data_1LSL
# 
_entry.id   1LSL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1LSL         
RCSB  RCSB016244   
WWPDB D_1000016244 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1LSL 
_pdbx_database_status.recvd_initial_deposition_date   2002-05-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tan, K.'        1 
'Duquette, M.'   2 
'Liu, J.'        3 
'Dong, Y.'       4 
'Zhang, R.'      5 
'Joachimiak, A.' 6 
'Lawler, J.'     7 
'Wang, J.-H.'    8 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of the TSP-1 type 1 repeats: a novel  
layered fold and its biological implication.
;
_citation.journal_abbrev            'J.Cell Biol.' 
_citation.journal_volume            159 
_citation.page_first                373 
_citation.page_last                 382 
_citation.year                      2002 
_citation.journal_id_ASTM           JCLBA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9525 
_citation.journal_id_CSD            2019 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12391027 
_citation.pdbx_database_id_DOI      10.1083/jcb.200206062 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Tan, K.'        1 ? 
primary 'Duquette, M.'   2 ? 
primary 'Liu, J.H.'      3 ? 
primary 'Dong, Y.'       4 ? 
primary 'Zhang, R.'      5 ? 
primary 'Joachimiak, A.' 6 ? 
primary 'Lawler, J.'     7 ? 
primary 'Wang, J.H.'     8 ? 
# 
_cell.entry_id           1LSL 
_cell.length_a           67.63 
_cell.length_b           84.41 
_cell.length_c           37.17 
_cell.angle_alpha        90 
_cell.angle_beta         108.67 
_cell.angle_gamma        90 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
# 
_symmetry.entry_id                         1LSL 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                5 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Thrombospondin 1'   12176.628 1   ? ? 'TSP Type 1 Repeats 2 and 3 (residues 434-546)' ? 
2 non-polymer man beta-L-fucopyranose  164.156   1   ? ? ?                                               ? 
3 non-polymer man alpha-L-fucopyranose 164.156   1   ? ? ?                                               ? 
4 water       nat water                18.015    154 ? ? ?                                               ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;QDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARETKACKKDACPINGGWGPWSPWDICSVTCGGGVQ
KRSRLCNNPTPQFGGKDCVGDVTENQICNKQDC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;QDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARETKACKKDACPINGGWGPWSPWDICSVTCGGGVQ
KRSRLCNNPTPQFGGKDCVGDVTENQICNKQDC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLN n 
1 2   ASP n 
1 3   GLY n 
1 4   GLY n 
1 5   TRP n 
1 6   SER n 
1 7   HIS n 
1 8   TRP n 
1 9   SER n 
1 10  PRO n 
1 11  TRP n 
1 12  SER n 
1 13  SER n 
1 14  CYS n 
1 15  SER n 
1 16  VAL n 
1 17  THR n 
1 18  CYS n 
1 19  GLY n 
1 20  ASP n 
1 21  GLY n 
1 22  VAL n 
1 23  ILE n 
1 24  THR n 
1 25  ARG n 
1 26  ILE n 
1 27  ARG n 
1 28  LEU n 
1 29  CYS n 
1 30  ASN n 
1 31  SER n 
1 32  PRO n 
1 33  SER n 
1 34  PRO n 
1 35  GLN n 
1 36  MET n 
1 37  ASN n 
1 38  GLY n 
1 39  LYS n 
1 40  PRO n 
1 41  CYS n 
1 42  GLU n 
1 43  GLY n 
1 44  GLU n 
1 45  ALA n 
1 46  ARG n 
1 47  GLU n 
1 48  THR n 
1 49  LYS n 
1 50  ALA n 
1 51  CYS n 
1 52  LYS n 
1 53  LYS n 
1 54  ASP n 
1 55  ALA n 
1 56  CYS n 
1 57  PRO n 
1 58  ILE n 
1 59  ASN n 
1 60  GLY n 
1 61  GLY n 
1 62  TRP n 
1 63  GLY n 
1 64  PRO n 
1 65  TRP n 
1 66  SER n 
1 67  PRO n 
1 68  TRP n 
1 69  ASP n 
1 70  ILE n 
1 71  CYS n 
1 72  SER n 
1 73  VAL n 
1 74  THR n 
1 75  CYS n 
1 76  GLY n 
1 77  GLY n 
1 78  GLY n 
1 79  VAL n 
1 80  GLN n 
1 81  LYS n 
1 82  ARG n 
1 83  SER n 
1 84  ARG n 
1 85  LEU n 
1 86  CYS n 
1 87  ASN n 
1 88  ASN n 
1 89  PRO n 
1 90  THR n 
1 91  PRO n 
1 92  GLN n 
1 93  PHE n 
1 94  GLY n 
1 95  GLY n 
1 96  LYS n 
1 97  ASP n 
1 98  CYS n 
1 99  VAL n 
1 100 GLY n 
1 101 ASP n 
1 102 VAL n 
1 103 THR n 
1 104 GLU n 
1 105 ASN n 
1 106 GLN n 
1 107 ILE n 
1 108 CYS n 
1 109 ASN n 
1 110 LYS n 
1 111 GLN n 
1 112 ASP n 
1 113 CYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 THBS1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fruit flies' 
_entity_src_gen.pdbx_host_org_scientific_name      Drosophila 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7215 
_entity_src_gen.host_org_genus                     Drosophila 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 'S2 cells' 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          eukaryotic 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'PMT-BIP-V5-HIS A' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TSP1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARETKACKKDACPINGGWGPWSPWDICSVTCGGGVQ
KRSRLCNNPTPQFGGKDCVGDVTENQICNKQDC
;
_struct_ref.pdbx_align_begin           434 
_struct_ref.pdbx_db_accession          P07996 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1LSL 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 113 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P07996 
_struct_ref_seq.db_align_beg                  434 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  546 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       416 
_struct_ref_seq.pdbx_auth_seq_align_end       528 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE              ?                        'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE             ?                        'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE           ?                        'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'      ?                        'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'           y CYSTEINE             ?                        'C3 H7 N O2 S'   121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose ?                        'C6 H12 O5'      164.156 
FUL 'L-saccharide, beta linking'  . beta-L-fucopyranose  6-DEOXY-BETA-L-GALACTOSE 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE            ?                        'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'      ?                        'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE              ?                        'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE            ?                        'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                ?                        'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE           ?                        'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE              ?                        'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE               ?                        'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE           ?                        'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking'           y PHENYLALANINE        ?                        'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE              ?                        'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE               ?                        'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE            ?                        'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN           ?                        'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking'           y VALINE               ?                        'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1LSL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   65.2 
_exptl_crystal.density_Matthews      3.56 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    
'0.5 M sodium potassium tartrate and 0.1 M sodium acetate, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'ADSC QUANTUM 4' 2000-12-17 ? 
2 CCD 'ADSC QUANTUM 4' 2000-12-17 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M Graphite MAD                 x-ray 
2 1 M Graphite 'SINGLE WAVELENGTH' x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.00803 1.0 
2 1.00808 1.0 
3 1.0596  1.0 
4 1.10000 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'APS BEAMLINE 19-ID' APS 19-ID ? '1.00803, 1.00808, 1.0596' 
2 SYNCHROTRON 'APS BEAMLINE 19-ID' APS 19-ID ? 1.10000                    
# 
_reflns.entry_id                     1LSL 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.9 
_reflns.d_resolution_low             20 
_reflns.number_all                   ? 
_reflns.number_obs                   15123 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.075 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.6 
_reflns.B_iso_Wilson_estimate        26.4 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1,2 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           0.469 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.8 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1LSL 
_refine.ls_d_res_high                            1.90 
_refine.ls_d_res_low                             20.0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     15123 
_refine.ls_number_reflns_obs                     15123 
_refine.ls_number_reflns_R_free                  1533 
_refine.ls_percent_reflns_obs                    99.8 
_refine.ls_R_factor_all                          0.235 
_refine.ls_R_factor_obs                          0.235 
_refine.ls_R_factor_R_work                       0.238 
_refine.ls_R_factor_R_free                       0.282 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 10 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               42.28 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1LSL 
_refine_analyze.Luzzati_coordinate_error_obs    0.321 
_refine_analyze.Luzzati_sigma_a_obs             0.321 
_refine_analyze.Luzzati_d_res_low_obs           3 
_refine_analyze.Luzzati_coordinate_error_free   0.345 
_refine_analyze.Luzzati_sigma_a_free            0.345 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        844 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             154 
_refine_hist.number_atoms_total               1018 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d           0.008  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg        1.631  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d 27.854 ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d 0.825  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        1.99 
_refine_ls_shell.number_reflns_R_work             1545 
_refine_ls_shell.R_factor_R_work                  0.439 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.457 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             168 
_refine_ls_shell.number_reflns_obs                1545 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1LSL 
_struct.title                     'Crystal Structure of the Thrombospondin-1 Type 1 Repeats' 
_struct.pdbx_descriptor           'Thrombospondin 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1LSL 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            'TSP-1, TSR, CELL ADHESION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 14 SG  ? ? ? 1_555 A CYS 51  SG ? ? A CYS 429 A CYS 466  1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf2 disulf ?   ? A CYS 18 SG  ? ? ? 1_555 A CYS 56  SG ? ? A CYS 433 A CYS 471  1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf3 disulf ?   ? A CYS 29 SG  ? ? ? 1_555 A CYS 41  SG ? ? A CYS 444 A CYS 456  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf4 disulf ?   ? A CYS 71 SG  ? ? ? 1_555 A CYS 108 SG ? ? A CYS 486 A CYS 523  1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf5 disulf ?   ? A CYS 75 SG  ? ? ? 1_555 A CYS 113 SG ? ? A CYS 490 A CYS 528  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf6 disulf ?   ? A CYS 86 SG  ? ? ? 1_555 A CYS 98  SG ? ? A CYS 501 A CYS 513  1_555 ? ? ? ? ? ? ? 2.046 ? ?               
covale1 covale one ? A THR 17 OG1 ? ? ? 1_555 B FUL .   C1 ? ? A THR 432 A FUL 1432 1_555 ? ? ? ? ? ? ? 1.397 ? ?               
covale2 covale one ? A THR 74 OG1 ? ? ? 1_555 C FUC .   C1 ? ? A THR 489 A FUC 1489 1_555 ? ? ? ? ? ? ? 1.408 ? O-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 31 A . ? SER 446 A PRO 32 A ? PRO 447 A 1 -0.07 
2 ASN 88 A . ? ASN 503 A PRO 89 A ? PRO 504 A 1 0.29  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASP A 20  ? ILE A 26  ? ASP A 435 ILE A 441 
A 2 ARG A 46  ? LYS A 52  ? ARG A 461 LYS A 467 
B 1 GLY A 78  ? SER A 83  ? GLY A 493 SER A 498 
B 2 THR A 103 ? CYS A 108 ? THR A 518 CYS A 523 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 23 ? N ILE A 438 O LYS A 49  ? O LYS A 464 
B 1 2 N ARG A 82 ? N ARG A 497 O GLU A 104 ? O GLU A 519 
# 
_database_PDB_matrix.entry_id          1LSL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1LSL 
_atom_sites.fract_transf_matrix[1][1]   0.014786 
_atom_sites.fract_transf_matrix[1][2]   -0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004996 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011847 
_atom_sites.fract_transf_matrix[2][3]   -0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.028398 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLN A 1 1   ? 10.280 26.469  -14.290 1.00 47.73  ? 416  GLN A N   1 
ATOM   2    C CA  . GLN A 1 1   ? 10.079 27.551  -13.286 1.00 47.08  ? 416  GLN A CA  1 
ATOM   3    C C   . GLN A 1 1   ? 10.897 28.804  -13.594 1.00 41.56  ? 416  GLN A C   1 
ATOM   4    O O   . GLN A 1 1   ? 12.108 28.851  -13.347 1.00 37.46  ? 416  GLN A O   1 
ATOM   5    C CB  . GLN A 1 1   ? 10.432 27.054  -11.879 1.00 52.74  ? 416  GLN A CB  1 
ATOM   6    C CG  . GLN A 1 1   ? 10.206 28.092  -10.784 1.00 59.88  ? 416  GLN A CG  1 
ATOM   7    C CD  . GLN A 1 1   ? 8.755  28.558  -10.702 1.00 68.82  ? 416  GLN A CD  1 
ATOM   8    O OE1 . GLN A 1 1   ? 8.086  28.370  -9.679  1.00 74.12  ? 416  GLN A OE1 1 
ATOM   9    N NE2 . GLN A 1 1   ? 8.263  29.169  -11.779 1.00 71.79  ? 416  GLN A NE2 1 
ATOM   10   N N   . ASP A 1 2   ? 10.215 29.810  -14.141 1.00 36.85  ? 417  ASP A N   1 
ATOM   11   C CA  . ASP A 1 2   ? 10.828 31.091  -14.480 1.00 34.23  ? 417  ASP A CA  1 
ATOM   12   C C   . ASP A 1 2   ? 11.133 31.824  -13.177 1.00 32.66  ? 417  ASP A C   1 
ATOM   13   O O   . ASP A 1 2   ? 10.477 31.581  -12.163 1.00 34.39  ? 417  ASP A O   1 
ATOM   14   C CB  . ASP A 1 2   ? 9.864  31.938  -15.309 1.00 34.20  ? 417  ASP A CB  1 
ATOM   15   C CG  . ASP A 1 2   ? 9.860  31.553  -16.776 1.00 41.40  ? 417  ASP A CG  1 
ATOM   16   O OD1 . ASP A 1 2   ? 10.768 30.790  -17.192 1.00 39.43  ? 417  ASP A OD1 1 
ATOM   17   O OD2 . ASP A 1 2   ? 8.950  32.016  -17.510 1.00 41.87  ? 417  ASP A OD2 1 
ATOM   18   N N   . GLY A 1 3   ? 12.120 32.714  -13.201 1.00 27.51  ? 418  GLY A N   1 
ATOM   19   C CA  . GLY A 1 3   ? 12.459 33.457  -12.003 1.00 23.55  ? 418  GLY A CA  1 
ATOM   20   C C   . GLY A 1 3   ? 11.491 34.605  -11.743 1.00 24.28  ? 418  GLY A C   1 
ATOM   21   O O   . GLY A 1 3   ? 10.896 35.154  -12.674 1.00 22.96  ? 418  GLY A O   1 
ATOM   22   N N   . GLY A 1 4   ? 11.324 34.948  -10.465 1.00 22.44  ? 419  GLY A N   1 
ATOM   23   C CA  . GLY A 1 4   ? 10.458 36.043  -10.064 1.00 19.81  ? 419  GLY A CA  1 
ATOM   24   C C   . GLY A 1 4   ? 11.169 36.934  -9.046  1.00 23.81  ? 419  GLY A C   1 
ATOM   25   O O   . GLY A 1 4   ? 11.843 36.446  -8.135  1.00 23.00  ? 419  GLY A O   1 
ATOM   26   N N   . TRP A 1 5   ? 11.030 38.249  -9.198  1.00 25.15  ? 420  TRP A N   1 
ATOM   27   C CA  . TRP A 1 5   ? 11.664 39.207  -8.294  1.00 23.11  ? 420  TRP A CA  1 
ATOM   28   C C   . TRP A 1 5   ? 11.000 39.218  -6.929  1.00 23.88  ? 420  TRP A C   1 
ATOM   29   O O   . TRP A 1 5   ? 9.782  39.078  -6.815  1.00 24.13  ? 420  TRP A O   1 
ATOM   30   C CB  . TRP A 1 5   ? 11.566 40.625  -8.861  1.00 20.19  ? 420  TRP A CB  1 
ATOM   31   C CG  . TRP A 1 5   ? 12.485 40.914  -10.004 1.00 23.41  ? 420  TRP A CG  1 
ATOM   32   C CD1 . TRP A 1 5   ? 12.125 41.256  -11.276 1.00 23.99  ? 420  TRP A CD1 1 
ATOM   33   C CD2 . TRP A 1 5   ? 13.916 40.939  -9.972  1.00 25.84  ? 420  TRP A CD2 1 
ATOM   34   N NE1 . TRP A 1 5   ? 13.244 41.496  -12.037 1.00 25.59  ? 420  TRP A NE1 1 
ATOM   35   C CE2 . TRP A 1 5   ? 14.356 41.309  -11.260 1.00 23.72  ? 420  TRP A CE2 1 
ATOM   36   C CE3 . TRP A 1 5   ? 14.871 40.688  -8.978  1.00 21.79  ? 420  TRP A CE3 1 
ATOM   37   C CZ2 . TRP A 1 5   ? 15.701 41.430  -11.580 1.00 23.15  ? 420  TRP A CZ2 1 
ATOM   38   C CZ3 . TRP A 1 5   ? 16.211 40.810  -9.296  1.00 25.58  ? 420  TRP A CZ3 1 
ATOM   39   C CH2 . TRP A 1 5   ? 16.613 41.176  -10.588 1.00 27.90  ? 420  TRP A CH2 1 
ATOM   40   N N   . SER A 1 6   ? 11.807 39.391  -5.893  1.00 22.90  ? 421  SER A N   1 
ATOM   41   C CA  . SER A 1 6   ? 11.288 39.489  -4.539  1.00 19.94  ? 421  SER A CA  1 
ATOM   42   C C   . SER A 1 6   ? 10.787 40.924  -4.449  1.00 19.55  ? 421  SER A C   1 
ATOM   43   O O   . SER A 1 6   ? 10.955 41.708  -5.384  1.00 21.85  ? 421  SER A O   1 
ATOM   44   C CB  . SER A 1 6   ? 12.413 39.316  -3.528  1.00 21.67  ? 421  SER A CB  1 
ATOM   45   O OG  . SER A 1 6   ? 13.271 40.449  -3.571  1.00 24.29  ? 421  SER A OG  1 
ATOM   46   N N   . HIS A 1 7   ? 10.160 41.274  -3.336  1.00 19.91  ? 422  HIS A N   1 
ATOM   47   C CA  . HIS A 1 7   ? 9.709  42.637  -3.159  1.00 18.59  ? 422  HIS A CA  1 
ATOM   48   C C   . HIS A 1 7   ? 10.971 43.464  -2.944  1.00 21.55  ? 422  HIS A C   1 
ATOM   49   O O   . HIS A 1 7   ? 12.018 42.933  -2.549  1.00 21.64  ? 422  HIS A O   1 
ATOM   50   C CB  . HIS A 1 7   ? 8.837  42.747  -1.925  1.00 19.77  ? 422  HIS A CB  1 
ATOM   51   C CG  . HIS A 1 7   ? 7.404  42.429  -2.177  1.00 22.51  ? 422  HIS A CG  1 
ATOM   52   N ND1 . HIS A 1 7   ? 6.918  41.144  -2.181  1.00 25.85  ? 422  HIS A ND1 1 
ATOM   53   C CD2 . HIS A 1 7   ? 6.344  43.238  -2.414  1.00 24.40  ? 422  HIS A CD2 1 
ATOM   54   C CE1 . HIS A 1 7   ? 5.618  41.169  -2.408  1.00 26.29  ? 422  HIS A CE1 1 
ATOM   55   N NE2 . HIS A 1 7   ? 5.246  42.428  -2.553  1.00 22.75  ? 422  HIS A NE2 1 
ATOM   56   N N   . TRP A 1 8   ? 10.879 44.760  -3.195  1.00 22.35  ? 423  TRP A N   1 
ATOM   57   C CA  . TRP A 1 8   ? 12.029 45.622  -2.998  1.00 24.28  ? 423  TRP A CA  1 
ATOM   58   C C   . TRP A 1 8   ? 12.342 45.713  -1.510  1.00 24.25  ? 423  TRP A C   1 
ATOM   59   O O   . TRP A 1 8   ? 11.453 45.585  -0.668  1.00 25.11  ? 423  TRP A O   1 
ATOM   60   C CB  . TRP A 1 8   ? 11.733 47.023  -3.509  1.00 23.81  ? 423  TRP A CB  1 
ATOM   61   C CG  . TRP A 1 8   ? 11.838 47.174  -4.977  1.00 24.61  ? 423  TRP A CG  1 
ATOM   62   C CD1 . TRP A 1 8   ? 10.812 47.379  -5.851  1.00 23.67  ? 423  TRP A CD1 1 
ATOM   63   C CD2 . TRP A 1 8   ? 13.038 47.165  -5.757  1.00 25.47  ? 423  TRP A CD2 1 
ATOM   64   N NE1 . TRP A 1 8   ? 11.295 47.499  -7.130  1.00 23.91  ? 423  TRP A NE1 1 
ATOM   65   C CE2 . TRP A 1 8   ? 12.659 47.373  -7.103  1.00 24.20  ? 423  TRP A CE2 1 
ATOM   66   C CE3 . TRP A 1 8   ? 14.396 47.003  -5.453  1.00 26.43  ? 423  TRP A CE3 1 
ATOM   67   C CZ2 . TRP A 1 8   ? 13.591 47.423  -8.148  1.00 26.24  ? 423  TRP A CZ2 1 
ATOM   68   C CZ3 . TRP A 1 8   ? 15.328 47.054  -6.493  1.00 27.45  ? 423  TRP A CZ3 1 
ATOM   69   C CH2 . TRP A 1 8   ? 14.917 47.263  -7.825  1.00 24.73  ? 423  TRP A CH2 1 
ATOM   70   N N   . SER A 1 9   ? 13.615 45.928  -1.197  1.00 26.44  ? 424  SER A N   1 
ATOM   71   C CA  . SER A 1 9   ? 14.051 46.102  0.183   1.00 25.26  ? 424  SER A CA  1 
ATOM   72   C C   . SER A 1 9   ? 13.735 47.548  0.514   1.00 27.09  ? 424  SER A C   1 
ATOM   73   O O   . SER A 1 9   ? 13.442 48.343  -0.388  1.00 29.74  ? 424  SER A O   1 
ATOM   74   C CB  . SER A 1 9   ? 15.558 45.941  0.294   1.00 25.55  ? 424  SER A CB  1 
ATOM   75   O OG  . SER A 1 9   ? 16.202 47.157  -0.083  1.00 24.90  ? 424  SER A OG  1 
ATOM   76   N N   . PRO A 1 10  ? 13.741 47.906  1.811   1.00 28.05  ? 425  PRO A N   1 
ATOM   77   C CA  . PRO A 1 10  ? 13.458 49.317  2.117   1.00 27.52  ? 425  PRO A CA  1 
ATOM   78   C C   . PRO A 1 10  ? 14.628 50.146  1.531   1.00 26.41  ? 425  PRO A C   1 
ATOM   79   O O   . PRO A 1 10  ? 15.714 49.606  1.280   1.00 25.40  ? 425  PRO A O   1 
ATOM   80   C CB  . PRO A 1 10  ? 13.423 49.361  3.653   1.00 24.35  ? 425  PRO A CB  1 
ATOM   81   C CG  . PRO A 1 10  ? 13.265 47.935  4.091   1.00 22.96  ? 425  PRO A CG  1 
ATOM   82   C CD  . PRO A 1 10  ? 13.940 47.101  3.029   1.00 23.12  ? 425  PRO A CD  1 
ATOM   83   N N   . TRP A 1 11  ? 14.405 51.434  1.289   1.00 30.55  ? 426  TRP A N   1 
ATOM   84   C CA  . TRP A 1 11  ? 15.456 52.307  0.748   1.00 31.49  ? 426  TRP A CA  1 
ATOM   85   C C   . TRP A 1 11  ? 16.489 52.571  1.834   1.00 31.75  ? 426  TRP A C   1 
ATOM   86   O O   . TRP A 1 11  ? 16.137 52.787  2.992   1.00 31.23  ? 426  TRP A O   1 
ATOM   87   C CB  . TRP A 1 11  ? 14.885 53.664  0.318   1.00 31.02  ? 426  TRP A CB  1 
ATOM   88   C CG  . TRP A 1 11  ? 14.185 53.684  -1.000  1.00 26.58  ? 426  TRP A CG  1 
ATOM   89   C CD1 . TRP A 1 11  ? 12.839 53.682  -1.205  1.00 26.28  ? 426  TRP A CD1 1 
ATOM   90   C CD2 . TRP A 1 11  ? 14.789 53.789  -2.295  1.00 28.05  ? 426  TRP A CD2 1 
ATOM   91   N NE1 . TRP A 1 11  ? 12.563 53.782  -2.546  1.00 29.03  ? 426  TRP A NE1 1 
ATOM   92   C CE2 . TRP A 1 11  ? 13.744 53.848  -3.238  1.00 28.42  ? 426  TRP A CE2 1 
ATOM   93   C CE3 . TRP A 1 11  ? 16.113 53.836  -2.749  1.00 28.83  ? 426  TRP A CE3 1 
ATOM   94   C CZ2 . TRP A 1 11  ? 13.980 53.957  -4.615  1.00 27.95  ? 426  TRP A CZ2 1 
ATOM   95   C CZ3 . TRP A 1 11  ? 16.347 53.941  -4.121  1.00 28.87  ? 426  TRP A CZ3 1 
ATOM   96   C CH2 . TRP A 1 11  ? 15.284 54.002  -5.034  1.00 27.11  ? 426  TRP A CH2 1 
ATOM   97   N N   . SER A 1 12  ? 17.764 52.541  1.470   1.00 34.09  ? 427  SER A N   1 
ATOM   98   C CA  . SER A 1 12  ? 18.809 52.828  2.440   1.00 33.21  ? 427  SER A CA  1 
ATOM   99   C C   . SER A 1 12  ? 18.748 54.332  2.714   1.00 33.62  ? 427  SER A C   1 
ATOM   100  O O   . SER A 1 12  ? 17.981 55.057  2.078   1.00 32.89  ? 427  SER A O   1 
ATOM   101  C CB  . SER A 1 12  ? 20.175 52.463  1.872   1.00 30.66  ? 427  SER A CB  1 
ATOM   102  O OG  . SER A 1 12  ? 20.603 53.439  0.940   1.00 34.31  ? 427  SER A OG  1 
ATOM   103  N N   . SER A 1 13  ? 19.532 54.798  3.674   1.00 34.99  ? 428  SER A N   1 
ATOM   104  C CA  . SER A 1 13  ? 19.558 56.219  3.985   1.00 35.08  ? 428  SER A CA  1 
ATOM   105  C C   . SER A 1 13  ? 20.536 56.871  3.013   1.00 33.39  ? 428  SER A C   1 
ATOM   106  O O   . SER A 1 13  ? 21.282 56.180  2.311   1.00 32.61  ? 428  SER A O   1 
ATOM   107  C CB  . SER A 1 13  ? 20.021 56.433  5.424   1.00 34.83  ? 428  SER A CB  1 
ATOM   108  O OG  . SER A 1 13  ? 21.229 55.731  5.661   1.00 43.43  ? 428  SER A OG  1 
ATOM   109  N N   . CYS A 1 14  ? 20.534 58.197  2.968   1.00 35.54  ? 429  CYS A N   1 
ATOM   110  C CA  . CYS A 1 14  ? 21.427 58.927  2.074   1.00 35.17  ? 429  CYS A CA  1 
ATOM   111  C C   . CYS A 1 14  ? 22.889 58.531  2.299   1.00 33.90  ? 429  CYS A C   1 
ATOM   112  O O   . CYS A 1 14  ? 23.317 58.357  3.437   1.00 36.99  ? 429  CYS A O   1 
ATOM   113  C CB  . CYS A 1 14  ? 21.243 60.429  2.289   1.00 38.46  ? 429  CYS A CB  1 
ATOM   114  S SG  . CYS A 1 14  ? 21.841 61.475  0.922   1.00 49.96  ? 429  CYS A SG  1 
ATOM   115  N N   . SER A 1 15  ? 23.648 58.380  1.212   1.00 32.14  ? 430  SER A N   1 
ATOM   116  C CA  . SER A 1 15  ? 25.061 58.006  1.292   1.00 30.01  ? 430  SER A CA  1 
ATOM   117  C C   . SER A 1 15  ? 25.916 59.104  1.923   1.00 31.37  ? 430  SER A C   1 
ATOM   118  O O   . SER A 1 15  ? 27.074 58.875  2.287   1.00 33.57  ? 430  SER A O   1 
ATOM   119  C CB  . SER A 1 15  ? 25.611 57.690  -0.100  1.00 29.71  ? 430  SER A CB  1 
ATOM   120  O OG  . SER A 1 15  ? 25.432 58.792  -0.977  1.00 33.84  ? 430  SER A OG  1 
ATOM   121  N N   . VAL A 1 16  ? 25.350 60.299  2.041   1.00 30.15  ? 431  VAL A N   1 
ATOM   122  C CA  . VAL A 1 16  ? 26.066 61.419  2.635   1.00 30.33  ? 431  VAL A CA  1 
ATOM   123  C C   . VAL A 1 16  ? 25.164 62.169  3.606   1.00 31.84  ? 431  VAL A C   1 
ATOM   124  O O   . VAL A 1 16  ? 23.934 62.052  3.559   1.00 31.57  ? 431  VAL A O   1 
ATOM   125  C CB  . VAL A 1 16  ? 26.574 62.415  1.557   1.00 28.31  ? 431  VAL A CB  1 
ATOM   126  C CG1 . VAL A 1 16  ? 27.552 61.720  0.627   1.00 27.32  ? 431  VAL A CG1 1 
ATOM   127  C CG2 . VAL A 1 16  ? 25.402 62.996  0.783   1.00 22.05  ? 431  VAL A CG2 1 
ATOM   128  N N   . THR A 1 17  ? 25.786 62.942  4.489   1.00 31.98  ? 432  THR A N   1 
ATOM   129  C CA  . THR A 1 17  ? 25.044 63.708  5.466   1.00 34.23  ? 432  THR A CA  1 
ATOM   130  C C   . THR A 1 17  ? 24.943 65.150  5.013   1.00 33.07  ? 432  THR A C   1 
ATOM   131  O O   . THR A 1 17  ? 24.211 65.939  5.594   1.00 35.06  ? 432  THR A O   1 
ATOM   132  C CB  . THR A 1 17  ? 25.718 63.658  6.841   1.00 39.46  ? 432  THR A CB  1 
ATOM   133  O OG1 . THR A 1 17  ? 27.131 63.824  6.682   1.00 50.09  ? 432  THR A OG1 1 
ATOM   134  C CG2 . THR A 1 17  ? 25.443 62.321  7.523   1.00 39.76  ? 432  THR A CG2 1 
ATOM   135  N N   . CYS A 1 18  ? 25.686 65.497  3.973   1.00 30.31  ? 433  CYS A N   1 
ATOM   136  C CA  . CYS A 1 18  ? 25.645 66.851  3.446   1.00 30.76  ? 433  CYS A CA  1 
ATOM   137  C C   . CYS A 1 18  ? 26.008 66.758  1.982   1.00 29.09  ? 433  CYS A C   1 
ATOM   138  O O   . CYS A 1 18  ? 26.702 65.833  1.571   1.00 30.31  ? 433  CYS A O   1 
ATOM   139  C CB  . CYS A 1 18  ? 26.634 67.760  4.189   1.00 32.12  ? 433  CYS A CB  1 
ATOM   140  S SG  . CYS A 1 18  ? 28.370 67.201  4.175   1.00 41.12  ? 433  CYS A SG  1 
ATOM   141  N N   . GLY A 1 19  ? 25.532 67.705  1.189   1.00 25.22  ? 434  GLY A N   1 
ATOM   142  C CA  . GLY A 1 19  ? 25.842 67.662  -0.221  1.00 27.20  ? 434  GLY A CA  1 
ATOM   143  C C   . GLY A 1 19  ? 24.990 66.613  -0.897  1.00 31.37  ? 434  GLY A C   1 
ATOM   144  O O   . GLY A 1 19  ? 23.960 66.214  -0.360  1.00 29.93  ? 434  GLY A O   1 
ATOM   145  N N   . ASP A 1 20  ? 25.435 66.151  -2.066  1.00 36.94  ? 435  ASP A N   1 
ATOM   146  C CA  . ASP A 1 20  ? 24.707 65.155  -2.854  1.00 37.32  ? 435  ASP A CA  1 
ATOM   147  C C   . ASP A 1 20  ? 25.221 63.708  -2.772  1.00 35.08  ? 435  ASP A C   1 
ATOM   148  O O   . ASP A 1 20  ? 26.420 63.446  -2.790  1.00 32.74  ? 435  ASP A O   1 
ATOM   149  C CB  . ASP A 1 20  ? 24.672 65.592  -4.322  1.00 41.99  ? 435  ASP A CB  1 
ATOM   150  C CG  . ASP A 1 20  ? 24.143 67.006  -4.500  1.00 48.98  ? 435  ASP A CG  1 
ATOM   151  O OD1 . ASP A 1 20  ? 23.281 67.433  -3.701  1.00 50.99  ? 435  ASP A OD1 1 
ATOM   152  O OD2 . ASP A 1 20  ? 24.590 67.695  -5.444  1.00 55.22  ? 435  ASP A OD2 1 
ATOM   153  N N   . GLY A 1 21  ? 24.286 62.771  -2.686  1.00 38.23  ? 436  GLY A N   1 
ATOM   154  C CA  . GLY A 1 21  ? 24.634 61.362  -2.623  1.00 38.48  ? 436  GLY A CA  1 
ATOM   155  C C   . GLY A 1 21  ? 23.514 60.548  -3.251  1.00 40.50  ? 436  GLY A C   1 
ATOM   156  O O   . GLY A 1 21  ? 22.800 61.048  -4.136  1.00 37.07  ? 436  GLY A O   1 
ATOM   157  N N   . VAL A 1 22  ? 23.343 59.306  -2.798  1.00 39.80  ? 437  VAL A N   1 
ATOM   158  C CA  . VAL A 1 22  ? 22.283 58.443  -3.330  1.00 41.64  ? 437  VAL A CA  1 
ATOM   159  C C   . VAL A 1 22  ? 21.695 57.454  -2.322  1.00 40.83  ? 437  VAL A C   1 
ATOM   160  O O   . VAL A 1 22  ? 22.382 57.011  -1.397  1.00 40.86  ? 437  VAL A O   1 
ATOM   161  C CB  . VAL A 1 22  ? 22.768 57.601  -4.552  1.00 39.94  ? 437  VAL A CB  1 
ATOM   162  C CG1 . VAL A 1 22  ? 23.187 58.512  -5.692  1.00 41.84  ? 437  VAL A CG1 1 
ATOM   163  C CG2 . VAL A 1 22  ? 23.906 56.681  -4.143  1.00 37.77  ? 437  VAL A CG2 1 
ATOM   164  N N   . ILE A 1 23  ? 20.412 57.132  -2.503  1.00 43.54  ? 438  ILE A N   1 
ATOM   165  C CA  . ILE A 1 23  ? 19.731 56.132  -1.676  1.00 40.79  ? 438  ILE A CA  1 
ATOM   166  C C   . ILE A 1 23  ? 19.582 54.915  -2.588  1.00 39.69  ? 438  ILE A C   1 
ATOM   167  O O   . ILE A 1 23  ? 19.233 55.045  -3.759  1.00 40.02  ? 438  ILE A O   1 
ATOM   168  C CB  . ILE A 1 23  ? 18.320 56.565  -1.207  1.00 39.00  ? 438  ILE A CB  1 
ATOM   169  C CG1 . ILE A 1 23  ? 17.552 57.221  -2.345  1.00 37.24  ? 438  ILE A CG1 1 
ATOM   170  C CG2 . ILE A 1 23  ? 18.427 57.493  -0.019  1.00 39.00  ? 438  ILE A CG2 1 
ATOM   171  C CD1 . ILE A 1 23  ? 16.089 57.389  -2.039  1.00 34.89  ? 438  ILE A CD1 1 
ATOM   172  N N   . THR A 1 24  ? 19.871 53.739  -2.050  1.00 38.71  ? 439  THR A N   1 
ATOM   173  C CA  . THR A 1 24  ? 19.791 52.507  -2.815  1.00 38.17  ? 439  THR A CA  1 
ATOM   174  C C   . THR A 1 24  ? 18.774 51.539  -2.211  1.00 39.05  ? 439  THR A C   1 
ATOM   175  O O   . THR A 1 24  ? 18.398 51.653  -1.036  1.00 37.11  ? 439  THR A O   1 
ATOM   176  C CB  . THR A 1 24  ? 21.173 51.831  -2.869  1.00 36.93  ? 439  THR A CB  1 
ATOM   177  O OG1 . THR A 1 24  ? 22.133 52.783  -3.338  1.00 41.39  ? 439  THR A OG1 1 
ATOM   178  C CG2 . THR A 1 24  ? 21.164 50.616  -3.797  1.00 36.44  ? 439  THR A CG2 1 
ATOM   179  N N   . ARG A 1 25  ? 18.318 50.600  -3.034  1.00 36.92  ? 440  ARG A N   1 
ATOM   180  C CA  . ARG A 1 25  ? 17.371 49.586  -2.605  1.00 35.19  ? 440  ARG A CA  1 
ATOM   181  C C   . ARG A 1 25  ? 17.608 48.364  -3.498  1.00 37.09  ? 440  ARG A C   1 
ATOM   182  O O   . ARG A 1 25  ? 17.974 48.514  -4.669  1.00 36.25  ? 440  ARG A O   1 
ATOM   183  C CB  . ARG A 1 25  ? 15.943 50.131  -2.719  1.00 34.13  ? 440  ARG A CB  1 
ATOM   184  C CG  . ARG A 1 25  ? 15.148 49.595  -3.863  1.00 36.09  ? 440  ARG A CG  1 
ATOM   185  C CD  . ARG A 1 25  ? 14.256 50.650  -4.446  1.00 32.32  ? 440  ARG A CD  1 
ATOM   186  N NE  . ARG A 1 25  ? 12.903 50.560  -3.925  1.00 35.36  ? 440  ARG A NE  1 
ATOM   187  C CZ  . ARG A 1 25  ? 11.807 50.657  -4.670  1.00 29.13  ? 440  ARG A CZ  1 
ATOM   188  N NH1 . ARG A 1 25  ? 11.905 50.848  -5.976  1.00 31.04  ? 440  ARG A NH1 1 
ATOM   189  N NH2 . ARG A 1 25  ? 10.613 50.565  -4.105  1.00 31.74  ? 440  ARG A NH2 1 
ATOM   190  N N   . ILE A 1 26  ? 17.430 47.160  -2.951  1.00 35.26  ? 441  ILE A N   1 
ATOM   191  C CA  . ILE A 1 26  ? 17.672 45.948  -3.736  1.00 33.53  ? 441  ILE A CA  1 
ATOM   192  C C   . ILE A 1 26  ? 16.543 44.905  -3.825  1.00 30.01  ? 441  ILE A C   1 
ATOM   193  O O   . ILE A 1 26  ? 15.614 44.886  -3.022  1.00 25.73  ? 441  ILE A O   1 
ATOM   194  C CB  . ILE A 1 26  ? 18.963 45.218  -3.258  1.00 35.27  ? 441  ILE A CB  1 
ATOM   195  C CG1 . ILE A 1 26  ? 18.882 44.938  -1.762  1.00 31.79  ? 441  ILE A CG1 1 
ATOM   196  C CG2 . ILE A 1 26  ? 20.201 46.041  -3.605  1.00 36.42  ? 441  ILE A CG2 1 
ATOM   197  C CD1 . ILE A 1 26  ? 19.014 43.473  -1.432  1.00 36.92  ? 441  ILE A CD1 1 
ATOM   198  N N   . ARG A 1 27  ? 16.682 44.040  -4.825  1.00 27.45  ? 442  ARG A N   1 
ATOM   199  C CA  . ARG A 1 27  ? 15.758 42.966  -5.148  1.00 29.22  ? 442  ARG A CA  1 
ATOM   200  C C   . ARG A 1 27  ? 16.610 41.724  -5.290  1.00 28.59  ? 442  ARG A C   1 
ATOM   201  O O   . ARG A 1 27  ? 17.804 41.816  -5.563  1.00 27.78  ? 442  ARG A O   1 
ATOM   202  C CB  . ARG A 1 27  ? 15.192 43.165  -6.535  1.00 34.12  ? 442  ARG A CB  1 
ATOM   203  C CG  . ARG A 1 27  ? 13.867 43.771  -6.708  1.00 36.99  ? 442  ARG A CG  1 
ATOM   204  C CD  . ARG A 1 27  ? 13.858 44.140  -8.167  1.00 34.00  ? 442  ARG A CD  1 
ATOM   205  N NE  . ARG A 1 27  ? 12.534 44.304  -8.736  1.00 42.00  ? 442  ARG A NE  1 
ATOM   206  C CZ  . ARG A 1 27  ? 12.328 44.614  -10.009 1.00 39.88  ? 442  ARG A CZ  1 
ATOM   207  N NH1 . ARG A 1 27  ? 13.362 44.787  -10.832 1.00 33.59  ? 442  ARG A NH1 1 
ATOM   208  N NH2 . ARG A 1 27  ? 11.089 44.746  -10.456 1.00 47.78  ? 442  ARG A NH2 1 
ATOM   209  N N   . LEU A 1 28  ? 15.968 40.567  -5.180  1.00 28.26  ? 443  LEU A N   1 
ATOM   210  C CA  . LEU A 1 28  ? 16.639 39.286  -5.357  1.00 25.96  ? 443  LEU A CA  1 
ATOM   211  C C   . LEU A 1 28  ? 15.779 38.471  -6.310  1.00 26.12  ? 443  LEU A C   1 
ATOM   212  O O   . LEU A 1 28  ? 14.557 38.544  -6.246  1.00 27.39  ? 443  LEU A O   1 
ATOM   213  C CB  . LEU A 1 28  ? 16.744 38.545  -4.032  1.00 26.10  ? 443  LEU A CB  1 
ATOM   214  C CG  . LEU A 1 28  ? 17.534 39.197  -2.907  1.00 28.91  ? 443  LEU A CG  1 
ATOM   215  C CD1 . LEU A 1 28  ? 17.443 38.312  -1.679  1.00 27.81  ? 443  LEU A CD1 1 
ATOM   216  C CD2 . LEU A 1 28  ? 18.987 39.400  -3.337  1.00 30.25  ? 443  LEU A CD2 1 
ATOM   217  N N   . CYS A 1 29  ? 16.394 37.721  -7.216  1.00 27.58  ? 444  CYS A N   1 
ATOM   218  C CA  . CYS A 1 29  ? 15.612 36.883  -8.125  1.00 28.75  ? 444  CYS A CA  1 
ATOM   219  C C   . CYS A 1 29  ? 15.474 35.558  -7.374  1.00 28.27  ? 444  CYS A C   1 
ATOM   220  O O   . CYS A 1 29  ? 16.153 34.573  -7.686  1.00 30.75  ? 444  CYS A O   1 
ATOM   221  C CB  . CYS A 1 29  ? 16.353 36.680  -9.454  1.00 33.59  ? 444  CYS A CB  1 
ATOM   222  S SG  . CYS A 1 29  ? 15.378 35.825  -10.743 1.00 36.84  ? 444  CYS A SG  1 
ATOM   223  N N   . ASN A 1 30  ? 14.596 35.553  -6.373  1.00 26.57  ? 445  ASN A N   1 
ATOM   224  C CA  . ASN A 1 30  ? 14.393 34.386  -5.517  1.00 24.98  ? 445  ASN A CA  1 
ATOM   225  C C   . ASN A 1 30  ? 12.934 34.069  -5.191  1.00 25.80  ? 445  ASN A C   1 
ATOM   226  O O   . ASN A 1 30  ? 12.664 33.233  -4.324  1.00 26.79  ? 445  ASN A O   1 
ATOM   227  C CB  . ASN A 1 30  ? 15.162 34.595  -4.199  1.00 26.22  ? 445  ASN A CB  1 
ATOM   228  C CG  . ASN A 1 30  ? 14.547 35.690  -3.313  1.00 19.90  ? 445  ASN A CG  1 
ATOM   229  O OD1 . ASN A 1 30  ? 13.555 36.311  -3.667  1.00 22.46  ? 445  ASN A OD1 1 
ATOM   230  N ND2 . ASN A 1 30  ? 15.146 35.918  -2.159  1.00 24.93  ? 445  ASN A ND2 1 
ATOM   231  N N   . SER A 1 31  ? 11.999 34.721  -5.882  1.00 25.15  ? 446  SER A N   1 
ATOM   232  C CA  . SER A 1 31  ? 10.571 34.526  -5.619  1.00 25.22  ? 446  SER A CA  1 
ATOM   233  C C   . SER A 1 31  ? 9.701  34.107  -6.813  1.00 23.53  ? 446  SER A C   1 
ATOM   234  O O   . SER A 1 31  ? 8.770  34.811  -7.182  1.00 25.91  ? 446  SER A O   1 
ATOM   235  C CB  . SER A 1 31  ? 9.994  35.808  -5.008  1.00 22.53  ? 446  SER A CB  1 
ATOM   236  O OG  . SER A 1 31  ? 10.782 36.248  -3.923  1.00 22.04  ? 446  SER A OG  1 
ATOM   237  N N   . PRO A 1 32  ? 9.977  32.943  -7.417  1.00 25.82  ? 447  PRO A N   1 
ATOM   238  C CA  . PRO A 1 32  ? 11.036 31.992  -7.073  1.00 24.43  ? 447  PRO A CA  1 
ATOM   239  C C   . PRO A 1 32  ? 12.286 32.257  -7.903  1.00 25.22  ? 447  PRO A C   1 
ATOM   240  O O   . PRO A 1 32  ? 12.245 32.983  -8.894  1.00 25.19  ? 447  PRO A O   1 
ATOM   241  C CB  . PRO A 1 32  ? 10.416 30.661  -7.448  1.00 20.80  ? 447  PRO A CB  1 
ATOM   242  C CG  . PRO A 1 32  ? 9.676  31.016  -8.725  1.00 24.10  ? 447  PRO A CG  1 
ATOM   243  C CD  . PRO A 1 32  ? 9.180  32.450  -8.555  1.00 20.89  ? 447  PRO A CD  1 
ATOM   244  N N   . SER A 1 33  ? 13.402 31.668  -7.500  1.00 31.71  ? 448  SER A N   1 
ATOM   245  C CA  . SER A 1 33  ? 14.619 31.829  -8.273  1.00 35.95  ? 448  SER A CA  1 
ATOM   246  C C   . SER A 1 33  ? 14.382 30.936  -9.492  1.00 37.76  ? 448  SER A C   1 
ATOM   247  O O   . SER A 1 33  ? 13.553 30.021  -9.449  1.00 35.03  ? 448  SER A O   1 
ATOM   248  C CB  . SER A 1 33  ? 15.846 31.376  -7.464  1.00 38.37  ? 448  SER A CB  1 
ATOM   249  O OG  . SER A 1 33  ? 15.831 29.984  -7.238  1.00 44.33  ? 448  SER A OG  1 
ATOM   250  N N   . PRO A 1 34  ? 15.089 31.190  -10.598 1.00 40.16  ? 449  PRO A N   1 
ATOM   251  C CA  . PRO A 1 34  ? 14.853 30.339  -11.767 1.00 44.67  ? 449  PRO A CA  1 
ATOM   252  C C   . PRO A 1 34  ? 15.430 28.930  -11.634 1.00 52.30  ? 449  PRO A C   1 
ATOM   253  O O   . PRO A 1 34  ? 16.478 28.730  -11.012 1.00 53.47  ? 449  PRO A O   1 
ATOM   254  C CB  . PRO A 1 34  ? 15.493 31.120  -12.907 1.00 42.90  ? 449  PRO A CB  1 
ATOM   255  C CG  . PRO A 1 34  ? 16.574 31.930  -12.245 1.00 37.70  ? 449  PRO A CG  1 
ATOM   256  C CD  . PRO A 1 34  ? 16.121 32.213  -10.842 1.00 37.57  ? 449  PRO A CD  1 
ATOM   257  N N   . GLN A 1 35  ? 14.734 27.952  -12.205 1.00 60.20  ? 450  GLN A N   1 
ATOM   258  C CA  . GLN A 1 35  ? 15.199 26.566  -12.174 1.00 69.79  ? 450  GLN A CA  1 
ATOM   259  C C   . GLN A 1 35  ? 16.158 26.378  -13.353 1.00 73.61  ? 450  GLN A C   1 
ATOM   260  O O   . GLN A 1 35  ? 16.580 27.354  -13.977 1.00 75.67  ? 450  GLN A O   1 
ATOM   261  C CB  . GLN A 1 35  ? 14.018 25.608  -12.319 1.00 72.24  ? 450  GLN A CB  1 
ATOM   262  C CG  . GLN A 1 35  ? 13.161 25.898  -13.540 1.00 80.67  ? 450  GLN A CG  1 
ATOM   263  C CD  . GLN A 1 35  ? 12.375 24.687  -14.011 1.00 85.93  ? 450  GLN A CD  1 
ATOM   264  O OE1 . GLN A 1 35  ? 12.223 23.704  -13.281 1.00 89.01  ? 450  GLN A OE1 1 
ATOM   265  N NE2 . GLN A 1 35  ? 11.867 24.754  -15.240 1.00 87.28  ? 450  GLN A NE2 1 
ATOM   266  N N   . MET A 1 36  ? 16.510 25.132  -13.659 1.00 77.19  ? 451  MET A N   1 
ATOM   267  C CA  . MET A 1 36  ? 17.407 24.877  -14.781 1.00 80.76  ? 451  MET A CA  1 
ATOM   268  C C   . MET A 1 36  ? 16.630 25.105  -16.083 1.00 81.10  ? 451  MET A C   1 
ATOM   269  O O   . MET A 1 36  ? 15.589 24.479  -16.317 1.00 82.66  ? 451  MET A O   1 
ATOM   270  C CB  . MET A 1 36  ? 17.949 23.441  -14.725 1.00 85.59  ? 451  MET A CB  1 
ATOM   271  C CG  . MET A 1 36  ? 19.271 23.289  -13.965 1.00 89.36  ? 451  MET A CG  1 
ATOM   272  S SD  . MET A 1 36  ? 20.638 24.302  -14.608 1.00 96.06  ? 451  MET A SD  1 
ATOM   273  C CE  . MET A 1 36  ? 21.402 23.151  -15.795 1.00 94.14  ? 451  MET A CE  1 
ATOM   274  N N   . ASN A 1 37  ? 17.142 26.014  -16.912 1.00 79.22  ? 452  ASN A N   1 
ATOM   275  C CA  . ASN A 1 37  ? 16.534 26.378  -18.197 1.00 75.71  ? 452  ASN A CA  1 
ATOM   276  C C   . ASN A 1 37  ? 15.257 27.217  -18.067 1.00 69.09  ? 452  ASN A C   1 
ATOM   277  O O   . ASN A 1 37  ? 14.514 27.397  -19.037 1.00 66.80  ? 452  ASN A O   1 
ATOM   278  C CB  . ASN A 1 37  ? 16.263 25.133  -19.053 1.00 80.43  ? 452  ASN A CB  1 
ATOM   279  C CG  . ASN A 1 37  ? 16.960 25.198  -20.407 1.00 84.78  ? 452  ASN A CG  1 
ATOM   280  O OD1 . ASN A 1 37  ? 17.967 25.901  -20.573 1.00 86.14  ? 452  ASN A OD1 1 
ATOM   281  N ND2 . ASN A 1 37  ? 16.428 24.469  -21.384 1.00 87.84  ? 452  ASN A ND2 1 
ATOM   282  N N   . GLY A 1 38  ? 15.012 27.720  -16.861 1.00 61.87  ? 453  GLY A N   1 
ATOM   283  C CA  . GLY A 1 38  ? 13.863 28.573  -16.627 1.00 50.13  ? 453  GLY A CA  1 
ATOM   284  C C   . GLY A 1 38  ? 14.382 29.977  -16.866 1.00 43.54  ? 453  GLY A C   1 
ATOM   285  O O   . GLY A 1 38  ? 15.573 30.228  -16.687 1.00 43.59  ? 453  GLY A O   1 
ATOM   286  N N   . LYS A 1 39  ? 13.511 30.893  -17.269 1.00 39.56  ? 454  LYS A N   1 
ATOM   287  C CA  . LYS A 1 39  ? 13.927 32.264  -17.549 1.00 35.61  ? 454  LYS A CA  1 
ATOM   288  C C   . LYS A 1 39  ? 14.382 33.027  -16.311 1.00 37.80  ? 454  LYS A C   1 
ATOM   289  O O   . LYS A 1 39  ? 13.732 32.980  -15.262 1.00 38.57  ? 454  LYS A O   1 
ATOM   290  C CB  . LYS A 1 39  ? 12.778 33.049  -18.188 1.00 35.51  ? 454  LYS A CB  1 
ATOM   291  C CG  . LYS A 1 39  ? 12.624 32.898  -19.695 1.00 35.32  ? 454  LYS A CG  1 
ATOM   292  C CD  . LYS A 1 39  ? 11.230 33.337  -20.120 1.00 38.27  ? 454  LYS A CD  1 
ATOM   293  C CE  . LYS A 1 39  ? 11.211 33.936  -21.509 1.00 41.40  ? 454  LYS A CE  1 
ATOM   294  N NZ  . LYS A 1 39  ? 10.640 35.315  -21.517 1.00 44.57  ? 454  LYS A NZ  1 
ATOM   295  N N   . PRO A 1 40  ? 15.519 33.734  -16.411 1.00 35.22  ? 455  PRO A N   1 
ATOM   296  C CA  . PRO A 1 40  ? 16.026 34.515  -15.278 1.00 33.20  ? 455  PRO A CA  1 
ATOM   297  C C   . PRO A 1 40  ? 15.167 35.775  -15.181 1.00 32.65  ? 455  PRO A C   1 
ATOM   298  O O   . PRO A 1 40  ? 14.482 36.119  -16.135 1.00 33.99  ? 455  PRO A O   1 
ATOM   299  C CB  . PRO A 1 40  ? 17.469 34.835  -15.675 1.00 33.97  ? 455  PRO A CB  1 
ATOM   300  C CG  . PRO A 1 40  ? 17.745 34.002  -16.920 1.00 30.56  ? 455  PRO A CG  1 
ATOM   301  C CD  . PRO A 1 40  ? 16.422 33.810  -17.567 1.00 33.10  ? 455  PRO A CD  1 
ATOM   302  N N   . CYS A 1 41  ? 15.192 36.461  -14.045 1.00 34.43  ? 456  CYS A N   1 
ATOM   303  C CA  . CYS A 1 41  ? 14.394 37.679  -13.882 1.00 36.95  ? 456  CYS A CA  1 
ATOM   304  C C   . CYS A 1 41  ? 14.847 38.776  -14.841 1.00 39.57  ? 456  CYS A C   1 
ATOM   305  O O   . CYS A 1 41  ? 16.033 38.919  -15.125 1.00 43.54  ? 456  CYS A O   1 
ATOM   306  C CB  . CYS A 1 41  ? 14.513 38.213  -12.455 1.00 38.60  ? 456  CYS A CB  1 
ATOM   307  S SG  . CYS A 1 41  ? 13.864 37.119  -11.164 1.00 33.00  ? 456  CYS A SG  1 
ATOM   308  N N   . GLU A 1 42  ? 13.905 39.566  -15.328 1.00 41.83  ? 457  GLU A N   1 
ATOM   309  C CA  . GLU A 1 42  ? 14.248 40.640  -16.243 1.00 46.92  ? 457  GLU A CA  1 
ATOM   310  C C   . GLU A 1 42  ? 14.218 41.980  -15.516 1.00 45.89  ? 457  GLU A C   1 
ATOM   311  O O   . GLU A 1 42  ? 13.256 42.290  -14.808 1.00 46.80  ? 457  GLU A O   1 
ATOM   312  C CB  . GLU A 1 42  ? 13.261 40.665  -17.407 1.00 53.33  ? 457  GLU A CB  1 
ATOM   313  C CG  . GLU A 1 42  ? 13.908 40.889  -18.756 1.00 64.61  ? 457  GLU A CG  1 
ATOM   314  C CD  . GLU A 1 42  ? 13.714 39.711  -19.688 1.00 68.98  ? 457  GLU A CD  1 
ATOM   315  O OE1 . GLU A 1 42  ? 13.330 38.626  -19.202 1.00 70.76  ? 457  GLU A OE1 1 
ATOM   316  O OE2 . GLU A 1 42  ? 13.944 39.869  -20.905 1.00 74.52  ? 457  GLU A OE2 1 
ATOM   317  N N   . GLY A 1 43  ? 15.270 42.773  -15.686 1.00 44.28  ? 458  GLY A N   1 
ATOM   318  C CA  . GLY A 1 43  ? 15.302 44.070  -15.038 1.00 41.97  ? 458  GLY A CA  1 
ATOM   319  C C   . GLY A 1 43  ? 16.490 44.275  -14.124 1.00 41.48  ? 458  GLY A C   1 
ATOM   320  O O   . GLY A 1 43  ? 17.438 43.491  -14.140 1.00 37.69  ? 458  GLY A O   1 
ATOM   321  N N   . GLU A 1 44  ? 16.427 45.331  -13.320 1.00 44.68  ? 459  GLU A N   1 
ATOM   322  C CA  . GLU A 1 44  ? 17.508 45.668  -12.397 1.00 47.97  ? 459  GLU A CA  1 
ATOM   323  C C   . GLU A 1 44  ? 17.304 45.080  -11.003 1.00 44.66  ? 459  GLU A C   1 
ATOM   324  O O   . GLU A 1 44  ? 16.179 45.029  -10.498 1.00 44.93  ? 459  GLU A O   1 
ATOM   325  C CB  . GLU A 1 44  ? 17.640 47.188  -12.290 1.00 53.18  ? 459  GLU A CB  1 
ATOM   326  C CG  . GLU A 1 44  ? 18.106 47.858  -13.566 1.00 60.60  ? 459  GLU A CG  1 
ATOM   327  C CD  . GLU A 1 44  ? 19.596 47.709  -13.773 1.00 68.35  ? 459  GLU A CD  1 
ATOM   328  O OE1 . GLU A 1 44  ? 20.363 48.332  -13.003 1.00 71.08  ? 459  GLU A OE1 1 
ATOM   329  O OE2 . GLU A 1 44  ? 19.999 46.967  -14.698 1.00 72.29  ? 459  GLU A OE2 1 
ATOM   330  N N   . ALA A 1 45  ? 18.405 44.646  -10.393 1.00 41.26  ? 460  ALA A N   1 
ATOM   331  C CA  . ALA A 1 45  ? 18.384 44.064  -9.057  1.00 40.50  ? 460  ALA A CA  1 
ATOM   332  C C   . ALA A 1 45  ? 18.665 45.119  -7.988  1.00 41.97  ? 460  ALA A C   1 
ATOM   333  O O   . ALA A 1 45  ? 18.477 44.878  -6.797  1.00 41.93  ? 460  ALA A O   1 
ATOM   334  C CB  . ALA A 1 45  ? 19.406 42.948  -8.964  1.00 36.27  ? 460  ALA A CB  1 
ATOM   335  N N   . ARG A 1 46  ? 19.132 46.284  -8.420  1.00 44.71  ? 461  ARG A N   1 
ATOM   336  C CA  . ARG A 1 46  ? 19.426 47.380  -7.503  1.00 45.02  ? 461  ARG A CA  1 
ATOM   337  C C   . ARG A 1 46  ? 18.870 48.650  -8.104  1.00 42.45  ? 461  ARG A C   1 
ATOM   338  O O   . ARG A 1 46  ? 18.802 48.789  -9.320  1.00 43.82  ? 461  ARG A O   1 
ATOM   339  C CB  . ARG A 1 46  ? 20.933 47.534  -7.302  1.00 48.00  ? 461  ARG A CB  1 
ATOM   340  C CG  . ARG A 1 46  ? 21.596 46.324  -6.679  1.00 56.25  ? 461  ARG A CG  1 
ATOM   341  C CD  . ARG A 1 46  ? 23.049 46.612  -6.364  1.00 63.33  ? 461  ARG A CD  1 
ATOM   342  N NE  . ARG A 1 46  ? 23.429 46.136  -5.036  1.00 68.52  ? 461  ARG A NE  1 
ATOM   343  C CZ  . ARG A 1 46  ? 23.968 46.904  -4.094  1.00 71.37  ? 461  ARG A CZ  1 
ATOM   344  N NH1 . ARG A 1 46  ? 24.194 48.192  -4.331  1.00 72.15  ? 461  ARG A NH1 1 
ATOM   345  N NH2 . ARG A 1 46  ? 24.279 46.387  -2.911  1.00 73.65  ? 461  ARG A NH2 1 
ATOM   346  N N   . GLU A 1 47  ? 18.461 49.576  -7.254  1.00 40.29  ? 462  GLU A N   1 
ATOM   347  C CA  . GLU A 1 47  ? 17.929 50.827  -7.739  1.00 39.94  ? 462  GLU A CA  1 
ATOM   348  C C   . GLU A 1 47  ? 18.481 51.986  -6.913  1.00 43.07  ? 462  GLU A C   1 
ATOM   349  O O   . GLU A 1 47  ? 18.088 52.196  -5.762  1.00 43.29  ? 462  GLU A O   1 
ATOM   350  C CB  . GLU A 1 47  ? 16.410 50.797  -7.688  1.00 39.56  ? 462  GLU A CB  1 
ATOM   351  C CG  . GLU A 1 47  ? 15.770 51.949  -8.415  1.00 44.51  ? 462  GLU A CG  1 
ATOM   352  C CD  . GLU A 1 47  ? 14.275 51.999  -8.211  1.00 48.65  ? 462  GLU A CD  1 
ATOM   353  O OE1 . GLU A 1 47  ? 13.732 53.112  -8.036  1.00 56.25  ? 462  GLU A OE1 1 
ATOM   354  O OE2 . GLU A 1 47  ? 13.641 50.925  -8.227  1.00 50.15  ? 462  GLU A OE2 1 
ATOM   355  N N   . THR A 1 48  ? 19.403 52.731  -7.518  1.00 43.63  ? 463  THR A N   1 
ATOM   356  C CA  . THR A 1 48  ? 20.043 53.875  -6.876  1.00 44.51  ? 463  THR A CA  1 
ATOM   357  C C   . THR A 1 48  ? 19.391 55.198  -7.258  1.00 44.47  ? 463  THR A C   1 
ATOM   358  O O   . THR A 1 48  ? 19.444 55.600  -8.416  1.00 47.49  ? 463  THR A O   1 
ATOM   359  C CB  . THR A 1 48  ? 21.528 53.959  -7.265  1.00 43.10  ? 463  THR A CB  1 
ATOM   360  O OG1 . THR A 1 48  ? 22.263 52.943  -6.578  1.00 46.58  ? 463  THR A OG1 1 
ATOM   361  C CG2 . THR A 1 48  ? 22.099 55.307  -6.903  1.00 48.53  ? 463  THR A CG2 1 
ATOM   362  N N   . LYS A 1 49  ? 18.783 55.866  -6.283  1.00 44.65  ? 464  LYS A N   1 
ATOM   363  C CA  . LYS A 1 49  ? 18.142 57.162  -6.499  1.00 45.93  ? 464  LYS A CA  1 
ATOM   364  C C   . LYS A 1 49  ? 19.079 58.245  -5.938  1.00 50.39  ? 464  LYS A C   1 
ATOM   365  O O   . LYS A 1 49  ? 20.137 57.927  -5.397  1.00 51.20  ? 464  LYS A O   1 
ATOM   366  C CB  . LYS A 1 49  ? 16.800 57.204  -5.777  1.00 42.96  ? 464  LYS A CB  1 
ATOM   367  C CG  . LYS A 1 49  ? 15.721 57.961  -6.509  1.00 44.05  ? 464  LYS A CG  1 
ATOM   368  C CD  . LYS A 1 49  ? 14.669 58.471  -5.535  1.00 45.95  ? 464  LYS A CD  1 
ATOM   369  C CE  . LYS A 1 49  ? 13.294 57.880  -5.832  1.00 48.67  ? 464  LYS A CE  1 
ATOM   370  N NZ  . LYS A 1 49  ? 12.400 57.853  -4.633  1.00 47.01  ? 464  LYS A NZ  1 
ATOM   371  N N   . ALA A 1 50  ? 18.709 59.518  -6.058  1.00 52.73  ? 465  ALA A N   1 
ATOM   372  C CA  . ALA A 1 50  ? 19.580 60.582  -5.552  1.00 51.14  ? 465  ALA A CA  1 
ATOM   373  C C   . ALA A 1 50  ? 18.953 61.395  -4.431  1.00 50.69  ? 465  ALA A C   1 
ATOM   374  O O   . ALA A 1 50  ? 17.767 61.724  -4.478  1.00 51.78  ? 465  ALA A O   1 
ATOM   375  C CB  . ALA A 1 50  ? 19.997 61.510  -6.691  1.00 47.00  ? 465  ALA A CB  1 
ATOM   376  N N   . CYS A 1 51  ? 19.764 61.704  -3.421  1.00 49.30  ? 466  CYS A N   1 
ATOM   377  C CA  . CYS A 1 51  ? 19.327 62.508  -2.284  1.00 48.73  ? 466  CYS A CA  1 
ATOM   378  C C   . CYS A 1 51  ? 20.249 63.718  -2.197  1.00 46.72  ? 466  CYS A C   1 
ATOM   379  O O   . CYS A 1 51  ? 21.441 63.633  -2.506  1.00 42.70  ? 466  CYS A O   1 
ATOM   380  C CB  . CYS A 1 51  ? 19.399 61.714  -0.972  1.00 49.22  ? 466  CYS A CB  1 
ATOM   381  S SG  . CYS A 1 51  ? 20.931 60.744  -0.752  1.00 57.93  ? 466  CYS A SG  1 
ATOM   382  N N   . LYS A 1 52  ? 19.688 64.846  -1.786  1.00 45.93  ? 467  LYS A N   1 
ATOM   383  C CA  . LYS A 1 52  ? 20.459 66.071  -1.663  1.00 45.82  ? 467  LYS A CA  1 
ATOM   384  C C   . LYS A 1 52  ? 20.302 66.654  -0.268  1.00 43.25  ? 467  LYS A C   1 
ATOM   385  O O   . LYS A 1 52  ? 19.187 66.932  0.178   1.00 44.28  ? 467  LYS A O   1 
ATOM   386  C CB  . LYS A 1 52  ? 20.003 67.091  -2.710  1.00 49.11  ? 467  LYS A CB  1 
ATOM   387  C CG  . LYS A 1 52  ? 20.447 66.763  -4.127  1.00 57.09  ? 467  LYS A CG  1 
ATOM   388  C CD  . LYS A 1 52  ? 20.319 67.973  -5.041  1.00 63.78  ? 467  LYS A CD  1 
ATOM   389  C CE  . LYS A 1 52  ? 20.283 67.546  -6.505  1.00 68.81  ? 467  LYS A CE  1 
ATOM   390  N NZ  . LYS A 1 52  ? 20.119 68.703  -7.429  1.00 69.42  ? 467  LYS A NZ  1 
ATOM   391  N N   . LYS A 1 53  ? 21.426 66.824  0.419   1.00 39.89  ? 468  LYS A N   1 
ATOM   392  C CA  . LYS A 1 53  ? 21.432 67.384  1.763   1.00 35.58  ? 468  LYS A CA  1 
ATOM   393  C C   . LYS A 1 53  ? 22.050 68.768  1.714   1.00 32.29  ? 468  LYS A C   1 
ATOM   394  O O   . LYS A 1 53  ? 22.544 69.203  0.675   1.00 30.17  ? 468  LYS A O   1 
ATOM   395  C CB  . LYS A 1 53  ? 22.236 66.492  2.709   1.00 35.54  ? 468  LYS A CB  1 
ATOM   396  C CG  . LYS A 1 53  ? 21.990 65.012  2.511   1.00 35.34  ? 468  LYS A CG  1 
ATOM   397  C CD  . LYS A 1 53  ? 20.652 64.618  3.083   1.00 37.83  ? 468  LYS A CD  1 
ATOM   398  C CE  . LYS A 1 53  ? 20.764 63.309  3.842   1.00 43.18  ? 468  LYS A CE  1 
ATOM   399  N NZ  . LYS A 1 53  ? 19.695 63.147  4.869   1.00 46.38  ? 468  LYS A NZ  1 
ATOM   400  N N   . ASP A 1 54  ? 22.024 69.462  2.839   1.00 32.25  ? 469  ASP A N   1 
ATOM   401  C CA  . ASP A 1 54  ? 22.593 70.798  2.896   1.00 33.51  ? 469  ASP A CA  1 
ATOM   402  C C   . ASP A 1 54  ? 24.094 70.791  2.610   1.00 27.83  ? 469  ASP A C   1 
ATOM   403  O O   . ASP A 1 54  ? 24.758 69.770  2.766   1.00 25.12  ? 469  ASP A O   1 
ATOM   404  C CB  . ASP A 1 54  ? 22.285 71.421  4.255   1.00 38.41  ? 469  ASP A CB  1 
ATOM   405  C CG  . ASP A 1 54  ? 20.832 71.845  4.367   1.00 40.81  ? 469  ASP A CG  1 
ATOM   406  O OD1 . ASP A 1 54  ? 20.198 72.053  3.311   1.00 42.74  ? 469  ASP A OD1 1 
ATOM   407  O OD2 . ASP A 1 54  ? 20.322 71.967  5.495   1.00 43.33  ? 469  ASP A OD2 1 
ATOM   408  N N   . ALA A 1 55  ? 24.614 71.936  2.171   1.00 28.23  ? 470  ALA A N   1 
ATOM   409  C CA  . ALA A 1 55  ? 26.027 72.063  1.834   1.00 24.34  ? 470  ALA A CA  1 
ATOM   410  C C   . ALA A 1 55  ? 26.919 71.654  2.990   1.00 25.99  ? 470  ALA A C   1 
ATOM   411  O O   . ALA A 1 55  ? 26.602 71.911  4.155   1.00 24.81  ? 470  ALA A O   1 
ATOM   412  C CB  . ALA A 1 55  ? 26.343 73.497  1.417   1.00 26.11  ? 470  ALA A CB  1 
ATOM   413  N N   . CYS A 1 56  ? 28.036 71.014  2.656   1.00 22.18  ? 471  CYS A N   1 
ATOM   414  C CA  . CYS A 1 56  ? 28.997 70.569  3.647   1.00 25.53  ? 471  CYS A CA  1 
ATOM   415  C C   . CYS A 1 56  ? 29.809 71.754  4.173   1.00 25.02  ? 471  CYS A C   1 
ATOM   416  O O   . CYS A 1 56  ? 30.052 72.732  3.453   1.00 24.14  ? 471  CYS A O   1 
ATOM   417  C CB  . CYS A 1 56  ? 29.952 69.544  3.030   1.00 32.88  ? 471  CYS A CB  1 
ATOM   418  S SG  . CYS A 1 56  ? 29.163 67.995  2.474   1.00 45.37  ? 471  CYS A SG  1 
ATOM   419  N N   . PRO A 1 57  ? 30.212 71.700  5.452   1.00 24.39  ? 472  PRO A N   1 
ATOM   420  C CA  . PRO A 1 57  ? 31.002 72.813  5.986   1.00 24.86  ? 472  PRO A CA  1 
ATOM   421  C C   . PRO A 1 57  ? 32.288 73.061  5.189   1.00 23.26  ? 472  PRO A C   1 
ATOM   422  O O   . PRO A 1 57  ? 32.913 72.132  4.681   1.00 24.32  ? 472  PRO A O   1 
ATOM   423  C CB  . PRO A 1 57  ? 31.291 72.405  7.435   1.00 25.74  ? 472  PRO A CB  1 
ATOM   424  C CG  . PRO A 1 57  ? 30.928 70.955  7.536   1.00 28.25  ? 472  PRO A CG  1 
ATOM   425  C CD  . PRO A 1 57  ? 29.925 70.673  6.469   1.00 23.51  ? 472  PRO A CD  1 
ATOM   426  N N   . ILE A 1 58  ? 32.661 74.326  5.058   1.00 22.31  ? 473  ILE A N   1 
ATOM   427  C CA  . ILE A 1 58  ? 33.885 74.692  4.362   1.00 20.14  ? 473  ILE A CA  1 
ATOM   428  C C   . ILE A 1 58  ? 34.820 75.256  5.442   1.00 20.97  ? 473  ILE A C   1 
ATOM   429  O O   . ILE A 1 58  ? 34.538 76.285  6.060   1.00 17.89  ? 473  ILE A O   1 
ATOM   430  C CB  . ILE A 1 58  ? 33.608 75.754  3.257   1.00 22.55  ? 473  ILE A CB  1 
ATOM   431  C CG1 . ILE A 1 58  ? 32.699 75.154  2.181   1.00 21.84  ? 473  ILE A CG1 1 
ATOM   432  C CG2 . ILE A 1 58  ? 34.931 76.231  2.632   1.00 20.11  ? 473  ILE A CG2 1 
ATOM   433  C CD1 . ILE A 1 58  ? 31.955 76.177  1.354   1.00 20.10  ? 473  ILE A CD1 1 
ATOM   434  N N   . ASN A 1 59  ? 35.918 74.553  5.695   1.00 20.66  ? 474  ASN A N   1 
ATOM   435  C CA  . ASN A 1 59  ? 36.863 74.983  6.708   1.00 20.07  ? 474  ASN A CA  1 
ATOM   436  C C   . ASN A 1 59  ? 37.739 76.084  6.166   1.00 19.74  ? 474  ASN A C   1 
ATOM   437  O O   . ASN A 1 59  ? 38.104 76.081  4.990   1.00 20.92  ? 474  ASN A O   1 
ATOM   438  C CB  . ASN A 1 59  ? 37.735 73.811  7.159   1.00 22.09  ? 474  ASN A CB  1 
ATOM   439  C CG  . ASN A 1 59  ? 36.943 72.747  7.886   1.00 24.96  ? 474  ASN A CG  1 
ATOM   440  O OD1 . ASN A 1 59  ? 36.098 73.055  8.720   1.00 22.44  ? 474  ASN A OD1 1 
ATOM   441  N ND2 . ASN A 1 59  ? 37.211 71.488  7.569   1.00 28.60  ? 474  ASN A ND2 1 
ATOM   442  N N   . GLY A 1 60  ? 38.075 77.032  7.025   1.00 18.01  ? 475  GLY A N   1 
ATOM   443  C CA  . GLY A 1 60  ? 38.915 78.116  6.584   1.00 17.12  ? 475  GLY A CA  1 
ATOM   444  C C   . GLY A 1 60  ? 40.297 77.639  6.202   1.00 20.40  ? 475  GLY A C   1 
ATOM   445  O O   . GLY A 1 60  ? 40.797 76.657  6.739   1.00 24.73  ? 475  GLY A O   1 
ATOM   446  N N   . GLY A 1 61  ? 40.905 78.328  5.243   1.00 19.59  ? 476  GLY A N   1 
ATOM   447  C CA  . GLY A 1 61  ? 42.248 78.005  4.813   1.00 16.37  ? 476  GLY A CA  1 
ATOM   448  C C   . GLY A 1 61  ? 42.977 79.329  4.683   1.00 16.99  ? 476  GLY A C   1 
ATOM   449  O O   . GLY A 1 61  ? 42.387 80.296  4.211   1.00 16.20  ? 476  GLY A O   1 
ATOM   450  N N   . TRP A 1 62  ? 44.241 79.382  5.100   1.00 19.05  ? 477  TRP A N   1 
ATOM   451  C CA  . TRP A 1 62  ? 45.049 80.608  5.022   1.00 20.09  ? 477  TRP A CA  1 
ATOM   452  C C   . TRP A 1 62  ? 45.453 80.965  3.592   1.00 22.27  ? 477  TRP A C   1 
ATOM   453  O O   . TRP A 1 62  ? 45.795 80.088  2.793   1.00 19.74  ? 477  TRP A O   1 
ATOM   454  C CB  . TRP A 1 62  ? 46.348 80.466  5.830   1.00 17.58  ? 477  TRP A CB  1 
ATOM   455  C CG  . TRP A 1 62  ? 46.176 80.482  7.313   1.00 19.17  ? 477  TRP A CG  1 
ATOM   456  C CD1 . TRP A 1 62  ? 46.504 79.485  8.186   1.00 18.71  ? 477  TRP A CD1 1 
ATOM   457  C CD2 . TRP A 1 62  ? 45.643 81.548  8.103   1.00 18.03  ? 477  TRP A CD2 1 
ATOM   458  N NE1 . TRP A 1 62  ? 46.207 79.864  9.471   1.00 18.69  ? 477  TRP A NE1 1 
ATOM   459  C CE2 . TRP A 1 62  ? 45.675 81.127  9.448   1.00 16.92  ? 477  TRP A CE2 1 
ATOM   460  C CE3 . TRP A 1 62  ? 45.138 82.822  7.803   1.00 20.79  ? 477  TRP A CE3 1 
ATOM   461  C CZ2 . TRP A 1 62  ? 45.225 81.929  10.494  1.00 16.95  ? 477  TRP A CZ2 1 
ATOM   462  C CZ3 . TRP A 1 62  ? 44.690 83.620  8.841   1.00 18.93  ? 477  TRP A CZ3 1 
ATOM   463  C CH2 . TRP A 1 62  ? 44.739 83.169  10.173  1.00 21.71  ? 477  TRP A CH2 1 
ATOM   464  N N   . GLY A 1 63  ? 45.411 82.256  3.279   1.00 23.78  ? 478  GLY A N   1 
ATOM   465  C CA  . GLY A 1 63  ? 45.851 82.709  1.977   1.00 23.89  ? 478  GLY A CA  1 
ATOM   466  C C   . GLY A 1 63  ? 47.356 82.909  2.124   1.00 27.28  ? 478  GLY A C   1 
ATOM   467  O O   . GLY A 1 63  ? 47.896 82.682  3.211   1.00 25.41  ? 478  GLY A O   1 
ATOM   468  N N   . PRO A 1 64  ? 48.070 83.335  1.064   1.00 28.14  ? 479  PRO A N   1 
ATOM   469  C CA  . PRO A 1 64  ? 49.524 83.538  1.156   1.00 25.27  ? 479  PRO A CA  1 
ATOM   470  C C   . PRO A 1 64  ? 49.910 84.682  2.094   1.00 24.83  ? 479  PRO A C   1 
ATOM   471  O O   . PRO A 1 64  ? 49.150 85.634  2.281   1.00 23.80  ? 479  PRO A O   1 
ATOM   472  C CB  . PRO A 1 64  ? 49.944 83.816  -0.288  1.00 27.75  ? 479  PRO A CB  1 
ATOM   473  C CG  . PRO A 1 64  ? 48.706 84.324  -0.958  1.00 24.49  ? 479  PRO A CG  1 
ATOM   474  C CD  . PRO A 1 64  ? 47.543 83.656  -0.277  1.00 26.97  ? 479  PRO A CD  1 
ATOM   475  N N   . TRP A 1 65  ? 51.091 84.580  2.694   1.00 24.89  ? 480  TRP A N   1 
ATOM   476  C CA  . TRP A 1 65  ? 51.565 85.614  3.605   1.00 25.28  ? 480  TRP A CA  1 
ATOM   477  C C   . TRP A 1 65  ? 51.927 86.855  2.797   1.00 26.66  ? 480  TRP A C   1 
ATOM   478  O O   . TRP A 1 65  ? 52.419 86.743  1.674   1.00 29.39  ? 480  TRP A O   1 
ATOM   479  C CB  . TRP A 1 65  ? 52.827 85.147  4.320   1.00 25.26  ? 480  TRP A CB  1 
ATOM   480  C CG  . TRP A 1 65  ? 52.644 84.299  5.551   1.00 23.37  ? 480  TRP A CG  1 
ATOM   481  C CD1 . TRP A 1 65  ? 53.033 82.998  5.704   1.00 23.17  ? 480  TRP A CD1 1 
ATOM   482  C CD2 . TRP A 1 65  ? 52.171 84.724  6.839   1.00 19.75  ? 480  TRP A CD2 1 
ATOM   483  N NE1 . TRP A 1 65  ? 52.841 82.591  7.000   1.00 22.30  ? 480  TRP A NE1 1 
ATOM   484  C CE2 . TRP A 1 65  ? 52.315 83.631  7.719   1.00 18.63  ? 480  TRP A CE2 1 
ATOM   485  C CE3 . TRP A 1 65  ? 51.647 85.922  7.331   1.00 22.76  ? 480  TRP A CE3 1 
ATOM   486  C CZ2 . TRP A 1 65  ? 51.955 83.698  9.060   1.00 19.68  ? 480  TRP A CZ2 1 
ATOM   487  C CZ3 . TRP A 1 65  ? 51.290 85.989  8.669   1.00 21.87  ? 480  TRP A CZ3 1 
ATOM   488  C CH2 . TRP A 1 65  ? 51.446 84.883  9.518   1.00 22.31  ? 480  TRP A CH2 1 
ATOM   489  N N   . SER A 1 66  ? 51.678 88.035  3.352   1.00 28.40  ? 481  SER A N   1 
ATOM   490  C CA  . SER A 1 66  ? 52.057 89.271  2.666   1.00 30.28  ? 481  SER A CA  1 
ATOM   491  C C   . SER A 1 66  ? 53.581 89.359  2.744   1.00 32.79  ? 481  SER A C   1 
ATOM   492  O O   . SER A 1 66  ? 54.203 88.677  3.567   1.00 32.48  ? 481  SER A O   1 
ATOM   493  C CB  . SER A 1 66  ? 51.471 90.487  3.381   1.00 26.88  ? 481  SER A CB  1 
ATOM   494  O OG  . SER A 1 66  ? 52.207 90.783  4.560   1.00 26.96  ? 481  SER A OG  1 
ATOM   495  N N   . PRO A 1 67  ? 54.213 90.156  1.858   1.00 33.61  ? 482  PRO A N   1 
ATOM   496  C CA  . PRO A 1 67  ? 55.676 90.248  1.957   1.00 33.48  ? 482  PRO A CA  1 
ATOM   497  C C   . PRO A 1 67  ? 56.037 90.854  3.324   1.00 33.94  ? 482  PRO A C   1 
ATOM   498  O O   . PRO A 1 67  ? 55.241 91.599  3.903   1.00 32.42  ? 482  PRO A O   1 
ATOM   499  C CB  . PRO A 1 67  ? 56.062 91.168  0.795   1.00 32.12  ? 482  PRO A CB  1 
ATOM   500  C CG  . PRO A 1 67  ? 54.905 91.092  -0.157  1.00 31.78  ? 482  PRO A CG  1 
ATOM   501  C CD  . PRO A 1 67  ? 53.689 90.936  0.724   1.00 32.12  ? 482  PRO A CD  1 
ATOM   502  N N   . TRP A 1 68  ? 57.217 90.519  3.844   1.00 34.90  ? 483  TRP A N   1 
ATOM   503  C CA  . TRP A 1 68  ? 57.663 91.044  5.136   1.00 37.20  ? 483  TRP A CA  1 
ATOM   504  C C   . TRP A 1 68  ? 57.811 92.563  5.091   1.00 41.02  ? 483  TRP A C   1 
ATOM   505  O O   . TRP A 1 68  ? 58.379 93.115  4.144   1.00 41.86  ? 483  TRP A O   1 
ATOM   506  C CB  . TRP A 1 68  ? 59.024 90.457  5.524   1.00 34.15  ? 483  TRP A CB  1 
ATOM   507  C CG  . TRP A 1 68  ? 58.993 89.129  6.212   1.00 27.15  ? 483  TRP A CG  1 
ATOM   508  C CD1 . TRP A 1 68  ? 59.472 87.950  5.721   1.00 25.80  ? 483  TRP A CD1 1 
ATOM   509  C CD2 . TRP A 1 68  ? 58.502 88.847  7.528   1.00 24.93  ? 483  TRP A CD2 1 
ATOM   510  N NE1 . TRP A 1 68  ? 59.313 86.950  6.648   1.00 28.17  ? 483  TRP A NE1 1 
ATOM   511  C CE2 . TRP A 1 68  ? 58.718 87.472  7.767   1.00 27.15  ? 483  TRP A CE2 1 
ATOM   512  C CE3 . TRP A 1 68  ? 57.901 89.619  8.529   1.00 22.90  ? 483  TRP A CE3 1 
ATOM   513  C CZ2 . TRP A 1 68  ? 58.355 86.852  8.970   1.00 22.53  ? 483  TRP A CZ2 1 
ATOM   514  C CZ3 . TRP A 1 68  ? 57.541 89.000  9.727   1.00 21.26  ? 483  TRP A CZ3 1 
ATOM   515  C CH2 . TRP A 1 68  ? 57.771 87.632  9.933   1.00 19.39  ? 483  TRP A CH2 1 
ATOM   516  N N   . ASP A 1 69  ? 57.299 93.238  6.114   1.00 43.72  ? 484  ASP A N   1 
ATOM   517  C CA  . ASP A 1 69  ? 57.435 94.684  6.200   1.00 47.45  ? 484  ASP A CA  1 
ATOM   518  C C   . ASP A 1 69  ? 58.936 94.943  6.270   1.00 50.54  ? 484  ASP A C   1 
ATOM   519  O O   . ASP A 1 69  ? 59.700 94.076  6.700   1.00 49.32  ? 484  ASP A O   1 
ATOM   520  C CB  . ASP A 1 69  ? 56.783 95.206  7.474   1.00 49.08  ? 484  ASP A CB  1 
ATOM   521  C CG  . ASP A 1 69  ? 55.352 95.603  7.266   1.00 49.94  ? 484  ASP A CG  1 
ATOM   522  O OD1 . ASP A 1 69  ? 54.772 95.218  6.229   1.00 56.11  ? 484  ASP A OD1 1 
ATOM   523  O OD2 . ASP A 1 69  ? 54.806 96.299  8.142   1.00 52.27  ? 484  ASP A OD2 1 
ATOM   524  N N   . ILE A 1 70  ? 59.373 96.123  5.853   1.00 54.76  ? 485  ILE A N   1 
ATOM   525  C CA  . ILE A 1 70  ? 60.797 96.397  5.906   1.00 56.57  ? 485  ILE A CA  1 
ATOM   526  C C   . ILE A 1 70  ? 61.216 96.591  7.364   1.00 58.80  ? 485  ILE A C   1 
ATOM   527  O O   . ILE A 1 70  ? 60.502 97.223  8.157   1.00 56.90  ? 485  ILE A O   1 
ATOM   528  C CB  . ILE A 1 70  ? 61.176 97.626  5.061   1.00 57.53  ? 485  ILE A CB  1 
ATOM   529  C CG1 . ILE A 1 70  ? 60.214 97.770  3.874   1.00 57.56  ? 485  ILE A CG1 1 
ATOM   530  C CG2 . ILE A 1 70  ? 62.614 97.472  4.569   1.00 58.16  ? 485  ILE A CG2 1 
ATOM   531  C CD1 . ILE A 1 70  ? 60.707 97.138  2.572   1.00 56.93  ? 485  ILE A CD1 1 
ATOM   532  N N   . CYS A 1 71  ? 62.371 96.025  7.708   1.00 60.18  ? 486  CYS A N   1 
ATOM   533  C CA  . CYS A 1 71  ? 62.896 96.089  9.066   1.00 61.61  ? 486  CYS A CA  1 
ATOM   534  C C   . CYS A 1 71  ? 62.893 97.488  9.660   1.00 61.39  ? 486  CYS A C   1 
ATOM   535  O O   . CYS A 1 71  ? 63.287 98.456  9.012   1.00 62.21  ? 486  CYS A O   1 
ATOM   536  C CB  . CYS A 1 71  ? 64.313 95.516  9.112   1.00 63.02  ? 486  CYS A CB  1 
ATOM   537  S SG  . CYS A 1 71  ? 64.797 94.935  10.769  1.00 65.09  ? 486  CYS A SG  1 
ATOM   538  N N   . SER A 1 72  ? 62.442 97.587  10.904  1.00 62.34  ? 487  SER A N   1 
ATOM   539  C CA  . SER A 1 72  ? 62.396 98.868  11.586  1.00 66.23  ? 487  SER A CA  1 
ATOM   540  C C   . SER A 1 72  ? 63.801 99.434  11.856  1.00 71.04  ? 487  SER A C   1 
ATOM   541  O O   . SER A 1 72  ? 63.927 100.552 12.361  1.00 71.93  ? 487  SER A O   1 
ATOM   542  C CB  . SER A 1 72  ? 61.625 98.728  12.905  1.00 62.32  ? 487  SER A CB  1 
ATOM   543  O OG  . SER A 1 72  ? 62.313 97.881  13.812  1.00 60.67  ? 487  SER A OG  1 
ATOM   544  N N   . VAL A 1 73  ? 64.849 98.675  11.506  1.00 74.65  ? 488  VAL A N   1 
ATOM   545  C CA  . VAL A 1 73  ? 66.240 99.101  11.737  1.00 76.65  ? 488  VAL A CA  1 
ATOM   546  C C   . VAL A 1 73  ? 67.291 98.438  10.815  1.00 78.54  ? 488  VAL A C   1 
ATOM   547  O O   . VAL A 1 73  ? 67.100 97.332  10.308  1.00 74.22  ? 488  VAL A O   1 
ATOM   548  C CB  . VAL A 1 73  ? 66.637 98.843  13.218  1.00 77.16  ? 488  VAL A CB  1 
ATOM   549  C CG1 . VAL A 1 73  ? 68.129 99.002  13.398  1.00 79.90  ? 488  VAL A CG1 1 
ATOM   550  C CG2 . VAL A 1 73  ? 65.893 99.804  14.146  1.00 78.96  ? 488  VAL A CG2 1 
ATOM   551  N N   . THR A 1 74  ? 68.418 99.134  10.628  1.00 82.81  ? 489  THR A N   1 
ATOM   552  C CA  . THR A 1 74  ? 69.514 98.675  9.768   1.00 87.77  ? 489  THR A CA  1 
ATOM   553  C C   . THR A 1 74  ? 70.781 98.230  10.510  1.00 89.98  ? 489  THR A C   1 
ATOM   554  O O   . THR A 1 74  ? 71.871 98.319  9.950   1.00 91.28  ? 489  THR A O   1 
ATOM   555  C CB  . THR A 1 74  ? 69.967 99.793  8.806   1.00 90.06  ? 489  THR A CB  1 
ATOM   556  O OG1 . THR A 1 74  ? 69.846 101.065 9.457   1.00 94.44  ? 489  THR A OG1 1 
ATOM   557  C CG2 . THR A 1 74  ? 69.143 99.765  7.521   1.00 88.10  ? 489  THR A CG2 1 
ATOM   558  N N   . CYS A 1 75  ? 70.659 97.741  11.741  1.00 91.65  ? 490  CYS A N   1 
ATOM   559  C CA  . CYS A 1 75  ? 71.849 97.324  12.493  1.00 92.14  ? 490  CYS A CA  1 
ATOM   560  C C   . CYS A 1 75  ? 71.640 96.556  13.784  1.00 91.07  ? 490  CYS A C   1 
ATOM   561  O O   . CYS A 1 75  ? 71.990 95.388  13.857  1.00 90.43  ? 490  CYS A O   1 
ATOM   562  C CB  . CYS A 1 75  ? 72.733 98.548  12.812  1.00 95.21  ? 490  CYS A CB  1 
ATOM   563  S SG  . CYS A 1 75  ? 71.901 99.855  13.799  1.00 100.00 ? 490  CYS A SG  1 
ATOM   564  N N   . GLY A 1 76  ? 71.056 97.200  14.790  1.00 89.51  ? 491  GLY A N   1 
ATOM   565  C CA  . GLY A 1 76  ? 70.883 96.544  16.070  1.00 90.40  ? 491  GLY A CA  1 
ATOM   566  C C   . GLY A 1 76  ? 69.681 95.661  16.382  1.00 90.68  ? 491  GLY A C   1 
ATOM   567  O O   . GLY A 1 76  ? 69.848 94.472  16.657  1.00 89.44  ? 491  GLY A O   1 
ATOM   568  N N   . GLY A 1 77  ? 68.487 96.238  16.394  1.00 89.37  ? 492  GLY A N   1 
ATOM   569  C CA  . GLY A 1 77  ? 67.310 95.446  16.717  1.00 85.01  ? 492  GLY A CA  1 
ATOM   570  C C   . GLY A 1 77  ? 66.076 95.879  15.953  1.00 81.81  ? 492  GLY A C   1 
ATOM   571  O O   . GLY A 1 77  ? 65.443 96.886  16.285  1.00 82.40  ? 492  GLY A O   1 
ATOM   572  N N   . GLY A 1 78  ? 65.740 95.116  14.923  1.00 77.61  ? 493  GLY A N   1 
ATOM   573  C CA  . GLY A 1 78  ? 64.566 95.432  14.134  1.00 71.82  ? 493  GLY A CA  1 
ATOM   574  C C   . GLY A 1 78  ? 63.399 94.494  14.390  1.00 66.95  ? 493  GLY A C   1 
ATOM   575  O O   . GLY A 1 78  ? 63.559 93.386  14.914  1.00 64.38  ? 493  GLY A O   1 
ATOM   576  N N   . VAL A 1 79  ? 62.219 94.962  14.023  1.00 63.36  ? 494  VAL A N   1 
ATOM   577  C CA  . VAL A 1 79  ? 60.995 94.192  14.157  1.00 57.91  ? 494  VAL A CA  1 
ATOM   578  C C   . VAL A 1 79  ? 60.215 94.426  12.866  1.00 53.37  ? 494  VAL A C   1 
ATOM   579  O O   . VAL A 1 79  ? 59.871 95.564  12.539  1.00 54.87  ? 494  VAL A O   1 
ATOM   580  C CB  . VAL A 1 79  ? 60.169 94.674  15.375  1.00 60.13  ? 494  VAL A CB  1 
ATOM   581  C CG1 . VAL A 1 79  ? 58.689 94.342  15.190  1.00 61.02  ? 494  VAL A CG1 1 
ATOM   582  C CG2 . VAL A 1 79  ? 60.702 94.027  16.634  1.00 61.53  ? 494  VAL A CG2 1 
ATOM   583  N N   . GLN A 1 80  ? 59.979 93.361  12.110  1.00 44.29  ? 495  GLN A N   1 
ATOM   584  C CA  . GLN A 1 80  ? 59.221 93.484  10.871  1.00 39.43  ? 495  GLN A CA  1 
ATOM   585  C C   . GLN A 1 80  ? 57.974 92.621  10.987  1.00 38.14  ? 495  GLN A C   1 
ATOM   586  O O   . GLN A 1 80  ? 58.001 91.568  11.625  1.00 35.09  ? 495  GLN A O   1 
ATOM   587  C CB  . GLN A 1 80  ? 60.062 93.051  9.672   1.00 32.75  ? 495  GLN A CB  1 
ATOM   588  C CG  . GLN A 1 80  ? 60.802 91.769  9.880   1.00 34.94  ? 495  GLN A CG  1 
ATOM   589  C CD  . GLN A 1 80  ? 61.526 91.335  8.634   1.00 38.26  ? 495  GLN A CD  1 
ATOM   590  O OE1 . GLN A 1 80  ? 61.536 92.053  7.634   1.00 41.14  ? 495  GLN A OE1 1 
ATOM   591  N NE2 . GLN A 1 80  ? 62.137 90.155  8.681   1.00 37.52  ? 495  GLN A NE2 1 
ATOM   592  N N   . LYS A 1 81  ? 56.885 93.089  10.383  1.00 38.47  ? 496  LYS A N   1 
ATOM   593  C CA  . LYS A 1 81  ? 55.599 92.396  10.413  1.00 37.78  ? 496  LYS A CA  1 
ATOM   594  C C   . LYS A 1 81  ? 55.261 91.670  9.105   1.00 37.38  ? 496  LYS A C   1 
ATOM   595  O O   . LYS A 1 81  ? 55.885 91.890  8.061   1.00 35.90  ? 496  LYS A O   1 
ATOM   596  C CB  . LYS A 1 81  ? 54.486 93.388  10.738  1.00 40.17  ? 496  LYS A CB  1 
ATOM   597  C CG  . LYS A 1 81  ? 53.725 93.067  11.987  1.00 43.64  ? 496  LYS A CG  1 
ATOM   598  C CD  . LYS A 1 81  ? 53.003 94.305  12.475  1.00 49.13  ? 496  LYS A CD  1 
ATOM   599  C CE  . LYS A 1 81  ? 53.639 94.852  13.743  1.00 52.20  ? 496  LYS A CE  1 
ATOM   600  N NZ  . LYS A 1 81  ? 53.228 94.085  14.953  1.00 56.43  ? 496  LYS A NZ  1 
ATOM   601  N N   . ARG A 1 82  ? 54.229 90.841  9.176   1.00 32.49  ? 497  ARG A N   1 
ATOM   602  C CA  . ARG A 1 82  ? 53.797 90.010  8.061   1.00 29.40  ? 497  ARG A CA  1 
ATOM   603  C C   . ARG A 1 82  ? 52.330 89.685  8.365   1.00 28.37  ? 497  ARG A C   1 
ATOM   604  O O   . ARG A 1 82  ? 52.008 89.376  9.510   1.00 28.11  ? 497  ARG A O   1 
ATOM   605  C CB  . ARG A 1 82  ? 54.654 88.754  8.122   1.00 31.09  ? 497  ARG A CB  1 
ATOM   606  C CG  . ARG A 1 82  ? 54.793 87.911  6.918   1.00 24.66  ? 497  ARG A CG  1 
ATOM   607  C CD  . ARG A 1 82  ? 55.314 86.574  7.394   1.00 19.24  ? 497  ARG A CD  1 
ATOM   608  N NE  . ARG A 1 82  ? 55.820 85.777  6.297   1.00 27.21  ? 497  ARG A NE  1 
ATOM   609  C CZ  . ARG A 1 82  ? 56.142 84.495  6.394   1.00 25.37  ? 497  ARG A CZ  1 
ATOM   610  N NH1 . ARG A 1 82  ? 56.015 83.852  7.547   1.00 24.18  ? 497  ARG A NH1 1 
ATOM   611  N NH2 . ARG A 1 82  ? 56.575 83.851  5.321   1.00 32.31  ? 497  ARG A NH2 1 
ATOM   612  N N   . SER A 1 83  ? 51.443 89.757  7.371   1.00 28.17  ? 498  SER A N   1 
ATOM   613  C CA  . SER A 1 83  ? 50.031 89.463  7.616   1.00 26.38  ? 498  SER A CA  1 
ATOM   614  C C   . SER A 1 83  ? 49.421 88.405  6.690   1.00 27.29  ? 498  SER A C   1 
ATOM   615  O O   . SER A 1 83  ? 49.896 88.184  5.575   1.00 26.70  ? 498  SER A O   1 
ATOM   616  C CB  . SER A 1 83  ? 49.212 90.747  7.546   1.00 27.19  ? 498  SER A CB  1 
ATOM   617  O OG  . SER A 1 83  ? 49.443 91.406  6.317   1.00 36.29  ? 498  SER A OG  1 
ATOM   618  N N   . ARG A 1 84  ? 48.347 87.784  7.178   1.00 26.86  ? 499  ARG A N   1 
ATOM   619  C CA  . ARG A 1 84  ? 47.614 86.693  6.511   1.00 27.00  ? 499  ARG A CA  1 
ATOM   620  C C   . ARG A 1 84  ? 46.124 86.998  6.408   1.00 26.36  ? 499  ARG A C   1 
ATOM   621  O O   . ARG A 1 84  ? 45.588 87.838  7.129   1.00 28.44  ? 499  ARG A O   1 
ATOM   622  C CB  . ARG A 1 84  ? 47.641 85.441  7.375   1.00 26.02  ? 499  ARG A CB  1 
ATOM   623  C CG  . ARG A 1 84  ? 48.643 84.397  7.167   1.00 22.66  ? 499  ARG A CG  1 
ATOM   624  C CD  . ARG A 1 84  ? 48.586 83.621  8.463   1.00 20.70  ? 499  ARG A CD  1 
ATOM   625  N NE  . ARG A 1 84  ? 49.089 82.272  8.338   1.00 28.25  ? 499  ARG A NE  1 
ATOM   626  C CZ  . ARG A 1 84  ? 49.326 81.481  9.369   1.00 24.42  ? 499  ARG A CZ  1 
ATOM   627  N NH1 . ARG A 1 84  ? 49.103 81.911  10.607  1.00 23.44  ? 499  ARG A NH1 1 
ATOM   628  N NH2 . ARG A 1 84  ? 49.789 80.259  9.153   1.00 37.25  ? 499  ARG A NH2 1 
ATOM   629  N N   . LEU A 1 85  ? 45.445 86.225  5.572   1.00 23.84  ? 500  LEU A N   1 
ATOM   630  C CA  . LEU A 1 85  ? 44.007 86.349  5.413   1.00 22.79  ? 500  LEU A CA  1 
ATOM   631  C C   . LEU A 1 85  ? 43.404 84.934  5.452   1.00 23.57  ? 500  LEU A C   1 
ATOM   632  O O   . LEU A 1 85  ? 43.898 84.024  4.783   1.00 21.10  ? 500  LEU A O   1 
ATOM   633  C CB  . LEU A 1 85  ? 43.689 86.999  4.071   1.00 24.45  ? 500  LEU A CB  1 
ATOM   634  C CG  . LEU A 1 85  ? 43.183 88.439  3.977   1.00 27.70  ? 500  LEU A CG  1 
ATOM   635  C CD1 . LEU A 1 85  ? 43.225 89.166  5.316   1.00 24.31  ? 500  LEU A CD1 1 
ATOM   636  C CD2 . LEU A 1 85  ? 44.021 89.140  2.939   1.00 27.29  ? 500  LEU A CD2 1 
ATOM   637  N N   . CYS A 1 86  ? 42.363 84.735  6.253   1.00 22.43  ? 501  CYS A N   1 
ATOM   638  C CA  . CYS A 1 86  ? 41.706 83.428  6.303   1.00 23.11  ? 501  CYS A CA  1 
ATOM   639  C C   . CYS A 1 86  ? 40.549 83.500  5.300   1.00 20.86  ? 501  CYS A C   1 
ATOM   640  O O   . CYS A 1 86  ? 39.384 83.653  5.675   1.00 23.00  ? 501  CYS A O   1 
ATOM   641  C CB  . CYS A 1 86  ? 41.179 83.129  7.712   1.00 24.50  ? 501  CYS A CB  1 
ATOM   642  S SG  . CYS A 1 86  ? 40.406 81.478  7.875   1.00 28.60  ? 501  CYS A SG  1 
ATOM   643  N N   . ASN A 1 87  ? 40.886 83.411  4.016   1.00 20.64  ? 502  ASN A N   1 
ATOM   644  C CA  . ASN A 1 87  ? 39.888 83.508  2.962   1.00 17.00  ? 502  ASN A CA  1 
ATOM   645  C C   . ASN A 1 87  ? 40.197 82.619  1.774   1.00 15.88  ? 502  ASN A C   1 
ATOM   646  O O   . ASN A 1 87  ? 39.650 82.815  0.690   1.00 16.39  ? 502  ASN A O   1 
ATOM   647  C CB  . ASN A 1 87  ? 39.762 84.967  2.502   1.00 19.63  ? 502  ASN A CB  1 
ATOM   648  C CG  . ASN A 1 87  ? 41.021 85.484  1.820   1.00 17.05  ? 502  ASN A CG  1 
ATOM   649  O OD1 . ASN A 1 87  ? 42.061 84.822  1.800   1.00 19.71  ? 502  ASN A OD1 1 
ATOM   650  N ND2 . ASN A 1 87  ? 40.927 86.678  1.255   1.00 21.95  ? 502  ASN A ND2 1 
ATOM   651  N N   . ASN A 1 88  ? 41.069 81.637  1.985   1.00 17.56  ? 503  ASN A N   1 
ATOM   652  C CA  . ASN A 1 88  ? 41.449 80.705  0.932   1.00 18.18  ? 503  ASN A CA  1 
ATOM   653  C C   . ASN A 1 88  ? 41.224 79.237  1.338   1.00 18.57  ? 503  ASN A C   1 
ATOM   654  O O   . ASN A 1 88  ? 42.173 78.453  1.380   1.00 17.97  ? 503  ASN A O   1 
ATOM   655  C CB  . ASN A 1 88  ? 42.922 80.916  0.566   1.00 17.61  ? 503  ASN A CB  1 
ATOM   656  C CG  . ASN A 1 88  ? 43.216 80.568  -0.878  1.00 18.17  ? 503  ASN A CG  1 
ATOM   657  O OD1 . ASN A 1 88  ? 42.779 81.262  -1.798  1.00 18.90  ? 503  ASN A OD1 1 
ATOM   658  N ND2 . ASN A 1 88  ? 43.953 79.489  -1.085  1.00 18.90  ? 503  ASN A ND2 1 
ATOM   659  N N   . PRO A 1 89  ? 39.962 78.836  1.610   1.00 21.54  ? 504  PRO A N   1 
ATOM   660  C CA  . PRO A 1 89  ? 38.719 79.616  1.571   1.00 19.89  ? 504  PRO A CA  1 
ATOM   661  C C   . PRO A 1 89  ? 38.302 80.223  2.914   1.00 19.22  ? 504  PRO A C   1 
ATOM   662  O O   . PRO A 1 89  ? 38.904 79.959  3.949   1.00 19.24  ? 504  PRO A O   1 
ATOM   663  C CB  . PRO A 1 89  ? 37.698 78.592  1.104   1.00 16.74  ? 504  PRO A CB  1 
ATOM   664  C CG  . PRO A 1 89  ? 38.160 77.336  1.776   1.00 16.57  ? 504  PRO A CG  1 
ATOM   665  C CD  . PRO A 1 89  ? 39.670 77.442  1.990   1.00 18.32  ? 504  PRO A CD  1 
ATOM   666  N N   . THR A 1 90  ? 37.256 81.039  2.866   1.00 20.38  ? 505  THR A N   1 
ATOM   667  C CA  . THR A 1 90  ? 36.678 81.675  4.041   1.00 17.28  ? 505  THR A CA  1 
ATOM   668  C C   . THR A 1 90  ? 35.802 80.596  4.657   1.00 17.99  ? 505  THR A C   1 
ATOM   669  O O   . THR A 1 90  ? 35.101 79.892  3.930   1.00 20.32  ? 505  THR A O   1 
ATOM   670  C CB  . THR A 1 90  ? 35.731 82.835  3.639   1.00 18.29  ? 505  THR A CB  1 
ATOM   671  O OG1 . THR A 1 90  ? 36.469 83.873  2.993   1.00 20.44  ? 505  THR A OG1 1 
ATOM   672  C CG2 . THR A 1 90  ? 35.042 83.406  4.852   1.00 19.55  ? 505  THR A CG2 1 
ATOM   673  N N   . PRO A 1 91  ? 35.823 80.439  5.990   1.00 20.97  ? 506  PRO A N   1 
ATOM   674  C CA  . PRO A 1 91  ? 34.971 79.403  6.598   1.00 19.27  ? 506  PRO A CA  1 
ATOM   675  C C   . PRO A 1 91  ? 33.497 79.634  6.272   1.00 21.02  ? 506  PRO A C   1 
ATOM   676  O O   . PRO A 1 91  ? 33.028 80.768  6.277   1.00 22.70  ? 506  PRO A O   1 
ATOM   677  C CB  . PRO A 1 91  ? 35.244 79.530  8.089   1.00 16.16  ? 506  PRO A CB  1 
ATOM   678  C CG  . PRO A 1 91  ? 36.546 80.243  8.179   1.00 20.44  ? 506  PRO A CG  1 
ATOM   679  C CD  . PRO A 1 91  ? 36.627 81.150  6.994   1.00 18.10  ? 506  PRO A CD  1 
ATOM   680  N N   . GLN A 1 92  ? 32.767 78.558  5.996   1.00 20.91  ? 507  GLN A N   1 
ATOM   681  C CA  . GLN A 1 92  ? 31.354 78.670  5.657   1.00 19.11  ? 507  GLN A CA  1 
ATOM   682  C C   . GLN A 1 92  ? 30.563 77.450  6.092   1.00 20.37  ? 507  GLN A C   1 
ATOM   683  O O   . GLN A 1 92  ? 31.108 76.353  6.230   1.00 19.84  ? 507  GLN A O   1 
ATOM   684  C CB  . GLN A 1 92  ? 31.191 78.847  4.155   1.00 24.39  ? 507  GLN A CB  1 
ATOM   685  C CG  . GLN A 1 92  ? 31.254 80.281  3.684   1.00 35.47  ? 507  GLN A CG  1 
ATOM   686  C CD  . GLN A 1 92  ? 30.722 80.420  2.278   1.00 42.36  ? 507  GLN A CD  1 
ATOM   687  O OE1 . GLN A 1 92  ? 31.451 80.215  1.308   1.00 42.82  ? 507  GLN A OE1 1 
ATOM   688  N NE2 . GLN A 1 92  ? 29.436 80.753  2.155   1.00 43.93  ? 507  GLN A NE2 1 
ATOM   689  N N   . PHE A 1 93  ? 29.265 77.645  6.286   1.00 22.73  ? 508  PHE A N   1 
ATOM   690  C CA  . PHE A 1 93  ? 28.379 76.571  6.709   1.00 26.15  ? 508  PHE A CA  1 
ATOM   691  C C   . PHE A 1 93  ? 28.910 75.832  7.943   1.00 25.31  ? 508  PHE A C   1 
ATOM   692  O O   . PHE A 1 93  ? 28.907 74.604  7.985   1.00 24.52  ? 508  PHE A O   1 
ATOM   693  C CB  . PHE A 1 93  ? 28.160 75.566  5.568   1.00 24.34  ? 508  PHE A CB  1 
ATOM   694  C CG  . PHE A 1 93  ? 27.860 76.205  4.235   1.00 29.15  ? 508  PHE A CG  1 
ATOM   695  C CD1 . PHE A 1 93  ? 28.566 75.830  3.093   1.00 29.56  ? 508  PHE A CD1 1 
ATOM   696  C CD2 . PHE A 1 93  ? 26.891 77.187  4.118   1.00 31.32  ? 508  PHE A CD2 1 
ATOM   697  C CE1 . PHE A 1 93  ? 28.311 76.428  1.855   1.00 26.89  ? 508  PHE A CE1 1 
ATOM   698  C CE2 . PHE A 1 93  ? 26.631 77.789  2.879   1.00 33.50  ? 508  PHE A CE2 1 
ATOM   699  C CZ  . PHE A 1 93  ? 27.346 77.405  1.750   1.00 27.21  ? 508  PHE A CZ  1 
ATOM   700  N N   . GLY A 1 94  ? 29.376 76.578  8.939   1.00 22.14  ? 509  GLY A N   1 
ATOM   701  C CA  . GLY A 1 94  ? 29.861 75.944  10.149  1.00 24.11  ? 509  GLY A CA  1 
ATOM   702  C C   . GLY A 1 94  ? 31.260 75.367  10.094  1.00 27.46  ? 509  GLY A C   1 
ATOM   703  O O   . GLY A 1 94  ? 31.678 74.662  11.017  1.00 29.00  ? 509  GLY A O   1 
ATOM   704  N N   . GLY A 1 95  ? 31.985 75.652  9.015   1.00 27.49  ? 510  GLY A N   1 
ATOM   705  C CA  . GLY A 1 95  ? 33.347 75.166  8.885   1.00 21.46  ? 510  GLY A CA  1 
ATOM   706  C C   . GLY A 1 95  ? 34.215 75.765  9.975   1.00 22.54  ? 510  GLY A C   1 
ATOM   707  O O   . GLY A 1 95  ? 33.859 76.772  10.598  1.00 21.60  ? 510  GLY A O   1 
ATOM   708  N N   . LYS A 1 96  ? 35.360 75.145  10.209  1.00 20.92  ? 511  LYS A N   1 
ATOM   709  C CA  . LYS A 1 96  ? 36.276 75.607  11.228  1.00 21.48  ? 511  LYS A CA  1 
ATOM   710  C C   . LYS A 1 96  ? 37.032 76.853  10.806  1.00 22.66  ? 511  LYS A C   1 
ATOM   711  O O   . LYS A 1 96  ? 37.278 77.090  9.623   1.00 24.40  ? 511  LYS A O   1 
ATOM   712  C CB  . LYS A 1 96  ? 37.277 74.505  11.544  1.00 26.66  ? 511  LYS A CB  1 
ATOM   713  C CG  . LYS A 1 96  ? 36.707 73.401  12.384  1.00 31.30  ? 511  LYS A CG  1 
ATOM   714  C CD  . LYS A 1 96  ? 37.661 72.240  12.494  1.00 36.14  ? 511  LYS A CD  1 
ATOM   715  C CE  . LYS A 1 96  ? 37.294 71.390  13.703  1.00 41.46  ? 511  LYS A CE  1 
ATOM   716  N NZ  . LYS A 1 96  ? 37.940 70.055  13.660  1.00 50.68  ? 511  LYS A NZ  1 
ATOM   717  N N   . ASP A 1 97  ? 37.403 77.656  11.789  1.00 26.94  ? 512  ASP A N   1 
ATOM   718  C CA  . ASP A 1 97  ? 38.174 78.855  11.537  1.00 25.57  ? 512  ASP A CA  1 
ATOM   719  C C   . ASP A 1 97  ? 39.594 78.386  11.242  1.00 27.26  ? 512  ASP A C   1 
ATOM   720  O O   . ASP A 1 97  ? 39.946 77.236  11.512  1.00 27.35  ? 512  ASP A O   1 
ATOM   721  C CB  . ASP A 1 97  ? 38.162 79.739  12.782  1.00 30.82  ? 512  ASP A CB  1 
ATOM   722  C CG  . ASP A 1 97  ? 38.833 81.086  12.561  1.00 40.24  ? 512  ASP A CG  1 
ATOM   723  O OD1 . ASP A 1 97  ? 39.231 81.719  13.571  1.00 45.90  ? 512  ASP A OD1 1 
ATOM   724  O OD2 . ASP A 1 97  ? 38.958 81.519  11.392  1.00 34.78  ? 512  ASP A OD2 1 
ATOM   725  N N   . CYS A 1 98  ? 40.407 79.262  10.665  1.00 29.15  ? 513  CYS A N   1 
ATOM   726  C CA  . CYS A 1 98  ? 41.790 78.911  10.382  1.00 27.62  ? 513  CYS A CA  1 
ATOM   727  C C   . CYS A 1 98  ? 42.478 78.850  11.737  1.00 28.36  ? 513  CYS A C   1 
ATOM   728  O O   . CYS A 1 98  ? 42.068 79.520  12.694  1.00 28.90  ? 513  CYS A O   1 
ATOM   729  C CB  . CYS A 1 98  ? 42.477 79.993  9.544   1.00 26.56  ? 513  CYS A CB  1 
ATOM   730  S SG  . CYS A 1 98  ? 41.957 80.145  7.806   1.00 28.74  ? 513  CYS A SG  1 
ATOM   731  N N   . VAL A 1 99  ? 43.525 78.045  11.827  1.00 28.39  ? 514  VAL A N   1 
ATOM   732  C CA  . VAL A 1 99  ? 44.266 77.952  13.069  1.00 32.12  ? 514  VAL A CA  1 
ATOM   733  C C   . VAL A 1 99  ? 45.583 78.724  12.965  1.00 29.16  ? 514  VAL A C   1 
ATOM   734  O O   . VAL A 1 99  ? 46.404 78.477  12.087  1.00 29.08  ? 514  VAL A O   1 
ATOM   735  C CB  . VAL A 1 99  ? 44.568 76.486  13.438  1.00 34.85  ? 514  VAL A CB  1 
ATOM   736  C CG1 . VAL A 1 99  ? 45.613 76.431  14.548  1.00 33.11  ? 514  VAL A CG1 1 
ATOM   737  C CG2 . VAL A 1 99  ? 43.286 75.802  13.885  1.00 37.52  ? 514  VAL A CG2 1 
ATOM   738  N N   . GLY A 1 100 ? 45.770 79.678  13.858  1.00 29.64  ? 515  GLY A N   1 
ATOM   739  C CA  . GLY A 1 100 ? 46.992 80.439  13.828  1.00 30.60  ? 515  GLY A CA  1 
ATOM   740  C C   . GLY A 1 100 ? 46.728 81.919  13.871  1.00 34.15  ? 515  GLY A C   1 
ATOM   741  O O   . GLY A 1 100 ? 45.581 82.374  13.875  1.00 35.32  ? 515  GLY A O   1 
ATOM   742  N N   . ASP A 1 101 ? 47.824 82.663  13.888  1.00 37.84  ? 516  ASP A N   1 
ATOM   743  C CA  . ASP A 1 101 ? 47.809 84.113  13.941  1.00 40.42  ? 516  ASP A CA  1 
ATOM   744  C C   . ASP A 1 101 ? 47.631 84.728  12.565  1.00 37.13  ? 516  ASP A C   1 
ATOM   745  O O   . ASP A 1 101 ? 48.083 84.196  11.550  1.00 33.60  ? 516  ASP A O   1 
ATOM   746  C CB  . ASP A 1 101 ? 49.116 84.619  14.548  1.00 50.34  ? 516  ASP A CB  1 
ATOM   747  C CG  . ASP A 1 101 ? 50.257 83.601  14.429  1.00 64.38  ? 516  ASP A CG  1 
ATOM   748  O OD1 . ASP A 1 101 ? 50.080 82.545  13.769  1.00 67.56  ? 516  ASP A OD1 1 
ATOM   749  O OD2 . ASP A 1 101 ? 51.343 83.861  14.998  1.00 72.92  ? 516  ASP A OD2 1 
ATOM   750  N N   . VAL A 1 102 ? 46.968 85.869  12.553  1.00 35.46  ? 517  VAL A N   1 
ATOM   751  C CA  . VAL A 1 102 ? 46.715 86.597  11.332  1.00 35.30  ? 517  VAL A CA  1 
ATOM   752  C C   . VAL A 1 102 ? 47.963 87.433  10.993  1.00 35.20  ? 517  VAL A C   1 
ATOM   753  O O   . VAL A 1 102 ? 48.229 87.747  9.827   1.00 32.76  ? 517  VAL A O   1 
ATOM   754  C CB  . VAL A 1 102 ? 45.458 87.487  11.535  1.00 36.29  ? 517  VAL A CB  1 
ATOM   755  C CG1 . VAL A 1 102 ? 45.496 88.711  10.643  1.00 38.25  ? 517  VAL A CG1 1 
ATOM   756  C CG2 . VAL A 1 102 ? 44.214 86.660  11.266  1.00 34.33  ? 517  VAL A CG2 1 
ATOM   757  N N   . THR A 1 103 ? 48.740 87.762  12.020  1.00 33.59  ? 518  THR A N   1 
ATOM   758  C CA  . THR A 1 103 ? 49.948 88.565  11.854  1.00 33.75  ? 518  THR A CA  1 
ATOM   759  C C   . THR A 1 103 ? 51.154 87.854  12.444  1.00 31.61  ? 518  THR A C   1 
ATOM   760  O O   . THR A 1 103 ? 51.034 87.101  13.408  1.00 32.00  ? 518  THR A O   1 
ATOM   761  C CB  . THR A 1 103 ? 49.798 89.952  12.556  1.00 34.20  ? 518  THR A CB  1 
ATOM   762  O OG1 . THR A 1 103 ? 48.761 90.703  11.915  1.00 40.92  ? 518  THR A OG1 1 
ATOM   763  C CG2 . THR A 1 103 ? 51.094 90.752  12.483  1.00 36.02  ? 518  THR A CG2 1 
ATOM   764  N N   . GLU A 1 104 ? 52.318 88.111  11.865  1.00 29.93  ? 519  GLU A N   1 
ATOM   765  C CA  . GLU A 1 104 ? 53.558 87.517  12.331  1.00 32.17  ? 519  GLU A CA  1 
ATOM   766  C C   . GLU A 1 104 ? 54.630 88.591  12.534  1.00 34.95  ? 519  GLU A C   1 
ATOM   767  O O   . GLU A 1 104 ? 54.760 89.518  11.723  1.00 33.99  ? 519  GLU A O   1 
ATOM   768  C CB  . GLU A 1 104 ? 54.045 86.497  11.317  1.00 33.24  ? 519  GLU A CB  1 
ATOM   769  C CG  . GLU A 1 104 ? 55.043 85.535  11.864  1.00 35.40  ? 519  GLU A CG  1 
ATOM   770  C CD  . GLU A 1 104 ? 55.143 84.296  11.020  1.00 36.97  ? 519  GLU A CD  1 
ATOM   771  O OE1 . GLU A 1 104 ? 55.846 84.338  9.988   1.00 36.56  ? 519  GLU A OE1 1 
ATOM   772  O OE2 . GLU A 1 104 ? 54.517 83.279  11.389  1.00 41.60  ? 519  GLU A OE2 1 
ATOM   773  N N   . ASN A 1 105 ? 55.389 88.460  13.619  1.00 36.02  ? 520  ASN A N   1 
ATOM   774  C CA  . ASN A 1 105 ? 56.456 89.401  13.948  1.00 34.74  ? 520  ASN A CA  1 
ATOM   775  C C   . ASN A 1 105 ? 57.767 88.664  13.988  1.00 36.19  ? 520  ASN A C   1 
ATOM   776  O O   . ASN A 1 105 ? 57.796 87.453  14.179  1.00 38.94  ? 520  ASN A O   1 
ATOM   777  C CB  . ASN A 1 105 ? 56.224 90.031  15.311  1.00 36.61  ? 520  ASN A CB  1 
ATOM   778  C CG  . ASN A 1 105 ? 55.107 91.024  15.296  1.00 39.75  ? 520  ASN A CG  1 
ATOM   779  O OD1 . ASN A 1 105 ? 54.045 90.791  15.873  1.00 44.05  ? 520  ASN A OD1 1 
ATOM   780  N ND2 . ASN A 1 105 ? 55.329 92.148  14.625  1.00 45.25  ? 520  ASN A ND2 1 
ATOM   781  N N   . GLN A 1 106 ? 58.856 89.395  13.807  1.00 36.74  ? 521  GLN A N   1 
ATOM   782  C CA  . GLN A 1 106 ? 60.170 88.785  13.848  1.00 37.90  ? 521  GLN A CA  1 
ATOM   783  C C   . GLN A 1 106 ? 61.264 89.847  13.907  1.00 41.18  ? 521  GLN A C   1 
ATOM   784  O O   . GLN A 1 106 ? 61.119 90.924  13.328  1.00 41.74  ? 521  GLN A O   1 
ATOM   785  C CB  . GLN A 1 106 ? 60.346 87.852  12.638  1.00 34.81  ? 521  GLN A CB  1 
ATOM   786  C CG  . GLN A 1 106 ? 61.300 88.337  11.567  1.00 32.14  ? 521  GLN A CG  1 
ATOM   787  C CD  . GLN A 1 106 ? 61.450 87.355  10.418  1.00 30.86  ? 521  GLN A CD  1 
ATOM   788  O OE1 . GLN A 1 106 ? 61.752 87.750  9.291   1.00 33.23  ? 521  GLN A OE1 1 
ATOM   789  N NE2 . GLN A 1 106 ? 61.245 86.072  10.696  1.00 30.58  ? 521  GLN A NE2 1 
ATOM   790  N N   . ILE A 1 107 ? 62.338 89.546  14.639  1.00 45.72  ? 522  ILE A N   1 
ATOM   791  C CA  . ILE A 1 107 ? 63.477 90.459  14.771  1.00 49.40  ? 522  ILE A CA  1 
ATOM   792  C C   . ILE A 1 107 ? 64.318 90.359  13.501  1.00 50.61  ? 522  ILE A C   1 
ATOM   793  O O   . ILE A 1 107 ? 64.500 89.279  12.944  1.00 49.00  ? 522  ILE A O   1 
ATOM   794  C CB  . ILE A 1 107 ? 64.396 90.088  15.975  1.00 49.95  ? 522  ILE A CB  1 
ATOM   795  C CG1 . ILE A 1 107 ? 63.621 90.153  17.283  1.00 49.58  ? 522  ILE A CG1 1 
ATOM   796  C CG2 . ILE A 1 107 ? 65.575 91.043  16.057  1.00 50.78  ? 522  ILE A CG2 1 
ATOM   797  C CD1 . ILE A 1 107 ? 64.017 89.061  18.235  1.00 50.28  ? 522  ILE A CD1 1 
ATOM   798  N N   . CYS A 1 108 ? 64.844 91.486  13.050  1.00 55.06  ? 523  CYS A N   1 
ATOM   799  C CA  . CYS A 1 108 ? 65.656 91.486  11.846  1.00 61.28  ? 523  CYS A CA  1 
ATOM   800  C C   . CYS A 1 108 ? 66.840 92.438  11.949  1.00 64.80  ? 523  CYS A C   1 
ATOM   801  O O   . CYS A 1 108 ? 66.905 93.304  12.833  1.00 63.44  ? 523  CYS A O   1 
ATOM   802  C CB  . CYS A 1 108 ? 64.799 91.885  10.651  1.00 63.60  ? 523  CYS A CB  1 
ATOM   803  S SG  . CYS A 1 108 ? 63.672 93.267  11.033  1.00 71.35  ? 523  CYS A SG  1 
ATOM   804  N N   . ASN A 1 109 ? 67.777 92.262  11.027  1.00 68.73  ? 524  ASN A N   1 
ATOM   805  C CA  . ASN A 1 109 ? 68.962 93.095  10.970  1.00 73.42  ? 524  ASN A CA  1 
ATOM   806  C C   . ASN A 1 109 ? 69.629 93.243  12.321  1.00 78.79  ? 524  ASN A C   1 
ATOM   807  O O   . ASN A 1 109 ? 70.237 94.271  12.609  1.00 81.28  ? 524  ASN A O   1 
ATOM   808  C CB  . ASN A 1 109 ? 68.604 94.468  10.415  1.00 68.00  ? 524  ASN A CB  1 
ATOM   809  C CG  . ASN A 1 109 ? 68.779 94.539  8.926   1.00 66.23  ? 524  ASN A CG  1 
ATOM   810  O OD1 . ASN A 1 109 ? 69.234 93.578  8.302   1.00 64.34  ? 524  ASN A OD1 1 
ATOM   811  N ND2 . ASN A 1 109 ? 68.422 95.676  8.338   1.00 67.63  ? 524  ASN A ND2 1 
ATOM   812  N N   . LYS A 1 110 ? 69.495 92.225  13.157  1.00 83.76  ? 525  LYS A N   1 
ATOM   813  C CA  . LYS A 1 110 ? 70.133 92.258  14.456  1.00 89.61  ? 525  LYS A CA  1 
ATOM   814  C C   . LYS A 1 110 ? 71.575 91.814  14.179  1.00 94.22  ? 525  LYS A C   1 
ATOM   815  O O   . LYS A 1 110 ? 71.878 90.625  14.056  1.00 97.26  ? 525  LYS A O   1 
ATOM   816  C CB  . LYS A 1 110 ? 69.391 91.321  15.426  1.00 88.48  ? 525  LYS A CB  1 
ATOM   817  C CG  . LYS A 1 110 ? 70.236 90.254  16.096  1.00 91.34  ? 525  LYS A CG  1 
ATOM   818  C CD  . LYS A 1 110 ? 69.958 88.882  15.507  1.00 90.83  ? 525  LYS A CD  1 
ATOM   819  C CE  . LYS A 1 110 ? 71.125 87.941  15.752  1.00 92.28  ? 525  LYS A CE  1 
ATOM   820  N NZ  . LYS A 1 110 ? 70.651 86.570  16.069  1.00 93.89  ? 525  LYS A NZ  1 
ATOM   821  N N   . GLN A 1 111 ? 72.453 92.806  14.020  1.00 96.61  ? 526  GLN A N   1 
ATOM   822  C CA  . GLN A 1 111 ? 73.870 92.579  13.737  1.00 97.13  ? 526  GLN A CA  1 
ATOM   823  C C   . GLN A 1 111 ? 74.642 93.854  14.087  1.00 98.95  ? 526  GLN A C   1 
ATOM   824  O O   . GLN A 1 111 ? 74.054 94.835  14.526  1.00 100.00 ? 526  GLN A O   1 
ATOM   825  C CB  . GLN A 1 111 ? 74.085 92.258  12.250  1.00 97.08  ? 526  GLN A CB  1 
ATOM   826  C CG  . GLN A 1 111 ? 73.304 91.067  11.717  1.00 96.64  ? 526  GLN A CG  1 
ATOM   827  C CD  . GLN A 1 111 ? 72.797 91.272  10.295  1.00 97.79  ? 526  GLN A CD  1 
ATOM   828  O OE1 . GLN A 1 111 ? 71.893 90.568  9.843   1.00 98.58  ? 526  GLN A OE1 1 
ATOM   829  N NE2 . GLN A 1 111 ? 73.379 92.234  9.584   1.00 98.94  ? 526  GLN A NE2 1 
ATOM   830  N N   . ASP A 1 112 ? 75.959 93.838  13.894  1.00 99.90  ? 527  ASP A N   1 
ATOM   831  C CA  . ASP A 1 112 ? 76.811 95.006  14.169  1.00 100.00 ? 527  ASP A CA  1 
ATOM   832  C C   . ASP A 1 112 ? 76.108 96.361  13.957  1.00 100.00 ? 527  ASP A C   1 
ATOM   833  O O   . ASP A 1 112 ? 75.906 96.777  12.815  1.00 100.00 ? 527  ASP A O   1 
ATOM   834  C CB  . ASP A 1 112 ? 78.047 94.959  13.259  1.00 100.00 ? 527  ASP A CB  1 
ATOM   835  C CG  . ASP A 1 112 ? 77.707 95.218  11.783  1.00 100.00 ? 527  ASP A CG  1 
ATOM   836  O OD1 . ASP A 1 112 ? 77.401 94.247  11.057  1.00 100.00 ? 527  ASP A OD1 1 
ATOM   837  O OD2 . ASP A 1 112 ? 77.749 96.393  11.348  1.00 100.00 ? 527  ASP A OD2 1 
ATOM   838  N N   . CYS A 1 113 ? 75.732 97.065  15.019  1.00 99.84  ? 528  CYS A N   1 
ATOM   839  C CA  . CYS A 1 113 ? 75.083 98.343  14.773  1.00 100.00 ? 528  CYS A CA  1 
ATOM   840  C C   . CYS A 1 113 ? 76.041 99.518  14.792  1.00 100.00 ? 528  CYS A C   1 
ATOM   841  O O   . CYS A 1 113 ? 76.485 99.910  15.893  1.00 100.00 ? 528  CYS A O   1 
ATOM   842  C CB  . CYS A 1 113 ? 73.943 98.613  15.749  1.00 99.78  ? 528  CYS A CB  1 
ATOM   843  S SG  . CYS A 1 113 ? 73.103 100.207 15.403  1.00 100.00 ? 528  CYS A SG  1 
ATOM   844  O OXT . CYS A 1 113 ? 76.317 100.030 13.685  1.00 100.00 ? 528  CYS A OXT 1 
HETATM 845  C C1  . FUL B 2 .   ? 27.776 64.560  7.679   1.00 62.38  ? 1432 FUL A C1  1 
HETATM 846  C C2  . FUL B 2 .   ? 26.818 65.596  8.319   1.00 65.79  ? 1432 FUL A C2  1 
HETATM 847  O O2  . FUL B 2 .   ? 25.860 64.927  9.130   1.00 70.33  ? 1432 FUL A O2  1 
HETATM 848  C C3  . FUL B 2 .   ? 27.575 66.599  9.190   1.00 69.91  ? 1432 FUL A C3  1 
HETATM 849  O O3  . FUL B 2 .   ? 26.688 67.633  9.587   1.00 73.15  ? 1432 FUL A O3  1 
HETATM 850  C C4  . FUL B 2 .   ? 28.748 67.201  8.425   1.00 71.27  ? 1432 FUL A C4  1 
HETATM 851  O O4  . FUL B 2 .   ? 28.251 67.943  7.320   1.00 75.32  ? 1432 FUL A O4  1 
HETATM 852  C C5  . FUL B 2 .   ? 29.647 66.071  7.928   1.00 71.10  ? 1432 FUL A C5  1 
HETATM 853  C C6  . FUL B 2 .   ? 30.853 66.573  7.150   1.00 69.93  ? 1432 FUL A C6  1 
HETATM 854  O O5  . FUL B 2 .   ? 28.898 65.210  7.045   1.00 69.35  ? 1432 FUL A O5  1 
HETATM 855  C C1  . FUC C 3 .   ? 70.970 101.912 9.402   1.00 95.34  ? 1489 FUC A C1  1 
HETATM 856  C C2  . FUC C 3 .   ? 72.140 101.381 8.534   1.00 95.60  ? 1489 FUC A C2  1 
HETATM 857  C C3  . FUC C 3 .   ? 73.242 102.449 8.513   1.00 96.07  ? 1489 FUC A C3  1 
HETATM 858  C C4  . FUC C 3 .   ? 73.651 102.847 9.941   1.00 96.12  ? 1489 FUC A C4  1 
HETATM 859  C C5  . FUC C 3 .   ? 72.426 103.187 10.814  1.00 95.49  ? 1489 FUC A C5  1 
HETATM 860  C C6  . FUC C 3 .   ? 72.798 103.348 12.275  1.00 95.31  ? 1489 FUC A C6  1 
HETATM 861  O O2  . FUC C 3 .   ? 71.717 101.117 7.204   1.00 93.58  ? 1489 FUC A O2  1 
HETATM 862  O O3  . FUC C 3 .   ? 74.373 101.962 7.799   1.00 96.49  ? 1489 FUC A O3  1 
HETATM 863  O O4  . FUC C 3 .   ? 74.408 101.805 10.542  1.00 97.86  ? 1489 FUC A O4  1 
HETATM 864  O O5  . FUC C 3 .   ? 71.432 102.135 10.742  1.00 94.49  ? 1489 FUC A O5  1 
HETATM 865  O O   . HOH D 4 .   ? 11.088 50.086  -0.991  1.00 28.22  ? 1001 HOH A O   1 
HETATM 866  O O   . HOH D 4 .   ? 11.014 43.549  0.814   1.00 22.62  ? 1002 HOH A O   1 
HETATM 867  O O   . HOH D 4 .   ? 8.763  46.133  -0.791  1.00 24.50  ? 1003 HOH A O   1 
HETATM 868  O O   . HOH D 4 .   ? 8.963  48.864  -0.063  1.00 35.78  ? 1004 HOH A O   1 
HETATM 869  O O   . HOH D 4 .   ? 11.708 35.109  -15.540 1.00 29.80  ? 1005 HOH A O   1 
HETATM 870  O O   . HOH D 4 .   ? 42.598 82.309  13.807  1.00 40.72  ? 1006 HOH A O   1 
HETATM 871  O O   . HOH D 4 .   ? 34.300 71.193  9.738   1.00 29.30  ? 1007 HOH A O   1 
HETATM 872  O O   . HOH D 4 .   ? 40.337 75.438  9.125   1.00 28.48  ? 1008 HOH A O   1 
HETATM 873  O O   . HOH D 4 .   ? 51.690 93.814  7.213   1.00 48.30  ? 1009 HOH A O   1 
HETATM 874  O O   . HOH D 4 .   ? 56.389 86.779  3.637   1.00 31.66  ? 1010 HOH A O   1 
HETATM 875  O O   . HOH D 4 .   ? 8.421  45.867  -3.574  1.00 25.74  ? 1011 HOH A O   1 
HETATM 876  O O   . HOH D 4 .   ? 7.803  37.158  -7.748  1.00 30.76  ? 1012 HOH A O   1 
HETATM 877  O O   . HOH D 4 .   ? 7.272  41.788  -5.930  1.00 33.71  ? 1013 HOH A O   1 
HETATM 878  O O   . HOH D 4 .   ? 12.177 52.422  2.368   1.00 35.96  ? 1014 HOH A O   1 
HETATM 879  O O   . HOH D 4 .   ? 13.953 53.170  4.164   1.00 60.13  ? 1015 HOH A O   1 
HETATM 880  O O   . HOH D 4 .   ? 16.254 56.786  2.585   1.00 40.91  ? 1016 HOH A O   1 
HETATM 881  O O   . HOH D 4 .   ? 20.521 41.864  -5.459  1.00 35.02  ? 1017 HOH A O   1 
HETATM 882  O O   . HOH D 4 .   ? 21.961 41.511  -3.152  1.00 55.10  ? 1018 HOH A O   1 
HETATM 883  O O   . HOH D 4 .   ? 34.233 69.099  7.503   1.00 49.00  ? 1019 HOH A O   1 
HETATM 884  O O   . HOH D 4 .   ? 33.051 72.308  11.608  1.00 31.90  ? 1020 HOH A O   1 
HETATM 885  O O   . HOH D 4 .   ? 10.216 43.790  -7.110  1.00 36.06  ? 1021 HOH A O   1 
HETATM 886  O O   . HOH D 4 .   ? 27.403 59.034  -2.671  1.00 50.99  ? 1022 HOH A O   1 
HETATM 887  O O   . HOH D 4 .   ? 28.759 64.590  -2.197  1.00 44.82  ? 1023 HOH A O   1 
HETATM 888  O O   . HOH D 4 .   ? 28.840 62.845  4.645   1.00 44.88  ? 1024 HOH A O   1 
HETATM 889  O O   . HOH D 4 .   ? 27.733 67.256  -3.355  1.00 41.18  ? 1025 HOH A O   1 
HETATM 890  O O   . HOH D 4 .   ? 17.943 29.561  -15.623 1.00 43.82  ? 1026 HOH A O   1 
HETATM 891  O O   . HOH D 4 .   ? 11.111 32.705  -1.712  1.00 45.66  ? 1027 HOH A O   1 
HETATM 892  O O   . HOH D 4 .   ? 19.274 37.899  -7.349  1.00 45.56  ? 1028 HOH A O   1 
HETATM 893  O O   . HOH D 4 .   ? 40.499 71.604  6.993   1.00 53.65  ? 1029 HOH A O   1 
HETATM 894  O O   . HOH D 4 .   ? 44.139 76.420  8.734   1.00 38.26  ? 1030 HOH A O   1 
HETATM 895  O O   . HOH D 4 .   ? 45.368 76.884  5.741   1.00 39.27  ? 1031 HOH A O   1 
HETATM 896  O O   . HOH D 4 .   ? 49.766 81.727  5.098   1.00 32.34  ? 1032 HOH A O   1 
HETATM 897  O O   . HOH D 4 .   ? 52.764 82.232  1.964   1.00 31.55  ? 1033 HOH A O   1 
HETATM 898  O O   . HOH D 4 .   ? 46.624 85.911  2.972   1.00 22.12  ? 1034 HOH A O   1 
HETATM 899  O O   . HOH D 4 .   ? 41.684 86.800  8.172   1.00 26.53  ? 1035 HOH A O   1 
HETATM 900  O O   . HOH D 4 .   ? 42.279 89.422  8.907   1.00 49.39  ? 1036 HOH A O   1 
HETATM 901  O O   . HOH D 4 .   ? 47.802 93.592  6.841   1.00 42.25  ? 1037 HOH A O   1 
HETATM 902  O O   . HOH D 4 .   ? 46.368 91.531  10.153  1.00 38.36  ? 1038 HOH A O   1 
HETATM 903  O O   . HOH D 4 .   ? 45.107 90.326  8.135   1.00 31.05  ? 1039 HOH A O   1 
HETATM 904  O O   . HOH D 4 .   ? 45.022 92.246  6.335   1.00 29.48  ? 1040 HOH A O   1 
HETATM 905  O O   . HOH D 4 .   ? 7.358  32.444  -11.889 1.00 33.96  ? 1041 HOH A O   1 
HETATM 906  O O   . HOH D 4 .   ? 10.427 50.350  3.547   1.00 48.73  ? 1042 HOH A O   1 
HETATM 907  O O   . HOH D 4 .   ? 23.890 54.480  2.636   1.00 38.29  ? 1043 HOH A O   1 
HETATM 908  O O   . HOH D 4 .   ? 29.694 64.140  2.450   1.00 43.64  ? 1044 HOH A O   1 
HETATM 909  O O   . HOH D 4 .   ? 28.875 65.226  0.271   1.00 37.74  ? 1045 HOH A O   1 
HETATM 910  O O   . HOH D 4 .   ? 28.967 65.764  -5.737  1.00 71.60  ? 1046 HOH A O   1 
HETATM 911  O O   . HOH D 4 .   ? 23.589 62.389  -6.350  1.00 42.03  ? 1047 HOH A O   1 
HETATM 912  O O   . HOH D 4 .   ? 17.819 34.370  -1.356  1.00 75.93  ? 1048 HOH A O   1 
HETATM 913  O O   . HOH D 4 .   ? 19.777 37.980  -10.572 1.00 43.87  ? 1049 HOH A O   1 
HETATM 914  O O   . HOH D 4 .   ? 18.921 35.384  -4.333  1.00 54.29  ? 1050 HOH A O   1 
HETATM 915  O O   . HOH D 4 .   ? 16.704 46.526  -17.796 1.00 57.89  ? 1051 HOH A O   1 
HETATM 916  O O   . HOH D 4 .   ? 21.705 45.416  -11.085 1.00 52.62  ? 1052 HOH A O   1 
HETATM 917  O O   . HOH D 4 .   ? 11.199 54.497  -7.264  1.00 47.94  ? 1053 HOH A O   1 
HETATM 918  O O   . HOH D 4 .   ? 19.439 52.644  -10.910 1.00 49.68  ? 1054 HOH A O   1 
HETATM 919  O O   . HOH D 4 .   ? 16.392 64.576  -1.874  1.00 48.39  ? 1055 HOH A O   1 
HETATM 920  O O   . HOH D 4 .   ? 17.895 62.582  1.308   1.00 48.38  ? 1056 HOH A O   1 
HETATM 921  O O   . HOH D 4 .   ? 19.014 70.915  0.549   1.00 50.98  ? 1057 HOH A O   1 
HETATM 922  O O   . HOH D 4 .   ? 29.427 73.695  -1.291  1.00 56.20  ? 1058 HOH A O   1 
HETATM 923  O O   . HOH D 4 .   ? 25.181 74.087  4.484   1.00 39.07  ? 1059 HOH A O   1 
HETATM 924  O O   . HOH D 4 .   ? 23.434 71.549  -0.786  1.00 39.32  ? 1060 HOH A O   1 
HETATM 925  O O   . HOH D 4 .   ? 26.118 70.847  -1.850  1.00 35.97  ? 1061 HOH A O   1 
HETATM 926  O O   . HOH D 4 .   ? 28.732 70.910  -4.654  1.00 48.26  ? 1062 HOH A O   1 
HETATM 927  O O   . HOH D 4 .   ? 28.844 70.284  -0.052  1.00 31.43  ? 1063 HOH A O   1 
HETATM 928  O O   . HOH D 4 .   ? 30.120 67.981  -1.002  1.00 40.80  ? 1064 HOH A O   1 
HETATM 929  O O   . HOH D 4 .   ? 30.294 72.718  0.840   1.00 31.90  ? 1065 HOH A O   1 
HETATM 930  O O   . HOH D 4 .   ? 26.830 73.985  -2.255  1.00 34.85  ? 1066 HOH A O   1 
HETATM 931  O O   . HOH D 4 .   ? 24.908 75.815  -1.385  1.00 32.87  ? 1067 HOH A O   1 
HETATM 932  O O   . HOH D 4 .   ? 30.697 72.597  -3.665  1.00 32.88  ? 1068 HOH A O   1 
HETATM 933  O O   . HOH D 4 .   ? 32.861 68.991  0.837   1.00 79.46  ? 1069 HOH A O   1 
HETATM 934  O O   . HOH D 4 .   ? 47.520 79.897  -0.201  1.00 39.06  ? 1070 HOH A O   1 
HETATM 935  O O   . HOH D 4 .   ? 41.043 74.287  4.969   1.00 36.27  ? 1071 HOH A O   1 
HETATM 936  O O   . HOH D 4 .   ? 53.940 80.797  10.728  1.00 47.43  ? 1072 HOH A O   1 
HETATM 937  O O   . HOH D 4 .   ? 56.900 80.699  5.596   1.00 62.10  ? 1073 HOH A O   1 
HETATM 938  O O   . HOH D 4 .   ? 37.760 84.454  7.433   1.00 34.93  ? 1074 HOH A O   1 
HETATM 939  O O   . HOH D 4 .   ? 37.755 83.457  10.242  1.00 30.99  ? 1075 HOH A O   1 
HETATM 940  O O   . HOH D 4 .   ? 44.689 86.445  14.863  1.00 55.07  ? 1076 HOH A O   1 
HETATM 941  O O   . HOH D 4 .   ? 41.547 83.416  11.612  1.00 36.36  ? 1077 HOH A O   1 
HETATM 942  O O   . HOH D 4 .   ? 40.522 85.551  10.856  1.00 41.60  ? 1078 HOH A O   1 
HETATM 943  O O   . HOH D 4 .   ? 33.110 82.806  8.153   1.00 31.28  ? 1079 HOH A O   1 
HETATM 944  O O   . HOH D 4 .   ? 39.228 87.231  6.524   1.00 38.72  ? 1080 HOH A O   1 
HETATM 945  O O   . HOH D 4 .   ? 33.906 80.379  1.353   1.00 32.50  ? 1081 HOH A O   1 
HETATM 946  O O   . HOH D 4 .   ? 31.657 81.768  -0.445  1.00 25.45  ? 1082 HOH A O   1 
HETATM 947  O O   . HOH D 4 .   ? 30.584 84.175  -0.314  1.00 32.62  ? 1083 HOH A O   1 
HETATM 948  O O   . HOH D 4 .   ? 33.183 84.778  1.029   1.00 41.59  ? 1084 HOH A O   1 
HETATM 949  O O   . HOH D 4 .   ? 31.663 84.511  3.183   1.00 37.56  ? 1085 HOH A O   1 
HETATM 950  O O   . HOH D 4 .   ? 40.882 78.945  15.416  1.00 30.97  ? 1086 HOH A O   1 
HETATM 951  O O   . HOH D 4 .   ? 39.652 76.549  14.119  1.00 24.68  ? 1087 HOH A O   1 
HETATM 952  O O   . HOH D 4 .   ? 36.903 76.996  14.401  1.00 30.86  ? 1088 HOH A O   1 
HETATM 953  O O   . HOH D 4 .   ? 5.973  30.434  -9.945  1.00 53.68  ? 1089 HOH A O   1 
HETATM 954  O O   . HOH D 4 .   ? 4.690  34.687  -13.786 1.00 67.37  ? 1090 HOH A O   1 
HETATM 955  O O   . HOH D 4 .   ? 25.369 59.106  5.981   1.00 42.35  ? 1091 HOH A O   1 
HETATM 956  O O   . HOH D 4 .   ? 73.864 104.218 6.126   1.00 55.88  ? 1092 HOH A O   1 
HETATM 957  O O   . HOH D 4 .   ? 4.875  36.855  -18.596 1.00 64.81  ? 1093 HOH A O   1 
HETATM 958  O O   . HOH D 4 .   ? 47.945 77.499  0.791   1.00 75.71  ? 1094 HOH A O   1 
HETATM 959  O O   . HOH D 4 .   ? 9.090  39.079  -11.215 1.00 38.91  ? 1095 HOH A O   1 
HETATM 960  O O   . HOH D 4 .   ? 9.721  39.715  -17.367 1.00 63.48  ? 1096 HOH A O   1 
HETATM 961  O O   . HOH D 4 .   ? 11.795 57.137  0.811   1.00 55.73  ? 1097 HOH A O   1 
HETATM 962  O O   . HOH D 4 .   ? 28.530 56.708  -4.344  1.00 58.54  ? 1098 HOH A O   1 
HETATM 963  O O   . HOH D 4 .   ? 17.051 38.124  -19.123 1.00 39.14  ? 1099 HOH A O   1 
HETATM 964  O O   . HOH D 4 .   ? 24.737 52.342  -4.227  1.00 66.77  ? 1100 HOH A O   1 
HETATM 965  O O   . HOH D 4 .   ? 24.887 49.233  -1.751  1.00 81.36  ? 1101 HOH A O   1 
HETATM 966  O O   . HOH D 4 .   ? 7.832  45.072  -6.454  1.00 49.21  ? 1102 HOH A O   1 
HETATM 967  O O   . HOH D 4 .   ? 11.710 35.028  0.303   1.00 49.25  ? 1103 HOH A O   1 
HETATM 968  O O   . HOH D 4 .   ? 50.605 79.886  1.776   1.00 40.60  ? 1104 HOH A O   1 
HETATM 969  O O   . HOH D 4 .   ? 18.291 23.770  -24.035 1.00 63.92  ? 1105 HOH A O   1 
HETATM 970  O O   . HOH D 4 .   ? 12.406 37.845  -22.891 1.00 38.76  ? 1106 HOH A O   1 
HETATM 971  O O   . HOH D 4 .   ? 14.604 36.562  -18.851 1.00 37.42  ? 1107 HOH A O   1 
HETATM 972  O O   . HOH D 4 .   ? 40.474 74.151  14.681  1.00 38.36  ? 1108 HOH A O   1 
HETATM 973  O O   . HOH D 4 .   ? 40.657 72.916  9.502   1.00 61.73  ? 1109 HOH A O   1 
HETATM 974  O O   . HOH D 4 .   ? 38.369 68.811  9.123   1.00 83.49  ? 1110 HOH A O   1 
HETATM 975  O O   . HOH D 4 .   ? 17.831 41.955  -17.568 1.00 42.70  ? 1111 HOH A O   1 
HETATM 976  O O   . HOH D 4 .   ? 16.482 61.158  -8.228  1.00 43.62  ? 1112 HOH A O   1 
HETATM 977  O O   . HOH D 4 .   ? 18.571 59.781  -9.542  1.00 55.43  ? 1113 HOH A O   1 
HETATM 978  O O   . HOH D 4 .   ? 23.978 68.684  6.316   1.00 43.45  ? 1114 HOH A O   1 
HETATM 979  O O   . HOH D 4 .   ? 18.077 68.745  4.387   1.00 53.57  ? 1115 HOH A O   1 
HETATM 980  O O   . HOH D 4 .   ? 18.668 41.342  -14.624 1.00 77.48  ? 1116 HOH A O   1 
HETATM 981  O O   . HOH D 4 .   ? 17.971 39.375  -16.992 1.00 54.89  ? 1117 HOH A O   1 
HETATM 982  O O   . HOH D 4 .   ? 48.401 76.540  5.775   1.00 65.72  ? 1118 HOH A O   1 
HETATM 983  O O   . HOH D 4 .   ? 30.223 79.130  9.069   1.00 38.05  ? 1119 HOH A O   1 
HETATM 984  O O   . HOH D 4 .   ? 53.535 93.060  5.128   1.00 49.47  ? 1120 HOH A O   1 
HETATM 985  O O   . HOH D 4 .   ? 55.018 86.239  1.417   1.00 45.36  ? 1121 HOH A O   1 
HETATM 986  O O   . HOH D 4 .   ? 7.715  42.744  -8.952  1.00 50.06  ? 1122 HOH A O   1 
HETATM 987  O O   . HOH D 4 .   ? 9.368  48.134  -9.380  1.00 44.88  ? 1123 HOH A O   1 
HETATM 988  O O   . HOH D 4 .   ? 10.419 50.477  -9.517  1.00 56.28  ? 1124 HOH A O   1 
HETATM 989  O O   . HOH D 4 .   ? 10.882 54.079  6.510   1.00 50.77  ? 1125 HOH A O   1 
HETATM 990  O O   . HOH D 4 .   ? 15.877 60.908  -3.300  1.00 43.96  ? 1126 HOH A O   1 
HETATM 991  O O   . HOH D 4 .   ? 22.031 61.314  5.857   1.00 52.32  ? 1127 HOH A O   1 
HETATM 992  O O   . HOH D 4 .   ? 31.296 61.857  0.643   1.00 54.84  ? 1128 HOH A O   1 
HETATM 993  O O   . HOH D 4 .   ? 7.321  36.098  -12.166 1.00 57.52  ? 1129 HOH A O   1 
HETATM 994  O O   . HOH D 4 .   ? 10.504 41.779  -14.300 1.00 71.62  ? 1130 HOH A O   1 
HETATM 995  O O   . HOH D 4 .   ? 18.798 33.681  -10.060 1.00 39.35  ? 1131 HOH A O   1 
HETATM 996  O O   . HOH D 4 .   ? 18.093 35.363  -12.544 1.00 44.27  ? 1132 HOH A O   1 
HETATM 997  O O   . HOH D 4 .   ? 18.216 38.043  -12.897 1.00 47.68  ? 1133 HOH A O   1 
HETATM 998  O O   . HOH D 4 .   ? 16.205 25.578  -8.813  1.00 45.15  ? 1134 HOH A O   1 
HETATM 999  O O   . HOH D 4 .   ? 19.365 29.133  -7.430  1.00 53.25  ? 1135 HOH A O   1 
HETATM 1000 O O   . HOH D 4 .   ? 17.882 64.489  -9.172  1.00 58.44  ? 1136 HOH A O   1 
HETATM 1001 O O   . HOH D 4 .   ? 24.569 70.587  -4.433  1.00 53.17  ? 1137 HOH A O   1 
HETATM 1002 O O   . HOH D 4 .   ? 23.078 54.877  -0.164  1.00 42.76  ? 1138 HOH A O   1 
HETATM 1003 O O   . HOH D 4 .   ? 20.724 36.651  -0.290  1.00 69.55  ? 1139 HOH A O   1 
HETATM 1004 O O   . HOH D 4 .   ? 22.312 38.792  -0.993  1.00 67.80  ? 1140 HOH A O   1 
HETATM 1005 O O   . HOH D 4 .   ? 63.615 90.790  4.808   1.00 70.54  ? 1141 HOH A O   1 
HETATM 1006 O O   . HOH D 4 .   ? 62.943 86.554  6.829   1.00 63.41  ? 1142 HOH A O   1 
HETATM 1007 O O   . HOH D 4 .   ? 62.809 98.133  16.680  1.00 55.80  ? 1143 HOH A O   1 
HETATM 1008 O O   . HOH D 4 .   ? 36.995 88.452  8.952   1.00 57.82  ? 1144 HOH A O   1 
HETATM 1009 O O   . HOH D 4 .   ? 46.734 79.716  17.635  1.00 47.69  ? 1145 HOH A O   1 
HETATM 1010 O O   . HOH D 4 .   ? 54.662 86.956  16.264  1.00 61.51  ? 1146 HOH A O   1 
HETATM 1011 O O   . HOH D 4 .   ? 45.193 82.515  17.256  1.00 54.02  ? 1147 HOH A O   1 
HETATM 1012 O O   . HOH D 4 .   ? 48.098 84.289  16.964  1.00 42.40  ? 1148 HOH A O   1 
HETATM 1013 O O   . HOH D 4 .   ? 32.975 71.507  1.638   1.00 46.43  ? 1149 HOH A O   1 
HETATM 1014 O O   . HOH D 4 .   ? 74.059 99.324  8.541   1.00 78.97  ? 1150 HOH A O   1 
HETATM 1015 O O   . HOH D 4 .   ? 69.773 84.314  15.687  1.00 77.66  ? 1151 HOH A O   1 
HETATM 1016 O O   . HOH D 4 .   ? 78.090 99.107  12.104  1.00 79.36  ? 1152 HOH A O   1 
HETATM 1017 O O   . HOH D 4 .   ? 69.577 99.076  15.781  1.00 47.62  ? 1153 HOH A O   1 
HETATM 1018 O O   . HOH D 4 .   ? 77.812 99.647  9.690   1.00 59.45  ? 1154 HOH A O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'FUC A 1489 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLN 1   416 416 GLN GLN A . n 
A 1 2   ASP 2   417 417 ASP ASP A . n 
A 1 3   GLY 3   418 418 GLY GLY A . n 
A 1 4   GLY 4   419 419 GLY GLY A . n 
A 1 5   TRP 5   420 420 TRP TRP A . n 
A 1 6   SER 6   421 421 SER SER A . n 
A 1 7   HIS 7   422 422 HIS HIS A . n 
A 1 8   TRP 8   423 423 TRP TRP A . n 
A 1 9   SER 9   424 424 SER SER A . n 
A 1 10  PRO 10  425 425 PRO PRO A . n 
A 1 11  TRP 11  426 426 TRP TRP A . n 
A 1 12  SER 12  427 427 SER SER A . n 
A 1 13  SER 13  428 428 SER SER A . n 
A 1 14  CYS 14  429 429 CYS CYS A . n 
A 1 15  SER 15  430 430 SER SER A . n 
A 1 16  VAL 16  431 431 VAL VAL A . n 
A 1 17  THR 17  432 432 THR THR A . n 
A 1 18  CYS 18  433 433 CYS CYS A . n 
A 1 19  GLY 19  434 434 GLY GLY A . n 
A 1 20  ASP 20  435 435 ASP ASP A . n 
A 1 21  GLY 21  436 436 GLY GLY A . n 
A 1 22  VAL 22  437 437 VAL VAL A . n 
A 1 23  ILE 23  438 438 ILE ILE A . n 
A 1 24  THR 24  439 439 THR THR A . n 
A 1 25  ARG 25  440 440 ARG ARG A . n 
A 1 26  ILE 26  441 441 ILE ILE A . n 
A 1 27  ARG 27  442 442 ARG ARG A . n 
A 1 28  LEU 28  443 443 LEU LEU A . n 
A 1 29  CYS 29  444 444 CYS CYS A . n 
A 1 30  ASN 30  445 445 ASN ASN A . n 
A 1 31  SER 31  446 446 SER SER A . n 
A 1 32  PRO 32  447 447 PRO PRO A . n 
A 1 33  SER 33  448 448 SER SER A . n 
A 1 34  PRO 34  449 449 PRO PRO A . n 
A 1 35  GLN 35  450 450 GLN GLN A . n 
A 1 36  MET 36  451 451 MET MET A . n 
A 1 37  ASN 37  452 452 ASN ASN A . n 
A 1 38  GLY 38  453 453 GLY GLY A . n 
A 1 39  LYS 39  454 454 LYS LYS A . n 
A 1 40  PRO 40  455 455 PRO PRO A . n 
A 1 41  CYS 41  456 456 CYS CYS A . n 
A 1 42  GLU 42  457 457 GLU GLU A . n 
A 1 43  GLY 43  458 458 GLY GLY A . n 
A 1 44  GLU 44  459 459 GLU GLU A . n 
A 1 45  ALA 45  460 460 ALA ALA A . n 
A 1 46  ARG 46  461 461 ARG ARG A . n 
A 1 47  GLU 47  462 462 GLU GLU A . n 
A 1 48  THR 48  463 463 THR THR A . n 
A 1 49  LYS 49  464 464 LYS LYS A . n 
A 1 50  ALA 50  465 465 ALA ALA A . n 
A 1 51  CYS 51  466 466 CYS CYS A . n 
A 1 52  LYS 52  467 467 LYS LYS A . n 
A 1 53  LYS 53  468 468 LYS LYS A . n 
A 1 54  ASP 54  469 469 ASP ASP A . n 
A 1 55  ALA 55  470 470 ALA ALA A . n 
A 1 56  CYS 56  471 471 CYS CYS A . n 
A 1 57  PRO 57  472 472 PRO PRO A . n 
A 1 58  ILE 58  473 473 ILE ILE A . n 
A 1 59  ASN 59  474 474 ASN ASN A . n 
A 1 60  GLY 60  475 475 GLY GLY A . n 
A 1 61  GLY 61  476 476 GLY GLY A . n 
A 1 62  TRP 62  477 477 TRP TRP A . n 
A 1 63  GLY 63  478 478 GLY GLY A . n 
A 1 64  PRO 64  479 479 PRO PRO A . n 
A 1 65  TRP 65  480 480 TRP TRP A . n 
A 1 66  SER 66  481 481 SER SER A . n 
A 1 67  PRO 67  482 482 PRO PRO A . n 
A 1 68  TRP 68  483 483 TRP TRP A . n 
A 1 69  ASP 69  484 484 ASP ASP A . n 
A 1 70  ILE 70  485 485 ILE ILE A . n 
A 1 71  CYS 71  486 486 CYS CYS A . n 
A 1 72  SER 72  487 487 SER SER A . n 
A 1 73  VAL 73  488 488 VAL VAL A . n 
A 1 74  THR 74  489 489 THR THR A . n 
A 1 75  CYS 75  490 490 CYS CYS A . n 
A 1 76  GLY 76  491 491 GLY GLY A . n 
A 1 77  GLY 77  492 492 GLY GLY A . n 
A 1 78  GLY 78  493 493 GLY GLY A . n 
A 1 79  VAL 79  494 494 VAL VAL A . n 
A 1 80  GLN 80  495 495 GLN GLN A . n 
A 1 81  LYS 81  496 496 LYS LYS A . n 
A 1 82  ARG 82  497 497 ARG ARG A . n 
A 1 83  SER 83  498 498 SER SER A . n 
A 1 84  ARG 84  499 499 ARG ARG A . n 
A 1 85  LEU 85  500 500 LEU LEU A . n 
A 1 86  CYS 86  501 501 CYS CYS A . n 
A 1 87  ASN 87  502 502 ASN ASN A . n 
A 1 88  ASN 88  503 503 ASN ASN A . n 
A 1 89  PRO 89  504 504 PRO PRO A . n 
A 1 90  THR 90  505 505 THR THR A . n 
A 1 91  PRO 91  506 506 PRO PRO A . n 
A 1 92  GLN 92  507 507 GLN GLN A . n 
A 1 93  PHE 93  508 508 PHE PHE A . n 
A 1 94  GLY 94  509 509 GLY GLY A . n 
A 1 95  GLY 95  510 510 GLY GLY A . n 
A 1 96  LYS 96  511 511 LYS LYS A . n 
A 1 97  ASP 97  512 512 ASP ASP A . n 
A 1 98  CYS 98  513 513 CYS CYS A . n 
A 1 99  VAL 99  514 514 VAL VAL A . n 
A 1 100 GLY 100 515 515 GLY GLY A . n 
A 1 101 ASP 101 516 516 ASP ASP A . n 
A 1 102 VAL 102 517 517 VAL VAL A . n 
A 1 103 THR 103 518 518 THR THR A . n 
A 1 104 GLU 104 519 519 GLU GLU A . n 
A 1 105 ASN 105 520 520 ASN ASN A . n 
A 1 106 GLN 106 521 521 GLN GLN A . n 
A 1 107 ILE 107 522 522 ILE ILE A . n 
A 1 108 CYS 108 523 523 CYS CYS A . n 
A 1 109 ASN 109 524 524 ASN ASN A . n 
A 1 110 LYS 110 525 525 LYS LYS A . n 
A 1 111 GLN 111 526 526 GLN GLN A . n 
A 1 112 ASP 112 527 527 ASP ASP A . n 
A 1 113 CYS 113 528 528 CYS CYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 FUL 1   1432 1432 FUL FUC A . 
C 3 FUC 1   1489 1489 FUC FUC A . 
D 4 HOH 1   1001 1001 HOH HOH A . 
D 4 HOH 2   1002 1002 HOH HOH A . 
D 4 HOH 3   1003 1003 HOH HOH A . 
D 4 HOH 4   1004 1004 HOH HOH A . 
D 4 HOH 5   1005 1005 HOH HOH A . 
D 4 HOH 6   1006 1006 HOH HOH A . 
D 4 HOH 7   1007 1007 HOH HOH A . 
D 4 HOH 8   1008 1008 HOH HOH A . 
D 4 HOH 9   1009 1009 HOH HOH A . 
D 4 HOH 10  1010 1010 HOH HOH A . 
D 4 HOH 11  1011 1011 HOH HOH A . 
D 4 HOH 12  1012 1012 HOH HOH A . 
D 4 HOH 13  1013 1013 HOH HOH A . 
D 4 HOH 14  1014 1014 HOH HOH A . 
D 4 HOH 15  1015 1015 HOH HOH A . 
D 4 HOH 16  1016 1016 HOH HOH A . 
D 4 HOH 17  1017 1017 HOH HOH A . 
D 4 HOH 18  1018 1018 HOH HOH A . 
D 4 HOH 19  1019 1019 HOH HOH A . 
D 4 HOH 20  1020 1020 HOH HOH A . 
D 4 HOH 21  1021 1021 HOH HOH A . 
D 4 HOH 22  1022 1022 HOH HOH A . 
D 4 HOH 23  1023 1023 HOH HOH A . 
D 4 HOH 24  1024 1024 HOH HOH A . 
D 4 HOH 25  1025 1025 HOH HOH A . 
D 4 HOH 26  1026 1026 HOH HOH A . 
D 4 HOH 27  1027 1027 HOH HOH A . 
D 4 HOH 28  1028 1028 HOH HOH A . 
D 4 HOH 29  1029 1029 HOH HOH A . 
D 4 HOH 30  1030 1030 HOH HOH A . 
D 4 HOH 31  1031 1031 HOH HOH A . 
D 4 HOH 32  1032 1032 HOH HOH A . 
D 4 HOH 33  1033 1033 HOH HOH A . 
D 4 HOH 34  1034 1034 HOH HOH A . 
D 4 HOH 35  1035 1035 HOH HOH A . 
D 4 HOH 36  1036 1036 HOH HOH A . 
D 4 HOH 37  1037 1037 HOH HOH A . 
D 4 HOH 38  1038 1038 HOH HOH A . 
D 4 HOH 39  1039 1039 HOH HOH A . 
D 4 HOH 40  1040 1040 HOH HOH A . 
D 4 HOH 41  1041 1041 HOH HOH A . 
D 4 HOH 42  1042 1042 HOH HOH A . 
D 4 HOH 43  1043 1043 HOH HOH A . 
D 4 HOH 44  1044 1044 HOH HOH A . 
D 4 HOH 45  1045 1045 HOH HOH A . 
D 4 HOH 46  1046 1046 HOH HOH A . 
D 4 HOH 47  1047 1047 HOH HOH A . 
D 4 HOH 48  1048 1048 HOH HOH A . 
D 4 HOH 49  1049 1049 HOH HOH A . 
D 4 HOH 50  1050 1050 HOH HOH A . 
D 4 HOH 51  1051 1051 HOH HOH A . 
D 4 HOH 52  1052 1052 HOH HOH A . 
D 4 HOH 53  1053 1053 HOH HOH A . 
D 4 HOH 54  1054 1054 HOH HOH A . 
D 4 HOH 55  1055 1055 HOH HOH A . 
D 4 HOH 56  1056 1056 HOH HOH A . 
D 4 HOH 57  1057 1057 HOH HOH A . 
D 4 HOH 58  1058 1058 HOH HOH A . 
D 4 HOH 59  1059 1059 HOH HOH A . 
D 4 HOH 60  1060 1060 HOH HOH A . 
D 4 HOH 61  1061 1061 HOH HOH A . 
D 4 HOH 62  1062 1062 HOH HOH A . 
D 4 HOH 63  1063 1063 HOH HOH A . 
D 4 HOH 64  1064 1064 HOH HOH A . 
D 4 HOH 65  1065 1065 HOH HOH A . 
D 4 HOH 66  1066 1066 HOH HOH A . 
D 4 HOH 67  1067 1067 HOH HOH A . 
D 4 HOH 68  1068 1068 HOH HOH A . 
D 4 HOH 69  1069 1069 HOH HOH A . 
D 4 HOH 70  1070 1070 HOH HOH A . 
D 4 HOH 71  1071 1071 HOH HOH A . 
D 4 HOH 72  1072 1072 HOH HOH A . 
D 4 HOH 73  1073 1073 HOH HOH A . 
D 4 HOH 74  1074 1074 HOH HOH A . 
D 4 HOH 75  1075 1075 HOH HOH A . 
D 4 HOH 76  1076 1076 HOH HOH A . 
D 4 HOH 77  1077 1077 HOH HOH A . 
D 4 HOH 78  1078 1078 HOH HOH A . 
D 4 HOH 79  1079 1079 HOH HOH A . 
D 4 HOH 80  1080 1080 HOH HOH A . 
D 4 HOH 81  1081 1081 HOH HOH A . 
D 4 HOH 82  1082 1082 HOH HOH A . 
D 4 HOH 83  1083 1083 HOH HOH A . 
D 4 HOH 84  1084 1084 HOH HOH A . 
D 4 HOH 85  1085 1085 HOH HOH A . 
D 4 HOH 86  1086 1086 HOH HOH A . 
D 4 HOH 87  1087 1087 HOH HOH A . 
D 4 HOH 88  1088 1088 HOH HOH A . 
D 4 HOH 89  1089 1089 HOH HOH A . 
D 4 HOH 90  1090 1090 HOH HOH A . 
D 4 HOH 91  1091 1091 HOH HOH A . 
D 4 HOH 92  1092 1092 HOH HOH A . 
D 4 HOH 93  1093 1093 HOH HOH A . 
D 4 HOH 94  1094 1094 HOH HOH A . 
D 4 HOH 95  1095 1095 HOH HOH A . 
D 4 HOH 96  1096 1096 HOH HOH A . 
D 4 HOH 97  1097 1097 HOH HOH A . 
D 4 HOH 98  1098 1098 HOH HOH A . 
D 4 HOH 99  1099 1099 HOH HOH A . 
D 4 HOH 100 1100 1100 HOH HOH A . 
D 4 HOH 101 1101 1101 HOH HOH A . 
D 4 HOH 102 1102 1102 HOH HOH A . 
D 4 HOH 103 1103 1103 HOH HOH A . 
D 4 HOH 104 1104 1104 HOH HOH A . 
D 4 HOH 105 1105 1105 HOH HOH A . 
D 4 HOH 106 1106 1106 HOH HOH A . 
D 4 HOH 107 1107 1107 HOH HOH A . 
D 4 HOH 108 1108 1108 HOH HOH A . 
D 4 HOH 109 1109 1109 HOH HOH A . 
D 4 HOH 110 1110 1110 HOH HOH A . 
D 4 HOH 111 1111 1111 HOH HOH A . 
D 4 HOH 112 1112 1112 HOH HOH A . 
D 4 HOH 113 1113 1113 HOH HOH A . 
D 4 HOH 114 1114 1114 HOH HOH A . 
D 4 HOH 115 1115 1115 HOH HOH A . 
D 4 HOH 116 1116 1116 HOH HOH A . 
D 4 HOH 117 1117 1117 HOH HOH A . 
D 4 HOH 118 1118 1118 HOH HOH A . 
D 4 HOH 119 1119 1119 HOH HOH A . 
D 4 HOH 120 1120 1120 HOH HOH A . 
D 4 HOH 121 1121 1121 HOH HOH A . 
D 4 HOH 122 1122 1122 HOH HOH A . 
D 4 HOH 123 1123 1123 HOH HOH A . 
D 4 HOH 124 1124 1124 HOH HOH A . 
D 4 HOH 125 1125 1125 HOH HOH A . 
D 4 HOH 126 1126 1126 HOH HOH A . 
D 4 HOH 127 1127 1127 HOH HOH A . 
D 4 HOH 128 1128 1128 HOH HOH A . 
D 4 HOH 129 1129 1129 HOH HOH A . 
D 4 HOH 130 1130 1130 HOH HOH A . 
D 4 HOH 131 1131 1131 HOH HOH A . 
D 4 HOH 132 1132 1132 HOH HOH A . 
D 4 HOH 133 1133 1133 HOH HOH A . 
D 4 HOH 134 1134 1134 HOH HOH A . 
D 4 HOH 135 1135 1135 HOH HOH A . 
D 4 HOH 136 1136 1136 HOH HOH A . 
D 4 HOH 137 1137 1137 HOH HOH A . 
D 4 HOH 138 1138 1138 HOH HOH A . 
D 4 HOH 139 1139 1139 HOH HOH A . 
D 4 HOH 140 1140 1140 HOH HOH A . 
D 4 HOH 141 1141 1141 HOH HOH A . 
D 4 HOH 142 1142 1142 HOH HOH A . 
D 4 HOH 143 1143 1143 HOH HOH A . 
D 4 HOH 144 1144 1144 HOH HOH A . 
D 4 HOH 145 1145 1145 HOH HOH A . 
D 4 HOH 146 1146 1146 HOH HOH A . 
D 4 HOH 147 1147 1147 HOH HOH A . 
D 4 HOH 148 1148 1148 HOH HOH A . 
D 4 HOH 149 1149 1149 HOH HOH A . 
D 4 HOH 150 1150 1150 HOH HOH A . 
D 4 HOH 151 1151 1151 HOH HOH A . 
D 4 HOH 152 1152 1152 HOH HOH A . 
D 4 HOH 153 1153 1153 HOH HOH A . 
D 4 HOH 154 1154 1154 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A THR 17 A THR 432 ? THR 'GLYCOSYLATION SITE' 
2 A THR 74 A THR 489 ? THR 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-12-18 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Derived calculations'      
6 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' chem_comp                 
2 4 'Structure model' database_PDB_caveat       
3 4 'Structure model' entity                    
4 4 'Structure model' pdbx_chem_comp_identifier 
5 4 'Structure model' pdbx_entity_nonpoly       
6 4 'Structure model' struct_conn               
7 4 'Structure model' struct_site               
8 4 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_chem_comp.name'                     
2 4 'Structure model' '_chem_comp.type'                     
3 4 'Structure model' '_entity.pdbx_description'            
4 4 'Structure model' '_pdbx_entity_nonpoly.name'           
5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
6 4 'Structure model' '_struct_conn.pdbx_role'              
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .     ? 1 
HKL-2000 'data reduction'  .     ? 2 
MLPHARE  phasing           .     ? 3 
X-PLOR   refinement        3.851 ? 4 
HKL-2000 'data scaling'    .     ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 490 ? ? -169.58 -65.86 
2 1 ASN A 502 ? ? -145.07 17.97  
3 1 ASN A 524 ? ? 48.15   29.86  
4 1 ASP A 527 ? ? -30.99  105.12 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C1 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    FUC 
_pdbx_validate_chiral.auth_seq_id     1489 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         'WRONG HAND' 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa           
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose 
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp         
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc              
FUL 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpb           
FUL 'COMMON NAME'                         GMML     1.0 b-L-fucopyranose 
FUL 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-L-Fucp         
FUL 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc              
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 beta-L-fucopyranose  FUL 
3 alpha-L-fucopyranose FUC 
4 water                HOH 
#