  1.00 0.00 ? 36 ASP A CA   8  
ATOM 7460  C C    . ASP A 1 36 ? 8.608   -5.929  -1.646  1.00 0.00 ? 36 ASP A C    8  
ATOM 7461  O O    . ASP A 1 36 ? 7.590   -6.163  -0.996  1.00 0.00 ? 36 ASP A O    8  
ATOM 7462  C CB   . ASP A 1 36 ? 9.508   -4.050  -3.041  1.00 0.00 ? 36 ASP A CB   8  
ATOM 7463  C CG   . ASP A 1 36 ? 9.592   -3.295  -1.735  1.00 0.00 ? 36 ASP A CG   8  
ATOM 7464  O OD1  . ASP A 1 36 ? 10.256  -3.791  -0.801  1.00 0.00 ? 36 ASP A OD1  8  
ATOM 7465  O OD2  . ASP A 1 36 ? 8.990   -2.205  -1.646  1.00 0.00 ? 36 ASP A OD2  8  
ATOM 7466  H H    . ASP A 1 36 ? 6.983   -3.818  -3.244  1.00 0.00 ? 36 ASP A H    8  
ATOM 7467  H HA   . ASP A 1 36 ? 8.819   -5.935  -3.764  1.00 0.00 ? 36 ASP A HA   8  
ATOM 7468  H HB2  . ASP A 1 36 ? 10.491  -4.413  -3.284  1.00 0.00 ? 36 ASP A HB2  8  
ATOM 7469  H HB3  . ASP A 1 36 ? 9.180   -3.363  -3.800  1.00 0.00 ? 36 ASP A HB3  8  
ATOM 7470  N N    . GLN A 1 37 ? 9.829   -6.267  -1.235  1.00 0.00 ? 37 GLN A N    8  
ATOM 7471  C CA   . GLN A 1 37 ? 10.059  -6.948  0.034   1.00 0.00 ? 37 GLN A CA   8  
ATOM 7472  C C    . GLN A 1 37 ? 9.318   -6.256  1.173   1.00 0.00 ? 37 GLN A C    8  
ATOM 7473  O O    . GLN A 1 37 ? 9.063   -6.865  2.212   1.00 0.00 ? 37 GLN A O    8  
ATOM 7474  C CB   . GLN A 1 37 ? 11.556  -7.002  0.344   1.00 0.00 ? 37 GLN A CB   8  
ATOM 7475  C CG   . GLN A 1 37 ? 12.313  -8.023  -0.489  1.00 0.00 ? 37 GLN A CG   8  
ATOM 7476  C CD   . GLN A 1 37 ? 13.769  -8.142  -0.083  1.00 0.00 ? 37 GLN A CD   8  
ATOM 7477  O OE1  . GLN A 1 37 ? 14.668  -7.752  -0.829  1.00 0.00 ? 37 GLN A OE1  8  
ATOM 7478  N NE2  . GLN A 1 37 ? 14.010  -8.683  1.105   1.00 0.00 ? 37 GLN A NE2  8  
ATOM 7479  H H    . GLN A 1 37 ? 10.597  -6.056  -1.804  1.00 0.00 ? 37 GLN A H    8  
ATOM 7480  H HA   . GLN A 1 37 ? 9.686   -7.955  -0.063  1.00 0.00 ? 37 GLN A HA   8  
ATOM 7481  H HB2  . GLN A 1 37 ? 11.985  -6.028  0.159   1.00 0.00 ? 37 GLN A HB2  8  
ATOM 7482  H HB3  . GLN A 1 37 ? 11.687  -7.251  1.386   1.00 0.00 ? 37 GLN A HB3  8  
ATOM 7483  H HG2  . GLN A 1 37 ? 11.842  -8.987  -0.369  1.00 0.00 ? 37 GLN A HG2  8  
ATOM 7484  H HG3  . GLN A 1 37 ? 12.267  -7.727  -1.527  1.00 0.00 ? 37 GLN A HG3  8  
ATOM 7485  H HE21 . GLN A 1 37 ? 13.246  -8.971  1.646   1.00 0.00 ? 37 GLN A HE21 8  
ATOM 7486  H HE22 . GLN A 1 37 ? 14.943  -8.772  1.393   1.00 0.00 ? 37 GLN A HE22 8  
ATOM 7487  N N    . CYS A 1 38 ? 8.983   -4.982  0.964   1.00 0.00 ? 38 CYS A N    8  
ATOM 7488  C CA   . CYS A 1 38 ? 8.271   -4.185  1.960   1.00 0.00 ? 38 CYS A CA   8  
ATOM 7489  C C    . CYS A 1 38 ? 7.435   -5.070  2.873   1.00 0.00 ? 38 CYS A C    8  
ATOM 7490  O O    . CYS A 1 38 ? 7.513   -4.967  4.096   1.00 0.00 ? 38 CYS A O    8  
ATOM 7491  C CB   . CYS A 1 38 ? 7.366   -3.152  1.270   1.00 0.00 ? 38 CYS A CB   8  
ATOM 7492  S SG   . CYS A 1 38 ? 6.940   -3.558  -0.457  1.00 0.00 ? 38 CYS A SG   8  
ATOM 7493  H H    . CYS A 1 38 ? 9.224   -4.566  0.118   1.00 0.00 ? 38 CYS A H    8  
ATOM 7494  H HA   . CYS A 1 38 ? 9.006   -3.665  2.556   1.00 0.00 ? 38 CYS A HA   8  
ATOM 7495  H HB2  . CYS A 1 38 ? 6.442   -3.067  1.821   1.00 0.00 ? 38 CYS A HB2  8  
ATOM 7496  H HB3  . CYS A 1 38 ? 7.864   -2.193  1.268   1.00 0.00 ? 38 CYS A HB3  8  
ATOM 7497  N N    . ARG A 1 39 ? 6.637   -5.936  2.260   1.00 0.00 ? 39 ARG A N    8  
ATOM 7498  C CA   . ARG A 1 39 ? 5.765   -6.843  3.004   1.00 0.00 ? 39 ARG A CA   8  
ATOM 7499  C C    . ARG A 1 39 ? 4.422   -6.169  3.255   1.00 0.00 ? 39 ARG A C    8  
ATOM 7500  O O    . ARG A 1 39 ? 4.086   -5.201  2.582   1.00 0.00 ? 39 ARG A O    8  
ATOM 7501  C CB   . ARG A 1 39 ? 6.409   -7.255  4.330   1.00 0.00 ? 39 ARG A CB   8  
ATOM 7502  C CG   . ARG A 1 39 ? 6.212   -8.724  4.670   1.00 0.00 ? 39 ARG A CG   8  
ATOM 7503  C CD   . ARG A 1 39 ? 5.352   -8.899  5.911   1.00 0.00 ? 39 ARG A CD   8  
ATOM 7504  N NE   . ARG A 1 39 ? 4.159   -9.697  5.641   1.00 0.00 ? 39 ARG A NE   8  
ATOM 7505  C CZ   . ARG A 1 39 ? 3.415   -10.254 6.591   1.00 0.00 ? 39 ARG A CZ   8  
ATOM 7506  N NH1  . ARG A 1 39 ? 3.741   -10.099 7.867   1.00 0.00 ? 39 ARG A NH1  8  
ATOM 7507  N NH2  . ARG A 1 39 ? 2.345   -10.967 6.265   1.00 0.00 ? 39 ARG A NH2  8  
ATOM 7508  H H    . ARG A 1 39 ? 6.630   -5.960  1.274   1.00 0.00 ? 39 ARG A H    8  
ATOM 7509  H HA   . ARG A 1 39 ? 5.606   -7.723  2.398   1.00 0.00 ? 39 ARG A HA   8  
ATOM 7510  H HB2  . ARG A 1 39 ? 7.470   -7.059  4.278   1.00 0.00 ? 39 ARG A HB2  8  
ATOM 7511  H HB3  . ARG A 1 39 ? 5.980   -6.663  5.126   1.00 0.00 ? 39 ARG A HB3  8  
ATOM 7512  H HG2  . ARG A 1 39 ? 5.730   -9.214  3.838   1.00 0.00 ? 39 ARG A HG2  8  
ATOM 7513  H HG3  . ARG A 1 39 ? 7.178   -9.175  4.845   1.00 0.00 ? 39 ARG A HG3  8  
ATOM 7514  H HD2  . ARG A 1 39 ? 5.938   -9.392  6.673   1.00 0.00 ? 39 ARG A HD2  8  
ATOM 7515  H HD3  . ARG A 1 39 ? 5.050   -7.924  6.265   1.00 0.00 ? 39 ARG A HD3  8  
ATOM 7516  H HE   . ARG A 1 39 ? 3.900   -9.823  4.705   1.00 0.00 ? 39 ARG A HE   8  
ATOM 7517  H HH11 . ARG A 1 39 ? 4.547   -9.562  8.116   1.00 0.00 ? 39 ARG A HH11 8  
ATOM 7518  H HH12 . ARG A 1 39 ? 3.180   -10.519 8.581   1.00 0.00 ? 39 ARG A HH12 8  
ATOM 7519  H HH21 . ARG A 1 39 ? 2.097   -11.085 5.304   1.00 0.00 ? 39 ARG A HH21 8  
ATOM 7520  H HH22 . ARG A 1 39 ? 1.787   -11.386 6.981   1.00 0.00 ? 39 ARG A HH22 8  
ATOM 7521  N N    . PHE A 1 40 ? 3.647   -6.673  4.213   1.00 0.00 ? 40 PHE A N    8  
ATOM 7522  C CA   . PHE A 1 40 ? 2.343   -6.079  4.502   1.00 0.00 ? 40 PHE A CA   8  
ATOM 7523  C C    . PHE A 1 40 ? 1.831   -6.458  5.886   1.00 0.00 ? 40 PHE A C    8  
ATOM 7524  O O    . PHE A 1 40 ? 2.096   -7.551  6.386   1.00 0.00 ? 40 PHE A O    8  
ATOM 7525  C CB   . PHE A 1 40 ? 1.338   -6.490  3.432   1.00 0.00 ? 40 PHE A CB   8  
ATOM 7526  C CG   . PHE A 1 40 ? 1.910   -6.399  2.053   1.00 0.00 ? 40 PHE A CG   8  
ATOM 7527  C CD1  . PHE A 1 40 ? 2.631   -7.453  1.512   1.00 0.00 ? 40 PHE A CD1  8  
ATOM 7528  C CD2  . PHE A 1 40 ? 1.760   -5.243  1.311   1.00 0.00 ? 40 PHE A CD2  8  
ATOM 7529  C CE1  . PHE A 1 40 ? 3.184   -7.352  0.253   1.00 0.00 ? 40 PHE A CE1  8  
ATOM 7530  C CE2  . PHE A 1 40 ? 2.316   -5.137  0.059   1.00 0.00 ? 40 PHE A CE2  8  
ATOM 7531  C CZ   . PHE A 1 40 ? 3.028   -6.191  -0.473  1.00 0.00 ? 40 PHE A CZ   8  
ATOM 7532  H H    . PHE A 1 40 ? 3.951   -7.450  4.726   1.00 0.00 ? 40 PHE A H    8  
ATOM 7533  H HA   . PHE A 1 40 ? 2.459   -5.008  4.461   1.00 0.00 ? 40 PHE A HA   8  
ATOM 7534  H HB2  . PHE A 1 40 ? 1.027   -7.508  3.603   1.00 0.00 ? 40 PHE A HB2  8  
ATOM 7535  H HB3  . PHE A 1 40 ? 0.478   -5.837  3.481   1.00 0.00 ? 40 PHE A HB3  8  
ATOM 7536  H HD1  . PHE A 1 40 ? 2.753   -8.361  2.080   1.00 0.00 ? 40 PHE A HD1  8  
ATOM 7537  H HD2  . PHE A 1 40 ? 1.202   -4.416  1.721   1.00 0.00 ? 40 PHE A HD2  8  
ATOM 7538  H HE1  . PHE A 1 40 ? 3.742   -8.179  -0.161  1.00 0.00 ? 40 PHE A HE1  8  
ATOM 7539  H HE2  . PHE A 1 40 ? 2.193   -4.231  -0.509  1.00 0.00 ? 40 PHE A HE2  8  
ATOM 7540  H HZ   . PHE A 1 40 ? 3.469   -6.101  -1.451  1.00 0.00 ? 40 PHE A HZ   8  
ATOM 7541  N N    . MET A 1 41 ? 1.096   -5.534  6.499   1.00 0.00 ? 41 MET A N    8  
ATOM 7542  C CA   . MET A 1 41 ? 0.538   -5.745  7.828   1.00 0.00 ? 41 MET A CA   8  
ATOM 7543  C C    . MET A 1 41 ? -0.179  -7.087  7.922   1.00 0.00 ? 41 MET A C    8  
ATOM 7544  O O    . MET A 1 41 ? 0.395   -8.066  8.397   1.00 0.00 ? 41 MET A O    8  
ATOM 7545  C CB   . MET A 1 41 ? -0.429  -4.610  8.180   1.00 0.00 ? 41 MET A CB   8  
ATOM 7546  C CG   . MET A 1 41 ? 0.017   -3.781  9.374   1.00 0.00 ? 41 MET A CG   8  
ATOM 7547  S SD   . MET A 1 41 ? 0.038   -4.730  10.908  1.00 0.00 ? 41 MET A SD   8  
ATOM 7548  C CE   . MET A 1 41 ? 1.531   -4.104  11.673  1.00 0.00 ? 41 MET A CE   8  
ATOM 7549  H H    . MET A 1 41 ? 0.927   -4.684  6.045   1.00 0.00 ? 41 MET A H    8  
ATOM 7550  H HA   . MET A 1 41 ? 1.355   -5.737  8.531   1.00 0.00 ? 41 MET A HA   8  
ATOM 7551  H HB2  . MET A 1 41 ? -0.521  -3.954  7.327   1.00 0.00 ? 41 MET A HB2  8  
ATOM 7552  H HB3  . MET A 1 41 ? -1.397  -5.032  8.404   1.00 0.00 ? 41 MET A HB3  8  
ATOM 7553  H HG2  . MET A 1 41 ? 1.012   -3.408  9.185   1.00 0.00 ? 41 MET A HG2  8  
ATOM 7554  H HG3  . MET A 1 41 ? -0.662  -2.949  9.491   1.00 0.00 ? 41 MET A HG3  8  
ATOM 7555  H HE1  . MET A 1 41 ? 1.325   -3.836  12.699  1.00 0.00 ? 41 MET A HE1  8  
ATOM 7556  H HE2  . MET A 1 41 ? 1.873   -3.232  11.135  1.00 0.00 ? 41 MET A HE2  8  
ATOM 7557  H HE3  . MET A 1 41 ? 2.297   -4.866  11.647  1.00 0.00 ? 41 MET A HE3  8  
ATOM 7558  N N    . LYS A 1 42 ? -1.438  -7.106  7.466   1.00 0.00 ? 42 LYS A N    8  
ATOM 7559  C CA   . LYS A 1 42 ? -2.285  -8.304  7.481   1.00 0.00 ? 42 LYS A CA   8  
ATOM 7560  C C    . LYS A 1 42 ? -3.636  -7.991  8.114   1.00 0.00 ? 42 LYS A C    8  
ATOM 7561  O O    . LYS A 1 42 ? -4.577  -8.778  8.019   1.00 0.00 ? 42 LYS A O    8  
ATOM 7562  C CB   . LYS A 1 42 ? -1.628  -9.465  8.232   1.00 0.00 ? 42 LYS A CB   8  
ATOM 7563  C CG   . LYS A 1 42 ? -2.501  -10.707 8.312   1.00 0.00 ? 42 LYS A CG   8  
ATOM 7564  C CD   . LYS A 1 42 ? -2.773  -11.287 6.933   1.00 0.00 ? 42 LYS A CD   8  
ATOM 7565  C CE   . LYS A 1 42 ? -1.914  -12.512 6.666   1.00 0.00 ? 42 LYS A CE   8  
ATOM 7566  N NZ   . LYS A 1 42 ? -2.332  -13.675 7.496   1.00 0.00 ? 42 LYS A NZ   8  
ATOM 7567  H H    . LYS A 1 42 ? -1.815  -6.277  7.104   1.00 0.00 ? 42 LYS A H    8  
ATOM 7568  H HA   . LYS A 1 42 ? -2.447  -8.596  6.457   1.00 0.00 ? 42 LYS A HA   8  
ATOM 7569  H HB2  . LYS A 1 42 ? -0.709  -9.730  7.731   1.00 0.00 ? 42 LYS A HB2  8  
ATOM 7570  H HB3  . LYS A 1 42 ? -1.401  -9.146  9.238   1.00 0.00 ? 42 LYS A HB3  8  
ATOM 7571  H HG2  . LYS A 1 42 ? -1.998  -11.451 8.911   1.00 0.00 ? 42 LYS A HG2  8  
ATOM 7572  H HG3  . LYS A 1 42 ? -3.442  -10.445 8.774   1.00 0.00 ? 42 LYS A HG3  8  
ATOM 7573  H HD2  . LYS A 1 42 ? -3.813  -11.568 6.870   1.00 0.00 ? 42 LYS A HD2  8  
ATOM 7574  H HD3  . LYS A 1 42 ? -2.555  -10.535 6.188   1.00 0.00 ? 42 LYS A HD3  8  
ATOM 7575  H HE2  . LYS A 1 42 ? -2.001  -12.777 5.623   1.00 0.00 ? 42 LYS A HE2  8  
ATOM 7576  H HE3  . LYS A 1 42 ? -0.885  -12.271 6.891   1.00 0.00 ? 42 LYS A HE3  8  
ATOM 7577  H HZ1  . LYS A 1 42 ? -2.714  -14.429 6.889   1.00 0.00 ? 42 LYS A HZ1  8  
ATOM 7578  H HZ2  . LYS A 1 42 ? -3.067  -13.386 8.173   1.00 0.00 ? 42 LYS A HZ2  8  
ATOM 7579  H HZ3  . LYS A 1 42 ? -1.517  -14.049 8.025   1.00 0.00 ? 42 LYS A HZ3  8  
ATOM 7580  N N    . GLU A 1 43 ? -3.722  -6.833  8.759   1.00 0.00 ? 43 GLU A N    8  
ATOM 7581  C CA   . GLU A 1 43 ? -4.954  -6.405  9.409   1.00 0.00 ? 43 GLU A CA   8  
ATOM 7582  C C    . GLU A 1 43 ? -5.334  -4.995  8.970   1.00 0.00 ? 43 GLU A C    8  
ATOM 7583  O O    . GLU A 1 43 ? -4.532  -4.069  9.085   1.00 0.00 ? 43 GLU A O    8  
ATOM 7584  C CB   . GLU A 1 43 ? -4.799  -6.456  10.930  1.00 0.00 ? 43 GLU A CB   8  
ATOM 7585  C CG   . GLU A 1 43 ? -6.085  -6.156  11.683  1.00 0.00 ? 43 GLU A CG   8  
ATOM 7586  C CD   . GLU A 1 43 ? -6.040  -6.621  13.125  1.00 0.00 ? 43 GLU A CD   8  
ATOM 7587  O OE1  . GLU A 1 43 ? -4.925  -6.745  13.675  1.00 0.00 ? 43 GLU A OE1  8  
ATOM 7588  O OE2  . GLU A 1 43 ? -7.120  -6.859  13.706  1.00 0.00 ? 43 GLU A OE2  8  
ATOM 7589  H H    . GLU A 1 43 ? -2.936  -6.250  8.797   1.00 0.00 ? 43 GLU A H    8  
ATOM 7590  H HA   . GLU A 1 43 ? -5.738  -7.085  9.113   1.00 0.00 ? 43 GLU A HA   8  
ATOM 7591  H HB2  . GLU A 1 43 ? -4.464  -7.443  11.213  1.00 0.00 ? 43 GLU A HB2  8  
ATOM 7592  H HB3  . GLU A 1 43 ? -4.054  -5.734  11.230  1.00 0.00 ? 43 GLU A HB3  8  
ATOM 7593  H HG2  . GLU A 1 43 ? -6.254  -5.090  11.670  1.00 0.00 ? 43 GLU A HG2  8  
ATOM 7594  H HG3  . GLU A 1 43 ? -6.903  -6.655  11.184  1.00 0.00 ? 43 GLU A HG3  8  
ATOM 7595  N N    . GLY A 1 44 ? -6.562  -4.860  8.463   1.00 0.00 ? 44 GLY A N    8  
ATOM 7596  C CA   . GLY A 1 44 ? -7.080  -3.583  7.990   1.00 0.00 ? 44 GLY A CA   8  
ATOM 7597  C C    . GLY A 1 44 ? -6.156  -2.409  8.196   1.00 0.00 ? 44 GLY A C    8  
ATOM 7598  O O    . GLY A 1 44 ? -6.427  -1.534  9.019   1.00 0.00 ? 44 GLY A O    8  
ATOM 7599  H H    . GLY A 1 44 ? -7.133  -5.652  8.405   1.00 0.00 ? 44 GLY A H    8  
ATOM 7600  H HA2  . GLY A 1 44 ? -7.275  -3.664  6.935   1.00 0.00 ? 44 GLY A HA2  8  
ATOM 7601  H HA3  . GLY A 1 44 ? -8.009  -3.381  8.498   1.00 0.00 ? 44 GLY A HA3  8  
ATOM 7602  N N    . THR A 1 45 ? -5.071  -2.376  7.438   1.00 0.00 ? 45 THR A N    8  
ATOM 7603  C CA   . THR A 1 45 ? -4.124  -1.281  7.540   1.00 0.00 ? 45 THR A CA   8  
ATOM 7604  C C    . THR A 1 45 ? -4.480  -0.176  6.551   1.00 0.00 ? 45 THR A C    8  
ATOM 7605  O O    . THR A 1 45 ? -5.040  0.852   6.927   1.00 0.00 ? 45 THR A O    8  
ATOM 7606  C CB   . THR A 1 45 ? -2.706  -1.789  7.311   1.00 0.00 ? 45 THR A CB   8  
ATOM 7607  O OG1  . THR A 1 45 ? -2.531  -3.067  7.899   1.00 0.00 ? 45 THR A OG1  8  
ATOM 7608  C CG2  . THR A 1 45 ? -1.655  -0.871  7.885   1.00 0.00 ? 45 THR A CG2  8  
ATOM 7609  H H    . THR A 1 45 ? -4.907  -3.100  6.787   1.00 0.00 ? 45 THR A H    8  
ATOM 7610  H HA   . THR A 1 45 ? -4.194  -0.880  8.530   1.00 0.00 ? 45 THR A HA   8  
ATOM 7611  H HB   . THR A 1 45 ? -2.530  -1.877  6.255   1.00 0.00 ? 45 THR A HB   8  
ATOM 7612  H HG1  . THR A 1 45 ? -3.289  -3.622  7.694   1.00 0.00 ? 45 THR A HG1  8  
ATOM 7613  H HG21 . THR A 1 45 ? -0.880  -1.460  8.351   1.00 0.00 ? 45 THR A HG21 8  
ATOM 7614  H HG22 . THR A 1 45 ? -2.110  -0.224  8.621   1.00 0.00 ? 45 THR A HG22 8  
ATOM 7615  H HG23 . THR A 1 45 ? -1.229  -0.274  7.093   1.00 0.00 ? 45 THR A HG23 8  
ATOM 7616  N N    . ILE A 1 46 ? -4.170  -0.412  5.289   1.00 0.00 ? 46 ILE A N    8  
ATOM 7617  C CA   . ILE A 1 46 ? -4.465  0.537   4.222   1.00 0.00 ? 46 ILE A CA   8  
ATOM 7618  C C    . ILE A 1 46 ? -4.011  -0.026  2.875   1.00 0.00 ? 46 ILE A C    8  
ATOM 7619  O O    . ILE A 1 46 ? -2.836  0.051   2.515   1.00 0.00 ? 46 ILE A O    8  
ATOM 7620  C CB   . ILE A 1 46 ? -3.832  1.935   4.497   1.00 0.00 ? 46 ILE A CB   8  
ATOM 7621  C CG1  . ILE A 1 46 ? -4.934  2.955   4.791   1.00 0.00 ? 46 ILE A CG1  8  
ATOM 7622  C CG2  . ILE A 1 46 ? -2.967  2.426   3.339   1.00 0.00 ? 46 ILE A CG2  8  
ATOM 7623  C CD1  . ILE A 1 46 ? -5.057  3.318   6.255   1.00 0.00 ? 46 ILE A CD1  8  
ATOM 7624  H H    . ILE A 1 46 ? -3.741  -1.258  5.067   1.00 0.00 ? 46 ILE A H    8  
ATOM 7625  H HA   . ILE A 1 46 ? -5.540  0.659   4.190   1.00 0.00 ? 46 ILE A HA   8  
ATOM 7626  H HB   . ILE A 1 46 ? -3.199  1.850   5.364   1.00 0.00 ? 46 ILE A HB   8  
ATOM 7627  H HG12 . ILE A 1 46 ? -4.730  3.863   4.243   1.00 0.00 ? 46 ILE A HG12 8  
ATOM 7628  H HG13 . ILE A 1 46 ? -5.883  2.552   4.468   1.00 0.00 ? 46 ILE A HG13 8  
ATOM 7629  H HG21 . ILE A 1 46 ? -2.748  3.476   3.472   1.00 0.00 ? 46 ILE A HG21 8  
ATOM 7630  H HG22 . ILE A 1 46 ? -3.497  2.284   2.409   1.00 0.00 ? 46 ILE A HG22 8  
ATOM 7631  H HG23 . ILE A 1 46 ? -2.044  1.866   3.316   1.00 0.00 ? 46 ILE A HG23 8  
ATOM 7632  H HD11 . ILE A 1 46 ? -4.185  2.967   6.787   1.00 0.00 ? 46 ILE A HD11 8  
ATOM 7633  H HD12 . ILE A 1 46 ? -5.941  2.854   6.667   1.00 0.00 ? 46 ILE A HD12 8  
ATOM 7634  H HD13 . ILE A 1 46 ? -5.132  4.390   6.355   1.00 0.00 ? 46 ILE A HD13 8  
ATOM 7635  N N    . CYS A 1 47 ? -4.949  -0.617  2.146   1.00 0.00 ? 47 CYS A N    8  
ATOM 7636  C CA   . CYS A 1 47 ? -4.642  -1.208  0.856   1.00 0.00 ? 47 CYS A CA   8  
ATOM 7637  C C    . CYS A 1 47 ? -4.868  -0.240  -0.291  1.00 0.00 ? 47 CYS A C    8  
ATOM 7638  O O    . CYS A 1 47 ? -4.868  -0.648  -1.452  1.00 0.00 ? 47 CYS A O    8  
ATOM 7639  C CB   . CYS A 1 47 ? -5.451  -2.465  0.633   1.00 0.00 ? 47 CYS A CB   8  
ATOM 7640  S SG   . CYS A 1 47 ? -4.696  -3.544  -0.599  1.00 0.00 ? 47 CYS A SG   8  
ATOM 7641  H H    . CYS A 1 47 ? -5.861  -0.670  2.492   1.00 0.00 ? 47 CYS A H    8  
ATOM 7642  H HA   . CYS A 1 47 ? -3.606  -1.479  0.862   1.00 0.00 ? 47 CYS A HA   8  
ATOM 7643  H HB2  . CYS A 1 47 ? -5.512  -3.013  1.559   1.00 0.00 ? 47 CYS A HB2  8  
ATOM 7644  H HB3  . CYS A 1 47 ? -6.439  -2.210  0.293   1.00 0.00 ? 47 CYS A HB3  8  
ATOM 7645  N N    . ARG A 1 48 ? -5.057  1.032   0.051   1.00 0.00 ? 48 ARG A N    8  
ATOM 7646  C CA   . ARG A 1 48 ? -5.287  2.100   -0.932  1.00 0.00 ? 48 ARG A CA   8  
ATOM 7647  C C    . ARG A 1 48 ? -5.102  1.614   -2.364  1.00 0.00 ? 48 ARG A C    8  
ATOM 7648  O O    . ARG A 1 48 ? -4.035  1.117   -2.726  1.00 0.00 ? 48 ARG A O    8  
ATOM 7649  C CB   . ARG A 1 48 ? -4.326  3.250   -0.663  1.00 0.00 ? 48 ARG A CB   8  
ATOM 7650  C CG   . ARG A 1 48 ? -4.347  3.731   0.778   1.00 0.00 ? 48 ARG A CG   8  
ATOM 7651  C CD   . ARG A 1 48 ? -4.884  5.151   0.885   1.00 0.00 ? 48 ARG A CD   8  
ATOM 7652  N NE   . ARG A 1 48 ? -3.992  6.120   0.256   1.00 0.00 ? 48 ARG A NE   8  
ATOM 7653  C CZ   . ARG A 1 48 ? -4.100  7.435   0.416   1.00 0.00 ? 48 ARG A CZ   8  
ATOM 7654  N NH1  . ARG A 1 48 ? -5.071  7.938   1.166   1.00 0.00 ? 48 ARG A NH1  8  
ATOM 7655  N NH2  . ARG A 1 48 ? -3.235  8.249   -0.175  1.00 0.00 ? 48 ARG A NH2  8  
ATOM 7656  H H    . ARG A 1 48 ? -5.052  1.262   1.005   1.00 0.00 ? 48 ARG A H    8  
ATOM 7657  H HA   . ARG A 1 48 ? -6.292  2.451   -0.811  1.00 0.00 ? 48 ARG A HA   8  
ATOM 7658  H HB2  . ARG A 1 48 ? -3.324  2.922   -0.898  1.00 0.00 ? 48 ARG A HB2  8  
ATOM 7659  H HB3  . ARG A 1 48 ? -4.585  4.076   -1.303  1.00 0.00 ? 48 ARG A HB3  8  
ATOM 7660  H HG2  . ARG A 1 48 ? -4.977  3.073   1.356   1.00 0.00 ? 48 ARG A HG2  8  
ATOM 7661  H HG3  . ARG A 1 48 ? -3.343  3.703   1.172   1.00 0.00 ? 48 ARG A HG3  8  
ATOM 7662  H HD2  . ARG A 1 48 ? -5.847  5.195   0.400   1.00 0.00 ? 48 ARG A HD2  8  
ATOM 7663  H HD3  . ARG A 1 48 ? -4.995  5.402   1.929   1.00 0.00 ? 48 ARG A HD3  8  
ATOM 7664  H HE   . ARG A 1 48 ? -3.272  5.773   -0.310  1.00 0.00 ? 48 ARG A HE   8  
ATOM 7665  H HH11 . ARG A 1 48 ? -5.725  7.328   1.612   1.00 0.00 ? 48 ARG A HH11 8  
ATOM 7666  H HH12 . ARG A 1 48 ? -5.149  8.928   1.284   1.00 0.00 ? 48 ARG A HH12 8  
ATOM 7667  H HH21 . ARG A 1 48 ? -2.502  7.872   -0.741  1.00 0.00 ? 48 ARG A HH21 8  
ATOM 7668  H HH22 . ARG A 1 48 ? -3.316  9.239   -0.055  1.00 0.00 ? 48 ARG A HH22 8  
ATOM 7669  N N    . ARG A 1 49 ? -6.156  1.721   -3.169  1.00 0.00 ? 49 ARG A N    8  
ATOM 7670  C CA   . ARG A 1 49 ? -6.093  1.245   -4.546  1.00 0.00 ? 49 ARG A CA   8  
ATOM 7671  C C    . ARG A 1 49 ? -5.982  2.360   -5.581  1.00 0.00 ? 49 ARG A C    8  
ATOM 7672  O O    . ARG A 1 49 ? -5.605  2.099   -6.724  1.00 0.00 ? 49 ARG A O    8  
ATOM 7673  C CB   . ARG A 1 49 ? -7.305  0.370   -4.849  1.00 0.00 ? 49 ARG A CB   8  
ATOM 7674  C CG   . ARG A 1 49 ? -7.232  -0.992  -4.188  1.00 0.00 ? 49 ARG A CG   8  
ATOM 7675  C CD   . ARG A 1 49 ? -8.448  -1.842  -4.522  1.00 0.00 ? 49 ARG A CD   8  
ATOM 7676  N NE   . ARG A 1 49 ? -8.096  -3.241  -4.741  1.00 0.00 ? 49 ARG A NE   8  
ATOM 7677  C CZ   . ARG A 1 49 ? -7.608  -3.707  -5.886  1.00 0.00 ? 49 ARG A CZ   8  
ATOM 7678  N NH1  . ARG A 1 49 ? -7.413  -2.886  -6.908  1.00 0.00 ? 49 ARG A NH1  8  
ATOM 7679  N NH2  . ARG A 1 49 ? -7.314  -4.994  -6.009  1.00 0.00 ? 49 ARG A NH2  8  
ATOM 7680  H H    . ARG A 1 49 ? -6.997  2.096   -2.821  1.00 0.00 ? 49 ARG A H    8  
ATOM 7681  H HA   . ARG A 1 49 ? -5.213  0.637   -4.626  1.00 0.00 ? 49 ARG A HA   8  
ATOM 7682  H HB2  . ARG A 1 49 ? -8.196  0.872   -4.500  1.00 0.00 ? 49 ARG A HB2  8  
ATOM 7683  H HB3  . ARG A 1 49 ? -7.377  0.227   -5.917  1.00 0.00 ? 49 ARG A HB3  8  
ATOM 7684  H HG2  . ARG A 1 49 ? -6.343  -1.499  -4.531  1.00 0.00 ? 49 ARG A HG2  8  
ATOM 7685  H HG3  . ARG A 1 49 ? -7.178  -0.857  -3.118  1.00 0.00 ? 49 ARG A HG3  8  
ATOM 7686  H HD2  . ARG A 1 49 ? -9.151  -1.781  -3.705  1.00 0.00 ? 49 ARG A HD2  8  
ATOM 7687  H HD3  . ARG A 1 49 ? -8.907  -1.452  -5.419  1.00 0.00 ? 49 ARG A HD3  8  
ATOM 7688  H HE   . ARG A 1 49 ? -8.231  -3.865  -3.997  1.00 0.00 ? 49 ARG A HE   8  
ATOM 7689  H HH11 . ARG A 1 49 ? -7.632  -1.915  -6.819  1.00 0.00 ? 49 ARG A HH11 8  
ATOM 7690  H HH12 . ARG A 1 49 ? -7.046  -3.238  -7.770  1.00 0.00 ? 49 ARG A HH12 8  
ATOM 7691  H HH21 . ARG A 1 49 ? -7.459  -5.616  -5.240  1.00 0.00 ? 49 ARG A HH21 8  
ATOM 7692  H HH22 . ARG A 1 49 ? -6.948  -5.343  -6.872  1.00 0.00 ? 49 ARG A HH22 8  
ATOM 7693  N N    . ALA A 1 50 ? -6.303  3.591   -5.212  1.00 0.00 ? 50 ALA A N    8  
ATOM 7694  C CA   . ALA A 1 50 ? -6.212  4.685   -6.176  1.00 0.00 ? 50 ALA A CA   8  
ATOM 7695  C C    . ALA A 1 50 ? -6.147  6.047   -5.502  1.00 0.00 ? 50 ALA A C    8  
ATOM 7696  O O    . ALA A 1 50 ? -6.210  6.151   -4.278  1.00 0.00 ? 50 ALA A O    8  
ATOM 7697  C CB   . ALA A 1 50 ? -7.381  4.627   -7.149  1.00 0.00 ? 50 ALA A CB   8  
ATOM 7698  H H    . ALA A 1 50 ? -6.604  3.766   -4.290  1.00 0.00 ? 50 ALA A H    8  
ATOM 7699  H HA   . ALA A 1 50 ? -5.305  4.542   -6.745  1.00 0.00 ? 50 ALA A HA   8  
ATOM 7700  H HB1  . ALA A 1 50 ? -8.099  3.897   -6.806  1.00 0.00 ? 50 ALA A HB1  8  
ATOM 7701  H HB2  . ALA A 1 50 ? -7.021  4.345   -8.128  1.00 0.00 ? 50 ALA A HB2  8  
ATOM 7702  H HB3  . ALA A 1 50 ? -7.851  5.597   -7.205  1.00 0.00 ? 50 ALA A HB3  8  
ATOM 7703  N N    . ARG A 1 51 ? -6.012  7.091   -6.316  1.00 0.00 ? 51 ARG A N    8  
ATOM 7704  C CA   . ARG A 1 51 ? -5.929  8.454   -5.807  1.00 0.00 ? 51 ARG A CA   8  
ATOM 7705  C C    . ARG A 1 51 ? -6.851  9.392   -6.579  1.00 0.00 ? 51 ARG A C    8  
ATOM 7706  O O    . ARG A 1 51 ? -7.689  10.073  -5.989  1.00 0.00 ? 51 ARG A O    8  
ATOM 7707  C CB   . ARG A 1 51 ? -4.487  8.958   -5.880  1.00 0.00 ? 51 ARG A CB   8  
ATOM 7708  C CG   . ARG A 1 51 ? -3.473  7.967   -5.335  1.00 0.00 ? 51 ARG A CG   8  
ATOM 7709  C CD   . ARG A 1 51 ? -2.186  8.658   -4.917  1.00 0.00 ? 51 ARG A CD   8  
ATOM 7710  N NE   . ARG A 1 51 ? -1.008  7.999   -5.473  1.00 0.00 ? 51 ARG A NE   8  
ATOM 7711  C CZ   . ARG A 1 51 ? 0.143   8.621   -5.705  1.00 0.00 ? 51 ARG A CZ   8  
ATOM 7712  N NH1  . ARG A 1 51 ? 0.269   9.911   -5.427  1.00 0.00 ? 51 ARG A NH1  8  
ATOM 7713  N NH2  . ARG A 1 51 ? 1.169   7.953   -6.215  1.00 0.00 ? 51 ARG A NH2  8  
ATOM 7714  H H    . ARG A 1 51 ? -5.963  6.940   -7.283  1.00 0.00 ? 51 ARG A H    8  
ATOM 7715  H HA   . ARG A 1 51 ? -6.240  8.436   -4.778  1.00 0.00 ? 51 ARG A HA   8  
ATOM 7716  H HB2  . ARG A 1 51 ? -4.241  9.163   -6.912  1.00 0.00 ? 51 ARG A HB2  8  
ATOM 7717  H HB3  . ARG A 1 51 ? -4.408  9.873   -5.312  1.00 0.00 ? 51 ARG A HB3  8  
ATOM 7718  H HG2  . ARG A 1 51 ? -3.896  7.468   -4.476  1.00 0.00 ? 51 ARG A HG2  8  
ATOM 7719  H HG3  . ARG A 1 51 ? -3.248  7.239   -6.101  1.00 0.00 ? 51 ARG A HG3  8  
ATOM 7720  H HD2  . ARG A 1 51 ? -2.212  9.681   -5.264  1.00 0.00 ? 51 ARG A HD2  8  
ATOM 7721  H HD3  . ARG A 1 51 ? -2.119  8.647   -3.839  1.00 0.00 ? 51 ARG A HD3  8  
ATOM 7722  H HE   . ARG A 1 51 ? -1.079  7.044   -5.684  1.00 0.00 ? 51 ARG A HE   8  
ATOM 7723  H HH11 . ARG A 1 51 ? -0.503  10.417  -5.042  1.00 0.00 ? 51 ARG A HH11 8  
ATOM 7724  H HH12 . ARG A 1 51 ? 1.135   10.379  -5.603  1.00 0.00 ? 51 ARG A HH12 8  
ATOM 7725  H HH21 . ARG A 1 51 ? 1.077   6.980   -6.425  1.00 0.00 ? 51 ARG A HH21 8  
ATOM 7726  H HH22 . ARG A 1 51 ? 2.034   8.423   -6.391  1.00 0.00 ? 51 ARG A HH22 8  
ATOM 7727  N N    . GLY A 1 52 ? -6.689  9.425   -7.899  1.00 0.00 ? 52 GLY A N    8  
ATOM 7728  C CA   . GLY A 1 52 ? -7.515  10.287  -8.727  1.00 0.00 ? 52 GLY A CA   8  
ATOM 7729  C C    . GLY A 1 52 ? -8.930  10.411  -8.200  1.00 0.00 ? 52 GLY A C    8  
ATOM 7730  O O    . GLY A 1 52 ? -9.562  11.460  -8.332  1.00 0.00 ? 52 GLY A O    8  
ATOM 7731  H H    . GLY A 1 52 ? -6.003  8.861   -8.314  1.00 0.00 ? 52 GLY A H    8  
ATOM 7732  H HA2  . GLY A 1 52 ? -7.068  11.269  -8.762  1.00 0.00 ? 52 GLY A HA2  8  
ATOM 7733  H HA3  . GLY A 1 52 ? -7.549  9.882   -9.728  1.00 0.00 ? 52 GLY A HA3  8  
ATOM 7734  N N    . ASP A 1 53 ? -9.427  9.336   -7.598  1.00 0.00 ? 53 ASP A N    8  
ATOM 7735  C CA   . ASP A 1 53 ? -10.774 9.321   -7.043  1.00 0.00 ? 53 ASP A CA   8  
ATOM 7736  C C    . ASP A 1 53 ? -10.996 8.062   -6.212  1.00 0.00 ? 53 ASP A C    8  
ATOM 7737  O O    . ASP A 1 53 ? -11.977 7.343   -6.408  1.00 0.00 ? 53 ASP A O    8  
ATOM 7738  C CB   . ASP A 1 53 ? -11.811 9.396   -8.164  1.00 0.00 ? 53 ASP A CB   8  
ATOM 7739  C CG   . ASP A 1 53 ? -12.602 10.689  -8.134  1.00 0.00 ? 53 ASP A CG   8  
ATOM 7740  O OD1  . ASP A 1 53 ? -13.001 11.115  -7.030  1.00 0.00 ? 53 ASP A OD1  8  
ATOM 7741  O OD2  . ASP A 1 53 ? -12.822 11.275  -9.215  1.00 0.00 ? 53 ASP A OD2  8  
ATOM 7742  H H    . ASP A 1 53 ? -8.871  8.532   -7.523  1.00 0.00 ? 53 ASP A H    8  
ATOM 7743  H HA   . ASP A 1 53 ? -10.881 10.184  -6.404  1.00 0.00 ? 53 ASP A HA   8  
ATOM 7744  H HB2  . ASP A 1 53 ? -11.307 9.326   -9.116  1.00 0.00 ? 53 ASP A HB2  8  
ATOM 7745  H HB3  . ASP A 1 53 ? -12.500 8.570   -8.064  1.00 0.00 ? 53 ASP A HB3  8  
ATOM 7746  N N    . ASP A 1 54 ? -10.074 7.793   -5.293  1.00 0.00 ? 54 ASP A N    8  
ATOM 7747  C CA   . ASP A 1 54 ? -10.172 6.611   -4.446  1.00 0.00 ? 54 ASP A CA   8  
ATOM 7748  C C    . ASP A 1 54 ? -9.512  6.831   -3.088  1.00 0.00 ? 54 ASP A C    8  
ATOM 7749  O O    . ASP A 1 54 ? -10.149 7.304   -2.147  1.00 0.00 ? 54 ASP A O    8  
ATOM 7750  C CB   . ASP A 1 54 ? -9.524  5.416   -5.140  1.00 0.00 ? 54 ASP A CB   8  
ATOM 7751  C CG   . ASP A 1 54 ? -10.292 4.972   -6.370  1.00 0.00 ? 54 ASP A CG   8  
ATOM 7752  O OD1  . ASP A 1 54 ? -10.183 5.650   -7.414  1.00 0.00 ? 54 ASP A OD1  8  
ATOM 7753  O OD2  . ASP A 1 54 ? -11.002 3.948   -6.288  1.00 0.00 ? 54 ASP A OD2  8  
ATOM 7754  H H    . ASP A 1 54 ? -9.310  8.398   -5.188  1.00 0.00 ? 54 ASP A H    8  
ATOM 7755  H HA   . ASP A 1 54 ? -11.219 6.400   -4.293  1.00 0.00 ? 54 ASP A HA   8  
ATOM 7756  H HB2  . ASP A 1 54 ? -8.524  5.688   -5.439  1.00 0.00 ? 54 ASP A HB2  8  
ATOM 7757  H HB3  . ASP A 1 54 ? -9.476  4.589   -4.447  1.00 0.00 ? 54 ASP A HB3  8  
ATOM 7758  N N    . LEU A 1 55 ? -8.234  6.468   -2.989  1.00 0.00 ? 55 LEU A N    8  
ATOM 7759  C CA   . LEU A 1 55 ? -7.498  6.608   -1.740  1.00 0.00 ? 55 LEU A CA   8  
ATOM 7760  C C    . LEU A 1 55 ? -8.202  5.842   -0.636  1.00 0.00 ? 55 LEU A C    8  
ATOM 7761  O O    . LEU A 1 55 ? -8.125  6.200   0.540   1.00 0.00 ? 55 LEU A O    8  
ATOM 7762  C CB   . LEU A 1 55 ? -7.364  8.080   -1.359  1.00 0.00 ? 55 LEU A CB   8  
ATOM 7763  C CG   . LEU A 1 55 ? -6.638  8.936   -2.391  1.00 0.00 ? 55 LEU A CG   8  
ATOM 7764  C CD1  . LEU A 1 55 ? -6.545  10.375  -1.918  1.00 0.00 ? 55 LEU A CD1  8  
ATOM 7765  C CD2  . LEU A 1 55 ? -5.254  8.368   -2.670  1.00 0.00 ? 55 LEU A CD2  8  
ATOM 7766  H H    . LEU A 1 55 ? -7.781  6.086   -3.768  1.00 0.00 ? 55 LEU A H    8  
ATOM 7767  H HA   . LEU A 1 55 ? -6.514  6.188   -1.884  1.00 0.00 ? 55 LEU A HA   8  
ATOM 7768  H HB2  . LEU A 1 55 ? -8.355  8.486   -1.213  1.00 0.00 ? 55 LEU A HB2  8  
ATOM 7769  H HB3  . LEU A 1 55 ? -6.824  8.144   -0.426  1.00 0.00 ? 55 LEU A HB3  8  
ATOM 7770  H HG   . LEU A 1 55 ? -7.200  8.926   -3.312  1.00 0.00 ? 55 LEU A HG   8  
ATOM 7771  H HD11 . LEU A 1 55 ? -7.532  10.733  -1.664  1.00 0.00 ? 55 LEU A HD11 8  
ATOM 7772  H HD12 . LEU A 1 55 ? -6.131  10.985  -2.706  1.00 0.00 ? 55 LEU A HD12 8  
ATOM 7773  H HD13 . LEU A 1 55 ? -5.908  10.426  -1.048  1.00 0.00 ? 55 LEU A HD13 8  
ATOM 7774  H HD21 . LEU A 1 55 ? -4.595  8.607   -1.851  1.00 0.00 ? 55 LEU A HD21 8  
ATOM 7775  H HD22 . LEU A 1 55 ? -4.865  8.795   -3.581  1.00 0.00 ? 55 LEU A HD22 8  
ATOM 7776  H HD23 . LEU A 1 55 ? -5.320  7.295   -2.776  1.00 0.00 ? 55 LEU A HD23 8  
ATOM 7777  N N    . ASP A 1 56 ? -8.900  4.787   -1.033  1.00 0.00 ? 56 ASP A N    8  
ATOM 7778  C CA   . ASP A 1 56 ? -9.637  3.962   -0.098  1.00 0.00 ? 56 ASP A CA   8  
ATOM 7779  C C    . ASP A 1 56 ? -9.302  2.490   -0.284  1.00 0.00 ? 56 ASP A C    8  
ATOM 7780  O O    . ASP A 1 56 ? -9.248  1.993   -1.410  1.00 0.00 ? 56 ASP A O    8  
ATOM 7781  C CB   . ASP A 1 56 ? -11.133 4.178   -0.294  1.00 0.00 ? 56 ASP A CB   8  
ATOM 7782  C CG   . ASP A 1 56 ? -11.633 5.435   0.390   1.00 0.00 ? 56 ASP A CG   8  
ATOM 7783  O OD1  . ASP A 1 56 ? -10.868 6.024   1.182   1.00 0.00 ? 56 ASP A OD1  8  
ATOM 7784  O OD2  . ASP A 1 56 ? -12.789 5.831   0.133   1.00 0.00 ? 56 ASP A OD2  8  
ATOM 7785  H H    . ASP A 1 56 ? -8.926  4.562   -1.987  1.00 0.00 ? 56 ASP A H    8  
ATOM 7786  H HA   . ASP A 1 56 ? -9.365  4.262   0.902   1.00 0.00 ? 56 ASP A HA   8  
ATOM 7787  H HB2  . ASP A 1 56 ? -11.337 4.262   -1.352  1.00 0.00 ? 56 ASP A HB2  8  
ATOM 7788  H HB3  . ASP A 1 56 ? -11.667 3.330   0.105   1.00 0.00 ? 56 ASP A HB3  8  
ATOM 7789  N N    . ASP A 1 57 ? -9.086  1.803   0.832   1.00 0.00 ? 57 ASP A N    8  
ATOM 7790  C CA   . ASP A 1 57 ? -8.765  0.382   0.822   1.00 0.00 ? 57 ASP A CA   8  
ATOM 7791  C C    . ASP A 1 57 ? -8.009  -0.007  2.090   1.00 0.00 ? 57 ASP A C    8  
ATOM 7792  O O    . ASP A 1 57 ? -7.131  0.724   2.551   1.00 0.00 ? 57 ASP A O    8  
ATOM 7793  C CB   . ASP A 1 57 ? -7.950  0.016   -0.415  1.00 0.00 ? 57 ASP A CB   8  
ATOM 7794  C CG   . ASP A 1 57 ? -8.771  -0.752  -1.433  1.00 0.00 ? 57 ASP A CG   8  
ATOM 7795  O OD1  . ASP A 1 57 ? -9.789  -0.208  -1.910  1.00 0.00 ? 57 ASP A OD1  8  
ATOM 7796  O OD2  . ASP A 1 57 ? -8.395  -1.899  -1.752  1.00 0.00 ? 57 ASP A OD2  8  
ATOM 7797  H H    . ASP A 1 57 ? -9.150  2.268   1.692   1.00 0.00 ? 57 ASP A H    8  
ATOM 7798  H HA   . ASP A 1 57 ? -9.694  -0.162  0.796   1.00 0.00 ? 57 ASP A HA   8  
ATOM 7799  H HB2  . ASP A 1 57 ? -7.576  0.916   -0.879  1.00 0.00 ? 57 ASP A HB2  8  
ATOM 7800  H HB3  . ASP A 1 57 ? -7.122  -0.598  -0.116  1.00 0.00 ? 57 ASP A HB3  8  
ATOM 7801  N N    . TYR A 1 58 ? -8.364  -1.161  2.650   1.00 0.00 ? 58 TYR A N    8  
ATOM 7802  C CA   . TYR A 1 58 ? -7.737  -1.660  3.876   1.00 0.00 ? 58 TYR A CA   8  
ATOM 7803  C C    . TYR A 1 58 ? -6.856  -2.877  3.604   1.00 0.00 ? 58 TYR A C    8  
ATOM 7804  O O    . TYR A 1 58 ? -7.108  -3.646  2.677   1.00 0.00 ? 58 TYR A O    8  
ATOM 7805  C CB   . TYR A 1 58 ? -8.805  -2.027  4.907   1.00 0.00 ? 58 TYR A CB   8  
ATOM 7806  C CG   . TYR A 1 58 ? -9.354  -0.844  5.671   1.00 0.00 ? 58 TYR A CG   8  
ATOM 7807  C CD1  . TYR A 1 58 ? -9.290  0.439   5.145   1.00 0.00 ? 58 TYR A CD1  8  
ATOM 7808  C CD2  . TYR A 1 58 ? -9.943  -1.012  6.918   1.00 0.00 ? 58 TYR A CD2  8  
ATOM 7809  C CE1  . TYR A 1 58 ? -9.796  1.521   5.839   1.00 0.00 ? 58 TYR A CE1  8  
ATOM 7810  C CE2  . TYR A 1 58 ? -10.452 0.065   7.618   1.00 0.00 ? 58 TYR A CE2  8  
ATOM 7811  C CZ   . TYR A 1 58 ? -10.377 1.329   7.074   1.00 0.00 ? 58 TYR A CZ   8  
ATOM 7812  O OH   . TYR A 1 58 ? -10.883 2.404   7.767   1.00 0.00 ? 58 TYR A OH   8  
ATOM 7813  H H    . TYR A 1 58 ? -9.069  -1.688  2.231   1.00 0.00 ? 58 TYR A H    8  
ATOM 7814  H HA   . TYR A 1 58 ? -7.122  -0.869  4.278   1.00 0.00 ? 58 TYR A HA   8  
ATOM 7815  H HB2  . TYR A 1 58 ? -9.631  -2.504  4.401   1.00 0.00 ? 58 TYR A HB2  8  
ATOM 7816  H HB3  . TYR A 1 58 ? -8.382  -2.718  5.621   1.00 0.00 ? 58 TYR A HB3  8  
ATOM 7817  H HD1  . TYR A 1 58 ? -8.834  0.586   4.180   1.00 0.00 ? 58 TYR A HD1  8  
ATOM 7818  H HD2  . TYR A 1 58 ? -9.998  -2.004  7.343   1.00 0.00 ? 58 TYR A HD2  8  
ATOM 7819  H HE1  . TYR A 1 58 ? -9.737  2.511   5.411   1.00 0.00 ? 58 TYR A HE1  8  
ATOM 7820  H HE2  . TYR A 1 58 ? -10.906 -0.086  8.585   1.00 0.00 ? 58 TYR A HE2  8  
ATOM 7821  H HH   . TYR A 1 58 ? -11.834 2.309   7.857   1.00 0.00 ? 58 TYR A HH   8  
ATOM 7822  N N    . CYS A 1 59 ? -5.822  -3.038  4.427   1.00 0.00 ? 59 CYS A N    8  
ATOM 7823  C CA   . CYS A 1 59 ? -4.883  -4.149  4.293   1.00 0.00 ? 59 CYS A CA   8  
ATOM 7824  C C    . CYS A 1 59 ? -5.263  -5.332  5.181   1.00 0.00 ? 59 CYS A C    8  
ATOM 7825  O O    . CYS A 1 59 ? -5.321  -5.207  6.404   1.00 0.00 ? 59 CYS A O    8  
ATOM 7826  C CB   . CYS A 1 59 ? -3.482  -3.679  4.661   1.00 0.00 ? 59 CYS A CB   8  
ATOM 7827  S SG   . CYS A 1 59 ? -2.633  -2.739  3.350   1.00 0.00 ? 59 CYS A SG   8  
ATOM 7828  H H    . CYS A 1 59 ? -5.683  -2.386  5.145   1.00 0.00 ? 59 CYS A H    8  
ATOM 7829  H HA   . CYS A 1 59 ? -4.885  -4.467  3.265   1.00 0.00 ? 59 CYS A HA   8  
ATOM 7830  H HB2  . CYS A 1 59 ? -3.554  -3.045  5.523   1.00 0.00 ? 59 CYS A HB2  8  
ATOM 7831  H HB3  . CYS A 1 59 ? -2.873  -4.534  4.904   1.00 0.00 ? 59 CYS A HB3  8  
ATOM 7832  N N    . ASN A 1 60 ? -5.497  -6.483  4.559   1.00 0.00 ? 60 ASN A N    8  
ATOM 7833  C CA   . ASN A 1 60 ? -5.847  -7.706  5.279   1.00 0.00 ? 60 ASN A CA   8  
ATOM 7834  C C    . ASN A 1 60 ? -5.021  -8.856  4.725   1.00 0.00 ? 60 ASN A C    8  
ATOM 7835  O O    . ASN A 1 60 ? -4.031  -9.275  5.319   1.00 0.00 ? 60 ASN A O    8  
ATOM 7836  C CB   . ASN A 1 60 ? -7.345  -7.992  5.151   1.00 0.00 ? 60 ASN A CB   8  
ATOM 7837  C CG   . ASN A 1 60 ? -8.170  -6.724  5.227   1.00 0.00 ? 60 ASN A CG   8  
ATOM 7838  O OD1  . ASN A 1 60 ? -9.186  -6.588  4.546   1.00 0.00 ? 60 ASN A OD1  8  
ATOM 7839  N ND2  . ASN A 1 60 ? -7.735  -5.785  6.060   1.00 0.00 ? 60 ASN A ND2  8  
ATOM 7840  H H    . ASN A 1 60 ? -5.417  -6.518  3.587   1.00 0.00 ? 60 ASN A H    8  
ATOM 7841  H HA   . ASN A 1 60 ? -5.597  -7.569  6.310   1.00 0.00 ? 60 ASN A HA   8  
ATOM 7842  H HB2  . ASN A 1 60 ? -7.541  -8.471  4.204   1.00 0.00 ? 60 ASN A HB2  8  
ATOM 7843  H HB3  . ASN A 1 60 ? -7.652  -8.648  5.952   1.00 0.00 ? 60 ASN A HB3  8  
ATOM 7844  H HD21 . ASN A 1 60 ? -6.921  -5.964  6.579   1.00 0.00 ? 60 ASN A HD21 8  
ATOM 7845  H HD22 . ASN A 1 60 ? -8.235  -4.945  6.110   1.00 0.00 ? 60 ASN A HD22 8  
ATOM 7846  N N    . GLY A 1 61 ? -5.397  -9.305  3.546   1.00 0.00 ? 61 GLY A N    8  
ATOM 7847  C CA   . GLY A 1 61 ? -4.650  -10.345 2.865   1.00 0.00 ? 61 GLY A CA   8  
ATOM 7848  C C    . GLY A 1 61 ? -3.764  -9.700  1.823   1.00 0.00 ? 61 GLY A C    8  
ATOM 7849  O O    . GLY A 1 61 ? -3.475  -10.269 0.770   1.00 0.00 ? 61 GLY A O    8  
ATOM 7850  H H    . GLY A 1 61 ? -6.160  -8.886  3.108   1.00 0.00 ? 61 GLY A H    8  
ATOM 7851  H HA2  . GLY A 1 61 ? -4.043  -10.883 3.580   1.00 0.00 ? 61 GLY A HA2  8  
ATOM 7852  H HA3  . GLY A 1 61 ? -5.333  -11.026 2.381   1.00 0.00 ? 61 GLY A HA3  8  
ATOM 7853  N N    . ILE A 1 62 ? -3.383  -8.467  2.136   1.00 0.00 ? 62 ILE A N    8  
ATOM 7854  C CA   . ILE A 1 62 ? -2.570  -7.628  1.270   1.00 0.00 ? 62 ILE A CA   8  
ATOM 7855  C C    . ILE A 1 62 ? -1.129  -8.095  1.108   1.00 0.00 ? 62 ILE A C    8  
ATOM 7856  O O    . ILE A 1 62 ? -0.262  -7.755  1.908   1.00 0.00 ? 62 ILE A O    8  
ATOM 7857  C CB   . ILE A 1 62 ? -2.559  -6.184  1.797   1.00 0.00 ? 62 ILE A CB   8  
ATOM 7858  C CG1  . ILE A 1 62 ? -2.371  -6.108  3.325   1.00 0.00 ? 62 ILE A CG1  8  
ATOM 7859  C CG2  . ILE A 1 62 ? -3.862  -5.509  1.428   1.00 0.00 ? 62 ILE A CG2  8  
ATOM 7860  C CD1  . ILE A 1 62 ? -1.730  -7.312  3.995   1.00 0.00 ? 62 ILE A CD1  8  
ATOM 7861  H H    . ILE A 1 62 ? -3.690  -8.088  2.985   1.00 0.00 ? 62 ILE A H    8  
ATOM 7862  H HA   . ILE A 1 62 ? -3.037  -7.615  0.297   1.00 0.00 ? 62 ILE A HA   8  
ATOM 7863  H HB   . ILE A 1 62 ? -1.754  -5.651  1.312   1.00 0.00 ? 62 ILE A HB   8  
ATOM 7864  H HG12 . ILE A 1 62 ? -1.753  -5.254  3.551   1.00 0.00 ? 62 ILE A HG12 8  
ATOM 7865  H HG13 . ILE A 1 62 ? -3.341  -5.961  3.780   1.00 0.00 ? 62 ILE A HG13 8  
ATOM 7866  H HG21 . ILE A 1 62 ? -4.114  -5.746  0.406   1.00 0.00 ? 62 ILE A HG21 8  
ATOM 7867  H HG22 . ILE A 1 62 ? -3.761  -4.442  1.540   1.00 0.00 ? 62 ILE A HG22 8  
ATOM 7868  H HG23 . ILE A 1 62 ? -4.642  -5.863  2.080   1.00 0.00 ? 62 ILE A HG23 8  
ATOM 7869  H HD11 . ILE A 1 62 ? -2.311  -7.581  4.865   1.00 0.00 ? 62 ILE A HD11 8  
ATOM 7870  H HD12 . ILE A 1 62 ? -0.731  -7.056  4.304   1.00 0.00 ? 62 ILE A HD12 8  
ATOM 7871  H HD13 . ILE A 1 62 ? -1.692  -8.145  3.324   1.00 0.00 ? 62 ILE A HD13 8  
ATOM 7872  N N    . SER A 1 63 ? -0.868  -8.834  0.044   1.00 0.00 ? 63 SER A N    8  
ATOM 7873  C CA   . SER A 1 63 ? 0.482   -9.293  -0.238  1.00 0.00 ? 63 SER A CA   8  
ATOM 7874  C C    . SER A 1 63 ? 1.117   -8.418  -1.319  1.00 0.00 ? 63 SER A C    8  
ATOM 7875  O O    . SER A 1 63 ? 2.118   -8.791  -1.929  1.00 0.00 ? 63 SER A O    8  
ATOM 7876  C CB   . SER A 1 63 ? 0.466   -10.751 -0.668  1.00 0.00 ? 63 SER A CB   8  
ATOM 7877  O OG   . SER A 1 63 ? 0.106   -10.881 -2.032  1.00 0.00 ? 63 SER A OG   8  
ATOM 7878  H H    . SER A 1 63 ? -1.591  -9.048  -0.582  1.00 0.00 ? 63 SER A H    8  
ATOM 7879  H HA   . SER A 1 63 ? 1.061   -9.198  0.670   1.00 0.00 ? 63 SER A HA   8  
ATOM 7880  H HB2  . SER A 1 63 ? 1.447   -11.172 -0.522  1.00 0.00 ? 63 SER A HB2  8  
ATOM 7881  H HB3  . SER A 1 63 ? -0.252  -11.285 -0.064  1.00 0.00 ? 63 SER A HB3  8  
ATOM 7882  H HG   . SER A 1 63 ? 0.635   -11.571 -2.439  1.00 0.00 ? 63 SER A HG   8  
ATOM 7883  N N    . ALA A 1 64 ? 0.501   -7.251  -1.531  1.00 0.00 ? 64 ALA A N    8  
ATOM 7884  C CA   . ALA A 1 64 ? 0.933   -6.262  -2.518  1.00 0.00 ? 64 ALA A CA   8  
ATOM 7885  C C    . ALA A 1 64 ? -0.255  -5.815  -3.359  1.00 0.00 ? 64 ALA A C    8  
ATOM 7886  O O    . ALA A 1 64 ? -0.222  -4.762  -3.996  1.00 0.00 ? 64 ALA A O    8  
ATOM 7887  C CB   . ALA A 1 64 ? 2.051   -6.768  -3.411  1.00 0.00 ? 64 ALA A CB   8  
ATOM 7888  H H    . ALA A 1 64 ? -0.291  -7.043  -0.994  1.00 0.00 ? 64 ALA A H    8  
ATOM 7889  H HA   . ALA A 1 64 ? 1.304   -5.412  -1.975  1.00 0.00 ? 64 ALA A HA   8  
ATOM 7890  H HB1  . ALA A 1 64 ? 2.346   -5.978  -4.087  1.00 0.00 ? 64 ALA A HB1  8  
ATOM 7891  H HB2  . ALA A 1 64 ? 1.707   -7.616  -3.974  1.00 0.00 ? 64 ALA A HB2  8  
ATOM 7892  H HB3  . ALA A 1 64 ? 2.897   -7.054  -2.806  1.00 0.00 ? 64 ALA A HB3  8  
ATOM 7893  N N    . GLY A 1 65 ? -1.313  -6.620  -3.337  1.00 0.00 ? 65 GLY A N    8  
ATOM 7894  C CA   . GLY A 1 65 ? -2.515  -6.294  -4.079  1.00 0.00 ? 65 GLY A CA   8  
ATOM 7895  C C    . GLY A 1 65 ? -3.579  -5.705  -3.177  1.00 0.00 ? 65 GLY A C    8  
ATOM 7896  O O    . GLY A 1 65 ? -3.447  -4.572  -2.732  1.00 0.00 ? 65 GLY A O    8  
ATOM 7897  H H    . GLY A 1 65 ? -1.282  -7.438  -2.798  1.00 0.00 ? 65 GLY A H    8  
ATOM 7898  H HA2  . GLY A 1 65 ? -2.270  -5.579  -4.851  1.00 0.00 ? 65 GLY A HA2  8  
ATOM 7899  H HA3  . GLY A 1 65 ? -2.901  -7.192  -4.538  1.00 0.00 ? 65 GLY A HA3  8  
ATOM 7900  N N    . CYS A 1 66 ? -4.617  -6.493  -2.896  1.00 0.00 ? 66 CYS A N    8  
ATOM 7901  C CA   . CYS A 1 66 ? -5.716  -6.080  -2.015  1.00 0.00 ? 66 CYS A CA   8  
ATOM 7902  C C    . CYS A 1 66 ? -6.667  -7.237  -1.726  1.00 0.00 ? 66 CYS A C    8  
ATOM 7903  O O    . CYS A 1 66 ? -6.922  -8.082  -2.584  1.00 0.00 ? 66 CYS A O    8  
ATOM 7904  C CB   . CYS A 1 66 ? -6.506  -4.894  -2.593  1.00 0.00 ? 66 CYS A CB   8  
ATOM 7905  S SG   . CYS A 1 66 ? -5.774  -3.255  -2.288  1.00 0.00 ? 66 CYS A SG   8  
ATOM 7906  H H    . CYS A 1 66 ? -4.630  -7.389  -3.273  1.00 0.00 ? 66 CYS A H    8  
ATOM 7907  H HA   . CYS A 1 66 ? -5.278  -5.787  -1.081  1.00 0.00 ? 66 CYS A HA   8  
ATOM 7908  H HB2  . CYS A 1 66 ? -6.588  -5.012  -3.659  1.00 0.00 ? 66 CYS A HB2  8  
ATOM 7909  H HB3  . CYS A 1 66 ? -7.495  -4.891  -2.159  1.00 0.00 ? 66 CYS A HB3  8  
ATOM 7910  N N    . PRO A 1 67 ? -7.208  -7.276  -0.497  1.00 0.00 ? 67 PRO A N    8  
ATOM 7911  C CA   . PRO A 1 67 ? -8.146  -8.319  -0.066  1.00 0.00 ? 67 PRO A CA   8  
ATOM 7912  C C    . PRO A 1 67 ? -9.486  -8.227  -0.791  1.00 0.00 ? 67 PRO A C    8  
ATOM 7913  O O    . PRO A 1 67 ? -9.591  -7.597  -1.842  1.00 0.00 ? 67 PRO A O    8  
ATOM 7914  C CB   . PRO A 1 67 ? -8.330  -8.036  1.429   1.00 0.00 ? 67 PRO A CB   8  
ATOM 7915  C CG   . PRO A 1 67 ? -8.014  -6.589  1.583   1.00 0.00 ? 67 PRO A CG   8  
ATOM 7916  C CD   . PRO A 1 67 ? -6.945  -6.295  0.572   1.00 0.00 ? 67 PRO A CD   8  
ATOM 7917  H HA   . PRO A 1 67 ? -7.730  -9.307  -0.201  1.00 0.00 ? 67 PRO A HA   8  
ATOM 7918  H HB2  . PRO A 1 67 ? -9.348  -8.251  1.718   1.00 0.00 ? 67 PRO A HB2  8  
ATOM 7919  H HB3  . PRO A 1 67 ? -7.650  -8.650  2.001   1.00 0.00 ? 67 PRO A HB3  8  
ATOM 7920  H HG2  . PRO A 1 67 ? -8.893  -5.995  1.382   1.00 0.00 ? 67 PRO A HG2  8  
ATOM 7921  H HG3  . PRO A 1 67 ? -7.649  -6.394  2.581   1.00 0.00 ? 67 PRO A HG3  8  
ATOM 7922  H HD2  . PRO A 1 67 ? -7.040  -5.284  0.204   1.00 0.00 ? 67 PRO A HD2  8  
ATOM 7923  H HD3  . PRO A 1 67 ? -5.969  -6.451  1.002   1.00 0.00 ? 67 PRO A HD3  8  
ATOM 7924  N N    . ARG A 1 68 ? -10.508 -8.859  -0.220  1.00 0.00 ? 68 ARG A N    8  
ATOM 7925  C CA   . ARG A 1 68 ? -11.841 -8.846  -0.811  1.00 0.00 ? 68 ARG A CA   8  
ATOM 7926  C C    . ARG A 1 68 ? -12.873 -8.324  0.184   1.00 0.00 ? 68 ARG A C    8  
ATOM 7927  O O    . ARG A 1 68 ? -13.773 -9.054  0.599   1.00 0.00 ? 68 ARG A O    8  
ATOM 7928  C CB   . ARG A 1 68 ? -12.229 -10.252 -1.273  1.00 0.00 ? 68 ARG A CB   8  
ATOM 7929  C CG   . ARG A 1 68 ? -11.480 -10.714 -2.512  1.00 0.00 ? 68 ARG A CG   8  
ATOM 7930  C CD   . ARG A 1 68 ? -12.343 -10.599 -3.758  1.00 0.00 ? 68 ARG A CD   8  
ATOM 7931  N NE   . ARG A 1 68 ? -12.599 -9.208  -4.121  1.00 0.00 ? 68 ARG A NE   8  
ATOM 7932  C CZ   . ARG A 1 68 ? -13.038 -8.828  -5.316  1.00 0.00 ? 68 ARG A CZ   8  
ATOM 7933  N NH1  . ARG A 1 68 ? -13.269 -9.732  -6.258  1.00 0.00 ? 68 ARG A NH1  8  
ATOM 7934  N NH2  . ARG A 1 68 ? -13.248 -7.543  -5.569  1.00 0.00 ? 68 ARG A NH2  8  
ATOM 7935  H H    . ARG A 1 68 ? -10.362 -9.345  0.618   1.00 0.00 ? 68 ARG A H    8  
ATOM 7936  H HA   . ARG A 1 68 ? -11.818 -8.189  -1.667  1.00 0.00 ? 68 ARG A HA   8  
ATOM 7937  H HB2  . ARG A 1 68 ? -12.026 -10.950 -0.475  1.00 0.00 ? 68 ARG A HB2  8  
ATOM 7938  H HB3  . ARG A 1 68 ? -13.287 -10.267 -1.492  1.00 0.00 ? 68 ARG A HB3  8  
ATOM 7939  H HG2  . ARG A 1 68 ? -10.600 -10.101 -2.638  1.00 0.00 ? 68 ARG A HG2  8  
ATOM 7940  H HG3  . ARG A 1 68 ? -11.188 -11.745 -2.380  1.00 0.00 ? 68 ARG A HG3  8  
ATOM 7941  H HD2  . ARG A 1 68 ? -11.836 -11.086 -4.578  1.00 0.00 ? 68 ARG A HD2  8  
ATOM 7942  H HD3  . ARG A 1 68 ? -13.285 -11.093 -3.574  1.00 0.00 ? 68 ARG A HD3  8  
ATOM 7943  H HE   . ARG A 1 68 ? -12.435 -8.524  -3.439  1.00 0.00 ? 68 ARG A HE   8  
ATOM 7944  H HH11 . ARG A 1 68 ? -13.112 -10.701 -6.070  1.00 0.00 ? 68 ARG A HH11 8  
ATOM 7945  H HH12 . ARG A 1 68 ? -13.600 -9.444  -7.157  1.00 0.00 ? 68 ARG A HH12 8  
ATOM 7946  H HH21 . ARG A 1 68 ? -13.075 -6.859  -4.861  1.00 0.00 ? 68 ARG A HH21 8  
ATOM 7947  H HH22 . ARG A 1 68 ? -13.578 -7.259  -6.469  1.00 0.00 ? 68 ARG A HH22 8  
ATOM 7948  N N    . ASN A 1 69 ? -12.737 -7.057  0.563   1.00 0.00 ? 69 ASN A N    8  
ATOM 7949  C CA   . ASN A 1 69 ? -13.661 -6.441  1.509   1.00 0.00 ? 69 ASN A CA   8  
ATOM 7950  C C    . ASN A 1 69 ? -14.011 -5.018  1.085   1.00 0.00 ? 69 ASN A C    8  
ATOM 7951  O O    . ASN A 1 69 ? -13.175 -4.296  0.542   1.00 0.00 ? 69 ASN A O    8  
ATOM 7952  C CB   . ASN A 1 69 ? -13.055 -6.431  2.913   1.00 0.00 ? 69 ASN A CB   8  
ATOM 7953  C CG   . ASN A 1 69 ? -13.028 -7.810  3.541   1.00 0.00 ? 69 ASN A CG   8  
ATOM 7954  O OD1  . ASN A 1 69 ? -14.024 -8.270  4.100   1.00 0.00 ? 69 ASN A OD1  8  
ATOM 7955  N ND2  . ASN A 1 69 ? -11.884 -8.478  3.452   1.00 0.00 ? 69 ASN A ND2  8  
ATOM 7956  H H    . ASN A 1 69 ? -12.000 -6.525  0.198   1.00 0.00 ? 69 ASN A H    8  
ATOM 7957  H HA   . ASN A 1 69 ? -14.564 -7.032  1.522   1.00 0.00 ? 69 ASN A HA   8  
ATOM 7958  H HB2  . ASN A 1 69 ? -12.042 -6.061  2.859   1.00 0.00 ? 69 ASN A HB2  8  
ATOM 7959  H HB3  . ASN A 1 69 ? -13.639 -5.778  3.546   1.00 0.00 ? 69 ASN A HB3  8  
ATOM 7960  H HD21 . ASN A 1 69 ? -11.132 -8.049  2.993   1.00 0.00 ? 69 ASN A HD21 8  
ATOM 7961  H HD22 . ASN A 1 69 ? -11.838 -9.373  3.848   1.00 0.00 ? 69 ASN A HD22 8  
ATOM 7962  N N    . PRO A 1 70 ? -15.263 -4.602  1.328   1.00 0.00 ? 70 PRO A N    8  
ATOM 7963  C CA   . PRO A 1 70 ? -15.740 -3.261  0.971   1.00 0.00 ? 70 PRO A CA   8  
ATOM 7964  C C    . PRO A 1 70 ? -14.851 -2.153  1.527   1.00 0.00 ? 70 PRO A C    8  
ATOM 7965  O O    . PRO A 1 70 ? -14.603 -2.084  2.731   1.00 0.00 ? 70 PRO A O    8  
ATOM 7966  C CB   . PRO A 1 70 ? -17.131 -3.198  1.608   1.00 0.00 ? 70 PRO A CB   8  
ATOM 7967  C CG   . PRO A 1 70 ? -17.564 -4.619  1.717   1.00 0.00 ? 70 PRO A CG   8  
ATOM 7968  C CD   . PRO A 1 70 ? -16.313 -5.413  1.968   1.00 0.00 ? 70 PRO A CD   8  
ATOM 7969  H HA   . PRO A 1 70 ? -15.827 -3.146  -0.099  1.00 0.00 ? 70 PRO A HA   8  
ATOM 7970  H HB2  . PRO A 1 70 ? -17.065 -2.728  2.578   1.00 0.00 ? 70 PRO A HB2  8  
ATOM 7971  H HB3  . PRO A 1 70 ? -17.796 -2.632  0.972   1.00 0.00 ? 70 PRO A HB3  8  
ATOM 7972  H HG2  . PRO A 1 70 ? -18.252 -4.731  2.543   1.00 0.00 ? 70 PRO A HG2  8  
ATOM 7973  H HG3  . PRO A 1 70 ? -18.029 -4.934  0.795   1.00 0.00 ? 70 PRO A HG3  8  
ATOM 7974  H HD2  . PRO A 1 70 ? -16.133 -5.509  3.029   1.00 0.00 ? 70 PRO A HD2  8  
ATOM 7975  H HD3  . PRO A 1 70 ? -16.384 -6.386  1.506   1.00 0.00 ? 70 PRO A HD3  8  
ATOM 7976  N N    . PHE A 1 71 ? -14.380 -1.283  0.639   1.00 0.00 ? 71 PHE A N    8  
ATOM 7977  C CA   . PHE A 1 71 ? -13.524 -0.169  1.032   1.00 0.00 ? 71 PHE A CA   8  
ATOM 7978  C C    . PHE A 1 71 ? -13.979 1.120   0.340   1.00 0.00 ? 71 PHE A C    8  
ATOM 7979  O O    . PHE A 1 71 ? -15.000 1.697   0.713   1.00 0.00 ? 71 PHE A O    8  
ATOM 7980  C CB   . PHE A 1 71 ? -12.065 -0.483  0.697   1.00 0.00 ? 71 PHE A CB   8  
ATOM 7981  C CG   . PHE A 1 71 ? -11.560 -1.744  1.337   1.00 0.00 ? 71 PHE A CG   8  
ATOM 7982  C CD1  . PHE A 1 71 ? -11.959 -2.097  2.616   1.00 0.00 ? 71 PHE A CD1  8  
ATOM 7983  C CD2  . PHE A 1 71 ? -10.688 -2.578  0.657   1.00 0.00 ? 71 PHE A CD2  8  
ATOM 7984  C CE1  . PHE A 1 71 ? -11.496 -3.259  3.205   1.00 0.00 ? 71 PHE A CE1  8  
ATOM 7985  C CE2  . PHE A 1 71 ? -10.222 -3.740  1.240   1.00 0.00 ? 71 PHE A CE2  8  
ATOM 7986  C CZ   . PHE A 1 71 ? -10.627 -4.082  2.516   1.00 0.00 ? 71 PHE A CZ   8  
ATOM 7987  H H    . PHE A 1 71 ? -14.619 -1.390  -0.305  1.00 0.00 ? 71 PHE A H    8  
ATOM 7988  H HA   . PHE A 1 71 ? -13.618 -0.042  2.102   1.00 0.00 ? 71 PHE A HA   8  
ATOM 7989  H HB2  . PHE A 1 71 ? -11.962 -0.593  -0.371  1.00 0.00 ? 71 PHE A HB2  8  
ATOM 7990  H HB3  . PHE A 1 71 ? -11.445 0.335   1.033   1.00 0.00 ? 71 PHE A HB3  8  
ATOM 7991  H HD1  . PHE A 1 71 ? -12.639 -1.455  3.156   1.00 0.00 ? 71 PHE A HD1  8  
ATOM 7992  H HD2  . PHE A 1 71 ? -10.372 -2.312  -0.341  1.00 0.00 ? 71 PHE A HD2  8  
ATOM 7993  H HE1  . PHE A 1 71 ? -11.814 -3.523  4.203   1.00 0.00 ? 71 PHE A HE1  8  
ATOM 7994  H HE2  . PHE A 1 71 ? -9.543  -4.382  0.699   1.00 0.00 ? 71 PHE A HE2  8  
ATOM 7995  H HZ   . PHE A 1 71 ? -10.264 -4.990  2.974   1.00 0.00 ? 71 PHE A HZ   8  
ATOM 7996  N N    . HIS A 1 72 ? -13.233 1.568   -0.672  1.00 0.00 ? 72 HIS A N    8  
ATOM 7997  C CA   . HIS A 1 72 ? -13.590 2.779   -1.400  1.00 0.00 ? 72 HIS A CA   8  
ATOM 7998  C C    . HIS A 1 72 ? -15.085 2.806   -1.704  1.00 0.00 ? 72 HIS A C    8  
ATOM 7999  O O    . HIS A 1 72 ? -15.551 2.141   -2.629  1.00 0.00 ? 72 HIS A O    8  
ATOM 8000  C CB   . HIS A 1 72 ? -12.791 2.866   -2.702  1.00 0.00 ? 72 HIS A CB   8  
ATOM 8001  C CG   . HIS A 1 72 ? -13.055 4.114   -3.485  1.00 0.00 ? 72 HIS A CG   8  
ATOM 8002  N ND1  . HIS A 1 72 ? -13.274 4.117   -4.847  1.00 0.00 ? 72 HIS A ND1  8  
ATOM 8003  C CD2  . HIS A 1 72 ? -13.138 5.407   -3.091  1.00 0.00 ? 72 HIS A CD2  8  
ATOM 8004  C CE1  . HIS A 1 72 ? -13.478 5.357   -5.256  1.00 0.00 ? 72 HIS A CE1  8  
ATOM 8005  N NE2  . HIS A 1 72 ? -13.401 6.157   -4.210  1.00 0.00 ? 72 HIS A NE2  8  
ATOM 8006  H H    . HIS A 1 72 ? -12.432 1.076   -0.940  1.00 0.00 ? 72 HIS A H    8  
ATOM 8007  H HA   . HIS A 1 72 ? -13.345 3.627   -0.778  1.00 0.00 ? 72 HIS A HA   8  
ATOM 8008  H HB2  . HIS A 1 72 ? -11.737 2.833   -2.474  1.00 0.00 ? 72 HIS A HB2  8  
ATOM 8009  H HB3  . HIS A 1 72 ? -13.044 2.021   -3.327  1.00 0.00 ? 72 HIS A HB3  8  
ATOM 8010  H HD1  . HIS A 1 72 ? -13.278 3.328   -5.428  1.00 0.00 ? 72 HIS A HD1  8  
ATOM 8011  H HD2  . HIS A 1 72 ? -13.018 5.778   -2.082  1.00 0.00 ? 72 HIS A HD2  8  
ATOM 8012  H HE1  . HIS A 1 72 ? -13.675 5.663   -6.273  1.00 0.00 ? 72 HIS A HE1  8  
ATOM 8013  H HE2  . HIS A 1 72 ? -13.536 7.128   -4.228  1.00 0.00 ? 72 HIS A HE2  8  
ATOM 8014  N N    . ALA A 1 73 ? -15.831 3.576   -0.919  1.00 0.00 ? 73 ALA A N    8  
ATOM 8015  C CA   . ALA A 1 73 ? -17.273 3.687   -1.106  1.00 0.00 ? 73 ALA A CA   8  
ATOM 8016  C C    . ALA A 1 73 ? -17.938 2.315   -1.064  1.00 0.00 ? 73 ALA A C    8  
ATOM 8017  O O    . ALA A 1 73 ? -18.806 2.054   -1.923  1.00 0.00 ? 73 ALA A O    8  
ATOM 8018  C CB   . ALA A 1 73 ? -17.583 4.385   -2.422  1.00 0.00 ? 73 ALA A CB   8  
ATOM 8019  O OXT  . ALA A 1 73 ? -17.585 1.514   -0.174  1.00 0.00 ? 73 ALA A OXT  8  
ATOM 8020  H H    . ALA A 1 73 ? -15.402 4.082   -0.197  1.00 0.00 ? 73 ALA A H    8  
ATOM 8021  H HA   . ALA A 1 73 ? -17.668 4.292   -0.303  1.00 0.00 ? 73 ALA A HA   8  
ATOM 8022  H HB1  . ALA A 1 73 ? -16.737 4.986   -2.719  1.00 0.00 ? 73 ALA A HB1  8  
ATOM 8023  H HB2  . ALA A 1 73 ? -18.449 5.018   -2.298  1.00 0.00 ? 73 ALA A HB2  8  
ATOM 8024  H HB3  . ALA A 1 73 ? -17.784 3.645   -3.183  1.00 0.00 ? 73 ALA A HB3  8  
ATOM 8025  N N    . GLU A 1 1  ? -4.317  5.698   12.190  1.00 0.00 ? 1  GLU A N    9  
ATOM 8026  C CA   . GLU A 1 1  ? -4.801  4.832   11.083  1.00 0.00 ? 1  GLU A CA   9  
ATOM 8027  C C    . GLU A 1 1  ? -3.718  3.858   10.632  1.00 0.00 ? 1  GLU A C    9  
ATOM 8028  O O    . GLU A 1 1  ? -2.617  3.839   11.184  1.00 0.00 ? 1  GLU A O    9  
ATOM 8029  C CB   . GLU A 1 1  ? -5.226  5.725   9.916   1.00 0.00 ? 1  GLU A CB   9  
ATOM 8030  C CG   . GLU A 1 1  ? -6.698  6.103   9.943   1.00 0.00 ? 1  GLU A CG   9  
ATOM 8031  C CD   . GLU A 1 1  ? -7.416  5.744   8.657   1.00 0.00 ? 1  GLU A CD   9  
ATOM 8032  O OE1  . GLU A 1 1  ? -6.837  4.994   7.842   1.00 0.00 ? 1  GLU A OE1  9  
ATOM 8033  O OE2  . GLU A 1 1  ? -8.558  6.211   8.465   1.00 0.00 ? 1  GLU A OE2  9  
ATOM 8034  H H1   . GLU A 1 1  ? -5.040  5.693   12.936  1.00 0.00 ? 1  GLU A H1   9  
ATOM 8035  H H2   . GLU A 1 1  ? -4.179  6.655   11.806  1.00 0.00 ? 1  GLU A H2   9  
ATOM 8036  H H3   . GLU A 1 1  ? -3.421  5.300   12.536  1.00 0.00 ? 1  GLU A H3   9  
ATOM 8037  H HA   . GLU A 1 1  ? -5.655  4.273   11.432  1.00 0.00 ? 1  GLU A HA   9  
ATOM 8038  H HB2  . GLU A 1 1  ? -4.643  6.634   9.942   1.00 0.00 ? 1  GLU A HB2  9  
ATOM 8039  H HB3  . GLU A 1 1  ? -5.026  5.207   8.990   1.00 0.00 ? 1  GLU A HB3  9  
ATOM 8040  H HG2  . GLU A 1 1  ? -7.174  5.582   10.760  1.00 0.00 ? 1  GLU A HG2  9  
ATOM 8041  H HG3  . GLU A 1 1  ? -6.780  7.168   10.099  1.00 0.00 ? 1  GLU A HG3  9  
ATOM 8042  N N    . ALA A 1 2  ? -4.037  3.052   9.627   1.00 0.00 ? 2  ALA A N    9  
ATOM 8043  C CA   . ALA A 1 2  ? -3.092  2.075   9.101   1.00 0.00 ? 2  ALA A CA   9  
ATOM 8044  C C    . ALA A 1 2  ? -2.017  2.752   8.256   1.00 0.00 ? 2  ALA A C    9  
ATOM 8045  O O    . ALA A 1 2  ? -0.824  2.602   8.517   1.00 0.00 ? 2  ALA A O    9  
ATOM 8046  C CB   . ALA A 1 2  ? -3.825  1.020   8.288   1.00 0.00 ? 2  ALA A CB   9  
ATOM 8047  H H    . ALA A 1 2  ? -4.930  3.115   9.228   1.00 0.00 ? 2  ALA A H    9  
ATOM 8048  H HA   . ALA A 1 2  ? -2.619  1.585   9.940   1.00 0.00 ? 2  ALA A HA   9  
ATOM 8049  H HB1  . ALA A 1 2  ? -3.692  0.053   8.749   1.00 0.00 ? 2  ALA A HB1  9  
ATOM 8050  H HB2  . ALA A 1 2  ? -3.428  0.999   7.284   1.00 0.00 ? 2  ALA A HB2  9  
ATOM 8051  H HB3  . ALA A 1 2  ? -4.878  1.260   8.254   1.00 0.00 ? 2  ALA A HB3  9  
ATOM 8052  N N    . GLY A 1 3  ? -2.448  3.501   7.245   1.00 0.00 ? 3  GLY A N    9  
ATOM 8053  C CA   . GLY A 1 3  ? -1.508  4.193   6.382   1.00 0.00 ? 3  GLY A CA   9  
ATOM 8054  C C    . GLY A 1 3  ? -1.719  5.697   6.392   1.00 0.00 ? 3  GLY A C    9  
ATOM 8055  O O    . GLY A 1 3  ? -1.475  6.351   7.407   1.00 0.00 ? 3  GLY A O    9  
ATOM 8056  H H    . GLY A 1 3  ? -3.411  3.587   7.086   1.00 0.00 ? 3  GLY A H    9  
ATOM 8057  H HA2  . GLY A 1 3  ? -0.503  3.977   6.720   1.00 0.00 ? 3  GLY A HA2  9  
ATOM 8058  H HA3  . GLY A 1 3  ? -1.623  3.827   5.373   1.00 0.00 ? 3  GLY A HA3  9  
ATOM 8059  N N    . GLU A 1 4  ? -2.179  6.254   5.270   1.00 0.00 ? 4  GLU A N    9  
ATOM 8060  C CA   . GLU A 1 4  ? -2.423  7.691   5.181   1.00 0.00 ? 4  GLU A CA   9  
ATOM 8061  C C    . GLU A 1 4  ? -1.115  8.479   5.112   1.00 0.00 ? 4  GLU A C    9  
ATOM 8062  O O    . GLU A 1 4  ? -0.918  9.290   4.207   1.00 0.00 ? 4  GLU A O    9  
ATOM 8063  C CB   . GLU A 1 4  ? -3.250  8.158   6.380   1.00 0.00 ? 4  GLU A CB   9  
ATOM 8064  C CG   . GLU A 1 4  ? -4.354  7.188   6.769   1.00 0.00 ? 4  GLU A CG   9  
ATOM 8065  C CD   . GLU A 1 4  ? -5.113  6.658   5.568   1.00 0.00 ? 4  GLU A CD   9  
ATOM 8066  O OE1  . GLU A 1 4  ? -4.541  5.838   4.820   1.00 0.00 ? 4  GLU A OE1  9  
ATOM 8067  O OE2  . GLU A 1 4  ? -6.278  7.064   5.376   1.00 0.00 ? 4  GLU A OE2  9  
ATOM 8068  H H    . GLU A 1 4  ? -2.365  5.689   4.488   1.00 0.00 ? 4  GLU A H    9  
ATOM 8069  H HA   . GLU A 1 4  ? -2.985  7.874   4.278   1.00 0.00 ? 4  GLU A HA   9  
ATOM 8070  H HB2  . GLU A 1 4  ? -2.595  8.284   7.229   1.00 0.00 ? 4  GLU A HB2  9  
ATOM 8071  H HB3  . GLU A 1 4  ? -3.704  9.109   6.141   1.00 0.00 ? 4  GLU A HB3  9  
ATOM 8072  H HG2  . GLU A 1 4  ? -3.913  6.353   7.293   1.00 0.00 ? 4  GLU A HG2  9  
ATOM 8073  H HG3  . GLU A 1 4  ? -5.049  7.696   7.421   1.00 0.00 ? 4  GLU A HG3  9  
ATOM 8074  N N    . GLU A 1 5  ? -0.227  8.244   6.075   1.00 0.00 ? 5  GLU A N    9  
ATOM 8075  C CA   . GLU A 1 5  ? 1.054   8.941   6.120   1.00 0.00 ? 5  GLU A CA   9  
ATOM 8076  C C    . GLU A 1 5  ? 1.960   8.496   4.977   1.00 0.00 ? 5  GLU A C    9  
ATOM 8077  O O    . GLU A 1 5  ? 1.537   7.757   4.088   1.00 0.00 ? 5  GLU A O    9  
ATOM 8078  C CB   . GLU A 1 5  ? 1.747   8.692   7.460   1.00 0.00 ? 5  GLU A CB   9  
ATOM 8079  C CG   . GLU A 1 5  ? 0.806   8.747   8.652   1.00 0.00 ? 5  GLU A CG   9  
ATOM 8080  C CD   . GLU A 1 5  ? 1.543   8.740   9.977   1.00 0.00 ? 5  GLU A CD   9  
ATOM 8081  O OE1  . GLU A 1 5  ? 2.236   7.741   10.265  1.00 0.00 ? 5  GLU A OE1  9  
ATOM 8082  O OE2  . GLU A 1 5  ? 1.427   9.732   10.727  1.00 0.00 ? 5  GLU A OE2  9  
ATOM 8083  H H    . GLU A 1 5  ? -0.440  7.593   6.775   1.00 0.00 ? 5  GLU A H    9  
ATOM 8084  H HA   . GLU A 1 5  ? 0.859   9.998   6.018   1.00 0.00 ? 5  GLU A HA   9  
ATOM 8085  H HB2  . GLU A 1 5  ? 2.208   7.715   7.438   1.00 0.00 ? 5  GLU A HB2  9  
ATOM 8086  H HB3  . GLU A 1 5  ? 2.515   9.439   7.600   1.00 0.00 ? 5  GLU A HB3  9  
ATOM 8087  H HG2  . GLU A 1 5  ? 0.219   9.651   8.590   1.00 0.00 ? 5  GLU A HG2  9  
ATOM 8088  H HG3  . GLU A 1 5  ? 0.150   7.890   8.617   1.00 0.00 ? 5  GLU A HG3  9  
ATOM 8089  N N    . CYS A 1 6  ? 3.208   8.956   5.003   1.00 0.00 ? 6  CYS A N    9  
ATOM 8090  C CA   . CYS A 1 6  ? 4.169   8.609   3.963   1.00 0.00 ? 6  CYS A CA   9  
ATOM 8091  C C    . CYS A 1 6  ? 3.773   9.254   2.638   1.00 0.00 ? 6  CYS A C    9  
ATOM 8092  O O    . CYS A 1 6  ? 2.612   9.198   2.236   1.00 0.00 ? 6  CYS A O    9  
ATOM 8093  C CB   . CYS A 1 6  ? 4.253   7.089   3.808   1.00 0.00 ? 6  CYS A CB   9  
ATOM 8094  S SG   . CYS A 1 6  ? 5.618   6.518   2.746   1.00 0.00 ? 6  CYS A SG   9  
ATOM 8095  H H    . CYS A 1 6  ? 3.486   9.546   5.734   1.00 0.00 ? 6  CYS A H    9  
ATOM 8096  H HA   . CYS A 1 6  ? 5.135   8.988   4.262   1.00 0.00 ? 6  CYS A HA   9  
ATOM 8097  H HB2  . CYS A 1 6  ? 4.389   6.643   4.782   1.00 0.00 ? 6  CYS A HB2  9  
ATOM 8098  H HB3  . CYS A 1 6  ? 3.329   6.727   3.379   1.00 0.00 ? 6  CYS A HB3  9  
ATOM 8099  N N    . ASP A 1 7  ? 4.737   9.878   1.968   1.00 0.00 ? 7  ASP A N    9  
ATOM 8100  C CA   . ASP A 1 7  ? 4.467   10.541  0.697   1.00 0.00 ? 7  ASP A CA   9  
ATOM 8101  C C    . ASP A 1 7  ? 5.482   10.145  -0.372  1.00 0.00 ? 7  ASP A C    9  
ATOM 8102  O O    . ASP A 1 7  ? 6.103   11.005  -0.997  1.00 0.00 ? 7  ASP A O    9  
ATOM 8103  C CB   . ASP A 1 7  ? 4.475   12.059  0.882   1.00 0.00 ? 7  ASP A CB   9  
ATOM 8104  C CG   . ASP A 1 7  ? 3.324   12.542  1.742   1.00 0.00 ? 7  ASP A CG   9  
ATOM 8105  O OD1  . ASP A 1 7  ? 3.484   12.584  2.980   1.00 0.00 ? 7  ASP A OD1  9  
ATOM 8106  O OD2  . ASP A 1 7  ? 2.262   12.879  1.178   1.00 0.00 ? 7  ASP A OD2  9  
ATOM 8107  H H    . ASP A 1 7  ? 5.644   9.900   2.339   1.00 0.00 ? 7  ASP A H    9  
ATOM 8108  H HA   . ASP A 1 7  ? 3.485   10.236  0.369   1.00 0.00 ? 7  ASP A HA   9  
ATOM 8109  H HB2  . ASP A 1 7  ? 5.401   12.353  1.354   1.00 0.00 ? 7  ASP A HB2  9  
ATOM 8110  H HB3  . ASP A 1 7  ? 4.403   12.534  -0.085  1.00 0.00 ? 7  ASP A HB3  9  
ATOM 8111  N N    . CYS A 1 8  ? 5.641   8.843   -0.586  1.00 0.00 ? 8  CYS A N    9  
ATOM 8112  C CA   . CYS A 1 8  ? 6.577   8.349   -1.591  1.00 0.00 ? 8  CYS A CA   9  
ATOM 8113  C C    . CYS A 1 8  ? 5.878   7.435   -2.600  1.00 0.00 ? 8  CYS A C    9  
ATOM 8114  O O    . CYS A 1 8  ? 6.439   7.116   -3.649  1.00 0.00 ? 8  CYS A O    9  
ATOM 8115  C CB   . CYS A 1 8  ? 7.724   7.577   -0.940  1.00 0.00 ? 8  CYS A CB   9  
ATOM 8116  S SG   . CYS A 1 8  ? 8.750   8.526   0.229   1.00 0.00 ? 8  CYS A SG   9  
ATOM 8117  H H    . CYS A 1 8  ? 5.116   8.203   -0.062  1.00 0.00 ? 8  CYS A H    9  
ATOM 8118  H HA   . CYS A 1 8  ? 6.982   9.202   -2.115  1.00 0.00 ? 8  CYS A HA   9  
ATOM 8119  H HB2  . CYS A 1 8  ? 7.318   6.734   -0.402  1.00 0.00 ? 8  CYS A HB2  9  
ATOM 8120  H HB3  . CYS A 1 8  ? 8.370   7.217   -1.721  1.00 0.00 ? 8  CYS A HB3  9  
ATOM 8121  N N    . GLY A 1 9  ? 4.668   6.994   -2.267  1.00 0.00 ? 9  GLY A N    9  
ATOM 8122  C CA   . GLY A 1 9  ? 3.928   6.102   -3.142  1.00 0.00 ? 9  GLY A CA   9  
ATOM 8123  C C    . GLY A 1 9  ? 3.587   4.810   -2.433  1.00 0.00 ? 9  GLY A C    9  
ATOM 8124  O O    . GLY A 1 9  ? 3.808   4.692   -1.231  1.00 0.00 ? 9  GLY A O    9  
ATOM 8125  H H    . GLY A 1 9  ? 4.279   7.259   -1.410  1.00 0.00 ? 9  GLY A H    9  
ATOM 8126  H HA2  . GLY A 1 9  ? 3.015   6.589   -3.454  1.00 0.00 ? 9  GLY A HA2  9  
ATOM 8127  H HA3  . GLY A 1 9  ? 4.528   5.880   -4.011  1.00 0.00 ? 9  GLY A HA3  9  
ATOM 8128  N N    . SER A 1 10 ? 3.051   3.832   -3.151  1.00 0.00 ? 10 SER A N    9  
ATOM 8129  C CA   . SER A 1 10 ? 2.712   2.573   -2.510  1.00 0.00 ? 10 SER A CA   9  
ATOM 8130  C C    . SER A 1 10 ? 2.327   1.473   -3.494  1.00 0.00 ? 10 SER A C    9  
ATOM 8131  O O    . SER A 1 10 ? 3.108   0.554   -3.740  1.00 0.00 ? 10 SER A O    9  
ATOM 8132  C CB   . SER A 1 10 ? 1.607   2.789   -1.482  1.00 0.00 ? 10 SER A CB   9  
ATOM 8133  O OG   . SER A 1 10 ? 2.134   3.276   -0.260  1.00 0.00 ? 10 SER A OG   9  
ATOM 8134  H H    . SER A 1 10 ? 2.884   3.957   -4.107  1.00 0.00 ? 10 SER A H    9  
ATOM 8135  H HA   . SER A 1 10 ? 3.584   2.247   -1.991  1.00 0.00 ? 10 SER A HA   9  
ATOM 8136  H HB2  . SER A 1 10 ? 0.899   3.510   -1.860  1.00 0.00 ? 10 SER A HB2  9  
ATOM 8137  H HB3  . SER A 1 10 ? 1.111   1.854   -1.303  1.00 0.00 ? 10 SER A HB3  9  
ATOM 8138  H HG   . SER A 1 10 ? 2.559   2.558   0.215   1.00 0.00 ? 10 SER A HG   9  
ATOM 8139  N N    . PRO A 1 11 ? 1.117   1.533   -4.056  1.00 0.00 ? 11 PRO A N    9  
ATOM 8140  C CA   . PRO A 1 11 ? 0.639   0.518   -4.994  1.00 0.00 ? 11 PRO A CA   9  
ATOM 8141  C C    . PRO A 1 11 ? 1.367   0.573   -6.329  1.00 0.00 ? 11 PRO A C    9  
ATOM 8142  O O    . PRO A 1 11 ? 1.056   1.398   -7.187  1.00 0.00 ? 11 PRO A O    9  
ATOM 8143  C CB   . PRO A 1 11 ? -0.838  0.864   -5.157  1.00 0.00 ? 11 PRO A CB   9  
ATOM 8144  C CG   . PRO A 1 11 ? -0.916  2.323   -4.872  1.00 0.00 ? 11 PRO A CG   9  
ATOM 8145  C CD   . PRO A 1 11 ? 0.117   2.582   -3.813  1.00 0.00 ? 11 PRO A CD   9  
ATOM 8146  H HA   . PRO A 1 11 ? 0.733   -0.475  -4.579  1.00 0.00 ? 11 PRO A HA   9  
ATOM 8147  H HB2  . PRO A 1 11 ? -1.153  0.637   -6.161  1.00 0.00 ? 11 PRO A HB2  9  
ATOM 8148  H HB3  . PRO A 1 11 ? -1.419  0.294   -4.448  1.00 0.00 ? 11 PRO A HB3  9  
ATOM 8149  H HG2  . PRO A 1 11 ? -0.689  2.885   -5.766  1.00 0.00 ? 11 PRO A HG2  9  
ATOM 8150  H HG3  . PRO A 1 11 ? -1.900  2.575   -4.506  1.00 0.00 ? 11 PRO A HG3  9  
ATOM 8151  H HD2  . PRO A 1 11 ? 0.553   3.563   -3.937  1.00 0.00 ? 11 PRO A HD2  9  
ATOM 8152  H HD3  . PRO A 1 11 ? -0.314  2.479   -2.828  1.00 0.00 ? 11 PRO A HD3  9  
ATOM 8153  N N    . GLY A 1 12 ? 2.352   -0.305  -6.487  1.00 0.00 ? 12 GLY A N    9  
ATOM 8154  C CA   . GLY A 1 12 ? 3.129   -0.334  -7.710  1.00 0.00 ? 12 GLY A CA   9  
ATOM 8155  C C    . GLY A 1 12 ? 4.411   0.450   -7.559  1.00 0.00 ? 12 GLY A C    9  
ATOM 8156  O O    . GLY A 1 12 ? 5.430   0.130   -8.172  1.00 0.00 ? 12 GLY A O    9  
ATOM 8157  H H    . GLY A 1 12 ? 2.563   -0.928  -5.757  1.00 0.00 ? 12 GLY A H    9  
ATOM 8158  H HA2  . GLY A 1 12 ? 3.367   -1.360  -7.954  1.00 0.00 ? 12 GLY A HA2  9  
ATOM 8159  H HA3  . GLY A 1 12 ? 2.546   0.094   -8.511  1.00 0.00 ? 12 GLY A HA3  9  
ATOM 8160  N N    . ASN A 1 13 ? 4.353   1.475   -6.720  1.00 0.00 ? 13 ASN A N    9  
ATOM 8161  C CA   . ASN A 1 13 ? 5.504   2.319   -6.447  1.00 0.00 ? 13 ASN A CA   9  
ATOM 8162  C C    . ASN A 1 13 ? 5.732   2.405   -4.943  1.00 0.00 ? 13 ASN A C    9  
ATOM 8163  O O    . ASN A 1 13 ? 5.712   3.489   -4.361  1.00 0.00 ? 13 ASN A O    9  
ATOM 8164  C CB   . ASN A 1 13 ? 5.293   3.718   -7.028  1.00 0.00 ? 13 ASN A CB   9  
ATOM 8165  C CG   . ASN A 1 13 ? 5.083   3.695   -8.530  1.00 0.00 ? 13 ASN A CG   9  
ATOM 8166  O OD1  . ASN A 1 13 ? 3.950   3.671   -9.010  1.00 0.00 ? 13 ASN A OD1  9  
ATOM 8167  N ND2  . ASN A 1 13 ? 6.179   3.701   -9.280  1.00 0.00 ? 13 ASN A ND2  9  
ATOM 8168  H H    . ASN A 1 13 ? 3.509   1.661   -6.258  1.00 0.00 ? 13 ASN A H    9  
ATOM 8169  H HA   . ASN A 1 13 ? 6.369   1.867   -6.909  1.00 0.00 ? 13 ASN A HA   9  
ATOM 8170  H HB2  . ASN A 1 13 ? 4.423   4.165   -6.569  1.00 0.00 ? 13 ASN A HB2  9  
ATOM 8171  H HB3  . ASN A 1 13 ? 6.160   4.325   -6.813  1.00 0.00 ? 13 ASN A HB3  9  
ATOM 8172  H HD21 . ASN A 1 13 ? 7.049   3.721   -8.829  1.00 0.00 ? 13 ASN A HD21 9  
ATOM 8173  H HD22 . ASN A 1 13 ? 6.073   3.687   -10.254 1.00 0.00 ? 13 ASN A HD22 9  
ATOM 8174  N N    . PRO A 1 14 ? 5.952   1.245   -4.300  1.00 0.00 ? 14 PRO A N    9  
ATOM 8175  C CA   . PRO A 1 14 ? 6.187   1.136   -2.875  1.00 0.00 ? 14 PRO A CA   9  
ATOM 8176  C C    . PRO A 1 14 ? 6.677   2.432   -2.250  1.00 0.00 ? 14 PRO A C    9  
ATOM 8177  O O    . PRO A 1 14 ? 7.680   3.006   -2.673  1.00 0.00 ? 14 PRO A O    9  
ATOM 8178  C CB   . PRO A 1 14 ? 7.252   0.050   -2.834  1.00 0.00 ? 14 PRO A CB   9  
ATOM 8179  C CG   . PRO A 1 14 ? 6.925   -0.850  -3.993  1.00 0.00 ? 14 PRO A CG   9  
ATOM 8180  C CD   . PRO A 1 14 ? 5.999   -0.083  -4.914  1.00 0.00 ? 14 PRO A CD   9  
ATOM 8181  H HA   . PRO A 1 14 ? 5.305   0.796   -2.353  1.00 0.00 ? 14 PRO A HA   9  
ATOM 8182  H HB2  . PRO A 1 14 ? 8.230   0.497   -2.942  1.00 0.00 ? 14 PRO A HB2  9  
ATOM 8183  H HB3  . PRO A 1 14 ? 7.193   -0.479  -1.898  1.00 0.00 ? 14 PRO A HB3  9  
ATOM 8184  H HG2  . PRO A 1 14 ? 7.831   -1.114  -4.516  1.00 0.00 ? 14 PRO A HG2  9  
ATOM 8185  H HG3  . PRO A 1 14 ? 6.431   -1.739  -3.634  1.00 0.00 ? 14 PRO A HG3  9  
ATOM 8186  H HD2  . PRO A 1 14 ? 6.407   -0.036  -5.910  1.00 0.00 ? 14 PRO A HD2  9  
ATOM 8187  H HD3  . PRO A 1 14 ? 5.018   -0.537  -4.923  1.00 0.00 ? 14 PRO A HD3  9  
ATOM 8188  N N    . CYS A 1 15 ? 5.942   2.891   -1.247  1.00 0.00 ? 15 CYS A N    9  
ATOM 8189  C CA   . CYS A 1 15 ? 6.268   4.128   -0.558  1.00 0.00 ? 15 CYS A CA   9  
ATOM 8190  C C    . CYS A 1 15 ? 7.770   4.333   -0.433  1.00 0.00 ? 15 CYS A C    9  
ATOM 8191  O O    . CYS A 1 15 ? 8.399   3.882   0.521   1.00 0.00 ? 15 CYS A O    9  
ATOM 8192  C CB   . CYS A 1 15 ? 5.618   4.160   0.826   1.00 0.00 ? 15 CYS A CB   9  
ATOM 8193  S SG   . CYS A 1 15 ? 4.667   5.678   1.163   1.00 0.00 ? 15 CYS A SG   9  
ATOM 8194  H H    . CYS A 1 15 ? 5.147   2.389   -0.971  1.00 0.00 ? 15 CYS A H    9  
ATOM 8195  H HA   . CYS A 1 15 ? 5.866   4.940   -1.143  1.00 0.00 ? 15 CYS A HA   9  
ATOM 8196  H HB2  . CYS A 1 15 ? 4.942   3.323   0.917   1.00 0.00 ? 15 CYS A HB2  9  
ATOM 8197  H HB3  . CYS A 1 15 ? 6.387   4.078   1.581   1.00 0.00 ? 15 CYS A HB3  9  
ATOM 8198  N N    . CYS A 1 16 ? 8.324   5.059   -1.391  1.00 0.00 ? 16 CYS A N    9  
ATOM 8199  C CA   . CYS A 1 16 ? 9.740   5.397   -1.393  1.00 0.00 ? 16 CYS A CA   9  
ATOM 8200  C C    . CYS A 1 16 ? 10.632  4.286   -1.933  1.00 0.00 ? 16 CYS A C    9  
ATOM 8201  O O    . CYS A 1 16 ? 11.721  4.049   -1.410  1.00 0.00 ? 16 CYS A O    9  
ATOM 8202  C CB   . CYS A 1 16 ? 10.186  5.819   0.010   1.00 0.00 ? 16 CYS A CB   9  
ATOM 8203  S SG   . CYS A 1 16 ? 10.567  7.601   0.162   1.00 0.00 ? 16 CYS A SG   9  
ATOM 8204  H H    . CYS A 1 16 ? 7.752   5.415   -2.106  1.00 0.00 ? 16 CYS A H    9  
ATOM 8205  H HA   . CYS A 1 16 ? 9.847   6.237   -2.040  1.00 0.00 ? 16 CYS A HA   9  
ATOM 8206  H HB2  . CYS A 1 16 ? 9.403   5.594   0.716   1.00 0.00 ? 16 CYS A HB2  9  
ATOM 8207  H HB3  . CYS A 1 16 ? 11.075  5.264   0.279   1.00 0.00 ? 16 CYS A HB3  9  
ATOM 8208  N N    . ASP A 1 17 ? 10.193  3.638   -3.007  1.00 0.00 ? 17 ASP A N    9  
ATOM 8209  C CA   . ASP A 1 17 ? 10.983  2.583   -3.629  1.00 0.00 ? 17 ASP A CA   9  
ATOM 8210  C C    . ASP A 1 17 ? 12.218  3.174   -4.305  1.00 0.00 ? 17 ASP A C    9  
ATOM 8211  O O    . ASP A 1 17 ? 13.141  2.450   -4.683  1.00 0.00 ? 17 ASP A O    9  
ATOM 8212  C CB   . ASP A 1 17 ? 10.145  1.817   -4.656  1.00 0.00 ? 17 ASP A CB   9  
ATOM 8213  C CG   . ASP A 1 17 ? 9.244   2.730   -5.464  1.00 0.00 ? 17 ASP A CG   9  
ATOM 8214  O OD1  . ASP A 1 17 ? 8.575   3.593   -4.857  1.00 0.00 ? 17 ASP A OD1  9  
ATOM 8215  O OD2  . ASP A 1 17 ? 9.206   2.582   -6.703  1.00 0.00 ? 17 ASP A OD2  9  
ATOM 8216  H H    . ASP A 1 17 ? 9.333   3.892   -3.403  1.00 0.00 ? 17 ASP A H    9  
ATOM 8217  H HA   . ASP A 1 17 ? 11.300  1.902   -2.853  1.00 0.00 ? 17 ASP A HA   9  
ATOM 8218  H HB2  . ASP A 1 17 ? 10.807  1.302   -5.338  1.00 0.00 ? 17 ASP A HB2  9  
ATOM 8219  H HB3  . ASP A 1 17 ? 9.530   1.094   -4.144  1.00 0.00 ? 17 ASP A HB3  9  
ATOM 8220  N N    . ALA A 1 18 ? 12.222  4.498   -4.465  1.00 0.00 ? 18 ALA A N    9  
ATOM 8221  C CA   . ALA A 1 18 ? 13.332  5.199   -5.099  1.00 0.00 ? 18 ALA A CA   9  
ATOM 8222  C C    . ALA A 1 18 ? 13.220  5.131   -6.614  1.00 0.00 ? 18 ALA A C    9  
ATOM 8223  O O    . ALA A 1 18 ? 13.386  6.133   -7.310  1.00 0.00 ? 18 ALA A O    9  
ATOM 8224  C CB   . ALA A 1 18 ? 14.658  4.613   -4.638  1.00 0.00 ? 18 ALA A CB   9  
ATOM 8225  H H    . ALA A 1 18 ? 11.454  5.016   -4.157  1.00 0.00 ? 18 ALA A H    9  
ATOM 8226  H HA   . ALA A 1 18 ? 13.294  6.233   -4.790  1.00 0.00 ? 18 ALA A HA   9  
ATOM 8227  H HB1  . ALA A 1 18 ? 14.484  3.919   -3.829  1.00 0.00 ? 18 ALA A HB1  9  
ATOM 8228  H HB2  . ALA A 1 18 ? 15.303  5.409   -4.296  1.00 0.00 ? 18 ALA A HB2  9  
ATOM 8229  H HB3  . ALA A 1 18 ? 15.129  4.097   -5.461  1.00 0.00 ? 18 ALA A HB3  9  
ATOM 8230  N N    . ALA A 1 19 ? 12.938  3.938   -7.113  1.00 0.00 ? 19 ALA A N    9  
ATOM 8231  C CA   . ALA A 1 19 ? 12.801  3.711   -8.540  1.00 0.00 ? 19 ALA A CA   9  
ATOM 8232  C C    . ALA A 1 19 ? 12.259  2.314   -8.810  1.00 0.00 ? 19 ALA A C    9  
ATOM 8233  O O    . ALA A 1 19 ? 11.507  2.097   -9.760  1.00 0.00 ? 19 ALA A O    9  
ATOM 8234  C CB   . ALA A 1 19 ? 14.141  3.902   -9.223  1.00 0.00 ? 19 ALA A CB   9  
ATOM 8235  H H    . ALA A 1 19 ? 12.820  3.188   -6.503  1.00 0.00 ? 19 ALA A H    9  
ATOM 8236  H HA   . ALA A 1 19 ? 12.110  4.442   -8.934  1.00 0.00 ? 19 ALA A HA   9  
ATOM 8237  H HB1  . ALA A 1 19 ? 14.033  4.604   -10.034 1.00 0.00 ? 19 ALA A HB1  9  
ATOM 8238  H HB2  . ALA A 1 19 ? 14.485  2.953   -9.607  1.00 0.00 ? 19 ALA A HB2  9  
ATOM 8239  H HB3  . ALA A 1 19 ? 14.855  4.282   -8.507  1.00 0.00 ? 19 ALA A HB3  9  
ATOM 8240  N N    . THR A 1 20 ? 12.649  1.369   -7.960  1.00 0.00 ? 20 THR A N    9  
ATOM 8241  C CA   . THR A 1 20 ? 12.210  -0.009  -8.089  1.00 0.00 ? 20 THR A CA   9  
ATOM 8242  C C    . THR A 1 20 ? 11.936  -0.599  -6.712  1.00 0.00 ? 20 THR A C    9  
ATOM 8243  O O    . THR A 1 20 ? 12.813  -0.594  -5.851  1.00 0.00 ? 20 THR A O    9  
ATOM 8244  C CB   . THR A 1 20 ? 13.272  -0.834  -8.817  1.00 0.00 ? 20 THR A CB   9  
ATOM 8245  O OG1  . THR A 1 20 ? 13.182  -0.641  -10.218 1.00 0.00 ? 20 THR A OG1  9  
ATOM 8246  C CG2  . THR A 1 20 ? 13.167  -2.318  -8.549  1.00 0.00 ? 20 THR A CG2  9  
ATOM 8247  H H    . THR A 1 20 ? 13.248  1.606   -7.220  1.00 0.00 ? 20 THR A H    9  
ATOM 8248  H HA   . THR A 1 20 ? 11.297  -0.018  -8.665  1.00 0.00 ? 20 THR A HA   9  
ATOM 8249  H HB   . THR A 1 20 ? 14.250  -0.507  -8.493  1.00 0.00 ? 20 THR A HB   9  
ATOM 8250  H HG1  . THR A 1 20 ? 13.075  0.295   -10.406 1.00 0.00 ? 20 THR A HG1  9  
ATOM 8251  H HG21 . THR A 1 20 ? 12.127  -2.605  -8.518  1.00 0.00 ? 20 THR A HG21 9  
ATOM 8252  H HG22 . THR A 1 20 ? 13.632  -2.545  -7.600  1.00 0.00 ? 20 THR A HG22 9  
ATOM 8253  H HG23 . THR A 1 20 ? 13.668  -2.862  -9.335  1.00 0.00 ? 20 THR A HG23 9  
ATOM 8254  N N    . CYS A 1 21 ? 10.710  -1.089  -6.523  1.00 0.00 ? 21 CYS A N    9  
ATOM 8255  C CA   . CYS A 1 21 ? 10.277  -1.682  -5.254  1.00 0.00 ? 21 CYS A CA   9  
ATOM 8256  C C    . CYS A 1 21 ? 11.458  -2.071  -4.364  1.00 0.00 ? 21 CYS A C    9  
ATOM 8257  O O    . CYS A 1 21 ? 11.863  -3.233  -4.329  1.00 0.00 ? 21 CYS A O    9  
ATOM 8258  C CB   . CYS A 1 21 ? 9.401   -2.911  -5.523  1.00 0.00 ? 21 CYS A CB   9  
ATOM 8259  S SG   . CYS A 1 21 ? 7.931   -2.573  -6.549  1.00 0.00 ? 21 CYS A SG   9  
ATOM 8260  H H    . CYS A 1 21 ? 10.068  -1.044  -7.262  1.00 0.00 ? 21 CYS A H    9  
ATOM 8261  H HA   . CYS A 1 21 ? 9.686   -0.942  -4.737  1.00 0.00 ? 21 CYS A HA   9  
ATOM 8262  H HB2  . CYS A 1 21 ? 9.991   -3.657  -6.034  1.00 0.00 ? 21 CYS A HB2  9  
ATOM 8263  H HB3  . CYS A 1 21 ? 9.059   -3.314  -4.582  1.00 0.00 ? 21 CYS A HB3  9  
ATOM 8264  N N    . LYS A 1 22 ? 12.003  -1.092  -3.641  1.00 0.00 ? 22 LYS A N    9  
ATOM 8265  C CA   . LYS A 1 22 ? 13.132  -1.344  -2.749  1.00 0.00 ? 22 LYS A CA   9  
ATOM 8266  C C    . LYS A 1 22 ? 13.453  -0.127  -1.880  1.00 0.00 ? 22 LYS A C    9  
ATOM 8267  O O    . LYS A 1 22 ? 14.511  0.483   -2.031  1.00 0.00 ? 22 LYS A O    9  
ATOM 8268  C CB   . LYS A 1 22 ? 14.366  -1.738  -3.562  1.00 0.00 ? 22 LYS A CB   9  
ATOM 8269  C CG   . LYS A 1 22 ? 15.180  -2.855  -2.930  1.00 0.00 ? 22 LYS A CG   9  
ATOM 8270  C CD   . LYS A 1 22 ? 16.138  -2.319  -1.879  1.00 0.00 ? 22 LYS A CD   9  
ATOM 8271  C CE   . LYS A 1 22 ? 15.720  -2.739  -0.479  1.00 0.00 ? 22 LYS A CE   9  
ATOM 8272  N NZ   . LYS A 1 22 ? 15.800  -1.609  0.487   1.00 0.00 ? 22 LYS A NZ   9  
ATOM 8273  H H    . LYS A 1 22 ? 11.636  -0.185  -3.706  1.00 0.00 ? 22 LYS A H    9  
ATOM 8274  H HA   . LYS A 1 22 ? 12.863  -2.167  -2.105  1.00 0.00 ? 22 LYS A HA   9  
ATOM 8275  H HB2  . LYS A 1 22 ? 14.049  -2.063  -4.542  1.00 0.00 ? 22 LYS A HB2  9  
ATOM 8276  H HB3  . LYS A 1 22 ? 15.004  -0.873  -3.669  1.00 0.00 ? 22 LYS A HB3  9  
ATOM 8277  H HG2  . LYS A 1 22 ? 14.507  -3.559  -2.464  1.00 0.00 ? 22 LYS A HG2  9  
ATOM 8278  H HG3  . LYS A 1 22 ? 15.748  -3.354  -3.702  1.00 0.00 ? 22 LYS A HG3  9  
ATOM 8279  H HD2  . LYS A 1 22 ? 17.127  -2.703  -2.078  1.00 0.00 ? 22 LYS A HD2  9  
ATOM 8280  H HD3  . LYS A 1 22 ? 16.150  -1.240  -1.933  1.00 0.00 ? 22 LYS A HD3  9  
ATOM 8281  H HE2  . LYS A 1 22 ? 14.703  -3.100  -0.514  1.00 0.00 ? 22 LYS A HE2  9  
ATOM 8282  H HE3  . LYS A 1 22 ? 16.372  -3.533  -0.146  1.00 0.00 ? 22 LYS A HE3  9  
ATOM 8283  H HZ1  . LYS A 1 22 ? 14.861  -1.417  0.890   1.00 0.00 ? 22 LYS A HZ1  9  
ATOM 8284  H HZ2  . LYS A 1 22 ? 16.141  -0.752  0.007   1.00 0.00 ? 22 LYS A HZ2  9  
ATOM 8285  H HZ3  . LYS A 1 22 ? 16.456  -1.844  1.259   1.00 0.00 ? 22 LYS A HZ3  9  
ATOM 8286  N N    . LEU A 1 23 ? 12.549  0.224   -0.965  1.00 0.00 ? 23 LEU A N    9  
ATOM 8287  C CA   . LEU A 1 23 ? 12.774  1.366   -0.084  1.00 0.00 ? 23 LEU A CA   9  
ATOM 8288  C C    . LEU A 1 23 ? 13.539  0.947   1.166   1.00 0.00 ? 23 LEU A C    9  
ATOM 8289  O O    . LEU A 1 23 ? 13.069  0.116   1.943   1.00 0.00 ? 23 LEU A O    9  
ATOM 8290  C CB   . LEU A 1 23 ? 11.448  2.034   0.302   1.00 0.00 ? 23 LEU A CB   9  
ATOM 8291  C CG   . LEU A 1 23 ? 10.455  1.172   1.079   1.00 0.00 ? 23 LEU A CG   9  
ATOM 8292  C CD1  . LEU A 1 23 ? 9.784   1.993   2.166   1.00 0.00 ? 23 LEU A CD1  9  
ATOM 8293  C CD2  . LEU A 1 23 ? 9.426   0.594   0.125   1.00 0.00 ? 23 LEU A CD2  9  
ATOM 8294  H H    . LEU A 1 23 ? 11.723  -0.293  -0.878  1.00 0.00 ? 23 LEU A H    9  
ATOM 8295  H HA   . LEU A 1 23 ? 13.375  2.080   -0.627  1.00 0.00 ? 23 LEU A HA   9  
ATOM 8296  H HB2  . LEU A 1 23 ? 11.670  2.905   0.898   1.00 0.00 ? 23 LEU A HB2  9  
ATOM 8297  H HB3  . LEU A 1 23 ? 10.961  2.354   -0.604  1.00 0.00 ? 23 LEU A HB3  9  
ATOM 8298  H HG   . LEU A 1 23 ? 10.968  0.355   1.555   1.00 0.00 ? 23 LEU A HG   9  
ATOM 8299  H HD11 . LEU A 1 23 ? 8.815   2.315   1.827   1.00 0.00 ? 23 LEU A HD11 9  
ATOM 8300  H HD12 . LEU A 1 23 ? 10.392  2.857   2.392   1.00 0.00 ? 23 LEU A HD12 9  
ATOM 8301  H HD13 . LEU A 1 23 ? 9.673   1.391   3.052   1.00 0.00 ? 23 LEU A HD13 9  
ATOM 8302  H HD21 . LEU A 1 23 ? 8.859   -0.173  0.626   1.00 0.00 ? 23 LEU A HD21 9  
ATOM 8303  H HD22 . LEU A 1 23 ? 9.927   0.169   -0.732  1.00 0.00 ? 23 LEU A HD22 9  
ATOM 8304  H HD23 . LEU A 1 23 ? 8.760   1.379   -0.203  1.00 0.00 ? 23 LEU A HD23 9  
ATOM 8305  N N    . ARG A 1 24 ? 14.725  1.529   1.350   1.00 0.00 ? 24 ARG A N    9  
ATOM 8306  C CA   . ARG A 1 24 ? 15.563  1.218   2.504   1.00 0.00 ? 24 ARG A CA   9  
ATOM 8307  C C    . ARG A 1 24 ? 14.707  0.939   3.727   1.00 0.00 ? 24 ARG A C    9  
ATOM 8308  O O    . ARG A 1 24 ? 15.047  0.109   4.570   1.00 0.00 ? 24 ARG A O    9  
ATOM 8309  C CB   . ARG A 1 24 ? 16.531  2.368   2.788   1.00 0.00 ? 24 ARG A CB   9  
ATOM 8310  C CG   . ARG A 1 24 ? 17.243  2.882   1.548   1.00 0.00 ? 24 ARG A CG   9  
ATOM 8311  C CD   . ARG A 1 24 ? 18.537  3.597   1.903   1.00 0.00 ? 24 ARG A CD   9  
ATOM 8312  N NE   . ARG A 1 24 ? 19.413  3.750   0.745   1.00 0.00 ? 24 ARG A NE   9  
ATOM 8313  C CZ   . ARG A 1 24 ? 20.314  4.720   0.627   1.00 0.00 ? 24 ARG A CZ   9  
ATOM 8314  N NH1  . ARG A 1 24 ? 20.455  5.617   1.592   1.00 0.00 ? 24 ARG A NH1  9  
ATOM 8315  N NH2  . ARG A 1 24 ? 21.073  4.793   -0.458  1.00 0.00 ? 24 ARG A NH2  9  
ATOM 8316  H H    . ARG A 1 24 ? 15.043  2.181   0.692   1.00 0.00 ? 24 ARG A H    9  
ATOM 8317  H HA   . ARG A 1 24 ? 16.125  0.334   2.272   1.00 0.00 ? 24 ARG A HA   9  
ATOM 8318  H HB2  . ARG A 1 24 ? 15.979  3.188   3.226   1.00 0.00 ? 24 ARG A HB2  9  
ATOM 8319  H HB3  . ARG A 1 24 ? 17.277  2.031   3.492   1.00 0.00 ? 24 ARG A HB3  9  
ATOM 8320  H HG2  . ARG A 1 24 ? 17.471  2.046   0.903   1.00 0.00 ? 24 ARG A HG2  9  
ATOM 8321  H HG3  . ARG A 1 24 ? 16.592  3.571   1.030   1.00 0.00 ? 24 ARG A HG3  9  
ATOM 8322  H HD2  . ARG A 1 24 ? 18.297  4.575   2.293   1.00 0.00 ? 24 ARG A HD2  9  
ATOM 8323  H HD3  . ARG A 1 24 ? 19.053  3.025   2.661   1.00 0.00 ? 24 ARG A HD3  9  
ATOM 8324  H HE   . ARG A 1 24 ? 19.325  3.097   0.020   1.00 0.00 ? 24 ARG A HE   9  
ATOM 8325  H HH11 . ARG A 1 24 ? 19.884  5.565   2.412   1.00 0.00 ? 24 ARG A HH11 9  
ATOM 8326  H HH12 . ARG A 1 24 ? 21.133  6.347   1.502   1.00 0.00 ? 24 ARG A HH12 9  
ATOM 8327  H HH21 . ARG A 1 24 ? 20.969  4.118   -1.188  1.00 0.00 ? 24 ARG A HH21 9  
ATOM 8328  H HH22 . ARG A 1 24 ? 21.750  5.524   -0.545  1.00 0.00 ? 24 ARG A HH22 9  
ATOM 8329  N N    . GLN A 1 25 ? 13.586  1.632   3.799   1.00 0.00 ? 25 GLN A N    9  
ATOM 8330  C CA   . GLN A 1 25 ? 12.648  1.467   4.898   1.00 0.00 ? 25 GLN A CA   9  
ATOM 8331  C C    . GLN A 1 25 ? 11.607  0.412   4.533   1.00 0.00 ? 25 GLN A C    9  
ATOM 8332  O O    . GLN A 1 25 ? 11.927  -0.573  3.866   1.00 0.00 ? 25 GLN A O    9  
ATOM 8333  C CB   . GLN A 1 25 ? 11.971  2.801   5.220   1.00 0.00 ? 25 GLN A CB   9  
ATOM 8334  C CG   . GLN A 1 25 ? 12.937  3.972   5.289   1.00 0.00 ? 25 GLN A CG   9  
ATOM 8335  C CD   . GLN A 1 25 ? 13.403  4.260   6.702   1.00 0.00 ? 25 GLN A CD   9  
ATOM 8336  O OE1  . GLN A 1 25 ? 14.239  3.542   7.251   1.00 0.00 ? 25 GLN A OE1  9  
ATOM 8337  N NE2  . GLN A 1 25 ? 12.863  5.316   7.300   1.00 0.00 ? 25 GLN A NE2  9  
ATOM 8338  H H    . GLN A 1 25 ? 13.379  2.264   3.083   1.00 0.00 ? 25 GLN A H    9  
ATOM 8339  H HA   . GLN A 1 25 ? 13.201  1.130   5.763   1.00 0.00 ? 25 GLN A HA   9  
ATOM 8340  H HB2  . GLN A 1 25 ? 11.237  3.012   4.456   1.00 0.00 ? 25 GLN A HB2  9  
ATOM 8341  H HB3  . GLN A 1 25 ? 11.471  2.717   6.173   1.00 0.00 ? 25 GLN A HB3  9  
ATOM 8342  H HG2  . GLN A 1 25 ? 13.800  3.747   4.680   1.00 0.00 ? 25 GLN A HG2  9  
ATOM 8343  H HG3  . GLN A 1 25 ? 12.444  4.852   4.901   1.00 0.00 ? 25 GLN A HG3  9  
ATOM 8344  H HE21 . GLN A 1 25 ? 12.204  5.843   6.802   1.00 0.00 ? 25 GLN A HE21 9  
ATOM 8345  H HE22 . GLN A 1 25 ? 13.147  5.525   8.215   1.00 0.00 ? 25 GLN A HE22 9  
ATOM 8346  N N    . GLY A 1 26 ? 10.365  0.616   4.956   1.00 0.00 ? 26 GLY A N    9  
ATOM 8347  C CA   . GLY A 1 26 ? 9.322   -0.339  4.638   1.00 0.00 ? 26 GLY A CA   9  
ATOM 8348  C C    . GLY A 1 26 ? 8.006   0.328   4.292   1.00 0.00 ? 26 GLY A C    9  
ATOM 8349  O O    . GLY A 1 26 ? 7.296   0.810   5.174   1.00 0.00 ? 26 GLY A O    9  
ATOM 8350  H H    . GLY A 1 26 ? 10.153  1.416   5.479   1.00 0.00 ? 26 GLY A H    9  
ATOM 8351  H HA2  . GLY A 1 26 ? 9.642   -0.933  3.795   1.00 0.00 ? 26 GLY A HA2  9  
ATOM 8352  H HA3  . GLY A 1 26 ? 9.173   -0.988  5.486   1.00 0.00 ? 26 GLY A HA3  9  
ATOM 8353  N N    . ALA A 1 27 ? 7.680   0.356   3.002   1.00 0.00 ? 27 ALA A N    9  
ATOM 8354  C CA   . ALA A 1 27 ? 6.445   0.966   2.541   1.00 0.00 ? 27 ALA A CA   9  
ATOM 8355  C C    . ALA A 1 27 ? 5.275   -0.019  2.614   1.00 0.00 ? 27 ALA A C    9  
ATOM 8356  O O    . ALA A 1 27 ? 4.355   0.041   1.799   1.00 0.00 ? 27 ALA A O    9  
ATOM 8357  C CB   . ALA A 1 27 ? 6.609   1.492   1.117   1.00 0.00 ? 27 ALA A CB   9  
ATOM 8358  H H    . ALA A 1 27 ? 8.283   -0.040  2.348   1.00 0.00 ? 27 ALA A H    9  
ATOM 8359  H HA   . ALA A 1 27 ? 6.245   1.805   3.182   1.00 0.00 ? 27 ALA A HA   9  
ATOM 8360  H HB1  . ALA A 1 27 ? 5.639   1.641   0.670   1.00 0.00 ? 27 ALA A HB1  9  
ATOM 8361  H HB2  . ALA A 1 27 ? 7.167   0.782   0.529   1.00 0.00 ? 27 ALA A HB2  9  
ATOM 8362  H HB3  . ALA A 1 27 ? 7.138   2.430   1.140   1.00 0.00 ? 27 ALA A HB3  9  
ATOM 8363  N N    . GLN A 1 28 ? 5.315   -0.931  3.590   1.00 0.00 ? 28 GLN A N    9  
ATOM 8364  C CA   . GLN A 1 28 ? 4.254   -1.925  3.749   1.00 0.00 ? 28 GLN A CA   9  
ATOM 8365  C C    . GLN A 1 28 ? 2.901   -1.261  3.930   1.00 0.00 ? 28 GLN A C    9  
ATOM 8366  O O    . GLN A 1 28 ? 2.591   -0.760  5.010   1.00 0.00 ? 28 GLN A O    9  
ATOM 8367  C CB   . GLN A 1 28 ? 4.502   -2.815  4.959   1.00 0.00 ? 28 GLN A CB   9  
ATOM 8368  C CG   . GLN A 1 28 ? 5.953   -3.150  5.185   1.00 0.00 ? 28 GLN A CG   9  
ATOM 8369  C CD   . GLN A 1 28 ? 6.510   -2.515  6.444   1.00 0.00 ? 28 GLN A CD   9  
ATOM 8370  O OE1  . GLN A 1 28 ? 7.403   -1.671  6.384   1.00 0.00 ? 28 GLN A OE1  9  
ATOM 8371  N NE2  . GLN A 1 28 ? 5.984   -2.921  7.593   1.00 0.00 ? 28 GLN A NE2  9  
ATOM 8372  H H    . GLN A 1 28 ? 6.072   -0.938  4.210   1.00 0.00 ? 28 GLN A H    9  
ATOM 8373  H HA   . GLN A 1 28 ? 4.241   -2.540  2.861   1.00 0.00 ? 28 GLN A HA   9  
ATOM 8374  H HB2  . GLN A 1 28 ? 4.130   -2.315  5.838   1.00 0.00 ? 28 GLN A HB2  9  
ATOM 8375  H HB3  . GLN A 1 28 ? 3.957   -3.739  4.827   1.00 0.00 ? 28 GLN A HB3  9  
ATOM 8376  H HG2  . GLN A 1 28 ? 6.042   -4.221  5.268   1.00 0.00 ? 28 GLN A HG2  9  
ATOM 8377  H HG3  . GLN A 1 28 ? 6.524   -2.804  4.336   1.00 0.00 ? 28 GLN A HG3  9  
ATOM 8378  H HE21 . GLN A 1 28 ? 5.275   -3.597  7.565   1.00 0.00 ? 28 GLN A HE21 9  
ATOM 8379  H HE22 . GLN A 1 28 ? 6.325   -2.527  8.423   1.00 0.00 ? 28 GLN A HE22 9  
ATOM 8380  N N    . CYS A 1 29 ? 2.094   -1.256  2.885   1.00 0.00 ? 29 CYS A N    9  
ATOM 8381  C CA   . CYS A 1 29 ? 0.779   -0.644  2.976   1.00 0.00 ? 29 CYS A CA   9  
ATOM 8382  C C    . CYS A 1 29 ? 0.932   0.765   3.510   1.00 0.00 ? 29 CYS A C    9  
ATOM 8383  O O    . CYS A 1 29 ? 0.194   1.201   4.394   1.00 0.00 ? 29 CYS A O    9  
ATOM 8384  C CB   . CYS A 1 29 ? -0.123  -1.460  3.902   1.00 0.00 ? 29 CYS A CB   9  
ATOM 8385  S SG   . CYS A 1 29 ? -0.691  -3.033  3.185   1.00 0.00 ? 29 CYS A SG   9  
ATOM 8386  H H    . CYS A 1 29 ? 2.388   -1.661  2.046   1.00 0.00 ? 29 CYS A H    9  
ATOM 8387  H HA   . CYS A 1 29 ? 0.346   -0.611  1.988   1.00 0.00 ? 29 CYS A HA   9  
ATOM 8388  H HB2  . CYS A 1 29 ? 0.417   -1.688  4.809   1.00 0.00 ? 29 CYS A HB2  9  
ATOM 8389  H HB3  . CYS A 1 29 ? -0.997  -0.875  4.147   1.00 0.00 ? 29 CYS A HB3  9  
ATOM 8390  N N    . ALA A 1 30 ? 1.913   1.464   2.964   1.00 0.00 ? 30 ALA A N    9  
ATOM 8391  C CA   . ALA A 1 30 ? 2.199   2.834   3.377   1.00 0.00 ? 30 ALA A CA   9  
ATOM 8392  C C    . ALA A 1 30 ? 1.031   3.741   3.015   1.00 0.00 ? 30 ALA A C    9  
ATOM 8393  O O    . ALA A 1 30 ? -0.124  3.345   3.175   1.00 0.00 ? 30 ALA A O    9  
ATOM 8394  C CB   . ALA A 1 30 ? 3.489   3.320   2.736   1.00 0.00 ? 30 ALA A CB   9  
ATOM 8395  H H    . ALA A 1 30 ? 2.457   1.041   2.261   1.00 0.00 ? 30 ALA A H    9  
ATOM 8396  H HA   . ALA A 1 30 ? 2.328   2.833   4.448   1.00 0.00 ? 30 ALA A HA   9  
ATOM 8397  H HB1  . ALA A 1 30 ? 3.288   3.654   1.729   1.00 0.00 ? 30 ALA A HB1  9  
ATOM 8398  H HB2  . ALA A 1 30 ? 4.206   2.513   2.711   1.00 0.00 ? 30 ALA A HB2  9  
ATOM 8399  H HB3  . ALA A 1 30 ? 3.891   4.140   3.313   1.00 0.00 ? 30 ALA A HB3  9  
ATOM 8400  N N    . GLU A 1 31 ? 1.312   4.941   2.492   1.00 0.00 ? 31 GLU A N    9  
ATOM 8401  C CA   . GLU A 1 31 ? 0.235   5.839   2.081   1.00 0.00 ? 31 GLU A CA   9  
ATOM 8402  C C    . GLU A 1 31 ? -0.824  5.006   1.380   1.00 0.00 ? 31 GLU A C    9  
ATOM 8403  O O    . GLU A 1 31 ? -2.021  5.278   1.455   1.00 0.00 ? 31 GLU A O    9  
ATOM 8404  C CB   . GLU A 1 31 ? 0.764   6.928   1.145   1.00 0.00 ? 31 GLU A CB   9  
ATOM 8405  C CG   . GLU A 1 31 ? -0.317  7.585   0.304   1.00 0.00 ? 31 GLU A CG   9  
ATOM 8406  C CD   . GLU A 1 31 ? -0.224  9.098   0.312   1.00 0.00 ? 31 GLU A CD   9  
ATOM 8407  O OE1  . GLU A 1 31 ? -0.276  9.690   1.411   1.00 0.00 ? 31 GLU A OE1  9  
ATOM 8408  O OE2  . GLU A 1 31 ? -0.099  9.692   -0.780  1.00 0.00 ? 31 GLU A OE2  9  
ATOM 8409  H H    . GLU A 1 31 ? 2.243   5.210   2.354   1.00 0.00 ? 31 GLU A H    9  
ATOM 8410  H HA   . GLU A 1 31 ? -0.191  6.290   2.965   1.00 0.00 ? 31 GLU A HA   9  
ATOM 8411  H HB2  . GLU A 1 31 ? 1.243   7.692   1.737   1.00 0.00 ? 31 GLU A HB2  9  
ATOM 8412  H HB3  . GLU A 1 31 ? 1.493   6.491   0.479   1.00 0.00 ? 31 GLU A HB3  9  
ATOM 8413  H HG2  . GLU A 1 31 ? -0.222  7.240   -0.715  1.00 0.00 ? 31 GLU A HG2  9  
ATOM 8414  H HG3  . GLU A 1 31 ? -1.283  7.296   0.691   1.00 0.00 ? 31 GLU A HG3  9  
ATOM 8415  N N    . GLY A 1 32 ? -0.336  3.951   0.737   1.00 0.00 ? 32 GLY A N    9  
ATOM 8416  C CA   . GLY A 1 32 ? -1.180  3.006   0.052   1.00 0.00 ? 32 GLY A CA   9  
ATOM 8417  C C    . GLY A 1 32 ? -0.591  1.617   0.165   1.00 0.00 ? 32 GLY A C    9  
ATOM 8418  O O    . GLY A 1 32 ? 0.013   1.288   1.183   1.00 0.00 ? 32 GLY A O    9  
ATOM 8419  H H    . GLY A 1 32 ? 0.630   3.796   0.755   1.00 0.00 ? 32 GLY A H    9  
ATOM 8420  H HA2  . GLY A 1 32 ? -2.159  3.016   0.503   1.00 0.00 ? 32 GLY A HA2  9  
ATOM 8421  H HA3  . GLY A 1 32 ? -1.255  3.277   -0.991  1.00 0.00 ? 32 GLY A HA3  9  
ATOM 8422  N N    . LEU A 1 33 ? -0.744  0.802   -0.866  1.00 0.00 ? 33 LEU A N    9  
ATOM 8423  C CA   . LEU A 1 33 ? -0.187  -0.551  -0.832  1.00 0.00 ? 33 LEU A CA   9  
ATOM 8424  C C    . LEU A 1 33 ? 1.361   -0.548  -0.902  1.00 0.00 ? 33 LEU A C    9  
ATOM 8425  O O    . LEU A 1 33 ? 2.010   0.294   -0.281  1.00 0.00 ? 33 LEU A O    9  
ATOM 8426  C CB   . LEU A 1 33 ? -0.787  -1.403  -1.948  1.00 0.00 ? 33 LEU A CB   9  
ATOM 8427  C CG   . LEU A 1 33 ? -1.045  -2.861  -1.560  1.00 0.00 ? 33 LEU A CG   9  
ATOM 8428  C CD1  . LEU A 1 33 ? 0.112   -3.418  -0.749  1.00 0.00 ? 33 LEU A CD1  9  
ATOM 8429  C CD2  . LEU A 1 33 ? -2.327  -2.974  -0.765  1.00 0.00 ? 33 LEU A CD2  9  
ATOM 8430  H H    . LEU A 1 33 ? -1.237  1.112   -1.661  1.00 0.00 ? 33 LEU A H    9  
ATOM 8431  H HA   . LEU A 1 33 ? -0.477  -0.982  0.115   1.00 0.00 ? 33 LEU A HA   9  
ATOM 8432  H HB2  . LEU A 1 33 ? -1.727  -0.957  -2.245  1.00 0.00 ? 33 LEU A HB2  9  
ATOM 8433  H HB3  . LEU A 1 33 ? -0.118  -1.386  -2.793  1.00 0.00 ? 33 LEU A HB3  9  
ATOM 8434  H HG   . LEU A 1 33 ? -1.149  -3.457  -2.455  1.00 0.00 ? 33 LEU A HG   9  
ATOM 8435  H HD11 . LEU A 1 33 ? 0.545   -2.633  -0.145  1.00 0.00 ? 33 LEU A HD11 9  
ATOM 8436  H HD12 . LEU A 1 33 ? 0.859   -3.804  -1.421  1.00 0.00 ? 33 LEU A HD12 9  
ATOM 8437  H HD13 . LEU A 1 33 ? -0.242  -4.210  -0.108  1.00 0.00 ? 33 LEU A HD13 9  
ATOM 8438  H HD21 . LEU A 1 33 ? -3.094  -2.374  -1.232  1.00 0.00 ? 33 LEU A HD21 9  
ATOM 8439  H HD22 . LEU A 1 33 ? -2.154  -2.616  0.241   1.00 0.00 ? 33 LEU A HD22 9  
ATOM 8440  H HD23 . LEU A 1 33 ? -2.643  -4.004  -0.730  1.00 0.00 ? 33 LEU A HD23 9  
ATOM 8441  N N    . CYS A 1 34 ? 1.946   -1.505  -1.642  1.00 0.00 ? 34 CYS A N    9  
ATOM 8442  C CA   . CYS A 1 34 ? 3.407   -1.625  -1.778  1.00 0.00 ? 34 CYS A CA   9  
ATOM 8443  C C    . CYS A 1 34 ? 3.744   -2.663  -2.843  1.00 0.00 ? 34 CYS A C    9  
ATOM 8444  O O    . CYS A 1 34 ? 2.903   -3.009  -3.673  1.00 0.00 ? 34 CYS A O    9  
ATOM 8445  C CB   . CYS A 1 34 ? 4.043   -2.046  -0.449  1.00 0.00 ? 34 CYS A CB   9  
ATOM 8446  S SG   . CYS A 1 34 ? 5.711   -1.394  -0.113  1.00 0.00 ? 34 CYS A SG   9  
ATOM 8447  H H    . CYS A 1 34 ? 1.386   -2.153  -2.107  1.00 0.00 ? 34 CYS A H    9  
ATOM 8448  H HA   . CYS A 1 34 ? 3.800   -0.673  -2.082  1.00 0.00 ? 34 CYS A HA   9  
ATOM 8449  H HB2  . CYS A 1 34 ? 3.406   -1.738  0.361   1.00 0.00 ? 34 CYS A HB2  9  
ATOM 8450  H HB3  . CYS A 1 34 ? 4.128   -3.115  -0.445  1.00 0.00 ? 34 CYS A HB3  9  
ATOM 8451  N N    . CYS A 1 35 ? 4.973   -3.171  -2.806  1.00 0.00 ? 35 CYS A N    9  
ATOM 8452  C CA   . CYS A 1 35 ? 5.402   -4.184  -3.763  1.00 0.00 ? 35 CYS A CA   9  
ATOM 8453  C C    . CYS A 1 35 ? 6.772   -4.751  -3.404  1.00 0.00 ? 35 CYS A C    9  
ATOM 8454  O O    . CYS A 1 35 ? 7.063   -5.919  -3.663  1.00 0.00 ? 35 CYS A O    9  
ATOM 8455  C CB   . CYS A 1 35 ? 5.410   -3.596  -5.185  1.00 0.00 ? 35 CYS A CB   9  
ATOM 8456  S SG   . CYS A 1 35 ? 6.749   -4.202  -6.271  1.00 0.00 ? 35 CYS A SG   9  
ATOM 8457  H H    . CYS A 1 35 ? 5.595   -2.869  -2.116  1.00 0.00 ? 35 CYS A H    9  
ATOM 8458  H HA   . CYS A 1 35 ? 4.688   -4.981  -3.717  1.00 0.00 ? 35 CYS A HA   9  
ATOM 8459  H HB2  . CYS A 1 35 ? 4.473   -3.834  -5.665  1.00 0.00 ? 35 CYS A HB2  9  
ATOM 8460  H HB3  . CYS A 1 35 ? 5.505   -2.521  -5.116  1.00 0.00 ? 35 CYS A HB3  9  
ATOM 8461  N N    . ASP A 1 36 ? 7.609   -3.907  -2.833  1.00 0.00 ? 36 ASP A N    9  
ATOM 8462  C CA   . ASP A 1 36 ? 8.961   -4.295  -2.458  1.00 0.00 ? 36 ASP A CA   9  
ATOM 8463  C C    . ASP A 1 36 ? 8.983   -5.115  -1.175  1.00 0.00 ? 36 ASP A C    9  
ATOM 8464  O O    . ASP A 1 36 ? 7.941   -5.398  -0.583  1.00 0.00 ? 36 ASP A O    9  
ATOM 8465  C CB   . ASP A 1 36 ? 9.824   -3.046  -2.295  1.00 0.00 ? 36 ASP A CB   9  
ATOM 8466  C CG   . ASP A 1 36 ? 9.596   -2.343  -0.978  1.00 0.00 ? 36 ASP A CG   9  
ATOM 8467  O OD1  . ASP A 1 36 ? 8.598   -1.607  -0.869  1.00 0.00 ? 36 ASP A OD1  9  
ATOM 8468  O OD2  . ASP A 1 36 ? 10.416  -2.529  -0.054  1.00 0.00 ? 36 ASP A OD2  9  
ATOM 8469  H H    . ASP A 1 36 ? 7.315   -2.992  -2.673  1.00 0.00 ? 36 ASP A H    9  
ATOM 8470  H HA   . ASP A 1 36 ? 9.366   -4.894  -3.259  1.00 0.00 ? 36 ASP A HA   9  
ATOM 8471  H HB2  . ASP A 1 36 ? 10.864  -3.323  -2.358  1.00 0.00 ? 36 ASP A HB2  9  
ATOM 8472  H HB3  . ASP A 1 36 ? 9.586   -2.356  -3.087  1.00 0.00 ? 36 ASP A HB3  9  
ATOM 8473  N N    . GLN A 1 37 ? 10.187  -5.493  -0.753  1.00 0.00 ? 37 GLN A N    9  
ATOM 8474  C CA   . GLN A 1 37 ? 10.367  -6.280  0.457   1.00 0.00 ? 37 GLN A CA   9  
ATOM 8475  C C    . GLN A 1 37 ? 9.625   -5.649  1.629   1.00 0.00 ? 37 GLN A C    9  
ATOM 8476  O O    . GLN A 1 37 ? 9.347   -6.320  2.623   1.00 0.00 ? 37 GLN A O    9  
ATOM 8477  C CB   . GLN A 1 37 ? 11.854  -6.412  0.790   1.00 0.00 ? 37 GLN A CB   9  
ATOM 8478  C CG   . GLN A 1 37 ? 12.626  -7.261  -0.207  1.00 0.00 ? 37 GLN A CG   9  
ATOM 8479  C CD   . GLN A 1 37 ? 14.108  -6.943  -0.219  1.00 0.00 ? 37 GLN A CD   9  
ATOM 8480  O OE1  . GLN A 1 37 ? 14.923  -7.709  0.296   1.00 0.00 ? 37 GLN A OE1  9  
ATOM 8481  N NE2  . GLN A 1 37 ? 14.465  -5.807  -0.808  1.00 0.00 ? 37 GLN A NE2  9  
ATOM 8482  H H    . GLN A 1 37 ? 10.976  -5.234  -1.271  1.00 0.00 ? 37 GLN A H    9  
ATOM 8483  H HA   . GLN A 1 37 ? 9.960   -7.261  0.274   1.00 0.00 ? 37 GLN A HA   9  
ATOM 8484  H HB2  . GLN A 1 37 ? 12.296  -5.427  0.810   1.00 0.00 ? 37 GLN A HB2  9  
ATOM 8485  H HB3  . GLN A 1 37 ? 11.954  -6.863  1.766   1.00 0.00 ? 37 GLN A HB3  9  
ATOM 8486  H HG2  . GLN A 1 37 ? 12.499  -8.302  0.050   1.00 0.00 ? 37 GLN A HG2  9  
ATOM 8487  H HG3  . GLN A 1 37 ? 12.227  -7.084  -1.196  1.00 0.00 ? 37 GLN A HG3  9  
ATOM 8488  H HE21 . GLN A 1 37 ? 13.762  -5.246  -1.196  1.00 0.00 ? 37 GLN A HE21 9  
ATOM 8489  H HE22 . GLN A 1 37 ? 15.418  -5.577  -0.830  1.00 0.00 ? 37 GLN A HE22 9  
ATOM 8490  N N    . CYS A 1 38 ? 9.315   -4.355  1.499   1.00 0.00 ? 38 CYS A N    9  
ATOM 8491  C CA   . CYS A 1 38 ? 8.604   -3.608  2.536   1.00 0.00 ? 38 CYS A CA   9  
ATOM 8492  C C    . CYS A 1 38 ? 7.778   -4.541  3.407   1.00 0.00 ? 38 CYS A C    9  
ATOM 8493  O O    . CYS A 1 38 ? 7.946   -4.562  4.624   1.00 0.00 ? 38 CYS A O    9  
ATOM 8494  C CB   . CYS A 1 38 ? 7.713   -2.520  1.910   1.00 0.00 ? 38 CYS A CB   9  
ATOM 8495  S SG   . CYS A 1 38 ? 6.730   -3.063  0.472   1.00 0.00 ? 38 CYS A SG   9  
ATOM 8496  H H    . CYS A 1 38 ? 9.576   -3.891  0.685   1.00 0.00 ? 38 CYS A H    9  
ATOM 8497  H HA   . CYS A 1 38 ? 9.339   -3.130  3.160   1.00 0.00 ? 38 CYS A HA   9  
ATOM 8498  H HB2  . CYS A 1 38 ? 7.022   -2.156  2.656   1.00 0.00 ? 38 CYS A HB2  9  
ATOM 8499  H HB3  . CYS A 1 38 ? 8.340   -1.703  1.584   1.00 0.00 ? 38 CYS A HB3  9  
ATOM 8500  N N    . ARG A 1 39 ? 6.906   -5.317  2.759   1.00 0.00 ? 39 ARG A N    9  
ATOM 8501  C CA   . ARG A 1 39 ? 6.031   -6.279  3.441   1.00 0.00 ? 39 ARG A CA   9  
ATOM 8502  C C    . ARG A 1 39 ? 4.631   -5.690  3.591   1.00 0.00 ? 39 ARG A C    9  
ATOM 8503  O O    . ARG A 1 39 ? 4.338   -4.642  3.016   1.00 0.00 ? 39 ARG A O    9  
ATOM 8504  C CB   . ARG A 1 39 ? 6.598   -6.687  4.809   1.00 0.00 ? 39 ARG A CB   9  
ATOM 8505  C CG   . ARG A 1 39 ? 6.291   -8.124  5.203   1.00 0.00 ? 39 ARG A CG   9  
ATOM 8506  C CD   . ARG A 1 39 ? 7.281   -8.639  6.234   1.00 0.00 ? 39 ARG A CD   9  
ATOM 8507  N NE   . ARG A 1 39 ? 8.040   -9.786  5.744   1.00 0.00 ? 39 ARG A NE   9  
ATOM 8508  C CZ   . ARG A 1 39 ? 8.584   -10.701 6.540   1.00 0.00 ? 39 ARG A CZ   9  
ATOM 8509  N NH1  . ARG A 1 39 ? 8.446   -10.605 7.855   1.00 0.00 ? 39 ARG A NH1  9  
ATOM 8510  N NH2  . ARG A 1 39 ? 9.265   -11.714 6.020   1.00 0.00 ? 39 ARG A NH2  9  
ATOM 8511  H H    . ARG A 1 39 ? 6.853   -5.241  1.779   1.00 0.00 ? 39 ARG A H    9  
ATOM 8512  H HA   . ARG A 1 39 ? 5.966   -7.158  2.814   1.00 0.00 ? 39 ARG A HA   9  
ATOM 8513  H HB2  . ARG A 1 39 ? 7.671   -6.575  4.788   1.00 0.00 ? 39 ARG A HB2  9  
ATOM 8514  H HB3  . ARG A 1 39 ? 6.190   -6.036  5.566   1.00 0.00 ? 39 ARG A HB3  9  
ATOM 8515  H HG2  . ARG A 1 39 ? 5.298   -8.170  5.622   1.00 0.00 ? 39 ARG A HG2  9  
ATOM 8516  H HG3  . ARG A 1 39 ? 6.342   -8.749  4.323   1.00 0.00 ? 39 ARG A HG3  9  
ATOM 8517  H HD2  . ARG A 1 39 ? 7.969   -7.845  6.482   1.00 0.00 ? 39 ARG A HD2  9  
ATOM 8518  H HD3  . ARG A 1 39 ? 6.737   -8.932  7.121   1.00 0.00 ? 39 ARG A HD3  9  
ATOM 8519  H HE   . ARG A 1 39 ? 8.151   -9.877  4.775   1.00 0.00 ? 39 ARG A HE   9  
ATOM 8520  H HH11 . ARG A 1 39 ? 7.933   -9.843  8.250   1.00 0.00 ? 39 ARG A HH11 9  
ATOM 8521  H HH12 . ARG A 1 39 ? 8.856   -11.295 8.453   1.00 0.00 ? 39 ARG A HH12 9  
ATOM 8522  H HH21 . ARG A 1 39 ? 9.370   -11.790 5.029   1.00 0.00 ? 39 ARG A HH21 9  
ATOM 8523  H HH22 . ARG A 1 39 ? 9.673   -12.401 6.620   1.00 0.00 ? 39 ARG A HH22 9  
ATOM 8524  N N    . PHE A 1 40 ? 3.754   -6.367  4.334   1.00 0.00 ? 40 PHE A N    9  
ATOM 8525  C CA   . PHE A 1 40 ? 2.387   -5.882  4.507   1.00 0.00 ? 40 PHE A CA   9  
ATOM 8526  C C    . PHE A 1 40 ? 1.698   -6.471  5.729   1.00 0.00 ? 40 PHE A C    9  
ATOM 8527  O O    . PHE A 1 40 ? 2.266   -7.280  6.463   1.00 0.00 ? 40 PHE A O    9  
ATOM 8528  C CB   . PHE A 1 40 ? 1.548   -6.212  3.280   1.00 0.00 ? 40 PHE A CB   9  
ATOM 8529  C CG   . PHE A 1 40 ? 2.255   -5.964  1.989   1.00 0.00 ? 40 PHE A CG   9  
ATOM 8530  C CD1  . PHE A 1 40 ? 3.213   -6.849  1.520   1.00 0.00 ? 40 PHE A CD1  9  
ATOM 8531  C CD2  . PHE A 1 40 ? 1.970   -4.836  1.251   1.00 0.00 ? 40 PHE A CD2  9  
ATOM 8532  C CE1  . PHE A 1 40 ? 3.874   -6.604  0.338   1.00 0.00 ? 40 PHE A CE1  9  
ATOM 8533  C CE2  . PHE A 1 40 ? 2.622   -4.589  0.072   1.00 0.00 ? 40 PHE A CE2  9  
ATOM 8534  C CZ   . PHE A 1 40 ? 3.580   -5.470  -0.390  1.00 0.00 ? 40 PHE A CZ   9  
ATOM 8535  H H    . PHE A 1 40 ? 4.024   -7.205  4.754   1.00 0.00 ? 40 PHE A H    9  
ATOM 8536  H HA   . PHE A 1 40 ? 2.429   -4.810  4.616   1.00 0.00 ? 40 PHE A HA   9  
ATOM 8537  H HB2  . PHE A 1 40 ? 1.267   -7.254  3.312   1.00 0.00 ? 40 PHE A HB2  9  
ATOM 8538  H HB3  . PHE A 1 40 ? 0.658   -5.601  3.295   1.00 0.00 ? 40 PHE A HB3  9  
ATOM 8539  H HD1  . PHE A 1 40 ? 3.443   -7.735  2.089   1.00 0.00 ? 40 PHE A HD1  9  
ATOM 8540  H HD2  . PHE A 1 40 ? 1.223   -4.143  1.605   1.00 0.00 ? 40 PHE A HD2  9  
ATOM 8541  H HE1  . PHE A 1 40 ? 4.622   -7.296  -0.013  1.00 0.00 ? 40 PHE A HE1  9  
ATOM 8542  H HE2  . PHE A 1 40 ? 2.396   -3.698  -0.487  1.00 0.00 ? 40 PHE A HE2  9  
ATOM 8543  H HZ   . PHE A 1 40 ? 4.096   -5.271  -1.316  1.00 0.00 ? 40 PHE A HZ   9  
ATOM 8544  N N    . MET A 1 41 ? 0.451   -6.046  5.920   1.00 0.00 ? 41 MET A N    9  
ATOM 8545  C CA   . MET A 1 41 ? -0.370  -6.499  7.022   1.00 0.00 ? 41 MET A CA   9  
ATOM 8546  C C    . MET A 1 41 ? -1.369  -7.559  6.565   1.00 0.00 ? 41 MET A C    9  
ATOM 8547  O O    . MET A 1 41 ? -1.265  -8.728  6.937   1.00 0.00 ? 41 MET A O    9  
ATOM 8548  C CB   . MET A 1 41 ? -1.121  -5.319  7.632   1.00 0.00 ? 41 MET A CB   9  
ATOM 8549  C CG   . MET A 1 41 ? -0.640  -4.945  9.024   1.00 0.00 ? 41 MET A CG   9  
ATOM 8550  S SD   . MET A 1 41 ? -1.457  -3.473  9.671   1.00 0.00 ? 41 MET A SD   9  
ATOM 8551  C CE   . MET A 1 41 ? -2.899  -4.199  10.447  1.00 0.00 ? 41 MET A CE   9  
ATOM 8552  H H    . MET A 1 41 ? 0.072   -5.410  5.293   1.00 0.00 ? 41 MET A H    9  
ATOM 8553  H HA   . MET A 1 41 ? 0.281   -6.922  7.759   1.00 0.00 ? 41 MET A HA   9  
ATOM 8554  H HB2  . MET A 1 41 ? -1.000  -4.460  6.986   1.00 0.00 ? 41 MET A HB2  9  
ATOM 8555  H HB3  . MET A 1 41 ? -2.172  -5.567  7.689   1.00 0.00 ? 41 MET A HB3  9  
ATOM 8556  H HG2  . MET A 1 41 ? -0.837  -5.770  9.692   1.00 0.00 ? 41 MET A HG2  9  
ATOM 8557  H HG3  . MET A 1 41 ? 0.424   -4.762  8.985   1.00 0.00 ? 41 MET A HG3  9  
ATOM 8558  H HE1  . MET A 1 41 ? -2.643  -5.170  10.845  1.00 0.00 ? 41 MET A HE1  9  
ATOM 8559  H HE2  . MET A 1 41 ? -3.686  -4.305  9.716   1.00 0.00 ? 41 MET A HE2  9  
ATOM 8560  H HE3  . MET A 1 41 ? -3.236  -3.559  11.249  1.00 0.00 ? 41 MET A HE3  9  
ATOM 8561  N N    . LYS A 1 42 ? -2.347  -7.134  5.765   1.00 0.00 ? 42 LYS A N    9  
ATOM 8562  C CA   . LYS A 1 42 ? -3.376  -8.035  5.268   1.00 0.00 ? 42 LYS A CA   9  
ATOM 8563  C C    . LYS A 1 42 ? -4.525  -8.132  6.270   1.00 0.00 ? 42 LYS A C    9  
ATOM 8564  O O    . LYS A 1 42 ? -5.435  -8.943  6.112   1.00 0.00 ? 42 LYS A O    9  
ATOM 8565  C CB   . LYS A 1 42 ? -2.772  -9.419  4.968   1.00 0.00 ? 42 LYS A CB   9  
ATOM 8566  C CG   . LYS A 1 42 ? -3.150  -10.518 5.957   1.00 0.00 ? 42 LYS A CG   9  
ATOM 8567  C CD   . LYS A 1 42 ? -4.281  -11.381 5.420   1.00 0.00 ? 42 LYS A CD   9  
ATOM 8568  C CE   . LYS A 1 42 ? -4.188  -12.807 5.938   1.00 0.00 ? 42 LYS A CE   9  
ATOM 8569  N NZ   . LYS A 1 42 ? -5.491  -13.520 5.837   1.00 0.00 ? 42 LYS A NZ   9  
ATOM 8570  H H    . LYS A 1 42 ? -2.384  -6.188  5.510   1.00 0.00 ? 42 LYS A H    9  
ATOM 8571  H HA   . LYS A 1 42 ? -3.758  -7.616  4.348   1.00 0.00 ? 42 LYS A HA   9  
ATOM 8572  H HB2  . LYS A 1 42 ? -3.097  -9.730  3.987   1.00 0.00 ? 42 LYS A HB2  9  
ATOM 8573  H HB3  . LYS A 1 42 ? -1.695  -9.329  4.963   1.00 0.00 ? 42 LYS A HB3  9  
ATOM 8574  H HG2  . LYS A 1 42 ? -2.286  -11.143 6.128   1.00 0.00 ? 42 LYS A HG2  9  
ATOM 8575  H HG3  . LYS A 1 42 ? -3.458  -10.069 6.888   1.00 0.00 ? 42 LYS A HG3  9  
ATOM 8576  H HD2  . LYS A 1 42 ? -5.224  -10.957 5.727   1.00 0.00 ? 42 LYS A HD2  9  
ATOM 8577  H HD3  . LYS A 1 42 ? -4.227  -11.395 4.341   1.00 0.00 ? 42 LYS A HD3  9  
ATOM 8578  H HE2  . LYS A 1 42 ? -3.450  -13.340 5.358   1.00 0.00 ? 42 LYS A HE2  9  
ATOM 8579  H HE3  . LYS A 1 42 ? -3.881  -12.781 6.974   1.00 0.00 ? 42 LYS A HE3  9  
ATOM 8580  H HZ1  . LYS A 1 42 ? -5.345  -14.480 5.462   1.00 0.00 ? 42 LYS A HZ1  9  
ATOM 8581  H HZ2  . LYS A 1 42 ? -6.133  -13.006 5.201   1.00 0.00 ? 42 LYS A HZ2  9  
ATOM 8582  H HZ3  . LYS A 1 42 ? -5.935  -13.590 6.776   1.00 0.00 ? 42 LYS A HZ3  9  
ATOM 8583  N N    . GLU A 1 43 ? -4.475  -7.296  7.304   1.00 0.00 ? 43 GLU A N    9  
ATOM 8584  C CA   . GLU A 1 43 ? -5.510  -7.292  8.328   1.00 0.00 ? 43 GLU A CA   9  
ATOM 8585  C C    . GLU A 1 43 ? -6.275  -5.978  8.332   1.00 0.00 ? 43 GLU A C    9  
ATOM 8586  O O    . GLU A 1 43 ? -6.595  -5.435  9.389   1.00 0.00 ? 43 GLU A O    9  
ATOM 8587  C CB   . GLU A 1 43 ? -4.898  -7.543  9.705   1.00 0.00 ? 43 GLU A CB   9  
ATOM 8588  C CG   . GLU A 1 43 ? -5.900  -8.027  10.739  1.00 0.00 ? 43 GLU A CG   9  
ATOM 8589  C CD   . GLU A 1 43 ? -5.262  -8.889  11.811  1.00 0.00 ? 43 GLU A CD   9  
ATOM 8590  O OE1  . GLU A 1 43 ? -4.208  -8.488  12.347  1.00 0.00 ? 43 GLU A OE1  9  
ATOM 8591  O OE2  . GLU A 1 43 ? -5.817  -9.966  12.115  1.00 0.00 ? 43 GLU A OE2  9  
ATOM 8592  H H    . GLU A 1 43 ? -3.726  -6.670  7.381   1.00 0.00 ? 43 GLU A H    9  
ATOM 8593  H HA   . GLU A 1 43 ? -6.199  -8.086  8.100   1.00 0.00 ? 43 GLU A HA   9  
ATOM 8594  H HB2  . GLU A 1 43 ? -4.123  -8.288  9.608   1.00 0.00 ? 43 GLU A HB2  9  
ATOM 8595  H HB3  . GLU A 1 43 ? -4.460  -6.623  10.061  1.00 0.00 ? 43 GLU A HB3  9  
ATOM 8596  H HG2  . GLU A 1 43 ? -6.353  -7.168  11.213  1.00 0.00 ? 43 GLU A HG2  9  
ATOM 8597  H HG3  . GLU A 1 43 ? -6.664  -8.605  10.239  1.00 0.00 ? 43 GLU A HG3  9  
ATOM 8598  N N    . GLY A 1 44 ? -6.570  -5.477  7.143   1.00 0.00 ? 44 GLY A N    9  
ATOM 8599  C CA   . GLY A 1 44 ? -7.303  -4.236  7.026   1.00 0.00 ? 44 GLY A CA   9  
ATOM 8600  C C    . GLY A 1 44 ? -6.468  -3.035  7.353   1.00 0.00 ? 44 GLY A C    9  
ATOM 8601  O O    . GLY A 1 44 ? -6.826  -2.239  8.222   1.00 0.00 ? 44 GLY A O    9  
ATOM 8602  H H    . GLY A 1 44 ? -6.292  -5.959  6.336   1.00 0.00 ? 44 GLY A H    9  
ATOM 8603  H HA2  . GLY A 1 44 ? -7.657  -4.140  6.014   1.00 0.00 ? 44 GLY A HA2  9  
ATOM 8604  H HA3  . GLY A 1 44 ? -8.147  -4.265  7.695   1.00 0.00 ? 44 GLY A HA3  9  
ATOM 8605  N N    . THR A 1 45 ? -5.352  -2.894  6.664   1.00 0.00 ? 45 THR A N    9  
ATOM 8606  C CA   . THR A 1 45 ? -4.479  -1.763  6.910   1.00 0.00 ? 45 THR A CA   9  
ATOM 8607  C C    . THR A 1 45 ? -4.824  -0.597  5.994   1.00 0.00 ? 45 THR A C    9  
ATOM 8608  O O    . THR A 1 45 ? -5.456  0.373   6.410   1.00 0.00 ? 45 THR A O    9  
ATOM 8609  C CB   . THR A 1 45 ? -3.031  -2.189  6.741   1.00 0.00 ? 45 THR A CB   9  
ATOM 8610  O OG1  . THR A 1 45 ? -2.830  -3.474  7.297   1.00 0.00 ? 45 THR A OG1  9  
ATOM 8611  C CG2  . THR A 1 45 ? -2.055  -1.245  7.397   1.00 0.00 ? 45 THR A CG2  9  
ATOM 8612  H H    . THR A 1 45 ? -5.106  -3.570  5.974   1.00 0.00 ? 45 THR A H    9  
ATOM 8613  H HA   . THR A 1 45 ? -4.630  -1.450  7.923   1.00 0.00 ? 45 THR A HA   9  
ATOM 8614  H HB   . THR A 1 45 ? -2.800  -2.235  5.694   1.00 0.00 ? 45 THR A HB   9  
ATOM 8615  H HG1  . THR A 1 45 ? -3.535  -4.062  7.012   1.00 0.00 ? 45 THR A HG1  9  
ATOM 8616  H HG21 . THR A 1 45 ? -2.117  -0.278  6.922   1.00 0.00 ? 45 THR A HG21 9  
ATOM 8617  H HG22 . THR A 1 45 ? -1.055  -1.635  7.294   1.00 0.00 ? 45 THR A HG22 9  
ATOM 8618  H HG23 . THR A 1 45 ? -2.299  -1.149  8.444   1.00 0.00 ? 45 THR A HG23 9  
ATOM 8619  N N    . ILE A 1 46 ? -4.417  -0.712  4.748   1.00 0.00 ? 46 ILE A N    9  
ATOM 8620  C CA   . ILE A 1 46 ? -4.683  0.310   3.748   1.00 0.00 ? 46 ILE A CA   9  
ATOM 8621  C C    . ILE A 1 46 ? -4.127  -0.122  2.389   1.00 0.00 ? 46 ILE A C    9  
ATOM 8622  O O    . ILE A 1 46 ? -2.932  0.010   2.121   1.00 0.00 ? 46 ILE A O    9  
ATOM 8623  C CB   . ILE A 1 46 ? -4.116  1.693   4.187   1.00 0.00 ? 46 ILE A CB   9  
ATOM 8624  C CG1  . ILE A 1 46 ? -5.269  2.638   4.529   1.00 0.00 ? 46 ILE A CG1  9  
ATOM 8625  C CG2  . ILE A 1 46 ? -3.220  2.321   3.124   1.00 0.00 ? 46 ILE A CG2  9  
ATOM 8626  C CD1  . ILE A 1 46 ? -5.397  2.925   6.009   1.00 0.00 ? 46 ILE A CD1  9  
ATOM 8627  H H    . ILE A 1 46 ? -3.933  -1.513  4.490   1.00 0.00 ? 46 ILE A H    9  
ATOM 8628  H HA   . ILE A 1 46 ? -5.754  0.402   3.665   1.00 0.00 ? 46 ILE A HA   9  
ATOM 8629  H HB   . ILE A 1 46 ? -3.520  1.542   5.074   1.00 0.00 ? 46 ILE A HB   9  
ATOM 8630  H HG12 . ILE A 1 46 ? -5.117  3.579   4.022   1.00 0.00 ? 46 ILE A HG12 9  
ATOM 8631  H HG13 . ILE A 1 46 ? -6.197  2.199   4.194   1.00 0.00 ? 46 ILE A HG13 9  
ATOM 8632  H HG21 . ILE A 1 46 ? -2.242  1.865   3.161   1.00 0.00 ? 46 ILE A HG21 9  
ATOM 8633  H HG22 . ILE A 1 46 ? -3.130  3.381   3.309   1.00 0.00 ? 46 ILE A HG22 9  
ATOM 8634  H HG23 . ILE A 1 46 ? -3.654  2.163   2.148   1.00 0.00 ? 46 ILE A HG23 9  
ATOM 8635  H HD11 . ILE A 1 46 ? -6.396  2.679   6.338   1.00 0.00 ? 46 ILE A HD11 9  
ATOM 8636  H HD12 . ILE A 1 46 ? -5.205  3.972   6.191   1.00 0.00 ? 46 ILE A HD12 9  
ATOM 8637  H HD13 . ILE A 1 46 ? -4.682  2.328   6.553   1.00 0.00 ? 46 ILE A HD13 9  
ATOM 8638  N N    . CYS A 1 47 ? -5.000  -0.663  1.543   1.00 0.00 ? 47 CYS A N    9  
ATOM 8639  C CA   . CYS A 1 47 ? -4.590  -1.132  0.224   1.00 0.00 ? 47 CYS A CA   9  
ATOM 8640  C C    . CYS A 1 47 ? -4.701  -0.028  -0.819  1.00 0.00 ? 47 CYS A C    9  
ATOM 8641  O O    . CYS A 1 47 ? -4.506  -0.276  -2.009  1.00 0.00 ? 47 CYS A O    9  
ATOM 8642  C CB   . CYS A 1 47 ? -5.412  -2.369  -0.178  1.00 0.00 ? 47 CYS A CB   9  
ATOM 8643  S SG   . CYS A 1 47 ? -6.362  -2.228  -1.734  1.00 0.00 ? 47 CYS A SG   9  
ATOM 8644  H H    . CYS A 1 47 ? -5.934  -0.760  1.816   1.00 0.00 ? 47 CYS A H    9  
ATOM 8645  H HA   . CYS A 1 47 ? -3.559  -1.416  0.300   1.00 0.00 ? 47 CYS A HA   9  
ATOM 8646  H HB2  . CYS A 1 47 ? -4.744  -3.206  -0.288  1.00 0.00 ? 47 CYS A HB2  9  
ATOM 8647  H HB3  . CYS A 1 47 ? -6.113  -2.585  0.610   1.00 0.00 ? 47 CYS A HB3  9  
ATOM 8648  N N    . ARG A 1 48 ? -5.015  1.180   -0.355  1.00 0.00 ? 48 ARG A N    9  
ATOM 8649  C CA   . ARG A 1 48 ? -5.170  2.352   -1.225  1.00 0.00 ? 48 ARG A CA   9  
ATOM 8650  C C    . ARG A 1 48 ? -4.768  2.071   -2.669  1.00 0.00 ? 48 ARG A C    9  
ATOM 8651  O O    . ARG A 1 48 ? -3.617  2.269   -3.058  1.00 0.00 ? 48 ARG A O    9  
ATOM 8652  C CB   . ARG A 1 48 ? -4.343  3.521   -0.693  1.00 0.00 ? 48 ARG A CB   9  
ATOM 8653  C CG   . ARG A 1 48 ? -4.576  3.823   0.780   1.00 0.00 ? 48 ARG A CG   9  
ATOM 8654  C CD   . ARG A 1 48 ? -5.389  5.094   0.965   1.00 0.00 ? 48 ARG A CD   9  
ATOM 8655  N NE   . ARG A 1 48 ? -4.597  6.174   1.547   1.00 0.00 ? 48 ARG A NE   9  
ATOM 8656  C CZ   . ARG A 1 48 ? -3.904  7.052   0.829   1.00 0.00 ? 48 ARG A CZ   9  
ATOM 8657  N NH1  . ARG A 1 48 ? -3.890  6.969   -0.495  1.00 0.00 ? 48 ARG A NH1  9  
ATOM 8658  N NH2  . ARG A 1 48 ? -3.222  8.014   1.435   1.00 0.00 ? 48 ARG A NH2  9  
ATOM 8659  H H    . ARG A 1 48 ? -5.164  1.286   0.610   1.00 0.00 ? 48 ARG A H    9  
ATOM 8660  H HA   . ARG A 1 48 ? -6.201  2.626   -1.211  1.00 0.00 ? 48 ARG A HA   9  
ATOM 8661  H HB2  . ARG A 1 48 ? -3.300  3.294   -0.833  1.00 0.00 ? 48 ARG A HB2  9  
ATOM 8662  H HB3  . ARG A 1 48 ? -4.585  4.404   -1.260  1.00 0.00 ? 48 ARG A HB3  9  
ATOM 8663  H HG2  . ARG A 1 48 ? -5.111  3.000   1.228   1.00 0.00 ? 48 ARG A HG2  9  
ATOM 8664  H HG3  . ARG A 1 48 ? -3.621  3.941   1.268   1.00 0.00 ? 48 ARG A HG3  9  
ATOM 8665  H HD2  . ARG A 1 48 ? -5.761  5.412   0.002   1.00 0.00 ? 48 ARG A HD2  9  
ATOM 8666  H HD3  . ARG A 1 48 ? -6.222  4.880   1.617   1.00 0.00 ? 48 ARG A HD3  9  
ATOM 8667  H HE   . ARG A 1 48 ? -4.585  6.251   2.524   1.00 0.00 ? 48 ARG A HE   9  
ATOM 8668  H HH11 . ARG A 1 48 ? -4.400  6.244   -0.957  1.00 0.00 ? 48 ARG A HH11 9  
ATOM 8669  H HH12 . ARG A 1 48 ? -3.368  7.633   -1.032  1.00 0.00 ? 48 ARG A HH12 9  
ATOM 8670  H HH21 . ARG A 1 48 ? -3.228  8.079   2.432   1.00 0.00 ? 48 ARG A HH21 9  
ATOM 8671  H HH22 . ARG A 1 48 ? -2.701  8.675   0.894   1.00 0.00 ? 48 ARG A HH22 9  
ATOM 8672  N N    . ARG A 1 49 ? -5.735  1.609   -3.457  1.00 0.00 ? 49 ARG A N    9  
ATOM 8673  C CA   . ARG A 1 49 ? -5.498  1.299   -4.862  1.00 0.00 ? 49 ARG A CA   9  
ATOM 8674  C C    . ARG A 1 49 ? -6.759  1.531   -5.689  1.00 0.00 ? 49 ARG A C    9  
ATOM 8675  O O    . ARG A 1 49 ? -6.878  1.037   -6.810  1.00 0.00 ? 49 ARG A O    9  
ATOM 8676  C CB   . ARG A 1 49 ? -5.033  -0.151  -5.016  1.00 0.00 ? 49 ARG A CB   9  
ATOM 8677  C CG   . ARG A 1 49 ? -3.666  -0.285  -5.666  1.00 0.00 ? 49 ARG A CG   9  
ATOM 8678  C CD   . ARG A 1 49 ? -3.780  -0.673  -7.131  1.00 0.00 ? 49 ARG A CD   9  
ATOM 8679  N NE   . ARG A 1 49 ? -3.758  0.494   -8.009  1.00 0.00 ? 49 ARG A NE   9  
ATOM 8680  C CZ   . ARG A 1 49 ? -3.298  0.473   -9.256  1.00 0.00 ? 49 ARG A CZ   9  
ATOM 8681  N NH1  . ARG A 1 49 ? -2.825  -0.653  -9.774  1.00 0.00 ? 49 ARG A NH1  9  
ATOM 8682  N NH2  . ARG A 1 49 ? -3.311  1.578   -9.988  1.00 0.00 ? 49 ARG A NH2  9  
ATOM 8683  H H    . ARG A 1 49 ? -6.634  1.475   -3.082  1.00 0.00 ? 49 ARG A H    9  
ATOM 8684  H HA   . ARG A 1 49 ? -4.721  1.957   -5.220  1.00 0.00 ? 49 ARG A HA   9  
ATOM 8685  H HB2  . ARG A 1 49 ? -4.990  -0.608  -4.039  1.00 0.00 ? 49 ARG A HB2  9  
ATOM 8686  H HB3  . ARG A 1 49 ? -5.750  -0.684  -5.623  1.00 0.00 ? 49 ARG A HB3  9  
ATOM 8687  H HG2  . ARG A 1 49 ? -3.150  0.661   -5.594  1.00 0.00 ? 49 ARG A HG2  9  
ATOM 8688  H HG3  . ARG A 1 49 ? -3.103  -1.045  -5.144  1.00 0.00 ? 49 ARG A HG3  9  
ATOM 8689  H HD2  . ARG A 1 49 ? -2.952  -1.318  -7.383  1.00 0.00 ? 49 ARG A HD2  9  
ATOM 8690  H HD3  . ARG A 1 49 ? -4.709  -1.205  -7.278  1.00 0.00 ? 49 ARG A HD3  9  
ATOM 8691  H HE   . ARG A 1 49 ? -4.104  1.338   -7.649  1.00 0.00 ? 49 ARG A HE   9  
ATOM 8692  H HH11 . ARG A 1 49 ? -2.814  -1.490  -9.227  1.00 0.00 ? 49 ARG A HH11 9  
ATOM 8693  H HH12 . ARG A 1 49 ? -2.479  -0.665  -10.712 1.00 0.00 ? 49 ARG A HH12 9  
ATOM 8694  H HH21 . ARG A 1 49 ? -3.668  2.429   -9.602  1.00 0.00 ? 49 ARG A HH21 9  
ATOM 8695  H HH22 . ARG A 1 49 ? -2.965  1.561   -10.926 1.00 0.00 ? 49 ARG A HH22 9  
ATOM 8696  N N    . ALA A 1 50 ? -7.699  2.284   -5.127  1.00 0.00 ? 50 ALA A N    9  
ATOM 8697  C CA   . ALA A 1 50 ? -8.951  2.582   -5.811  1.00 0.00 ? 50 ALA A CA   9  
ATOM 8698  C C    . ALA A 1 50 ? -8.738  3.599   -6.927  1.00 0.00 ? 50 ALA A C    9  
ATOM 8699  O O    . ALA A 1 50 ? -7.604  3.962   -7.240  1.00 0.00 ? 50 ALA A O    9  
ATOM 8700  C CB   . ALA A 1 50 ? -9.986  3.093   -4.819  1.00 0.00 ? 50 ALA A CB   9  
ATOM 8701  H H    . ALA A 1 50 ? -7.546  2.649   -4.230  1.00 0.00 ? 50 ALA A H    9  
ATOM 8702  H HA   . ALA A 1 50 ? -9.322  1.663   -6.241  1.00 0.00 ? 50 ALA A HA   9  
ATOM 8703  H HB1  . ALA A 1 50 ? -10.867 2.470   -4.865  1.00 0.00 ? 50 ALA A HB1  9  
ATOM 8704  H HB2  . ALA A 1 50 ? -10.250 4.110   -5.066  1.00 0.00 ? 50 ALA A HB2  9  
ATOM 8705  H HB3  . ALA A 1 50 ? -9.574  3.061   -3.821  1.00 0.00 ? 50 ALA A HB3  9  
ATOM 8706  N N    . ARG A 1 51 ? -9.834  4.056   -7.524  1.00 0.00 ? 51 ARG A N    9  
ATOM 8707  C CA   . ARG A 1 51 ? -9.761  5.032   -8.605  1.00 0.00 ? 51 ARG A CA   9  
ATOM 8708  C C    . ARG A 1 51 ? -10.624 6.256   -8.296  1.00 0.00 ? 51 ARG A C    9  
ATOM 8709  O O    . ARG A 1 51 ? -10.209 7.136   -7.542  1.00 0.00 ? 51 ARG A O    9  
ATOM 8710  C CB   . ARG A 1 51 ? -10.194 4.393   -9.927  1.00 0.00 ? 51 ARG A CB   9  
ATOM 8711  C CG   . ARG A 1 51 ? -9.093  3.598   -10.608 1.00 0.00 ? 51 ARG A CG   9  
ATOM 8712  C CD   . ARG A 1 51 ? -9.024  3.904   -12.096 1.00 0.00 ? 51 ARG A CD   9  
ATOM 8713  N NE   . ARG A 1 51 ? -7.915  4.797   -12.419 1.00 0.00 ? 51 ARG A NE   9  
ATOM 8714  C CZ   . ARG A 1 51 ? -6.646  4.407   -12.468 1.00 0.00 ? 51 ARG A CZ   9  
ATOM 8715  N NH1  . ARG A 1 51 ? -6.328  3.145   -12.217 1.00 0.00 ? 51 ARG A NH1  9  
ATOM 8716  N NH2  . ARG A 1 51 ? -5.693  5.279   -12.770 1.00 0.00 ? 51 ARG A NH2  9  
ATOM 8717  H H    . ARG A 1 51 ? -10.710 3.730   -7.231  1.00 0.00 ? 51 ARG A H    9  
ATOM 8718  H HA   . ARG A 1 51 ? -8.733  5.349   -8.692  1.00 0.00 ? 51 ARG A HA   9  
ATOM 8719  H HB2  . ARG A 1 51 ? -11.024 3.728   -9.738  1.00 0.00 ? 51 ARG A HB2  9  
ATOM 8720  H HB3  . ARG A 1 51 ? -10.516 5.173   -10.602 1.00 0.00 ? 51 ARG A HB3  9  
ATOM 8721  H HG2  . ARG A 1 51 ? -8.146  3.851   -10.155 1.00 0.00 ? 51 ARG A HG2  9  
ATOM 8722  H HG3  . ARG A 1 51 ? -9.288  2.544   -10.475 1.00 0.00 ? 51 ARG A HG3  9  
ATOM 8723  H HD2  . ARG A 1 51 ? -8.896  2.977   -12.635 1.00 0.00 ? 51 ARG A HD2  9  
ATOM 8724  H HD3  . ARG A 1 51 ? -9.950  4.370   -12.397 1.00 0.00 ? 51 ARG A HD3  9  
ATOM 8725  H HE   . ARG A 1 51 ? -8.128  5.735   -12.609 1.00 0.00 ? 51 ARG A HE   9  
ATOM 8726  H HH11 . ARG A 1 51 ? -7.044  2.484   -11.991 1.00 0.00 ? 51 ARG A HH11 9  
ATOM 8727  H HH12 . ARG A 1 51 ? -5.372  2.853   -12.255 1.00 0.00 ? 51 ARG A HH12 9  
ATOM 8728  H HH21 . ARG A 1 51 ? -5.929  6.232   -12.960 1.00 0.00 ? 51 ARG A HH21 9  
ATOM 8729  H HH22 . ARG A 1 51 ? -4.738  4.984   -12.805 1.00 0.00 ? 51 ARG A HH22 9  
ATOM 8730  N N    . GLY A 1 52 ? -11.824 6.305   -8.877  1.00 0.00 ? 52 GLY A N    9  
ATOM 8731  C CA   . GLY A 1 52 ? -12.720 7.426   -8.647  1.00 0.00 ? 52 GLY A CA   9  
ATOM 8732  C C    . GLY A 1 52 ? -11.982 8.733   -8.438  1.00 0.00 ? 52 GLY A C    9  
ATOM 8733  O O    . GLY A 1 52 ? -11.391 9.278   -9.371  1.00 0.00 ? 52 GLY A O    9  
ATOM 8734  H H    . GLY A 1 52 ? -12.105 5.575   -9.465  1.00 0.00 ? 52 GLY A H    9  
ATOM 8735  H HA2  . GLY A 1 52 ? -13.375 7.528   -9.500  1.00 0.00 ? 52 GLY A HA2  9  
ATOM 8736  H HA3  . GLY A 1 52 ? -13.318 7.219   -7.771  1.00 0.00 ? 52 GLY A HA3  9  
ATOM 8737  N N    . ASP A 1 53 ? -12.012 9.232   -7.208  1.00 0.00 ? 53 ASP A N    9  
ATOM 8738  C CA   . ASP A 1 53 ? -11.340 10.480  -6.867  1.00 0.00 ? 53 ASP A CA   9  
ATOM 8739  C C    . ASP A 1 53 ? -10.687 10.382  -5.493  1.00 0.00 ? 53 ASP A C    9  
ATOM 8740  O O    . ASP A 1 53 ? -10.270 11.387  -4.917  1.00 0.00 ? 53 ASP A O    9  
ATOM 8741  C CB   . ASP A 1 53 ? -12.334 11.640  -6.890  1.00 0.00 ? 53 ASP A CB   9  
ATOM 8742  C CG   . ASP A 1 53 ? -13.464 11.453  -5.897  1.00 0.00 ? 53 ASP A CG   9  
ATOM 8743  O OD1  . ASP A 1 53 ? -13.349 10.564  -5.028  1.00 0.00 ? 53 ASP A OD1  9  
ATOM 8744  O OD2  . ASP A 1 53 ? -14.464 12.196  -5.989  1.00 0.00 ? 53 ASP A OD2  9  
ATOM 8745  H H    . ASP A 1 53 ? -12.498 8.747   -6.508  1.00 0.00 ? 53 ASP A H    9  
ATOM 8746  H HA   . ASP A 1 53 ? -10.573 10.658  -7.607  1.00 0.00 ? 53 ASP A HA   9  
ATOM 8747  H HB2  . ASP A 1 53 ? -11.814 12.555  -6.647  1.00 0.00 ? 53 ASP A HB2  9  
ATOM 8748  H HB3  . ASP A 1 53 ? -12.757 11.723  -7.880  1.00 0.00 ? 53 ASP A HB3  9  
ATOM 8749  N N    . ASP A 1 54 ? -10.607 9.162   -4.975  1.00 0.00 ? 54 ASP A N    9  
ATOM 8750  C CA   . ASP A 1 54 ? -10.010 8.920   -3.667  1.00 0.00 ? 54 ASP A CA   9  
ATOM 8751  C C    . ASP A 1 54 ? -8.820  7.978   -3.780  1.00 0.00 ? 54 ASP A C    9  
ATOM 8752  O O    . ASP A 1 54 ? -7.689  8.346   -3.466  1.00 0.00 ? 54 ASP A O    9  
ATOM 8753  C CB   . ASP A 1 54 ? -11.042 8.316   -2.722  1.00 0.00 ? 54 ASP A CB   9  
ATOM 8754  C CG   . ASP A 1 54 ? -11.972 9.358   -2.134  1.00 0.00 ? 54 ASP A CG   9  
ATOM 8755  O OD1  . ASP A 1 54 ? -11.563 10.046  -1.175  1.00 0.00 ? 54 ASP A OD1  9  
ATOM 8756  O OD2  . ASP A 1 54 ? -13.111 9.486   -2.632  1.00 0.00 ? 54 ASP A OD2  9  
ATOM 8757  H H    . ASP A 1 54 ? -10.960 8.405   -5.485  1.00 0.00 ? 54 ASP A H    9  
ATOM 8758  H HA   . ASP A 1 54 ? -9.675  9.865   -3.268  1.00 0.00 ? 54 ASP A HA   9  
ATOM 8759  H HB2  . ASP A 1 54 ? -11.633 7.595   -3.267  1.00 0.00 ? 54 ASP A HB2  9  
ATOM 8760  H HB3  . ASP A 1 54 ? -10.527 7.818   -1.915  1.00 0.00 ? 54 ASP A HB3  9  
ATOM 8761  N N    . LEU A 1 55 ? -9.088  6.757   -4.231  1.00 0.00 ? 55 LEU A N    9  
ATOM 8762  C CA   . LEU A 1 55 ? -8.041  5.759   -4.392  1.00 0.00 ? 55 LEU A CA   9  
ATOM 8763  C C    . LEU A 1 55 ? -7.565  5.240   -3.039  1.00 0.00 ? 55 LEU A C    9  
ATOM 8764  O O    . LEU A 1 55 ? -6.397  5.385   -2.681  1.00 0.00 ? 55 LEU A O    9  
ATOM 8765  C CB   . LEU A 1 55 ? -6.874  6.361   -5.171  1.00 0.00 ? 55 LEU A CB   9  
ATOM 8766  C CG   . LEU A 1 55 ? -7.289  7.271   -6.327  1.00 0.00 ? 55 LEU A CG   9  
ATOM 8767  C CD1  . LEU A 1 55 ? -7.137  8.735   -5.941  1.00 0.00 ? 55 LEU A CD1  9  
ATOM 8768  C CD2  . LEU A 1 55 ? -6.474  6.955   -7.569  1.00 0.00 ? 55 LEU A CD2  9  
ATOM 8769  H H    . LEU A 1 55 ? -10.010 6.524   -4.464  1.00 0.00 ? 55 LEU A H    9  
ATOM 8770  H HA   . LEU A 1 55 ? -8.451  4.936   -4.956  1.00 0.00 ? 55 LEU A HA   9  
ATOM 8771  H HB2  . LEU A 1 55 ? -6.266  6.933   -4.485  1.00 0.00 ? 55 LEU A HB2  9  
ATOM 8772  H HB3  . LEU A 1 55 ? -6.279  5.555   -5.571  1.00 0.00 ? 55 LEU A HB3  9  
ATOM 8773  H HG   . LEU A 1 55 ? -8.330  7.096   -6.557  1.00 0.00 ? 55 LEU A HG   9  
ATOM 8774  H HD11 . LEU A 1 55 ? -8.102  9.138   -5.672  1.00 0.00 ? 55 LEU A HD11 9  
ATOM 8775  H HD12 . LEU A 1 55 ? -6.736  9.288   -6.776  1.00 0.00 ? 55 LEU A HD12 9  
ATOM 8776  H HD13 . LEU A 1 55 ? -6.466  8.817   -5.099  1.00 0.00 ? 55 LEU A HD13 9  
ATOM 8777  H HD21 . LEU A 1 55 ? -7.065  6.351   -8.241  1.00 0.00 ? 55 LEU A HD21 9  
ATOM 8778  H HD22 . LEU A 1 55 ? -5.584  6.415   -7.286  1.00 0.00 ? 55 LEU A HD22 9  
ATOM 8779  H HD23 . LEU A 1 55 ? -6.197  7.875   -8.061  1.00 0.00 ? 55 LEU A HD23 9  
ATOM 8780  N N    . ASP A 1 56 ? -8.482  4.631   -2.295  1.00 0.00 ? 56 ASP A N    9  
ATOM 8781  C CA   . ASP A 1 56 ? -8.165  4.082   -0.983  1.00 0.00 ? 56 ASP A CA   9  
ATOM 8782  C C    . ASP A 1 56 ? -8.551  2.608   -0.912  1.00 0.00 ? 56 ASP A C    9  
ATOM 8783  O O    . ASP A 1 56 ? -8.917  2.008   -1.922  1.00 0.00 ? 56 ASP A O    9  
ATOM 8784  C CB   . ASP A 1 56 ? -8.894  4.866   0.110   1.00 0.00 ? 56 ASP A CB   9  
ATOM 8785  C CG   . ASP A 1 56 ? -8.347  6.271   0.276   1.00 0.00 ? 56 ASP A CG   9  
ATOM 8786  O OD1  . ASP A 1 56 ? -7.801  6.815   -0.706  1.00 0.00 ? 56 ASP A OD1  9  
ATOM 8787  O OD2  . ASP A 1 56 ? -8.466  6.827   1.388   1.00 0.00 ? 56 ASP A OD2  9  
ATOM 8788  H H    . ASP A 1 56 ? -9.396  4.545   -2.639  1.00 0.00 ? 56 ASP A H    9  
ATOM 8789  H HA   . ASP A 1 56 ? -7.100  4.176   -0.832  1.00 0.00 ? 56 ASP A HA   9  
ATOM 8790  H HB2  . ASP A 1 56 ? -9.941  4.935   -0.142  1.00 0.00 ? 56 ASP A HB2  9  
ATOM 8791  H HB3  . ASP A 1 56 ? -8.787  4.345   1.050   1.00 0.00 ? 56 ASP A HB3  9  
ATOM 8792  N N    . ASP A 1 57 ? -8.475  2.035   0.287   1.00 0.00 ? 57 ASP A N    9  
ATOM 8793  C CA   . ASP A 1 57 ? -8.825  0.632   0.501   1.00 0.00 ? 57 ASP A CA   9  
ATOM 8794  C C    . ASP A 1 57 ? -8.103  0.071   1.723   1.00 0.00 ? 57 ASP A C    9  
ATOM 8795  O O    . ASP A 1 57 ? -7.209  0.714   2.269   1.00 0.00 ? 57 ASP A O    9  
ATOM 8796  C CB   . ASP A 1 57 ? -8.489  -0.213  -0.726  1.00 0.00 ? 57 ASP A CB   9  
ATOM 8797  C CG   . ASP A 1 57 ? -9.685  -0.413  -1.637  1.00 0.00 ? 57 ASP A CG   9  
ATOM 8798  O OD1  . ASP A 1 57 ? -10.755 0.165   -1.348  1.00 0.00 ? 57 ASP A OD1  9  
ATOM 8799  O OD2  . ASP A 1 57 ? -9.553  -1.146  -2.639  1.00 0.00 ? 57 ASP A OD2  9  
ATOM 8800  H H    . ASP A 1 57 ? -8.181  2.573   1.052   1.00 0.00 ? 57 ASP A H    9  
ATOM 8801  H HA   . ASP A 1 57 ? -9.888  0.584   0.676   1.00 0.00 ? 57 ASP A HA   9  
ATOM 8802  H HB2  . ASP A 1 57 ? -7.705  0.270   -1.289  1.00 0.00 ? 57 ASP A HB2  9  
ATOM 8803  H HB3  . ASP A 1 57 ? -8.149  -1.182  -0.395  1.00 0.00 ? 57 ASP A HB3  9  
ATOM 8804  N N    . TYR A 1 58 ? -8.502  -1.133  2.140   1.00 0.00 ? 58 TYR A N    9  
ATOM 8805  C CA   . TYR A 1 58 ? -7.907  -1.797  3.303   1.00 0.00 ? 58 TYR A CA   9  
ATOM 8806  C C    . TYR A 1 58 ? -6.997  -2.954  2.881   1.00 0.00 ? 58 TYR A C    9  
ATOM 8807  O O    . TYR A 1 58 ? -7.276  -3.651  1.906   1.00 0.00 ? 58 TYR A O    9  
ATOM 8808  C CB   . TYR A 1 58 ? -9.008  -2.308  4.232   1.00 0.00 ? 58 TYR A CB   9  
ATOM 8809  C CG   . TYR A 1 58 ? -9.589  -1.236  5.126   1.00 0.00 ? 58 TYR A CG   9  
ATOM 8810  C CD1  . TYR A 1 58 ? -9.896  0.022   4.624   1.00 0.00 ? 58 TYR A CD1  9  
ATOM 8811  C CD2  . TYR A 1 58 ? -9.827  -1.481  6.472   1.00 0.00 ? 58 TYR A CD2  9  
ATOM 8812  C CE1  . TYR A 1 58 ? -10.425 1.006   5.438   1.00 0.00 ? 58 TYR A CE1  9  
ATOM 8813  C CE2  . TYR A 1 58 ? -10.356 -0.504  7.293   1.00 0.00 ? 58 TYR A CE2  9  
ATOM 8814  C CZ   . TYR A 1 58 ? -10.653 0.738   6.771   1.00 0.00 ? 58 TYR A CZ   9  
ATOM 8815  O OH   . TYR A 1 58 ? -11.179 1.714   7.585   1.00 0.00 ? 58 TYR A OH   9  
ATOM 8816  H H    . TYR A 1 58 ? -9.216  -1.585  1.652   1.00 0.00 ? 58 TYR A H    9  
ATOM 8817  H HA   . TYR A 1 58 ? -7.314  -1.067  3.832   1.00 0.00 ? 58 TYR A HA   9  
ATOM 8818  H HB2  . TYR A 1 58 ? -9.812  -2.713  3.636   1.00 0.00 ? 58 TYR A HB2  9  
ATOM 8819  H HB3  . TYR A 1 58 ? -8.607  -3.085  4.861   1.00 0.00 ? 58 TYR A HB3  9  
ATOM 8820  H HD1  . TYR A 1 58 ? -9.717  0.229   3.579   1.00 0.00 ? 58 TYR A HD1  9  
ATOM 8821  H HD2  . TYR A 1 58 ? -9.593  -2.455  6.878   1.00 0.00 ? 58 TYR A HD2  9  
ATOM 8822  H HE1  . TYR A 1 58 ? -10.657 1.978   5.028   1.00 0.00 ? 58 TYR A HE1  9  
ATOM 8823  H HE2  . TYR A 1 58 ? -10.534 -0.714  8.337   1.00 0.00 ? 58 TYR A HE2  9  
ATOM 8824  H HH   . TYR A 1 58 ? -11.577 2.402   7.045   1.00 0.00 ? 58 TYR A HH   9  
ATOM 8825  N N    . CYS A 1 59 ? -5.898  -3.137  3.615   1.00 0.00 ? 59 CYS A N    9  
ATOM 8826  C CA   . CYS A 1 59 ? -4.926  -4.187  3.305   1.00 0.00 ? 59 CYS A CA   9  
ATOM 8827  C C    . CYS A 1 59 ? -5.299  -5.555  3.868   1.00 0.00 ? 59 CYS A C    9  
ATOM 8828  O O    . CYS A 1 59 ? -4.907  -5.913  4.979   1.00 0.00 ? 59 CYS A O    9  
ATOM 8829  C CB   . CYS A 1 59 ? -3.552  -3.799  3.825   1.00 0.00 ? 59 CYS A CB   9  
ATOM 8830  S SG   . CYS A 1 59 ? -2.632  -2.669  2.729   1.00 0.00 ? 59 CYS A SG   9  
ATOM 8831  H H    . CYS A 1 59 ? -5.727  -2.539  4.372   1.00 0.00 ? 59 CYS A H    9  
ATOM 8832  H HA   . CYS A 1 59 ? -4.867  -4.264  2.236   1.00 0.00 ? 59 CYS A HA   9  
ATOM 8833  H HB2  . CYS A 1 59 ? -3.672  -3.319  4.776   1.00 0.00 ? 59 CYS A HB2  9  
ATOM 8834  H HB3  . CYS A 1 59 ? -2.959  -4.692  3.952   1.00 0.00 ? 59 CYS A HB3  9  
ATOM 8835  N N    . ASN A 1 60 ? -6.016  -6.331  3.067   1.00 0.00 ? 60 ASN A N    9  
ATOM 8836  C CA   . ASN A 1 60 ? -6.409  -7.683  3.426   1.00 0.00 ? 60 ASN A CA   9  
ATOM 8837  C C    . ASN A 1 60 ? -5.771  -8.649  2.435   1.00 0.00 ? 60 ASN A C    9  
ATOM 8838  O O    . ASN A 1 60 ? -5.867  -8.448  1.225   1.00 0.00 ? 60 ASN A O    9  
ATOM 8839  C CB   . ASN A 1 60 ? -7.932  -7.830  3.403   1.00 0.00 ? 60 ASN A CB   9  
ATOM 8840  C CG   . ASN A 1 60 ? -8.585  -7.301  4.664   1.00 0.00 ? 60 ASN A CG   9  
ATOM 8841  O OD1  . ASN A 1 60 ? -9.505  -7.917  5.203   1.00 0.00 ? 60 ASN A OD1  9  
ATOM 8842  N ND2  . ASN A 1 60 ? -8.117  -6.154  5.144   1.00 0.00 ? 60 ASN A ND2  9  
ATOM 8843  H H    . ASN A 1 60 ? -6.261  -5.996  2.191   1.00 0.00 ? 60 ASN A H    9  
ATOM 8844  H HA   . ASN A 1 60 ? -6.039  -7.892  4.417   1.00 0.00 ? 60 ASN A HA   9  
ATOM 8845  H HB2  . ASN A 1 60 ? -8.327  -7.284  2.560   1.00 0.00 ? 60 ASN A HB2  9  
ATOM 8846  H HB3  . ASN A 1 60 ? -8.184  -8.875  3.300   1.00 0.00 ? 60 ASN A HB3  9  
ATOM 8847  H HD21 . ASN A 1 60 ? -7.386  -5.712  4.667   1.00 0.00 ? 60 ASN A HD21 9  
ATOM 8848  H HD22 . ASN A 1 60 ? -8.520  -5.801  5.959   1.00 0.00 ? 60 ASN A HD22 9  
ATOM 8849  N N    . GLY A 1 61 ? -5.089  -9.673  2.935   1.00 0.00 ? 61 GLY A N    9  
ATOM 8850  C CA   . GLY A 1 61 ? -4.425  -10.608 2.041   1.00 0.00 ? 61 GLY A CA   9  
ATOM 8851  C C    . GLY A 1 61 ? -3.780  -9.870  0.887   1.00 0.00 ? 61 GLY A C    9  
ATOM 8852  O O    . GLY A 1 61 ? -3.789  -10.333 -0.253  1.00 0.00 ? 61 GLY A O    9  
ATOM 8853  H H    . GLY A 1 61 ? -5.016  -9.776  3.903   1.00 0.00 ? 61 GLY A H    9  
ATOM 8854  H HA2  . GLY A 1 61 ? -3.667  -11.148 2.588   1.00 0.00 ? 61 GLY A HA2  9  
ATOM 8855  H HA3  . GLY A 1 61 ? -5.151  -11.306 1.652   1.00 0.00 ? 61 GLY A HA3  9  
ATOM 8856  N N    . ILE A 1 62 ? -3.268  -8.684  1.203   1.00 0.00 ? 62 ILE A N    9  
ATOM 8857  C CA   . ILE A 1 62 ? -2.648  -7.795  0.223   1.00 0.00 ? 62 ILE A CA   9  
ATOM 8858  C C    . ILE A 1 62 ? -1.141  -7.997  0.056   1.00 0.00 ? 62 ILE A C    9  
ATOM 8859  O O    . ILE A 1 62 ? -0.361  -7.097  0.360   1.00 0.00 ? 62 ILE A O    9  
ATOM 8860  C CB   . ILE A 1 62 ? -2.874  -6.326  0.623   1.00 0.00 ? 62 ILE A CB   9  
ATOM 8861  C CG1  . ILE A 1 62 ? -2.594  -6.111  2.112   1.00 0.00 ? 62 ILE A CG1  9  
ATOM 8862  C CG2  . ILE A 1 62 ? -4.293  -5.908  0.315   1.00 0.00 ? 62 ILE A CG2  9  
ATOM 8863  C CD1  . ILE A 1 62 ? -1.469  -6.946  2.675   1.00 0.00 ? 62 ILE A CD1  9  
ATOM 8864  H H    . ILE A 1 62 ? -3.348  -8.376  2.129   1.00 0.00 ? 62 ILE A H    9  
ATOM 8865  H HA   . ILE A 1 62 ? -3.131  -7.957  -0.727  1.00 0.00 ? 62 ILE A HA   9  
ATOM 8866  H HB   . ILE A 1 62 ? -2.205  -5.708  0.044   1.00 0.00 ? 62 ILE A HB   9  
ATOM 8867  H HG12 . ILE A 1 62 ? -2.336  -5.079  2.267   1.00 0.00 ? 62 ILE A HG12 9  
ATOM 8868  H HG13 . ILE A 1 62 ? -3.486  -6.340  2.671   1.00 0.00 ? 62 ILE A HG13 9  
ATOM 8869  H HG21 . ILE A 1 62 ? -4.827  -5.774  1.238   1.00 0.00 ? 62 ILE A HG21 9  
ATOM 8870  H HG22 . ILE A 1 62 ? -4.776  -6.673  -0.271  1.00 0.00 ? 62 ILE A HG22 9  
ATOM 8871  H HG23 . ILE A 1 62 ? -4.286  -4.980  -0.233  1.00 0.00 ? 62 ILE A HG23 9  
ATOM 8872  H HD11 . ILE A 1 62 ? -0.531  -6.555  2.329   1.00 0.00 ? 62 ILE A HD11 9  
ATOM 8873  H HD12 . ILE A 1 62 ? -1.575  -7.968  2.352   1.00 0.00 ? 62 ILE A HD12 9  
ATOM 8874  H HD13 . ILE A 1 62 ? -1.500  -6.904  3.754   1.00 0.00 ? 62 ILE A HD13 9  
ATOM 8875  N N    . SER A 1 63 ? -0.721  -9.139  -0.470  1.00 0.00 ? 63 SER A N    9  
ATOM 8876  C CA   . SER A 1 63 ? 0.700   -9.363  -0.697  1.00 0.00 ? 63 SER A CA   9  
ATOM 8877  C C    . SER A 1 63 ? 1.172   -8.464  -1.834  1.00 0.00 ? 63 SER A C    9  
ATOM 8878  O O    . SER A 1 63 ? 1.461   -8.933  -2.934  1.00 0.00 ? 63 SER A O    9  
ATOM 8879  C CB   . SER A 1 63 ? 0.976   -10.826 -1.030  1.00 0.00 ? 63 SER A CB   9  
ATOM 8880  O OG   . SER A 1 63 ? -0.024  -11.356 -1.883  1.00 0.00 ? 63 SER A OG   9  
ATOM 8881  H H    . SER A 1 63 ? -1.368  -9.820  -0.739  1.00 0.00 ? 63 SER A H    9  
ATOM 8882  H HA   . SER A 1 63 ? 1.229   -9.095  0.206   1.00 0.00 ? 63 SER A HA   9  
ATOM 8883  H HB2  . SER A 1 63 ? 1.932   -10.901 -1.526  1.00 0.00 ? 63 SER A HB2  9  
ATOM 8884  H HB3  . SER A 1 63 ? 0.998   -11.399 -0.117  1.00 0.00 ? 63 SER A HB3  9  
ATOM 8885  H HG   . SER A 1 63 ? 0.109   -11.027 -2.775  1.00 0.00 ? 63 SER A HG   9  
ATOM 8886  N N    . ALA A 1 64 ? 1.210   -7.164  -1.558  1.00 0.00 ? 64 ALA A N    9  
ATOM 8887  C CA   . ALA A 1 64 ? 1.605   -6.165  -2.544  1.00 0.00 ? 64 ALA A CA   9  
ATOM 8888  C C    . ALA A 1 64 ? 0.483   -5.936  -3.549  1.00 0.00 ? 64 ALA A C    9  
ATOM 8889  O O    . ALA A 1 64 ? 0.692   -5.350  -4.611  1.00 0.00 ? 64 ALA A O    9  
ATOM 8890  C CB   . ALA A 1 64 ? 2.888   -6.559  -3.259  1.00 0.00 ? 64 ALA A CB   9  
ATOM 8891  H H    . ALA A 1 64 ? 0.941   -6.863  -0.665  1.00 0.00 ? 64 ALA A H    9  
ATOM 8892  H HA   . ALA A 1 64 ? 1.790   -5.244  -2.016  1.00 0.00 ? 64 ALA A HA   9  
ATOM 8893  H HB1  . ALA A 1 64 ? 3.100   -5.833  -4.031  1.00 0.00 ? 64 ALA A HB1  9  
ATOM 8894  H HB2  . ALA A 1 64 ? 2.772   -7.532  -3.705  1.00 0.00 ? 64 ALA A HB2  9  
ATOM 8895  H HB3  . ALA A 1 64 ? 3.704   -6.579  -2.553  1.00 0.00 ? 64 ALA A HB3  9  
ATOM 8896  N N    . GLY A 1 65 ? -0.713  -6.405  -3.200  1.00 0.00 ? 65 GLY A N    9  
ATOM 8897  C CA   . GLY A 1 65 ? -1.862  -6.247  -4.072  1.00 0.00 ? 65 GLY A CA   9  
ATOM 8898  C C    . GLY A 1 65 ? -3.053  -5.648  -3.350  1.00 0.00 ? 65 GLY A C    9  
ATOM 8899  O O    . GLY A 1 65 ? -2.935  -4.601  -2.715  1.00 0.00 ? 65 GLY A O    9  
ATOM 8900  H H    . GLY A 1 65 ? -0.816  -6.862  -2.340  1.00 0.00 ? 65 GLY A H    9  
ATOM 8901  H HA2  . GLY A 1 65 ? -1.590  -5.602  -4.895  1.00 0.00 ? 65 GLY A HA2  9  
ATOM 8902  H HA3  . GLY A 1 65 ? -2.140  -7.214  -4.462  1.00 0.00 ? 65 GLY A HA3  9  
ATOM 8903  N N    . CYS A 1 66 ? -4.201  -6.313  -3.447  1.00 0.00 ? 66 CYS A N    9  
ATOM 8904  C CA   . CYS A 1 66 ? -5.421  -5.840  -2.797  1.00 0.00 ? 66 CYS A CA   9  
ATOM 8905  C C    . CYS A 1 66 ? -6.481  -6.939  -2.750  1.00 0.00 ? 66 CYS A C    9  
ATOM 8906  O O    . CYS A 1 66 ? -6.596  -7.738  -3.678  1.00 0.00 ? 66 CYS A O    9  
ATOM 8907  C CB   . CYS A 1 66 ? -5.975  -4.621  -3.537  1.00 0.00 ? 66 CYS A CB   9  
ATOM 8908  S SG   . CYS A 1 66 ? -5.143  -3.055  -3.127  1.00 0.00 ? 66 CYS A SG   9  
ATOM 8909  H H    . CYS A 1 66 ? -4.229  -7.143  -3.967  1.00 0.00 ? 66 CYS A H    9  
ATOM 8910  H HA   . CYS A 1 66 ? -5.171  -5.552  -1.790  1.00 0.00 ? 66 CYS A HA   9  
ATOM 8911  H HB2  . CYS A 1 66 ? -5.871  -4.776  -4.599  1.00 0.00 ? 66 CYS A HB2  9  
ATOM 8912  H HB3  . CYS A 1 66 ? -7.021  -4.508  -3.295  1.00 0.00 ? 66 CYS A HB3  9  
ATOM 8913  N N    . PRO A 1 67 ? -7.274  -6.990  -1.663  1.00 0.00 ? 67 PRO A N    9  
ATOM 8914  C CA   . PRO A 1 67 ? -8.335  -7.991  -1.496  1.00 0.00 ? 67 PRO A CA   9  
ATOM 8915  C C    . PRO A 1 67 ? -9.266  -8.058  -2.703  1.00 0.00 ? 67 PRO A C    9  
ATOM 8916  O O    . PRO A 1 67 ? -8.913  -7.624  -3.799  1.00 0.00 ? 67 PRO A O    9  
ATOM 8917  C CB   . PRO A 1 67 ? -9.105  -7.504  -0.257  1.00 0.00 ? 67 PRO A CB   9  
ATOM 8918  C CG   . PRO A 1 67 ? -8.625  -6.112  -0.013  1.00 0.00 ? 67 PRO A CG   9  
ATOM 8919  C CD   . PRO A 1 67 ? -7.212  -6.082  -0.512  1.00 0.00 ? 67 PRO A CD   9  
ATOM 8920  H HA   . PRO A 1 67 ? -7.924  -8.972  -1.304  1.00 0.00 ? 67 PRO A HA   9  
ATOM 8921  H HB2  . PRO A 1 67 ? -10.166 -7.525  -0.461  1.00 0.00 ? 67 PRO A HB2  9  
ATOM 8922  H HB3  . PRO A 1 67 ? -8.884  -8.148  0.582   1.00 0.00 ? 67 PRO A HB3  9  
ATOM 8923  H HG2  . PRO A 1 67 ? -9.233  -5.410  -0.564  1.00 0.00 ? 67 PRO A HG2  9  
ATOM 8924  H HG3  . PRO A 1 67 ? -8.655  -5.890  1.043   1.00 0.00 ? 67 PRO A HG3  9  
ATOM 8925  H HD2  . PRO A 1 67 ? -6.931  -5.083  -0.811  1.00 0.00 ? 67 PRO A HD2  9  
ATOM 8926  H HD3  . PRO A 1 67 ? -6.540  -6.460  0.243   1.00 0.00 ? 67 PRO A HD3  9  
ATOM 8927  N N    . ARG A 1 68 ? -10.460 -8.604  -2.492  1.00 0.00 ? 68 ARG A N    9  
ATOM 8928  C CA   . ARG A 1 68 ? -11.443 -8.727  -3.563  1.00 0.00 ? 68 ARG A CA   9  
ATOM 8929  C C    . ARG A 1 68 ? -12.547 -7.684  -3.417  1.00 0.00 ? 68 ARG A C    9  
ATOM 8930  O O    . ARG A 1 68 ? -13.084 -7.192  -4.409  1.00 0.00 ? 68 ARG A O    9  
ATOM 8931  C CB   . ARG A 1 68 ? -12.051 -10.131 -3.564  1.00 0.00 ? 68 ARG A CB   9  
ATOM 8932  C CG   . ARG A 1 68 ? -11.016 -11.243 -3.610  1.00 0.00 ? 68 ARG A CG   9  
ATOM 8933  C CD   . ARG A 1 68 ? -11.063 -11.994 -4.931  1.00 0.00 ? 68 ARG A CD   9  
ATOM 8934  N NE   . ARG A 1 68 ? -11.243 -13.430 -4.738  1.00 0.00 ? 68 ARG A NE   9  
ATOM 8935  C CZ   . ARG A 1 68 ? -12.312 -13.967 -4.160  1.00 0.00 ? 68 ARG A CZ   9  
ATOM 8936  N NH1  . ARG A 1 68 ? -13.292 -13.190 -3.720  1.00 0.00 ? 68 ARG A NH1  9  
ATOM 8937  N NH2  . ARG A 1 68 ? -12.403 -15.283 -4.021  1.00 0.00 ? 68 ARG A NH2  9  
ATOM 8938  H H    . ARG A 1 68 ? -10.685 -8.931  -1.597  1.00 0.00 ? 68 ARG A H    9  
ATOM 8939  H HA   . ARG A 1 68 ? -10.933 -8.565  -4.501  1.00 0.00 ? 68 ARG A HA   9  
ATOM 8940  H HB2  . ARG A 1 68 ? -12.642 -10.256 -2.669  1.00 0.00 ? 68 ARG A HB2  9  
ATOM 8941  H HB3  . ARG A 1 68 ? -12.694 -10.232 -4.426  1.00 0.00 ? 68 ARG A HB3  9  
ATOM 8942  H HG2  . ARG A 1 68 ? -10.033 -10.812 -3.488  1.00 0.00 ? 68 ARG A HG2  9  
ATOM 8943  H HG3  . ARG A 1 68 ? -11.210 -11.936 -2.805  1.00 0.00 ? 68 ARG A HG3  9  
ATOM 8944  H HD2  . ARG A 1 68 ? -11.887 -11.614 -5.517  1.00 0.00 ? 68 ARG A HD2  9  
ATOM 8945  H HD3  . ARG A 1 68 ? -10.137 -11.824 -5.461  1.00 0.00 ? 68 ARG A HD3  9  
ATOM 8946  H HE   . ARG A 1 68 ? -10.530 -14.024 -5.055  1.00 0.00 ? 68 ARG A HE   9  
ATOM 8947  H HH11 . ARG A 1 68 ? -13.227 -12.197 -3.824  1.00 0.00 ? 68 ARG A HH11 9  
ATOM 8948  H HH12 . ARG A 1 68 ? -14.096 -13.596 -3.286  1.00 0.00 ? 68 ARG A HH12 9  
ATOM 8949  H HH21 . ARG A 1 68 ? -11.666 -15.872 -4.352  1.00 0.00 ? 68 ARG A HH21 9  
ATOM 8950  H HH22 . ARG A 1 68 ? -13.208 -15.686 -3.586  1.00 0.00 ? 68 ARG A HH22 9  
ATOM 8951  N N    . ASN A 1 69 ? -12.884 -7.354  -2.174  1.00 0.00 ? 69 ASN A N    9  
ATOM 8952  C CA   . ASN A 1 69 ? -13.928 -6.372  -1.902  1.00 0.00 ? 69 ASN A CA   9  
ATOM 8953  C C    . ASN A 1 69 ? -13.326 -5.025  -1.512  1.00 0.00 ? 69 ASN A C    9  
ATOM 8954  O O    . ASN A 1 69 ? -12.383 -4.958  -0.724  1.00 0.00 ? 69 ASN A O    9  
ATOM 8955  C CB   . ASN A 1 69 ? -14.849 -6.873  -0.787  1.00 0.00 ? 69 ASN A CB   9  
ATOM 8956  C CG   . ASN A 1 69 ? -15.828 -7.922  -1.274  1.00 0.00 ? 69 ASN A CG   9  
ATOM 8957  O OD1  . ASN A 1 69 ? -15.638 -8.522  -2.332  1.00 0.00 ? 69 ASN A OD1  9  
ATOM 8958  N ND2  . ASN A 1 69 ? -16.885 -8.149  -0.502  1.00 0.00 ? 69 ASN A ND2  9  
ATOM 8959  H H    . ASN A 1 69 ? -12.423 -7.782  -1.423  1.00 0.00 ? 69 ASN A H    9  
ATOM 8960  H HA   . ASN A 1 69 ? -14.507 -6.246  -2.804  1.00 0.00 ? 69 ASN A HA   9  
ATOM 8961  H HB2  . ASN A 1 69 ? -14.249 -7.305  0.000   1.00 0.00 ? 69 ASN A HB2  9  
ATOM 8962  H HB3  . ASN A 1 69 ? -15.409 -6.039  -0.390  1.00 0.00 ? 69 ASN A HB3  9  
ATOM 8963  H HD21 . ASN A 1 69 ? -16.972 -7.634  0.327   1.00 0.00 ? 69 ASN A HD21 9  
ATOM 8964  H HD22 . ASN A 1 69 ? -17.534 -8.823  -0.793  1.00 0.00 ? 69 ASN A HD22 9  
ATOM 8965  N N    . PRO A 1 70 ? -13.873 -3.931  -2.063  1.00 0.00 ? 70 PRO A N    9  
ATOM 8966  C CA   . PRO A 1 70 ? -13.396 -2.573  -1.775  1.00 0.00 ? 70 PRO A CA   9  
ATOM 8967  C C    . PRO A 1 70 ? -13.372 -2.275  -0.280  1.00 0.00 ? 70 PRO A C    9  
ATOM 8968  O O    . PRO A 1 70 ? -13.585 -3.165  0.543   1.00 0.00 ? 70 PRO A O    9  
ATOM 8969  C CB   . PRO A 1 70 ? -14.417 -1.677  -2.482  1.00 0.00 ? 70 PRO A CB   9  
ATOM 8970  C CG   . PRO A 1 70 ? -14.999 -2.533  -3.554  1.00 0.00 ? 70 PRO A CG   9  
ATOM 8971  C CD   . PRO A 1 70 ? -15.002 -3.934  -3.009  1.00 0.00 ? 70 PRO A CD   9  
ATOM 8972  H HA   . PRO A 1 70 ? -12.414 -2.403  -2.191  1.00 0.00 ? 70 PRO A HA   9  
ATOM 8973  H HB2  . PRO A 1 70 ? -15.170 -1.360  -1.776  1.00 0.00 ? 70 PRO A HB2  9  
ATOM 8974  H HB3  . PRO A 1 70 ? -13.917 -0.814  -2.896  1.00 0.00 ? 70 PRO A HB3  9  
ATOM 8975  H HG2  . PRO A 1 70 ? -16.008 -2.213  -3.771  1.00 0.00 ? 70 PRO A HG2  9  
ATOM 8976  H HG3  . PRO A 1 70 ? -14.387 -2.477  -4.442  1.00 0.00 ? 70 PRO A HG3  9  
ATOM 8977  H HD2  . PRO A 1 70 ? -15.932 -4.140  -2.500  1.00 0.00 ? 70 PRO A HD2  9  
ATOM 8978  H HD3  . PRO A 1 70 ? -14.837 -4.648  -3.802  1.00 0.00 ? 70 PRO A HD3  9  
ATOM 8979  N N    . PHE A 1 71 ? -13.112 -1.017  0.066   1.00 0.00 ? 71 PHE A N    9  
ATOM 8980  C CA   . PHE A 1 71 ? -13.061 -0.606  1.464   1.00 0.00 ? 71 PHE A CA   9  
ATOM 8981  C C    . PHE A 1 71 ? -13.141 0.912   1.592   1.00 0.00 ? 71 PHE A C    9  
ATOM 8982  O O    . PHE A 1 71 ? -13.778 1.434   2.507   1.00 0.00 ? 71 PHE A O    9  
ATOM 8983  C CB   . PHE A 1 71 ? -11.778 -1.118  2.121   1.00 0.00 ? 71 PHE A CB   9  
ATOM 8984  C CG   . PHE A 1 71 ? -11.790 -2.596  2.387   1.00 0.00 ? 71 PHE A CG   9  
ATOM 8985  C CD1  . PHE A 1 71 ? -12.377 -3.102  3.535   1.00 0.00 ? 71 PHE A CD1  9  
ATOM 8986  C CD2  . PHE A 1 71 ? -11.213 -3.479  1.488   1.00 0.00 ? 71 PHE A CD2  9  
ATOM 8987  C CE1  . PHE A 1 71 ? -12.390 -4.462  3.782   1.00 0.00 ? 71 PHE A CE1  9  
ATOM 8988  C CE2  . PHE A 1 71 ? -11.223 -4.840  1.730   1.00 0.00 ? 71 PHE A CE2  9  
ATOM 8989  C CZ   . PHE A 1 71 ? -11.812 -5.332  2.878   1.00 0.00 ? 71 PHE A CZ   9  
ATOM 8990  H H    . PHE A 1 71 ? -12.951 -0.352  -0.635  1.00 0.00 ? 71 PHE A H    9  
ATOM 8991  H HA   . PHE A 1 71 ? -13.910 -1.042  1.968   1.00 0.00 ? 71 PHE A HA   9  
ATOM 8992  H HB2  . PHE A 1 71 ? -10.941 -0.903  1.474   1.00 0.00 ? 71 PHE A HB2  9  
ATOM 8993  H HB3  . PHE A 1 71 ? -11.638 -0.610  3.064   1.00 0.00 ? 71 PHE A HB3  9  
ATOM 8994  H HD1  . PHE A 1 71 ? -12.830 -2.422  4.242   1.00 0.00 ? 71 PHE A HD1  9  
ATOM 8995  H HD2  . PHE A 1 71 ? -10.752 -3.096  0.590   1.00 0.00 ? 71 PHE A HD2  9  
ATOM 8996  H HE1  . PHE A 1 71 ? -12.851 -4.843  4.681   1.00 0.00 ? 71 PHE A HE1  9  
ATOM 8997  H HE2  . PHE A 1 71 ? -10.770 -5.518  1.022   1.00 0.00 ? 71 PHE A HE2  9  
ATOM 8998  H HZ   . PHE A 1 71 ? -11.821 -6.395  3.069   1.00 0.00 ? 71 PHE A HZ   9  
ATOM 8999  N N    . HIS A 1 72 ? -12.489 1.617   0.672   1.00 0.00 ? 72 HIS A N    9  
ATOM 9000  C CA   . HIS A 1 72 ? -12.486 3.075   0.686   1.00 0.00 ? 72 HIS A CA   9  
ATOM 9001  C C    . HIS A 1 72 ? -13.833 3.619   1.155   1.00 0.00 ? 72 HIS A C    9  
ATOM 9002  O O    . HIS A 1 72 ? -14.024 3.895   2.339   1.00 0.00 ? 72 HIS A O    9  
ATOM 9003  C CB   . HIS A 1 72 ? -12.161 3.621   -0.705  1.00 0.00 ? 72 HIS A CB   9  
ATOM 9004  C CG   . HIS A 1 72 ? -12.503 5.069   -0.873  1.00 0.00 ? 72 HIS A CG   9  
ATOM 9005  N ND1  . HIS A 1 72 ? -13.239 5.550   -1.934  1.00 0.00 ? 72 HIS A ND1  9  
ATOM 9006  C CD2  . HIS A 1 72 ? -12.208 6.143   -0.104  1.00 0.00 ? 72 HIS A CD2  9  
ATOM 9007  C CE1  . HIS A 1 72 ? -13.381 6.858   -1.812  1.00 0.00 ? 72 HIS A CE1  9  
ATOM 9008  N NE2  . HIS A 1 72 ? -12.765 7.243   -0.709  1.00 0.00 ? 72 HIS A NE2  9  
ATOM 9009  H H    . HIS A 1 72 ? -11.997 1.145   -0.032  1.00 0.00 ? 72 HIS A H    9  
ATOM 9010  H HA   . HIS A 1 72 ? -11.722 3.398   1.377   1.00 0.00 ? 72 HIS A HA   9  
ATOM 9011  H HB2  . HIS A 1 72 ? -11.103 3.506   -0.891  1.00 0.00 ? 72 HIS A HB2  9  
ATOM 9012  H HB3  . HIS A 1 72 ? -12.715 3.059   -1.443  1.00 0.00 ? 72 HIS A HB3  9  
ATOM 9013  H HD1  . HIS A 1 72 ? -13.602 5.013   -2.669  1.00 0.00 ? 72 HIS A HD1  9  
ATOM 9014  H HD2  . HIS A 1 72 ? -11.639 6.137   0.816   1.00 0.00 ? 72 HIS A HD2  9  
ATOM 9015  H HE1  . HIS A 1 72 ? -13.912 7.503   -2.496  1.00 0.00 ? 72 HIS A HE1  9  
ATOM 9016  H HE2  . HIS A 1 72 ? -12.814 8.141   -0.320  1.00 0.00 ? 72 HIS A HE2  9  
ATOM 9017  N N    . ALA A 1 73 ? -14.762 3.771   0.217   1.00 0.00 ? 73 ALA A N    9  
ATOM 9018  C CA   . ALA A 1 73 ? -16.091 4.282   0.534   1.00 0.00 ? 73 ALA A CA   9  
ATOM 9019  C C    . ALA A 1 73 ? -16.563 3.777   1.893   1.00 0.00 ? 73 ALA A C    9  
ATOM 9020  O O    . ALA A 1 73 ? -16.093 2.701   2.320   1.00 0.00 ? 73 ALA A O    9  
ATOM 9021  C CB   . ALA A 1 73 ? -17.081 3.886   -0.551  1.00 0.00 ? 73 ALA A CB   9  
ATOM 9022  O OXT  . ALA A 1 73 ? -17.398 4.461   2.520   1.00 0.00 ? 73 ALA A OXT  9  
ATOM 9023  H H    . ALA A 1 73 ? -14.550 3.534   -0.709  1.00 0.00 ? 73 ALA A H    9  
ATOM 9024  H HA   . ALA A 1 73 ? -16.035 5.360   0.562   1.00 0.00 ? 73 ALA A HA   9  
ATOM 9025  H HB1  . ALA A 1 73 ? -17.748 3.127   -0.170  1.00 0.00 ? 73 ALA A HB1  9  
ATOM 9026  H HB2  . ALA A 1 73 ? -16.544 3.498   -1.404  1.00 0.00 ? 73 ALA A HB2  9  
ATOM 9027  H HB3  . ALA A 1 73 ? -17.653 4.752   -0.849  1.00 0.00 ? 73 ALA A HB3  9  
ATOM 9028  N N    . GLU A 1 1  ? -1.727  14.488  2.369   1.00 0.00 ? 1  GLU A N    10 
ATOM 9029  C CA   . GLU A 1 1  ? -2.109  13.171  1.795   1.00 0.00 ? 1  GLU A CA   10 
ATOM 9030  C C    . GLU A 1 1  ? -3.423  12.672  2.388   1.00 0.00 ? 1  GLU A C    10 
ATOM 9031  O O    . GLU A 1 1  ? -4.198  13.448  2.946   1.00 0.00 ? 1  GLU A O    10 
ATOM 9032  C CB   . GLU A 1 1  ? -0.987  12.171  2.081   1.00 0.00 ? 1  GLU A CB   10 
ATOM 9033  C CG   . GLU A 1 1  ? 0.384   12.651  1.635   1.00 0.00 ? 1  GLU A CG   10 
ATOM 9034  C CD   . GLU A 1 1  ? 0.384   13.173  0.211   1.00 0.00 ? 1  GLU A CD   10 
ATOM 9035  O OE1  . GLU A 1 1  ? -0.323  12.587  -0.636  1.00 0.00 ? 1  GLU A OE1  10 
ATOM 9036  O OE2  . GLU A 1 1  ? 1.093   14.166  -0.057  1.00 0.00 ? 1  GLU A OE2  10 
ATOM 9037  H H1   . GLU A 1 1  ? -1.305  14.317  3.303   1.00 0.00 ? 1  GLU A H1   10 
ATOM 9038  H H2   . GLU A 1 1  ? -2.591  15.063  2.446   1.00 0.00 ? 1  GLU A H2   10 
ATOM 9039  H H3   . GLU A 1 1  ? -1.040  14.928  1.724   1.00 0.00 ? 1  GLU A H3   10 
ATOM 9040  H HA   . GLU A 1 1  ? -2.224  13.282  0.727   1.00 0.00 ? 1  GLU A HA   10 
ATOM 9041  H HB2  . GLU A 1 1  ? -0.951  11.983  3.144   1.00 0.00 ? 1  GLU A HB2  10 
ATOM 9042  H HB3  . GLU A 1 1  ? -1.206  11.247  1.568   1.00 0.00 ? 1  GLU A HB3  10 
ATOM 9043  H HG2  . GLU A 1 1  ? 0.705   13.445  2.292   1.00 0.00 ? 1  GLU A HG2  10 
ATOM 9044  H HG3  . GLU A 1 1  ? 1.079   11.827  1.701   1.00 0.00 ? 1  GLU A HG3  10 
ATOM 9045  N N    . ALA A 1 2  ? -3.666  11.371  2.262   1.00 0.00 ? 2  ALA A N    10 
ATOM 9046  C CA   . ALA A 1 2  ? -4.885  10.769  2.786   1.00 0.00 ? 2  ALA A CA   10 
ATOM 9047  C C    . ALA A 1 2  ? -4.578  9.495   3.565   1.00 0.00 ? 2  ALA A C    10 
ATOM 9048  O O    . ALA A 1 2  ? -5.185  9.230   4.603   1.00 0.00 ? 2  ALA A O    10 
ATOM 9049  C CB   . ALA A 1 2  ? -5.857  10.475  1.652   1.00 0.00 ? 2  ALA A CB   10 
ATOM 9050  H H    . ALA A 1 2  ? -3.010  10.804  1.807   1.00 0.00 ? 2  ALA A H    10 
ATOM 9051  H HA   . ALA A 1 2  ? -5.351  11.482  3.450   1.00 0.00 ? 2  ALA A HA   10 
ATOM 9052  H HB1  . ALA A 1 2  ? -6.858  10.737  1.960   1.00 0.00 ? 2  ALA A HB1  10 
ATOM 9053  H HB2  . ALA A 1 2  ? -5.818  9.423   1.409   1.00 0.00 ? 2  ALA A HB2  10 
ATOM 9054  H HB3  . ALA A 1 2  ? -5.583  11.055  0.784   1.00 0.00 ? 2  ALA A HB3  10 
ATOM 9055  N N    . GLY A 1 3  ? -3.633  8.709   3.059   1.00 0.00 ? 3  GLY A N    10 
ATOM 9056  C CA   . GLY A 1 3  ? -3.264  7.473   3.723   1.00 0.00 ? 3  GLY A CA   10 
ATOM 9057  C C    . GLY A 1 3  ? -2.112  7.654   4.692   1.00 0.00 ? 3  GLY A C    10 
ATOM 9058  O O    . GLY A 1 3  ? -2.319  8.036   5.844   1.00 0.00 ? 3  GLY A O    10 
ATOM 9059  H H    . GLY A 1 3  ? -3.183  8.971   2.229   1.00 0.00 ? 3  GLY A H    10 
ATOM 9060  H HA2  . GLY A 1 3  ? -4.121  7.100   4.265   1.00 0.00 ? 3  GLY A HA2  10 
ATOM 9061  H HA3  . GLY A 1 3  ? -2.982  6.746   2.977   1.00 0.00 ? 3  GLY A HA3  10 
ATOM 9062  N N    . GLU A 1 4  ? -0.896  7.377   4.230   1.00 0.00 ? 4  GLU A N    10 
ATOM 9063  C CA   . GLU A 1 4  ? 0.287   7.511   5.074   1.00 0.00 ? 4  GLU A CA   10 
ATOM 9064  C C    . GLU A 1 4  ? 1.348   8.382   4.409   1.00 0.00 ? 4  GLU A C    10 
ATOM 9065  O O    . GLU A 1 4  ? 1.114   8.966   3.351   1.00 0.00 ? 4  GLU A O    10 
ATOM 9066  C CB   . GLU A 1 4  ? 0.870   6.133   5.393   1.00 0.00 ? 4  GLU A CB   10 
ATOM 9067  C CG   . GLU A 1 4  ? 0.065   5.357   6.422   1.00 0.00 ? 4  GLU A CG   10 
ATOM 9068  C CD   . GLU A 1 4  ? -0.514  6.250   7.502   1.00 0.00 ? 4  GLU A CD   10 
ATOM 9069  O OE1  . GLU A 1 4  ? 0.270   6.937   8.189   1.00 0.00 ? 4  GLU A OE1  10 
ATOM 9070  O OE2  . GLU A 1 4  ? -1.753  6.261   7.661   1.00 0.00 ? 4  GLU A OE2  10 
ATOM 9071  H H    . GLU A 1 4  ? -0.792  7.073   3.302   1.00 0.00 ? 4  GLU A H    10 
ATOM 9072  H HA   . GLU A 1 4  ? -0.019  7.982   5.997   1.00 0.00 ? 4  GLU A HA   10 
ATOM 9073  H HB2  . GLU A 1 4  ? 0.908   5.552   4.484   1.00 0.00 ? 4  GLU A HB2  10 
ATOM 9074  H HB3  . GLU A 1 4  ? 1.873   6.259   5.772   1.00 0.00 ? 4  GLU A HB3  10 
ATOM 9075  H HG2  . GLU A 1 4  ? -0.746  4.853   5.920   1.00 0.00 ? 4  GLU A HG2  10 
ATOM 9076  H HG3  . GLU A 1 4  ? 0.710   4.626   6.887   1.00 0.00 ? 4  GLU A HG3  10 
ATOM 9077  N N    . GLU A 1 5  ? 2.515   8.465   5.041   1.00 0.00 ? 5  GLU A N    10 
ATOM 9078  C CA   . GLU A 1 5  ? 3.618   9.265   4.517   1.00 0.00 ? 5  GLU A CA   10 
ATOM 9079  C C    . GLU A 1 5  ? 4.282   8.564   3.336   1.00 0.00 ? 5  GLU A C    10 
ATOM 9080  O O    . GLU A 1 5  ? 3.644   7.789   2.626   1.00 0.00 ? 5  GLU A O    10 
ATOM 9081  C CB   . GLU A 1 5  ? 4.647   9.527   5.617   1.00 0.00 ? 5  GLU A CB   10 
ATOM 9082  C CG   . GLU A 1 5  ? 4.024   9.819   6.972   1.00 0.00 ? 5  GLU A CG   10 
ATOM 9083  C CD   . GLU A 1 5  ? 4.383   11.197  7.494   1.00 0.00 ? 5  GLU A CD   10 
ATOM 9084  O OE1  . GLU A 1 5  ? 5.590   11.472  7.664   1.00 0.00 ? 5  GLU A OE1  10 
ATOM 9085  O OE2  . GLU A 1 5  ? 3.458   12.000  7.734   1.00 0.00 ? 5  GLU A OE2  10 
ATOM 9086  H H    . GLU A 1 5  ? 2.638   7.977   5.881   1.00 0.00 ? 5  GLU A H    10 
ATOM 9087  H HA   . GLU A 1 5  ? 3.214   10.208  4.180   1.00 0.00 ? 5  GLU A HA   10 
ATOM 9088  H HB2  . GLU A 1 5  ? 5.282   8.659   5.715   1.00 0.00 ? 5  GLU A HB2  10 
ATOM 9089  H HB3  . GLU A 1 5  ? 5.253   10.375  5.332   1.00 0.00 ? 5  GLU A HB3  10 
ATOM 9090  H HG2  . GLU A 1 5  ? 2.950   9.755   6.881   1.00 0.00 ? 5  GLU A HG2  10 
ATOM 9091  H HG3  . GLU A 1 5  ? 4.370   9.080   7.679   1.00 0.00 ? 5  GLU A HG3  10 
ATOM 9092  N N    . CYS A 1 6  ? 5.568   8.839   3.130   1.00 0.00 ? 6  CYS A N    10 
ATOM 9093  C CA   . CYS A 1 6  ? 6.307   8.228   2.031   1.00 0.00 ? 6  CYS A CA   10 
ATOM 9094  C C    . CYS A 1 6  ? 5.721   8.660   0.688   1.00 0.00 ? 6  CYS A C    10 
ATOM 9095  O O    . CYS A 1 6  ? 4.534   8.973   0.596   1.00 0.00 ? 6  CYS A O    10 
ATOM 9096  C CB   . CYS A 1 6  ? 6.275   6.705   2.165   1.00 0.00 ? 6  CYS A CB   10 
ATOM 9097  S SG   . CYS A 1 6  ? 6.668   5.807   0.632   1.00 0.00 ? 6  CYS A SG   10 
ATOM 9098  H H    . CYS A 1 6  ? 6.027   9.465   3.728   1.00 0.00 ? 6  CYS A H    10 
ATOM 9099  H HA   . CYS A 1 6  ? 7.331   8.567   2.090   1.00 0.00 ? 6  CYS A HA   10 
ATOM 9100  H HB2  . CYS A 1 6  ? 6.993   6.403   2.912   1.00 0.00 ? 6  CYS A HB2  10 
ATOM 9101  H HB3  . CYS A 1 6  ? 5.287   6.401   2.480   1.00 0.00 ? 6  CYS A HB3  10 
ATOM 9102  N N    . ASP A 1 7  ? 6.556   8.692   -0.349  1.00 0.00 ? 7  ASP A N    10 
ATOM 9103  C CA   . ASP A 1 7  ? 6.099   9.107   -1.673  1.00 0.00 ? 7  ASP A CA   10 
ATOM 9104  C C    . ASP A 1 7  ? 6.617   8.184   -2.775  1.00 0.00 ? 7  ASP A C    10 
ATOM 9105  O O    . ASP A 1 7  ? 6.395   8.440   -3.958  1.00 0.00 ? 7  ASP A O    10 
ATOM 9106  C CB   . ASP A 1 7  ? 6.540   10.544  -1.955  1.00 0.00 ? 7  ASP A CB   10 
ATOM 9107  C CG   . ASP A 1 7  ? 6.156   11.496  -0.840  1.00 0.00 ? 7  ASP A CG   10 
ATOM 9108  O OD1  . ASP A 1 7  ? 4.990   11.450  -0.394  1.00 0.00 ? 7  ASP A OD1  10 
ATOM 9109  O OD2  . ASP A 1 7  ? 7.022   12.288  -0.411  1.00 0.00 ? 7  ASP A OD2  10 
ATOM 9110  H H    . ASP A 1 7  ? 7.495   8.443   -0.219  1.00 0.00 ? 7  ASP A H    10 
ATOM 9111  H HA   . ASP A 1 7  ? 5.020   9.071   -1.673  1.00 0.00 ? 7  ASP A HA   10 
ATOM 9112  H HB2  . ASP A 1 7  ? 7.614   10.569  -2.070  1.00 0.00 ? 7  ASP A HB2  10 
ATOM 9113  H HB3  . ASP A 1 7  ? 6.076   10.884  -2.870  1.00 0.00 ? 7  ASP A HB3  10 
ATOM 9114  N N    . CYS A 1 8  ? 7.303   7.112   -2.391  1.00 0.00 ? 8  CYS A N    10 
ATOM 9115  C CA   . CYS A 1 8  ? 7.838   6.168   -3.367  1.00 0.00 ? 8  CYS A CA   10 
ATOM 9116  C C    . CYS A 1 8  ? 6.724   5.379   -4.049  1.00 0.00 ? 8  CYS A C    10 
ATOM 9117  O O    . CYS A 1 8  ? 6.992   4.544   -4.914  1.00 0.00 ? 8  CYS A O    10 
ATOM 9118  C CB   . CYS A 1 8  ? 8.741   5.145   -2.709  1.00 0.00 ? 8  CYS A CB   10 
ATOM 9119  S SG   . CYS A 1 8  ? 10.318  5.733   -2.022  1.00 0.00 ? 8  CYS A SG   10 
ATOM 9120  H H    . CYS A 1 8  ? 7.454   6.952   -1.437  1.00 0.00 ? 8  CYS A H    10 
ATOM 9121  H HA   . CYS A 1 8  ? 8.397   6.717   -4.108  1.00 0.00 ? 8  CYS A HA   10 
ATOM 9122  H HB2  . CYS A 1 8  ? 8.200   4.685   -1.902  1.00 0.00 ? 8  CYS A HB2  10 
ATOM 9123  H HB3  . CYS A 1 8  ? 8.968   4.398   -3.449  1.00 0.00 ? 8  CYS A HB3  10 
ATOM 9124  N N    . GLY A 1 9  ? 5.488   5.595   -3.616  1.00 0.00 ? 9  GLY A N    10 
ATOM 9125  C CA   . GLY A 1 9  ? 4.370   4.860   -4.168  1.00 0.00 ? 9  GLY A CA   10 
ATOM 9126  C C    . GLY A 1 9  ? 3.788   3.921   -3.138  1.00 0.00 ? 9  GLY A C    10 
ATOM 9127  O O    . GLY A 1 9  ? 4.015   4.102   -1.942  1.00 0.00 ? 9  GLY A O    10 
ATOM 9128  H H    . GLY A 1 9  ? 5.337   6.228   -2.887  1.00 0.00 ? 9  GLY A H    10 
ATOM 9129  H HA2  . GLY A 1 9  ? 3.608   5.558   -4.485  1.00 0.00 ? 9  GLY A HA2  10 
ATOM 9130  H HA3  . GLY A 1 9  ? 4.705   4.287   -5.019  1.00 0.00 ? 9  GLY A HA3  10 
ATOM 9131  N N    . SER A 1 10 ? 3.043   2.916   -3.576  1.00 0.00 ? 10 SER A N    10 
ATOM 9132  C CA   . SER A 1 10 ? 2.464   1.981   -2.631  1.00 0.00 ? 10 SER A CA   10 
ATOM 9133  C C    . SER A 1 10 ? 1.867   0.751   -3.303  1.00 0.00 ? 10 SER A C    10 
ATOM 9134  O O    . SER A 1 10 ? 2.444   -0.335  -3.245  1.00 0.00 ? 10 SER A O    10 
ATOM 9135  C CB   . SER A 1 10 ? 1.436   2.698   -1.765  1.00 0.00 ? 10 SER A CB   10 
ATOM 9136  O OG   . SER A 1 10 ? 2.077   3.408   -0.721  1.00 0.00 ? 10 SER A OG   10 
ATOM 9137  H H    . SER A 1 10 ? 2.884   2.803   -4.534  1.00 0.00 ? 10 SER A H    10 
ATOM 9138  H HA   . SER A 1 10 ? 3.255   1.651   -1.998  1.00 0.00 ? 10 SER A HA   10 
ATOM 9139  H HB2  . SER A 1 10 ? 0.884   3.402   -2.369  1.00 0.00 ? 10 SER A HB2  10 
ATOM 9140  H HB3  . SER A 1 10 ? 0.763   1.978   -1.339  1.00 0.00 ? 10 SER A HB3  10 
ATOM 9141  H HG   . SER A 1 10 ? 2.895   2.964   -0.487  1.00 0.00 ? 10 SER A HG   10 
ATOM 9142  N N    . PRO A 1 11 ? 0.709   0.894   -3.948  1.00 0.00 ? 11 PRO A N    10 
ATOM 9143  C CA   . PRO A 1 11 ? 0.047   -0.221  -4.625  1.00 0.00 ? 11 PRO A CA   10 
ATOM 9144  C C    . PRO A 1 11 ? 0.757   -0.597  -5.917  1.00 0.00 ? 11 PRO A C    10 
ATOM 9145  O O    . PRO A 1 11 ? 0.586   0.055   -6.946  1.00 0.00 ? 11 PRO A O    10 
ATOM 9146  C CB   . PRO A 1 11 ? -1.341  0.335   -4.906  1.00 0.00 ? 11 PRO A CB   10 
ATOM 9147  C CG   . PRO A 1 11 ? -1.117  1.797   -5.070  1.00 0.00 ? 11 PRO A CG   10 
ATOM 9148  C CD   . PRO A 1 11 ? -0.048  2.147   -4.073  1.00 0.00 ? 11 PRO A CD   10 
ATOM 9149  H HA   . PRO A 1 11 ? -0.027  -1.088  -3.985  1.00 0.00 ? 11 PRO A HA   10 
ATOM 9150  H HB2  . PRO A 1 11 ? -1.737  -0.115  -5.801  1.00 0.00 ? 11 PRO A HB2  10 
ATOM 9151  H HB3  . PRO A 1 11 ? -1.988  0.127   -4.067  1.00 0.00 ? 11 PRO A HB3  10 
ATOM 9152  H HG2  . PRO A 1 11 ? -0.781  2.008   -6.075  1.00 0.00 ? 11 PRO A HG2  10 
ATOM 9153  H HG3  . PRO A 1 11 ? -2.025  2.339   -4.855  1.00 0.00 ? 11 PRO A HG3  10 
ATOM 9154  H HD2  . PRO A 1 11 ? 0.582   2.941   -4.450  1.00 0.00 ? 11 PRO A HD2  10 
ATOM 9155  H HD3  . PRO A 1 11 ? -0.487  2.426   -3.127  1.00 0.00 ? 11 PRO A HD3  10 
ATOM 9156  N N    . GLY A 1 12 ? 1.577   -1.638  -5.845  1.00 0.00 ? 12 GLY A N    10 
ATOM 9157  C CA   . GLY A 1 12 ? 2.330   -2.067  -7.007  1.00 0.00 ? 12 GLY A CA   10 
ATOM 9158  C C    . GLY A 1 12 ? 3.714   -1.461  -6.997  1.00 0.00 ? 12 GLY A C    10 
ATOM 9159  O O    . GLY A 1 12 ? 4.656   -2.012  -7.568  1.00 0.00 ? 12 GLY A O    10 
ATOM 9160  H H    . GLY A 1 12 ? 1.690   -2.104  -4.989  1.00 0.00 ? 12 GLY A H    10 
ATOM 9161  H HA2  . GLY A 1 12 ? 2.411   -3.144  -6.999  1.00 0.00 ? 12 GLY A HA2  10 
ATOM 9162  H HA3  . GLY A 1 12 ? 1.814   -1.754  -7.901  1.00 0.00 ? 12 GLY A HA3  10 
ATOM 9163  N N    . ASN A 1 13 ? 3.828   -0.325  -6.319  1.00 0.00 ? 13 ASN A N    10 
ATOM 9164  C CA   . ASN A 1 13 ? 5.093   0.380   -6.190  1.00 0.00 ? 13 ASN A CA   10 
ATOM 9165  C C    . ASN A 1 13 ? 5.491   0.456   -4.721  1.00 0.00 ? 13 ASN A C    10 
ATOM 9166  O O    . ASN A 1 13 ? 5.762   1.534   -4.192  1.00 0.00 ? 13 ASN A O    10 
ATOM 9167  C CB   . ASN A 1 13 ? 4.986   1.787   -6.782  1.00 0.00 ? 13 ASN A CB   10 
ATOM 9168  C CG   . ASN A 1 13 ? 5.064   1.785   -8.296  1.00 0.00 ? 13 ASN A CG   10 
ATOM 9169  O OD1  . ASN A 1 13 ? 6.093   1.440   -8.876  1.00 0.00 ? 13 ASN A OD1  10 
ATOM 9170  N ND2  . ASN A 1 13 ? 3.972   2.174   -8.945  1.00 0.00 ? 13 ASN A ND2  10 
ATOM 9171  H H    . ASN A 1 13 ? 3.035   0.044   -5.878  1.00 0.00 ? 13 ASN A H    10 
ATOM 9172  H HA   . ASN A 1 13 ? 5.844   -0.178  -6.730  1.00 0.00 ? 13 ASN A HA   10 
ATOM 9173  H HB2  . ASN A 1 13 ? 4.043   2.223   -6.489  1.00 0.00 ? 13 ASN A HB2  10 
ATOM 9174  H HB3  . ASN A 1 13 ? 5.793   2.394   -6.398  1.00 0.00 ? 13 ASN A HB3  10 
ATOM 9175  H HD21 . ASN A 1 13 ? 3.189   2.435   -8.417  1.00 0.00 ? 13 ASN A HD21 10 
ATOM 9176  H HD22 . ASN A 1 13 ? 3.994   2.182   -9.924  1.00 0.00 ? 13 ASN A HD22 10 
ATOM 9177  N N    . PRO A 1 14 ? 5.530   -0.706  -4.051  1.00 0.00 ? 14 PRO A N    10 
ATOM 9178  C CA   . PRO A 1 14 ? 5.889   -0.831  -2.652  1.00 0.00 ? 14 PRO A CA   10 
ATOM 9179  C C    . PRO A 1 14 ? 6.706   0.340   -2.134  1.00 0.00 ? 14 PRO A C    10 
ATOM 9180  O O    . PRO A 1 14 ? 7.935   0.300   -2.166  1.00 0.00 ? 14 PRO A O    10 
ATOM 9181  C CB   . PRO A 1 14 ? 6.716   -2.111  -2.684  1.00 0.00 ? 14 PRO A CB   10 
ATOM 9182  C CG   . PRO A 1 14 ? 6.072   -2.952  -3.748  1.00 0.00 ? 14 PRO A CG   10 
ATOM 9183  C CD   . PRO A 1 14 ? 5.236   -2.027  -4.608  1.00 0.00 ? 14 PRO A CD   10 
ATOM 9184  H HA   . PRO A 1 14 ? 5.021   -0.977  -2.026  1.00 0.00 ? 14 PRO A HA   10 
ATOM 9185  H HB2  . PRO A 1 14 ? 7.740   -1.872  -2.935  1.00 0.00 ? 14 PRO A HB2  10 
ATOM 9186  H HB3  . PRO A 1 14 ? 6.681   -2.596  -1.724  1.00 0.00 ? 14 PRO A HB3  10 
ATOM 9187  H HG2  . PRO A 1 14 ? 6.835   -3.424  -4.344  1.00 0.00 ? 14 PRO A HG2  10 
ATOM 9188  H HG3  . PRO A 1 14 ? 5.443   -3.699  -3.289  1.00 0.00 ? 14 PRO A HG3  10 
ATOM 9189  H HD2  . PRO A 1 14 ? 5.542   -2.090  -5.640  1.00 0.00 ? 14 PRO A HD2  10 
ATOM 9190  H HD3  . PRO A 1 14 ? 4.187   -2.265  -4.506  1.00 0.00 ? 14 PRO A HD3  10 
ATOM 9191  N N    . CYS A 1 15 ? 5.998   1.375   -1.658  1.00 0.00 ? 15 CYS A N    10 
ATOM 9192  C CA   . CYS A 1 15 ? 6.614   2.590   -1.115  1.00 0.00 ? 15 CYS A CA   10 
ATOM 9193  C C    . CYS A 1 15 ? 8.133   2.517   -1.147  1.00 0.00 ? 15 CYS A C    10 
ATOM 9194  O O    . CYS A 1 15 ? 8.777   2.395   -0.107  1.00 0.00 ? 15 CYS A O    10 
ATOM 9195  C CB   . CYS A 1 15 ? 6.126   2.840   0.313   1.00 0.00 ? 15 CYS A CB   10 
ATOM 9196  S SG   . CYS A 1 15 ? 5.210   4.401   0.518   1.00 0.00 ? 15 CYS A SG   10 
ATOM 9197  H H    . CYS A 1 15 ? 5.023   1.319   -1.672  1.00 0.00 ? 15 CYS A H    10 
ATOM 9198  H HA   . CYS A 1 15 ? 6.300   3.416   -1.735  1.00 0.00 ? 15 CYS A HA   10 
ATOM 9199  H HB2  . CYS A 1 15 ? 5.467   2.037   0.608   1.00 0.00 ? 15 CYS A HB2  10 
ATOM 9200  H HB3  . CYS A 1 15 ? 6.976   2.864   0.979   1.00 0.00 ? 15 CYS A HB3  10 
ATOM 9201  N N    . CYS A 1 16 ? 8.673   2.602   -2.365  1.00 0.00 ? 16 CYS A N    10 
ATOM 9202  C CA   . CYS A 1 16 ? 10.115  2.561   -2.620  1.00 0.00 ? 16 CYS A CA   10 
ATOM 9203  C C    . CYS A 1 16 ? 10.489  1.254   -3.309  1.00 0.00 ? 16 CYS A C    10 
ATOM 9204  O O    . CYS A 1 16 ? 10.333  0.171   -2.749  1.00 0.00 ? 16 CYS A O    10 
ATOM 9205  C CB   . CYS A 1 16 ? 10.939  2.770   -1.343  1.00 0.00 ? 16 CYS A CB   10 
ATOM 9206  S SG   . CYS A 1 16 ? 10.691  4.395   -0.525  1.00 0.00 ? 16 CYS A SG   10 
ATOM 9207  H H    . CYS A 1 16 ? 8.067   2.711   -3.136  1.00 0.00 ? 16 CYS A H    10 
ATOM 9208  H HA   . CYS A 1 16 ? 10.340  3.360   -3.302  1.00 0.00 ? 16 CYS A HA   10 
ATOM 9209  H HB2  . CYS A 1 16 ? 10.688  2.001   -0.629  1.00 0.00 ? 16 CYS A HB2  10 
ATOM 9210  H HB3  . CYS A 1 16 ? 11.985  2.686   -1.589  1.00 0.00 ? 16 CYS A HB3  10 
ATOM 9211  N N    . ASP A 1 17 ? 10.963  1.375   -4.547  1.00 0.00 ? 17 ASP A N    10 
ATOM 9212  C CA   . ASP A 1 17 ? 11.345  0.213   -5.346  1.00 0.00 ? 17 ASP A CA   10 
ATOM 9213  C C    . ASP A 1 17 ? 12.192  0.616   -6.555  1.00 0.00 ? 17 ASP A C    10 
ATOM 9214  O O    . ASP A 1 17 ? 13.041  -0.153  -7.010  1.00 0.00 ? 17 ASP A O    10 
ATOM 9215  C CB   . ASP A 1 17 ? 10.099  -0.540  -5.815  1.00 0.00 ? 17 ASP A CB   10 
ATOM 9216  C CG   . ASP A 1 17 ? 8.982   0.396   -6.234  1.00 0.00 ? 17 ASP A CG   10 
ATOM 9217  O OD1  . ASP A 1 17 ? 8.691   1.349   -5.480  1.00 0.00 ? 17 ASP A OD1  10 
ATOM 9218  O OD2  . ASP A 1 17 ? 8.399   0.177   -7.316  1.00 0.00 ? 17 ASP A OD2  10 
ATOM 9219  H H    . ASP A 1 17 ? 11.044  2.269   -4.934  1.00 0.00 ? 17 ASP A H    10 
ATOM 9220  H HA   . ASP A 1 17 ? 11.930  -0.440  -4.718  1.00 0.00 ? 17 ASP A HA   10 
ATOM 9221  H HB2  . ASP A 1 17 ? 10.357  -1.162  -6.659  1.00 0.00 ? 17 ASP A HB2  10 
ATOM 9222  H HB3  . ASP A 1 17 ? 9.738   -1.164  -5.010  1.00 0.00 ? 17 ASP A HB3  10 
ATOM 9223  N N    . ALA A 1 18 ? 11.946  1.815   -7.087  1.00 0.00 ? 18 ALA A N    10 
ATOM 9224  C CA   . ALA A 1 18 ? 12.684  2.308   -8.244  1.00 0.00 ? 18 ALA A CA   10 
ATOM 9225  C C    . ALA A 1 18 ? 12.098  1.771   -9.542  1.00 0.00 ? 18 ALA A C    10 
ATOM 9226  O O    . ALA A 1 18 ? 11.994  2.490   -10.535 1.00 0.00 ? 18 ALA A O    10 
ATOM 9227  C CB   . ALA A 1 18 ? 14.154  1.930   -8.131  1.00 0.00 ? 18 ALA A CB   10 
ATOM 9228  H H    . ALA A 1 18 ? 11.249  2.376   -6.702  1.00 0.00 ? 18 ALA A H    10 
ATOM 9229  H HA   . ALA A 1 18 ? 12.615  3.386   -8.249  1.00 0.00 ? 18 ALA A HA   10 
ATOM 9230  H HB1  . ALA A 1 18 ? 14.481  2.060   -7.110  1.00 0.00 ? 18 ALA A HB1  10 
ATOM 9231  H HB2  . ALA A 1 18 ? 14.739  2.563   -8.780  1.00 0.00 ? 18 ALA A HB2  10 
ATOM 9232  H HB3  . ALA A 1 18 ? 14.283  0.898   -8.422  1.00 0.00 ? 18 ALA A HB3  10 
ATOM 9233  N N    . ALA A 1 19 ? 11.722  0.500   -9.525  1.00 0.00 ? 19 ALA A N    10 
ATOM 9234  C CA   . ALA A 1 19 ? 11.152  -0.142  -10.696 1.00 0.00 ? 19 ALA A CA   10 
ATOM 9235  C C    . ALA A 1 19 ? 10.595  -1.525  -10.361 1.00 0.00 ? 19 ALA A C    10 
ATOM 9236  O O    . ALA A 1 19 ? 9.648   -1.988  -10.995 1.00 0.00 ? 19 ALA A O    10 
ATOM 9237  C CB   . ALA A 1 19 ? 12.199  -0.241  -11.791 1.00 0.00 ? 19 ALA A CB   10 
ATOM 9238  H H    . ALA A 1 19 ? 11.833  -0.016  -8.708  1.00 0.00 ? 19 ALA A H    10 
ATOM 9239  H HA   . ALA A 1 19 ? 10.347  0.480   -11.059 1.00 0.00 ? 19 ALA A HA   10 
ATOM 9240  H HB1  . ALA A 1 19 ? 12.371  -1.279  -12.031 1.00 0.00 ? 19 ALA A HB1  10 
ATOM 9241  H HB2  . ALA A 1 19 ? 13.120  0.207   -11.446 1.00 0.00 ? 19 ALA A HB2  10 
ATOM 9242  H HB3  . ALA A 1 19 ? 11.851  0.280   -12.669 1.00 0.00 ? 19 ALA A HB3  10 
ATOM 9243  N N    . THR A 1 20 ? 11.187  -2.185  -9.365  1.00 0.00 ? 20 THR A N    10 
ATOM 9244  C CA   . THR A 1 20 ? 10.737  -3.512  -8.966  1.00 0.00 ? 20 THR A CA   10 
ATOM 9245  C C    . THR A 1 20 ? 10.527  -3.581  -7.459  1.00 0.00 ? 20 THR A C    10 
ATOM 9246  O O    . THR A 1 20 ? 11.408  -3.209  -6.684  1.00 0.00 ? 20 THR A O    10 
ATOM 9247  C CB   . THR A 1 20 ? 11.753  -4.570  -9.400  1.00 0.00 ? 20 THR A CB   10 
ATOM 9248  O OG1  . THR A 1 20 ? 11.286  -5.871  -9.089  1.00 0.00 ? 20 THR A OG1  10 
ATOM 9249  C CG2  . THR A 1 20 ? 13.109  -4.400  -8.750  1.00 0.00 ? 20 THR A CG2  10 
ATOM 9250  H H    . THR A 1 20 ? 11.941  -1.775  -8.889  1.00 0.00 ? 20 THR A H    10 
ATOM 9251  H HA   . THR A 1 20 ? 9.796   -3.705  -9.458  1.00 0.00 ? 20 THR A HA   10 
ATOM 9252  H HB   . THR A 1 20 ? 11.889  -4.505  -10.470 1.00 0.00 ? 20 THR A HB   10 
ATOM 9253  H HG1  . THR A 1 20 ? 11.609  -6.128  -8.223  1.00 0.00 ? 20 THR A HG1  10 
ATOM 9254  H HG21 . THR A 1 20 ? 13.403  -3.362  -8.796  1.00 0.00 ? 20 THR A HG21 10 
ATOM 9255  H HG22 . THR A 1 20 ? 13.836  -5.005  -9.271  1.00 0.00 ? 20 THR A HG22 10 
ATOM 9256  H HG23 . THR A 1 20 ? 13.054  -4.713  -7.718  1.00 0.00 ? 20 THR A HG23 10 
ATOM 9257  N N    . CYS A 1 21 ? 9.358   -4.060  -7.051  1.00 0.00 ? 21 CYS A N    10 
ATOM 9258  C CA   . CYS A 1 21 ? 9.039   -4.176  -5.635  1.00 0.00 ? 21 CYS A CA   10 
ATOM 9259  C C    . CYS A 1 21 ? 10.276  -4.590  -4.839  1.00 0.00 ? 21 CYS A C    10 
ATOM 9260  O O    . CYS A 1 21 ? 10.596  -5.776  -4.749  1.00 0.00 ? 21 CYS A O    10 
ATOM 9261  C CB   . CYS A 1 21 ? 7.912   -5.197  -5.421  1.00 0.00 ? 21 CYS A CB   10 
ATOM 9262  S SG   . CYS A 1 21 ? 6.376   -4.837  -6.341  1.00 0.00 ? 21 CYS A SG   10 
ATOM 9263  H H    . CYS A 1 21 ? 8.695   -4.341  -7.716  1.00 0.00 ? 21 CYS A H    10 
ATOM 9264  H HA   . CYS A 1 21 ? 8.710   -3.207  -5.290  1.00 0.00 ? 21 CYS A HA   10 
ATOM 9265  H HB2  . CYS A 1 21 ? 8.257   -6.171  -5.732  1.00 0.00 ? 21 CYS A HB2  10 
ATOM 9266  H HB3  . CYS A 1 21 ? 7.663   -5.229  -4.371  1.00 0.00 ? 21 CYS A HB3  10 
ATOM 9267  N N    . LYS A 1 22 ? 10.971  -3.610  -4.264  1.00 0.00 ? 22 LYS A N    10 
ATOM 9268  C CA   . LYS A 1 22 ? 12.173  -3.889  -3.479  1.00 0.00 ? 22 LYS A CA   10 
ATOM 9269  C C    . LYS A 1 22 ? 12.658  -2.642  -2.740  1.00 0.00 ? 22 LYS A C    10 
ATOM 9270  O O    . LYS A 1 22 ? 12.975  -1.628  -3.359  1.00 0.00 ? 22 LYS A O    10 
ATOM 9271  C CB   . LYS A 1 22 ? 13.284  -4.419  -4.386  1.00 0.00 ? 22 LYS A CB   10 
ATOM 9272  C CG   . LYS A 1 22 ? 14.652  -4.440  -3.724  1.00 0.00 ? 22 LYS A CG   10 
ATOM 9273  C CD   . LYS A 1 22 ? 15.759  -4.670  -4.741  1.00 0.00 ? 22 LYS A CD   10 
ATOM 9274  C CE   . LYS A 1 22 ? 16.005  -3.430  -5.585  1.00 0.00 ? 22 LYS A CE   10 
ATOM 9275  N NZ   . LYS A 1 22 ? 16.313  -2.239  -4.746  1.00 0.00 ? 22 LYS A NZ   10 
ATOM 9276  H H    . LYS A 1 22 ? 10.672  -2.683  -4.370  1.00 0.00 ? 22 LYS A H    10 
ATOM 9277  H HA   . LYS A 1 22 ? 11.923  -4.647  -2.752  1.00 0.00 ? 22 LYS A HA   10 
ATOM 9278  H HB2  . LYS A 1 22 ? 13.037  -5.427  -4.686  1.00 0.00 ? 22 LYS A HB2  10 
ATOM 9279  H HB3  . LYS A 1 22 ? 13.343  -3.796  -5.266  1.00 0.00 ? 22 LYS A HB3  10 
ATOM 9280  H HG2  . LYS A 1 22 ? 14.818  -3.493  -3.234  1.00 0.00 ? 22 LYS A HG2  10 
ATOM 9281  H HG3  . LYS A 1 22 ? 14.675  -5.235  -2.994  1.00 0.00 ? 22 LYS A HG3  10 
ATOM 9282  H HD2  . LYS A 1 22 ? 16.668  -4.923  -4.217  1.00 0.00 ? 22 LYS A HD2  10 
ATOM 9283  H HD3  . LYS A 1 22 ? 15.475  -5.486  -5.389  1.00 0.00 ? 22 LYS A HD3  10 
ATOM 9284  H HE2  . LYS A 1 22 ? 16.838  -3.619  -6.245  1.00 0.00 ? 22 LYS A HE2  10 
ATOM 9285  H HE3  . LYS A 1 22 ? 15.121  -3.228  -6.172  1.00 0.00 ? 22 LYS A HE3  10 
ATOM 9286  H HZ1  . LYS A 1 22 ? 17.103  -1.704  -5.161  1.00 0.00 ? 22 LYS A HZ1  10 
ATOM 9287  H HZ2  . LYS A 1 22 ? 16.578  -2.536  -3.786  1.00 0.00 ? 22 LYS A HZ2  10 
ATOM 9288  H HZ3  . LYS A 1 22 ? 15.481  -1.618  -4.688  1.00 0.00 ? 22 LYS A HZ3  10 
ATOM 9289  N N    . LEU A 1 23 ? 12.723  -2.728  -1.413  1.00 0.00 ? 23 LEU A N    10 
ATOM 9290  C CA   . LEU A 1 23 ? 13.178  -1.607  -0.595  1.00 0.00 ? 23 LEU A CA   10 
ATOM 9291  C C    . LEU A 1 23 ? 13.810  -2.089  0.707   1.00 0.00 ? 23 LEU A C    10 
ATOM 9292  O O    . LEU A 1 23 ? 13.210  -2.863  1.454   1.00 0.00 ? 23 LEU A O    10 
ATOM 9293  C CB   . LEU A 1 23 ? 12.026  -0.637  -0.295  1.00 0.00 ? 23 LEU A CB   10 
ATOM 9294  C CG   . LEU A 1 23 ? 10.822  -1.213  0.466   1.00 0.00 ? 23 LEU A CG   10 
ATOM 9295  C CD1  . LEU A 1 23 ? 9.573   -0.404  0.157   1.00 0.00 ? 23 LEU A CD1  10 
ATOM 9296  C CD2  . LEU A 1 23 ? 10.593  -2.675  0.119   1.00 0.00 ? 23 LEU A CD2  10 
ATOM 9297  H H    . LEU A 1 23 ? 12.463  -3.565  -0.975  1.00 0.00 ? 23 LEU A H    10 
ATOM 9298  H HA   . LEU A 1 23 ? 13.932  -1.080  -1.162  1.00 0.00 ? 23 LEU A HA   10 
ATOM 9299  H HB2  . LEU A 1 23 ? 12.423  0.181   0.287   1.00 0.00 ? 23 LEU A HB2  10 
ATOM 9300  H HB3  . LEU A 1 23 ? 11.671  -0.242  -1.232  1.00 0.00 ? 23 LEU A HB3  10 
ATOM 9301  H HG   . LEU A 1 23 ? 11.006  -1.142  1.528   1.00 0.00 ? 23 LEU A HG   10 
ATOM 9302  H HD11 . LEU A 1 23 ? 9.197   0.041   1.066   1.00 0.00 ? 23 LEU A HD11 10 
ATOM 9303  H HD12 . LEU A 1 23 ? 8.822   -1.054  -0.264  1.00 0.00 ? 23 LEU A HD12 10 
ATOM 9304  H HD13 . LEU A 1 23 ? 9.814   0.373   -0.552  1.00 0.00 ? 23 LEU A HD13 10 
ATOM 9305  H HD21 . LEU A 1 23 ? 10.572  -2.791  -0.954  1.00 0.00 ? 23 LEU A HD21 10 
ATOM 9306  H HD22 . LEU A 1 23 ? 9.650   -2.996  0.534   1.00 0.00 ? 23 LEU A HD22 10 
ATOM 9307  H HD23 . LEU A 1 23 ? 11.390  -3.274  0.531   1.00 0.00 ? 23 LEU A HD23 10 
ATOM 9308  N N    . ARG A 1 24 ? 15.026  -1.621  0.977   1.00 0.00 ? 24 ARG A N    10 
ATOM 9309  C CA   . ARG A 1 24 ? 15.736  -2.000  2.193   1.00 0.00 ? 24 ARG A CA   10 
ATOM 9310  C C    . ARG A 1 24 ? 14.863  -1.760  3.415   1.00 0.00 ? 24 ARG A C    10 
ATOM 9311  O O    . ARG A 1 24 ? 15.070  -2.355  4.472   1.00 0.00 ? 24 ARG A O    10 
ATOM 9312  C CB   . ARG A 1 24 ? 17.043  -1.214  2.317   1.00 0.00 ? 24 ARG A CB   10 
ATOM 9313  C CG   . ARG A 1 24 ? 18.018  -1.471  1.180   1.00 0.00 ? 24 ARG A CG   10 
ATOM 9314  C CD   . ARG A 1 24 ? 19.400  -1.832  1.702   1.00 0.00 ? 24 ARG A CD   10 
ATOM 9315  N NE   . ARG A 1 24 ? 20.095  -2.759  0.814   1.00 0.00 ? 24 ARG A NE   10 
ATOM 9316  C CZ   . ARG A 1 24 ? 20.808  -2.375  -0.239  1.00 0.00 ? 24 ARG A CZ   10 
ATOM 9317  N NH1  . ARG A 1 24 ? 20.918  -1.086  -0.534  1.00 0.00 ? 24 ARG A NH1  10 
ATOM 9318  N NH2  . ARG A 1 24 ? 21.412  -3.278  -1.000  1.00 0.00 ? 24 ARG A NH2  10 
ATOM 9319  H H    . ARG A 1 24 ? 15.452  -1.004  0.346   1.00 0.00 ? 24 ARG A H    10 
ATOM 9320  H HA   . ARG A 1 24 ? 15.960  -3.050  2.129   1.00 0.00 ? 24 ARG A HA   10 
ATOM 9321  H HB2  . ARG A 1 24 ? 16.814  -0.159  2.335   1.00 0.00 ? 24 ARG A HB2  10 
ATOM 9322  H HB3  . ARG A 1 24 ? 17.525  -1.485  3.245   1.00 0.00 ? 24 ARG A HB3  10 
ATOM 9323  H HG2  . ARG A 1 24 ? 17.648  -2.287  0.578   1.00 0.00 ? 24 ARG A HG2  10 
ATOM 9324  H HG3  . ARG A 1 24 ? 18.093  -0.580  0.575   1.00 0.00 ? 24 ARG A HG3  10 
ATOM 9325  H HD2  . ARG A 1 24 ? 19.984  -0.928  1.791   1.00 0.00 ? 24 ARG A HD2  10 
ATOM 9326  H HD3  . ARG A 1 24 ? 19.295  -2.289  2.675   1.00 0.00 ? 24 ARG A HD3  10 
ATOM 9327  H HE   . ARG A 1 24 ? 20.026  -3.716  1.013   1.00 0.00 ? 24 ARG A HE   10 
ATOM 9328  H HH11 . ARG A 1 24 ? 20.464  -0.403  0.038   1.00 0.00 ? 24 ARG A HH11 10 
ATOM 9329  H HH12 . ARG A 1 24 ? 21.455  -0.799  -1.326  1.00 0.00 ? 24 ARG A HH12 10 
ATOM 9330  H HH21 . ARG A 1 24 ? 21.331  -4.250  -0.781  1.00 0.00 ? 24 ARG A HH21 10 
ATOM 9331  H HH22 . ARG A 1 24 ? 21.948  -2.987  -1.792  1.00 0.00 ? 24 ARG A HH22 10 
ATOM 9332  N N    . GLN A 1 25 ? 13.880  -0.889  3.250   1.00 0.00 ? 25 GLN A N    10 
ATOM 9333  C CA   . GLN A 1 25 ? 12.953  -0.562  4.323   1.00 0.00 ? 25 GLN A CA   10 
ATOM 9334  C C    . GLN A 1 25 ? 11.688  -1.411  4.201   1.00 0.00 ? 25 GLN A C    10 
ATOM 9335  O O    . GLN A 1 25 ? 11.767  -2.605  3.910   1.00 0.00 ? 25 GLN A O    10 
ATOM 9336  C CB   . GLN A 1 25 ? 12.610  0.930   4.284   1.00 0.00 ? 25 GLN A CB   10 
ATOM 9337  C CG   . GLN A 1 25 ? 12.251  1.506   5.644   1.00 0.00 ? 25 GLN A CG   10 
ATOM 9338  C CD   . GLN A 1 25 ? 10.934  2.257   5.629   1.00 0.00 ? 25 GLN A CD   10 
ATOM 9339  O OE1  . GLN A 1 25 ? 9.953   1.827   6.237   1.00 0.00 ? 25 GLN A OE1  10 
ATOM 9340  N NE2  . GLN A 1 25 ? 10.905  3.387   4.932   1.00 0.00 ? 25 GLN A NE2  10 
ATOM 9341  H H    . GLN A 1 25 ? 13.772  -0.461  2.377   1.00 0.00 ? 25 GLN A H    10 
ATOM 9342  H HA   . GLN A 1 25 ? 13.437  -0.790  5.261   1.00 0.00 ? 25 GLN A HA   10 
ATOM 9343  H HB2  . GLN A 1 25 ? 13.461  1.473   3.901   1.00 0.00 ? 25 GLN A HB2  10 
ATOM 9344  H HB3  . GLN A 1 25 ? 11.771  1.078   3.621   1.00 0.00 ? 25 GLN A HB3  10 
ATOM 9345  H HG2  . GLN A 1 25 ? 12.178  0.697   6.356   1.00 0.00 ? 25 GLN A HG2  10 
ATOM 9346  H HG3  . GLN A 1 25 ? 13.032  2.185   5.951   1.00 0.00 ? 25 GLN A HG3  10 
ATOM 9347  H HE21 . GLN A 1 25 ? 11.723  3.668   4.473   1.00 0.00 ? 25 GLN A HE21 10 
ATOM 9348  H HE22 . GLN A 1 25 ? 10.066  3.893   4.905   1.00 0.00 ? 25 GLN A HE22 10 
ATOM 9349  N N    . GLY A 1 26 ? 10.523  -0.804  4.418   1.00 0.00 ? 26 GLY A N    10 
ATOM 9350  C CA   . GLY A 1 26 ? 9.283   -1.548  4.315   1.00 0.00 ? 26 GLY A CA   10 
ATOM 9351  C C    . GLY A 1 26 ? 8.114   -0.681  3.894   1.00 0.00 ? 26 GLY A C    10 
ATOM 9352  O O    . GLY A 1 26 ? 7.661   0.176   4.654   1.00 0.00 ? 26 GLY A O    10 
ATOM 9353  H H    . GLY A 1 26 ? 10.503  0.147   4.646   1.00 0.00 ? 26 GLY A H    10 
ATOM 9354  H HA2  . GLY A 1 26 ? 9.411   -2.336  3.588   1.00 0.00 ? 26 GLY A HA2  10 
ATOM 9355  H HA3  . GLY A 1 26 ? 9.062   -1.990  5.274   1.00 0.00 ? 26 GLY A HA3  10 
ATOM 9356  N N    . ALA A 1 27 ? 7.620   -0.909  2.683   1.00 0.00 ? 27 ALA A N    10 
ATOM 9357  C CA   . ALA A 1 27 ? 6.496   -0.155  2.160   1.00 0.00 ? 27 ALA A CA   10 
ATOM 9358  C C    . ALA A 1 27 ? 5.190   -0.875  2.468   1.00 0.00 ? 27 ALA A C    10 
ATOM 9359  O O    . ALA A 1 27 ? 4.200   -0.724  1.752   1.00 0.00 ? 27 ALA A O    10 
ATOM 9360  C CB   . ALA A 1 27 ? 6.658   0.040   0.659   1.00 0.00 ? 27 ALA A CB   10 
ATOM 9361  H H    . ALA A 1 27 ? 8.017   -1.609  2.127   1.00 0.00 ? 27 ALA A H    10 
ATOM 9362  H HA   . ALA A 1 27 ? 6.491   0.815   2.633   1.00 0.00 ? 27 ALA A HA   10 
ATOM 9363  H HB1  . ALA A 1 27 ? 5.699   0.263   0.217   1.00 0.00 ? 27 ALA A HB1  10 
ATOM 9364  H HB2  . ALA A 1 27 ? 7.052   -0.864  0.220   1.00 0.00 ? 27 ALA A HB2  10 
ATOM 9365  H HB3  . ALA A 1 27 ? 7.341   0.856   0.471   1.00 0.00 ? 27 ALA A HB3  10 
ATOM 9366  N N    . GLN A 1 28 ? 5.201   -1.678  3.530   1.00 0.00 ? 28 GLN A N    10 
ATOM 9367  C CA   . GLN A 1 28 ? 4.023   -2.443  3.920   1.00 0.00 ? 28 GLN A CA   10 
ATOM 9368  C C    . GLN A 1 28 ? 2.812   -1.541  4.122   1.00 0.00 ? 28 GLN A C    10 
ATOM 9369  O O    . GLN A 1 28 ? 2.777   -0.739  5.056   1.00 0.00 ? 28 GLN A O    10 
ATOM 9370  C CB   . GLN A 1 28 ? 4.264   -3.213  5.209   1.00 0.00 ? 28 GLN A CB   10 
ATOM 9371  C CG   . GLN A 1 28 ? 5.633   -3.835  5.303   1.00 0.00 ? 28 GLN A CG   10 
ATOM 9372  C CD   . GLN A 1 28 ? 6.396   -3.393  6.536   1.00 0.00 ? 28 GLN A CD   10 
ATOM 9373  O OE1  . GLN A 1 28 ? 6.874   -4.220  7.314   1.00 0.00 ? 28 GLN A OE1  10 
ATOM 9374  N NE2  . GLN A 1 28 ? 6.514   -2.084  6.722   1.00 0.00 ? 28 GLN A NE2  10 
ATOM 9375  H H    . GLN A 1 28 ? 6.025   -1.766  4.054   1.00 0.00 ? 28 GLN A H    10 
ATOM 9376  H HA   . GLN A 1 28 ? 3.825   -3.150  3.128   1.00 0.00 ? 28 GLN A HA   10 
ATOM 9377  H HB2  . GLN A 1 28 ? 4.136   -2.545  6.042   1.00 0.00 ? 28 GLN A HB2  10 
ATOM 9378  H HB3  . GLN A 1 28 ? 3.534   -4.003  5.277   1.00 0.00 ? 28 GLN A HB3  10 
ATOM 9379  H HG2  . GLN A 1 28 ? 5.513   -4.903  5.333   1.00 0.00 ? 28 GLN A HG2  10 
ATOM 9380  H HG3  . GLN A 1 28 ? 6.199   -3.565  4.428   1.00 0.00 ? 28 GLN A HG3  10 
ATOM 9381  H HE21 . GLN A 1 28 ? 6.108   -1.484  6.061   1.00 0.00 ? 28 GLN A HE21 10 
ATOM 9382  H HE22 . GLN A 1 28 ? 7.003   -1.770  7.511   1.00 0.00 ? 28 GLN A HE22 10 
ATOM 9383  N N    . CYS A 1 29 ? 1.823   -1.665  3.249   1.00 0.00 ? 29 CYS A N    10 
ATOM 9384  C CA   . CYS A 1 29 ? 0.621   -0.844  3.352   1.00 0.00 ? 29 CYS A CA   10 
ATOM 9385  C C    . CYS A 1 29 ? 1.036   0.579   3.677   1.00 0.00 ? 29 CYS A C    10 
ATOM 9386  O O    . CYS A 1 29 ? 0.425   1.254   4.507   1.00 0.00 ? 29 CYS A O    10 
ATOM 9387  C CB   . CYS A 1 29 ? -0.332  -1.380  4.437   1.00 0.00 ? 29 CYS A CB   10 
ATOM 9388  S SG   . CYS A 1 29 ? -0.710  -3.162  4.299   1.00 0.00 ? 29 CYS A SG   10 
ATOM 9389  H H    . CYS A 1 29 ? 1.912   -2.306  2.521   1.00 0.00 ? 29 CYS A H    10 
ATOM 9390  H HA   . CYS A 1 29 ? 0.121   -0.856  2.395   1.00 0.00 ? 29 CYS A HA   10 
ATOM 9391  H HB2  . CYS A 1 29 ? 0.112   -1.216  5.407   1.00 0.00 ? 29 CYS A HB2  10 
ATOM 9392  H HB3  . CYS A 1 29 ? -1.267  -0.841  4.381   1.00 0.00 ? 29 CYS A HB3  10 
ATOM 9393  N N    . ALA A 1 30 ? 2.103   1.012   3.019   1.00 0.00 ? 30 ALA A N    10 
ATOM 9394  C CA   . ALA A 1 30 ? 2.649   2.349   3.231   1.00 0.00 ? 30 ALA A CA   10 
ATOM 9395  C C    . ALA A 1 30 ? 1.632   3.417   2.838   1.00 0.00 ? 30 ALA A C    10 
ATOM 9396  O O    . ALA A 1 30 ? 0.434   3.232   3.055   1.00 0.00 ? 30 ALA A O    10 
ATOM 9397  C CB   . ALA A 1 30 ? 3.942   2.518   2.447   1.00 0.00 ? 30 ALA A CB   10 
ATOM 9398  H H    . ALA A 1 30 ? 2.540   0.406   2.378   1.00 0.00 ? 30 ALA A H    10 
ATOM 9399  H HA   . ALA A 1 30 ? 2.874   2.442   4.280   1.00 0.00 ? 30 ALA A HA   10 
ATOM 9400  H HB1  . ALA A 1 30 ? 3.723   2.533   1.390   1.00 0.00 ? 30 ALA A HB1  10 
ATOM 9401  H HB2  . ALA A 1 30 ? 4.605   1.694   2.666   1.00 0.00 ? 30 ALA A HB2  10 
ATOM 9402  H HB3  . ALA A 1 30 ? 4.416   3.446   2.730   1.00 0.00 ? 30 ALA A HB3  10 
ATOM 9403  N N    . GLU A 1 31 ? 2.096   4.522   2.233   1.00 0.00 ? 31 GLU A N    10 
ATOM 9404  C CA   . GLU A 1 31 ? 1.183   5.580   1.789   1.00 0.00 ? 31 GLU A CA   10 
ATOM 9405  C C    . GLU A 1 31 ? -0.064  4.928   1.236   1.00 0.00 ? 31 GLU A C    10 
ATOM 9406  O O    . GLU A 1 31 ? -1.175  5.435   1.372   1.00 0.00 ? 31 GLU A O    10 
ATOM 9407  C CB   . GLU A 1 31 ? 1.843   6.451   0.717   1.00 0.00 ? 31 GLU A CB   10 
ATOM 9408  C CG   . GLU A 1 31 ? 1.096   7.745   0.439   1.00 0.00 ? 31 GLU A CG   10 
ATOM 9409  C CD   . GLU A 1 31 ? 1.768   8.587   -0.627  1.00 0.00 ? 31 GLU A CD   10 
ATOM 9410  O OE1  . GLU A 1 31 ? 2.843   8.181   -1.116  1.00 0.00 ? 31 GLU A OE1  10 
ATOM 9411  O OE2  . GLU A 1 31 ? 1.218   9.654   -0.975  1.00 0.00 ? 31 GLU A OE2  10 
ATOM 9412  H H    . GLU A 1 31 ? 3.056   4.614   2.062   1.00 0.00 ? 31 GLU A H    10 
ATOM 9413  H HA   . GLU A 1 31 ? 0.914   6.185   2.638   1.00 0.00 ? 31 GLU A HA   10 
ATOM 9414  H HB2  . GLU A 1 31 ? 2.844   6.698   1.036   1.00 0.00 ? 31 GLU A HB2  10 
ATOM 9415  H HB3  . GLU A 1 31 ? 1.897   5.888   -0.203  1.00 0.00 ? 31 GLU A HB3  10 
ATOM 9416  H HG2  . GLU A 1 31 ? 0.097   7.505   0.110   1.00 0.00 ? 31 GLU A HG2  10 
ATOM 9417  H HG3  . GLU A 1 31 ? 1.045   8.319   1.352   1.00 0.00 ? 31 GLU A HG3  10 
ATOM 9418  N N    . GLY A 1 32 ? 0.162   3.767   0.649   1.00 0.00 ? 32 GLY A N    10 
ATOM 9419  C CA   . GLY A 1 32 ? -0.889  2.959   0.098   1.00 0.00 ? 32 GLY A CA   10 
ATOM 9420  C C    . GLY A 1 32 ? -0.632  1.512   0.425   1.00 0.00 ? 32 GLY A C    10 
ATOM 9421  O O    . GLY A 1 32 ? -0.289  1.185   1.560   1.00 0.00 ? 32 GLY A O    10 
ATOM 9422  H H    . GLY A 1 32 ? 1.081   3.432   0.613   1.00 0.00 ? 32 GLY A H    10 
ATOM 9423  H HA2  . GLY A 1 32 ? -1.833  3.263   0.520   1.00 0.00 ? 32 GLY A HA2  10 
ATOM 9424  H HA3  . GLY A 1 32 ? -0.911  3.081   -0.974  1.00 0.00 ? 32 GLY A HA3  10 
ATOM 9425  N N    . LEU A 1 33 ? -0.760  0.640   -0.557  1.00 0.00 ? 33 LEU A N    10 
ATOM 9426  C CA   . LEU A 1 33 ? -0.490  -0.765  -0.315  1.00 0.00 ? 33 LEU A CA   10 
ATOM 9427  C C    . LEU A 1 33 ? 0.987   -1.097  -0.586  1.00 0.00 ? 33 LEU A C    10 
ATOM 9428  O O    . LEU A 1 33 ? 1.850   -0.224  -0.487  1.00 0.00 ? 33 LEU A O    10 
ATOM 9429  C CB   . LEU A 1 33 ? -1.400  -1.654  -1.153  1.00 0.00 ? 33 LEU A CB   10 
ATOM 9430  C CG   . LEU A 1 33 ? -1.776  -2.994  -0.510  1.00 0.00 ? 33 LEU A CG   10 
ATOM 9431  C CD1  . LEU A 1 33 ? -1.474  -4.129  -1.464  1.00 0.00 ? 33 LEU A CD1  10 
ATOM 9432  C CD2  . LEU A 1 33 ? -1.052  -3.206  0.816   1.00 0.00 ? 33 LEU A CD2  10 
ATOM 9433  H H    . LEU A 1 33 ? -1.023  0.947   -1.453  1.00 0.00 ? 33 LEU A H    10 
ATOM 9434  H HA   . LEU A 1 33 ? -0.696  -0.940  0.728   1.00 0.00 ? 33 LEU A HA   10 
ATOM 9435  H HB2  . LEU A 1 33 ? -2.310  -1.109  -1.358  1.00 0.00 ? 33 LEU A HB2  10 
ATOM 9436  H HB3  . LEU A 1 33 ? -0.905  -1.858  -2.090  1.00 0.00 ? 33 LEU A HB3  10 
ATOM 9437  H HG   . LEU A 1 33 ? -2.835  -3.003  -0.312  1.00 0.00 ? 33 LEU A HG   10 
ATOM 9438  H HD11 . LEU A 1 33 ? -1.225  -5.013  -0.900  1.00 0.00 ? 33 LEU A HD11 10 
ATOM 9439  H HD12 . LEU A 1 33 ? -0.642  -3.856  -2.097  1.00 0.00 ? 33 LEU A HD12 10 
ATOM 9440  H HD13 . LEU A 1 33 ? -2.341  -4.324  -2.076  1.00 0.00 ? 33 LEU A HD13 10 
ATOM 9441  H HD21 . LEU A 1 33 ? -0.055  -2.793  0.757   1.00 0.00 ? 33 LEU A HD21 10 
ATOM 9442  H HD22 . LEU A 1 33 ? -0.991  -4.262  1.025   1.00 0.00 ? 33 LEU A HD22 10 
ATOM 9443  H HD23 . LEU A 1 33 ? -1.597  -2.712  1.607   1.00 0.00 ? 33 LEU A HD23 10 
ATOM 9444  N N    . CYS A 1 34 ? 1.274   -2.360  -0.920  1.00 0.00 ? 34 CYS A N    10 
ATOM 9445  C CA   . CYS A 1 34 ? 2.650   -2.795  -1.192  1.00 0.00 ? 34 CYS A CA   10 
ATOM 9446  C C    . CYS A 1 34 ? 2.680   -3.971  -2.166  1.00 0.00 ? 34 CYS A C    10 
ATOM 9447  O O    . CYS A 1 34 ? 1.706   -4.226  -2.875  1.00 0.00 ? 34 CYS A O    10 
ATOM 9448  C CB   . CYS A 1 34 ? 3.351   -3.190  0.109   1.00 0.00 ? 34 CYS A CB   10 
ATOM 9449  S SG   . CYS A 1 34 ? 5.120   -2.773  0.182   1.00 0.00 ? 34 CYS A SG   10 
ATOM 9450  H H    . CYS A 1 34 ? 0.549   -3.014  -0.978  1.00 0.00 ? 34 CYS A H    10 
ATOM 9451  H HA   . CYS A 1 34 ? 3.176   -1.971  -1.639  1.00 0.00 ? 34 CYS A HA   10 
ATOM 9452  H HB2  . CYS A 1 34 ? 2.866   -2.696  0.934   1.00 0.00 ? 34 CYS A HB2  10 
ATOM 9453  H HB3  . CYS A 1 34 ? 3.270   -4.254  0.235   1.00 0.00 ? 34 CYS A HB3  10 
ATOM 9454  N N    . CYS A 1 35 ? 3.808   -4.685  -2.199  1.00 0.00 ? 35 CYS A N    10 
ATOM 9455  C CA   . CYS A 1 35 ? 3.953   -5.830  -3.097  1.00 0.00 ? 35 CYS A CA   10 
ATOM 9456  C C    . CYS A 1 35 ? 5.221   -6.636  -2.808  1.00 0.00 ? 35 CYS A C    10 
ATOM 9457  O O    . CYS A 1 35 ? 5.257   -7.849  -3.015  1.00 0.00 ? 35 CYS A O    10 
ATOM 9458  C CB   . CYS A 1 35 ? 3.946   -5.347  -4.560  1.00 0.00 ? 35 CYS A CB   10 
ATOM 9459  S SG   . CYS A 1 35 ? 5.067   -6.252  -5.690  1.00 0.00 ? 35 CYS A SG   10 
ATOM 9460  H H    . CYS A 1 35 ? 4.551   -4.434  -1.614  1.00 0.00 ? 35 CYS A H    10 
ATOM 9461  H HA   . CYS A 1 35 ? 3.106   -6.466  -2.937  1.00 0.00 ? 35 CYS A HA   10 
ATOM 9462  H HB2  . CYS A 1 35 ? 2.946   -5.445  -4.954  1.00 0.00 ? 35 CYS A HB2  10 
ATOM 9463  H HB3  . CYS A 1 35 ? 4.230   -4.305  -4.583  1.00 0.00 ? 35 CYS A HB3  10 
ATOM 9464  N N    . ASP A 1 36 ? 6.259   -5.953  -2.362  1.00 0.00 ? 36 ASP A N    10 
ATOM 9465  C CA   . ASP A 1 36 ? 7.540   -6.591  -2.078  1.00 0.00 ? 36 ASP A CA   10 
ATOM 9466  C C    . ASP A 1 36 ? 7.583   -7.176  -0.668  1.00 0.00 ? 36 ASP A C    10 
ATOM 9467  O O    . ASP A 1 36 ? 6.624   -7.065  0.095   1.00 0.00 ? 36 ASP A O    10 
ATOM 9468  C CB   . ASP A 1 36 ? 8.671   -5.569  -2.298  1.00 0.00 ? 36 ASP A CB   10 
ATOM 9469  C CG   . ASP A 1 36 ? 9.720   -5.543  -1.200  1.00 0.00 ? 36 ASP A CG   10 
ATOM 9470  O OD1  . ASP A 1 36 ? 9.444   -4.964  -0.130  1.00 0.00 ? 36 ASP A OD1  10 
ATOM 9471  O OD2  . ASP A 1 36 ? 10.817  -6.101  -1.413  1.00 0.00 ? 36 ASP A OD2  10 
ATOM 9472  H H    . ASP A 1 36 ? 6.169   -4.991  -2.239  1.00 0.00 ? 36 ASP A H    10 
ATOM 9473  H HA   . ASP A 1 36 ? 7.664   -7.397  -2.785  1.00 0.00 ? 36 ASP A HA   10 
ATOM 9474  H HB2  . ASP A 1 36 ? 9.167   -5.804  -3.222  1.00 0.00 ? 36 ASP A HB2  10 
ATOM 9475  H HB3  . ASP A 1 36 ? 8.236   -4.583  -2.374  1.00 0.00 ? 36 ASP A HB3  10 
ATOM 9476  N N    . GLN A 1 37 ? 8.711   -7.796  -0.332  1.00 0.00 ? 37 GLN A N    10 
ATOM 9477  C CA   . GLN A 1 37 ? 8.899   -8.394  0.980   1.00 0.00 ? 37 GLN A CA   10 
ATOM 9478  C C    . GLN A 1 37 ? 8.439   -7.444  2.080   1.00 0.00 ? 37 GLN A C    10 
ATOM 9479  O O    . GLN A 1 37 ? 8.126   -7.886  3.186   1.00 0.00 ? 37 GLN A O    10 
ATOM 9480  C CB   . GLN A 1 37 ? 10.368  -8.764  1.190   1.00 0.00 ? 37 GLN A CB   10 
ATOM 9481  C CG   . GLN A 1 37 ? 10.884  -9.795  0.200   1.00 0.00 ? 37 GLN A CG   10 
ATOM 9482  C CD   . GLN A 1 37 ? 10.608  -11.219 0.644   1.00 0.00 ? 37 GLN A CD   10 
ATOM 9483  O OE1  . GLN A 1 37 ? 9.699   -11.875 0.136   1.00 0.00 ? 37 GLN A OE1  10 
ATOM 9484  N NE2  . GLN A 1 37 ? 11.395  -11.703 1.599   1.00 0.00 ? 37 GLN A NE2  10 
ATOM 9485  H H    . GLN A 1 37 ? 9.438   -7.849  -0.986  1.00 0.00 ? 37 GLN A H    10 
ATOM 9486  H HA   . GLN A 1 37 ? 8.302   -9.292  1.022   1.00 0.00 ? 37 GLN A HA   10 
ATOM 9487  H HB2  . GLN A 1 37 ? 10.969  -7.872  1.093   1.00 0.00 ? 37 GLN A HB2  10 
ATOM 9488  H HB3  . GLN A 1 37 ? 10.488  -9.162  2.187   1.00 0.00 ? 37 GLN A HB3  10 
ATOM 9489  H HG2  . GLN A 1 37 ? 10.402  -9.633  -0.753  1.00 0.00 ? 37 GLN A HG2  10 
ATOM 9490  H HG3  . GLN A 1 37 ? 11.950  -9.668  0.089   1.00 0.00 ? 37 GLN A HG3  10 
ATOM 9491  H HE21 . GLN A 1 37 ? 12.098  -11.123 1.957   1.00 0.00 ? 37 GLN A HE21 10 
ATOM 9492  H HE22 . GLN A 1 37 ? 11.239  -12.621 1.905   1.00 0.00 ? 37 GLN A HE22 10 
ATOM 9493  N N    . CYS A 1 38 ? 8.401   -6.139  1.766   1.00 0.00 ? 38 CYS A N    10 
ATOM 9494  C CA   . CYS A 1 38 ? 7.974   -5.113  2.722   1.00 0.00 ? 38 CYS A CA   10 
ATOM 9495  C C    . CYS A 1 38 ? 7.092   -5.715  3.805   1.00 0.00 ? 38 CYS A C    10 
ATOM 9496  O O    . CYS A 1 38 ? 7.393   -5.596  4.992   1.00 0.00 ? 38 CYS A O    10 
ATOM 9497  C CB   . CYS A 1 38 ? 7.245   -3.970  1.995   1.00 0.00 ? 38 CYS A CB   10 
ATOM 9498  S SG   . CYS A 1 38 ? 5.985   -4.508  0.794   1.00 0.00 ? 38 CYS A SG   10 
ATOM 9499  H H    . CYS A 1 38 ? 8.668   -5.861  0.868   1.00 0.00 ? 38 CYS A H    10 
ATOM 9500  H HA   . CYS A 1 38 ? 8.849   -4.710  3.192   1.00 0.00 ? 38 CYS A HA   10 
ATOM 9501  H HB2  . CYS A 1 38 ? 6.753   -3.343  2.721   1.00 0.00 ? 38 CYS A HB2  10 
ATOM 9502  H HB3  . CYS A 1 38 ? 7.973   -3.376  1.459   1.00 0.00 ? 38 CYS A HB3  10 
ATOM 9503  N N    . ARG A 1 39 ? 6.022   -6.377  3.367   1.00 0.00 ? 39 ARG A N    10 
ATOM 9504  C CA   . ARG A 1 39 ? 5.060   -7.028  4.257   1.00 0.00 ? 39 ARG A CA   10 
ATOM 9505  C C    . ARG A 1 39 ? 3.807   -6.173  4.356   1.00 0.00 ? 39 ARG A C    10 
ATOM 9506  O O    . ARG A 1 39 ? 3.645   -5.224  3.589   1.00 0.00 ? 39 ARG A O    10 
ATOM 9507  C CB   . ARG A 1 39 ? 5.648   -7.299  5.648   1.00 0.00 ? 39 ARG A CB   10 
ATOM 9508  C CG   . ARG A 1 39 ? 5.036   -8.507  6.338   1.00 0.00 ? 39 ARG A CG   10 
ATOM 9509  C CD   . ARG A 1 39 ? 6.010   -9.673  6.388   1.00 0.00 ? 39 ARG A CD   10 
ATOM 9510  N NE   . ARG A 1 39 ? 5.639   -10.653 7.405   1.00 0.00 ? 39 ARG A NE   10 
ATOM 9511  C CZ   . ARG A 1 39 ? 6.038   -11.920 7.385   1.00 0.00 ? 39 ARG A CZ   10 
ATOM 9512  N NH1  . ARG A 1 39 ? 6.816   -12.358 6.405   1.00 0.00 ? 39 ARG A NH1  10 
ATOM 9513  N NH2  . ARG A 1 39 ? 5.659   -12.751 8.347   1.00 0.00 ? 39 ARG A NH2  10 
ATOM 9514  H H    . ARG A 1 39 ? 5.875   -6.434  2.398   1.00 0.00 ? 39 ARG A H    10 
ATOM 9515  H HA   . ARG A 1 39 ? 4.791   -7.972  3.802   1.00 0.00 ? 39 ARG A HA   10 
ATOM 9516  H HB2  . ARG A 1 39 ? 6.709   -7.471  5.551   1.00 0.00 ? 39 ARG A HB2  10 
ATOM 9517  H HB3  . ARG A 1 39 ? 5.487   -6.436  6.275   1.00 0.00 ? 39 ARG A HB3  10 
ATOM 9518  H HG2  . ARG A 1 39 ? 4.764   -8.234  7.346   1.00 0.00 ? 39 ARG A HG2  10 
ATOM 9519  H HG3  . ARG A 1 39 ? 4.152   -8.810  5.794   1.00 0.00 ? 39 ARG A HG3  10 
ATOM 9520  H HD2  . ARG A 1 39 ? 6.022   -10.157 5.423   1.00 0.00 ? 39 ARG A HD2  10 
ATOM 9521  H HD3  . ARG A 1 39 ? 6.996   -9.292  6.610   1.00 0.00 ? 39 ARG A HD3  10 
ATOM 9522  H HE   . ARG A 1 39 ? 5.064   -10.350 8.138   1.00 0.00 ? 39 ARG A HE   10 
ATOM 9523  H HH11 . ARG A 1 39 ? 7.104   -11.735 5.678   1.00 0.00 ? 39 ARG A HH11 10 
ATOM 9524  H HH12 . ARG A 1 39 ? 7.115   -13.312 6.392   1.00 0.00 ? 39 ARG A HH12 10 
ATOM 9525  H HH21 . ARG A 1 39 ? 5.072   -12.425 9.088   1.00 0.00 ? 39 ARG A HH21 10 
ATOM 9526  H HH22 . ARG A 1 39 ? 5.959   -13.705 8.330   1.00 0.00 ? 39 ARG A HH22 10 
ATOM 9527  N N    . PHE A 1 40 ? 2.905   -6.510  5.269   1.00 0.00 ? 40 PHE A N    10 
ATOM 9528  C CA   . PHE A 1 40 ? 1.671   -5.747  5.396   1.00 0.00 ? 40 PHE A CA   10 
ATOM 9529  C C    . PHE A 1 40 ? 1.094   -5.789  6.804   1.00 0.00 ? 40 PHE A C    10 
ATOM 9530  O O    . PHE A 1 40 ? 1.341   -6.720  7.570   1.00 0.00 ? 40 PHE A O    10 
ATOM 9531  C CB   . PHE A 1 40 ? 0.646   -6.253  4.389   1.00 0.00 ? 40 PHE A CB   10 
ATOM 9532  C CG   . PHE A 1 40 ? 1.167   -6.270  2.983   1.00 0.00 ? 40 PHE A CG   10 
ATOM 9533  C CD1  . PHE A 1 40 ? 2.008   -7.281  2.555   1.00 0.00 ? 40 PHE A CD1  10 
ATOM 9534  C CD2  . PHE A 1 40 ? 0.832   -5.264  2.097   1.00 0.00 ? 40 PHE A CD2  10 
ATOM 9535  C CE1  . PHE A 1 40 ? 2.504   -7.290  1.270   1.00 0.00 ? 40 PHE A CE1  10 
ATOM 9536  C CE2  . PHE A 1 40 ? 1.320   -5.265  0.812   1.00 0.00 ? 40 PHE A CE2  10 
ATOM 9537  C CZ   . PHE A 1 40 ? 2.160   -6.280  0.394   1.00 0.00 ? 40 PHE A CZ   10 
ATOM 9538  H H    . PHE A 1 40 ? 3.062   -7.284  5.848   1.00 0.00 ? 40 PHE A H    10 
ATOM 9539  H HA   . PHE A 1 40 ? 1.897   -4.721  5.157   1.00 0.00 ? 40 PHE A HA   10 
ATOM 9540  H HB2  . PHE A 1 40 ? 0.351   -7.258  4.647   1.00 0.00 ? 40 PHE A HB2  10 
ATOM 9541  H HB3  . PHE A 1 40 ? -0.212  -5.607  4.418   1.00 0.00 ? 40 PHE A HB3  10 
ATOM 9542  H HD1  . PHE A 1 40 ? 2.276   -8.072  3.238   1.00 0.00 ? 40 PHE A HD1  10 
ATOM 9543  H HD2  . PHE A 1 40 ? 0.180   -4.471  2.417   1.00 0.00 ? 40 PHE A HD2  10 
ATOM 9544  H HE1  . PHE A 1 40 ? 3.165   -8.080  0.955   1.00 0.00 ? 40 PHE A HE1  10 
ATOM 9545  H HE2  . PHE A 1 40 ? 1.053   -4.467  0.136   1.00 0.00 ? 40 PHE A HE2  10 
ATOM 9546  H HZ   . PHE A 1 40 ? 2.547   -6.283  -0.614  1.00 0.00 ? 40 PHE A HZ   10 
ATOM 9547  N N    . MET A 1 41 ? 0.324   -4.755  7.126   1.00 0.00 ? 41 MET A N    10 
ATOM 9548  C CA   . MET A 1 41 ? -0.305  -4.627  8.429   1.00 0.00 ? 41 MET A CA   10 
ATOM 9549  C C    . MET A 1 41 ? -1.232  -5.797  8.722   1.00 0.00 ? 41 MET A C    10 
ATOM 9550  O O    . MET A 1 41 ? -0.993  -6.570  9.650   1.00 0.00 ? 41 MET A O    10 
ATOM 9551  C CB   . MET A 1 41 ? -1.097  -3.325  8.503   1.00 0.00 ? 41 MET A CB   10 
ATOM 9552  C CG   . MET A 1 41 ? -0.550  -2.338  9.523   1.00 0.00 ? 41 MET A CG   10 
ATOM 9553  S SD   . MET A 1 41 ? -0.678  -2.947  11.216  1.00 0.00 ? 41 MET A SD   10 
ATOM 9554  C CE   . MET A 1 41 ? 0.844   -3.881  11.359  1.00 0.00 ? 41 MET A CE   10 
ATOM 9555  H H    . MET A 1 41 ? 0.179   -4.051  6.466   1.00 0.00 ? 41 MET A H    10 
ATOM 9556  H HA   . MET A 1 41 ? 0.476   -4.604  9.169   1.00 0.00 ? 41 MET A HA   10 
ATOM 9557  H HB2  . MET A 1 41 ? -1.088  -2.853  7.529   1.00 0.00 ? 41 MET A HB2  10 
ATOM 9558  H HB3  . MET A 1 41 ? -2.118  -3.557  8.769   1.00 0.00 ? 41 MET A HB3  10 
ATOM 9559  H HG2  . MET A 1 41 ? 0.490   -2.151  9.301   1.00 0.00 ? 41 MET A HG2  10 
ATOM 9560  H HG3  . MET A 1 41 ? -1.105  -1.416  9.445   1.00 0.00 ? 41 MET A HG3  10 
ATOM 9561  H HE1  . MET A 1 41 ? 1.609   -3.416  10.755  1.00 0.00 ? 41 MET A HE1  10 
ATOM 9562  H HE2  . MET A 1 41 ? 0.679   -4.892  11.016  1.00 0.00 ? 41 MET A HE2  10 
ATOM 9563  H HE3  . MET A 1 41 ? 1.160   -3.898  12.391  1.00 0.00 ? 41 MET A HE3  10 
ATOM 9564  N N    . LYS A 1 42 ? -2.304  -5.911  7.939   1.00 0.00 ? 42 LYS A N    10 
ATOM 9565  C CA   . LYS A 1 42 ? -3.272  -6.976  8.130   1.00 0.00 ? 42 LYS A CA   10 
ATOM 9566  C C    . LYS A 1 42 ? -4.312  -6.570  9.164   1.00 0.00 ? 42 LYS A C    10 
ATOM 9567  O O    . LYS A 1 42 ? -4.729  -7.375  9.997   1.00 0.00 ? 42 LYS A O    10 
ATOM 9568  C CB   . LYS A 1 42 ? -2.577  -8.273  8.551   1.00 0.00 ? 42 LYS A CB   10 
ATOM 9569  C CG   . LYS A 1 42 ? -3.011  -9.486  7.746   1.00 0.00 ? 42 LYS A CG   10 
ATOM 9570  C CD   . LYS A 1 42 ? -2.397  -9.476  6.355   1.00 0.00 ? 42 LYS A CD   10 
ATOM 9571  C CE   . LYS A 1 42 ? -1.003  -10.083 6.352   1.00 0.00 ? 42 LYS A CE   10 
ATOM 9572  N NZ   . LYS A 1 42 ? -0.231  -9.719  7.572   1.00 0.00 ? 42 LYS A NZ   10 
ATOM 9573  H H    . LYS A 1 42 ? -2.455  -5.254  7.220   1.00 0.00 ? 42 LYS A H    10 
ATOM 9574  H HA   . LYS A 1 42 ? -3.766  -7.131  7.191   1.00 0.00 ? 42 LYS A HA   10 
ATOM 9575  H HB2  . LYS A 1 42 ? -1.511  -8.153  8.428   1.00 0.00 ? 42 LYS A HB2  10 
ATOM 9576  H HB3  . LYS A 1 42 ? -2.792  -8.462  9.593   1.00 0.00 ? 42 LYS A HB3  10 
ATOM 9577  H HG2  . LYS A 1 42 ? -2.695  -10.380 8.262   1.00 0.00 ? 42 LYS A HG2  10 
ATOM 9578  H HG3  . LYS A 1 42 ? -4.087  -9.480  7.656   1.00 0.00 ? 42 LYS A HG3  10 
ATOM 9579  H HD2  . LYS A 1 42 ? -3.026  -10.049 5.692   1.00 0.00 ? 42 LYS A HD2  10 
ATOM 9580  H HD3  . LYS A 1 42 ? -2.338  -8.455  6.006   1.00 0.00 ? 42 LYS A HD3  10 
ATOM 9581  H HE2  . LYS A 1 42 ? -1.092  -11.158 6.303   1.00 0.00 ? 42 LYS A HE2  10 
ATOM 9582  H HE3  . LYS A 1 42 ? -0.472  -9.727  5.481   1.00 0.00 ? 42 LYS A HE3  10 
ATOM 9583  H HZ1  . LYS A 1 42 ? 0.633   -10.295 7.633   1.00 0.00 ? 42 LYS A HZ1  10 
ATOM 9584  H HZ2  . LYS A 1 42 ? -0.805  -9.886  8.423   1.00 0.00 ? 42 LYS A HZ2  10 
ATOM 9585  H HZ3  . LYS A 1 42 ? 0.036   -8.714  7.540   1.00 0.00 ? 42 LYS A HZ3  10 
ATOM 9586  N N    . GLU A 1 43 ? -4.724  -5.310  9.098   1.00 0.00 ? 43 GLU A N    10 
ATOM 9587  C CA   . GLU A 1 43 ? -5.715  -4.775  10.019  1.00 0.00 ? 43 GLU A CA   10 
ATOM 9588  C C    . GLU A 1 43 ? -6.097  -3.356  9.625   1.00 0.00 ? 43 GLU A C    10 
ATOM 9589  O O    . GLU A 1 43 ? -5.433  -2.392  10.007  1.00 0.00 ? 43 GLU A O    10 
ATOM 9590  C CB   . GLU A 1 43 ? -5.178  -4.791  11.446  1.00 0.00 ? 43 GLU A CB   10 
ATOM 9591  C CG   . GLU A 1 43 ? -6.263  -4.720  12.508  1.00 0.00 ? 43 GLU A CG   10 
ATOM 9592  C CD   . GLU A 1 43 ? -5.716  -4.368  13.878  1.00 0.00 ? 43 GLU A CD   10 
ATOM 9593  O OE1  . GLU A 1 43 ? -4.636  -3.745  13.943  1.00 0.00 ? 43 GLU A OE1  10 
ATOM 9594  O OE2  . GLU A 1 43 ? -6.368  -4.716  14.884  1.00 0.00 ? 43 GLU A OE2  10 
ATOM 9595  H H    . GLU A 1 43 ? -4.350  -4.723  8.409   1.00 0.00 ? 43 GLU A H    10 
ATOM 9596  H HA   . GLU A 1 43 ? -6.593  -5.402  9.965   1.00 0.00 ? 43 GLU A HA   10 
ATOM 9597  H HB2  . GLU A 1 43 ? -4.618  -5.701  11.594  1.00 0.00 ? 43 GLU A HB2  10 
ATOM 9598  H HB3  . GLU A 1 43 ? -4.520  -3.945  11.576  1.00 0.00 ? 43 GLU A HB3  10 
ATOM 9599  H HG2  . GLU A 1 43 ? -6.982  -3.967  12.220  1.00 0.00 ? 43 GLU A HG2  10 
ATOM 9600  H HG3  . GLU A 1 43 ? -6.754  -5.680  12.568  1.00 0.00 ? 43 GLU A HG3  10 
ATOM 9601  N N    . GLY A 1 44 ? -7.174  -3.242  8.861   1.00 0.00 ? 44 GLY A N    10 
ATOM 9602  C CA   . GLY A 1 44 ? -7.647  -1.948  8.417   1.00 0.00 ? 44 GLY A CA   10 
ATOM 9603  C C    . GLY A 1 44 ? -6.547  -0.932  8.224   1.00 0.00 ? 44 GLY A C    10 
ATOM 9604  O O    . GLY A 1 44 ? -6.582  0.136   8.836   1.00 0.00 ? 44 GLY A O    10 
ATOM 9605  H H    . GLY A 1 44 ? -7.658  -4.049  8.600   1.00 0.00 ? 44 GLY A H    10 
ATOM 9606  H HA2  . GLY A 1 44 ? -8.161  -2.068  7.481   1.00 0.00 ? 44 GLY A HA2  10 
ATOM 9607  H HA3  . GLY A 1 44 ? -8.343  -1.567  9.148   1.00 0.00 ? 44 GLY A HA3  10 
ATOM 9608  N N    . THR A 1 45 ? -5.577  -1.227  7.360   1.00 0.00 ? 45 THR A N    10 
ATOM 9609  C CA   . THR A 1 45 ? -4.514  -0.267  7.118   1.00 0.00 ? 45 THR A CA   10 
ATOM 9610  C C    . THR A 1 45 ? -4.850  0.556   5.871   1.00 0.00 ? 45 THR A C    10 
ATOM 9611  O O    . THR A 1 45 ? -5.951  1.099   5.789   1.00 0.00 ? 45 THR A O    10 
ATOM 9612  C CB   . THR A 1 45 ? -3.165  -0.976  7.024   1.00 0.00 ? 45 THR A CB   10 
ATOM 9613  O OG1  . THR A 1 45 ? -3.237  -2.245  7.642   1.00 0.00 ? 45 THR A OG1  10 
ATOM 9614  C CG2  . THR A 1 45 ? -2.048  -0.206  7.689   1.00 0.00 ? 45 THR A CG2  10 
ATOM 9615  H H    . THR A 1 45 ? -5.585  -2.091  6.862   1.00 0.00 ? 45 THR A H    10 
ATOM 9616  H HA   . THR A 1 45 ? -4.494  0.404   7.966   1.00 0.00 ? 45 THR A HA   10 
ATOM 9617  H HB   . THR A 1 45 ? -2.903  -1.120  6.000   1.00 0.00 ? 45 THR A HB   10 
ATOM 9618  H HG1  . THR A 1 45 ? -3.912  -2.775  7.213   1.00 0.00 ? 45 THR A HG1  10 
ATOM 9619  H HG21 . THR A 1 45 ? -2.259  -0.106  8.743   1.00 0.00 ? 45 THR A HG21 10 
ATOM 9620  H HG22 . THR A 1 45 ? -1.972  0.775   7.242   1.00 0.00 ? 45 THR A HG22 10 
ATOM 9621  H HG23 . THR A 1 45 ? -1.117  -0.736  7.556   1.00 0.00 ? 45 THR A HG23 10 
ATOM 9622  N N    . ILE A 1 46 ? -3.942  0.672   4.905   1.00 0.00 ? 46 ILE A N    10 
ATOM 9623  C CA   . ILE A 1 46 ? -4.247  1.453   3.718   1.00 0.00 ? 46 ILE A CA   10 
ATOM 9624  C C    . ILE A 1 46 ? -3.761  0.770   2.430   1.00 0.00 ? 46 ILE A C    10 
ATOM 9625  O O    . ILE A 1 46 ? -2.573  0.802   2.107   1.00 0.00 ? 46 ILE A O    10 
ATOM 9626  C CB   . ILE A 1 46 ? -3.671  2.892   3.853   1.00 0.00 ? 46 ILE A CB   10 
ATOM 9627  C CG1  . ILE A 1 46 ? -4.815  3.901   3.962   1.00 0.00 ? 46 ILE A CG1  10 
ATOM 9628  C CG2  . ILE A 1 46 ? -2.745  3.265   2.699   1.00 0.00 ? 46 ILE A CG2  10 
ATOM 9629  C CD1  . ILE A 1 46 ? -4.847  4.637   5.283   1.00 0.00 ? 46 ILE A CD1  10 
ATOM 9630  H H    . ILE A 1 46 ? -3.071  0.246   4.988   1.00 0.00 ? 46 ILE A H    10 
ATOM 9631  H HA   . ILE A 1 46 ? -5.320  1.536   3.668   1.00 0.00 ? 46 ILE A HA   10 
ATOM 9632  H HB   . ILE A 1 46 ? -3.091  2.932   4.762   1.00 0.00 ? 46 ILE A HB   10 
ATOM 9633  H HG12 . ILE A 1 46 ? -4.717  4.635   3.177   1.00 0.00 ? 46 ILE A HG12 10 
ATOM 9634  H HG13 . ILE A 1 46 ? -5.756  3.382   3.849   1.00 0.00 ? 46 ILE A HG13 10 
ATOM 9635  H HG21 . ILE A 1 46 ? -2.631  4.339   2.662   1.00 0.00 ? 46 ILE A HG21 10 
ATOM 9636  H HG22 . ILE A 1 46 ? -3.168  2.916   1.771   1.00 0.00 ? 46 ILE A HG22 10 
ATOM 9637  H HG23 . ILE A 1 46 ? -1.779  2.806   2.850   1.00 0.00 ? 46 ILE A HG23 10 
ATOM 9638  H HD11 . ILE A 1 46 ? -4.141  5.454   5.257   1.00 0.00 ? 46 ILE A HD11 10 
ATOM 9639  H HD12 . ILE A 1 46 ? -4.583  3.958   6.080   1.00 0.00 ? 46 ILE A HD12 10 
ATOM 9640  H HD13 . ILE A 1 46 ? -5.840  5.026   5.455   1.00 0.00 ? 46 ILE A HD13 10 
ATOM 9641  N N    . CYS A 1 47 ? -4.695  0.167   1.686   1.00 0.00 ? 47 CYS A N    10 
ATOM 9642  C CA   . CYS A 1 47 ? -4.358  -0.492  0.425   1.00 0.00 ? 47 CYS A CA   10 
ATOM 9643  C C    . CYS A 1 47 ? -4.440  0.497   -0.736  1.00 0.00 ? 47 CYS A C    10 
ATOM 9644  O O    . CYS A 1 47 ? -4.407  0.099   -1.899  1.00 0.00 ? 47 CYS A O    10 
ATOM 9645  C CB   . CYS A 1 47 ? -5.288  -1.672  0.151   1.00 0.00 ? 47 CYS A CB   10 
ATOM 9646  S SG   . CYS A 1 47 ? -4.960  -2.503  -1.439  1.00 0.00 ? 47 CYS A SG   10 
ATOM 9647  H H    . CYS A 1 47 ? -5.631  0.179   1.985   1.00 0.00 ? 47 CYS A H    10 
ATOM 9648  H HA   . CYS A 1 47 ? -3.348  -0.858  0.498   1.00 0.00 ? 47 CYS A HA   10 
ATOM 9649  H HB2  . CYS A 1 47 ? -5.172  -2.404  0.936   1.00 0.00 ? 47 CYS A HB2  10 
ATOM 9650  H HB3  . CYS A 1 47 ? -6.310  -1.322  0.137   1.00 0.00 ? 47 CYS A HB3  10 
ATOM 9651  N N    . ARG A 1 48 ? -4.557  1.785   -0.399  1.00 0.00 ? 48 ARG A N    10 
ATOM 9652  C CA   . ARG A 1 48 ? -4.660  2.864   -1.389  1.00 0.00 ? 48 ARG A CA   10 
ATOM 9653  C C    . ARG A 1 48 ? -4.403  2.379   -2.811  1.00 0.00 ? 48 ARG A C    10 
ATOM 9654  O O    . ARG A 1 48 ? -3.264  2.118   -3.194  1.00 0.00 ? 48 ARG A O    10 
ATOM 9655  C CB   . ARG A 1 48 ? -3.691  3.990   -1.036  1.00 0.00 ? 48 ARG A CB   10 
ATOM 9656  C CG   . ARG A 1 48 ? -3.936  4.579   0.340   1.00 0.00 ? 48 ARG A CG   10 
ATOM 9657  C CD   . ARG A 1 48 ? -4.590  5.950   0.257   1.00 0.00 ? 48 ARG A CD   10 
ATOM 9658  N NE   . ARG A 1 48 ? -4.071  6.743   -0.855  1.00 0.00 ? 48 ARG A NE   10 
ATOM 9659  C CZ   . ARG A 1 48 ? -3.016  7.548   -0.761  1.00 0.00 ? 48 ARG A CZ   10 
ATOM 9660  N NH1  . ARG A 1 48 ? -2.366  7.663   0.389   1.00 0.00 ? 48 ARG A NH1  10 
ATOM 9661  N NH2  . ARG A 1 48 ? -2.609  8.236   -1.818  1.00 0.00 ? 48 ARG A NH2  10 
ATOM 9662  H H    . ARG A 1 48 ? -4.585  2.020   0.553   1.00 0.00 ? 48 ARG A H    10 
ATOM 9663  H HA   . ARG A 1 48 ? -5.657  3.249   -1.340  1.00 0.00 ? 48 ARG A HA   10 
ATOM 9664  H HB2  . ARG A 1 48 ? -2.688  3.606   -1.068  1.00 0.00 ? 48 ARG A HB2  10 
ATOM 9665  H HB3  . ARG A 1 48 ? -3.783  4.777   -1.762  1.00 0.00 ? 48 ARG A HB3  10 
ATOM 9666  H HG2  . ARG A 1 48 ? -4.584  3.914   0.893   1.00 0.00 ? 48 ARG A HG2  10 
ATOM 9667  H HG3  . ARG A 1 48 ? -2.995  4.669   0.853   1.00 0.00 ? 48 ARG A HG3  10 
ATOM 9668  H HD2  . ARG A 1 48 ? -5.653  5.819   0.125   1.00 0.00 ? 48 ARG A HD2  10 
ATOM 9669  H HD3  . ARG A 1 48 ? -4.407  6.479   1.181   1.00 0.00 ? 48 ARG A HD3  10 
ATOM 9670  H HE   . ARG A 1 48 ? -4.533  6.672   -1.716  1.00 0.00 ? 48 ARG A HE   10 
ATOM 9671  H HH11 . ARG A 1 48 ? -2.666  7.144   1.188   1.00 0.00 ? 48 ARG A HH11 10 
ATOM 9672  H HH12 . ARG A 1 48 ? -1.574  8.271   0.456   1.00 0.00 ? 48 ARG A HH12 10 
ATOM 9673  H HH21 . ARG A 1 48 ? -3.096  8.150   -2.688  1.00 0.00 ? 48 ARG A HH21 10 
ATOM 9674  H HH22 . ARG A 1 48 ? -1.817  8.841   -1.746  1.00 0.00 ? 48 ARG A HH22 10 
ATOM 9675  N N    . ARG A 1 49 ? -5.480  2.249   -3.585  1.00 0.00 ? 49 ARG A N    10 
ATOM 9676  C CA   . ARG A 1 49 ? -5.382  1.783   -4.965  1.00 0.00 ? 49 ARG A CA   10 
ATOM 9677  C C    . ARG A 1 49 ? -6.303  2.579   -5.884  1.00 0.00 ? 49 ARG A C    10 
ATOM 9678  O O    . ARG A 1 49 ? -6.648  2.124   -6.975  1.00 0.00 ? 49 ARG A O    10 
ATOM 9679  C CB   . ARG A 1 49 ? -5.736  0.296   -5.045  1.00 0.00 ? 49 ARG A CB   10 
ATOM 9680  C CG   . ARG A 1 49 ? -4.532  -0.624  -4.939  1.00 0.00 ? 49 ARG A CG   10 
ATOM 9681  C CD   . ARG A 1 49 ? -4.539  -1.679  -6.033  1.00 0.00 ? 49 ARG A CD   10 
ATOM 9682  N NE   . ARG A 1 49 ? -5.325  -2.851  -5.660  1.00 0.00 ? 49 ARG A NE   10 
ATOM 9683  C CZ   . ARG A 1 49 ? -5.158  -4.053  -6.202  1.00 0.00 ? 49 ARG A CZ   10 
ATOM 9684  N NH1  . ARG A 1 49 ? -4.237  -4.238  -7.138  1.00 0.00 ? 49 ARG A NH1  10 
ATOM 9685  N NH2  . ARG A 1 49 ? -5.913  -5.070  -5.810  1.00 0.00 ? 49 ARG A NH2  10 
ATOM 9686  H H    . ARG A 1 49 ? -6.363  2.467   -3.215  1.00 0.00 ? 49 ARG A H    10 
ATOM 9687  H HA   . ARG A 1 49 ? -4.362  1.918   -5.290  1.00 0.00 ? 49 ARG A HA   10 
ATOM 9688  H HB2  . ARG A 1 49 ? -6.417  0.057   -4.241  1.00 0.00 ? 49 ARG A HB2  10 
ATOM 9689  H HB3  . ARG A 1 49 ? -6.226  0.106   -5.988  1.00 0.00 ? 49 ARG A HB3  10 
ATOM 9690  H HG2  . ARG A 1 49 ? -3.634  -0.034  -5.027  1.00 0.00 ? 49 ARG A HG2  10 
ATOM 9691  H HG3  . ARG A 1 49 ? -4.550  -1.115  -3.977  1.00 0.00 ? 49 ARG A HG3  10 
ATOM 9692  H HD2  . ARG A 1 49 ? -4.959  -1.247  -6.929  1.00 0.00 ? 49 ARG A HD2  10 
ATOM 9693  H HD3  . ARG A 1 49 ? -3.521  -1.985  -6.226  1.00 0.00 ? 49 ARG A HD3  10 
ATOM 9694  H HE   . ARG A 1 49 ? -6.012  -2.736  -4.970  1.00 0.00 ? 49 ARG A HE   10 
ATOM 9695  H HH11 . ARG A 1 49 ? -3.666  -3.473  -7.436  1.00 0.00 ? 49 ARG A HH11 10 
ATOM 9696  H HH12 . ARG A 1 49 ? -4.112  -5.143  -7.544  1.00 0.00 ? 49 ARG A HH12 10 
ATOM 9697  H HH21 . ARG A 1 49 ? -6.608  -4.934  -5.105  1.00 0.00 ? 49 ARG A HH21 10 
ATOM 9698  H HH22 . ARG A 1 49 ? -5.786  -5.974  -6.219  1.00 0.00 ? 49 ARG A HH22 10 
ATOM 9699  N N    . ALA A 1 50 ? -6.700  3.767   -5.441  1.00 0.00 ? 50 ALA A N    10 
ATOM 9700  C CA   . ALA A 1 50 ? -7.583  4.617   -6.230  1.00 0.00 ? 50 ALA A CA   10 
ATOM 9701  C C    . ALA A 1 50 ? -6.837  5.830   -6.776  1.00 0.00 ? 50 ALA A C    10 
ATOM 9702  O O    . ALA A 1 50 ? -5.866  6.293   -6.177  1.00 0.00 ? 50 ALA A O    10 
ATOM 9703  C CB   . ALA A 1 50 ? -8.774  5.061   -5.394  1.00 0.00 ? 50 ALA A CB   10 
ATOM 9704  H H    . ALA A 1 50 ? -6.394  4.078   -4.563  1.00 0.00 ? 50 ALA A H    10 
ATOM 9705  H HA   . ALA A 1 50 ? -7.954  4.033   -7.060  1.00 0.00 ? 50 ALA A HA   10 
ATOM 9706  H HB1  . ALA A 1 50 ? -9.541  5.457   -6.042  1.00 0.00 ? 50 ALA A HB1  10 
ATOM 9707  H HB2  . ALA A 1 50 ? -8.460  5.826   -4.699  1.00 0.00 ? 50 ALA A HB2  10 
ATOM 9708  H HB3  . ALA A 1 50 ? -9.165  4.216   -4.847  1.00 0.00 ? 50 ALA A HB3  10 
ATOM 9709  N N    . ARG A 1 51 ? -7.297  6.341   -7.913  1.00 0.00 ? 51 ARG A N    10 
ATOM 9710  C CA   . ARG A 1 51 ? -6.673  7.503   -8.535  1.00 0.00 ? 51 ARG A CA   10 
ATOM 9711  C C    . ARG A 1 51 ? -7.702  8.610   -8.769  1.00 0.00 ? 51 ARG A C    10 
ATOM 9712  O O    . ARG A 1 51 ? -8.099  9.294   -7.828  1.00 0.00 ? 51 ARG A O    10 
ATOM 9713  C CB   . ARG A 1 51 ? -5.997  7.105   -9.849  1.00 0.00 ? 51 ARG A CB   10 
ATOM 9714  C CG   . ARG A 1 51 ? -4.587  6.566   -9.669  1.00 0.00 ? 51 ARG A CG   10 
ATOM 9715  C CD   . ARG A 1 51 ? -4.253  5.521   -10.721 1.00 0.00 ? 51 ARG A CD   10 
ATOM 9716  N NE   . ARG A 1 51 ? -4.667  4.182   -10.311 1.00 0.00 ? 51 ARG A NE   10 
ATOM 9717  C CZ   . ARG A 1 51 ? -4.252  3.069   -10.908 1.00 0.00 ? 51 ARG A CZ   10 
ATOM 9718  N NH1  . ARG A 1 51 ? -3.415  3.137   -11.934 1.00 0.00 ? 51 ARG A NH1  10 
ATOM 9719  N NH2  . ARG A 1 51 ? -4.673  1.888   -10.477 1.00 0.00 ? 51 ARG A NH2  10 
ATOM 9720  H H    . ARG A 1 51 ? -8.076  5.930   -8.343  1.00 0.00 ? 51 ARG A H    10 
ATOM 9721  H HA   . ARG A 1 51 ? -5.920  7.873   -7.854  1.00 0.00 ? 51 ARG A HA   10 
ATOM 9722  H HB2  . ARG A 1 51 ? -6.592  6.344   -10.331 1.00 0.00 ? 51 ARG A HB2  10 
ATOM 9723  H HB3  . ARG A 1 51 ? -5.948  7.972   -10.492 1.00 0.00 ? 51 ARG A HB3  10 
ATOM 9724  H HG2  . ARG A 1 51 ? -3.886  7.383   -9.753  1.00 0.00 ? 51 ARG A HG2  10 
ATOM 9725  H HG3  . ARG A 1 51 ? -4.506  6.118   -8.690  1.00 0.00 ? 51 ARG A HG3  10 
ATOM 9726  H HD2  . ARG A 1 51 ? -4.759  5.778   -11.639 1.00 0.00 ? 51 ARG A HD2  10 
ATOM 9727  H HD3  . ARG A 1 51 ? -3.186  5.523   -10.886 1.00 0.00 ? 51 ARG A HD3  10 
ATOM 9728  H HE   . ARG A 1 51 ? -5.285  4.109   -9.554  1.00 0.00 ? 51 ARG A HE   10 
ATOM 9729  H HH11 . ARG A 1 51 ? -3.095  4.026   -12.260 1.00 0.00 ? 51 ARG A HH11 10 
ATOM 9730  H HH12 . ARG A 1 51 ? -3.104  2.298   -12.381 1.00 0.00 ? 51 ARG A HH12 10 
ATOM 9731  H HH21 . ARG A 1 51 ? -5.304  1.833   -9.703  1.00 0.00 ? 51 ARG A HH21 10 
ATOM 9732  H HH22 . ARG A 1 51 ? -4.361  1.051   -10.927 1.00 0.00 ? 51 ARG A HH22 10 
ATOM 9733  N N    . GLY A 1 52 ? -8.136  8.778   -10.021 1.00 0.00 ? 52 GLY A N    10 
ATOM 9734  C CA   . GLY A 1 52 ? -9.117  9.803   -10.341 1.00 0.00 ? 52 GLY A CA   10 
ATOM 9735  C C    . GLY A 1 52 ? -9.007  11.023  -9.446  1.00 0.00 ? 52 GLY A C    10 
ATOM 9736  O O    . GLY A 1 52 ? -8.275  11.964  -9.752  1.00 0.00 ? 52 GLY A O    10 
ATOM 9737  H H    . GLY A 1 52 ? -7.792  8.202   -10.732 1.00 0.00 ? 52 GLY A H    10 
ATOM 9738  H HA2  . GLY A 1 52 ? -8.977  10.111  -11.366 1.00 0.00 ? 52 GLY A HA2  10 
ATOM 9739  H HA3  . GLY A 1 52 ? -10.106 9.382   -10.236 1.00 0.00 ? 52 GLY A HA3  10 
ATOM 9740  N N    . ASP A 1 53 ? -9.735  11.001  -8.334  1.00 0.00 ? 53 ASP A N    10 
ATOM 9741  C CA   . ASP A 1 53 ? -9.720  12.106  -7.382  1.00 0.00 ? 53 ASP A CA   10 
ATOM 9742  C C    . ASP A 1 53 ? -10.073 11.614  -5.983  1.00 0.00 ? 53 ASP A C    10 
ATOM 9743  O O    . ASP A 1 53 ? -10.764 12.298  -5.228  1.00 0.00 ? 53 ASP A O    10 
ATOM 9744  C CB   . ASP A 1 53 ? -10.702 13.194  -7.817  1.00 0.00 ? 53 ASP A CB   10 
ATOM 9745  C CG   . ASP A 1 53 ? -10.677 14.398  -6.895  1.00 0.00 ? 53 ASP A CG   10 
ATOM 9746  O OD1  . ASP A 1 53 ? -9.601  15.018  -6.758  1.00 0.00 ? 53 ASP A OD1  10 
ATOM 9747  O OD2  . ASP A 1 53 ? -11.733 14.721  -6.311  1.00 0.00 ? 53 ASP A OD2  10 
ATOM 9748  H H    . ASP A 1 53 ? -10.295 10.219  -8.147  1.00 0.00 ? 53 ASP A H    10 
ATOM 9749  H HA   . ASP A 1 53 ? -8.722  12.517  -7.367  1.00 0.00 ? 53 ASP A HA   10 
ATOM 9750  H HB2  . ASP A 1 53 ? -10.449 13.522  -8.813  1.00 0.00 ? 53 ASP A HB2  10 
ATOM 9751  H HB3  . ASP A 1 53 ? -11.702 12.786  -7.819  1.00 0.00 ? 53 ASP A HB3  10 
ATOM 9752  N N    . ASP A 1 54 ? -9.598  10.419  -5.646  1.00 0.00 ? 54 ASP A N    10 
ATOM 9753  C CA   . ASP A 1 54 ? -9.866  9.828   -4.339  1.00 0.00 ? 54 ASP A CA   10 
ATOM 9754  C C    . ASP A 1 54 ? -8.584  9.305   -3.697  1.00 0.00 ? 54 ASP A C    10 
ATOM 9755  O O    . ASP A 1 54 ? -8.030  9.934   -2.796  1.00 0.00 ? 54 ASP A O    10 
ATOM 9756  C CB   . ASP A 1 54 ? -10.879 8.690   -4.475  1.00 0.00 ? 54 ASP A CB   10 
ATOM 9757  C CG   . ASP A 1 54 ? -12.185 9.150   -5.092  1.00 0.00 ? 54 ASP A CG   10 
ATOM 9758  O OD1  . ASP A 1 54 ? -12.553 10.327  -4.895  1.00 0.00 ? 54 ASP A OD1  10 
ATOM 9759  O OD2  . ASP A 1 54 ? -12.840 8.333   -5.773  1.00 0.00 ? 54 ASP A OD2  10 
ATOM 9760  H H    . ASP A 1 54 ? -9.057  9.921   -6.293  1.00 0.00 ? 54 ASP A H    10 
ATOM 9761  H HA   . ASP A 1 54 ? -10.285 10.596  -3.707  1.00 0.00 ? 54 ASP A HA   10 
ATOM 9762  H HB2  . ASP A 1 54 ? -10.460 7.916   -5.101  1.00 0.00 ? 54 ASP A HB2  10 
ATOM 9763  H HB3  . ASP A 1 54 ? -11.086 8.283   -3.497  1.00 0.00 ? 54 ASP A HB3  10 
ATOM 9764  N N    . LEU A 1 55 ? -8.124  8.148   -4.166  1.00 0.00 ? 55 LEU A N    10 
ATOM 9765  C CA   . LEU A 1 55 ? -6.909  7.531   -3.641  1.00 0.00 ? 55 LEU A CA   10 
ATOM 9766  C C    . LEU A 1 55 ? -7.117  7.030   -2.216  1.00 0.00 ? 55 LEU A C    10 
ATOM 9767  O O    . LEU A 1 55 ? -6.461  7.497   -1.285  1.00 0.00 ? 55 LEU A O    10 
ATOM 9768  C CB   . LEU A 1 55 ? -5.743  8.523   -3.675  1.00 0.00 ? 55 LEU A CB   10 
ATOM 9769  C CG   . LEU A 1 55 ? -5.275  8.929   -5.072  1.00 0.00 ? 55 LEU A CG   10 
ATOM 9770  C CD1  . LEU A 1 55 ? -6.434  9.488   -5.881  1.00 0.00 ? 55 LEU A CD1  10 
ATOM 9771  C CD2  . LEU A 1 55 ? -4.147  9.945   -4.981  1.00 0.00 ? 55 LEU A CD2  10 
ATOM 9772  H H    . LEU A 1 55 ? -8.615  7.696   -4.883  1.00 0.00 ? 55 LEU A H    10 
ATOM 9773  H HA   . LEU A 1 55 ? -6.669  6.689   -4.273  1.00 0.00 ? 55 LEU A HA   10 
ATOM 9774  H HB2  . LEU A 1 55 ? -6.040  9.415   -3.144  1.00 0.00 ? 55 LEU A HB2  10 
ATOM 9775  H HB3  . LEU A 1 55 ? -4.907  8.079   -3.156  1.00 0.00 ? 55 LEU A HB3  10 
ATOM 9776  H HG   . LEU A 1 55 ? -4.900  8.057   -5.587  1.00 0.00 ? 55 LEU A HG   10 
ATOM 9777  H HD11 . LEU A 1 55 ? -6.900  10.294  -5.334  1.00 0.00 ? 55 LEU A HD11 10 
ATOM 9778  H HD12 . LEU A 1 55 ? -7.158  8.706   -6.057  1.00 0.00 ? 55 LEU A HD12 10 
ATOM 9779  H HD13 . LEU A 1 55 ? -6.068  9.859   -6.827  1.00 0.00 ? 55 LEU A HD13 10 
ATOM 9780  H HD21 . LEU A 1 55 ? -3.209  9.465   -5.221  1.00 0.00 ? 55 LEU A HD21 10 
ATOM 9781  H HD22 . LEU A 1 55 ? -4.101  10.343  -3.978  1.00 0.00 ? 55 LEU A HD22 10 
ATOM 9782  H HD23 . LEU A 1 55 ? -4.328  10.749  -5.679  1.00 0.00 ? 55 LEU A HD23 10 
ATOM 9783  N N    . ASP A 1 56 ? -8.026  6.074   -2.049  1.00 0.00 ? 56 ASP A N    10 
ATOM 9784  C CA   . ASP A 1 56 ? -8.304  5.515   -0.735  1.00 0.00 ? 56 ASP A CA   10 
ATOM 9785  C C    . ASP A 1 56 ? -8.348  3.992   -0.793  1.00 0.00 ? 56 ASP A C    10 
ATOM 9786  O O    . ASP A 1 56 ? -8.437  3.404   -1.872  1.00 0.00 ? 56 ASP A O    10 
ATOM 9787  C CB   . ASP A 1 56 ? -9.626  6.062   -0.192  1.00 0.00 ? 56 ASP A CB   10 
ATOM 9788  C CG   . ASP A 1 56 ? -9.475  7.448   0.406   1.00 0.00 ? 56 ASP A CG   10 
ATOM 9789  O OD1  . ASP A 1 56 ? -8.597  8.203   -0.060  1.00 0.00 ? 56 ASP A OD1  10 
ATOM 9790  O OD2  . ASP A 1 56 ? -10.237 7.777   1.340   1.00 0.00 ? 56 ASP A OD2  10 
ATOM 9791  H H    . ASP A 1 56 ? -8.520  5.733   -2.825  1.00 0.00 ? 56 ASP A H    10 
ATOM 9792  H HA   . ASP A 1 56 ? -7.505  5.813   -0.074  1.00 0.00 ? 56 ASP A HA   10 
ATOM 9793  H HB2  . ASP A 1 56 ? -10.343 6.117   -0.996  1.00 0.00 ? 56 ASP A HB2  10 
ATOM 9794  H HB3  . ASP A 1 56 ? -9.997  5.397   0.573   1.00 0.00 ? 56 ASP A HB3  10 
ATOM 9795  N N    . ASP A 1 57 ? -8.281  3.365   0.377   1.00 0.00 ? 57 ASP A N    10 
ATOM 9796  C CA   . ASP A 1 57 ? -8.311  1.910   0.479   1.00 0.00 ? 57 ASP A CA   10 
ATOM 9797  C C    . ASP A 1 57 ? -7.629  1.450   1.760   1.00 0.00 ? 57 ASP A C    10 
ATOM 9798  O O    . ASP A 1 57 ? -6.637  2.037   2.185   1.00 0.00 ? 57 ASP A O    10 
ATOM 9799  C CB   . ASP A 1 57 ? -7.637  1.267   -0.734  1.00 0.00 ? 57 ASP A CB   10 
ATOM 9800  C CG   . ASP A 1 57 ? -8.640  0.738   -1.740  1.00 0.00 ? 57 ASP A CG   10 
ATOM 9801  O OD1  . ASP A 1 57 ? -9.829  1.106   -1.642  1.00 0.00 ? 57 ASP A OD1  10 
ATOM 9802  O OD2  . ASP A 1 57 ? -8.236  -0.042  -2.627  1.00 0.00 ? 57 ASP A OD2  10 
ATOM 9803  H H    . ASP A 1 57 ? -8.209  3.897   1.197   1.00 0.00 ? 57 ASP A H    10 
ATOM 9804  H HA   . ASP A 1 57 ? -9.343  1.605   0.509   1.00 0.00 ? 57 ASP A HA   10 
ATOM 9805  H HB2  . ASP A 1 57 ? -7.017  2.000   -1.225  1.00 0.00 ? 57 ASP A HB2  10 
ATOM 9806  H HB3  . ASP A 1 57 ? -7.021  0.445   -0.401  1.00 0.00 ? 57 ASP A HB3  10 
ATOM 9807  N N    . TYR A 1 58 ? -8.173  0.401   2.371   1.00 0.00 ? 58 TYR A N    10 
ATOM 9808  C CA   . TYR A 1 58 ? -7.623  -0.140  3.611   1.00 0.00 ? 58 TYR A CA   10 
ATOM 9809  C C    . TYR A 1 58 ? -6.755  -1.365  3.347   1.00 0.00 ? 58 TYR A C    10 
ATOM 9810  O O    . TYR A 1 58 ? -6.745  -1.903  2.241   1.00 0.00 ? 58 TYR A O    10 
ATOM 9811  C CB   . TYR A 1 58 ? -8.750  -0.498  4.579   1.00 0.00 ? 58 TYR A CB   10 
ATOM 9812  C CG   . TYR A 1 58 ? -9.283  0.689   5.346   1.00 0.00 ? 58 TYR A CG   10 
ATOM 9813  C CD1  . TYR A 1 58 ? -8.983  1.985   4.947   1.00 0.00 ? 58 TYR A CD1  10 
ATOM 9814  C CD2  . TYR A 1 58 ? -10.083 0.516   6.468   1.00 0.00 ? 58 TYR A CD2  10 
ATOM 9815  C CE1  . TYR A 1 58 ? -9.464  3.076   5.644   1.00 0.00 ? 58 TYR A CE1  10 
ATOM 9816  C CE2  . TYR A 1 58 ? -10.569 1.602   7.171   1.00 0.00 ? 58 TYR A CE2  10 
ATOM 9817  C CZ   . TYR A 1 58 ? -10.257 2.880   6.755   1.00 0.00 ? 58 TYR A CZ   10 
ATOM 9818  O OH   . TYR A 1 58 ? -10.739 3.964   7.453   1.00 0.00 ? 58 TYR A OH   10 
ATOM 9819  H H    . TYR A 1 58 ? -8.966  -0.018  1.979   1.00 0.00 ? 58 TYR A H    10 
ATOM 9820  H HA   . TYR A 1 58 ? -7.011  0.626   4.058   1.00 0.00 ? 58 TYR A HA   10 
ATOM 9821  H HB2  . TYR A 1 58 ? -9.570  -0.928  4.022   1.00 0.00 ? 58 TYR A HB2  10 
ATOM 9822  H HB3  . TYR A 1 58 ? -8.387  -1.222  5.293   1.00 0.00 ? 58 TYR A HB3  10 
ATOM 9823  H HD1  . TYR A 1 58 ? -8.361  2.134   4.077   1.00 0.00 ? 58 TYR A HD1  10 
ATOM 9824  H HD2  . TYR A 1 58 ? -10.324 -0.486  6.793   1.00 0.00 ? 58 TYR A HD2  10 
ATOM 9825  H HE1  . TYR A 1 58 ? -9.219  4.076   5.318   1.00 0.00 ? 58 TYR A HE1  10 
ATOM 9826  H HE2  . TYR A 1 58 ? -11.189 1.448   8.041   1.00 0.00 ? 58 TYR A HE2  10 
ATOM 9827  H HH   . TYR A 1 58 ? -10.800 3.744   8.385   1.00 0.00 ? 58 TYR A HH   10 
ATOM 9828  N N    . CYS A 1 59 ? -6.020  -1.799  4.369   1.00 0.00 ? 59 CYS A N    10 
ATOM 9829  C CA   . CYS A 1 59 ? -5.144  -2.955  4.234   1.00 0.00 ? 59 CYS A CA   10 
ATOM 9830  C C    . CYS A 1 59 ? -5.404  -3.999  5.322   1.00 0.00 ? 59 CYS A C    10 
ATOM 9831  O O    . CYS A 1 59 ? -4.889  -3.919  6.437   1.00 0.00 ? 59 CYS A O    10 
ATOM 9832  C CB   . CYS A 1 59 ? -3.676  -2.496  4.186   1.00 0.00 ? 59 CYS A CB   10 
ATOM 9833  S SG   . CYS A 1 59 ? -2.500  -3.412  5.240   1.00 0.00 ? 59 CYS A SG   10 
ATOM 9834  H H    . CYS A 1 59 ? -6.065  -1.328  5.226   1.00 0.00 ? 59 CYS A H    10 
ATOM 9835  H HA   . CYS A 1 59 ? -5.375  -3.411  3.291   1.00 0.00 ? 59 CYS A HA   10 
ATOM 9836  H HB2  . CYS A 1 59 ? -3.324  -2.591  3.173   1.00 0.00 ? 59 CYS A HB2  10 
ATOM 9837  H HB3  . CYS A 1 59 ? -3.633  -1.460  4.469   1.00 0.00 ? 59 CYS A HB3  10 
ATOM 9838  N N    . ASN A 1 60 ? -6.198  -4.999  4.943   1.00 0.00 ? 60 ASN A N    10 
ATOM 9839  C CA   . ASN A 1 60 ? -6.546  -6.120  5.807   1.00 0.00 ? 60 ASN A CA   10 
ATOM 9840  C C    . ASN A 1 60 ? -5.701  -7.309  5.378   1.00 0.00 ? 60 ASN A C    10 
ATOM 9841  O O    . ASN A 1 60 ? -4.477  -7.218  5.378   1.00 0.00 ? 60 ASN A O    10 
ATOM 9842  C CB   . ASN A 1 60 ? -8.037  -6.453  5.694   1.00 0.00 ? 60 ASN A CB   10 
ATOM 9843  C CG   . ASN A 1 60 ? -8.938  -5.262  5.953   1.00 0.00 ? 60 ASN A CG   10 
ATOM 9844  O OD1  . ASN A 1 60 ? -10.120 -5.283  5.610   1.00 0.00 ? 60 ASN A OD1  10 
ATOM 9845  N ND2  . ASN A 1 60 ? -8.392  -4.217  6.558   1.00 0.00 ? 60 ASN A ND2  10 
ATOM 9846  H H    . ASN A 1 60 ? -6.538  -4.994  4.035   1.00 0.00 ? 60 ASN A H    10 
ATOM 9847  H HA   . ASN A 1 60 ? -6.308  -5.851  6.814   1.00 0.00 ? 60 ASN A HA   10 
ATOM 9848  H HB2  . ASN A 1 60 ? -8.241  -6.817  4.699   1.00 0.00 ? 60 ASN A HB2  10 
ATOM 9849  H HB3  . ASN A 1 60 ? -8.279  -7.225  6.410   1.00 0.00 ? 60 ASN A HB3  10 
ATOM 9850  H HD21 . ASN A 1 60 ? -7.443  -4.261  6.804   1.00 0.00 ? 60 ASN A HD21 10 
ATOM 9851  H HD22 . ASN A 1 60 ? -8.963  -3.447  6.742   1.00 0.00 ? 60 ASN A HD22 10 
ATOM 9852  N N    . GLY A 1 61 ? -6.329  -8.393  4.927   1.00 0.00 ? 61 GLY A N    10 
ATOM 9853  C CA   . GLY A 1 61 ? -5.555  -9.512  4.417   1.00 0.00 ? 61 GLY A CA   10 
ATOM 9854  C C    . GLY A 1 61 ? -5.068  -9.164  3.024   1.00 0.00 ? 61 GLY A C    10 
ATOM 9855  O O    . GLY A 1 61 ? -5.349  -9.864  2.051   1.00 0.00 ? 61 GLY A O    10 
ATOM 9856  H H    . GLY A 1 61 ? -7.304  -8.411  4.878   1.00 0.00 ? 61 GLY A H    10 
ATOM 9857  H HA2  . GLY A 1 61 ? -4.713  -9.693  5.066   1.00 0.00 ? 61 GLY A HA2  10 
ATOM 9858  H HA3  . GLY A 1 61 ? -6.177  -10.392 4.369   1.00 0.00 ? 61 GLY A HA3  10 
ATOM 9859  N N    . ILE A 1 62 ? -4.396  -8.019  2.943   1.00 0.00 ? 62 ILE A N    10 
ATOM 9860  C CA   . ILE A 1 62 ? -3.914  -7.460  1.700   1.00 0.00 ? 62 ILE A CA   10 
ATOM 9861  C C    . ILE A 1 62 ? -2.468  -7.818  1.371   1.00 0.00 ? 62 ILE A C    10 
ATOM 9862  O O    . ILE A 1 62 ? -1.597  -6.951  1.358   1.00 0.00 ? 62 ILE A O    10 
ATOM 9863  C CB   . ILE A 1 62 ? -4.058  -5.921  1.744   1.00 0.00 ? 62 ILE A CB   10 
ATOM 9864  C CG1  . ILE A 1 62 ? -3.409  -5.299  2.989   1.00 0.00 ? 62 ILE A CG1  10 
ATOM 9865  C CG2  . ILE A 1 62 ? -5.525  -5.539  1.740   1.00 0.00 ? 62 ILE A CG2  10 
ATOM 9866  C CD1  . ILE A 1 62 ? -2.316  -6.110  3.639   1.00 0.00 ? 62 ILE A CD1  10 
ATOM 9867  H H    . ILE A 1 62 ? -4.263  -7.504  3.749   1.00 0.00 ? 62 ILE A H    10 
ATOM 9868  H HA   . ILE A 1 62 ? -4.549  -7.827  0.911   1.00 0.00 ? 62 ILE A HA   10 
ATOM 9869  H HB   . ILE A 1 62 ? -3.596  -5.509  0.859   1.00 0.00 ? 62 ILE A HB   10 
ATOM 9870  H HG12 . ILE A 1 62 ? -2.980  -4.349  2.716   1.00 0.00 ? 62 ILE A HG12 10 
ATOM 9871  H HG13 . ILE A 1 62 ? -4.176  -5.133  3.728   1.00 0.00 ? 62 ILE A HG13 10 
ATOM 9872  H HG21 . ILE A 1 62 ? -5.999  -5.890  0.840   1.00 0.00 ? 62 ILE A HG21 10 
ATOM 9873  H HG22 . ILE A 1 62 ? -5.610  -4.465  1.796   1.00 0.00 ? 62 ILE A HG22 10 
ATOM 9874  H HG23 . ILE A 1 62 ? -6.009  -5.982  2.597   1.00 0.00 ? 62 ILE A HG23 10 
ATOM 9875  H HD11 . ILE A 1 62 ? -2.541  -7.157  3.576   1.00 0.00 ? 62 ILE A HD11 10 
ATOM 9876  H HD12 . ILE A 1 62 ? -2.233  -5.826  4.679   1.00 0.00 ? 62 ILE A HD12 10 
ATOM 9877  H HD13 . ILE A 1 62 ? -1.386  -5.910  3.138   1.00 0.00 ? 62 ILE A HD13 10 
ATOM 9878  N N    . SER A 1 63 ? -2.215  -9.082  1.064   1.00 0.00 ? 63 SER A N    10 
ATOM 9879  C CA   . SER A 1 63 ? -0.869  -9.502  0.700   1.00 0.00 ? 63 SER A CA   10 
ATOM 9880  C C    . SER A 1 63 ? -0.482  -8.892  -0.643  1.00 0.00 ? 63 SER A C    10 
ATOM 9881  O O    . SER A 1 63 ? -0.262  -9.601  -1.625  1.00 0.00 ? 63 SER A O    10 
ATOM 9882  C CB   . SER A 1 63 ? -0.778  -11.022 0.636   1.00 0.00 ? 63 SER A CB   10 
ATOM 9883  O OG   . SER A 1 63 ? -1.806  -11.564 -0.175  1.00 0.00 ? 63 SER A OG   10 
ATOM 9884  H H    . SER A 1 63 ? -2.946  -9.735  1.056   1.00 0.00 ? 63 SER A H    10 
ATOM 9885  H HA   . SER A 1 63 ? -0.192  -9.136  1.458   1.00 0.00 ? 63 SER A HA   10 
ATOM 9886  H HB2  . SER A 1 63 ? 0.177   -11.301 0.221   1.00 0.00 ? 63 SER A HB2  10 
ATOM 9887  H HB3  . SER A 1 63 ? -0.871  -11.423 1.634   1.00 0.00 ? 63 SER A HB3  10 
ATOM 9888  H HG   . SER A 1 63 ? -2.451  -10.881 -0.373  1.00 0.00 ? 63 SER A HG   10 
ATOM 9889  N N    . ALA A 1 64 ? -0.423  -7.566  -0.669  1.00 0.00 ? 64 ALA A N    10 
ATOM 9890  C CA   . ALA A 1 64 ? -0.089  -6.817  -1.872  1.00 0.00 ? 64 ALA A CA   10 
ATOM 9891  C C    . ALA A 1 64 ? -1.331  -6.605  -2.740  1.00 0.00 ? 64 ALA A C    10 
ATOM 9892  O O    . ALA A 1 64 ? -1.243  -6.454  -3.958  1.00 0.00 ? 64 ALA A O    10 
ATOM 9893  C CB   . ALA A 1 64 ? 1.017   -7.502  -2.659  1.00 0.00 ? 64 ALA A CB   10 
ATOM 9894  H H    . ALA A 1 64 ? -0.624  -7.070  0.150   1.00 0.00 ? 64 ALA A H    10 
ATOM 9895  H HA   . ALA A 1 64 ? 0.279   -5.855  -1.549  1.00 0.00 ? 64 ALA A HA   10 
ATOM 9896  H HB1  . ALA A 1 64 ? 1.841   -7.728  -1.999  1.00 0.00 ? 64 ALA A HB1  10 
ATOM 9897  H HB2  . ALA A 1 64 ? 1.357   -6.842  -3.445  1.00 0.00 ? 64 ALA A HB2  10 
ATOM 9898  H HB3  . ALA A 1 64 ? 0.640   -8.413  -3.094  1.00 0.00 ? 64 ALA A HB3  10 
ATOM 9899  N N    . GLY A 1 65 ? -2.486  -6.588  -2.080  1.00 0.00 ? 65 GLY A N    10 
ATOM 9900  C CA   . GLY A 1 65 ? -3.764  -6.384  -2.748  1.00 0.00 ? 65 GLY A CA   10 
ATOM 9901  C C    . GLY A 1 65 ? -4.830  -6.024  -1.733  1.00 0.00 ? 65 GLY A C    10 
ATOM 9902  O O    . GLY A 1 65 ? -4.747  -6.465  -0.602  1.00 0.00 ? 65 GLY A O    10 
ATOM 9903  H H    . GLY A 1 65 ? -2.471  -6.707  -1.107  1.00 0.00 ? 65 GLY A H    10 
ATOM 9904  H HA2  . GLY A 1 65 ? -3.668  -5.584  -3.468  1.00 0.00 ? 65 GLY A HA2  10 
ATOM 9905  H HA3  . GLY A 1 65 ? -4.052  -7.292  -3.256  1.00 0.00 ? 65 GLY A HA3  10 
ATOM 9906  N N    . CYS A 1 66 ? -5.813  -5.209  -2.110  1.00 0.00 ? 66 CYS A N    10 
ATOM 9907  C CA   . CYS A 1 66 ? -6.855  -4.787  -1.163  1.00 0.00 ? 66 CYS A CA   10 
ATOM 9908  C C    . CYS A 1 66 ? -7.763  -5.939  -0.741  1.00 0.00 ? 66 CYS A C    10 
ATOM 9909  O O    . CYS A 1 66 ? -7.853  -6.960  -1.422  1.00 0.00 ? 66 CYS A O    10 
ATOM 9910  C CB   . CYS A 1 66 ? -7.694  -3.660  -1.765  1.00 0.00 ? 66 CYS A CB   10 
ATOM 9911  S SG   . CYS A 1 66 ? -6.701  -2.308  -2.452  1.00 0.00 ? 66 CYS A SG   10 
ATOM 9912  H H    . CYS A 1 66 ? -5.827  -4.863  -3.027  1.00 0.00 ? 66 CYS A H    10 
ATOM 9913  H HA   . CYS A 1 66 ? -6.356  -4.409  -0.284  1.00 0.00 ? 66 CYS A HA   10 
ATOM 9914  H HB2  . CYS A 1 66 ? -8.306  -4.056  -2.558  1.00 0.00 ? 66 CYS A HB2  10 
ATOM 9915  H HB3  . CYS A 1 66 ? -8.327  -3.243  -0.995  1.00 0.00 ? 66 CYS A HB3  10 
ATOM 9916  N N    . PRO A 1 67 ? -8.447  -5.779  0.412   1.00 0.00 ? 67 PRO A N    10 
ATOM 9917  C CA   . PRO A 1 67 ? -9.354  -6.802  0.952   1.00 0.00 ? 67 PRO A CA   10 
ATOM 9918  C C    . PRO A 1 67 ? -10.438 -7.212  -0.047  1.00 0.00 ? 67 PRO A C    10 
ATOM 9919  O O    . PRO A 1 67 ? -10.159 -7.402  -1.230  1.00 0.00 ? 67 PRO A O    10 
ATOM 9920  C CB   . PRO A 1 67 ? -9.969  -6.118  2.182   1.00 0.00 ? 67 PRO A CB   10 
ATOM 9921  C CG   . PRO A 1 67 ? -8.987  -5.066  2.568   1.00 0.00 ? 67 PRO A CG   10 
ATOM 9922  C CD   . PRO A 1 67 ? -8.386  -4.586  1.284   1.00 0.00 ? 67 PRO A CD   10 
ATOM 9923  H HA   . PRO A 1 67 ? -8.809  -7.681  1.264   1.00 0.00 ? 67 PRO A HA   10 
ATOM 9924  H HB2  . PRO A 1 67 ? -10.924 -5.688  1.918   1.00 0.00 ? 67 PRO A HB2  10 
ATOM 9925  H HB3  . PRO A 1 67 ? -10.100 -6.842  2.972   1.00 0.00 ? 67 PRO A HB3  10 
ATOM 9926  H HG2  . PRO A 1 67 ? -9.493  -4.253  3.070   1.00 0.00 ? 67 PRO A HG2  10 
ATOM 9927  H HG3  . PRO A 1 67 ? -8.223  -5.485  3.205   1.00 0.00 ? 67 PRO A HG3  10 
ATOM 9928  H HD2  . PRO A 1 67 ? -8.970  -3.777  0.881   1.00 0.00 ? 67 PRO A HD2  10 
ATOM 9929  H HD3  . PRO A 1 67 ? -7.372  -4.271  1.445   1.00 0.00 ? 67 PRO A HD3  10 
ATOM 9930  N N    . ARG A 1 68 ? -11.673 -7.355  0.435   1.00 0.00 ? 68 ARG A N    10 
ATOM 9931  C CA   . ARG A 1 68 ? -12.789 -7.751  -0.418  1.00 0.00 ? 68 ARG A CA   10 
ATOM 9932  C C    . ARG A 1 68 ? -13.166 -6.642  -1.396  1.00 0.00 ? 68 ARG A C    10 
ATOM 9933  O O    . ARG A 1 68 ? -13.005 -6.794  -2.607  1.00 0.00 ? 68 ARG A O    10 
ATOM 9934  C CB   . ARG A 1 68 ? -14.002 -8.123  0.437   1.00 0.00 ? 68 ARG A CB   10 
ATOM 9935  C CG   . ARG A 1 68 ? -13.921 -9.518  1.034   1.00 0.00 ? 68 ARG A CG   10 
ATOM 9936  C CD   . ARG A 1 68 ? -14.908 -10.466 0.371   1.00 0.00 ? 68 ARG A CD   10 
ATOM 9937  N NE   . ARG A 1 68 ? -14.690 -11.852 0.774   1.00 0.00 ? 68 ARG A NE   10 
ATOM 9938  C CZ   . ARG A 1 68 ? -15.082 -12.349 1.943   1.00 0.00 ? 68 ARG A CZ   10 
ATOM 9939  N NH1  . ARG A 1 68 ? -15.707 -11.575 2.819   1.00 0.00 ? 68 ARG A NH1  10 
ATOM 9940  N NH2  . ARG A 1 68 ? -14.849 -13.621 2.236   1.00 0.00 ? 68 ARG A NH2  10 
ATOM 9941  H H    . ARG A 1 68 ? -11.839 -7.199  1.386   1.00 0.00 ? 68 ARG A H    10 
ATOM 9942  H HA   . ARG A 1 68 ? -12.480 -8.619  -0.981  1.00 0.00 ? 68 ARG A HA   10 
ATOM 9943  H HB2  . ARG A 1 68 ? -14.088 -7.413  1.246   1.00 0.00 ? 68 ARG A HB2  10 
ATOM 9944  H HB3  . ARG A 1 68 ? -14.890 -8.068  -0.175  1.00 0.00 ? 68 ARG A HB3  10 
ATOM 9945  H HG2  . ARG A 1 68 ? -12.921 -9.902  0.895   1.00 0.00 ? 68 ARG A HG2  10 
ATOM 9946  H HG3  . ARG A 1 68 ? -14.143 -9.461  2.090   1.00 0.00 ? 68 ARG A HG3  10 
ATOM 9947  H HD2  . ARG A 1 68 ? -15.909 -10.174 0.649   1.00 0.00 ? 68 ARG A HD2  10 
ATOM 9948  H HD3  . ARG A 1 68 ? -14.795 -10.390 -0.700  1.00 0.00 ? 68 ARG A HD3  10 
ATOM 9949  H HE   . ARG A 1 68 ? -14.229 -12.442 0.142   1.00 0.00 ? 68 ARG A HE   10 
ATOM 9950  H HH11 . ARG A 1 68 ? -15.885 -10.616 2.601   1.00 0.00 ? 68 ARG A HH11 10 
ATOM 9951  H HH12 . ARG A 1 68 ? -16.002 -11.951 3.698   1.00 0.00 ? 68 ARG A HH12 10 
ATOM 9952  H HH21 . ARG A 1 68 ? -14.377 -14.208 1.578   1.00 0.00 ? 68 ARG A HH21 10 
ATOM 9953  H HH22 . ARG A 1 68 ? -15.144 -13.994 3.116   1.00 0.00 ? 68 ARG A HH22 10 
ATOM 9954  N N    . ASN A 1 69 ? -13.671 -5.530  -0.869  1.00 0.00 ? 69 ASN A N    10 
ATOM 9955  C CA   . ASN A 1 69 ? -14.071 -4.406  -1.712  1.00 0.00 ? 69 ASN A CA   10 
ATOM 9956  C C    . ASN A 1 69 ? -14.344 -3.150  -0.892  1.00 0.00 ? 69 ASN A C    10 
ATOM 9957  O O    . ASN A 1 69 ? -13.703 -2.121  -1.095  1.00 0.00 ? 69 ASN A O    10 
ATOM 9958  C CB   . ASN A 1 69 ? -15.305 -4.773  -2.540  1.00 0.00 ? 69 ASN A CB   10 
ATOM 9959  C CG   . ASN A 1 69 ? -14.955 -5.587  -3.770  1.00 0.00 ? 69 ASN A CG   10 
ATOM 9960  O OD1  . ASN A 1 69 ? -13.990 -5.288  -4.473  1.00 0.00 ? 69 ASN A OD1  10 
ATOM 9961  N ND2  . ASN A 1 69 ? -15.740 -6.625  -4.035  1.00 0.00 ? 69 ASN A ND2  10 
ATOM 9962  H H    . ASN A 1 69 ? -13.777 -5.464  0.102   1.00 0.00 ? 69 ASN A H    10 
ATOM 9963  H HA   . ASN A 1 69 ? -13.256 -4.198  -2.380  1.00 0.00 ? 69 ASN A HA   10 
ATOM 9964  H HB2  . ASN A 1 69 ? -15.980 -5.353  -1.931  1.00 0.00 ? 69 ASN A HB2  10 
ATOM 9965  H HB3  . ASN A 1 69 ? -15.800 -3.867  -2.858  1.00 0.00 ? 69 ASN A HB3  10 
ATOM 9966  H HD21 . ASN A 1 69 ? -16.491 -6.803  -3.431  1.00 0.00 ? 69 ASN A HD21 10 
ATOM 9967  H HD22 . ASN A 1 69 ? -15.537 -7.169  -4.825  1.00 0.00 ? 69 ASN A HD22 10 
ATOM 9968  N N    . PRO A 1 70 ? -15.304 -3.206  0.039   1.00 0.00 ? 70 PRO A N    10 
ATOM 9969  C CA   . PRO A 1 70 ? -15.651 -2.064  0.877   1.00 0.00 ? 70 PRO A CA   10 
ATOM 9970  C C    . PRO A 1 70 ? -14.439 -1.220  1.267   1.00 0.00 ? 70 PRO A C    10 
ATOM 9971  O O    . PRO A 1 70 ? -13.815 -1.457  2.301   1.00 0.00 ? 70 PRO A O    10 
ATOM 9972  C CB   . PRO A 1 70 ? -16.251 -2.738  2.102   1.00 0.00 ? 70 PRO A CB   10 
ATOM 9973  C CG   . PRO A 1 70 ? -16.924 -3.956  1.567   1.00 0.00 ? 70 PRO A CG   10 
ATOM 9974  C CD   . PRO A 1 70 ? -16.138 -4.384  0.350   1.00 0.00 ? 70 PRO A CD   10 
ATOM 9975  H HA   . PRO A 1 70 ? -16.393 -1.437  0.406   1.00 0.00 ? 70 PRO A HA   10 
ATOM 9976  H HB2  . PRO A 1 70 ? -15.462 -2.994  2.795   1.00 0.00 ? 70 PRO A HB2  10 
ATOM 9977  H HB3  . PRO A 1 70 ? -16.955 -2.073  2.574   1.00 0.00 ? 70 PRO A HB3  10 
ATOM 9978  H HG2  . PRO A 1 70 ? -16.912 -4.738  2.312   1.00 0.00 ? 70 PRO A HG2  10 
ATOM 9979  H HG3  . PRO A 1 70 ? -17.941 -3.720  1.290   1.00 0.00 ? 70 PRO A HG3  10 
ATOM 9980  H HD2  . PRO A 1 70 ? -15.527 -5.241  0.581   1.00 0.00 ? 70 PRO A HD2  10 
ATOM 9981  H HD3  . PRO A 1 70 ? -16.808 -4.607  -0.467  1.00 0.00 ? 70 PRO A HD3  10 
ATOM 9982  N N    . PHE A 1 71 ? -14.116 -0.228  0.438   1.00 0.00 ? 71 PHE A N    10 
ATOM 9983  C CA   . PHE A 1 71 ? -12.984 0.657   0.704   1.00 0.00 ? 71 PHE A CA   10 
ATOM 9984  C C    . PHE A 1 71 ? -13.391 2.124   0.524   1.00 0.00 ? 71 PHE A C    10 
ATOM 9985  O O    . PHE A 1 71 ? -14.396 2.556   1.088   1.00 0.00 ? 71 PHE A O    10 
ATOM 9986  C CB   . PHE A 1 71 ? -11.808 0.305   -0.209  1.00 0.00 ? 71 PHE A CB   10 
ATOM 9987  C CG   . PHE A 1 71 ? -11.501 -1.160  -0.261  1.00 0.00 ? 71 PHE A CG   10 
ATOM 9988  C CD1  . PHE A 1 71 ? -11.530 -1.928  0.891   1.00 0.00 ? 71 PHE A CD1  10 
ATOM 9989  C CD2  . PHE A 1 71 ? -11.185 -1.772  -1.463  1.00 0.00 ? 71 PHE A CD2  10 
ATOM 9990  C CE1  . PHE A 1 71 ? -11.252 -3.279  0.845   1.00 0.00 ? 71 PHE A CE1  10 
ATOM 9991  C CE2  . PHE A 1 71 ? -10.906 -3.123  -1.516  1.00 0.00 ? 71 PHE A CE2  10 
ATOM 9992  C CZ   . PHE A 1 71 ? -10.940 -3.878  -0.361  1.00 0.00 ? 71 PHE A CZ   10 
ATOM 9993  H H    . PHE A 1 71 ? -14.656 -0.084  -0.367  1.00 0.00 ? 71 PHE A H    10 
ATOM 9994  H HA   . PHE A 1 71 ? -12.686 0.506   1.731   1.00 0.00 ? 71 PHE A HA   10 
ATOM 9995  H HB2  . PHE A 1 71 ? -12.030 0.633   -1.213  1.00 0.00 ? 71 PHE A HB2  10 
ATOM 9996  H HB3  . PHE A 1 71 ? -10.928 0.816   0.144   1.00 0.00 ? 71 PHE A HB3  10 
ATOM 9997  H HD1  . PHE A 1 71 ? -11.773 -1.461  1.833   1.00 0.00 ? 71 PHE A HD1  10 
ATOM 9998  H HD2  . PHE A 1 71 ? -11.159 -1.181  -2.367  1.00 0.00 ? 71 PHE A HD2  10 
ATOM 9999  H HE1  . PHE A 1 71 ? -11.278 -3.867  1.750   1.00 0.00 ? 71 PHE A HE1  10 
ATOM 10000 H HE2  . PHE A 1 71 ? -10.662 -3.588  -2.459  1.00 0.00 ? 71 PHE A HE2  10 
ATOM 10001 H HZ   . PHE A 1 71 ? -10.722 -4.933  -0.399  1.00 0.00 ? 71 PHE A HZ   10 
ATOM 10002 N N    . HIS A 1 72 ? -12.613 2.888   -0.254  1.00 0.00 ? 72 HIS A N    10 
ATOM 10003 C CA   . HIS A 1 72 ? -12.912 4.298   -0.490  1.00 0.00 ? 72 HIS A CA   10 
ATOM 10004 C C    . HIS A 1 72 ? -14.415 4.558   -0.471  1.00 0.00 ? 72 HIS A C    10 
ATOM 10005 O O    . HIS A 1 72 ? -15.168 3.964   -1.242  1.00 0.00 ? 72 HIS A O    10 
ATOM 10006 C CB   . HIS A 1 72 ? -12.328 4.741   -1.831  1.00 0.00 ? 72 HIS A CB   10 
ATOM 10007 C CG   . HIS A 1 72 ? -12.733 6.127   -2.226  1.00 0.00 ? 72 HIS A CG   10 
ATOM 10008 N ND1  . HIS A 1 72 ? -13.663 6.388   -3.210  1.00 0.00 ? 72 HIS A ND1  10 
ATOM 10009 C CD2  . HIS A 1 72 ? -12.336 7.334   -1.757  1.00 0.00 ? 72 HIS A CD2  10 
ATOM 10010 C CE1  . HIS A 1 72 ? -13.819 7.694   -3.331  1.00 0.00 ? 72 HIS A CE1  10 
ATOM 10011 N NE2  . HIS A 1 72 ? -13.026 8.290   -2.460  1.00 0.00 ? 72 HIS A NE2  10 
ATOM 10012 H H    . HIS A 1 72 ? -11.819 2.502   -0.680  1.00 0.00 ? 72 HIS A H    10 
ATOM 10013 H HA   . HIS A 1 72 ? -12.449 4.871   0.300   1.00 0.00 ? 72 HIS A HA   10 
ATOM 10014 H HB2  . HIS A 1 72 ? -11.251 4.710   -1.776  1.00 0.00 ? 72 HIS A HB2  10 
ATOM 10015 H HB3  . HIS A 1 72 ? -12.663 4.063   -2.603  1.00 0.00 ? 72 HIS A HB3  10 
ATOM 10016 H HD1  . HIS A 1 72 ? -14.137 5.715   -3.743  1.00 0.00 ? 72 HIS A HD1  10 
ATOM 10017 H HD2  . HIS A 1 72 ? -11.611 7.511   -0.975  1.00 0.00 ? 72 HIS A HD2  10 
ATOM 10018 H HE1  . HIS A 1 72 ? -14.484 8.190   -4.022  1.00 0.00 ? 72 HIS A HE1  10 
ATOM 10019 H HE2  . HIS A 1 72 ? -13.008 9.253   -2.279  1.00 0.00 ? 72 HIS A HE2  10 
ATOM 10020 N N    . ALA A 1 73 ? -14.844 5.451   0.416   1.00 0.00 ? 73 ALA A N    10 
ATOM 10021 C CA   . ALA A 1 73 ? -16.256 5.791   0.537   1.00 0.00 ? 73 ALA A CA   10 
ATOM 10022 C C    . ALA A 1 73 ? -17.076 4.585   0.980   1.00 0.00 ? 73 ALA A C    10 
ATOM 10023 O O    . ALA A 1 73 ? -17.410 3.748   0.116   1.00 0.00 ? 73 ALA A O    10 
ATOM 10024 C CB   . ALA A 1 73 ? -16.783 6.333   -0.783  1.00 0.00 ? 73 ALA A CB   10 
ATOM 10025 O OXT  . ALA A 1 73 ? -17.376 4.486   2.189   1.00 0.00 ? 73 ALA A OXT  10 
ATOM 10026 H H    . ALA A 1 73 ? -14.194 5.891   1.003   1.00 0.00 ? 73 ALA A H    10 
ATOM 10027 H HA   . ALA A 1 73 ? -16.349 6.569   1.281   1.00 0.00 ? 73 ALA A HA   10 
ATOM 10028 H HB1  . ALA A 1 73 ? -17.831 6.574   -0.680  1.00 0.00 ? 73 ALA A HB1  10 
ATOM 10029 H HB2  . ALA A 1 73 ? -16.659 5.587   -1.554  1.00 0.00 ? 73 ALA A HB2  10 
ATOM 10030 H HB3  . ALA A 1 73 ? -16.234 7.224   -1.051  1.00 0.00 ? 73 ALA A HB3  10 
ATOM 10031 N N    . GLU A 1 1  ? -0.627  2.350   12.207  1.00 0.00 ? 1  GLU A N    11 
ATOM 10032 C CA   . GLU A 1 1  ? -0.655  3.440   11.196  1.00 0.00 ? 1  GLU A CA   11 
ATOM 10033 C C    . GLU A 1 1  ? -1.343  2.986   9.913   1.00 0.00 ? 1  GLU A C    11 
ATOM 10034 O O    . GLU A 1 1  ? -1.665  1.808   9.753   1.00 0.00 ? 1  GLU A O    11 
ATOM 10035 C CB   . GLU A 1 1  ? 0.784   3.868   10.900  1.00 0.00 ? 1  GLU A CB   11 
ATOM 10036 C CG   . GLU A 1 1  ? 1.552   4.310   12.135  1.00 0.00 ? 1  GLU A CG   11 
ATOM 10037 C CD   . GLU A 1 1  ? 2.515   5.446   11.849  1.00 0.00 ? 1  GLU A CD   11 
ATOM 10038 O OE1  . GLU A 1 1  ? 3.321   5.317   10.903  1.00 0.00 ? 1  GLU A OE1  11 
ATOM 10039 O OE2  . GLU A 1 1  ? 2.464   6.463   12.572  1.00 0.00 ? 1  GLU A OE2  11 
ATOM 10040 H H1   . GLU A 1 1  ? 0.363   2.062   12.337  1.00 0.00 ? 1  GLU A H1   11 
ATOM 10041 H H2   . GLU A 1 1  ? -1.203  1.564   11.841  1.00 0.00 ? 1  GLU A H2   11 
ATOM 10042 H H3   . GLU A 1 1  ? -1.025  2.728   13.090  1.00 0.00 ? 1  GLU A H3   11 
ATOM 10043 H HA   . GLU A 1 1  ? -1.197  4.278   11.608  1.00 0.00 ? 1  GLU A HA   11 
ATOM 10044 H HB2  . GLU A 1 1  ? 1.310   3.037   10.454  1.00 0.00 ? 1  GLU A HB2  11 
ATOM 10045 H HB3  . GLU A 1 1  ? 0.767   4.690   10.200  1.00 0.00 ? 1  GLU A HB3  11 
ATOM 10046 H HG2  . GLU A 1 1  ? 0.846   4.638   12.883  1.00 0.00 ? 1  GLU A HG2  11 
ATOM 10047 H HG3  . GLU A 1 1  ? 2.112   3.468   12.515  1.00 0.00 ? 1  GLU A HG3  11 
ATOM 10048 N N    . ALA A 1 2  ? -1.567  3.927   9.001   1.00 0.00 ? 2  ALA A N    11 
ATOM 10049 C CA   . ALA A 1 2  ? -2.218  3.623   7.733   1.00 0.00 ? 2  ALA A CA   11 
ATOM 10050 C C    . ALA A 1 2  ? -1.567  4.387   6.585   1.00 0.00 ? 2  ALA A C    11 
ATOM 10051 O O    . ALA A 1 2  ? -0.631  5.159   6.793   1.00 0.00 ? 2  ALA A O    11 
ATOM 10052 C CB   . ALA A 1 2  ? -3.702  3.947   7.813   1.00 0.00 ? 2  ALA A CB   11 
ATOM 10053 H H    . ALA A 1 2  ? -1.288  4.848   9.187   1.00 0.00 ? 2  ALA A H    11 
ATOM 10054 H HA   . ALA A 1 2  ? -2.115  2.563   7.552   1.00 0.00 ? 2  ALA A HA   11 
ATOM 10055 H HB1  . ALA A 1 2  ? -4.257  3.250   7.203   1.00 0.00 ? 2  ALA A HB1  11 
ATOM 10056 H HB2  . ALA A 1 2  ? -3.871  4.952   7.456   1.00 0.00 ? 2  ALA A HB2  11 
ATOM 10057 H HB3  . ALA A 1 2  ? -4.033  3.870   8.839   1.00 0.00 ? 2  ALA A HB3  11 
ATOM 10058 N N    . GLY A 1 3  ? -2.068  4.167   5.374   1.00 0.00 ? 3  GLY A N    11 
ATOM 10059 C CA   . GLY A 1 3  ? -1.522  4.844   4.212   1.00 0.00 ? 3  GLY A CA   11 
ATOM 10060 C C    . GLY A 1 3  ? -1.811  6.335   4.224   1.00 0.00 ? 3  GLY A C    11 
ATOM 10061 O O    . GLY A 1 3  ? -1.335  7.051   5.106   1.00 0.00 ? 3  GLY A O    11 
ATOM 10062 H H    . GLY A 1 3  ? -2.814  3.541   5.268   1.00 0.00 ? 3  GLY A H    11 
ATOM 10063 H HA2  . GLY A 1 3  ? -0.450  4.693   4.196   1.00 0.00 ? 3  GLY A HA2  11 
ATOM 10064 H HA3  . GLY A 1 3  ? -1.948  4.409   3.321   1.00 0.00 ? 3  GLY A HA3  11 
ATOM 10065 N N    . GLU A 1 4  ? -2.592  6.812   3.252   1.00 0.00 ? 4  GLU A N    11 
ATOM 10066 C CA   . GLU A 1 4  ? -2.930  8.231   3.179   1.00 0.00 ? 4  GLU A CA   11 
ATOM 10067 C C    . GLU A 1 4  ? -1.684  9.077   2.936   1.00 0.00 ? 4  GLU A C    11 
ATOM 10068 O O    . GLU A 1 4  ? -1.545  9.706   1.887   1.00 0.00 ? 4  GLU A O    11 
ATOM 10069 C CB   . GLU A 1 4  ? -3.622  8.680   4.468   1.00 0.00 ? 4  GLU A CB   11 
ATOM 10070 C CG   . GLU A 1 4  ? -4.827  7.831   4.838   1.00 0.00 ? 4  GLU A CG   11 
ATOM 10071 C CD   . GLU A 1 4  ? -6.117  8.627   4.857   1.00 0.00 ? 4  GLU A CD   11 
ATOM 10072 O OE1  . GLU A 1 4  ? -6.047  9.870   4.957   1.00 0.00 ? 4  GLU A OE1  11 
ATOM 10073 O OE2  . GLU A 1 4  ? -7.198  8.007   4.771   1.00 0.00 ? 4  GLU A OE2  11 
ATOM 10074 H H    . GLU A 1 4  ? -2.951  6.200   2.572   1.00 0.00 ? 4  GLU A H    11 
ATOM 10075 H HA   . GLU A 1 4  ? -3.610  8.366   2.351   1.00 0.00 ? 4  GLU A HA   11 
ATOM 10076 H HB2  . GLU A 1 4  ? -2.911  8.631   5.279   1.00 0.00 ? 4  GLU A HB2  11 
ATOM 10077 H HB3  . GLU A 1 4  ? -3.950  9.701   4.349   1.00 0.00 ? 4  GLU A HB3  11 
ATOM 10078 H HG2  . GLU A 1 4  ? -4.925  7.034   4.116   1.00 0.00 ? 4  GLU A HG2  11 
ATOM 10079 H HG3  . GLU A 1 4  ? -4.666  7.409   5.819   1.00 0.00 ? 4  GLU A HG3  11 
ATOM 10080 N N    . GLU A 1 5  ? -0.780  9.086   3.911   1.00 0.00 ? 5  GLU A N    11 
ATOM 10081 C CA   . GLU A 1 5  ? 0.455   9.853   3.800   1.00 0.00 ? 5  GLU A CA   11 
ATOM 10082 C C    . GLU A 1 5  ? 1.378   9.234   2.757   1.00 0.00 ? 5  GLU A C    11 
ATOM 10083 O O    . GLU A 1 5  ? 0.922   8.530   1.856   1.00 0.00 ? 5  GLU A O    11 
ATOM 10084 C CB   . GLU A 1 5  ? 1.165   9.921   5.154   1.00 0.00 ? 5  GLU A CB   11 
ATOM 10085 C CG   . GLU A 1 5  ? 0.249   10.308  6.304   1.00 0.00 ? 5  GLU A CG   11 
ATOM 10086 C CD   . GLU A 1 5  ? -0.004  11.801  6.369   1.00 0.00 ? 5  GLU A CD   11 
ATOM 10087 O OE1  . GLU A 1 5  ? 0.061   12.461  5.311   1.00 0.00 ? 5  GLU A OE1  11 
ATOM 10088 O OE2  . GLU A 1 5  ? -0.269  12.310  7.479   1.00 0.00 ? 5  GLU A OE2  11 
ATOM 10089 H H    . GLU A 1 5  ? -0.946  8.563   4.723   1.00 0.00 ? 5  GLU A H    11 
ATOM 10090 H HA   . GLU A 1 5  ? 0.197   10.854  3.487   1.00 0.00 ? 5  GLU A HA   11 
ATOM 10091 H HB2  . GLU A 1 5  ? 1.593   8.954   5.372   1.00 0.00 ? 5  GLU A HB2  11 
ATOM 10092 H HB3  . GLU A 1 5  ? 1.960   10.650  5.095   1.00 0.00 ? 5  GLU A HB3  11 
ATOM 10093 H HG2  . GLU A 1 5  ? -0.697  9.803   6.179   1.00 0.00 ? 5  GLU A HG2  11 
ATOM 10094 H HG3  . GLU A 1 5  ? 0.705   9.993   7.231   1.00 0.00 ? 5  GLU A HG3  11 
ATOM 10095 N N    . CYS A 1 6  ? 2.675   9.499   2.880   1.00 0.00 ? 6  CYS A N    11 
ATOM 10096 C CA   . CYS A 1 6  ? 3.647   8.962   1.936   1.00 0.00 ? 6  CYS A CA   11 
ATOM 10097 C C    . CYS A 1 6  ? 3.285   9.381   0.516   1.00 0.00 ? 6  CYS A C    11 
ATOM 10098 O O    . CYS A 1 6  ? 2.126   9.677   0.229   1.00 0.00 ? 6  CYS A O    11 
ATOM 10099 C CB   . CYS A 1 6  ? 3.697   7.436   2.047   1.00 0.00 ? 6  CYS A CB   11 
ATOM 10100 S SG   . CYS A 1 6  ? 4.425   6.595   0.603   1.00 0.00 ? 6  CYS A SG   11 
ATOM 10101 H H    . CYS A 1 6  ? 2.982   10.067  3.616   1.00 0.00 ? 6  CYS A H    11 
ATOM 10102 H HA   . CYS A 1 6  ? 4.616   9.368   2.187   1.00 0.00 ? 6  CYS A HA   11 
ATOM 10103 H HB2  . CYS A 1 6  ? 4.285   7.166   2.911   1.00 0.00 ? 6  CYS A HB2  11 
ATOM 10104 H HB3  . CYS A 1 6  ? 2.692   7.062   2.174   1.00 0.00 ? 6  CYS A HB3  11 
ATOM 10105 N N    . ASP A 1 7  ? 4.275   9.418   -0.369  1.00 0.00 ? 7  ASP A N    11 
ATOM 10106 C CA   . ASP A 1 7  ? 4.032   9.816   -1.752  1.00 0.00 ? 7  ASP A CA   11 
ATOM 10107 C C    . ASP A 1 7  ? 5.157   9.359   -2.673  1.00 0.00 ? 7  ASP A C    11 
ATOM 10108 O O    . ASP A 1 7  ? 5.673   10.145  -3.468  1.00 0.00 ? 7  ASP A O    11 
ATOM 10109 C CB   . ASP A 1 7  ? 3.875   11.335  -1.845  1.00 0.00 ? 7  ASP A CB   11 
ATOM 10110 C CG   . ASP A 1 7  ? 2.752   11.857  -0.972  1.00 0.00 ? 7  ASP A CG   11 
ATOM 10111 O OD1  . ASP A 1 7  ? 2.963   11.986  0.252   1.00 0.00 ? 7  ASP A OD1  11 
ATOM 10112 O OD2  . ASP A 1 7  ? 1.661   12.137  -1.512  1.00 0.00 ? 7  ASP A OD2  11 
ATOM 10113 H H    . ASP A 1 7  ? 5.183   9.181   -0.088  1.00 0.00 ? 7  ASP A H    11 
ATOM 10114 H HA   . ASP A 1 7  ? 3.112   9.350   -2.072  1.00 0.00 ? 7  ASP A HA   11 
ATOM 10115 H HB2  . ASP A 1 7  ? 4.796   11.805  -1.534  1.00 0.00 ? 7  ASP A HB2  11 
ATOM 10116 H HB3  . ASP A 1 7  ? 3.666   11.606  -2.870  1.00 0.00 ? 7  ASP A HB3  11 
ATOM 10117 N N    . CYS A 1 8  ? 5.530   8.088   -2.575  1.00 0.00 ? 8  CYS A N    11 
ATOM 10118 C CA   . CYS A 1 8  ? 6.587   7.551   -3.420  1.00 0.00 ? 8  CYS A CA   11 
ATOM 10119 C C    . CYS A 1 8  ? 6.042   6.502   -4.394  1.00 0.00 ? 8  CYS A C    11 
ATOM 10120 O O    . CYS A 1 8  ? 6.802   5.926   -5.170  1.00 0.00 ? 8  CYS A O    11 
ATOM 10121 C CB   . CYS A 1 8  ? 7.695   6.908   -2.590  1.00 0.00 ? 8  CYS A CB   11 
ATOM 10122 S SG   . CYS A 1 8  ? 8.878   8.047   -1.798  1.00 0.00 ? 8  CYS A SG   11 
ATOM 10123 H H    . CYS A 1 8  ? 5.081   7.502   -1.932  1.00 0.00 ? 8  CYS A H    11 
ATOM 10124 H HA   . CYS A 1 8  ? 7.005   8.369   -3.987  1.00 0.00 ? 8  CYS A HA   11 
ATOM 10125 H HB2  . CYS A 1 8  ? 7.249   6.314   -1.809  1.00 0.00 ? 8  CYS A HB2  11 
ATOM 10126 H HB3  . CYS A 1 8  ? 8.258   6.269   -3.243  1.00 0.00 ? 8  CYS A HB3  11 
ATOM 10127 N N    . GLY A 1 9  ? 4.733   6.246   -4.349  1.00 0.00 ? 9  GLY A N    11 
ATOM 10128 C CA   . GLY A 1 9  ? 4.150   5.259   -5.249  1.00 0.00 ? 9  GLY A CA   11 
ATOM 10129 C C    . GLY A 1 9  ? 2.897   4.591   -4.700  1.00 0.00 ? 9  GLY A C    11 
ATOM 10130 O O    . GLY A 1 9  ? 2.131   5.208   -3.959  1.00 0.00 ? 9  GLY A O    11 
ATOM 10131 H H    . GLY A 1 9  ? 4.166   6.722   -3.707  1.00 0.00 ? 9  GLY A H    11 
ATOM 10132 H HA2  . GLY A 1 9  ? 3.895   5.751   -6.176  1.00 0.00 ? 9  GLY A HA2  11 
ATOM 10133 H HA3  . GLY A 1 9  ? 4.887   4.502   -5.455  1.00 0.00 ? 9  GLY A HA3  11 
ATOM 10134 N N    . SER A 1 10 ? 2.681   3.327   -5.082  1.00 0.00 ? 10 SER A N    11 
ATOM 10135 C CA   . SER A 1 10 ? 1.510   2.576   -4.645  1.00 0.00 ? 10 SER A CA   11 
ATOM 10136 C C    . SER A 1 10 ? 1.685   1.099   -5.018  1.00 0.00 ? 10 SER A C    11 
ATOM 10137 O O    . SER A 1 10 ? 2.815   0.653   -5.212  1.00 0.00 ? 10 SER A O    11 
ATOM 10138 C CB   . SER A 1 10 ? 0.257   3.183   -5.287  1.00 0.00 ? 10 SER A CB   11 
ATOM 10139 O OG   . SER A 1 10 ? 0.348   4.596   -5.334  1.00 0.00 ? 10 SER A OG   11 
ATOM 10140 H H    . SER A 1 10 ? 3.321   2.890   -5.681  1.00 0.00 ? 10 SER A H    11 
ATOM 10141 H HA   . SER A 1 10 ? 1.441   2.653   -3.574  1.00 0.00 ? 10 SER A HA   11 
ATOM 10142 H HB2  . SER A 1 10 ? 0.146   2.806   -6.292  1.00 0.00 ? 10 SER A HB2  11 
ATOM 10143 H HB3  . SER A 1 10 ? -0.610  2.918   -4.703  1.00 0.00 ? 10 SER A HB3  11 
ATOM 10144 H HG   . SER A 1 10 ? 0.680   4.868   -6.193  1.00 0.00 ? 10 SER A HG   11 
ATOM 10145 N N    . PRO A 1 11 ? 0.601   0.297   -5.121  1.00 0.00 ? 11 PRO A N    11 
ATOM 10146 C CA   . PRO A 1 11 ? 0.736   -1.116  -5.466  1.00 0.00 ? 11 PRO A CA   11 
ATOM 10147 C C    . PRO A 1 11 ? 1.598   -1.310  -6.701  1.00 0.00 ? 11 PRO A C    11 
ATOM 10148 O O    . PRO A 1 11 ? 1.151   -1.113  -7.831  1.00 0.00 ? 11 PRO A O    11 
ATOM 10149 C CB   . PRO A 1 11 ? -0.698  -1.575  -5.717  1.00 0.00 ? 11 PRO A CB   11 
ATOM 10150 C CG   . PRO A 1 11 ? -1.535  -0.641  -4.916  1.00 0.00 ? 11 PRO A CG   11 
ATOM 10151 C CD   . PRO A 1 11 ? -0.807  0.677   -4.913  1.00 0.00 ? 11 PRO A CD   11 
ATOM 10152 H HA   . PRO A 1 11 ? 1.164   -1.671  -4.648  1.00 0.00 ? 11 PRO A HA   11 
ATOM 10153 H HB2  . PRO A 1 11 ? -0.924  -1.506  -6.770  1.00 0.00 ? 11 PRO A HB2  11 
ATOM 10154 H HB3  . PRO A 1 11 ? -0.817  -2.595  -5.382  1.00 0.00 ? 11 PRO A HB3  11 
ATOM 10155 H HG2  . PRO A 1 11 ? -2.504  -0.532  -5.379  1.00 0.00 ? 11 PRO A HG2  11 
ATOM 10156 H HG3  . PRO A 1 11 ? -1.639  -1.013  -3.908  1.00 0.00 ? 11 PRO A HG3  11 
ATOM 10157 H HD2  . PRO A 1 11 ? -1.159  1.302   -5.720  1.00 0.00 ? 11 PRO A HD2  11 
ATOM 10158 H HD3  . PRO A 1 11 ? -0.935  1.178   -3.966  1.00 0.00 ? 11 PRO A HD3  11 
ATOM 10159 N N    . GLY A 1 12 ? 2.850   -1.665  -6.464  1.00 0.00 ? 12 GLY A N    11 
ATOM 10160 C CA   . GLY A 1 12 ? 3.796   -1.850  -7.547  1.00 0.00 ? 12 GLY A CA   11 
ATOM 10161 C C    . GLY A 1 12 ? 4.944   -0.885  -7.393  1.00 0.00 ? 12 GLY A C    11 
ATOM 10162 O O    . GLY A 1 12 ? 6.077   -1.162  -7.788  1.00 0.00 ? 12 GLY A O    11 
ATOM 10163 H H    . GLY A 1 12 ? 3.146   -1.776  -5.531  1.00 0.00 ? 12 GLY A H    11 
ATOM 10164 H HA2  . GLY A 1 12 ? 4.172   -2.863  -7.525  1.00 0.00 ? 12 GLY A HA2  11 
ATOM 10165 H HA3  . GLY A 1 12 ? 3.304   -1.669  -8.490  1.00 0.00 ? 12 GLY A HA3  11 
ATOM 10166 N N    . ASN A 1 13 ? 4.632   0.245   -6.773  1.00 0.00 ? 13 ASN A N    11 
ATOM 10167 C CA   . ASN A 1 13 ? 5.606   1.282   -6.494  1.00 0.00 ? 13 ASN A CA   11 
ATOM 10168 C C    . ASN A 1 13 ? 5.579   1.586   -5.001  1.00 0.00 ? 13 ASN A C    11 
ATOM 10169 O O    . ASN A 1 13 ? 5.405   2.728   -4.584  1.00 0.00 ? 13 ASN A O    11 
ATOM 10170 C CB   . ASN A 1 13 ? 5.301   2.546   -7.303  1.00 0.00 ? 13 ASN A CB   11 
ATOM 10171 C CG   . ASN A 1 13 ? 5.764   2.437   -8.743  1.00 0.00 ? 13 ASN A CG   11 
ATOM 10172 O OD1  . ASN A 1 13 ? 6.817   2.958   -9.110  1.00 0.00 ? 13 ASN A OD1  11 
ATOM 10173 N ND2  . ASN A 1 13 ? 4.976   1.757   -9.569  1.00 0.00 ? 13 ASN A ND2  11 
ATOM 10174 H H    . ASN A 1 13 ? 3.710   0.373   -6.468  1.00 0.00 ? 13 ASN A H    11 
ATOM 10175 H HA   . ASN A 1 13 ? 6.584   0.909   -6.762  1.00 0.00 ? 13 ASN A HA   11 
ATOM 10176 H HB2  . ASN A 1 13 ? 4.236   2.720   -7.300  1.00 0.00 ? 13 ASN A HB2  11 
ATOM 10177 H HB3  . ASN A 1 13 ? 5.801   3.388   -6.846  1.00 0.00 ? 13 ASN A HB3  11 
ATOM 10178 H HD21 . ASN A 1 13 ? 4.152   1.370   -9.207  1.00 0.00 ? 13 ASN A HD21 11 
ATOM 10179 H HD22 . ASN A 1 13 ? 5.251   1.672   -10.505 1.00 0.00 ? 13 ASN A HD22 11 
ATOM 10180 N N    . PRO A 1 14 ? 5.761   0.545   -4.178  1.00 0.00 ? 14 PRO A N    11 
ATOM 10181 C CA   . PRO A 1 14 ? 5.770   0.645   -2.723  1.00 0.00 ? 14 PRO A CA   11 
ATOM 10182 C C    . PRO A 1 14 ? 6.463   1.896   -2.238  1.00 0.00 ? 14 PRO A C    11 
ATOM 10183 O O    . PRO A 1 14 ? 7.618   2.122   -2.583  1.00 0.00 ? 14 PRO A O    11 
ATOM 10184 C CB   . PRO A 1 14 ? 6.575   -0.601  -2.296  1.00 0.00 ? 14 PRO A CB   11 
ATOM 10185 C CG   . PRO A 1 14 ? 7.027   -1.229  -3.571  1.00 0.00 ? 14 PRO A CG   11 
ATOM 10186 C CD   . PRO A 1 14 ? 5.998   -0.830  -4.580  1.00 0.00 ? 14 PRO A CD   11 
ATOM 10187 H HA   . PRO A 1 14 ? 4.774   0.595   -2.310  1.00 0.00 ? 14 PRO A HA   11 
ATOM 10188 H HB2  . PRO A 1 14 ? 7.414   -0.301  -1.688  1.00 0.00 ? 14 PRO A HB2  11 
ATOM 10189 H HB3  . PRO A 1 14 ? 5.943   -1.268  -1.740  1.00 0.00 ? 14 PRO A HB3  11 
ATOM 10190 H HG2  . PRO A 1 14 ? 7.997   -0.842  -3.846  1.00 0.00 ? 14 PRO A HG2  11 
ATOM 10191 H HG3  . PRO A 1 14 ? 7.064   -2.298  -3.462  1.00 0.00 ? 14 PRO A HG3  11 
ATOM 10192 H HD2  . PRO A 1 14 ? 6.395   -0.891  -5.579  1.00 0.00 ? 14 PRO A HD2  11 
ATOM 10193 H HD3  . PRO A 1 14 ? 5.103   -1.428  -4.475  1.00 0.00 ? 14 PRO A HD3  11 
ATOM 10194 N N    . CYS A 1 15 ? 5.752   2.684   -1.422  1.00 0.00 ? 15 CYS A N    11 
ATOM 10195 C CA   . CYS A 1 15 ? 6.287   3.917   -0.842  1.00 0.00 ? 15 CYS A CA   11 
ATOM 10196 C C    . CYS A 1 15 ? 7.787   4.025   -1.041  1.00 0.00 ? 15 CYS A C    11 
ATOM 10197 O O    . CYS A 1 15 ? 8.558   3.779   -0.117  1.00 0.00 ? 15 CYS A O    11 
ATOM 10198 C CB   . CYS A 1 15 ? 5.987   3.973   0.656   1.00 0.00 ? 15 CYS A CB   11 
ATOM 10199 S SG   . CYS A 1 15 ? 6.050   5.651   1.371   1.00 0.00 ? 15 CYS A SG   11 
ATOM 10200 H H    . CYS A 1 15 ? 4.839   2.415   -1.188  1.00 0.00 ? 15 CYS A H    11 
ATOM 10201 H HA   . CYS A 1 15 ? 5.807   4.752   -1.327  1.00 0.00 ? 15 CYS A HA   11 
ATOM 10202 H HB2  . CYS A 1 15 ? 5.007   3.569   0.835   1.00 0.00 ? 15 CYS A HB2  11 
ATOM 10203 H HB3  . CYS A 1 15 ? 6.715   3.371   1.182   1.00 0.00 ? 15 CYS A HB3  11 
ATOM 10204 N N    . CYS A 1 16 ? 8.186   4.391   -2.249  1.00 0.00 ? 16 CYS A N    11 
ATOM 10205 C CA   . CYS A 1 16 ? 9.591   4.546   -2.582  1.00 0.00 ? 16 CYS A CA   11 
ATOM 10206 C C    . CYS A 1 16 ? 10.256  3.204   -2.847  1.00 0.00 ? 16 CYS A C    11 
ATOM 10207 O O    . CYS A 1 16 ? 9.899   2.190   -2.252  1.00 0.00 ? 16 CYS A O    11 
ATOM 10208 C CB   . CYS A 1 16 ? 10.312  5.323   -1.476  1.00 0.00 ? 16 CYS A CB   11 
ATOM 10209 S SG   . CYS A 1 16 ? 10.670  7.068   -1.907  1.00 0.00 ? 16 CYS A SG   11 
ATOM 10210 H H    . CYS A 1 16 ? 7.511   4.572   -2.942  1.00 0.00 ? 16 CYS A H    11 
ATOM 10211 H HA   . CYS A 1 16 ? 9.637   5.118   -3.487  1.00 0.00 ? 16 CYS A HA   11 
ATOM 10212 H HB2  . CYS A 1 16 ? 9.702   5.324   -0.586  1.00 0.00 ? 16 CYS A HB2  11 
ATOM 10213 H HB3  . CYS A 1 16 ? 11.251  4.832   -1.258  1.00 0.00 ? 16 CYS A HB3  11 
ATOM 10214 N N    . ASP A 1 17 ? 11.214  3.206   -3.769  1.00 0.00 ? 17 ASP A N    11 
ATOM 10215 C CA   . ASP A 1 17 ? 11.921  1.990   -4.143  1.00 0.00 ? 17 ASP A CA   11 
ATOM 10216 C C    . ASP A 1 17 ? 13.195  2.311   -4.922  1.00 0.00 ? 17 ASP A C    11 
ATOM 10217 O O    . ASP A 1 17 ? 14.237  1.689   -4.710  1.00 0.00 ? 17 ASP A O    11 
ATOM 10218 C CB   . ASP A 1 17 ? 11.004  1.094   -4.976  1.00 0.00 ? 17 ASP A CB   11 
ATOM 10219 C CG   . ASP A 1 17 ? 10.153  1.885   -5.950  1.00 0.00 ? 17 ASP A CG   11 
ATOM 10220 O OD1  . ASP A 1 17 ? 10.445  3.081   -6.161  1.00 0.00 ? 17 ASP A OD1  11 
ATOM 10221 O OD2  . ASP A 1 17 ? 9.194   1.307   -6.504  1.00 0.00 ? 17 ASP A OD2  11 
ATOM 10222 H H    . ASP A 1 17 ? 11.438  4.047   -4.221  1.00 0.00 ? 17 ASP A H    11 
ATOM 10223 H HA   . ASP A 1 17 ? 12.190  1.470   -3.236  1.00 0.00 ? 17 ASP A HA   11 
ATOM 10224 H HB2  . ASP A 1 17 ? 11.606  0.401   -5.540  1.00 0.00 ? 17 ASP A HB2  11 
ATOM 10225 H HB3  . ASP A 1 17 ? 10.349  0.545   -4.314  1.00 0.00 ? 17 ASP A HB3  11 
ATOM 10226 N N    . ALA A 1 18 ? 13.102  3.278   -5.835  1.00 0.00 ? 18 ALA A N    11 
ATOM 10227 C CA   . ALA A 1 18 ? 14.244  3.688   -6.650  1.00 0.00 ? 18 ALA A CA   11 
ATOM 10228 C C    . ALA A 1 18 ? 14.483  2.736   -7.819  1.00 0.00 ? 18 ALA A C    11 
ATOM 10229 O O    . ALA A 1 18 ? 14.928  3.151   -8.889  1.00 0.00 ? 18 ALA A O    11 
ATOM 10230 C CB   . ALA A 1 18 ? 15.495  3.789   -5.790  1.00 0.00 ? 18 ALA A CB   11 
ATOM 10231 H H    . ALA A 1 18 ? 12.244  3.726   -5.965  1.00 0.00 ? 18 ALA A H    11 
ATOM 10232 H HA   . ALA A 1 18 ? 14.031  4.671   -7.044  1.00 0.00 ? 18 ALA A HA   11 
ATOM 10233 H HB1  . ALA A 1 18 ? 16.165  4.521   -6.216  1.00 0.00 ? 18 ALA A HB1  11 
ATOM 10234 H HB2  . ALA A 1 18 ? 15.986  2.828   -5.755  1.00 0.00 ? 18 ALA A HB2  11 
ATOM 10235 H HB3  . ALA A 1 18 ? 15.221  4.091   -4.790  1.00 0.00 ? 18 ALA A HB3  11 
ATOM 10236 N N    . ALA A 1 19 ? 14.198  1.459   -7.605  1.00 0.00 ? 19 ALA A N    11 
ATOM 10237 C CA   . ALA A 1 19 ? 14.392  0.449   -8.632  1.00 0.00 ? 19 ALA A CA   11 
ATOM 10238 C C    . ALA A 1 19 ? 13.774  -0.886  -8.221  1.00 0.00 ? 19 ALA A C    11 
ATOM 10239 O O    . ALA A 1 19 ? 13.338  -1.663  -9.070  1.00 0.00 ? 19 ALA A O    11 
ATOM 10240 C CB   . ALA A 1 19 ? 15.874  0.283   -8.917  1.00 0.00 ? 19 ALA A CB   11 
ATOM 10241 H H    . ALA A 1 19 ? 13.854  1.191   -6.738  1.00 0.00 ? 19 ALA A H    11 
ATOM 10242 H HA   . ALA A 1 19 ? 13.912  0.795   -9.536  1.00 0.00 ? 19 ALA A HA   11 
ATOM 10243 H HB1  . ALA A 1 19 ? 16.324  -0.317  -8.141  1.00 0.00 ? 19 ALA A HB1  11 
ATOM 10244 H HB2  . ALA A 1 19 ? 16.345  1.255   -8.939  1.00 0.00 ? 19 ALA A HB2  11 
ATOM 10245 H HB3  . ALA A 1 19 ? 16.004  -0.202  -9.872  1.00 0.00 ? 19 ALA A HB3  11 
ATOM 10246 N N    . THR A 1 20 ? 13.731  -1.146  -6.914  1.00 0.00 ? 20 THR A N    11 
ATOM 10247 C CA   . THR A 1 20 ? 13.159  -2.380  -6.400  1.00 0.00 ? 20 THR A CA   11 
ATOM 10248 C C    . THR A 1 20 ? 12.150  -2.060  -5.309  1.00 0.00 ? 20 THR A C    11 
ATOM 10249 O O    . THR A 1 20 ? 12.384  -1.178  -4.483  1.00 0.00 ? 20 THR A O    11 
ATOM 10250 C CB   . THR A 1 20 ? 14.258  -3.294  -5.853  1.00 0.00 ? 20 THR A CB   11 
ATOM 10251 O OG1  . THR A 1 20 ? 13.867  -3.862  -4.615  1.00 0.00 ? 20 THR A OG1  11 
ATOM 10252 C CG2  . THR A 1 20 ? 15.578  -2.584  -5.636  1.00 0.00 ? 20 THR A CG2  11 
ATOM 10253 H H    . THR A 1 20 ? 14.084  -0.492  -6.277  1.00 0.00 ? 20 THR A H    11 
ATOM 10254 H HA   . THR A 1 20 ? 12.653  -2.879  -7.212  1.00 0.00 ? 20 THR A HA   11 
ATOM 10255 H HB   . THR A 1 20 ? 14.426  -4.097  -6.556  1.00 0.00 ? 20 THR A HB   11 
ATOM 10256 H HG1  . THR A 1 20 ? 14.196  -3.318  -3.895  1.00 0.00 ? 20 THR A HG1  11 
ATOM 10257 H HG21 . THR A 1 20 ? 15.523  -1.988  -4.737  1.00 0.00 ? 20 THR A HG21 11 
ATOM 10258 H HG22 . THR A 1 20 ? 15.786  -1.944  -6.480  1.00 0.00 ? 20 THR A HG22 11 
ATOM 10259 H HG23 . THR A 1 20 ? 16.367  -3.315  -5.535  1.00 0.00 ? 20 THR A HG23 11 
ATOM 10260 N N    . CYS A 1 21 ? 11.024  -2.764  -5.319  1.00 0.00 ? 21 CYS A N    11 
ATOM 10261 C CA   . CYS A 1 21 ? 9.973   -2.537  -4.340  1.00 0.00 ? 21 CYS A CA   11 
ATOM 10262 C C    . CYS A 1 21 ? 10.540  -2.122  -2.976  1.00 0.00 ? 21 CYS A C    11 
ATOM 10263 O O    . CYS A 1 21 ? 9.895   -1.386  -2.229  1.00 0.00 ? 21 CYS A O    11 
ATOM 10264 C CB   . CYS A 1 21 ? 9.101   -3.791  -4.206  1.00 0.00 ? 21 CYS A CB   11 
ATOM 10265 S SG   . CYS A 1 21 ? 8.202   -4.241  -5.728  1.00 0.00 ? 21 CYS A SG   11 
ATOM 10266 H H    . CYS A 1 21 ? 10.889  -3.446  -6.012  1.00 0.00 ? 21 CYS A H    11 
ATOM 10267 H HA   . CYS A 1 21 ? 9.366   -1.730  -4.714  1.00 0.00 ? 21 CYS A HA   11 
ATOM 10268 H HB2  . CYS A 1 21 ? 9.728   -4.629  -3.946  1.00 0.00 ? 21 CYS A HB2  11 
ATOM 10269 H HB3  . CYS A 1 21 ? 8.372   -3.634  -3.426  1.00 0.00 ? 21 CYS A HB3  11 
ATOM 10270 N N    . LYS A 1 22 ? 11.744  -2.593  -2.658  1.00 0.00 ? 22 LYS A N    11 
ATOM 10271 C CA   . LYS A 1 22 ? 12.390  -2.264  -1.387  1.00 0.00 ? 22 LYS A CA   11 
ATOM 10272 C C    . LYS A 1 22 ? 12.882  -0.818  -1.357  1.00 0.00 ? 22 LYS A C    11 
ATOM 10273 O O    . LYS A 1 22 ? 13.473  -0.330  -2.320  1.00 0.00 ? 22 LYS A O    11 
ATOM 10274 C CB   . LYS A 1 22 ? 13.563  -3.215  -1.140  1.00 0.00 ? 22 LYS A CB   11 
ATOM 10275 C CG   . LYS A 1 22 ? 14.254  -3.004  0.198   1.00 0.00 ? 22 LYS A CG   11 
ATOM 10276 C CD   . LYS A 1 22 ? 15.330  -4.051  0.439   1.00 0.00 ? 22 LYS A CD   11 
ATOM 10277 C CE   . LYS A 1 22 ? 16.608  -3.722  -0.317  1.00 0.00 ? 22 LYS A CE   11 
ATOM 10278 N NZ   . LYS A 1 22 ? 16.652  -4.382  -1.651  1.00 0.00 ? 22 LYS A NZ   11 
ATOM 10279 H H    . LYS A 1 22 ? 12.211  -3.176  -3.290  1.00 0.00 ? 22 LYS A H    11 
ATOM 10280 H HA   . LYS A 1 22 ? 11.665  -2.392  -0.602  1.00 0.00 ? 22 LYS A HA   11 
ATOM 10281 H HB2  . LYS A 1 22 ? 13.201  -4.232  -1.176  1.00 0.00 ? 22 LYS A HB2  11 
ATOM 10282 H HB3  . LYS A 1 22 ? 14.294  -3.075  -1.923  1.00 0.00 ? 22 LYS A HB3  11 
ATOM 10283 H HG2  . LYS A 1 22 ? 14.710  -2.026  0.206   1.00 0.00 ? 22 LYS A HG2  11 
ATOM 10284 H HG3  . LYS A 1 22 ? 13.518  -3.068  0.986   1.00 0.00 ? 22 LYS A HG3  11 
ATOM 10285 H HD2  . LYS A 1 22 ? 15.549  -4.092  1.495   1.00 0.00 ? 22 LYS A HD2  11 
ATOM 10286 H HD3  . LYS A 1 22 ? 14.964  -5.012  0.108   1.00 0.00 ? 22 LYS A HD3  11 
ATOM 10287 H HE2  . LYS A 1 22 ? 16.666  -2.652  -0.453  1.00 0.00 ? 22 LYS A HE2  11 
ATOM 10288 H HE3  . LYS A 1 22 ? 17.453  -4.055  0.268   1.00 0.00 ? 22 LYS A HE3  11 
ATOM 10289 H HZ1  . LYS A 1 22 ? 16.481  -5.403  -1.550  1.00 0.00 ? 22 LYS A HZ1  11 
ATOM 10290 H HZ2  . LYS A 1 22 ? 17.584  -4.241  -2.090  1.00 0.00 ? 22 LYS A HZ2  11 
ATOM 10291 H HZ3  . LYS A 1 22 ? 15.923  -3.978  -2.274  1.00 0.00 ? 22 LYS A HZ3  11 
ATOM 10292 N N    . LEU A 1 23 ? 12.636  -0.141  -0.234  1.00 0.00 ? 23 LEU A N    11 
ATOM 10293 C CA   . LEU A 1 23 ? 13.053  1.247   -0.058  1.00 0.00 ? 23 LEU A CA   11 
ATOM 10294 C C    . LEU A 1 23 ? 13.941  1.404   1.173   1.00 0.00 ? 23 LEU A C    11 
ATOM 10295 O O    . LEU A 1 23 ? 14.186  0.443   1.902   1.00 0.00 ? 23 LEU A O    11 
ATOM 10296 C CB   . LEU A 1 23 ? 11.832  2.155   0.068   1.00 0.00 ? 23 LEU A CB   11 
ATOM 10297 C CG   . LEU A 1 23 ? 10.674  1.578   0.881   1.00 0.00 ? 23 LEU A CG   11 
ATOM 10298 C CD1  . LEU A 1 23 ? 10.000  2.673   1.694   1.00 0.00 ? 23 LEU A CD1  11 
ATOM 10299 C CD2  . LEU A 1 23 ? 9.678   0.891   -0.041  1.00 0.00 ? 23 LEU A CD2  11 
ATOM 10300 H H    . LEU A 1 23 ? 12.162  -0.587  0.496   1.00 0.00 ? 23 LEU A H    11 
ATOM 10301 H HA   . LEU A 1 23 ? 13.616  1.536   -0.933  1.00 0.00 ? 23 LEU A HA   11 
ATOM 10302 H HB2  . LEU A 1 23 ? 12.144  3.079   0.534   1.00 0.00 ? 23 LEU A HB2  11 
ATOM 10303 H HB3  . LEU A 1 23 ? 11.471  2.376   -0.922  1.00 0.00 ? 23 LEU A HB3  11 
ATOM 10304 H HG   . LEU A 1 23 ? 11.054  0.841   1.572   1.00 0.00 ? 23 LEU A HG   11 
ATOM 10305 H HD11 . LEU A 1 23 ? 10.433  2.705   2.682   1.00 0.00 ? 23 LEU A HD11 11 
ATOM 10306 H HD12 . LEU A 1 23 ? 8.943   2.467   1.770   1.00 0.00 ? 23 LEU A HD12 11 
ATOM 10307 H HD13 . LEU A 1 23 ? 10.148  3.625   1.206   1.00 0.00 ? 23 LEU A HD13 11 
ATOM 10308 H HD21 . LEU A 1 23 ? 10.179  0.593   -0.950  1.00 0.00 ? 23 LEU A HD21 11 
ATOM 10309 H HD22 . LEU A 1 23 ? 8.876   1.573   -0.280  1.00 0.00 ? 23 LEU A HD22 11 
ATOM 10310 H HD23 . LEU A 1 23 ? 9.276   0.018   0.447   1.00 0.00 ? 23 LEU A HD23 11 
ATOM 10311 N N    . ARG A 1 24 ? 14.419  2.625   1.396   1.00 0.00 ? 24 ARG A N    11 
ATOM 10312 C CA   . ARG A 1 24 ? 15.283  2.916   2.536   1.00 0.00 ? 24 ARG A CA   11 
ATOM 10313 C C    . ARG A 1 24 ? 14.552  2.688   3.855   1.00 0.00 ? 24 ARG A C    11 
ATOM 10314 O O    . ARG A 1 24 ? 15.165  2.681   4.923   1.00 0.00 ? 24 ARG A O    11 
ATOM 10315 C CB   . ARG A 1 24 ? 15.787  4.360   2.466   1.00 0.00 ? 24 ARG A CB   11 
ATOM 10316 C CG   . ARG A 1 24 ? 16.914  4.568   1.467   1.00 0.00 ? 24 ARG A CG   11 
ATOM 10317 C CD   . ARG A 1 24 ? 18.195  5.011   2.157   1.00 0.00 ? 24 ARG A CD   11 
ATOM 10318 N NE   . ARG A 1 24 ? 18.770  3.948   2.977   1.00 0.00 ? 24 ARG A NE   11 
ATOM 10319 C CZ   . ARG A 1 24 ? 20.056  3.888   3.310   1.00 0.00 ? 24 ARG A CZ   11 
ATOM 10320 N NH1  . ARG A 1 24 ? 20.896  4.825   2.890   1.00 0.00 ? 24 ARG A NH1  11 
ATOM 10321 N NH2  . ARG A 1 24 ? 20.503  2.892   4.062   1.00 0.00 ? 24 ARG A NH2  11 
ATOM 10322 H H    . ARG A 1 24 ? 14.187  3.348   0.777   1.00 0.00 ? 24 ARG A H    11 
ATOM 10323 H HA   . ARG A 1 24 ? 16.127  2.248   2.489   1.00 0.00 ? 24 ARG A HA   11 
ATOM 10324 H HB2  . ARG A 1 24 ? 14.965  5.002   2.185   1.00 0.00 ? 24 ARG A HB2  11 
ATOM 10325 H HB3  . ARG A 1 24 ? 16.142  4.653   3.443   1.00 0.00 ? 24 ARG A HB3  11 
ATOM 10326 H HG2  . ARG A 1 24 ? 17.099  3.639   0.949   1.00 0.00 ? 24 ARG A HG2  11 
ATOM 10327 H HG3  . ARG A 1 24 ? 16.617  5.326   0.757   1.00 0.00 ? 24 ARG A HG3  11 
ATOM 10328 H HD2  . ARG A 1 24 ? 18.913  5.300   1.404   1.00 0.00 ? 24 ARG A HD2  11 
ATOM 10329 H HD3  . ARG A 1 24 ? 17.974  5.860   2.787   1.00 0.00 ? 24 ARG A HD3  11 
ATOM 10330 H HE   . ARG A 1 24 ? 18.168  3.245   3.297   1.00 0.00 ? 24 ARG A HE   11 
ATOM 10331 H HH11 . ARG A 1 24 ? 20.563  5.578   2.323   1.00 0.00 ? 24 ARG A HH11 11 
ATOM 10332 H HH12 . ARG A 1 24 ? 21.863  4.778   3.142   1.00 0.00 ? 24 ARG A HH12 11 
ATOM 10333 H HH21 . ARG A 1 24 ? 19.873  2.184   4.381   1.00 0.00 ? 24 ARG A HH21 11 
ATOM 10334 H HH22 . ARG A 1 24 ? 21.471  2.849   4.311   1.00 0.00 ? 24 ARG A HH22 11 
ATOM 10335 N N    . GLN A 1 25 ? 13.240  2.502   3.775   1.00 0.00 ? 25 GLN A N    11 
ATOM 10336 C CA   . GLN A 1 25 ? 12.427  2.273   4.966   1.00 0.00 ? 25 GLN A CA   11 
ATOM 10337 C C    . GLN A 1 25 ? 11.494  1.079   4.773   1.00 0.00 ? 25 GLN A C    11 
ATOM 10338 O O    . GLN A 1 25 ? 11.922  -0.072  4.863   1.00 0.00 ? 25 GLN A O    11 
ATOM 10339 C CB   . GLN A 1 25 ? 11.627  3.531   5.317   1.00 0.00 ? 25 GLN A CB   11 
ATOM 10340 C CG   . GLN A 1 25 ? 12.390  4.515   6.190   1.00 0.00 ? 25 GLN A CG   11 
ATOM 10341 C CD   . GLN A 1 25 ? 12.205  5.952   5.743   1.00 0.00 ? 25 GLN A CD   11 
ATOM 10342 O OE1  . GLN A 1 25 ? 12.911  6.434   4.857   1.00 0.00 ? 25 GLN A OE1  11 
ATOM 10343 N NE2  . GLN A 1 25 ? 11.252  6.645   6.355   1.00 0.00 ? 25 GLN A NE2  11 
ATOM 10344 H H    . GLN A 1 25 ? 12.809  2.518   2.896   1.00 0.00 ? 25 GLN A H    11 
ATOM 10345 H HA   . GLN A 1 25 ? 13.093  2.051   5.779   1.00 0.00 ? 25 GLN A HA   11 
ATOM 10346 H HB2  . GLN A 1 25 ? 11.349  4.034   4.403   1.00 0.00 ? 25 GLN A HB2  11 
ATOM 10347 H HB3  . GLN A 1 25 ? 10.731  3.238   5.844   1.00 0.00 ? 25 GLN A HB3  11 
ATOM 10348 H HG2  . GLN A 1 25 ? 12.038  4.423   7.206   1.00 0.00 ? 25 GLN A HG2  11 
ATOM 10349 H HG3  . GLN A 1 25 ? 13.441  4.272   6.150   1.00 0.00 ? 25 GLN A HG3  11 
ATOM 10350 H HE21 . GLN A 1 25 ? 10.729  6.197   7.052   1.00 0.00 ? 25 GLN A HE21 11 
ATOM 10351 H HE22 . GLN A 1 25 ? 11.111  7.576   6.085   1.00 0.00 ? 25 GLN A HE22 11 
ATOM 10352 N N    . GLY A 1 26 ? 10.223  1.356   4.511   1.00 0.00 ? 26 GLY A N    11 
ATOM 10353 C CA   . GLY A 1 26 ? 9.260   0.288   4.314   1.00 0.00 ? 26 GLY A CA   11 
ATOM 10354 C C    . GLY A 1 26 ? 7.918   0.793   3.819   1.00 0.00 ? 26 GLY A C    11 
ATOM 10355 O O    . GLY A 1 26 ? 7.155   1.398   4.571   1.00 0.00 ? 26 GLY A O    11 
ATOM 10356 H H    . GLY A 1 26 ? 9.936   2.287   4.451   1.00 0.00 ? 26 GLY A H    11 
ATOM 10357 H HA2  . GLY A 1 26 ? 9.658   -0.408  3.590   1.00 0.00 ? 26 GLY A HA2  11 
ATOM 10358 H HA3  . GLY A 1 26 ? 9.115   -0.227  5.251   1.00 0.00 ? 26 GLY A HA3  11 
ATOM 10359 N N    . ALA A 1 27 ? 7.642   0.549   2.544   1.00 0.00 ? 27 ALA A N    11 
ATOM 10360 C CA   . ALA A 1 27 ? 6.400   0.979   1.916   1.00 0.00 ? 27 ALA A CA   11 
ATOM 10361 C C    . ALA A 1 27 ? 5.218   0.057   2.250   1.00 0.00 ? 27 ALA A C    11 
ATOM 10362 O O    . ALA A 1 27 ? 4.371   -0.200  1.396   1.00 0.00 ? 27 ALA A O    11 
ATOM 10363 C CB   . ALA A 1 27 ? 6.607   1.032   0.413   1.00 0.00 ? 27 ALA A CB   11 
ATOM 10364 H H    . ALA A 1 27 ? 8.301   0.077   1.999   1.00 0.00 ? 27 ALA A H    11 
ATOM 10365 H HA   . ALA A 1 27 ? 6.180   1.976   2.260   1.00 0.00 ? 27 ALA A HA   11 
ATOM 10366 H HB1  . ALA A 1 27 ? 7.222   0.201   0.103   1.00 0.00 ? 27 ALA A HB1  11 
ATOM 10367 H HB2  . ALA A 1 27 ? 7.100   1.956   0.146   1.00 0.00 ? 27 ALA A HB2  11 
ATOM 10368 H HB3  . ALA A 1 27 ? 5.651   0.977   -0.085  1.00 0.00 ? 27 ALA A HB3  11 
ATOM 10369 N N    . GLN A 1 28 ? 5.165   -0.442  3.482   1.00 0.00 ? 28 GLN A N    11 
ATOM 10370 C CA   . GLN A 1 28 ? 4.090   -1.341  3.905   1.00 0.00 ? 28 GLN A CA   11 
ATOM 10371 C C    . GLN A 1 28 ? 2.726   -0.653  3.952   1.00 0.00 ? 28 GLN A C    11 
ATOM 10372 O O    . GLN A 1 28 ? 2.341   -0.092  4.978   1.00 0.00 ? 28 GLN A O    11 
ATOM 10373 C CB   . GLN A 1 28 ? 4.390   -1.912  5.284   1.00 0.00 ? 28 GLN A CB   11 
ATOM 10374 C CG   . GLN A 1 28 ? 5.868   -2.046  5.576   1.00 0.00 ? 28 GLN A CG   11 
ATOM 10375 C CD   . GLN A 1 28 ? 6.444   -0.844  6.307   1.00 0.00 ? 28 GLN A CD   11 
ATOM 10376 O OE1  . GLN A 1 28 ? 7.500   -0.936  6.932   1.00 0.00 ? 28 GLN A OE1  11 
ATOM 10377 N NE2  . GLN A 1 28 ? 5.756   0.293   6.235   1.00 0.00 ? 28 GLN A NE2  11 
ATOM 10378 H H    . GLN A 1 28 ? 5.868   -0.213  4.119   1.00 0.00 ? 28 GLN A H    11 
ATOM 10379 H HA   . GLN A 1 28 ? 4.049   -2.156  3.199   1.00 0.00 ? 28 GLN A HA   11 
ATOM 10380 H HB2  . GLN A 1 28 ? 3.954   -1.268  6.030   1.00 0.00 ? 28 GLN A HB2  11 
ATOM 10381 H HB3  . GLN A 1 28 ? 3.941   -2.889  5.360   1.00 0.00 ? 28 GLN A HB3  11 
ATOM 10382 H HG2  . GLN A 1 28 ? 6.009   -2.916  6.190   1.00 0.00 ? 28 GLN A HG2  11 
ATOM 10383 H HG3  . GLN A 1 28 ? 6.395   -2.173  4.640   1.00 0.00 ? 28 GLN A HG3  11 
ATOM 10384 H HE21 . GLN A 1 28 ? 4.923   0.300   5.720   1.00 0.00 ? 28 GLN A HE21 11 
ATOM 10385 H HE22 . GLN A 1 28 ? 6.111   1.078   6.701   1.00 0.00 ? 28 GLN A HE22 11 
ATOM 10386 N N    . CYS A 1 29 ? 1.992   -0.715  2.849   1.00 0.00 ? 29 CYS A N    11 
ATOM 10387 C CA   . CYS A 1 29 ? 0.662   -0.116  2.775   1.00 0.00 ? 29 CYS A CA   11 
ATOM 10388 C C    . CYS A 1 29 ? 0.729   1.372   3.066   1.00 0.00 ? 29 CYS A C    11 
ATOM 10389 O O    . CYS A 1 29 ? -0.072  1.902   3.836   1.00 0.00 ? 29 CYS A O    11 
ATOM 10390 C CB   . CYS A 1 29 ? -0.297  -0.785  3.767   1.00 0.00 ? 29 CYS A CB   11 
ATOM 10391 S SG   . CYS A 1 29 ? -0.644  -2.543  3.425   1.00 0.00 ? 29 CYS A SG   11 
ATOM 10392 H H    . CYS A 1 29 ? 2.350   -1.177  2.069   1.00 0.00 ? 29 CYS A H    11 
ATOM 10393 H HA   . CYS A 1 29 ? 0.288   -0.259  1.772   1.00 0.00 ? 29 CYS A HA   11 
ATOM 10394 H HB2  . CYS A 1 29 ? 0.124   -0.724  4.758   1.00 0.00 ? 29 CYS A HB2  11 
ATOM 10395 H HB3  . CYS A 1 29 ? -1.239  -0.256  3.751   1.00 0.00 ? 29 CYS A HB3  11 
ATOM 10396 N N    . ALA A 1 30 ? 1.683   2.042   2.443   1.00 0.00 ? 30 ALA A N    11 
ATOM 10397 C CA   . ALA A 1 30 ? 1.841   3.476   2.639   1.00 0.00 ? 30 ALA A CA   11 
ATOM 10398 C C    . ALA A 1 30 ? 0.832   4.230   1.780   1.00 0.00 ? 30 ALA A C    11 
ATOM 10399 O O    . ALA A 1 30 ? -0.327  3.822   1.696   1.00 0.00 ? 30 ALA A O    11 
ATOM 10400 C CB   . ALA A 1 30 ? 3.262   3.903   2.319   1.00 0.00 ? 30 ALA A CB   11 
ATOM 10401 H H    . ALA A 1 30 ? 2.287   1.563   1.834   1.00 0.00 ? 30 ALA A H    11 
ATOM 10402 H HA   . ALA A 1 30 ? 1.649   3.682   3.678   1.00 0.00 ? 30 ALA A HA   11 
ATOM 10403 H HB1  . ALA A 1 30 ? 3.942   3.097   2.551   1.00 0.00 ? 30 ALA A HB1  11 
ATOM 10404 H HB2  . ALA A 1 30 ? 3.518   4.772   2.907   1.00 0.00 ? 30 ALA A HB2  11 
ATOM 10405 H HB3  . ALA A 1 30 ? 3.335   4.144   1.270   1.00 0.00 ? 30 ALA A HB3  11 
ATOM 10406 N N    . GLU A 1 31 ? 1.261   5.307   1.109   1.00 0.00 ? 31 GLU A N    11 
ATOM 10407 C CA   . GLU A 1 31 ? 0.352   6.045   0.237   1.00 0.00 ? 31 GLU A CA   11 
ATOM 10408 C C    . GLU A 1 31 ? -0.474  5.037   -0.542  1.00 0.00 ? 31 GLU A C    11 
ATOM 10409 O O    . GLU A 1 31 ? -1.639  5.263   -0.868  1.00 0.00 ? 31 GLU A O    11 
ATOM 10410 C CB   . GLU A 1 31 ? 1.132   6.942   -0.727  1.00 0.00 ? 31 GLU A CB   11 
ATOM 10411 C CG   . GLU A 1 31 ? 0.246   7.691   -1.710  1.00 0.00 ? 31 GLU A CG   11 
ATOM 10412 C CD   . GLU A 1 31 ? 0.323   9.195   -1.537  1.00 0.00 ? 31 GLU A CD   11 
ATOM 10413 O OE1  . GLU A 1 31 ? -0.206  9.705   -0.527  1.00 0.00 ? 31 GLU A OE1  11 
ATOM 10414 O OE2  . GLU A 1 31 ? 0.913   9.864   -2.412  1.00 0.00 ? 31 GLU A OE2  11 
ATOM 10415 H H    . GLU A 1 31 ? 2.195   5.587   1.179   1.00 0.00 ? 31 GLU A H    11 
ATOM 10416 H HA   . GLU A 1 31 ? -0.300  6.647   0.852   1.00 0.00 ? 31 GLU A HA   11 
ATOM 10417 H HB2  . GLU A 1 31 ? 1.692   7.666   -0.155  1.00 0.00 ? 31 GLU A HB2  11 
ATOM 10418 H HB3  . GLU A 1 31 ? 1.821   6.331   -1.292  1.00 0.00 ? 31 GLU A HB3  11 
ATOM 10419 H HG2  . GLU A 1 31 ? 0.556   7.444   -2.715  1.00 0.00 ? 31 GLU A HG2  11 
ATOM 10420 H HG3  . GLU A 1 31 ? -0.777  7.378   -1.563  1.00 0.00 ? 31 GLU A HG3  11 
ATOM 10421 N N    . GLY A 1 32 ? 0.162   3.900   -0.794  1.00 0.00 ? 32 GLY A N    11 
ATOM 10422 C CA   . GLY A 1 32 ? -0.468  2.806   -1.488  1.00 0.00 ? 32 GLY A CA   11 
ATOM 10423 C C    . GLY A 1 32 ? 0.178   1.494   -1.101  1.00 0.00 ? 32 GLY A C    11 
ATOM 10424 O O    . GLY A 1 32 ? 1.099   1.474   -0.285  1.00 0.00 ? 32 GLY A O    11 
ATOM 10425 H H    . GLY A 1 32 ? 1.083   3.795   -0.477  1.00 0.00 ? 32 GLY A H    11 
ATOM 10426 H HA2  . GLY A 1 32 ? -1.514  2.778   -1.216  1.00 0.00 ? 32 GLY A HA2  11 
ATOM 10427 H HA3  . GLY A 1 32 ? -0.376  2.950   -2.551  1.00 0.00 ? 32 GLY A HA3  11 
ATOM 10428 N N    . LEU A 1 33 ? -0.308  0.395   -1.651  1.00 0.00 ? 33 LEU A N    11 
ATOM 10429 C CA   . LEU A 1 33 ? 0.236   -0.912  -1.310  1.00 0.00 ? 33 LEU A CA   11 
ATOM 10430 C C    . LEU A 1 33 ? 1.685   -1.090  -1.782  1.00 0.00 ? 33 LEU A C    11 
ATOM 10431 O O    . LEU A 1 33 ? 2.140   -0.424  -2.712  1.00 0.00 ? 33 LEU A O    11 
ATOM 10432 C CB   . LEU A 1 33 ? -0.653  -2.018  -1.877  1.00 0.00 ? 33 LEU A CB   11 
ATOM 10433 C CG   . LEU A 1 33 ? -0.796  -3.257  -0.992  1.00 0.00 ? 33 LEU A CG   11 
ATOM 10434 C CD1  . LEU A 1 33 ? 0.222   -4.303  -1.391  1.00 0.00 ? 33 LEU A CD1  11 
ATOM 10435 C CD2  . LEU A 1 33 ? -0.634  -2.899  0.476   1.00 0.00 ? 33 LEU A CD2  11 
ATOM 10436 H H    . LEU A 1 33 ? -1.061  0.459   -2.278  1.00 0.00 ? 33 LEU A H    11 
ATOM 10437 H HA   . LEU A 1 33 ? 0.226   -0.975  -0.238  1.00 0.00 ? 33 LEU A HA   11 
ATOM 10438 H HB2  . LEU A 1 33 ? -1.637  -1.607  -2.047  1.00 0.00 ? 33 LEU A HB2  11 
ATOM 10439 H HB3  . LEU A 1 33 ? -0.242  -2.328  -2.826  1.00 0.00 ? 33 LEU A HB3  11 
ATOM 10440 H HG   . LEU A 1 33 ? -1.780  -3.677  -1.127  1.00 0.00 ? 33 LEU A HG   11 
ATOM 10441 H HD11 . LEU A 1 33 ? 1.213   -3.904  -1.257  1.00 0.00 ? 33 LEU A HD11 11 
ATOM 10442 H HD12 . LEU A 1 33 ? 0.077   -4.570  -2.428  1.00 0.00 ? 33 LEU A HD12 11 
ATOM 10443 H HD13 . LEU A 1 33 ? 0.100   -5.178  -0.772  1.00 0.00 ? 33 LEU A HD13 11 
ATOM 10444 H HD21 . LEU A 1 33 ? -1.020  -3.699  1.088   1.00 0.00 ? 33 LEU A HD21 11 
ATOM 10445 H HD22 . LEU A 1 33 ? -1.179  -1.989  0.686   1.00 0.00 ? 33 LEU A HD22 11 
ATOM 10446 H HD23 . LEU A 1 33 ? 0.413   -2.748  0.697   1.00 0.00 ? 33 LEU A HD23 11 
ATOM 10447 N N    . CYS A 1 34 ? 2.399   -1.997  -1.107  1.00 0.00 ? 34 CYS A N    11 
ATOM 10448 C CA   . CYS A 1 34 ? 3.801   -2.295  -1.405  1.00 0.00 ? 34 CYS A CA   11 
ATOM 10449 C C    . CYS A 1 34 ? 3.945   -3.663  -2.064  1.00 0.00 ? 34 CYS A C    11 
ATOM 10450 O O    . CYS A 1 34 ? 3.016   -4.466  -2.070  1.00 0.00 ? 34 CYS A O    11 
ATOM 10451 C CB   . CYS A 1 34 ? 4.623   -2.259  -0.093  1.00 0.00 ? 34 CYS A CB   11 
ATOM 10452 S SG   . CYS A 1 34 ? 5.686   -3.722  0.228   1.00 0.00 ? 34 CYS A SG   11 
ATOM 10453 H H    . CYS A 1 34 ? 1.971   -2.477  -0.377  1.00 0.00 ? 34 CYS A H    11 
ATOM 10454 H HA   . CYS A 1 34 ? 4.169   -1.538  -2.078  1.00 0.00 ? 34 CYS A HA   11 
ATOM 10455 H HB2  . CYS A 1 34 ? 5.260   -1.395  -0.099  1.00 0.00 ? 34 CYS A HB2  11 
ATOM 10456 H HB3  . CYS A 1 34 ? 3.934   -2.179  0.734   1.00 0.00 ? 34 CYS A HB3  11 
ATOM 10457 N N    . CYS A 1 35 ? 5.135   -3.936  -2.580  1.00 0.00 ? 35 CYS A N    11 
ATOM 10458 C CA   . CYS A 1 35 ? 5.410   -5.228  -3.191  1.00 0.00 ? 35 CYS A CA   11 
ATOM 10459 C C    . CYS A 1 35 ? 6.704   -5.832  -2.646  1.00 0.00 ? 35 CYS A C    11 
ATOM 10460 O O    . CYS A 1 35 ? 7.007   -6.999  -2.895  1.00 0.00 ? 35 CYS A O    11 
ATOM 10461 C CB   . CYS A 1 35 ? 5.478   -5.139  -4.721  1.00 0.00 ? 35 CYS A CB   11 
ATOM 10462 S SG   . CYS A 1 35 ? 6.294   -3.649  -5.370  1.00 0.00 ? 35 CYS A SG   11 
ATOM 10463 H H    . CYS A 1 35 ? 5.843   -3.267  -2.523  1.00 0.00 ? 35 CYS A H    11 
ATOM 10464 H HA   . CYS A 1 35 ? 4.594   -5.875  -2.914  1.00 0.00 ? 35 CYS A HA   11 
ATOM 10465 H HB2  . CYS A 1 35 ? 6.027   -5.990  -5.095  1.00 0.00 ? 35 CYS A HB2  11 
ATOM 10466 H HB3  . CYS A 1 35 ? 4.476   -5.162  -5.119  1.00 0.00 ? 35 CYS A HB3  11 
ATOM 10467 N N    . ASP A 1 36 ? 7.460   -5.034  -1.897  1.00 0.00 ? 36 ASP A N    11 
ATOM 10468 C CA   . ASP A 1 36 ? 8.713   -5.487  -1.311  1.00 0.00 ? 36 ASP A CA   11 
ATOM 10469 C C    . ASP A 1 36 ? 8.491   -5.985  0.113   1.00 0.00 ? 36 ASP A C    11 
ATOM 10470 O O    . ASP A 1 36 ? 7.419   -5.796  0.696   1.00 0.00 ? 36 ASP A O    11 
ATOM 10471 C CB   . ASP A 1 36 ? 9.740   -4.342  -1.311  1.00 0.00 ? 36 ASP A CB   11 
ATOM 10472 C CG   . ASP A 1 36 ? 10.771  -4.461  -0.202  1.00 0.00 ? 36 ASP A CG   11 
ATOM 10473 O OD1  . ASP A 1 36 ? 11.642  -5.352  -0.294  1.00 0.00 ? 36 ASP A OD1  11 
ATOM 10474 O OD2  . ASP A 1 36 ? 10.706  -3.665  0.758   1.00 0.00 ? 36 ASP A OD2  11 
ATOM 10475 H H    . ASP A 1 36 ? 7.167   -4.120  -1.730  1.00 0.00 ? 36 ASP A H    11 
ATOM 10476 H HA   . ASP A 1 36 ? 9.089   -6.298  -1.913  1.00 0.00 ? 36 ASP A HA   11 
ATOM 10477 H HB2  . ASP A 1 36 ? 10.262  -4.337  -2.251  1.00 0.00 ? 36 ASP A HB2  11 
ATOM 10478 H HB3  . ASP A 1 36 ? 9.218   -3.404  -1.190  1.00 0.00 ? 36 ASP A HB3  11 
ATOM 10479 N N    . GLN A 1 37 ? 9.523   -6.600  0.674   1.00 0.00 ? 37 GLN A N    11 
ATOM 10480 C CA   . GLN A 1 37 ? 9.465   -7.107  2.031   1.00 0.00 ? 37 GLN A CA   11 
ATOM 10481 C C    . GLN A 1 37 ? 8.801   -6.101  2.970   1.00 0.00 ? 37 GLN A C    11 
ATOM 10482 O O    . GLN A 1 37 ? 8.329   -6.491  4.037   1.00 0.00 ? 37 GLN A O    11 
ATOM 10483 C CB   . GLN A 1 37 ? 10.871  -7.438  2.535   1.00 0.00 ? 37 GLN A CB   11 
ATOM 10484 C CG   . GLN A 1 37 ? 11.567  -8.522  1.729   1.00 0.00 ? 37 GLN A CG   11 
ATOM 10485 C CD   . GLN A 1 37 ? 11.792  -9.790  2.529   1.00 0.00 ? 37 GLN A CD   11 
ATOM 10486 O OE1  . GLN A 1 37 ? 10.901  -10.257 3.238   1.00 0.00 ? 37 GLN A OE1  11 
ATOM 10487 N NE2  . GLN A 1 37 ? 12.989  -10.356 2.417   1.00 0.00 ? 37 GLN A NE2  11 
ATOM 10488 H H    . GLN A 1 37 ? 10.352  -6.706  0.163   1.00 0.00 ? 37 GLN A H    11 
ATOM 10489 H HA   . GLN A 1 37 ? 8.877   -8.011  2.020   1.00 0.00 ? 37 GLN A HA   11 
ATOM 10490 H HB2  . GLN A 1 37 ? 11.476  -6.544  2.493   1.00 0.00 ? 37 GLN A HB2  11 
ATOM 10491 H HB3  . GLN A 1 37 ? 10.805  -7.768  3.561   1.00 0.00 ? 37 GLN A HB3  11 
ATOM 10492 H HG2  . GLN A 1 37 ? 10.958  -8.761  0.869   1.00 0.00 ? 37 GLN A HG2  11 
ATOM 10493 H HG3  . GLN A 1 37 ? 12.524  -8.148  1.398   1.00 0.00 ? 37 GLN A HG3  11 
ATOM 10494 H HE21 . GLN A 1 37 ? 13.650  -9.928  1.833   1.00 0.00 ? 37 GLN A HE21 11 
ATOM 10495 H HE22 . GLN A 1 37 ? 13.162  -11.177 2.923   1.00 0.00 ? 37 GLN A HE22 11 
ATOM 10496 N N    . CYS A 1 38 ? 8.777   -4.808  2.575   1.00 0.00 ? 38 CYS A N    11 
ATOM 10497 C CA   . CYS A 1 38 ? 8.170   -3.749  3.398   1.00 0.00 ? 38 CYS A CA   11 
ATOM 10498 C C    . CYS A 1 38 ? 7.232   -4.345  4.435   1.00 0.00 ? 38 CYS A C    11 
ATOM 10499 O O    . CYS A 1 38 ? 7.451   -4.192  5.633   1.00 0.00 ? 38 CYS A O    11 
ATOM 10500 C CB   . CYS A 1 38 ? 7.400   -2.723  2.540   1.00 0.00 ? 38 CYS A CB   11 
ATOM 10501 S SG   . CYS A 1 38 ? 7.508   -2.974  0.736   1.00 0.00 ? 38 CYS A SG   11 
ATOM 10502 H H    . CYS A 1 38 ? 9.184   -4.563  1.721   1.00 0.00 ? 38 CYS A H    11 
ATOM 10503 H HA   . CYS A 1 38 ? 8.966   -3.238  3.915   1.00 0.00 ? 38 CYS A HA   11 
ATOM 10504 H HB2  . CYS A 1 38 ? 6.355   -2.757  2.806   1.00 0.00 ? 38 CYS A HB2  11 
ATOM 10505 H HB3  . CYS A 1 38 ? 7.781   -1.733  2.754   1.00 0.00 ? 38 CYS A HB3  11 
ATOM 10506 N N    . ARG A 1 39 ? 6.210   -5.042  3.936   1.00 0.00 ? 39 ARG A N    11 
ATOM 10507 C CA   . ARG A 1 39 ? 5.199   -5.709  4.769   1.00 0.00 ? 39 ARG A CA   11 
ATOM 10508 C C    . ARG A 1 39 ? 3.847   -5.052  4.562   1.00 0.00 ? 39 ARG A C    11 
ATOM 10509 O O    . ARG A 1 39 ? 3.706   -4.171  3.715   1.00 0.00 ? 39 ARG A O    11 
ATOM 10510 C CB   . ARG A 1 39 ? 5.558   -5.703  6.259   1.00 0.00 ? 39 ARG A CB   11 
ATOM 10511 C CG   . ARG A 1 39 ? 6.812   -6.496  6.590   1.00 0.00 ? 39 ARG A CG   11 
ATOM 10512 C CD   . ARG A 1 39 ? 6.542   -7.533  7.668   1.00 0.00 ? 39 ARG A CD   11 
ATOM 10513 N NE   . ARG A 1 39 ? 5.921   -6.942  8.850   1.00 0.00 ? 39 ARG A NE   11 
ATOM 10514 C CZ   . ARG A 1 39 ? 5.502   -7.650  9.894   1.00 0.00 ? 39 ARG A CZ   11 
ATOM 10515 N NH1  . ARG A 1 39 ? 5.637   -8.969  9.901   1.00 0.00 ? 39 ARG A NH1  11 
ATOM 10516 N NH2  . ARG A 1 39 ? 4.947   -7.039  10.932  1.00 0.00 ? 39 ARG A NH2  11 
ATOM 10517 H H    . ARG A 1 39 ? 6.136   -5.120  2.953   1.00 0.00 ? 39 ARG A H    11 
ATOM 10518 H HA   . ARG A 1 39 ? 5.132   -6.734  4.432   1.00 0.00 ? 39 ARG A HA   11 
ATOM 10519 H HB2  . ARG A 1 39 ? 5.700   -4.686  6.584   1.00 0.00 ? 39 ARG A HB2  11 
ATOM 10520 H HB3  . ARG A 1 39 ? 4.735   -6.132  6.812   1.00 0.00 ? 39 ARG A HB3  11 
ATOM 10521 H HG2  . ARG A 1 39 ? 7.153   -7.000  5.699   1.00 0.00 ? 39 ARG A HG2  11 
ATOM 10522 H HG3  . ARG A 1 39 ? 7.576   -5.818  6.939   1.00 0.00 ? 39 ARG A HG3  11 
ATOM 10523 H HD2  . ARG A 1 39 ? 5.883   -8.289  7.267   1.00 0.00 ? 39 ARG A HD2  11 
ATOM 10524 H HD3  . ARG A 1 39 ? 7.479   -7.988  7.954   1.00 0.00 ? 39 ARG A HD3  11 
ATOM 10525 H HE   . ARG A 1 39 ? 5.811   -5.969  8.866   1.00 0.00 ? 39 ARG A HE   11 
ATOM 10526 H HH11 . ARG A 1 39 ? 6.055   -9.433  9.120   1.00 0.00 ? 39 ARG A HH11 11 
ATOM 10527 H HH12 . ARG A 1 39 ? 5.321   -9.500  10.687  1.00 0.00 ? 39 ARG A HH12 11 
ATOM 10528 H HH21 . ARG A 1 39 ? 4.843   -6.044  10.930  1.00 0.00 ? 39 ARG A HH21 11 
ATOM 10529 H HH22 . ARG A 1 39 ? 4.631   -7.573  11.716  1.00 0.00 ? 39 ARG A HH22 11 
ATOM 10530 N N    . PHE A 1 40 ? 2.843   -5.490  5.316   1.00 0.00 ? 40 PHE A N    11 
ATOM 10531 C CA   . PHE A 1 40 ? 1.502   -4.936  5.169   1.00 0.00 ? 40 PHE A CA   11 
ATOM 10532 C C    . PHE A 1 40 ? 0.663   -5.154  6.423   1.00 0.00 ? 40 PHE A C    11 
ATOM 10533 O O    . PHE A 1 40 ? 0.395   -6.288  6.823   1.00 0.00 ? 40 PHE A O    11 
ATOM 10534 C CB   . PHE A 1 40 ? 0.846   -5.559  3.936   1.00 0.00 ? 40 PHE A CB   11 
ATOM 10535 C CG   . PHE A 1 40 ? 1.825   -5.679  2.808   1.00 0.00 ? 40 PHE A CG   11 
ATOM 10536 C CD1  . PHE A 1 40 ? 2.647   -6.790  2.708   1.00 0.00 ? 40 PHE A CD1  11 
ATOM 10537 C CD2  . PHE A 1 40 ? 1.976   -4.655  1.889   1.00 0.00 ? 40 PHE A CD2  11 
ATOM 10538 C CE1  . PHE A 1 40 ? 3.596   -6.878  1.716   1.00 0.00 ? 40 PHE A CE1  11 
ATOM 10539 C CE2  . PHE A 1 40 ? 2.917   -4.743  0.888   1.00 0.00 ? 40 PHE A CE2  11 
ATOM 10540 C CZ   . PHE A 1 40 ? 3.731   -5.855  0.803   1.00 0.00 ? 40 PHE A CZ   11 
ATOM 10541 H H    . PHE A 1 40 ? 3.003   -6.206  5.965   1.00 0.00 ? 40 PHE A H    11 
ATOM 10542 H HA   . PHE A 1 40 ? 1.605   -3.874  5.006   1.00 0.00 ? 40 PHE A HA   11 
ATOM 10543 H HB2  . PHE A 1 40 ? 0.486   -6.548  4.180   1.00 0.00 ? 40 PHE A HB2  11 
ATOM 10544 H HB3  . PHE A 1 40 ? 0.026   -4.941  3.610   1.00 0.00 ? 40 PHE A HB3  11 
ATOM 10545 H HD1  . PHE A 1 40 ? 2.539   -7.596  3.415   1.00 0.00 ? 40 PHE A HD1  11 
ATOM 10546 H HD2  . PHE A 1 40 ? 1.341   -3.785  1.949   1.00 0.00 ? 40 PHE A HD2  11 
ATOM 10547 H HE1  . PHE A 1 40 ? 4.232   -7.747  1.656   1.00 0.00 ? 40 PHE A HE1  11 
ATOM 10548 H HE2  . PHE A 1 40 ? 3.022   -3.938  0.179   1.00 0.00 ? 40 PHE A HE2  11 
ATOM 10549 H HZ   . PHE A 1 40 ? 4.480   -5.918  0.030   1.00 0.00 ? 40 PHE A HZ   11 
ATOM 10550 N N    . MET A 1 41 ? 0.266   -4.042  7.038   1.00 0.00 ? 41 MET A N    11 
ATOM 10551 C CA   . MET A 1 41 ? -0.535  -4.056  8.259   1.00 0.00 ? 41 MET A CA   11 
ATOM 10552 C C    . MET A 1 41 ? -1.385  -5.315  8.375   1.00 0.00 ? 41 MET A C    11 
ATOM 10553 O O    . MET A 1 41 ? -1.169  -6.136  9.266   1.00 0.00 ? 41 MET A O    11 
ATOM 10554 C CB   . MET A 1 41 ? -1.436  -2.822  8.305   1.00 0.00 ? 41 MET A CB   11 
ATOM 10555 C CG   . MET A 1 41 ? -1.219  -1.956  9.535   1.00 0.00 ? 41 MET A CG   11 
ATOM 10556 S SD   . MET A 1 41 ? -2.471  -2.226  10.804  1.00 0.00 ? 41 MET A SD   11 
ATOM 10557 C CE   . MET A 1 41 ? -1.701  -3.523  11.769  1.00 0.00 ? 41 MET A CE   11 
ATOM 10558 H H    . MET A 1 41 ? 0.529   -3.177  6.659   1.00 0.00 ? 41 MET A H    11 
ATOM 10559 H HA   . MET A 1 41 ? 0.144   -4.019  9.097   1.00 0.00 ? 41 MET A HA   11 
ATOM 10560 H HB2  . MET A 1 41 ? -1.247  -2.220  7.428   1.00 0.00 ? 41 MET A HB2  11 
ATOM 10561 H HB3  . MET A 1 41 ? -2.467  -3.143  8.294   1.00 0.00 ? 41 MET A HB3  11 
ATOM 10562 H HG2  . MET A 1 41 ? -0.249  -2.184  9.952   1.00 0.00 ? 41 MET A HG2  11 
ATOM 10563 H HG3  . MET A 1 41 ? -1.245  -0.918  9.237   1.00 0.00 ? 41 MET A HG3  11 
ATOM 10564 H HE1  . MET A 1 41 ? -2.464  -4.161  12.188  1.00 0.00 ? 41 MET A HE1  11 
ATOM 10565 H HE2  . MET A 1 41 ? -1.121  -3.082  12.566  1.00 0.00 ? 41 MET A HE2  11 
ATOM 10566 H HE3  . MET A 1 41 ? -1.052  -4.108  11.133  1.00 0.00 ? 41 MET A HE3  11 
ATOM 10567 N N    . LYS A 1 42 ? -2.362  -5.450  7.484   1.00 0.00 ? 42 LYS A N    11 
ATOM 10568 C CA   . LYS A 1 42 ? -3.261  -6.598  7.496   1.00 0.00 ? 42 LYS A CA   11 
ATOM 10569 C C    . LYS A 1 42 ? -4.335  -6.422  8.559   1.00 0.00 ? 42 LYS A C    11 
ATOM 10570 O O    . LYS A 1 42 ? -4.226  -6.950  9.665   1.00 0.00 ? 42 LYS A O    11 
ATOM 10571 C CB   . LYS A 1 42 ? -2.490  -7.902  7.733   1.00 0.00 ? 42 LYS A CB   11 
ATOM 10572 C CG   . LYS A 1 42 ? -3.344  -9.150  7.571   1.00 0.00 ? 42 LYS A CG   11 
ATOM 10573 C CD   . LYS A 1 42 ? -2.898  -9.986  6.381   1.00 0.00 ? 42 LYS A CD   11 
ATOM 10574 C CE   . LYS A 1 42 ? -1.663  -10.809 6.708   1.00 0.00 ? 42 LYS A CE   11 
ATOM 10575 N NZ   . LYS A 1 42 ? -2.016  -12.186 7.154   1.00 0.00 ? 42 LYS A NZ   11 
ATOM 10576 H H    . LYS A 1 42 ? -2.492  -4.752  6.807   1.00 0.00 ? 42 LYS A H    11 
ATOM 10577 H HA   . LYS A 1 42 ? -3.742  -6.643  6.534   1.00 0.00 ? 42 LYS A HA   11 
ATOM 10578 H HB2  . LYS A 1 42 ? -1.673  -7.957  7.030   1.00 0.00 ? 42 LYS A HB2  11 
ATOM 10579 H HB3  . LYS A 1 42 ? -2.092  -7.896  8.735   1.00 0.00 ? 42 LYS A HB3  11 
ATOM 10580 H HG2  . LYS A 1 42 ? -3.263  -9.747  8.467   1.00 0.00 ? 42 LYS A HG2  11 
ATOM 10581 H HG3  . LYS A 1 42 ? -4.373  -8.854  7.427   1.00 0.00 ? 42 LYS A HG3  11 
ATOM 10582 H HD2  . LYS A 1 42 ? -3.700  -10.654 6.103   1.00 0.00 ? 42 LYS A HD2  11 
ATOM 10583 H HD3  . LYS A 1 42 ? -2.674  -9.327  5.555   1.00 0.00 ? 42 LYS A HD3  11 
ATOM 10584 H HE2  . LYS A 1 42 ? -1.046  -10.874 5.825   1.00 0.00 ? 42 LYS A HE2  11 
ATOM 10585 H HE3  . LYS A 1 42 ? -1.114  -10.314 7.495   1.00 0.00 ? 42 LYS A HE3  11 
ATOM 10586 H HZ1  . LYS A 1 42 ? -1.205  -12.823 7.022   1.00 0.00 ? 42 LYS A HZ1  11 
ATOM 10587 H HZ2  . LYS A 1 42 ? -2.819  -12.546 6.601   1.00 0.00 ? 42 LYS A HZ2  11 
ATOM 10588 H HZ3  . LYS A 1 42 ? -2.278  -12.179 8.161   1.00 0.00 ? 42 LYS A HZ3  11 
ATOM 10589 N N    . GLU A 1 43 ? -5.374  -5.674  8.208   1.00 0.00 ? 43 GLU A N    11 
ATOM 10590 C CA   . GLU A 1 43 ? -6.479  -5.420  9.122   1.00 0.00 ? 43 GLU A CA   11 
ATOM 10591 C C    . GLU A 1 43 ? -7.408  -4.349  8.571   1.00 0.00 ? 43 GLU A C    11 
ATOM 10592 O O    . GLU A 1 43 ? -8.597  -4.314  8.890   1.00 0.00 ? 43 GLU A O    11 
ATOM 10593 C CB   . GLU A 1 43 ? -5.951  -5.003  10.496  1.00 0.00 ? 43 GLU A CB   11 
ATOM 10594 C CG   . GLU A 1 43 ? -7.032  -4.502  11.440  1.00 0.00 ? 43 GLU A CG   11 
ATOM 10595 C CD   . GLU A 1 43 ? -7.492  -5.568  12.416  1.00 0.00 ? 43 GLU A CD   11 
ATOM 10596 O OE1  . GLU A 1 43 ? -7.745  -6.708  11.973  1.00 0.00 ? 43 GLU A OE1  11 
ATOM 10597 O OE2  . GLU A 1 43 ? -7.598  -5.263  13.622  1.00 0.00 ? 43 GLU A OE2  11 
ATOM 10598 H H    . GLU A 1 43 ? -5.398  -5.286  7.309   1.00 0.00 ? 43 GLU A H    11 
ATOM 10599 H HA   . GLU A 1 43 ? -7.032  -6.329  9.219   1.00 0.00 ? 43 GLU A HA   11 
ATOM 10600 H HB2  . GLU A 1 43 ? -5.468  -5.852  10.956  1.00 0.00 ? 43 GLU A HB2  11 
ATOM 10601 H HB3  . GLU A 1 43 ? -5.225  -4.214  10.365  1.00 0.00 ? 43 GLU A HB3  11 
ATOM 10602 H HG2  . GLU A 1 43 ? -6.643  -3.667  12.002  1.00 0.00 ? 43 GLU A HG2  11 
ATOM 10603 H HG3  . GLU A 1 43 ? -7.881  -4.179  10.857  1.00 0.00 ? 43 GLU A HG3  11 
ATOM 10604 N N    . GLY A 1 44 ? -6.856  -3.480  7.743   1.00 0.00 ? 44 GLY A N    11 
ATOM 10605 C CA   . GLY A 1 44 ? -7.632  -2.418  7.154   1.00 0.00 ? 44 GLY A CA   11 
ATOM 10606 C C    . GLY A 1 44 ? -6.836  -1.159  7.031   1.00 0.00 ? 44 GLY A C    11 
ATOM 10607 O O    . GLY A 1 44 ? -7.344  -0.061  7.261   1.00 0.00 ? 44 GLY A O    11 
ATOM 10608 H H    . GLY A 1 44 ? -5.908  -3.559  7.529   1.00 0.00 ? 44 GLY A H    11 
ATOM 10609 H HA2  . GLY A 1 44 ? -7.947  -2.720  6.172   1.00 0.00 ? 44 GLY A HA2  11 
ATOM 10610 H HA3  . GLY A 1 44 ? -8.494  -2.225  7.768   1.00 0.00 ? 44 GLY A HA3  11 
ATOM 10611 N N    . THR A 1 45 ? -5.580  -1.317  6.672   1.00 0.00 ? 45 THR A N    11 
ATOM 10612 C CA   . THR A 1 45 ? -4.710  -0.172  6.526   1.00 0.00 ? 45 THR A CA   11 
ATOM 10613 C C    . THR A 1 45 ? -4.920  0.510   5.177   1.00 0.00 ? 45 THR A C    11 
ATOM 10614 O O    . THR A 1 45 ? -5.874  1.271   5.014   1.00 0.00 ? 45 THR A O    11 
ATOM 10615 C CB   . THR A 1 45 ? -3.266  -0.585  6.749   1.00 0.00 ? 45 THR A CB   11 
ATOM 10616 O OG1  . THR A 1 45 ? -3.039  -0.824  8.126   1.00 0.00 ? 45 THR A OG1  11 
ATOM 10617 C CG2  . THR A 1 45 ? -2.283  0.456   6.292   1.00 0.00 ? 45 THR A CG2  11 
ATOM 10618 H H    . THR A 1 45 ? -5.230  -2.230  6.504   1.00 0.00 ? 45 THR A H    11 
ATOM 10619 H HA   . THR A 1 45 ? -4.980  0.531   7.290   1.00 0.00 ? 45 THR A HA   11 
ATOM 10620 H HB   . THR A 1 45 ? -3.067  -1.496  6.215   1.00 0.00 ? 45 THR A HB   11 
ATOM 10621 H HG1  . THR A 1 45 ? -3.807  -1.269  8.502   1.00 0.00 ? 45 THR A HG1  11 
ATOM 10622 H HG21 . THR A 1 45 ? -2.822  1.291   5.869   1.00 0.00 ? 45 THR A HG21 11 
ATOM 10623 H HG22 . THR A 1 45 ? -1.634  0.029   5.545   1.00 0.00 ? 45 THR A HG22 11 
ATOM 10624 H HG23 . THR A 1 45 ? -1.700  0.791   7.134   1.00 0.00 ? 45 THR A HG23 11 
ATOM 10625 N N    . ILE A 1 46 ? -4.048  0.256   4.211   1.00 0.00 ? 46 ILE A N    11 
ATOM 10626 C CA   . ILE A 1 46 ? -4.199  0.884   2.903   1.00 0.00 ? 46 ILE A CA   11 
ATOM 10627 C C    . ILE A 1 46 ? -3.592  0.056   1.764   1.00 0.00 ? 46 ILE A C    11 
ATOM 10628 O O    . ILE A 1 46 ? -2.380  0.064   1.553   1.00 0.00 ? 46 ILE A O    11 
ATOM 10629 C CB   . ILE A 1 46 ? -3.606  2.323   2.906   1.00 0.00 ? 46 ILE A CB   11 
ATOM 10630 C CG1  . ILE A 1 46 ? -4.737  3.348   2.988   1.00 0.00 ? 46 ILE A CG1  11 
ATOM 10631 C CG2  . ILE A 1 46 ? -2.737  2.600   1.680   1.00 0.00 ? 46 ILE A CG2  11 
ATOM 10632 C CD1  . ILE A 1 46 ? -4.944  3.913   4.377   1.00 0.00 ? 46 ILE A CD1  11 
ATOM 10633 H H    . ILE A 1 46 ? -3.303  -0.347  4.379   1.00 0.00 ? 46 ILE A H    11 
ATOM 10634 H HA   . ILE A 1 46 ? -5.257  0.974   2.722   1.00 0.00 ? 46 ILE A HA   11 
ATOM 10635 H HB   . ILE A 1 46 ? -2.982  2.425   3.780   1.00 0.00 ? 46 ILE A HB   11 
ATOM 10636 H HG12 . ILE A 1 46 ? -4.517  4.171   2.325   1.00 0.00 ? 46 ILE A HG12 11 
ATOM 10637 H HG13 . ILE A 1 46 ? -5.661  2.880   2.678   1.00 0.00 ? 46 ILE A HG13 11 
ATOM 10638 H HG21 . ILE A 1 46 ? -1.754  2.181   1.834   1.00 0.00 ? 46 ILE A HG21 11 
ATOM 10639 H HG22 . ILE A 1 46 ? -2.655  3.667   1.531   1.00 0.00 ? 46 ILE A HG22 11 
ATOM 10640 H HG23 . ILE A 1 46 ? -3.189  2.150   0.809   1.00 0.00 ? 46 ILE A HG23 11 
ATOM 10641 H HD11 . ILE A 1 46 ? -4.227  4.700   4.556   1.00 0.00 ? 46 ILE A HD11 11 
ATOM 10642 H HD12 . ILE A 1 46 ? -4.809  3.129   5.108   1.00 0.00 ? 46 ILE A HD12 11 
ATOM 10643 H HD13 . ILE A 1 46 ? -5.944  4.313   4.457   1.00 0.00 ? 46 ILE A HD13 11 
ATOM 10644 N N    . CYS A 1 47 ? -4.459  -0.611  1.002   1.00 0.00 ? 47 CYS A N    11 
ATOM 10645 C CA   . CYS A 1 47 ? -4.027  -1.389  -0.156  1.00 0.00 ? 47 CYS A CA   11 
ATOM 10646 C C    . CYS A 1 47 ? -4.302  -0.583  -1.424  1.00 0.00 ? 47 CYS A C    11 
ATOM 10647 O O    . CYS A 1 47 ? -4.277  -1.120  -2.531  1.00 0.00 ? 47 CYS A O    11 
ATOM 10648 C CB   . CYS A 1 47 ? -4.733  -2.752  -0.201  1.00 0.00 ? 47 CYS A CB   11 
ATOM 10649 S SG   . CYS A 1 47 ? -6.058  -2.902  -1.446  1.00 0.00 ? 47 CYS A SG   11 
ATOM 10650 H H    . CYS A 1 47 ? -5.416  -0.543  1.199   1.00 0.00 ? 47 CYS A H    11 
ATOM 10651 H HA   . CYS A 1 47 ? -2.965  -1.551  -0.076  1.00 0.00 ? 47 CYS A HA   11 
ATOM 10652 H HB2  . CYS A 1 47 ? -4.000  -3.513  -0.420  1.00 0.00 ? 47 CYS A HB2  11 
ATOM 10653 H HB3  . CYS A 1 47 ? -5.164  -2.952  0.765   1.00 0.00 ? 47 CYS A HB3  11 
ATOM 10654 N N    . ARG A 1 48 ? -4.569  0.714   -1.225  1.00 0.00 ? 48 ARG A N    11 
ATOM 10655 C CA   . ARG A 1 48 ? -4.867  1.656   -2.307  1.00 0.00 ? 48 ARG A CA   11 
ATOM 10656 C C    . ARG A 1 48 ? -4.640  1.054   -3.688  1.00 0.00 ? 48 ARG A C    11 
ATOM 10657 O O    . ARG A 1 48 ? -3.512  0.737   -4.059  1.00 0.00 ? 48 ARG A O    11 
ATOM 10658 C CB   . ARG A 1 48 ? -4.000  2.904   -2.146  1.00 0.00 ? 48 ARG A CB   11 
ATOM 10659 C CG   . ARG A 1 48 ? -4.138  3.572   -0.788  1.00 0.00 ? 48 ARG A CG   11 
ATOM 10660 C CD   . ARG A 1 48 ? -4.789  4.941   -0.905  1.00 0.00 ? 48 ARG A CD   11 
ATOM 10661 N NE   . ARG A 1 48 ? -3.955  5.995   -0.333  1.00 0.00 ? 48 ARG A NE   11 
ATOM 10662 C CZ   . ARG A 1 48 ? -4.012  7.267   -0.713  1.00 0.00 ? 48 ARG A CZ   11 
ATOM 10663 N NH1  . ARG A 1 48 ? -4.861  7.640   -1.662  1.00 0.00 ? 48 ARG A NH1  11 
ATOM 10664 N NH2  . ARG A 1 48 ? -3.223  8.169   -0.145  1.00 0.00 ? 48 ARG A NH2  11 
ATOM 10665 H H    . ARG A 1 48 ? -4.576  1.054   -0.304  1.00 0.00 ? 48 ARG A H    11 
ATOM 10666 H HA   . ARG A 1 48 ? -5.900  1.941   -2.219  1.00 0.00 ? 48 ARG A HA   11 
ATOM 10667 H HB2  . ARG A 1 48 ? -2.966  2.625   -2.281  1.00 0.00 ? 48 ARG A HB2  11 
ATOM 10668 H HB3  . ARG A 1 48 ? -4.271  3.619   -2.905  1.00 0.00 ? 48 ARG A HB3  11 
ATOM 10669 H HG2  . ARG A 1 48 ? -4.747  2.949   -0.150  1.00 0.00 ? 48 ARG A HG2  11 
ATOM 10670 H HG3  . ARG A 1 48 ? -3.156  3.686   -0.352  1.00 0.00 ? 48 ARG A HG3  11 
ATOM 10671 H HD2  . ARG A 1 48 ? -4.959  5.157   -1.949  1.00 0.00 ? 48 ARG A HD2  11 
ATOM 10672 H HD3  . ARG A 1 48 ? -5.735  4.921   -0.384  1.00 0.00 ? 48 ARG A HD3  11 
ATOM 10673 H HE   . ARG A 1 48 ? -3.321  5.741   0.370   1.00 0.00 ? 48 ARG A HE   11 
ATOM 10674 H HH11 . ARG A 1 48 ? -5.458  6.963   -2.092  1.00 0.00 ? 48 ARG A HH11 11 
ATOM 10675 H HH12 . ARG A 1 48 ? -4.903  8.598   -1.946  1.00 0.00 ? 48 ARG A HH12 11 
ATOM 10676 H HH21 . ARG A 1 48 ? -2.582  7.892   0.571   1.00 0.00 ? 48 ARG A HH21 11 
ATOM 10677 H HH22 . ARG A 1 48 ? -3.268  9.125   -0.433  1.00 0.00 ? 48 ARG A HH22 11 
ATOM 10678 N N    . ARG A 1 49 ? -5.723  0.906   -4.446  1.00 0.00 ? 49 ARG A N    11 
ATOM 10679 C CA   . ARG A 1 49 ? -5.644  0.345   -5.791  1.00 0.00 ? 49 ARG A CA   11 
ATOM 10680 C C    . ARG A 1 49 ? -6.049  1.371   -6.837  1.00 0.00 ? 49 ARG A C    11 
ATOM 10681 O O    . ARG A 1 49 ? -5.265  1.728   -7.715  1.00 0.00 ? 49 ARG A O    11 
ATOM 10682 C CB   . ARG A 1 49 ? -6.530  -0.896  -5.906  1.00 0.00 ? 49 ARG A CB   11 
ATOM 10683 C CG   . ARG A 1 49 ? -7.540  -1.030  -4.779  1.00 0.00 ? 49 ARG A CG   11 
ATOM 10684 C CD   . ARG A 1 49 ? -8.668  -1.977  -5.155  1.00 0.00 ? 49 ARG A CD   11 
ATOM 10685 N NE   . ARG A 1 49 ? -8.207  -3.060  -6.019  1.00 0.00 ? 49 ARG A NE   11 
ATOM 10686 C CZ   . ARG A 1 49 ? -8.993  -3.702  -6.877  1.00 0.00 ? 49 ARG A CZ   11 
ATOM 10687 N NH1  . ARG A 1 49 ? -10.272 -3.372  -6.984  1.00 0.00 ? 49 ARG A NH1  11 
ATOM 10688 N NH2  . ARG A 1 49 ? -8.499  -4.677  -7.629  1.00 0.00 ? 49 ARG A NH2  11 
ATOM 10689 H H    . ARG A 1 49 ? -6.596  1.182   -4.094  1.00 0.00 ? 49 ARG A H    11 
ATOM 10690 H HA   . ARG A 1 49 ? -4.628  0.065   -5.969  1.00 0.00 ? 49 ARG A HA   11 
ATOM 10691 H HB2  . ARG A 1 49 ? -7.069  -0.854  -6.841  1.00 0.00 ? 49 ARG A HB2  11 
ATOM 10692 H HB3  . ARG A 1 49 ? -5.901  -1.774  -5.903  1.00 0.00 ? 49 ARG A HB3  11 
ATOM 10693 H HG2  . ARG A 1 49 ? -7.038  -1.413  -3.903  1.00 0.00 ? 49 ARG A HG2  11 
ATOM 10694 H HG3  . ARG A 1 49 ? -7.955  -0.057  -4.563  1.00 0.00 ? 49 ARG A HG3  11 
ATOM 10695 H HD2  . ARG A 1 49 ? -9.080  -2.401  -4.251  1.00 0.00 ? 49 ARG A HD2  11 
ATOM 10696 H HD3  . ARG A 1 49 ? -9.434  -1.417  -5.671  1.00 0.00 ? 49 ARG A HD3  11 
ATOM 10697 H HE   . ARG A 1 49 ? -7.265  -3.320  -5.957  1.00 0.00 ? 49 ARG A HE   11 
ATOM 10698 H HH11 . ARG A 1 49 ? -10.648 -2.637  -6.420  1.00 0.00 ? 49 ARG A HH11 11 
ATOM 10699 H HH12 . ARG A 1 49 ? -10.861 -3.857  -7.630  1.00 0.00 ? 49 ARG A HH12 11 
ATOM 10700 H HH21 . ARG A 1 49 ? -7.535  -4.928  -7.551  1.00 0.00 ? 49 ARG A HH21 11 
ATOM 10701 H HH22 . ARG A 1 49 ? -9.092  -5.160  -8.273  1.00 0.00 ? 49 ARG A HH22 11 
ATOM 10702 N N    . ALA A 1 50 ? -7.280  1.836   -6.733  1.00 0.00 ? 50 ALA A N    11 
ATOM 10703 C CA   . ALA A 1 50 ? -7.807  2.823   -7.667  1.00 0.00 ? 50 ALA A CA   11 
ATOM 10704 C C    . ALA A 1 50 ? -9.151  3.379   -7.204  1.00 0.00 ? 50 ALA A C    11 
ATOM 10705 O O    . ALA A 1 50 ? -9.910  2.705   -6.508  1.00 0.00 ? 50 ALA A O    11 
ATOM 10706 C CB   . ALA A 1 50 ? -7.939  2.214   -9.055  1.00 0.00 ? 50 ALA A CB   11 
ATOM 10707 H H    . ALA A 1 50 ? -7.845  1.504   -6.009  1.00 0.00 ? 50 ALA A H    11 
ATOM 10708 H HA   . ALA A 1 50 ? -7.097  3.635   -7.726  1.00 0.00 ? 50 ALA A HA   11 
ATOM 10709 H HB1  . ALA A 1 50 ? -8.166  2.991   -9.769  1.00 0.00 ? 50 ALA A HB1  11 
ATOM 10710 H HB2  . ALA A 1 50 ? -8.734  1.483   -9.053  1.00 0.00 ? 50 ALA A HB2  11 
ATOM 10711 H HB3  . ALA A 1 50 ? -7.010  1.735   -9.327  1.00 0.00 ? 50 ALA A HB3  11 
ATOM 10712 N N    . ARG A 1 51 ? -9.434  4.616   -7.603  1.00 0.00 ? 51 ARG A N    11 
ATOM 10713 C CA   . ARG A 1 51 ? -10.677 5.283   -7.249  1.00 0.00 ? 51 ARG A CA   11 
ATOM 10714 C C    . ARG A 1 51 ? -10.951 6.449   -8.193  1.00 0.00 ? 51 ARG A C    11 
ATOM 10715 O O    . ARG A 1 51 ? -11.275 7.553   -7.754  1.00 0.00 ? 51 ARG A O    11 
ATOM 10716 C CB   . ARG A 1 51 ? -10.614 5.786   -5.811  1.00 0.00 ? 51 ARG A CB   11 
ATOM 10717 C CG   . ARG A 1 51 ? -11.604 5.100   -4.898  1.00 0.00 ? 51 ARG A CG   11 
ATOM 10718 C CD   . ARG A 1 51 ? -12.775 6.012   -4.561  1.00 0.00 ? 51 ARG A CD   11 
ATOM 10719 N NE   . ARG A 1 51 ? -12.338 7.248   -3.916  1.00 0.00 ? 51 ARG A NE   11 
ATOM 10720 C CZ   . ARG A 1 51 ? -12.226 7.398   -2.599  1.00 0.00 ? 51 ARG A CZ   11 
ATOM 10721 N NH1  . ARG A 1 51 ? -12.518 6.395   -1.783  1.00 0.00 ? 51 ARG A NH1  11 
ATOM 10722 N NH2  . ARG A 1 51 ? -11.821 8.556   -2.097  1.00 0.00 ? 51 ARG A NH2  11 
ATOM 10723 H H    . ARG A 1 51 ? -8.789  5.092   -8.153  1.00 0.00 ? 51 ARG A H    11 
ATOM 10724 H HA   . ARG A 1 51 ? -11.478 4.564   -7.337  1.00 0.00 ? 51 ARG A HA   11 
ATOM 10725 H HB2  . ARG A 1 51 ? -9.621  5.613   -5.422  1.00 0.00 ? 51 ARG A HB2  11 
ATOM 10726 H HB3  . ARG A 1 51 ? -10.819 6.846   -5.800  1.00 0.00 ? 51 ARG A HB3  11 
ATOM 10727 H HG2  . ARG A 1 51 ? -11.977 4.216   -5.395  1.00 0.00 ? 51 ARG A HG2  11 
ATOM 10728 H HG3  . ARG A 1 51 ? -11.097 4.820   -3.989  1.00 0.00 ? 51 ARG A HG3  11 
ATOM 10729 H HD2  . ARG A 1 51 ? -13.295 6.260   -5.474  1.00 0.00 ? 51 ARG A HD2  11 
ATOM 10730 H HD3  . ARG A 1 51 ? -13.447 5.488   -3.899  1.00 0.00 ? 51 ARG A HD3  11 
ATOM 10731 H HE   . ARG A 1 51 ? -12.116 8.006   -4.496  1.00 0.00 ? 51 ARG A HE   11 
ATOM 10732 H HH11 . ARG A 1 51 ? -12.823 5.520   -2.155  1.00 0.00 ? 51 ARG A HH11 11 
ATOM 10733 H HH12 . ARG A 1 51 ? -12.431 6.514   -0.794  1.00 0.00 ? 51 ARG A HH12 11 
ATOM 10734 H HH21 . ARG A 1 51 ? -11.599 9.316   -2.708  1.00 0.00 ? 51 ARG A HH21 11 
ATOM 10735 H HH22 . ARG A 1 51 ? -11.738 8.671   -1.107  1.00 0.00 ? 51 ARG A HH22 11 
ATOM 10736 N N    . GLY A 1 52 ? -10.815 6.197   -9.491  1.00 0.00 ? 52 GLY A N    11 
ATOM 10737 C CA   . GLY A 1 52 ? -11.049 7.237   -10.477 1.00 0.00 ? 52 GLY A CA   11 
ATOM 10738 C C    . GLY A 1 52 ? -9.851  8.149   -10.654 1.00 0.00 ? 52 GLY A C    11 
ATOM 10739 O O    . GLY A 1 52 ? -9.157  8.084   -11.669 1.00 0.00 ? 52 GLY A O    11 
ATOM 10740 H H    . GLY A 1 52 ? -10.552 5.299   -9.782  1.00 0.00 ? 52 GLY A H    11 
ATOM 10741 H HA2  . GLY A 1 52 ? -11.278 6.772   -11.425 1.00 0.00 ? 52 GLY A HA2  11 
ATOM 10742 H HA3  . GLY A 1 52 ? -11.896 7.829   -10.165 1.00 0.00 ? 52 GLY A HA3  11 
ATOM 10743 N N    . ASP A 1 53 ? -9.608  9.003   -9.665  1.00 0.00 ? 53 ASP A N    11 
ATOM 10744 C CA   . ASP A 1 53 ? -8.485  9.933   -9.716  1.00 0.00 ? 53 ASP A CA   11 
ATOM 10745 C C    . ASP A 1 53 ? -7.912  10.173  -8.322  1.00 0.00 ? 53 ASP A C    11 
ATOM 10746 O O    . ASP A 1 53 ? -7.164  11.125  -8.102  1.00 0.00 ? 53 ASP A O    11 
ATOM 10747 C CB   . ASP A 1 53 ? -8.924  11.261  -10.333 1.00 0.00 ? 53 ASP A CB   11 
ATOM 10748 C CG   . ASP A 1 53 ? -10.416 11.498  -10.199 1.00 0.00 ? 53 ASP A CG   11 
ATOM 10749 O OD1  . ASP A 1 53 ? -11.196 10.699  -10.758 1.00 0.00 ? 53 ASP A OD1  11 
ATOM 10750 O OD2  . ASP A 1 53 ? -10.803 12.482  -9.534  1.00 0.00 ? 53 ASP A OD2  11 
ATOM 10751 H H    . ASP A 1 53 ? -10.197 9.007   -8.881  1.00 0.00 ? 53 ASP A H    11 
ATOM 10752 H HA   . ASP A 1 53 ? -7.719  9.493   -10.336 1.00 0.00 ? 53 ASP A HA   11 
ATOM 10753 H HB2  . ASP A 1 53 ? -8.405  12.069  -9.840  1.00 0.00 ? 53 ASP A HB2  11 
ATOM 10754 H HB3  . ASP A 1 53 ? -8.670  11.264  -11.383 1.00 0.00 ? 53 ASP A HB3  11 
ATOM 10755 N N    . ASP A 1 54 ? -8.272  9.303   -7.385  1.00 0.00 ? 54 ASP A N    11 
ATOM 10756 C CA   . ASP A 1 54 ? -7.798  9.418   -6.010  1.00 0.00 ? 54 ASP A CA   11 
ATOM 10757 C C    . ASP A 1 54 ? -7.041  8.167   -5.584  1.00 0.00 ? 54 ASP A C    11 
ATOM 10758 O O    . ASP A 1 54 ? -5.892  8.242   -5.149  1.00 0.00 ? 54 ASP A O    11 
ATOM 10759 C CB   . ASP A 1 54 ? -8.973  9.647   -5.065  1.00 0.00 ? 54 ASP A CB   11 
ATOM 10760 C CG   . ASP A 1 54 ? -9.436  11.091  -5.052  1.00 0.00 ? 54 ASP A CG   11 
ATOM 10761 O OD1  . ASP A 1 54 ? -8.585  11.988  -5.228  1.00 0.00 ? 54 ASP A OD1  11 
ATOM 10762 O OD2  . ASP A 1 54 ? -10.648 11.324  -4.866  1.00 0.00 ? 54 ASP A OD2  11 
ATOM 10763 H H    . ASP A 1 54 ? -8.874  8.567   -7.623  1.00 0.00 ? 54 ASP A H    11 
ATOM 10764 H HA   . ASP A 1 54 ? -7.133  10.267  -5.956  1.00 0.00 ? 54 ASP A HA   11 
ATOM 10765 H HB2  . ASP A 1 54 ? -9.799  9.025   -5.376  1.00 0.00 ? 54 ASP A HB2  11 
ATOM 10766 H HB3  . ASP A 1 54 ? -8.677  9.371   -4.063  1.00 0.00 ? 54 ASP A HB3  11 
ATOM 10767 N N    . LEU A 1 55 ? -7.697  7.019   -5.712  1.00 0.00 ? 55 LEU A N    11 
ATOM 10768 C CA   . LEU A 1 55 ? -7.090  5.745   -5.343  1.00 0.00 ? 55 LEU A CA   11 
ATOM 10769 C C    . LEU A 1 55 ? -7.266  5.469   -3.853  1.00 0.00 ? 55 LEU A C    11 
ATOM 10770 O O    . LEU A 1 55 ? -6.588  6.070   -3.019  1.00 0.00 ? 55 LEU A O    11 
ATOM 10771 C CB   . LEU A 1 55 ? -5.602  5.748   -5.699  1.00 0.00 ? 55 LEU A CB   11 
ATOM 10772 C CG   . LEU A 1 55 ? -5.245  6.423   -7.028  1.00 0.00 ? 55 LEU A CG   11 
ATOM 10773 C CD1  . LEU A 1 55 ? -4.057  5.731   -7.672  1.00 0.00 ? 55 LEU A CD1  11 
ATOM 10774 C CD2  . LEU A 1 55 ? -6.438  6.422   -7.972  1.00 0.00 ? 55 LEU A CD2  11 
ATOM 10775 H H    . LEU A 1 55 ? -8.611  7.029   -6.064  1.00 0.00 ? 55 LEU A H    11 
ATOM 10776 H HA   . LEU A 1 55 ? -7.585  4.966   -5.903  1.00 0.00 ? 55 LEU A HA   11 
ATOM 10777 H HB2  . LEU A 1 55 ? -5.067  6.254   -4.908  1.00 0.00 ? 55 LEU A HB2  11 
ATOM 10778 H HB3  . LEU A 1 55 ? -5.263  4.724   -5.740  1.00 0.00 ? 55 LEU A HB3  11 
ATOM 10779 H HG   . LEU A 1 55 ? -4.968  7.450   -6.840  1.00 0.00 ? 55 LEU A HG   11 
ATOM 10780 H HD11 . LEU A 1 55 ? -3.346  5.452   -6.908  1.00 0.00 ? 55 LEU A HD11 11 
ATOM 10781 H HD12 . LEU A 1 55 ? -3.586  6.404   -8.373  1.00 0.00 ? 55 LEU A HD12 11 
ATOM 10782 H HD13 . LEU A 1 55 ? -4.394  4.847   -8.192  1.00 0.00 ? 55 LEU A HD13 11 
ATOM 10783 H HD21 . LEU A 1 55 ? -6.090  6.425   -8.994  1.00 0.00 ? 55 LEU A HD21 11 
ATOM 10784 H HD22 . LEU A 1 55 ? -7.039  7.302   -7.794  1.00 0.00 ? 55 LEU A HD22 11 
ATOM 10785 H HD23 . LEU A 1 55 ? -7.032  5.538   -7.797  1.00 0.00 ? 55 LEU A HD23 11 
ATOM 10786 N N    . ASP A 1 56 ? -8.176  4.557   -3.521  1.00 0.00 ? 56 ASP A N    11 
ATOM 10787 C CA   . ASP A 1 56 ? -8.430  4.209   -2.130  1.00 0.00 ? 56 ASP A CA   11 
ATOM 10788 C C    . ASP A 1 56 ? -8.522  2.697   -1.958  1.00 0.00 ? 56 ASP A C    11 
ATOM 10789 O O    . ASP A 1 56 ? -8.804  1.969   -2.910  1.00 0.00 ? 56 ASP A O    11 
ATOM 10790 C CB   . ASP A 1 56 ? -9.723  4.865   -1.647  1.00 0.00 ? 56 ASP A CB   11 
ATOM 10791 C CG   . ASP A 1 56 ? -9.702  6.374   -1.798  1.00 0.00 ? 56 ASP A CG   11 
ATOM 10792 O OD1  . ASP A 1 56 ? -9.673  6.855   -2.950  1.00 0.00 ? 56 ASP A OD1  11 
ATOM 10793 O OD2  . ASP A 1 56 ? -9.716  7.074   -0.764  1.00 0.00 ? 56 ASP A OD2  11 
ATOM 10794 H H    . ASP A 1 56 ? -8.687  4.108   -4.226  1.00 0.00 ? 56 ASP A H    11 
ATOM 10795 H HA   . ASP A 1 56 ? -7.606  4.578   -1.539  1.00 0.00 ? 56 ASP A HA   11 
ATOM 10796 H HB2  . ASP A 1 56 ? -10.549 4.478   -2.221  1.00 0.00 ? 56 ASP A HB2  11 
ATOM 10797 H HB3  . ASP A 1 56 ? -9.873  4.628   -0.604  1.00 0.00 ? 56 ASP A HB3  11 
ATOM 10798 N N    . ASP A 1 57 ? -8.283  2.235   -0.736  1.00 0.00 ? 57 ASP A N    11 
ATOM 10799 C CA   . ASP A 1 57 ? -8.338  0.812   -0.429  1.00 0.00 ? 57 ASP A CA   11 
ATOM 10800 C C    . ASP A 1 57 ? -7.654  0.521   0.900   1.00 0.00 ? 57 ASP A C    11 
ATOM 10801 O O    . ASP A 1 57 ? -6.695  1.195   1.272   1.00 0.00 ? 57 ASP A O    11 
ATOM 10802 C CB   . ASP A 1 57 ? -7.683  -0.004  -1.543  1.00 0.00 ? 57 ASP A CB   11 
ATOM 10803 C CG   . ASP A 1 57 ? -8.655  -0.965  -2.201  1.00 0.00 ? 57 ASP A CG   11 
ATOM 10804 O OD1  . ASP A 1 57 ? -9.412  -0.526  -3.092  1.00 0.00 ? 57 ASP A OD1  11 
ATOM 10805 O OD2  . ASP A 1 57 ? -8.661  -2.155  -1.824  1.00 0.00 ? 57 ASP A OD2  11 
ATOM 10806 H H    . ASP A 1 57 ? -8.065  2.869   -0.021  1.00 0.00 ? 57 ASP A H    11 
ATOM 10807 H HA   . ASP A 1 57 ? -9.378  0.531   -0.354  1.00 0.00 ? 57 ASP A HA   11 
ATOM 10808 H HB2  . ASP A 1 57 ? -7.300  0.667   -2.297  1.00 0.00 ? 57 ASP A HB2  11 
ATOM 10809 H HB3  . ASP A 1 57 ? -6.867  -0.572  -1.127  1.00 0.00 ? 57 ASP A HB3  11 
ATOM 10810 N N    . TYR A 1 58 ? -8.162  -0.480  1.613   1.00 0.00 ? 58 TYR A N    11 
ATOM 10811 C CA   . TYR A 1 58 ? -7.613  -0.861  2.911   1.00 0.00 ? 58 TYR A CA   11 
ATOM 10812 C C    . TYR A 1 58 ? -6.760  -2.116  2.813   1.00 0.00 ? 58 TYR A C    11 
ATOM 10813 O O    . TYR A 1 58 ? -6.881  -2.889  1.865   1.00 0.00 ? 58 TYR A O    11 
ATOM 10814 C CB   . TYR A 1 58 ? -8.739  -1.078  3.914   1.00 0.00 ? 58 TYR A CB   11 
ATOM 10815 C CG   . TYR A 1 58 ? -9.340  0.213   4.411   1.00 0.00 ? 58 TYR A CG   11 
ATOM 10816 C CD1  . TYR A 1 58 ? -8.944  1.428   3.871   1.00 0.00 ? 58 TYR A CD1  11 
ATOM 10817 C CD2  . TYR A 1 58 ? -10.300 0.219   5.413   1.00 0.00 ? 58 TYR A CD2  11 
ATOM 10818 C CE1  . TYR A 1 58 ? -9.487  2.617   4.313   1.00 0.00 ? 58 TYR A CE1  11 
ATOM 10819 C CE2  . TYR A 1 58 ? -10.850 1.405   5.862   1.00 0.00 ? 58 TYR A CE2  11 
ATOM 10820 C CZ   . TYR A 1 58 ? -10.441 2.601   5.309   1.00 0.00 ? 58 TYR A CZ   11 
ATOM 10821 O OH   . TYR A 1 58 ? -10.987 3.783   5.754   1.00 0.00 ? 58 TYR A OH   11 
ATOM 10822 H H    . TYR A 1 58 ? -8.929  -0.970  1.259   1.00 0.00 ? 58 TYR A H    11 
ATOM 10823 H HA   . TYR A 1 58 ? -6.993  -0.048  3.257   1.00 0.00 ? 58 TYR A HA   11 
ATOM 10824 H HB2  . TYR A 1 58 ? -9.523  -1.655  3.445   1.00 0.00 ? 58 TYR A HB2  11 
ATOM 10825 H HB3  . TYR A 1 58 ? -8.356  -1.620  4.763   1.00 0.00 ? 58 TYR A HB3  11 
ATOM 10826 H HD1  . TYR A 1 58 ? -8.195  1.435   3.093   1.00 0.00 ? 58 TYR A HD1  11 
ATOM 10827 H HD2  . TYR A 1 58 ? -10.615 -0.720  5.845   1.00 0.00 ? 58 TYR A HD2  11 
ATOM 10828 H HE1  . TYR A 1 58 ? -9.165  3.553   3.878   1.00 0.00 ? 58 TYR A HE1  11 
ATOM 10829 H HE2  . TYR A 1 58 ? -11.596 1.392   6.641   1.00 0.00 ? 58 TYR A HE2  11 
ATOM 10830 H HH   . TYR A 1 58 ? -10.995 4.422   5.038   1.00 0.00 ? 58 TYR A HH   11 
ATOM 10831 N N    . CYS A 1 59 ? -5.885  -2.298  3.798   1.00 0.00 ? 59 CYS A N    11 
ATOM 10832 C CA   . CYS A 1 59 ? -4.983  -3.443  3.824   1.00 0.00 ? 59 CYS A CA   11 
ATOM 10833 C C    . CYS A 1 59 ? -5.414  -4.512  4.831   1.00 0.00 ? 59 CYS A C    11 
ATOM 10834 O O    . CYS A 1 59 ? -5.252  -4.349  6.040   1.00 0.00 ? 59 CYS A O    11 
ATOM 10835 C CB   . CYS A 1 59 ? -3.573  -2.965  4.158   1.00 0.00 ? 59 CYS A CB   11 
ATOM 10836 S SG   . CYS A 1 59 ? -2.549  -2.546  2.711   1.00 0.00 ? 59 CYS A SG   11 
ATOM 10837 H H    . CYS A 1 59 ? -5.834  -1.636  4.517   1.00 0.00 ? 59 CYS A H    11 
ATOM 10838 H HA   . CYS A 1 59 ? -4.976  -3.874  2.841   1.00 0.00 ? 59 CYS A HA   11 
ATOM 10839 H HB2  . CYS A 1 59 ? -3.653  -2.082  4.758   1.00 0.00 ? 59 CYS A HB2  11 
ATOM 10840 H HB3  . CYS A 1 59 ? -3.061  -3.730  4.720   1.00 0.00 ? 59 CYS A HB3  11 
ATOM 10841 N N    . ASN A 1 60 ? -5.933  -5.622  4.309   1.00 0.00 ? 60 ASN A N    11 
ATOM 10842 C CA   . ASN A 1 60 ? -6.360  -6.754  5.130   1.00 0.00 ? 60 ASN A CA   11 
ATOM 10843 C C    . ASN A 1 60 ? -5.500  -7.955  4.785   1.00 0.00 ? 60 ASN A C    11 
ATOM 10844 O O    . ASN A 1 60 ? -4.486  -8.219  5.426   1.00 0.00 ? 60 ASN A O    11 
ATOM 10845 C CB   . ASN A 1 60 ? -7.838  -7.065  4.891   1.00 0.00 ? 60 ASN A CB   11 
ATOM 10846 C CG   . ASN A 1 60 ? -8.748  -6.127  5.658   1.00 0.00 ? 60 ASN A CG   11 
ATOM 10847 O OD1  . ASN A 1 60 ? -9.691  -6.560  6.319   1.00 0.00 ? 60 ASN A OD1  11 
ATOM 10848 N ND2  . ASN A 1 60 ? -8.467  -4.831  5.571   1.00 0.00 ? 60 ASN A ND2  11 
ATOM 10849 H H    . ASN A 1 60 ? -6.009  -5.692  3.336   1.00 0.00 ? 60 ASN A H    11 
ATOM 10850 H HA   . ASN A 1 60 ? -6.208  -6.503  6.160   1.00 0.00 ? 60 ASN A HA   11 
ATOM 10851 H HB2  . ASN A 1 60 ? -8.055  -6.969  3.838   1.00 0.00 ? 60 ASN A HB2  11 
ATOM 10852 H HB3  . ASN A 1 60 ? -8.043  -8.077  5.208   1.00 0.00 ? 60 ASN A HB3  11 
ATOM 10853 H HD21 . ASN A 1 60 ? -7.702  -4.558  5.024   1.00 0.00 ? 60 ASN A HD21 11 
ATOM 10854 H HD22 . ASN A 1 60 ? -9.032  -4.202  6.062   1.00 0.00 ? 60 ASN A HD22 11 
ATOM 10855 N N    . GLY A 1 61 ? -5.876  -8.634  3.719   1.00 0.00 ? 61 GLY A N    11 
ATOM 10856 C CA   . GLY A 1 61 ? -5.093  -9.756  3.236   1.00 0.00 ? 61 GLY A CA   11 
ATOM 10857 C C    . GLY A 1 61 ? -4.105  -9.258  2.202   1.00 0.00 ? 61 GLY A C    11 
ATOM 10858 O O    . GLY A 1 61 ? -3.946  -9.843  1.132   1.00 0.00 ? 61 GLY A O    11 
ATOM 10859 H H    . GLY A 1 61 ? -6.664  -8.336  3.227   1.00 0.00 ? 61 GLY A H    11 
ATOM 10860 H HA2  . GLY A 1 61 ? -4.561  -10.209 4.062   1.00 0.00 ? 61 GLY A HA2  11 
ATOM 10861 H HA3  . GLY A 1 61 ? -5.747  -10.485 2.782   1.00 0.00 ? 61 GLY A HA3  11 
ATOM 10862 N N    . ILE A 1 62 ? -3.503  -8.115  2.527   1.00 0.00 ? 62 ILE A N    11 
ATOM 10863 C CA   . ILE A 1 62 ? -2.570  -7.416  1.650   1.00 0.00 ? 62 ILE A CA   11 
ATOM 10864 C C    . ILE A 1 62 ? -1.122  -7.885  1.741   1.00 0.00 ? 62 ILE A C    11 
ATOM 10865 O O    . ILE A 1 62 ? -0.285  -7.199  2.326   1.00 0.00 ? 62 ILE A O    11 
ATOM 10866 C CB   . ILE A 1 62 ? -2.593  -5.904  1.951   1.00 0.00 ? 62 ILE A CB   11 
ATOM 10867 C CG1  . ILE A 1 62 ? -2.499  -5.589  3.461   1.00 0.00 ? 62 ILE A CG1  11 
ATOM 10868 C CG2  . ILE A 1 62 ? -3.864  -5.295  1.394   1.00 0.00 ? 62 ILE A CG2  11 
ATOM 10869 C CD1  . ILE A 1 62 ? -2.009  -6.706  4.371   1.00 0.00 ? 62 ILE A CD1  11 
ATOM 10870 H H    . ILE A 1 62 ? -3.740  -7.700  3.374   1.00 0.00 ? 62 ILE A H    11 
ATOM 10871 H HA   . ILE A 1 62 ? -2.912  -7.549  0.636   1.00 0.00 ? 62 ILE A HA   11 
ATOM 10872 H HB   . ILE A 1 62 ? -1.756  -5.449  1.443   1.00 0.00 ? 62 ILE A HB   11 
ATOM 10873 H HG12 . ILE A 1 62 ? -1.829  -4.758  3.597   1.00 0.00 ? 62 ILE A HG12 11 
ATOM 10874 H HG13 . ILE A 1 62 ? -3.481  -5.298  3.807   1.00 0.00 ? 62 ILE A HG13 11 
ATOM 10875 H HG21 . ILE A 1 62 ? -4.683  -5.509  2.064   1.00 0.00 ? 62 ILE A HG21 11 
ATOM 10876 H HG22 . ILE A 1 62 ? -4.070  -5.718  0.429   1.00 0.00 ? 62 ILE A HG22 11 
ATOM 10877 H HG23 . ILE A 1 62 ? -3.744  -4.228  1.305   1.00 0.00 ? 62 ILE A HG23 11 
ATOM 10878 H HD11 . ILE A 1 62 ? -1.174  -6.351  4.954   1.00 0.00 ? 62 ILE A HD11 11 
ATOM 10879 H HD12 . ILE A 1 62 ? -1.709  -7.556  3.796   1.00 0.00 ? 62 ILE A HD12 11 
ATOM 10880 H HD13 . ILE A 1 62 ? -2.805  -6.996  5.034   1.00 0.00 ? 62 ILE A HD13 11 
ATOM 10881 N N    . SER A 1 63 ? -0.804  -9.010  1.129   1.00 0.00 ? 63 SER A N    11 
ATOM 10882 C CA   . SER A 1 63 ? 0.569   -9.476  1.132   1.00 0.00 ? 63 SER A CA   11 
ATOM 10883 C C    . SER A 1 63 ? 1.283   -8.887  -0.067  1.00 0.00 ? 63 SER A C    11 
ATOM 10884 O O    . SER A 1 63 ? 1.862   -9.601  -0.886  1.00 0.00 ? 63 SER A O    11 
ATOM 10885 C CB   . SER A 1 63 ? 0.637   -10.993 1.102   1.00 0.00 ? 63 SER A CB   11 
ATOM 10886 O OG   . SER A 1 63 ? -0.248  -11.530 0.134   1.00 0.00 ? 63 SER A OG   11 
ATOM 10887 H H    . SER A 1 63 ? -1.485  -9.509  0.636   1.00 0.00 ? 63 SER A H    11 
ATOM 10888 H HA   . SER A 1 63 ? 1.042   -9.114  2.034   1.00 0.00 ? 63 SER A HA   11 
ATOM 10889 H HB2  . SER A 1 63 ? 1.644   -11.292 0.861   1.00 0.00 ? 63 SER A HB2  11 
ATOM 10890 H HB3  . SER A 1 63 ? 0.368   -11.373 2.075   1.00 0.00 ? 63 SER A HB3  11 
ATOM 10891 H HG   . SER A 1 63 ? -0.437  -12.447 0.346   1.00 0.00 ? 63 SER A HG   11 
ATOM 10892 N N    . ALA A 1 64 ? 1.197   -7.567  -0.166  1.00 0.00 ? 64 ALA A N    11 
ATOM 10893 C CA   . ALA A 1 64 ? 1.789   -6.823  -1.260  1.00 0.00 ? 64 ALA A CA   11 
ATOM 10894 C C    . ALA A 1 64 ? 0.849   -6.809  -2.461  1.00 0.00 ? 64 ALA A C    11 
ATOM 10895 O O    . ALA A 1 64 ? 1.283   -6.804  -3.613  1.00 0.00 ? 64 ALA A O    11 
ATOM 10896 C CB   . ALA A 1 64 ? 3.153   -7.379  -1.628  1.00 0.00 ? 64 ALA A CB   11 
ATOM 10897 H H    . ALA A 1 64 ? 0.696   -7.076  0.518   1.00 0.00 ? 64 ALA A H    11 
ATOM 10898 H HA   . ALA A 1 64 ? 1.924   -5.813  -0.919  1.00 0.00 ? 64 ALA A HA   11 
ATOM 10899 H HB1  . ALA A 1 64 ? 3.391   -8.212  -0.987  1.00 0.00 ? 64 ALA A HB1  11 
ATOM 10900 H HB2  . ALA A 1 64 ? 3.893   -6.608  -1.496  1.00 0.00 ? 64 ALA A HB2  11 
ATOM 10901 H HB3  . ALA A 1 64 ? 3.148   -7.700  -2.657  1.00 0.00 ? 64 ALA A HB3  11 
ATOM 10902 N N    . GLY A 1 65 ? -0.450  -6.791  -2.165  1.00 0.00 ? 65 GLY A N    11 
ATOM 10903 C CA   . GLY A 1 65 ? -1.467  -6.764  -3.201  1.00 0.00 ? 65 GLY A CA   11 
ATOM 10904 C C    . GLY A 1 65 ? -2.731  -6.068  -2.727  1.00 0.00 ? 65 GLY A C    11 
ATOM 10905 O O    . GLY A 1 65 ? -2.736  -4.858  -2.526  1.00 0.00 ? 65 GLY A O    11 
ATOM 10906 H H    . GLY A 1 65 ? -0.722  -6.790  -1.224  1.00 0.00 ? 65 GLY A H    11 
ATOM 10907 H HA2  . GLY A 1 65 ? -1.078  -6.241  -4.063  1.00 0.00 ? 65 GLY A HA2  11 
ATOM 10908 H HA3  . GLY A 1 65 ? -1.709  -7.778  -3.483  1.00 0.00 ? 65 GLY A HA3  11 
ATOM 10909 N N    . CYS A 1 66 ? -3.797  -6.842  -2.536  1.00 0.00 ? 66 CYS A N    11 
ATOM 10910 C CA   . CYS A 1 66 ? -5.078  -6.309  -2.065  1.00 0.00 ? 66 CYS A CA   11 
ATOM 10911 C C    . CYS A 1 66 ? -6.045  -7.431  -1.709  1.00 0.00 ? 66 CYS A C    11 
ATOM 10912 O O    . CYS A 1 66 ? -6.093  -8.460  -2.383  1.00 0.00 ? 66 CYS A O    11 
ATOM 10913 C CB   . CYS A 1 66 ? -5.715  -5.385  -3.106  1.00 0.00 ? 66 CYS A CB   11 
ATOM 10914 S SG   . CYS A 1 66 ? -5.108  -3.673  -3.064  1.00 0.00 ? 66 CYS A SG   11 
ATOM 10915 H H    . CYS A 1 66 ? -3.720  -7.804  -2.706  1.00 0.00 ? 66 CYS A H    11 
ATOM 10916 H HA   . CYS A 1 66 ? -4.881  -5.735  -1.175  1.00 0.00 ? 66 CYS A HA   11 
ATOM 10917 H HB2  . CYS A 1 66 ? -5.516  -5.774  -4.090  1.00 0.00 ? 66 CYS A HB2  11 
ATOM 10918 H HB3  . CYS A 1 66 ? -6.781  -5.355  -2.941  1.00 0.00 ? 66 CYS A HB3  11 
ATOM 10919 N N    . PRO A 1 67 ? -6.834  -7.245  -0.637  1.00 0.00 ? 67 PRO A N    11 
ATOM 10920 C CA   . PRO A 1 67 ? -7.808  -8.246  -0.190  1.00 0.00 ? 67 PRO A CA   11 
ATOM 10921 C C    . PRO A 1 67 ? -8.877  -8.519  -1.244  1.00 0.00 ? 67 PRO A C    11 
ATOM 10922 O O    . PRO A 1 67 ? -8.757  -9.453  -2.037  1.00 0.00 ? 67 PRO A O    11 
ATOM 10923 C CB   . PRO A 1 67 ? -8.438  -7.615  1.058   1.00 0.00 ? 67 PRO A CB   11 
ATOM 10924 C CG   . PRO A 1 67 ? -8.154  -6.156  0.943   1.00 0.00 ? 67 PRO A CG   11 
ATOM 10925 C CD   . PRO A 1 67 ? -6.842  -6.046  0.221   1.00 0.00 ? 67 PRO A CD   11 
ATOM 10926 H HA   . PRO A 1 67 ? -7.325  -9.174  0.077   1.00 0.00 ? 67 PRO A HA   11 
ATOM 10927 H HB2  . PRO A 1 67 ? -9.501  -7.810  1.063   1.00 0.00 ? 67 PRO A HB2  11 
ATOM 10928 H HB3  . PRO A 1 67 ? -7.987  -8.036  1.943   1.00 0.00 ? 67 PRO A HB3  11 
ATOM 10929 H HG2  . PRO A 1 67 ? -8.936  -5.672  0.377   1.00 0.00 ? 67 PRO A HG2  11 
ATOM 10930 H HG3  . PRO A 1 67 ? -8.077  -5.719  1.928   1.00 0.00 ? 67 PRO A HG3  11 
ATOM 10931 H HD2  . PRO A 1 67 ? -6.812  -5.142  -0.369  1.00 0.00 ? 67 PRO A HD2  11 
ATOM 10932 H HD3  . PRO A 1 67 ? -6.024  -6.067  0.924   1.00 0.00 ? 67 PRO A HD3  11 
ATOM 10933 N N    . ARG A 1 68 ? -9.919  -7.696  -1.246  1.00 0.00 ? 68 ARG A N    11 
ATOM 10934 C CA   . ARG A 1 68 ? -11.010 -7.842  -2.201  1.00 0.00 ? 68 ARG A CA   11 
ATOM 10935 C C    . ARG A 1 68 ? -11.453 -6.470  -2.715  1.00 0.00 ? 68 ARG A C    11 
ATOM 10936 O O    . ARG A 1 68 ? -10.632 -5.707  -3.224  1.00 0.00 ? 68 ARG A O    11 
ATOM 10937 C CB   . ARG A 1 68 ? -12.177 -8.592  -1.553  1.00 0.00 ? 68 ARG A CB   11 
ATOM 10938 C CG   . ARG A 1 68 ? -11.828 -10.008 -1.127  1.00 0.00 ? 68 ARG A CG   11 
ATOM 10939 C CD   . ARG A 1 68 ? -13.071 -10.872 -0.996  1.00 0.00 ? 68 ARG A CD   11 
ATOM 10940 N NE   . ARG A 1 68 ? -13.290 -11.697 -2.180  1.00 0.00 ? 68 ARG A NE   11 
ATOM 10941 C CZ   . ARG A 1 68 ? -14.026 -12.803 -2.180  1.00 0.00 ? 68 ARG A CZ   11 
ATOM 10942 N NH1  . ARG A 1 68 ? -14.611 -13.212 -1.063  1.00 0.00 ? 68 ARG A NH1  11 
ATOM 10943 N NH2  . ARG A 1 68 ? -14.178 -13.501 -3.297  1.00 0.00 ? 68 ARG A NH2  11 
ATOM 10944 H H    . ARG A 1 68 ? -9.956  -6.970  -0.590  1.00 0.00 ? 68 ARG A H    11 
ATOM 10945 H HA   . ARG A 1 68 ? -10.641 -8.421  -3.035  1.00 0.00 ? 68 ARG A HA   11 
ATOM 10946 H HB2  . ARG A 1 68 ? -12.501 -8.046  -0.680  1.00 0.00 ? 68 ARG A HB2  11 
ATOM 10947 H HB3  . ARG A 1 68 ? -12.993 -8.643  -2.259  1.00 0.00 ? 68 ARG A HB3  11 
ATOM 10948 H HG2  . ARG A 1 68 ? -11.174 -10.445 -1.866  1.00 0.00 ? 68 ARG A HG2  11 
ATOM 10949 H HG3  . ARG A 1 68 ? -11.323 -9.972  -0.172  1.00 0.00 ? 68 ARG A HG3  11 
ATOM 10950 H HD2  . ARG A 1 68 ? -12.958 -11.516 -0.137  1.00 0.00 ? 68 ARG A HD2  11 
ATOM 10951 H HD3  . ARG A 1 68 ? -13.927 -10.229 -0.853  1.00 0.00 ? 68 ARG A HD3  11 
ATOM 10952 H HE   . ARG A 1 68 ? -12.866 -11.413 -3.017  1.00 0.00 ? 68 ARG A HE   11 
ATOM 10953 H HH11 . ARG A 1 68 ? -14.499 -12.688 -0.219  1.00 0.00 ? 68 ARG A HH11 11 
ATOM 10954 H HH12 . ARG A 1 68 ? -15.165 -14.045 -1.064  1.00 0.00 ? 68 ARG A HH12 11 
ATOM 10955 H HH21 . ARG A 1 68 ? -13.738 -13.195 -4.142  1.00 0.00 ? 68 ARG A HH21 11 
ATOM 10956 H HH22 . ARG A 1 68 ? -14.732 -14.333 -3.295  1.00 0.00 ? 68 ARG A HH22 11 
ATOM 10957 N N    . ASN A 1 69 ? -12.740 -6.147  -2.585  1.00 0.00 ? 69 ASN A N    11 
ATOM 10958 C CA   . ASN A 1 69 ? -13.239 -4.858  -3.045  1.00 0.00 ? 69 ASN A CA   11 
ATOM 10959 C C    . ASN A 1 69 ? -14.184 -4.208  -2.029  1.00 0.00 ? 69 ASN A C    11 
ATOM 10960 O O    . ASN A 1 69 ? -15.121 -3.511  -2.416  1.00 0.00 ? 69 ASN A O    11 
ATOM 10961 C CB   . ASN A 1 69 ? -13.953 -5.020  -4.387  1.00 0.00 ? 69 ASN A CB   11 
ATOM 10962 C CG   . ASN A 1 69 ? -12.989 -5.295  -5.524  1.00 0.00 ? 69 ASN A CG   11 
ATOM 10963 O OD1  . ASN A 1 69 ? -12.018 -4.565  -5.720  1.00 0.00 ? 69 ASN A OD1  11 
ATOM 10964 N ND2  . ASN A 1 69 ? -13.254 -6.354  -6.280  1.00 0.00 ? 69 ASN A ND2  11 
ATOM 10965 H H    . ASN A 1 69 ? -13.362 -6.779  -2.173  1.00 0.00 ? 69 ASN A H    11 
ATOM 10966 H HA   . ASN A 1 69 ? -12.387 -4.210  -3.183  1.00 0.00 ? 69 ASN A HA   11 
ATOM 10967 H HB2  . ASN A 1 69 ? -14.649 -5.843  -4.321  1.00 0.00 ? 69 ASN A HB2  11 
ATOM 10968 H HB3  . ASN A 1 69 ? -14.496 -4.113  -4.610  1.00 0.00 ? 69 ASN A HB3  11 
ATOM 10969 H HD21 . ASN A 1 69 ? -14.045 -6.890  -6.065  1.00 0.00 ? 69 ASN A HD21 11 
ATOM 10970 H HD22 . ASN A 1 69 ? -12.647 -6.556  -7.022  1.00 0.00 ? 69 ASN A HD22 11 
ATOM 10971 N N    . PRO A 1 70 ? -13.956 -4.410  -0.715  1.00 0.00 ? 70 PRO A N    11 
ATOM 10972 C CA   . PRO A 1 70 ? -14.800 -3.819  0.323   1.00 0.00 ? 70 PRO A CA   11 
ATOM 10973 C C    . PRO A 1 70 ? -14.401 -2.380  0.630   1.00 0.00 ? 70 PRO A C    11 
ATOM 10974 O O    . PRO A 1 70 ? -14.920 -1.764  1.561   1.00 0.00 ? 70 PRO A O    11 
ATOM 10975 C CB   . PRO A 1 70 ? -14.523 -4.714  1.525   1.00 0.00 ? 70 PRO A CB   11 
ATOM 10976 C CG   . PRO A 1 70 ? -13.097 -5.107  1.358   1.00 0.00 ? 70 PRO A CG   11 
ATOM 10977 C CD   . PRO A 1 70 ? -12.863 -5.216  -0.129  1.00 0.00 ? 70 PRO A CD   11 
ATOM 10978 H HA   . PRO A 1 70 ? -15.846 -3.860  0.064   1.00 0.00 ? 70 PRO A HA   11 
ATOM 10979 H HB2  . PRO A 1 70 ? -14.680 -4.157  2.438   1.00 0.00 ? 70 PRO A HB2  11 
ATOM 10980 H HB3  . PRO A 1 70 ? -15.176 -5.573  1.500   1.00 0.00 ? 70 PRO A HB3  11 
ATOM 10981 H HG2  . PRO A 1 70 ? -12.456 -4.350  1.784   1.00 0.00 ? 70 PRO A HG2  11 
ATOM 10982 H HG3  . PRO A 1 70 ? -12.921 -6.060  1.835   1.00 0.00 ? 70 PRO A HG3  11 
ATOM 10983 H HD2  . PRO A 1 70 ? -11.899 -4.805  -0.390  1.00 0.00 ? 70 PRO A HD2  11 
ATOM 10984 H HD3  . PRO A 1 70 ? -12.933 -6.246  -0.440  1.00 0.00 ? 70 PRO A HD3  11 
ATOM 10985 N N    . PHE A 1 71 ? -13.466 -1.857  -0.156  1.00 0.00 ? 71 PHE A N    11 
ATOM 10986 C CA   . PHE A 1 71 ? -12.978 -0.497  0.027   1.00 0.00 ? 71 PHE A CA   11 
ATOM 10987 C C    . PHE A 1 71 ? -13.104 0.304   -1.275  1.00 0.00 ? 71 PHE A C    11 
ATOM 10988 O O    . PHE A 1 71 ? -14.176 0.336   -1.879  1.00 0.00 ? 71 PHE A O    11 
ATOM 10989 C CB   . PHE A 1 71 ? -11.530 -0.546  0.512   1.00 0.00 ? 71 PHE A CB   11 
ATOM 10990 C CG   . PHE A 1 71 ? -11.281 -1.637  1.515   1.00 0.00 ? 71 PHE A CG   11 
ATOM 10991 C CD1  . PHE A 1 71 ? -11.868 -1.590  2.770   1.00 0.00 ? 71 PHE A CD1  11 
ATOM 10992 C CD2  . PHE A 1 71 ? -10.464 -2.711  1.201   1.00 0.00 ? 71 PHE A CD2  11 
ATOM 10993 C CE1  . PHE A 1 71 ? -11.644 -2.594  3.693   1.00 0.00 ? 71 PHE A CE1  11 
ATOM 10994 C CE2  . PHE A 1 71 ? -10.236 -3.718  2.120   1.00 0.00 ? 71 PHE A CE2  11 
ATOM 10995 C CZ   . PHE A 1 71 ? -10.826 -3.660  3.368   1.00 0.00 ? 71 PHE A CZ   11 
ATOM 10996 H H    . PHE A 1 71 ? -13.088 -2.404  -0.875  1.00 0.00 ? 71 PHE A H    11 
ATOM 10997 H HA   . PHE A 1 71 ? -13.585 -0.025  0.787   1.00 0.00 ? 71 PHE A HA   11 
ATOM 10998 H HB2  . PHE A 1 71 ? -10.880 -0.716  -0.332  1.00 0.00 ? 71 PHE A HB2  11 
ATOM 10999 H HB3  . PHE A 1 71 ? -11.279 0.397   0.974   1.00 0.00 ? 71 PHE A HB3  11 
ATOM 11000 H HD1  . PHE A 1 71 ? -12.508 -0.758  3.025   1.00 0.00 ? 71 PHE A HD1  11 
ATOM 11001 H HD2  . PHE A 1 71 ? -10.001 -2.758  0.226   1.00 0.00 ? 71 PHE A HD2  11 
ATOM 11002 H HE1  . PHE A 1 71 ? -12.107 -2.546  4.667   1.00 0.00 ? 71 PHE A HE1  11 
ATOM 11003 H HE2  . PHE A 1 71 ? -9.597  -4.550  1.863   1.00 0.00 ? 71 PHE A HE2  11 
ATOM 11004 H HZ   . PHE A 1 71 ? -10.649 -4.445  4.087   1.00 0.00 ? 71 PHE A HZ   11 
ATOM 11005 N N    . HIS A 1 72 ? -12.020 0.950   -1.711  1.00 0.00 ? 72 HIS A N    11 
ATOM 11006 C CA   . HIS A 1 72 ? -12.052 1.734   -2.939  1.00 0.00 ? 72 HIS A CA   11 
ATOM 11007 C C    . HIS A 1 72 ? -12.979 2.935   -2.790  1.00 0.00 ? 72 HIS A C    11 
ATOM 11008 O O    . HIS A 1 72 ? -12.526 4.069   -2.671  1.00 0.00 ? 72 HIS A O    11 
ATOM 11009 C CB   . HIS A 1 72 ? -12.508 0.869   -4.115  1.00 0.00 ? 72 HIS A CB   11 
ATOM 11010 C CG   . HIS A 1 72 ? -12.752 1.649   -5.369  1.00 0.00 ? 72 HIS A CG   11 
ATOM 11011 N ND1  . HIS A 1 72 ? -12.009 1.479   -6.519  1.00 0.00 ? 72 HIS A ND1  11 
ATOM 11012 C CD2  . HIS A 1 72 ? -13.663 2.611   -5.651  1.00 0.00 ? 72 HIS A CD2  11 
ATOM 11013 C CE1  . HIS A 1 72 ? -12.452 2.304   -7.452  1.00 0.00 ? 72 HIS A CE1  11 
ATOM 11014 N NE2  . HIS A 1 72 ? -13.455 3.001   -6.951  1.00 0.00 ? 72 HIS A NE2  11 
ATOM 11015 H H    . HIS A 1 72 ? -11.186 0.902   -1.203  1.00 0.00 ? 72 HIS A H    11 
ATOM 11016 H HA   . HIS A 1 72 ? -11.051 2.089   -3.132  1.00 0.00 ? 72 HIS A HA   11 
ATOM 11017 H HB2  . HIS A 1 72 ? -11.750 0.130   -4.326  1.00 0.00 ? 72 HIS A HB2  11 
ATOM 11018 H HB3  . HIS A 1 72 ? -13.428 0.368   -3.849  1.00 0.00 ? 72 HIS A HB3  11 
ATOM 11019 H HD1  . HIS A 1 72 ? -11.267 0.850   -6.634  1.00 0.00 ? 72 HIS A HD1  11 
ATOM 11020 H HD2  . HIS A 1 72 ? -14.414 2.999   -4.978  1.00 0.00 ? 72 HIS A HD2  11 
ATOM 11021 H HE1  . HIS A 1 72 ? -12.060 2.393   -8.455  1.00 0.00 ? 72 HIS A HE1  11 
ATOM 11022 H HE2  . HIS A 1 72 ? -13.898 3.753   -7.397  1.00 0.00 ? 72 HIS A HE2  11 
ATOM 11023 N N    . ALA A 1 73 ? -14.281 2.680   -2.797  1.00 0.00 ? 73 ALA A N    11 
ATOM 11024 C CA   . ALA A 1 73 ? -15.262 3.747   -2.662  1.00 0.00 ? 73 ALA A CA   11 
ATOM 11025 C C    . ALA A 1 73 ? -15.908 3.728   -1.281  1.00 0.00 ? 73 ALA A C    11 
ATOM 11026 O O    . ALA A 1 73 ? -16.326 4.806   -0.809  1.00 0.00 ? 73 ALA A O    11 
ATOM 11027 C CB   . ALA A 1 73 ? -16.321 3.631   -3.747  1.00 0.00 ? 73 ALA A CB   11 
ATOM 11028 O OXT  . ALA A 1 73 ? -15.991 2.635   -0.683  1.00 0.00 ? 73 ALA A OXT  11 
ATOM 11029 H H    . ALA A 1 73 ? -14.588 1.754   -2.894  1.00 0.00 ? 73 ALA A H    11 
ATOM 11030 H HA   . ALA A 1 73 ? -14.748 4.689   -2.793  1.00 0.00 ? 73 ALA A HA   11 
ATOM 11031 H HB1  . ALA A 1 73 ? -16.344 2.617   -4.119  1.00 0.00 ? 73 ALA A HB1  11 
ATOM 11032 H HB2  . ALA A 1 73 ? -16.082 4.306   -4.556  1.00 0.00 ? 73 ALA A HB2  11 
ATOM 11033 H HB3  . ALA A 1 73 ? -17.286 3.887   -3.337  1.00 0.00 ? 73 ALA A HB3  11 
ATOM 11034 N N    . GLU A 1 1  ? -9.734  9.350   8.514   1.00 0.00 ? 1  GLU A N    12 
ATOM 11035 C CA   . GLU A 1 1  ? -8.816  8.487   9.303   1.00 0.00 ? 1  GLU A CA   12 
ATOM 11036 C C    . GLU A 1 1  ? -8.468  7.213   8.541   1.00 0.00 ? 1  GLU A C    12 
ATOM 11037 O O    . GLU A 1 1  ? -8.944  6.128   8.877   1.00 0.00 ? 1  GLU A O    12 
ATOM 11038 C CB   . GLU A 1 1  ? -9.495  8.140   10.630  1.00 0.00 ? 1  GLU A CB   12 
ATOM 11039 C CG   . GLU A 1 1  ? -8.627  8.412   11.847  1.00 0.00 ? 1  GLU A CG   12 
ATOM 11040 C CD   . GLU A 1 1  ? -9.290  7.985   13.142  1.00 0.00 ? 1  GLU A CD   12 
ATOM 11041 O OE1  . GLU A 1 1  ? -10.270 8.642   13.552  1.00 0.00 ? 1  GLU A OE1  12 
ATOM 11042 O OE2  . GLU A 1 1  ? -8.831  6.992   13.745  1.00 0.00 ? 1  GLU A OE2  12 
ATOM 11043 H H1   . GLU A 1 1  ? -9.178  9.798   7.759   1.00 0.00 ? 1  GLU A H1   12 
ATOM 11044 H H2   . GLU A 1 1  ? -10.133 10.062  9.161   1.00 0.00 ? 1  GLU A H2   12 
ATOM 11045 H H3   . GLU A 1 1  ? -10.479 8.743   8.119   1.00 0.00 ? 1  GLU A H3   12 
ATOM 11046 H HA   . GLU A 1 1  ? -7.910  9.039   9.501   1.00 0.00 ? 1  GLU A HA   12 
ATOM 11047 H HB2  . GLU A 1 1  ? -10.399 8.723   10.721  1.00 0.00 ? 1  GLU A HB2  12 
ATOM 11048 H HB3  . GLU A 1 1  ? -9.753  7.091   10.625  1.00 0.00 ? 1  GLU A HB3  12 
ATOM 11049 H HG2  . GLU A 1 1  ? -7.699  7.871   11.741  1.00 0.00 ? 1  GLU A HG2  12 
ATOM 11050 H HG3  . GLU A 1 1  ? -8.422  9.472   11.898  1.00 0.00 ? 1  GLU A HG3  12 
ATOM 11051 N N    . ALA A 1 2  ? -7.635  7.351   7.515   1.00 0.00 ? 2  ALA A N    12 
ATOM 11052 C CA   . ALA A 1 2  ? -7.224  6.210   6.706   1.00 0.00 ? 2  ALA A CA   12 
ATOM 11053 C C    . ALA A 1 2  ? -5.918  6.496   5.973   1.00 0.00 ? 2  ALA A C    12 
ATOM 11054 O O    . ALA A 1 2  ? -4.881  5.906   6.277   1.00 0.00 ? 2  ALA A O    12 
ATOM 11055 C CB   . ALA A 1 2  ? -8.319  5.844   5.716   1.00 0.00 ? 2  ALA A CB   12 
ATOM 11056 H H    . ALA A 1 2  ? -7.289  8.242   7.296   1.00 0.00 ? 2  ALA A H    12 
ATOM 11057 H HA   . ALA A 1 2  ? -7.076  5.369   7.368   1.00 0.00 ? 2  ALA A HA   12 
ATOM 11058 H HB1  . ALA A 1 2  ? -9.274  6.175   6.097   1.00 0.00 ? 2  ALA A HB1  12 
ATOM 11059 H HB2  . ALA A 1 2  ? -8.338  4.773   5.579   1.00 0.00 ? 2  ALA A HB2  12 
ATOM 11060 H HB3  . ALA A 1 2  ? -8.123  6.325   4.769   1.00 0.00 ? 2  ALA A HB3  12 
ATOM 11061 N N    . GLY A 1 3  ? -5.975  7.405   5.005   1.00 0.00 ? 3  GLY A N    12 
ATOM 11062 C CA   . GLY A 1 3  ? -4.791  7.754   4.241   1.00 0.00 ? 3  GLY A CA   12 
ATOM 11063 C C    . GLY A 1 3  ? -3.529  7.740   5.085   1.00 0.00 ? 3  GLY A C    12 
ATOM 11064 O O    . GLY A 1 3  ? -3.231  8.710   5.781   1.00 0.00 ? 3  GLY A O    12 
ATOM 11065 H H    . GLY A 1 3  ? -6.830  7.843   4.806   1.00 0.00 ? 3  GLY A H    12 
ATOM 11066 H HA2  . GLY A 1 3  ? -4.678  7.050   3.431   1.00 0.00 ? 3  GLY A HA2  12 
ATOM 11067 H HA3  . GLY A 1 3  ? -4.923  8.743   3.828   1.00 0.00 ? 3  GLY A HA3  12 
ATOM 11068 N N    . GLU A 1 4  ? -2.785  6.638   5.024   1.00 0.00 ? 4  GLU A N    12 
ATOM 11069 C CA   . GLU A 1 4  ? -1.550  6.507   5.790   1.00 0.00 ? 4  GLU A CA   12 
ATOM 11070 C C    . GLU A 1 4  ? -0.539  7.574   5.382   1.00 0.00 ? 4  GLU A C    12 
ATOM 11071 O O    . GLU A 1 4  ? -0.769  8.336   4.443   1.00 0.00 ? 4  GLU A O    12 
ATOM 11072 C CB   . GLU A 1 4  ? -0.947  5.115   5.592   1.00 0.00 ? 4  GLU A CB   12 
ATOM 11073 C CG   . GLU A 1 4  ? -1.612  4.037   6.432   1.00 0.00 ? 4  GLU A CG   12 
ATOM 11074 C CD   . GLU A 1 4  ? -0.715  2.836   6.656   1.00 0.00 ? 4  GLU A CD   12 
ATOM 11075 O OE1  . GLU A 1 4  ? 0.520   3.017   6.707   1.00 0.00 ? 4  GLU A OE1  12 
ATOM 11076 O OE2  . GLU A 1 4  ? -1.247  1.712   6.781   1.00 0.00 ? 4  GLU A OE2  12 
ATOM 11077 H H    . GLU A 1 4  ? -3.073  5.896   4.451   1.00 0.00 ? 4  GLU A H    12 
ATOM 11078 H HA   . GLU A 1 4  ? -1.793  6.638   6.833   1.00 0.00 ? 4  GLU A HA   12 
ATOM 11079 H HB2  . GLU A 1 4  ? -1.040  4.839   4.552   1.00 0.00 ? 4  GLU A HB2  12 
ATOM 11080 H HB3  . GLU A 1 4  ? 0.101   5.149   5.853   1.00 0.00 ? 4  GLU A HB3  12 
ATOM 11081 H HG2  . GLU A 1 4  ? -1.871  4.457   7.393   1.00 0.00 ? 4  GLU A HG2  12 
ATOM 11082 H HG3  . GLU A 1 4  ? -2.510  3.710   5.930   1.00 0.00 ? 4  GLU A HG3  12 
ATOM 11083 N N    . GLU A 1 5  ? 0.582   7.623   6.096   1.00 0.00 ? 5  GLU A N    12 
ATOM 11084 C CA   . GLU A 1 5  ? 1.630   8.597   5.810   1.00 0.00 ? 5  GLU A CA   12 
ATOM 11085 C C    . GLU A 1 5  ? 2.330   8.271   4.494   1.00 0.00 ? 5  GLU A C    12 
ATOM 11086 O O    . GLU A 1 5  ? 1.784   7.562   3.649   1.00 0.00 ? 5  GLU A O    12 
ATOM 11087 C CB   . GLU A 1 5  ? 2.649   8.629   6.950   1.00 0.00 ? 5  GLU A CB   12 
ATOM 11088 C CG   . GLU A 1 5  ? 2.016   8.610   8.331   1.00 0.00 ? 5  GLU A CG   12 
ATOM 11089 C CD   . GLU A 1 5  ? 1.892   9.995   8.934   1.00 0.00 ? 5  GLU A CD   12 
ATOM 11090 O OE1  . GLU A 1 5  ? 2.714   10.869  8.588   1.00 0.00 ? 5  GLU A OE1  12 
ATOM 11091 O OE2  . GLU A 1 5  ? 0.972   10.206  9.753   1.00 0.00 ? 5  GLU A OE2  12 
ATOM 11092 H H    . GLU A 1 5  ? 0.707   6.989   6.833   1.00 0.00 ? 5  GLU A H    12 
ATOM 11093 H HA   . GLU A 1 5  ? 1.166   9.568   5.726   1.00 0.00 ? 5  GLU A HA   12 
ATOM 11094 H HB2  . GLU A 1 5  ? 3.297   7.769   6.862   1.00 0.00 ? 5  GLU A HB2  12 
ATOM 11095 H HB3  . GLU A 1 5  ? 3.243   9.526   6.861   1.00 0.00 ? 5  GLU A HB3  12 
ATOM 11096 H HG2  . GLU A 1 5  ? 1.030   8.177   8.255   1.00 0.00 ? 5  GLU A HG2  12 
ATOM 11097 H HG3  . GLU A 1 5  ? 2.626   8.002   8.984   1.00 0.00 ? 5  GLU A HG3  12 
ATOM 11098 N N    . CYS A 1 6  ? 3.543   8.791   4.327   1.00 0.00 ? 6  CYS A N    12 
ATOM 11099 C CA   . CYS A 1 6  ? 4.314   8.552   3.113   1.00 0.00 ? 6  CYS A CA   12 
ATOM 11100 C C    . CYS A 1 6  ? 3.543   9.023   1.882   1.00 0.00 ? 6  CYS A C    12 
ATOM 11101 O O    . CYS A 1 6  ? 2.313   8.999   1.864   1.00 0.00 ? 6  CYS A O    12 
ATOM 11102 C CB   . CYS A 1 6  ? 4.650   7.064   2.989   1.00 0.00 ? 6  CYS A CB   12 
ATOM 11103 S SG   . CYS A 1 6  ? 5.592   6.630   1.491   1.00 0.00 ? 6  CYS A SG   12 
ATOM 11104 H H    . CYS A 1 6  ? 3.927   9.348   5.037   1.00 0.00 ? 6  CYS A H    12 
ATOM 11105 H HA   . CYS A 1 6  ? 5.232   9.115   3.186   1.00 0.00 ? 6  CYS A HA   12 
ATOM 11106 H HB2  . CYS A 1 6  ? 5.239   6.764   3.842   1.00 0.00 ? 6  CYS A HB2  12 
ATOM 11107 H HB3  . CYS A 1 6  ? 3.731   6.495   2.976   1.00 0.00 ? 6  CYS A HB3  12 
ATOM 11108 N N    . ASP A 1 7  ? 4.271   9.457   0.857   1.00 0.00 ? 7  ASP A N    12 
ATOM 11109 C CA   . ASP A 1 7  ? 3.646   9.938   -0.372  1.00 0.00 ? 7  ASP A CA   12 
ATOM 11110 C C    . ASP A 1 7  ? 4.449   9.515   -1.598  1.00 0.00 ? 7  ASP A C    12 
ATOM 11111 O O    . ASP A 1 7  ? 4.403   10.169  -2.640  1.00 0.00 ? 7  ASP A O    12 
ATOM 11112 C CB   . ASP A 1 7  ? 3.513   11.462  -0.337  1.00 0.00 ? 7  ASP A CB   12 
ATOM 11113 C CG   . ASP A 1 7  ? 2.598   11.937  0.774   1.00 0.00 ? 7  ASP A CG   12 
ATOM 11114 O OD1  . ASP A 1 7  ? 1.422   11.517  0.795   1.00 0.00 ? 7  ASP A OD1  12 
ATOM 11115 O OD2  . ASP A 1 7  ? 3.057   12.728  1.624   1.00 0.00 ? 7  ASP A OD2  12 
ATOM 11116 H H    . ASP A 1 7  ? 5.248   9.458   0.930   1.00 0.00 ? 7  ASP A H    12 
ATOM 11117 H HA   . ASP A 1 7  ? 2.661   9.502   -0.434  1.00 0.00 ? 7  ASP A HA   12 
ATOM 11118 H HB2  . ASP A 1 7  ? 4.489   11.899  -0.185  1.00 0.00 ? 7  ASP A HB2  12 
ATOM 11119 H HB3  . ASP A 1 7  ? 3.112   11.803  -1.280  1.00 0.00 ? 7  ASP A HB3  12 
ATOM 11120 N N    . CYS A 1 8  ? 5.184   8.416   -1.467  1.00 0.00 ? 8  CYS A N    12 
ATOM 11121 C CA   . CYS A 1 8  ? 5.998   7.902   -2.563  1.00 0.00 ? 8  CYS A CA   12 
ATOM 11122 C C    . CYS A 1 8  ? 5.197   6.962   -3.466  1.00 0.00 ? 8  CYS A C    12 
ATOM 11123 O O    . CYS A 1 8  ? 5.712   6.486   -4.478  1.00 0.00 ? 8  CYS A O    12 
ATOM 11124 C CB   . CYS A 1 8  ? 7.164   7.091   -2.033  1.00 0.00 ? 8  CYS A CB   12 
ATOM 11125 S SG   . CYS A 1 8  ? 8.409   7.940   -1.018  1.00 0.00 ? 8  CYS A SG   12 
ATOM 11126 H H    . CYS A 1 8  ? 5.180   7.938   -0.612  1.00 0.00 ? 8  CYS A H    12 
ATOM 11127 H HA   . CYS A 1 8  ? 6.370   8.734   -3.140  1.00 0.00 ? 8  CYS A HA   12 
ATOM 11128 H HB2  . CYS A 1 8  ? 6.760   6.308   -1.424  1.00 0.00 ? 8  CYS A HB2  12 
ATOM 11129 H HB3  . CYS A 1 8  ? 7.675   6.657   -2.877  1.00 0.00 ? 8  CYS A HB3  12 
ATOM 11130 N N    . GLY A 1 9  ? 3.971   6.641   -3.062  1.00 0.00 ? 9  GLY A N    12 
ATOM 11131 C CA   . GLY A 1 9  ? 3.153   5.712   -3.822  1.00 0.00 ? 9  GLY A CA   12 
ATOM 11132 C C    . GLY A 1 9  ? 2.953   4.427   -3.051  1.00 0.00 ? 9  GLY A C    12 
ATOM 11133 O O    . GLY A 1 9  ? 3.299   4.361   -1.874  1.00 0.00 ? 9  GLY A O    12 
ATOM 11134 H H    . GLY A 1 9  ? 3.634   6.999   -2.218  1.00 0.00 ? 9  GLY A H    12 
ATOM 11135 H HA2  . GLY A 1 9  ? 2.191   6.165   -4.019  1.00 0.00 ? 9  GLY A HA2  12 
ATOM 11136 H HA3  . GLY A 1 9  ? 3.641   5.491   -4.759  1.00 0.00 ? 9  GLY A HA3  12 
ATOM 11137 N N    . SER A 1 10 ? 2.408   3.394   -3.682  1.00 0.00 ? 10 SER A N    12 
ATOM 11138 C CA   . SER A 1 10 ? 2.213   2.144   -2.965  1.00 0.00 ? 10 SER A CA   12 
ATOM 11139 C C    . SER A 1 10 ? 1.843   0.964   -3.863  1.00 0.00 ? 10 SER A C    12 
ATOM 11140 O O    . SER A 1 10 ? 2.696   0.135   -4.179  1.00 0.00 ? 10 SER A O    12 
ATOM 11141 C CB   . SER A 1 10 ? 1.185   2.326   -1.854  1.00 0.00 ? 10 SER A CB   12 
ATOM 11142 O OG   . SER A 1 10 ? 1.770   2.917   -0.708  1.00 0.00 ? 10 SER A OG   12 
ATOM 11143 H H    . SER A 1 10 ? 2.144   3.470   -4.623  1.00 0.00 ? 10 SER A H    12 
ATOM 11144 H HA   . SER A 1 10 ? 3.145   1.911   -2.507  1.00 0.00 ? 10 SER A HA   12 
ATOM 11145 H HB2  . SER A 1 10 ? 0.388   2.966   -2.201  1.00 0.00 ? 10 SER A HB2  12 
ATOM 11146 H HB3  . SER A 1 10 ? 0.788   1.365   -1.587  1.00 0.00 ? 10 SER A HB3  12 
ATOM 11147 H HG   . SER A 1 10 ? 2.707   2.711   -0.685  1.00 0.00 ? 10 SER A HG   12 
ATOM 11148 N N    . PRO A 1 11 ? 0.574   0.849   -4.272  1.00 0.00 ? 11 PRO A N    12 
ATOM 11149 C CA   . PRO A 1 11 ? 0.125   -0.262  -5.113  1.00 0.00 ? 11 PRO A CA   12 
ATOM 11150 C C    . PRO A 1 11 ? 0.635   -0.145  -6.540  1.00 0.00 ? 11 PRO A C    12 
ATOM 11151 O O    . PRO A 1 11 ? 0.086   0.599   -7.353  1.00 0.00 ? 11 PRO A O    12 
ATOM 11152 C CB   . PRO A 1 11 ? -1.395  -0.145  -5.054  1.00 0.00 ? 11 PRO A CB   12 
ATOM 11153 C CG   . PRO A 1 11 ? -1.645  1.304   -4.827  1.00 0.00 ? 11 PRO A CG   12 
ATOM 11154 C CD   . PRO A 1 11 ? -0.523  1.773   -3.945  1.00 0.00 ? 11 PRO A CD   12 
ATOM 11155 H HA   . PRO A 1 11 ? 0.431   -1.213  -4.702  1.00 0.00 ? 11 PRO A HA   12 
ATOM 11156 H HB2  . PRO A 1 11 ? -1.821  -0.485  -5.982  1.00 0.00 ? 11 PRO A HB2  12 
ATOM 11157 H HB3  . PRO A 1 11 ? -1.768  -0.741  -4.233  1.00 0.00 ? 11 PRO A HB3  12 
ATOM 11158 H HG2  . PRO A 1 11 ? -1.630  1.832   -5.770  1.00 0.00 ? 11 PRO A HG2  12 
ATOM 11159 H HG3  . PRO A 1 11 ? -2.595  1.441   -4.333  1.00 0.00 ? 11 PRO A HG3  12 
ATOM 11160 H HD2  . PRO A 1 11 ? -0.250  2.790   -4.182  1.00 0.00 ? 11 PRO A HD2  12 
ATOM 11161 H HD3  . PRO A 1 11 ? -0.797  1.687   -2.904  1.00 0.00 ? 11 PRO A HD3  12 
ATOM 11162 N N    . GLY A 1 12 ? 1.709   -0.871  -6.827  1.00 0.00 ? 12 GLY A N    12 
ATOM 11163 C CA   . GLY A 1 12 ? 2.307   -0.826  -8.147  1.00 0.00 ? 12 GLY A CA   12 
ATOM 11164 C C    . GLY A 1 12 ? 3.528   0.064   -8.152  1.00 0.00 ? 12 GLY A C    12 
ATOM 11165 O O    . GLY A 1 12 ? 4.402   -0.055  -9.010  1.00 0.00 ? 12 GLY A O    12 
ATOM 11166 H H    . GLY A 1 12 ? 2.113   -1.430  -6.126  1.00 0.00 ? 12 GLY A H    12 
ATOM 11167 H HA2  . GLY A 1 12 ? 2.592   -1.825  -8.442  1.00 0.00 ? 12 GLY A HA2  12 
ATOM 11168 H HA3  . GLY A 1 12 ? 1.585   -0.439  -8.851  1.00 0.00 ? 12 GLY A HA3  12 
ATOM 11169 N N    . ASN A 1 13 ? 3.580   0.952   -7.167  1.00 0.00 ? 13 ASN A N    12 
ATOM 11170 C CA   . ASN A 1 13 ? 4.689   1.876   -7.007  1.00 0.00 ? 13 ASN A CA   12 
ATOM 11171 C C    . ASN A 1 13 ? 5.041   2.004   -5.531  1.00 0.00 ? 13 ASN A C    12 
ATOM 11172 O O    . ASN A 1 13 ? 4.985   3.092   -4.958  1.00 0.00 ? 13 ASN A O    12 
ATOM 11173 C CB   . ASN A 1 13 ? 4.332   3.247   -7.585  1.00 0.00 ? 13 ASN A CB   12 
ATOM 11174 C CG   . ASN A 1 13 ? 4.214   3.225   -9.096  1.00 0.00 ? 13 ASN A CG   12 
ATOM 11175 O OD1  . ASN A 1 13 ? 3.185   3.602   -9.656  1.00 0.00 ? 13 ASN A OD1  12 
ATOM 11176 N ND2  . ASN A 1 13 ? 5.271   2.781   -9.766  1.00 0.00 ? 13 ASN A ND2  12 
ATOM 11177 H H    . ASN A 1 13 ? 2.848   0.978   -6.515  1.00 0.00 ? 13 ASN A H    12 
ATOM 11178 H HA   . ASN A 1 13 ? 5.539   1.475   -7.539  1.00 0.00 ? 13 ASN A HA   12 
ATOM 11179 H HB2  . ASN A 1 13 ? 3.387   3.569   -7.174  1.00 0.00 ? 13 ASN A HB2  12 
ATOM 11180 H HB3  . ASN A 1 13 ? 5.100   3.957   -7.312  1.00 0.00 ? 13 ASN A HB3  12 
ATOM 11181 H HD21 . ASN A 1 13 ? 6.057   2.496   -9.254  1.00 0.00 ? 13 ASN A HD21 12 
ATOM 11182 H HD22 . ASN A 1 13 ? 5.223   2.756   -10.744 1.00 0.00 ? 13 ASN A HD22 12 
ATOM 11183 N N    . PRO A 1 14 ? 5.410   0.876   -4.900  1.00 0.00 ? 14 PRO A N    12 
ATOM 11184 C CA   . PRO A 1 14 ? 5.780   0.809   -3.499  1.00 0.00 ? 14 PRO A CA   12 
ATOM 11185 C C    . PRO A 1 14 ? 6.224   2.149   -2.936  1.00 0.00 ? 14 PRO A C    12 
ATOM 11186 O O    . PRO A 1 14 ? 7.192   2.741   -3.408  1.00 0.00 ? 14 PRO A O    12 
ATOM 11187 C CB   . PRO A 1 14 ? 6.930   -0.186  -3.554  1.00 0.00 ? 14 PRO A CB   12 
ATOM 11188 C CG   . PRO A 1 14 ? 6.550   -1.145  -4.646  1.00 0.00 ? 14 PRO A CG   12 
ATOM 11189 C CD   . PRO A 1 14 ? 5.513   -0.453  -5.508  1.00 0.00 ? 14 PRO A CD   12 
ATOM 11190 H HA   . PRO A 1 14 ? 4.982   0.407   -2.894  1.00 0.00 ? 14 PRO A HA   12 
ATOM 11191 H HB2  . PRO A 1 14 ? 7.848   0.335   -3.786  1.00 0.00 ? 14 PRO A HB2  12 
ATOM 11192 H HB3  . PRO A 1 14 ? 7.026   -0.687  -2.606  1.00 0.00 ? 14 PRO A HB3  12 
ATOM 11193 H HG2  . PRO A 1 14 ? 7.421   -1.387  -5.236  1.00 0.00 ? 14 PRO A HG2  12 
ATOM 11194 H HG3  . PRO A 1 14 ? 6.134   -2.041  -4.212  1.00 0.00 ? 14 PRO A HG3  12 
ATOM 11195 H HD2  . PRO A 1 14 ? 5.852   -0.387  -6.529  1.00 0.00 ? 14 PRO A HD2  12 
ATOM 11196 H HD3  . PRO A 1 14 ? 4.568   -0.976  -5.452  1.00 0.00 ? 14 PRO A HD3  12 
ATOM 11197 N N    . CYS A 1 15 ? 5.488   2.622   -1.934  1.00 0.00 ? 15 CYS A N    12 
ATOM 11198 C CA   . CYS A 1 15 ? 5.767   3.900   -1.295  1.00 0.00 ? 15 CYS A CA   12 
ATOM 11199 C C    . CYS A 1 15 ? 7.259   4.146   -1.117  1.00 0.00 ? 15 CYS A C    12 
ATOM 11200 O O    . CYS A 1 15 ? 7.805   3.941   -0.035  1.00 0.00 ? 15 CYS A O    12 
ATOM 11201 C CB   . CYS A 1 15 ? 5.059   4.000   0.062   1.00 0.00 ? 15 CYS A CB   12 
ATOM 11202 S SG   . CYS A 1 15 ? 4.251   5.606   0.362   1.00 0.00 ? 15 CYS A SG   12 
ATOM 11203 H H    . CYS A 1 15 ? 4.722   2.101   -1.626  1.00 0.00 ? 15 CYS A H    12 
ATOM 11204 H HA   . CYS A 1 15 ? 5.374   4.672   -1.940  1.00 0.00 ? 15 CYS A HA   12 
ATOM 11205 H HB2  . CYS A 1 15 ? 4.299   3.236   0.121   1.00 0.00 ? 15 CYS A HB2  12 
ATOM 11206 H HB3  . CYS A 1 15 ? 5.781   3.842   0.851   1.00 0.00 ? 15 CYS A HB3  12 
ATOM 11207 N N    . CYS A 1 16 ? 7.876   4.656   -2.184  1.00 0.00 ? 16 CYS A N    12 
ATOM 11208 C CA   . CYS A 1 16 ? 9.291   5.033   -2.199  1.00 0.00 ? 16 CYS A CA   12 
ATOM 11209 C C    . CYS A 1 16 ? 10.146  4.072   -3.017  1.00 0.00 ? 16 CYS A C    12 
ATOM 11210 O O    . CYS A 1 16 ? 11.278  3.767   -2.646  1.00 0.00 ? 16 CYS A O    12 
ATOM 11211 C CB   . CYS A 1 16 ? 9.866   5.194   -0.786  1.00 0.00 ? 16 CYS A CB   12 
ATOM 11212 S SG   . CYS A 1 16 ? 9.035   6.465   0.253   1.00 0.00 ? 16 CYS A SG   12 
ATOM 11213 H H    . CYS A 1 16 ? 7.337   4.837   -2.990  1.00 0.00 ? 16 CYS A H    12 
ATOM 11214 H HA   . CYS A 1 16 ? 9.339   5.986   -2.679  1.00 0.00 ? 16 CYS A HA   12 
ATOM 11215 H HB2  . CYS A 1 16 ? 9.799   4.248   -0.269  1.00 0.00 ? 16 CYS A HB2  12 
ATOM 11216 H HB3  . CYS A 1 16 ? 10.907  5.468   -0.868  1.00 0.00 ? 16 CYS A HB3  12 
ATOM 11217 N N    . ASP A 1 17 ? 9.613   3.626   -4.150  1.00 0.00 ? 17 ASP A N    12 
ATOM 11218 C CA   . ASP A 1 17 ? 10.346  2.724   -5.031  1.00 0.00 ? 17 ASP A CA   12 
ATOM 11219 C C    . ASP A 1 17 ? 11.389  3.494   -5.838  1.00 0.00 ? 17 ASP A C    12 
ATOM 11220 O O    . ASP A 1 17 ? 12.410  2.937   -6.246  1.00 0.00 ? 17 ASP A O    12 
ATOM 11221 C CB   . ASP A 1 17 ? 9.387   2.001   -5.979  1.00 0.00 ? 17 ASP A CB   12 
ATOM 11222 C CG   . ASP A 1 17 ? 8.286   2.908   -6.492  1.00 0.00 ? 17 ASP A CG   12 
ATOM 11223 O OD1  . ASP A 1 17 ? 7.525   3.445   -5.660  1.00 0.00 ? 17 ASP A OD1  12 
ATOM 11224 O OD2  . ASP A 1 17 ? 8.184   3.081   -7.724  1.00 0.00 ? 17 ASP A OD2  12 
ATOM 11225 H H    . ASP A 1 17 ? 8.715   3.924   -4.408  1.00 0.00 ? 17 ASP A H    12 
ATOM 11226 H HA   . ASP A 1 17 ? 10.850  1.995   -4.416  1.00 0.00 ? 17 ASP A HA   12 
ATOM 11227 H HB2  . ASP A 1 17 ? 9.944   1.628   -6.828  1.00 0.00 ? 17 ASP A HB2  12 
ATOM 11228 H HB3  . ASP A 1 17 ? 8.934   1.170   -5.459  1.00 0.00 ? 17 ASP A HB3  12 
ATOM 11229 N N    . ALA A 1 18 ? 11.117  4.777   -6.078  1.00 0.00 ? 18 ALA A N    12 
ATOM 11230 C CA   . ALA A 1 18 ? 12.021  5.629   -6.842  1.00 0.00 ? 18 ALA A CA   12 
ATOM 11231 C C    . ALA A 1 18 ? 11.813  5.440   -8.339  1.00 0.00 ? 18 ALA A C    12 
ATOM 11232 O O    . ALA A 1 18 ? 11.791  6.403   -9.106  1.00 0.00 ? 18 ALA A O    12 
ATOM 11233 C CB   . ALA A 1 18 ? 13.466  5.336   -6.466  1.00 0.00 ? 18 ALA A CB   12 
ATOM 11234 H H    . ALA A 1 18 ? 10.283  5.157   -5.741  1.00 0.00 ? 18 ALA A H    12 
ATOM 11235 H HA   . ALA A 1 18 ? 11.808  6.657   -6.586  1.00 0.00 ? 18 ALA A HA   12 
ATOM 11236 H HB1  . ALA A 1 18 ? 14.009  6.265   -6.371  1.00 0.00 ? 18 ALA A HB1  12 
ATOM 11237 H HB2  . ALA A 1 18 ? 13.922  4.730   -7.235  1.00 0.00 ? 18 ALA A HB2  12 
ATOM 11238 H HB3  . ALA A 1 18 ? 13.492  4.805   -5.526  1.00 0.00 ? 18 ALA A HB3  12 
ATOM 11239 N N    . ALA A 1 19 ? 11.664  4.187   -8.742  1.00 0.00 ? 19 ALA A N    12 
ATOM 11240 C CA   . ALA A 1 19 ? 11.458  3.839   -10.136 1.00 0.00 ? 19 ALA A CA   12 
ATOM 11241 C C    . ALA A 1 19 ? 11.091  2.365   -10.266 1.00 0.00 ? 19 ALA A C    12 
ATOM 11242 O O    . ALA A 1 19 ? 10.302  1.982   -11.130 1.00 0.00 ? 19 ALA A O    12 
ATOM 11243 C CB   . ALA A 1 19 ? 12.707  4.156   -10.938 1.00 0.00 ? 19 ALA A CB   12 
ATOM 11244 H H    . ALA A 1 19 ? 11.693  3.474   -8.080  1.00 0.00 ? 19 ALA A H    12 
ATOM 11245 H HA   . ALA A 1 19 ? 10.646  4.442   -10.518 1.00 0.00 ? 19 ALA A HA   12 
ATOM 11246 H HB1  . ALA A 1 19 ? 13.580  3.957   -10.334 1.00 0.00 ? 19 ALA A HB1  12 
ATOM 11247 H HB2  . ALA A 1 19 ? 12.695  5.198   -11.222 1.00 0.00 ? 19 ALA A HB2  12 
ATOM 11248 H HB3  . ALA A 1 19 ? 12.731  3.540   -11.823 1.00 0.00 ? 19 ALA A HB3  12 
ATOM 11249 N N    . THR A 1 20 ? 11.665  1.545   -9.388  1.00 0.00 ? 20 THR A N    12 
ATOM 11250 C CA   . THR A 1 20 ? 11.400  0.115   -9.381  1.00 0.00 ? 20 THR A CA   12 
ATOM 11251 C C    . THR A 1 20 ? 11.152  -0.355  -7.955  1.00 0.00 ? 20 THR A C    12 
ATOM 11252 O O    . THR A 1 20 ? 11.884  0.019   -7.040  1.00 0.00 ? 20 THR A O    12 
ATOM 11253 C CB   . THR A 1 20 ? 12.576  -0.647  -9.992  1.00 0.00 ? 20 THR A CB   12 
ATOM 11254 O OG1  . THR A 1 20 ? 12.152  -1.895  -10.511 1.00 0.00 ? 20 THR A OG1  12 
ATOM 11255 C CG2  . THR A 1 20 ? 13.694  -0.915  -9.007  1.00 0.00 ? 20 THR A CG2  12 
ATOM 11256 H H    . THR A 1 20 ? 12.278  1.914   -8.718  1.00 0.00 ? 20 THR A H    12 
ATOM 11257 H HA   . THR A 1 20 ? 10.514  -0.065  -9.971  1.00 0.00 ? 20 THR A HA   12 
ATOM 11258 H HB   . THR A 1 20 ? 12.984  -0.063  -10.803 1.00 0.00 ? 20 THR A HB   12 
ATOM 11259 H HG1  . THR A 1 20 ? 11.210  -2.002  -10.360 1.00 0.00 ? 20 THR A HG1  12 
ATOM 11260 H HG21 . THR A 1 20 ? 14.479  -1.473  -9.496  1.00 0.00 ? 20 THR A HG21 12 
ATOM 11261 H HG22 . THR A 1 20 ? 13.311  -1.486  -8.174  1.00 0.00 ? 20 THR A HG22 12 
ATOM 11262 H HG23 . THR A 1 20 ? 14.090  0.023   -8.648  1.00 0.00 ? 20 THR A HG23 12 
ATOM 11263 N N    . CYS A 1 21 ? 10.112  -1.159  -7.771  1.00 0.00 ? 21 CYS A N    12 
ATOM 11264 C CA   . CYS A 1 21 ? 9.762   -1.664  -6.448  1.00 0.00 ? 21 CYS A CA   12 
ATOM 11265 C C    . CYS A 1 21 ? 11.009  -1.896  -5.595  1.00 0.00 ? 21 CYS A C    12 
ATOM 11266 O O    . CYS A 1 21 ? 11.597  -2.978  -5.616  1.00 0.00 ? 21 CYS A O    12 
ATOM 11267 C CB   . CYS A 1 21 ? 8.950   -2.958  -6.570  1.00 0.00 ? 21 CYS A CB   12 
ATOM 11268 S SG   . CYS A 1 21 ? 7.315   -2.737  -7.349  1.00 0.00 ? 21 CYS A SG   12 
ATOM 11269 H H    . CYS A 1 21 ? 9.560   -1.411  -8.540  1.00 0.00 ? 21 CYS A H    12 
ATOM 11270 H HA   . CYS A 1 21 ? 9.152   -0.914  -5.969  1.00 0.00 ? 21 CYS A HA   12 
ATOM 11271 H HB2  . CYS A 1 21 ? 9.504   -3.667  -7.167  1.00 0.00 ? 21 CYS A HB2  12 
ATOM 11272 H HB3  . CYS A 1 21 ? 8.793   -3.369  -5.584  1.00 0.00 ? 21 CYS A HB3  12 
ATOM 11273 N N    . LYS A 1 22 ? 11.405  -0.867  -4.846  1.00 0.00 ? 22 LYS A N    12 
ATOM 11274 C CA   . LYS A 1 22 ? 12.580  -0.947  -3.981  1.00 0.00 ? 22 LYS A CA   12 
ATOM 11275 C C    . LYS A 1 22 ? 12.677  0.280   -3.075  1.00 0.00 ? 22 LYS A C    12 
ATOM 11276 O O    . LYS A 1 22 ? 12.867  1.399   -3.551  1.00 0.00 ? 22 LYS A O    12 
ATOM 11277 C CB   . LYS A 1 22 ? 13.851  -1.074  -4.823  1.00 0.00 ? 22 LYS A CB   12 
ATOM 11278 C CG   . LYS A 1 22 ? 15.130  -1.044  -4.003  1.00 0.00 ? 22 LYS A CG   12 
ATOM 11279 C CD   . LYS A 1 22 ? 15.587  -2.446  -3.632  1.00 0.00 ? 22 LYS A CD   12 
ATOM 11280 C CE   . LYS A 1 22 ? 16.574  -2.997  -4.649  1.00 0.00 ? 22 LYS A CE   12 
ATOM 11281 N NZ   . LYS A 1 22 ? 15.887  -3.703  -5.765  1.00 0.00 ? 22 LYS A NZ   12 
ATOM 11282 H H    . LYS A 1 22 ? 10.893  -0.032  -4.876  1.00 0.00 ? 22 LYS A H    12 
ATOM 11283 H HA   . LYS A 1 22 ? 12.478  -1.828  -3.365  1.00 0.00 ? 22 LYS A HA   12 
ATOM 11284 H HB2  . LYS A 1 22 ? 13.818  -2.007  -5.366  1.00 0.00 ? 22 LYS A HB2  12 
ATOM 11285 H HB3  . LYS A 1 22 ? 13.883  -0.258  -5.530  1.00 0.00 ? 22 LYS A HB3  12 
ATOM 11286 H HG2  . LYS A 1 22 ? 15.906  -0.565  -4.580  1.00 0.00 ? 22 LYS A HG2  12 
ATOM 11287 H HG3  . LYS A 1 22 ? 14.952  -0.482  -3.098  1.00 0.00 ? 22 LYS A HG3  12 
ATOM 11288 H HD2  . LYS A 1 22 ? 16.064  -2.415  -2.664  1.00 0.00 ? 22 LYS A HD2  12 
ATOM 11289 H HD3  . LYS A 1 22 ? 14.725  -3.096  -3.591  1.00 0.00 ? 22 LYS A HD3  12 
ATOM 11290 H HE2  . LYS A 1 22 ? 17.149  -2.177  -5.053  1.00 0.00 ? 22 LYS A HE2  12 
ATOM 11291 H HE3  . LYS A 1 22 ? 17.237  -3.689  -4.150  1.00 0.00 ? 22 LYS A HE3  12 
ATOM 11292 H HZ1  . LYS A 1 22 ? 15.577  -3.018  -6.484  1.00 0.00 ? 22 LYS A HZ1  12 
ATOM 11293 H HZ2  . LYS A 1 22 ? 15.054  -4.212  -5.407  1.00 0.00 ? 22 LYS A HZ2  12 
ATOM 11294 H HZ3  . LYS A 1 22 ? 16.534  -4.386  -6.208  1.00 0.00 ? 22 LYS A HZ3  12 
ATOM 11295 N N    . LEU A 1 23 ? 12.543  0.065   -1.768  1.00 0.00 ? 23 LEU A N    12 
ATOM 11296 C CA   . LEU A 1 23 ? 12.614  1.154   -0.801  1.00 0.00 ? 23 LEU A CA   12 
ATOM 11297 C C    . LEU A 1 23 ? 13.131  0.664   0.548   1.00 0.00 ? 23 LEU A C    12 
ATOM 11298 O O    . LEU A 1 23 ? 12.974  -0.505  0.900   1.00 0.00 ? 23 LEU A O    12 
ATOM 11299 C CB   . LEU A 1 23 ? 11.237  1.787   -0.623  1.00 0.00 ? 23 LEU A CB   12 
ATOM 11300 C CG   . LEU A 1 23 ? 10.193  0.898   0.047   1.00 0.00 ? 23 LEU A CG   12 
ATOM 11301 C CD1  . LEU A 1 23 ? 8.804   1.443   -0.217  1.00 0.00 ? 23 LEU A CD1  12 
ATOM 11302 C CD2  . LEU A 1 23 ? 10.304  -0.532  -0.455  1.00 0.00 ? 23 LEU A CD2  12 
ATOM 11303 H H    . LEU A 1 23 ? 12.390  -0.843  -1.448  1.00 0.00 ? 23 LEU A H    12 
ATOM 11304 H HA   . LEU A 1 23 ? 13.295  1.897   -1.187  1.00 0.00 ? 23 LEU A HA   12 
ATOM 11305 H HB2  . LEU A 1 23 ? 11.348  2.684   -0.031  1.00 0.00 ? 23 LEU A HB2  12 
ATOM 11306 H HB3  . LEU A 1 23 ? 10.863  2.061   -1.595  1.00 0.00 ? 23 LEU A HB3  12 
ATOM 11307 H HG   . LEU A 1 23 ? 10.358  0.897   1.114   1.00 0.00 ? 23 LEU A HG   12 
ATOM 11308 H HD11 . LEU A 1 23 ? 8.878   2.341   -0.812  1.00 0.00 ? 23 LEU A HD11 12 
ATOM 11309 H HD12 . LEU A 1 23 ? 8.323   1.670   0.722   1.00 0.00 ? 23 LEU A HD12 12 
ATOM 11310 H HD13 . LEU A 1 23 ? 8.227   0.705   -0.751  1.00 0.00 ? 23 LEU A HD13 12 
ATOM 11311 H HD21 . LEU A 1 23 ? 9.404   -1.071  -0.205  1.00 0.00 ? 23 LEU A HD21 12 
ATOM 11312 H HD22 . LEU A 1 23 ? 11.152  -1.011  0.008   1.00 0.00 ? 23 LEU A HD22 12 
ATOM 11313 H HD23 . LEU A 1 23 ? 10.434  -0.527  -1.528  1.00 0.00 ? 23 LEU A HD23 12 
ATOM 11314 N N    . ARG A 1 24 ? 13.745  1.570   1.302   1.00 0.00 ? 24 ARG A N    12 
ATOM 11315 C CA   . ARG A 1 24 ? 14.281  1.237   2.616   1.00 0.00 ? 24 ARG A CA   12 
ATOM 11316 C C    . ARG A 1 24 ? 13.343  1.707   3.726   1.00 0.00 ? 24 ARG A C    12 
ATOM 11317 O O    . ARG A 1 24 ? 13.659  1.584   4.910   1.00 0.00 ? 24 ARG A O    12 
ATOM 11318 C CB   . ARG A 1 24 ? 15.663  1.866   2.800   1.00 0.00 ? 24 ARG A CB   12 
ATOM 11319 C CG   . ARG A 1 24 ? 16.770  1.126   2.066   1.00 0.00 ? 24 ARG A CG   12 
ATOM 11320 C CD   . ARG A 1 24 ? 18.136  1.710   2.385   1.00 0.00 ? 24 ARG A CD   12 
ATOM 11321 N NE   . ARG A 1 24 ? 19.156  1.264   1.440   1.00 0.00 ? 24 ARG A NE   12 
ATOM 11322 C CZ   . ARG A 1 24 ? 19.654  0.032   1.421   1.00 0.00 ? 24 ARG A CZ   12 
ATOM 11323 N NH1  . ARG A 1 24 ? 19.226  -0.872  2.292   1.00 0.00 ? 24 ARG A NH1  12 
ATOM 11324 N NH2  . ARG A 1 24 ? 20.579  -0.297  0.530   1.00 0.00 ? 24 ARG A NH2  12 
ATOM 11325 H H    . ARG A 1 24 ? 13.836  2.487   0.967   1.00 0.00 ? 24 ARG A H    12 
ATOM 11326 H HA   . ARG A 1 24 ? 14.375  0.163   2.672   1.00 0.00 ? 24 ARG A HA   12 
ATOM 11327 H HB2  . ARG A 1 24 ? 15.635  2.882   2.435   1.00 0.00 ? 24 ARG A HB2  12 
ATOM 11328 H HB3  . ARG A 1 24 ? 15.904  1.877   3.853   1.00 0.00 ? 24 ARG A HB3  12 
ATOM 11329 H HG2  . ARG A 1 24 ? 16.755  0.088   2.363   1.00 0.00 ? 24 ARG A HG2  12 
ATOM 11330 H HG3  . ARG A 1 24 ? 16.595  1.201   1.003   1.00 0.00 ? 24 ARG A HG3  12 
ATOM 11331 H HD2  . ARG A 1 24 ? 18.071  2.787   2.348   1.00 0.00 ? 24 ARG A HD2  12 
ATOM 11332 H HD3  . ARG A 1 24 ? 18.422  1.402   3.381   1.00 0.00 ? 24 ARG A HD3  12 
ATOM 11333 H HE   . ARG A 1 24 ? 19.487  1.916   0.788   1.00 0.00 ? 24 ARG A HE   12 
ATOM 11334 H HH11 . ARG A 1 24 ? 18.528  -0.627  2.964   1.00 0.00 ? 24 ARG A HH11 12 
ATOM 11335 H HH12 . ARG A 1 24 ? 19.602  -1.799  2.276   1.00 0.00 ? 24 ARG A HH12 12 
ATOM 11336 H HH21 . ARG A 1 24 ? 20.904  0.382   -0.128  1.00 0.00 ? 24 ARG A HH21 12 
ATOM 11337 H HH22 . ARG A 1 24 ? 20.953  -1.225  0.517   1.00 0.00 ? 24 ARG A HH22 12 
ATOM 11338 N N    . GLN A 1 25 ? 12.192  2.252   3.339   1.00 0.00 ? 25 GLN A N    12 
ATOM 11339 C CA   . GLN A 1 25 ? 11.216  2.745   4.307   1.00 0.00 ? 25 GLN A CA   12 
ATOM 11340 C C    . GLN A 1 25 ? 10.071  1.755   4.494   1.00 0.00 ? 25 GLN A C    12 
ATOM 11341 O O    . GLN A 1 25 ? 9.232   1.921   5.379   1.00 0.00 ? 25 GLN A O    12 
ATOM 11342 C CB   . GLN A 1 25 ? 10.665  4.100   3.860   1.00 0.00 ? 25 GLN A CB   12 
ATOM 11343 C CG   . GLN A 1 25 ? 10.716  5.166   4.942   1.00 0.00 ? 25 GLN A CG   12 
ATOM 11344 C CD   . GLN A 1 25 ? 12.117  5.701   5.167   1.00 0.00 ? 25 GLN A CD   12 
ATOM 11345 O OE1  . GLN A 1 25 ? 12.517  6.698   4.566   1.00 0.00 ? 25 GLN A OE1  12 
ATOM 11346 N NE2  . GLN A 1 25 ? 12.871  5.038   6.036   1.00 0.00 ? 25 GLN A NE2  12 
ATOM 11347 H H    . GLN A 1 25 ? 11.995  2.328   2.382   1.00 0.00 ? 25 GLN A H    12 
ATOM 11348 H HA   . GLN A 1 25 ? 11.723  2.868   5.251   1.00 0.00 ? 25 GLN A HA   12 
ATOM 11349 H HB2  . GLN A 1 25 ? 11.240  4.448   3.014   1.00 0.00 ? 25 GLN A HB2  12 
ATOM 11350 H HB3  . GLN A 1 25 ? 9.636   3.975   3.557   1.00 0.00 ? 25 GLN A HB3  12 
ATOM 11351 H HG2  . GLN A 1 25 ? 10.077  5.987   4.653   1.00 0.00 ? 25 GLN A HG2  12 
ATOM 11352 H HG3  . GLN A 1 25 ? 10.357  4.739   5.867   1.00 0.00 ? 25 GLN A HG3  12 
ATOM 11353 H HE21 . GLN A 1 25 ? 12.486  4.252   6.477   1.00 0.00 ? 25 GLN A HE21 12 
ATOM 11354 H HE22 . GLN A 1 25 ? 13.781  5.362   6.201   1.00 0.00 ? 25 GLN A HE22 12 
ATOM 11355 N N    . GLY A 1 26 ? 10.043  0.725   3.658   1.00 0.00 ? 26 GLY A N    12 
ATOM 11356 C CA   . GLY A 1 26 ? 8.997   -0.278  3.749   1.00 0.00 ? 26 GLY A CA   12 
ATOM 11357 C C    . GLY A 1 26 ? 7.615   0.292   3.490   1.00 0.00 ? 26 GLY A C    12 
ATOM 11358 O O    . GLY A 1 26 ? 6.935   0.743   4.411   1.00 0.00 ? 26 GLY A O    12 
ATOM 11359 H H    . GLY A 1 26 ? 10.739  0.644   2.974   1.00 0.00 ? 26 GLY A H    12 
ATOM 11360 H HA2  . GLY A 1 26 ? 9.196   -1.053  3.023   1.00 0.00 ? 26 GLY A HA2  12 
ATOM 11361 H HA3  . GLY A 1 26 ? 9.016   -0.711  4.737   1.00 0.00 ? 26 GLY A HA3  12 
ATOM 11362 N N    . ALA A 1 27 ? 7.206   0.273   2.227   1.00 0.00 ? 27 ALA A N    12 
ATOM 11363 C CA   . ALA A 1 27 ? 5.905   0.792   1.823   1.00 0.00 ? 27 ALA A CA   12 
ATOM 11364 C C    . ALA A 1 27 ? 4.841   -0.301  1.811   1.00 0.00 ? 27 ALA A C    12 
ATOM 11365 O O    . ALA A 1 27 ? 3.898   -0.253  1.022   1.00 0.00 ? 27 ALA A O    12 
ATOM 11366 C CB   . ALA A 1 27 ? 6.015   1.410   0.446   1.00 0.00 ? 27 ALA A CB   12 
ATOM 11367 H H    . ALA A 1 27 ? 7.800   -0.093  1.544   1.00 0.00 ? 27 ALA A H    12 
ATOM 11368 H HA   . ALA A 1 27 ? 5.616   1.564   2.519   1.00 0.00 ? 27 ALA A HA   12 
ATOM 11369 H HB1  . ALA A 1 27 ? 6.609   2.308   0.499   1.00 0.00 ? 27 ALA A HB1  12 
ATOM 11370 H HB2  . ALA A 1 27 ? 5.032   1.645   0.085   1.00 0.00 ? 27 ALA A HB2  12 
ATOM 11371 H HB3  . ALA A 1 27 ? 6.484   0.711   -0.226  1.00 0.00 ? 27 ALA A HB3  12 
ATOM 11372 N N    . GLN A 1 28 ? 5.007   -1.288  2.676   1.00 0.00 ? 28 GLN A N    12 
ATOM 11373 C CA   . GLN A 1 28 ? 4.074   -2.407  2.761   1.00 0.00 ? 28 GLN A CA   12 
ATOM 11374 C C    . GLN A 1 28 ? 2.624   -1.966  2.569   1.00 0.00 ? 28 GLN A C    12 
ATOM 11375 O O    . GLN A 1 28 ? 2.023   -2.194  1.519   1.00 0.00 ? 28 GLN A O    12 
ATOM 11376 C CB   . GLN A 1 28 ? 4.231   -3.105  4.112   1.00 0.00 ? 28 GLN A CB   12 
ATOM 11377 C CG   . GLN A 1 28 ? 5.672   -3.282  4.534   1.00 0.00 ? 28 GLN A CG   12 
ATOM 11378 C CD   . GLN A 1 28 ? 6.036   -2.442  5.743   1.00 0.00 ? 28 GLN A CD   12 
ATOM 11379 O OE1  . GLN A 1 28 ? 6.843   -2.852  6.578   1.00 0.00 ? 28 GLN A OE1  12 
ATOM 11380 N NE2  . GLN A 1 28 ? 5.440   -1.259  5.844   1.00 0.00 ? 28 GLN A NE2  12 
ATOM 11381 H H    . GLN A 1 28 ? 5.786   -1.271  3.270   1.00 0.00 ? 28 GLN A H    12 
ATOM 11382 H HA   . GLN A 1 28 ? 4.329   -3.099  1.978   1.00 0.00 ? 28 GLN A HA   12 
ATOM 11383 H HB2  . GLN A 1 28 ? 3.727   -2.526  4.869   1.00 0.00 ? 28 GLN A HB2  12 
ATOM 11384 H HB3  . GLN A 1 28 ? 3.778   -4.076  4.057   1.00 0.00 ? 28 GLN A HB3  12 
ATOM 11385 H HG2  . GLN A 1 28 ? 5.835   -4.322  4.773   1.00 0.00 ? 28 GLN A HG2  12 
ATOM 11386 H HG3  . GLN A 1 28 ? 6.311   -3.000  3.709   1.00 0.00 ? 28 GLN A HG3  12 
ATOM 11387 H HE21 . GLN A 1 28 ? 4.808   -0.999  5.142   1.00 0.00 ? 28 GLN A HE21 12 
ATOM 11388 H HE22 . GLN A 1 28 ? 5.657   -0.696  6.615   1.00 0.00 ? 28 GLN A HE22 12 
ATOM 11389 N N    . CYS A 1 29 ? 2.075   -1.334  3.592   1.00 0.00 ? 29 CYS A N    12 
ATOM 11390 C CA   . CYS A 1 29 ? 0.703   -0.845  3.565   1.00 0.00 ? 29 CYS A CA   12 
ATOM 11391 C C    . CYS A 1 29 ? 0.687   0.605   4.020   1.00 0.00 ? 29 CYS A C    12 
ATOM 11392 O O    . CYS A 1 29 ? -0.140  1.014   4.835   1.00 0.00 ? 29 CYS A O    12 
ATOM 11393 C CB   . CYS A 1 29 ? -0.199  -1.692  4.471   1.00 0.00 ? 29 CYS A CB   12 
ATOM 11394 S SG   . CYS A 1 29 ? -0.760  -3.259  3.724   1.00 0.00 ? 29 CYS A SG   12 
ATOM 11395 H H    . CYS A 1 29 ? 2.614   -1.178  4.389   1.00 0.00 ? 29 CYS A H    12 
ATOM 11396 H HA   . CYS A 1 29 ? 0.346   -0.908  2.547   1.00 0.00 ? 29 CYS A HA   12 
ATOM 11397 H HB2  . CYS A 1 29 ? 0.340   -1.936  5.374   1.00 0.00 ? 29 CYS A HB2  12 
ATOM 11398 H HB3  . CYS A 1 29 ? -1.077  -1.117  4.728   1.00 0.00 ? 29 CYS A HB3  12 
ATOM 11399 N N    . ALA A 1 30 ? 1.631   1.369   3.487   1.00 0.00 ? 30 ALA A N    12 
ATOM 11400 C CA   . ALA A 1 30 ? 1.771   2.785   3.830   1.00 0.00 ? 30 ALA A CA   12 
ATOM 11401 C C    . ALA A 1 30 ? 0.618   3.595   3.249   1.00 0.00 ? 30 ALA A C    12 
ATOM 11402 O O    . ALA A 1 30 ? -0.526  3.142   3.277   1.00 0.00 ? 30 ALA A O    12 
ATOM 11403 C CB   . ALA A 1 30 ? 3.111   3.310   3.335   1.00 0.00 ? 30 ALA A CB   12 
ATOM 11404 H H    . ALA A 1 30 ? 2.256   0.961   2.846   1.00 0.00 ? 30 ALA A H    12 
ATOM 11405 H HA   . ALA A 1 30 ? 1.751   2.871   4.907   1.00 0.00 ? 30 ALA A HA   12 
ATOM 11406 H HB1  . ALA A 1 30 ? 3.253   4.322   3.686   1.00 0.00 ? 30 ALA A HB1  12 
ATOM 11407 H HB2  . ALA A 1 30 ? 3.126   3.299   2.255   1.00 0.00 ? 30 ALA A HB2  12 
ATOM 11408 H HB3  . ALA A 1 30 ? 3.906   2.684   3.713   1.00 0.00 ? 30 ALA A HB3  12 
ATOM 11409 N N    . GLU A 1 31 ? 0.911   4.781   2.699   1.00 0.00 ? 31 GLU A N    12 
ATOM 11410 C CA   . GLU A 1 31 ? -0.133  5.605   2.095   1.00 0.00 ? 31 GLU A CA   12 
ATOM 11411 C C    . GLU A 1 31 ? -1.092  4.697   1.345   1.00 0.00 ? 31 GLU A C    12 
ATOM 11412 O O    . GLU A 1 31 ? -2.291  4.955   1.258   1.00 0.00 ? 31 GLU A O    12 
ATOM 11413 C CB   . GLU A 1 31 ? 0.475   6.636   1.142   1.00 0.00 ? 31 GLU A CB   12 
ATOM 11414 C CG   . GLU A 1 31 ? -0.545  7.298   0.229   1.00 0.00 ? 31 GLU A CG   12 
ATOM 11415 C CD   . GLU A 1 31 ? -0.679  8.786   0.487   1.00 0.00 ? 31 GLU A CD   12 
ATOM 11416 O OE1  . GLU A 1 31 ? -1.509  9.168   1.338   1.00 0.00 ? 31 GLU A OE1  12 
ATOM 11417 O OE2  . GLU A 1 31 ? 0.048   9.568   -0.161  1.00 0.00 ? 31 GLU A OE2  12 
ATOM 11418 H H    . GLU A 1 31 ? 1.838   5.095   2.684   1.00 0.00 ? 31 GLU A H    12 
ATOM 11419 H HA   . GLU A 1 31 ? -0.666  6.112   2.886   1.00 0.00 ? 31 GLU A HA   12 
ATOM 11420 H HB2  . GLU A 1 31 ? 0.957   7.406   1.725   1.00 0.00 ? 31 GLU A HB2  12 
ATOM 11421 H HB3  . GLU A 1 31 ? 1.215   6.147   0.525   1.00 0.00 ? 31 GLU A HB3  12 
ATOM 11422 H HG2  . GLU A 1 31 ? -0.239  7.152   -0.796  1.00 0.00 ? 31 GLU A HG2  12 
ATOM 11423 H HG3  . GLU A 1 31 ? -1.506  6.831   0.387   1.00 0.00 ? 31 GLU A HG3  12 
ATOM 11424 N N    . GLY A 1 32 ? -0.529  3.607   0.840   1.00 0.00 ? 32 GLY A N    12 
ATOM 11425 C CA   . GLY A 1 32 ? -1.290  2.607   0.132   1.00 0.00 ? 32 GLY A CA   12 
ATOM 11426 C C    . GLY A 1 32 ? -0.609  1.261   0.235   1.00 0.00 ? 32 GLY A C    12 
ATOM 11427 O O    . GLY A 1 32 ? 0.163   1.031   1.165   1.00 0.00 ? 32 GLY A O    12 
ATOM 11428 H H    . GLY A 1 32 ? 0.431   3.467   0.973   1.00 0.00 ? 32 GLY A H    12 
ATOM 11429 H HA2  . GLY A 1 32 ? -2.272  2.540   0.573   1.00 0.00 ? 32 GLY A HA2  12 
ATOM 11430 H HA3  . GLY A 1 32 ? -1.376  2.886   -0.907  1.00 0.00 ? 32 GLY A HA3  12 
ATOM 11431 N N    . LEU A 1 33 ? -0.878  0.363   -0.702  1.00 0.00 ? 33 LEU A N    12 
ATOM 11432 C CA   . LEU A 1 33 ? -0.252  -0.954  -0.654  1.00 0.00 ? 33 LEU A CA   12 
ATOM 11433 C C    . LEU A 1 33 ? 1.248   -0.902  -1.008  1.00 0.00 ? 33 LEU A C    12 
ATOM 11434 O O    . LEU A 1 33 ? 1.962   -0.018  -0.533  1.00 0.00 ? 33 LEU A O    12 
ATOM 11435 C CB   . LEU A 1 33 ? -1.021  -1.950  -1.525  1.00 0.00 ? 33 LEU A CB   12 
ATOM 11436 C CG   . LEU A 1 33 ? -1.224  -3.325  -0.877  1.00 0.00 ? 33 LEU A CG   12 
ATOM 11437 C CD1  . LEU A 1 33 ? 0.046   -4.143  -0.948  1.00 0.00 ? 33 LEU A CD1  12 
ATOM 11438 C CD2  . LEU A 1 33 ? -1.650  -3.171  0.574   1.00 0.00 ? 33 LEU A CD2  12 
ATOM 11439 H H    . LEU A 1 33 ? -1.508  0.585   -1.424  1.00 0.00 ? 33 LEU A H    12 
ATOM 11440 H HA   . LEU A 1 33 ? -0.321  -1.279  0.368   1.00 0.00 ? 33 LEU A HA   12 
ATOM 11441 H HB2  . LEU A 1 33 ? -1.994  -1.527  -1.737  1.00 0.00 ? 33 LEU A HB2  12 
ATOM 11442 H HB3  . LEU A 1 33 ? -0.497  -2.080  -2.456  1.00 0.00 ? 33 LEU A HB3  12 
ATOM 11443 H HG   . LEU A 1 33 ? -1.996  -3.859  -1.403  1.00 0.00 ? 33 LEU A HG   12 
ATOM 11444 H HD11 . LEU A 1 33 ? 0.371   -4.220  -1.974  1.00 0.00 ? 33 LEU A HD11 12 
ATOM 11445 H HD12 . LEU A 1 33 ? -0.137  -5.130  -0.550  1.00 0.00 ? 33 LEU A HD12 12 
ATOM 11446 H HD13 . LEU A 1 33 ? 0.807   -3.652  -0.364  1.00 0.00 ? 33 LEU A HD13 12 
ATOM 11447 H HD21 . LEU A 1 33 ? -1.790  -2.127  0.800   1.00 0.00 ? 33 LEU A HD21 12 
ATOM 11448 H HD22 . LEU A 1 33 ? -0.882  -3.574  1.217   1.00 0.00 ? 33 LEU A HD22 12 
ATOM 11449 H HD23 . LEU A 1 33 ? -2.570  -3.701  0.740   1.00 0.00 ? 33 LEU A HD23 12 
ATOM 11450 N N    . CYS A 1 34 ? 1.741   -1.866  -1.798  1.00 0.00 ? 34 CYS A N    12 
ATOM 11451 C CA   . CYS A 1 34 ? 3.165   -1.922  -2.143  1.00 0.00 ? 34 CYS A CA   12 
ATOM 11452 C C    . CYS A 1 34 ? 3.436   -2.950  -3.241  1.00 0.00 ? 34 CYS A C    12 
ATOM 11453 O O    . CYS A 1 34 ? 2.546   -3.285  -4.023  1.00 0.00 ? 34 CYS A O    12 
ATOM 11454 C CB   . CYS A 1 34 ? 3.960   -2.298  -0.895  1.00 0.00 ? 34 CYS A CB   12 
ATOM 11455 S SG   . CYS A 1 34 ? 5.616   -1.565  -0.768  1.00 0.00 ? 34 CYS A SG   12 
ATOM 11456 H H    . CYS A 1 34 ? 1.152   -2.564  -2.129  1.00 0.00 ? 34 CYS A H    12 
ATOM 11457 H HA   . CYS A 1 34 ? 3.473   -0.952  -2.485  1.00 0.00 ? 34 CYS A HA   12 
ATOM 11458 H HB2  . CYS A 1 34 ? 3.407   -1.996  -0.025  1.00 0.00 ? 34 CYS A HB2  12 
ATOM 11459 H HB3  . CYS A 1 34 ? 4.085   -3.368  -0.879  1.00 0.00 ? 34 CYS A HB3  12 
ATOM 11460 N N    . CYS A 1 35 ? 4.673   -3.454  -3.288  1.00 0.00 ? 35 CYS A N    12 
ATOM 11461 C CA   . CYS A 1 35 ? 5.050   -4.447  -4.286  1.00 0.00 ? 35 CYS A CA   12 
ATOM 11462 C C    . CYS A 1 35 ? 6.427   -5.048  -4.007  1.00 0.00 ? 35 CYS A C    12 
ATOM 11463 O O    . CYS A 1 35 ? 6.670   -6.219  -4.298  1.00 0.00 ? 35 CYS A O    12 
ATOM 11464 C CB   . CYS A 1 35 ? 5.003   -3.828  -5.694  1.00 0.00 ? 35 CYS A CB   12 
ATOM 11465 S SG   . CYS A 1 35 ? 6.292   -4.420  -6.849  1.00 0.00 ? 35 CYS A SG   12 
ATOM 11466 H H    . CYS A 1 35 ? 5.338   -3.156  -2.638  1.00 0.00 ? 35 CYS A H    12 
ATOM 11467 H HA   . CYS A 1 35 ? 4.330   -5.234  -4.228  1.00 0.00 ? 35 CYS A HA   12 
ATOM 11468 H HB2  . CYS A 1 35 ? 4.046   -4.049  -6.140  1.00 0.00 ? 35 CYS A HB2  12 
ATOM 11469 H HB3  . CYS A 1 35 ? 5.110   -2.757  -5.607  1.00 0.00 ? 35 CYS A HB3  12 
ATOM 11470 N N    . ASP A 1 36 ? 7.327   -4.245  -3.465  1.00 0.00 ? 36 ASP A N    12 
ATOM 11471 C CA   . ASP A 1 36 ? 8.683   -4.716  -3.177  1.00 0.00 ? 36 ASP A CA   12 
ATOM 11472 C C    . ASP A 1 36 ? 8.765   -5.426  -1.830  1.00 0.00 ? 36 ASP A C    12 
ATOM 11473 O O    . ASP A 1 36 ? 7.750   -5.688  -1.185  1.00 0.00 ? 36 ASP A O    12 
ATOM 11474 C CB   . ASP A 1 36 ? 9.701   -3.569  -3.221  1.00 0.00 ? 36 ASP A CB   12 
ATOM 11475 C CG   . ASP A 1 36 ? 9.082   -2.203  -3.008  1.00 0.00 ? 36 ASP A CG   12 
ATOM 11476 O OD1  . ASP A 1 36 ? 8.552   -1.955  -1.908  1.00 0.00 ? 36 ASP A OD1  12 
ATOM 11477 O OD2  . ASP A 1 36 ? 9.139   -1.378  -3.939  1.00 0.00 ? 36 ASP A OD2  12 
ATOM 11478 H H    . ASP A 1 36 ? 7.077   -3.323  -3.268  1.00 0.00 ? 36 ASP A H    12 
ATOM 11479 H HA   . ASP A 1 36 ? 8.941   -5.428  -3.946  1.00 0.00 ? 36 ASP A HA   12 
ATOM 11480 H HB2  . ASP A 1 36 ? 10.440  -3.727  -2.450  1.00 0.00 ? 36 ASP A HB2  12 
ATOM 11481 H HB3  . ASP A 1 36 ? 10.191  -3.574  -4.183  1.00 0.00 ? 36 ASP A HB3  12 
ATOM 11482 N N    . GLN A 1 37 ? 9.992   -5.743  -1.425  1.00 0.00 ? 37 GLN A N    12 
ATOM 11483 C CA   . GLN A 1 37 ? 10.245  -6.436  -0.169  1.00 0.00 ? 37 GLN A CA   12 
ATOM 11484 C C    . GLN A 1 37 ? 9.560   -5.750  1.009   1.00 0.00 ? 37 GLN A C    12 
ATOM 11485 O O    . GLN A 1 37 ? 9.401   -6.354  2.070   1.00 0.00 ? 37 GLN A O    12 
ATOM 11486 C CB   . GLN A 1 37 ? 11.750  -6.527  0.089   1.00 0.00 ? 37 GLN A CB   12 
ATOM 11487 C CG   . GLN A 1 37 ? 12.552  -6.930  -1.137  1.00 0.00 ? 37 GLN A CG   12 
ATOM 11488 C CD   . GLN A 1 37 ? 13.368  -5.784  -1.704  1.00 0.00 ? 37 GLN A CD   12 
ATOM 11489 O OE1  . GLN A 1 37 ? 12.984  -5.166  -2.697  1.00 0.00 ? 37 GLN A OE1  12 
ATOM 11490 N NE2  . GLN A 1 37 ? 14.500  -5.496  -1.074  1.00 0.00 ? 37 GLN A NE2  12 
ATOM 11491 H H    . GLN A 1 37 ? 10.752  -5.512  -1.996  1.00 0.00 ? 37 GLN A H    12 
ATOM 11492 H HA   . GLN A 1 37 ? 9.850   -7.435  -0.263  1.00 0.00 ? 37 GLN A HA   12 
ATOM 11493 H HB2  . GLN A 1 37 ? 12.105  -5.563  0.424   1.00 0.00 ? 37 GLN A HB2  12 
ATOM 11494 H HB3  . GLN A 1 37 ? 11.927  -7.256  0.865   1.00 0.00 ? 37 GLN A HB3  12 
ATOM 11495 H HG2  . GLN A 1 37 ? 13.225  -7.729  -0.864  1.00 0.00 ? 37 GLN A HG2  12 
ATOM 11496 H HG3  . GLN A 1 37 ? 11.871  -7.279  -1.899  1.00 0.00 ? 37 GLN A HG3  12 
ATOM 11497 H HE21 . GLN A 1 37 ? 14.743  -6.031  -0.290  1.00 0.00 ? 37 GLN A HE21 12 
ATOM 11498 H HE22 . GLN A 1 37 ? 15.047  -4.759  -1.419  1.00 0.00 ? 37 GLN A HE22 12 
ATOM 11499 N N    . CYS A 1 38 ? 9.163   -4.489  0.822   1.00 0.00 ? 38 CYS A N    12 
ATOM 11500 C CA   . CYS A 1 38 ? 8.498   -3.727  1.879   1.00 0.00 ? 38 CYS A CA   12 
ATOM 11501 C C    . CYS A 1 38 ? 7.689   -4.653  2.788   1.00 0.00 ? 38 CYS A C    12 
ATOM 11502 O O    . CYS A 1 38 ? 7.779   -4.558  4.011   1.00 0.00 ? 38 CYS A O    12 
ATOM 11503 C CB   . CYS A 1 38 ? 7.595   -2.646  1.265   1.00 0.00 ? 38 CYS A CB   12 
ATOM 11504 S SG   . CYS A 1 38 ? 6.761   -3.164  -0.267  1.00 0.00 ? 38 CYS A SG   12 
ATOM 11505 H H    . CYS A 1 38 ? 9.324   -4.061  -0.043  1.00 0.00 ? 38 CYS A H    12 
ATOM 11506 H HA   . CYS A 1 38 ? 9.265   -3.248  2.469   1.00 0.00 ? 38 CYS A HA   12 
ATOM 11507 H HB2  . CYS A 1 38 ? 6.830   -2.366  1.977   1.00 0.00 ? 38 CYS A HB2  12 
ATOM 11508 H HB3  . CYS A 1 38 ? 8.193   -1.777  1.032   1.00 0.00 ? 38 CYS A HB3  12 
ATOM 11509 N N    . ARG A 1 39 ? 6.916   -5.554  2.173   1.00 0.00 ? 39 ARG A N    12 
ATOM 11510 C CA   . ARG A 1 39 ? 6.086   -6.520  2.903   1.00 0.00 ? 39 ARG A CA   12 
ATOM 11511 C C    . ARG A 1 39 ? 4.651   -6.016  3.019   1.00 0.00 ? 39 ARG A C    12 
ATOM 11512 O O    . ARG A 1 39 ? 4.266   -5.085  2.320   1.00 0.00 ? 39 ARG A O    12 
ATOM 11513 C CB   . ARG A 1 39 ? 6.661   -6.806  4.293   1.00 0.00 ? 39 ARG A CB   12 
ATOM 11514 C CG   . ARG A 1 39 ? 6.418   -8.229  4.771   1.00 0.00 ? 39 ARG A CG   12 
ATOM 11515 C CD   . ARG A 1 39 ? 6.103   -8.270  6.257   1.00 0.00 ? 39 ARG A CD   12 
ATOM 11516 N NE   . ARG A 1 39 ? 7.114   -7.578  7.050   1.00 0.00 ? 39 ARG A NE   12 
ATOM 11517 C CZ   . ARG A 1 39 ? 8.359   -8.018  7.201   1.00 0.00 ? 39 ARG A CZ   12 
ATOM 11518 N NH1  . ARG A 1 39 ? 8.742   -9.145  6.617   1.00 0.00 ? 39 ARG A NH1  12 
ATOM 11519 N NH2  . ARG A 1 39 ? 9.223   -7.331  7.935   1.00 0.00 ? 39 ARG A NH2  12 
ATOM 11520 H H    . ARG A 1 39 ? 6.908   -5.574  1.192   1.00 0.00 ? 39 ARG A H    12 
ATOM 11521 H HA   . ARG A 1 39 ? 6.080   -7.438  2.333   1.00 0.00 ? 39 ARG A HA   12 
ATOM 11522 H HB2  . ARG A 1 39 ? 7.727   -6.635  4.272   1.00 0.00 ? 39 ARG A HB2  12 
ATOM 11523 H HB3  . ARG A 1 39 ? 6.210   -6.130  5.004   1.00 0.00 ? 39 ARG A HB3  12 
ATOM 11524 H HG2  . ARG A 1 39 ? 5.586   -8.645  4.224   1.00 0.00 ? 39 ARG A HG2  12 
ATOM 11525 H HG3  . ARG A 1 39 ? 7.305   -8.817  4.583   1.00 0.00 ? 39 ARG A HG3  12 
ATOM 11526 H HD2  . ARG A 1 39 ? 5.145   -7.799  6.422   1.00 0.00 ? 39 ARG A HD2  12 
ATOM 11527 H HD3  . ARG A 1 39 ? 6.054   -9.302  6.573   1.00 0.00 ? 39 ARG A HD3  12 
ATOM 11528 H HE   . ARG A 1 39 ? 6.852   -6.743  7.491   1.00 0.00 ? 39 ARG A HE   12 
ATOM 11529 H HH11 . ARG A 1 39 ? 8.093   -9.666  6.062   1.00 0.00 ? 39 ARG A HH11 12 
ATOM 11530 H HH12 . ARG A 1 39 ? 9.679   -9.475  6.731   1.00 0.00 ? 39 ARG A HH12 12 
ATOM 11531 H HH21 . ARG A 1 39 ? 8.938   -6.480  8.377   1.00 0.00 ? 39 ARG A HH21 12 
ATOM 11532 H HH22 . ARG A 1 39 ? 10.159  -7.664  8.048   1.00 0.00 ? 39 ARG A HH22 12 
ATOM 11533 N N    . PHE A 1 40 ? 3.861   -6.637  3.898   1.00 0.00 ? 40 PHE A N    12 
ATOM 11534 C CA   . PHE A 1 40 ? 2.464   -6.237  4.088   1.00 0.00 ? 40 PHE A CA   12 
ATOM 11535 C C    . PHE A 1 40 ? 1.897   -6.792  5.391   1.00 0.00 ? 40 PHE A C    12 
ATOM 11536 O O    . PHE A 1 40 ? 2.149   -7.939  5.760   1.00 0.00 ? 40 PHE A O    12 
ATOM 11537 C CB   . PHE A 1 40 ? 1.613   -6.687  2.901   1.00 0.00 ? 40 PHE A CB   12 
ATOM 11538 C CG   . PHE A 1 40 ? 2.275   -6.449  1.575   1.00 0.00 ? 40 PHE A CG   12 
ATOM 11539 C CD1  . PHE A 1 40 ? 3.171   -7.369  1.055   1.00 0.00 ? 40 PHE A CD1  12 
ATOM 11540 C CD2  . PHE A 1 40 ? 2.017   -5.294  0.856   1.00 0.00 ? 40 PHE A CD2  12 
ATOM 11541 C CE1  . PHE A 1 40 ? 3.794   -7.140  -0.155  1.00 0.00 ? 40 PHE A CE1  12 
ATOM 11542 C CE2  . PHE A 1 40 ? 2.636   -5.064  -0.354  1.00 0.00 ? 40 PHE A CE2  12 
ATOM 11543 C CZ   . PHE A 1 40 ? 3.526   -5.987  -0.861  1.00 0.00 ? 40 PHE A CZ   12 
ATOM 11544 H H    . PHE A 1 40 ? 4.223   -7.378  4.426   1.00 0.00 ? 40 PHE A H    12 
ATOM 11545 H HA   . PHE A 1 40 ? 2.433   -5.163  4.141   1.00 0.00 ? 40 PHE A HA   12 
ATOM 11546 H HB2  . PHE A 1 40 ? 1.407   -7.741  2.989   1.00 0.00 ? 40 PHE A HB2  12 
ATOM 11547 H HB3  . PHE A 1 40 ? 0.681   -6.139  2.910   1.00 0.00 ? 40 PHE A HB3  12 
ATOM 11548 H HD1  . PHE A 1 40 ? 3.382   -8.274  1.602   1.00 0.00 ? 40 PHE A HD1  12 
ATOM 11549 H HD2  . PHE A 1 40 ? 1.321   -4.568  1.248   1.00 0.00 ? 40 PHE A HD2  12 
ATOM 11550 H HE1  . PHE A 1 40 ? 4.490   -7.861  -0.547  1.00 0.00 ? 40 PHE A HE1  12 
ATOM 11551 H HE2  . PHE A 1 40 ? 2.427   -4.157  -0.903  1.00 0.00 ? 40 PHE A HE2  12 
ATOM 11552 H HZ   . PHE A 1 40 ? 4.013   -5.806  -1.808  1.00 0.00 ? 40 PHE A HZ   12 
ATOM 11553 N N    . MET A 1 41 ? 1.136   -5.951  6.087   1.00 0.00 ? 41 MET A N    12 
ATOM 11554 C CA   . MET A 1 41 ? 0.529   -6.318  7.361   1.00 0.00 ? 41 MET A CA   12 
ATOM 11555 C C    . MET A 1 41 ? -0.230  -7.639  7.276   1.00 0.00 ? 41 MET A C    12 
ATOM 11556 O O    . MET A 1 41 ? 0.265   -8.673  7.723   1.00 0.00 ? 41 MET A O    12 
ATOM 11557 C CB   . MET A 1 41 ? -0.420  -5.211  7.824   1.00 0.00 ? 41 MET A CB   12 
ATOM 11558 C CG   . MET A 1 41 ? 0.052   -4.487  9.074   1.00 0.00 ? 41 MET A CG   12 
ATOM 11559 S SD   . MET A 1 41 ? 1.489   -3.442  8.768   1.00 0.00 ? 41 MET A SD   12 
ATOM 11560 C CE   . MET A 1 41 ? 1.714   -2.696  10.381  1.00 0.00 ? 41 MET A CE   12 
ATOM 11561 H H    . MET A 1 41 ? 0.987   -5.050  5.737   1.00 0.00 ? 41 MET A H    12 
ATOM 11562 H HA   . MET A 1 41 ? 1.322   -6.419  8.084   1.00 0.00 ? 41 MET A HA   12 
ATOM 11563 H HB2  . MET A 1 41 ? -0.522  -4.485  7.030   1.00 0.00 ? 41 MET A HB2  12 
ATOM 11564 H HB3  . MET A 1 41 ? -1.388  -5.645  8.029   1.00 0.00 ? 41 MET A HB3  12 
ATOM 11565 H HG2  . MET A 1 41 ? -0.753  -3.868  9.441   1.00 0.00 ? 41 MET A HG2  12 
ATOM 11566 H HG3  . MET A 1 41 ? 0.311   -5.221  9.823   1.00 0.00 ? 41 MET A HG3  12 
ATOM 11567 H HE1  . MET A 1 41 ? 2.199   -3.401  11.039  1.00 0.00 ? 41 MET A HE1  12 
ATOM 11568 H HE2  . MET A 1 41 ? 0.752   -2.425  10.790  1.00 0.00 ? 41 MET A HE2  12 
ATOM 11569 H HE3  . MET A 1 41 ? 2.327   -1.812  10.286  1.00 0.00 ? 41 MET A HE3  12 
ATOM 11570 N N    . LYS A 1 42 ? -1.443  -7.578  6.722   1.00 0.00 ? 42 LYS A N    12 
ATOM 11571 C CA   . LYS A 1 42 ? -2.316  -8.747  6.586   1.00 0.00 ? 42 LYS A CA   12 
ATOM 11572 C C    . LYS A 1 42 ? -3.360  -8.755  7.693   1.00 0.00 ? 42 LYS A C    12 
ATOM 11573 O O    . LYS A 1 42 ? -3.674  -9.799  8.264   1.00 0.00 ? 42 LYS A O    12 
ATOM 11574 C CB   . LYS A 1 42 ? -1.519  -10.054 6.605   1.00 0.00 ? 42 LYS A CB   12 
ATOM 11575 C CG   . LYS A 1 42 ? -0.357  -10.074 5.625   1.00 0.00 ? 42 LYS A CG   12 
ATOM 11576 C CD   . LYS A 1 42 ? -0.746  -10.743 4.317   1.00 0.00 ? 42 LYS A CD   12 
ATOM 11577 C CE   . LYS A 1 42 ? 0.474   -11.249 3.566   1.00 0.00 ? 42 LYS A CE   12 
ATOM 11578 N NZ   . LYS A 1 42 ? 0.179   -12.491 2.799   1.00 0.00 ? 42 LYS A NZ   12 
ATOM 11579 H H    . LYS A 1 42 ? -1.771  -6.709  6.408   1.00 0.00 ? 42 LYS A H    12 
ATOM 11580 H HA   . LYS A 1 42 ? -2.828  -8.664  5.640   1.00 0.00 ? 42 LYS A HA   12 
ATOM 11581 H HB2  . LYS A 1 42 ? -1.129  -10.212 7.599   1.00 0.00 ? 42 LYS A HB2  12 
ATOM 11582 H HB3  . LYS A 1 42 ? -2.183  -10.869 6.356   1.00 0.00 ? 42 LYS A HB3  12 
ATOM 11583 H HG2  . LYS A 1 42 ? -0.053  -9.058  5.422   1.00 0.00 ? 42 LYS A HG2  12 
ATOM 11584 H HG3  . LYS A 1 42 ? 0.465   -10.617 6.068   1.00 0.00 ? 42 LYS A HG3  12 
ATOM 11585 H HD2  . LYS A 1 42 ? -1.397  -11.578 4.531   1.00 0.00 ? 42 LYS A HD2  12 
ATOM 11586 H HD3  . LYS A 1 42 ? -1.268  -10.027 3.699   1.00 0.00 ? 42 LYS A HD3  12 
ATOM 11587 H HE2  . LYS A 1 42 ? 0.802   -10.483 2.879   1.00 0.00 ? 42 LYS A HE2  12 
ATOM 11588 H HE3  . LYS A 1 42 ? 1.260   -11.454 4.278   1.00 0.00 ? 42 LYS A HE3  12 
ATOM 11589 H HZ1  . LYS A 1 42 ? -0.546  -13.051 3.292   1.00 0.00 ? 42 LYS A HZ1  12 
ATOM 11590 H HZ2  . LYS A 1 42 ? 1.040   -13.066 2.705   1.00 0.00 ? 42 LYS A HZ2  12 
ATOM 11591 H HZ3  . LYS A 1 42 ? -0.169  -12.251 1.849   1.00 0.00 ? 42 LYS A HZ3  12 
ATOM 11592 N N    . GLU A 1 43 ? -3.894  -7.574  7.987   1.00 0.00 ? 43 GLU A N    12 
ATOM 11593 C CA   . GLU A 1 43 ? -4.907  -7.423  9.022   1.00 0.00 ? 43 GLU A CA   12 
ATOM 11594 C C    . GLU A 1 43 ? -5.646  -6.102  8.858   1.00 0.00 ? 43 GLU A C    12 
ATOM 11595 O O    . GLU A 1 43 ? -5.294  -5.097  9.477   1.00 0.00 ? 43 GLU A O    12 
ATOM 11596 C CB   . GLU A 1 43 ? -4.267  -7.493  10.404  1.00 0.00 ? 43 GLU A CB   12 
ATOM 11597 C CG   . GLU A 1 43 ? -5.274  -7.541  11.541  1.00 0.00 ? 43 GLU A CG   12 
ATOM 11598 C CD   . GLU A 1 43 ? -4.739  -8.260  12.764  1.00 0.00 ? 43 GLU A CD   12 
ATOM 11599 O OE1  . GLU A 1 43 ? -3.960  -7.644  13.522  1.00 0.00 ? 43 GLU A OE1  12 
ATOM 11600 O OE2  . GLU A 1 43 ? -5.099  -9.439  12.965  1.00 0.00 ? 43 GLU A OE2  12 
ATOM 11601 H H    . GLU A 1 43 ? -3.598  -6.782  7.491   1.00 0.00 ? 43 GLU A H    12 
ATOM 11602 H HA   . GLU A 1 43 ? -5.612  -8.233  8.918   1.00 0.00 ? 43 GLU A HA   12 
ATOM 11603 H HB2  . GLU A 1 43 ? -3.653  -8.378  10.457  1.00 0.00 ? 43 GLU A HB2  12 
ATOM 11604 H HB3  . GLU A 1 43 ? -3.643  -6.622  10.541  1.00 0.00 ? 43 GLU A HB3  12 
ATOM 11605 H HG2  . GLU A 1 43 ? -5.532  -6.530  11.821  1.00 0.00 ? 43 GLU A HG2  12 
ATOM 11606 H HG3  . GLU A 1 43 ? -6.160  -8.055  11.198  1.00 0.00 ? 43 GLU A HG3  12 
ATOM 11607 N N    . GLY A 1 44 ? -6.675  -6.117  8.022   1.00 0.00 ? 44 GLY A N    12 
ATOM 11608 C CA   . GLY A 1 44 ? -7.463  -4.930  7.779   1.00 0.00 ? 44 GLY A CA   12 
ATOM 11609 C C    . GLY A 1 44 ? -6.672  -3.650  7.868   1.00 0.00 ? 44 GLY A C    12 
ATOM 11610 O O    . GLY A 1 44 ? -7.051  -2.741  8.607   1.00 0.00 ? 44 GLY A O    12 
ATOM 11611 H H    . GLY A 1 44 ? -6.906  -6.949  7.567   1.00 0.00 ? 44 GLY A H    12 
ATOM 11612 H HA2  . GLY A 1 44 ? -7.892  -4.993  6.795   1.00 0.00 ? 44 GLY A HA2  12 
ATOM 11613 H HA3  . GLY A 1 44 ? -8.260  -4.891  8.504   1.00 0.00 ? 44 GLY A HA3  12 
ATOM 11614 N N    . THR A 1 45 ? -5.583  -3.546  7.111   1.00 0.00 ? 45 THR A N    12 
ATOM 11615 C CA   . THR A 1 45 ? -4.801  -2.324  7.143   1.00 0.00 ? 45 THR A CA   12 
ATOM 11616 C C    . THR A 1 45 ? -5.264  -1.386  6.027   1.00 0.00 ? 45 THR A C    12 
ATOM 11617 O O    . THR A 1 45 ? -6.466  -1.203  5.840   1.00 0.00 ? 45 THR A O    12 
ATOM 11618 C CB   . THR A 1 45 ? -3.310  -2.635  7.045   1.00 0.00 ? 45 THR A CB   12 
ATOM 11619 O OG1  . THR A 1 45 ? -3.029  -3.919  7.577   1.00 0.00 ? 45 THR A OG1  12 
ATOM 11620 C CG2  . THR A 1 45 ? -2.453  -1.636  7.782   1.00 0.00 ? 45 THR A CG2  12 
ATOM 11621 H H    . THR A 1 45 ? -5.310  -4.294  6.511   1.00 0.00 ? 45 THR A H    12 
ATOM 11622 H HA   . THR A 1 45 ? -4.994  -1.843  8.092   1.00 0.00 ? 45 THR A HA   12 
ATOM 11623 H HB   . THR A 1 45 ? -3.017  -2.627  6.008   1.00 0.00 ? 45 THR A HB   12 
ATOM 11624 H HG1  . THR A 1 45 ? -3.769  -4.216  8.113   1.00 0.00 ? 45 THR A HG1  12 
ATOM 11625 H HG21 . THR A 1 45 ? -2.821  -1.526  8.792   1.00 0.00 ? 45 THR A HG21 12 
ATOM 11626 H HG22 . THR A 1 45 ? -2.498  -0.683  7.277   1.00 0.00 ? 45 THR A HG22 12 
ATOM 11627 H HG23 . THR A 1 45 ? -1.433  -1.986  7.805   1.00 0.00 ? 45 THR A HG23 12 
ATOM 11628 N N    . ILE A 1 46 ? -4.334  -0.791  5.287   1.00 0.00 ? 46 ILE A N    12 
ATOM 11629 C CA   . ILE A 1 46 ? -4.704  0.109   4.209   1.00 0.00 ? 46 ILE A CA   12 
ATOM 11630 C C    . ILE A 1 46 ? -4.136  -0.383  2.877   1.00 0.00 ? 46 ILE A C    12 
ATOM 11631 O O    . ILE A 1 46 ? -2.965  -0.164  2.566   1.00 0.00 ? 46 ILE A O    12 
ATOM 11632 C CB   . ILE A 1 46 ? -4.252  1.567   4.526   1.00 0.00 ? 46 ILE A CB   12 
ATOM 11633 C CG1  . ILE A 1 46 ? -5.478  2.450   4.759   1.00 0.00 ? 46 ILE A CG1  12 
ATOM 11634 C CG2  . ILE A 1 46 ? -3.370  2.167   3.434   1.00 0.00 ? 46 ILE A CG2  12 
ATOM 11635 C CD1  . ILE A 1 46 ? -5.773  2.701   6.221   1.00 0.00 ? 46 ILE A CD1  12 
ATOM 11636 H H    . ILE A 1 46 ? -3.389  -0.956  5.462   1.00 0.00 ? 46 ILE A H    12 
ATOM 11637 H HA   . ILE A 1 46 ? -5.783  0.104   4.141   1.00 0.00 ? 46 ILE A HA   12 
ATOM 11638 H HB   . ILE A 1 46 ? -3.672  1.541   5.435   1.00 0.00 ? 46 ILE A HB   12 
ATOM 11639 H HG12 . ILE A 1 46 ? -5.321  3.407   4.284   1.00 0.00 ? 46 ILE A HG12 12 
ATOM 11640 H HG13 . ILE A 1 46 ? -6.344  1.974   4.322   1.00 0.00 ? 46 ILE A HG13 12 
ATOM 11641 H HG21 . ILE A 1 46 ? -3.404  3.245   3.496   1.00 0.00 ? 46 ILE A HG21 12 
ATOM 11642 H HG22 . ILE A 1 46 ? -3.726  1.851   2.467   1.00 0.00 ? 46 ILE A HG22 12 
ATOM 11643 H HG23 . ILE A 1 46 ? -2.352  1.832   3.570   1.00 0.00 ? 46 ILE A HG23 12 
ATOM 11644 H HD11 . ILE A 1 46 ? -6.322  3.625   6.324   1.00 0.00 ? 46 ILE A HD11 12 
ATOM 11645 H HD12 . ILE A 1 46 ? -4.844  2.770   6.769   1.00 0.00 ? 46 ILE A HD12 12 
ATOM 11646 H HD13 . ILE A 1 46 ? -6.363  1.886   6.615   1.00 0.00 ? 46 ILE A HD13 12 
ATOM 11647 N N    . CYS A 1 47 ? -4.973  -1.058  2.093   1.00 0.00 ? 47 CYS A N    12 
ATOM 11648 C CA   . CYS A 1 47 ? -4.541  -1.570  0.803   1.00 0.00 ? 47 CYS A CA   12 
ATOM 11649 C C    . CYS A 1 47 ? -4.771  -0.562  -0.304  1.00 0.00 ? 47 CYS A C    12 
ATOM 11650 O O    . CYS A 1 47 ? -4.632  -0.888  -1.480  1.00 0.00 ? 47 CYS A O    12 
ATOM 11651 C CB   . CYS A 1 47 ? -5.233  -2.866  0.459   1.00 0.00 ? 47 CYS A CB   12 
ATOM 11652 S SG   . CYS A 1 47 ? -4.417  -3.712  -0.912  1.00 0.00 ? 47 CYS A SG   12 
ATOM 11653 H H    . CYS A 1 47 ? -5.894  -1.214  2.389   1.00 0.00 ? 47 CYS A H    12 
ATOM 11654 H HA   . CYS A 1 47 ? -3.492  -1.763  0.863   1.00 0.00 ? 47 CYS A HA   12 
ATOM 11655 H HB2  . CYS A 1 47 ? -5.207  -3.520  1.316   1.00 0.00 ? 47 CYS A HB2  12 
ATOM 11656 H HB3  . CYS A 1 47 ? -6.251  -2.674  0.176   1.00 0.00 ? 47 CYS A HB3  12 
ATOM 11657 N N    . ARG A 1 48 ? -5.118  0.656   0.092   1.00 0.00 ? 48 ARG A N    12 
ATOM 11658 C CA   . ARG A 1 48 ? -5.378  1.753   -0.847  1.00 0.00 ? 48 ARG A CA   12 
ATOM 11659 C C    . ARG A 1 48 ? -5.034  1.390   -2.288  1.00 0.00 ? 48 ARG A C    12 
ATOM 11660 O O    . ARG A 1 48 ? -3.863  1.326   -2.662  1.00 0.00 ? 48 ARG A O    12 
ATOM 11661 C CB   . ARG A 1 48 ? -4.566  2.980   -0.447  1.00 0.00 ? 48 ARG A CB   12 
ATOM 11662 C CG   . ARG A 1 48 ? -4.709  3.361   1.017   1.00 0.00 ? 48 ARG A CG   12 
ATOM 11663 C CD   . ARG A 1 48 ? -5.461  4.672   1.181   1.00 0.00 ? 48 ARG A CD   12 
ATOM 11664 N NE   . ARG A 1 48 ? -4.561  5.798   1.413   1.00 0.00 ? 48 ARG A NE   12 
ATOM 11665 C CZ   . ARG A 1 48 ? -4.856  7.054   1.096   1.00 0.00 ? 48 ARG A CZ   12 
ATOM 11666 N NH1  . ARG A 1 48 ? -6.025  7.343   0.539   1.00 0.00 ? 48 ARG A NH1  12 
ATOM 11667 N NH2  . ARG A 1 48 ? -3.984  8.024   1.337   1.00 0.00 ? 48 ARG A NH2  12 
ATOM 11668 H H    . ARG A 1 48 ? -5.214  0.822   1.057   1.00 0.00 ? 48 ARG A H    12 
ATOM 11669 H HA   . ARG A 1 48 ? -6.419  1.993   -0.790  1.00 0.00 ? 48 ARG A HA   12 
ATOM 11670 H HB2  . ARG A 1 48 ? -3.524  2.781   -0.647  1.00 0.00 ? 48 ARG A HB2  12 
ATOM 11671 H HB3  . ARG A 1 48 ? -4.881  3.816   -1.048  1.00 0.00 ? 48 ARG A HB3  12 
ATOM 11672 H HG2  . ARG A 1 48 ? -5.251  2.582   1.530   1.00 0.00 ? 48 ARG A HG2  12 
ATOM 11673 H HG3  . ARG A 1 48 ? -3.725  3.460   1.450   1.00 0.00 ? 48 ARG A HG3  12 
ATOM 11674 H HD2  . ARG A 1 48 ? -6.031  4.860   0.284   1.00 0.00 ? 48 ARG A HD2  12 
ATOM 11675 H HD3  . ARG A 1 48 ? -6.134  4.583   2.022   1.00 0.00 ? 48 ARG A HD3  12 
ATOM 11676 H HE   . ARG A 1 48 ? -3.692  5.607   1.824   1.00 0.00 ? 48 ARG A HE   12 
ATOM 11677 H HH11 . ARG A 1 48 ? -6.685  6.615   0.357   1.00 0.00 ? 48 ARG A HH11 12 
ATOM 11678 H HH12 . ARG A 1 48 ? -6.245  8.289   0.302   1.00 0.00 ? 48 ARG A HH12 12 
ATOM 11679 H HH21 . ARG A 1 48 ? -3.103  7.810   1.757   1.00 0.00 ? 48 ARG A HH21 12 
ATOM 11680 H HH22 . ARG A 1 48 ? -4.209  8.969   1.098   1.00 0.00 ? 48 ARG A HH22 12 
ATOM 11681 N N    . ARG A 1 49 ? -6.066  1.156   -3.094  1.00 0.00 ? 49 ARG A N    12 
ATOM 11682 C CA   . ARG A 1 49 ? -5.874  0.803   -4.495  1.00 0.00 ? 49 ARG A CA   12 
ATOM 11683 C C    . ARG A 1 49 ? -5.443  2.020   -5.311  1.00 0.00 ? 49 ARG A C    12 
ATOM 11684 O O    . ARG A 1 49 ? -5.181  1.913   -6.509  1.00 0.00 ? 49 ARG A O    12 
ATOM 11685 C CB   . ARG A 1 49 ? -7.162  0.216   -5.075  1.00 0.00 ? 49 ARG A CB   12 
ATOM 11686 C CG   . ARG A 1 49 ? -7.945  -0.628  -4.083  1.00 0.00 ? 49 ARG A CG   12 
ATOM 11687 C CD   . ARG A 1 49 ? -8.781  -1.683  -4.789  1.00 0.00 ? 49 ARG A CD   12 
ATOM 11688 N NE   . ARG A 1 49 ? -9.602  -1.110  -5.851  1.00 0.00 ? 49 ARG A NE   12 
ATOM 11689 C CZ   . ARG A 1 49 ? -10.636 -0.305  -5.628  1.00 0.00 ? 49 ARG A CZ   12 
ATOM 11690 N NH1  . ARG A 1 49 ? -10.972 0.018   -4.387  1.00 0.00 ? 49 ARG A NH1  12 
ATOM 11691 N NH2  . ARG A 1 49 ? -11.334 0.178   -6.647  1.00 0.00 ? 49 ARG A NH2  12 
ATOM 11692 H H    . ARG A 1 49 ? -6.978  1.225   -2.737  1.00 0.00 ? 49 ARG A H    12 
ATOM 11693 H HA   . ARG A 1 49 ? -5.095  0.057   -4.545  1.00 0.00 ? 49 ARG A HA   12 
ATOM 11694 H HB2  . ARG A 1 49 ? -7.796  1.025   -5.406  1.00 0.00 ? 49 ARG A HB2  12 
ATOM 11695 H HB3  . ARG A 1 49 ? -6.912  -0.403  -5.923  1.00 0.00 ? 49 ARG A HB3  12 
ATOM 11696 H HG2  . ARG A 1 49 ? -7.252  -1.119  -3.416  1.00 0.00 ? 49 ARG A HG2  12 
ATOM 11697 H HG3  . ARG A 1 49 ? -8.600  0.016   -3.515  1.00 0.00 ? 49 ARG A HG3  12 
ATOM 11698 H HD2  . ARG A 1 49 ? -8.119  -2.421  -5.218  1.00 0.00 ? 49 ARG A HD2  12 
ATOM 11699 H HD3  . ARG A 1 49 ? -9.426  -2.158  -4.064  1.00 0.00 ? 49 ARG A HD3  12 
ATOM 11700 H HE   . ARG A 1 49 ? -9.371  -1.336  -6.776  1.00 0.00 ? 49 ARG A HE   12 
ATOM 11701 H HH11 . ARG A 1 49 ? -10.448 -0.345  -3.617  1.00 0.00 ? 49 ARG A HH11 12 
ATOM 11702 H HH12 . ARG A 1 49 ? -11.750 0.623   -4.221  1.00 0.00 ? 49 ARG A HH12 12 
ATOM 11703 H HH21 . ARG A 1 49 ? -11.083 -0.063  -7.584  1.00 0.00 ? 49 ARG A HH21 12 
ATOM 11704 H HH22 . ARG A 1 49 ? -12.112 0.783   -6.477  1.00 0.00 ? 49 ARG A HH22 12 
ATOM 11705 N N    . ALA A 1 50 ? -5.371  3.175   -4.655  1.00 0.00 ? 50 ALA A N    12 
ATOM 11706 C CA   . ALA A 1 50 ? -4.971  4.409   -5.321  1.00 0.00 ? 50 ALA A CA   12 
ATOM 11707 C C    . ALA A 1 50 ? -4.674  5.507   -4.305  1.00 0.00 ? 50 ALA A C    12 
ATOM 11708 O O    . ALA A 1 50 ? -4.645  5.258   -3.100  1.00 0.00 ? 50 ALA A O    12 
ATOM 11709 C CB   . ALA A 1 50 ? -6.056  4.862   -6.286  1.00 0.00 ? 50 ALA A CB   12 
ATOM 11710 H H    . ALA A 1 50 ? -5.592  3.199   -3.701  1.00 0.00 ? 50 ALA A H    12 
ATOM 11711 H HA   . ALA A 1 50 ? -4.076  4.206   -5.891  1.00 0.00 ? 50 ALA A HA   12 
ATOM 11712 H HB1  . ALA A 1 50 ? -5.605  5.164   -7.219  1.00 0.00 ? 50 ALA A HB1  12 
ATOM 11713 H HB2  . ALA A 1 50 ? -6.591  5.697   -5.858  1.00 0.00 ? 50 ALA A HB2  12 
ATOM 11714 H HB3  . ALA A 1 50 ? -6.742  4.048   -6.464  1.00 0.00 ? 50 ALA A HB3  12 
ATOM 11715 N N    . ARG A 1 51 ? -4.455  6.721   -4.799  1.00 0.00 ? 51 ARG A N    12 
ATOM 11716 C CA   . ARG A 1 51 ? -4.162  7.853   -3.939  1.00 0.00 ? 51 ARG A CA   12 
ATOM 11717 C C    . ARG A 1 51 ? -5.238  8.927   -4.079  1.00 0.00 ? 51 ARG A C    12 
ATOM 11718 O O    . ARG A 1 51 ? -6.264  8.874   -3.402  1.00 0.00 ? 51 ARG A O    12 
ATOM 11719 C CB   . ARG A 1 51 ? -2.790  8.430   -4.281  1.00 0.00 ? 51 ARG A CB   12 
ATOM 11720 C CG   . ARG A 1 51 ? -2.491  9.731   -3.565  1.00 0.00 ? 51 ARG A CG   12 
ATOM 11721 C CD   . ARG A 1 51 ? -1.381  10.508  -4.253  1.00 0.00 ? 51 ARG A CD   12 
ATOM 11722 N NE   . ARG A 1 51 ? -0.438  9.629   -4.937  1.00 0.00 ? 51 ARG A NE   12 
ATOM 11723 C CZ   . ARG A 1 51 ? 0.468   10.059  -5.809  1.00 0.00 ? 51 ARG A CZ   12 
ATOM 11724 N NH1  . ARG A 1 51 ? 0.550   11.349  -6.101  1.00 0.00 ? 51 ARG A NH1  12 
ATOM 11725 N NH2  . ARG A 1 51 ? 1.292   9.198   -6.390  1.00 0.00 ? 51 ARG A NH2  12 
ATOM 11726 H H    . ARG A 1 51 ? -4.491  6.861   -5.765  1.00 0.00 ? 51 ARG A H    12 
ATOM 11727 H HA   . ARG A 1 51 ? -4.151  7.501   -2.918  1.00 0.00 ? 51 ARG A HA   12 
ATOM 11728 H HB2  . ARG A 1 51 ? -2.030  7.711   -4.011  1.00 0.00 ? 51 ARG A HB2  12 
ATOM 11729 H HB3  . ARG A 1 51 ? -2.741  8.609   -5.345  1.00 0.00 ? 51 ARG A HB3  12 
ATOM 11730 H HG2  . ARG A 1 51 ? -3.386  10.333  -3.553  1.00 0.00 ? 51 ARG A HG2  12 
ATOM 11731 H HG3  . ARG A 1 51 ? -2.192  9.507   -2.553  1.00 0.00 ? 51 ARG A HG3  12 
ATOM 11732 H HD2  . ARG A 1 51 ? -1.823  11.178  -4.976  1.00 0.00 ? 51 ARG A HD2  12 
ATOM 11733 H HD3  . ARG A 1 51 ? -0.849  11.084  -3.509  1.00 0.00 ? 51 ARG A HD3  12 
ATOM 11734 H HE   . ARG A 1 51 ? -0.482  8.671   -4.736  1.00 0.00 ? 51 ARG A HE   12 
ATOM 11735 H HH11 . ARG A 1 51 ? -0.070  12.001  -5.664  1.00 0.00 ? 51 ARG A HH11 12 
ATOM 11736 H HH12 . ARG A 1 51 ? 1.232   11.671  -6.757  1.00 0.00 ? 51 ARG A HH12 12 
ATOM 11737 H HH21 . ARG A 1 51 ? 1.233   8.224   -6.172  1.00 0.00 ? 51 ARG A HH21 12 
ATOM 11738 H HH22 . ARG A 1 51 ? 1.973   9.523   -7.047  1.00 0.00 ? 51 ARG A HH22 12 
ATOM 11739 N N    . GLY A 1 52 ? -4.994  9.895   -4.966  1.00 0.00 ? 52 GLY A N    12 
ATOM 11740 C CA   . GLY A 1 52 ? -5.946  10.972  -5.190  1.00 0.00 ? 52 GLY A CA   12 
ATOM 11741 C C    . GLY A 1 52 ? -6.791  11.275  -3.969  1.00 0.00 ? 52 GLY A C    12 
ATOM 11742 O O    . GLY A 1 52 ? -6.329  11.919  -3.027  1.00 0.00 ? 52 GLY A O    12 
ATOM 11743 H H    . GLY A 1 52 ? -4.159  9.876   -5.476  1.00 0.00 ? 52 GLY A H    12 
ATOM 11744 H HA2  . GLY A 1 52 ? -5.403  11.864  -5.467  1.00 0.00 ? 52 GLY A HA2  12 
ATOM 11745 H HA3  . GLY A 1 52 ? -6.598  10.695  -6.005  1.00 0.00 ? 52 GLY A HA3  12 
ATOM 11746 N N    . ASP A 1 53 ? -8.031  10.802  -3.987  1.00 0.00 ? 53 ASP A N    12 
ATOM 11747 C CA   . ASP A 1 53 ? -8.949  11.015  -2.876  1.00 0.00 ? 53 ASP A CA   12 
ATOM 11748 C C    . ASP A 1 53 ? -9.945  9.864   -2.773  1.00 0.00 ? 53 ASP A C    12 
ATOM 11749 O O    . ASP A 1 53 ? -10.988 9.989   -2.130  1.00 0.00 ? 53 ASP A O    12 
ATOM 11750 C CB   . ASP A 1 53 ? -9.695  12.339  -3.049  1.00 0.00 ? 53 ASP A CB   12 
ATOM 11751 C CG   . ASP A 1 53 ? -9.444  13.298  -1.902  1.00 0.00 ? 53 ASP A CG   12 
ATOM 11752 O OD1  . ASP A 1 53 ? -8.393  13.972  -1.911  1.00 0.00 ? 53 ASP A OD1  12 
ATOM 11753 O OD2  . ASP A 1 53 ? -10.298 13.375  -0.994  1.00 0.00 ? 53 ASP A OD2  12 
ATOM 11754 H H    . ASP A 1 53 ? -8.336  10.293  -4.767  1.00 0.00 ? 53 ASP A H    12 
ATOM 11755 H HA   . ASP A 1 53 ? -8.367  11.054  -1.967  1.00 0.00 ? 53 ASP A HA   12 
ATOM 11756 H HB2  . ASP A 1 53 ? -9.371  12.810  -3.965  1.00 0.00 ? 53 ASP A HB2  12 
ATOM 11757 H HB3  . ASP A 1 53 ? -10.756 12.143  -3.105  1.00 0.00 ? 53 ASP A HB3  12 
ATOM 11758 N N    . ASP A 1 54 ? -9.617  8.744   -3.412  1.00 0.00 ? 54 ASP A N    12 
ATOM 11759 C CA   . ASP A 1 54 ? -10.484 7.571   -3.394  1.00 0.00 ? 54 ASP A CA   12 
ATOM 11760 C C    . ASP A 1 54 ? -9.715  6.319   -3.806  1.00 0.00 ? 54 ASP A C    12 
ATOM 11761 O O    . ASP A 1 54 ? -8.486  6.329   -3.878  1.00 0.00 ? 54 ASP A O    12 
ATOM 11762 C CB   . ASP A 1 54 ? -11.678 7.778   -4.328  1.00 0.00 ? 54 ASP A CB   12 
ATOM 11763 C CG   . ASP A 1 54 ? -12.491 9.006   -3.967  1.00 0.00 ? 54 ASP A CG   12 
ATOM 11764 O OD1  . ASP A 1 54 ? -13.387 8.892   -3.105  1.00 0.00 ? 54 ASP A OD1  12 
ATOM 11765 O OD2  . ASP A 1 54 ? -12.232 10.081  -4.548  1.00 0.00 ? 54 ASP A OD2  12 
ATOM 11766 H H    . ASP A 1 54 ? -8.772  8.706   -3.908  1.00 0.00 ? 54 ASP A H    12 
ATOM 11767 H HA   . ASP A 1 54 ? -10.846 7.441   -2.385  1.00 0.00 ? 54 ASP A HA   12 
ATOM 11768 H HB2  . ASP A 1 54 ? -11.319 7.893   -5.340  1.00 0.00 ? 54 ASP A HB2  12 
ATOM 11769 H HB3  . ASP A 1 54 ? -12.323 6.913   -4.276  1.00 0.00 ? 54 ASP A HB3  12 
ATOM 11770 N N    . LEU A 1 55 ? -10.447 5.244   -4.077  1.00 0.00 ? 55 LEU A N    12 
ATOM 11771 C CA   . LEU A 1 55 ? -9.838  3.983   -4.484  1.00 0.00 ? 55 LEU A CA   12 
ATOM 11772 C C    . LEU A 1 55 ? -9.014  3.381   -3.350  1.00 0.00 ? 55 LEU A C    12 
ATOM 11773 O O    . LEU A 1 55 ? -8.032  2.678   -3.588  1.00 0.00 ? 55 LEU A O    12 
ATOM 11774 C CB   . LEU A 1 55 ? -8.955  4.193   -5.716  1.00 0.00 ? 55 LEU A CB   12 
ATOM 11775 C CG   . LEU A 1 55 ? -9.712  4.453   -7.019  1.00 0.00 ? 55 LEU A CG   12 
ATOM 11776 C CD1  . LEU A 1 55 ? -9.688  5.934   -7.364  1.00 0.00 ? 55 LEU A CD1  12 
ATOM 11777 C CD2  . LEU A 1 55 ? -9.118  3.630   -8.152  1.00 0.00 ? 55 LEU A CD2  12 
ATOM 11778 H H    . LEU A 1 55 ? -11.423 5.299   -4.002  1.00 0.00 ? 55 LEU A H    12 
ATOM 11779 H HA   . LEU A 1 55 ? -10.633 3.298   -4.737  1.00 0.00 ? 55 LEU A HA   12 
ATOM 11780 H HB2  . LEU A 1 55 ? -8.305  5.035   -5.527  1.00 0.00 ? 55 LEU A HB2  12 
ATOM 11781 H HB3  . LEU A 1 55 ? -8.346  3.312   -5.850  1.00 0.00 ? 55 LEU A HB3  12 
ATOM 11782 H HG   . LEU A 1 55 ? -10.744 4.156   -6.894  1.00 0.00 ? 55 LEU A HG   12 
ATOM 11783 H HD11 . LEU A 1 55 ? -10.222 6.488   -6.606  1.00 0.00 ? 55 LEU A HD11 12 
ATOM 11784 H HD12 . LEU A 1 55 ? -10.161 6.088   -8.322  1.00 0.00 ? 55 LEU A HD12 12 
ATOM 11785 H HD13 . LEU A 1 55 ? -8.665  6.277   -7.407  1.00 0.00 ? 55 LEU A HD13 12 
ATOM 11786 H HD21 . LEU A 1 55 ? -9.680  2.715   -8.265  1.00 0.00 ? 55 LEU A HD21 12 
ATOM 11787 H HD22 . LEU A 1 55 ? -8.089  3.395   -7.925  1.00 0.00 ? 55 LEU A HD22 12 
ATOM 11788 H HD23 . LEU A 1 55 ? -9.164  4.196   -9.071  1.00 0.00 ? 55 LEU A HD23 12 
ATOM 11789 N N    . ASP A 1 56 ? -9.424  3.657   -2.117  1.00 0.00 ? 56 ASP A N    12 
ATOM 11790 C CA   . ASP A 1 56 ? -8.729  3.137   -0.945  1.00 0.00 ? 56 ASP A CA   12 
ATOM 11791 C C    . ASP A 1 56 ? -8.970  1.640   -0.803  1.00 0.00 ? 56 ASP A C    12 
ATOM 11792 O O    . ASP A 1 56 ? -9.407  0.982   -1.746  1.00 0.00 ? 56 ASP A O    12 
ATOM 11793 C CB   . ASP A 1 56 ? -9.197  3.867   0.316   1.00 0.00 ? 56 ASP A CB   12 
ATOM 11794 C CG   . ASP A 1 56 ? -9.184  5.374   0.149   1.00 0.00 ? 56 ASP A CG   12 
ATOM 11795 O OD1  . ASP A 1 56 ? -9.546  5.853   -0.946  1.00 0.00 ? 56 ASP A OD1  12 
ATOM 11796 O OD2  . ASP A 1 56 ? -8.812  6.075   1.114   1.00 0.00 ? 56 ASP A OD2  12 
ATOM 11797 H H    . ASP A 1 56 ? -10.217 4.218   -1.992  1.00 0.00 ? 56 ASP A H    12 
ATOM 11798 H HA   . ASP A 1 56 ? -7.674  3.308   -1.077  1.00 0.00 ? 56 ASP A HA   12 
ATOM 11799 H HB2  . ASP A 1 56 ? -10.205 3.559   0.550   1.00 0.00 ? 56 ASP A HB2  12 
ATOM 11800 H HB3  . ASP A 1 56 ? -8.546  3.607   1.137   1.00 0.00 ? 56 ASP A HB3  12 
ATOM 11801 N N    . ASP A 1 57 ? -8.684  1.108   0.378   1.00 0.00 ? 57 ASP A N    12 
ATOM 11802 C CA   . ASP A 1 57 ? -8.880  -0.316  0.637   1.00 0.00 ? 57 ASP A CA   12 
ATOM 11803 C C    . ASP A 1 57 ? -8.119  -0.771  1.884   1.00 0.00 ? 57 ASP A C    12 
ATOM 11804 O O    . ASP A 1 57 ? -7.328  -0.016  2.453   1.00 0.00 ? 57 ASP A O    12 
ATOM 11805 C CB   . ASP A 1 57 ? -8.451  -1.139  -0.577  1.00 0.00 ? 57 ASP A CB   12 
ATOM 11806 C CG   . ASP A 1 57 ? -9.631  -1.754  -1.303  1.00 0.00 ? 57 ASP A CG   12 
ATOM 11807 O OD1  . ASP A 1 57 ? -10.112 -2.816  -0.856  1.00 0.00 ? 57 ASP A OD1  12 
ATOM 11808 O OD2  . ASP A 1 57 ? -10.073 -1.176  -2.318  1.00 0.00 ? 57 ASP A OD2  12 
ATOM 11809 H H    . ASP A 1 57 ? -8.338  1.685   1.089   1.00 0.00 ? 57 ASP A H    12 
ATOM 11810 H HA   . ASP A 1 57 ? -9.935  -0.473  0.805   1.00 0.00 ? 57 ASP A HA   12 
ATOM 11811 H HB2  . ASP A 1 57 ? -7.918  -0.503  -1.268  1.00 0.00 ? 57 ASP A HB2  12 
ATOM 11812 H HB3  . ASP A 1 57 ? -7.803  -1.933  -0.252  1.00 0.00 ? 57 ASP A HB3  12 
ATOM 11813 N N    . TYR A 1 58 ? -8.377  -2.011  2.303   1.00 0.00 ? 58 TYR A N    12 
ATOM 11814 C CA   . TYR A 1 58 ? -7.740  -2.584  3.491   1.00 0.00 ? 58 TYR A CA   12 
ATOM 11815 C C    . TYR A 1 58 ? -6.775  -3.713  3.138   1.00 0.00 ? 58 TYR A C    12 
ATOM 11816 O O    . TYR A 1 58 ? -6.895  -4.351  2.092   1.00 0.00 ? 58 TYR A O    12 
ATOM 11817 C CB   . TYR A 1 58 ? -8.797  -3.104  4.467   1.00 0.00 ? 58 TYR A CB   12 
ATOM 11818 C CG   . TYR A 1 58 ? -9.414  -2.025  5.324   1.00 0.00 ? 58 TYR A CG   12 
ATOM 11819 C CD1  . TYR A 1 58 ? -9.761  -0.796  4.782   1.00 0.00 ? 58 TYR A CD1  12 
ATOM 11820 C CD2  . TYR A 1 58 ? -9.651  -2.237  6.677   1.00 0.00 ? 58 TYR A CD2  12 
ATOM 11821 C CE1  . TYR A 1 58 ? -10.327 0.195   5.561   1.00 0.00 ? 58 TYR A CE1  12 
ATOM 11822 C CE2  . TYR A 1 58 ? -10.217 -1.251  7.464   1.00 0.00 ? 58 TYR A CE2  12 
ATOM 11823 C CZ   . TYR A 1 58 ? -10.553 -0.038  6.902   1.00 0.00 ? 58 TYR A CZ   12 
ATOM 11824 O OH   . TYR A 1 58 ? -11.117 0.945   7.682   1.00 0.00 ? 58 TYR A OH   12 
ATOM 11825 H H    . TYR A 1 58 ? -9.017  -2.550  1.802   1.00 0.00 ? 58 TYR A H    12 
ATOM 11826 H HA   . TYR A 1 58 ? -7.183  -1.796  3.972   1.00 0.00 ? 58 TYR A HA   12 
ATOM 11827 H HB2  . TYR A 1 58 ? -9.590  -3.577  3.908   1.00 0.00 ? 58 TYR A HB2  12 
ATOM 11828 H HB3  . TYR A 1 58 ? -8.342  -3.832  5.123   1.00 0.00 ? 58 TYR A HB3  12 
ATOM 11829 H HD1  . TYR A 1 58 ? -9.581  -0.617  3.732   1.00 0.00 ? 58 TYR A HD1  12 
ATOM 11830 H HD2  . TYR A 1 58 ? -9.385  -3.189  7.115   1.00 0.00 ? 58 TYR A HD2  12 
ATOM 11831 H HE1  . TYR A 1 58 ? -10.590 1.145   5.120   1.00 0.00 ? 58 TYR A HE1  12 
ATOM 11832 H HE2  . TYR A 1 58 ? -10.393 -1.434  8.514   1.00 0.00 ? 58 TYR A HE2  12 
ATOM 11833 H HH   . TYR A 1 58 ? -10.833 1.807   7.366   1.00 0.00 ? 58 TYR A HH   12 
ATOM 11834 N N    . CYS A 1 59 ? -5.814  -3.941  4.032   1.00 0.00 ? 59 CYS A N    12 
ATOM 11835 C CA   . CYS A 1 59 ? -4.793  -4.972  3.851   1.00 0.00 ? 59 CYS A CA   12 
ATOM 11836 C C    . CYS A 1 59 ? -5.153  -6.282  4.556   1.00 0.00 ? 59 CYS A C    12 
ATOM 11837 O O    . CYS A 1 59 ? -5.296  -6.320  5.778   1.00 0.00 ? 59 CYS A O    12 
ATOM 11838 C CB   . CYS A 1 59 ? -3.469  -4.465  4.413   1.00 0.00 ? 59 CYS A CB   12 
ATOM 11839 S SG   . CYS A 1 59 ? -2.771  -3.024  3.537   1.00 0.00 ? 59 CYS A SG   12 
ATOM 11840 H H    . CYS A 1 59 ? -5.784  -3.387  4.840   1.00 0.00 ? 59 CYS A H    12 
ATOM 11841 H HA   . CYS A 1 59 ? -4.679  -5.156  2.796   1.00 0.00 ? 59 CYS A HA   12 
ATOM 11842 H HB2  . CYS A 1 59 ? -3.628  -4.184  5.433   1.00 0.00 ? 59 CYS A HB2  12 
ATOM 11843 H HB3  . CYS A 1 59 ? -2.741  -5.253  4.386   1.00 0.00 ? 59 CYS A HB3  12 
ATOM 11844 N N    . ASN A 1 60 ? -5.261  -7.358  3.780   1.00 0.00 ? 60 ASN A N    12 
ATOM 11845 C CA   . ASN A 1 60 ? -5.562  -8.686  4.312   1.00 0.00 ? 60 ASN A CA   12 
ATOM 11846 C C    . ASN A 1 60 ? -4.613  -9.693  3.684   1.00 0.00 ? 60 ASN A C    12 
ATOM 11847 O O    . ASN A 1 60 ? -3.594  -10.058 4.268   1.00 0.00 ? 60 ASN A O    12 
ATOM 11848 C CB   . ASN A 1 60 ? -7.023  -9.056  4.045   1.00 0.00 ? 60 ASN A CB   12 
ATOM 11849 C CG   . ASN A 1 60 ? -7.958  -7.929  4.420   1.00 0.00 ? 60 ASN A CG   12 
ATOM 11850 O OD1  . ASN A 1 60 ? -9.028  -7.767  3.832   1.00 0.00 ? 60 ASN A OD1  12 
ATOM 11851 N ND2  . ASN A 1 60 ? -7.552  -7.141  5.407   1.00 0.00 ? 60 ASN A ND2  12 
ATOM 11852 H H    . ASN A 1 60 ? -5.111  -7.263  2.822   1.00 0.00 ? 60 ASN A H    12 
ATOM 11853 H HA   . ASN A 1 60 ? -5.388  -8.666  5.367   1.00 0.00 ? 60 ASN A HA   12 
ATOM 11854 H HB2  . ASN A 1 60 ? -7.155  -9.275  2.998   1.00 0.00 ? 60 ASN A HB2  12 
ATOM 11855 H HB3  . ASN A 1 60 ? -7.282  -9.926  4.630   1.00 0.00 ? 60 ASN A HB3  12 
ATOM 11856 H HD21 . ASN A 1 60 ? -6.691  -7.337  5.831   1.00 0.00 ? 60 ASN A HD21 12 
ATOM 11857 H HD22 . ASN A 1 60 ? -8.121  -6.389  5.663   1.00 0.00 ? 60 ASN A HD22 12 
ATOM 11858 N N    . GLY A 1 61 ? -4.919  -10.072 2.460   1.00 0.00 ? 61 GLY A N    12 
ATOM 11859 C CA   . GLY A 1 61 ? -4.053  -10.964 1.716   1.00 0.00 ? 61 GLY A CA   12 
ATOM 11860 C C    . GLY A 1 61 ? -3.181  -10.141 0.794   1.00 0.00 ? 61 GLY A C    12 
ATOM 11861 O O    . GLY A 1 61 ? -2.763  -10.588 -0.274  1.00 0.00 ? 61 GLY A O    12 
ATOM 11862 H H    . GLY A 1 61 ? -5.711  -9.696  2.035   1.00 0.00 ? 61 GLY A H    12 
ATOM 11863 H HA2  . GLY A 1 61 ? -3.434  -11.523 2.403