data_1LJM
# 
_entry.id   1LJM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1LJM         
RCSB  RCSB016000   
WWPDB D_1000016000 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1LJM 
_pdbx_database_status.recvd_initial_deposition_date   2002-04-22 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bartfeld, D.'   1 
'Shimon, L.'     2 
'Couture, G.C.'  3 
'Rabinovich, D.' 4 
'Frolow, F.'     5 
'Levanon, D.'    6 
'Groner, Y.'     7 
'Shakked, Z.'    8 
# 
_citation.id                        primary 
_citation.title                     
'DNA Recognition by the RUNX1 Transcription Factor Is Mediated by an Allosteric Transition in the RUNT Domain and by DNA Bending.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            10 
_citation.page_first                1395 
_citation.page_last                 1407 
_citation.year                      ? 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12377125 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(02)00853-5' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bartfeld, D.'   1 
primary 'Shimon, L.'     2 
primary 'Couture, G.'    3 
primary 'Rabinovich, D.' 4 
primary 'Frolow, F.'     5 
primary 'Levanon, D.'    6 
primary 'Groner, Y.'     7 
primary 'Shakked, Z.'    8 
# 
_cell.entry_id           1LJM 
_cell.length_a           121.230 
_cell.length_b           121.230 
_cell.length_c           186.330 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              36 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1LJM 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'RUNX1 transcription factor' 14579.675 2   ? ? 'Runt domain' ? 
2 non-polymer syn 'CHLORIDE ION'               35.453    5   ? ? ?             ? 
3 water       nat water                        18.015    201 ? ? ?             ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Runt-related transcription factor 1, Acute myeloid leukemia 1 protein, Core-binding factor, alpha 2 subunit' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVAR
FNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVAR
FNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQ
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   GLU n 
1 4   VAL n 
1 5   LEU n 
1 6   ALA n 
1 7   ASP n 
1 8   HIS n 
1 9   PRO n 
1 10  GLY n 
1 11  GLU n 
1 12  LEU n 
1 13  VAL n 
1 14  ARG n 
1 15  THR n 
1 16  ASP n 
1 17  SER n 
1 18  PRO n 
1 19  ASN n 
1 20  PHE n 
1 21  LEU n 
1 22  CYS n 
1 23  SER n 
1 24  VAL n 
1 25  LEU n 
1 26  PRO n 
1 27  THR n 
1 28  HIS n 
1 29  TRP n 
1 30  ARG n 
1 31  CYS n 
1 32  ASN n 
1 33  LYS n 
1 34  THR n 
1 35  LEU n 
1 36  PRO n 
1 37  ILE n 
1 38  ALA n 
1 39  PHE n 
1 40  LYS n 
1 41  VAL n 
1 42  VAL n 
1 43  ALA n 
1 44  LEU n 
1 45  GLY n 
1 46  ASP n 
1 47  VAL n 
1 48  PRO n 
1 49  ASP n 
1 50  GLY n 
1 51  THR n 
1 52  LEU n 
1 53  VAL n 
1 54  THR n 
1 55  VAL n 
1 56  MET n 
1 57  ALA n 
1 58  GLY n 
1 59  ASN n 
1 60  ASP n 
1 61  GLU n 
1 62  ASN n 
1 63  TYR n 
1 64  SER n 
1 65  ALA n 
1 66  GLU n 
1 67  LEU n 
1 68  ARG n 
1 69  ASN n 
1 70  ALA n 
1 71  THR n 
1 72  ALA n 
1 73  ALA n 
1 74  MET n 
1 75  LYS n 
1 76  ASN n 
1 77  GLN n 
1 78  VAL n 
1 79  ALA n 
1 80  ARG n 
1 81  PHE n 
1 82  ASN n 
1 83  ASP n 
1 84  LEU n 
1 85  ARG n 
1 86  PHE n 
1 87  VAL n 
1 88  GLY n 
1 89  ARG n 
1 90  SER n 
1 91  GLY n 
1 92  ARG n 
1 93  GLY n 
1 94  LYS n 
1 95  SER n 
1 96  PHE n 
1 97  THR n 
1 98  LEU n 
1 99  THR n 
1 100 ILE n 
1 101 THR n 
1 102 VAL n 
1 103 PHE n 
1 104 THR n 
1 105 ASN n 
1 106 PRO n 
1 107 PRO n 
1 108 GLN n 
1 109 VAL n 
1 110 ALA n 
1 111 THR n 
1 112 TYR n 
1 113 HIS n 
1 114 ARG n 
1 115 ALA n 
1 116 ILE n 
1 117 LYS n 
1 118 ILE n 
1 119 THR n 
1 120 VAL n 
1 121 ASP n 
1 122 GLY n 
1 123 PRO n 
1 124 ARG n 
1 125 GLU n 
1 126 PRO n 
1 127 ARG n 
1 128 ARG n 
1 129 HIS n 
1 130 ARG n 
1 131 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 human 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               PHS2 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PV/8+lambdaPL+RBS 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       RUNT-PV-8 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RUNX1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVAR
FNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQ
;
_struct_ref.pdbx_align_begin           51 
_struct_ref.pdbx_db_accession          Q01196 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1LJM A 1 ? 131 ? Q01196 51 ? 181 ? 1051 1181 
2 1 1LJM B 1 ? 131 ? Q01196 51 ? 181 ? 2051 2181 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1LJM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   72.76 
_exptl_crystal.density_Matthews      4.52 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'Ethanol, Sodium Chloride, Tris-HCl, Hepes, DTT, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2000-01-18 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'osmic mirrors' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU ULTRAX 18' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1LJM 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             43.0 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   17379 
_reflns.number_all                   17501 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            0.0710000 
_reflns.pdbx_Rsym_value              0.0710000 
_reflns.pdbx_netI_over_sigmaI        17.2 
_reflns.B_iso_Wilson_estimate        31.5 
_reflns.pdbx_redundancy              13.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.5 
_reflns_shell.d_res_low              2.54 
_reflns_shell.percent_possible_all   99.3 
_reflns_shell.Rmerge_I_obs           0.2950000 
_reflns_shell.pdbx_Rsym_value        0.2950000 
_reflns_shell.meanI_over_sigI_obs    2.7 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1LJM 
_refine.ls_number_reflns_obs                     17379 
_refine.ls_number_reflns_all                     17501 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             43 
_refine.ls_d_res_high                            2.5 
_refine.ls_percent_reflns_obs                    99.3 
_refine.ls_R_factor_obs                          0.1947000 
_refine.ls_R_factor_all                          0.1947000 
_refine.ls_R_factor_R_work                       0.1930000 
_refine.ls_R_factor_R_free                       0.2490000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  842 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               40.5 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1E50' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1LJM 
_refine_analyze.Luzzati_coordinate_error_obs    0.29 
_refine_analyze.Luzzati_sigma_a_obs             0.36 
_refine_analyze.Luzzati_d_res_low_obs           43.00 
_refine_analyze.Luzzati_coordinate_error_free   0.39 
_refine_analyze.Luzzati_sigma_a_free            0.39 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1759 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             201 
_refine_hist.number_atoms_total               1965 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        43 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg        1.2   ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d           0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        3.8   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 26.5  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.78  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1LJM 
_struct.title                     'DNA recognition is mediated by conformational transition and by DNA bending' 
_struct.pdbx_descriptor           'RUNX1 transcription factor' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1LJM 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'immunoglobulin fold, beta-sandwich, TRANSCRIPTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 3 ? 
I N N 3 ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 105 A . ? ASN 1155 A PRO 106 A ? PRO 1156 A 1 0.78 
2 ASN 105 B . ? ASN 2155 B PRO 106 B ? PRO 2156 B 1 0.12 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 4 ? 
D ? 2 ? 
E ? 4 ? 
F ? 2 ? 
G ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 12  ? ARG A 14  ? LEU A 1062 ARG A 1064 
A 2 PHE A 20  ? SER A 23  ? PHE A 1070 SER A 1073 
A 3 LYS A 40  ? ALA A 43  ? LYS A 1090 ALA A 1093 
A 4 VAL A 78  ? ARG A 80  ? VAL A 1128 ARG A 1130 
B 1 HIS A 28  ? ARG A 30  ? HIS A 1078 ARG A 1080 
B 2 LYS A 117 ? THR A 119 ? LYS A 1167 THR A 1169 
C 1 THR A 71  ? ALA A 73  ? THR A 1121 ALA A 1123 
C 2 LEU A 52  ? GLY A 58  ? LEU A 1102 GLY A 1108 
C 3 THR A 97  ? VAL A 102 ? THR A 1147 VAL A 1152 
C 4 GLN A 108 ? THR A 111 ? GLN A 1158 THR A 1161 
D 1 LEU A 67  ? ARG A 68  ? LEU A 1117 ARG A 1118 
D 2 ARG A 85  ? PHE A 86  ? ARG A 1135 PHE A 1136 
E 1 VAL B 13  ? ARG B 14  ? VAL B 2063 ARG B 2064 
E 2 PHE B 20  ? CYS B 22  ? PHE B 2070 CYS B 2072 
E 3 LYS B 40  ? ALA B 43  ? LYS B 2090 ALA B 2093 
E 4 VAL B 78  ? ARG B 80  ? VAL B 2128 ARG B 2130 
F 1 HIS B 28  ? ARG B 30  ? HIS B 2078 ARG B 2080 
F 2 LYS B 117 ? THR B 119 ? LYS B 2167 THR B 2169 
G 1 THR B 71  ? ALA B 73  ? THR B 2121 ALA B 2123 
G 2 LEU B 52  ? GLY B 58  ? LEU B 2102 GLY B 2108 
G 3 THR B 97  ? VAL B 102 ? THR B 2147 VAL B 2152 
G 4 GLN B 108 ? THR B 111 ? GLN B 2158 THR B 2161 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 13  ? N VAL A 1063 O CYS A 22  ? O CYS A 1072 
A 2 3 N LEU A 21  ? N LEU A 1071 O VAL A 42  ? O VAL A 1092 
A 3 4 N VAL A 41  ? N VAL A 1091 O ALA A 79  ? O ALA A 1129 
B 1 2 N TRP A 29  ? N TRP A 1079 O LYS A 117 ? O LYS A 1167 
C 1 2 O ALA A 72  ? O ALA A 1122 N VAL A 53  ? N VAL A 1103 
C 2 3 N MET A 56  ? N MET A 1106 O THR A 99  ? O THR A 1149 
C 3 4 N ILE A 100 ? N ILE A 1150 O ALA A 110 ? O ALA A 1160 
D 1 2 N ARG A 68  ? N ARG A 1118 O ARG A 85  ? O ARG A 1135 
E 1 2 N VAL B 13  ? N VAL B 2063 O CYS B 22  ? O CYS B 2072 
E 2 3 N LEU B 21  ? N LEU B 2071 O VAL B 42  ? O VAL B 2092 
E 3 4 N VAL B 41  ? N VAL B 2091 O ALA B 79  ? O ALA B 2129 
F 1 2 N TRP B 29  ? N TRP B 2079 O LYS B 117 ? O LYS B 2167 
G 1 2 O ALA B 72  ? O ALA B 2122 N VAL B 53  ? N VAL B 2103 
G 2 3 N GLY B 58  ? N GLY B 2108 O THR B 97  ? O THR B 2147 
G 3 4 N ILE B 100 ? N ILE B 2150 O ALA B 110 ? O ALA B 2160 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL B 4001' 
AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL B 4002' 
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 4003' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL B 4004' 
AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL B 4005' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 THR B 104 ? THR B 2154 . ? 10_455 ? 
2  AC1 3 ASN B 105 ? ASN B 2155 . ? 1_555  ? 
3  AC1 3 ASN B 105 ? ASN B 2155 . ? 10_455 ? 
4  AC2 2 GLN B 108 ? GLN B 2158 . ? 1_555  ? 
5  AC2 2 HOH I .   ? HOH B 3056 . ? 1_555  ? 
6  AC3 3 ALA A 65  ? ALA A 1115 . ? 1_555  ? 
7  AC3 3 GLU A 66  ? GLU A 1116 . ? 1_555  ? 
8  AC3 3 GLY A 88  ? GLY A 1138 . ? 1_555  ? 
9  AC4 4 ASN B 62  ? ASN B 2112 . ? 1_555  ? 
10 AC4 4 ALA B 65  ? ALA B 2115 . ? 1_555  ? 
11 AC4 4 GLU B 66  ? GLU B 2116 . ? 1_555  ? 
12 AC4 4 GLY B 88  ? GLY B 2138 . ? 1_555  ? 
13 AC5 3 ARG B 92  ? ARG B 2142 . ? 1_555  ? 
14 AC5 3 THR B 119 ? THR B 2169 . ? 1_555  ? 
15 AC5 3 VAL B 120 ? VAL B 2170 . ? 1_555  ? 
# 
_database_PDB_matrix.entry_id          1LJM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1LJM 
_atom_sites.fract_transf_matrix[1][1]   0.008249 
_atom_sites.fract_transf_matrix[1][2]   0.004762 
_atom_sites.fract_transf_matrix[1][3]   -0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009525 
_atom_sites.fract_transf_matrix[2][3]   -0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005367 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLU A 1 11  ? 1.442   37.097 7.875   1.00 65.91  ? 1061 GLU A N   1 
ATOM   2    C  CA  . GLU A 1 11  ? 1.915   38.217 7.007   1.00 71.62  ? 1061 GLU A CA  1 
ATOM   3    C  C   . GLU A 1 11  ? 1.194   39.536 7.302   1.00 67.50  ? 1061 GLU A C   1 
ATOM   4    O  O   . GLU A 1 11  ? 0.022   39.715 6.955   1.00 62.83  ? 1061 GLU A O   1 
ATOM   5    C  CB  . GLU A 1 11  ? 1.730   37.843 5.531   1.00 85.11  ? 1061 GLU A CB  1 
ATOM   6    C  CG  . GLU A 1 11  ? 2.116   38.937 4.536   1.00 98.52  ? 1061 GLU A CG  1 
ATOM   7    C  CD  . GLU A 1 11  ? 3.421   39.630 4.898   1.00 110.66 ? 1061 GLU A CD  1 
ATOM   8    O  OE1 . GLU A 1 11  ? 4.403   38.933 5.242   1.00 114.22 ? 1061 GLU A OE1 1 
ATOM   9    O  OE2 . GLU A 1 11  ? 3.467   40.877 4.825   1.00 114.94 ? 1061 GLU A OE2 1 
ATOM   10   N  N   . LEU A 1 12  ? 1.911   40.460 7.936   1.00 60.98  ? 1062 LEU A N   1 
ATOM   11   C  CA  . LEU A 1 12  ? 1.357   41.762 8.287   1.00 52.83  ? 1062 LEU A CA  1 
ATOM   12   C  C   . LEU A 1 12  ? 1.946   42.894 7.466   1.00 53.26  ? 1062 LEU A C   1 
ATOM   13   O  O   . LEU A 1 12  ? 3.091   42.829 7.021   1.00 60.58  ? 1062 LEU A O   1 
ATOM   14   C  CB  . LEU A 1 12  ? 1.601   42.067 9.763   1.00 42.49  ? 1062 LEU A CB  1 
ATOM   15   C  CG  . LEU A 1 12  ? 0.839   41.203 10.759  1.00 44.65  ? 1062 LEU A CG  1 
ATOM   16   C  CD1 . LEU A 1 12  ? 1.191   41.625 12.174  1.00 40.97  ? 1062 LEU A CD1 1 
ATOM   17   C  CD2 . LEU A 1 12  ? -0.657  41.349 10.514  1.00 47.95  ? 1062 LEU A CD2 1 
ATOM   18   N  N   . VAL A 1 13  ? 1.152   43.938 7.278   1.00 45.45  ? 1063 VAL A N   1 
ATOM   19   C  CA  . VAL A 1 13  ? 1.596   45.106 6.539   1.00 47.29  ? 1063 VAL A CA  1 
ATOM   20   C  C   . VAL A 1 13  ? 1.475   46.292 7.472   1.00 47.79  ? 1063 VAL A C   1 
ATOM   21   O  O   . VAL A 1 13  ? 0.674   46.271 8.405   1.00 51.09  ? 1063 VAL A O   1 
ATOM   22   C  CB  . VAL A 1 13  ? 0.724   45.360 5.300   1.00 44.97  ? 1063 VAL A CB  1 
ATOM   23   C  CG1 . VAL A 1 13  ? 0.936   44.249 4.286   1.00 49.79  ? 1063 VAL A CG1 1 
ATOM   24   C  CG2 . VAL A 1 13  ? -0.736  45.453 5.708   1.00 38.84  ? 1063 VAL A CG2 1 
ATOM   25   N  N   . ARG A 1 14  ? 2.269   47.328 7.233   1.00 47.86  ? 1064 ARG A N   1 
ATOM   26   C  CA  . ARG A 1 14  ? 2.212   48.500 8.091   1.00 46.93  ? 1064 ARG A CA  1 
ATOM   27   C  C   . ARG A 1 14  ? 1.168   49.486 7.606   1.00 38.54  ? 1064 ARG A C   1 
ATOM   28   O  O   . ARG A 1 14  ? 0.765   49.463 6.448   1.00 38.48  ? 1064 ARG A O   1 
ATOM   29   C  CB  . ARG A 1 14  ? 3.586   49.175 8.165   1.00 53.96  ? 1064 ARG A CB  1 
ATOM   30   C  CG  . ARG A 1 14  ? 4.097   49.728 6.851   1.00 72.79  ? 1064 ARG A CG  1 
ATOM   31   C  CD  . ARG A 1 14  ? 5.443   49.115 6.469   1.00 87.58  ? 1064 ARG A CD  1 
ATOM   32   N  NE  . ARG A 1 14  ? 6.507   49.439 7.416   1.00 93.62  ? 1064 ARG A NE  1 
ATOM   33   C  CZ  . ARG A 1 14  ? 7.752   48.977 7.323   1.00 98.66  ? 1064 ARG A CZ  1 
ATOM   34   N  NH1 . ARG A 1 14  ? 8.089   48.170 6.325   1.00 98.86  ? 1064 ARG A NH1 1 
ATOM   35   N  NH2 . ARG A 1 14  ? 8.660   49.319 8.227   1.00 103.16 ? 1064 ARG A NH2 1 
ATOM   36   N  N   . THR A 1 15  ? 0.721   50.340 8.515   1.00 37.68  ? 1065 THR A N   1 
ATOM   37   C  CA  . THR A 1 15  ? -0.268  51.357 8.195   1.00 34.21  ? 1065 THR A CA  1 
ATOM   38   C  C   . THR A 1 15  ? 0.475   52.682 8.070   1.00 34.70  ? 1065 THR A C   1 
ATOM   39   O  O   . THR A 1 15  ? 1.703   52.695 8.006   1.00 36.03  ? 1065 THR A O   1 
ATOM   40   C  CB  . THR A 1 15  ? -1.333  51.468 9.309   1.00 38.83  ? 1065 THR A CB  1 
ATOM   41   O  OG1 . THR A 1 15  ? -0.714  51.901 10.528  1.00 36.87  ? 1065 THR A OG1 1 
ATOM   42   C  CG2 . THR A 1 15  ? -1.999  50.113 9.540   1.00 32.60  ? 1065 THR A CG2 1 
ATOM   43   N  N   . ASP A 1 16  ? -0.256  53.792 8.049   1.00 33.51  ? 1066 ASP A N   1 
ATOM   44   C  CA  . ASP A 1 16  ? 0.380   55.096 7.928   1.00 35.60  ? 1066 ASP A CA  1 
ATOM   45   C  C   . ASP A 1 16  ? 0.840   55.546 9.309   1.00 40.92  ? 1066 ASP A C   1 
ATOM   46   O  O   . ASP A 1 16  ? 1.346   56.656 9.494   1.00 43.43  ? 1066 ASP A O   1 
ATOM   47   C  CB  . ASP A 1 16  ? -0.596  56.105 7.317   1.00 31.26  ? 1066 ASP A CB  1 
ATOM   48   C  CG  . ASP A 1 16  ? -1.634  56.583 8.301   1.00 38.75  ? 1066 ASP A CG  1 
ATOM   49   O  OD1 . ASP A 1 16  ? -2.019  55.805 9.201   1.00 40.42  ? 1066 ASP A OD1 1 
ATOM   50   O  OD2 . ASP A 1 16  ? -2.074  57.742 8.160   1.00 44.24  ? 1066 ASP A OD2 1 
ATOM   51   N  N   . SER A 1 17  ? 0.643   54.656 10.276  1.00 40.91  ? 1067 SER A N   1 
ATOM   52   C  CA  . SER A 1 17  ? 1.039   54.886 11.659  1.00 35.85  ? 1067 SER A CA  1 
ATOM   53   C  C   . SER A 1 17  ? 2.073   53.834 12.025  1.00 39.57  ? 1067 SER A C   1 
ATOM   54   O  O   . SER A 1 17  ? 1.819   52.634 11.917  1.00 40.13  ? 1067 SER A O   1 
ATOM   55   C  CB  . SER A 1 17  ? -0.151  54.759 12.599  1.00 36.07  ? 1067 SER A CB  1 
ATOM   56   O  OG  . SER A 1 17  ? 0.280   54.841 13.943  1.00 38.85  ? 1067 SER A OG  1 
ATOM   57   N  N   . PRO A 1 18  ? 3.257   54.274 12.468  1.00 41.73  ? 1068 PRO A N   1 
ATOM   58   C  CA  . PRO A 1 18  ? 4.347   53.373 12.851  1.00 41.21  ? 1068 PRO A CA  1 
ATOM   59   C  C   . PRO A 1 18  ? 4.051   52.537 14.092  1.00 41.33  ? 1068 PRO A C   1 
ATOM   60   O  O   . PRO A 1 18  ? 4.706   51.521 14.337  1.00 41.25  ? 1068 PRO A O   1 
ATOM   61   C  CB  . PRO A 1 18  ? 5.518   54.325 13.052  1.00 42.22  ? 1068 PRO A CB  1 
ATOM   62   C  CG  . PRO A 1 18  ? 4.842   55.557 13.573  1.00 43.48  ? 1068 PRO A CG  1 
ATOM   63   C  CD  . PRO A 1 18  ? 3.640   55.682 12.676  1.00 41.25  ? 1068 PRO A CD  1 
ATOM   64   N  N   . ASN A 1 19  ? 3.061   52.959 14.872  1.00 39.74  ? 1069 ASN A N   1 
ATOM   65   C  CA  . ASN A 1 19  ? 2.696   52.233 16.087  1.00 42.41  ? 1069 ASN A CA  1 
ATOM   66   C  C   . ASN A 1 19  ? 1.713   51.088 15.857  1.00 37.75  ? 1069 ASN A C   1 
ATOM   67   O  O   . ASN A 1 19  ? 1.396   50.347 16.791  1.00 33.64  ? 1069 ASN A O   1 
ATOM   68   C  CB  . ASN A 1 19  ? 2.139   53.208 17.125  1.00 48.99  ? 1069 ASN A CB  1 
ATOM   69   C  CG  . ASN A 1 19  ? 3.233   54.011 17.796  1.00 59.28  ? 1069 ASN A CG  1 
ATOM   70   O  OD1 . ASN A 1 19  ? 3.011   55.127 18.251  1.00 68.71  ? 1069 ASN A OD1 1 
ATOM   71   N  ND2 . ASN A 1 19  ? 4.428   53.428 17.876  1.00 62.03  ? 1069 ASN A ND2 1 
ATOM   72   N  N   . PHE A 1 20  ? 1.249   50.934 14.615  1.00 35.89  ? 1070 PHE A N   1 
ATOM   73   C  CA  . PHE A 1 20  ? 0.299   49.874 14.278  1.00 30.96  ? 1070 PHE A CA  1 
ATOM   74   C  C   . PHE A 1 20  ? 0.528   49.152 12.954  1.00 29.09  ? 1070 PHE A C   1 
ATOM   75   O  O   . PHE A 1 20  ? 0.930   49.749 11.956  1.00 30.19  ? 1070 PHE A O   1 
ATOM   76   C  CB  . PHE A 1 20  ? -1.133  50.419 14.278  1.00 26.49  ? 1070 PHE A CB  1 
ATOM   77   C  CG  . PHE A 1 20  ? -1.574  50.964 15.602  1.00 31.48  ? 1070 PHE A CG  1 
ATOM   78   C  CD1 . PHE A 1 20  ? -1.443  52.321 15.890  1.00 22.49  ? 1070 PHE A CD1 1 
ATOM   79   C  CD2 . PHE A 1 20  ? -2.075  50.112 16.584  1.00 30.51  ? 1070 PHE A CD2 1 
ATOM   80   C  CE1 . PHE A 1 20  ? -1.802  52.820 17.137  1.00 27.25  ? 1070 PHE A CE1 1 
ATOM   81   C  CE2 . PHE A 1 20  ? -2.436  50.602 17.835  1.00 30.64  ? 1070 PHE A CE2 1 
ATOM   82   C  CZ  . PHE A 1 20  ? -2.298  51.959 18.113  1.00 30.65  ? 1070 PHE A CZ  1 
ATOM   83   N  N   . LEU A 1 21  ? 0.233   47.857 12.978  1.00 31.00  ? 1071 LEU A N   1 
ATOM   84   C  CA  . LEU A 1 21  ? 0.332   46.954 11.833  1.00 35.60  ? 1071 LEU A CA  1 
ATOM   85   C  C   . LEU A 1 21  ? -1.023  46.259 11.714  1.00 39.38  ? 1071 LEU A C   1 
ATOM   86   O  O   . LEU A 1 21  ? -1.818  46.291 12.653  1.00 44.93  ? 1071 LEU A O   1 
ATOM   87   C  CB  . LEU A 1 21  ? 1.400   45.892 12.093  1.00 25.55  ? 1071 LEU A CB  1 
ATOM   88   C  CG  . LEU A 1 21  ? 2.812   46.127 11.576  1.00 32.23  ? 1071 LEU A CG  1 
ATOM   89   C  CD1 . LEU A 1 21  ? 3.210   47.589 11.672  1.00 26.40  ? 1071 LEU A CD1 1 
ATOM   90   C  CD2 . LEU A 1 21  ? 3.739   45.245 12.376  1.00 25.86  ? 1071 LEU A CD2 1 
ATOM   91   N  N   . CYS A 1 22  ? -1.298  45.633 10.576  1.00 39.58  ? 1072 CYS A N   1 
ATOM   92   C  CA  . CYS A 1 22  ? -2.559  44.919 10.421  1.00 39.43  ? 1072 CYS A CA  1 
ATOM   93   C  C   . CYS A 1 22  ? -2.468  43.898 9.308   1.00 39.47  ? 1072 CYS A C   1 
ATOM   94   O  O   . CYS A 1 22  ? -1.597  43.989 8.440   1.00 33.26  ? 1072 CYS A O   1 
ATOM   95   C  CB  . CYS A 1 22  ? -3.719  45.887 10.157  1.00 38.73  ? 1072 CYS A CB  1 
ATOM   96   S  SG  . CYS A 1 22  ? -3.678  46.735 8.587   1.00 39.53  ? 1072 CYS A SG  1 
ATOM   97   N  N   . SER A 1 23  ? -3.358  42.911 9.350   1.00 39.36  ? 1073 SER A N   1 
ATOM   98   C  CA  . SER A 1 23  ? -3.376  41.864 8.340   1.00 36.06  ? 1073 SER A CA  1 
ATOM   99   C  C   . SER A 1 23  ? -3.686  42.459 6.972   1.00 34.73  ? 1073 SER A C   1 
ATOM   100  O  O   . SER A 1 23  ? -4.200  43.574 6.870   1.00 34.94  ? 1073 SER A O   1 
ATOM   101  C  CB  . SER A 1 23  ? -4.409  40.801 8.708   1.00 25.47  ? 1073 SER A CB  1 
ATOM   102  O  OG  . SER A 1 23  ? -5.652  41.394 9.011   1.00 29.68  ? 1073 SER A OG  1 
ATOM   103  N  N   . VAL A 1 24  ? -3.363  41.715 5.920   1.00 39.28  ? 1074 VAL A N   1 
ATOM   104  C  CA  . VAL A 1 24  ? -3.597  42.168 4.550   1.00 36.47  ? 1074 VAL A CA  1 
ATOM   105  C  C   . VAL A 1 24  ? -5.039  41.965 4.089   1.00 33.36  ? 1074 VAL A C   1 
ATOM   106  O  O   . VAL A 1 24  ? -5.615  40.892 4.272   1.00 30.69  ? 1074 VAL A O   1 
ATOM   107  C  CB  . VAL A 1 24  ? -2.688  41.420 3.543   1.00 34.65  ? 1074 VAL A CB  1 
ATOM   108  C  CG1 . VAL A 1 24  ? -2.851  42.018 2.162   1.00 32.63  ? 1074 VAL A CG1 1 
ATOM   109  C  CG2 . VAL A 1 24  ? -1.249  41.482 3.991   1.00 32.98  ? 1074 VAL A CG2 1 
ATOM   110  N  N   . LEU A 1 25  ? -5.601  43.006 3.483   1.00 31.60  ? 1075 LEU A N   1 
ATOM   111  C  CA  . LEU A 1 25  ? -6.958  42.979 2.951   1.00 31.78  ? 1075 LEU A CA  1 
ATOM   112  C  C   . LEU A 1 25  ? -6.881  42.981 1.431   1.00 39.04  ? 1075 LEU A C   1 
ATOM   113  O  O   . LEU A 1 25  ? -5.915  43.483 0.860   1.00 45.81  ? 1075 LEU A O   1 
ATOM   114  C  CB  . LEU A 1 25  ? -7.739  44.219 3.390   1.00 20.35  ? 1075 LEU A CB  1 
ATOM   115  C  CG  . LEU A 1 25  ? -8.157  44.310 4.848   1.00 27.94  ? 1075 LEU A CG  1 
ATOM   116  C  CD1 . LEU A 1 25  ? -8.787  45.679 5.125   1.00 25.06  ? 1075 LEU A CD1 1 
ATOM   117  C  CD2 . LEU A 1 25  ? -9.129  43.192 5.158   1.00 22.20  ? 1075 LEU A CD2 1 
ATOM   118  N  N   . PRO A 1 26  ? -7.905  42.429 0.756   1.00 43.02  ? 1076 PRO A N   1 
ATOM   119  C  CA  . PRO A 1 26  ? -7.942  42.381 -0.711  1.00 34.81  ? 1076 PRO A CA  1 
ATOM   120  C  C   . PRO A 1 26  ? -8.015  43.793 -1.290  1.00 32.70  ? 1076 PRO A C   1 
ATOM   121  O  O   . PRO A 1 26  ? -8.403  44.733 -0.594  1.00 22.93  ? 1076 PRO A O   1 
ATOM   122  C  CB  . PRO A 1 26  ? -9.220  41.592 -0.998  1.00 36.88  ? 1076 PRO A CB  1 
ATOM   123  C  CG  . PRO A 1 26  ? -9.386  40.738 0.216   1.00 43.54  ? 1076 PRO A CG  1 
ATOM   124  C  CD  . PRO A 1 26  ? -9.048  41.693 1.328   1.00 43.64  ? 1076 PRO A CD  1 
ATOM   125  N  N   . THR A 1 27  ? -7.645  43.947 -2.559  1.00 32.11  ? 1077 THR A N   1 
ATOM   126  C  CA  . THR A 1 27  ? -7.716  45.262 -3.196  1.00 37.04  ? 1077 THR A CA  1 
ATOM   127  C  C   . THR A 1 27  ? -9.127  45.446 -3.737  1.00 36.70  ? 1077 THR A C   1 
ATOM   128  O  O   . THR A 1 27  ? -9.619  46.570 -3.863  1.00 37.31  ? 1077 THR A O   1 
ATOM   129  C  CB  . THR A 1 27  ? -6.718  45.393 -4.363  1.00 30.54  ? 1077 THR A CB  1 
ATOM   130  O  OG1 . THR A 1 27  ? -6.888  44.293 -5.266  1.00 39.91  ? 1077 THR A OG1 1 
ATOM   131  C  CG2 . THR A 1 27  ? -5.296  45.412 -3.840  1.00 39.97  ? 1077 THR A CG2 1 
ATOM   132  N  N   . HIS A 1 28  ? -9.763  44.316 -4.046  1.00 34.80  ? 1078 HIS A N   1 
ATOM   133  C  CA  . HIS A 1 28  ? -11.123 44.284 -4.568  1.00 35.06  ? 1078 HIS A CA  1 
ATOM   134  C  C   . HIS A 1 28  ? -11.823 43.057 -3.996  1.00 34.35  ? 1078 HIS A C   1 
ATOM   135  O  O   . HIS A 1 28  ? -11.284 41.953 -4.062  1.00 37.66  ? 1078 HIS A O   1 
ATOM   136  C  CB  . HIS A 1 28  ? -11.105 44.184 -6.089  1.00 36.72  ? 1078 HIS A CB  1 
ATOM   137  C  CG  . HIS A 1 28  ? -12.439 44.419 -6.723  1.00 42.18  ? 1078 HIS A CG  1 
ATOM   138  N  ND1 . HIS A 1 28  ? -12.695 44.129 -8.045  1.00 47.44  ? 1078 HIS A ND1 1 
ATOM   139  C  CD2 . HIS A 1 28  ? -13.578 44.961 -6.228  1.00 46.92  ? 1078 HIS A CD2 1 
ATOM   140  C  CE1 . HIS A 1 28  ? -13.933 44.486 -8.339  1.00 52.55  ? 1078 HIS A CE1 1 
ATOM   141  N  NE2 . HIS A 1 28  ? -14.490 44.994 -7.255  1.00 50.59  ? 1078 HIS A NE2 1 
ATOM   142  N  N   . TRP A 1 29  ? -13.014 43.248 -3.436  1.00 30.91  ? 1079 TRP A N   1 
ATOM   143  C  CA  . TRP A 1 29  ? -13.760 42.137 -2.854  1.00 32.30  ? 1079 TRP A CA  1 
ATOM   144  C  C   . TRP A 1 29  ? -15.271 42.326 -3.038  1.00 36.52  ? 1079 TRP A C   1 
ATOM   145  O  O   . TRP A 1 29  ? -15.748 43.440 -3.284  1.00 30.37  ? 1079 TRP A O   1 
ATOM   146  C  CB  . TRP A 1 29  ? -13.421 42.020 -1.367  1.00 29.63  ? 1079 TRP A CB  1 
ATOM   147  C  CG  . TRP A 1 29  ? -13.653 40.673 -0.771  1.00 24.09  ? 1079 TRP A CG  1 
ATOM   148  C  CD1 . TRP A 1 29  ? -14.478 40.370 0.277   1.00 29.48  ? 1079 TRP A CD1 1 
ATOM   149  C  CD2 . TRP A 1 29  ? -13.013 39.444 -1.143  1.00 21.54  ? 1079 TRP A CD2 1 
ATOM   150  N  NE1 . TRP A 1 29  ? -14.388 39.028 0.583   1.00 27.13  ? 1079 TRP A NE1 1 
ATOM   151  C  CE2 . TRP A 1 29  ? -13.494 38.439 -0.270  1.00 17.34  ? 1079 TRP A CE2 1 
ATOM   152  C  CE3 . TRP A 1 29  ? -12.073 39.098 -2.123  1.00 27.10  ? 1079 TRP A CE3 1 
ATOM   153  C  CZ2 . TRP A 1 29  ? -13.071 37.107 -0.349  1.00 29.76  ? 1079 TRP A CZ2 1 
ATOM   154  C  CZ3 . TRP A 1 29  ? -11.645 37.768 -2.206  1.00 19.36  ? 1079 TRP A CZ3 1 
ATOM   155  C  CH2 . TRP A 1 29  ? -12.146 36.788 -1.319  1.00 25.98  ? 1079 TRP A CH2 1 
ATOM   156  N  N   . ARG A 1 30  ? -16.019 41.231 -2.915  1.00 38.26  ? 1080 ARG A N   1 
ATOM   157  C  CA  . ARG A 1 30  ? -17.472 41.257 -3.075  1.00 36.63  ? 1080 ARG A CA  1 
ATOM   158  C  C   . ARG A 1 30  ? -18.216 41.773 -1.835  1.00 33.38  ? 1080 ARG A C   1 
ATOM   159  O  O   . ARG A 1 30  ? -17.795 41.531 -0.703  1.00 34.54  ? 1080 ARG A O   1 
ATOM   160  C  CB  . ARG A 1 30  ? -17.967 39.848 -3.429  1.00 32.33  ? 1080 ARG A CB  1 
ATOM   161  C  CG  . ARG A 1 30  ? -19.471 39.682 -3.351  1.00 32.61  ? 1080 ARG A CG  1 
ATOM   162  C  CD  . ARG A 1 30  ? -19.897 38.302 -3.789  1.00 38.09  ? 1080 ARG A CD  1 
ATOM   163  N  NE  . ARG A 1 30  ? -19.734 38.107 -5.223  1.00 38.06  ? 1080 ARG A NE  1 
ATOM   164  C  CZ  . ARG A 1 30  ? -20.043 36.982 -5.858  1.00 40.65  ? 1080 ARG A CZ  1 
ATOM   165  N  NH1 . ARG A 1 30  ? -20.531 35.951 -5.181  1.00 45.39  ? 1080 ARG A NH1 1 
ATOM   166  N  NH2 . ARG A 1 30  ? -19.869 36.885 -7.172  1.00 41.95  ? 1080 ARG A NH2 1 
ATOM   167  N  N   . CYS A 1 31  ? -19.322 42.480 -2.061  1.00 31.83  ? 1081 CYS A N   1 
ATOM   168  C  CA  . CYS A 1 31  ? -20.144 43.005 -0.969  1.00 32.67  ? 1081 CYS A CA  1 
ATOM   169  C  C   . CYS A 1 31  ? -20.618 41.895 -0.045  1.00 32.64  ? 1081 CYS A C   1 
ATOM   170  O  O   . CYS A 1 31  ? -21.062 40.840 -0.501  1.00 36.46  ? 1081 CYS A O   1 
ATOM   171  C  CB  . CYS A 1 31  ? -21.409 43.696 -1.490  1.00 21.36  ? 1081 CYS A CB  1 
ATOM   172  S  SG  . CYS A 1 31  ? -21.189 45.225 -2.370  1.00 50.06  ? 1081 CYS A SG  1 
ATOM   173  N  N   . ASN A 1 32  ? -20.532 42.156 1.253   1.00 30.63  ? 1082 ASN A N   1 
ATOM   174  C  CA  . ASN A 1 32  ? -20.997 41.237 2.281   1.00 27.56  ? 1082 ASN A CA  1 
ATOM   175  C  C   . ASN A 1 32  ? -20.389 39.839 2.271   1.00 20.12  ? 1082 ASN A C   1 
ATOM   176  O  O   . ASN A 1 32  ? -20.865 38.951 2.964   1.00 30.23  ? 1082 ASN A O   1 
ATOM   177  C  CB  . ASN A 1 32  ? -22.526 41.150 2.209   1.00 24.69  ? 1082 ASN A CB  1 
ATOM   178  C  CG  . ASN A 1 32  ? -23.139 40.637 3.489   1.00 23.78  ? 1082 ASN A CG  1 
ATOM   179  O  OD1 . ASN A 1 32  ? -22.721 41.016 4.579   1.00 30.68  ? 1082 ASN A OD1 1 
ATOM   180  N  ND2 . ASN A 1 32  ? -24.144 39.788 3.367   1.00 22.58  ? 1082 ASN A ND2 1 
ATOM   181  N  N   . LYS A 1 33  ? -19.329 39.650 1.500   1.00 24.84  ? 1083 LYS A N   1 
ATOM   182  C  CA  . LYS A 1 33  ? -18.671 38.357 1.445   1.00 20.92  ? 1083 LYS A CA  1 
ATOM   183  C  C   . LYS A 1 33  ? -17.559 38.289 2.480   1.00 28.78  ? 1083 LYS A C   1 
ATOM   184  O  O   . LYS A 1 33  ? -16.823 39.259 2.686   1.00 25.72  ? 1083 LYS A O   1 
ATOM   185  C  CB  . LYS A 1 33  ? -18.079 38.119 0.063   1.00 21.86  ? 1083 LYS A CB  1 
ATOM   186  C  CG  . LYS A 1 33  ? -17.409 36.775 -0.068  1.00 20.58  ? 1083 LYS A CG  1 
ATOM   187  C  CD  . LYS A 1 33  ? -16.897 36.563 -1.471  1.00 27.19  ? 1083 LYS A CD  1 
ATOM   188  C  CE  . LYS A 1 33  ? -16.211 35.217 -1.574  1.00 29.67  ? 1083 LYS A CE  1 
ATOM   189  N  NZ  . LYS A 1 33  ? -15.564 35.027 -2.895  1.00 38.59  ? 1083 LYS A NZ  1 
ATOM   190  N  N   . THR A 1 34  ? -17.447 37.138 3.131   1.00 28.98  ? 1084 THR A N   1 
ATOM   191  C  CA  . THR A 1 34  ? -16.422 36.934 4.135   1.00 26.65  ? 1084 THR A CA  1 
ATOM   192  C  C   . THR A 1 34  ? -15.050 37.156 3.513   1.00 29.01  ? 1084 THR A C   1 
ATOM   193  O  O   . THR A 1 34  ? -14.822 36.842 2.338   1.00 31.93  ? 1084 THR A O   1 
ATOM   194  C  CB  . THR A 1 34  ? -16.507 35.513 4.723   1.00 24.69  ? 1084 THR A CB  1 
ATOM   195  O  OG1 . THR A 1 34  ? -17.730 35.385 5.454   1.00 27.24  ? 1084 THR A OG1 1 
ATOM   196  C  CG2 . THR A 1 34  ? -15.333 35.234 5.656   1.00 29.18  ? 1084 THR A CG2 1 
ATOM   197  N  N   . LEU A 1 35  ? -14.143 37.714 4.308   1.00 29.35  ? 1085 LEU A N   1 
ATOM   198  C  CA  . LEU A 1 35  ? -12.792 37.996 3.847   1.00 28.65  ? 1085 LEU A CA  1 
ATOM   199  C  C   . LEU A 1 35  ? -11.959 36.735 3.782   1.00 28.65  ? 1085 LEU A C   1 
ATOM   200  O  O   . LEU A 1 35  ? -12.157 35.805 4.568   1.00 31.30  ? 1085 LEU A O   1 
ATOM   201  C  CB  . LEU A 1 35  ? -12.109 38.976 4.792   1.00 30.93  ? 1085 LEU A CB  1 
ATOM   202  C  CG  . LEU A 1 35  ? -12.715 40.360 4.878   1.00 29.33  ? 1085 LEU A CG  1 
ATOM   203  C  CD1 . LEU A 1 35  ? -12.092 41.111 6.040   1.00 26.01  ? 1085 LEU A CD1 1 
ATOM   204  C  CD2 . LEU A 1 35  ? -12.489 41.082 3.557   1.00 26.95  ? 1085 LEU A CD2 1 
ATOM   205  N  N   . PRO A 1 36  ? -11.003 36.693 2.845   1.00 25.47  ? 1086 PRO A N   1 
ATOM   206  C  CA  . PRO A 1 36  ? -10.120 35.536 2.679   1.00 29.37  ? 1086 PRO A CA  1 
ATOM   207  C  C   . PRO A 1 36  ? -9.160  35.392 3.862   1.00 37.88  ? 1086 PRO A C   1 
ATOM   208  O  O   . PRO A 1 36  ? -8.673  34.299 4.153   1.00 40.75  ? 1086 PRO A O   1 
ATOM   209  C  CB  . PRO A 1 36  ? -9.388  35.846 1.378   1.00 20.20  ? 1086 PRO A CB  1 
ATOM   210  C  CG  . PRO A 1 36  ? -9.335  37.342 1.375   1.00 22.80  ? 1086 PRO A CG  1 
ATOM   211  C  CD  . PRO A 1 36  ? -10.716 37.724 1.833   1.00 26.31  ? 1086 PRO A CD  1 
ATOM   212  N  N   . ILE A 1 37  ? -8.904  36.509 4.541   1.00 41.35  ? 1087 ILE A N   1 
ATOM   213  C  CA  . ILE A 1 37  ? -8.006  36.542 5.690   1.00 36.06  ? 1087 ILE A CA  1 
ATOM   214  C  C   . ILE A 1 37  ? -8.617  37.359 6.811   1.00 33.03  ? 1087 ILE A C   1 
ATOM   215  O  O   . ILE A 1 37  ? -8.860  38.551 6.646   1.00 33.28  ? 1087 ILE A O   1 
ATOM   216  C  CB  . ILE A 1 37  ? -6.661  37.197 5.329   1.00 42.21  ? 1087 ILE A CB  1 
ATOM   217  C  CG1 . ILE A 1 37  ? -5.987  36.422 4.198   1.00 45.61  ? 1087 ILE A CG1 1 
ATOM   218  C  CG2 . ILE A 1 37  ? -5.765  37.261 6.561   1.00 32.59  ? 1087 ILE A CG2 1 
ATOM   219  C  CD1 . ILE A 1 37  ? -4.730  37.092 3.676   1.00 43.60  ? 1087 ILE A CD1 1 
ATOM   220  N  N   . ALA A 1 38  ? -8.857  36.717 7.950   1.00 31.52  ? 1088 ALA A N   1 
ATOM   221  C  CA  . ALA A 1 38  ? -9.435  37.398 9.103   1.00 33.85  ? 1088 ALA A CA  1 
ATOM   222  C  C   . ALA A 1 38  ? -8.637  38.659 9.433   1.00 36.25  ? 1088 ALA A C   1 
ATOM   223  O  O   . ALA A 1 38  ? -7.412  38.612 9.582   1.00 36.37  ? 1088 ALA A O   1 
ATOM   224  C  CB  . ALA A 1 38  ? -9.454  36.468 10.300  1.00 27.04  ? 1088 ALA A CB  1 
ATOM   225  N  N   . PHE A 1 39  ? -9.342  39.780 9.561   1.00 31.63  ? 1089 PHE A N   1 
ATOM   226  C  CA  . PHE A 1 39  ? -8.702  41.051 9.850   1.00 28.48  ? 1089 PHE A CA  1 
ATOM   227  C  C   . PHE A 1 39  ? -8.369  41.271 11.316  1.00 33.35  ? 1089 PHE A C   1 
ATOM   228  O  O   . PHE A 1 39  ? -9.179  41.001 12.209  1.00 33.66  ? 1089 PHE A O   1 
ATOM   229  C  CB  . PHE A 1 39  ? -9.581  42.199 9.383   1.00 26.53  ? 1089 PHE A CB  1 
ATOM   230  C  CG  . PHE A 1 39  ? -8.902  43.533 9.439   1.00 26.18  ? 1089 PHE A CG  1 
ATOM   231  C  CD1 . PHE A 1 39  ? -7.892  43.851 8.528   1.00 28.87  ? 1089 PHE A CD1 1 
ATOM   232  C  CD2 . PHE A 1 39  ? -9.277  44.479 10.386  1.00 15.71  ? 1089 PHE A CD2 1 
ATOM   233  C  CE1 . PHE A 1 39  ? -7.265  45.097 8.553   1.00 24.76  ? 1089 PHE A CE1 1 
ATOM   234  C  CE2 . PHE A 1 39  ? -8.658  45.732 10.424  1.00 27.75  ? 1089 PHE A CE2 1 
ATOM   235  C  CZ  . PHE A 1 39  ? -7.649  46.043 9.503   1.00 23.34  ? 1089 PHE A CZ  1 
ATOM   236  N  N   . LYS A 1 40  ? -7.167  41.781 11.553  1.00 33.34  ? 1090 LYS A N   1 
ATOM   237  C  CA  . LYS A 1 40  ? -6.716  42.073 12.904  1.00 33.54  ? 1090 LYS A CA  1 
ATOM   238  C  C   . LYS A 1 40  ? -5.731  43.239 12.907  1.00 35.79  ? 1090 LYS A C   1 
ATOM   239  O  O   . LYS A 1 40  ? -5.044  43.499 11.913  1.00 31.73  ? 1090 LYS A O   1 
ATOM   240  C  CB  . LYS A 1 40  ? -6.071  40.838 13.535  1.00 22.77  ? 1090 LYS A CB  1 
ATOM   241  C  CG  . LYS A 1 40  ? -4.808  40.379 12.859  1.00 25.73  ? 1090 LYS A CG  1 
ATOM   242  C  CD  . LYS A 1 40  ? -4.201  39.210 13.601  1.00 30.94  ? 1090 LYS A CD  1 
ATOM   243  C  CE  . LYS A 1 40  ? -2.883  38.794 12.966  1.00 37.56  ? 1090 LYS A CE  1 
ATOM   244  N  NZ  . LYS A 1 40  ? -2.174  37.764 13.781  1.00 41.69  ? 1090 LYS A NZ  1 
ATOM   245  N  N   . VAL A 1 41  ? -5.688  43.949 14.032  1.00 38.87  ? 1091 VAL A N   1 
ATOM   246  C  CA  . VAL A 1 41  ? -4.801  45.095 14.210  1.00 31.68  ? 1091 VAL A CA  1 
ATOM   247  C  C   . VAL A 1 41  ? -3.796  44.760 15.312  1.00 30.78  ? 1091 VAL A C   1 
ATOM   248  O  O   . VAL A 1 41  ? -4.167  44.383 16.423  1.00 30.24  ? 1091 VAL A O   1 
ATOM   249  C  CB  . VAL A 1 41  ? -5.595  46.369 14.610  1.00 23.20  ? 1091 VAL A CB  1 
ATOM   250  C  CG1 . VAL A 1 41  ? -4.643  47.520 14.859  1.00 26.02  ? 1091 VAL A CG1 1 
ATOM   251  C  CG2 . VAL A 1 41  ? -6.578  46.737 13.516  1.00 21.95  ? 1091 VAL A CG2 1 
ATOM   252  N  N   . VAL A 1 42  ? -2.517  44.888 14.992  1.00 37.22  ? 1092 VAL A N   1 
ATOM   253  C  CA  . VAL A 1 42  ? -1.465  44.597 15.952  1.00 39.54  ? 1092 VAL A CA  1 
ATOM   254  C  C   . VAL A 1 42  ? -0.826  45.880 16.468  1.00 35.82  ? 1092 VAL A C   1 
ATOM   255  O  O   . VAL A 1 42  ? -0.313  46.681 15.689  1.00 35.38  ? 1092 VAL A O   1 
ATOM   256  C  CB  . VAL A 1 42  ? -0.372  43.713 15.318  1.00 39.88  ? 1092 VAL A CB  1 
ATOM   257  C  CG1 . VAL A 1 42  ? 0.729   43.449 16.331  1.00 32.31  ? 1092 VAL A CG1 1 
ATOM   258  C  CG2 . VAL A 1 42  ? -0.980  42.402 14.829  1.00 33.11  ? 1092 VAL A CG2 1 
ATOM   259  N  N   . ALA A 1 43  ? -0.870  46.073 17.783  1.00 32.90  ? 1093 ALA A N   1 
ATOM   260  C  CA  . ALA A 1 43  ? -0.284  47.253 18.405  1.00 31.22  ? 1093 ALA A CA  1 
ATOM   261  C  C   . ALA A 1 43  ? 1.175   46.962 18.725  1.00 29.01  ? 1093 ALA A C   1 
ATOM   262  O  O   . ALA A 1 43  ? 1.503   45.895 19.248  1.00 30.52  ? 1093 ALA A O   1 
ATOM   263  C  CB  . ALA A 1 43  ? -1.040  47.612 19.682  1.00 23.75  ? 1093 ALA A CB  1 
ATOM   264  N  N   . LEU A 1 44  ? 2.048   47.909 18.404  1.00 28.83  ? 1094 LEU A N   1 
ATOM   265  C  CA  . LEU A 1 44  ? 3.473   47.746 18.666  1.00 33.02  ? 1094 LEU A CA  1 
ATOM   266  C  C   . LEU A 1 44  ? 3.878   48.429 19.964  1.00 30.64  ? 1094 LEU A C   1 
ATOM   267  O  O   . LEU A 1 44  ? 4.783   47.971 20.662  1.00 33.96  ? 1094 LEU A O   1 
ATOM   268  C  CB  . LEU A 1 44  ? 4.280   48.323 17.509  1.00 32.43  ? 1094 LEU A CB  1 
ATOM   269  C  CG  . LEU A 1 44  ? 4.084   47.605 16.177  1.00 33.34  ? 1094 LEU A CG  1 
ATOM   270  C  CD1 . LEU A 1 44  ? 4.730   48.403 15.058  1.00 34.88  ? 1094 LEU A CD1 1 
ATOM   271  C  CD2 . LEU A 1 44  ? 4.685   46.214 16.267  1.00 28.73  ? 1094 LEU A CD2 1 
ATOM   272  N  N   . GLY A 1 45  ? 3.192   49.522 20.283  1.00 32.36  ? 1095 GLY A N   1 
ATOM   273  C  CA  . GLY A 1 45  ? 3.500   50.265 21.491  1.00 29.14  ? 1095 GLY A CA  1 
ATOM   274  C  C   . GLY A 1 45  ? 2.582   49.993 22.666  1.00 29.19  ? 1095 GLY A C   1 
ATOM   275  O  O   . GLY A 1 45  ? 2.059   48.892 22.822  1.00 30.26  ? 1095 GLY A O   1 
ATOM   276  N  N   . ASP A 1 46  ? 2.387   51.011 23.497  1.00 29.93  ? 1096 ASP A N   1 
ATOM   277  C  CA  . ASP A 1 46  ? 1.539   50.903 24.677  1.00 29.41  ? 1096 ASP A CA  1 
ATOM   278  C  C   . ASP A 1 46  ? 0.049   51.032 24.367  1.00 27.59  ? 1096 ASP A C   1 
ATOM   279  O  O   . ASP A 1 46  ? -0.450  52.121 24.078  1.00 33.87  ? 1096 ASP A O   1 
ATOM   280  C  CB  . ASP A 1 46  ? 1.961   51.963 25.709  1.00 30.55  ? 1096 ASP A CB  1 
ATOM   281  C  CG  . ASP A 1 46  ? 1.061   51.988 26.938  1.00 35.66  ? 1096 ASP A CG  1 
ATOM   282  O  OD1 . ASP A 1 46  ? 0.433   50.948 27.257  1.00 43.45  ? 1096 ASP A OD1 1 
ATOM   283  O  OD2 . ASP A 1 46  ? 0.999   53.048 27.601  1.00 32.43  ? 1096 ASP A OD2 1 
ATOM   284  N  N   . VAL A 1 47  ? -0.649  49.901 24.414  1.00 28.49  ? 1097 VAL A N   1 
ATOM   285  C  CA  . VAL A 1 47  ? -2.091  49.852 24.175  1.00 26.76  ? 1097 VAL A CA  1 
ATOM   286  C  C   . VAL A 1 47  ? -2.676  48.852 25.174  1.00 31.05  ? 1097 VAL A C   1 
ATOM   287  O  O   . VAL A 1 47  ? -2.662  47.640 24.930  1.00 25.07  ? 1097 VAL A O   1 
ATOM   288  C  CB  . VAL A 1 47  ? -2.431  49.364 22.754  1.00 28.14  ? 1097 VAL A CB  1 
ATOM   289  C  CG1 . VAL A 1 47  ? -3.938  49.411 22.552  1.00 22.55  ? 1097 VAL A CG1 1 
ATOM   290  C  CG2 . VAL A 1 47  ? -1.723  50.221 21.715  1.00 26.34  ? 1097 VAL A CG2 1 
ATOM   291  N  N   . PRO A 1 48  ? -3.200  49.351 26.311  1.00 30.52  ? 1098 PRO A N   1 
ATOM   292  C  CA  . PRO A 1 48  ? -3.796  48.552 27.389  1.00 27.97  ? 1098 PRO A CA  1 
ATOM   293  C  C   . PRO A 1 48  ? -4.840  47.549 26.911  1.00 29.00  ? 1098 PRO A C   1 
ATOM   294  O  O   . PRO A 1 48  ? -5.581  47.824 25.964  1.00 30.30  ? 1098 PRO A O   1 
ATOM   295  C  CB  . PRO A 1 48  ? -4.409  49.614 28.297  1.00 26.98  ? 1098 PRO A CB  1 
ATOM   296  C  CG  . PRO A 1 48  ? -3.525  50.804 28.065  1.00 25.99  ? 1098 PRO A CG  1 
ATOM   297  C  CD  . PRO A 1 48  ? -3.391  50.788 26.577  1.00 22.62  ? 1098 PRO A CD  1 
ATOM   298  N  N   . ASP A 1 49  ? -4.904  46.388 27.564  1.00 24.28  ? 1099 ASP A N   1 
ATOM   299  C  CA  . ASP A 1 49  ? -5.896  45.383 27.187  1.00 26.63  ? 1099 ASP A CA  1 
ATOM   300  C  C   . ASP A 1 49  ? -7.294  45.947 27.422  1.00 28.32  ? 1099 ASP A C   1 
ATOM   301  O  O   . ASP A 1 49  ? -7.532  46.629 28.419  1.00 29.75  ? 1099 ASP A O   1 
ATOM   302  C  CB  . ASP A 1 49  ? -5.728  44.100 28.003  1.00 14.42  ? 1099 ASP A CB  1 
ATOM   303  C  CG  . ASP A 1 49  ? -4.442  43.361 27.677  1.00 23.81  ? 1099 ASP A CG  1 
ATOM   304  O  OD1 . ASP A 1 49  ? -3.982  43.411 26.511  1.00 26.25  ? 1099 ASP A OD1 1 
ATOM   305  O  OD2 . ASP A 1 49  ? -3.897  42.706 28.586  1.00 29.73  ? 1099 ASP A OD2 1 
ATOM   306  N  N   . GLY A 1 50  ? -8.212  45.672 26.500  1.00 28.91  ? 1100 GLY A N   1 
ATOM   307  C  CA  . GLY A 1 50  ? -9.569  46.166 26.647  1.00 29.16  ? 1100 GLY A CA  1 
ATOM   308  C  C   . GLY A 1 50  ? -9.816  47.454 25.894  1.00 31.55  ? 1100 GLY A C   1 
ATOM   309  O  O   . GLY A 1 50  ? -10.940 47.958 25.863  1.00 34.26  ? 1100 GLY A O   1 
ATOM   310  N  N   . THR A 1 51  ? -8.762  48.001 25.300  1.00 34.60  ? 1101 THR A N   1 
ATOM   311  C  CA  . THR A 1 51  ? -8.891  49.231 24.530  1.00 34.71  ? 1101 THR A CA  1 
ATOM   312  C  C   . THR A 1 51  ? -9.742  48.927 23.296  1.00 32.83  ? 1101 THR A C   1 
ATOM   313  O  O   . THR A 1 51  ? -9.442  48.007 22.529  1.00 29.88  ? 1101 THR A O   1 
ATOM   314  C  CB  . THR A 1 51  ? -7.507  49.773 24.082  1.00 26.91  ? 1101 THR A CB  1 
ATOM   315  O  OG1 . THR A 1 51  ? -6.767  50.200 25.233  1.00 30.33  ? 1101 THR A OG1 1 
ATOM   316  C  CG2 . THR A 1 51  ? -7.674  50.956 23.122  1.00 21.03  ? 1101 THR A CG2 1 
ATOM   317  N  N   . LEU A 1 52  ? -10.812 49.692 23.113  1.00 30.23  ? 1102 LEU A N   1 
ATOM   318  C  CA  . LEU A 1 52  ? -11.686 49.489 21.971  1.00 25.28  ? 1102 LEU A CA  1 
ATOM   319  C  C   . LEU A 1 52  ? -11.024 49.963 20.691  1.00 28.09  ? 1102 LEU A C   1 
ATOM   320  O  O   . LEU A 1 52  ? -10.243 50.914 20.685  1.00 28.87  ? 1102 LEU A O   1 
ATOM   321  C  CB  . LEU A 1 52  ? -13.013 50.217 22.181  1.00 27.81  ? 1102 LEU A CB  1 
ATOM   322  C  CG  . LEU A 1 52  ? -14.228 49.398 22.640  1.00 31.72  ? 1102 LEU A CG  1 
ATOM   323  C  CD1 . LEU A 1 52  ? -13.846 48.368 23.686  1.00 36.44  ? 1102 LEU A CD1 1 
ATOM   324  C  CD2 . LEU A 1 52  ? -15.274 50.359 23.192  1.00 42.30  ? 1102 LEU A CD2 1 
ATOM   325  N  N   . VAL A 1 53  ? -11.345 49.272 19.606  1.00 36.95  ? 1103 VAL A N   1 
ATOM   326  C  CA  . VAL A 1 53  ? -10.809 49.573 18.285  1.00 31.85  ? 1103 VAL A CA  1 
ATOM   327  C  C   . VAL A 1 53  ? -11.969 49.482 17.300  1.00 29.94  ? 1103 VAL A C   1 
ATOM   328  O  O   . VAL A 1 53  ? -12.690 48.487 17.286  1.00 35.79  ? 1103 VAL A O   1 
ATOM   329  C  CB  . VAL A 1 53  ? -9.746  48.531 17.872  1.00 25.04  ? 1103 VAL A CB  1 
ATOM   330  C  CG1 . VAL A 1 53  ? -9.180  48.874 16.512  1.00 19.09  ? 1103 VAL A CG1 1 
ATOM   331  C  CG2 . VAL A 1 53  ? -8.658  48.456 18.917  1.00 26.06  ? 1103 VAL A CG2 1 
ATOM   332  N  N   . THR A 1 54  ? -12.165 50.521 16.495  1.00 29.97  ? 1104 THR A N   1 
ATOM   333  C  CA  . THR A 1 54  ? -13.226 50.503 15.498  1.00 26.11  ? 1104 THR A CA  1 
ATOM   334  C  C   . THR A 1 54  ? -12.603 50.660 14.124  1.00 29.60  ? 1104 THR A C   1 
ATOM   335  O  O   . THR A 1 54  ? -11.534 51.248 13.971  1.00 32.01  ? 1104 THR A O   1 
ATOM   336  C  CB  . THR A 1 54  ? -14.247 51.649 15.668  1.00 20.01  ? 1104 THR A CB  1 
ATOM   337  O  OG1 . THR A 1 54  ? -13.592 52.906 15.462  1.00 28.44  ? 1104 THR A OG1 1 
ATOM   338  C  CG2 . THR A 1 54  ? -14.879 51.615 17.042  1.00 16.75  ? 1104 THR A CG2 1 
ATOM   339  N  N   . VAL A 1 55  ? -13.286 50.111 13.130  1.00 30.70  ? 1105 VAL A N   1 
ATOM   340  C  CA  . VAL A 1 55  ? -12.852 50.179 11.752  1.00 25.40  ? 1105 VAL A CA  1 
ATOM   341  C  C   . VAL A 1 55  ? -13.948 50.907 11.004  1.00 28.92  ? 1105 VAL A C   1 
ATOM   342  O  O   . VAL A 1 55  ? -15.134 50.687 11.249  1.00 33.45  ? 1105 VAL A O   1 
ATOM   343  C  CB  . VAL A 1 55  ? -12.674 48.780 11.159  1.00 24.61  ? 1105 VAL A CB  1 
ATOM   344  C  CG1 . VAL A 1 55  ? -12.670 48.848 9.649   1.00 34.03  ? 1105 VAL A CG1 1 
ATOM   345  C  CG2 . VAL A 1 55  ? -11.386 48.186 11.662  1.00 30.23  ? 1105 VAL A CG2 1 
ATOM   346  N  N   . MET A 1 56  ? -13.546 51.783 10.096  1.00 29.56  ? 1106 MET A N   1 
ATOM   347  C  CA  . MET A 1 56  ? -14.496 52.555 9.323   1.00 28.13  ? 1106 MET A CA  1 
ATOM   348  C  C   . MET A 1 56  ? -14.014 52.568 7.877   1.00 29.14  ? 1106 MET A C   1 
ATOM   349  O  O   . MET A 1 56  ? -12.813 52.628 7.614   1.00 26.27  ? 1106 MET A O   1 
ATOM   350  C  CB  . MET A 1 56  ? -14.566 53.963 9.902   1.00 32.82  ? 1106 MET A CB  1 
ATOM   351  C  CG  . MET A 1 56  ? -15.580 54.874 9.264   1.00 57.36  ? 1106 MET A CG  1 
ATOM   352  S  SD  . MET A 1 56  ? -15.342 56.576 9.828   1.00 59.87  ? 1106 MET A SD  1 
ATOM   353  C  CE  . MET A 1 56  ? -16.127 56.504 11.464  1.00 64.65  ? 1106 MET A CE  1 
ATOM   354  N  N   . ALA A 1 57  ? -14.950 52.479 6.941   1.00 31.94  ? 1107 ALA A N   1 
ATOM   355  C  CA  . ALA A 1 57  ? -14.620 52.479 5.517   1.00 32.75  ? 1107 ALA A CA  1 
ATOM   356  C  C   . ALA A 1 57  ? -15.392 53.596 4.831   1.00 34.93  ? 1107 ALA A C   1 
ATOM   357  O  O   . ALA A 1 57  ? -16.550 53.851 5.164   1.00 37.12  ? 1107 ALA A O   1 
ATOM   358  C  CB  . ALA A 1 57  ? -14.990 51.135 4.894   1.00 23.87  ? 1107 ALA A CB  1 
ATOM   359  N  N   . GLY A 1 58  ? -14.755 54.263 3.878   1.00 36.14  ? 1108 GLY A N   1 
ATOM   360  C  CA  . GLY A 1 58  ? -15.444 55.327 3.178   1.00 42.50  ? 1108 GLY A CA  1 
ATOM   361  C  C   . GLY A 1 58  ? -14.611 56.046 2.142   1.00 43.25  ? 1108 GLY A C   1 
ATOM   362  O  O   . GLY A 1 58  ? -13.431 55.745 1.965   1.00 46.36  ? 1108 GLY A O   1 
ATOM   363  N  N   . ASN A 1 59  ? -15.259 56.973 1.436   1.00 47.33  ? 1109 ASN A N   1 
ATOM   364  C  CA  . ASN A 1 59  ? -14.628 57.816 0.422   1.00 51.82  ? 1109 ASN A CA  1 
ATOM   365  C  C   . ASN A 1 59  ? -15.380 59.147 0.323   1.00 55.08  ? 1109 ASN A C   1 
ATOM   366  O  O   . ASN A 1 59  ? -16.135 59.507 1.228   1.00 53.32  ? 1109 ASN A O   1 
ATOM   367  C  CB  . ASN A 1 59  ? -14.558 57.129 -0.959  1.00 49.85  ? 1109 ASN A CB  1 
ATOM   368  C  CG  . ASN A 1 59  ? -15.891 56.565 -1.425  1.00 48.26  ? 1109 ASN A CG  1 
ATOM   369  O  OD1 . ASN A 1 59  ? -16.953 57.164 -1.231  1.00 48.42  ? 1109 ASN A OD1 1 
ATOM   370  N  ND2 . ASN A 1 59  ? -15.832 55.415 -2.081  1.00 50.90  ? 1109 ASN A ND2 1 
ATOM   371  N  N   . ASP A 1 60  ? -15.171 59.877 -0.767  1.00 58.51  ? 1110 ASP A N   1 
ATOM   372  C  CA  . ASP A 1 60  ? -15.813 61.174 -0.944  1.00 65.34  ? 1110 ASP A CA  1 
ATOM   373  C  C   . ASP A 1 60  ? -17.330 61.120 -0.935  1.00 68.48  ? 1110 ASP A C   1 
ATOM   374  O  O   . ASP A 1 60  ? -17.989 61.948 -0.302  1.00 71.28  ? 1110 ASP A O   1 
ATOM   375  C  CB  . ASP A 1 60  ? -15.330 61.809 -2.239  1.00 72.74  ? 1110 ASP A CB  1 
ATOM   376  C  CG  . ASP A 1 60  ? -13.829 61.918 -2.290  1.00 90.00  ? 1110 ASP A CG  1 
ATOM   377  O  OD1 . ASP A 1 60  ? -13.256 62.540 -1.370  1.00 93.86  ? 1110 ASP A OD1 1 
ATOM   378  O  OD2 . ASP A 1 60  ? -13.224 61.375 -3.240  1.00 100.74 ? 1110 ASP A OD2 1 
ATOM   379  N  N   . GLU A 1 61  ? -17.881 60.144 -1.643  1.00 69.13  ? 1111 GLU A N   1 
ATOM   380  C  CA  . GLU A 1 61  ? -19.323 59.976 -1.731  1.00 72.28  ? 1111 GLU A CA  1 
ATOM   381  C  C   . GLU A 1 61  ? -19.907 59.323 -0.485  1.00 68.88  ? 1111 GLU A C   1 
ATOM   382  O  O   . GLU A 1 61  ? -21.000 59.675 -0.043  1.00 65.22  ? 1111 GLU A O   1 
ATOM   383  C  CB  . GLU A 1 61  ? -19.669 59.140 -2.970  1.00 87.93  ? 1111 GLU A CB  1 
ATOM   384  C  CG  . GLU A 1 61  ? -19.764 59.933 -4.280  1.00 100.95 ? 1111 GLU A CG  1 
ATOM   385  C  CD  . GLU A 1 61  ? -18.541 60.796 -4.566  1.00 108.61 ? 1111 GLU A CD  1 
ATOM   386  O  OE1 . GLU A 1 61  ? -17.415 60.250 -4.648  1.00 111.20 ? 1111 GLU A OE1 1 
ATOM   387  O  OE2 . GLU A 1 61  ? -18.714 62.028 -4.716  1.00 105.84 ? 1111 GLU A OE2 1 
ATOM   388  N  N   . ASN A 1 62  ? -19.172 58.371 0.082   1.00 69.02  ? 1112 ASN A N   1 
ATOM   389  C  CA  . ASN A 1 62  ? -19.622 57.655 1.273   1.00 64.68  ? 1112 ASN A CA  1 
ATOM   390  C  C   . ASN A 1 62  ? -18.697 57.932 2.453   1.00 61.57  ? 1112 ASN A C   1 
ATOM   391  O  O   . ASN A 1 62  ? -17.542 57.509 2.449   1.00 58.29  ? 1112 ASN A O   1 
ATOM   392  C  CB  . ASN A 1 62  ? -19.633 56.152 1.001   1.00 62.79  ? 1112 ASN A CB  1 
ATOM   393  C  CG  . ASN A 1 62  ? -20.864 55.473 1.549   1.00 60.90  ? 1112 ASN A CG  1 
ATOM   394  O  OD1 . ASN A 1 62  ? -21.314 55.762 2.665   1.00 54.07  ? 1112 ASN A OD1 1 
ATOM   395  N  ND2 . ASN A 1 62  ? -21.413 54.551 0.773   1.00 66.06  ? 1112 ASN A ND2 1 
ATOM   396  N  N   . TYR A 1 63  ? -19.201 58.632 3.463   1.00 57.70  ? 1113 TYR A N   1 
ATOM   397  C  CA  . TYR A 1 63  ? -18.388 58.939 4.634   1.00 62.01  ? 1113 TYR A CA  1 
ATOM   398  C  C   . TYR A 1 63  ? -18.050 57.671 5.419   1.00 57.89  ? 1113 TYR A C   1 
ATOM   399  O  O   . TYR A 1 63  ? -16.876 57.385 5.692   1.00 57.88  ? 1113 TYR A O   1 
ATOM   400  C  CB  . TYR A 1 63  ? -19.114 59.929 5.546   1.00 67.92  ? 1113 TYR A CB  1 
ATOM   401  C  CG  . TYR A 1 63  ? -18.380 60.189 6.838   1.00 73.83  ? 1113 TYR A CG  1 
ATOM   402  C  CD1 . TYR A 1 63  ? -17.185 60.911 6.854   1.00 77.09  ? 1113 TYR A CD1 1 
ATOM   403  C  CD2 . TYR A 1 63  ? -18.857 59.672 8.041   1.00 77.57  ? 1113 TYR A CD2 1 
ATOM   404  C  CE1 . TYR A 1 63  ? -16.482 61.108 8.041   1.00 80.55  ? 1113 TYR A CE1 1 
ATOM   405  C  CE2 . TYR A 1 63  ? -18.166 59.859 9.230   1.00 81.38  ? 1113 TYR A CE2 1 
ATOM   406  C  CZ  . TYR A 1 63  ? -16.980 60.575 9.226   1.00 83.75  ? 1113 TYR A CZ  1 
ATOM   407  O  OH  . TYR A 1 63  ? -16.291 60.740 10.408  1.00 82.77  ? 1113 TYR A OH  1 
ATOM   408  N  N   . SER A 1 64  ? -19.088 56.924 5.789   1.00 48.44  ? 1114 SER A N   1 
ATOM   409  C  CA  . SER A 1 64  ? -18.925 55.675 6.525   1.00 41.52  ? 1114 SER A CA  1 
ATOM   410  C  C   . SER A 1 64  ? -19.874 54.622 5.968   1.00 41.25  ? 1114 SER A C   1 
ATOM   411  O  O   . SER A 1 64  ? -21.079 54.652 6.224   1.00 46.94  ? 1114 SER A O   1 
ATOM   412  C  CB  . SER A 1 64  ? -19.204 55.880 8.012   1.00 32.37  ? 1114 SER A CB  1 
ATOM   413  O  OG  . SER A 1 64  ? -19.026 54.671 8.724   1.00 38.18  ? 1114 SER A OG  1 
ATOM   414  N  N   . ALA A 1 65  ? -19.313 53.696 5.201   1.00 34.09  ? 1115 ALA A N   1 
ATOM   415  C  CA  . ALA A 1 65  ? -20.081 52.626 4.590   1.00 27.89  ? 1115 ALA A CA  1 
ATOM   416  C  C   . ALA A 1 65  ? -20.447 51.564 5.620   1.00 31.11  ? 1115 ALA A C   1 
ATOM   417  O  O   . ALA A 1 65  ? -19.751 51.387 6.620   1.00 33.14  ? 1115 ALA A O   1 
ATOM   418  C  CB  . ALA A 1 65  ? -19.285 52.000 3.454   1.00 17.61  ? 1115 ALA A CB  1 
ATOM   419  N  N   . GLU A 1 66  ? -21.543 50.856 5.367   1.00 32.41  ? 1116 GLU A N   1 
ATOM   420  C  CA  . GLU A 1 66  ? -21.989 49.814 6.276   1.00 33.99  ? 1116 GLU A CA  1 
ATOM   421  C  C   . GLU A 1 66  ? -21.010 48.652 6.304   1.00 31.71  ? 1116 GLU A C   1 
ATOM   422  O  O   . GLU A 1 66  ? -20.674 48.071 5.269   1.00 33.43  ? 1116 GLU A O   1 
ATOM   423  C  CB  . GLU A 1 66  ? -23.381 49.306 5.885   1.00 32.48  ? 1116 GLU A CB  1 
ATOM   424  C  CG  . GLU A 1 66  ? -23.819 48.066 6.660   1.00 40.25  ? 1116 GLU A CG  1 
ATOM   425  C  CD  . GLU A 1 66  ? -25.252 47.659 6.375   1.00 38.49  ? 1116 GLU A CD  1 
ATOM   426  O  OE1 . GLU A 1 66  ? -25.733 47.919 5.252   1.00 41.43  ? 1116 GLU A OE1 1 
ATOM   427  O  OE2 . GLU A 1 66  ? -25.889 47.060 7.269   1.00 44.61  ? 1116 GLU A OE2 1 
ATOM   428  N  N   . LEU A 1 67  ? -20.553 48.330 7.507   1.00 28.23  ? 1117 LEU A N   1 
ATOM   429  C  CA  . LEU A 1 67  ? -19.624 47.238 7.709   1.00 24.95  ? 1117 LEU A CA  1 
ATOM   430  C  C   . LEU A 1 67  ? -20.246 46.288 8.718   1.00 28.12  ? 1117 LEU A C   1 
ATOM   431  O  O   . LEU A 1 67  ? -21.174 46.652 9.439   1.00 24.52  ? 1117 LEU A O   1 
ATOM   432  C  CB  . LEU A 1 67  ? -18.301 47.760 8.267   1.00 26.91  ? 1117 LEU A CB  1 
ATOM   433  C  CG  . LEU A 1 67  ? -17.497 48.780 7.476   1.00 26.24  ? 1117 LEU A CG  1 
ATOM   434  C  CD1 . LEU A 1 67  ? -16.277 49.177 8.285   1.00 19.46  ? 1117 LEU A CD1 1 
ATOM   435  C  CD2 . LEU A 1 67  ? -17.085 48.203 6.135   1.00 27.64  ? 1117 LEU A CD2 1 
ATOM   436  N  N   . ARG A 1 68  ? -19.722 45.071 8.774   1.00 30.71  ? 1118 ARG A N   1 
ATOM   437  C  CA  . ARG A 1 68  ? -20.217 44.091 9.718   1.00 27.62  ? 1118 ARG A CA  1 
ATOM   438  C  C   . ARG A 1 68  ? -19.034 43.645 10.578  1.00 29.74  ? 1118 ARG A C   1 
ATOM   439  O  O   . ARG A 1 68  ? -17.944 43.377 10.059  1.00 32.18  ? 1118 ARG A O   1 
ATOM   440  C  CB  . ARG A 1 68  ? -20.824 42.902 8.966   1.00 29.89  ? 1118 ARG A CB  1 
ATOM   441  C  CG  . ARG A 1 68  ? -21.868 42.112 9.748   1.00 28.38  ? 1118 ARG A CG  1 
ATOM   442  C  CD  . ARG A 1 68  ? -23.034 42.991 10.202  1.00 25.54  ? 1118 ARG A CD  1 
ATOM   443  N  NE  . ARG A 1 68  ? -24.113 42.204 10.806  1.00 30.84  ? 1118 ARG A NE  1 
ATOM   444  C  CZ  . ARG A 1 68  ? -25.170 42.722 11.434  1.00 35.20  ? 1118 ARG A CZ  1 
ATOM   445  N  NH1 . ARG A 1 68  ? -25.301 44.037 11.549  1.00 33.17  ? 1118 ARG A NH1 1 
ATOM   446  N  NH2 . ARG A 1 68  ? -26.101 41.927 11.948  1.00 31.99  ? 1118 ARG A NH2 1 
ATOM   447  N  N   . ASN A 1 69  ? -19.256 43.593 11.890  1.00 27.76  ? 1119 ASN A N   1 
ATOM   448  C  CA  . ASN A 1 69  ? -18.232 43.189 12.852  1.00 27.88  ? 1119 ASN A CA  1 
ATOM   449  C  C   . ASN A 1 69  ? -16.989 44.071 12.743  1.00 28.73  ? 1119 ASN A C   1 
ATOM   450  O  O   . ASN A 1 69  ? -15.870 43.574 12.570  1.00 18.93  ? 1119 ASN A O   1 
ATOM   451  C  CB  . ASN A 1 69  ? -17.841 41.729 12.631  1.00 26.81  ? 1119 ASN A CB  1 
ATOM   452  C  CG  . ASN A 1 69  ? -19.036 40.834 12.417  1.00 30.14  ? 1119 ASN A CG  1 
ATOM   453  O  OD1 . ASN A 1 69  ? -19.218 40.289 11.327  1.00 31.12  ? 1119 ASN A OD1 1 
ATOM   454  N  ND2 . ASN A 1 69  ? -19.866 40.681 13.447  1.00 19.01  ? 1119 ASN A ND2 1 
ATOM   455  N  N   . ALA A 1 70  ? -17.199 45.379 12.859  1.00 25.01  ? 1120 ALA A N   1 
ATOM   456  C  CA  . ALA A 1 70  ? -16.123 46.357 12.754  1.00 26.34  ? 1120 ALA A CA  1 
ATOM   457  C  C   . ALA A 1 70  ? -15.682 46.897 14.110  1.00 27.30  ? 1120 ALA A C   1 
ATOM   458  O  O   . ALA A 1 70  ? -15.125 47.996 14.198  1.00 26.46  ? 1120 ALA A O   1 
ATOM   459  C  CB  . ALA A 1 70  ? -16.561 47.506 11.858  1.00 27.85  ? 1120 ALA A CB  1 
ATOM   460  N  N   . THR A 1 71  ? -15.931 46.125 15.164  1.00 25.69  ? 1121 THR A N   1 
ATOM   461  C  CA  . THR A 1 71  ? -15.552 46.524 16.517  1.00 23.19  ? 1121 THR A CA  1 
ATOM   462  C  C   . THR A 1 71  ? -14.786 45.396 17.190  1.00 26.46  ? 1121 THR A C   1 
ATOM   463  O  O   . THR A 1 71  ? -15.146 44.226 17.052  1.00 37.91  ? 1121 THR A O   1 
ATOM   464  C  CB  . THR A 1 71  ? -16.797 46.868 17.366  1.00 20.69  ? 1121 THR A CB  1 
ATOM   465  O  OG1 . THR A 1 71  ? -17.631 47.787 16.645  1.00 23.77  ? 1121 THR A OG1 1 
ATOM   466  C  CG2 . THR A 1 71  ? -16.382 47.512 18.687  1.00 15.24  ? 1121 THR A CG2 1 
ATOM   467  N  N   . ALA A 1 72  ? -13.719 45.745 17.901  1.00 26.10  ? 1122 ALA A N   1 
ATOM   468  C  CA  . ALA A 1 72  ? -12.903 44.749 18.601  1.00 27.45  ? 1122 ALA A CA  1 
ATOM   469  C  C   . ALA A 1 72  ? -12.227 45.373 19.816  1.00 25.84  ? 1122 ALA A C   1 
ATOM   470  O  O   . ALA A 1 72  ? -12.242 46.587 19.995  1.00 32.35  ? 1122 ALA A O   1 
ATOM   471  C  CB  . ALA A 1 72  ? -11.846 44.159 17.660  1.00 20.10  ? 1122 ALA A CB  1 
ATOM   472  N  N   . ALA A 1 73  ? -11.637 44.531 20.649  1.00 22.64  ? 1123 ALA A N   1 
ATOM   473  C  CA  . ALA A 1 73  ? -10.961 45.005 21.838  1.00 23.80  ? 1123 ALA A CA  1 
ATOM   474  C  C   . ALA A 1 73  ? -9.563  44.419 21.875  1.00 25.80  ? 1123 ALA A C   1 
ATOM   475  O  O   . ALA A 1 73  ? -9.355  43.251 21.541  1.00 27.60  ? 1123 ALA A O   1 
ATOM   476  C  CB  . ALA A 1 73  ? -11.728 44.600 23.080  1.00 6.95   ? 1123 ALA A CB  1 
ATOM   477  N  N   . MET A 1 74  ? -8.609  45.249 22.276  1.00 26.87  ? 1124 MET A N   1 
ATOM   478  C  CA  . MET A 1 74  ? -7.220  44.843 22.373  1.00 25.81  ? 1124 MET A CA  1 
ATOM   479  C  C   . MET A 1 74  ? -7.000  43.770 23.428  1.00 25.10  ? 1124 MET A C   1 
ATOM   480  O  O   . MET A 1 74  ? -7.544  43.837 24.526  1.00 25.53  ? 1124 MET A O   1 
ATOM   481  C  CB  . MET A 1 74  ? -6.357  46.053 22.704  1.00 24.51  ? 1124 MET A CB  1 
ATOM   482  C  CG  . MET A 1 74  ? -5.989  46.875 21.493  1.00 27.65  ? 1124 MET A CG  1 
ATOM   483  S  SD  . MET A 1 74  ? -4.710  46.045 20.543  1.00 33.89  ? 1124 MET A SD  1 
ATOM   484  C  CE  . MET A 1 74  ? -4.628  47.055 19.128  1.00 16.02  ? 1124 MET A CE  1 
ATOM   485  N  N   . LYS A 1 75  ? -6.200  42.773 23.080  1.00 24.60  ? 1125 LYS A N   1 
ATOM   486  C  CA  . LYS A 1 75  ? -5.865  41.699 24.004  1.00 27.65  ? 1125 LYS A CA  1 
ATOM   487  C  C   . LYS A 1 75  ? -4.414  41.336 23.698  1.00 30.44  ? 1125 LYS A C   1 
ATOM   488  O  O   . LYS A 1 75  ? -4.107  40.762 22.650  1.00 30.26  ? 1125 LYS A O   1 
ATOM   489  C  CB  . LYS A 1 75  ? -6.792  40.498 23.803  1.00 26.55  ? 1125 LYS A CB  1 
ATOM   490  C  CG  . LYS A 1 75  ? -6.559  39.358 24.783  1.00 38.90  ? 1125 LYS A CG  1 
ATOM   491  C  CD  . LYS A 1 75  ? -7.563  38.214 24.602  1.00 48.78  ? 1125 LYS A CD  1 
ATOM   492  C  CE  . LYS A 1 75  ? -7.361  37.456 23.302  1.00 46.99  ? 1125 LYS A CE  1 
ATOM   493  N  NZ  . LYS A 1 75  ? -8.306  36.313 23.191  1.00 55.87  ? 1125 LYS A NZ  1 
ATOM   494  N  N   . ASN A 1 76  ? -3.521  41.710 24.609  1.00 25.62  ? 1126 ASN A N   1 
ATOM   495  C  CA  . ASN A 1 76  ? -2.096  41.453 24.459  1.00 27.92  ? 1126 ASN A CA  1 
ATOM   496  C  C   . ASN A 1 76  ? -1.521  42.009 23.164  1.00 26.23  ? 1126 ASN A C   1 
ATOM   497  O  O   . ASN A 1 76  ? -0.851  41.294 22.426  1.00 30.41  ? 1126 ASN A O   1 
ATOM   498  C  CB  . ASN A 1 76  ? -1.816  39.955 24.555  1.00 28.10  ? 1126 ASN A CB  1 
ATOM   499  C  CG  . ASN A 1 76  ? -2.356  39.351 25.841  1.00 33.62  ? 1126 ASN A CG  1 
ATOM   500  O  OD1 . ASN A 1 76  ? -2.242  39.947 26.911  1.00 39.62  ? 1126 ASN A OD1 1 
ATOM   501  N  ND2 . ASN A 1 76  ? -2.935  38.162 25.744  1.00 27.76  ? 1126 ASN A ND2 1 
ATOM   502  N  N   . GLN A 1 77  ? -1.788  43.292 22.905  1.00 28.57  ? 1127 GLN A N   1 
ATOM   503  C  CA  . GLN A 1 77  ? -1.290  44.003 21.719  1.00 36.88  ? 1127 GLN A CA  1 
ATOM   504  C  C   . GLN A 1 77  ? -1.997  43.662 20.412  1.00 36.87  ? 1127 GLN A C   1 
ATOM   505  O  O   . GLN A 1 77  ? -1.593  44.135 19.351  1.00 39.45  ? 1127 GLN A O   1 
ATOM   506  C  CB  . GLN A 1 77  ? 0.215   43.750 21.552  1.00 48.41  ? 1127 GLN A CB  1 
ATOM   507  C  CG  . GLN A 1 77  ? 1.056   44.268 22.700  1.00 58.34  ? 1127 GLN A CG  1 
ATOM   508  C  CD  . GLN A 1 77  ? 1.432   45.722 22.534  1.00 75.88  ? 1127 GLN A CD  1 
ATOM   509  O  OE1 . GLN A 1 77  ? 2.532   46.037 22.074  1.00 89.09  ? 1127 GLN A OE1 1 
ATOM   510  N  NE2 . GLN A 1 77  ? 0.519   46.622 22.898  1.00 78.73  ? 1127 GLN A NE2 1 
ATOM   511  N  N   . VAL A 1 78  ? -3.052  42.853 20.490  1.00 35.81  ? 1128 VAL A N   1 
ATOM   512  C  CA  . VAL A 1 78  ? -3.784  42.447 19.296  1.00 29.11  ? 1128 VAL A CA  1 
ATOM   513  C  C   . VAL A 1 78  ? -5.295  42.589 19.401  1.00 30.36  ? 1128 VAL A C   1 
ATOM   514  O  O   . VAL A 1 78  ? -5.901  42.207 20.400  1.00 32.48  ? 1128 VAL A O   1 
ATOM   515  C  CB  . VAL A 1 78  ? -3.494  40.984 18.938  1.00 30.05  ? 1128 VAL A CB  1 
ATOM   516  C  CG1 . VAL A 1 78  ? -4.184  40.629 17.629  1.00 23.18  ? 1128 VAL A CG1 1 
ATOM   517  C  CG2 . VAL A 1 78  ? -1.998  40.758 18.842  1.00 28.25  ? 1128 VAL A CG2 1 
ATOM   518  N  N   . ALA A 1 79  ? -5.894  43.129 18.344  1.00 28.03  ? 1129 ALA A N   1 
ATOM   519  C  CA  . ALA A 1 79  ? -7.339  43.320 18.265  1.00 25.73  ? 1129 ALA A CA  1 
ATOM   520  C  C   . ALA A 1 79  ? -7.859  42.512 17.078  1.00 27.80  ? 1129 ALA A C   1 
ATOM   521  O  O   . ALA A 1 79  ? -7.685  42.914 15.931  1.00 23.61  ? 1129 ALA A O   1 
ATOM   522  C  CB  . ALA A 1 79  ? -7.657  44.788 18.070  1.00 24.82  ? 1129 ALA A CB  1 
ATOM   523  N  N   . ARG A 1 80  ? -8.493  41.373 17.344  1.00 32.32  ? 1130 ARG A N   1 
ATOM   524  C  CA  . ARG A 1 80  ? -9.002  40.538 16.257  1.00 28.93  ? 1130 ARG A CA  1 
ATOM   525  C  C   . ARG A 1 80  ? -10.459 40.796 15.929  1.00 30.84  ? 1130 ARG A C   1 
ATOM   526  O  O   . ARG A 1 80  ? -11.315 40.850 16.816  1.00 29.69  ? 1130 ARG A O   1 
ATOM   527  C  CB  . ARG A 1 80  ? -8.817  39.053 16.578  1.00 30.90  ? 1130 ARG A CB  1 
ATOM   528  C  CG  . ARG A 1 80  ? -7.365  38.632 16.719  1.00 38.31  ? 1130 ARG A CG  1 
ATOM   529  C  CD  . ARG A 1 80  ? -7.220  37.123 16.799  1.00 44.96  ? 1130 ARG A CD  1 
ATOM   530  N  NE  . ARG A 1 80  ? -5.820  36.712 16.956  1.00 55.00  ? 1130 ARG A NE  1 
ATOM   531  C  CZ  . ARG A 1 80  ? -5.103  36.889 18.063  1.00 54.75  ? 1130 ARG A CZ  1 
ATOM   532  N  NH1 . ARG A 1 80  ? -5.646  37.472 19.128  1.00 61.24  ? 1130 ARG A NH1 1 
ATOM   533  N  NH2 . ARG A 1 80  ? -3.842  36.488 18.098  1.00 59.60  ? 1130 ARG A NH2 1 
ATOM   534  N  N   . PHE A 1 81  ? -10.737 40.954 14.641  1.00 32.73  ? 1131 PHE A N   1 
ATOM   535  C  CA  . PHE A 1 81  ? -12.098 41.186 14.208  1.00 38.09  ? 1131 PHE A CA  1 
ATOM   536  C  C   . PHE A 1 81  ? -12.724 39.886 13.716  1.00 43.34  ? 1131 PHE A C   1 
ATOM   537  O  O   . PHE A 1 81  ? -12.224 39.242 12.794  1.00 37.35  ? 1131 PHE A O   1 
ATOM   538  C  CB  . PHE A 1 81  ? -12.137 42.268 13.126  1.00 29.29  ? 1131 PHE A CB  1 
ATOM   539  C  CG  . PHE A 1 81  ? -11.746 43.635 13.627  1.00 29.48  ? 1131 PHE A CG  1 
ATOM   540  C  CD1 . PHE A 1 81  ? -10.416 43.942 13.889  1.00 34.47  ? 1131 PHE A CD1 1 
ATOM   541  C  CD2 . PHE A 1 81  ? -12.713 44.611 13.857  1.00 33.97  ? 1131 PHE A CD2 1 
ATOM   542  C  CE1 . PHE A 1 81  ? -10.057 45.203 14.374  1.00 33.03  ? 1131 PHE A CE1 1 
ATOM   543  C  CE2 . PHE A 1 81  ? -12.366 45.874 14.341  1.00 27.63  ? 1131 PHE A CE2 1 
ATOM   544  C  CZ  . PHE A 1 81  ? -11.037 46.171 14.599  1.00 28.24  ? 1131 PHE A CZ  1 
ATOM   545  N  N   . ASN A 1 82  ? -13.811 39.501 14.377  1.00 54.27  ? 1132 ASN A N   1 
ATOM   546  C  CA  . ASN A 1 82  ? -14.552 38.290 14.060  1.00 54.82  ? 1132 ASN A CA  1 
ATOM   547  C  C   . ASN A 1 82  ? -15.399 38.469 12.799  1.00 53.49  ? 1132 ASN A C   1 
ATOM   548  O  O   . ASN A 1 82  ? -16.493 39.032 12.865  1.00 58.46  ? 1132 ASN A O   1 
ATOM   549  C  CB  . ASN A 1 82  ? -15.480 37.934 15.224  1.00 65.81  ? 1132 ASN A CB  1 
ATOM   550  C  CG  . ASN A 1 82  ? -16.395 36.773 14.898  1.00 77.86  ? 1132 ASN A CG  1 
ATOM   551  O  OD1 . ASN A 1 82  ? -17.481 36.637 15.466  1.00 84.68  ? 1132 ASN A OD1 1 
ATOM   552  N  ND2 . ASN A 1 82  ? -15.953 35.917 13.982  1.00 82.79  ? 1132 ASN A ND2 1 
ATOM   553  N  N   . ASP A 1 83  ? -14.896 37.993 11.663  1.00 39.82  ? 1133 ASP A N   1 
ATOM   554  C  CA  . ASP A 1 83  ? -15.618 38.079 10.394  1.00 41.71  ? 1133 ASP A CA  1 
ATOM   555  C  C   . ASP A 1 83  ? -16.021 39.493 9.930   1.00 37.88  ? 1133 ASP A C   1 
ATOM   556  O  O   . ASP A 1 83  ? -17.208 39.805 9.799   1.00 30.14  ? 1133 ASP A O   1 
ATOM   557  C  CB  . ASP A 1 83  ? -16.860 37.168 10.450  1.00 41.94  ? 1133 ASP A CB  1 
ATOM   558  C  CG  . ASP A 1 83  ? -17.611 37.099 9.119   1.00 44.60  ? 1133 ASP A CG  1 
ATOM   559  O  OD1 . ASP A 1 83  ? -16.953 37.057 8.052   1.00 46.38  ? 1133 ASP A OD1 1 
ATOM   560  O  OD2 . ASP A 1 83  ? -18.862 37.060 9.148   1.00 35.68  ? 1133 ASP A OD2 1 
ATOM   561  N  N   . LEU A 1 84  ? -15.023 40.341 9.680   1.00 32.39  ? 1134 LEU A N   1 
ATOM   562  C  CA  . LEU A 1 84  ? -15.262 41.697 9.207   1.00 22.32  ? 1134 LEU A CA  1 
ATOM   563  C  C   . LEU A 1 84  ? -15.743 41.605 7.772   1.00 27.02  ? 1134 LEU A C   1 
ATOM   564  O  O   . LEU A 1 84  ? -15.151 40.898 6.950   1.00 24.30  ? 1134 LEU A O   1 
ATOM   565  C  CB  . LEU A 1 84  ? -13.971 42.524 9.225   1.00 26.05  ? 1134 LEU A CB  1 
ATOM   566  C  CG  . LEU A 1 84  ? -14.044 43.902 8.533   1.00 22.41  ? 1134 LEU A CG  1 
ATOM   567  C  CD1 . LEU A 1 84  ? -14.987 44.823 9.295   1.00 14.99  ? 1134 LEU A CD1 1 
ATOM   568  C  CD2 . LEU A 1 84  ? -12.668 44.513 8.453   1.00 13.17  ? 1134 LEU A CD2 1 
ATOM   569  N  N   . ARG A 1 85  ? -16.807 42.329 7.463   1.00 28.49  ? 1135 ARG A N   1 
ATOM   570  C  CA  . ARG A 1 85  ? -17.343 42.308 6.113   1.00 30.38  ? 1135 ARG A CA  1 
ATOM   571  C  C   . ARG A 1 85  ? -17.740 43.692 5.660   1.00 28.69  ? 1135 ARG A C   1 
ATOM   572  O  O   . ARG A 1 85  ? -18.173 44.527 6.463   1.00 26.45  ? 1135 ARG A O   1 
ATOM   573  C  CB  . ARG A 1 85  ? -18.554 41.369 6.033   1.00 31.30  ? 1135 ARG A CB  1 
ATOM   574  C  CG  . ARG A 1 85  ? -18.184 39.904 5.986   1.00 31.34  ? 1135 ARG A CG  1 
ATOM   575  C  CD  . ARG A 1 85  ? -19.389 39.038 5.735   1.00 27.58  ? 1135 ARG A CD  1 
ATOM   576  N  NE  . ARG A 1 85  ? -20.050 38.660 6.979   1.00 38.04  ? 1135 ARG A NE  1 
ATOM   577  C  CZ  . ARG A 1 85  ? -21.228 39.121 7.386   1.00 33.22  ? 1135 ARG A CZ  1 
ATOM   578  N  NH1 . ARG A 1 85  ? -21.905 39.990 6.656   1.00 34.74  ? 1135 ARG A NH1 1 
ATOM   579  N  NH2 . ARG A 1 85  ? -21.735 38.706 8.533   1.00 34.06  ? 1135 ARG A NH2 1 
ATOM   580  N  N   . PHE A 1 86  ? -17.575 43.933 4.366   1.00 26.74  ? 1136 PHE A N   1 
ATOM   581  C  CA  . PHE A 1 86  ? -17.942 45.215 3.784   1.00 26.87  ? 1136 PHE A CA  1 
ATOM   582  C  C   . PHE A 1 86  ? -19.290 45.031 3.125   1.00 30.58  ? 1136 PHE A C   1 
ATOM   583  O  O   . PHE A 1 86  ? -19.400 44.462 2.036   1.00 29.04  ? 1136 PHE A O   1 
ATOM   584  C  CB  . PHE A 1 86  ? -16.906 45.661 2.753   1.00 22.65  ? 1136 PHE A CB  1 
ATOM   585  C  CG  . PHE A 1 86  ? -15.543 45.860 3.332   1.00 35.29  ? 1136 PHE A CG  1 
ATOM   586  C  CD1 . PHE A 1 86  ? -14.764 44.765 3.694   1.00 34.59  ? 1136 PHE A CD1 1 
ATOM   587  C  CD2 . PHE A 1 86  ? -15.060 47.140 3.581   1.00 34.17  ? 1136 PHE A CD2 1 
ATOM   588  C  CE1 . PHE A 1 86  ? -13.527 44.938 4.301   1.00 23.69  ? 1136 PHE A CE1 1 
ATOM   589  C  CE2 . PHE A 1 86  ? -13.821 47.326 4.191   1.00 27.75  ? 1136 PHE A CE2 1 
ATOM   590  C  CZ  . PHE A 1 86  ? -13.055 46.220 4.551   1.00 25.37  ? 1136 PHE A CZ  1 
ATOM   591  N  N   . VAL A 1 87  ? -20.321 45.498 3.811   1.00 29.36  ? 1137 VAL A N   1 
ATOM   592  C  CA  . VAL A 1 87  ? -21.671 45.378 3.309   1.00 28.23  ? 1137 VAL A CA  1 
ATOM   593  C  C   . VAL A 1 87  ? -21.887 46.373 2.177   1.00 29.85  ? 1137 VAL A C   1 
ATOM   594  O  O   . VAL A 1 87  ? -22.223 45.978 1.062   1.00 37.77  ? 1137 VAL A O   1 
ATOM   595  C  CB  . VAL A 1 87  ? -22.684 45.606 4.452   1.00 29.29  ? 1137 VAL A CB  1 
ATOM   596  C  CG1 . VAL A 1 87  ? -24.099 45.440 3.946   1.00 22.18  ? 1137 VAL A CG1 1 
ATOM   597  C  CG2 . VAL A 1 87  ? -22.406 44.607 5.580   1.00 19.43  ? 1137 VAL A CG2 1 
ATOM   598  N  N   . GLY A 1 88  ? -21.664 47.654 2.454   1.00 25.97  ? 1138 GLY A N   1 
ATOM   599  C  CA  . GLY A 1 88  ? -21.844 48.672 1.430   1.00 29.45  ? 1138 GLY A CA  1 
ATOM   600  C  C   . GLY A 1 88  ? -20.831 48.608 0.297   1.00 34.10  ? 1138 GLY A C   1 
ATOM   601  O  O   . GLY A 1 88  ? -19.667 48.271 0.513   1.00 40.47  ? 1138 GLY A O   1 
ATOM   602  N  N   . ARG A 1 89  ? -21.278 48.933 -0.915  1.00 37.62  ? 1139 ARG A N   1 
ATOM   603  C  CA  . ARG A 1 89  ? -20.414 48.922 -2.094  1.00 40.19  ? 1139 ARG A CA  1 
ATOM   604  C  C   . ARG A 1 89  ? -19.636 50.234 -2.183  1.00 40.98  ? 1139 ARG A C   1 
ATOM   605  O  O   . ARG A 1 89  ? -20.147 51.288 -1.791  1.00 40.56  ? 1139 ARG A O   1 
ATOM   606  C  CB  . ARG A 1 89  ? -21.249 48.708 -3.366  1.00 43.88  ? 1139 ARG A CB  1 
ATOM   607  C  CG  . ARG A 1 89  ? -22.463 49.616 -3.493  1.00 54.73  ? 1139 ARG A CG  1 
ATOM   608  C  CD  . ARG A 1 89  ? -23.088 49.528 -4.882  1.00 61.78  ? 1139 ARG A CD  1 
ATOM   609  N  NE  . ARG A 1 89  ? -23.818 48.283 -5.129  1.00 74.43  ? 1139 ARG A NE  1 
ATOM   610  C  CZ  . ARG A 1 89  ? -24.922 47.915 -4.482  1.00 74.15  ? 1139 ARG A CZ  1 
ATOM   611  N  NH1 . ARG A 1 89  ? -25.435 48.690 -3.537  1.00 81.66  ? 1139 ARG A NH1 1 
ATOM   612  N  NH2 . ARG A 1 89  ? -25.530 46.782 -4.796  1.00 65.67  ? 1139 ARG A NH2 1 
ATOM   613  N  N   . SER A 1 90  ? -18.405 50.174 -2.694  1.00 40.39  ? 1140 SER A N   1 
ATOM   614  C  CA  . SER A 1 90  ? -17.569 51.375 -2.789  1.00 45.28  ? 1140 SER A CA  1 
ATOM   615  C  C   . SER A 1 90  ? -18.037 52.365 -3.850  1.00 51.49  ? 1140 SER A C   1 
ATOM   616  O  O   . SER A 1 90  ? -17.755 53.562 -3.766  1.00 53.05  ? 1140 SER A O   1 
ATOM   617  C  CB  . SER A 1 90  ? -16.097 50.995 -3.035  1.00 35.03  ? 1140 SER A CB  1 
ATOM   618  O  OG  . SER A 1 90  ? -15.933 50.192 -4.190  1.00 52.52  ? 1140 SER A OG  1 
ATOM   619  N  N   . GLY A 1 91  ? -18.773 51.871 -4.835  1.00 54.97  ? 1141 GLY A N   1 
ATOM   620  C  CA  . GLY A 1 91  ? -19.238 52.749 -5.884  1.00 53.54  ? 1141 GLY A CA  1 
ATOM   621  C  C   . GLY A 1 91  ? -18.473 52.427 -7.144  1.00 63.17  ? 1141 GLY A C   1 
ATOM   622  O  O   . GLY A 1 91  ? -17.367 51.870 -7.092  1.00 60.93  ? 1141 GLY A O   1 
ATOM   623  N  N   . ARG A 1 92  ? -19.069 52.774 -8.279  1.00 66.82  ? 1142 ARG A N   1 
ATOM   624  C  CA  . ARG A 1 92  ? -18.461 52.514 -9.575  1.00 68.78  ? 1142 ARG A CA  1 
ATOM   625  C  C   . ARG A 1 92  ? -17.290 53.460 -9.794  1.00 65.80  ? 1142 ARG A C   1 
ATOM   626  O  O   . ARG A 1 92  ? -17.444 54.684 -9.760  1.00 61.35  ? 1142 ARG A O   1 
ATOM   627  C  CB  . ARG A 1 92  ? -19.504 52.692 -10.688 1.00 77.48  ? 1142 ARG A CB  1 
ATOM   628  C  CG  . ARG A 1 92  ? -19.154 51.987 -12.005 1.00 81.98  ? 1142 ARG A CG  1 
ATOM   629  C  CD  . ARG A 1 92  ? -20.278 52.104 -13.042 1.00 83.36  ? 1142 ARG A CD  1 
ATOM   630  N  NE  . ARG A 1 92  ? -20.414 53.459 -13.575 1.00 89.95  ? 1142 ARG A NE  1 
ATOM   631  C  CZ  . ARG A 1 92  ? -21.576 54.083 -13.746 1.00 88.87  ? 1142 ARG A CZ  1 
ATOM   632  N  NH1 . ARG A 1 92  ? -22.707 53.468 -13.420 1.00 85.84  ? 1142 ARG A NH1 1 
ATOM   633  N  NH2 . ARG A 1 92  ? -21.608 55.321 -14.235 1.00 86.22  ? 1142 ARG A NH2 1 
ATOM   634  N  N   . GLY A 1 93  ? -16.115 52.881 -10.004 1.00 62.61  ? 1143 GLY A N   1 
ATOM   635  C  CA  . GLY A 1 93  ? -14.935 53.689 -10.232 1.00 66.86  ? 1143 GLY A CA  1 
ATOM   636  C  C   . GLY A 1 93  ? -14.399 54.347 -8.977  1.00 66.78  ? 1143 GLY A C   1 
ATOM   637  O  O   . GLY A 1 93  ? -13.638 55.307 -9.054  1.00 70.22  ? 1143 GLY A O   1 
ATOM   638  N  N   . LYS A 1 94  ? -14.801 53.842 -7.818  1.00 64.90  ? 1144 LYS A N   1 
ATOM   639  C  CA  . LYS A 1 94  ? -14.326 54.392 -6.565  1.00 58.68  ? 1144 LYS A CA  1 
ATOM   640  C  C   . LYS A 1 94  ? -13.954 53.275 -5.602  1.00 57.16  ? 1144 LYS A C   1 
ATOM   641  O  O   . LYS A 1 94  ? -14.378 52.127 -5.772  1.00 58.84  ? 1144 LYS A O   1 
ATOM   642  C  CB  . LYS A 1 94  ? -15.383 55.312 -5.949  1.00 60.04  ? 1144 LYS A CB  1 
ATOM   643  C  CG  . LYS A 1 94  ? -15.602 56.591 -6.746  1.00 67.17  ? 1144 LYS A CG  1 
ATOM   644  C  CD  . LYS A 1 94  ? -16.313 57.674 -5.936  1.00 74.03  ? 1144 LYS A CD  1 
ATOM   645  C  CE  . LYS A 1 94  ? -17.777 57.335 -5.668  1.00 88.10  ? 1144 LYS A CE  1 
ATOM   646  N  NZ  . LYS A 1 94  ? -17.984 56.185 -4.735  1.00 96.37  ? 1144 LYS A NZ  1 
ATOM   647  N  N   . SER A 1 95  ? -13.138 53.614 -4.606  1.00 50.47  ? 1145 SER A N   1 
ATOM   648  C  CA  . SER A 1 95  ? -12.691 52.655 -3.605  1.00 46.85  ? 1145 SER A CA  1 
ATOM   649  C  C   . SER A 1 95  ? -12.971 53.172 -2.211  1.00 45.53  ? 1145 SER A C   1 
ATOM   650  O  O   . SER A 1 95  ? -13.536 54.254 -2.033  1.00 38.53  ? 1145 SER A O   1 
ATOM   651  C  CB  . SER A 1 95  ? -11.187 52.380 -3.735  1.00 46.01  ? 1145 SER A CB  1 
ATOM   652  O  OG  . SER A 1 95  ? -10.891 51.608 -4.883  1.00 55.28  ? 1145 SER A OG  1 
ATOM   653  N  N   . PHE A 1 96  ? -12.553 52.381 -1.228  1.00 45.45  ? 1146 PHE A N   1 
ATOM   654  C  CA  . PHE A 1 96  ? -12.729 52.699 0.187   1.00 43.95  ? 1146 PHE A CA  1 
ATOM   655  C  C   . PHE A 1 96  ? -11.407 52.938 0.891   1.00 38.81  ? 1146 PHE A C   1 
ATOM   656  O  O   . PHE A 1 96  ? -10.395 52.320 0.564   1.00 35.74  ? 1146 PHE A O   1 
ATOM   657  C  CB  . PHE A 1 96  ? -13.436 51.542 0.902   1.00 36.77  ? 1146 PHE A CB  1 
ATOM   658  C  CG  . PHE A 1 96  ? -14.922 51.591 0.813   1.00 37.63  ? 1146 PHE A CG  1 
ATOM   659  C  CD1 . PHE A 1 96  ? -15.668 50.417 0.852   1.00 35.28  ? 1146 PHE A CD1 1 
ATOM   660  C  CD2 . PHE A 1 96  ? -15.585 52.813 0.708   1.00 31.97  ? 1146 PHE A CD2 1 
ATOM   661  C  CE1 . PHE A 1 96  ? -17.057 50.457 0.788   1.00 37.35  ? 1146 PHE A CE1 1 
ATOM   662  C  CE2 . PHE A 1 96  ? -16.973 52.866 0.644   1.00 31.81  ? 1146 PHE A CE2 1 
ATOM   663  C  CZ  . PHE A 1 96  ? -17.711 51.687 0.683   1.00 34.21  ? 1146 PHE A CZ  1 
ATOM   664  N  N   . THR A 1 97  ? -11.424 53.839 1.864   1.00 38.48  ? 1147 THR A N   1 
ATOM   665  C  CA  . THR A 1 97  ? -10.240 54.113 2.663   1.00 41.67  ? 1147 THR A CA  1 
ATOM   666  C  C   . THR A 1 97  ? -10.557 53.593 4.062   1.00 39.83  ? 1147 THR A C   1 
ATOM   667  O  O   . THR A 1 97  ? -11.462 54.100 4.731   1.00 37.70  ? 1147 THR A O   1 
ATOM   668  C  CB  . THR A 1 97  ? -9.921  55.612 2.734   1.00 42.07  ? 1147 THR A CB  1 
ATOM   669  O  OG1 . THR A 1 97  ? -9.416  56.051 1.467   1.00 56.17  ? 1147 THR A OG1 1 
ATOM   670  C  CG2 . THR A 1 97  ? -8.880  55.876 3.802   1.00 45.47  ? 1147 THR A CG2 1 
ATOM   671  N  N   . LEU A 1 98  ? -9.820  52.567 4.483   1.00 35.68  ? 1148 LEU A N   1 
ATOM   672  C  CA  . LEU A 1 98  ? -10.023 51.946 5.787   1.00 34.98  ? 1148 LEU A CA  1 
ATOM   673  C  C   . LEU A 1 98  ? -9.342  52.743 6.891   1.00 33.66  ? 1148 LEU A C   1 
ATOM   674  O  O   . LEU A 1 98  ? -8.120  52.885 6.915   1.00 35.28  ? 1148 LEU A O   1 
ATOM   675  C  CB  . LEU A 1 98  ? -9.486  50.513 5.766   1.00 38.36  ? 1148 LEU A CB  1 
ATOM   676  C  CG  . LEU A 1 98  ? -10.107 49.471 6.709   1.00 39.35  ? 1148 LEU A CG  1 
ATOM   677  C  CD1 . LEU A 1 98  ? -9.704  49.720 8.154   1.00 47.50  ? 1148 LEU A CD1 1 
ATOM   678  C  CD2 . LEU A 1 98  ? -11.616 49.511 6.543   1.00 37.04  ? 1148 LEU A CD2 1 
ATOM   679  N  N   . THR A 1 99  ? -10.150 53.256 7.809   1.00 33.06  ? 1149 THR A N   1 
ATOM   680  C  CA  . THR A 1 99  ? -9.650  54.052 8.915   1.00 29.93  ? 1149 THR A CA  1 
ATOM   681  C  C   . THR A 1 99  ? -9.823  53.342 10.254  1.00 29.32  ? 1149 THR A C   1 
ATOM   682  O  O   . THR A 1 99  ? -10.940 53.138 10.728  1.00 28.36  ? 1149 THR A O   1 
ATOM   683  C  CB  . THR A 1 99  ? -10.373 55.395 8.966   1.00 29.93  ? 1149 THR A CB  1 
ATOM   684  O  OG1 . THR A 1 99  ? -10.195 56.062 7.716   1.00 36.47  ? 1149 THR A OG1 1 
ATOM   685  C  CG2 . THR A 1 99  ? -9.831  56.253 10.078  1.00 25.52  ? 1149 THR A CG2 1 
ATOM   686  N  N   . ILE A 1 100 ? -8.699  52.983 10.859  1.00 29.32  ? 1150 ILE A N   1 
ATOM   687  C  CA  . ILE A 1 100 ? -8.679  52.293 12.139  1.00 27.58  ? 1150 ILE A CA  1 
ATOM   688  C  C   . ILE A 1 100 ? -8.540  53.298 13.287  1.00 29.40  ? 1150 ILE A C   1 
ATOM   689  O  O   . ILE A 1 100 ? -7.672  54.167 13.249  1.00 25.87  ? 1150 ILE A O   1 
ATOM   690  C  CB  . ILE A 1 100 ? -7.489  51.321 12.188  1.00 30.31  ? 1150 ILE A CB  1 
ATOM   691  C  CG1 . ILE A 1 100 ? -7.440  50.503 10.895  1.00 24.38  ? 1150 ILE A CG1 1 
ATOM   692  C  CG2 . ILE A 1 100 ? -7.605  50.422 13.407  1.00 27.12  ? 1150 ILE A CG2 1 
ATOM   693  C  CD1 . ILE A 1 100 ? -6.256  49.556 10.803  1.00 30.88  ? 1150 ILE A CD1 1 
ATOM   694  N  N   . THR A 1 101 ? -9.389  53.182 14.305  1.00 29.48  ? 1151 THR A N   1 
ATOM   695  C  CA  . THR A 1 101 ? -9.318  54.089 15.445  1.00 26.74  ? 1151 THR A CA  1 
ATOM   696  C  C   . THR A 1 101 ? -9.173  53.324 16.753  1.00 29.25  ? 1151 THR A C   1 
ATOM   697  O  O   . THR A 1 101 ? -10.107 52.664 17.208  1.00 35.50  ? 1151 THR A O   1 
ATOM   698  C  CB  . THR A 1 101 ? -10.567 54.990 15.529  1.00 31.85  ? 1151 THR A CB  1 
ATOM   699  O  OG1 . THR A 1 101 ? -10.712 55.724 14.306  1.00 34.64  ? 1151 THR A OG1 1 
ATOM   700  C  CG2 . THR A 1 101 ? -10.437 55.979 16.682  1.00 20.74  ? 1151 THR A CG2 1 
ATOM   701  N  N   . VAL A 1 102 ? -7.982  53.409 17.339  1.00 29.02  ? 1152 VAL A N   1 
ATOM   702  C  CA  . VAL A 1 102 ? -7.674  52.740 18.601  1.00 25.45  ? 1152 VAL A CA  1 
ATOM   703  C  C   . VAL A 1 102 ? -7.981  53.726 19.707  1.00 26.19  ? 1152 VAL A C   1 
ATOM   704  O  O   . VAL A 1 102 ? -7.313  54.746 19.845  1.00 39.50  ? 1152 VAL A O   1 
ATOM   705  C  CB  . VAL A 1 102 ? -6.196  52.361 18.674  1.00 24.68  ? 1152 VAL A CB  1 
ATOM   706  C  CG1 . VAL A 1 102 ? -5.906  51.614 19.966  1.00 21.61  ? 1152 VAL A CG1 1 
ATOM   707  C  CG2 . VAL A 1 102 ? -5.838  51.533 17.465  1.00 21.02  ? 1152 VAL A CG2 1 
ATOM   708  N  N   . PHE A 1 103 ? -8.987  53.422 20.508  1.00 26.69  ? 1153 PHE A N   1 
ATOM   709  C  CA  . PHE A 1 103 ? -9.380  54.339 21.553  1.00 26.59  ? 1153 PHE A CA  1 
ATOM   710  C  C   . PHE A 1 103 ? -8.577  54.345 22.832  1.00 30.85  ? 1153 PHE A C   1 
ATOM   711  O  O   . PHE A 1 103 ? -9.095  54.056 23.915  1.00 30.73  ? 1153 PHE A O   1 
ATOM   712  C  CB  . PHE A 1 103 ? -10.848 54.140 21.856  1.00 27.77  ? 1153 PHE A CB  1 
ATOM   713  C  CG  . PHE A 1 103 ? -11.735 54.615 20.764  1.00 31.13  ? 1153 PHE A CG  1 
ATOM   714  C  CD1 . PHE A 1 103 ? -12.154 55.935 20.728  1.00 24.44  ? 1153 PHE A CD1 1 
ATOM   715  C  CD2 . PHE A 1 103 ? -12.142 53.752 19.755  1.00 33.35  ? 1153 PHE A CD2 1 
ATOM   716  C  CE1 . PHE A 1 103 ? -12.971 56.395 19.707  1.00 29.03  ? 1153 PHE A CE1 1 
ATOM   717  C  CE2 . PHE A 1 103 ? -12.960 54.203 18.727  1.00 36.27  ? 1153 PHE A CE2 1 
ATOM   718  C  CZ  . PHE A 1 103 ? -13.376 55.530 18.705  1.00 22.61  ? 1153 PHE A CZ  1 
ATOM   719  N  N   . THR A 1 104 ? -7.303  54.685 22.700  1.00 31.25  ? 1154 THR A N   1 
ATOM   720  C  CA  . THR A 1 104 ? -6.434  54.795 23.852  1.00 31.88  ? 1154 THR A CA  1 
ATOM   721  C  C   . THR A 1 104 ? -6.676  56.198 24.384  1.00 37.88  ? 1154 THR A C   1 
ATOM   722  O  O   . THR A 1 104 ? -7.532  56.926 23.877  1.00 39.17  ? 1154 THR A O   1 
ATOM   723  C  CB  . THR A 1 104 ? -4.960  54.667 23.454  1.00 23.78  ? 1154 THR A CB  1 
ATOM   724  O  OG1 . THR A 1 104 ? -4.739  55.352 22.213  1.00 21.44  ? 1154 THR A OG1 1 
ATOM   725  C  CG2 . THR A 1 104 ? -4.569  53.219 23.328  1.00 17.12  ? 1154 THR A CG2 1 
ATOM   726  N  N   . ASN A 1 105 ? -5.928  56.582 25.409  1.00 43.88  ? 1155 ASN A N   1 
ATOM   727  C  CA  . ASN A 1 105 ? -6.072  57.917 25.974  1.00 40.23  ? 1155 ASN A CA  1 
ATOM   728  C  C   . ASN A 1 105 ? -4.771  58.688 25.809  1.00 37.30  ? 1155 ASN A C   1 
ATOM   729  O  O   . ASN A 1 105 ? -3.831  58.483 26.568  1.00 44.24  ? 1155 ASN A O   1 
ATOM   730  C  CB  . ASN A 1 105 ? -6.409  57.837 27.452  1.00 39.56  ? 1155 ASN A CB  1 
ATOM   731  C  CG  . ASN A 1 105 ? -6.660  59.197 28.053  1.00 43.21  ? 1155 ASN A CG  1 
ATOM   732  O  OD1 . ASN A 1 105 ? -6.826  59.338 29.263  1.00 48.33  ? 1155 ASN A OD1 1 
ATOM   733  N  ND2 . ASN A 1 105 ? -6.698  60.213 27.202  1.00 42.26  ? 1155 ASN A ND2 1 
ATOM   734  N  N   . PRO A 1 106 ? -4.697  59.584 24.808  1.00 33.04  ? 1156 PRO A N   1 
ATOM   735  C  CA  . PRO A 1 106 ? -5.745  59.927 23.845  1.00 33.44  ? 1156 PRO A CA  1 
ATOM   736  C  C   . PRO A 1 106 ? -5.763  58.938 22.673  1.00 32.37  ? 1156 PRO A C   1 
ATOM   737  O  O   . PRO A 1 106 ? -4.828  58.150 22.492  1.00 35.70  ? 1156 PRO A O   1 
ATOM   738  C  CB  . PRO A 1 106 ? -5.355  61.329 23.413  1.00 31.27  ? 1156 PRO A CB  1 
ATOM   739  C  CG  . PRO A 1 106 ? -3.872  61.214 23.324  1.00 36.00  ? 1156 PRO A CG  1 
ATOM   740  C  CD  . PRO A 1 106 ? -3.487  60.389 24.559  1.00 34.33  ? 1156 PRO A CD  1 
ATOM   741  N  N   . PRO A 1 107 ? -6.826  58.984 21.854  1.00 27.69  ? 1157 PRO A N   1 
ATOM   742  C  CA  . PRO A 1 107 ? -6.998  58.102 20.696  1.00 22.11  ? 1157 PRO A CA  1 
ATOM   743  C  C   . PRO A 1 107 ? -5.936  58.243 19.620  1.00 27.39  ? 1157 PRO A C   1 
ATOM   744  O  O   . PRO A 1 107 ? -5.431  59.334 19.371  1.00 36.26  ? 1157 PRO A O   1 
ATOM   745  C  CB  . PRO A 1 107 ? -8.380  58.481 20.171  1.00 21.13  ? 1157 PRO A CB  1 
ATOM   746  C  CG  . PRO A 1 107 ? -9.091  59.019 21.391  1.00 22.01  ? 1157 PRO A CG  1 
ATOM   747  C  CD  . PRO A 1 107 ? -8.012  59.838 22.040  1.00 24.77  ? 1157 PRO A CD  1 
ATOM   748  N  N   . GLN A 1 108 ? -5.618  57.119 18.986  1.00 29.86  ? 1158 GLN A N   1 
ATOM   749  C  CA  . GLN A 1 108 ? -4.646  57.064 17.902  1.00 19.87  ? 1158 GLN A CA  1 
ATOM   750  C  C   . GLN A 1 108 ? -5.349  56.521 16.665  1.00 27.39  ? 1158 GLN A C   1 
ATOM   751  O  O   . GLN A 1 108 ? -6.008  55.485 16.727  1.00 34.16  ? 1158 GLN A O   1 
ATOM   752  C  CB  . GLN A 1 108 ? -3.507  56.122 18.245  1.00 18.68  ? 1158 GLN A CB  1 
ATOM   753  C  CG  . GLN A 1 108 ? -2.740  56.480 19.486  1.00 25.13  ? 1158 GLN A CG  1 
ATOM   754  C  CD  . GLN A 1 108 ? -1.590  55.523 19.713  1.00 30.63  ? 1158 GLN A CD  1 
ATOM   755  O  OE1 . GLN A 1 108 ? -0.693  55.395 18.868  1.00 31.51  ? 1158 GLN A OE1 1 
ATOM   756  N  NE2 . GLN A 1 108 ? -1.611  54.834 20.851  1.00 43.09  ? 1158 GLN A NE2 1 
ATOM   757  N  N   . VAL A 1 109 ? -5.199  57.216 15.543  1.00 27.25  ? 1159 VAL A N   1 
ATOM   758  C  CA  . VAL A 1 109 ? -5.816  56.806 14.283  1.00 27.00  ? 1159 VAL A CA  1 
ATOM   759  C  C   . VAL A 1 109 ? -4.777  56.300 13.260  1.00 34.89  ? 1159 VAL A C   1 
ATOM   760  O  O   . VAL A 1 109 ? -3.707  56.892 13.098  1.00 49.68  ? 1159 VAL A O   1 
ATOM   761  C  CB  . VAL A 1 109 ? -6.592  57.984 13.642  1.00 21.68  ? 1159 VAL A CB  1 
ATOM   762  C  CG1 . VAL A 1 109 ? -7.233  57.532 12.337  1.00 20.35  ? 1159 VAL A CG1 1 
ATOM   763  C  CG2 . VAL A 1 109 ? -7.646  58.513 14.604  1.00 12.58  ? 1159 VAL A CG2 1 
ATOM   764  N  N   . ALA A 1 110 ? -5.098  55.204 12.579  1.00 30.83  ? 1160 ALA A N   1 
ATOM   765  C  CA  . ALA A 1 110 ? -4.217  54.634 11.563  1.00 30.07  ? 1160 ALA A CA  1 
ATOM   766  C  C   . ALA A 1 110 ? -5.058  54.355 10.318  1.00 32.52  ? 1160 ALA A C   1 
ATOM   767  O  O   . ALA A 1 110 ? -6.245  54.051 10.424  1.00 36.01  ? 1160 ALA A O   1 
ATOM   768  C  CB  . ALA A 1 110 ? -3.581  53.346 12.074  1.00 16.92  ? 1160 ALA A CB  1 
ATOM   769  N  N   . THR A 1 111 ? -4.449  54.466 9.144   1.00 33.17  ? 1161 THR A N   1 
ATOM   770  C  CA  . THR A 1 111 ? -5.155  54.222 7.891   1.00 34.19  ? 1161 THR A CA  1 
ATOM   771  C  C   . THR A 1 111 ? -4.480  53.075 7.141   1.00 39.63  ? 1161 THR A C   1 
ATOM   772  O  O   . THR A 1 111 ? -3.252  52.966 7.159   1.00 41.43  ? 1161 THR A O   1 
ATOM   773  C  CB  . THR A 1 111 ? -5.155  55.498 7.015   1.00 35.00  ? 1161 THR A CB  1 
ATOM   774  O  OG1 . THR A 1 111 ? -5.736  56.570 7.760   1.00 30.74  ? 1161 THR A OG1 1 
ATOM   775  C  CG2 . THR A 1 111 ? -5.963  55.296 5.736   1.00 35.41  ? 1161 THR A CG2 1 
ATOM   776  N  N   . TYR A 1 112 ? -5.281  52.214 6.507   1.00 42.06  ? 1162 TYR A N   1 
ATOM   777  C  CA  . TYR A 1 112 ? -4.743  51.083 5.750   1.00 42.35  ? 1162 TYR A CA  1 
ATOM   778  C  C   . TYR A 1 112 ? -3.907  51.681 4.620   1.00 44.40  ? 1162 TYR A C   1 
ATOM   779  O  O   . TYR A 1 112 ? -4.345  52.617 3.943   1.00 37.94  ? 1162 TYR A O   1 
ATOM   780  C  CB  . TYR A 1 112 ? -5.879  50.210 5.187   1.00 43.40  ? 1162 TYR A CB  1 
ATOM   781  C  CG  . TYR A 1 112 ? -5.429  48.856 4.639   1.00 40.70  ? 1162 TYR A CG  1 
ATOM   782  C  CD1 . TYR A 1 112 ? -5.151  47.788 5.490   1.00 32.42  ? 1162 TYR A CD1 1 
ATOM   783  C  CD2 . TYR A 1 112 ? -5.230  48.665 3.270   1.00 38.44  ? 1162 TYR A CD2 1 
ATOM   784  C  CE1 . TYR A 1 112 ? -4.682  46.564 4.987   1.00 29.14  ? 1162 TYR A CE1 1 
ATOM   785  C  CE2 . TYR A 1 112 ? -4.761  47.456 2.759   1.00 26.06  ? 1162 TYR A CE2 1 
ATOM   786  C  CZ  . TYR A 1 112 ? -4.487  46.412 3.618   1.00 33.25  ? 1162 TYR A CZ  1 
ATOM   787  O  OH  . TYR A 1 112 ? -4.006  45.227 3.099   1.00 33.15  ? 1162 TYR A OH  1 
ATOM   788  N  N   . HIS A 1 113 ? -2.704  51.138 4.437   1.00 52.23  ? 1163 HIS A N   1 
ATOM   789  C  CA  . HIS A 1 113 ? -1.752  51.614 3.429   1.00 58.87  ? 1163 HIS A CA  1 
ATOM   790  C  C   . HIS A 1 113 ? -2.303  51.732 2.010   1.00 60.87  ? 1163 HIS A C   1 
ATOM   791  O  O   . HIS A 1 113 ? -1.759  52.470 1.185   1.00 64.61  ? 1163 HIS A O   1 
ATOM   792  C  CB  . HIS A 1 113 ? -0.508  50.710 3.419   1.00 57.33  ? 1163 HIS A CB  1 
ATOM   793  C  CG  . HIS A 1 113 ? -0.737  49.363 2.804   1.00 61.78  ? 1163 HIS A CG  1 
ATOM   794  N  ND1 . HIS A 1 113 ? -0.962  49.189 1.455   1.00 63.10  ? 1163 HIS A ND1 1 
ATOM   795  C  CD2 . HIS A 1 113 ? -0.774  48.126 3.353   1.00 67.76  ? 1163 HIS A CD2 1 
ATOM   796  C  CE1 . HIS A 1 113 ? -1.127  47.903 1.201   1.00 66.99  ? 1163 HIS A CE1 1 
ATOM   797  N  NE2 . HIS A 1 113 ? -1.019  47.237 2.334   1.00 66.25  ? 1163 HIS A NE2 1 
ATOM   798  N  N   . ARG A 1 114 ? -3.384  51.016 1.729   1.00 61.02  ? 1164 ARG A N   1 
ATOM   799  C  CA  . ARG A 1 114 ? -3.970  51.042 0.398   1.00 55.75  ? 1164 ARG A CA  1 
ATOM   800  C  C   . ARG A 1 114 ? -5.489  51.080 0.471   1.00 46.29  ? 1164 ARG A C   1 
ATOM   801  O  O   . ARG A 1 114 ? -6.069  50.809 1.514   1.00 48.65  ? 1164 ARG A O   1 
ATOM   802  C  CB  . ARG A 1 114 ? -3.501  49.812 -0.378  1.00 59.68  ? 1164 ARG A CB  1 
ATOM   803  C  CG  . ARG A 1 114 ? -3.719  49.885 -1.873  1.00 84.59  ? 1164 ARG A CG  1 
ATOM   804  C  CD  . ARG A 1 114 ? -2.849  48.857 -2.569  1.00 97.47  ? 1164 ARG A CD  1 
ATOM   805  N  NE  . ARG A 1 114 ? -1.429  49.126 -2.343  1.00 109.88 ? 1164 ARG A NE  1 
ATOM   806  C  CZ  . ARG A 1 114 ? -0.451  48.269 -2.618  1.00 115.13 ? 1164 ARG A CZ  1 
ATOM   807  N  NH1 . ARG A 1 114 ? -0.738  47.078 -3.131  1.00 117.64 ? 1164 ARG A NH1 1 
ATOM   808  N  NH2 . ARG A 1 114 ? 0.813   48.601 -2.382  1.00 114.09 ? 1164 ARG A NH2 1 
ATOM   809  N  N   . ALA A 1 115 ? -6.130  51.432 -0.635  1.00 43.20  ? 1165 ALA A N   1 
ATOM   810  C  CA  . ALA A 1 115 ? -7.583  51.494 -0.674  1.00 41.82  ? 1165 ALA A CA  1 
ATOM   811  C  C   . ALA A 1 115 ? -8.146  50.125 -1.033  1.00 45.21  ? 1165 ALA A C   1 
ATOM   812  O  O   . ALA A 1 115 ? -7.446  49.292 -1.616  1.00 43.31  ? 1165 ALA A O   1 
ATOM   813  C  CB  . ALA A 1 115 ? -8.040  52.532 -1.693  1.00 33.42  ? 1165 ALA A CB  1 
ATOM   814  N  N   . ILE A 1 116 ? -9.406  49.890 -0.672  1.00 44.86  ? 1166 ILE A N   1 
ATOM   815  C  CA  . ILE A 1 116 ? -10.065 48.622 -0.971  1.00 44.60  ? 1166 ILE A CA  1 
ATOM   816  C  C   . ILE A 1 116 ? -11.357 48.875 -1.743  1.00 41.73  ? 1166 ILE A C   1 
ATOM   817  O  O   . ILE A 1 116 ? -12.182 49.700 -1.348  1.00 36.88  ? 1166 ILE A O   1 
ATOM   818  C  CB  . ILE A 1 116 ? -10.362 47.801 0.328   1.00 39.36  ? 1166 ILE A CB  1 
ATOM   819  C  CG1 . ILE A 1 116 ? -11.099 46.508 -0.026  1.00 35.81  ? 1166 ILE A CG1 1 
ATOM   820  C  CG2 . ILE A 1 116 ? -11.183 48.617 1.300   1.00 41.97  ? 1166 ILE A CG2 1 
ATOM   821  C  CD1 . ILE A 1 116 ? -11.315 45.570 1.161   1.00 28.00  ? 1166 ILE A CD1 1 
ATOM   822  N  N   . LYS A 1 117 ? -11.512 48.175 -2.862  1.00 39.36  ? 1167 LYS A N   1 
ATOM   823  C  CA  . LYS A 1 117 ? -12.701 48.319 -3.696  1.00 40.89  ? 1167 LYS A CA  1 
ATOM   824  C  C   . LYS A 1 117 ? -13.726 47.255 -3.307  1.00 36.99  ? 1167 LYS A C   1 
ATOM   825  O  O   . LYS A 1 117 ? -13.389 46.076 -3.167  1.00 28.68  ? 1167 LYS A O   1 
ATOM   826  C  CB  . LYS A 1 117 ? -12.332 48.160 -5.177  1.00 39.72  ? 1167 LYS A CB  1 
ATOM   827  C  CG  . LYS A 1 117 ? -13.332 48.778 -6.145  1.00 43.42  ? 1167 LYS A CG  1 
ATOM   828  C  CD  . LYS A 1 117 ? -12.923 48.543 -7.594  1.00 43.50  ? 1167 LYS A CD  1 
ATOM   829  C  CE  . LYS A 1 117 ? -13.333 49.708 -8.488  1.00 47.57  ? 1167 LYS A CE  1 
ATOM   830  N  NZ  . LYS A 1 117 ? -14.776 50.056 -8.343  1.00 62.66  ? 1167 LYS A NZ  1 
ATOM   831  N  N   . ILE A 1 118 ? -14.971 47.675 -3.114  1.00 30.86  ? 1168 ILE A N   1 
ATOM   832  C  CA  . ILE A 1 118 ? -16.035 46.746 -2.761  1.00 32.51  ? 1168 ILE A CA  1 
ATOM   833  C  C   . ILE A 1 118 ? -17.177 46.893 -3.768  1.00 34.81  ? 1168 ILE A C   1 
ATOM   834  O  O   . ILE A 1 118 ? -17.820 47.947 -3.839  1.00 30.54  ? 1168 ILE A O   1 
ATOM   835  C  CB  . ILE A 1 118 ? -16.597 47.020 -1.334  1.00 34.36  ? 1168 ILE A CB  1 
ATOM   836  C  CG1 . ILE A 1 118 ? -15.479 46.932 -0.280  1.00 37.16  ? 1168 ILE A CG1 1 
ATOM   837  C  CG2 . ILE A 1 118 ? -17.717 46.032 -1.025  1.00 27.15  ? 1168 ILE A CG2 1 
ATOM   838  C  CD1 . ILE A 1 118 ? -14.831 45.548 -0.128  1.00 20.07  ? 1168 ILE A CD1 1 
ATOM   839  N  N   . THR A 1 119 ? -17.415 45.843 -4.555  1.00 34.09  ? 1169 THR A N   1 
ATOM   840  C  CA  . THR A 1 119 ? -18.488 45.849 -5.557  1.00 34.37  ? 1169 THR A CA  1 
ATOM   841  C  C   . THR A 1 119 ? -19.411 44.641 -5.400  1.00 34.89  ? 1169 THR A C   1 
ATOM   842  O  O   . THR A 1 119 ? -19.076 43.675 -4.711  1.00 36.91  ? 1169 THR A O   1 
ATOM   843  C  CB  . THR A 1 119 ? -17.931 45.832 -7.001  1.00 34.25  ? 1169 THR A CB  1 
ATOM   844  O  OG1 . THR A 1 119 ? -17.172 44.635 -7.216  1.00 27.28  ? 1169 THR A OG1 1 
ATOM   845  C  CG2 . THR A 1 119 ? -17.047 47.046 -7.248  1.00 37.38  ? 1169 THR A CG2 1 
ATOM   846  N  N   . VAL A 1 120 ? -20.567 44.694 -6.055  1.00 34.69  ? 1170 VAL A N   1 
ATOM   847  C  CA  . VAL A 1 120 ? -21.543 43.609 -5.976  1.00 29.85  ? 1170 VAL A CA  1 
ATOM   848  C  C   . VAL A 1 120 ? -20.961 42.261 -6.394  1.00 27.76  ? 1170 VAL A C   1 
ATOM   849  O  O   . VAL A 1 120 ? -21.099 41.274 -5.676  1.00 34.09  ? 1170 VAL A O   1 
ATOM   850  C  CB  . VAL A 1 120 ? -22.789 43.905 -6.856  1.00 34.60  ? 1170 VAL A CB  1 
ATOM   851  C  CG1 . VAL A 1 120 ? -23.866 42.871 -6.596  1.00 33.53  ? 1170 VAL A CG1 1 
ATOM   852  C  CG2 . VAL A 1 120 ? -23.323 45.303 -6.561  1.00 42.59  ? 1170 VAL A CG2 1 
ATOM   853  N  N   . ASP A 1 121 ? -20.300 42.228 -7.548  1.00 27.64  ? 1171 ASP A N   1 
ATOM   854  C  CA  . ASP A 1 121 ? -19.719 40.993 -8.073  1.00 30.53  ? 1171 ASP A CA  1 
ATOM   855  C  C   . ASP A 1 121 ? -18.303 40.724 -7.576  1.00 33.86  ? 1171 ASP A C   1 
ATOM   856  O  O   . ASP A 1 121 ? -17.883 39.570 -7.458  1.00 26.26  ? 1171 ASP A O   1 
ATOM   857  C  CB  . ASP A 1 121 ? -19.708 41.048 -9.600  1.00 36.01  ? 1171 ASP A CB  1 
ATOM   858  C  CG  . ASP A 1 121 ? -21.002 41.568 -10.162 1.00 36.65  ? 1171 ASP A CG  1 
ATOM   859  O  OD1 . ASP A 1 121 ? -22.054 40.966 -9.867  1.00 42.81  ? 1171 ASP A OD1 1 
ATOM   860  O  OD2 . ASP A 1 121 ? -20.974 42.584 -10.889 1.00 48.23  ? 1171 ASP A OD2 1 
ATOM   861  N  N   . GLY A 1 122 ? -17.573 41.798 -7.295  1.00 37.02  ? 1172 GLY A N   1 
ATOM   862  C  CA  . GLY A 1 122 ? -16.209 41.662 -6.836  1.00 38.24  ? 1172 GLY A CA  1 
ATOM   863  C  C   . GLY A 1 122 ? -15.278 41.493 -8.022  1.00 43.94  ? 1172 GLY A C   1 
ATOM   864  O  O   . GLY A 1 122 ? -15.668 41.762 -9.161  1.00 43.53  ? 1172 GLY A O   1 
ATOM   865  N  N   . PRO A 1 123 ? -14.035 41.045 -7.793  1.00 49.88  ? 1173 PRO A N   1 
ATOM   866  C  CA  . PRO A 1 123 ? -13.089 40.862 -8.896  1.00 57.51  ? 1173 PRO A CA  1 
ATOM   867  C  C   . PRO A 1 123 ? -13.654 39.936 -9.971  1.00 65.10  ? 1173 PRO A C   1 
ATOM   868  O  O   . PRO A 1 123 ? -14.089 38.819 -9.677  1.00 64.92  ? 1173 PRO A O   1 
ATOM   869  C  CB  . PRO A 1 123 ? -11.861 40.286 -8.196  1.00 52.57  ? 1173 PRO A CB  1 
ATOM   870  C  CG  . PRO A 1 123 ? -12.449 39.541 -7.037  1.00 53.07  ? 1173 PRO A CG  1 
ATOM   871  C  CD  . PRO A 1 123 ? -13.481 40.515 -6.535  1.00 50.59  ? 1173 PRO A CD  1 
ATOM   872  N  N   . ARG A 1 124 ? -13.647 40.410 -11.215 1.00 70.53  ? 1174 ARG A N   1 
ATOM   873  C  CA  . ARG A 1 124 ? -14.166 39.632 -12.336 1.00 75.03  ? 1174 ARG A CA  1 
ATOM   874  C  C   . ARG A 1 124 ? -13.076 38.775 -12.976 1.00 79.37  ? 1174 ARG A C   1 
ATOM   875  O  O   . ARG A 1 124 ? -11.913 38.870 -12.528 1.00 83.44  ? 1174 ARG A O   1 
ATOM   876  C  CB  . ARG A 1 124 ? -14.775 40.571 -13.381 1.00 67.96  ? 1174 ARG A CB  1 
ATOM   877  C  CG  . ARG A 1 124 ? -13.765 41.305 -14.242 1.00 66.53  ? 1174 ARG A CG  1 
ATOM   878  C  CD  . ARG A 1 124 ? -14.280 42.675 -14.674 1.00 72.29  ? 1174 ARG A CD  1 
ATOM   879  N  NE  . ARG A 1 124 ? -15.670 42.657 -15.142 1.00 72.53  ? 1174 ARG A NE  1 
ATOM   880  C  CZ  . ARG A 1 124 ? -16.099 42.008 -16.220 1.00 68.53  ? 1174 ARG A CZ  1 
ATOM   881  N  NH1 . ARG A 1 124 ? -15.255 41.307 -16.964 1.00 69.35  ? 1174 ARG A NH1 1 
ATOM   882  N  NH2 . ARG A 1 124 ? -17.375 42.070 -16.558 1.00 68.09  ? 1174 ARG A NH2 1 
ATOM   883  N  N   . GLY B 1 10  ? -40.324 49.675 21.102  1.00 71.72  ? 2060 GLY B N   1 
ATOM   884  C  CA  . GLY B 1 10  ? -40.487 50.598 19.934  1.00 75.81  ? 2060 GLY B CA  1 
ATOM   885  C  C   . GLY B 1 10  ? -39.631 50.216 18.736  1.00 75.13  ? 2060 GLY B C   1 
ATOM   886  O  O   . GLY B 1 10  ? -39.431 49.028 18.466  1.00 76.94  ? 2060 GLY B O   1 
ATOM   887  N  N   . GLU B 1 11  ? -39.128 51.220 18.016  1.00 69.87  ? 2061 GLU B N   1 
ATOM   888  C  CA  . GLU B 1 11  ? -38.286 50.993 16.835  1.00 64.96  ? 2061 GLU B CA  1 
ATOM   889  C  C   . GLU B 1 11  ? -36.900 50.503 17.251  1.00 58.53  ? 2061 GLU B C   1 
ATOM   890  O  O   . GLU B 1 11  ? -36.349 50.962 18.246  1.00 56.58  ? 2061 GLU B O   1 
ATOM   891  C  CB  . GLU B 1 11  ? -38.130 52.288 16.025  1.00 68.07  ? 2061 GLU B CB  1 
ATOM   892  C  CG  . GLU B 1 11  ? -37.519 52.096 14.629  1.00 72.10  ? 2061 GLU B CG  1 
ATOM   893  C  CD  . GLU B 1 11  ? -37.139 53.416 13.950  1.00 78.03  ? 2061 GLU B CD  1 
ATOM   894  O  OE1 . GLU B 1 11  ? -37.798 54.444 14.222  1.00 83.06  ? 2061 GLU B OE1 1 
ATOM   895  O  OE2 . GLU B 1 11  ? -36.191 53.423 13.130  1.00 75.56  ? 2061 GLU B OE2 1 
ATOM   896  N  N   . LEU B 1 12  ? -36.339 49.571 16.488  1.00 48.16  ? 2062 LEU B N   1 
ATOM   897  C  CA  . LEU B 1 12  ? -35.014 49.045 16.793  1.00 45.41  ? 2062 LEU B CA  1 
ATOM   898  C  C   . LEU B 1 12  ? -34.077 49.146 15.589  1.00 44.88  ? 2062 LEU B C   1 
ATOM   899  O  O   . LEU B 1 12  ? -34.449 48.800 14.467  1.00 45.27  ? 2062 LEU B O   1 
ATOM   900  C  CB  . LEU B 1 12  ? -35.103 47.581 17.250  1.00 44.87  ? 2062 LEU B CB  1 
ATOM   901  C  CG  . LEU B 1 12  ? -35.839 47.252 18.554  1.00 41.16  ? 2062 LEU B CG  1 
ATOM   902  C  CD1 . LEU B 1 12  ? -35.840 45.747 18.753  1.00 46.68  ? 2062 LEU B CD1 1 
ATOM   903  C  CD2 . LEU B 1 12  ? -35.175 47.942 19.733  1.00 43.38  ? 2062 LEU B CD2 1 
ATOM   904  N  N   . VAL B 1 13  ? -32.863 49.635 15.826  1.00 40.87  ? 2063 VAL B N   1 
ATOM   905  C  CA  . VAL B 1 13  ? -31.867 49.765 14.769  1.00 37.07  ? 2063 VAL B CA  1 
ATOM   906  C  C   . VAL B 1 13  ? -30.797 48.692 14.966  1.00 38.32  ? 2063 VAL B C   1 
ATOM   907  O  O   . VAL B 1 13  ? -30.629 48.166 16.068  1.00 37.98  ? 2063 VAL B O   1 
ATOM   908  C  CB  . VAL B 1 13  ? -31.206 51.162 14.792  1.00 36.21  ? 2063 VAL B CB  1 
ATOM   909  C  CG1 . VAL B 1 13  ? -32.239 52.219 14.480  1.00 36.25  ? 2063 VAL B CG1 1 
ATOM   910  C  CG2 . VAL B 1 13  ? -30.578 51.430 16.150  1.00 30.54  ? 2063 VAL B CG2 1 
ATOM   911  N  N   . ARG B 1 14  ? -30.080 48.355 13.903  1.00 36.41  ? 2064 ARG B N   1 
ATOM   912  C  CA  . ARG B 1 14  ? -29.045 47.337 14.010  1.00 36.05  ? 2064 ARG B CA  1 
ATOM   913  C  C   . ARG B 1 14  ? -27.698 47.948 14.391  1.00 35.20  ? 2064 ARG B C   1 
ATOM   914  O  O   . ARG B 1 14  ? -27.517 49.156 14.310  1.00 32.29  ? 2064 ARG B O   1 
ATOM   915  C  CB  . ARG B 1 14  ? -28.938 46.556 12.688  1.00 40.45  ? 2064 ARG B CB  1 
ATOM   916  C  CG  . ARG B 1 14  ? -28.587 47.387 11.455  1.00 54.18  ? 2064 ARG B CG  1 
ATOM   917  C  CD  . ARG B 1 14  ? -27.082 47.629 11.361  1.00 62.90  ? 2064 ARG B CD  1 
ATOM   918  N  NE  . ARG B 1 14  ? -26.720 48.690 10.414  1.00 58.71  ? 2064 ARG B NE  1 
ATOM   919  C  CZ  . ARG B 1 14  ? -25.507 49.236 10.340  1.00 61.28  ? 2064 ARG B CZ  1 
ATOM   920  N  NH1 . ARG B 1 14  ? -24.535 48.825 11.150  1.00 54.34  ? 2064 ARG B NH1 1 
ATOM   921  N  NH2 . ARG B 1 14  ? -25.266 50.206 9.469   1.00 61.84  ? 2064 ARG B NH2 1 
ATOM   922  N  N   . THR B 1 15  ? -26.777 47.108 14.852  1.00 35.18  ? 2065 THR B N   1 
ATOM   923  C  CA  . THR B 1 15  ? -25.425 47.538 15.211  1.00 33.55  ? 2065 THR B CA  1 
ATOM   924  C  C   . THR B 1 15  ? -24.547 46.783 14.211  1.00 36.21  ? 2065 THR B C   1 
ATOM   925  O  O   . THR B 1 15  ? -25.073 46.215 13.253  1.00 40.45  ? 2065 THR B O   1 
ATOM   926  C  CB  . THR B 1 15  ? -25.027 47.110 16.668  1.00 29.61  ? 2065 THR B CB  1 
ATOM   927  O  OG1 . THR B 1 15  ? -24.981 45.680 16.765  1.00 33.06  ? 2065 THR B OG1 1 
ATOM   928  C  CG2 . THR B 1 15  ? -26.019 47.648 17.683  1.00 18.67  ? 2065 THR B CG2 1 
ATOM   929  N  N   . ASP B 1 16  ? -23.230 46.769 14.406  1.00 30.93  ? 2066 ASP B N   1 
ATOM   930  C  CA  . ASP B 1 16  ? -22.380 46.027 13.477  1.00 30.12  ? 2066 ASP B CA  1 
ATOM   931  C  C   . ASP B 1 16  ? -22.286 44.575 13.954  1.00 30.38  ? 2066 ASP B C   1 
ATOM   932  O  O   . ASP B 1 16  ? -21.573 43.752 13.369  1.00 25.83  ? 2066 ASP B O   1 
ATOM   933  C  CB  . ASP B 1 16  ? -20.977 46.658 13.355  1.00 30.15  ? 2066 ASP B CB  1 
ATOM   934  C  CG  . ASP B 1 16  ? -20.213 46.693 14.674  1.00 36.81  ? 2066 ASP B CG  1 
ATOM   935  O  OD1 . ASP B 1 16  ? -18.970 46.823 14.630  1.00 34.25  ? 2066 ASP B OD1 1 
ATOM   936  O  OD2 . ASP B 1 16  ? -20.844 46.611 15.749  1.00 36.39  ? 2066 ASP B OD2 1 
ATOM   937  N  N   . SER B 1 17  ? -23.034 44.272 15.015  1.00 24.62  ? 2067 SER B N   1 
ATOM   938  C  CA  . SER B 1 17  ? -23.063 42.935 15.592  1.00 26.46  ? 2067 SER B CA  1 
ATOM   939  C  C   . SER B 1 17  ? -24.371 42.203 15.319  1.00 27.34  ? 2067 SER B C   1 
ATOM   940  O  O   . SER B 1 17  ? -25.456 42.757 15.489  1.00 27.23  ? 2067 SER B O   1 
ATOM   941  C  CB  . SER B 1 17  ? -22.851 42.987 17.105  1.00 28.29  ? 2067 SER B CB  1 
ATOM   942  O  OG  . SER B 1 17  ? -22.873 41.668 17.653  1.00 36.32  ? 2067 SER B OG  1 
ATOM   943  N  N   . PRO B 1 18  ? -24.278 40.935 14.897  1.00 27.46  ? 2068 PRO B N   1 
ATOM   944  C  CA  . PRO B 1 18  ? -25.453 40.108 14.603  1.00 29.01  ? 2068 PRO B CA  1 
ATOM   945  C  C   . PRO B 1 18  ? -26.238 39.799 15.874  1.00 31.06  ? 2068 PRO B C   1 
ATOM   946  O  O   . PRO B 1 18  ? -27.394 39.394 15.810  1.00 35.75  ? 2068 PRO B O   1 
ATOM   947  C  CB  . PRO B 1 18  ? -24.849 38.832 14.024  1.00 23.68  ? 2068 PRO B CB  1 
ATOM   948  C  CG  . PRO B 1 18  ? -23.542 39.278 13.462  1.00 33.75  ? 2068 PRO B CG  1 
ATOM   949  C  CD  . PRO B 1 18  ? -23.038 40.245 14.497  1.00 29.11  ? 2068 PRO B CD  1 
ATOM   950  N  N   . ASN B 1 19  ? -25.605 40.004 17.027  1.00 25.46  ? 2069 ASN B N   1 
ATOM   951  C  CA  . ASN B 1 19  ? -26.242 39.677 18.289  1.00 23.63  ? 2069 ASN B CA  1 
ATOM   952  C  C   . ASN B 1 19  ? -26.942 40.772 19.072  1.00 27.59  ? 2069 ASN B C   1 
ATOM   953  O  O   . ASN B 1 19  ? -27.555 40.486 20.108  1.00 23.88  ? 2069 ASN B O   1 
ATOM   954  C  CB  . ASN B 1 19  ? -25.239 38.980 19.206  1.00 19.84  ? 2069 ASN B CB  1 
ATOM   955  C  CG  . ASN B 1 19  ? -24.591 37.779 18.545  1.00 29.90  ? 2069 ASN B CG  1 
ATOM   956  O  OD1 . ASN B 1 19  ? -25.248 37.016 17.831  1.00 35.29  ? 2069 ASN B OD1 1 
ATOM   957  N  ND2 . ASN B 1 19  ? -23.301 37.593 18.792  1.00 34.64  ? 2069 ASN B ND2 1 
ATOM   958  N  N   . PHE B 1 20  ? -26.875 42.017 18.612  1.00 22.47  ? 2070 PHE B N   1 
ATOM   959  C  CA  . PHE B 1 20  ? -27.531 43.078 19.371  1.00 24.27  ? 2070 PHE B CA  1 
ATOM   960  C  C   . PHE B 1 20  ? -28.148 44.176 18.524  1.00 27.45  ? 2070 PHE B C   1 
ATOM   961  O  O   . PHE B 1 20  ? -27.630 44.531 17.467  1.00 29.11  ? 2070 PHE B O   1 
ATOM   962  C  CB  . PHE B 1 20  ? -26.543 43.705 20.369  1.00 19.41  ? 2070 PHE B CB  1 
ATOM   963  C  CG  . PHE B 1 20  ? -25.853 42.699 21.256  1.00 22.80  ? 2070 PHE B CG  1 
ATOM   964  C  CD1 . PHE B 1 20  ? -24.673 42.075 20.842  1.00 17.49  ? 2070 PHE B CD1 1 
ATOM   965  C  CD2 . PHE B 1 20  ? -26.408 42.338 22.483  1.00 14.95  ? 2070 PHE B CD2 1 
ATOM   966  C  CE1 . PHE B 1 20  ? -24.055 41.105 21.636  1.00 23.97  ? 2070 PHE B CE1 1 
ATOM   967  C  CE2 . PHE B 1 20  ? -25.801 41.370 23.286  1.00 20.43  ? 2070 PHE B CE2 1 
ATOM   968  C  CZ  . PHE B 1 20  ? -24.621 40.750 22.862  1.00 20.91  ? 2070 PHE B CZ  1 
ATOM   969  N  N   . LEU B 1 21  ? -29.276 44.694 19.001  1.00 29.44  ? 2071 LEU B N   1 
ATOM   970  C  CA  . LEU B 1 21  ? -29.994 45.788 18.352  1.00 28.96  ? 2071 LEU B CA  1 
ATOM   971  C  C   . LEU B 1 21  ? -30.169 46.857 19.422  1.00 29.52  ? 2071 LEU B C   1 
ATOM   972  O  O   . LEU B 1 21  ? -30.050 46.568 20.614  1.00 29.30  ? 2071 LEU B O   1 
ATOM   973  C  CB  . LEU B 1 21  ? -31.370 45.331 17.867  1.00 25.93  ? 2071 LEU B CB  1 
ATOM   974  C  CG  . LEU B 1 21  ? -31.408 44.220 16.828  1.00 32.19  ? 2071 LEU B CG  1 
ATOM   975  C  CD1 . LEU B 1 21  ? -32.855 43.865 16.554  1.00 30.84  ? 2071 LEU B CD1 1 
ATOM   976  C  CD2 . LEU B 1 21  ? -30.703 44.660 15.557  1.00 29.29  ? 2071 LEU B CD2 1 
ATOM   977  N  N   . CYS B 1 22  ? -30.450 48.084 19.000  1.00 32.58  ? 2072 CYS B N   1 
ATOM   978  C  CA  . CYS B 1 22  ? -30.643 49.193 19.931  1.00 34.03  ? 2072 CYS B CA  1 
ATOM   979  C  C   . CYS B 1 22  ? -31.872 50.007 19.606  1.00 34.30  ? 2072 CYS B C   1 
ATOM   980  O  O   . CYS B 1 22  ? -32.530 49.791 18.588  1.00 32.36  ? 2072 CYS B O   1 
ATOM   981  C  CB  . CYS B 1 22  ? -29.458 50.150 19.891  1.00 32.87  ? 2072 CYS B CB  1 
ATOM   982  S  SG  . CYS B 1 22  ? -27.951 49.457 20.463  1.00 53.62  ? 2072 CYS B SG  1 
ATOM   983  N  N   . SER B 1 23  ? -32.165 50.958 20.484  1.00 37.59  ? 2073 SER B N   1 
ATOM   984  C  CA  . SER B 1 23  ? -33.289 51.852 20.284  1.00 36.29  ? 2073 SER B CA  1 
ATOM   985  C  C   . SER B 1 23  ? -32.734 53.038 19.498  1.00 38.31  ? 2073 SER B C   1 
ATOM   986  O  O   . SER B 1 23  ? -31.522 53.147 19.324  1.00 38.03  ? 2073 SER B O   1 
ATOM   987  C  CB  . SER B 1 23  ? -33.870 52.291 21.633  1.00 34.69  ? 2073 SER B CB  1 
ATOM   988  O  OG  . SER B 1 23  ? -32.875 52.814 22.492  1.00 39.84  ? 2073 SER B OG  1 
ATOM   989  N  N   . VAL B 1 24  ? -33.605 53.914 19.010  1.00 41.11  ? 2074 VAL B N   1 
ATOM   990  C  CA  . VAL B 1 24  ? -33.143 55.056 18.231  1.00 38.38  ? 2074 VAL B CA  1 
ATOM   991  C  C   . VAL B 1 24  ? -32.725 56.239 19.089  1.00 39.10  ? 2074 VAL B C   1 
ATOM   992  O  O   . VAL B 1 24  ? -33.491 56.727 19.922  1.00 47.28  ? 2074 VAL B O   1 
ATOM   993  C  CB  . VAL B 1 24  ? -34.219 55.509 17.214  1.00 37.36  ? 2074 VAL B CB  1 
ATOM   994  C  CG1 . VAL B 1 24  ? -33.752 56.754 16.473  1.00 27.83  ? 2074 VAL B CG1 1 
ATOM   995  C  CG2 . VAL B 1 24  ? -34.487 54.381 16.220  1.00 26.31  ? 2074 VAL B CG2 1 
ATOM   996  N  N   . LEU B 1 25  ? -31.496 56.697 18.876  1.00 38.09  ? 2075 LEU B N   1 
ATOM   997  C  CA  . LEU B 1 25  ? -30.960 57.828 19.622  1.00 43.18  ? 2075 LEU B CA  1 
ATOM   998  C  C   . LEU B 1 25  ? -30.922 59.097 18.772  1.00 42.27  ? 2075 LEU B C   1 
ATOM   999  O  O   . LEU B 1 25  ? -30.989 59.044 17.544  1.00 45.27  ? 2075 LEU B O   1 
ATOM   1000 C  CB  . LEU B 1 25  ? -29.539 57.511 20.126  1.00 40.86  ? 2075 LEU B CB  1 
ATOM   1001 C  CG  . LEU B 1 25  ? -29.336 56.541 21.297  1.00 43.70  ? 2075 LEU B CG  1 
ATOM   1002 C  CD1 . LEU B 1 25  ? -27.852 56.267 21.460  1.00 27.88  ? 2075 LEU B CD1 1 
ATOM   1003 C  CD2 . LEU B 1 25  ? -29.918 57.118 22.586  1.00 29.19  ? 2075 LEU B CD2 1 
ATOM   1004 N  N   . PRO B 1 26  ? -30.834 60.262 19.428  1.00 41.43  ? 2076 PRO B N   1 
ATOM   1005 C  CA  . PRO B 1 26  ? -30.779 61.527 18.694  1.00 42.46  ? 2076 PRO B CA  1 
ATOM   1006 C  C   . PRO B 1 26  ? -29.520 61.567 17.839  1.00 43.55  ? 2076 PRO B C   1 
ATOM   1007 O  O   . PRO B 1 26  ? -28.574 60.810 18.070  1.00 38.76  ? 2076 PRO B O   1 
ATOM   1008 C  CB  . PRO B 1 26  ? -30.727 62.572 19.808  1.00 45.51  ? 2076 PRO B CB  1 
ATOM   1009 C  CG  . PRO B 1 26  ? -31.474 61.915 20.923  1.00 45.53  ? 2076 PRO B CG  1 
ATOM   1010 C  CD  . PRO B 1 26  ? -30.960 60.502 20.877  1.00 40.97  ? 2076 PRO B CD  1 
ATOM   1011 N  N   . THR B 1 27  ? -29.508 62.446 16.850  1.00 37.66  ? 2077 THR B N   1 
ATOM   1012 C  CA  . THR B 1 27  ? -28.336 62.580 16.010  1.00 37.25  ? 2077 THR B CA  1 
ATOM   1013 C  C   . THR B 1 27  ? -27.563 63.770 16.563  1.00 37.85  ? 2077 THR B C   1 
ATOM   1014 O  O   . THR B 1 27  ? -26.360 63.906 16.344  1.00 40.56  ? 2077 THR B O   1 
ATOM   1015 C  CB  . THR B 1 27  ? -28.721 62.849 14.553  1.00 36.51  ? 2077 THR B CB  1 
ATOM   1016 O  OG1 . THR B 1 27  ? -29.388 64.115 14.464  1.00 43.12  ? 2077 THR B OG1 1 
ATOM   1017 C  CG2 . THR B 1 27  ? -29.640 61.757 14.044  1.00 37.25  ? 2077 THR B CG2 1 
ATOM   1018 N  N   . HIS B 1 28  ? -28.282 64.623 17.289  1.00 41.73  ? 2078 HIS B N   1 
ATOM   1019 C  CA  . HIS B 1 28  ? -27.721 65.818 17.918  1.00 45.68  ? 2078 HIS B CA  1 
ATOM   1020 C  C   . HIS B 1 28  ? -28.515 66.038 19.207  1.00 46.55  ? 2078 HIS B C   1 
ATOM   1021 O  O   . HIS B 1 28  ? -29.749 66.048 19.186  1.00 45.39  ? 2078 HIS B O   1 
ATOM   1022 C  CB  . HIS B 1 28  ? -27.889 67.031 16.996  1.00 50.69  ? 2078 HIS B CB  1 
ATOM   1023 C  CG  . HIS B 1 28  ? -27.038 68.207 17.370  1.00 60.59  ? 2078 HIS B CG  1 
ATOM   1024 N  ND1 . HIS B 1 28  ? -27.056 68.780 18.624  1.00 62.00  ? 2078 HIS B ND1 1 
ATOM   1025 C  CD2 . HIS B 1 28  ? -26.155 68.936 16.642  1.00 67.87  ? 2078 HIS B CD2 1 
ATOM   1026 C  CE1 . HIS B 1 28  ? -26.226 69.808 18.652  1.00 55.83  ? 2078 HIS B CE1 1 
ATOM   1027 N  NE2 . HIS B 1 28  ? -25.667 69.924 17.460  1.00 65.02  ? 2078 HIS B NE2 1 
ATOM   1028 N  N   . TRP B 1 29  ? -27.816 66.205 20.326  1.00 43.72  ? 2079 TRP B N   1 
ATOM   1029 C  CA  . TRP B 1 29  ? -28.494 66.409 21.598  1.00 40.55  ? 2079 TRP B CA  1 
ATOM   1030 C  C   . TRP B 1 29  ? -27.726 67.334 22.543  1.00 42.39  ? 2079 TRP B C   1 
ATOM   1031 O  O   . TRP B 1 29  ? -26.528 67.579 22.356  1.00 36.34  ? 2079 TRP B O   1 
ATOM   1032 C  CB  . TRP B 1 29  ? -28.742 65.054 22.264  1.00 39.87  ? 2079 TRP B CB  1 
ATOM   1033 C  CG  . TRP B 1 29  ? -29.813 65.084 23.315  1.00 50.66  ? 2079 TRP B CG  1 
ATOM   1034 C  CD1 . TRP B 1 29  ? -29.648 64.921 24.662  1.00 48.06  ? 2079 TRP B CD1 1 
ATOM   1035 C  CD2 . TRP B 1 29  ? -31.217 65.284 23.105  1.00 52.21  ? 2079 TRP B CD2 1 
ATOM   1036 N  NE1 . TRP B 1 29  ? -30.858 65.008 25.302  1.00 50.37  ? 2079 TRP B NE1 1 
ATOM   1037 C  CE2 . TRP B 1 29  ? -31.839 65.233 24.374  1.00 52.22  ? 2079 TRP B CE2 1 
ATOM   1038 C  CE3 . TRP B 1 29  ? -32.009 65.510 21.969  1.00 47.55  ? 2079 TRP B CE3 1 
ATOM   1039 C  CZ2 . TRP B 1 29  ? -33.223 65.390 24.537  1.00 49.01  ? 2079 TRP B CZ2 1 
ATOM   1040 C  CZ3 . TRP B 1 29  ? -33.381 65.666 22.135  1.00 35.18  ? 2079 TRP B CZ3 1 
ATOM   1041 C  CH2 . TRP B 1 29  ? -33.971 65.609 23.410  1.00 44.85  ? 2079 TRP B CH2 1 
ATOM   1042 N  N   . ARG B 1 30  ? -28.426 67.862 23.548  1.00 46.01  ? 2080 ARG B N   1 
ATOM   1043 C  CA  . ARG B 1 30  ? -27.810 68.765 24.518  1.00 47.65  ? 2080 ARG B CA  1 
ATOM   1044 C  C   . ARG B 1 30  ? -27.151 67.975 25.641  1.00 47.86  ? 2080 ARG B C   1 
ATOM   1045 O  O   . ARG B 1 30  ? -27.745 67.049 26.195  1.00 42.33  ? 2080 ARG B O   1 
ATOM   1046 C  CB  . ARG B 1 30  ? -28.849 69.724 25.114  1.00 51.27  ? 2080 ARG B CB  1 
ATOM   1047 C  CG  . ARG B 1 30  ? -28.292 70.546 26.280  1.00 64.57  ? 2080 ARG B CG  1 
ATOM   1048 C  CD  . ARG B 1 30  ? -29.269 71.588 26.816  1.00 62.64  ? 2080 ARG B CD  1 
ATOM   1049 N  NE  . ARG B 1 30  ? -29.484 72.670 25.862  1.00 70.32  ? 2080 ARG B NE  1 
ATOM   1050 C  CZ  . ARG B 1 30  ? -30.144 73.793 26.132  1.00 71.14  ? 2080 ARG B CZ  1 
ATOM   1051 N  NH1 . ARG B 1 30  ? -30.659 73.991 27.342  1.00 63.62  ? 2080 ARG B NH1 1 
ATOM   1052 N  NH2 . ARG B 1 30  ? -30.290 74.721 25.187  1.00 65.60  ? 2080 ARG B NH2 1 
ATOM   1053 N  N   . CYS B 1 31  ? -25.926 68.355 25.984  1.00 46.03  ? 2081 CYS B N   1 
ATOM   1054 C  CA  . CYS B 1 31  ? -25.208 67.661 27.035  1.00 45.92  ? 2081 CYS B CA  1 
ATOM   1055 C  C   . CYS B 1 31  ? -25.937 67.742 28.383  1.00 46.59  ? 2081 CYS B C   1 
ATOM   1056 O  O   . CYS B 1 31  ? -26.512 68.776 28.726  1.00 42.93  ? 2081 CYS B O   1 
ATOM   1057 C  CB  . CYS B 1 31  ? -23.756 68.186 27.136  1.00 48.80  ? 2081 CYS B CB  1 
ATOM   1058 S  SG  . CYS B 1 31  ? -23.468 69.899 27.662  1.00 53.86  ? 2081 CYS B SG  1 
ATOM   1059 N  N   . ASN B 1 32  ? -25.932 66.619 29.108  1.00 46.84  ? 2082 ASN B N   1 
ATOM   1060 C  CA  . ASN B 1 32  ? -26.556 66.460 30.430  1.00 39.59  ? 2082 ASN B CA  1 
ATOM   1061 C  C   . ASN B 1 32  ? -28.084 66.430 30.409  1.00 39.75  ? 2082 ASN B C   1 
ATOM   1062 O  O   . ASN B 1 32  ? -28.725 66.307 31.452  1.00 43.65  ? 2082 ASN B O   1 
ATOM   1063 C  CB  . ASN B 1 32  ? -26.088 67.562 31.385  1.00 38.69  ? 2082 ASN B CB  1 
ATOM   1064 C  CG  . ASN B 1 32  ? -26.198 67.159 32.852  1.00 41.21  ? 2082 ASN B CG  1 
ATOM   1065 O  OD1 . ASN B 1 32  ? -26.085 68.000 33.745  1.00 48.55  ? 2082 ASN B OD1 1 
ATOM   1066 N  ND2 . ASN B 1 32  ? -26.401 65.872 33.104  1.00 39.20  ? 2082 ASN B ND2 1 
ATOM   1067 N  N   . LYS B 1 33  ? -28.667 66.527 29.220  1.00 41.92  ? 2083 LYS B N   1 
ATOM   1068 C  CA  . LYS B 1 33  ? -30.117 66.520 29.087  1.00 37.33  ? 2083 LYS B CA  1 
ATOM   1069 C  C   . LYS B 1 33  ? -30.659 65.117 28.848  1.00 38.56  ? 2083 LYS B C   1 
ATOM   1070 O  O   . LYS B 1 33  ? -30.118 64.358 28.043  1.00 39.74  ? 2083 LYS B O   1 
ATOM   1071 C  CB  . LYS B 1 33  ? -30.533 67.432 27.938  1.00 42.26  ? 2083 LYS B CB  1 
ATOM   1072 C  CG  . LYS B 1 33  ? -32.024 67.587 27.793  1.00 45.33  ? 2083 LYS B CG  1 
ATOM   1073 C  CD  . LYS B 1 33  ? -32.360 68.400 26.562  1.00 56.33  ? 2083 LYS B CD  1 
ATOM   1074 C  CE  . LYS B 1 33  ? -33.862 68.600 26.441  1.00 52.00  ? 2083 LYS B CE  1 
ATOM   1075 N  NZ  . LYS B 1 33  ? -34.223 69.282 25.168  1.00 57.07  ? 2083 LYS B NZ  1 
ATOM   1076 N  N   . THR B 1 34  ? -31.736 64.782 29.547  1.00 33.78  ? 2084 THR B N   1 
ATOM   1077 C  CA  . THR B 1 34  ? -32.350 63.472 29.417  1.00 34.62  ? 2084 THR B CA  1 
ATOM   1078 C  C   . THR B 1 34  ? -32.793 63.204 27.986  1.00 36.55  ? 2084 THR B C   1 
ATOM   1079 O  O   . THR B 1 34  ? -33.344 64.079 27.322  1.00 46.37  ? 2084 THR B O   1 
ATOM   1080 C  CB  . THR B 1 34  ? -33.556 63.343 30.357  1.00 34.75  ? 2084 THR B CB  1 
ATOM   1081 O  OG1 . THR B 1 34  ? -33.098 63.352 31.716  1.00 45.56  ? 2084 THR B OG1 1 
ATOM   1082 C  CG2 . THR B 1 34  ? -34.312 62.057 30.088  1.00 35.97  ? 2084 THR B CG2 1 
ATOM   1083 N  N   . LEU B 1 35  ? -32.546 61.986 27.518  1.00 37.13  ? 2085 LEU B N   1 
ATOM   1084 C  CA  . LEU B 1 35  ? -32.904 61.592 26.163  1.00 42.51  ? 2085 LEU B CA  1 
ATOM   1085 C  C   . LEU B 1 35  ? -34.414 61.615 25.951  1.00 47.89  ? 2085 LEU B C   1 
ATOM   1086 O  O   . LEU B 1 35  ? -35.188 61.468 26.900  1.00 52.52  ? 2085 LEU B O   1 
ATOM   1087 C  CB  . LEU B 1 35  ? -32.374 60.181 25.872  1.00 34.17  ? 2085 LEU B CB  1 
ATOM   1088 C  CG  . LEU B 1 35  ? -30.867 59.965 26.032  1.00 31.30  ? 2085 LEU B CG  1 
ATOM   1089 C  CD1 . LEU B 1 35  ? -30.547 58.481 25.966  1.00 32.86  ? 2085 LEU B CD1 1 
ATOM   1090 C  CD2 . LEU B 1 35  ? -30.125 60.731 24.956  1.00 31.46  ? 2085 LEU B CD2 1 
ATOM   1091 N  N   . PRO B 1 36  ? -34.851 61.817 24.697  1.00 50.65  ? 2086 PRO B N   1 
ATOM   1092 C  CA  . PRO B 1 36  ? -36.275 61.850 24.352  1.00 49.79  ? 2086 PRO B CA  1 
ATOM   1093 C  C   . PRO B 1 36  ? -36.860 60.433 24.272  1.00 48.93  ? 2086 PRO B C   1 
ATOM   1094 O  O   . PRO B 1 36  ? -38.075 60.243 24.366  1.00 49.00  ? 2086 PRO B O   1 
ATOM   1095 C  CB  . PRO B 1 36  ? -36.278 62.562 23.002  1.00 46.95  ? 2086 PRO B CB  1 
ATOM   1096 C  CG  . PRO B 1 36  ? -35.001 62.096 22.390  1.00 48.72  ? 2086 PRO B CG  1 
ATOM   1097 C  CD  . PRO B 1 36  ? -34.027 62.218 23.540  1.00 49.73  ? 2086 PRO B CD  1 
ATOM   1098 N  N   . ILE B 1 37  ? -35.975 59.452 24.094  1.00 49.25  ? 2087 ILE B N   1 
ATOM   1099 C  CA  . ILE B 1 37  ? -36.349 58.037 24.004  1.00 46.46  ? 2087 ILE B CA  1 
ATOM   1100 C  C   . ILE B 1 37  ? -35.353 57.195 24.810  1.00 47.35  ? 2087 ILE B C   1 
ATOM   1101 O  O   . ILE B 1 37  ? -34.179 57.101 24.443  1.00 48.51  ? 2087 ILE B O   1 
ATOM   1102 C  CB  . ILE B 1 37  ? -36.324 57.539 22.542  1.00 41.97  ? 2087 ILE B CB  1 
ATOM   1103 C  CG1 . ILE B 1 37  ? -37.234 58.414 21.678  1.00 48.64  ? 2087 ILE B CG1 1 
ATOM   1104 C  CG2 . ILE B 1 37  ? -36.771 56.084 22.477  1.00 36.03  ? 2087 ILE B CG2 1 
ATOM   1105 C  CD1 . ILE B 1 37  ? -37.083 58.169 20.189  1.00 45.75  ? 2087 ILE B CD1 1 
ATOM   1106 N  N   . ALA B 1 38  ? -35.827 56.592 25.903  1.00 45.73  ? 2088 ALA B N   1 
ATOM   1107 C  CA  . ALA B 1 38  ? -34.985 55.766 26.769  1.00 40.09  ? 2088 ALA B CA  1 
ATOM   1108 C  C   . ALA B 1 38  ? -34.191 54.753 25.961  1.00 41.41  ? 2088 ALA B C   1 
ATOM   1109 O  O   . ALA B 1 38  ? -34.748 53.992 25.169  1.00 44.98  ? 2088 ALA B O   1 
ATOM   1110 C  CB  . ALA B 1 38  ? -35.831 55.049 27.810  1.00 34.72  ? 2088 ALA B CB  1 
ATOM   1111 N  N   . PHE B 1 39  ? -32.881 54.746 26.172  1.00 36.16  ? 2089 PHE B N   1 
ATOM   1112 C  CA  . PHE B 1 39  ? -32.019 53.837 25.451  1.00 33.16  ? 2089 PHE B CA  1 
ATOM   1113 C  C   . PHE B 1 39  ? -32.136 52.414 25.972  1.00 35.44  ? 2089 PHE B C   1 
ATOM   1114 O  O   . PHE B 1 39  ? -32.266 52.191 27.175  1.00 39.21  ? 2089 PHE B O   1 
ATOM   1115 C  CB  . PHE B 1 39  ? -30.572 54.297 25.553  1.00 31.31  ? 2089 PHE B CB  1 
ATOM   1116 C  CG  . PHE B 1 39  ? -29.641 53.522 24.674  1.00 32.13  ? 2089 PHE B CG  1 
ATOM   1117 C  CD1 . PHE B 1 39  ? -29.713 53.643 23.285  1.00 26.81  ? 2089 PHE B CD1 1 
ATOM   1118 C  CD2 . PHE B 1 39  ? -28.707 52.656 25.228  1.00 29.48  ? 2089 PHE B CD2 1 
ATOM   1119 C  CE1 . PHE B 1 39  ? -28.866 52.913 22.458  1.00 20.85  ? 2089 PHE B CE1 1 
ATOM   1120 C  CE2 . PHE B 1 39  ? -27.852 51.917 24.413  1.00 31.18  ? 2089 PHE B CE2 1 
ATOM   1121 C  CZ  . PHE B 1 39  ? -27.930 52.046 23.021  1.00 27.71  ? 2089 PHE B CZ  1 
ATOM   1122 N  N   . LYS B 1 40  ? -32.096 51.453 25.058  1.00 31.67  ? 2090 LYS B N   1 
ATOM   1123 C  CA  . LYS B 1 40  ? -32.172 50.057 25.438  1.00 31.98  ? 2090 LYS B CA  1 
ATOM   1124 C  C   . LYS B 1 40  ? -31.477 49.202 24.400  1.00 28.35  ? 2090 LYS B C   1 
ATOM   1125 O  O   . LYS B 1 40  ? -31.441 49.548 23.221  1.00 33.54  ? 2090 LYS B O   1 
ATOM   1126 C  CB  . LYS B 1 40  ? -33.631 49.614 25.605  1.00 40.84  ? 2090 LYS B CB  1 
ATOM   1127 C  CG  . LYS B 1 40  ? -34.481 49.746 24.360  1.00 50.79  ? 2090 LYS B CG  1 
ATOM   1128 C  CD  . LYS B 1 40  ? -35.901 49.234 24.592  1.00 58.83  ? 2090 LYS B CD  1 
ATOM   1129 C  CE  . LYS B 1 40  ? -36.728 49.333 23.309  1.00 71.39  ? 2090 LYS B CE  1 
ATOM   1130 N  NZ  . LYS B 1 40  ? -38.112 48.799 23.454  1.00 74.93  ? 2090 LYS B NZ  1 
ATOM   1131 N  N   . VAL B 1 41  ? -30.901 48.098 24.859  1.00 26.29  ? 2091 VAL B N   1 
ATOM   1132 C  CA  . VAL B 1 41  ? -30.211 47.162 23.988  1.00 27.15  ? 2091 VAL B CA  1 
ATOM   1133 C  C   . VAL B 1 41  ? -30.996 45.857 24.001  1.00 32.45  ? 2091 VAL B C   1 
ATOM   1134 O  O   . VAL B 1 41  ? -31.477 45.429 25.049  1.00 38.21  ? 2091 VAL B O   1 
ATOM   1135 C  CB  . VAL B 1 41  ? -28.776 46.891 24.482  1.00 25.62  ? 2091 VAL B CB  1 
ATOM   1136 C  CG1 . VAL B 1 41  ? -28.110 45.829 23.611  1.00 24.69  ? 2091 VAL B CG1 1 
ATOM   1137 C  CG2 . VAL B 1 41  ? -27.974 48.177 24.456  1.00 13.16  ? 2091 VAL B CG2 1 
ATOM   1138 N  N   . VAL B 1 42  ? -31.127 45.235 22.833  1.00 33.26  ? 2092 VAL B N   1 
ATOM   1139 C  CA  . VAL B 1 42  ? -31.865 43.985 22.701  1.00 29.46  ? 2092 VAL B CA  1 
ATOM   1140 C  C   . VAL B 1 42  ? -30.948 42.870 22.214  1.00 30.24  ? 2092 VAL B C   1 
ATOM   1141 O  O   . VAL B 1 42  ? -30.282 43.011 21.188  1.00 36.88  ? 2092 VAL B O   1 
ATOM   1142 C  CB  . VAL B 1 42  ? -33.025 44.127 21.695  1.00 27.64  ? 2092 VAL B CB  1 
ATOM   1143 C  CG1 . VAL B 1 42  ? -33.918 42.903 21.764  1.00 26.57  ? 2092 VAL B CG1 1 
ATOM   1144 C  CG2 . VAL B 1 42  ? -33.814 45.385 21.983  1.00 22.57  ? 2092 VAL B CG2 1 
ATOM   1145 N  N   . ALA B 1 43  ? -30.922 41.762 22.951  1.00 30.59  ? 2093 ALA B N   1 
ATOM   1146 C  CA  . ALA B 1 43  ? -30.082 40.616 22.600  1.00 31.17  ? 2093 ALA B CA  1 
ATOM   1147 C  C   . ALA B 1 43  ? -30.761 39.710 21.570  1.00 33.34  ? 2093 ALA B C   1 
ATOM   1148 O  O   . ALA B 1 43  ? -31.978 39.562 21.579  1.00 42.08  ? 2093 ALA B O   1 
ATOM   1149 C  CB  . ALA B 1 43  ? -29.754 39.824 23.859  1.00 27.02  ? 2093 ALA B CB  1 
ATOM   1150 N  N   . LEU B 1 44  ? -29.975 39.107 20.685  1.00 33.11  ? 2094 LEU B N   1 
ATOM   1151 C  CA  . LEU B 1 44  ? -30.531 38.218 19.669  1.00 35.04  ? 2094 LEU B CA  1 
ATOM   1152 C  C   . LEU B 1 44  ? -29.974 36.809 19.790  1.00 41.90  ? 2094 LEU B C   1 
ATOM   1153 O  O   . LEU B 1 44  ? -30.462 35.883 19.146  1.00 52.68  ? 2094 LEU B O   1 
ATOM   1154 C  CB  . LEU B 1 44  ? -30.218 38.736 18.268  1.00 28.97  ? 2094 LEU B CB  1 
ATOM   1155 C  CG  . LEU B 1 44  ? -30.678 40.148 17.919  1.00 34.64  ? 2094 LEU B CG  1 
ATOM   1156 C  CD1 . LEU B 1 44  ? -30.198 40.471 16.518  1.00 32.88  ? 2094 LEU B CD1 1 
ATOM   1157 C  CD2 . LEU B 1 44  ? -32.187 40.270 18.016  1.00 32.23  ? 2094 LEU B CD2 1 
ATOM   1158 N  N   . GLY B 1 45  ? -28.942 36.647 20.606  1.00 47.46  ? 2095 GLY B N   1 
ATOM   1159 C  CA  . GLY B 1 45  ? -28.337 35.339 20.763  1.00 46.94  ? 2095 GLY B CA  1 
ATOM   1160 C  C   . GLY B 1 45  ? -28.681 34.642 22.064  1.00 48.58  ? 2095 GLY B C   1 
ATOM   1161 O  O   . GLY B 1 45  ? -27.981 33.707 22.462  1.00 48.87  ? 2095 GLY B O   1 
ATOM   1162 N  N   . ASP B 1 46  ? -29.743 35.090 22.733  1.00 46.82  ? 2096 ASP B N   1 
ATOM   1163 C  CA  . ASP B 1 46  ? -30.167 34.476 23.992  1.00 49.93  ? 2096 ASP B CA  1 
ATOM   1164 C  C   . ASP B 1 46  ? -29.090 34.592 25.076  1.00 47.92  ? 2096 ASP B C   1 
ATOM   1165 O  O   . ASP B 1 46  ? -28.289 33.673 25.289  1.00 54.05  ? 2096 ASP B O   1 
ATOM   1166 C  CB  . ASP B 1 46  ? -30.509 32.998 23.763  1.00 56.60  ? 2096 ASP B CB  1 
ATOM   1167 C  CG  . ASP B 1 46  ? -31.096 32.329 24.994  1.00 66.91  ? 2096 ASP B CG  1 
ATOM   1168 O  OD1 . ASP B 1 46  ? -31.169 31.081 25.005  1.00 70.27  ? 2096 ASP B OD1 1 
ATOM   1169 O  OD2 . ASP B 1 46  ? -31.495 33.038 25.944  1.00 75.50  ? 2096 ASP B OD2 1 
ATOM   1170 N  N   . VAL B 1 47  ? -29.086 35.731 25.760  1.00 39.14  ? 2097 VAL B N   1 
ATOM   1171 C  CA  . VAL B 1 47  ? -28.123 35.996 26.814  1.00 31.23  ? 2097 VAL B CA  1 
ATOM   1172 C  C   . VAL B 1 47  ? -28.765 35.856 28.185  1.00 32.00  ? 2097 VAL B C   1 
ATOM   1173 O  O   . VAL B 1 47  ? -29.930 36.210 28.381  1.00 28.04  ? 2097 VAL B O   1 
ATOM   1174 C  CB  . VAL B 1 47  ? -27.544 37.423 26.698  1.00 34.54  ? 2097 VAL B CB  1 
ATOM   1175 C  CG1 . VAL B 1 47  ? -26.846 37.585 25.360  1.00 33.92  ? 2097 VAL B CG1 1 
ATOM   1176 C  CG2 . VAL B 1 47  ? -28.657 38.460 26.851  1.00 17.96  ? 2097 VAL B CG2 1 
ATOM   1177 N  N   . PRO B 1 48  ? -28.003 35.346 29.159  1.00 26.41  ? 2098 PRO B N   1 
ATOM   1178 C  CA  . PRO B 1 48  ? -28.497 35.159 30.524  1.00 24.82  ? 2098 PRO B CA  1 
ATOM   1179 C  C   . PRO B 1 48  ? -29.007 36.464 31.119  1.00 31.27  ? 2098 PRO B C   1 
ATOM   1180 O  O   . PRO B 1 48  ? -28.497 37.540 30.805  1.00 39.42  ? 2098 PRO B O   1 
ATOM   1181 C  CB  . PRO B 1 48  ? -27.270 34.645 31.271  1.00 19.27  ? 2098 PRO B CB  1 
ATOM   1182 C  CG  . PRO B 1 48  ? -26.489 33.946 30.203  1.00 19.78  ? 2098 PRO B CG  1 
ATOM   1183 C  CD  . PRO B 1 48  ? -26.608 34.899 29.041  1.00 24.76  ? 2098 PRO B CD  1 
ATOM   1184 N  N   . ASP B 1 49  ? -30.032 36.374 31.958  1.00 36.39  ? 2099 ASP B N   1 
ATOM   1185 C  CA  . ASP B 1 49  ? -30.545 37.565 32.610  1.00 32.05  ? 2099 ASP B CA  1 
ATOM   1186 C  C   . ASP B 1 49  ? -29.420 37.990 33.540  1.00 36.19  ? 2099 ASP B C   1 
ATOM   1187 O  O   . ASP B 1 49  ? -28.688 37.143 34.063  1.00 32.72  ? 2099 ASP B O   1 
ATOM   1188 C  CB  . ASP B 1 49  ? -31.810 37.245 33.407  1.00 27.83  ? 2099 ASP B CB  1 
ATOM   1189 C  CG  . ASP B 1 49  ? -33.053 37.210 32.534  1.00 41.85  ? 2099 ASP B CG  1 
ATOM   1190 O  OD1 . ASP B 1 49  ? -34.142 36.894 33.051  1.00 52.47  ? 2099 ASP B OD1 1 
ATOM   1191 O  OD2 . ASP B 1 49  ? -32.944 37.508 31.328  1.00 48.60  ? 2099 ASP B OD2 1 
ATOM   1192 N  N   . GLY B 1 50  ? -29.254 39.296 33.723  1.00 38.12  ? 2100 GLY B N   1 
ATOM   1193 C  CA  . GLY B 1 50  ? -28.195 39.785 34.591  1.00 32.05  ? 2100 GLY B CA  1 
ATOM   1194 C  C   . GLY B 1 50  ? -26.912 40.088 33.836  1.00 30.90  ? 2100 GLY B C   1 
ATOM   1195 O  O   . GLY B 1 50  ? -25.930 40.521 34.435  1.00 30.11  ? 2100 GLY B O   1 
ATOM   1196 N  N   . THR B 1 51  ? -26.920 39.840 32.526  1.00 29.74  ? 2101 THR B N   1 
ATOM   1197 C  CA  . THR B 1 51  ? -25.773 40.117 31.676  1.00 27.97  ? 2101 THR B CA  1 
ATOM   1198 C  C   . THR B 1 51  ? -25.659 41.629 31.587  1.00 31.05  ? 2101 THR B C   1 
ATOM   1199 O  O   . THR B 1 51  ? -26.597 42.305 31.160  1.00 31.89  ? 2101 THR B O   1 
ATOM   1200 C  CB  . THR B 1 51  ? -25.968 39.549 30.253  1.00 29.00  ? 2101 THR B CB  1 
ATOM   1201 O  OG1 . THR B 1 51  ? -25.970 38.118 30.307  1.00 34.70  ? 2101 THR B OG1 1 
ATOM   1202 C  CG2 . THR B 1 51  ? -24.844 40.016 29.317  1.00 24.92  ? 2101 THR B CG2 1 
ATOM   1203 N  N   . LEU B 1 52  ? -24.515 42.157 32.007  1.00 34.12  ? 2102 LEU B N   1 
ATOM   1204 C  CA  . LEU B 1 52  ? -24.296 43.596 31.998  1.00 28.84  ? 2102 LEU B CA  1 
ATOM   1205 C  C   . LEU B 1 52  ? -23.951 44.149 30.628  1.00 27.65  ? 2102 LEU B C   1 
ATOM   1206 O  O   . LEU B 1 52  ? -23.310 43.489 29.807  1.00 27.23  ? 2102 LEU B O   1 
ATOM   1207 C  CB  . LEU B 1 52  ? -23.187 43.968 32.980  1.00 26.76  ? 2102 LEU B CB  1 
ATOM   1208 C  CG  . LEU B 1 52  ? -23.464 43.682 34.448  1.00 24.75  ? 2102 LEU B CG  1 
ATOM   1209 C  CD1 . LEU B 1 52  ? -22.252 44.087 35.268  1.00 23.98  ? 2102 LEU B CD1 1 
ATOM   1210 C  CD2 . LEU B 1 52  ? -24.703 44.447 34.906  1.00 19.25  ? 2102 LEU B CD2 1 
ATOM   1211 N  N   . VAL B 1 53  ? -24.375 45.387 30.412  1.00 24.30  ? 2103 VAL B N   1 
ATOM   1212 C  CA  . VAL B 1 53  ? -24.134 46.099 29.174  1.00 23.85  ? 2103 VAL B CA  1 
ATOM   1213 C  C   . VAL B 1 53  ? -23.755 47.532 29.519  1.00 27.70  ? 2103 VAL B C   1 
ATOM   1214 O  O   . VAL B 1 53  ? -24.526 48.224 30.182  1.00 33.51  ? 2103 VAL B O   1 
ATOM   1215 C  CB  . VAL B 1 53  ? -25.405 46.144 28.306  1.00 23.19  ? 2103 VAL B CB  1 
ATOM   1216 C  CG1 . VAL B 1 53  ? -25.143 46.961 27.051  1.00 20.05  ? 2103 VAL B CG1 1 
ATOM   1217 C  CG2 . VAL B 1 53  ? -25.849 44.734 27.950  1.00 18.90  ? 2103 VAL B CG2 1 
ATOM   1218 N  N   . THR B 1 54  ? -22.571 47.978 29.105  1.00 22.79  ? 2104 THR B N   1 
ATOM   1219 C  CA  . THR B 1 54  ? -22.186 49.364 29.376  1.00 26.53  ? 2104 THR B CA  1 
ATOM   1220 C  C   . THR B 1 54  ? -21.870 50.075 28.068  1.00 23.61  ? 2104 THR B C   1 
ATOM   1221 O  O   . THR B 1 54  ? -21.235 49.504 27.179  1.00 20.41  ? 2104 THR B O   1 
ATOM   1222 C  CB  . THR B 1 54  ? -20.936 49.496 30.283  1.00 25.65  ? 2104 THR B CB  1 
ATOM   1223 O  OG1 . THR B 1 54  ? -19.783 49.103 29.542  1.00 51.31  ? 2104 THR B OG1 1 
ATOM   1224 C  CG2 . THR B 1 54  ? -21.062 48.638 31.523  1.00 19.99  ? 2104 THR B CG2 1 
ATOM   1225 N  N   . VAL B 1 55  ? -22.314 51.325 27.963  1.00 26.79  ? 2105 VAL B N   1 
ATOM   1226 C  CA  . VAL B 1 55  ? -22.078 52.134 26.770  1.00 31.54  ? 2105 VAL B CA  1 
ATOM   1227 C  C   . VAL B 1 55  ? -20.872 53.075 26.959  1.00 31.98  ? 2105 VAL B C   1 
ATOM   1228 O  O   . VAL B 1 55  ? -20.522 53.449 28.083  1.00 22.88  ? 2105 VAL B O   1 
ATOM   1229 C  CB  . VAL B 1 55  ? -23.327 53.005 26.411  1.00 29.79  ? 2105 VAL B CB  1 
ATOM   1230 C  CG1 . VAL B 1 55  ? -24.591 52.175 26.484  1.00 21.85  ? 2105 VAL B CG1 1 
ATOM   1231 C  CG2 . VAL B 1 55  ? -23.422 54.199 27.347  1.00 46.55  ? 2105 VAL B CG2 1 
ATOM   1232 N  N   . MET B 1 56  ? -20.242 53.441 25.849  1.00 29.85  ? 2106 MET B N   1 
ATOM   1233 C  CA  . MET B 1 56  ? -19.109 54.351 25.860  1.00 28.11  ? 2106 MET B CA  1 
ATOM   1234 C  C   . MET B 1 56  ? -19.238 55.262 24.652  1.00 32.19  ? 2106 MET B C   1 
ATOM   1235 O  O   . MET B 1 56  ? -19.666 54.828 23.585  1.00 37.95  ? 2106 MET B O   1 
ATOM   1236 C  CB  . MET B 1 56  ? -17.785 53.587 25.783  1.00 25.84  ? 2106 MET B CB  1 
ATOM   1237 C  CG  . MET B 1 56  ? -17.281 53.060 27.120  1.00 32.42  ? 2106 MET B CG  1 
ATOM   1238 S  SD  . MET B 1 56  ? -15.615 52.311 27.026  1.00 32.17  ? 2106 MET B SD  1 
ATOM   1239 C  CE  . MET B 1 56  ? -15.791 50.876 28.171  1.00 49.85  ? 2106 MET B CE  1 
ATOM   1240 N  N   . ALA B 1 57  ? -18.889 56.530 24.826  1.00 27.60  ? 2107 ALA B N   1 
ATOM   1241 C  CA  . ALA B 1 57  ? -18.948 57.493 23.739  1.00 27.00  ? 2107 ALA B CA  1 
ATOM   1242 C  C   . ALA B 1 57  ? -17.559 58.101 23.586  1.00 30.77  ? 2107 ALA B C   1 
ATOM   1243 O  O   . ALA B 1 57  ? -16.897 58.397 24.580  1.00 32.52  ? 2107 ALA B O   1 
ATOM   1244 C  CB  . ALA B 1 57  ? -19.971 58.581 24.059  1.00 26.68  ? 2107 ALA B CB  1 
ATOM   1245 N  N   . GLY B 1 58  ? -17.111 58.276 22.348  1.00 31.26  ? 2108 GLY B N   1 
ATOM   1246 C  CA  . GLY B 1 58  ? -15.801 58.861 22.122  1.00 26.42  ? 2108 GLY B CA  1 
ATOM   1247 C  C   . GLY B 1 58  ? -15.497 59.119 20.658  1.00 28.71  ? 2108 GLY B C   1 
ATOM   1248 O  O   . GLY B 1 58  ? -16.209 58.644 19.778  1.00 31.36  ? 2108 GLY B O   1 
ATOM   1249 N  N   . ASN B 1 59  ? -14.461 59.908 20.397  1.00 32.97  ? 2109 ASN B N   1 
ATOM   1250 C  CA  . ASN B 1 59  ? -14.029 60.195 19.032  1.00 34.36  ? 2109 ASN B CA  1 
ATOM   1251 C  C   . ASN B 1 59  ? -12.512 60.218 19.038  1.00 26.51  ? 2109 ASN B C   1 
ATOM   1252 O  O   . ASN B 1 59  ? -11.904 59.763 20.000  1.00 29.96  ? 2109 ASN B O   1 
ATOM   1253 C  CB  . ASN B 1 59  ? -14.611 61.518 18.489  1.00 28.84  ? 2109 ASN B CB  1 
ATOM   1254 C  CG  . ASN B 1 59  ? -14.473 62.673 19.452  1.00 25.76  ? 2109 ASN B CG  1 
ATOM   1255 O  OD1 . ASN B 1 59  ? -13.403 62.910 20.012  1.00 29.32  ? 2109 ASN B OD1 1 
ATOM   1256 N  ND2 . ASN B 1 59  ? -15.561 63.414 19.636  1.00 28.55  ? 2109 ASN B ND2 1 
ATOM   1257 N  N   . ASP B 1 60  ? -11.893 60.727 17.979  1.00 33.49  ? 2110 ASP B N   1 
ATOM   1258 C  CA  . ASP B 1 60  ? -10.433 60.747 17.918  1.00 37.25  ? 2110 ASP B CA  1 
ATOM   1259 C  C   . ASP B 1 60  ? -9.751  61.703 18.900  1.00 38.28  ? 2110 ASP B C   1 
ATOM   1260 O  O   . ASP B 1 60  ? -8.527  61.676 19.049  1.00 34.21  ? 2110 ASP B O   1 
ATOM   1261 C  CB  . ASP B 1 60  ? -9.963  61.023 16.481  1.00 44.44  ? 2110 ASP B CB  1 
ATOM   1262 C  CG  . ASP B 1 60  ? -10.832 62.032 15.760  1.00 51.60  ? 2110 ASP B CG  1 
ATOM   1263 O  OD1 . ASP B 1 60  ? -11.047 63.134 16.306  1.00 59.51  ? 2110 ASP B OD1 1 
ATOM   1264 O  OD2 . ASP B 1 60  ? -11.296 61.721 14.641  1.00 65.70  ? 2110 ASP B OD2 1 
ATOM   1265 N  N   . GLU B 1 61  ? -10.549 62.527 19.578  1.00 42.15  ? 2111 GLU B N   1 
ATOM   1266 C  CA  . GLU B 1 61  ? -10.045 63.484 20.563  1.00 43.74  ? 2111 GLU B CA  1 
ATOM   1267 C  C   . GLU B 1 61  ? -10.363 63.032 21.990  1.00 47.06  ? 2111 GLU B C   1 
ATOM   1268 O  O   . GLU B 1 61  ? -9.581  63.270 22.914  1.00 48.91  ? 2111 GLU B O   1 
ATOM   1269 C  CB  . GLU B 1 61  ? -10.666 64.855 20.323  1.00 45.60  ? 2111 GLU B CB  1 
ATOM   1270 C  CG  . GLU B 1 61  ? -10.171 65.540 19.074  1.00 63.67  ? 2111 GLU B CG  1 
ATOM   1271 C  CD  . GLU B 1 61  ? -11.048 66.708 18.675  1.00 77.19  ? 2111 GLU B CD  1 
ATOM   1272 O  OE1 . GLU B 1 61  ? -11.296 67.587 19.531  1.00 75.63  ? 2111 GLU B OE1 1 
ATOM   1273 O  OE2 . GLU B 1 61  ? -11.490 66.743 17.501  1.00 84.97  ? 2111 GLU B OE2 1 
ATOM   1274 N  N   . ASN B 1 62  ? -11.513 62.383 22.165  1.00 45.98  ? 2112 ASN B N   1 
ATOM   1275 C  CA  . ASN B 1 62  ? -11.942 61.895 23.480  1.00 41.96  ? 2112 ASN B CA  1 
ATOM   1276 C  C   . ASN B 1 62  ? -12.150 60.373 23.454  1.00 36.91  ? 2112 ASN B C   1 
ATOM   1277 O  O   . ASN B 1 62  ? -13.074 59.884 22.807  1.00 41.47  ? 2112 ASN B O   1 
ATOM   1278 C  CB  . ASN B 1 62  ? -13.252 62.571 23.890  1.00 43.59  ? 2112 ASN B CB  1 
ATOM   1279 C  CG  . ASN B 1 62  ? -13.547 62.413 25.366  1.00 47.68  ? 2112 ASN B CG  1 
ATOM   1280 O  OD1 . ASN B 1 62  ? -13.205 61.395 25.978  1.00 56.21  ? 2112 ASN B OD1 1 
ATOM   1281 N  ND2 . ASN B 1 62  ? -14.196 63.411 25.945  1.00 49.97  ? 2112 ASN B ND2 1 
ATOM   1282 N  N   . TYR B 1 63  ? -11.314 59.630 24.173  1.00 28.73  ? 2113 TYR B N   1 
ATOM   1283 C  CA  . TYR B 1 63  ? -11.420 58.176 24.179  1.00 30.99  ? 2113 TYR B CA  1 
ATOM   1284 C  C   . TYR B 1 63  ? -12.643 57.649 24.938  1.00 31.22  ? 2113 TYR B C   1 
ATOM   1285 O  O   . TYR B 1 63  ? -13.092 56.530 24.693  1.00 35.46  ? 2113 TYR B O   1 
ATOM   1286 C  CB  . TYR B 1 63  ? -10.124 57.552 24.726  1.00 32.73  ? 2113 TYR B CB  1 
ATOM   1287 C  CG  . TYR B 1 63  ? -10.102 57.297 26.217  1.00 37.36  ? 2113 TYR B CG  1 
ATOM   1288 C  CD1 . TYR B 1 63  ? -10.271 56.008 26.726  1.00 45.54  ? 2113 TYR B CD1 1 
ATOM   1289 C  CD2 . TYR B 1 63  ? -9.951  58.343 27.119  1.00 44.04  ? 2113 TYR B CD2 1 
ATOM   1290 C  CE1 . TYR B 1 63  ? -10.296 55.771 28.097  1.00 43.10  ? 2113 TYR B CE1 1 
ATOM   1291 C  CE2 . TYR B 1 63  ? -9.978  58.117 28.491  1.00 47.60  ? 2113 TYR B CE2 1 
ATOM   1292 C  CZ  . TYR B 1 63  ? -10.153 56.832 28.974  1.00 47.73  ? 2113 TYR B CZ  1 
ATOM   1293 O  OH  . TYR B 1 63  ? -10.221 56.619 30.333  1.00 55.23  ? 2113 TYR B OH  1 
ATOM   1294 N  N   . SER B 1 64  ? -13.183 58.452 25.852  1.00 31.93  ? 2114 SER B N   1 
ATOM   1295 C  CA  . SER B 1 64  ? -14.366 58.062 26.618  1.00 28.47  ? 2114 SER B CA  1 
ATOM   1296 C  C   . SER B 1 64  ? -15.002 59.272 27.302  1.00 33.72  ? 2114 SER B C   1 
ATOM   1297 O  O   . SER B 1 64  ? -14.569 59.706 28.369  1.00 33.74  ? 2114 SER B O   1 
ATOM   1298 C  CB  . SER B 1 64  ? -14.012 57.001 27.663  1.00 30.39  ? 2114 SER B CB  1 
ATOM   1299 O  OG  . SER B 1 64  ? -15.190 56.461 28.254  1.00 33.84  ? 2114 SER B OG  1 
ATOM   1300 N  N   . ALA B 1 65  ? -16.039 59.803 26.663  1.00 34.97  ? 2115 ALA B N   1 
ATOM   1301 C  CA  . ALA B 1 65  ? -16.766 60.960 27.155  1.00 25.95  ? 2115 ALA B CA  1 
ATOM   1302 C  C   . ALA B 1 65  ? -17.555 60.620 28.401  1.00 27.88  ? 2115 ALA B C   1 
ATOM   1303 O  O   . ALA B 1 65  ? -18.089 59.515 28.528  1.00 35.42  ? 2115 ALA B O   1 
ATOM   1304 C  CB  . ALA B 1 65  ? -17.712 61.467 26.073  1.00 28.89  ? 2115 ALA B CB  1 
ATOM   1305 N  N   . GLU B 1 66  ? -17.646 61.588 29.307  1.00 28.37  ? 2116 GLU B N   1 
ATOM   1306 C  CA  . GLU B 1 66  ? -18.376 61.406 30.550  1.00 25.59  ? 2116 GLU B CA  1 
ATOM   1307 C  C   . GLU B 1 66  ? -19.853 61.134 30.272  1.00 27.37  ? 2116 GLU B C   1 
ATOM   1308 O  O   . GLU B 1 66  ? -20.472 61.790 29.432  1.00 25.80  ? 2116 GLU B O   1 
ATOM   1309 C  CB  . GLU B 1 66  ? -18.248 62.650 31.427  1.00 20.90  ? 2116 GLU B CB  1 
ATOM   1310 C  CG  . GLU B 1 66  ? -18.659 62.400 32.862  1.00 30.97  ? 2116 GLU B CG  1 
ATOM   1311 C  CD  . GLU B 1 66  ? -18.727 63.659 33.695  1.00 35.53  ? 2116 GLU B CD  1 
ATOM   1312 O  OE1 . GLU B 1 66  ? -18.106 64.676 33.304  1.00 34.49  ? 2116 GLU B OE1 1 
ATOM   1313 O  OE2 . GLU B 1 66  ? -19.393 63.622 34.756  1.00 32.83  ? 2116 GLU B OE2 1 
ATOM   1314 N  N   . LEU B 1 67  ? -20.405 60.160 30.991  1.00 31.36  ? 2117 LEU B N   1 
ATOM   1315 C  CA  . LEU B 1 67  ? -21.804 59.769 30.846  1.00 28.17  ? 2117 LEU B CA  1 
ATOM   1316 C  C   . LEU B 1 67  ? -22.414 59.522 32.222  1.00 26.81  ? 2117 LEU B C   1 
ATOM   1317 O  O   . LEU B 1 67  ? -21.722 59.552 33.241  1.00 29.24  ? 2117 LEU B O   1 
ATOM   1318 C  CB  . LEU B 1 67  ? -21.908 58.479 30.028  1.00 21.90  ? 2117 LEU B CB  1 
ATOM   1319 C  CG  . LEU B 1 67  ? -21.269 58.418 28.638  1.00 27.82  ? 2117 LEU B CG  1 
ATOM   1320 C  CD1 . LEU B 1 67  ? -21.334 56.991 28.098  1.00 20.12  ? 2117 LEU B CD1 1 
ATOM   1321 C  CD2 . LEU B 1 67  ? -21.989 59.380 27.706  1.00 24.33  ? 2117 LEU B CD2 1 
ATOM   1322 N  N   . ARG B 1 68  ? -23.717 59.273 32.238  1.00 27.51  ? 2118 ARG B N   1 
ATOM   1323 C  CA  . ARG B 1 68  ? -24.429 58.985 33.470  1.00 28.07  ? 2118 ARG B CA  1 
ATOM   1324 C  C   . ARG B 1 68  ? -25.364 57.814 33.220  1.00 34.99  ? 2118 ARG B C   1 
ATOM   1325 O  O   . ARG B 1 68  ? -26.097 57.804 32.227  1.00 32.50  ? 2118 ARG B O   1 
ATOM   1326 C  CB  . ARG B 1 68  ? -25.233 60.199 33.929  1.00 30.96  ? 2118 ARG B CB  1 
ATOM   1327 C  CG  . ARG B 1 68  ? -24.467 61.154 34.831  1.00 32.76  ? 2118 ARG B CG  1 
ATOM   1328 C  CD  . ARG B 1 68  ? -24.069 60.487 36.139  1.00 31.49  ? 2118 ARG B CD  1 
ATOM   1329 N  NE  . ARG B 1 68  ? -23.406 61.420 37.055  1.00 41.50  ? 2118 ARG B NE  1 
ATOM   1330 C  CZ  . ARG B 1 68  ? -22.179 61.903 36.883  1.00 44.26  ? 2118 ARG B CZ  1 
ATOM   1331 N  NH1 . ARG B 1 68  ? -21.456 61.539 35.824  1.00 31.84  ? 2118 ARG B NH1 1 
ATOM   1332 N  NH2 . ARG B 1 68  ? -21.685 62.767 37.763  1.00 44.05  ? 2118 ARG B NH2 1 
ATOM   1333 N  N   . ASN B 1 69  ? -25.318 56.827 34.114  1.00 33.14  ? 2119 ASN B N   1 
ATOM   1334 C  CA  . ASN B 1 69  ? -26.162 55.646 34.004  1.00 31.95  ? 2119 ASN B CA  1 
ATOM   1335 C  C   . ASN B 1 69  ? -25.904 54.908 32.691  1.00 26.67  ? 2119 ASN B C   1 
ATOM   1336 O  O   . ASN B 1 69  ? -26.836 54.572 31.956  1.00 29.90  ? 2119 ASN B O   1 
ATOM   1337 C  CB  . ASN B 1 69  ? -27.632 56.064 34.098  1.00 35.74  ? 2119 ASN B CB  1 
ATOM   1338 C  CG  . ASN B 1 69  ? -27.912 56.920 35.315  1.00 36.43  ? 2119 ASN B CG  1 
ATOM   1339 O  OD1 . ASN B 1 69  ? -27.659 56.509 36.450  1.00 49.64  ? 2119 ASN B OD1 1 
ATOM   1340 N  ND2 . ASN B 1 69  ? -28.430 58.118 35.087  1.00 30.32  ? 2119 ASN B ND2 1 
ATOM   1341 N  N   . ALA B 1 70  ? -24.631 54.643 32.417  1.00 24.02  ? 2120 ALA B N   1 
ATOM   1342 C  CA  . ALA B 1 70  ? -24.222 53.973 31.188  1.00 28.02  ? 2120 ALA B CA  1 
ATOM   1343 C  C   . ALA B 1 70  ? -24.248 52.448 31.247  1.00 30.70  ? 2120 ALA B C   1 
ATOM   1344 O  O   . ALA B 1 70  ? -23.864 51.779 30.287  1.00 36.38  ? 2120 ALA B O   1 
ATOM   1345 C  CB  . ALA B 1 70  ? -22.823 54.437 30.793  1.00 22.64  ? 2120 ALA B CB  1 
ATOM   1346 N  N   . THR B 1 71  ? -24.701 51.894 32.361  1.00 32.55  ? 2121 THR B N   1 
ATOM   1347 C  CA  . THR B 1 71  ? -24.739 50.447 32.506  1.00 31.65  ? 2121 THR B CA  1 
ATOM   1348 C  C   . THR B 1 71  ? -26.124 49.929 32.872  1.00 36.19  ? 2121 THR B C   1 
ATOM   1349 O  O   . THR B 1 71  ? -26.821 50.515 33.706  1.00 33.03  ? 2121 THR B O   1 
ATOM   1350 C  CB  . THR B 1 71  ? -23.720 49.994 33.567  1.00 30.11  ? 2121 THR B CB  1 
ATOM   1351 O  OG1 . THR B 1 71  ? -22.409 50.398 33.156  1.00 34.34  ? 2121 THR B OG1 1 
ATOM   1352 C  CG2 . THR B 1 71  ? -23.752 48.487 33.746  1.00 20.70  ? 2121 THR B CG2 1 
ATOM   1353 N  N   . ALA B 1 72  ? -26.519 48.834 32.228  1.00 34.35  ? 2122 ALA B N   1 
ATOM   1354 C  CA  . ALA B 1 72  ? -27.813 48.207 32.478  1.00 35.32  ? 2122 ALA B CA  1 
ATOM   1355 C  C   . ALA B 1 72  ? -27.662 46.694 32.422  1.00 38.05  ? 2122 ALA B C   1 
ATOM   1356 O  O   . ALA B 1 72  ? -26.785 46.168 31.731  1.00 33.54  ? 2122 ALA B O   1 
ATOM   1357 C  CB  . ALA B 1 72  ? -28.833 48.668 31.452  1.00 27.87  ? 2122 ALA B CB  1 
ATOM   1358 N  N   . ALA B 1 73  ? -28.524 45.999 33.155  1.00 36.42  ? 2123 ALA B N   1 
ATOM   1359 C  CA  . ALA B 1 73  ? -28.488 44.546 33.204  1.00 33.45  ? 2123 ALA B CA  1 
ATOM   1360 C  C   . ALA B 1 73  ? -29.570 43.930 32.315  1.00 34.38  ? 2123 ALA B C   1 
ATOM   1361 O  O   . ALA B 1 73  ? -30.720 44.370 32.331  1.00 32.78  ? 2123 ALA B O   1 
ATOM   1362 C  CB  . ALA B 1 73  ? -28.662 44.083 34.634  1.00 26.82  ? 2123 ALA B CB  1 
ATOM   1363 N  N   . MET B 1 74  ? -29.193 42.920 31.535  1.00 29.29  ? 2124 MET B N   1 
ATOM   1364 C  CA  . MET B 1 74  ? -30.129 42.239 30.645  1.00 32.82  ? 2124 MET B CA  1 
ATOM   1365 C  C   . MET B 1 74  ? -31.273 41.570 31.398  1.00 36.86  ? 2124 MET B C   1 
ATOM   1366 O  O   . MET B 1 74  ? -31.054 40.810 32.345  1.00 37.15  ? 2124 MET B O   1 
ATOM   1367 C  CB  . MET B 1 74  ? -29.407 41.174 29.821  1.00 25.35  ? 2124 MET B CB  1 
ATOM   1368 C  CG  . MET B 1 74  ? -28.783 41.671 28.537  1.00 38.49  ? 2124 MET B CG  1 
ATOM   1369 S  SD  . MET B 1 74  ? -30.017 42.092 27.310  1.00 38.83  ? 2124 MET B SD  1 
ATOM   1370 C  CE  . MET B 1 74  ? -29.125 43.225 26.258  1.00 27.34  ? 2124 MET B CE  1 
ATOM   1371 N  N   . LYS B 1 75  ? -32.497 41.855 30.967  1.00 40.29  ? 2125 LYS B N   1 
ATOM   1372 C  CA  . LYS B 1 75  ? -33.688 41.266 31.573  1.00 43.46  ? 2125 LYS B CA  1 
ATOM   1373 C  C   . LYS B 1 75  ? -34.575 40.774 30.441  1.00 42.12  ? 2125 LYS B C   1 
ATOM   1374 O  O   . LYS B 1 75  ? -35.203 41.573 29.742  1.00 42.60  ? 2125 LYS B O   1 
ATOM   1375 C  CB  . LYS B 1 75  ? -34.446 42.303 32.402  1.00 47.94  ? 2125 LYS B CB  1 
ATOM   1376 C  CG  . LYS B 1 75  ? -35.690 41.753 33.085  1.00 57.29  ? 2125 LYS B CG  1 
ATOM   1377 C  CD  . LYS B 1 75  ? -35.322 40.741 34.159  1.00 66.77  ? 2125 LYS B CD  1 
ATOM   1378 C  CE  . LYS B 1 75  ? -36.554 40.193 34.861  1.00 66.51  ? 2125 LYS B CE  1 
ATOM   1379 N  NZ  . LYS B 1 75  ? -37.376 39.363 33.938  1.00 74.36  ? 2125 LYS B NZ  1 
ATOM   1380 N  N   . ASN B 1 76  ? -34.618 39.458 30.262  1.00 40.53  ? 2126 ASN B N   1 
ATOM   1381 C  CA  . ASN B 1 76  ? -35.418 38.858 29.199  1.00 46.08  ? 2126 ASN B CA  1 
ATOM   1382 C  C   . ASN B 1 76  ? -34.954 39.385 27.843  1.00 46.21  ? 2126 ASN B C   1 
ATOM   1383 O  O   . ASN B 1 76  ? -35.759 39.859 27.036  1.00 43.31  ? 2126 ASN B O   1 
ATOM   1384 C  CB  . ASN B 1 76  ? -36.909 39.167 29.404  1.00 49.00  ? 2126 ASN B CB  1 
ATOM   1385 C  CG  . ASN B 1 76  ? -37.520 38.384 30.561  1.00 56.46  ? 2126 ASN B CG  1 
ATOM   1386 O  OD1 . ASN B 1 76  ? -38.502 38.819 31.167  1.00 55.39  ? 2126 ASN B OD1 1 
ATOM   1387 N  ND2 . ASN B 1 76  ? -36.950 37.215 30.862  1.00 54.79  ? 2126 ASN B ND2 1 
ATOM   1388 N  N   . GLN B 1 77  ? -33.642 39.315 27.620  1.00 40.55  ? 2127 GLN B N   1 
ATOM   1389 C  CA  . GLN B 1 77  ? -33.024 39.751 26.370  1.00 38.86  ? 2127 GLN B CA  1 
ATOM   1390 C  C   . GLN B 1 77  ? -33.096 41.251 26.108  1.00 33.68  ? 2127 GLN B C   1 
ATOM   1391 O  O   . GLN B 1 77  ? -32.873 41.697 24.984  1.00 36.71  ? 2127 GLN B O   1 
ATOM   1392 C  CB  . GLN B 1 77  ? -33.659 39.009 25.189  1.00 42.43  ? 2127 GLN B CB  1 
ATOM   1393 C  CG  . GLN B 1 77  ? -33.702 37.508 25.354  1.00 29.52  ? 2127 GLN B CG  1 
ATOM   1394 C  CD  . GLN B 1 77  ? -32.327 36.907 25.522  1.00 43.94  ? 2127 GLN B CD  1 
ATOM   1395 O  OE1 . GLN B 1 77  ? -31.454 37.065 24.661  1.00 51.39  ? 2127 GLN B OE1 1 
ATOM   1396 N  NE2 . GLN B 1 77  ? -32.124 36.202 26.631  1.00 41.08  ? 2127 GLN B NE2 1 
ATOM   1397 N  N   . VAL B 1 78  ? -33.412 42.034 27.131  1.00 30.67  ? 2128 VAL B N   1 
ATOM   1398 C  CA  . VAL B 1 78  ? -33.490 43.479 26.950  1.00 31.32  ? 2128 VAL B CA  1 
ATOM   1399 C  C   . VAL B 1 78  ? -32.832 44.224 28.104  1.00 34.59  ? 2128 VAL B C   1 
ATOM   1400 O  O   . VAL B 1 78  ? -33.143 43.983 29.270  1.00 34.29  ? 2128 VAL B O   1 
ATOM   1401 C  CB  . VAL B 1 78  ? -34.951 43.971 26.840  1.00 26.36  ? 2128 VAL B CB  1 
ATOM   1402 C  CG1 . VAL B 1 78  ? -34.970 45.446 26.495  1.00 12.76  ? 2128 VAL B CG1 1 
ATOM   1403 C  CG2 . VAL B 1 78  ? -35.701 43.167 25.784  1.00 29.82  ? 2128 VAL B CG2 1 
ATOM   1404 N  N   . ALA B 1 79  ? -31.915 45.127 27.768  1.00 33.23  ? 2129 ALA B N   1 
ATOM   1405 C  CA  . ALA B 1 79  ? -31.230 45.933 28.770  1.00 32.50  ? 2129 ALA B CA  1 
ATOM   1406 C  C   . ALA B 1 79  ? -31.763 47.355 28.647  1.00 34.42  ? 2129 ALA B C   1 
ATOM   1407 O  O   . ALA B 1 79  ? -31.515 48.036 27.650  1.00 34.08  ? 2129 ALA B O   1 
ATOM   1408 C  CB  . ALA B 1 79  ? -29.724 45.901 28.543  1.00 26.57  ? 2129 ALA B CB  1 
ATOM   1409 N  N   . ARG B 1 80  ? -32.508 47.792 29.661  1.00 35.00  ? 2130 ARG B N   1 
ATOM   1410 C  CA  . ARG B 1 80  ? -33.090 49.129 29.665  1.00 37.86  ? 2130 ARG B CA  1 
ATOM   1411 C  C   . ARG B 1 80  ? -32.264 50.085 30.513  1.00 36.24  ? 2130 ARG B C   1 
ATOM   1412 O  O   . ARG B 1 80  ? -32.089 49.873 31.707  1.00 40.19  ? 2130 ARG B O   1 
ATOM   1413 C  CB  . ARG B 1 80  ? -34.529 49.072 30.184  1.00 39.29  ? 2130 ARG B CB  1 
ATOM   1414 C  CG  . ARG B 1 80  ? -35.438 48.207 29.315  1.00 51.33  ? 2130 ARG B CG  1 
ATOM   1415 C  CD  . ARG B 1 80  ? -36.914 48.384 29.639  1.00 51.63  ? 2130 ARG B CD  1 
ATOM   1416 N  NE  . ARG B 1 80  ? -37.760 47.946 28.530  1.00 52.19  ? 2130 ARG B NE  1 
ATOM   1417 C  CZ  . ARG B 1 80  ? -37.992 46.677 28.211  1.00 58.68  ? 2130 ARG B CZ  1 
ATOM   1418 N  NH1 . ARG B 1 80  ? -37.448 45.697 28.920  1.00 59.64  ? 2130 ARG B NH1 1 
ATOM   1419 N  NH2 . ARG B 1 80  ? -38.759 46.387 27.167  1.00 68.80  ? 2130 ARG B NH2 1 
ATOM   1420 N  N   . PHE B 1 81  ? -31.752 51.137 29.889  1.00 34.84  ? 2131 PHE B N   1 
ATOM   1421 C  CA  . PHE B 1 81  ? -30.946 52.094 30.616  1.00 35.41  ? 2131 PHE B CA  1 
ATOM   1422 C  C   . PHE B 1 81  ? -31.788 53.148 31.295  1.00 36.23  ? 2131 PHE B C   1 
ATOM   1423 O  O   . PHE B 1 81  ? -32.635 53.785 30.674  1.00 36.62  ? 2131 PHE B O   1 
ATOM   1424 C  CB  . PHE B 1 81  ? -29.922 52.746 29.695  1.00 24.88  ? 2131 PHE B CB  1 
ATOM   1425 C  CG  . PHE B 1 81  ? -28.880 51.793 29.198  1.00 26.52  ? 2131 PHE B CG  1 
ATOM   1426 C  CD1 . PHE B 1 81  ? -29.188 50.862 28.208  1.00 24.35  ? 2131 PHE B CD1 1 
ATOM   1427 C  CD2 . PHE B 1 81  ? -27.597 51.804 29.736  1.00 23.04  ? 2131 PHE B CD2 1 
ATOM   1428 C  CE1 . PHE B 1 81  ? -28.232 49.956 27.759  1.00 27.08  ? 2131 PHE B CE1 1 
ATOM   1429 C  CE2 . PHE B 1 81  ? -26.629 50.901 29.297  1.00 26.94  ? 2131 PHE B CE2 1 
ATOM   1430 C  CZ  . PHE B 1 81  ? -26.946 49.974 28.305  1.00 26.99  ? 2131 PHE B CZ  1 
ATOM   1431 N  N   . ASN B 1 82  ? -31.545 53.318 32.588  1.00 39.05  ? 2132 ASN B N   1 
ATOM   1432 C  CA  . ASN B 1 82  ? -32.281 54.283 33.374  1.00 44.92  ? 2132 ASN B CA  1 
ATOM   1433 C  C   . ASN B 1 82  ? -31.663 55.664 33.271  1.00 46.07  ? 2132 ASN B C   1 
ATOM   1434 O  O   . ASN B 1 82  ? -30.623 55.945 33.873  1.00 42.44  ? 2132 ASN B O   1 
ATOM   1435 C  CB  . ASN B 1 82  ? -32.324 53.849 34.834  1.00 53.64  ? 2132 ASN B CB  1 
ATOM   1436 C  CG  . ASN B 1 82  ? -33.162 54.778 35.684  1.00 62.98  ? 2132 ASN B CG  1 
ATOM   1437 O  OD1 . ASN B 1 82  ? -34.358 54.953 35.433  1.00 62.75  ? 2132 ASN B OD1 1 
ATOM   1438 N  ND2 . ASN B 1 82  ? -32.541 55.386 36.693  1.00 64.82  ? 2132 ASN B ND2 1 
ATOM   1439 N  N   . ASP B 1 83  ? -32.317 56.522 32.496  1.00 46.07  ? 2133 ASP B N   1 
ATOM   1440 C  CA  . ASP B 1 83  ? -31.868 57.891 32.299  1.00 42.47  ? 2133 ASP B CA  1 
ATOM   1441 C  C   . ASP B 1 83  ? -30.385 58.012 31.934  1.00 43.30  ? 2133 ASP B C   1 
ATOM   1442 O  O   . ASP B 1 83  ? -29.562 58.474 32.728  1.00 37.22  ? 2133 ASP B O   1 
ATOM   1443 C  CB  . ASP B 1 83  ? -32.162 58.709 33.551  1.00 40.21  ? 2133 ASP B CB  1 
ATOM   1444 C  CG  . ASP B 1 83  ? -31.764 60.153 33.401  1.00 46.95  ? 2133 ASP B CG  1 
ATOM   1445 O  OD1 . ASP B 1 83  ? -32.135 60.765 32.374  1.00 49.44  ? 2133 ASP B OD1 1 
ATOM   1446 O  OD2 . ASP B 1 83  ? -31.087 60.676 34.314  1.00 45.69  ? 2133 ASP B OD2 1 
ATOM   1447 N  N   . LEU B 1 84  ? -30.052 57.583 30.724  1.00 38.52  ? 2134 LEU B N   1 
ATOM   1448 C  CA  . LEU B 1 84  ? -28.691 57.669 30.229  1.00 33.21  ? 2134 LEU B CA  1 
ATOM   1449 C  C   . LEU B 1 84  ? -28.488 59.093 29.705  1.00 32.00  ? 2134 LEU B C   1 
ATOM   1450 O  O   . LEU B 1 84  ? -29.237 59.551 28.846  1.00 37.10  ? 2134 LEU B O   1 
ATOM   1451 C  CB  . LEU B 1 84  ? -28.496 56.662 29.095  1.00 29.50  ? 2134 LEU B CB  1 
ATOM   1452 C  CG  . LEU B 1 84  ? -27.242 56.837 28.228  1.00 32.05  ? 2134 LEU B CG  1 
ATOM   1453 C  CD1 . LEU B 1 84  ? -26.014 56.381 28.993  1.00 26.20  ? 2134 LEU B CD1 1 
ATOM   1454 C  CD2 . LEU B 1 84  ? -27.398 56.041 26.939  1.00 26.73  ? 2134 LEU B CD2 1 
ATOM   1455 N  N   . ARG B 1 85  ? -27.489 59.792 30.233  1.00 32.95  ? 2135 ARG B N   1 
ATOM   1456 C  CA  . ARG B 1 85  ? -27.196 61.157 29.801  1.00 28.66  ? 2135 ARG B CA  1 
ATOM   1457 C  C   . ARG B 1 85  ? -25.771 61.268 29.243  1.00 34.42  ? 2135 ARG B C   1 
ATOM   1458 O  O   . ARG B 1 85  ? -24.859 60.578 29.703  1.00 34.22  ? 2135 ARG B O   1 
ATOM   1459 C  CB  . ARG B 1 85  ? -27.347 62.141 30.973  1.00 27.84  ? 2135 ARG B CB  1 
ATOM   1460 C  CG  . ARG B 1 85  ? -28.769 62.632 31.239  1.00 24.80  ? 2135 ARG B CG  1 
ATOM   1461 C  CD  . ARG B 1 85  ? -29.356 62.004 32.484  1.00 43.21  ? 2135 ARG B CD  1 
ATOM   1462 N  NE  . ARG B 1 85  ? -28.489 62.216 33.637  1.00 41.95  ? 2135 ARG B NE  1 
ATOM   1463 C  CZ  . ARG B 1 85  ? -28.076 63.411 34.031  1.00 44.03  ? 2135 ARG B CZ  1 
ATOM   1464 N  NH1 . ARG B 1 85  ? -28.468 64.485 33.365  1.00 51.28  ? 2135 ARG B NH1 1 
ATOM   1465 N  NH2 . ARG B 1 85  ? -27.246 63.531 35.059  1.00 43.02  ? 2135 ARG B NH2 1 
ATOM   1466 N  N   . PHE B 1 86  ? -25.586 62.128 28.242  1.00 33.45  ? 2136 PHE B N   1 
ATOM   1467 C  CA  . PHE B 1 86  ? -24.262 62.350 27.669  1.00 30.23  ? 2136 PHE B CA  1 
ATOM   1468 C  C   . PHE B 1 86  ? -23.748 63.644 28.276  1.00 32.69  ? 2136 PHE B C   1 
ATOM   1469 O  O   . PHE B 1 86  ? -23.965 64.725 27.733  1.00 39.65  ? 2136 PHE B O   1 
ATOM   1470 C  CB  . PHE B 1 86  ? -24.320 62.497 26.145  1.00 30.33  ? 2136 PHE B CB  1 
ATOM   1471 C  CG  . PHE B 1 86  ? -24.761 61.252 25.425  1.00 30.99  ? 2136 PHE B CG  1 
ATOM   1472 C  CD1 . PHE B 1 86  ? -26.107 60.906 25.370  1.00 28.68  ? 2136 PHE B CD1 1 
ATOM   1473 C  CD2 . PHE B 1 86  ? -23.827 60.420 24.808  1.00 27.30  ? 2136 PHE B CD2 1 
ATOM   1474 C  CE1 . PHE B 1 86  ? -26.521 59.749 24.714  1.00 28.44  ? 2136 PHE B CE1 1 
ATOM   1475 C  CE2 . PHE B 1 86  ? -24.229 59.261 24.150  1.00 21.87  ? 2136 PHE B CE2 1 
ATOM   1476 C  CZ  . PHE B 1 86  ? -25.579 58.924 24.102  1.00 26.04  ? 2136 PHE B CZ  1 
ATOM   1477 N  N   . VAL B 1 87  ? -23.072 63.534 29.410  1.00 33.42  ? 2137 VAL B N   1 
ATOM   1478 C  CA  . VAL B 1 87  ? -22.560 64.712 30.088  1.00 33.99  ? 2137 VAL B CA  1 
ATOM   1479 C  C   . VAL B 1 87  ? -21.538 65.458 29.233  1.00 35.03  ? 2137 VAL B C   1 
ATOM   1480 O  O   . VAL B 1 87  ? -21.722 66.636 28.941  1.00 32.42  ? 2137 VAL B O   1 
ATOM   1481 C  CB  . VAL B 1 87  ? -21.952 64.324 31.448  1.00 31.58  ? 2137 VAL B CB  1 
ATOM   1482 C  CG1 . VAL B 1 87  ? -21.470 65.562 32.189  1.00 36.54  ? 2137 VAL B CG1 1 
ATOM   1483 C  CG2 . VAL B 1 87  ? -22.992 63.590 32.271  1.00 30.73  ? 2137 VAL B CG2 1 
ATOM   1484 N  N   . GLY B 1 88  ? -20.477 64.769 28.821  1.00 40.06  ? 2138 GLY B N   1 
ATOM   1485 C  CA  . GLY B 1 88  ? -19.450 65.398 28.006  1.00 35.54  ? 2138 GLY B CA  1 
ATOM   1486 C  C   . GLY B 1 88  ? -19.911 65.770 26.605  1.00 40.34  ? 2138 GLY B C   1 
ATOM   1487 O  O   . GLY B 1 88  ? -20.724 65.066 25.997  1.00 40.40  ? 2138 GLY B O   1 
ATOM   1488 N  N   . ARG B 1 89  ? -19.384 66.875 26.082  1.00 38.32  ? 2139 ARG B N   1 
ATOM   1489 C  CA  . ARG B 1 89  ? -19.754 67.338 24.746  1.00 41.87  ? 2139 ARG B CA  1 
ATOM   1490 C  C   . ARG B 1 89  ? -18.758 66.840 23.704  1.00 42.50  ? 2139 ARG B C   1 
ATOM   1491 O  O   . ARG B 1 89  ? -17.593 66.580 24.015  1.00 37.02  ? 2139 ARG B O   1 
ATOM   1492 C  CB  . ARG B 1 89  ? -19.794 68.865 24.709  1.00 48.91  ? 2139 ARG B CB  1 
ATOM   1493 C  CG  . ARG B 1 89  ? -18.448 69.489 24.999  1.00 57.57  ? 2139 ARG B CG  1 
ATOM   1494 C  CD  . ARG B 1 89  ? -18.541 70.495 26.125  1.00 62.53  ? 2139 ARG B CD  1 
ATOM   1495 N  NE  . ARG B 1 89  ? -18.441 71.854 25.620  1.00 57.86  ? 2139 ARG B NE  1 
ATOM   1496 C  CZ  . ARG B 1 89  ? -18.493 72.940 26.378  1.00 50.49  ? 2139 ARG B CZ  1 
ATOM   1497 N  NH1 . ARG B 1 89  ? -18.649 72.826 27.689  1.00 45.82  ? 2139 ARG B NH1 1 
ATOM   1498 N  NH2 . ARG B 1 89  ? -18.379 74.140 25.822  1.00 46.29  ? 2139 ARG B NH2 1 
ATOM   1499 N  N   . SER B 1 90  ? -19.221 66.709 22.464  1.00 43.74  ? 2140 SER B N   1 
ATOM   1500 C  CA  . SER B 1 90  ? -18.360 66.243 21.386  1.00 43.45  ? 2140 SER B CA  1 
ATOM   1501 C  C   . SER B 1 90  ? -17.718 67.412 20.660  1.00 47.37  ? 2140 SER B C   1 
ATOM   1502 O  O   . SER B 1 90  ? -16.578 67.326 20.211  1.00 54.16  ? 2140 SER B O   1 
ATOM   1503 C  CB  . SER B 1 90  ? -19.148 65.376 20.391  1.00 39.25  ? 2140 SER B CB  1 
ATOM   1504 O  OG  . SER B 1 90  ? -20.316 66.023 19.921  1.00 31.35  ? 2140 SER B OG  1 
ATOM   1505 N  N   . GLY B 1 91  ? -18.442 68.515 20.561  1.00 47.05  ? 2141 GLY B N   1 
ATOM   1506 C  CA  . GLY B 1 91  ? -17.890 69.657 19.876  1.00 58.21  ? 2141 GLY B CA  1 
ATOM   1507 C  C   . GLY B 1 91  ? -18.825 70.048 18.765  1.00 63.08  ? 2141 GLY B C   1 
ATOM   1508 O  O   . GLY B 1 91  ? -19.790 69.333 18.472  1.00 59.67  ? 2141 GLY B O   1 
ATOM   1509 N  N   . ARG B 1 92  ? -18.538 71.190 18.152  1.00 65.49  ? 2142 ARG B N   1 
ATOM   1510 C  CA  . ARG B 1 92  ? -19.363 71.696 17.071  1.00 65.20  ? 2142 ARG B CA  1 
ATOM   1511 C  C   . ARG B 1 92  ? -18.820 71.197 15.747  1.00 63.23  ? 2142 ARG B C   1 
ATOM   1512 O  O   . ARG B 1 92  ? -19.299 71.600 14.691  1.00 78.06  ? 2142 ARG B O   1 
ATOM   1513 C  CB  . ARG B 1 92  ? -19.374 73.231 17.084  1.00 61.38  ? 2142 ARG B CB  1 
ATOM   1514 C  CG  . ARG B 1 92  ? -19.583 73.862 18.461  1.00 55.08  ? 2142 ARG B CG  1 
ATOM   1515 C  CD  . ARG B 1 92  ? -20.801 73.294 19.198  1.00 59.47  ? 2142 ARG B CD  1 
ATOM   1516 N  NE  . ARG B 1 92  ? -22.111 73.900 18.892  1.00 53.72  ? 2142 ARG B NE  1 
ATOM   1517 C  CZ  . ARG B 1 92  ? -22.858 73.639 17.820  1.00 47.38  ? 2142 ARG B CZ  1 
ATOM   1518 N  NH1 . ARG B 1 92  ? -22.446 72.785 16.891  1.00 45.91  ? 2142 ARG B NH1 1 
ATOM   1519 N  NH2 . ARG B 1 92  ? -24.060 74.186 17.714  1.00 46.08  ? 2142 ARG B NH2 1 
ATOM   1520 N  N   . GLY B 1 93  ? -17.822 70.321 15.801  1.00 54.52  ? 2143 GLY B N   1 
ATOM   1521 C  CA  . GLY B 1 93  ? -17.244 69.811 14.570  1.00 56.16  ? 2143 GLY B CA  1 
ATOM   1522 C  C   . GLY B 1 93  ? -17.111 68.305 14.545  1.00 58.41  ? 2143 GLY B C   1 
ATOM   1523 O  O   . GLY B 1 93  ? -17.290 67.672 13.504  1.00 60.38  ? 2143 GLY B O   1 
ATOM   1524 N  N   . LYS B 1 94  ? -16.786 67.734 15.699  1.00 58.65  ? 2144 LYS B N   1 
ATOM   1525 C  CA  . LYS B 1 94  ? -16.630 66.291 15.834  1.00 55.09  ? 2144 LYS B CA  1 
ATOM   1526 C  C   . LYS B 1 94  ? -17.916 65.663 16.370  1.00 53.01  ? 2144 LYS B C   1 
ATOM   1527 O  O   . LYS B 1 94  ? -18.816 66.368 16.833  1.00 55.85  ? 2144 LYS B O   1 
ATOM   1528 C  CB  . LYS B 1 94  ? -15.458 65.975 16.776  1.00 56.38  ? 2144 LYS B CB  1 
ATOM   1529 C  CG  . LYS B 1 94  ? -14.117 65.744 16.073  1.00 58.80  ? 2144 LYS B CG  1 
ATOM   1530 C  CD  . LYS B 1 94  ? -13.772 64.250 15.944  1.00 71.21  ? 2144 LYS B CD  1 
ATOM   1531 C  CE  . LYS B 1 94  ? -14.907 63.402 15.332  1.00 76.25  ? 2144 LYS B CE  1 
ATOM   1532 N  NZ  . LYS B 1 94  ? -15.265 63.744 13.925  1.00 76.41  ? 2144 LYS B NZ  1 
ATOM   1533 N  N   . SER B 1 95  ? -18.001 64.339 16.280  1.00 46.12  ? 2145 SER B N   1 
ATOM   1534 C  CA  . SER B 1 95  ? -19.156 63.595 16.771  1.00 41.15  ? 2145 SER B CA  1 
ATOM   1535 C  C   . SER B 1 95  ? -18.679 62.361 17.520  1.00 40.09  ? 2145 SER B C   1 
ATOM   1536 O  O   . SER B 1 95  ? -17.541 61.915 17.354  1.00 44.66  ? 2145 SER B O   1 
ATOM   1537 C  CB  . SER B 1 95  ? -20.080 63.168 15.626  1.00 39.26  ? 2145 SER B CB  1 
ATOM   1538 O  OG  . SER B 1 95  ? -21.099 64.127 15.404  1.00 41.13  ? 2145 SER B OG  1 
ATOM   1539 N  N   . PHE B 1 96  ? -19.564 61.809 18.340  1.00 34.53  ? 2146 PHE B N   1 
ATOM   1540 C  CA  . PHE B 1 96  ? -19.240 60.635 19.136  1.00 33.75  ? 2146 PHE B CA  1 
ATOM   1541 C  C   . PHE B 1 96  ? -19.591 59.306 18.484  1.00 34.86  ? 2146 PHE B C   1 
ATOM   1542 O  O   . PHE B 1 96  ? -20.616 59.172 17.809  1.00 33.87  ? 2146 PHE B O   1 
ATOM   1543 C  CB  . PHE B 1 96  ? -19.947 60.719 20.494  1.00 29.40  ? 2146 PHE B CB  1 
ATOM   1544 C  CG  . PHE B 1 96  ? -19.272 61.633 21.481  1.00 34.31  ? 2146 PHE B CG  1 
ATOM   1545 C  CD1 . PHE B 1 96  ? -20.016 62.266 22.477  1.00 21.06  ? 2146 PHE B CD1 1 
ATOM   1546 C  CD2 . PHE B 1 96  ? -17.889 61.844 21.433  1.00 27.56  ? 2146 PHE B CD2 1 
ATOM   1547 C  CE1 . PHE B 1 96  ? -19.396 63.089 23.411  1.00 24.39  ? 2146 PHE B CE1 1 
ATOM   1548 C  CE2 . PHE B 1 96  ? -17.259 62.664 22.363  1.00 30.63  ? 2146 PHE B CE2 1 
ATOM   1549 C  CZ  . PHE B 1 96  ? -18.012 63.290 23.354  1.00 29.96  ? 2146 PHE B CZ  1 
ATOM   1550 N  N   . THR B 1 97  ? -18.714 58.329 18.678  1.00 34.51  ? 2147 THR B N   1 
ATOM   1551 C  CA  . THR B 1 97  ? -18.950 56.982 18.187  1.00 32.72  ? 2147 THR B CA  1 
ATOM   1552 C  C   . THR B 1 97  ? -19.377 56.245 19.461  1.00 35.11  ? 2147 THR B C   1 
ATOM   1553 O  O   . THR B 1 97  ? -18.626 56.180 20.439  1.00 37.84  ? 2147 THR B O   1 
ATOM   1554 C  CB  . THR B 1 97  ? -17.674 56.331 17.620  1.00 28.85  ? 2147 THR B CB  1 
ATOM   1555 O  OG1 . THR B 1 97  ? -17.203 57.083 16.493  1.00 34.96  ? 2147 THR B OG1 1 
ATOM   1556 C  CG2 . THR B 1 97  ? -17.968 54.904 17.184  1.00 29.99  ? 2147 THR B CG2 1 
ATOM   1557 N  N   . LEU B 1 98  ? -20.599 55.730 19.466  1.00 34.41  ? 2148 LEU B N   1 
ATOM   1558 C  CA  . LEU B 1 98  ? -21.118 55.022 20.629  1.00 31.31  ? 2148 LEU B CA  1 
ATOM   1559 C  C   . LEU B 1 98  ? -20.889 53.513 20.504  1.00 33.31  ? 2148 LEU B C   1 
ATOM   1560 O  O   . LEU B 1 98  ? -21.329 52.880 19.540  1.00 29.62  ? 2148 LEU B O   1 
ATOM   1561 C  CB  . LEU B 1 98  ? -22.611 55.324 20.793  1.00 36.25  ? 2148 LEU B CB  1 
ATOM   1562 C  CG  . LEU B 1 98  ? -23.348 54.732 21.992  1.00 44.68  ? 2148 LEU B CG  1 
ATOM   1563 C  CD1 . LEU B 1 98  ? -22.644 55.110 23.284  1.00 59.00  ? 2148 LEU B CD1 1 
ATOM   1564 C  CD2 . LEU B 1 98  ? -24.773 55.246 22.003  1.00 47.53  ? 2148 LEU B CD2 1 
ATOM   1565 N  N   . THR B 1 99  ? -20.177 52.946 21.473  1.00 29.41  ? 2149 THR B N   1 
ATOM   1566 C  CA  . THR B 1 99  ? -19.903 51.516 21.475  1.00 27.89  ? 2149 THR B CA  1 
ATOM   1567 C  C   . THR B 1 99  ? -20.661 50.854 22.616  1.00 29.30  ? 2149 THR B C   1 
ATOM   1568 O  O   . THR B 1 99  ? -21.027 51.499 23.601  1.00 32.19  ? 2149 THR B O   1 
ATOM   1569 C  CB  . THR B 1 99  ? -18.389 51.211 21.630  1.00 25.91  ? 2149 THR B CB  1 
ATOM   1570 O  OG1 . THR B 1 99  ? -17.895 51.788 22.848  1.00 31.93  ? 2149 THR B OG1 1 
ATOM   1571 C  CG2 . THR B 1 99  ? -17.614 51.779 20.451  1.00 31.53  ? 2149 THR B CG2 1 
ATOM   1572 N  N   . ILE B 1 100 ? -20.906 49.560 22.472  1.00 32.32  ? 2150 ILE B N   1 
ATOM   1573 C  CA  . ILE B 1 100 ? -21.626 48.809 23.481  1.00 25.73  ? 2150 ILE B CA  1 
ATOM   1574 C  C   . ILE B 1 100 ? -20.746 47.644 23.913  1.00 24.58  ? 2150 ILE B C   1 
ATOM   1575 O  O   . ILE B 1 100 ? -20.118 46.989 23.081  1.00 29.40  ? 2150 ILE B O   1 
ATOM   1576 C  CB  . ILE B 1 100 ? -23.008 48.317 22.896  1.00 32.27  ? 2150 ILE B CB  1 
ATOM   1577 C  CG1 . ILE B 1 100 ? -24.140 48.779 23.796  1.00 32.45  ? 2150 ILE B CG1 1 
ATOM   1578 C  CG2 . ILE B 1 100 ? -23.060 46.812 22.750  1.00 36.60  ? 2150 ILE B CG2 1 
ATOM   1579 C  CD1 . ILE B 1 100 ? -24.276 50.276 23.842  1.00 35.91  ? 2150 ILE B CD1 1 
ATOM   1580 N  N   . THR B 1 101 ? -20.643 47.425 25.217  1.00 24.80  ? 2151 THR B N   1 
ATOM   1581 C  CA  . THR B 1 101 ? -19.869 46.293 25.706  1.00 26.17  ? 2151 THR B CA  1 
ATOM   1582 C  C   . THR B 1 101 ? -20.844 45.423 26.481  1.00 26.65  ? 2151 THR B C   1 
ATOM   1583 O  O   . THR B 1 101 ? -21.445 45.857 27.470  1.00 19.44  ? 2151 THR B O   1 
ATOM   1584 C  CB  . THR B 1 101 ? -18.698 46.707 26.632  1.00 26.00  ? 2151 THR B CB  1 
ATOM   1585 O  OG1 . THR B 1 101 ? -17.767 47.526 25.908  1.00 22.71  ? 2151 THR B OG1 1 
ATOM   1586 C  CG2 . THR B 1 101 ? -17.961 45.457 27.138  1.00 27.77  ? 2151 THR B CG2 1 
ATOM   1587 N  N   . VAL B 1 102 ? -21.027 44.202 25.993  1.00 25.83  ? 2152 VAL B N   1 
ATOM   1588 C  CA  . VAL B 1 102 ? -21.935 43.257 26.623  1.00 30.13  ? 2152 VAL B CA  1 
ATOM   1589 C  C   . VAL B 1 102 ? -21.067 42.238 27.319  1.00 29.43  ? 2152 VAL B C   1 
ATOM   1590 O  O   . VAL B 1 102 ? -20.300 41.509 26.682  1.00 25.25  ? 2152 VAL B O   1 
ATOM   1591 C  CB  . VAL B 1 102 ? -22.823 42.548 25.589  1.00 31.12  ? 2152 VAL B CB  1 
ATOM   1592 C  CG1 . VAL B 1 102 ? -23.753 41.569 26.288  1.00 24.71  ? 2152 VAL B CG1 1 
ATOM   1593 C  CG2 . VAL B 1 102 ? -23.624 43.585 24.811  1.00 22.21  ? 2152 VAL B CG2 1 
ATOM   1594 N  N   . PHE B 1 103 ? -21.199 42.175 28.635  1.00 27.78  ? 2153 PHE B N   1 
ATOM   1595 C  CA  . PHE B 1 103 ? -20.364 41.278 29.395  1.00 28.44  ? 2153 PHE B CA  1 
ATOM   1596 C  C   . PHE B 1 103 ? -20.787 39.837 29.519  1.00 28.73  ? 2153 PHE B C   1 
ATOM   1597 O  O   . PHE B 1 103 ? -21.072 39.339 30.608  1.00 26.46  ? 2153 PHE B O   1 
ATOM   1598 C  CB  . PHE B 1 103 ? -20.094 41.883 30.765  1.00 29.38  ? 2153 PHE B CB  1 
ATOM   1599 C  CG  . PHE B 1 103 ? -19.333 43.173 30.697  1.00 29.99  ? 2153 PHE B CG  1 
ATOM   1600 C  CD1 . PHE B 1 103 ? -20.004 44.395 30.662  1.00 26.99  ? 2153 PHE B CD1 1 
ATOM   1601 C  CD2 . PHE B 1 103 ? -17.941 43.165 30.623  1.00 31.44  ? 2153 PHE B CD2 1 
ATOM   1602 C  CE1 . PHE B 1 103 ? -19.299 45.588 30.555  1.00 22.49  ? 2153 PHE B CE1 1 
ATOM   1603 C  CE2 . PHE B 1 103 ? -17.229 44.354 30.514  1.00 26.41  ? 2153 PHE B CE2 1 
ATOM   1604 C  CZ  . PHE B 1 103 ? -17.911 45.567 30.481  1.00 13.65  ? 2153 PHE B CZ  1 
ATOM   1605 N  N   . THR B 1 104 ? -20.813 39.172 28.375  1.00 27.05  ? 2154 THR B N   1 
ATOM   1606 C  CA  . THR B 1 104 ? -21.127 37.768 28.335  1.00 28.69  ? 2154 THR B CA  1 
ATOM   1607 C  C   . THR B 1 104 ? -19.767 37.102 28.487  1.00 29.98  ? 2154 THR B C   1 
ATOM   1608 O  O   . THR B 1 104 ? -18.760 37.782 28.687  1.00 30.12  ? 2154 THR B O   1 
ATOM   1609 C  CB  . THR B 1 104 ? -21.771 37.389 27.002  1.00 26.17  ? 2154 THR B CB  1 
ATOM   1610 O  OG1 . THR B 1 104 ? -21.031 37.983 25.931  1.00 18.59  ? 2154 THR B OG1 1 
ATOM   1611 C  CG2 . THR B 1 104 ? -23.209 37.873 26.959  1.00 23.54  ? 2154 THR B CG2 1 
ATOM   1612 N  N   . ASN B 1 105 ? -19.731 35.782 28.404  1.00 30.90  ? 2155 ASN B N   1 
ATOM   1613 C  CA  . ASN B 1 105 ? -18.481 35.057 28.546  1.00 31.47  ? 2155 ASN B CA  1 
ATOM   1614 C  C   . ASN B 1 105 ? -18.184 34.296 27.253  1.00 36.28  ? 2155 ASN B C   1 
ATOM   1615 O  O   . ASN B 1 105 ? -18.787 33.250 26.986  1.00 42.97  ? 2155 ASN B O   1 
ATOM   1616 C  CB  . ASN B 1 105 ? -18.591 34.078 29.715  1.00 29.28  ? 2155 ASN B CB  1 
ATOM   1617 C  CG  . ASN B 1 105 ? -17.269 33.422 30.057  1.00 29.53  ? 2155 ASN B CG  1 
ATOM   1618 O  OD1 . ASN B 1 105 ? -16.401 33.250 29.196  1.00 28.64  ? 2155 ASN B OD1 1 
ATOM   1619 N  ND2 . ASN B 1 105 ? -17.118 33.029 31.317  1.00 29.05  ? 2155 ASN B ND2 1 
ATOM   1620 N  N   . PRO B 1 106 ? -17.251 34.812 26.432  1.00 35.94  ? 2156 PRO B N   1 
ATOM   1621 C  CA  . PRO B 1 106 ? -16.490 36.043 26.671  1.00 31.94  ? 2156 PRO B CA  1 
ATOM   1622 C  C   . PRO B 1 106 ? -17.263 37.310 26.282  1.00 29.81  ? 2156 PRO B C   1 
ATOM   1623 O  O   . PRO B 1 106 ? -18.305 37.238 25.632  1.00 32.12  ? 2156 PRO B O   1 
ATOM   1624 C  CB  . PRO B 1 106 ? -15.247 35.836 25.821  1.00 29.32  ? 2156 PRO B CB  1 
ATOM   1625 C  CG  . PRO B 1 106 ? -15.810 35.146 24.623  1.00 34.65  ? 2156 PRO B CG  1 
ATOM   1626 C  CD  . PRO B 1 106 ? -16.768 34.132 25.217  1.00 30.37  ? 2156 PRO B CD  1 
ATOM   1627 N  N   . PRO B 1 107 ? -16.747 38.490 26.666  1.00 33.45  ? 2157 PRO B N   1 
ATOM   1628 C  CA  . PRO B 1 107 ? -17.406 39.767 26.354  1.00 28.42  ? 2157 PRO B CA  1 
ATOM   1629 C  C   . PRO B 1 107 ? -17.507 40.065 24.866  1.00 28.47  ? 2157 PRO B C   1 
ATOM   1630 O  O   . PRO B 1 107 ? -16.670 39.634 24.072  1.00 28.04  ? 2157 PRO B O   1 
ATOM   1631 C  CB  . PRO B 1 107 ? -16.527 40.801 27.056  1.00 18.53  ? 2157 PRO B CB  1 
ATOM   1632 C  CG  . PRO B 1 107 ? -15.831 40.022 28.129  1.00 24.46  ? 2157 PRO B CG  1 
ATOM   1633 C  CD  . PRO B 1 107 ? -15.521 38.718 27.454  1.00 24.12  ? 2157 PRO B CD  1 
ATOM   1634 N  N   . GLN B 1 108 ? -18.531 40.822 24.497  1.00 24.36  ? 2158 GLN B N   1 
ATOM   1635 C  CA  . GLN B 1 108 ? -18.716 41.212 23.107  1.00 27.56  ? 2158 GLN B CA  1 
ATOM   1636 C  C   . GLN B 1 108 ? -18.800 42.736 22.990  1.00 22.82  ? 2158 GLN B C   1 
ATOM   1637 O  O   . GLN B 1 108 ? -19.262 43.418 23.907  1.00 23.86  ? 2158 GLN B O   1 
ATOM   1638 C  CB  . GLN B 1 108 ? -19.997 40.610 22.561  1.00 28.53  ? 2158 GLN B CB  1 
ATOM   1639 C  CG  . GLN B 1 108 ? -20.076 39.119 22.664  1.00 26.55  ? 2158 GLN B CG  1 
ATOM   1640 C  CD  . GLN B 1 108 ? -21.436 38.634 22.248  1.00 25.87  ? 2158 GLN B CD  1 
ATOM   1641 O  OE1 . GLN B 1 108 ? -21.835 38.808 21.103  1.00 28.57  ? 2158 GLN B OE1 1 
ATOM   1642 N  NE2 . GLN B 1 108 ? -22.169 38.045 23.180  1.00 33.80  ? 2158 GLN B NE2 1 
ATOM   1643 N  N   . VAL B 1 109 ? -18.361 43.261 21.852  1.00 22.41  ? 2159 VAL B N   1 
ATOM   1644 C  CA  . VAL B 1 109 ? -18.395 44.699 21.607  1.00 17.43  ? 2159 VAL B CA  1 
ATOM   1645 C  C   . VAL B 1 109 ? -19.050 45.008 20.273  1.00 15.76  ? 2159 VAL B C   1 
ATOM   1646 O  O   . VAL B 1 109 ? -18.845 44.291 19.294  1.00 23.32  ? 2159 VAL B O   1 
ATOM   1647 C  CB  . VAL B 1 109 ? -16.971 45.315 21.609  1.00 19.81  ? 2159 VAL B CB  1 
ATOM   1648 C  CG1 . VAL B 1 109 ? -16.416 45.357 23.029  1.00 16.22  ? 2159 VAL B CG1 1 
ATOM   1649 C  CG2 . VAL B 1 109 ? -16.044 44.497 20.707  1.00 18.95  ? 2159 VAL B CG2 1 
ATOM   1650 N  N   . ALA B 1 110 ? -19.845 46.074 20.242  1.00 23.04  ? 2160 ALA B N   1 
ATOM   1651 C  CA  . ALA B 1 110 ? -20.530 46.492 19.017  1.00 27.10  ? 2160 ALA B CA  1 
ATOM   1652 C  C   . ALA B 1 110 ? -20.577 48.019 18.943  1.00 30.43  ? 2160 ALA B C   1 
ATOM   1653 O  O   . ALA B 1 110 ? -20.334 48.700 19.937  1.00 32.37  ? 2160 ALA B O   1 
ATOM   1654 C  CB  . ALA B 1 110 ? -21.944 45.913 18.978  1.00 23.73  ? 2160 ALA B CB  1 
ATOM   1655 N  N   . THR B 1 111 ? -20.893 48.547 17.763  1.00 30.81  ? 2161 THR B N   1 
ATOM   1656 C  CA  . THR B 1 111 ? -20.958 49.987 17.542  1.00 29.04  ? 2161 THR B CA  1 
ATOM   1657 C  C   . THR B 1 111 ? -22.344 50.407 17.040  1.00 26.08  ? 2161 THR B C   1 
ATOM   1658 O  O   . THR B 1 111 ? -22.927 49.740 16.186  1.00 26.71  ? 2161 THR B O   1 
ATOM   1659 C  CB  . THR B 1 111 ? -19.891 50.420 16.495  1.00 32.31  ? 2161 THR B CB  1 
ATOM   1660 O  OG1 . THR B 1 111 ? -18.589 50.071 16.971  1.00 43.16  ? 2161 THR B OG1 1 
ATOM   1661 C  CG2 . THR B 1 111 ? -19.944 51.917 16.239  1.00 33.41  ? 2161 THR B CG2 1 
ATOM   1662 N  N   . TYR B 1 112 ? -22.866 51.504 17.583  1.00 24.89  ? 2162 TYR B N   1 
ATOM   1663 C  CA  . TYR B 1 112 ? -24.163 52.033 17.174  1.00 32.28  ? 2162 TYR B CA  1 
ATOM   1664 C  C   . TYR B 1 112 ? -23.999 52.390 15.691  1.00 37.25  ? 2162 TYR B C   1 
ATOM   1665 O  O   . TYR B 1 112 ? -22.978 52.963 15.314  1.00 38.24  ? 2162 TYR B O   1 
ATOM   1666 C  CB  . TYR B 1 112 ? -24.486 53.283 17.996  1.00 37.26  ? 2162 TYR B CB  1 
ATOM   1667 C  CG  . TYR B 1 112 ? -25.910 53.764 17.887  1.00 30.47  ? 2162 TYR B CG  1 
ATOM   1668 C  CD1 . TYR B 1 112 ? -26.972 52.952 18.284  1.00 32.60  ? 2162 TYR B CD1 1 
ATOM   1669 C  CD2 . TYR B 1 112 ? -26.199 55.030 17.381  1.00 33.10  ? 2162 TYR B CD2 1 
ATOM   1670 C  CE1 . TYR B 1 112 ? -28.289 53.388 18.177  1.00 38.42  ? 2162 TYR B CE1 1 
ATOM   1671 C  CE2 . TYR B 1 112 ? -27.511 55.478 17.267  1.00 39.10  ? 2162 TYR B CE2 1 
ATOM   1672 C  CZ  . TYR B 1 112 ? -28.551 54.655 17.664  1.00 38.70  ? 2162 TYR B CZ  1 
ATOM   1673 O  OH  . TYR B 1 112 ? -29.846 55.095 17.530  1.00 44.51  ? 2162 TYR B OH  1 
ATOM   1674 N  N   . HIS B 1 113 ? -24.989 52.061 14.858  1.00 39.50  ? 2163 HIS B N   1 
ATOM   1675 C  CA  . HIS B 1 113 ? -24.895 52.316 13.416  1.00 38.01  ? 2163 HIS B CA  1 
ATOM   1676 C  C   . HIS B 1 113 ? -24.517 53.733 12.991  1.00 38.23  ? 2163 HIS B C   1 
ATOM   1677 O  O   . HIS B 1 113 ? -24.050 53.939 11.868  1.00 46.53  ? 2163 HIS B O   1 
ATOM   1678 C  CB  . HIS B 1 113 ? -26.188 51.904 12.700  1.00 38.19  ? 2163 HIS B CB  1 
ATOM   1679 C  CG  . HIS B 1 113 ? -27.355 52.795 12.982  1.00 40.55  ? 2163 HIS B CG  1 
ATOM   1680 N  ND1 . HIS B 1 113 ? -28.420 52.917 12.115  1.00 45.86  ? 2163 HIS B ND1 1 
ATOM   1681 C  CD2 . HIS B 1 113 ? -27.638 53.594 14.037  1.00 46.19  ? 2163 HIS B CD2 1 
ATOM   1682 C  CE1 . HIS B 1 113 ? -29.307 53.752 12.624  1.00 50.27  ? 2163 HIS B CE1 1 
ATOM   1683 N  NE2 . HIS B 1 113 ? -28.857 54.177 13.791  1.00 53.04  ? 2163 HIS B NE2 1 
ATOM   1684 N  N   . ARG B 1 114 ? -24.710 54.709 13.872  1.00 39.44  ? 2164 ARG B N   1 
ATOM   1685 C  CA  . ARG B 1 114 ? -24.359 56.086 13.537  1.00 44.05  ? 2164 ARG B CA  1 
ATOM   1686 C  C   . ARG B 1 114 ? -23.858 56.898 14.726  1.00 42.47  ? 2164 ARG B C   1 
ATOM   1687 O  O   . ARG B 1 114 ? -24.069 56.534 15.885  1.00 37.30  ? 2164 ARG B O   1 
ATOM   1688 C  CB  . ARG B 1 114 ? -25.546 56.803 12.891  1.00 49.13  ? 2164 ARG B CB  1 
ATOM   1689 C  CG  . ARG B 1 114 ? -26.737 57.019 13.787  1.00 55.49  ? 2164 ARG B CG  1 
ATOM   1690 C  CD  . ARG B 1 114 ? -27.753 57.861 13.052  1.00 78.24  ? 2164 ARG B CD  1 
ATOM   1691 N  NE  . ARG B 1 114 ? -27.156 59.126 12.623  1.00 97.84  ? 2164 ARG B NE  1 
ATOM   1692 C  CZ  . ARG B 1 114 ? -27.728 59.978 11.778  1.00 101.90 ? 2164 ARG B CZ  1 
ATOM   1693 N  NH1 . ARG B 1 114 ? -28.921 59.703 11.263  1.00 101.92 ? 2164 ARG B NH1 1 
ATOM   1694 N  NH2 . ARG B 1 114 ? -27.107 61.104 11.453  1.00 101.18 ? 2164 ARG B NH2 1 
ATOM   1695 N  N   . ALA B 1 115 ? -23.194 58.008 14.418  1.00 34.14  ? 2165 ALA B N   1 
ATOM   1696 C  CA  . ALA B 1 115 ? -22.642 58.880 15.438  1.00 33.93  ? 2165 ALA B CA  1 
ATOM   1697 C  C   . ALA B 1 115 ? -23.680 59.838 15.985  1.00 35.41  ? 2165 ALA B C   1 
ATOM   1698 O  O   . ALA B 1 115 ? -24.662 60.165 15.320  1.00 37.33  ? 2165 ALA B O   1 
ATOM   1699 C  CB  . ALA B 1 115 ? -21.473 59.664 14.877  1.00 34.15  ? 2165 ALA B CB  1 
ATOM   1700 N  N   . ILE B 1 116 ? -23.442 60.286 17.209  1.00 31.72  ? 2166 ILE B N   1 
ATOM   1701 C  CA  . ILE B 1 116 ? -24.335 61.209 17.877  1.00 35.14  ? 2166 ILE B CA  1 
ATOM   1702 C  C   . ILE B 1 116 ? -23.532 62.443 18.285  1.00 39.11  ? 2166 ILE B C   1 
ATOM   1703 O  O   . ILE B 1 116 ? -22.408 62.333 18.784  1.00 38.28  ? 2166 ILE B O   1 
ATOM   1704 C  CB  . ILE B 1 116 ? -24.973 60.540 19.120  1.00 34.33  ? 2166 ILE B CB  1 
ATOM   1705 C  CG1 . ILE B 1 116 ? -25.934 61.508 19.806  1.00 40.04  ? 2166 ILE B CG1 1 
ATOM   1706 C  CG2 . ILE B 1 116 ? -23.885 60.085 20.076  1.00 32.93  ? 2166 ILE B CG2 1 
ATOM   1707 C  CD1 . ILE B 1 116 ? -26.717 60.879 20.931  1.00 40.04  ? 2166 ILE B CD1 1 
ATOM   1708 N  N   . LYS B 1 117 ? -24.105 63.619 18.053  1.00 36.37  ? 2167 LYS B N   1 
ATOM   1709 C  CA  . LYS B 1 117 ? -23.433 64.867 18.386  1.00 39.81  ? 2167 LYS B CA  1 
ATOM   1710 C  C   . LYS B 1 117 ? -23.987 65.431 19.693  1.00 40.88  ? 2167 LYS B C   1 
ATOM   1711 O  O   . LYS B 1 117 ? -25.205 65.514 19.876  1.00 36.62  ? 2167 LYS B O   1 
ATOM   1712 C  CB  . LYS B 1 117 ? -23.629 65.870 17.248  1.00 43.25  ? 2167 LYS B CB  1 
ATOM   1713 C  CG  . LYS B 1 117 ? -22.765 67.110 17.336  1.00 43.22  ? 2167 LYS B CG  1 
ATOM   1714 C  CD  . LYS B 1 117 ? -22.999 67.989 16.131  1.00 45.82  ? 2167 LYS B CD  1 
ATOM   1715 C  CE  . LYS B 1 117 ? -22.163 69.246 16.194  1.00 60.95  ? 2167 LYS B CE  1 
ATOM   1716 N  NZ  . LYS B 1 117 ? -22.479 70.161 15.057  1.00 63.10  ? 2167 LYS B NZ  1 
ATOM   1717 N  N   . ILE B 1 118 ? -23.087 65.811 20.599  1.00 40.11  ? 2168 ILE B N   1 
ATOM   1718 C  CA  . ILE B 1 118 ? -23.470 66.364 21.899  1.00 37.47  ? 2168 ILE B CA  1 
ATOM   1719 C  C   . ILE B 1 118 ? -22.854 67.748 22.070  1.00 39.84  ? 2168 ILE B C   1 
ATOM   1720 O  O   . ILE B 1 118 ? -21.632 67.902 22.040  1.00 42.02  ? 2168 ILE B O   1 
ATOM   1721 C  CB  . ILE B 1 118 ? -22.979 65.462 23.069  1.00 38.15  ? 2168 ILE B CB  1 
ATOM   1722 C  CG1 . ILE B 1 118 ? -23.515 64.032 22.910  1.00 29.05  ? 2168 ILE B CG1 1 
ATOM   1723 C  CG2 . ILE B 1 118 ? -23.428 66.045 24.401  1.00 38.05  ? 2168 ILE B CG2 1 
ATOM   1724 C  CD1 . ILE B 1 118 ? -25.024 63.907 23.047  1.00 27.02  ? 2168 ILE B CD1 1 
ATOM   1725 N  N   . THR B 1 119 ? -23.701 68.754 22.252  1.00 41.00  ? 2169 THR B N   1 
ATOM   1726 C  CA  . THR B 1 119 ? -23.223 70.120 22.422  1.00 40.44  ? 2169 THR B CA  1 
ATOM   1727 C  C   . THR B 1 119 ? -23.961 70.823 23.551  1.00 40.38  ? 2169 THR B C   1 
ATOM   1728 O  O   . THR B 1 119 ? -25.040 70.392 23.962  1.00 39.89  ? 2169 THR B O   1 
ATOM   1729 C  CB  . THR B 1 119 ? -23.410 70.928 21.134  1.00 38.19  ? 2169 THR B CB  1 
ATOM   1730 O  OG1 . THR B 1 119 ? -24.795 70.916 20.766  1.00 32.53  ? 2169 THR B OG1 1 
ATOM   1731 C  CG2 . THR B 1 119 ? -22.591 70.319 20.007  1.00 37.82  ? 2169 THR B CG2 1 
ATOM   1732 N  N   . VAL B 1 120 ? -23.372 71.910 24.038  1.00 40.57  ? 2170 VAL B N   1 
ATOM   1733 C  CA  . VAL B 1 120 ? -23.953 72.688 25.126  1.00 42.68  ? 2170 VAL B CA  1 
ATOM   1734 C  C   . VAL B 1 120 ? -25.376 73.120 24.799  1.00 44.45  ? 2170 VAL B C   1 
ATOM   1735 O  O   . VAL B 1 120 ? -26.322 72.808 25.525  1.00 48.03  ? 2170 VAL B O   1 
ATOM   1736 C  CB  . VAL B 1 120 ? -23.124 73.959 25.412  1.00 36.91  ? 2170 VAL B CB  1 
ATOM   1737 C  CG1 . VAL B 1 120 ? -23.671 74.669 26.640  1.00 30.72  ? 2170 VAL B CG1 1 
ATOM   1738 C  CG2 . VAL B 1 120 ? -21.661 73.596 25.609  1.00 48.44  ? 2170 VAL B CG2 1 
ATOM   1739 N  N   . ASP B 1 121 ? -25.511 73.846 23.698  1.00 50.10  ? 2171 ASP B N   1 
ATOM   1740 C  CA  . ASP B 1 121 ? -26.799 74.350 23.253  1.00 56.41  ? 2171 ASP B CA  1 
ATOM   1741 C  C   . ASP B 1 121 ? -27.683 73.221 22.734  1.00 58.08  ? 2171 ASP B C   1 
ATOM   1742 O  O   . ASP B 1 121 ? -28.889 73.182 23.001  1.00 53.53  ? 2171 ASP B O   1 
ATOM   1743 C  CB  . ASP B 1 121 ? -26.562 75.423 22.188  1.00 59.11  ? 2171 ASP B CB  1 
ATOM   1744 C  CG  . ASP B 1 121 ? -25.812 76.637 22.747  1.00 73.72  ? 2171 ASP B CG  1 
ATOM   1745 O  OD1 . ASP B 1 121 ? -26.392 77.334 23.613  1.00 73.19  ? 2171 ASP B OD1 1 
ATOM   1746 O  OD2 . ASP B 1 121 ? -24.648 76.888 22.342  1.00 71.13  ? 2171 ASP B OD2 1 
ATOM   1747 N  N   . GLY B 1 122 ? -27.069 72.290 22.015  1.00 62.28  ? 2172 GLY B N   1 
ATOM   1748 C  CA  . GLY B 1 122 ? -27.810 71.166 21.481  1.00 70.89  ? 2172 GLY B CA  1 
ATOM   1749 C  C   . GLY B 1 122 ? -28.403 71.475 20.124  1.00 77.99  ? 2172 GLY B C   1 
ATOM   1750 O  O   . GLY B 1 122 ? -27.948 72.392 19.438  1.00 76.09  ? 2172 GLY B O   1 
ATOM   1751 N  N   . PRO B 1 123 ? -29.422 70.712 19.703  1.00 83.63  ? 2173 PRO B N   1 
ATOM   1752 C  CA  . PRO B 1 123 ? -30.088 70.903 18.412  1.00 88.72  ? 2173 PRO B CA  1 
ATOM   1753 C  C   . PRO B 1 123 ? -30.832 72.241 18.332  1.00 97.04  ? 2173 PRO B C   1 
ATOM   1754 O  O   . PRO B 1 123 ? -32.070 72.253 18.528  1.00 101.12 ? 2173 PRO B O   1 
ATOM   1755 C  CB  . PRO B 1 123 ? -31.018 69.695 18.329  1.00 83.43  ? 2173 PRO B CB  1 
ATOM   1756 C  CG  . PRO B 1 123 ? -31.371 69.450 19.760  1.00 87.38  ? 2173 PRO B CG  1 
ATOM   1757 C  CD  . PRO B 1 123 ? -30.045 69.611 20.459  1.00 85.87  ? 2173 PRO B CD  1 
HETATM 1758 CL CL  . CL  C 2 .   ? -22.962 51.688 2.635   1.00 53.59  ? 4003 CL  A CL  1 
HETATM 1759 CL CL  . CL  D 2 .   ? -19.521 32.748 33.282  1.00 38.90  ? 4001 CL  B CL  1 
HETATM 1760 CL CL  . CL  E 2 .   ? -25.010 36.474 22.306  1.00 40.78  ? 4002 CL  B CL  1 
HETATM 1761 CL CL  . CL  F 2 .   ? -16.084 64.247 28.412  1.00 39.50  ? 4004 CL  B CL  1 
HETATM 1762 CL CL  . CL  G 2 .   ? -20.691 72.630 22.520  1.00 45.05  ? 4005 CL  B CL  1 
HETATM 1763 O  O   . HOH H 3 .   ? -14.601 38.279 7.070   1.00 18.26  ? 3001 HOH A O   1 
HETATM 1764 O  O   . HOH H 3 .   ? -3.277  45.021 24.492  1.00 26.03  ? 3002 HOH A O   1 
HETATM 1765 O  O   . HOH H 3 .   ? -7.359  52.462 3.296   1.00 32.51  ? 3003 HOH A O   1 
HETATM 1766 O  O   . HOH H 3 .   ? -23.714 46.048 9.894   1.00 31.14  ? 3004 HOH A O   1 
HETATM 1767 O  O   . HOH H 3 .   ? -12.198 39.502 10.076  1.00 24.22  ? 3006 HOH A O   1 
HETATM 1768 O  O   . HOH H 3 .   ? -16.892 41.805 2.407   1.00 16.47  ? 3007 HOH A O   1 
HETATM 1769 O  O   . HOH H 3 .   ? -20.179 44.837 -9.372  1.00 35.98  ? 3008 HOH A O   1 
HETATM 1770 O  O   . HOH H 3 .   ? -20.393 34.636 -2.306  1.00 25.04  ? 3009 HOH A O   1 
HETATM 1771 O  O   . HOH H 3 .   ? 3.505   53.537 22.384  1.00 24.99  ? 3010 HOH A O   1 
HETATM 1772 O  O   . HOH H 3 .   ? -12.515 54.280 12.507  1.00 24.07  ? 3011 HOH A O   1 
HETATM 1773 O  O   . HOH H 3 .   ? -7.630  52.650 27.454  1.00 28.65  ? 3012 HOH A O   1 
HETATM 1774 O  O   . HOH H 3 .   ? -19.597 37.860 14.266  1.00 27.55  ? 3018 HOH A O   1 
HETATM 1775 O  O   . HOH H 3 .   ? -21.163 50.213 10.059  1.00 32.44  ? 3022 HOH A O   1 
HETATM 1776 O  O   . HOH H 3 .   ? -17.740 52.222 8.180   1.00 28.65  ? 3024 HOH A O   1 
HETATM 1777 O  O   . HOH H 3 .   ? -17.068 43.810 -10.281 1.00 40.21  ? 3026 HOH A O   1 
HETATM 1778 O  O   . HOH H 3 .   ? -1.196  43.702 27.963  1.00 28.08  ? 3027 HOH A O   1 
HETATM 1779 O  O   . HOH H 3 .   ? -2.707  45.914 29.520  1.00 21.04  ? 3029 HOH A O   1 
HETATM 1780 O  O   . HOH H 3 .   ? -8.704  60.792 25.361  1.00 30.34  ? 3030 HOH A O   1 
HETATM 1781 O  O   . HOH H 3 .   ? -7.212  40.758 6.880   1.00 50.80  ? 3031 HOH A O   1 
HETATM 1782 O  O   . HOH H 3 .   ? -8.299  34.315 8.330   1.00 54.75  ? 3032 HOH A O   1 
HETATM 1783 O  O   . HOH H 3 .   ? 0.932   50.717 19.606  1.00 34.44  ? 3033 HOH A O   1 
HETATM 1784 O  O   . HOH H 3 .   ? -12.804 55.654 6.510   1.00 40.65  ? 3034 HOH A O   1 
HETATM 1785 O  O   . HOH H 3 .   ? -4.169  54.349 26.445  1.00 32.40  ? 3035 HOH A O   1 
HETATM 1786 O  O   . HOH H 3 .   ? -7.857  57.837 7.525   1.00 40.38  ? 3037 HOH A O   1 
HETATM 1787 O  O   . HOH H 3 .   ? -22.476 56.482 4.847   1.00 32.77  ? 3038 HOH A O   1 
HETATM 1788 O  O   . HOH H 3 .   ? -14.977 38.356 -3.907  1.00 31.89  ? 3040 HOH A O   1 
HETATM 1789 O  O   . HOH H 3 .   ? -6.282  47.035 31.004  1.00 29.69  ? 3041 HOH A O   1 
HETATM 1790 O  O   . HOH H 3 .   ? -22.005 38.431 -10.922 1.00 33.94  ? 3042 HOH A O   1 
HETATM 1791 O  O   . HOH H 3 .   ? -8.839  39.420 4.094   1.00 37.93  ? 3043 HOH A O   1 
HETATM 1792 O  O   . HOH H 3 .   ? -6.995  47.077 -0.018  1.00 39.09  ? 3044 HOH A O   1 
HETATM 1793 O  O   . HOH H 3 .   ? -8.194  50.260 28.717  1.00 52.42  ? 3045 HOH A O   1 
HETATM 1794 O  O   . HOH H 3 .   ? -13.880 58.810 -3.885  1.00 36.43  ? 3048 HOH A O   1 
HETATM 1795 O  O   . HOH H 3 .   ? -11.296 52.121 24.997  1.00 34.52  ? 3051 HOH A O   1 
HETATM 1796 O  O   . HOH H 3 .   ? -17.905 51.105 11.051  1.00 40.50  ? 3054 HOH A O   1 
HETATM 1797 O  O   . HOH H 3 .   ? -14.295 34.396 1.855   1.00 32.20  ? 3058 HOH A O   1 
HETATM 1798 O  O   . HOH H 3 .   ? -4.389  54.589 1.865   1.00 53.81  ? 3060 HOH A O   1 
HETATM 1799 O  O   . HOH H 3 .   ? -20.814 47.540 -7.205  1.00 24.60  ? 3071 HOH A O   1 
HETATM 1800 O  O   . HOH H 3 .   ? -29.026 42.624 12.622  1.00 28.02  ? 3074 HOH A O   1 
HETATM 1801 O  O   . HOH H 3 .   ? -12.417 43.276 -11.821 1.00 34.82  ? 3075 HOH A O   1 
HETATM 1802 O  O   . HOH H 3 .   ? -12.228 56.635 -4.584  1.00 32.62  ? 3077 HOH A O   1 
HETATM 1803 O  O   . HOH H 3 .   ? -17.460 53.226 13.124  1.00 30.29  ? 3081 HOH A O   1 
HETATM 1804 O  O   . HOH H 3 .   ? -18.920 41.515 15.886  1.00 57.67  ? 3082 HOH A O   1 
HETATM 1805 O  O   . HOH H 3 .   ? -0.587  38.387 15.957  1.00 40.64  ? 3083 HOH A O   1 
HETATM 1806 O  O   . HOH H 3 .   ? -6.402  39.176 1.994   1.00 46.51  ? 3084 HOH A O   1 
HETATM 1807 O  O   . HOH H 3 .   ? 4.342   46.724 4.691   1.00 40.17  ? 3085 HOH A O   1 
HETATM 1808 O  O   . HOH H 3 .   ? 0.511   53.188 20.786  1.00 48.09  ? 3089 HOH A O   1 
HETATM 1809 O  O   . HOH H 3 .   ? 0.588   43.401 25.621  1.00 30.71  ? 3093 HOH A O   1 
HETATM 1810 O  O   . HOH H 3 .   ? -1.769  49.042 6.314   1.00 37.86  ? 3094 HOH A O   1 
HETATM 1811 O  O   . HOH H 3 .   ? -16.135 37.740 -6.375  1.00 47.17  ? 3095 HOH A O   1 
HETATM 1812 O  O   . HOH H 3 .   ? -22.379 51.383 -0.398  1.00 47.47  ? 3096 HOH A O   1 
HETATM 1813 O  O   . HOH H 3 .   ? -15.657 40.998 16.044  1.00 43.87  ? 3097 HOH A O   1 
HETATM 1814 O  O   . HOH H 3 .   ? -17.379 35.001 -4.821  1.00 41.43  ? 3099 HOH A O   1 
HETATM 1815 O  O   . HOH H 3 .   ? -13.500 41.673 20.565  1.00 25.67  ? 3101 HOH A O   1 
HETATM 1816 O  O   . HOH H 3 .   ? -4.559  45.933 0.046   1.00 47.54  ? 3102 HOH A O   1 
HETATM 1817 O  O   . HOH H 3 .   ? -0.983  51.810 30.303  1.00 60.24  ? 3103 HOH A O   1 
HETATM 1818 O  O   . HOH H 3 .   ? -28.705 44.624 9.713   1.00 44.38  ? 3105 HOH A O   1 
HETATM 1819 O  O   . HOH H 3 .   ? -17.814 42.621 -12.661 1.00 35.21  ? 3106 HOH A O   1 
HETATM 1820 O  O   . HOH H 3 .   ? -3.726  36.132 23.595  1.00 50.99  ? 3107 HOH A O   1 
HETATM 1821 O  O   . HOH H 3 .   ? -17.886 40.148 -12.428 1.00 44.76  ? 3108 HOH A O   1 
HETATM 1822 O  O   . HOH H 3 .   ? -6.391  42.236 -3.888  1.00 59.87  ? 3109 HOH A O   1 
HETATM 1823 O  O   . HOH H 3 .   ? -4.531  38.050 21.518  1.00 66.08  ? 3110 HOH A O   1 
HETATM 1824 O  O   . HOH H 3 .   ? -8.957  40.680 -4.721  1.00 42.61  ? 3111 HOH A O   1 
HETATM 1825 O  O   . HOH H 3 .   ? 0.794   48.110 27.011  1.00 44.26  ? 3113 HOH A O   1 
HETATM 1826 O  O   . HOH H 3 .   ? -22.081 38.245 0.000   0.50 53.72  ? 3114 HOH A O   1 
HETATM 1827 O  O   . HOH H 3 .   ? -7.782  34.518 20.806  1.00 41.54  ? 3115 HOH A O   1 
HETATM 1828 O  O   . HOH H 3 .   ? -9.532  47.605 -8.100  1.00 41.82  ? 3117 HOH A O   1 
HETATM 1829 O  O   . HOH H 3 .   ? -6.035  34.910 25.282  1.00 41.07  ? 3118 HOH A O   1 
HETATM 1830 O  O   . HOH H 3 .   ? -10.630 51.578 27.386  1.00 52.16  ? 3119 HOH A O   1 
HETATM 1831 O  O   . HOH H 3 .   ? -0.189  45.559 25.215  1.00 37.62  ? 3120 HOH A O   1 
HETATM 1832 O  O   . HOH H 3 .   ? -19.665 36.372 11.938  1.00 41.03  ? 3121 HOH A O   1 
HETATM 1833 O  O   . HOH H 3 .   ? -10.925 46.180 30.239  1.00 68.98  ? 3124 HOH A O   1 
HETATM 1834 O  O   . HOH H 3 .   ? -3.829  57.838 9.799   1.00 46.22  ? 3125 HOH A O   1 
HETATM 1835 O  O   . HOH H 3 .   ? -8.891  49.901 -5.980  1.00 60.18  ? 3126 HOH A O   1 
HETATM 1836 O  O   . HOH H 3 .   ? -12.807 37.168 8.620   1.00 37.10  ? 3129 HOH A O   1 
HETATM 1837 O  O   . HOH H 3 .   ? -12.419 51.479 30.344  1.00 44.36  ? 3130 HOH A O   1 
HETATM 1838 O  O   . HOH H 3 .   ? -15.161 55.062 13.800  1.00 52.87  ? 3131 HOH A O   1 
HETATM 1839 O  O   . HOH H 3 .   ? 4.368   39.308 9.397   1.00 53.41  ? 3135 HOH A O   1 
HETATM 1840 O  O   . HOH H 3 .   ? -1.684  55.030 4.708   1.00 50.02  ? 3136 HOH A O   1 
HETATM 1841 O  O   . HOH H 3 .   ? -18.483 48.132 3.269   1.00 59.07  ? 3137 HOH A O   1 
HETATM 1842 O  O   . HOH H 3 .   ? -9.706  44.018 -9.534  1.00 47.14  ? 3138 HOH A O   1 
HETATM 1843 O  O   . HOH H 3 .   ? -7.685  39.733 19.998  1.00 42.36  ? 3140 HOH A O   1 
HETATM 1844 O  O   . HOH H 3 .   ? 2.269   41.581 23.796  1.00 55.39  ? 3141 HOH A O   1 
HETATM 1845 O  O   . HOH H 3 .   ? -8.966  41.677 26.094  1.00 53.74  ? 3143 HOH A O   1 
HETATM 1846 O  O   . HOH H 3 .   ? -11.920 34.835 7.349   1.00 35.17  ? 3149 HOH A O   1 
HETATM 1847 O  O   . HOH H 3 .   ? 5.785   44.778 8.367   1.00 36.89  ? 3150 HOH A O   1 
HETATM 1848 O  O   . HOH H 3 .   ? 0.652   39.310 21.845  1.00 47.25  ? 3152 HOH A O   1 
HETATM 1849 O  O   . HOH H 3 .   ? 1.509   41.036 19.628  1.00 41.11  ? 3153 HOH A O   1 
HETATM 1850 O  O   . HOH H 3 .   ? -22.225 60.064 3.419   1.00 43.99  ? 3154 HOH A O   1 
HETATM 1851 O  O   . HOH H 3 .   ? -4.749  36.112 14.439  1.00 64.53  ? 3156 HOH A O   1 
HETATM 1852 O  O   . HOH H 3 .   ? -7.364  37.618 13.234  1.00 62.95  ? 3157 HOH A O   1 
HETATM 1853 O  O   . HOH H 3 .   ? -16.593 55.100 -13.649 1.00 45.58  ? 3159 HOH A O   1 
HETATM 1854 O  O   . HOH H 3 .   ? -11.105 40.848 19.915  1.00 49.06  ? 3160 HOH A O   1 
HETATM 1855 O  O   . HOH H 3 .   ? -10.164 56.129 -2.109  1.00 48.28  ? 3161 HOH A O   1 
HETATM 1856 O  O   . HOH H 3 .   ? -18.713 62.181 2.681   1.00 43.86  ? 3162 HOH A O   1 
HETATM 1857 O  O   . HOH H 3 .   ? -19.409 49.514 -6.767  1.00 38.98  ? 3164 HOH A O   1 
HETATM 1858 O  O   . HOH H 3 .   ? -9.643  42.607 28.589  1.00 34.98  ? 3165 HOH A O   1 
HETATM 1859 O  O   . HOH H 3 .   ? -21.696 52.897 9.302   1.00 39.04  ? 3166 HOH A O   1 
HETATM 1860 O  O   . HOH H 3 .   ? -13.401 44.486 27.685  1.00 39.02  ? 3167 HOH A O   1 
HETATM 1861 O  O   . HOH H 3 .   ? 3.319   50.823 10.558  1.00 32.74  ? 3168 HOH A O   1 
HETATM 1862 O  O   . HOH H 3 .   ? -5.380  33.769 21.160  1.00 48.92  ? 3169 HOH A O   1 
HETATM 1863 O  O   . HOH H 3 .   ? -7.845  45.680 -7.682  1.00 36.07  ? 3172 HOH A O   1 
HETATM 1864 O  O   . HOH H 3 .   ? -9.819  48.809 29.607  0.50 16.41  ? 3176 HOH A O   1 
HETATM 1865 O  O   . HOH H 3 .   ? -12.298 48.686 29.898  0.50 24.46  ? 3178 HOH A O   1 
HETATM 1866 O  O   . HOH H 3 .   ? -11.650 52.364 -8.802  1.00 45.54  ? 3179 HOH A O   1 
HETATM 1867 O  O   . HOH H 3 .   ? 0.986   55.229 23.261  1.00 52.47  ? 3181 HOH A O   1 
HETATM 1868 O  O   . HOH H 3 .   ? -10.321 33.729 21.113  1.00 60.90  ? 3182 HOH A O   1 
HETATM 1869 O  O   . HOH H 3 .   ? -9.242  36.517 19.946  1.00 50.53  ? 3183 HOH A O   1 
HETATM 1870 O  O   . HOH H 3 .   ? 4.243   53.621 9.135   1.00 55.39  ? 3184 HOH A O   1 
HETATM 1871 O  O   . HOH H 3 .   ? -8.607  41.844 -7.651  1.00 47.50  ? 3185 HOH A O   1 
HETATM 1872 O  O   . HOH H 3 .   ? -19.634 64.429 -3.528  1.00 62.71  ? 3188 HOH A O   1 
HETATM 1873 O  O   . HOH H 3 .   ? -4.069  60.993 30.489  1.00 44.89  ? 3189 HOH A O   1 
HETATM 1874 O  O   . HOH H 3 .   ? -19.374 34.490 7.782   1.00 59.73  ? 3192 HOH A O   1 
HETATM 1875 O  O   . HOH H 3 .   ? 6.293   50.559 12.295  1.00 41.77  ? 3193 HOH A O   1 
HETATM 1876 O  O   . HOH H 3 .   ? -12.447 32.831 4.070   1.00 68.47  ? 3194 HOH A O   1 
HETATM 1877 O  O   . HOH H 3 .   ? 1.475   44.631 1.180   1.00 58.65  ? 3195 HOH A O   1 
HETATM 1878 O  O   . HOH H 3 .   ? -0.465  52.121 -1.781  1.00 69.33  ? 3196 HOH A O   1 
HETATM 1879 O  O   . HOH H 3 .   ? 1.721   58.546 6.829   1.00 55.67  ? 3197 HOH A O   1 
HETATM 1880 O  O   . HOH H 3 .   ? -1.312  57.199 15.308  1.00 58.71  ? 3198 HOH A O   1 
HETATM 1881 O  O   . HOH H 3 .   ? -25.323 48.936 2.774   1.00 44.07  ? 3199 HOH A O   1 
HETATM 1882 O  O   . HOH I 3 .   ? -31.634 38.305 29.168  1.00 32.17  ? 3005 HOH B O   1 
HETATM 1883 O  O   . HOH I 3 .   ? -18.746 58.214 32.558  1.00 31.55  ? 3013 HOH B O   1 
HETATM 1884 O  O   . HOH I 3 .   ? -32.059 60.039 29.307  1.00 29.52  ? 3014 HOH B O   1 
HETATM 1885 O  O   . HOH I 3 .   ? -22.440 40.221 32.705  1.00 27.62  ? 3015 HOH B O   1 
HETATM 1886 O  O   . HOH I 3 .   ? -17.266 50.173 14.221  1.00 39.16  ? 3016 HOH B O   1 
HETATM 1887 O  O   . HOH I 3 .   ? -14.565 47.843 27.185  1.00 30.18  ? 3017 HOH B O   1 
HETATM 1888 O  O   . HOH I 3 .   ? -32.077 55.765 28.801  1.00 29.39  ? 3019 HOH B O   1 
HETATM 1889 O  O   . HOH I 3 .   ? -18.497 50.267 25.430  1.00 36.25  ? 3020 HOH B O   1 
HETATM 1890 O  O   . HOH I 3 .   ? -28.654 52.555 33.461  1.00 30.78  ? 3021 HOH B O   1 
HETATM 1891 O  O   . HOH I 3 .   ? -25.697 40.966 37.062  1.00 30.59  ? 3023 HOH B O   1 
HETATM 1892 O  O   . HOH I 3 .   ? -27.074 44.110 14.262  1.00 29.65  ? 3025 HOH B O   1 
HETATM 1893 O  O   . HOH I 3 .   ? -15.700 59.159 15.610  1.00 38.08  ? 3028 HOH B O   1 
HETATM 1894 O  O   . HOH I 3 .   ? -14.247 54.527 30.608  1.00 39.88  ? 3036 HOH B O   1 
HETATM 1895 O  O   . HOH I 3 .   ? -17.585 56.776 27.720  1.00 23.27  ? 3039 HOH B O   1 
HETATM 1896 O  O   . HOH I 3 .   ? -31.281 36.600 14.732  1.00 47.70  ? 3046 HOH B O   1 
HETATM 1897 O  O   . HOH I 3 .   ? -24.412 63.109 14.042  1.00 42.68  ? 3047 HOH B O   1 
HETATM 1898 O  O   . HOH I 3 .   ? -33.471 59.029 22.267  1.00 43.56  ? 3049 HOH B O   1 
HETATM 1899 O  O   . HOH I 3 .   ? -19.725 35.588 23.655  1.00 32.18  ? 3050 HOH B O   1 
HETATM 1900 O  O   . HOH I 3 .   ? -35.179 56.415 31.673  1.00 47.43  ? 3052 HOH B O   1 
HETATM 1901 O  O   . HOH I 3 .   ? -20.530 40.186 18.694  1.00 49.04  ? 3053 HOH B O   1 
HETATM 1902 O  O   . HOH I 3 .   ? -21.321 33.600 24.705  1.00 40.17  ? 3055 HOH B O   1 
HETATM 1903 O  O   . HOH I 3 .   ? -27.283 38.369 21.916  1.00 28.86  ? 3056 HOH B O   1 
HETATM 1904 O  O   . HOH I 3 .   ? -19.272 44.210 16.514  1.00 27.86  ? 3057 HOH B O   1 
HETATM 1905 O  O   . HOH I 3 .   ? -36.428 53.172 19.235  1.00 34.77  ? 3059 HOH B O   1 
HETATM 1906 O  O   . HOH I 3 .   ? -15.714 31.085 27.677  1.00 25.92  ? 3061 HOH B O   1 
HETATM 1907 O  O   . HOH I 3 .   ? -38.306 46.105 23.128  1.00 39.53  ? 3062 HOH B O   1 
HETATM 1908 O  O   . HOH I 3 .   ? -21.955 55.230 16.600  1.00 35.98  ? 3063 HOH B O   1 
HETATM 1909 O  O   . HOH I 3 .   ? -14.605 65.656 20.897  1.00 41.78  ? 3064 HOH B O   1 
HETATM 1910 O  O   . HOH I 3 .   ? -14.278 54.035 23.959  1.00 30.57  ? 3065 HOH B O   1 
HETATM 1911 O  O   . HOH I 3 .   ? -29.255 57.910 16.028  1.00 58.32  ? 3066 HOH B O   1 
HETATM 1912 O  O   . HOH I 3 .   ? -34.524 52.141 28.535  1.00 51.15  ? 3067 HOH B O   1 
HETATM 1913 O  O   . HOH I 3 .   ? -18.921 54.498 30.210  1.00 25.66  ? 3068 HOH B O   1 
HETATM 1914 O  O   . HOH I 3 .   ? -27.578 63.762 27.346  1.00 38.13  ? 3069 HOH B O   1 
HETATM 1915 O  O   . HOH I 3 .   ? -12.114 61.695 28.931  1.00 35.52  ? 3070 HOH B O   1 
HETATM 1916 O  O   . HOH I 3 .   ? -16.219 54.344 22.220  1.00 23.71  ? 3072 HOH B O   1 
HETATM 1917 O  O   . HOH I 3 .   ? -17.417 41.112 19.838  1.00 27.09  ? 3073 HOH B O   1 
HETATM 1918 O  O   . HOH I 3 .   ? -33.974 58.086 29.240  1.00 30.77  ? 3076 HOH B O   1 
HETATM 1919 O  O   . HOH I 3 .   ? -22.251 50.113 13.296  1.00 33.47  ? 3078 HOH B O   1 
HETATM 1920 O  O   . HOH I 3 .   ? -26.742 59.283 16.619  1.00 33.84  ? 3079 HOH B O   1 
HETATM 1921 O  O   . HOH I 3 .   ? -29.065 53.888 36.828  1.00 44.55  ? 3080 HOH B O   1 
HETATM 1922 O  O   . HOH I 3 .   ? -17.299 57.552 30.764  1.00 41.41  ? 3086 HOH B O   1 
HETATM 1923 O  O   . HOH I 3 .   ? -27.877 43.036 37.683  1.00 42.94  ? 3087 HOH B O   1 
HETATM 1924 O  O   . HOH I 3 .   ? -32.747 46.214 32.124  1.00 33.10  ? 3088 HOH B O   1 
HETATM 1925 O  O   . HOH I 3 .   ? -20.062 50.940 12.539  1.00 51.42  ? 3090 HOH B O   1 
HETATM 1926 O  O   . HOH I 3 .   ? -24.951 34.511 25.089  1.00 41.21  ? 3091 HOH B O   1 
HETATM 1927 O  O   . HOH I 3 .   ? -13.307 37.795 23.130  1.00 52.78  ? 3092 HOH B O   1 
HETATM 1928 O  O   . HOH I 3 .   ? -25.186 76.819 19.224  1.00 50.67  ? 3098 HOH B O   1 
HETATM 1929 O  O   . HOH I 3 .   ? -30.875 49.400 10.830  1.00 30.00  ? 3100 HOH B O   1 
HETATM 1930 O  O   . HOH I 3 .   ? -20.594 54.127 12.960  1.00 33.46  ? 3104 HOH B O   1 
HETATM 1931 O  O   . HOH I 3 .   ? -17.702 39.332 31.055  0.50 46.13  ? 3112 HOH B O   1 
HETATM 1932 O  O   . HOH I 3 .   ? -23.368 74.452 21.462  1.00 47.38  ? 3116 HOH B O   1 
HETATM 1933 O  O   . HOH I 3 .   ? -26.463 54.124 9.375   1.00 48.54  ? 3122 HOH B O   1 
HETATM 1934 O  O   . HOH I 3 .   ? -14.222 41.555 23.151  1.00 48.48  ? 3123 HOH B O   1 
HETATM 1935 O  O   . HOH I 3 .   ? -33.383 60.100 16.085  1.00 49.82  ? 3127 HOH B O   1 
HETATM 1936 O  O   . HOH I 3 .   ? -35.641 53.039 31.220  1.00 35.67  ? 3128 HOH B O   1 
HETATM 1937 O  O   . HOH I 3 .   ? -18.790 65.157 12.702  1.00 46.81  ? 3132 HOH B O   1 
HETATM 1938 O  O   . HOH I 3 .   ? -19.618 56.314 13.934  1.00 48.99  ? 3133 HOH B O   1 
HETATM 1939 O  O   . HOH I 3 .   ? -17.314 66.248 31.065  1.00 50.94  ? 3134 HOH B O   1 
HETATM 1940 O  O   . HOH I 3 .   ? -36.821 36.265 28.202  1.00 61.53  ? 3139 HOH B O   1 
HETATM 1941 O  O   . HOH I 3 .   ? -28.791 38.830 13.623  1.00 57.48  ? 3142 HOH B O   1 
HETATM 1942 O  O   . HOH I 3 .   ? -23.119 58.790 11.503  1.00 42.77  ? 3144 HOH B O   1 
HETATM 1943 O  O   . HOH I 3 .   ? -12.149 58.842 13.930  1.00 30.66  ? 3145 HOH B O   1 
HETATM 1944 O  O   . HOH I 3 .   ? -25.625 71.137 14.269  1.00 47.04  ? 3146 HOH B O   1 
HETATM 1945 O  O   . HOH I 3 .   ? -34.159 41.022 14.147  1.00 55.11  ? 3147 HOH B O   1 
HETATM 1946 O  O   . HOH I 3 .   ? -7.565  56.889 31.055  0.50 56.17  ? 3148 HOH B O   1 
HETATM 1947 O  O   . HOH I 3 .   ? -26.293 37.893 37.552  1.00 51.08  ? 3151 HOH B O   1 
HETATM 1948 O  O   . HOH I 3 .   ? -31.917 35.131 11.836  1.00 59.18  ? 3155 HOH B O   1 
HETATM 1949 O  O   . HOH I 3 .   ? -32.432 63.133 15.809  1.00 42.69  ? 3158 HOH B O   1 
HETATM 1950 O  O   . HOH I 3 .   ? -15.220 41.094 18.732  1.00 42.00  ? 3163 HOH B O   1 
HETATM 1951 O  O   . HOH I 3 .   ? -12.485 36.980 16.910  1.00 41.54  ? 3170 HOH B O   1 
HETATM 1952 O  O   . HOH I 3 .   ? -28.674 50.914 9.022   1.00 45.95  ? 3171 HOH B O   1 
HETATM 1953 O  O   . HOH I 3 .   ? -39.546 63.966 23.761  1.00 60.98  ? 3173 HOH B O   1 
HETATM 1954 O  O   . HOH I 3 .   ? -32.843 66.110 32.117  1.00 58.66  ? 3174 HOH B O   1 
HETATM 1955 O  O   . HOH I 3 .   ? -31.497 33.745 32.418  1.00 49.75  ? 3175 HOH B O   1 
HETATM 1956 O  O   . HOH I 3 .   ? -36.497 42.138 16.138  1.00 53.86  ? 3177 HOH B O   1 
HETATM 1957 O  O   . HOH I 3 .   ? -30.564 57.652 37.258  1.00 52.52  ? 3180 HOH B O   1 
HETATM 1958 O  O   . HOH I 3 .   ? -35.717 44.654 30.637  1.00 52.61  ? 3186 HOH B O   1 
HETATM 1959 O  O   . HOH I 3 .   ? -37.625 52.535 21.566  1.00 50.29  ? 3187 HOH B O   1 
HETATM 1960 O  O   . HOH I 3 .   ? -15.693 38.235 21.258  1.00 43.01  ? 3190 HOH B O   1 
HETATM 1961 O  O   . HOH I 3 .   ? -13.282 38.623 18.722  1.00 67.37  ? 3191 HOH B O   1 
HETATM 1962 O  O   . HOH I 3 .   ? -32.949 55.347 22.372  1.00 37.16  ? 3200 HOH B O   1 
HETATM 1963 O  O   . HOH I 3 .   ? -27.016 50.729 15.849  1.00 37.57  ? 3201 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1051 ?    ?   ?   A . n 
A 1 2   VAL 2   1052 ?    ?   ?   A . n 
A 1 3   GLU 3   1053 ?    ?   ?   A . n 
A 1 4   VAL 4   1054 ?    ?   ?   A . n 
A 1 5   LEU 5   1055 ?    ?   ?   A . n 
A 1 6   ALA 6   1056 ?    ?   ?   A . n 
A 1 7   ASP 7   1057 ?    ?   ?   A . n 
A 1 8   HIS 8   1058 ?    ?   ?   A . n 
A 1 9   PRO 9   1059 ?    ?   ?   A . n 
A 1 10  GLY 10  1060 ?    ?   ?   A . n 
A 1 11  GLU 11  1061 1061 GLU GLU A . n 
A 1 12  LEU 12  1062 1062 LEU LEU A . n 
A 1 13  VAL 13  1063 1063 VAL VAL A . n 
A 1 14  ARG 14  1064 1064 ARG ARG A . n 
A 1 15  THR 15  1065 1065 THR THR A . n 
A 1 16  ASP 16  1066 1066 ASP ASP A . n 
A 1 17  SER 17  1067 1067 SER SER A . n 
A 1 18  PRO 18  1068 1068 PRO PRO A . n 
A 1 19  ASN 19  1069 1069 ASN ASN A . n 
A 1 20  PHE 20  1070 1070 PHE PHE A . n 
A 1 21  LEU 21  1071 1071 LEU LEU A . n 
A 1 22  CYS 22  1072 1072 CYS CYS A . n 
A 1 23  SER 23  1073 1073 SER SER A . n 
A 1 24  VAL 24  1074 1074 VAL VAL A . n 
A 1 25  LEU 25  1075 1075 LEU LEU A . n 
A 1 26  PRO 26  1076 1076 PRO PRO A . n 
A 1 27  THR 27  1077 1077 THR THR A . n 
A 1 28  HIS 28  1078 1078 HIS HIS A . n 
A 1 29  TRP 29  1079 1079 TRP TRP A . n 
A 1 30  ARG 30  1080 1080 ARG ARG A . n 
A 1 31  CYS 31  1081 1081 CYS CYS A . n 
A 1 32  ASN 32  1082 1082 ASN ASN A . n 
A 1 33  LYS 33  1083 1083 LYS LYS A . n 
A 1 34  THR 34  1084 1084 THR THR A . n 
A 1 35  LEU 35  1085 1085 LEU LEU A . n 
A 1 36  PRO 36  1086 1086 PRO PRO A . n 
A 1 37  ILE 37  1087 1087 ILE ILE A . n 
A 1 38  ALA 38  1088 1088 ALA ALA A . n 
A 1 39  PHE 39  1089 1089 PHE PHE A . n 
A 1 40  LYS 40  1090 1090 LYS LYS A . n 
A 1 41  VAL 41  1091 1091 VAL VAL A . n 
A 1 42  VAL 42  1092 1092 VAL VAL A . n 
A 1 43  ALA 43  1093 1093 ALA ALA A . n 
A 1 44  LEU 44  1094 1094 LEU LEU A . n 
A 1 45  GLY 45  1095 1095 GLY GLY A . n 
A 1 46  ASP 46  1096 1096 ASP ASP A . n 
A 1 47  VAL 47  1097 1097 VAL VAL A . n 
A 1 48  PRO 48  1098 1098 PRO PRO A . n 
A 1 49  ASP 49  1099 1099 ASP ASP A . n 
A 1 50  GLY 50  1100 1100 GLY GLY A . n 
A 1 51  THR 51  1101 1101 THR THR A . n 
A 1 52  LEU 52  1102 1102 LEU LEU A . n 
A 1 53  VAL 53  1103 1103 VAL VAL A . n 
A 1 54  THR 54  1104 1104 THR THR A . n 
A 1 55  VAL 55  1105 1105 VAL VAL A . n 
A 1 56  MET 56  1106 1106 MET MET A . n 
A 1 57  ALA 57  1107 1107 ALA ALA A . n 
A 1 58  GLY 58  1108 1108 GLY GLY A . n 
A 1 59  ASN 59  1109 1109 ASN ASN A . n 
A 1 60  ASP 60  1110 1110 ASP ASP A . n 
A 1 61  GLU 61  1111 1111 GLU GLU A . n 
A 1 62  ASN 62  1112 1112 ASN ASN A . n 
A 1 63  TYR 63  1113 1113 TYR TYR A . n 
A 1 64  SER 64  1114 1114 SER SER A . n 
A 1 65  ALA 65  1115 1115 ALA ALA A . n 
A 1 66  GLU 66  1116 1116 GLU GLU A . n 
A 1 67  LEU 67  1117 1117 LEU LEU A . n 
A 1 68  ARG 68  1118 1118 ARG ARG A . n 
A 1 69  ASN 69  1119 1119 ASN ASN A . n 
A 1 70  ALA 70  1120 1120 ALA ALA A . n 
A 1 71  THR 71  1121 1121 THR THR A . n 
A 1 72  ALA 72  1122 1122 ALA ALA A . n 
A 1 73  ALA 73  1123 1123 ALA ALA A . n 
A 1 74  MET 74  1124 1124 MET MET A . n 
A 1 75  LYS 75  1125 1125 LYS LYS A . n 
A 1 76  ASN 76  1126 1126 ASN ASN A . n 
A 1 77  GLN 77  1127 1127 GLN GLN A . n 
A 1 78  VAL 78  1128 1128 VAL VAL A . n 
A 1 79  ALA 79  1129 1129 ALA ALA A . n 
A 1 80  ARG 80  1130 1130 ARG ARG A . n 
A 1 81  PHE 81  1131 1131 PHE PHE A . n 
A 1 82  ASN 82  1132 1132 ASN ASN A . n 
A 1 83  ASP 83  1133 1133 ASP ASP A . n 
A 1 84  LEU 84  1134 1134 LEU LEU A . n 
A 1 85  ARG 85  1135 1135 ARG ARG A . n 
A 1 86  PHE 86  1136 1136 PHE PHE A . n 
A 1 87  VAL 87  1137 1137 VAL VAL A . n 
A 1 88  GLY 88  1138 1138 GLY GLY A . n 
A 1 89  ARG 89  1139 1139 ARG ARG A . n 
A 1 90  SER 90  1140 1140 SER SER A . n 
A 1 91  GLY 91  1141 1141 GLY GLY A . n 
A 1 92  ARG 92  1142 1142 ARG ARG A . n 
A 1 93  GLY 93  1143 1143 GLY GLY A . n 
A 1 94  LYS 94  1144 1144 LYS LYS A . n 
A 1 95  SER 95  1145 1145 SER SER A . n 
A 1 96  PHE 96  1146 1146 PHE PHE A . n 
A 1 97  THR 97  1147 1147 THR THR A . n 
A 1 98  LEU 98  1148 1148 LEU LEU A . n 
A 1 99  THR 99  1149 1149 THR THR A . n 
A 1 100 ILE 100 1150 1150 ILE ILE A . n 
A 1 101 THR 101 1151 1151 THR THR A . n 
A 1 102 VAL 102 1152 1152 VAL VAL A . n 
A 1 103 PHE 103 1153 1153 PHE PHE A . n 
A 1 104 THR 104 1154 1154 THR THR A . n 
A 1 105 ASN 105 1155 1155 ASN ASN A . n 
A 1 106 PRO 106 1156 1156 PRO PRO A . n 
A 1 107 PRO 107 1157 1157 PRO PRO A . n 
A 1 108 GLN 108 1158 1158 GLN GLN A . n 
A 1 109 VAL 109 1159 1159 VAL VAL A . n 
A 1 110 ALA 110 1160 1160 ALA ALA A . n 
A 1 111 THR 111 1161 1161 THR THR A . n 
A 1 112 TYR 112 1162 1162 TYR TYR A . n 
A 1 113 HIS 113 1163 1163 HIS HIS A . n 
A 1 114 ARG 114 1164 1164 ARG ARG A . n 
A 1 115 ALA 115 1165 1165 ALA ALA A . n 
A 1 116 ILE 116 1166 1166 ILE ILE A . n 
A 1 117 LYS 117 1167 1167 LYS LYS A . n 
A 1 118 ILE 118 1168 1168 ILE ILE A . n 
A 1 119 THR 119 1169 1169 THR THR A . n 
A 1 120 VAL 120 1170 1170 VAL VAL A . n 
A 1 121 ASP 121 1171 1171 ASP ASP A . n 
A 1 122 GLY 122 1172 1172 GLY GLY A . n 
A 1 123 PRO 123 1173 1173 PRO PRO A . n 
A 1 124 ARG 124 1174 1174 ARG ARG A . n 
A 1 125 GLU 125 1175 ?    ?   ?   A . n 
A 1 126 PRO 126 1176 ?    ?   ?   A . n 
A 1 127 ARG 127 1177 ?    ?   ?   A . n 
A 1 128 ARG 128 1178 ?    ?   ?   A . n 
A 1 129 HIS 129 1179 ?    ?   ?   A . n 
A 1 130 ARG 130 1180 ?    ?   ?   A . n 
A 1 131 GLN 131 1181 ?    ?   ?   A . n 
B 1 1   MET 1   2051 ?    ?   ?   B . n 
B 1 2   VAL 2   2052 ?    ?   ?   B . n 
B 1 3   GLU 3   2053 ?    ?   ?   B . n 
B 1 4   VAL 4   2054 ?    ?   ?   B . n 
B 1 5   LEU 5   2055 ?    ?   ?   B . n 
B 1 6   ALA 6   2056 ?    ?   ?   B . n 
B 1 7   ASP 7   2057 ?    ?   ?   B . n 
B 1 8   HIS 8   2058 ?    ?   ?   B . n 
B 1 9   PRO 9   2059 ?    ?   ?   B . n 
B 1 10  GLY 10  2060 2060 GLY GLY B . n 
B 1 11  GLU 11  2061 2061 GLU GLU B . n 
B 1 12  LEU 12  2062 2062 LEU LEU B . n 
B 1 13  VAL 13  2063 2063 VAL VAL B . n 
B 1 14  ARG 14  2064 2064 ARG ARG B . n 
B 1 15  THR 15  2065 2065 THR THR B . n 
B 1 16  ASP 16  2066 2066 ASP ASP B . n 
B 1 17  SER 17  2067 2067 SER SER B . n 
B 1 18  PRO 18  2068 2068 PRO PRO B . n 
B 1 19  ASN 19  2069 2069 ASN ASN B . n 
B 1 20  PHE 20  2070 2070 PHE PHE B . n 
B 1 21  LEU 21  2071 2071 LEU LEU B . n 
B 1 22  CYS 22  2072 2072 CYS CYS B . n 
B 1 23  SER 23  2073 2073 SER SER B . n 
B 1 24  VAL 24  2074 2074 VAL VAL B . n 
B 1 25  LEU 25  2075 2075 LEU LEU B . n 
B 1 26  PRO 26  2076 2076 PRO PRO B . n 
B 1 27  THR 27  2077 2077 THR THR B . n 
B 1 28  HIS 28  2078 2078 HIS HIS B . n 
B 1 29  TRP 29  2079 2079 TRP TRP B . n 
B 1 30  ARG 30  2080 2080 ARG ARG B . n 
B 1 31  CYS 31  2081 2081 CYS CYS B . n 
B 1 32  ASN 32  2082 2082 ASN ASN B . n 
B 1 33  LYS 33  2083 2083 LYS LYS B . n 
B 1 34  THR 34  2084 2084 THR THR B . n 
B 1 35  LEU 35  2085 2085 LEU LEU B . n 
B 1 36  PRO 36  2086 2086 PRO PRO B . n 
B 1 37  ILE 37  2087 2087 ILE ILE B . n 
B 1 38  ALA 38  2088 2088 ALA ALA B . n 
B 1 39  PHE 39  2089 2089 PHE PHE B . n 
B 1 40  LYS 40  2090 2090 LYS LYS B . n 
B 1 41  VAL 41  2091 2091 VAL VAL B . n 
B 1 42  VAL 42  2092 2092 VAL VAL B . n 
B 1 43  ALA 43  2093 2093 ALA ALA B . n 
B 1 44  LEU 44  2094 2094 LEU LEU B . n 
B 1 45  GLY 45  2095 2095 GLY GLY B . n 
B 1 46  ASP 46  2096 2096 ASP ASP B . n 
B 1 47  VAL 47  2097 2097 VAL VAL B . n 
B 1 48  PRO 48  2098 2098 PRO PRO B . n 
B 1 49  ASP 49  2099 2099 ASP ASP B . n 
B 1 50  GLY 50  2100 2100 GLY GLY B . n 
B 1 51  THR 51  2101 2101 THR THR B . n 
B 1 52  LEU 52  2102 2102 LEU LEU B . n 
B 1 53  VAL 53  2103 2103 VAL VAL B . n 
B 1 54  THR 54  2104 2104 THR THR B . n 
B 1 55  VAL 55  2105 2105 VAL VAL B . n 
B 1 56  MET 56  2106 2106 MET MET B . n 
B 1 57  ALA 57  2107 2107 ALA ALA B . n 
B 1 58  GLY 58  2108 2108 GLY GLY B . n 
B 1 59  ASN 59  2109 2109 ASN ASN B . n 
B 1 60  ASP 60  2110 2110 ASP ASP B . n 
B 1 61  GLU 61  2111 2111 GLU GLU B . n 
B 1 62  ASN 62  2112 2112 ASN ASN B . n 
B 1 63  TYR 63  2113 2113 TYR TYR B . n 
B 1 64  SER 64  2114 2114 SER SER B . n 
B 1 65  ALA 65  2115 2115 ALA ALA B . n 
B 1 66  GLU 66  2116 2116 GLU GLU B . n 
B 1 67  LEU 67  2117 2117 LEU LEU B . n 
B 1 68  ARG 68  2118 2118 ARG ARG B . n 
B 1 69  ASN 69  2119 2119 ASN ASN B . n 
B 1 70  ALA 70  2120 2120 ALA ALA B . n 
B 1 71  THR 71  2121 2121 THR THR B . n 
B 1 72  ALA 72  2122 2122 ALA ALA B . n 
B 1 73  ALA 73  2123 2123 ALA ALA B . n 
B 1 74  MET 74  2124 2124 MET MET B . n 
B 1 75  LYS 75  2125 2125 LYS LYS B . n 
B 1 76  ASN 76  2126 2126 ASN ASN B . n 
B 1 77  GLN 77  2127 2127 GLN GLN B . n 
B 1 78  VAL 78  2128 2128 VAL VAL B . n 
B 1 79  ALA 79  2129 2129 ALA ALA B . n 
B 1 80  ARG 80  2130 2130 ARG ARG B . n 
B 1 81  PHE 81  2131 2131 PHE PHE B . n 
B 1 82  ASN 82  2132 2132 ASN ASN B . n 
B 1 83  ASP 83  2133 2133 ASP ASP B . n 
B 1 84  LEU 84  2134 2134 LEU LEU B . n 
B 1 85  ARG 85  2135 2135 ARG ARG B . n 
B 1 86  PHE 86  2136 2136 PHE PHE B . n 
B 1 87  VAL 87  2137 2137 VAL VAL B . n 
B 1 88  GLY 88  2138 2138 GLY GLY B . n 
B 1 89  ARG 89  2139 2139 ARG ARG B . n 
B 1 90  SER 90  2140 2140 SER SER B . n 
B 1 91  GLY 91  2141 2141 GLY GLY B . n 
B 1 92  ARG 92  2142 2142 ARG ARG B . n 
B 1 93  GLY 93  2143 2143 GLY GLY B . n 
B 1 94  LYS 94  2144 2144 LYS LYS B . n 
B 1 95  SER 95  2145 2145 SER SER B . n 
B 1 96  PHE 96  2146 2146 PHE PHE B . n 
B 1 97  THR 97  2147 2147 THR THR B . n 
B 1 98  LEU 98  2148 2148 LEU LEU B . n 
B 1 99  THR 99  2149 2149 THR THR B . n 
B 1 100 ILE 100 2150 2150 ILE ILE B . n 
B 1 101 THR 101 2151 2151 THR THR B . n 
B 1 102 VAL 102 2152 2152 VAL VAL B . n 
B 1 103 PHE 103 2153 2153 PHE PHE B . n 
B 1 104 THR 104 2154 2154 THR THR B . n 
B 1 105 ASN 105 2155 2155 ASN ASN B . n 
B 1 106 PRO 106 2156 2156 PRO PRO B . n 
B 1 107 PRO 107 2157 2157 PRO PRO B . n 
B 1 108 GLN 108 2158 2158 GLN GLN B . n 
B 1 109 VAL 109 2159 2159 VAL VAL B . n 
B 1 110 ALA 110 2160 2160 ALA ALA B . n 
B 1 111 THR 111 2161 2161 THR THR B . n 
B 1 112 TYR 112 2162 2162 TYR TYR B . n 
B 1 113 HIS 113 2163 2163 HIS HIS B . n 
B 1 114 ARG 114 2164 2164 ARG ARG B . n 
B 1 115 ALA 115 2165 2165 ALA ALA B . n 
B 1 116 ILE 116 2166 2166 ILE ILE B . n 
B 1 117 LYS 117 2167 2167 LYS LYS B . n 
B 1 118 ILE 118 2168 2168 ILE ILE B . n 
B 1 119 THR 119 2169 2169 THR THR B . n 
B 1 120 VAL 120 2170 2170 VAL VAL B . n 
B 1 121 ASP 121 2171 2171 ASP ASP B . n 
B 1 122 GLY 122 2172 2172 GLY GLY B . n 
B 1 123 PRO 123 2173 2173 PRO PRO B . n 
B 1 124 ARG 124 2174 ?    ?   ?   B . n 
B 1 125 GLU 125 2175 ?    ?   ?   B . n 
B 1 126 PRO 126 2176 ?    ?   ?   B . n 
B 1 127 ARG 127 2177 ?    ?   ?   B . n 
B 1 128 ARG 128 2178 ?    ?   ?   B . n 
B 1 129 HIS 129 2179 ?    ?   ?   B . n 
B 1 130 ARG 130 2180 ?    ?   ?   B . n 
B 1 131 GLN 131 2181 ?    ?   ?   B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric  1 
2 author_defined_assembly              ?    monomeric  1 
3 software_defined_assembly            PISA tetrameric 4 
4 software_defined_assembly            PISA dimeric    2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,C,H             
2 1   B,D,E,F,G,I       
3 1,2 A,B,C,D,E,F,G,H,I 
4 1,2 B,D,E,F,G,I       
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
3 'ABSA (A^2)' 5810  ? 
3 MORE         -119  ? 
3 'SSA (A^2)'  20950 ? 
4 'ABSA (A^2)' 1860  ? 
4 MORE         -88   ? 
4 'SSA (A^2)'  11440 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z              1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 
1.0000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 10_455 y-1/3,x+1/3,-z+1/3 -0.5000000000 0.8660254038 0.0000000000 -60.6150000000 0.8660254038 
0.5000000000 0.0000000000 34.9960865669 0.0000000000 0.0000000000 -1.0000000000 62.1100000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 3114 ? H HOH . 
2 1 B HOH 3112 ? I HOH . 
3 1 B HOH 3148 ? I HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-11-06 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO      'data reduction' . ? 1 
SCALEPACK  'data scaling'   . ? 2 
MTF/ULTIMA 'model building' . ? 3 
CNS        refinement       . ? 4 
MTF        phasing          . ? 5 
ULTIMA     phasing          . ? 6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 THR A 1065 ? ? -103.10 -166.72 
2 1 ASN A 1082 ? ? 57.27   11.93   
3 1 THR B 2065 ? ? -116.15 -168.58 
4 1 ASP B 2096 ? ? 61.79   84.62   
5 1 SER B 2114 ? ? -164.46 98.15   
6 1 ASP B 2133 ? ? 49.30   70.13   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1051 ? A MET 1   
2  1 Y 1 A VAL 1052 ? A VAL 2   
3  1 Y 1 A GLU 1053 ? A GLU 3   
4  1 Y 1 A VAL 1054 ? A VAL 4   
5  1 Y 1 A LEU 1055 ? A LEU 5   
6  1 Y 1 A ALA 1056 ? A ALA 6   
7  1 Y 1 A ASP 1057 ? A ASP 7   
8  1 Y 1 A HIS 1058 ? A HIS 8   
9  1 Y 1 A PRO 1059 ? A PRO 9   
10 1 Y 1 A GLY 1060 ? A GLY 10  
11 1 Y 1 A GLU 1175 ? A GLU 125 
12 1 Y 1 A PRO 1176 ? A PRO 126 
13 1 Y 1 A ARG 1177 ? A ARG 127 
14 1 Y 1 A ARG 1178 ? A ARG 128 
15 1 Y 1 A HIS 1179 ? A HIS 129 
16 1 Y 1 A ARG 1180 ? A ARG 130 
17 1 Y 1 A GLN 1181 ? A GLN 131 
18 1 Y 1 B MET 2051 ? B MET 1   
19 1 Y 1 B VAL 2052 ? B VAL 2   
20 1 Y 1 B GLU 2053 ? B GLU 3   
21 1 Y 1 B VAL 2054 ? B VAL 4   
22 1 Y 1 B LEU 2055 ? B LEU 5   
23 1 Y 1 B ALA 2056 ? B ALA 6   
24 1 Y 1 B ASP 2057 ? B ASP 7   
25 1 Y 1 B HIS 2058 ? B HIS 8   
26 1 Y 1 B PRO 2059 ? B PRO 9   
27 1 Y 1 B ARG 2174 ? B ARG 124 
28 1 Y 1 B GLU 2175 ? B GLU 125 
29 1 Y 1 B PRO 2176 ? B PRO 126 
30 1 Y 1 B ARG 2177 ? B ARG 127 
31 1 Y 1 B ARG 2178 ? B ARG 128 
32 1 Y 1 B HIS 2179 ? B HIS 129 
33 1 Y 1 B ARG 2180 ? B ARG 130 
34 1 Y 1 B GLN 2181 ? B GLN 131 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION' CL  
3 water          HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 CL  1   4003 4003 CL  CL1 A . 
D 2 CL  1   4001 4001 CL  CL1 B . 
E 2 CL  1   4002 4002 CL  CL1 B . 
F 2 CL  1   4004 4004 CL  CL1 B . 
G 2 CL  1   4005 4005 CL  CL1 B . 
H 3 HOH 1   3001 3001 HOH TIP A . 
H 3 HOH 2   3002 3002 HOH TIP A . 
H 3 HOH 3   3003 3003 HOH TIP A . 
H 3 HOH 4   3004 3004 HOH TIP A . 
H 3 HOH 5   3006 3006 HOH TIP A . 
H 3 HOH 6   3007 3007 HOH TIP A . 
H 3 HOH 7   3008 3008 HOH TIP A . 
H 3 HOH 8   3009 3009 HOH TIP A . 
H 3 HOH 9   3010 3010 HOH TIP A . 
H 3 HOH 10  3011 3011 HOH TIP A . 
H 3 HOH 11  3012 3012 HOH TIP A . 
H 3 HOH 12  3018 3018 HOH TIP A . 
H 3 HOH 13  3022 3022 HOH TIP A . 
H 3 HOH 14  3024 3024 HOH TIP A . 
H 3 HOH 15  3026 3026 HOH TIP A . 
H 3 HOH 16  3027 3027 HOH TIP A . 
H 3 HOH 17  3029 3029 HOH TIP A . 
H 3 HOH 18  3030 3030 HOH TIP A . 
H 3 HOH 19  3031 3031 HOH TIP A . 
H 3 HOH 20  3032 3032 HOH TIP A . 
H 3 HOH 21  3033 3033 HOH TIP A . 
H 3 HOH 22  3034 3034 HOH TIP A . 
H 3 HOH 23  3035 3035 HOH TIP A . 
H 3 HOH 24  3037 3037 HOH TIP A . 
H 3 HOH 25  3038 3038 HOH TIP A . 
H 3 HOH 26  3040 3040 HOH TIP A . 
H 3 HOH 27  3041 3041 HOH TIP A . 
H 3 HOH 28  3042 3042 HOH TIP A . 
H 3 HOH 29  3043 3043 HOH TIP A . 
H 3 HOH 30  3044 3044 HOH TIP A . 
H 3 HOH 31  3045 3045 HOH TIP A . 
H 3 HOH 32  3048 3048 HOH TIP A . 
H 3 HOH 33  3051 3051 HOH TIP A . 
H 3 HOH 34  3054 3054 HOH TIP A . 
H 3 HOH 35  3058 3058 HOH TIP A . 
H 3 HOH 36  3060 3060 HOH TIP A . 
H 3 HOH 37  3071 3071 HOH TIP A . 
H 3 HOH 38  3074 3074 HOH TIP A . 
H 3 HOH 39  3075 3075 HOH TIP A . 
H 3 HOH 40  3077 3077 HOH TIP A . 
H 3 HOH 41  3081 3081 HOH TIP A . 
H 3 HOH 42  3082 3082 HOH TIP A . 
H 3 HOH 43  3083 3083 HOH TIP A . 
H 3 HOH 44  3084 3084 HOH TIP A . 
H 3 HOH 45  3085 3085 HOH TIP A . 
H 3 HOH 46  3089 3089 HOH TIP A . 
H 3 HOH 47  3093 3093 HOH TIP A . 
H 3 HOH 48  3094 3094 HOH TIP A . 
H 3 HOH 49  3095 3095 HOH TIP A . 
H 3 HOH 50  3096 3096 HOH TIP A . 
H 3 HOH 51  3097 3097 HOH TIP A . 
H 3 HOH 52  3099 3099 HOH TIP A . 
H 3 HOH 53  3101 3101 HOH TIP A . 
H 3 HOH 54  3102 3102 HOH TIP A . 
H 3 HOH 55  3103 3103 HOH TIP A . 
H 3 HOH 56  3105 3105 HOH TIP A . 
H 3 HOH 57  3106 3106 HOH TIP A . 
H 3 HOH 58  3107 3107 HOH TIP A . 
H 3 HOH 59  3108 3108 HOH TIP A . 
H 3 HOH 60  3109 3109 HOH TIP A . 
H 3 HOH 61  3110 3110 HOH TIP A . 
H 3 HOH 62  3111 3111 HOH TIP A . 
H 3 HOH 63  3113 3113 HOH TIP A . 
H 3 HOH 64  3114 3114 HOH TIP A . 
H 3 HOH 65  3115 3115 HOH TIP A . 
H 3 HOH 66  3117 3117 HOH TIP A . 
H 3 HOH 67  3118 3118 HOH TIP A . 
H 3 HOH 68  3119 3119 HOH TIP A . 
H 3 HOH 69  3120 3120 HOH TIP A . 
H 3 HOH 70  3121 3121 HOH TIP A . 
H 3 HOH 71  3124 3124 HOH TIP A . 
H 3 HOH 72  3125 3125 HOH TIP A . 
H 3 HOH 73  3126 3126 HOH TIP A . 
H 3 HOH 74  3129 3129 HOH TIP A . 
H 3 HOH 75  3130 3130 HOH TIP A . 
H 3 HOH 76  3131 3131 HOH TIP A . 
H 3 HOH 77  3135 3135 HOH TIP A . 
H 3 HOH 78  3136 3136 HOH TIP A . 
H 3 HOH 79  3137 3137 HOH TIP A . 
H 3 HOH 80  3138 3138 HOH TIP A . 
H 3 HOH 81  3140 3140 HOH TIP A . 
H 3 HOH 82  3141 3141 HOH TIP A . 
H 3 HOH 83  3143 3143 HOH TIP A . 
H 3 HOH 84  3149 3149 HOH TIP A . 
H 3 HOH 85  3150 3150 HOH TIP A . 
H 3 HOH 86  3152 3152 HOH TIP A . 
H 3 HOH 87  3153 3153 HOH TIP A . 
H 3 HOH 88  3154 3154 HOH TIP A . 
H 3 HOH 89  3156 3156 HOH TIP A . 
H 3 HOH 90  3157 3157 HOH TIP A . 
H 3 HOH 91  3159 3159 HOH TIP A . 
H 3 HOH 92  3160 3160 HOH TIP A . 
H 3 HOH 93  3161 3161 HOH TIP A . 
H 3 HOH 94  3162 3162 HOH TIP A . 
H 3 HOH 95  3164 3164 HOH TIP A . 
H 3 HOH 96  3165 3165 HOH TIP A . 
H 3 HOH 97  3166 3166 HOH TIP A . 
H 3 HOH 98  3167 3167 HOH TIP A . 
H 3 HOH 99  3168 3168 HOH TIP A . 
H 3 HOH 100 3169 3169 HOH TIP A . 
H 3 HOH 101 3172 3172 HOH TIP A . 
H 3 HOH 102 3176 3176 HOH TIP A . 
H 3 HOH 103 3178 3178 HOH TIP A . 
H 3 HOH 104 3179 3179 HOH TIP A . 
H 3 HOH 105 3181 3181 HOH TIP A . 
H 3 HOH 106 3182 3182 HOH TIP A . 
H 3 HOH 107 3183 3183 HOH TIP A . 
H 3 HOH 108 3184 3184 HOH TIP A . 
H 3 HOH 109 3185 3185 HOH TIP A . 
H 3 HOH 110 3188 3188 HOH TIP A . 
H 3 HOH 111 3189 3189 HOH TIP A . 
H 3 HOH 112 3192 3192 HOH TIP A . 
H 3 HOH 113 3193 3193 HOH TIP A . 
H 3 HOH 114 3194 3194 HOH TIP A . 
H 3 HOH 115 3195 3195 HOH TIP A . 
H 3 HOH 116 3196 3196 HOH TIP A . 
H 3 HOH 117 3197 3197 HOH TIP A . 
H 3 HOH 118 3198 3198 HOH TIP A . 
H 3 HOH 119 3199 3199 HOH TIP A . 
I 3 HOH 1   3005 3005 HOH TIP B . 
I 3 HOH 2   3013 3013 HOH TIP B . 
I 3 HOH 3   3014 3014 HOH TIP B . 
I 3 HOH 4   3015 3015 HOH TIP B . 
I 3 HOH 5   3016 3016 HOH TIP B . 
I 3 HOH 6   3017 3017 HOH TIP B . 
I 3 HOH 7   3019 3019 HOH TIP B . 
I 3 HOH 8   3020 3020 HOH TIP B . 
I 3 HOH 9   3021 3021 HOH TIP B . 
I 3 HOH 10  3023 3023 HOH TIP B . 
I 3 HOH 11  3025 3025 HOH TIP B . 
I 3 HOH 12  3028 3028 HOH TIP B . 
I 3 HOH 13  3036 3036 HOH TIP B . 
I 3 HOH 14  3039 3039 HOH TIP B . 
I 3 HOH 15  3046 3046 HOH TIP B . 
I 3 HOH 16  3047 3047 HOH TIP B . 
I 3 HOH 17  3049 3049 HOH TIP B . 
I 3 HOH 18  3050 3050 HOH TIP B . 
I 3 HOH 19  3052 3052 HOH TIP B . 
I 3 HOH 20  3053 3053 HOH TIP B . 
I 3 HOH 21  3055 3055 HOH TIP B . 
I 3 HOH 22  3056 3056 HOH TIP B . 
I 3 HOH 23  3057 3057 HOH TIP B . 
I 3 HOH 24  3059 3059 HOH TIP B . 
I 3 HOH 25  3061 3061 HOH TIP B . 
I 3 HOH 26  3062 3062 HOH TIP B . 
I 3 HOH 27  3063 3063 HOH TIP B . 
I 3 HOH 28  3064 3064 HOH TIP B . 
I 3 HOH 29  3065 3065 HOH TIP B . 
I 3 HOH 30  3066 3066 HOH TIP B . 
I 3 HOH 31  3067 3067 HOH TIP B . 
I 3 HOH 32  3068 3068 HOH TIP B . 
I 3 HOH 33  3069 3069 HOH TIP B . 
I 3 HOH 34  3070 3070 HOH TIP B . 
I 3 HOH 35  3072 3072 HOH TIP B . 
I 3 HOH 36  3073 3073 HOH TIP B . 
I 3 HOH 37  3076 3076 HOH TIP B . 
I 3 HOH 38  3078 3078 HOH TIP B . 
I 3 HOH 39  3079 3079 HOH TIP B . 
I 3 HOH 40  3080 3080 HOH TIP B . 
I 3 HOH 41  3086 3086 HOH TIP B . 
I 3 HOH 42  3087 3087 HOH TIP B . 
I 3 HOH 43  3088 3088 HOH TIP B . 
I 3 HOH 44  3090 3090 HOH TIP B . 
I 3 HOH 45  3091 3091 HOH TIP B . 
I 3 HOH 46  3092 3092 HOH TIP B . 
I 3 HOH 47  3098 3098 HOH TIP B . 
I 3 HOH 48  3100 3100 HOH TIP B . 
I 3 HOH 49  3104 3104 HOH TIP B . 
I 3 HOH 50  3112 3112 HOH TIP B . 
I 3 HOH 51  3116 3116 HOH TIP B . 
I 3 HOH 52  3122 3122 HOH TIP B . 
I 3 HOH 53  3123 3123 HOH TIP B . 
I 3 HOH 54  3127 3127 HOH TIP B . 
I 3 HOH 55  3128 3128 HOH TIP B . 
I 3 HOH 56  3132 3132 HOH TIP B . 
I 3 HOH 57  3133 3133 HOH TIP B . 
I 3 HOH 58  3134 3134 HOH TIP B . 
I 3 HOH 59  3139 3139 HOH TIP B . 
I 3 HOH 60  3142 3142 HOH TIP B . 
I 3 HOH 61  3144 3144 HOH TIP B . 
I 3 HOH 62  3145 3145 HOH TIP B . 
I 3 HOH 63  3146 3146 HOH TIP B . 
I 3 HOH 64  3147 3147 HOH TIP B . 
I 3 HOH 65  3148 3148 HOH TIP B . 
I 3 HOH 66  3151 3151 HOH TIP B . 
I 3 HOH 67  3155 3155 HOH TIP B . 
I 3 HOH 68  3158 3158 HOH TIP B . 
I 3 HOH 69  3163 3163 HOH TIP B . 
I 3 HOH 70  3170 3170 HOH TIP B . 
I 3 HOH 71  3171 3171 HOH TIP B . 
I 3 HOH 72  3173 3173 HOH TIP B . 
I 3 HOH 73  3174 3174 HOH TIP B . 
I 3 HOH 74  3175 3175 HOH TIP B . 
I 3 HOH 75  3177 3177 HOH TIP B . 
I 3 HOH 76  3180 3180 HOH TIP B . 
I 3 HOH 77  3186 3186 HOH TIP B . 
I 3 HOH 78  3187 3187 HOH TIP B . 
I 3 HOH 79  3190 3190 HOH TIP B . 
I 3 HOH 80  3191 3191 HOH TIP B . 
I 3 HOH 81  3200 3200 HOH TIP B . 
I 3 HOH 82  3201 3201 HOH TIP B . 
#