data_1MQ8
# 
_entry.id   1MQ8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1MQ8         
RCSB  RCSB017093   
WWPDB D_1000017093 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1MQ9 . unspecified 
PDB 1MQA . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1MQ8 
_pdbx_database_status.recvd_initial_deposition_date   2002-09-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shimaoka, M.'   1  
'Xiao, T.'       2  
'Liu, J.-H.'     3  
'Yang, Y.'       4  
'Dong, Y.'       5  
'Jun, C.-D.'     6  
'McCormack, A.'  7  
'Zhang, R.'      8  
'Joachimiak, A.' 9  
'Takagi, J.'     10 
'Wang, J.-H.'    11 
'Springer, T.A.' 12 
# 
_citation.id                        primary 
_citation.title                     
'Structures of the aL I domain and its complex with ICAM-1 reveal a shape-shifting pathway for integrin regulation' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            112 
_citation.page_first                99 
_citation.page_last                 111 
_citation.year                      2003 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12526797 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(02)01257-6' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shimaoka, M.'   1  ? 
primary 'Xiao, T.'       2  ? 
primary 'Liu, J.-H.'     3  ? 
primary 'Yang, Y.'       4  ? 
primary 'Dong, Y.'       5  ? 
primary 'Jun, C.-D.'     6  ? 
primary 'McCormack, A.'  7  ? 
primary 'Zhang, R.'      8  ? 
primary 'Joachimiak, A.' 9  ? 
primary 'Takagi, J.'     10 ? 
primary 'Wang, J.-H.'    11 ? 
primary 'Springer, T.A.' 12 ? 
# 
_cell.entry_id           1MQ8 
_cell.length_a           46.560 
_cell.length_b           62.868 
_cell.length_c           81.517 
_cell.angle_alpha        95.39 
_cell.angle_beta         106.67 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1MQ8 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.cell_setting                     triclinic 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'intercellular adhesion molecule-1'                                                       31623.771 2 ? ? 
'domains 1 and 2'          ? 
2 polymer     man 'Integrin alpha-L'                                                                        20191.178 2 ? 
'L186C, F324C' 'Integrin alphaL I domain' ? 
3 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   4 ? ? ? ? 
4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                  221.208   4 ? ? ? ? 
5 non-polymer syn 'MAGNESIUM ION'                                                                           24.305    2 ? ? ? ? 
6 water       nat water                                                                                     18.015    4 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'ICAM-1; CD54 antigen; Major group rhinovirus receptor'                                                            
2 
;Leukocyte adhesion glycoprotein LFA-1 alpha chain; Leukocyte function 
associated molecule 1, alpha chain; CD11a
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFL
TVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCR
TELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGN
DSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILT
;
;QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFL
TVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCR
TELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGN
DSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILT
;
A,C ? 
2 'polypeptide(L)' no no 
;VDLVFLFDGSMSLQPDEFQKILDFMKDVMKKCSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTNTF
GAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFVKIL
DTFEKLKDLCTELQKKI
;
;VDLVFLFDGSMSLQPDEFQKILDFMKDVMKKCSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTNTF
GAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFVKIL
DTFEKLKDLCTELQKKI
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLN n 
1 2   THR n 
1 3   SER n 
1 4   VAL n 
1 5   SER n 
1 6   PRO n 
1 7   SER n 
1 8   LYS n 
1 9   VAL n 
1 10  ILE n 
1 11  LEU n 
1 12  PRO n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  SER n 
1 17  VAL n 
1 18  LEU n 
1 19  VAL n 
1 20  THR n 
1 21  CYS n 
1 22  SER n 
1 23  THR n 
1 24  SER n 
1 25  CYS n 
1 26  ASP n 
1 27  GLN n 
1 28  PRO n 
1 29  LYS n 
1 30  LEU n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  GLU n 
1 35  THR n 
1 36  PRO n 
1 37  LEU n 
1 38  PRO n 
1 39  LYS n 
1 40  LYS n 
1 41  GLU n 
1 42  LEU n 
1 43  LEU n 
1 44  LEU n 
1 45  PRO n 
1 46  GLY n 
1 47  ASN n 
1 48  ASN n 
1 49  ARG n 
1 50  LYS n 
1 51  VAL n 
1 52  TYR n 
1 53  GLU n 
1 54  LEU n 
1 55  SER n 
1 56  ASN n 
1 57  VAL n 
1 58  GLN n 
1 59  GLU n 
1 60  ASP n 
1 61  SER n 
1 62  GLN n 
1 63  PRO n 
1 64  MET n 
1 65  CYS n 
1 66  TYR n 
1 67  SER n 
1 68  ASN n 
1 69  CYS n 
1 70  PRO n 
1 71  ASP n 
1 72  GLY n 
1 73  GLN n 
1 74  SER n 
1 75  THR n 
1 76  ALA n 
1 77  LYS n 
1 78  THR n 
1 79  PHE n 
1 80  LEU n 
1 81  THR n 
1 82  VAL n 
1 83  TYR n 
1 84  TRP n 
1 85  THR n 
1 86  PRO n 
1 87  GLU n 
1 88  ARG n 
1 89  VAL n 
1 90  GLU n 
1 91  LEU n 
1 92  ALA n 
1 93  PRO n 
1 94  LEU n 
1 95  PRO n 
1 96  SER n 
1 97  TRP n 
1 98  GLN n 
1 99  PRO n 
1 100 VAL n 
1 101 GLY n 
1 102 LYS n 
1 103 ASN n 
1 104 LEU n 
1 105 THR n 
1 106 LEU n 
1 107 ARG n 
1 108 CYS n 
1 109 GLN n 
1 110 VAL n 
1 111 GLU n 
1 112 GLY n 
1 113 GLY n 
1 114 ALA n 
1 115 PRO n 
1 116 ARG n 
1 117 ALA n 
1 118 ASN n 
1 119 LEU n 
1 120 THR n 
1 121 VAL n 
1 122 VAL n 
1 123 LEU n 
1 124 LEU n 
1 125 ARG n 
1 126 GLY n 
1 127 GLU n 
1 128 LYS n 
1 129 GLU n 
1 130 LEU n 
1 131 LYS n 
1 132 ARG n 
1 133 GLU n 
1 134 PRO n 
1 135 ALA n 
1 136 VAL n 
1 137 GLY n 
1 138 GLU n 
1 139 PRO n 
1 140 ALA n 
1 141 GLU n 
1 142 VAL n 
1 143 THR n 
1 144 THR n 
1 145 THR n 
1 146 VAL n 
1 147 LEU n 
1 148 VAL n 
1 149 ARG n 
1 150 ARG n 
1 151 ASP n 
1 152 HIS n 
1 153 HIS n 
1 154 GLY n 
1 155 ALA n 
1 156 ASN n 
1 157 PHE n 
1 158 SER n 
1 159 CYS n 
1 160 ARG n 
1 161 THR n 
1 162 GLU n 
1 163 LEU n 
1 164 ASP n 
1 165 LEU n 
1 166 ARG n 
1 167 PRO n 
1 168 GLN n 
1 169 GLY n 
1 170 LEU n 
1 171 GLU n 
1 172 LEU n 
1 173 PHE n 
1 174 GLU n 
1 175 ASN n 
1 176 THR n 
1 177 SER n 
1 178 ALA n 
1 179 PRO n 
1 180 TYR n 
1 181 GLN n 
1 182 LEU n 
1 183 GLN n 
1 184 THR n 
1 185 PHE n 
1 186 VAL n 
1 187 LEU n 
1 188 PRO n 
1 189 ALA n 
1 190 THR n 
1 191 PRO n 
1 192 PRO n 
1 193 GLN n 
1 194 LEU n 
1 195 VAL n 
1 196 SER n 
1 197 PRO n 
1 198 ARG n 
1 199 VAL n 
1 200 LEU n 
1 201 GLU n 
1 202 VAL n 
1 203 ASP n 
1 204 THR n 
1 205 GLN n 
1 206 GLY n 
1 207 THR n 
1 208 VAL n 
1 209 VAL n 
1 210 CYS n 
1 211 SER n 
1 212 LEU n 
1 213 ASP n 
1 214 GLY n 
1 215 LEU n 
1 216 PHE n 
1 217 PRO n 
1 218 VAL n 
1 219 SER n 
1 220 GLU n 
1 221 ALA n 
1 222 GLN n 
1 223 VAL n 
1 224 HIS n 
1 225 LEU n 
1 226 ALA n 
1 227 LEU n 
1 228 GLY n 
1 229 ASP n 
1 230 GLN n 
1 231 ARG n 
1 232 LEU n 
1 233 ASN n 
1 234 PRO n 
1 235 THR n 
1 236 VAL n 
1 237 THR n 
1 238 TYR n 
1 239 GLY n 
1 240 ASN n 
1 241 ASP n 
1 242 SER n 
1 243 PHE n 
1 244 SER n 
1 245 ALA n 
1 246 LYS n 
1 247 ALA n 
1 248 SER n 
1 249 VAL n 
1 250 SER n 
1 251 VAL n 
1 252 THR n 
1 253 ALA n 
1 254 GLU n 
1 255 ASP n 
1 256 GLU n 
1 257 GLY n 
1 258 THR n 
1 259 GLN n 
1 260 ARG n 
1 261 LEU n 
1 262 THR n 
1 263 CYS n 
1 264 ALA n 
1 265 VAL n 
1 266 ILE n 
1 267 LEU n 
1 268 GLY n 
1 269 ASN n 
1 270 GLN n 
1 271 SER n 
1 272 GLN n 
1 273 GLU n 
1 274 THR n 
1 275 LEU n 
1 276 GLN n 
1 277 THR n 
1 278 VAL n 
1 279 THR n 
1 280 ILE n 
1 281 TYR n 
1 282 SER n 
1 283 PHE n 
1 284 PRO n 
1 285 ALA n 
1 286 PRO n 
1 287 ASN n 
1 288 VAL n 
1 289 ILE n 
1 290 LEU n 
1 291 THR n 
2 1   VAL n 
2 2   ASP n 
2 3   LEU n 
2 4   VAL n 
2 5   PHE n 
2 6   LEU n 
2 7   PHE n 
2 8   ASP n 
2 9   GLY n 
2 10  SER n 
2 11  MET n 
2 12  SER n 
2 13  LEU n 
2 14  GLN n 
2 15  PRO n 
2 16  ASP n 
2 17  GLU n 
2 18  PHE n 
2 19  GLN n 
2 20  LYS n 
2 21  ILE n 
2 22  LEU n 
2 23  ASP n 
2 24  PHE n 
2 25  MET n 
2 26  LYS n 
2 27  ASP n 
2 28  VAL n 
2 29  MET n 
2 30  LYS n 
2 31  LYS n 
2 32  CYS n 
2 33  SER n 
2 34  ASN n 
2 35  THR n 
2 36  SER n 
2 37  TYR n 
2 38  GLN n 
2 39  PHE n 
2 40  ALA n 
2 41  ALA n 
2 42  VAL n 
2 43  GLN n 
2 44  PHE n 
2 45  SER n 
2 46  THR n 
2 47  SER n 
2 48  TYR n 
2 49  LYS n 
2 50  THR n 
2 51  GLU n 
2 52  PHE n 
2 53  ASP n 
2 54  PHE n 
2 55  SER n 
2 56  ASP n 
2 57  TYR n 
2 58  VAL n 
2 59  LYS n 
2 60  ARG n 
2 61  LYS n 
2 62  ASP n 
2 63  PRO n 
2 64  ASP n 
2 65  ALA n 
2 66  LEU n 
2 67  LEU n 
2 68  LYS n 
2 69  HIS n 
2 70  VAL n 
2 71  LYS n 
2 72  HIS n 
2 73  MET n 
2 74  LEU n 
2 75  LEU n 
2 76  LEU n 
2 77  THR n 
2 78  ASN n 
2 79  THR n 
2 80  PHE n 
2 81  GLY n 
2 82  ALA n 
2 83  ILE n 
2 84  ASN n 
2 85  TYR n 
2 86  VAL n 
2 87  ALA n 
2 88  THR n 
2 89  GLU n 
2 90  VAL n 
2 91  PHE n 
2 92  ARG n 
2 93  GLU n 
2 94  GLU n 
2 95  LEU n 
2 96  GLY n 
2 97  ALA n 
2 98  ARG n 
2 99  PRO n 
2 100 ASP n 
2 101 ALA n 
2 102 THR n 
2 103 LYS n 
2 104 VAL n 
2 105 LEU n 
2 106 ILE n 
2 107 ILE n 
2 108 ILE n 
2 109 THR n 
2 110 ASP n 
2 111 GLY n 
2 112 GLU n 
2 113 ALA n 
2 114 THR n 
2 115 ASP n 
2 116 SER n 
2 117 GLY n 
2 118 ASN n 
2 119 ILE n 
2 120 ASP n 
2 121 ALA n 
2 122 ALA n 
2 123 LYS n 
2 124 ASP n 
2 125 ILE n 
2 126 ILE n 
2 127 ARG n 
2 128 TYR n 
2 129 ILE n 
2 130 ILE n 
2 131 GLY n 
2 132 ILE n 
2 133 GLY n 
2 134 LYS n 
2 135 HIS n 
2 136 PHE n 
2 137 GLN n 
2 138 THR n 
2 139 LYS n 
2 140 GLU n 
2 141 SER n 
2 142 GLN n 
2 143 GLU n 
2 144 THR n 
2 145 LEU n 
2 146 HIS n 
2 147 LYS n 
2 148 PHE n 
2 149 ALA n 
2 150 SER n 
2 151 LYS n 
2 152 PRO n 
2 153 ALA n 
2 154 SER n 
2 155 GLU n 
2 156 PHE n 
2 157 VAL n 
2 158 LYS n 
2 159 ILE n 
2 160 LEU n 
2 161 ASP n 
2 162 THR n 
2 163 PHE n 
2 164 GLU n 
2 165 LYS n 
2 166 LEU n 
2 167 LYS n 
2 168 ASP n 
2 169 LEU n 
2 170 CYS n 
2 171 THR n 
2 172 GLU n 
2 173 LEU n 
2 174 GLN n 
2 175 LYS n 
2 176 LYS n 
2 177 ILE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ICAM-1                ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Schneider S2 insect cells'  ? ? 
? ? ?                  ? ? 'Schneider S2 insect cells' ? ? ? ? ? ? ? plasmid ? ? ? pMT/BiP/V5-His ? ? 
2 1 sample ? ? ? human Homo 'LFA-1 (AlphaLbeta2)' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 
469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)'                 ? ? ? ? ? ? ? plasmid ? ? ? pET11          ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 1 UNP ICA1_HUMAN P05362 28  
;QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFL
TVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCR
TELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGN
DSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILT
;
? 
2 2 UNP ITAL_HUMAN P20701 155 
;VDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTNTF
GAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFVKIL
DTFEKLKDLFTELQKKI
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1MQ8 A 1 ? 291 ? P05362 28  ? 318 ? 1   291 
2 1 1MQ8 C 1 ? 291 ? P05362 28  ? 318 ? 1   291 
3 2 1MQ8 B 1 ? 177 ? P20701 155 ? 331 ? 130 306 
4 2 1MQ8 D 1 ? 177 ? P20701 155 ? 331 ? 130 306 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 1MQ8 CYS B 32  ? UNP P20701 LEU 186 ENGINEERED 161 1 
3 1MQ8 CYS B 170 ? UNP P20701 PHE 324 ENGINEERED 299 2 
4 1MQ8 CYS D 32  ? UNP P20701 LEU 186 ENGINEERED 161 3 
4 1MQ8 CYS D 170 ? UNP P20701 PHE 324 ENGINEERED 299 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer                  . 'MAGNESIUM ION'                          ? 'Mg 2'           24.305  
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1MQ8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   55.3 
_exptl_crystal.density_Matthews      2.78 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    '25% PEG 4000, 0.1 M sodium acetate, pH 4.6, VAPOR DIFFUSION, HANGING DROP at 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   CUSTOM-MADE 
_diffrn_detector.pdbx_collection_date   2001-01-01 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Ni MIRROR + Ni FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9100 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9100 
# 
_reflns.entry_id                     1MQ8 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3. 
_reflns.d_resolution_high            3.30 
_reflns.d_resolution_low             50 
_reflns.number_all                   25280 
_reflns.number_obs                   23330 
_reflns.percent_possible_obs         92.3 
_reflns.pdbx_Rmerge_I_obs            0.094 
_reflns.pdbx_Rsym_value              0.094 
_reflns.pdbx_netI_over_sigmaI        7.7 
_reflns.B_iso_Wilson_estimate        46.4 
_reflns.pdbx_redundancy              1.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.30 
_reflns_shell.d_res_low              3.36 
_reflns_shell.percent_possible_all   70.7 
_reflns_shell.Rmerge_I_obs           0.412 
_reflns_shell.pdbx_Rsym_value        0.412 
_reflns_shell.meanI_over_sigI_obs    1.5 
_reflns_shell.pdbx_redundancy        1.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      469 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1MQ8 
_refine.ls_d_res_high                            3.30 
_refine.ls_d_res_low                             50. 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     13251 
_refine.ls_number_reflns_obs                     11448 
_refine.ls_number_reflns_R_free                  577 
_refine.ls_percent_reflns_obs                    86.4 
_refine.ls_R_factor_all                          0.28 
_refine.ls_R_factor_obs                          0.28 
_refine.ls_R_factor_R_work                       0.264 
_refine.ls_R_factor_R_free                       0.313 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_R_factor_R_free_error                 0.013 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1IC1 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.B_iso_mean                               67 
_refine.aniso_B[1][1]                            -28.7 
_refine.aniso_B[1][2]                            0.12 
_refine.aniso_B[1][3]                            8.64 
_refine.aniso_B[2][2]                            2.0 
_refine.aniso_B[2][3]                            -1.43 
_refine.aniso_B[3][3]                            26.7 
_refine.details                                  'maximum likelihood refinement target' 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1MQ8 
_refine_analyze.Luzzati_coordinate_error_obs    0.47 
_refine_analyze.Luzzati_sigma_a_obs             0.87 
_refine_analyze.Luzzati_d_res_low_obs           5 
_refine_analyze.Luzzati_coordinate_error_free   0.45 
_refine_analyze.Luzzati_sigma_a_free            0.90 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5680 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         170 
_refine_hist.number_atoms_solvent             4 
_refine_hist.number_atoms_total               5854 
_refine_hist.d_res_high                       3.30 
_refine_hist.d_res_low                        50. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.015638 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.74184  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1MQ8 
_struct.title                     'Crystal structure of alphaL I domain in complex with ICAM-1' 
_struct.pdbx_descriptor           'intercellular adhesion molecule-1/Integrin alpha-L' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1MQ8 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'Ig superfamily, Rossmann fold, metal mediated protein interface, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
K N N 5 ? 
L N N 4 ? 
M N N 4 ? 
N N N 5 ? 
O N N 6 ? 
P N N 6 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 
;chain A and B form a biological complex, so do chain C and D.  
Chain A and C also form a biological dimer.
;
? 
2 ?                                                                                                             ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 166 ? GLY A 169 ? ARG A 166 GLY A 169 5 ? 4  
HELX_P HELX_P2  2  ASP B 16  ? MET B 29  ? ASP B 145 MET B 158 1 ? 14 
HELX_P HELX_P3  3  LYS B 30  ? SER B 33  ? LYS B 159 SER B 162 5 ? 4  
HELX_P HELX_P4  4  ASP B 53  ? VAL B 58  ? ASP B 182 VAL B 187 1 ? 6  
HELX_P HELX_P5  5  THR B 79  ? GLU B 89  ? THR B 208 GLU B 218 1 ? 11 
HELX_P HELX_P6  6  ARG B 92  ? ALA B 97  ? ARG B 221 ALA B 226 1 ? 6  
HELX_P HELX_P7  7  ILE B 119 ? LYS B 123 ? ILE B 248 LYS B 252 5 ? 5  
HELX_P HELX_P8  8  LEU B 169 ? GLN B 174 ? LEU B 298 GLN B 303 1 ? 6  
HELX_P HELX_P9  9  ARG C 166 ? GLY C 169 ? ARG C 166 GLY C 169 5 ? 4  
HELX_P HELX_P10 10 ASP D 16  ? MET D 29  ? ASP D 145 MET D 158 1 ? 14 
HELX_P HELX_P11 11 LYS D 30  ? SER D 33  ? LYS D 159 SER D 162 5 ? 4  
HELX_P HELX_P12 12 ASP D 53  ? VAL D 58  ? ASP D 182 VAL D 187 1 ? 6  
HELX_P HELX_P13 13 THR D 79  ? GLU D 89  ? THR D 208 GLU D 218 1 ? 11 
HELX_P HELX_P14 14 ARG D 92  ? ALA D 97  ? ARG D 221 ALA D 226 1 ? 6  
HELX_P HELX_P15 15 ILE D 119 ? LYS D 123 ? ILE D 248 LYS D 252 5 ? 5  
HELX_P HELX_P16 16 LEU D 169 ? GLN D 174 ? LEU D 298 GLN D 303 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 21  SG  ? ? ? 1_555 A CYS 65  SG ? ? A CYS 21  A CYS 65  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf2  disulf ?    ? A CYS 25  SG  ? ? ? 1_555 A CYS 69  SG ? ? A CYS 25  A CYS 69  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf3  disulf ?    ? A CYS 108 SG  ? ? ? 1_555 A CYS 159 SG ? ? A CYS 108 A CYS 159 1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf4  disulf ?    ? B CYS 32  SG  ? ? ? 1_555 B CYS 170 SG ? ? B CYS 161 B CYS 299 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf5  disulf ?    ? C CYS 21  SG  ? ? ? 1_555 C CYS 65  SG ? ? C CYS 21  C CYS 65  1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf6  disulf ?    ? C CYS 25  SG  ? ? ? 1_555 C CYS 69  SG ? ? C CYS 25  C CYS 69  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf7  disulf ?    ? C CYS 108 SG  ? ? ? 1_555 C CYS 159 SG ? ? C CYS 108 C CYS 159 1_555 ? ? ? ? ? ? ? 2.024 ? ?               
disulf8  disulf ?    ? D CYS 32  SG  ? ? ? 1_555 D CYS 170 SG ? ? D CYS 161 D CYS 299 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
covale1  covale one  ? A ASN 103 ND2 ? ? ? 1_555 I NAG .   C1 ? ? A ASN 103 A NAG 401 1_555 ? ? ? ? ? ? ? 1.457 ? N-Glycosylation 
covale2  covale one  ? A ASN 118 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 118 E NAG 1   1_555 ? ? ? ? ? ? ? 1.443 ? N-Glycosylation 
covale3  covale one  ? A ASN 156 ND2 ? ? ? 1_555 J NAG .   C1 ? ? A ASN 156 A NAG 404 1_555 ? ? ? ? ? ? ? 1.463 ? N-Glycosylation 
covale4  covale one  ? A ASN 175 ND2 ? ? ? 1_555 F NAG .   C1 ? ? A ASN 175 F NAG 1   1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation 
covale5  covale one  ? C ASN 103 ND2 ? ? ? 1_555 L NAG .   C1 ? ? C ASN 103 C NAG 407 1_555 ? ? ? ? ? ? ? 1.451 ? N-Glycosylation 
covale6  covale one  ? C ASN 118 ND2 ? ? ? 1_555 G NAG .   C1 ? ? C ASN 118 G NAG 1   1_555 ? ? ? ? ? ? ? 1.446 ? N-Glycosylation 
covale7  covale one  ? C ASN 156 ND2 ? ? ? 1_555 M NAG .   C1 ? ? C ASN 156 C NAG 410 1_555 ? ? ? ? ? ? ? 1.463 ? N-Glycosylation 
covale8  covale one  ? C ASN 175 ND2 ? ? ? 1_555 H NAG .   C1 ? ? C ASN 175 H NAG 1   1_555 ? ? ? ? ? ? ? 1.458 ? N-Glycosylation 
covale9  covale both ? E NAG .   O4  ? ? ? 1_555 E NAG .   C1 ? ? E NAG 1   E NAG 2   1_555 ? ? ? ? ? ? ? 1.385 ? ?               
covale10 covale both ? F NAG .   O4  ? ? ? 1_555 F NAG .   C1 ? ? F NAG 1   F NAG 2   1_555 ? ? ? ? ? ? ? 1.401 ? ?               
covale11 covale both ? G NAG .   O4  ? ? ? 1_555 G NAG .   C1 ? ? G NAG 1   G NAG 2   1_555 ? ? ? ? ? ? ? 1.395 ? ?               
covale12 covale both ? H NAG .   O4  ? ? ? 1_555 H NAG .   C1 ? ? H NAG 1   H NAG 2   1_555 ? ? ? ? ? ? ? 1.395 ? ?               
metalc1  metalc ?    ? A GLU 34  OE2 ? ? ? 1_555 K MG  .   MG ? ? A GLU 34  B MG  901 1_555 ? ? ? ? ? ? ? 2.235 ? ?               
metalc2  metalc ?    ? O HOH .   O   ? ? ? 1_555 K MG  .   MG ? ? B HOH 1   B MG  901 1_555 ? ? ? ? ? ? ? 1.976 ? ?               
metalc3  metalc ?    ? O HOH .   O   ? ? ? 1_555 K MG  .   MG ? ? B HOH 2   B MG  901 1_555 ? ? ? ? ? ? ? 2.073 ? ?               
metalc4  metalc ?    ? B SER 10  OG  ? ? ? 1_555 K MG  .   MG ? ? B SER 139 B MG  901 1_555 ? ? ? ? ? ? ? 2.192 ? ?               
metalc5  metalc ?    ? B SER 12  OG  ? ? ? 1_555 K MG  .   MG ? ? B SER 141 B MG  901 1_555 ? ? ? ? ? ? ? 2.076 ? ?               
metalc6  metalc ?    ? B THR 77  OG1 ? ? ? 1_555 K MG  .   MG ? ? B THR 206 B MG  901 1_555 ? ? ? ? ? ? ? 2.049 ? ?               
metalc7  metalc ?    ? C GLU 34  OE2 ? ? ? 1_555 N MG  .   MG ? ? C GLU 34  D MG  902 1_555 ? ? ? ? ? ? ? 2.257 ? ?               
metalc8  metalc ?    ? P HOH .   O   ? ? ? 1_555 N MG  .   MG ? ? D HOH 3   D MG  902 1_555 ? ? ? ? ? ? ? 2.003 ? ?               
metalc9  metalc ?    ? P HOH .   O   ? ? ? 1_555 N MG  .   MG ? ? D HOH 4   D MG  902 1_555 ? ? ? ? ? ? ? 2.164 ? ?               
metalc10 metalc ?    ? D SER 10  OG  ? ? ? 1_555 N MG  .   MG ? ? D SER 139 D MG  902 1_555 ? ? ? ? ? ? ? 2.183 ? ?               
metalc11 metalc ?    ? D SER 12  OG  ? ? ? 1_555 N MG  .   MG ? ? D SER 141 D MG  902 1_555 ? ? ? ? ? ? ? 2.024 ? ?               
metalc12 metalc ?    ? D THR 77  OG1 ? ? ? 1_555 N MG  .   MG ? ? D THR 206 D MG  902 1_555 ? ? ? ? ? ? ? 2.098 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 5   A . ? SER 5   A PRO 6   A ? PRO 6   A 1 -0.11 
2 ALA 114 A . ? ALA 114 A PRO 115 A ? PRO 115 A 1 -0.15 
3 GLU 138 A . ? GLU 138 A PRO 139 A ? PRO 139 A 1 -0.83 
4 SER 5   C . ? SER 5   C PRO 6   C ? PRO 6   C 1 -0.19 
5 ALA 92  C . ? ALA 92  C PRO 93  C ? PRO 93  C 1 4.00  
6 ALA 114 C . ? ALA 114 C PRO 115 C ? PRO 115 C 1 -0.24 
7 GLU 138 C . ? GLU 138 C PRO 139 C ? PRO 139 C 1 -0.80 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 3 ? 
D ? 2 ? 
E ? 4 ? 
F ? 4 ? 
G ? 2 ? 
H ? 2 ? 
I ? 3 ? 
J ? 2 ? 
K ? 3 ? 
L ? 2 ? 
M ? 4 ? 
N ? 4 ? 
O ? 2 ? 
P ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? parallel      
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? parallel      
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? parallel      
P 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 2   ? SER A 5   ? THR A 2   SER A 5   
A 2 SER A 16  ? THR A 23  ? SER A 16  THR A 23  
A 3 ARG A 49  ? SER A 55  ? ARG A 49  SER A 55  
B 1 LYS A 8   ? LEU A 11  ? LYS A 8   LEU A 11  
B 2 PHE A 79  ? VAL A 82  ? PHE A 79  VAL A 82  
C 1 LEU A 30  ? GLU A 34  ? LEU A 30  GLU A 34  
C 2 MET A 64  ? ASN A 68  ? MET A 64  ASN A 68  
C 3 GLN A 73  ? LYS A 77  ? GLN A 73  LYS A 77  
D 1 THR A 105 ? VAL A 110 ? THR A 105 VAL A 110 
D 2 ALA A 140 ? THR A 145 ? ALA A 140 THR A 145 
E 1 GLU A 129 ? PRO A 134 ? GLU A 129 PRO A 134 
E 2 LEU A 119 ? LEU A 124 ? LEU A 119 LEU A 124 
E 3 ASN A 156 ? ASP A 164 ? ASN A 156 ASP A 164 
E 4 LEU A 172 ? ASN A 175 ? LEU A 172 ASN A 175 
F 1 GLU A 129 ? PRO A 134 ? GLU A 129 PRO A 134 
F 2 LEU A 119 ? LEU A 124 ? LEU A 119 LEU A 124 
F 3 ASN A 156 ? ASP A 164 ? ASN A 156 ASP A 164 
F 4 TYR A 180 ? GLN A 181 ? TYR A 180 GLN A 181 
G 1 ASP B 2   ? PHE B 7   ? ASP B 131 PHE B 136 
G 2 LYS B 103 ? ILE B 108 ? LYS B 232 ILE B 237 
H 1 ALA B 41  ? VAL B 42  ? ALA B 170 VAL B 171 
H 2 THR B 50  ? PHE B 52  ? THR B 179 PHE B 181 
I 1 THR C 2   ? SER C 5   ? THR C 2   SER C 5   
I 2 SER C 16  ? THR C 23  ? SER C 16  THR C 23  
I 3 ARG C 49  ? SER C 55  ? ARG C 49  SER C 55  
J 1 LYS C 8   ? LEU C 11  ? LYS C 8   LEU C 11  
J 2 PHE C 79  ? VAL C 82  ? PHE C 79  VAL C 82  
K 1 LEU C 30  ? GLU C 34  ? LEU C 30  GLU C 34  
K 2 MET C 64  ? ASN C 68  ? MET C 64  ASN C 68  
K 3 GLN C 73  ? LYS C 77  ? GLN C 73  LYS C 77  
L 1 THR C 105 ? VAL C 110 ? THR C 105 VAL C 110 
L 2 ALA C 140 ? THR C 145 ? ALA C 140 THR C 145 
M 1 GLU C 129 ? PRO C 134 ? GLU C 129 PRO C 134 
M 2 LEU C 119 ? LEU C 124 ? LEU C 119 LEU C 124 
M 3 ASN C 156 ? ASP C 164 ? ASN C 156 ASP C 164 
M 4 LEU C 172 ? ASN C 175 ? LEU C 172 ASN C 175 
N 1 GLU C 129 ? PRO C 134 ? GLU C 129 PRO C 134 
N 2 LEU C 119 ? LEU C 124 ? LEU C 119 LEU C 124 
N 3 ASN C 156 ? ASP C 164 ? ASN C 156 ASP C 164 
N 4 TYR C 180 ? GLN C 181 ? TYR C 180 GLN C 181 
O 1 ASP D 2   ? PHE D 7   ? ASP D 131 PHE D 136 
O 2 LYS D 103 ? ILE D 108 ? LYS D 232 ILE D 237 
P 1 ALA D 41  ? PHE D 44  ? ALA D 170 PHE D 173 
P 2 TYR D 48  ? PHE D 52  ? TYR D 177 PHE D 181 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 5   ? N SER A 5   O THR A 20  ? O THR A 20  
A 2 3 N CYS A 21  ? N CYS A 21  O LYS A 50  ? O LYS A 50  
B 1 2 N LEU A 11  ? N LEU A 11  O THR A 81  ? O THR A 81  
C 1 2 N GLY A 32  ? N GLY A 32  O TYR A 66  ? O TYR A 66  
C 2 3 N CYS A 65  ? N CYS A 65  O ALA A 76  ? O ALA A 76  
D 1 2 N VAL A 110 ? N VAL A 110 O ALA A 140 ? O ALA A 140 
E 1 2 O GLU A 133 ? O GLU A 133 N VAL A 121 ? N VAL A 121 
E 2 3 N LEU A 124 ? N LEU A 124 O SER A 158 ? O SER A 158 
E 3 4 N LEU A 163 ? N LEU A 163 O PHE A 173 ? O PHE A 173 
F 1 2 O GLU A 133 ? O GLU A 133 N VAL A 121 ? N VAL A 121 
F 2 3 N LEU A 124 ? N LEU A 124 O SER A 158 ? O SER A 158 
F 3 4 N PHE A 157 ? N PHE A 157 O TYR A 180 ? O TYR A 180 
G 1 2 N LEU B 6   ? N LEU B 135 O ILE B 106 ? O ILE B 235 
H 1 2 N ALA B 41  ? N ALA B 170 O GLU B 51  ? O GLU B 180 
I 1 2 N SER C 5   ? N SER C 5   O THR C 20  ? O THR C 20  
I 2 3 N CYS C 21  ? N CYS C 21  O LYS C 50  ? O LYS C 50  
J 1 2 N LEU C 11  ? N LEU C 11  O THR C 81  ? O THR C 81  
K 1 2 N GLY C 32  ? N GLY C 32  O TYR C 66  ? O TYR C 66  
K 2 3 N CYS C 65  ? N CYS C 65  O ALA C 76  ? O ALA C 76  
L 1 2 N VAL C 110 ? N VAL C 110 O ALA C 140 ? O ALA C 140 
M 1 2 O GLU C 133 ? O GLU C 133 N VAL C 121 ? N VAL C 121 
M 2 3 N LEU C 124 ? N LEU C 124 O SER C 158 ? O SER C 158 
M 3 4 N LEU C 163 ? N LEU C 163 O PHE C 173 ? O PHE C 173 
N 1 2 O GLU C 133 ? O GLU C 133 N VAL C 121 ? N VAL C 121 
N 2 3 N LEU C 124 ? N LEU C 124 O SER C 158 ? O SER C 158 
N 3 4 N PHE C 157 ? N PHE C 157 O TYR C 180 ? O TYR C 180 
O 1 2 N LEU D 6   ? N LEU D 135 O ILE D 106 ? O ILE D 235 
P 1 2 N ALA D 41  ? N ALA D 170 O GLU D 51  ? O GLU D 180 
# 
_database_PDB_matrix.entry_id          1MQ8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1MQ8 
_atom_sites.fract_transf_matrix[1][1]   0.021478 
_atom_sites.fract_transf_matrix[1][2]   -0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.006462 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015906 
_atom_sites.fract_transf_matrix[2][3]   0.001567 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012868 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLN A 1 1   ? 14.810  28.601  -6.424  1.00 51.21  ? 1   GLN A N   1 
ATOM   2    C  CA  . GLN A 1 1   ? 14.810  28.274  -7.874  1.00 51.21  ? 1   GLN A CA  1 
ATOM   3    C  C   . GLN A 1 1   ? 15.063  26.779  -8.075  1.00 51.21  ? 1   GLN A C   1 
ATOM   4    O  O   . GLN A 1 1   ? 15.458  26.341  -9.166  1.00 51.21  ? 1   GLN A O   1 
ATOM   5    C  CB  . GLN A 1 1   ? 15.902  29.091  -8.592  1.00 98.46  ? 1   GLN A CB  1 
ATOM   6    C  CG  . GLN A 1 1   ? 15.964  30.592  -8.230  1.00 98.46  ? 1   GLN A CG  1 
ATOM   7    C  CD  . GLN A 1 1   ? 14.822  31.426  -8.818  1.00 98.46  ? 1   GLN A CD  1 
ATOM   8    O  OE1 . GLN A 1 1   ? 14.618  32.585  -8.433  1.00 98.46  ? 1   GLN A OE1 1 
ATOM   9    N  NE2 . GLN A 1 1   ? 14.084  30.843  -9.760  1.00 98.46  ? 1   GLN A NE2 1 
ATOM   10   N  N   . THR A 1 2   ? 14.815  25.988  -7.027  1.00 56.49  ? 2   THR A N   1 
ATOM   11   C  CA  . THR A 1 2   ? 15.025  24.529  -7.058  1.00 56.49  ? 2   THR A CA  1 
ATOM   12   C  C   . THR A 1 2   ? 14.004  23.812  -7.922  1.00 56.49  ? 2   THR A C   1 
ATOM   13   O  O   . THR A 1 2   ? 13.133  24.448  -8.494  1.00 56.49  ? 2   THR A O   1 
ATOM   14   C  CB  . THR A 1 2   ? 14.989  23.918  -5.648  1.00 78.41  ? 2   THR A CB  1 
ATOM   15   O  OG1 . THR A 1 2   ? 15.705  24.764  -4.739  1.00 78.41  ? 2   THR A OG1 1 
ATOM   16   C  CG2 . THR A 1 2   ? 15.686  22.564  -5.650  1.00 78.41  ? 2   THR A CG2 1 
ATOM   17   N  N   . SER A 1 3   ? 14.108  22.488  -7.949  1.00 7.34   ? 3   SER A N   1 
ATOM   18   C  CA  . SER A 1 3   ? 13.256  21.621  -8.726  1.00 7.34   ? 3   SER A CA  1 
ATOM   19   C  C   . SER A 1 3   ? 13.628  20.160  -8.487  1.00 7.34   ? 3   SER A C   1 
ATOM   20   O  O   . SER A 1 3   ? 14.770  19.835  -8.115  1.00 7.34   ? 3   SER A O   1 
ATOM   21   C  CB  . SER A 1 3   ? 13.382  21.949  -10.226 1.00 39.35  ? 3   SER A CB  1 
ATOM   22   O  OG  . SER A 1 3   ? 14.728  22.088  -10.637 1.00 39.35  ? 3   SER A OG  1 
ATOM   23   N  N   . VAL A 1 4   ? 12.682  19.262  -8.694  1.00 49.83  ? 4   VAL A N   1 
ATOM   24   C  CA  . VAL A 1 4   ? 12.979  17.867  -8.446  1.00 49.83  ? 4   VAL A CA  1 
ATOM   25   C  C   . VAL A 1 4   ? 12.050  16.967  -9.214  1.00 49.83  ? 4   VAL A C   1 
ATOM   26   O  O   . VAL A 1 4   ? 10.912  17.327  -9.527  1.00 49.83  ? 4   VAL A O   1 
ATOM   27   C  CB  . VAL A 1 4   ? 12.878  17.561  -6.962  1.00 6.45   ? 4   VAL A CB  1 
ATOM   28   C  CG1 . VAL A 1 4   ? 11.415  17.501  -6.520  1.00 6.45   ? 4   VAL A CG1 1 
ATOM   29   C  CG2 . VAL A 1 4   ? 13.554  16.260  -6.655  1.00 6.45   ? 4   VAL A CG2 1 
ATOM   30   N  N   . SER A 1 5   ? 12.549  15.779  -9.512  1.00 15.18  ? 5   SER A N   1 
ATOM   31   C  CA  . SER A 1 5   ? 11.748  14.797  -10.204 1.00 15.18  ? 5   SER A CA  1 
ATOM   32   C  C   . SER A 1 5   ? 12.179  13.380  -9.868  1.00 15.18  ? 5   SER A C   1 
ATOM   33   O  O   . SER A 1 5   ? 13.305  13.149  -9.416  1.00 15.18  ? 5   SER A O   1 
ATOM   34   C  CB  . SER A 1 5   ? 11.710  15.052  -11.722 1.00 19.07  ? 5   SER A CB  1 
ATOM   35   O  OG  . SER A 1 5   ? 12.883  14.646  -12.386 1.00 19.07  ? 5   SER A OG  1 
ATOM   36   N  N   . PRO A 1 6   ? 11.223  12.439  -9.929  1.00 8.29   ? 6   PRO A N   1 
ATOM   37   C  CA  . PRO A 1 6   ? 9.811   12.674  -10.289 1.00 8.29   ? 6   PRO A CA  1 
ATOM   38   C  C   . PRO A 1 6   ? 9.058   13.383  -9.165  1.00 8.29   ? 6   PRO A C   1 
ATOM   39   O  O   . PRO A 1 6   ? 9.455   13.261  -8.016  1.00 8.29   ? 6   PRO A O   1 
ATOM   40   C  CB  . PRO A 1 6   ? 9.290   11.269  -10.498 1.00 28.61  ? 6   PRO A CB  1 
ATOM   41   C  CG  . PRO A 1 6   ? 10.071  10.486  -9.472  1.00 28.61  ? 6   PRO A CG  1 
ATOM   42   C  CD  . PRO A 1 6   ? 11.463  11.015  -9.636  1.00 28.61  ? 6   PRO A CD  1 
ATOM   43   N  N   . SER A 1 7   ? 7.984   14.101  -9.476  1.00 25.47  ? 7   SER A N   1 
ATOM   44   C  CA  . SER A 1 7   ? 7.304   14.832  -8.414  1.00 25.47  ? 7   SER A CA  1 
ATOM   45   C  C   . SER A 1 7   ? 6.416   13.905  -7.590  1.00 25.47  ? 7   SER A C   1 
ATOM   46   O  O   . SER A 1 7   ? 6.155   14.185  -6.441  1.00 25.47  ? 7   SER A O   1 
ATOM   47   C  CB  . SER A 1 7   ? 6.480   15.981  -8.998  1.00 35.78  ? 7   SER A CB  1 
ATOM   48   O  OG  . SER A 1 7   ? 5.448   15.495  -9.838  1.00 35.78  ? 7   SER A OG  1 
ATOM   49   N  N   . LYS A 1 8   ? 5.929   12.871  -8.235  1.00 2.19   ? 8   LYS A N   1 
ATOM   50   C  CA  . LYS A 1 8   ? 5.111   11.926  -7.503  1.00 2.19   ? 8   LYS A CA  1 
ATOM   51   C  C   . LYS A 1 8   ? 5.582   10.543  -7.842  1.00 2.19   ? 8   LYS A C   1 
ATOM   52   O  O   . LYS A 1 8   ? 6.218   10.352  -8.857  1.00 2.19   ? 8   LYS A O   1 
ATOM   53   C  CB  . LYS A 1 8   ? 3.616   12.120  -7.772  1.00 61.59  ? 8   LYS A CB  1 
ATOM   54   C  CG  . LYS A 1 8   ? 3.088   13.382  -7.107  1.00 61.59  ? 8   LYS A CG  1 
ATOM   55   C  CD  . LYS A 1 8   ? 1.592   13.452  -7.008  1.00 61.59  ? 8   LYS A CD  1 
ATOM   56   C  CE  . LYS A 1 8   ? 1.182   14.735  -6.299  1.00 61.59  ? 8   LYS A CE  1 
ATOM   57   N  NZ  . LYS A 1 8   ? 1.635   15.963  -7.013  1.00 61.59  ? 8   LYS A NZ  1 
ATOM   58   N  N   . VAL A 1 9   ? 5.391   9.600   -6.927  1.00 53.51  ? 9   VAL A N   1 
ATOM   59   C  CA  . VAL A 1 9   ? 5.823   8.227   -7.144  1.00 53.51  ? 9   VAL A CA  1 
ATOM   60   C  C   . VAL A 1 9   ? 4.944   7.327   -6.287  1.00 53.51  ? 9   VAL A C   1 
ATOM   61   O  O   . VAL A 1 9   ? 4.389   7.773   -5.283  1.00 53.51  ? 9   VAL A O   1 
ATOM   62   C  CB  . VAL A 1 9   ? 7.291   8.009   -6.679  1.00 2.19   ? 9   VAL A CB  1 
ATOM   63   C  CG1 . VAL A 1 9   ? 7.855   6.813   -7.323  1.00 2.19   ? 9   VAL A CG1 1 
ATOM   64   C  CG2 . VAL A 1 9   ? 8.158   9.183   -6.979  1.00 2.19   ? 9   VAL A CG2 1 
ATOM   65   N  N   . ILE A 1 10  ? 4.750   6.090   -6.725  1.00 11.03  ? 10  ILE A N   1 
ATOM   66   C  CA  . ILE A 1 10  ? 3.986   5.118   -5.951  1.00 11.03  ? 10  ILE A CA  1 
ATOM   67   C  C   . ILE A 1 10  ? 4.843   3.884   -6.000  1.00 11.03  ? 10  ILE A C   1 
ATOM   68   O  O   . ILE A 1 10  ? 5.299   3.521   -7.071  1.00 11.03  ? 10  ILE A O   1 
ATOM   69   C  CB  . ILE A 1 10  ? 2.586   4.823   -6.556  1.00 27.10  ? 10  ILE A CB  1 
ATOM   70   C  CG1 . ILE A 1 10  ? 1.636   5.989   -6.260  1.00 27.10  ? 10  ILE A CG1 1 
ATOM   71   C  CG2 . ILE A 1 10  ? 2.012   3.536   -5.981  1.00 27.10  ? 10  ILE A CG2 1 
ATOM   72   C  CD1 . ILE A 1 10  ? 0.157   5.619   -6.233  1.00 27.10  ? 10  ILE A CD1 1 
ATOM   73   N  N   . LEU A 1 11  ? 5.162   3.303   -4.849  1.00 7.62   ? 11  LEU A N   1 
ATOM   74   C  CA  . LEU A 1 11  ? 5.988   2.094   -4.838  1.00 7.62   ? 11  LEU A CA  1 
ATOM   75   C  C   . LEU A 1 11  ? 5.841   1.205   -3.602  1.00 7.62   ? 11  LEU A C   1 
ATOM   76   O  O   . LEU A 1 11  ? 5.435   1.661   -2.529  1.00 7.62   ? 11  LEU A O   1 
ATOM   77   C  CB  . LEU A 1 11  ? 7.462   2.429   -5.051  1.00 17.13  ? 11  LEU A CB  1 
ATOM   78   C  CG  . LEU A 1 11  ? 8.220   3.016   -3.874  1.00 17.13  ? 11  LEU A CG  1 
ATOM   79   C  CD1 . LEU A 1 11  ? 9.672   2.674   -4.039  1.00 17.13  ? 11  LEU A CD1 1 
ATOM   80   C  CD2 . LEU A 1 11  ? 8.011   4.512   -3.779  1.00 17.13  ? 11  LEU A CD2 1 
ATOM   81   N  N   . PRO A 1 12  ? 6.197   -0.083  -3.738  1.00 14.09  ? 12  PRO A N   1 
ATOM   82   C  CA  . PRO A 1 12  ? 6.104   -1.035  -2.635  1.00 14.09  ? 12  PRO A CA  1 
ATOM   83   C  C   . PRO A 1 12  ? 7.234   -0.863  -1.634  1.00 14.09  ? 12  PRO A C   1 
ATOM   84   O  O   . PRO A 1 12  ? 8.260   -0.245  -1.920  1.00 14.09  ? 12  PRO A O   1 
ATOM   85   C  CB  . PRO A 1 12  ? 6.220   -2.365  -3.350  1.00 12.89  ? 12  PRO A CB  1 
ATOM   86   C  CG  . PRO A 1 12  ? 7.220   -2.059  -4.406  1.00 12.89  ? 12  PRO A CG  1 
ATOM   87   C  CD  . PRO A 1 12  ? 6.705   -0.750  -4.947  1.00 12.89  ? 12  PRO A CD  1 
ATOM   88   N  N   . ARG A 1 13  ? 7.047   -1.451  -0.465  1.00 57.29  ? 13  ARG A N   1 
ATOM   89   C  CA  . ARG A 1 13  ? 8.042   -1.362  0.582   1.00 57.29  ? 13  ARG A CA  1 
ATOM   90   C  C   . ARG A 1 13  ? 9.358   -1.974  0.141   1.00 57.29  ? 13  ARG A C   1 
ATOM   91   O  O   . ARG A 1 13  ? 9.400   -2.850  -0.727  1.00 57.29  ? 13  ARG A O   1 
ATOM   92   C  CB  . ARG A 1 13  ? 7.557   -2.071  1.855   1.00 86.01  ? 13  ARG A CB  1 
ATOM   93   C  CG  . ARG A 1 13  ? 6.774   -1.194  2.825   1.00 86.01  ? 13  ARG A CG  1 
ATOM   94   C  CD  . ARG A 1 13  ? 5.288   -1.447  2.760   1.00 86.01  ? 13  ARG A CD  1 
ATOM   95   N  NE  . ARG A 1 13  ? 4.742   -1.735  4.080   1.00 86.01  ? 13  ARG A NE  1 
ATOM   96   C  CZ  . ARG A 1 13  ? 4.708   -2.946  4.624   1.00 86.01  ? 13  ARG A CZ  1 
ATOM   97   N  NH1 . ARG A 1 13  ? 5.184   -3.992  3.963   1.00 86.01  ? 13  ARG A NH1 1 
ATOM   98   N  NH2 . ARG A 1 13  ? 4.204   -3.109  5.835   1.00 86.01  ? 13  ARG A NH2 1 
ATOM   99   N  N   . GLY A 1 14  ? 10.434  -1.459  0.723   1.00 13.12  ? 14  GLY A N   1 
ATOM   100  C  CA  . GLY A 1 14  ? 11.766  -1.959  0.432   1.00 13.12  ? 14  GLY A CA  1 
ATOM   101  C  C   . GLY A 1 14  ? 12.222  -1.571  -0.951  1.00 13.12  ? 14  GLY A C   1 
ATOM   102  O  O   . GLY A 1 14  ? 13.384  -1.759  -1.330  1.00 13.12  ? 14  GLY A O   1 
ATOM   103  N  N   . GLY A 1 15  ? 11.268  -1.087  -1.744  1.00 36.11  ? 15  GLY A N   1 
ATOM   104  C  CA  . GLY A 1 15  ? 11.604  -0.687  -3.085  1.00 36.11  ? 15  GLY A CA  1 
ATOM   105  C  C   . GLY A 1 15  ? 12.590  0.450   -3.025  1.00 36.11  ? 15  GLY A C   1 
ATOM   106  O  O   . GLY A 1 15  ? 12.934  0.940   -1.947  1.00 36.11  ? 15  GLY A O   1 
ATOM   107  N  N   . SER A 1 16  ? 13.111  0.820   -4.184  1.00 61.84  ? 16  SER A N   1 
ATOM   108  C  CA  . SER A 1 16  ? 14.055  1.929   -4.221  1.00 61.84  ? 16  SER A CA  1 
ATOM   109  C  C   . SER A 1 16  ? 13.651  2.846   -5.355  1.00 61.84  ? 16  SER A C   1 
ATOM   110  O  O   . SER A 1 16  ? 12.947  2.438   -6.286  1.00 61.84  ? 16  SER A O   1 
ATOM   111  C  CB  . SER A 1 16  ? 15.495  1.431   -4.421  1.00 35.32  ? 16  SER A CB  1 
ATOM   112  O  OG  . SER A 1 16  ? 15.676  0.868   -5.709  1.00 35.32  ? 16  SER A OG  1 
ATOM   113  N  N   . VAL A 1 17  ? 14.011  4.109   -5.205  1.00 2.19   ? 17  VAL A N   1 
ATOM   114  C  CA  . VAL A 1 17  ? 13.735  5.110   -6.209  1.00 2.19   ? 17  VAL A CA  1 
ATOM   115  C  C   . VAL A 1 17  ? 14.943  6.014   -6.451  1.00 2.19   ? 17  VAL A C   1 
ATOM   116  O  O   . VAL A 1 17  ? 15.895  6.031   -5.682  1.00 2.19   ? 17  VAL A O   1 
ATOM   117  C  CB  . VAL A 1 17  ? 12.492  5.964   -5.853  1.00 24.28  ? 17  VAL A CB  1 
ATOM   118  C  CG1 . VAL A 1 17  ? 11.317  5.521   -6.695  1.00 24.28  ? 17  VAL A CG1 1 
ATOM   119  C  CG2 . VAL A 1 17  ? 12.140  5.844   -4.384  1.00 24.28  ? 17  VAL A CG2 1 
ATOM   120  N  N   . LEU A 1 18  ? 14.917  6.717   -7.572  1.00 44.75  ? 18  LEU A N   1 
ATOM   121  C  CA  . LEU A 1 18  ? 15.978  7.642   -7.948  1.00 44.75  ? 18  LEU A CA  1 
ATOM   122  C  C   . LEU A 1 18  ? 15.364  9.040   -7.979  1.00 44.75  ? 18  LEU A C   1 
ATOM   123  O  O   . LEU A 1 18  ? 14.209  9.204   -8.381  1.00 44.75  ? 18  LEU A O   1 
ATOM   124  C  CB  . LEU A 1 18  ? 16.489  7.290   -9.345  1.00 12.52  ? 18  LEU A CB  1 
ATOM   125  C  CG  . LEU A 1 18  ? 17.731  6.426   -9.559  1.00 12.52  ? 18  LEU A CG  1 
ATOM   126  C  CD1 . LEU A 1 18  ? 17.818  5.313   -8.552  1.00 12.52  ? 18  LEU A CD1 1 
ATOM   127  C  CD2 . LEU A 1 18  ? 17.696  5.878   -10.960 1.00 12.52  ? 18  LEU A CD2 1 
ATOM   128  N  N   . VAL A 1 19  ? 16.094  10.047  -7.514  1.00 24.15  ? 19  VAL A N   1 
ATOM   129  C  CA  . VAL A 1 19  ? 15.547  11.403  -7.550  1.00 24.15  ? 19  VAL A CA  1 
ATOM   130  C  C   . VAL A 1 19  ? 16.592  12.407  -8.010  1.00 24.15  ? 19  VAL A C   1 
ATOM   131  O  O   . VAL A 1 19  ? 17.757  12.334  -7.625  1.00 24.15  ? 19  VAL A O   1 
ATOM   132  C  CB  . VAL A 1 19  ? 14.958  11.868  -6.192  1.00 8.25   ? 19  VAL A CB  1 
ATOM   133  C  CG1 . VAL A 1 19  ? 13.781  12.799  -6.438  1.00 8.25   ? 19  VAL A CG1 1 
ATOM   134  C  CG2 . VAL A 1 19  ? 14.527  10.690  -5.347  1.00 8.25   ? 19  VAL A CG2 1 
ATOM   135  N  N   . THR A 1 20  ? 16.178  13.348  -8.843  1.00 41.47  ? 20  THR A N   1 
ATOM   136  C  CA  . THR A 1 20  ? 17.136  14.306  -9.323  1.00 41.47  ? 20  THR A CA  1 
ATOM   137  C  C   . THR A 1 20  ? 16.920  15.717  -8.777  1.00 41.47  ? 20  THR A C   1 
ATOM   138  O  O   . THR A 1 20  ? 15.988  16.426  -9.173  1.00 41.47  ? 20  THR A O   1 
ATOM   139  C  CB  . THR A 1 20  ? 17.230  14.307  -10.867 1.00 68.83  ? 20  THR A CB  1 
ATOM   140  O  OG1 . THR A 1 20  ? 16.221  15.162  -11.407 1.00 68.83  ? 20  THR A OG1 1 
ATOM   141  C  CG2 . THR A 1 20  ? 17.027  12.899  -11.431 1.00 68.83  ? 20  THR A CG2 1 
ATOM   142  N  N   . CYS A 1 21  ? 17.743  16.089  -7.802  1.00 47.55  ? 21  CYS A N   1 
ATOM   143  C  CA  . CYS A 1 21  ? 17.676  17.417  -7.234  1.00 47.55  ? 21  CYS A CA  1 
ATOM   144  C  C   . CYS A 1 21  ? 18.368  18.317  -8.244  1.00 47.55  ? 21  CYS A C   1 
ATOM   145  O  O   . CYS A 1 21  ? 19.591  18.274  -8.387  1.00 47.55  ? 21  CYS A O   1 
ATOM   146  C  CB  . CYS A 1 21  ? 18.422  17.488  -5.901  1.00 86.87  ? 21  CYS A CB  1 
ATOM   147  S  SG  . CYS A 1 21  ? 17.700  16.579  -4.500  1.00 86.87  ? 21  CYS A SG  1 
ATOM   148  N  N   . SER A 1 22  ? 17.570  19.030  -9.036  1.00 38.56  ? 22  SER A N   1 
ATOM   149  C  CA  . SER A 1 22  ? 18.078  19.965  -10.053 1.00 38.56  ? 22  SER A CA  1 
ATOM   150  C  C   . SER A 1 22  ? 17.983  21.381  -9.491  1.00 38.56  ? 22  SER A C   1 
ATOM   151  O  O   . SER A 1 22  ? 17.410  21.598  -8.435  1.00 38.56  ? 22  SER A O   1 
ATOM   152  C  CB  . SER A 1 22  ? 17.243  19.879  -11.337 1.00 64.47  ? 22  SER A CB  1 
ATOM   153  O  OG  . SER A 1 22  ? 17.102  18.538  -11.779 1.00 64.47  ? 22  SER A OG  1 
ATOM   154  N  N   . THR A 1 23  ? 18.553  22.333  -10.211 1.00 51.13  ? 23  THR A N   1 
ATOM   155  C  CA  . THR A 1 23  ? 18.497  23.726  -9.787  1.00 51.13  ? 23  THR A CA  1 
ATOM   156  C  C   . THR A 1 23  ? 18.963  24.638  -10.910 1.00 51.13  ? 23  THR A C   1 
ATOM   157  O  O   . THR A 1 23  ? 19.665  24.196  -11.829 1.00 51.13  ? 23  THR A O   1 
ATOM   158  C  CB  . THR A 1 23  ? 19.311  24.009  -8.477  1.00 35.22  ? 23  THR A CB  1 
ATOM   159  O  OG1 . THR A 1 23  ? 19.352  25.422  -8.229  1.00 35.22  ? 23  THR A OG1 1 
ATOM   160  C  CG2 . THR A 1 23  ? 20.727  23.453  -8.550  1.00 35.22  ? 23  THR A CG2 1 
ATOM   161  N  N   . SER A 1 24  ? 18.506  25.885  -10.876 1.00 50.83  ? 24  SER A N   1 
ATOM   162  C  CA  . SER A 1 24  ? 18.859  26.846  -11.897 1.00 50.83  ? 24  SER A CA  1 
ATOM   163  C  C   . SER A 1 24  ? 19.522  28.064  -11.307 1.00 50.83  ? 24  SER A C   1 
ATOM   164  O  O   . SER A 1 24  ? 18.867  29.062  -11.017 1.00 50.83  ? 24  SER A O   1 
ATOM   165  C  CB  . SER A 1 24  ? 17.629  27.268  -12.713 1.00 14.51  ? 24  SER A CB  1 
ATOM   166  O  OG  . SER A 1 24  ? 16.654  27.913  -11.922 1.00 14.51  ? 24  SER A OG  1 
ATOM   167  N  N   . CYS A 1 25  ? 20.826  27.979  -11.103 1.00 69.03  ? 25  CYS A N   1 
ATOM   168  C  CA  . CYS A 1 25  ? 21.567  29.107  -10.559 1.00 69.03  ? 25  CYS A CA  1 
ATOM   169  C  C   . CYS A 1 25  ? 22.861  29.303  -11.329 1.00 69.03  ? 25  CYS A C   1 
ATOM   170  O  O   . CYS A 1 25  ? 23.373  28.369  -11.960 1.00 69.03  ? 25  CYS A O   1 
ATOM   171  C  CB  . CYS A 1 25  ? 21.788  28.944  -9.055  1.00 97.98  ? 25  CYS A CB  1 
ATOM   172  S  SG  . CYS A 1 25  ? 20.214  29.164  -8.142  1.00 97.98  ? 25  CYS A SG  1 
ATOM   173  N  N   . ASP A 1 26  ? 23.319  30.553  -11.356 1.00 98.65  ? 26  ASP A N   1 
ATOM   174  C  CA  . ASP A 1 26  ? 24.554  30.908  -12.047 1.00 98.65  ? 26  ASP A CA  1 
ATOM   175  C  C   . ASP A 1 26  ? 25.686  30.055  -11.459 1.00 98.65  ? 26  ASP A C   1 
ATOM   176  O  O   . ASP A 1 26  ? 26.538  29.542  -12.186 1.00 98.65  ? 26  ASP A O   1 
ATOM   177  C  CB  . ASP A 1 26  ? 24.846  32.413  -11.868 1.00 94.31  ? 26  ASP A CB  1 
ATOM   178  C  CG  . ASP A 1 26  ? 25.456  33.059  -13.112 1.00 94.31  ? 26  ASP A CG  1 
ATOM   179  O  OD1 . ASP A 1 26  ? 25.012  32.745  -14.236 1.00 94.31  ? 26  ASP A OD1 1 
ATOM   180  O  OD2 . ASP A 1 26  ? 26.373  33.898  -12.959 1.00 94.31  ? 26  ASP A OD2 1 
ATOM   181  N  N   . GLN A 1 27  ? 25.625  29.852  -10.143 1.00 85.25  ? 27  GLN A N   1 
ATOM   182  C  CA  . GLN A 1 27  ? 26.602  29.055  -9.401  1.00 85.25  ? 27  GLN A CA  1 
ATOM   183  C  C   . GLN A 1 27  ? 26.105  28.837  -7.957  1.00 85.25  ? 27  GLN A C   1 
ATOM   184  O  O   . GLN A 1 27  ? 26.353  29.658  -7.074  1.00 85.25  ? 27  GLN A O   1 
ATOM   185  C  CB  . GLN A 1 27  ? 27.976  29.751  -9.405  1.00 96.57  ? 27  GLN A CB  1 
ATOM   186  C  CG  . GLN A 1 27  ? 29.150  28.873  -8.956  1.00 96.57  ? 27  GLN A CG  1 
ATOM   187  C  CD  . GLN A 1 27  ? 29.429  27.698  -9.896  1.00 96.57  ? 27  GLN A CD  1 
ATOM   188  O  OE1 . GLN A 1 27  ? 29.177  26.534  -9.560  1.00 96.57  ? 27  GLN A OE1 1 
ATOM   189  N  NE2 . GLN A 1 27  ? 29.972  28.001  -11.071 1.00 96.57  ? 27  GLN A NE2 1 
ATOM   190  N  N   . PRO A 1 28  ? 25.364  27.743  -7.718  1.00 56.58  ? 28  PRO A N   1 
ATOM   191  C  CA  . PRO A 1 28  ? 24.822  27.395  -6.401  1.00 56.58  ? 28  PRO A CA  1 
ATOM   192  C  C   . PRO A 1 28  ? 25.918  26.979  -5.406  1.00 56.58  ? 28  PRO A C   1 
ATOM   193  O  O   . PRO A 1 28  ? 26.839  26.234  -5.765  1.00 56.58  ? 28  PRO A O   1 
ATOM   194  C  CB  . PRO A 1 28  ? 23.896  26.223  -6.728  1.00 87.29  ? 28  PRO A CB  1 
ATOM   195  C  CG  . PRO A 1 28  ? 24.595  25.553  -7.870  1.00 87.29  ? 28  PRO A CG  1 
ATOM   196  C  CD  . PRO A 1 28  ? 24.976  26.737  -8.723  1.00 87.29  ? 28  PRO A CD  1 
ATOM   197  N  N   . LYS A 1 29  ? 25.810  27.435  -4.161  1.00 72.47  ? 29  LYS A N   1 
ATOM   198  C  CA  . LYS A 1 29  ? 26.810  27.085  -3.161  1.00 72.47  ? 29  LYS A CA  1 
ATOM   199  C  C   . LYS A 1 29  ? 26.561  25.746  -2.443  1.00 72.47  ? 29  LYS A C   1 
ATOM   200  O  O   . LYS A 1 29  ? 27.416  25.275  -1.692  1.00 72.47  ? 29  LYS A O   1 
ATOM   201  C  CB  . LYS A 1 29  ? 26.981  28.238  -2.145  1.00 66.27  ? 29  LYS A CB  1 
ATOM   202  C  CG  . LYS A 1 29  ? 28.238  28.139  -1.258  1.00 66.27  ? 29  LYS A CG  1 
ATOM   203  C  CD  . LYS A 1 29  ? 29.542  28.178  -2.076  1.00 66.27  ? 29  LYS A CD  1 
ATOM   204  C  CE  . LYS A 1 29  ? 30.783  27.835  -1.247  1.00 66.27  ? 29  LYS A CE  1 
ATOM   205  N  NZ  . LYS A 1 29  ? 30.471  27.528  0.174   1.00 66.27  ? 29  LYS A NZ  1 
ATOM   206  N  N   . LEU A 1 30  ? 25.427  25.110  -2.726  1.00 22.93  ? 30  LEU A N   1 
ATOM   207  C  CA  . LEU A 1 30  ? 25.091  23.837  -2.110  1.00 22.93  ? 30  LEU A CA  1 
ATOM   208  C  C   . LEU A 1 30  ? 23.855  23.203  -2.720  1.00 22.93  ? 30  LEU A C   1 
ATOM   209  O  O   . LEU A 1 30  ? 22.927  23.899  -3.137  1.00 22.93  ? 30  LEU A O   1 
ATOM   210  C  CB  . LEU A 1 30  ? 24.871  24.019  -0.606  1.00 67.15  ? 30  LEU A CB  1 
ATOM   211  C  CG  . LEU A 1 30  ? 25.544  23.042  0.343   1.00 67.15  ? 30  LEU A CG  1 
ATOM   212  C  CD1 . LEU A 1 30  ? 24.793  21.726  0.421   1.00 67.15  ? 30  LEU A CD1 1 
ATOM   213  C  CD2 . LEU A 1 30  ? 26.996  22.814  -0.085  1.00 67.15  ? 30  LEU A CD2 1 
ATOM   214  N  N   . LEU A 1 31  ? 23.874  21.875  -2.806  1.00 46.44  ? 31  LEU A N   1 
ATOM   215  C  CA  . LEU A 1 31  ? 22.759  21.079  -3.340  1.00 46.44  ? 31  LEU A CA  1 
ATOM   216  C  C   . LEU A 1 31  ? 22.713  19.747  -2.611  1.00 46.44  ? 31  LEU A C   1 
ATOM   217  O  O   . LEU A 1 31  ? 23.746  19.092  -2.421  1.00 46.44  ? 31  LEU A O   1 
ATOM   218  C  CB  . LEU A 1 31  ? 22.885  20.850  -4.844  1.00 31.41  ? 31  LEU A CB  1 
ATOM   219  C  CG  . LEU A 1 31  ? 21.833  19.949  -5.509  1.00 31.41  ? 31  LEU A CG  1 
ATOM   220  C  CD1 . LEU A 1 31  ? 20.460  20.383  -5.091  1.00 31.41  ? 31  LEU A CD1 1 
ATOM   221  C  CD2 . LEU A 1 31  ? 21.941  19.985  -7.032  1.00 31.41  ? 31  LEU A CD2 1 
ATOM   222  N  N   . GLY A 1 32  ? 21.503  19.365  -2.202  1.00 38.54  ? 32  GLY A N   1 
ATOM   223  C  CA  . GLY A 1 32  ? 21.299  18.118  -1.488  1.00 38.54  ? 32  GLY A CA  1 
ATOM   224  C  C   . GLY A 1 32  ? 19.844  17.727  -1.385  1.00 38.54  ? 32  GLY A C   1 
ATOM   225  O  O   . GLY A 1 32  ? 18.966  18.443  -1.864  1.00 38.54  ? 32  GLY A O   1 
ATOM   226  N  N   . ILE A 1 33  ? 19.597  16.571  -0.775  1.00 34.36  ? 33  ILE A N   1 
ATOM   227  C  CA  . ILE A 1 33  ? 18.237  16.054  -0.595  1.00 34.36  ? 33  ILE A CA  1 
ATOM   228  C  C   . ILE A 1 33  ? 17.981  15.841  0.906   1.00 34.36  ? 33  ILE A C   1 
ATOM   229  O  O   . ILE A 1 33  ? 18.910  15.555  1.649   1.00 34.36  ? 33  ILE A O   1 
ATOM   230  C  CB  . ILE A 1 33  ? 18.028  14.745  -1.425  1.00 40.70  ? 33  ILE A CB  1 
ATOM   231  C  CG1 . ILE A 1 33  ? 16.552  14.354  -1.473  1.00 40.70  ? 33  ILE A CG1 1 
ATOM   232  C  CG2 . ILE A 1 33  ? 18.854  13.629  -0.855  1.00 40.70  ? 33  ILE A CG2 1 
ATOM   233  C  CD1 . ILE A 1 33  ? 16.248  13.270  -2.454  1.00 40.70  ? 33  ILE A CD1 1 
ATOM   234  N  N   . GLU A 1 34  ? 16.744  16.040  1.357   1.00 28.20  ? 34  GLU A N   1 
ATOM   235  C  CA  . GLU A 1 34  ? 16.414  15.892  2.760   1.00 28.20  ? 34  GLU A CA  1 
ATOM   236  C  C   . GLU A 1 34  ? 15.462  14.748  3.019   1.00 28.20  ? 34  GLU A C   1 
ATOM   237  O  O   . GLU A 1 34  ? 14.247  14.924  2.849   1.00 28.20  ? 34  GLU A O   1 
ATOM   238  C  CB  . GLU A 1 34  ? 15.778  17.184  3.271   1.00 25.94  ? 34  GLU A CB  1 
ATOM   239  C  CG  . GLU A 1 34  ? 15.514  17.230  4.772   1.00 25.94  ? 34  GLU A CG  1 
ATOM   240  C  CD  . GLU A 1 34  ? 16.758  17.518  5.580   1.00 25.94  ? 34  GLU A CD  1 
ATOM   241  O  OE1 . GLU A 1 34  ? 17.803  17.822  4.987   1.00 25.94  ? 34  GLU A OE1 1 
ATOM   242  O  OE2 . GLU A 1 34  ? 16.699  17.471  6.814   1.00 25.94  ? 34  GLU A OE2 1 
ATOM   243  N  N   . THR A 1 35  ? 15.978  13.610  3.494   1.00 50.82  ? 35  THR A N   1 
ATOM   244  C  CA  . THR A 1 35  ? 15.113  12.468  3.777   1.00 50.82  ? 35  THR A CA  1 
ATOM   245  C  C   . THR A 1 35  ? 15.621  11.599  4.888   1.00 50.82  ? 35  THR A C   1 
ATOM   246  O  O   . THR A 1 35  ? 16.822  11.568  5.149   1.00 50.82  ? 35  THR A O   1 
ATOM   247  C  CB  . THR A 1 35  ? 15.021  11.471  2.615   1.00 18.34  ? 35  THR A CB  1 
ATOM   248  O  OG1 . THR A 1 35  ? 16.249  10.740  2.523   1.00 18.34  ? 35  THR A OG1 1 
ATOM   249  C  CG2 . THR A 1 35  ? 14.722  12.151  1.305   1.00 18.34  ? 35  THR A CG2 1 
ATOM   250  N  N   . PRO A 1 36  ? 14.701  10.844  5.529   1.00 43.04  ? 36  PRO A N   1 
ATOM   251  C  CA  . PRO A 1 36  ? 14.962  9.902   6.624   1.00 43.04  ? 36  PRO A CA  1 
ATOM   252  C  C   . PRO A 1 36  ? 15.412  8.580   5.960   1.00 43.04  ? 36  PRO A C   1 
ATOM   253  O  O   . PRO A 1 36  ? 16.011  7.711   6.593   1.00 43.04  ? 36  PRO A O   1 
ATOM   254  C  CB  . PRO A 1 36  ? 13.583  9.731   7.271   1.00 93.45  ? 36  PRO A CB  1 
ATOM   255  C  CG  . PRO A 1 36  ? 12.829  10.953  6.859   1.00 93.45  ? 36  PRO A CG  1 
ATOM   256  C  CD  . PRO A 1 36  ? 13.255  11.113  5.436   1.00 93.45  ? 36  PRO A CD  1 
ATOM   257  N  N   . LEU A 1 37  ? 15.113  8.460   4.668   1.00 36.49  ? 37  LEU A N   1 
ATOM   258  C  CA  . LEU A 1 37  ? 15.461  7.293   3.875   1.00 36.49  ? 37  LEU A CA  1 
ATOM   259  C  C   . LEU A 1 37  ? 16.947  7.203   3.579   1.00 36.49  ? 37  LEU A C   1 
ATOM   260  O  O   . LEU A 1 37  ? 17.635  8.219   3.493   1.00 36.49  ? 37  LEU A O   1 
ATOM   261  C  CB  . LEU A 1 37  ? 14.752  7.322   2.523   1.00 33.23  ? 37  LEU A CB  1 
ATOM   262  C  CG  . LEU A 1 37  ? 13.242  7.307   2.383   1.00 33.23  ? 37  LEU A CG  1 
ATOM   263  C  CD1 . LEU A 1 37  ? 12.737  8.707   2.536   1.00 33.23  ? 37  LEU A CD1 1 
ATOM   264  C  CD2 . LEU A 1 37  ? 12.900  6.784   1.001   1.00 33.23  ? 37  LEU A CD2 1 
ATOM   265  N  N   . PRO A 1 38  ? 17.452  5.973   3.379   1.00 26.86  ? 38  PRO A N   1 
ATOM   266  C  CA  . PRO A 1 38  ? 18.861  5.713   3.073   1.00 26.86  ? 38  PRO A CA  1 
ATOM   267  C  C   . PRO A 1 38  ? 19.222  6.361   1.742   1.00 26.86  ? 38  PRO A C   1 
ATOM   268  O  O   . PRO A 1 38  ? 18.620  6.044   0.720   1.00 26.86  ? 38  PRO A O   1 
ATOM   269  C  CB  . PRO A 1 38  ? 18.904  4.187   2.958   1.00 27.45  ? 38  PRO A CB  1 
ATOM   270  C  CG  . PRO A 1 38  ? 17.833  3.734   3.897   1.00 27.45  ? 38  PRO A CG  1 
ATOM   271  C  CD  . PRO A 1 38  ? 16.722  4.712   3.626   1.00 27.45  ? 38  PRO A CD  1 
ATOM   272  N  N   . LYS A 1 39  ? 20.179  7.284   1.753   1.00 66.81  ? 39  LYS A N   1 
ATOM   273  C  CA  . LYS A 1 39  ? 20.593  7.934   0.516   1.00 66.81  ? 39  LYS A CA  1 
ATOM   274  C  C   . LYS A 1 39  ? 21.894  7.351   -0.062  1.00 66.81  ? 39  LYS A C   1 
ATOM   275  O  O   . LYS A 1 39  ? 22.773  6.881   0.670   1.00 66.81  ? 39  LYS A O   1 
ATOM   276  C  CB  . LYS A 1 39  ? 20.692  9.458   0.697   1.00 69.03  ? 39  LYS A CB  1 
ATOM   277  C  CG  . LYS A 1 39  ? 21.879  9.948   1.521   1.00 69.03  ? 39  LYS A CG  1 
ATOM   278  C  CD  . LYS A 1 39  ? 21.978  11.486  1.520   1.00 69.03  ? 39  LYS A CD  1 
ATOM   279  C  CE  . LYS A 1 39  ? 23.314  12.022  2.105   1.00 69.03  ? 39  LYS A CE  1 
ATOM   280  N  NZ  . LYS A 1 39  ? 23.233  12.635  3.481   1.00 69.03  ? 39  LYS A NZ  1 
ATOM   281  N  N   . LYS A 1 40  ? 21.965  7.322   -1.390  1.00 2.19   ? 40  LYS A N   1 
ATOM   282  C  CA  . LYS A 1 40  ? 23.127  6.829   -2.115  1.00 2.19   ? 40  LYS A CA  1 
ATOM   283  C  C   . LYS A 1 40  ? 23.204  7.680   -3.367  1.00 2.19   ? 40  LYS A C   1 
ATOM   284  O  O   . LYS A 1 40  ? 22.336  7.566   -4.211  1.00 2.19   ? 40  LYS A O   1 
ATOM   285  C  CB  . LYS A 1 40  ? 22.923  5.365   -2.521  1.00 61.89  ? 40  LYS A CB  1 
ATOM   286  C  CG  . LYS A 1 40  ? 23.908  4.848   -3.589  1.00 61.89  ? 40  LYS A CG  1 
ATOM   287  C  CD  . LYS A 1 40  ? 25.251  4.413   -3.008  1.00 61.89  ? 40  LYS A CD  1 
ATOM   288  C  CE  . LYS A 1 40  ? 25.152  3.054   -2.310  1.00 61.89  ? 40  LYS A CE  1 
ATOM   289  N  NZ  . LYS A 1 40  ? 26.432  2.592   -1.680  1.00 61.89  ? 40  LYS A NZ  1 
ATOM   290  N  N   . GLU A 1 41  ? 24.232  8.515   -3.508  1.00 25.82  ? 41  GLU A N   1 
ATOM   291  C  CA  . GLU A 1 41  ? 24.351  9.364   -4.691  1.00 25.82  ? 41  GLU A CA  1 
ATOM   292  C  C   . GLU A 1 41  ? 24.900  8.669   -5.947  1.00 25.82  ? 41  GLU A C   1 
ATOM   293  O  O   . GLU A 1 41  ? 25.638  7.682   -5.850  1.00 25.82  ? 41  GLU A O   1 
ATOM   294  C  CB  . GLU A 1 41  ? 25.181  10.606  -4.382  1.00 93.29  ? 41  GLU A CB  1 
ATOM   295  C  CG  . GLU A 1 41  ? 26.641  10.338  -4.043  1.00 93.29  ? 41  GLU A CG  1 
ATOM   296  C  CD  . GLU A 1 41  ? 27.507  11.595  -4.143  1.00 93.29  ? 41  GLU A CD  1 
ATOM   297  O  OE1 . GLU A 1 41  ? 28.746  11.476  -3.959  1.00 93.29  ? 41  GLU A OE1 1 
ATOM   298  O  OE2 . GLU A 1 41  ? 26.952  12.693  -4.418  1.00 93.29  ? 41  GLU A OE2 1 
ATOM   299  N  N   . LEU A 1 42  ? 24.534  9.201   -7.119  1.00 43.82  ? 42  LEU A N   1 
ATOM   300  C  CA  . LEU A 1 42  ? 24.964  8.665   -8.414  1.00 43.82  ? 42  LEU A CA  1 
ATOM   301  C  C   . LEU A 1 42  ? 26.143  9.382   -9.068  1.00 43.82  ? 42  LEU A C   1 
ATOM   302  O  O   . LEU A 1 42  ? 27.092  9.788   -8.384  1.00 43.82  ? 42  LEU A O   1 
ATOM   303  C  CB  . LEU A 1 42  ? 23.796  8.599   -9.394  1.00 87.68  ? 42  LEU A CB  1 
ATOM   304  C  CG  . LEU A 1 42  ? 22.805  7.475   -9.125  1.00 87.68  ? 42  LEU A CG  1 
ATOM   305  C  CD1 . LEU A 1 42  ? 21.674  7.497   -10.124 1.00 87.68  ? 42  LEU A CD1 1 
ATOM   306  C  CD2 . LEU A 1 42  ? 23.519  6.143   -9.180  1.00 87.68  ? 42  LEU A CD2 1 
ATOM   307  N  N   . LEU A 1 43  ? 26.091  9.505   -10.374 1.00 98.21  ? 43  LEU A N   1 
ATOM   308  C  CA  . LEU A 1 43  ? 27.159  10.132  -11.158 1.00 98.21  ? 43  LEU A CA  1 
ATOM   309  C  C   . LEU A 1 43  ? 27.735  11.482  -10.734 1.00 98.21  ? 43  LEU A C   1 
ATOM   310  O  O   . LEU A 1 43  ? 27.098  12.274  -10.036 1.00 98.21  ? 43  LEU A O   1 
ATOM   311  C  CB  . LEU A 1 43  ? 26.763  10.217  -12.642 1.00 98.21  ? 43  LEU A CB  1 
ATOM   312  C  CG  . LEU A 1 43  ? 27.173  9.059   -13.558 1.00 98.21  ? 43  LEU A CG  1 
ATOM   313  C  CD1 . LEU A 1 43  ? 27.030  9.471   -15.032 1.00 98.21  ? 43  LEU A CD1 1 
ATOM   314  C  CD2 . LEU A 1 43  ? 28.620  8.672   -13.268 1.00 98.21  ? 43  LEU A CD2 1 
ATOM   315  N  N   . LEU A 1 44  ? 28.958  11.710  -11.212 1.00 63.60  ? 44  LEU A N   1 
ATOM   316  C  CA  . LEU A 1 44  ? 29.737  12.934  -10.993 1.00 63.60  ? 44  LEU A CA  1 
ATOM   317  C  C   . LEU A 1 44  ? 29.474  13.995  -12.091 1.00 63.60  ? 44  LEU A C   1 
ATOM   318  O  O   . LEU A 1 44  ? 29.479  15.202  -11.801 1.00 63.60  ? 44  LEU A O   1 
ATOM   319  C  CB  . LEU A 1 44  ? 31.238  12.580  -10.920 1.00 98.21  ? 44  LEU A CB  1 
ATOM   320  C  CG  . LEU A 1 44  ? 32.335  13.636  -10.717 1.00 98.21  ? 44  LEU A CG  1 
ATOM   321  C  CD1 . LEU A 1 44  ? 31.982  14.581  -9.564  1.00 98.21  ? 44  LEU A CD1 1 
ATOM   322  C  CD2 . LEU A 1 44  ? 33.674  12.920  -10.459 1.00 98.21  ? 44  LEU A CD2 1 
ATOM   323  N  N   . PRO A 1 45  ? 29.291  13.561  -13.364 1.00 68.74  ? 45  PRO A N   1 
ATOM   324  C  CA  . PRO A 1 45  ? 29.025  14.466  -14.489 1.00 68.74  ? 45  PRO A CA  1 
ATOM   325  C  C   . PRO A 1 45  ? 27.809  15.370  -14.271 1.00 68.74  ? 45  PRO A C   1 
ATOM   326  O  O   . PRO A 1 45  ? 26.691  14.894  -14.027 1.00 68.74  ? 45  PRO A O   1 
ATOM   327  C  CB  . PRO A 1 45  ? 28.808  13.500  -15.639 1.00 79.88  ? 45  PRO A CB  1 
ATOM   328  C  CG  . PRO A 1 45  ? 29.819  12.457  -15.341 1.00 79.88  ? 45  PRO A CG  1 
ATOM   329  C  CD  . PRO A 1 45  ? 29.593  12.211  -13.875 1.00 79.88  ? 45  PRO A CD  1 
ATOM   330  N  N   . GLY A 1 46  ? 28.052  16.675  -14.415 1.00 98.21  ? 46  GLY A N   1 
ATOM   331  C  CA  . GLY A 1 46  ? 27.033  17.691  -14.201 1.00 98.21  ? 46  GLY A CA  1 
ATOM   332  C  C   . GLY A 1 46  ? 27.459  18.529  -13.003 1.00 98.21  ? 46  GLY A C   1 
ATOM   333  O  O   . GLY A 1 46  ? 28.418  18.156  -12.319 1.00 98.21  ? 46  GLY A O   1 
ATOM   334  N  N   . ASN A 1 47  ? 26.712  19.600  -12.709 1.00 49.93  ? 47  ASN A N   1 
ATOM   335  C  CA  . ASN A 1 47  ? 27.018  20.499  -11.574 1.00 49.93  ? 47  ASN A CA  1 
ATOM   336  C  C   . ASN A 1 47  ? 25.797  20.965  -10.814 1.00 49.93  ? 47  ASN A C   1 
ATOM   337  O  O   . ASN A 1 47  ? 25.784  20.952  -9.578  1.00 49.93  ? 47  ASN A O   1 
ATOM   338  C  CB  . ASN A 1 47  ? 27.789  21.731  -12.040 1.00 72.34  ? 47  ASN A CB  1 
ATOM   339  C  CG  . ASN A 1 47  ? 27.393  22.171  -13.460 1.00 72.34  ? 47  ASN A CG  1 
ATOM   340  O  OD1 . ASN A 1 47  ? 26.215  22.108  -13.835 1.00 72.34  ? 47  ASN A OD1 1 
ATOM   341  N  ND2 . ASN A 1 47  ? 28.379  22.572  -14.258 1.00 72.34  ? 47  ASN A ND2 1 
ATOM   342  N  N   . ASN A 1 48  ? 24.780  21.409  -11.554 1.00 58.42  ? 48  ASN A N   1 
ATOM   343  C  CA  . ASN A 1 48  ? 23.522  21.915  -11.000 1.00 58.42  ? 48  ASN A CA  1 
ATOM   344  C  C   . ASN A 1 48  ? 22.420  20.905  -11.185 1.00 58.42  ? 48  ASN A C   1 
ATOM   345  O  O   . ASN A 1 48  ? 21.279  21.252  -11.490 1.00 58.42  ? 48  ASN A O   1 
ATOM   346  C  CB  . ASN A 1 48  ? 23.137  23.231  -11.729 1.00 98.21  ? 48  ASN A CB  1 
ATOM   347  C  CG  . ASN A 1 48  ? 24.127  24.352  -11.489 1.00 98.21  ? 48  ASN A CG  1 
ATOM   348  O  OD1 . ASN A 1 48  ? 25.085  24.217  -10.744 1.00 98.21  ? 48  ASN A OD1 1 
ATOM   349  N  ND2 . ASN A 1 48  ? 23.879  25.494  -12.142 1.00 98.21  ? 48  ASN A ND2 1 
ATOM   350  N  N   . ARG A 1 49  ? 22.773  19.614  -11.072 1.00 25.10  ? 49  ARG A N   1 
ATOM   351  C  CA  . ARG A 1 49  ? 21.845  18.494  -11.212 1.00 25.10  ? 49  ARG A CA  1 
ATOM   352  C  C   . ARG A 1 49  ? 22.480  17.330  -10.473 1.00 25.10  ? 49  ARG A C   1 
ATOM   353  O  O   . ARG A 1 49  ? 23.639  16.985  -10.718 1.00 25.10  ? 49  ARG A O   1 
ATOM   354  C  CB  . ARG A 1 49  ? 21.644  18.116  -12.686 1.00 83.27  ? 49  ARG A CB  1 
ATOM   355  C  CG  . ARG A 1 49  ? 20.660  16.998  -12.910 1.00 83.27  ? 49  ARG A CG  1 
ATOM   356  C  CD  . ARG A 1 49  ? 20.642  16.560  -14.368 1.00 83.27  ? 49  ARG A CD  1 
ATOM   357  N  NE  . ARG A 1 49  ? 19.832  17.428  -15.218 1.00 83.27  ? 49  ARG A NE  1 
ATOM   358  C  CZ  . ARG A 1 49  ? 18.738  17.032  -15.866 1.00 83.27  ? 49  ARG A CZ  1 
ATOM   359  N  NH1 . ARG A 1 49  ? 18.310  15.777  -15.766 1.00 83.27  ? 49  ARG A NH1 1 
ATOM   360  N  NH2 . ARG A 1 49  ? 18.072  17.890  -16.627 1.00 83.27  ? 49  ARG A NH2 1 
ATOM   361  N  N   . LYS A 1 50  ? 21.711  16.731  -9.571  1.00 43.78  ? 50  LYS A N   1 
ATOM   362  C  CA  . LYS A 1 50  ? 22.202  15.651  -8.720  1.00 43.78  ? 50  LYS A CA  1 
ATOM   363  C  C   . LYS A 1 50  ? 21.171  14.537  -8.565  1.00 43.78  ? 50  LYS A C   1 
ATOM   364  O  O   . LYS A 1 50  ? 20.030  14.799  -8.219  1.00 43.78  ? 50  LYS A O   1 
ATOM   365  C  CB  . LYS A 1 50  ? 22.533  16.234  -7.354  1.00 32.72  ? 50  LYS A CB  1 
ATOM   366  C  CG  . LYS A 1 50  ? 23.369  15.348  -6.444  1.00 32.72  ? 50  LYS A CG  1 
ATOM   367  C  CD  . LYS A 1 50  ? 23.564  15.992  -5.068  1.00 32.72  ? 50  LYS A CD  1 
ATOM   368  C  CE  . LYS A 1 50  ? 24.045  17.440  -5.145  1.00 32.72  ? 50  LYS A CE  1 
ATOM   369  N  NZ  . LYS A 1 50  ? 25.339  17.595  -5.855  1.00 32.72  ? 50  LYS A NZ  1 
ATOM   370  N  N   . VAL A 1 51  ? 21.595  13.296  -8.776  1.00 36.75  ? 51  VAL A N   1 
ATOM   371  C  CA  . VAL A 1 51  ? 20.703  12.166  -8.639  1.00 36.75  ? 51  VAL A CA  1 
ATOM   372  C  C   . VAL A 1 51  ? 21.114  11.258  -7.484  1.00 36.75  ? 51  VAL A C   1 
ATOM   373  O  O   . VAL A 1 51  ? 22.302  11.039  -7.227  1.00 36.75  ? 51  VAL A O   1 
ATOM   374  C  CB  . VAL A 1 51  ? 20.652  11.334  -9.927  1.00 20.11  ? 51  VAL A CB  1 
ATOM   375  C  CG1 . VAL A 1 51  ? 19.620  10.234  -9.803  1.00 20.11  ? 51  VAL A CG1 1 
ATOM   376  C  CG2 . VAL A 1 51  ? 20.361  12.228  -11.115 1.00 20.11  ? 51  VAL A CG2 1 
ATOM   377  N  N   . TYR A 1 52  ? 20.122  10.751  -6.775  1.00 12.50  ? 52  TYR A N   1 
ATOM   378  C  CA  . TYR A 1 52  ? 20.328  9.865   -5.631  1.00 12.50  ? 52  TYR A CA  1 
ATOM   379  C  C   . TYR A 1 52  ? 19.517  8.602   -5.861  1.00 12.50  ? 52  TYR A C   1 
ATOM   380  O  O   . TYR A 1 52  ? 18.935  8.412   -6.909  1.00 12.50  ? 52  TYR A O   1 
ATOM   381  C  CB  . TYR A 1 52  ? 19.807  10.491  -4.347  1.00 33.60  ? 52  TYR A CB  1 
ATOM   382  C  CG  . TYR A 1 52  ? 20.440  11.772  -3.916  1.00 33.60  ? 52  TYR A CG  1 
ATOM   383  C  CD1 . TYR A 1 52  ? 21.082  11.863  -2.700  1.00 33.60  ? 52  TYR A CD1 1 
ATOM   384  C  CD2 . TYR A 1 52  ? 20.333  12.909  -4.683  1.00 33.60  ? 52  TYR A CD2 1 
ATOM   385  C  CE1 . TYR A 1 52  ? 21.605  13.046  -2.262  1.00 33.60  ? 52  TYR A CE1 1 
ATOM   386  C  CE2 . TYR A 1 52  ? 20.861  14.122  -4.251  1.00 33.60  ? 52  TYR A CE2 1 
ATOM   387  C  CZ  . TYR A 1 52  ? 21.490  14.170  -3.036  1.00 33.60  ? 52  TYR A CZ  1 
ATOM   388  O  OH  . TYR A 1 52  ? 22.010  15.350  -2.606  1.00 33.60  ? 52  TYR A OH  1 
ATOM   389  N  N   . GLU A 1 53  ? 19.437  7.825   -4.800  1.00 23.20  ? 53  GLU A N   1 
ATOM   390  C  CA  . GLU A 1 53  ? 18.667  6.604   -4.786  1.00 23.20  ? 53  GLU A CA  1 
ATOM   391  C  C   . GLU A 1 53  ? 18.185  6.311   -3.387  1.00 23.20  ? 53  GLU A C   1 
ATOM   392  O  O   . GLU A 1 53  ? 18.960  5.904   -2.501  1.00 23.20  ? 53  GLU A O   1 
ATOM   393  C  CB  . GLU A 1 53  ? 19.439  5.389   -5.298  1.00 79.33  ? 53  GLU A CB  1 
ATOM   394  C  CG  . GLU A 1 53  ? 18.539  4.139   -5.346  1.00 79.33  ? 53  GLU A CG  1 
ATOM   395  C  CD  . GLU A 1 53  ? 19.272  2.837   -5.410  1.00 79.33  ? 53  GLU A CD  1 
ATOM   396  O  OE1 . GLU A 1 53  ? 20.191  2.656   -4.597  1.00 79.33  ? 53  GLU A OE1 1 
ATOM   397  O  OE2 . GLU A 1 53  ? 18.930  2.007   -6.281  1.00 79.33  ? 53  GLU A OE2 1 
ATOM   398  N  N   . LEU A 1 54  ? 16.910  6.600   -3.183  1.00 10.10  ? 54  LEU A N   1 
ATOM   399  C  CA  . LEU A 1 54  ? 16.250  6.377   -1.917  1.00 10.10  ? 54  LEU A CA  1 
ATOM   400  C  C   . LEU A 1 54  ? 15.874  4.897   -1.851  1.00 10.10  ? 54  LEU A C   1 
ATOM   401  O  O   . LEU A 1 54  ? 15.052  4.408   -2.629  1.00 10.10  ? 54  LEU A O   1 
ATOM   402  C  CB  . LEU A 1 54  ? 15.019  7.258   -1.820  1.00 12.43  ? 54  LEU A CB  1 
ATOM   403  C  CG  . LEU A 1 54  ? 15.379  8.727   -1.924  1.00 12.43  ? 54  LEU A CG  1 
ATOM   404  C  CD1 . LEU A 1 54  ? 14.153  9.558   -2.076  1.00 12.43  ? 54  LEU A CD1 1 
ATOM   405  C  CD2 . LEU A 1 54  ? 16.143  9.118   -0.686  1.00 12.43  ? 54  LEU A CD2 1 
ATOM   406  N  N   . SER A 1 55  ? 16.481  4.180   -0.921  1.00 52.53  ? 55  SER A N   1 
ATOM   407  C  CA  . SER A 1 55  ? 16.244  2.756   -0.810  1.00 52.53  ? 55  SER A CA  1 
ATOM   408  C  C   . SER A 1 55  ? 15.529  2.322   0.434   1.00 52.53  ? 55  SER A C   1 
ATOM   409  O  O   . SER A 1 55  ? 15.490  3.049   1.415   1.00 52.53  ? 55  SER A O   1 
ATOM   410  C  CB  . SER A 1 55  ? 17.579  2.034   -0.908  1.00 13.77  ? 55  SER A CB  1 
ATOM   411  O  OG  . SER A 1 55  ? 18.619  2.833   -0.367  1.00 13.77  ? 55  SER A OG  1 
ATOM   412  N  N   . ASN A 1 56  ? 14.947  1.129   0.362   1.00 25.38  ? 56  ASN A N   1 
ATOM   413  C  CA  . ASN A 1 56  ? 14.230  0.516   1.479   1.00 25.38  ? 56  ASN A CA  1 
ATOM   414  C  C   . ASN A 1 56  ? 13.140  1.397   2.129   1.00 25.38  ? 56  ASN A C   1 
ATOM   415  O  O   . ASN A 1 56  ? 13.019  1.429   3.360   1.00 25.38  ? 56  ASN A O   1 
ATOM   416  C  CB  . ASN A 1 56  ? 15.232  0.037   2.557   1.00 98.65  ? 56  ASN A CB  1 
ATOM   417  C  CG  . ASN A 1 56  ? 16.239  -0.995  2.033   1.00 98.65  ? 56  ASN A CG  1 
ATOM   418  O  OD1 . ASN A 1 56  ? 15.866  -1.989  1.409   1.00 98.65  ? 56  ASN A OD1 1 
ATOM   419  N  ND2 . ASN A 1 56  ? 17.522  -0.768  2.315   1.00 98.65  ? 56  ASN A ND2 1 
ATOM   420  N  N   . VAL A 1 57  ? 12.348  2.096   1.313   1.00 25.04  ? 57  VAL A N   1 
ATOM   421  C  CA  . VAL A 1 57  ? 11.271  2.963   1.819   1.00 25.04  ? 57  VAL A CA  1 
ATOM   422  C  C   . VAL A 1 57  ? 10.056  2.147   2.249   1.00 25.04  ? 57  VAL A C   1 
ATOM   423  O  O   . VAL A 1 57  ? 9.481   1.425   1.449   1.00 25.04  ? 57  VAL A O   1 
ATOM   424  C  CB  . VAL A 1 57  ? 10.869  4.056   0.757   1.00 13.19  ? 57  VAL A CB  1 
ATOM   425  C  CG1 . VAL A 1 57  ? 10.595  3.440   -0.563  1.00 13.19  ? 57  VAL A CG1 1 
ATOM   426  C  CG2 . VAL A 1 57  ? 9.664   4.860   1.211   1.00 13.19  ? 57  VAL A CG2 1 
ATOM   427  N  N   . GLN A 1 58  ? 9.676   2.238   3.515   1.00 23.33  ? 58  GLN A N   1 
ATOM   428  C  CA  . GLN A 1 58  ? 8.534   1.460   3.983   1.00 23.33  ? 58  GLN A CA  1 
ATOM   429  C  C   . GLN A 1 58  ? 7.273   2.294   4.246   1.00 23.33  ? 58  GLN A C   1 
ATOM   430  O  O   . GLN A 1 58  ? 6.154   1.809   4.029   1.00 23.33  ? 58  GLN A O   1 
ATOM   431  C  CB  . GLN A 1 58  ? 8.907   0.613   5.215   1.00 42.06  ? 58  GLN A CB  1 
ATOM   432  C  CG  . GLN A 1 58  ? 10.297  -0.063  5.147   1.00 42.06  ? 58  GLN A CG  1 
ATOM   433  C  CD  . GLN A 1 58  ? 10.276  -1.591  5.026   1.00 42.06  ? 58  GLN A CD  1 
ATOM   434  O  OE1 . GLN A 1 58  ? 9.219   -2.227  5.035   1.00 42.06  ? 58  GLN A OE1 1 
ATOM   435  N  NE2 . GLN A 1 58  ? 11.464  -2.183  4.915   1.00 42.06  ? 58  GLN A NE2 1 
ATOM   436  N  N   . GLU A 1 59  ? 7.449   3.530   4.720   1.00 26.55  ? 59  GLU A N   1 
ATOM   437  C  CA  . GLU A 1 59  ? 6.317   4.426   4.982   1.00 26.55  ? 59  GLU A CA  1 
ATOM   438  C  C   . GLU A 1 59  ? 6.211   5.484   3.873   1.00 26.55  ? 59  GLU A C   1 
ATOM   439  O  O   . GLU A 1 59  ? 7.187   5.741   3.171   1.00 26.55  ? 59  GLU A O   1 
ATOM   440  C  CB  . GLU A 1 59  ? 6.453   5.100   6.350   1.00 78.60  ? 59  GLU A CB  1 
ATOM   441  C  CG  . GLU A 1 59  ? 6.374   4.140   7.544   1.00 78.60  ? 59  GLU A CG  1 
ATOM   442  C  CD  . GLU A 1 59  ? 5.852   4.806   8.816   1.00 78.60  ? 59  GLU A CD  1 
ATOM   443  O  OE1 . GLU A 1 59  ? 6.508   5.746   9.322   1.00 78.60  ? 59  GLU A OE1 1 
ATOM   444  O  OE2 . GLU A 1 59  ? 4.779   4.381   9.306   1.00 78.60  ? 59  GLU A OE2 1 
ATOM   445  N  N   . ASP A 1 60  ? 5.029   6.059   3.672   1.00 13.81  ? 60  ASP A N   1 
ATOM   446  C  CA  . ASP A 1 60  ? 4.863   7.073   2.634   1.00 13.81  ? 60  ASP A CA  1 
ATOM   447  C  C   . ASP A 1 60  ? 5.787   8.253   2.947   1.00 13.81  ? 60  ASP A C   1 
ATOM   448  O  O   . ASP A 1 60  ? 5.417   9.178   3.694   1.00 13.81  ? 60  ASP A O   1 
ATOM   449  C  CB  . ASP A 1 60  ? 3.411   7.557   2.567   1.00 75.07  ? 60  ASP A CB  1 
ATOM   450  C  CG  . ASP A 1 60  ? 2.475   6.534   1.952   1.00 75.07  ? 60  ASP A CG  1 
ATOM   451  O  OD1 . ASP A 1 60  ? 2.901   5.392   1.682   1.00 75.07  ? 60  ASP A OD1 1 
ATOM   452  O  OD2 . ASP A 1 60  ? 1.299   6.873   1.732   1.00 75.07  ? 60  ASP A OD2 1 
ATOM   453  N  N   . SER A 1 61  ? 7.005   8.214   2.410   1.00 23.16  ? 61  SER A N   1 
ATOM   454  C  CA  . SER A 1 61  ? 7.964   9.284   2.657   1.00 23.16  ? 61  SER A CA  1 
ATOM   455  C  C   . SER A 1 61  ? 7.779   10.445  1.679   1.00 23.16  ? 61  SER A C   1 
ATOM   456  O  O   . SER A 1 61  ? 7.028   10.325  0.711   1.00 23.16  ? 61  SER A O   1 
ATOM   457  C  CB  . SER A 1 61  ? 9.395   8.744   2.630   1.00 59.98  ? 61  SER A CB  1 
ATOM   458  O  OG  . SER A 1 61  ? 10.279  9.642   3.277   1.00 59.98  ? 61  SER A OG  1 
ATOM   459  N  N   . GLN A 1 62  ? 8.456   11.560  1.952   1.00 52.17  ? 62  GLN A N   1 
ATOM   460  C  CA  . GLN A 1 62  ? 8.371   12.759  1.118   1.00 52.17  ? 62  GLN A CA  1 
ATOM   461  C  C   . GLN A 1 62  ? 9.681   13.565  1.124   1.00 52.17  ? 62  GLN A C   1 
ATOM   462  O  O   . GLN A 1 62  ? 9.810   14.568  1.825   1.00 52.17  ? 62  GLN A O   1 
ATOM   463  C  CB  . GLN A 1 62  ? 7.182   13.621  1.567   1.00 93.52  ? 62  GLN A CB  1 
ATOM   464  C  CG  . GLN A 1 62  ? 7.104   13.824  3.076   1.00 93.52  ? 62  GLN A CG  1 
ATOM   465  C  CD  . GLN A 1 62  ? 5.680   13.867  3.596   1.00 93.52  ? 62  GLN A CD  1 
ATOM   466  O  OE1 . GLN A 1 62  ? 5.001   14.898  3.504   1.00 93.52  ? 62  GLN A OE1 1 
ATOM   467  N  NE2 . GLN A 1 62  ? 5.215   12.746  4.140   1.00 93.52  ? 62  GLN A NE2 1 
ATOM   468  N  N   . PRO A 1 63  ? 10.668  13.127  0.319   1.00 24.71  ? 63  PRO A N   1 
ATOM   469  C  CA  . PRO A 1 63  ? 11.992  13.740  0.168   1.00 24.71  ? 63  PRO A CA  1 
ATOM   470  C  C   . PRO A 1 63  ? 11.914  15.223  -0.149  1.00 24.71  ? 63  PRO A C   1 
ATOM   471  O  O   . PRO A 1 63  ? 10.976  15.694  -0.784  1.00 24.71  ? 63  PRO A O   1 
ATOM   472  C  CB  . PRO A 1 63  ? 12.592  12.963  -1.004  1.00 55.42  ? 63  PRO A CB  1 
ATOM   473  C  CG  . PRO A 1 63  ? 11.975  11.627  -0.862  1.00 55.42  ? 63  PRO A CG  1 
ATOM   474  C  CD  . PRO A 1 63  ? 10.544  11.955  -0.568  1.00 55.42  ? 63  PRO A CD  1 
ATOM   475  N  N   . MET A 1 64  ? 12.956  15.942  0.226   1.00 21.56  ? 64  MET A N   1 
ATOM   476  C  CA  . MET A 1 64  ? 12.976  17.368  0.002   1.00 21.56  ? 64  MET A CA  1 
ATOM   477  C  C   . MET A 1 64  ? 14.313  17.871  -0.548  1.00 21.56  ? 64  MET A C   1 
ATOM   478  O  O   . MET A 1 64  ? 15.308  17.919  0.170   1.00 21.56  ? 64  MET A O   1 
ATOM   479  C  CB  . MET A 1 64  ? 12.646  18.041  1.326   1.00 48.43  ? 64  MET A CB  1 
ATOM   480  C  CG  . MET A 1 64  ? 11.876  19.314  1.216   1.00 48.43  ? 64  MET A CG  1 
ATOM   481  S  SD  . MET A 1 64  ? 11.168  19.646  2.790   1.00 48.43  ? 64  MET A SD  1 
ATOM   482  C  CE  . MET A 1 64  ? 12.605  19.795  3.750   1.00 48.43  ? 64  MET A CE  1 
ATOM   483  N  N   . CYS A 1 65  ? 14.330  18.220  -1.832  1.00 8.14   ? 65  CYS A N   1 
ATOM   484  C  CA  . CYS A 1 65  ? 15.532  18.729  -2.468  1.00 8.14   ? 65  CYS A CA  1 
ATOM   485  C  C   . CYS A 1 65  ? 15.683  20.195  -2.138  1.00 8.14   ? 65  CYS A C   1 
ATOM   486  O  O   . CYS A 1 65  ? 14.741  20.986  -2.311  1.00 8.14   ? 65  CYS A O   1 
ATOM   487  C  CB  . CYS A 1 65  ? 15.455  18.571  -3.985  1.00 65.68  ? 65  CYS A CB  1 
ATOM   488  S  SG  . CYS A 1 65  ? 15.694  16.889  -4.630  1.00 65.68  ? 65  CYS A SG  1 
ATOM   489  N  N   . TYR A 1 66  ? 16.867  20.563  -1.649  1.00 38.32  ? 66  TYR A N   1 
ATOM   490  C  CA  . TYR A 1 66  ? 17.160  21.959  -1.292  1.00 38.32  ? 66  TYR A CA  1 
ATOM   491  C  C   . TYR A 1 66  ? 18.277  22.516  -2.177  1.00 38.32  ? 66  TYR A C   1 
ATOM   492  O  O   . TYR A 1 66  ? 18.833  21.802  -2.998  1.00 38.32  ? 66  TYR A O   1 
ATOM   493  C  CB  . TYR A 1 66  ? 17.573  22.078  0.182   1.00 48.61  ? 66  TYR A CB  1 
ATOM   494  C  CG  . TYR A 1 66  ? 18.876  21.407  0.574   1.00 48.61  ? 66  TYR A CG  1 
ATOM   495  C  CD1 . TYR A 1 66  ? 20.079  21.787  0.006   1.00 48.61  ? 66  TYR A CD1 1 
ATOM   496  C  CD2 . TYR A 1 66  ? 18.892  20.371  1.490   1.00 48.61  ? 66  TYR A CD2 1 
ATOM   497  C  CE1 . TYR A 1 66  ? 21.263  21.148  0.322   1.00 48.61  ? 66  TYR A CE1 1 
ATOM   498  C  CE2 . TYR A 1 66  ? 20.073  19.723  1.819   1.00 48.61  ? 66  TYR A CE2 1 
ATOM   499  C  CZ  . TYR A 1 66  ? 21.256  20.114  1.225   1.00 48.61  ? 66  TYR A CZ  1 
ATOM   500  O  OH  . TYR A 1 66  ? 22.428  19.438  1.491   1.00 48.61  ? 66  TYR A OH  1 
ATOM   501  N  N   . SER A 1 67  ? 18.652  23.764  -1.929  1.00 48.21  ? 67  SER A N   1 
ATOM   502  C  CA  . SER A 1 67  ? 19.705  24.403  -2.662  1.00 48.21  ? 67  SER A CA  1 
ATOM   503  C  C   . SER A 1 67  ? 20.018  25.774  -2.102  1.00 48.21  ? 67  SER A C   1 
ATOM   504  O  O   . SER A 1 67  ? 19.130  26.616  -1.950  1.00 48.21  ? 67  SER A O   1 
ATOM   505  C  CB  . SER A 1 67  ? 19.359  24.522  -4.150  1.00 48.65  ? 67  SER A CB  1 
ATOM   506  O  OG  . SER A 1 67  ? 18.336  25.479  -4.414  1.00 48.65  ? 67  SER A OG  1 
ATOM   507  N  N   . ASN A 1 68  ? 21.266  25.976  -1.727  1.00 19.11  ? 68  ASN A N   1 
ATOM   508  C  CA  . ASN A 1 68  ? 21.669  27.265  -1.227  1.00 19.11  ? 68  ASN A CA  1 
ATOM   509  C  C   . ASN A 1 68  ? 22.226  27.986  -2.431  1.00 19.11  ? 68  ASN A C   1 
ATOM   510  O  O   . ASN A 1 68  ? 23.339  27.721  -2.884  1.00 19.11  ? 68  ASN A O   1 
ATOM   511  C  CB  . ASN A 1 68  ? 22.731  27.137  -0.160  1.00 31.63  ? 68  ASN A CB  1 
ATOM   512  C  CG  . ASN A 1 68  ? 22.321  26.218  0.954   1.00 31.63  ? 68  ASN A CG  1 
ATOM   513  O  OD1 . ASN A 1 68  ? 21.143  26.093  1.275   1.00 31.63  ? 68  ASN A OD1 1 
ATOM   514  N  ND2 . ASN A 1 68  ? 23.297  25.537  1.535   1.00 31.63  ? 68  ASN A ND2 1 
ATOM   515  N  N   . CYS A 1 69  ? 21.373  28.796  -3.034  1.00 40.71  ? 69  CYS A N   1 
ATOM   516  C  CA  . CYS A 1 69  ? 21.768  29.603  -4.170  1.00 40.71  ? 69  CYS A CA  1 
ATOM   517  C  C   . CYS A 1 69  ? 22.128  30.983  -3.621  1.00 40.71  ? 69  CYS A C   1 
ATOM   518  O  O   . CYS A 1 69  ? 21.719  31.342  -2.514  1.00 40.71  ? 69  CYS A O   1 
ATOM   519  C  CB  . CYS A 1 69  ? 20.617  29.714  -5.172  1.00 98.65  ? 69  CYS A CB  1 
ATOM   520  S  SG  . CYS A 1 69  ? 20.464  28.303  -6.314  1.00 98.65  ? 69  CYS A SG  1 
ATOM   521  N  N   . PRO A 1 70  ? 22.936  31.751  -4.361  1.00 76.48  ? 70  PRO A N   1 
ATOM   522  C  CA  . PRO A 1 70  ? 23.316  33.083  -3.903  1.00 76.48  ? 70  PRO A CA  1 
ATOM   523  C  C   . PRO A 1 70  ? 22.045  33.859  -3.554  1.00 76.48  ? 70  PRO A C   1 
ATOM   524  O  O   . PRO A 1 70  ? 21.923  34.430  -2.465  1.00 76.48  ? 70  PRO A O   1 
ATOM   525  C  CB  . PRO A 1 70  ? 24.012  33.664  -5.132  1.00 33.71  ? 70  PRO A CB  1 
ATOM   526  C  CG  . PRO A 1 70  ? 23.379  32.888  -6.290  1.00 33.71  ? 70  PRO A CG  1 
ATOM   527  C  CD  . PRO A 1 70  ? 23.411  31.520  -5.731  1.00 33.71  ? 70  PRO A CD  1 
ATOM   528  N  N   . ASP A 1 71  ? 21.075  33.792  -4.462  1.00 64.50  ? 71  ASP A N   1 
ATOM   529  C  CA  . ASP A 1 71  ? 19.793  34.456  -4.292  1.00 64.50  ? 71  ASP A CA  1 
ATOM   530  C  C   . ASP A 1 71  ? 19.185  33.990  -2.981  1.00 64.50  ? 71  ASP A C   1 
ATOM   531  O  O   . ASP A 1 71  ? 18.648  34.784  -2.215  1.00 64.50  ? 71  ASP A O   1 
ATOM   532  C  CB  . ASP A 1 71  ? 18.872  34.096  -5.455  1.00 98.57  ? 71  ASP A CB  1 
ATOM   533  C  CG  . ASP A 1 71  ? 17.549  34.824  -5.397  1.00 98.57  ? 71  ASP A CG  1 
ATOM   534  O  OD1 . ASP A 1 71  ? 16.508  34.135  -5.387  1.00 98.57  ? 71  ASP A OD1 1 
ATOM   535  O  OD2 . ASP A 1 71  ? 17.551  36.077  -5.363  1.00 98.57  ? 71  ASP A OD2 1 
ATOM   536  N  N   . GLY A 1 72  ? 19.300  32.691  -2.726  1.00 69.94  ? 72  GLY A N   1 
ATOM   537  C  CA  . GLY A 1 72  ? 18.781  32.127  -1.497  1.00 69.94  ? 72  GLY A CA  1 
ATOM   538  C  C   . GLY A 1 72  ? 18.612  30.624  -1.549  1.00 69.94  ? 72  GLY A C   1 
ATOM   539  O  O   . GLY A 1 72  ? 18.886  29.992  -2.571  1.00 69.94  ? 72  GLY A O   1 
ATOM   540  N  N   . GLN A 1 73  ? 18.196  30.048  -0.424  1.00 29.52  ? 73  GLN A N   1 
ATOM   541  C  CA  . GLN A 1 73  ? 17.954  28.617  -0.334  1.00 29.52  ? 73  GLN A CA  1 
ATOM   542  C  C   . GLN A 1 73  ? 16.492  28.379  -0.664  1.00 29.52  ? 73  GLN A C   1 
ATOM   543  O  O   . GLN A 1 73  ? 15.610  29.019  -0.090  1.00 29.52  ? 73  GLN A O   1 
ATOM   544  C  CB  . GLN A 1 73  ? 18.257  28.109  1.077   1.00 36.66  ? 73  GLN A CB  1 
ATOM   545  C  CG  . GLN A 1 73  ? 18.154  26.593  1.256   1.00 36.66  ? 73  GLN A CG  1 
ATOM   546  C  CD  . GLN A 1 73  ? 18.132  26.172  2.722   1.00 36.66  ? 73  GLN A CD  1 
ATOM   547  O  OE1 . GLN A 1 73  ? 17.085  26.204  3.365   1.00 36.66  ? 73  GLN A OE1 1 
ATOM   548  N  NE2 . GLN A 1 73  ? 19.284  25.769  3.249   1.00 36.66  ? 73  GLN A NE2 1 
ATOM   549  N  N   . SER A 1 74  ? 16.249  27.501  -1.631  1.00 12.83  ? 74  SER A N   1 
ATOM   550  C  CA  . SER A 1 74  ? 14.892  27.155  -2.037  1.00 12.83  ? 74  SER A CA  1 
ATOM   551  C  C   . SER A 1 74  ? 14.634  25.646  -1.855  1.00 12.83  ? 74  SER A C   1 
ATOM   552  O  O   . SER A 1 74  ? 15.549  24.863  -1.565  1.00 12.83  ? 74  SER A O   1 
ATOM   553  C  CB  . SER A 1 74  ? 14.660  27.550  -3.488  1.00 39.70  ? 74  SER A CB  1 
ATOM   554  O  OG  . SER A 1 74  ? 15.457  28.657  -3.835  1.00 39.70  ? 74  SER A OG  1 
ATOM   555  N  N   . THR A 1 75  ? 13.389  25.227  -2.064  1.00 42.50  ? 75  THR A N   1 
ATOM   556  C  CA  . THR A 1 75  ? 13.053  23.822  -1.886  1.00 42.50  ? 75  THR A CA  1 
ATOM   557  C  C   . THR A 1 75  ? 12.052  23.244  -2.880  1.00 42.50  ? 75  THR A C   1 
ATOM   558  O  O   . THR A 1 75  ? 11.074  23.896  -3.264  1.00 42.50  ? 75  THR A O   1 
ATOM   559  C  CB  . THR A 1 75  ? 12.587  23.573  -0.439  1.00 27.18  ? 75  THR A CB  1 
ATOM   560  O  OG1 . THR A 1 75  ? 13.697  23.746  0.441   1.00 27.18  ? 75  THR A OG1 1 
ATOM   561  C  CG2 . THR A 1 75  ? 12.063  22.192  -0.258  1.00 27.18  ? 75  THR A CG2 1 
ATOM   562  N  N   . ALA A 1 76  ? 12.351  22.010  -3.296  1.00 39.52  ? 76  ALA A N   1 
ATOM   563  C  CA  . ALA A 1 76  ? 11.546  21.220  -4.230  1.00 39.52  ? 76  ALA A CA  1 
ATOM   564  C  C   . ALA A 1 76  ? 11.191  19.917  -3.534  1.00 39.52  ? 76  ALA A C   1 
ATOM   565  O  O   . ALA A 1 76  ? 12.072  19.155  -3.148  1.00 39.52  ? 76  ALA A O   1 
ATOM   566  C  CB  . ALA A 1 76  ? 12.330  20.942  -5.481  1.00 98.65  ? 76  ALA A CB  1 
ATOM   567  N  N   . LYS A 1 77  ? 9.895   19.672  -3.390  1.00 40.09  ? 77  LYS A N   1 
ATOM   568  C  CA  . LYS A 1 77  ? 9.399   18.491  -2.698  1.00 40.09  ? 77  LYS A CA  1 
ATOM   569  C  C   . LYS A 1 77  ? 8.747   17.438  -3.585  1.00 40.09  ? 77  LYS A C   1 
ATOM   570  O  O   . LYS A 1 77  ? 7.937   17.734  -4.465  1.00 40.09  ? 77  LYS A O   1 
ATOM   571  C  CB  . LYS A 1 77  ? 8.424   18.924  -1.591  1.00 71.24  ? 77  LYS A CB  1 
ATOM   572  C  CG  . LYS A 1 77  ? 7.987   17.826  -0.615  1.00 71.24  ? 77  LYS A CG  1 
ATOM   573  C  CD  . LYS A 1 77  ? 7.027   18.373  0.451   1.00 71.24  ? 77  LYS A CD  1 
ATOM   574  C  CE  . LYS A 1 77  ? 6.525   17.260  1.349   1.00 71.24  ? 77  LYS A CE  1 
ATOM   575  N  NZ  . LYS A 1 77  ? 5.348   17.661  2.162   1.00 71.24  ? 77  LYS A NZ  1 
ATOM   576  N  N   . THR A 1 78  ? 9.145   16.200  -3.345  1.00 64.02  ? 78  THR A N   1 
ATOM   577  C  CA  . THR A 1 78  ? 8.620   15.062  -4.064  1.00 64.02  ? 78  THR A CA  1 
ATOM   578  C  C   . THR A 1 78  ? 7.789   14.278  -3.052  1.00 64.02  ? 78  THR A C   1 
ATOM   579  O  O   . THR A 1 78  ? 7.866   14.531  -1.850  1.00 64.02  ? 78  THR A O   1 
ATOM   580  C  CB  . THR A 1 78  ? 9.768   14.204  -4.669  1.00 22.94  ? 78  THR A CB  1 
ATOM   581  O  OG1 . THR A 1 78  ? 9.236   13.023  -5.274  1.00 22.94  ? 78  THR A OG1 1 
ATOM   582  C  CG2 . THR A 1 78  ? 10.749  13.796  -3.622  1.00 22.94  ? 78  THR A CG2 1 
ATOM   583  N  N   . PHE A 1 79  ? 6.969   13.358  -3.548  1.00 16.49  ? 79  PHE A N   1 
ATOM   584  C  CA  . PHE A 1 79  ? 6.095   12.542  -2.708  1.00 16.49  ? 79  PHE A CA  1 
ATOM   585  C  C   . PHE A 1 79  ? 6.190   11.036  -2.969  1.00 16.49  ? 79  PHE A C   1 
ATOM   586  O  O   . PHE A 1 79  ? 5.792   10.565  -4.026  1.00 16.49  ? 79  PHE A O   1 
ATOM   587  C  CB  . PHE A 1 79  ? 4.660   12.994  -2.917  1.00 16.51  ? 79  PHE A CB  1 
ATOM   588  C  CG  . PHE A 1 79  ? 4.411   14.386  -2.476  1.00 16.51  ? 79  PHE A CG  1 
ATOM   589  C  CD1 . PHE A 1 79  ? 4.387   14.703  -1.126  1.00 16.51  ? 79  PHE A CD1 1 
ATOM   590  C  CD2 . PHE A 1 79  ? 4.165   15.376  -3.398  1.00 16.51  ? 79  PHE A CD2 1 
ATOM   591  C  CE1 . PHE A 1 79  ? 4.120   15.998  -0.702  1.00 16.51  ? 79  PHE A CE1 1 
ATOM   592  C  CE2 . PHE A 1 79  ? 3.898   16.674  -2.981  1.00 16.51  ? 79  PHE A CE2 1 
ATOM   593  C  CZ  . PHE A 1 79  ? 3.870   16.986  -1.628  1.00 16.51  ? 79  PHE A CZ  1 
ATOM   594  N  N   . LEU A 1 80  ? 6.698   10.280  -2.001  1.00 42.34  ? 80  LEU A N   1 
ATOM   595  C  CA  . LEU A 1 80  ? 6.814   8.843   -2.179  1.00 42.34  ? 80  LEU A CA  1 
ATOM   596  C  C   . LEU A 1 80  ? 5.647   8.148   -1.509  1.00 42.34  ? 80  LEU A C   1 
ATOM   597  O  O   . LEU A 1 80  ? 5.368   8.389   -0.335  1.00 42.34  ? 80  LEU A O   1 
ATOM   598  C  CB  . LEU A 1 80  ? 8.141   8.328   -1.627  1.00 6.74   ? 80  LEU A CB  1 
ATOM   599  C  CG  . LEU A 1 80  ? 9.435   8.960   -2.145  1.00 6.74   ? 80  LEU A CG  1 
ATOM   600  C  CD1 . LEU A 1 80  ? 10.485  7.890   -2.159  1.00 6.74   ? 80  LEU A CD1 1 
ATOM   601  C  CD2 . LEU A 1 80  ? 9.280   9.502   -3.538  1.00 6.74   ? 80  LEU A CD2 1 
ATOM   602  N  N   . THR A 1 81  ? 4.938   7.335   -2.295  1.00 44.70  ? 81  THR A N   1 
ATOM   603  C  CA  . THR A 1 81  ? 3.770   6.586   -1.831  1.00 44.70  ? 81  THR A CA  1 
ATOM   604  C  C   . THR A 1 81  ? 4.071   5.106   -1.823  1.00 44.70  ? 81  THR A C   1 
ATOM   605  O  O   . THR A 1 81  ? 4.487   4.553   -2.836  1.00 44.70  ? 81  THR A O   1 
ATOM   606  C  CB  . THR A 1 81  ? 2.559   6.761   -2.762  1.00 59.73  ? 81  THR A CB  1 
ATOM   607  O  OG1 . THR A 1 81  ? 2.239   8.149   -2.911  1.00 59.73  ? 81  THR A OG1 1 
ATOM   608  C  CG2 . THR A 1 81  ? 1.362   6.030   -2.192  1.00 59.73  ? 81  THR A CG2 1 
ATOM   609  N  N   . VAL A 1 82  ? 3.834   4.462   -0.687  1.00 33.78  ? 82  VAL A N   1 
ATOM   610  C  CA  . VAL A 1 82  ? 4.077   3.035   -0.581  1.00 33.78  ? 82  VAL A CA  1 
ATOM   611  C  C   . VAL A 1 82  ? 2.738   2.300   -0.588  1.00 33.78  ? 82  VAL A C   1 
ATOM   612  O  O   . VAL A 1 82  ? 1.782   2.746   0.070   1.00 33.78  ? 82  VAL A O   1 
ATOM   613  C  CB  . VAL A 1 82  ? 4.877   2.663   0.683   1.00 14.82  ? 82  VAL A CB  1 
ATOM   614  C  CG1 . VAL A 1 82  ? 5.340   1.256   0.583   1.00 14.82  ? 82  VAL A CG1 1 
ATOM   615  C  CG2 . VAL A 1 82  ? 6.073   3.534   0.832   1.00 14.82  ? 82  VAL A CG2 1 
ATOM   616  N  N   . TYR A 1 83  ? 2.669   1.209   -1.368  1.00 45.16  ? 83  TYR A N   1 
ATOM   617  C  CA  . TYR A 1 83  ? 1.462   0.380   -1.499  1.00 45.16  ? 83  TYR A CA  1 
ATOM   618  C  C   . TYR A 1 83  ? 1.808   -1.078  -1.232  1.00 45.16  ? 83  TYR A C   1 
ATOM   619  O  O   . TYR A 1 83  ? 2.857   -1.545  -1.670  1.00 45.16  ? 83  TYR A O   1 
ATOM   620  C  CB  . TYR A 1 83  ? 0.878   0.509   -2.904  1.00 18.55  ? 83  TYR A CB  1 
ATOM   621  C  CG  . TYR A 1 83  ? 1.537   -0.385  -3.913  1.00 18.55  ? 83  TYR A CG  1 
ATOM   622  C  CD1 . TYR A 1 83  ? 1.037   -1.652  -4.164  1.00 18.55  ? 83  TYR A CD1 1 
ATOM   623  C  CD2 . TYR A 1 83  ? 2.663   0.025   -4.615  1.00 18.55  ? 83  TYR A CD2 1 
ATOM   624  C  CE1 . TYR A 1 83  ? 1.648   -2.494  -5.069  1.00 18.55  ? 83  TYR A CE1 1 
ATOM   625  C  CE2 . TYR A 1 83  ? 3.279   -0.816  -5.530  1.00 18.55  ? 83  TYR A CE2 1 
ATOM   626  C  CZ  . TYR A 1 83  ? 2.757   -2.067  -5.751  1.00 18.55  ? 83  TYR A CZ  1 
ATOM   627  O  OH  . TYR A 1 83  ? 3.344   -2.914  -6.646  1.00 18.55  ? 83  TYR A OH  1 
ATOM   628  N  N   . TRP A 1 84  ? 0.911   -1.808  -0.577  1.00 37.01  ? 84  TRP A N   1 
ATOM   629  C  CA  . TRP A 1 84  ? 1.162   -3.216  -0.255  1.00 37.01  ? 84  TRP A CA  1 
ATOM   630  C  C   . TRP A 1 84  ? -0.075  -4.083  0.053   1.00 37.01  ? 84  TRP A C   1 
ATOM   631  O  O   . TRP A 1 84  ? -1.074  -3.562  0.577   1.00 37.01  ? 84  TRP A O   1 
ATOM   632  C  CB  . TRP A 1 84  ? 2.184   -3.330  0.895   1.00 56.28  ? 84  TRP A CB  1 
ATOM   633  C  CG  . TRP A 1 84  ? 1.886   -2.451  2.122   1.00 56.28  ? 84  TRP A CG  1 
ATOM   634  C  CD1 . TRP A 1 84  ? 1.971   -1.091  2.196   1.00 56.28  ? 84  TRP A CD1 1 
ATOM   635  C  CD2 . TRP A 1 84  ? 1.434   -2.894  3.406   1.00 56.28  ? 84  TRP A CD2 1 
ATOM   636  N  NE1 . TRP A 1 84  ? 1.590   -0.658  3.438   1.00 56.28  ? 84  TRP A NE1 1 
ATOM   637  C  CE2 . TRP A 1 84  ? 1.250   -1.740  4.202   1.00 56.28  ? 84  TRP A CE2 1 
ATOM   638  C  CE3 . TRP A 1 84  ? 1.151   -4.145  3.969   1.00 56.28  ? 84  TRP A CE3 1 
ATOM   639  C  CZ2 . TRP A 1 84  ? 0.805   -1.809  5.517   1.00 56.28  ? 84  TRP A CZ2 1 
ATOM   640  C  CZ3 . TRP A 1 84  ? 0.712   -4.210  5.273   1.00 56.28  ? 84  TRP A CZ3 1 
ATOM   641  C  CH2 . TRP A 1 84  ? 0.537   -3.051  6.030   1.00 56.28  ? 84  TRP A CH2 1 
ATOM   642  N  N   . THR A 1 85  ? -0.026  -5.347  -0.305  1.00 20.62  ? 85  THR A N   1 
ATOM   643  C  CA  . THR A 1 85  ? -1.118  -6.271  -0.039  1.00 20.62  ? 85  THR A CA  1 
ATOM   644  C  C   . THR A 1 85  ? -1.103  -6.746  1.422   1.00 20.62  ? 85  THR A C   1 
ATOM   645  O  O   . THR A 1 85  ? -0.064  -7.144  1.966   1.00 20.62  ? 85  THR A O   1 
ATOM   646  C  CB  . THR A 1 85  ? -1.056  -7.511  -0.954  1.00 65.31  ? 85  THR A CB  1 
ATOM   647  O  OG1 . THR A 1 85  ? 0.096   -8.286  -0.597  1.00 65.31  ? 85  THR A OG1 1 
ATOM   648  C  CG2 . THR A 1 85  ? -0.984  -7.080  -2.388  1.00 65.31  ? 85  THR A CG2 1 
ATOM   649  N  N   . PRO A 1 86  ? -2.282  -6.647  2.123   1.00 13.17  ? 86  PRO A N   1 
ATOM   650  C  CA  . PRO A 1 86  ? -2.403  -7.038  3.553   1.00 13.17  ? 86  PRO A CA  1 
ATOM   651  C  C   . PRO A 1 86  ? -1.796  -8.382  4.007   1.00 13.17  ? 86  PRO A C   1 
ATOM   652  O  O   . PRO A 1 86  ? -1.372  -9.235  3.173   1.00 13.17  ? 86  PRO A O   1 
ATOM   653  C  CB  . PRO A 1 86  ? -3.915  -6.898  3.853   1.00 15.46  ? 86  PRO A CB  1 
ATOM   654  C  CG  . PRO A 1 86  ? -4.563  -6.948  2.532   1.00 15.46  ? 86  PRO A CG  1 
ATOM   655  C  CD  . PRO A 1 86  ? -3.618  -6.212  1.613   1.00 15.46  ? 86  PRO A CD  1 
ATOM   656  N  N   . GLU A 1 87  ? -1.671  -8.528  5.301   1.00 39.42  ? 87  GLU A N   1 
ATOM   657  C  CA  . GLU A 1 87  ? -1.149  -9.716  5.989   1.00 39.42  ? 87  GLU A CA  1 
ATOM   658  C  C   . GLU A 1 87  ? -2.176  -10.835 5.850   1.00 39.42  ? 87  GLU A C   1 
ATOM   659  O  O   . GLU A 1 87  ? -1.897  -11.871 5.269   1.00 39.42  ? 87  GLU A O   1 
ATOM   660  C  CB  . GLU A 1 87  ? -0.873  -9.447  7.458   1.00 98.65  ? 87  GLU A CB  1 
ATOM   661  C  CG  . GLU A 1 87  ? 0.254   -8.443  7.735   1.00 98.65  ? 87  GLU A CG  1 
ATOM   662  C  CD  . GLU A 1 87  ? 0.422   -8.131  9.219   1.00 98.65  ? 87  GLU A CD  1 
ATOM   663  O  OE1 . GLU A 1 87  ? 0.504   -9.076  10.044  1.00 98.65  ? 87  GLU A OE1 1 
ATOM   664  O  OE2 . GLU A 1 87  ? 0.477   -6.927  9.552   1.00 98.65  ? 87  GLU A OE2 1 
ATOM   665  N  N   . ARG A 1 88  ? -3.354  -10.628 6.416   1.00 63.27  ? 88  ARG A N   1 
ATOM   666  C  CA  . ARG A 1 88  ? -4.391  -11.623 6.293   1.00 63.27  ? 88  ARG A CA  1 
ATOM   667  C  C   . ARG A 1 88  ? -5.747  -10.979 6.095   1.00 63.27  ? 88  ARG A C   1 
ATOM   668  O  O   . ARG A 1 88  ? -6.074  -9.961  6.728   1.00 63.27  ? 88  ARG A O   1 
ATOM   669  C  CB  . ARG A 1 88  ? -4.394  -12.605 7.471   1.00 98.65  ? 88  ARG A CB  1 
ATOM   670  C  CG  . ARG A 1 88  ? -4.696  -12.008 8.821   1.00 98.65  ? 88  ARG A CG  1 
ATOM   671  C  CD  . ARG A 1 88  ? -4.916  -13.104 9.854   1.00 98.65  ? 88  ARG A CD  1 
ATOM   672  N  NE  . ARG A 1 88  ? -6.264  -13.675 9.806   1.00 98.65  ? 88  ARG A NE  1 
ATOM   673  C  CZ  . ARG A 1 88  ? -7.347  -13.089 10.319  1.00 98.65  ? 88  ARG A CZ  1 
ATOM   674  N  NH1 . ARG A 1 88  ? -7.256  -11.904 10.920  1.00 98.65  ? 88  ARG A NH1 1 
ATOM   675  N  NH2 . ARG A 1 88  ? -8.523  -13.702 10.262  1.00 98.65  ? 88  ARG A NH2 1 
ATOM   676  N  N   . VAL A 1 89  ? -6.512  -11.574 5.184   1.00 57.22  ? 89  VAL A N   1 
ATOM   677  C  CA  . VAL A 1 89  ? -7.841  -11.116 4.816   1.00 57.22  ? 89  VAL A CA  1 
ATOM   678  C  C   . VAL A 1 89  ? -8.938  -12.051 5.354   1.00 57.22  ? 89  VAL A C   1 
ATOM   679  O  O   . VAL A 1 89  ? -10.121 -11.734 5.279   1.00 57.22  ? 89  VAL A O   1 
ATOM   680  C  CB  . VAL A 1 89  ? -7.934  -11.051 3.281   1.00 28.07  ? 89  VAL A CB  1 
ATOM   681  C  CG1 . VAL A 1 89  ? -7.575  -12.389 2.703   1.00 28.07  ? 89  VAL A CG1 1 
ATOM   682  C  CG2 . VAL A 1 89  ? -9.310  -10.603 2.826   1.00 28.07  ? 89  VAL A CG2 1 
ATOM   683  N  N   . GLU A 1 90  ? -8.528  -13.186 5.915   1.00 39.77  ? 90  GLU A N   1 
ATOM   684  C  CA  . GLU A 1 90  ? -9.441  -14.176 6.492   1.00 39.77  ? 90  GLU A CA  1 
ATOM   685  C  C   . GLU A 1 90  ? -10.606 -13.629 7.345   1.00 39.77  ? 90  GLU A C   1 
ATOM   686  O  O   . GLU A 1 90  ? -10.538 -12.550 7.951   1.00 39.77  ? 90  GLU A O   1 
ATOM   687  C  CB  . GLU A 1 90  ? -8.656  -15.218 7.304   1.00 98.39  ? 90  GLU A CB  1 
ATOM   688  C  CG  . GLU A 1 90  ? -9.484  -16.441 7.727   1.00 98.39  ? 90  GLU A CG  1 
ATOM   689  C  CD  . GLU A 1 90  ? -8.864  -17.239 8.878   1.00 98.39  ? 90  GLU A CD  1 
ATOM   690  O  OE1 . GLU A 1 90  ? -8.164  -16.631 9.719   1.00 98.39  ? 90  GLU A OE1 1 
ATOM   691  O  OE2 . GLU A 1 90  ? -9.095  -18.474 8.951   1.00 98.39  ? 90  GLU A OE2 1 
ATOM   692  N  N   . LEU A 1 91  ? -11.699 -14.380 7.339   1.00 57.04  ? 91  LEU A N   1 
ATOM   693  C  CA  . LEU A 1 91  ? -12.870 -14.001 8.105   1.00 57.04  ? 91  LEU A CA  1 
ATOM   694  C  C   . LEU A 1 91  ? -13.046 -14.930 9.301   1.00 57.04  ? 91  LEU A C   1 
ATOM   695  O  O   . LEU A 1 91  ? -12.559 -16.058 9.314   1.00 57.04  ? 91  LEU A O   1 
ATOM   696  C  CB  . LEU A 1 91  ? -14.124 -13.962 7.230   1.00 18.92  ? 91  LEU A CB  1 
ATOM   697  C  CG  . LEU A 1 91  ? -14.673 -15.241 6.605   1.00 18.92  ? 91  LEU A CG  1 
ATOM   698  C  CD1 . LEU A 1 91  ? -16.029 -14.919 5.993   1.00 18.92  ? 91  LEU A CD1 1 
ATOM   699  C  CD2 . LEU A 1 91  ? -13.700 -15.823 5.578   1.00 18.92  ? 91  LEU A CD2 1 
ATOM   700  N  N   . ALA A 1 92  ? -13.748 -14.404 10.299  1.00 35.52  ? 92  ALA A N   1 
ATOM   701  C  CA  . ALA A 1 92  ? -14.032 -15.043 11.582  1.00 35.52  ? 92  ALA A CA  1 
ATOM   702  C  C   . ALA A 1 92  ? -14.829 -16.328 11.570  1.00 35.52  ? 92  ALA A C   1 
ATOM   703  O  O   . ALA A 1 92  ? -16.044 -16.321 11.306  1.00 35.52  ? 92  ALA A O   1 
ATOM   704  C  CB  . ALA A 1 92  ? -14.703 -14.048 12.495  1.00 27.89  ? 92  ALA A CB  1 
ATOM   705  N  N   . PRO A 1 93  ? -14.191 -17.410 12.046  1.00 98.59  ? 93  PRO A N   1 
ATOM   706  C  CA  . PRO A 1 93  ? -14.718 -18.769 12.135  1.00 98.59  ? 93  PRO A CA  1 
ATOM   707  C  C   . PRO A 1 93  ? -15.952 -19.064 12.940  1.00 98.59  ? 93  PRO A C   1 
ATOM   708  O  O   . PRO A 1 93  ? -16.071 -18.745 14.122  1.00 98.59  ? 93  PRO A O   1 
ATOM   709  C  CB  . PRO A 1 93  ? -13.523 -19.564 12.662  1.00 70.59  ? 93  PRO A CB  1 
ATOM   710  C  CG  . PRO A 1 93  ? -12.871 -18.585 13.562  1.00 70.59  ? 93  PRO A CG  1 
ATOM   711  C  CD  . PRO A 1 93  ? -12.856 -17.354 12.674  1.00 70.59  ? 93  PRO A CD  1 
ATOM   712  N  N   . LEU A 1 94  ? -16.907 -19.590 12.182  1.00 50.50  ? 94  LEU A N   1 
ATOM   713  C  CA  . LEU A 1 94  ? -18.188 -20.124 12.607  1.00 50.50  ? 94  LEU A CA  1 
ATOM   714  C  C   . LEU A 1 94  ? -18.121 -21.605 12.197  1.00 50.50  ? 94  LEU A C   1 
ATOM   715  O  O   . LEU A 1 94  ? -17.364 -21.985 11.301  1.00 50.50  ? 94  LEU A O   1 
ATOM   716  C  CB  . LEU A 1 94  ? -19.331 -19.424 11.888  1.00 85.62  ? 94  LEU A CB  1 
ATOM   717  C  CG  . LEU A 1 94  ? -19.412 -17.929 12.217  1.00 85.62  ? 94  LEU A CG  1 
ATOM   718  C  CD1 . LEU A 1 94  ? -20.536 -17.303 11.414  1.00 85.62  ? 94  LEU A CD1 1 
ATOM   719  C  CD2 . LEU A 1 94  ? -19.627 -17.732 13.724  1.00 85.62  ? 94  LEU A CD2 1 
ATOM   720  N  N   . PRO A 1 95  ? -18.894 -22.467 12.870  1.00 48.04  ? 95  PRO A N   1 
ATOM   721  C  CA  . PRO A 1 95  ? -18.899 -23.897 12.543  1.00 48.04  ? 95  PRO A CA  1 
ATOM   722  C  C   . PRO A 1 95  ? -19.733 -24.224 11.316  1.00 48.04  ? 95  PRO A C   1 
ATOM   723  O  O   . PRO A 1 95  ? -20.734 -23.567 11.038  1.00 48.04  ? 95  PRO A O   1 
ATOM   724  C  CB  . PRO A 1 95  ? -19.440 -24.536 13.809  1.00 91.36  ? 95  PRO A CB  1 
ATOM   725  C  CG  . PRO A 1 95  ? -20.383 -23.500 14.354  1.00 91.36  ? 95  PRO A CG  1 
ATOM   726  C  CD  . PRO A 1 95  ? -19.612 -22.220 14.151  1.00 91.36  ? 95  PRO A CD  1 
ATOM   727  N  N   . SER A 1 96  ? -19.314 -25.259 10.602  1.00 98.65  ? 96  SER A N   1 
ATOM   728  C  CA  . SER A 1 96  ? -19.953 -25.718 9.366   1.00 98.65  ? 96  SER A CA  1 
ATOM   729  C  C   . SER A 1 96  ? -21.485 -25.799 9.299   1.00 98.65  ? 96  SER A C   1 
ATOM   730  O  O   . SER A 1 96  ? -22.090 -25.303 8.348   1.00 98.65  ? 96  SER A O   1 
ATOM   731  C  CB  . SER A 1 96  ? -19.369 -27.080 8.946   1.00 98.65  ? 96  SER A CB  1 
ATOM   732  O  OG  . SER A 1 96  ? -17.961 -27.043 8.777   1.00 98.65  ? 96  SER A OG  1 
ATOM   733  N  N   . TRP A 1 97  ? -22.110 -26.437 10.284  1.00 51.90  ? 97  TRP A N   1 
ATOM   734  C  CA  . TRP A 1 97  ? -23.559 -26.633 10.298  1.00 51.90  ? 97  TRP A CA  1 
ATOM   735  C  C   . TRP A 1 97  ? -24.302 -25.526 11.013  1.00 51.90  ? 97  TRP A C   1 
ATOM   736  O  O   . TRP A 1 97  ? -23.836 -25.026 12.034  1.00 51.90  ? 97  TRP A O   1 
ATOM   737  C  CB  . TRP A 1 97  ? -23.884 -27.987 10.930  1.00 58.85  ? 97  TRP A CB  1 
ATOM   738  C  CG  . TRP A 1 97  ? -22.890 -29.017 10.545  1.00 58.85  ? 97  TRP A CG  1 
ATOM   739  C  CD1 . TRP A 1 97  ? -21.642 -29.188 11.079  1.00 58.85  ? 97  TRP A CD1 1 
ATOM   740  C  CD2 . TRP A 1 97  ? -22.995 -29.968 9.488   1.00 58.85  ? 97  TRP A CD2 1 
ATOM   741  N  NE1 . TRP A 1 97  ? -20.961 -30.175 10.414  1.00 58.85  ? 97  TRP A NE1 1 
ATOM   742  C  CE2 . TRP A 1 97  ? -21.775 -30.676 9.433   1.00 58.85  ? 97  TRP A CE2 1 
ATOM   743  C  CE3 . TRP A 1 97  ? -24.010 -30.283 8.578   1.00 58.85  ? 97  TRP A CE3 1 
ATOM   744  C  CZ2 . TRP A 1 97  ? -21.528 -31.690 8.499   1.00 58.85  ? 97  TRP A CZ2 1 
ATOM   745  C  CZ3 . TRP A 1 97  ? -23.765 -31.294 7.643   1.00 58.85  ? 97  TRP A CZ3 1 
ATOM   746  C  CH2 . TRP A 1 97  ? -22.533 -31.986 7.614   1.00 58.85  ? 97  TRP A CH2 1 
ATOM   747  N  N   . GLN A 1 98  ? -25.466 -25.159 10.473  1.00 48.05  ? 98  GLN A N   1 
ATOM   748  C  CA  . GLN A 1 98  ? -26.308 -24.101 11.039  1.00 48.05  ? 98  GLN A CA  1 
ATOM   749  C  C   . GLN A 1 98  ? -27.806 -24.265 10.721  1.00 48.05  ? 98  GLN A C   1 
ATOM   750  O  O   . GLN A 1 98  ? -28.168 -24.690 9.625   1.00 48.05  ? 98  GLN A O   1 
ATOM   751  C  CB  . GLN A 1 98  ? -25.847 -22.729 10.528  1.00 78.77  ? 98  GLN A CB  1 
ATOM   752  C  CG  . GLN A 1 98  ? -24.532 -22.212 11.108  1.00 78.77  ? 98  GLN A CG  1 
ATOM   753  C  CD  . GLN A 1 98  ? -24.678 -21.669 12.513  1.00 78.77  ? 98  GLN A CD  1 
ATOM   754  O  OE1 . GLN A 1 98  ? -25.621 -20.937 12.815  1.00 78.77  ? 98  GLN A OE1 1 
ATOM   755  N  NE2 . GLN A 1 98  ? -23.734 -22.010 13.379  1.00 78.77  ? 98  GLN A NE2 1 
ATOM   756  N  N   . PRO A 1 99  ? -28.690 -23.920 11.683  1.00 98.65  ? 99  PRO A N   1 
ATOM   757  C  CA  . PRO A 1 99  ? -30.162 -23.988 11.590  1.00 98.65  ? 99  PRO A CA  1 
ATOM   758  C  C   . PRO A 1 99  ? -30.696 -22.937 10.607  1.00 98.65  ? 99  PRO A C   1 
ATOM   759  O  O   . PRO A 1 99  ? -30.453 -21.744 10.814  1.00 98.65  ? 99  PRO A O   1 
ATOM   760  C  CB  . PRO A 1 99  ? -30.604 -23.624 13.009  1.00 39.75  ? 99  PRO A CB  1 
ATOM   761  C  CG  . PRO A 1 99  ? -29.424 -24.022 13.871  1.00 39.75  ? 99  PRO A CG  1 
ATOM   762  C  CD  . PRO A 1 99  ? -28.271 -23.562 13.053  1.00 39.75  ? 99  PRO A CD  1 
ATOM   763  N  N   . VAL A 1 100 ? -31.451 -23.344 9.578   1.00 61.68  ? 100 VAL A N   1 
ATOM   764  C  CA  . VAL A 1 100 ? -31.964 -22.358 8.605   1.00 61.68  ? 100 VAL A CA  1 
ATOM   765  C  C   . VAL A 1 100 ? -32.857 -21.297 9.238   1.00 61.68  ? 100 VAL A C   1 
ATOM   766  O  O   . VAL A 1 100 ? -33.562 -21.563 10.218  1.00 61.68  ? 100 VAL A O   1 
ATOM   767  C  CB  . VAL A 1 100 ? -32.695 -22.973 7.365   1.00 29.35  ? 100 VAL A CB  1 
ATOM   768  C  CG1 . VAL A 1 100 ? -31.925 -24.166 6.823   1.00 29.35  ? 100 VAL A CG1 1 
ATOM   769  C  CG2 . VAL A 1 100 ? -34.150 -23.289 7.678   1.00 29.35  ? 100 VAL A CG2 1 
ATOM   770  N  N   . GLY A 1 101 ? -32.814 -20.097 8.661   1.00 89.31  ? 101 GLY A N   1 
ATOM   771  C  CA  . GLY A 1 101 ? -33.583 -18.984 9.184   1.00 89.31  ? 101 GLY A CA  1 
ATOM   772  C  C   . GLY A 1 101 ? -32.898 -18.490 10.446  1.00 89.31  ? 101 GLY A C   1 
ATOM   773  O  O   . GLY A 1 101 ? -33.510 -18.393 11.512  1.00 89.31  ? 101 GLY A O   1 
ATOM   774  N  N   . LYS A 1 102 ? -31.601 -18.231 10.325  1.00 77.30  ? 102 LYS A N   1 
ATOM   775  C  CA  . LYS A 1 102 ? -30.794 -17.755 11.437  1.00 77.30  ? 102 LYS A CA  1 
ATOM   776  C  C   . LYS A 1 102 ? -30.139 -16.456 10.965  1.00 77.30  ? 102 LYS A C   1 
ATOM   777  O  O   . LYS A 1 102 ? -29.460 -16.451 9.942   1.00 77.30  ? 102 LYS A O   1 
ATOM   778  C  CB  . LYS A 1 102 ? -29.732 -18.808 11.768  1.00 98.61  ? 102 LYS A CB  1 
ATOM   779  C  CG  . LYS A 1 102 ? -29.214 -18.778 13.192  1.00 98.61  ? 102 LYS A CG  1 
ATOM   780  C  CD  . LYS A 1 102 ? -28.350 -17.560 13.464  1.00 98.61  ? 102 LYS A CD  1 
ATOM   781  C  CE  . LYS A 1 102 ? -27.730 -17.623 14.850  1.00 98.61  ? 102 LYS A CE  1 
ATOM   782  N  NZ  . LYS A 1 102 ? -26.937 -18.877 15.061  1.00 98.61  ? 102 LYS A NZ  1 
ATOM   783  N  N   . ASN A 1 103 ? -30.369 -15.353 11.679  1.00 98.65  ? 103 ASN A N   1 
ATOM   784  C  CA  . ASN A 1 103 ? -29.784 -14.060 11.297  1.00 98.65  ? 103 ASN A CA  1 
ATOM   785  C  C   . ASN A 1 103 ? -28.318 -13.976 11.743  1.00 98.65  ? 103 ASN A C   1 
ATOM   786  O  O   . ASN A 1 103 ? -27.878 -12.971 12.318  1.00 98.65  ? 103 ASN A O   1 
ATOM   787  C  CB  . ASN A 1 103 ? -30.601 -12.899 11.885  1.00 98.50  ? 103 ASN A CB  1 
ATOM   788  C  CG  . ASN A 1 103 ? -30.273 -11.558 11.240  1.00 98.50  ? 103 ASN A CG  1 
ATOM   789  O  OD1 . ASN A 1 103 ? -30.472 -11.375 10.038  1.00 98.50  ? 103 ASN A OD1 1 
ATOM   790  N  ND2 . ASN A 1 103 ? -29.784 -10.617 12.038  1.00 98.50  ? 103 ASN A ND2 1 
ATOM   791  N  N   . LEU A 1 104 ? -27.572 -15.040 11.449  1.00 66.14  ? 104 LEU A N   1 
ATOM   792  C  CA  . LEU A 1 104 ? -26.166 -15.144 11.799  1.00 66.14  ? 104 LEU A CA  1 
ATOM   793  C  C   . LEU A 1 104 ? -25.318 -14.041 11.157  1.00 66.14  ? 104 LEU A C   1 
ATOM   794  O  O   . LEU A 1 104 ? -25.674 -13.494 10.112  1.00 66.14  ? 104 LEU A O   1 
ATOM   795  C  CB  . LEU A 1 104 ? -25.637 -16.545 11.445  1.00 31.52  ? 104 LEU A CB  1 
ATOM   796  C  CG  . LEU A 1 104 ? -24.530 -16.718 10.394  1.00 31.52  ? 104 LEU A CG  1 
ATOM   797  C  CD1 . LEU A 1 104 ? -24.009 -18.154 10.383  1.00 31.52  ? 104 LEU A CD1 1 
ATOM   798  C  CD2 . LEU A 1 104 ? -25.040 -16.299 9.012   1.00 31.52  ? 104 LEU A CD2 1 
ATOM   799  N  N   . THR A 1 105 ? -24.187 -13.749 11.800  1.00 73.37  ? 105 THR A N   1 
ATOM   800  C  CA  . THR A 1 105 ? -23.248 -12.714 11.371  1.00 73.37  ? 105 THR A CA  1 
ATOM   801  C  C   . THR A 1 105 ? -21.991 -13.195 10.635  1.00 73.37  ? 105 THR A C   1 
ATOM   802  O  O   . THR A 1 105 ? -21.328 -14.148 11.044  1.00 73.37  ? 105 THR A O   1 
ATOM   803  C  CB  . THR A 1 105 ? -22.795 -11.844 12.583  1.00 98.65  ? 105 THR A CB  1 
ATOM   804  O  OG1 . THR A 1 105 ? -22.484 -12.689 13.700  1.00 98.65  ? 105 THR A OG1 1 
ATOM   805  C  CG2 . THR A 1 105 ? -23.884 -10.867 12.988  1.00 98.65  ? 105 THR A CG2 1 
ATOM   806  N  N   . LEU A 1 106 ? -21.685 -12.518 9.535   1.00 69.27  ? 106 LEU A N   1 
ATOM   807  C  CA  . LEU A 1 106 ? -20.502 -12.802 8.742   1.00 69.27  ? 106 LEU A CA  1 
ATOM   808  C  C   . LEU A 1 106 ? -19.533 -11.679 9.032   1.00 69.27  ? 106 LEU A C   1 
ATOM   809  O  O   . LEU A 1 106 ? -19.774 -10.537 8.646   1.00 69.27  ? 106 LEU A O   1 
ATOM   810  C  CB  . LEU A 1 106 ? -20.806 -12.740 7.259   1.00 14.77  ? 106 LEU A CB  1 
ATOM   811  C  CG  . LEU A 1 106 ? -21.368 -13.907 6.476   1.00 14.77  ? 106 LEU A CG  1 
ATOM   812  C  CD1 . LEU A 1 106 ? -21.251 -13.477 5.028   1.00 14.77  ? 106 LEU A CD1 1 
ATOM   813  C  CD2 . LEU A 1 106 ? -20.583 -15.189 6.694   1.00 14.77  ? 106 LEU A CD2 1 
ATOM   814  N  N   . ARG A 1 107 ? -18.431 -11.998 9.691   1.00 48.93  ? 107 ARG A N   1 
ATOM   815  C  CA  . ARG A 1 107 ? -17.444 -10.981 10.015  1.00 48.93  ? 107 ARG A CA  1 
ATOM   816  C  C   . ARG A 1 107 ? -16.128 -11.273 9.305   1.00 48.93  ? 107 ARG A C   1 
ATOM   817  O  O   . ARG A 1 107 ? -15.691 -12.419 9.219   1.00 48.93  ? 107 ARG A O   1 
ATOM   818  C  CB  . ARG A 1 107 ? -17.238 -10.909 11.531  1.00 98.65  ? 107 ARG A CB  1 
ATOM   819  C  CG  . ARG A 1 107 ? -16.814 -9.539  12.037  1.00 98.65  ? 107 ARG A CG  1 
ATOM   820  C  CD  . ARG A 1 107 ? -17.584 -9.160  13.302  1.00 98.65  ? 107 ARG A CD  1 
ATOM   821  N  NE  . ARG A 1 107 ? -17.324 -7.783  13.726  1.00 98.65  ? 107 ARG A NE  1 
ATOM   822  C  CZ  . ARG A 1 107 ? -18.220 -6.981  14.297  1.00 98.65  ? 107 ARG A CZ  1 
ATOM   823  N  NH1 . ARG A 1 107 ? -19.461 -7.398  14.526  1.00 98.65  ? 107 ARG A NH1 1 
ATOM   824  N  NH2 . ARG A 1 107 ? -17.872 -5.752  14.643  1.00 98.65  ? 107 ARG A NH2 1 
ATOM   825  N  N   . CYS A 1 108 ? -15.523 -10.229 8.759   1.00 73.72  ? 108 CYS A N   1 
ATOM   826  C  CA  . CYS A 1 108 ? -14.261 -10.371 8.071   1.00 73.72  ? 108 CYS A CA  1 
ATOM   827  C  C   . CYS A 1 108 ? -13.316 -9.279  8.517   1.00 73.72  ? 108 CYS A C   1 
ATOM   828  O  O   . CYS A 1 108 ? -13.727 -8.130  8.709   1.00 73.72  ? 108 CYS A O   1 
ATOM   829  C  CB  . CYS A 1 108 ? -14.458 -10.258 6.569   1.00 48.39  ? 108 CYS A CB  1 
ATOM   830  S  SG  . CYS A 1 108 ? -12.868 -10.216 5.697   1.00 48.39  ? 108 CYS A SG  1 
ATOM   831  N  N   . GLN A 1 109 ? -12.049 -9.636  8.700   1.00 15.04  ? 109 GLN A N   1 
ATOM   832  C  CA  . GLN A 1 109 ? -11.053 -8.643  9.096   1.00 15.04  ? 109 GLN A CA  1 
ATOM   833  C  C   . GLN A 1 109 ? -9.781  -8.667  8.231   1.00 15.04  ? 109 GLN A C   1 
ATOM   834  O  O   . GLN A 1 109 ? -9.238  -9.725  7.917   1.00 15.04  ? 109 GLN A O   1 
ATOM   835  C  CB  . GLN A 1 109 ? -10.706 -8.771  10.586  1.00 88.81  ? 109 GLN A CB  1 
ATOM   836  C  CG  . GLN A 1 109 ? -11.799 -8.269  11.544  1.00 88.81  ? 109 GLN A CG  1 
ATOM   837  C  CD  . GLN A 1 109 ? -11.273 -7.943  12.944  1.00 88.81  ? 109 GLN A CD  1 
ATOM   838  O  OE1 . GLN A 1 109 ? -11.816 -7.070  13.631  1.00 88.81  ? 109 GLN A OE1 1 
ATOM   839  N  NE2 . GLN A 1 109 ? -10.206 -8.633  13.366  1.00 88.81  ? 109 GLN A NE2 1 
ATOM   840  N  N   . VAL A 1 110 ? -9.325  -7.490  7.819   1.00 31.40  ? 110 VAL A N   1 
ATOM   841  C  CA  . VAL A 1 110 ? -8.122  -7.393  7.001   1.00 31.40  ? 110 VAL A CA  1 
ATOM   842  C  C   . VAL A 1 110 ? -7.086  -6.572  7.776   1.00 31.40  ? 110 VAL A C   1 
ATOM   843  O  O   . VAL A 1 110 ? -7.435  -5.593  8.438   1.00 31.40  ? 110 VAL A O   1 
ATOM   844  C  CB  . VAL A 1 110 ? -8.449  -6.781  5.604   1.00 28.45  ? 110 VAL A CB  1 
ATOM   845  C  CG1 . VAL A 1 110 ? -9.783  -7.314  5.096   1.00 28.45  ? 110 VAL A CG1 1 
ATOM   846  C  CG2 . VAL A 1 110 ? -8.486  -5.280  5.644   1.00 28.45  ? 110 VAL A CG2 1 
ATOM   847  N  N   . GLU A 1 111 ? -5.836  -7.028  7.788   1.00 65.03  ? 111 GLU A N   1 
ATOM   848  C  CA  . GLU A 1 111 ? -4.801  -6.304  8.517   1.00 65.03  ? 111 GLU A CA  1 
ATOM   849  C  C   . GLU A 1 111 ? -3.663  -5.811  7.646   1.00 65.03  ? 111 GLU A C   1 
ATOM   850  O  O   . GLU A 1 111 ? -2.789  -6.577  7.246   1.00 65.03  ? 111 GLU A O   1 
ATOM   851  C  CB  . GLU A 1 111 ? -4.276  -7.119  9.710   1.00 98.65  ? 111 GLU A CB  1 
ATOM   852  C  CG  . GLU A 1 111 ? -3.745  -8.509  9.394   1.00 98.65  ? 111 GLU A CG  1 
ATOM   853  C  CD  . GLU A 1 111 ? -3.302  -9.272  10.644  1.00 98.65  ? 111 GLU A CD  1 
ATOM   854  O  OE1 . GLU A 1 111 ? -4.114  -9.403  11.589  1.00 98.65  ? 111 GLU A OE1 1 
ATOM   855  O  OE2 . GLU A 1 111 ? -2.148  -9.757  10.677  1.00 98.65  ? 111 GLU A OE2 1 
ATOM   856  N  N   . GLY A 1 112 ? -3.685  -4.511  7.367   1.00 80.90  ? 112 GLY A N   1 
ATOM   857  C  CA  . GLY A 1 112 ? -2.663  -3.904  6.537   1.00 80.90  ? 112 GLY A CA  1 
ATOM   858  C  C   . GLY A 1 112 ? -3.221  -3.402  5.220   1.00 80.90  ? 112 GLY A C   1 
ATOM   859  O  O   . GLY A 1 112 ? -4.417  -3.149  5.108   1.00 80.90  ? 112 GLY A O   1 
ATOM   860  N  N   . GLY A 1 113 ? -2.357  -3.263  4.219   1.00 41.28  ? 113 GLY A N   1 
ATOM   861  C  CA  . GLY A 1 113 ? -2.797  -2.787  2.917   1.00 41.28  ? 113 GLY A CA  1 
ATOM   862  C  C   . GLY A 1 113 ? -2.754  -1.276  2.778   1.00 41.28  ? 113 GLY A C   1 
ATOM   863  O  O   . GLY A 1 113 ? -3.349  -0.562  3.576   1.00 41.28  ? 113 GLY A O   1 
ATOM   864  N  N   . ALA A 1 114 ? -2.043  -0.792  1.765   1.00 34.24  ? 114 ALA A N   1 
ATOM   865  C  CA  . ALA A 1 114 ? -1.911  0.642   1.506   1.00 34.24  ? 114 ALA A CA  1 
ATOM   866  C  C   . ALA A 1 114 ? -1.689  0.849   0.001   1.00 34.24  ? 114 ALA A C   1 
ATOM   867  O  O   . ALA A 1 114 ? -1.213  -0.066  -0.679  1.00 34.24  ? 114 ALA A O   1 
ATOM   868  C  CB  . ALA A 1 114 ? -0.743  1.221   2.307   1.00 101.64 ? 114 ALA A CB  1 
ATOM   869  N  N   . PRO A 1 115 ? -2.083  2.027   -0.550  1.00 28.18  ? 115 PRO A N   1 
ATOM   870  C  CA  . PRO A 1 115 ? -2.714  3.137   0.170   1.00 28.18  ? 115 PRO A CA  1 
ATOM   871  C  C   . PRO A 1 115 ? -4.157  2.842   0.605   1.00 28.18  ? 115 PRO A C   1 
ATOM   872  O  O   . PRO A 1 115 ? -5.017  2.462   -0.189  1.00 28.18  ? 115 PRO A O   1 
ATOM   873  C  CB  . PRO A 1 115 ? -2.585  4.303   -0.819  1.00 19.05  ? 115 PRO A CB  1 
ATOM   874  C  CG  . PRO A 1 115 ? -2.640  3.644   -2.130  1.00 19.05  ? 115 PRO A CG  1 
ATOM   875  C  CD  . PRO A 1 115 ? -1.790  2.426   -1.941  1.00 19.05  ? 115 PRO A CD  1 
ATOM   876  N  N   . ARG A 1 116 ? -4.390  3.017   1.899   1.00 58.02  ? 116 ARG A N   1 
ATOM   877  C  CA  . ARG A 1 116 ? -5.674  2.747   2.512   1.00 58.02  ? 116 ARG A CA  1 
ATOM   878  C  C   . ARG A 1 116 ? -6.895  3.468   2.005   1.00 58.02  ? 116 ARG A C   1 
ATOM   879  O  O   . ARG A 1 116 ? -8.006  3.129   2.408   1.00 58.02  ? 116 ARG A O   1 
ATOM   880  C  CB  . ARG A 1 116 ? -5.583  2.916   4.018   1.00 33.75  ? 116 ARG A CB  1 
ATOM   881  C  CG  . ARG A 1 116 ? -5.178  1.641   4.727   1.00 33.75  ? 116 ARG A CG  1 
ATOM   882  C  CD  . ARG A 1 116 ? -6.187  0.513   4.510   1.00 33.75  ? 116 ARG A CD  1 
ATOM   883  N  NE  . ARG A 1 116 ? -5.832  -0.650  5.314   1.00 33.75  ? 116 ARG A NE  1 
ATOM   884  C  CZ  . ARG A 1 116 ? -6.389  -0.949  6.483   1.00 33.75  ? 116 ARG A CZ  1 
ATOM   885  N  NH1 . ARG A 1 116 ? -7.350  -0.181  6.975   1.00 33.75  ? 116 ARG A NH1 1 
ATOM   886  N  NH2 . ARG A 1 116 ? -5.916  -1.959  7.208   1.00 33.75  ? 116 ARG A NH2 1 
ATOM   887  N  N   . ALA A 1 117 ? -6.712  4.482   1.169   1.00 48.10  ? 117 ALA A N   1 
ATOM   888  C  CA  . ALA A 1 117 ? -7.862  5.197   0.632   1.00 48.10  ? 117 ALA A CA  1 
ATOM   889  C  C   . ALA A 1 117 ? -8.271  4.547   -0.679  1.00 48.10  ? 117 ALA A C   1 
ATOM   890  O  O   . ALA A 1 117 ? -9.245  4.951   -1.304  1.00 48.10  ? 117 ALA A O   1 
ATOM   891  C  CB  . ALA A 1 117 ? -7.538  6.656   0.426   1.00 98.65  ? 117 ALA A CB  1 
ATOM   892  N  N   . ASN A 1 118 ? -7.527  3.521   -1.083  1.00 49.35  ? 118 ASN A N   1 
ATOM   893  C  CA  . ASN A 1 118 ? -7.804  2.807   -2.323  1.00 49.35  ? 118 ASN A CA  1 
ATOM   894  C  C   . ASN A 1 118 ? -8.260  1.344   -2.091  1.00 49.35  ? 118 ASN A C   1 
ATOM   895  O  O   . ASN A 1 118 ? -8.865  0.716   -2.972  1.00 49.35  ? 118 ASN A O   1 
ATOM   896  C  CB  . ASN A 1 118 ? -6.554  2.816   -3.216  1.00 65.46  ? 118 ASN A CB  1 
ATOM   897  C  CG  . ASN A 1 118 ? -6.083  4.231   -3.597  1.00 65.46  ? 118 ASN A CG  1 
ATOM   898  O  OD1 . ASN A 1 118 ? -5.143  4.371   -4.367  1.00 65.46  ? 118 ASN A OD1 1 
ATOM   899  N  ND2 . ASN A 1 118 ? -6.713  5.276   -3.083  1.00 65.46  ? 118 ASN A ND2 1 
ATOM   900  N  N   . LEU A 1 119 ? -7.969  0.824   -0.897  1.00 25.74  ? 119 LEU A N   1 
ATOM   901  C  CA  . LEU A 1 119 ? -8.311  -0.546  -0.497  1.00 25.74  ? 119 LEU A CA  1 
ATOM   902  C  C   . LEU A 1 119 ? -9.745  -0.728  -0.006  1.00 25.74  ? 119 LEU A C   1 
ATOM   903  O  O   . LEU A 1 119 ? -10.139 -0.144  1.010   1.00 25.74  ? 119 LEU A O   1 
ATOM   904  C  CB  . LEU A 1 119 ? -7.352  -1.003  0.610   1.00 5.74   ? 119 LEU A CB  1 
ATOM   905  C  CG  . LEU A 1 119 ? -7.346  -2.419  1.186   1.00 5.74   ? 119 LEU A CG  1 
ATOM   906  C  CD1 . LEU A 1 119 ? -6.764  -3.392  0.187   1.00 5.74   ? 119 LEU A CD1 1 
ATOM   907  C  CD2 . LEU A 1 119 ? -6.517  -2.427  2.445   1.00 5.74   ? 119 LEU A CD2 1 
ATOM   908  N  N   . THR A 1 120 ? -10.522 -1.523  -0.750  1.00 30.66  ? 120 THR A N   1 
ATOM   909  C  CA  . THR A 1 120 ? -11.904 -1.853  -0.370  1.00 30.66  ? 120 THR A CA  1 
ATOM   910  C  C   . THR A 1 120 ? -12.005 -3.322  0.009   1.00 30.66  ? 120 THR A C   1 
ATOM   911  O  O   . THR A 1 120 ? -11.202 -4.158  -0.402  1.00 30.66  ? 120 THR A O   1 
ATOM   912  C  CB  . THR A 1 120 ? -12.990 -1.564  -1.467  1.00 27.23  ? 120 THR A CB  1 
ATOM   913  O  OG1 . THR A 1 120 ? -12.580 -2.094  -2.734  1.00 27.23  ? 120 THR A OG1 1 
ATOM   914  C  CG2 . THR A 1 120 ? -13.283 -0.090  -1.579  1.00 27.23  ? 120 THR A CG2 1 
ATOM   915  N  N   . VAL A 1 121 ? -13.013 -3.611  0.811   1.00 84.14  ? 121 VAL A N   1 
ATOM   916  C  CA  . VAL A 1 121 ? -13.261 -4.953  1.273   1.00 84.14  ? 121 VAL A CA  1 
ATOM   917  C  C   . VAL A 1 121 ? -14.661 -5.369  0.871   1.00 84.14  ? 121 VAL A C   1 
ATOM   918  O  O   . VAL A 1 121 ? -15.576 -4.547  0.825   1.00 84.14  ? 121 VAL A O   1 
ATOM   919  C  CB  . VAL A 1 121 ? -13.136 -5.026  2.784   1.00 13.77  ? 121 VAL A CB  1 
ATOM   920  C  CG1 . VAL A 1 121 ? -13.635 -6.349  3.266   1.00 13.77  ? 121 VAL A CG1 1 
ATOM   921  C  CG2 . VAL A 1 121 ? -11.688 -4.853  3.193   1.00 13.77  ? 121 VAL A CG2 1 
ATOM   922  N  N   . VAL A 1 122 ? -14.823 -6.655  0.585   1.00 11.05  ? 122 VAL A N   1 
ATOM   923  C  CA  . VAL A 1 122 ? -16.121 -7.183  0.187   1.00 11.05  ? 122 VAL A CA  1 
ATOM   924  C  C   . VAL A 1 122 ? -16.428 -8.611  0.677   1.00 11.05  ? 122 VAL A C   1 
ATOM   925  O  O   . VAL A 1 122 ? -15.660 -9.554  0.484   1.00 11.05  ? 122 VAL A O   1 
ATOM   926  C  CB  . VAL A 1 122 ? -16.319 -7.063  -1.332  1.00 21.07  ? 122 VAL A CB  1 
ATOM   927  C  CG1 . VAL A 1 122 ? -15.131 -7.624  -2.059  1.00 21.07  ? 122 VAL A CG1 1 
ATOM   928  C  CG2 . VAL A 1 122 ? -17.573 -7.776  -1.743  1.00 21.07  ? 122 VAL A CG2 1 
ATOM   929  N  N   . LEU A 1 123 ? -17.527 -8.730  1.406   1.00 57.70  ? 123 LEU A N   1 
ATOM   930  C  CA  . LEU A 1 123 ? -17.960 -10.023 1.908   1.00 57.70  ? 123 LEU A CA  1 
ATOM   931  C  C   . LEU A 1 123 ? -18.836 -10.590 0.802   1.00 57.70  ? 123 LEU A C   1 
ATOM   932  O  O   . LEU A 1 123 ? -19.502 -9.827  0.100   1.00 57.70  ? 123 LEU A O   1 
ATOM   933  C  CB  . LEU A 1 123 ? -18.747 -9.845  3.202   1.00 85.61  ? 123 LEU A CB  1 
ATOM   934  C  CG  . LEU A 1 123 ? -17.879 -9.711  4.458   1.00 85.61  ? 123 LEU A CG  1 
ATOM   935  C  CD1 . LEU A 1 123 ? -18.641 -9.046  5.588   1.00 85.61  ? 123 LEU A CD1 1 
ATOM   936  C  CD2 . LEU A 1 123 ? -17.397 -11.087 4.871   1.00 85.61  ? 123 LEU A CD2 1 
ATOM   937  N  N   . LEU A 1 124 ? -18.814 -11.910 0.621   1.00 31.47  ? 124 LEU A N   1 
ATOM   938  C  CA  . LEU A 1 124 ? -19.612 -12.520 -0.423  1.00 31.47  ? 124 LEU A CA  1 
ATOM   939  C  C   . LEU A 1 124 ? -19.798 -14.025 -0.343  1.00 31.47  ? 124 LEU A C   1 
ATOM   940  O  O   . LEU A 1 124 ? -18.887 -14.748 0.059   1.00 31.47  ? 124 LEU A O   1 
ATOM   941  C  CB  . LEU A 1 124 ? -19.034 -12.151 -1.800  1.00 64.79  ? 124 LEU A CB  1 
ATOM   942  C  CG  . LEU A 1 124 ? -17.672 -12.625 -2.294  1.00 64.79  ? 124 LEU A CG  1 
ATOM   943  C  CD1 . LEU A 1 124 ? -17.371 -11.951 -3.636  1.00 64.79  ? 124 LEU A CD1 1 
ATOM   944  C  CD2 . LEU A 1 124 ? -16.583 -12.290 -1.297  1.00 64.79  ? 124 LEU A CD2 1 
ATOM   945  N  N   . ARG A 1 125 ? -21.000 -14.477 -0.705  1.00 60.39  ? 125 ARG A N   1 
ATOM   946  C  CA  . ARG A 1 125 ? -21.346 -15.898 -0.737  1.00 60.39  ? 125 ARG A CA  1 
ATOM   947  C  C   . ARG A 1 125 ? -21.181 -16.305 -2.197  1.00 60.39  ? 125 ARG A C   1 
ATOM   948  O  O   . ARG A 1 125 ? -22.148 -16.360 -2.951  1.00 60.39  ? 125 ARG A O   1 
ATOM   949  C  CB  . ARG A 1 125 ? -22.799 -16.113 -0.304  1.00 74.94  ? 125 ARG A CB  1 
ATOM   950  C  CG  . ARG A 1 125 ? -23.240 -17.580 -0.330  1.00 74.94  ? 125 ARG A CG  1 
ATOM   951  C  CD  . ARG A 1 125 ? -24.735 -17.751 -0.093  1.00 74.94  ? 125 ARG A CD  1 
ATOM   952  N  NE  . ARG A 1 125 ? -25.530 -17.161 -1.164  1.00 74.94  ? 125 ARG A NE  1 
ATOM   953  C  CZ  . ARG A 1 125 ? -26.502 -16.276 -0.969  1.00 74.94  ? 125 ARG A CZ  1 
ATOM   954  N  NH1 . ARG A 1 125 ? -26.809 -15.880 0.260   1.00 74.94  ? 125 ARG A NH1 1 
ATOM   955  N  NH2 . ARG A 1 125 ? -27.147 -15.761 -2.009  1.00 74.94  ? 125 ARG A NH2 1 
ATOM   956  N  N   . GLY A 1 126 ? -19.947 -16.588 -2.594  1.00 87.97  ? 126 GLY A N   1 
ATOM   957  C  CA  . GLY A 1 126 ? -19.695 -16.945 -3.976  1.00 87.97  ? 126 GLY A CA  1 
ATOM   958  C  C   . GLY A 1 126 ? -19.577 -15.661 -4.776  1.00 87.97  ? 126 GLY A C   1 
ATOM   959  O  O   . GLY A 1 126 ? -19.517 -14.576 -4.199  1.00 87.97  ? 126 GLY A O   1 
ATOM   960  N  N   . GLU A 1 127 ? -19.584 -15.770 -6.101  1.00 53.97  ? 127 GLU A N   1 
ATOM   961  C  CA  . GLU A 1 127 ? -19.450 -14.609 -6.985  1.00 53.97  ? 127 GLU A CA  1 
ATOM   962  C  C   . GLU A 1 127 ? -20.562 -13.558 -6.879  1.00 53.97  ? 127 GLU A C   1 
ATOM   963  O  O   . GLU A 1 127 ? -20.831 -12.834 -7.847  1.00 53.97  ? 127 GLU A O   1 
ATOM   964  C  CB  . GLU A 1 127 ? -19.318 -15.056 -8.441  1.00 94.87  ? 127 GLU A CB  1 
ATOM   965  C  CG  . GLU A 1 127 ? -17.938 -15.582 -8.839  1.00 94.87  ? 127 GLU A CG  1 
ATOM   966  C  CD  . GLU A 1 127 ? -16.968 -14.492 -9.293  1.00 94.87  ? 127 GLU A CD  1 
ATOM   967  O  OE1 . GLU A 1 127 ? -16.314 -14.688 -10.343 1.00 94.87  ? 127 GLU A OE1 1 
ATOM   968  O  OE2 . GLU A 1 127 ? -16.843 -13.454 -8.603  1.00 94.87  ? 127 GLU A OE2 1 
ATOM   969  N  N   . LYS A 1 128 ? -21.206 -13.459 -5.720  1.00 17.37  ? 128 LYS A N   1 
ATOM   970  C  CA  . LYS A 1 128 ? -22.265 -12.471 -5.553  1.00 17.37  ? 128 LYS A CA  1 
ATOM   971  C  C   . LYS A 1 128 ? -21.799 -11.486 -4.526  1.00 17.37  ? 128 LYS A C   1 
ATOM   972  O  O   . LYS A 1 128 ? -21.406 -11.891 -3.451  1.00 17.37  ? 128 LYS A O   1 
ATOM   973  C  CB  . LYS A 1 128 ? -23.558 -13.147 -5.092  1.00 85.41  ? 128 LYS A CB  1 
ATOM   974  C  CG  . LYS A 1 128 ? -24.749 -12.203 -4.981  1.00 85.41  ? 128 LYS A CG  1 
ATOM   975  C  CD  . LYS A 1 128 ? -26.023 -12.842 -5.525  1.00 85.41  ? 128 LYS A CD  1 
ATOM   976  C  CE  . LYS A 1 128 ? -26.156 -12.671 -7.047  1.00 85.41  ? 128 LYS A CE  1 
ATOM   977  N  NZ  . LYS A 1 128 ? -25.091 -13.334 -7.865  1.00 85.41  ? 128 LYS A NZ  1 
ATOM   978  N  N   . GLU A 1 129 ? -21.757 -10.204 -4.887  1.00 63.28  ? 129 GLU A N   1 
ATOM   979  C  CA  . GLU A 1 129 ? -21.326 -9.142  -3.961  1.00 63.28  ? 129 GLU A CA  1 
ATOM   980  C  C   . GLU A 1 129 ? -22.278 -8.965  -2.752  1.00 63.28  ? 129 GLU A C   1 
ATOM   981  O  O   . GLU A 1 129 ? -23.416 -8.492  -2.895  1.00 63.28  ? 129 GLU A O   1 
ATOM   982  C  CB  . GLU A 1 129 ? -21.131 -7.811  -4.710  1.00 72.04  ? 129 GLU A CB  1 
ATOM   983  C  CG  . GLU A 1 129 ? -21.866 -7.706  -6.053  1.00 72.04  ? 129 GLU A CG  1 
ATOM   984  C  CD  . GLU A 1 129 ? -23.377 -7.903  -5.938  1.00 72.04  ? 129 GLU A CD  1 
ATOM   985  O  OE1 . GLU A 1 129 ? -23.863 -9.029  -6.198  1.00 72.04  ? 129 GLU A OE1 1 
ATOM   986  O  OE2 . GLU A 1 129 ? -24.078 -6.929  -5.596  1.00 72.04  ? 129 GLU A OE2 1 
ATOM   987  N  N   . LEU A 1 130 ? -21.810 -9.334  -1.564  1.00 32.05  ? 130 LEU A N   1 
ATOM   988  C  CA  . LEU A 1 130 ? -22.652 -9.194  -0.380  1.00 32.05  ? 130 LEU A CA  1 
ATOM   989  C  C   . LEU A 1 130 ? -22.511 -7.830  0.299   1.00 32.05  ? 130 LEU A C   1 
ATOM   990  O  O   . LEU A 1 130 ? -23.469 -7.336  0.890   1.00 32.05  ? 130 LEU A O   1 
ATOM   991  C  CB  . LEU A 1 130 ? -22.356 -10.303 0.643   1.00 25.18  ? 130 LEU A CB  1 
ATOM   992  C  CG  . LEU A 1 130 ? -23.525 -10.961 1.367   1.00 25.18  ? 130 LEU A CG  1 
ATOM   993  C  CD1 . LEU A 1 130 ? -24.817 -10.147 1.237   1.00 25.18  ? 130 LEU A CD1 1 
ATOM   994  C  CD2 . LEU A 1 130 ? -23.717 -12.335 0.784   1.00 25.18  ? 130 LEU A CD2 1 
ATOM   995  N  N   . LYS A 1 131 ? -21.323 -7.231  0.219   1.00 98.65  ? 131 LYS A N   1 
ATOM   996  C  CA  . LYS A 1 131 ? -21.086 -5.920  0.803   1.00 98.65  ? 131 LYS A CA  1 
ATOM   997  C  C   . LYS A 1 131 ? -19.671 -5.412  0.528   1.00 98.65  ? 131 LYS A C   1 
ATOM   998  O  O   . LYS A 1 131 ? -18.686 -6.066  0.896   1.00 98.65  ? 131 LYS A O   1 
ATOM   999  C  CB  . LYS A 1 131 ? -21.327 -5.955  2.314   1.00 40.10  ? 131 LYS A CB  1 
ATOM   1000 C  CG  . LYS A 1 131 ? -21.697 -4.608  2.909   1.00 40.10  ? 131 LYS A CG  1 
ATOM   1001 C  CD  . LYS A 1 131 ? -21.940 -4.684  4.406   1.00 40.10  ? 131 LYS A CD  1 
ATOM   1002 C  CE  . LYS A 1 131 ? -22.500 -3.381  4.936   1.00 40.10  ? 131 LYS A CE  1 
ATOM   1003 N  NZ  . LYS A 1 131 ? -22.848 -3.505  6.365   1.00 40.10  ? 131 LYS A NZ  1 
ATOM   1004 N  N   . ARG A 1 132 ? -19.575 -4.277  -0.159  1.00 60.29  ? 132 ARG A N   1 
ATOM   1005 C  CA  . ARG A 1 132 ? -18.278 -3.661  -0.483  1.00 60.29  ? 132 ARG A CA  1 
ATOM   1006 C  C   . ARG A 1 132 ? -18.081 -2.404  0.355   1.00 60.29  ? 132 ARG A C   1 
ATOM   1007 O  O   . ARG A 1 132 ? -18.808 -1.425  0.193   1.00 60.29  ? 132 ARG A O   1 
ATOM   1008 C  CB  . ARG A 1 132 ? -18.205 -3.293  -1.962  1.00 87.03  ? 132 ARG A CB  1 
ATOM   1009 C  CG  . ARG A 1 132 ? -18.325 -4.460  -2.927  1.00 87.03  ? 132 ARG A CG  1 
ATOM   1010 C  CD  . ARG A 1 132 ? -18.133 -4.022  -4.380  1.00 87.03  ? 132 ARG A CD  1 
ATOM   1011 N  NE  . ARG A 1 132 ? -16.807 -3.451  -4.622  1.00 87.03  ? 132 ARG A NE  1 
ATOM   1012 C  CZ  . ARG A 1 132 ? -16.385 -2.989  -5.799  1.00 87.03  ? 132 ARG A CZ  1 
ATOM   1013 N  NH1 . ARG A 1 132 ? -17.179 -3.030  -6.867  1.00 87.03  ? 132 ARG A NH1 1 
ATOM   1014 N  NH2 . ARG A 1 132 ? -15.171 -2.463  -5.905  1.00 87.03  ? 132 ARG A NH2 1 
ATOM   1015 N  N   . GLU A 1 133 ? -17.111 -2.447  1.263   1.00 57.64  ? 133 GLU A N   1 
ATOM   1016 C  CA  . GLU A 1 133 ? -16.798 -1.301  2.115   1.00 57.64  ? 133 GLU A CA  1 
ATOM   1017 C  C   . GLU A 1 133 ? -15.285 -1.115  2.282   1.00 57.64  ? 133 GLU A C   1 
ATOM   1018 O  O   . GLU A 1 133 ? -14.543 -2.099  2.320   1.00 57.64  ? 133 GLU A O   1 
ATOM   1019 C  CB  . GLU A 1 133 ? -17.478 -1.418  3.482   1.00 98.62  ? 133 GLU A CB  1 
ATOM   1020 C  CG  . GLU A 1 133 ? -18.956 -1.036  3.473   1.00 98.62  ? 133 GLU A CG  1 
ATOM   1021 C  CD  . GLU A 1 133 ? -19.516 -0.792  4.867   1.00 98.62  ? 133 GLU A CD  1 
ATOM   1022 O  OE1 . GLU A 1 133 ? -20.634 -0.232  4.969   1.00 98.62  ? 133 GLU A OE1 1 
ATOM   1023 O  OE2 . GLU A 1 133 ? -18.840 -1.153  5.860   1.00 98.62  ? 133 GLU A OE2 1 
ATOM   1024 N  N   . PRO A 1 134 ? -14.820 0.151   2.367   1.00 41.76  ? 134 PRO A N   1 
ATOM   1025 C  CA  . PRO A 1 134 ? -13.407 0.519   2.527   1.00 41.76  ? 134 PRO A CA  1 
ATOM   1026 C  C   . PRO A 1 134 ? -12.793 0.099   3.862   1.00 41.76  ? 134 PRO A C   1 
ATOM   1027 O  O   . PRO A 1 134 ? -13.405 0.287   4.910   1.00 41.76  ? 134 PRO A O   1 
ATOM   1028 C  CB  . PRO A 1 134 ? -13.439 2.038   2.360   1.00 98.65  ? 134 PRO A CB  1 
ATOM   1029 C  CG  . PRO A 1 134 ? -14.779 2.404   2.896   1.00 98.65  ? 134 PRO A CG  1 
ATOM   1030 C  CD  . PRO A 1 134 ? -15.667 1.356   2.289   1.00 98.65  ? 134 PRO A CD  1 
ATOM   1031 N  N   . ALA A 1 135 ? -11.583 -0.455  3.803   1.00 47.61  ? 135 ALA A N   1 
ATOM   1032 C  CA  . ALA A 1 135 ? -10.867 -0.916  4.983   1.00 47.61  ? 135 ALA A CA  1 
ATOM   1033 C  C   . ALA A 1 135 ? -10.694 0.168   6.034   1.00 47.61  ? 135 ALA A C   1 
ATOM   1034 O  O   . ALA A 1 135 ? -9.966  1.147   5.812   1.00 47.61  ? 135 ALA A O   1 
ATOM   1035 C  CB  . ALA A 1 135 ? -9.532  -1.474  4.590   1.00 28.68  ? 135 ALA A CB  1 
ATOM   1036 N  N   . VAL A 1 136 ? -11.369 -0.039  7.172   1.00 95.28  ? 136 VAL A N   1 
ATOM   1037 C  CA  . VAL A 1 136 ? -11.359 0.877   8.322   1.00 95.28  ? 136 VAL A CA  1 
ATOM   1038 C  C   . VAL A 1 136 ? -10.627 0.278   9.523   1.00 95.28  ? 136 VAL A C   1 
ATOM   1039 O  O   . VAL A 1 136 ? -10.993 -0.788  10.015  1.00 95.28  ? 136 VAL A O   1 
ATOM   1040 C  CB  . VAL A 1 136 ? -12.811 1.252   8.771   1.00 98.65  ? 136 VAL A CB  1 
ATOM   1041 C  CG1 . VAL A 1 136 ? -13.632 -0.004  9.068   1.00 98.65  ? 136 VAL A CG1 1 
ATOM   1042 C  CG2 . VAL A 1 136 ? -12.776 2.154   9.999   1.00 98.65  ? 136 VAL A CG2 1 
ATOM   1043 N  N   . GLY A 1 137 ? -9.595  0.972   9.986   1.00 46.56  ? 137 GLY A N   1 
ATOM   1044 C  CA  . GLY A 1 137 ? -8.830  0.514   11.134  1.00 46.56  ? 137 GLY A CA  1 
ATOM   1045 C  C   . GLY A 1 137 ? -7.825  -0.613  10.938  1.00 46.56  ? 137 GLY A C   1 
ATOM   1046 O  O   . GLY A 1 137 ? -7.389  -0.910  9.825   1.00 46.56  ? 137 GLY A O   1 
ATOM   1047 N  N   . GLU A 1 138 ? -7.454  -1.242  12.048  1.00 65.31  ? 138 GLU A N   1 
ATOM   1048 C  CA  . GLU A 1 138 ? -6.494  -2.332  12.034  1.00 65.31  ? 138 GLU A CA  1 
ATOM   1049 C  C   . GLU A 1 138 ? -6.772  -3.274  13.199  1.00 65.31  ? 138 GLU A C   1 
ATOM   1050 O  O   . GLU A 1 138 ? -6.583  -2.907  14.357  1.00 65.31  ? 138 GLU A O   1 
ATOM   1051 C  CB  . GLU A 1 138 ? -5.064  -1.766  12.104  1.00 84.08  ? 138 GLU A CB  1 
ATOM   1052 C  CG  . GLU A 1 138 ? -4.002  -2.655  12.782  1.00 84.08  ? 138 GLU A CG  1 
ATOM   1053 C  CD  . GLU A 1 138 ? -3.710  -3.962  12.043  1.00 84.08  ? 138 GLU A CD  1 
ATOM   1054 O  OE1 . GLU A 1 138 ? -3.307  -3.902  10.852  1.00 84.08  ? 138 GLU A OE1 1 
ATOM   1055 O  OE2 . GLU A 1 138 ? -3.857  -5.042  12.674  1.00 84.08  ? 138 GLU A OE2 1 
ATOM   1056 N  N   . PRO A 1 139 ? -7.314  -4.472  12.910  1.00 42.61  ? 139 PRO A N   1 
ATOM   1057 C  CA  . PRO A 1 139 ? -7.673  -4.933  11.563  1.00 42.61  ? 139 PRO A CA  1 
ATOM   1058 C  C   . PRO A 1 139 ? -8.971  -4.278  11.103  1.00 42.61  ? 139 PRO A C   1 
ATOM   1059 O  O   . PRO A 1 139 ? -9.708  -3.709  11.916  1.00 42.61  ? 139 PRO A O   1 
ATOM   1060 C  CB  . PRO A 1 139 ? -7.849  -6.442  11.756  1.00 68.32  ? 139 PRO A CB  1 
ATOM   1061 C  CG  . PRO A 1 139 ? -6.989  -6.757  12.954  1.00 68.32  ? 139 PRO A CG  1 
ATOM   1062 C  CD  . PRO A 1 139 ? -7.311  -5.603  13.855  1.00 68.32  ? 139 PRO A CD  1 
ATOM   1063 N  N   . ALA A 1 140 ? -9.255  -4.363  9.809   1.00 70.32  ? 140 ALA A N   1 
ATOM   1064 C  CA  . ALA A 1 140 ? -10.460 -3.753  9.266   1.00 70.32  ? 140 ALA A CA  1 
ATOM   1065 C  C   . ALA A 1 140 ? -11.722 -4.537  9.565   1.00 70.32  ? 140 ALA A C   1 
ATOM   1066 O  O   . ALA A 1 140 ? -11.983 -5.592  8.987   1.00 70.32  ? 140 ALA A O   1 
ATOM   1067 C  CB  . ALA A 1 140 ? -10.323 -3.519  7.780   1.00 101.64 ? 140 ALA A CB  1 
ATOM   1068 N  N   . GLU A 1 141 ? -12.500 -4.006  10.492  1.00 98.65  ? 141 GLU A N   1 
ATOM   1069 C  CA  . GLU A 1 141 ? -13.755 -4.614  10.893  1.00 98.65  ? 141 GLU A CA  1 
ATOM   1070 C  C   . GLU A 1 141 ? -14.788 -4.446  9.779   1.00 98.65  ? 141 GLU A C   1 
ATOM   1071 O  O   . GLU A 1 141 ? -14.968 -3.348  9.245   1.00 98.65  ? 141 GLU A O   1 
ATOM   1072 C  CB  . GLU A 1 141 ? -14.254 -3.927  12.174  1.00 98.65  ? 141 GLU A CB  1 
ATOM   1073 C  CG  . GLU A 1 141 ? -15.687 -4.252  12.603  1.00 98.65  ? 141 GLU A CG  1 
ATOM   1074 C  CD  . GLU A 1 141 ? -16.251 -3.217  13.574  1.00 98.65  ? 141 GLU A CD  1 
ATOM   1075 O  OE1 . GLU A 1 141 ? -15.900 -3.263  14.776  1.00 98.65  ? 141 GLU A OE1 1 
ATOM   1076 O  OE2 . GLU A 1 141 ? -17.040 -2.349  13.130  1.00 98.65  ? 141 GLU A OE2 1 
ATOM   1077 N  N   . VAL A 1 142 ? -15.441 -5.544  9.413   1.00 90.77  ? 142 VAL A N   1 
ATOM   1078 C  CA  . VAL A 1 142 ? -16.482 -5.506  8.395   1.00 90.77  ? 142 VAL A CA  1 
ATOM   1079 C  C   . VAL A 1 142 ? -17.477 -6.635  8.667   1.00 90.77  ? 142 VAL A C   1 
ATOM   1080 O  O   . VAL A 1 142 ? -17.076 -7.777  8.910   1.00 90.77  ? 142 VAL A O   1 
ATOM   1081 C  CB  . VAL A 1 142 ? -15.895 -5.582  6.983   1.00 12.80  ? 142 VAL A CB  1 
ATOM   1082 C  CG1 . VAL A 1 142 ? -15.835 -7.031  6.485   1.00 12.80  ? 142 VAL A CG1 1 
ATOM   1083 C  CG2 . VAL A 1 142 ? -16.695 -4.665  6.062   1.00 12.80  ? 142 VAL A CG2 1 
ATOM   1084 N  N   . THR A 1 143 ? -18.772 -6.319  8.637   1.00 96.18  ? 143 THR A N   1 
ATOM   1085 C  CA  . THR A 1 143 ? -19.787 -7.325  8.949   1.00 96.18  ? 143 THR A CA  1 
ATOM   1086 C  C   . THR A 1 143 ? -21.149 -7.148  8.277   1.00 96.18  ? 143 THR A C   1 
ATOM   1087 O  O   . THR A 1 143 ? -21.649 -6.029  8.137   1.00 96.18  ? 143 THR A O   1 
ATOM   1088 C  CB  . THR A 1 143 ? -20.038 -7.373  10.476  1.00 94.04  ? 143 THR A CB  1 
ATOM   1089 O  OG1 . THR A 1 143 ? -18.785 -7.367  11.171  1.00 94.04  ? 143 THR A OG1 1 
ATOM   1090 C  CG2 . THR A 1 143 ? -20.824 -8.623  10.860  1.00 94.04  ? 143 THR A CG2 1 
ATOM   1091 N  N   . THR A 1 144 ? -21.757 -8.276  7.906   1.00 54.33  ? 144 THR A N   1 
ATOM   1092 C  CA  . THR A 1 144 ? -23.081 -8.298  7.288   1.00 54.33  ? 144 THR A CA  1 
ATOM   1093 C  C   . THR A 1 144 ? -23.796 -9.575  7.710   1.00 54.33  ? 144 THR A C   1 
ATOM   1094 O  O   . THR A 1 144 ? -23.324 -10.683 7.452   1.00 54.33  ? 144 THR A O   1 
ATOM   1095 C  CB  . THR A 1 144 ? -23.025 -8.188  5.737   1.00 98.64  ? 144 THR A CB  1 
ATOM   1096 O  OG1 . THR A 1 144 ? -24.359 -8.158  5.208   1.00 98.64  ? 144 THR A OG1 1 
ATOM   1097 C  CG2 . THR A 1 144 ? -22.260 -9.352  5.122   1.00 98.64  ? 144 THR A CG2 1 
ATOM   1098 N  N   . THR A 1 145 ? -24.920 -9.401  8.398   1.00 64.53  ? 145 THR A N   1 
ATOM   1099 C  CA  . THR A 1 145 ? -25.717 -10.519 8.895   1.00 64.53  ? 145 THR A CA  1 
ATOM   1100 C  C   . THR A 1 145 ? -26.430 -11.285 7.788   1.00 64.53  ? 145 THR A C   1 
ATOM   1101 O  O   . THR A 1 145 ? -27.409 -10.805 7.218   1.00 64.53  ? 145 THR A O   1 
ATOM   1102 C  CB  . THR A 1 145 ? -26.774 -10.051 9.923   1.00 75.13  ? 145 THR A CB  1 
ATOM   1103 O  OG1 . THR A 1 145 ? -27.790 -9.287  9.258   1.00 75.13  ? 145 THR A OG1 1 
ATOM   1104 C  CG2 . THR A 1 145 ? -26.129 -9.195  11.005  1.00 75.13  ? 145 THR A CG2 1 
ATOM   1105 N  N   . VAL A 1 146 ? -25.945 -12.489 7.511   1.00 98.65  ? 146 VAL A N   1 
ATOM   1106 C  CA  . VAL A 1 146 ? -26.535 -13.326 6.489   1.00 98.65  ? 146 VAL A CA  1 
ATOM   1107 C  C   . VAL A 1 146 ? -27.563 -14.266 7.081   1.00 98.65  ? 146 VAL A C   1 
ATOM   1108 O  O   . VAL A 1 146 ? -27.464 -14.703 8.226   1.00 98.65  ? 146 VAL A O   1 
ATOM   1109 C  CB  . VAL A 1 146 ? -25.466 -14.114 5.710   1.00 98.65  ? 146 VAL A CB  1 
ATOM   1110 C  CG1 . VAL A 1 146 ? -26.101 -15.123 4.772   1.00 98.65  ? 146 VAL A CG1 1 
ATOM   1111 C  CG2 . VAL A 1 146 ? -24.630 -13.159 4.908   1.00 98.65  ? 146 VAL A CG2 1 
ATOM   1112 N  N   . LEU A 1 147 ? -28.559 -14.524 6.255   1.00 42.80  ? 147 LEU A N   1 
ATOM   1113 C  CA  . LEU A 1 147 ? -29.675 -15.418 6.551   1.00 42.80  ? 147 LEU A CA  1 
ATOM   1114 C  C   . LEU A 1 147 ? -29.481 -16.830 6.013   1.00 42.80  ? 147 LEU A C   1 
ATOM   1115 O  O   . LEU A 1 147 ? -28.665 -16.964 5.101   1.00 42.80  ? 147 LEU A O   1 
ATOM   1116 C  CB  . LEU A 1 147 ? -31.002 -14.801 6.145   1.00 98.65  ? 147 LEU A CB  1 
ATOM   1117 C  CG  . LEU A 1 147 ? -31.988 -14.624 7.305   1.00 98.65  ? 147 LEU A CG  1 
ATOM   1118 C  CD1 . LEU A 1 147 ? -31.257 -14.137 8.555   1.00 98.65  ? 147 LEU A CD1 1 
ATOM   1119 C  CD2 . LEU A 1 147 ? -33.099 -13.660 6.934   1.00 98.65  ? 147 LEU A CD2 1 
ATOM   1120 N  N   . VAL A 1 148 ? -30.289 -17.750 6.437   1.00 77.40  ? 148 VAL A N   1 
ATOM   1121 C  CA  . VAL A 1 148 ? -30.184 -19.098 5.907   1.00 77.40  ? 148 VAL A CA  1 
ATOM   1122 C  C   . VAL A 1 148 ? -31.560 -19.464 5.335   1.00 77.40  ? 148 VAL A C   1 
ATOM   1123 O  O   . VAL A 1 148 ? -32.456 -19.882 6.077   1.00 77.40  ? 148 VAL A O   1 
ATOM   1124 C  CB  . VAL A 1 148 ? -29.756 -20.105 7.011   1.00 63.39  ? 148 VAL A CB  1 
ATOM   1125 C  CG1 . VAL A 1 148 ? -29.096 -21.323 6.384   1.00 63.39  ? 148 VAL A CG1 1 
ATOM   1126 C  CG2 . VAL A 1 148 ? -28.806 -19.448 8.019   1.00 63.39  ? 148 VAL A CG2 1 
ATOM   1127 N  N   . ARG A 1 149 ? -31.731 -19.264 4.026   1.00 85.25  ? 149 ARG A N   1 
ATOM   1128 C  CA  . ARG A 1 149 ? -32.928 -19.768 3.337   1.00 85.25  ? 149 ARG A CA  1 
ATOM   1129 C  C   . ARG A 1 149 ? -32.890 -20.747 2.147   1.00 85.25  ? 149 ARG A C   1 
ATOM   1130 O  O   . ARG A 1 149 ? -33.201 -21.932 2.290   1.00 85.25  ? 149 ARG A O   1 
ATOM   1131 C  CB  . ARG A 1 149 ? -33.647 -18.468 2.912   1.00 97.25  ? 149 ARG A CB  1 
ATOM   1132 C  CG  . ARG A 1 149 ? -34.019 -17.517 4.066   1.00 97.25  ? 149 ARG A CG  1 
ATOM   1133 C  CD  . ARG A 1 149 ? -35.021 -16.431 3.647   1.00 97.25  ? 149 ARG A CD  1 
ATOM   1134 N  NE  . ARG A 1 149 ? -36.390 -16.939 3.460   1.00 97.25  ? 149 ARG A NE  1 
ATOM   1135 C  CZ  . ARG A 1 149 ? -37.478 -16.172 3.364   1.00 97.25  ? 149 ARG A CZ  1 
ATOM   1136 N  NH1 . ARG A 1 149 ? -37.379 -14.850 3.435   1.00 97.25  ? 149 ARG A NH1 1 
ATOM   1137 N  NH2 . ARG A 1 149 ? -38.678 -16.724 3.210   1.00 97.25  ? 149 ARG A NH2 1 
ATOM   1138 N  N   . ARG A 1 150 ? -32.532 -20.228 0.972   1.00 98.54  ? 150 ARG A N   1 
ATOM   1139 C  CA  . ARG A 1 150 ? -32.800 -20.980 -0.305  1.00 98.54  ? 150 ARG A CA  1 
ATOM   1140 C  C   . ARG A 1 150 ? -31.469 -21.124 -1.020  1.00 98.54  ? 150 ARG A C   1 
ATOM   1141 O  O   . ARG A 1 150 ? -31.230 -22.121 -1.715  1.00 98.54  ? 150 ARG A O   1 
ATOM   1142 C  CB  . ARG A 1 150 ? -33.842 -20.382 -1.270  1.00 98.65  ? 150 ARG A CB  1 
ATOM   1143 C  CG  . ARG A 1 150 ? -33.918 -18.857 -1.261  1.00 98.65  ? 150 ARG A CG  1 
ATOM   1144 C  CD  . ARG A 1 150 ? -34.987 -18.349 -2.198  1.00 98.65  ? 150 ARG A CD  1 
ATOM   1145 N  NE  . ARG A 1 150 ? -34.611 -18.525 -3.600  1.00 98.65  ? 150 ARG A NE  1 
ATOM   1146 C  CZ  . ARG A 1 150 ? -34.305 -17.526 -4.430  1.00 98.65  ? 150 ARG A CZ  1 
ATOM   1147 N  NH1 . ARG A 1 150 ? -34.329 -16.265 -4.004  1.00 98.65  ? 150 ARG A NH1 1 
ATOM   1148 N  NH2 . ARG A 1 150 ? -33.963 -17.783 -5.689  1.00 98.65  ? 150 ARG A NH2 1 
ATOM   1149 N  N   . ASP A 1 151 ? -30.683 -20.047 -0.989  1.00 98.65  ? 151 ASP A N   1 
ATOM   1150 C  CA  . ASP A 1 151 ? -29.350 -20.017 -1.599  1.00 98.65  ? 151 ASP A CA  1 
ATOM   1151 C  C   . ASP A 1 151 ? -28.394 -20.584 -0.543  1.00 98.65  ? 151 ASP A C   1 
ATOM   1152 O  O   . ASP A 1 151 ? -27.175 -20.645 -0.734  1.00 98.65  ? 151 ASP A O   1 
ATOM   1153 C  CB  . ASP A 1 151 ? -28.951 -18.574 -1.962  1.00 98.65  ? 151 ASP A CB  1 
ATOM   1154 C  CG  . ASP A 1 151 ? -29.935 -17.905 -2.923  1.00 98.65  ? 151 ASP A CG  1 
ATOM   1155 O  OD1 . ASP A 1 151 ? -29.643 -17.840 -4.139  1.00 98.65  ? 151 ASP A OD1 1 
ATOM   1156 O  OD2 . ASP A 1 151 ? -30.994 -17.431 -2.457  1.00 98.65  ? 151 ASP A OD2 1 
ATOM   1157 N  N   . HIS A 1 152 ? -28.994 -21.006 0.568   1.00 98.42  ? 152 HIS A N   1 
ATOM   1158 C  CA  . HIS A 1 152 ? -28.301 -21.581 1.708   1.00 98.42  ? 152 HIS A CA  1 
ATOM   1159 C  C   . HIS A 1 152 ? -28.785 -23.021 1.814   1.00 98.42  ? 152 HIS A C   1 
ATOM   1160 O  O   . HIS A 1 152 ? -29.954 -23.289 2.133   1.00 98.42  ? 152 HIS A O   1 
ATOM   1161 C  CB  . HIS A 1 152 ? -28.651 -20.780 2.953   1.00 98.65  ? 152 HIS A CB  1 
ATOM   1162 C  CG  . HIS A 1 152 ? -28.680 -19.303 2.711   1.00 98.65  ? 152 HIS A CG  1 
ATOM   1163 N  ND1 . HIS A 1 152 ? -29.763 -18.669 2.133   1.00 98.65  ? 152 HIS A ND1 1 
ATOM   1164 C  CD2 . HIS A 1 152 ? -27.747 -18.348 2.910   1.00 98.65  ? 152 HIS A CD2 1 
ATOM   1165 C  CE1 . HIS A 1 152 ? -29.489 -17.387 1.989   1.00 98.65  ? 152 HIS A CE1 1 
ATOM   1166 N  NE2 . HIS A 1 152 ? -28.274 -17.161 2.451   1.00 98.65  ? 152 HIS A NE2 1 
ATOM   1167 N  N   . HIS A 1 153 ? -27.865 -23.933 1.506   1.00 96.11  ? 153 HIS A N   1 
ATOM   1168 C  CA  . HIS A 1 153 ? -28.115 -25.370 1.481   1.00 96.11  ? 153 HIS A CA  1 
ATOM   1169 C  C   . HIS A 1 153 ? -26.809 -26.160 1.563   1.00 96.11  ? 153 HIS A C   1 
ATOM   1170 O  O   . HIS A 1 153 ? -26.821 -27.378 1.738   1.00 96.11  ? 153 HIS A O   1 
ATOM   1171 C  CB  . HIS A 1 153 ? -28.830 -25.723 0.169   1.00 97.25  ? 153 HIS A CB  1 
ATOM   1172 C  CG  . HIS A 1 153 ? -28.360 -24.930 -1.024  1.00 97.25  ? 153 HIS A CG  1 
ATOM   1173 N  ND1 . HIS A 1 153 ? -27.177 -24.216 -1.037  1.00 97.25  ? 153 HIS A ND1 1 
ATOM   1174 C  CD2 . HIS A 1 153 ? -28.929 -24.723 -2.239  1.00 97.25  ? 153 HIS A CD2 1 
ATOM   1175 C  CE1 . HIS A 1 153 ? -27.041 -23.606 -2.202  1.00 97.25  ? 153 HIS A CE1 1 
ATOM   1176 N  NE2 . HIS A 1 153 ? -28.092 -23.898 -2.949  1.00 97.25  ? 153 HIS A NE2 1 
ATOM   1177 N  N   . GLY A 1 154 ? -25.694 -25.452 1.403   1.00 86.60  ? 154 GLY A N   1 
ATOM   1178 C  CA  . GLY A 1 154 ? -24.371 -26.056 1.435   1.00 86.60  ? 154 GLY A CA  1 
ATOM   1179 C  C   . GLY A 1 154 ? -23.449 -25.143 0.654   1.00 86.60  ? 154 GLY A C   1 
ATOM   1180 O  O   . GLY A 1 154 ? -22.710 -25.586 -0.227  1.00 86.60  ? 154 GLY A O   1 
ATOM   1181 N  N   . ALA A 1 155 ? -23.512 -23.857 0.997   1.00 98.39  ? 155 ALA A N   1 
ATOM   1182 C  CA  . ALA A 1 155 ? -22.745 -22.801 0.341   1.00 98.39  ? 155 ALA A CA  1 
ATOM   1183 C  C   . ALA A 1 155 ? -21.338 -22.534 0.877   1.00 98.39  ? 155 ALA A C   1 
ATOM   1184 O  O   . ALA A 1 155 ? -20.956 -23.032 1.936   1.00 98.39  ? 155 ALA A O   1 
ATOM   1185 C  CB  . ALA A 1 155 ? -23.558 -21.511 0.356   1.00 98.65  ? 155 ALA A CB  1 
ATOM   1186 N  N   . ASN A 1 156 ? -20.580 -21.742 0.117   1.00 43.54  ? 156 ASN A N   1 
ATOM   1187 C  CA  . ASN A 1 156 ? -19.219 -21.348 0.470   1.00 43.54  ? 156 ASN A CA  1 
ATOM   1188 C  C   . ASN A 1 156 ? -19.098 -19.813 0.476   1.00 43.54  ? 156 ASN A C   1 
ATOM   1189 O  O   . ASN A 1 156 ? -19.181 -19.177 -0.583  1.00 43.54  ? 156 ASN A O   1 
ATOM   1190 C  CB  . ASN A 1 156 ? -18.215 -21.949 -0.520  1.00 66.07  ? 156 ASN A CB  1 
ATOM   1191 C  CG  . ASN A 1 156 ? -17.600 -23.248 -0.021  1.00 66.07  ? 156 ASN A CG  1 
ATOM   1192 O  OD1 . ASN A 1 156 ? -16.857 -23.241 0.964   1.00 66.07  ? 156 ASN A OD1 1 
ATOM   1193 N  ND2 . ASN A 1 156 ? -17.921 -24.361 -0.694  1.00 66.07  ? 156 ASN A ND2 1 
ATOM   1194 N  N   . PHE A 1 157 ? -18.955 -19.232 1.675   1.00 32.26  ? 157 PHE A N   1 
ATOM   1195 C  CA  . PHE A 1 157 ? -18.815 -17.781 1.868   1.00 32.26  ? 157 PHE A CA  1 
ATOM   1196 C  C   . PHE A 1 157 ? -17.335 -17.433 1.938   1.00 32.26  ? 157 PHE A C   1 
ATOM   1197 O  O   . PHE A 1 157 ? -16.533 -18.230 2.426   1.00 32.26  ? 157 PHE A O   1 
ATOM   1198 C  CB  . PHE A 1 157 ? -19.474 -17.326 3.173   1.00 61.12  ? 157 PHE A CB  1 
ATOM   1199 C  CG  . PHE A 1 157 ? -20.971 -17.424 3.176   1.00 61.12  ? 157 PHE A CG  1 
ATOM   1200 C  CD1 . PHE A 1 157 ? -21.748 -16.276 3.206   1.00 61.12  ? 157 PHE A CD1 1 
ATOM   1201 C  CD2 . PHE A 1 157 ? -21.604 -18.659 3.205   1.00 61.12  ? 157 PHE A CD2 1 
ATOM   1202 C  CE1 . PHE A 1 157 ? -23.130 -16.355 3.264   1.00 61.12  ? 157 PHE A CE1 1 
ATOM   1203 C  CE2 . PHE A 1 157 ? -22.984 -18.747 3.261   1.00 61.12  ? 157 PHE A CE2 1 
ATOM   1204 C  CZ  . PHE A 1 157 ? -23.749 -17.594 3.295   1.00 61.12  ? 157 PHE A CZ  1 
ATOM   1205 N  N   . SER A 1 158 ? -16.986 -16.222 1.507   1.00 23.55  ? 158 SER A N   1 
ATOM   1206 C  CA  . SER A 1 158 ? -15.597 -15.788 1.506   1.00 23.55  ? 158 SER A CA  1 
ATOM   1207 C  C   . SER A 1 158 ? -15.470 -14.283 1.585   1.00 23.55  ? 158 SER A C   1 
ATOM   1208 O  O   . SER A 1 158 ? -16.451 -13.570 1.405   1.00 23.55  ? 158 SER A O   1 
ATOM   1209 C  CB  . SER A 1 158 ? -14.897 -16.291 0.251   1.00 85.95  ? 158 SER A CB  1 
ATOM   1210 O  OG  . SER A 1 158 ? -15.588 -15.846 -0.898  1.00 85.95  ? 158 SER A OG  1 
ATOM   1211 N  N   . CYS A 1 159 ? -14.240 -13.821 1.818   1.00 41.91  ? 159 CYS A N   1 
ATOM   1212 C  CA  . CYS A 1 159 ? -13.906 -12.402 1.948   1.00 41.91  ? 159 CYS A CA  1 
ATOM   1213 C  C   . CYS A 1 159 ? -12.696 -12.005 1.124   1.00 41.91  ? 159 CYS A C   1 
ATOM   1214 O  O   . CYS A 1 159 ? -11.606 -12.524 1.328   1.00 41.91  ? 159 CYS A O   1 
ATOM   1215 C  CB  . CYS A 1 159 ? -13.593 -12.069 3.406   1.00 39.32  ? 159 CYS A CB  1 
ATOM   1216 S  SG  . CYS A 1 159 ? -13.332 -10.290 3.723   1.00 39.32  ? 159 CYS A SG  1 
ATOM   1217 N  N   . ARG A 1 160 ? -12.875 -11.027 0.248   1.00 15.39  ? 160 ARG A N   1 
ATOM   1218 C  CA  . ARG A 1 160 ? -11.788 -10.547 -0.596  1.00 15.39  ? 160 ARG A CA  1 
ATOM   1219 C  C   . ARG A 1 160 ? -11.490 -9.072  -0.404  1.00 15.39  ? 160 ARG A C   1 
ATOM   1220 O  O   . ARG A 1 160 ? -12.295 -8.337  0.168   1.00 15.39  ? 160 ARG A O   1 
ATOM   1221 C  CB  . ARG A 1 160 ? -12.101 -10.806 -2.061  1.00 55.02  ? 160 ARG A CB  1 
ATOM   1222 C  CG  . ARG A 1 160 ? -11.085 -10.227 -3.025  1.00 55.02  ? 160 ARG A CG  1 
ATOM   1223 C  CD  . ARG A 1 160 ? -11.343 -10.721 -4.419  1.00 55.02  ? 160 ARG A CD  1 
ATOM   1224 N  NE  . ARG A 1 160 ? -12.771 -10.704 -4.705  1.00 55.02  ? 160 ARG A NE  1 
ATOM   1225 C  CZ  . ARG A 1 160 ? -13.306 -10.297 -5.846  1.00 55.02  ? 160 ARG A CZ  1 
ATOM   1226 N  NH1 . ARG A 1 160 ? -12.535 -9.864  -6.838  1.00 55.02  ? 160 ARG A NH1 1 
ATOM   1227 N  NH2 . ARG A 1 160 ? -14.622 -10.334 -5.988  1.00 55.02  ? 160 ARG A NH2 1 
ATOM   1228 N  N   . THR A 1 161 ? -10.295 -8.671  -0.840  1.00 20.25  ? 161 THR A N   1 
ATOM   1229 C  CA  . THR A 1 161 ? -9.831  -7.284  -0.772  1.00 20.25  ? 161 THR A CA  1 
ATOM   1230 C  C   . THR A 1 161 ? -9.508  -6.876  -2.184  1.00 20.25  ? 161 THR A C   1 
ATOM   1231 O  O   . THR A 1 161 ? -8.982  -7.693  -2.920  1.00 20.25  ? 161 THR A O   1 
ATOM   1232 C  CB  . THR A 1 161 ? -8.498  -7.132  -0.037  1.00 26.70  ? 161 THR A CB  1 
ATOM   1233 O  OG1 . THR A 1 161 ? -7.488  -7.895  -0.722  1.00 26.70  ? 161 THR A OG1 1 
ATOM   1234 C  CG2 . THR A 1 161 ? -8.622  -7.534  1.416   1.00 26.70  ? 161 THR A CG2 1 
ATOM   1235 N  N   . GLU A 1 162 ? -9.779  -5.610  -2.522  1.00 50.64  ? 162 GLU A N   1 
ATOM   1236 C  CA  . GLU A 1 162 ? -9.499  -5.030  -3.843  1.00 50.64  ? 162 GLU A CA  1 
ATOM   1237 C  C   . GLU A 1 162 ? -8.805  -3.656  -3.684  1.00 50.64  ? 162 GLU A C   1 
ATOM   1238 O  O   . GLU A 1 162 ? -9.413  -2.694  -3.203  1.00 50.64  ? 162 GLU A O   1 
ATOM   1239 C  CB  . GLU A 1 162 ? -10.792 -4.893  -4.665  1.00 80.19  ? 162 GLU A CB  1 
ATOM   1240 C  CG  . GLU A 1 162 ? -11.454 -6.227  -5.033  1.00 80.19  ? 162 GLU A CG  1 
ATOM   1241 C  CD  . GLU A 1 162 ? -12.708 -6.073  -5.891  1.00 80.19  ? 162 GLU A CD  1 
ATOM   1242 O  OE1 . GLU A 1 162 ? -12.747 -6.650  -6.997  1.00 80.19  ? 162 GLU A OE1 1 
ATOM   1243 O  OE2 . GLU A 1 162 ? -13.663 -5.390  -5.464  1.00 80.19  ? 162 GLU A OE2 1 
ATOM   1244 N  N   . LEU A 1 163 ? -7.516  -3.600  -4.033  1.00 32.06  ? 163 LEU A N   1 
ATOM   1245 C  CA  . LEU A 1 163 ? -6.695  -2.377  -3.955  1.00 32.06  ? 163 LEU A CA  1 
ATOM   1246 C  C   . LEU A 1 163 ? -6.488  -1.847  -5.360  1.00 32.06  ? 163 LEU A C   1 
ATOM   1247 O  O   . LEU A 1 163 ? -5.638  -2.336  -6.093  1.00 32.06  ? 163 LEU A O   1 
ATOM   1248 C  CB  . LEU A 1 163 ? -5.334  -2.681  -3.334  1.00 45.47  ? 163 LEU A CB  1 
ATOM   1249 C  CG  . LEU A 1 163 ? -4.366  -1.519  -3.134  1.00 45.47  ? 163 LEU A CG  1 
ATOM   1250 C  CD1 . LEU A 1 163 ? -4.898  -0.549  -2.100  1.00 45.47  ? 163 LEU A CD1 1 
ATOM   1251 C  CD2 . LEU A 1 163 ? -3.037  -2.077  -2.689  1.00 45.47  ? 163 LEU A CD2 1 
ATOM   1252 N  N   . ASP A 1 164 ? -7.244  -0.814  -5.708  1.00 48.23  ? 164 ASP A N   1 
ATOM   1253 C  CA  . ASP A 1 164 ? -7.216  -0.240  -7.043  1.00 48.23  ? 164 ASP A CA  1 
ATOM   1254 C  C   . ASP A 1 164 ? -6.141  0.784   -7.316  1.00 48.23  ? 164 ASP A C   1 
ATOM   1255 O  O   . ASP A 1 164 ? -6.258  1.938   -6.928  1.00 48.23  ? 164 ASP A O   1 
ATOM   1256 C  CB  . ASP A 1 164 ? -8.591  0.357   -7.374  1.00 58.78  ? 164 ASP A CB  1 
ATOM   1257 C  CG  . ASP A 1 164 ? -8.942  0.257   -8.850  1.00 58.78  ? 164 ASP A CG  1 
ATOM   1258 O  OD1 . ASP A 1 164 ? -8.360  -0.594  -9.552  1.00 58.78  ? 164 ASP A OD1 1 
ATOM   1259 O  OD2 . ASP A 1 164 ? -9.817  1.021   -9.308  1.00 58.78  ? 164 ASP A OD2 1 
ATOM   1260 N  N   . LEU A 1 165 ? -5.076  0.347   -7.972  1.00 56.23  ? 165 LEU A N   1 
ATOM   1261 C  CA  . LEU A 1 165 ? -3.997  1.248   -8.346  1.00 56.23  ? 165 LEU A CA  1 
ATOM   1262 C  C   . LEU A 1 165 ? -4.033  1.340   -9.846  1.00 56.23  ? 165 LEU A C   1 
ATOM   1263 O  O   . LEU A 1 165 ? -3.053  1.690   -10.492 1.00 56.23  ? 165 LEU A O   1 
ATOM   1264 C  CB  . LEU A 1 165 ? -2.647  0.735   -7.889  1.00 5.48   ? 165 LEU A CB  1 
ATOM   1265 C  CG  . LEU A 1 165 ? -2.554  0.697   -6.370  1.00 5.48   ? 165 LEU A CG  1 
ATOM   1266 C  CD1 . LEU A 1 165 ? -1.172  0.265   -5.959  1.00 5.48   ? 165 LEU A CD1 1 
ATOM   1267 C  CD2 . LEU A 1 165 ? -2.929  2.048   -5.770  1.00 5.48   ? 165 LEU A CD2 1 
ATOM   1268 N  N   . ARG A 1 166 ? -5.174  0.942   -10.391 1.00 17.25  ? 166 ARG A N   1 
ATOM   1269 C  CA  . ARG A 1 166 ? -5.417  1.007   -11.814 1.00 17.25  ? 166 ARG A CA  1 
ATOM   1270 C  C   . ARG A 1 166 ? -5.542  2.480   -12.206 1.00 17.25  ? 166 ARG A C   1 
ATOM   1271 O  O   . ARG A 1 166 ? -5.115  2.843   -13.279 1.00 17.25  ? 166 ARG A O   1 
ATOM   1272 C  CB  . ARG A 1 166 ? -6.660  0.207   -12.183 1.00 49.60  ? 166 ARG A CB  1 
ATOM   1273 C  CG  . ARG A 1 166 ? -6.502  -1.265  -11.888 1.00 49.60  ? 166 ARG A CG  1 
ATOM   1274 C  CD  . ARG A 1 166 ? -7.640  -2.072  -12.459 1.00 49.60  ? 166 ARG A CD  1 
ATOM   1275 N  NE  . ARG A 1 166 ? -8.898  -1.890  -11.733 1.00 49.60  ? 166 ARG A NE  1 
ATOM   1276 C  CZ  . ARG A 1 166 ? -10.032 -2.536  -12.016 1.00 49.60  ? 166 ARG A CZ  1 
ATOM   1277 N  NH1 . ARG A 1 166 ? -10.082 -3.408  -13.023 1.00 49.60  ? 166 ARG A NH1 1 
ATOM   1278 N  NH2 . ARG A 1 166 ? -11.110 -2.354  -11.257 1.00 49.60  ? 166 ARG A NH2 1 
ATOM   1279 N  N   . PRO A 1 167 ? -6.101  3.357   -11.334 1.00 40.47  ? 167 PRO A N   1 
ATOM   1280 C  CA  . PRO A 1 167 ? -6.173  4.755   -11.764 1.00 40.47  ? 167 PRO A CA  1 
ATOM   1281 C  C   . PRO A 1 167 ? -4.780  5.369   -11.972 1.00 40.47  ? 167 PRO A C   1 
ATOM   1282 O  O   . PRO A 1 167 ? -4.653  6.520   -12.361 1.00 40.47  ? 167 PRO A O   1 
ATOM   1283 C  CB  . PRO A 1 167 ? -6.935  5.433   -10.619 1.00 33.37  ? 167 PRO A CB  1 
ATOM   1284 C  CG  . PRO A 1 167 ? -6.687  4.569   -9.453  1.00 33.37  ? 167 PRO A CG  1 
ATOM   1285 C  CD  . PRO A 1 167 ? -6.811  3.199   -10.053 1.00 33.37  ? 167 PRO A CD  1 
ATOM   1286 N  N   . GLN A 1 168 ? -3.741  4.592   -11.701 1.00 11.04  ? 168 GLN A N   1 
ATOM   1287 C  CA  . GLN A 1 168 ? -2.370  5.032   -11.906 1.00 11.04  ? 168 GLN A CA  1 
ATOM   1288 C  C   . GLN A 1 168 ? -1.493  3.932   -12.538 1.00 11.04  ? 168 GLN A C   1 
ATOM   1289 O  O   . GLN A 1 168 ? -0.423  3.572   -12.033 1.00 11.04  ? 168 GLN A O   1 
ATOM   1290 C  CB  . GLN A 1 168 ? -1.760  5.584   -10.618 1.00 30.71  ? 168 GLN A CB  1 
ATOM   1291 C  CG  . GLN A 1 168 ? -2.262  4.934   -9.357  1.00 30.71  ? 168 GLN A CG  1 
ATOM   1292 C  CD  . GLN A 1 168 ? -3.355  5.730   -8.702  1.00 30.71  ? 168 GLN A CD  1 
ATOM   1293 O  OE1 . GLN A 1 168 ? -4.296  5.179   -8.148  1.00 30.71  ? 168 GLN A OE1 1 
ATOM   1294 N  NE2 . GLN A 1 168 ? -3.222  7.042   -8.738  1.00 30.71  ? 168 GLN A NE2 1 
ATOM   1295 N  N   . GLY A 1 169 ? -1.979  3.394   -13.647 1.00 89.98  ? 169 GLY A N   1 
ATOM   1296 C  CA  . GLY A 1 169 ? -1.240  2.383   -14.374 1.00 89.98  ? 169 GLY A CA  1 
ATOM   1297 C  C   . GLY A 1 169 ? -0.920  1.032   -13.759 1.00 89.98  ? 169 GLY A C   1 
ATOM   1298 O  O   . GLY A 1 169 ? -0.540  0.124   -14.502 1.00 89.98  ? 169 GLY A O   1 
ATOM   1299 N  N   . LEU A 1 170 ? -1.009  0.869   -12.440 1.00 56.50  ? 170 LEU A N   1 
ATOM   1300 C  CA  . LEU A 1 170 ? -0.708  -0.448  -11.860 1.00 56.50  ? 170 LEU A CA  1 
ATOM   1301 C  C   . LEU A 1 170 ? -1.873  -1.399  -12.107 1.00 56.50  ? 170 LEU A C   1 
ATOM   1302 O  O   . LEU A 1 170 ? -2.683  -1.179  -13.010 1.00 56.50  ? 170 LEU A O   1 
ATOM   1303 C  CB  . LEU A 1 170 ? -0.388  -0.348  -10.360 1.00 9.24   ? 170 LEU A CB  1 
ATOM   1304 C  CG  . LEU A 1 170 ? 0.871   0.434   -10.015 1.00 9.24   ? 170 LEU A CG  1 
ATOM   1305 C  CD1 . LEU A 1 170 ? 1.141   0.359   -8.548  1.00 9.24   ? 170 LEU A CD1 1 
ATOM   1306 C  CD2 . LEU A 1 170 ? 2.007   -0.158  -10.767 1.00 9.24   ? 170 LEU A CD2 1 
ATOM   1307 N  N   . GLU A 1 171 ? -1.931  -2.477  -11.341 1.00 36.02  ? 171 GLU A N   1 
ATOM   1308 C  CA  . GLU A 1 171 ? -3.024  -3.430  -11.485 1.00 36.02  ? 171 GLU A CA  1 
ATOM   1309 C  C   . GLU A 1 171 ? -3.959  -3.381  -10.271 1.00 36.02  ? 171 GLU A C   1 
ATOM   1310 O  O   . GLU A 1 171 ? -3.790  -2.552  -9.371  1.00 36.02  ? 171 GLU A O   1 
ATOM   1311 C  CB  . GLU A 1 171 ? -2.473  -4.848  -11.684 1.00 98.65  ? 171 GLU A CB  1 
ATOM   1312 C  CG  . GLU A 1 171 ? -1.575  -5.023  -12.923 1.00 98.65  ? 171 GLU A CG  1 
ATOM   1313 C  CD  . GLU A 1 171 ? -2.317  -4.912  -14.263 1.00 98.65  ? 171 GLU A CD  1 
ATOM   1314 O  OE1 . GLU A 1 171 ? -3.550  -4.701  -14.278 1.00 98.65  ? 171 GLU A OE1 1 
ATOM   1315 O  OE2 . GLU A 1 171 ? -1.657  -5.046  -15.318 1.00 98.65  ? 171 GLU A OE2 1 
ATOM   1316 N  N   . LEU A 1 172 ? -5.000  -4.205  -10.292 1.00 38.91  ? 172 LEU A N   1 
ATOM   1317 C  CA  . LEU A 1 172 ? -5.918  -4.270  -9.165  1.00 38.91  ? 172 LEU A CA  1 
ATOM   1318 C  C   . LEU A 1 172 ? -5.342  -5.364  -8.284  1.00 38.91  ? 172 LEU A C   1 
ATOM   1319 O  O   . LEU A 1 172 ? -5.214  -6.503  -8.714  1.00 38.91  ? 172 LEU A O   1 
ATOM   1320 C  CB  . LEU A 1 172 ? -7.317  -4.651  -9.634  1.00 9.12   ? 172 LEU A CB  1 
ATOM   1321 C  CG  . LEU A 1 172 ? -8.440  -4.750  -8.603  1.00 9.12   ? 172 LEU A CG  1 
ATOM   1322 C  CD1 . LEU A 1 172 ? -8.711  -3.421  -7.935  1.00 9.12   ? 172 LEU A CD1 1 
ATOM   1323 C  CD2 . LEU A 1 172 ? -9.691  -5.230  -9.308  1.00 9.12   ? 172 LEU A CD2 1 
ATOM   1324 N  N   . PHE A 1 173 ? -4.915  -5.002  -7.085  1.00 28.45  ? 173 PHE A N   1 
ATOM   1325 C  CA  . PHE A 1 173 ? -4.332  -5.973  -6.181  1.00 28.45  ? 173 PHE A CA  1 
ATOM   1326 C  C   . PHE A 1 173 ? -5.337  -6.472  -5.191  1.00 28.45  ? 173 PHE A C   1 
ATOM   1327 O  O   . PHE A 1 173 ? -5.604  -5.815  -4.185  1.00 28.45  ? 173 PHE A O   1 
ATOM   1328 C  CB  . PHE A 1 173 ? -3.156  -5.369  -5.450  1.00 4.32   ? 173 PHE A CB  1 
ATOM   1329 C  CG  . PHE A 1 173 ? -2.078  -4.945  -6.355  1.00 4.32   ? 173 PHE A CG  1 
ATOM   1330 C  CD1 . PHE A 1 173 ? -1.878  -3.606  -6.626  1.00 4.32   ? 173 PHE A CD1 1 
ATOM   1331 C  CD2 . PHE A 1 173 ? -1.304  -5.890  -6.994  1.00 4.32   ? 173 PHE A CD2 1 
ATOM   1332 C  CE1 . PHE A 1 173 ? -0.927  -3.216  -7.523  1.00 4.32   ? 173 PHE A CE1 1 
ATOM   1333 C  CE2 . PHE A 1 173 ? -0.354  -5.516  -7.888  1.00 4.32   ? 173 PHE A CE2 1 
ATOM   1334 C  CZ  . PHE A 1 173 ? -0.161  -4.177  -8.159  1.00 4.32   ? 173 PHE A CZ  1 
ATOM   1335 N  N   . GLU A 1 174 ? -5.825  -7.684  -5.445  1.00 57.12  ? 174 GLU A N   1 
ATOM   1336 C  CA  . GLU A 1 174 ? -6.827  -8.329  -4.606  1.00 57.12  ? 174 GLU A CA  1 
ATOM   1337 C  C   . GLU A 1 174 ? -6.388  -9.663  -4.019  1.00 57.12  ? 174 GLU A C   1 
ATOM   1338 O  O   . GLU A 1 174 ? -5.572  -10.364 -4.611  1.00 57.12  ? 174 GLU A O   1 
ATOM   1339 C  CB  . GLU A 1 174 ? -8.110  -8.513  -5.418  1.00 50.12  ? 174 GLU A CB  1 
ATOM   1340 C  CG  . GLU A 1 174 ? -7.930  -9.237  -6.734  1.00 50.12  ? 174 GLU A CG  1 
ATOM   1341 C  CD  . GLU A 1 174 ? -8.944  -8.798  -7.773  1.00 50.12  ? 174 GLU A CD  1 
ATOM   1342 O  OE1 . GLU A 1 174 ? -8.743  -9.117  -8.963  1.00 50.12  ? 174 GLU A OE1 1 
ATOM   1343 O  OE2 . GLU A 1 174 ? -9.930  -8.119  -7.409  1.00 50.12  ? 174 GLU A OE2 1 
ATOM   1344 N  N   . ASN A 1 175 ? -6.902  -9.989  -2.836  1.00 32.69  ? 175 ASN A N   1 
ATOM   1345 C  CA  . ASN A 1 175 ? -6.577  -11.262 -2.202  1.00 32.69  ? 175 ASN A CA  1 
ATOM   1346 C  C   . ASN A 1 175 ? -7.824  -11.952 -1.657  1.00 32.69  ? 175 ASN A C   1 
ATOM   1347 O  O   . ASN A 1 175 ? -8.549  -11.370 -0.845  1.00 32.69  ? 175 ASN A O   1 
ATOM   1348 C  CB  . ASN A 1 175 ? -5.558  -11.071 -1.078  1.00 42.19  ? 175 ASN A CB  1 
ATOM   1349 C  CG  . ASN A 1 175 ? -4.235  -10.555 -1.574  1.00 42.19  ? 175 ASN A CG  1 
ATOM   1350 O  OD1 . ASN A 1 175 ? -4.142  -9.398  -1.961  1.00 42.19  ? 175 ASN A OD1 1 
ATOM   1351 N  ND2 . ASN A 1 175 ? -3.210  -11.418 -1.562  1.00 42.19  ? 175 ASN A ND2 1 
ATOM   1352 N  N   . THR A 1 176 ? -8.091  -13.178 -2.115  1.00 19.91  ? 176 THR A N   1 
ATOM   1353 C  CA  . THR A 1 176 ? -9.258  -13.929 -1.648  1.00 19.91  ? 176 THR A CA  1 
ATOM   1354 C  C   . THR A 1 176 ? -8.910  -14.599 -0.326  1.00 19.91  ? 176 THR A C   1 
ATOM   1355 O  O   . THR A 1 176 ? -7.728  -14.807 -0.039  1.00 19.91  ? 176 THR A O   1 
ATOM   1356 C  CB  . THR A 1 176 ? -9.697  -14.992 -2.678  1.00 98.65  ? 176 THR A CB  1 
ATOM   1357 O  OG1 . THR A 1 176 ? -10.926 -15.607 -2.256  1.00 98.65  ? 176 THR A OG1 1 
ATOM   1358 C  CG2 . THR A 1 176 ? -8.611  -16.055 -2.841  1.00 98.65  ? 176 THR A CG2 1 
ATOM   1359 N  N   . SER A 1 177 ? -9.933  -14.914 0.478   1.00 70.53  ? 177 SER A N   1 
ATOM   1360 C  CA  . SER A 1 177 ? -9.753  -15.568 1.785   1.00 70.53  ? 177 SER A CA  1 
ATOM   1361 C  C   . SER A 1 177 ? -10.295 -16.999 1.867   1.00 70.53  ? 177 SER A C   1 
ATOM   1362 O  O   . SER A 1 177 ? -11.147 -17.409 1.067   1.00 70.53  ? 177 SER A O   1 
ATOM   1363 C  CB  . SER A 1 177 ? -10.373 -14.725 2.911   1.00 24.30  ? 177 SER A CB  1 
ATOM   1364 O  OG  . SER A 1 177 ? -11.775 -14.605 2.781   1.00 24.30  ? 177 SER A OG  1 
ATOM   1365 N  N   . ALA A 1 178 ? -9.785  -17.748 2.846   1.00 41.37  ? 178 ALA A N   1 
ATOM   1366 C  CA  . ALA A 1 178 ? -10.196 -19.127 3.084   1.00 41.37  ? 178 ALA A CA  1 
ATOM   1367 C  C   . ALA A 1 178 ? -11.706 -19.137 3.180   1.00 41.37  ? 178 ALA A C   1 
ATOM   1368 O  O   . ALA A 1 178 ? -12.279 -18.409 3.987   1.00 41.37  ? 178 ALA A O   1 
ATOM   1369 C  CB  . ALA A 1 178 ? -9.596  -19.625 4.355   1.00 15.50  ? 178 ALA A CB  1 
ATOM   1370 N  N   . PRO A 1 179 ? -12.360 -20.008 2.400   1.00 6.77   ? 179 PRO A N   1 
ATOM   1371 C  CA  . PRO A 1 179 ? -13.807 -20.202 2.292   1.00 6.77   ? 179 PRO A CA  1 
ATOM   1372 C  C   . PRO A 1 179 ? -14.526 -20.563 3.548   1.00 6.77   ? 179 PRO A C   1 
ATOM   1373 O  O   . PRO A 1 179 ? -13.920 -21.021 4.497   1.00 6.77   ? 179 PRO A O   1 
ATOM   1374 C  CB  . PRO A 1 179 ? -13.919 -21.335 1.282   1.00 98.61  ? 179 PRO A CB  1 
ATOM   1375 C  CG  . PRO A 1 179 ? -12.721 -22.156 1.598   1.00 98.61  ? 179 PRO A CG  1 
ATOM   1376 C  CD  . PRO A 1 179 ? -11.650 -21.098 1.711   1.00 98.61  ? 179 PRO A CD  1 
ATOM   1377 N  N   . TYR A 1 180 ? -15.840 -20.394 3.531   1.00 90.98  ? 180 TYR A N   1 
ATOM   1378 C  CA  . TYR A 1 180 ? -16.667 -20.739 4.674   1.00 90.98  ? 180 TYR A CA  1 
ATOM   1379 C  C   . TYR A 1 180 ? -17.574 -21.891 4.266   1.00 90.98  ? 180 TYR A C   1 
ATOM   1380 O  O   . TYR A 1 180 ? -18.554 -21.697 3.549   1.00 90.98  ? 180 TYR A O   1 
ATOM   1381 C  CB  . TYR A 1 180 ? -17.499 -19.536 5.119   1.00 72.87  ? 180 TYR A CB  1 
ATOM   1382 C  CG  . TYR A 1 180 ? -18.466 -19.830 6.246   1.00 72.87  ? 180 TYR A CG  1 
ATOM   1383 C  CD1 . TYR A 1 180 ? -18.009 -20.216 7.501   1.00 72.87  ? 180 TYR A CD1 1 
ATOM   1384 C  CD2 . TYR A 1 180 ? -19.841 -19.695 6.062   1.00 72.87  ? 180 TYR A CD2 1 
ATOM   1385 C  CE1 . TYR A 1 180 ? -18.894 -20.459 8.535   1.00 72.87  ? 180 TYR A CE1 1 
ATOM   1386 C  CE2 . TYR A 1 180 ? -20.727 -19.937 7.093   1.00 72.87  ? 180 TYR A CE2 1 
ATOM   1387 C  CZ  . TYR A 1 180 ? -20.244 -20.315 8.324   1.00 72.87  ? 180 TYR A CZ  1 
ATOM   1388 O  OH  . TYR A 1 180 ? -21.116 -20.551 9.351   1.00 72.87  ? 180 TYR A OH  1 
ATOM   1389 N  N   . GLN A 1 181 ? -17.199 -23.100 4.674   1.00 43.65  ? 181 GLN A N   1 
ATOM   1390 C  CA  . GLN A 1 181 ? -17.970 -24.300 4.374   1.00 43.65  ? 181 GLN A CA  1 
ATOM   1391 C  C   . GLN A 1 181 ? -19.270 -24.352 5.205   1.00 43.65  ? 181 GLN A C   1 
ATOM   1392 O  O   . GLN A 1 181 ? -19.292 -24.875 6.318   1.00 43.65  ? 181 GLN A O   1 
ATOM   1393 C  CB  . GLN A 1 181 ? -17.096 -25.560 4.577   1.00 94.40  ? 181 GLN A CB  1 
ATOM   1394 C  CG  . GLN A 1 181 ? -16.043 -25.817 3.458   1.00 94.40  ? 181 GLN A CG  1 
ATOM   1395 C  CD  . GLN A 1 181 ? -14.564 -25.778 3.921   1.00 94.40  ? 181 GLN A CD  1 
ATOM   1396 O  OE1 . GLN A 1 181 ? -13.699 -26.469 3.361   1.00 94.40  ? 181 GLN A OE1 1 
ATOM   1397 N  NE2 . GLN A 1 181 ? -14.277 -24.953 4.922   1.00 94.40  ? 181 GLN A NE2 1 
ATOM   1398 N  N   . LEU A 1 182 ? -20.332 -23.747 4.665   1.00 51.06  ? 182 LEU A N   1 
ATOM   1399 C  CA  . LEU A 1 182 ? -21.638 -23.720 5.321   1.00 51.06  ? 182 LEU A CA  1 
ATOM   1400 C  C   . LEU A 1 182 ? -22.458 -24.895 4.826   1.00 51.06  ? 182 LEU A C   1 
ATOM   1401 O  O   . LEU A 1 182 ? -22.518 -25.149 3.626   1.00 51.06  ? 182 LEU A O   1 
ATOM   1402 C  CB  . LEU A 1 182 ? -22.385 -22.423 4.997   1.00 34.38  ? 182 LEU A CB  1 
ATOM   1403 C  CG  . LEU A 1 182 ? -23.791 -22.256 5.590   1.00 34.38  ? 182 LEU A CG  1 
ATOM   1404 C  CD1 . LEU A 1 182 ? -23.718 -22.442 7.081   1.00 34.38  ? 182 LEU A CD1 1 
ATOM   1405 C  CD2 . LEU A 1 182 ? -24.386 -20.882 5.261   1.00 34.38  ? 182 LEU A CD2 1 
ATOM   1406 N  N   . GLN A 1 183 ? -23.091 -25.595 5.758   1.00 51.03  ? 183 GLN A N   1 
ATOM   1407 C  CA  . GLN A 1 183 ? -23.905 -26.754 5.436   1.00 51.03  ? 183 GLN A CA  1 
ATOM   1408 C  C   . GLN A 1 183 ? -25.276 -26.689 6.088   1.00 51.03  ? 183 GLN A C   1 
ATOM   1409 O  O   . GLN A 1 183 ? -25.407 -26.234 7.220   1.00 51.03  ? 183 GLN A O   1 
ATOM   1410 C  CB  . GLN A 1 183 ? -23.188 -28.033 5.865   1.00 67.71  ? 183 GLN A CB  1 
ATOM   1411 C  CG  . GLN A 1 183 ? -21.994 -28.382 4.996   1.00 67.71  ? 183 GLN A CG  1 
ATOM   1412 C  CD  . GLN A 1 183 ? -21.223 -29.597 5.488   1.00 67.71  ? 183 GLN A CD  1 
ATOM   1413 O  OE1 . GLN A 1 183 ? -20.419 -29.493 6.419   1.00 67.71  ? 183 GLN A OE1 1 
ATOM   1414 N  NE2 . GLN A 1 183 ? -21.442 -30.753 4.845   1.00 67.71  ? 183 GLN A NE2 1 
ATOM   1415 N  N   . THR A 1 184 ? -26.291 -27.118 5.337   1.00 98.65  ? 184 THR A N   1 
ATOM   1416 C  CA  . THR A 1 184 ? -27.691 -27.157 5.780   1.00 98.65  ? 184 THR A CA  1 
ATOM   1417 C  C   . THR A 1 184 ? -28.651 -27.303 4.582   1.00 98.65  ? 184 THR A C   1 
ATOM   1418 O  O   . THR A 1 184 ? -28.547 -28.300 3.825   1.00 98.65  ? 184 THR A O   1 
ATOM   1419 C  CB  . THR A 1 184 ? -28.095 -25.890 6.612   1.00 55.83  ? 184 THR A CB  1 
ATOM   1420 O  OG1 . THR A 1 184 ? -29.295 -26.170 7.354   1.00 55.83  ? 184 THR A OG1 1 
ATOM   1421 C  CG2 . THR A 1 184 ? -28.307 -24.659 5.701   1.00 55.83  ? 184 THR A CG2 1 
ATOM   1422 N  N   . VAL B 2 1   ? 26.381  27.924  35.339  1.00 98.62  ? 130 VAL B N   1 
ATOM   1423 C  CA  . VAL B 2 1   ? 26.545  27.600  33.895  1.00 98.62  ? 130 VAL B CA  1 
ATOM   1424 C  C   . VAL B 2 1   ? 25.219  27.617  33.171  1.00 98.62  ? 130 VAL B C   1 
ATOM   1425 O  O   . VAL B 2 1   ? 24.296  26.865  33.502  1.00 98.62  ? 130 VAL B O   1 
ATOM   1426 C  CB  . VAL B 2 1   ? 27.229  26.233  33.694  1.00 72.21  ? 130 VAL B CB  1 
ATOM   1427 C  CG1 . VAL B 2 1   ? 26.983  25.689  32.301  1.00 72.21  ? 130 VAL B CG1 1 
ATOM   1428 C  CG2 . VAL B 2 1   ? 28.719  26.364  33.945  1.00 72.21  ? 130 VAL B CG2 1 
ATOM   1429 N  N   . ASP B 2 2   ? 25.127  28.498  32.188  1.00 77.40  ? 131 ASP B N   1 
ATOM   1430 C  CA  . ASP B 2 2   ? 23.916  28.620  31.394  1.00 77.40  ? 131 ASP B CA  1 
ATOM   1431 C  C   . ASP B 2 2   ? 24.056  27.749  30.152  1.00 77.40  ? 131 ASP B C   1 
ATOM   1432 O  O   . ASP B 2 2   ? 24.618  28.165  29.130  1.00 77.40  ? 131 ASP B O   1 
ATOM   1433 C  CB  . ASP B 2 2   ? 23.677  30.086  31.031  1.00 98.65  ? 131 ASP B CB  1 
ATOM   1434 C  CG  . ASP B 2 2   ? 23.574  30.977  32.272  1.00 98.65  ? 131 ASP B CG  1 
ATOM   1435 O  OD1 . ASP B 2 2   ? 22.844  30.609  33.224  1.00 98.65  ? 131 ASP B OD1 1 
ATOM   1436 O  OD2 . ASP B 2 2   ? 24.227  32.043  32.296  1.00 98.65  ? 131 ASP B OD2 1 
ATOM   1437 N  N   . LEU B 2 3   ? 23.620  26.497  30.289  1.00 65.85  ? 132 LEU B N   1 
ATOM   1438 C  CA  . LEU B 2 3   ? 23.674  25.507  29.223  1.00 65.85  ? 132 LEU B CA  1 
ATOM   1439 C  C   . LEU B 2 3   ? 22.480  25.599  28.269  1.00 65.85  ? 132 LEU B C   1 
ATOM   1440 O  O   . LEU B 2 3   ? 21.387  26.017  28.648  1.00 65.85  ? 132 LEU B O   1 
ATOM   1441 C  CB  . LEU B 2 3   ? 23.787  24.092  29.830  1.00 80.05  ? 132 LEU B CB  1 
ATOM   1442 C  CG  . LEU B 2 3   ? 24.030  22.877  28.910  1.00 80.05  ? 132 LEU B CG  1 
ATOM   1443 C  CD1 . LEU B 2 3   ? 24.701  21.764  29.701  1.00 80.05  ? 132 LEU B CD1 1 
ATOM   1444 C  CD2 . LEU B 2 3   ? 22.731  22.404  28.297  1.00 80.05  ? 132 LEU B CD2 1 
ATOM   1445 N  N   . VAL B 2 4   ? 22.719  25.178  27.030  1.00 73.66  ? 133 VAL B N   1 
ATOM   1446 C  CA  . VAL B 2 4   ? 21.684  25.188  26.004  1.00 73.66  ? 133 VAL B CA  1 
ATOM   1447 C  C   . VAL B 2 4   ? 21.655  23.920  25.154  1.00 73.66  ? 133 VAL B C   1 
ATOM   1448 O  O   . VAL B 2 4   ? 22.688  23.377  24.773  1.00 73.66  ? 133 VAL B O   1 
ATOM   1449 C  CB  . VAL B 2 4   ? 21.826  26.434  25.080  1.00 98.65  ? 133 VAL B CB  1 
ATOM   1450 C  CG1 . VAL B 2 4   ? 21.059  26.240  23.778  1.00 98.65  ? 133 VAL B CG1 1 
ATOM   1451 C  CG2 . VAL B 2 4   ? 21.285  27.657  25.795  1.00 98.65  ? 133 VAL B CG2 1 
ATOM   1452 N  N   . PHE B 2 5   ? 20.443  23.439  24.919  1.00 38.06  ? 134 PHE B N   1 
ATOM   1453 C  CA  . PHE B 2 5   ? 20.197  22.272  24.100  1.00 38.06  ? 134 PHE B CA  1 
ATOM   1454 C  C   . PHE B 2 5   ? 19.760  22.796  22.729  1.00 38.06  ? 134 PHE B C   1 
ATOM   1455 O  O   . PHE B 2 5   ? 18.864  23.632  22.614  1.00 38.06  ? 134 PHE B O   1 
ATOM   1456 C  CB  . PHE B 2 5   ? 19.085  21.412  24.719  1.00 48.59  ? 134 PHE B CB  1 
ATOM   1457 C  CG  . PHE B 2 5   ? 19.488  20.702  25.993  1.00 48.59  ? 134 PHE B CG  1 
ATOM   1458 C  CD1 . PHE B 2 5   ? 20.791  20.252  26.177  1.00 48.59  ? 134 PHE B CD1 1 
ATOM   1459 C  CD2 . PHE B 2 5   ? 18.562  20.472  27.005  1.00 48.59  ? 134 PHE B CD2 1 
ATOM   1460 C  CE1 . PHE B 2 5   ? 21.166  19.584  27.350  1.00 48.59  ? 134 PHE B CE1 1 
ATOM   1461 C  CE2 . PHE B 2 5   ? 18.936  19.801  28.186  1.00 48.59  ? 134 PHE B CE2 1 
ATOM   1462 C  CZ  . PHE B 2 5   ? 20.236  19.360  28.354  1.00 48.59  ? 134 PHE B CZ  1 
ATOM   1463 N  N   . LEU B 2 6   ? 20.445  22.347  21.695  1.00 39.96  ? 135 LEU B N   1 
ATOM   1464 C  CA  . LEU B 2 6   ? 20.152  22.747  20.328  1.00 39.96  ? 135 LEU B CA  1 
ATOM   1465 C  C   . LEU B 2 6   ? 19.871  21.449  19.543  1.00 39.96  ? 135 LEU B C   1 
ATOM   1466 O  O   . LEU B 2 6   ? 20.781  20.837  18.964  1.00 39.96  ? 135 LEU B O   1 
ATOM   1467 C  CB  . LEU B 2 6   ? 21.358  23.506  19.758  1.00 10.99  ? 135 LEU B CB  1 
ATOM   1468 C  CG  . LEU B 2 6   ? 21.294  23.917  18.289  1.00 10.99  ? 135 LEU B CG  1 
ATOM   1469 C  CD1 . LEU B 2 6   ? 20.213  24.977  18.036  1.00 10.99  ? 135 LEU B CD1 1 
ATOM   1470 C  CD2 . LEU B 2 6   ? 22.666  24.397  17.862  1.00 10.99  ? 135 LEU B CD2 1 
ATOM   1471 N  N   . PHE B 2 7   ? 18.609  21.028  19.541  1.00 45.54  ? 136 PHE B N   1 
ATOM   1472 C  CA  . PHE B 2 7   ? 18.216  19.793  18.876  1.00 45.54  ? 136 PHE B CA  1 
ATOM   1473 C  C   . PHE B 2 7   ? 17.715  19.945  17.453  1.00 45.54  ? 136 PHE B C   1 
ATOM   1474 O  O   . PHE B 2 7   ? 17.076  20.945  17.108  1.00 45.54  ? 136 PHE B O   1 
ATOM   1475 C  CB  . PHE B 2 7   ? 17.187  19.054  19.714  1.00 50.44  ? 136 PHE B CB  1 
ATOM   1476 C  CG  . PHE B 2 7   ? 15.965  19.853  20.001  1.00 50.44  ? 136 PHE B CG  1 
ATOM   1477 C  CD1 . PHE B 2 7   ? 16.058  21.087  20.622  1.00 50.44  ? 136 PHE B CD1 1 
ATOM   1478 C  CD2 . PHE B 2 7   ? 14.714  19.369  19.661  1.00 50.44  ? 136 PHE B CD2 1 
ATOM   1479 C  CE1 . PHE B 2 7   ? 14.924  21.822  20.907  1.00 50.44  ? 136 PHE B CE1 1 
ATOM   1480 C  CE2 . PHE B 2 7   ? 13.568  20.100  19.942  1.00 50.44  ? 136 PHE B CE2 1 
ATOM   1481 C  CZ  . PHE B 2 7   ? 13.679  21.327  20.565  1.00 50.44  ? 136 PHE B CZ  1 
ATOM   1482 N  N   . ASP B 2 8   ? 17.989  18.900  16.665  1.00 29.23  ? 137 ASP B N   1 
ATOM   1483 C  CA  . ASP B 2 8   ? 17.667  18.762  15.234  1.00 29.23  ? 137 ASP B CA  1 
ATOM   1484 C  C   . ASP B 2 8   ? 16.213  18.350  14.941  1.00 29.23  ? 137 ASP B C   1 
ATOM   1485 O  O   . ASP B 2 8   ? 15.832  17.184  15.081  1.00 29.23  ? 137 ASP B O   1 
ATOM   1486 C  CB  . ASP B 2 8   ? 18.662  17.747  14.627  1.00 29.27  ? 137 ASP B CB  1 
ATOM   1487 C  CG  . ASP B 2 8   ? 18.436  17.467  13.150  1.00 29.27  ? 137 ASP B CG  1 
ATOM   1488 O  OD1 . ASP B 2 8   ? 19.250  16.718  12.575  1.00 29.27  ? 137 ASP B OD1 1 
ATOM   1489 O  OD2 . ASP B 2 8   ? 17.466  17.964  12.554  1.00 29.27  ? 137 ASP B OD2 1 
ATOM   1490 N  N   . GLY B 2 9   ? 15.434  19.298  14.437  1.00 49.33  ? 138 GLY B N   1 
ATOM   1491 C  CA  . GLY B 2 9   ? 14.048  19.013  14.117  1.00 49.33  ? 138 GLY B CA  1 
ATOM   1492 C  C   . GLY B 2 9   ? 13.820  18.944  12.625  1.00 49.33  ? 138 GLY B C   1 
ATOM   1493 O  O   . GLY B 2 9   ? 12.801  19.416  12.133  1.00 49.33  ? 138 GLY B O   1 
ATOM   1494 N  N   . SER B 2 10  ? 14.776  18.362  11.906  1.00 60.10  ? 139 SER B N   1 
ATOM   1495 C  CA  . SER B 2 10  ? 14.692  18.224  10.452  1.00 60.10  ? 139 SER B CA  1 
ATOM   1496 C  C   . SER B 2 10  ? 14.086  16.902  10.018  1.00 60.10  ? 139 SER B C   1 
ATOM   1497 O  O   . SER B 2 10  ? 14.139  15.923  10.749  1.00 60.10  ? 139 SER B O   1 
ATOM   1498 C  CB  . SER B 2 10  ? 16.077  18.370  9.821   1.00 22.48  ? 139 SER B CB  1 
ATOM   1499 O  OG  . SER B 2 10  ? 16.875  17.213  9.977   1.00 22.48  ? 139 SER B OG  1 
ATOM   1500 N  N   . MET B 2 11  ? 13.553  16.876  8.801   1.00 25.05  ? 140 MET B N   1 
ATOM   1501 C  CA  . MET B 2 11  ? 12.940  15.679  8.220   1.00 25.05  ? 140 MET B CA  1 
ATOM   1502 C  C   . MET B 2 11  ? 13.792  14.418  8.295   1.00 25.05  ? 140 MET B C   1 
ATOM   1503 O  O   . MET B 2 11  ? 13.294  13.346  8.645   1.00 25.05  ? 140 MET B O   1 
ATOM   1504 C  CB  . MET B 2 11  ? 12.601  15.913  6.736   1.00 55.50  ? 140 MET B CB  1 
ATOM   1505 C  CG  . MET B 2 11  ? 12.274  14.628  5.972   1.00 55.50  ? 140 MET B CG  1 
ATOM   1506 S  SD  . MET B 2 11  ? 11.710  14.803  4.267   1.00 55.50  ? 140 MET B SD  1 
ATOM   1507 C  CE  . MET B 2 11  ? 10.085  15.504  4.552   1.00 55.50  ? 140 MET B CE  1 
ATOM   1508 N  N   . SER B 2 12  ? 15.090  14.594  8.102   1.00 38.24  ? 141 SER B N   1 
ATOM   1509 C  CA  . SER B 2 12  ? 16.031  13.496  7.995   1.00 38.24  ? 141 SER B CA  1 
ATOM   1510 C  C   . SER B 2 12  ? 16.147  12.561  9.178   1.00 38.24  ? 141 SER B C   1 
ATOM   1511 O  O   . SER B 2 12  ? 16.912  11.586  9.141   1.00 38.24  ? 141 SER B O   1 
ATOM   1512 C  CB  . SER B 2 12  ? 17.377  14.032  7.630   1.00 42.88  ? 141 SER B CB  1 
ATOM   1513 O  OG  . SER B 2 12  ? 17.974  14.909  8.569   1.00 42.88  ? 141 SER B OG  1 
ATOM   1514 N  N   . LEU B 2 13  ? 15.447  12.883  10.256  1.00 45.18  ? 142 LEU B N   1 
ATOM   1515 C  CA  . LEU B 2 13  ? 15.448  12.020  11.423  1.00 45.18  ? 142 LEU B CA  1 
ATOM   1516 C  C   . LEU B 2 13  ? 14.123  11.263  11.444  1.00 45.18  ? 142 LEU B C   1 
ATOM   1517 O  O   . LEU B 2 13  ? 13.062  11.845  11.161  1.00 45.18  ? 142 LEU B O   1 
ATOM   1518 C  CB  . LEU B 2 13  ? 15.613  12.834  12.706  1.00 32.35  ? 142 LEU B CB  1 
ATOM   1519 C  CG  . LEU B 2 13  ? 16.971  13.476  13.002  1.00 32.35  ? 142 LEU B CG  1 
ATOM   1520 C  CD1 . LEU B 2 13  ? 16.871  14.180  14.358  1.00 32.35  ? 142 LEU B CD1 1 
ATOM   1521 C  CD2 . LEU B 2 13  ? 18.102  12.431  12.989  1.00 32.35  ? 142 LEU B CD2 1 
ATOM   1522 N  N   . GLN B 2 14  ? 14.202  9.961   11.726  1.00 59.54  ? 143 GLN B N   1 
ATOM   1523 C  CA  . GLN B 2 14  ? 13.021  9.101   11.794  1.00 59.54  ? 143 GLN B CA  1 
ATOM   1524 C  C   . GLN B 2 14  ? 12.092  9.742   12.814  1.00 59.54  ? 143 GLN B C   1 
ATOM   1525 O  O   . GLN B 2 14  ? 12.543  10.190  13.871  1.00 59.54  ? 143 GLN B O   1 
ATOM   1526 C  CB  . GLN B 2 14  ? 13.382  7.691   12.278  1.00 80.12  ? 143 GLN B CB  1 
ATOM   1527 C  CG  . GLN B 2 14  ? 14.593  7.035   11.636  1.00 80.12  ? 143 GLN B CG  1 
ATOM   1528 C  CD  . GLN B 2 14  ? 14.352  6.556   10.238  1.00 80.12  ? 143 GLN B CD  1 
ATOM   1529 O  OE1 . GLN B 2 14  ? 13.213  6.486   9.774   1.00 80.12  ? 143 GLN B OE1 1 
ATOM   1530 N  NE2 . GLN B 2 14  ? 15.431  6.209   9.549   1.00 80.12  ? 143 GLN B NE2 1 
ATOM   1531 N  N   . PRO B 2 15  ? 10.782  9.782   12.520  1.00 35.29  ? 144 PRO B N   1 
ATOM   1532 C  CA  . PRO B 2 15  ? 9.769   10.374  13.408  1.00 35.29  ? 144 PRO B CA  1 
ATOM   1533 C  C   . PRO B 2 15  ? 9.897   9.960   14.874  1.00 35.29  ? 144 PRO B C   1 
ATOM   1534 O  O   . PRO B 2 15  ? 9.396   10.635  15.776  1.00 35.29  ? 144 PRO B O   1 
ATOM   1535 C  CB  . PRO B 2 15  ? 8.447   9.920   12.777  1.00 97.66  ? 144 PRO B CB  1 
ATOM   1536 C  CG  . PRO B 2 15  ? 8.841   8.732   11.903  1.00 97.66  ? 144 PRO B CG  1 
ATOM   1537 C  CD  . PRO B 2 15  ? 10.150  9.166   11.342  1.00 97.66  ? 144 PRO B CD  1 
ATOM   1538 N  N   . ASP B 2 16  ? 10.602  8.860   15.102  1.00 39.94  ? 145 ASP B N   1 
ATOM   1539 C  CA  . ASP B 2 16  ? 10.819  8.361   16.444  1.00 39.94  ? 145 ASP B CA  1 
ATOM   1540 C  C   . ASP B 2 16  ? 12.020  9.051   17.047  1.00 39.94  ? 145 ASP B C   1 
ATOM   1541 O  O   . ASP B 2 16  ? 11.919  9.603   18.133  1.00 39.94  ? 145 ASP B O   1 
ATOM   1542 C  CB  . ASP B 2 16  ? 11.029  6.842   16.442  1.00 78.96  ? 145 ASP B CB  1 
ATOM   1543 C  CG  . ASP B 2 16  ? 12.115  6.397   15.483  1.00 78.96  ? 145 ASP B CG  1 
ATOM   1544 O  OD1 . ASP B 2 16  ? 11.759  6.002   14.359  1.00 78.96  ? 145 ASP B OD1 1 
ATOM   1545 O  OD2 . ASP B 2 16  ? 13.311  6.428   15.850  1.00 78.96  ? 145 ASP B OD2 1 
ATOM   1546 N  N   . GLU B 2 17  ? 13.128  9.058   16.304  1.00 43.60  ? 146 GLU B N   1 
ATOM   1547 C  CA  . GLU B 2 17  ? 14.399  9.663   16.715  1.00 43.60  ? 146 GLU B CA  1 
ATOM   1548 C  C   . GLU B 2 17  ? 14.278  11.045  17.353  1.00 43.60  ? 146 GLU B C   1 
ATOM   1549 O  O   . GLU B 2 17  ? 15.176  11.484  18.071  1.00 43.60  ? 146 GLU B O   1 
ATOM   1550 C  CB  . GLU B 2 17  ? 15.347  9.732   15.520  1.00 60.23  ? 146 GLU B CB  1 
ATOM   1551 C  CG  . GLU B 2 17  ? 15.760  8.364   14.978  1.00 60.23  ? 146 GLU B CG  1 
ATOM   1552 C  CD  . GLU B 2 17  ? 16.541  8.445   13.666  1.00 60.23  ? 146 GLU B CD  1 
ATOM   1553 O  OE1 . GLU B 2 17  ? 16.471  9.492   12.984  1.00 60.23  ? 146 GLU B OE1 1 
ATOM   1554 O  OE2 . GLU B 2 17  ? 17.208  7.446   13.303  1.00 60.23  ? 146 GLU B OE2 1 
ATOM   1555 N  N   . PHE B 2 18  ? 13.162  11.715  17.079  1.00 38.16  ? 147 PHE B N   1 
ATOM   1556 C  CA  . PHE B 2 18  ? 12.854  13.041  17.614  1.00 38.16  ? 147 PHE B CA  1 
ATOM   1557 C  C   . PHE B 2 18  ? 12.608  12.898  19.104  1.00 38.16  ? 147 PHE B C   1 
ATOM   1558 O  O   . PHE B 2 18  ? 13.137  13.671  19.903  1.00 38.16  ? 147 PHE B O   1 
ATOM   1559 C  CB  . PHE B 2 18  ? 11.583  13.580  16.935  1.00 42.53  ? 147 PHE B CB  1 
ATOM   1560 C  CG  . PHE B 2 18  ? 11.195  14.983  17.349  1.00 42.53  ? 147 PHE B CG  1 
ATOM   1561 C  CD1 . PHE B 2 18  ? 12.101  16.030  17.247  1.00 42.53  ? 147 PHE B CD1 1 
ATOM   1562 C  CD2 . PHE B 2 18  ? 9.900   15.259  17.793  1.00 42.53  ? 147 PHE B CD2 1 
ATOM   1563 C  CE1 . PHE B 2 18  ? 11.721  17.333  17.574  1.00 42.53  ? 147 PHE B CE1 1 
ATOM   1564 C  CE2 . PHE B 2 18  ? 9.512   16.558  18.123  1.00 42.53  ? 147 PHE B CE2 1 
ATOM   1565 C  CZ  . PHE B 2 18  ? 10.424  17.597  18.013  1.00 42.53  ? 147 PHE B CZ  1 
ATOM   1566 N  N   . GLN B 2 19  ? 11.792  11.897  19.451  1.00 53.51  ? 148 GLN B N   1 
ATOM   1567 C  CA  . GLN B 2 19  ? 11.416  11.593  20.827  1.00 53.51  ? 148 GLN B CA  1 
ATOM   1568 C  C   . GLN B 2 19  ? 12.523  10.857  21.580  1.00 53.51  ? 148 GLN B C   1 
ATOM   1569 O  O   . GLN B 2 19  ? 12.573  10.906  22.799  1.00 53.51  ? 148 GLN B O   1 
ATOM   1570 C  CB  . GLN B 2 19  ? 10.109  10.793  20.852  1.00 88.14  ? 148 GLN B CB  1 
ATOM   1571 C  CG  . GLN B 2 19  ? 9.250   11.019  22.099  1.00 88.14  ? 148 GLN B CG  1 
ATOM   1572 C  CD  . GLN B 2 19  ? 8.690   12.445  22.216  1.00 88.14  ? 148 GLN B CD  1 
ATOM   1573 O  OE1 . GLN B 2 19  ? 8.308   13.064  21.219  1.00 88.14  ? 148 GLN B OE1 1 
ATOM   1574 N  NE2 . GLN B 2 19  ? 8.621   12.957  23.447  1.00 88.14  ? 148 GLN B NE2 1 
ATOM   1575 N  N   . LYS B 2 20  ? 13.410  10.172  20.861  1.00 68.30  ? 149 LYS B N   1 
ATOM   1576 C  CA  . LYS B 2 20  ? 14.531  9.468   21.497  1.00 68.30  ? 149 LYS B CA  1 
ATOM   1577 C  C   . LYS B 2 20  ? 15.549  10.524  21.910  1.00 68.30  ? 149 LYS B C   1 
ATOM   1578 O  O   . LYS B 2 20  ? 16.321  10.326  22.845  1.00 68.30  ? 149 LYS B O   1 
ATOM   1579 C  CB  . LYS B 2 20  ? 15.193  8.480   20.531  1.00 71.99  ? 149 LYS B CB  1 
ATOM   1580 C  CG  . LYS B 2 20  ? 14.247  7.461   19.896  1.00 71.99  ? 149 LYS B CG  1 
ATOM   1581 C  CD  . LYS B 2 20  ? 13.582  6.565   20.929  1.00 71.99  ? 149 LYS B CD  1 
ATOM   1582 C  CE  . LYS B 2 20  ? 12.569  5.648   20.274  1.00 71.99  ? 149 LYS B CE  1 
ATOM   1583 N  NZ  . LYS B 2 20  ? 11.846  4.837   21.278  1.00 71.99  ? 149 LYS B NZ  1 
ATOM   1584 N  N   . ILE B 2 21  ? 15.548  11.633  21.168  1.00 69.43  ? 150 ILE B N   1 
ATOM   1585 C  CA  . ILE B 2 21  ? 16.423  12.779  21.411  1.00 69.43  ? 150 ILE B CA  1 
ATOM   1586 C  C   . ILE B 2 21  ? 16.005  13.467  22.706  1.00 69.43  ? 150 ILE B C   1 
ATOM   1587 O  O   . ILE B 2 21  ? 16.837  13.733  23.578  1.00 69.43  ? 150 ILE B O   1 
ATOM   1588 C  CB  . ILE B 2 21  ? 16.374  13.800  20.214  1.00 81.20  ? 150 ILE B CB  1 
ATOM   1589 C  CG1 . ILE B 2 21  ? 17.467  13.480  19.195  1.00 81.20  ? 150 ILE B CG1 1 
ATOM   1590 C  CG2 . ILE B 2 21  ? 16.528  15.239  20.689  1.00 81.20  ? 150 ILE B CG2 1 
ATOM   1591 C  CD1 . ILE B 2 21  ? 17.593  14.501  18.094  1.00 81.20  ? 150 ILE B CD1 1 
ATOM   1592 N  N   . LEU B 2 22  ? 14.706  13.728  22.828  1.00 60.24  ? 151 LEU B N   1 
ATOM   1593 C  CA  . LEU B 2 22  ? 14.154  14.384  24.006  1.00 60.24  ? 151 LEU B CA  1 
ATOM   1594 C  C   . LEU B 2 22  ? 14.510  13.598  25.276  1.00 60.24  ? 151 LEU B C   1 
ATOM   1595 O  O   . LEU B 2 22  ? 14.940  14.167  26.282  1.00 60.24  ? 151 LEU B O   1 
ATOM   1596 C  CB  . LEU B 2 22  ? 12.635  14.513  23.868  1.00 14.02  ? 151 LEU B CB  1 
ATOM   1597 C  CG  . LEU B 2 22  ? 12.048  14.943  22.527  1.00 14.02  ? 151 LEU B CG  1 
ATOM   1598 C  CD1 . LEU B 2 22  ? 10.656  15.530  22.770  1.00 14.02  ? 151 LEU B CD1 1 
ATOM   1599 C  CD2 . LEU B 2 22  ? 12.929  15.969  21.867  1.00 14.02  ? 151 LEU B CD2 1 
ATOM   1600 N  N   . ASP B 2 23  ? 14.354  12.281  25.201  1.00 95.88  ? 152 ASP B N   1 
ATOM   1601 C  CA  . ASP B 2 23  ? 14.673  11.398  26.310  1.00 95.88  ? 152 ASP B CA  1 
ATOM   1602 C  C   . ASP B 2 23  ? 16.074  11.725  26.817  1.00 95.88  ? 152 ASP B C   1 
ATOM   1603 O  O   . ASP B 2 23  ? 16.295  11.831  28.021  1.00 95.88  ? 152 ASP B O   1 
ATOM   1604 C  CB  . ASP B 2 23  ? 14.611  9.938   25.848  1.00 48.43  ? 152 ASP B CB  1 
ATOM   1605 C  CG  . ASP B 2 23  ? 13.224  9.520   25.386  1.00 48.43  ? 152 ASP B CG  1 
ATOM   1606 O  OD1 . ASP B 2 23  ? 13.098  8.380   24.896  1.00 48.43  ? 152 ASP B OD1 1 
ATOM   1607 O  OD2 . ASP B 2 23  ? 12.265  10.314  25.523  1.00 48.43  ? 152 ASP B OD2 1 
ATOM   1608 N  N   . PHE B 2 24  ? 17.005  11.923  25.885  1.00 58.81  ? 153 PHE B N   1 
ATOM   1609 C  CA  . PHE B 2 24  ? 18.381  12.259  26.233  1.00 58.81  ? 153 PHE B CA  1 
ATOM   1610 C  C   . PHE B 2 24  ? 18.451  13.623  26.871  1.00 58.81  ? 153 PHE B C   1 
ATOM   1611 O  O   . PHE B 2 24  ? 19.220  13.828  27.809  1.00 58.81  ? 153 PHE B O   1 
ATOM   1612 C  CB  . PHE B 2 24  ? 19.296  12.273  25.010  1.00 81.39  ? 153 PHE B CB  1 
ATOM   1613 C  CG  . PHE B 2 24  ? 20.633  12.906  25.275  1.00 81.39  ? 153 PHE B CG  1 
ATOM   1614 C  CD1 . PHE B 2 24  ? 21.682  12.147  25.782  1.00 81.39  ? 153 PHE B CD1 1 
ATOM   1615 C  CD2 . PHE B 2 24  ? 20.816  14.275  25.095  1.00 81.39  ? 153 PHE B CD2 1 
ATOM   1616 C  CE1 . PHE B 2 24  ? 22.894  12.740  26.103  1.00 81.39  ? 153 PHE B CE1 1 
ATOM   1617 C  CE2 . PHE B 2 24  ? 22.021  14.878  25.415  1.00 81.39  ? 153 PHE B CE2 1 
ATOM   1618 C  CZ  . PHE B 2 24  ? 23.062  14.114  25.923  1.00 81.39  ? 153 PHE B CZ  1 
ATOM   1619 N  N   . MET B 2 25  ? 17.752  14.587  26.281  1.00 29.82  ? 154 MET B N   1 
ATOM   1620 C  CA  . MET B 2 25  ? 17.757  15.919  26.849  1.00 29.82  ? 154 MET B CA  1 
ATOM   1621 C  C   . MET B 2 25  ? 17.424  15.754  28.332  1.00 29.82  ? 154 MET B C   1 
ATOM   1622 O  O   . MET B 2 25  ? 18.163  16.208  29.192  1.00 29.82  ? 154 MET B O   1 
ATOM   1623 C  CB  . MET B 2 25  ? 16.743  16.828  26.152  1.00 83.74  ? 154 MET B CB  1 
ATOM   1624 C  CG  . MET B 2 25  ? 17.056  17.095  24.688  1.00 83.74  ? 154 MET B CG  1 
ATOM   1625 S  SD  . MET B 2 25  ? 16.493  18.724  24.107  1.00 83.74  ? 154 MET B SD  1 
ATOM   1626 C  CE  . MET B 2 25  ? 14.697  18.539  24.113  1.00 83.74  ? 154 MET B CE  1 
ATOM   1627 N  N   . LYS B 2 26  ? 16.398  14.964  28.620  1.00 82.93  ? 155 LYS B N   1 
ATOM   1628 C  CA  . LYS B 2 26  ? 15.990  14.711  30.000  1.00 82.93  ? 155 LYS B CA  1 
ATOM   1629 C  C   . LYS B 2 26  ? 17.023  13.863  30.782  1.00 82.93  ? 155 LYS B C   1 
ATOM   1630 O  O   . LYS B 2 26  ? 17.154  14.009  31.994  1.00 82.93  ? 155 LYS B O   1 
ATOM   1631 C  CB  . LYS B 2 26  ? 14.613  14.048  30.005  1.00 98.65  ? 155 LYS B CB  1 
ATOM   1632 C  CG  . LYS B 2 26  ? 13.568  14.862  29.241  1.00 98.65  ? 155 LYS B CG  1 
ATOM   1633 C  CD  . LYS B 2 26  ? 12.288  14.080  28.967  1.00 98.65  ? 155 LYS B CD  1 
ATOM   1634 C  CE  . LYS B 2 26  ? 11.356  14.860  28.042  1.00 98.65  ? 155 LYS B CE  1 
ATOM   1635 N  NZ  . LYS B 2 26  ? 10.102  14.126  27.692  1.00 98.65  ? 155 LYS B NZ  1 
ATOM   1636 N  N   . ASP B 2 27  ? 17.776  13.016  30.084  1.00 98.65  ? 156 ASP B N   1 
ATOM   1637 C  CA  . ASP B 2 27  ? 18.797  12.179  30.724  1.00 98.65  ? 156 ASP B CA  1 
ATOM   1638 C  C   . ASP B 2 27  ? 19.864  13.043  31.408  1.00 98.65  ? 156 ASP B C   1 
ATOM   1639 O  O   . ASP B 2 27  ? 20.534  12.597  32.331  1.00 98.65  ? 156 ASP B O   1 
ATOM   1640 C  CB  . ASP B 2 27  ? 19.444  11.234  29.682  1.00 98.65  ? 156 ASP B CB  1 
ATOM   1641 C  CG  . ASP B 2 27  ? 20.436  10.236  30.307  1.00 98.65  ? 156 ASP B CG  1 
ATOM   1642 O  OD1 . ASP B 2 27  ? 20.001  9.146   30.751  1.00 98.65  ? 156 ASP B OD1 1 
ATOM   1643 O  OD2 . ASP B 2 27  ? 21.662  10.522  30.314  1.00 98.65  ? 156 ASP B OD2 1 
ATOM   1644 N  N   . VAL B 2 28  ? 19.987  14.292  30.967  1.00 95.26  ? 157 VAL B N   1 
ATOM   1645 C  CA  . VAL B 2 28  ? 20.989  15.195  31.547  1.00 95.26  ? 157 VAL B CA  1 
ATOM   1646 C  C   . VAL B 2 28  ? 20.307  16.298  32.344  1.00 95.26  ? 157 VAL B C   1 
ATOM   1647 O  O   . VAL B 2 28  ? 20.680  16.563  33.496  1.00 95.26  ? 157 VAL B O   1 
ATOM   1648 C  CB  . VAL B 2 28  ? 21.891  15.856  30.487  1.00 98.65  ? 157 VAL B CB  1 
ATOM   1649 C  CG1 . VAL B 2 28  ? 23.180  16.330  31.123  1.00 98.65  ? 157 VAL B CG1 1 
ATOM   1650 C  CG2 . VAL B 2 28  ? 22.175  14.899  29.320  1.00 98.65  ? 157 VAL B CG2 1 
ATOM   1651 N  N   . MET B 2 29  ? 19.289  16.912  31.741  1.00 98.65  ? 158 MET B N   1 
ATOM   1652 C  CA  . MET B 2 29  ? 18.529  18.011  32.334  1.00 98.65  ? 158 MET B CA  1 
ATOM   1653 C  C   . MET B 2 29  ? 17.862  17.689  33.672  1.00 98.65  ? 158 MET B C   1 
ATOM   1654 O  O   . MET B 2 29  ? 18.324  18.153  34.718  1.00 98.65  ? 158 MET B O   1 
ATOM   1655 C  CB  . MET B 2 29  ? 17.481  18.511  31.339  1.00 87.55  ? 158 MET B CB  1 
ATOM   1656 C  CG  . MET B 2 29  ? 16.681  19.697  31.839  1.00 87.55  ? 158 MET B CG  1 
ATOM   1657 S  SD  . MET B 2 29  ? 15.525  20.283  30.596  1.00 87.55  ? 158 MET B SD  1 
ATOM   1658 C  CE  . MET B 2 29  ? 16.536  21.448  29.719  1.00 87.55  ? 158 MET B CE  1 
ATOM   1659 N  N   . LYS B 2 30  ? 16.761  16.934  33.639  1.00 69.90  ? 159 LYS B N   1 
ATOM   1660 C  CA  . LYS B 2 30  ? 16.019  16.571  34.860  1.00 69.90  ? 159 LYS B CA  1 
ATOM   1661 C  C   . LYS B 2 30  ? 16.883  15.799  35.865  1.00 69.90  ? 159 LYS B C   1 
ATOM   1662 O  O   . LYS B 2 30  ? 16.663  15.874  37.079  1.00 69.90  ? 159 LYS B O   1 
ATOM   1663 C  CB  . LYS B 2 30  ? 14.760  15.756  34.519  1.00 79.49  ? 159 LYS B CB  1 
ATOM   1664 C  CG  . LYS B 2 30  ? 13.757  15.652  35.670  1.00 79.49  ? 159 LYS B CG  1 
ATOM   1665 C  CD  . LYS B 2 30  ? 13.232  17.041  36.035  1.00 79.49  ? 159 LYS B CD  1 
ATOM   1666 C  CE  . LYS B 2 30  ? 12.452  17.043  37.333  1.00 79.49  ? 159 LYS B CE  1 
ATOM   1667 N  NZ  . LYS B 2 30  ? 11.978  18.421  37.661  1.00 79.49  ? 159 LYS B NZ  1 
ATOM   1668 N  N   . LYS B 2 31  ? 17.850  15.039  35.356  1.00 98.65  ? 160 LYS B N   1 
ATOM   1669 C  CA  . LYS B 2 31  ? 18.734  14.288  36.229  1.00 98.65  ? 160 LYS B CA  1 
ATOM   1670 C  C   . LYS B 2 31  ? 19.599  15.272  36.990  1.00 98.65  ? 160 LYS B C   1 
ATOM   1671 O  O   . LYS B 2 31  ? 19.952  15.026  38.142  1.00 98.65  ? 160 LYS B O   1 
ATOM   1672 C  CB  . LYS B 2 31  ? 19.573  13.288  35.438  1.00 98.65  ? 160 LYS B CB  1 
ATOM   1673 C  CG  . LYS B 2 31  ? 18.763  12.089  34.950  1.00 98.65  ? 160 LYS B CG  1 
ATOM   1674 C  CD  . LYS B 2 31  ? 19.665  10.931  34.538  1.00 98.65  ? 160 LYS B CD  1 
ATOM   1675 C  CE  . LYS B 2 31  ? 18.868  9.720   34.065  1.00 98.65  ? 160 LYS B CE  1 
ATOM   1676 N  NZ  . LYS B 2 31  ? 19.766  8.623   33.599  1.00 98.65  ? 160 LYS B NZ  1 
ATOM   1677 N  N   . CYS B 2 32  ? 19.897  16.406  36.359  1.00 50.62  ? 161 CYS B N   1 
ATOM   1678 C  CA  . CYS B 2 32  ? 20.687  17.440  37.013  1.00 50.62  ? 161 CYS B CA  1 
ATOM   1679 C  C   . CYS B 2 32  ? 19.854  18.707  37.256  1.00 50.62  ? 161 CYS B C   1 
ATOM   1680 O  O   . CYS B 2 32  ? 20.270  19.823  36.922  1.00 50.62  ? 161 CYS B O   1 
ATOM   1681 C  CB  . CYS B 2 32  ? 21.959  17.753  36.218  1.00 98.65  ? 161 CYS B CB  1 
ATOM   1682 S  SG  . CYS B 2 32  ? 22.949  16.276  35.813  1.00 98.65  ? 161 CYS B SG  1 
ATOM   1683 N  N   . SER B 2 33  ? 18.683  18.521  37.872  1.00 57.61  ? 162 SER B N   1 
ATOM   1684 C  CA  . SER B 2 33  ? 17.759  19.621  38.181  1.00 57.61  ? 162 SER B CA  1 
ATOM   1685 C  C   . SER B 2 33  ? 18.247  20.436  39.377  1.00 57.61  ? 162 SER B C   1 
ATOM   1686 O  O   . SER B 2 33  ? 17.557  21.338  39.857  1.00 57.61  ? 162 SER B O   1 
ATOM   1687 C  CB  . SER B 2 33  ? 16.340  19.088  38.453  1.00 98.65  ? 162 SER B CB  1 
ATOM   1688 O  OG  . SER B 2 33  ? 16.280  18.253  39.608  1.00 98.65  ? 162 SER B OG  1 
ATOM   1689 N  N   . ASN B 2 34  ? 19.443  20.107  39.851  1.00 86.14  ? 163 ASN B N   1 
ATOM   1690 C  CA  . ASN B 2 34  ? 20.065  20.793  40.973  1.00 86.14  ? 163 ASN B CA  1 
ATOM   1691 C  C   . ASN B 2 34  ? 20.197  22.283  40.679  1.00 86.14  ? 163 ASN B C   1 
ATOM   1692 O  O   . ASN B 2 34  ? 20.420  22.678  39.534  1.00 86.14  ? 163 ASN B O   1 
ATOM   1693 C  CB  . ASN B 2 34  ? 21.445  20.182  41.273  1.00 98.65  ? 163 ASN B CB  1 
ATOM   1694 C  CG  . ASN B 2 34  ? 21.916  19.215  40.186  1.00 98.65  ? 163 ASN B CG  1 
ATOM   1695 O  OD1 . ASN B 2 34  ? 22.996  19.371  39.606  1.00 98.65  ? 163 ASN B OD1 1 
ATOM   1696 N  ND2 . ASN B 2 34  ? 21.107  18.201  39.921  1.00 98.65  ? 163 ASN B ND2 1 
ATOM   1697 N  N   . THR B 2 35  ? 20.067  23.100  41.720  1.00 94.20  ? 164 THR B N   1 
ATOM   1698 C  CA  . THR B 2 35  ? 20.162  24.551  41.590  1.00 94.20  ? 164 THR B CA  1 
ATOM   1699 C  C   . THR B 2 35  ? 21.471  25.003  40.930  1.00 94.20  ? 164 THR B C   1 
ATOM   1700 O  O   . THR B 2 35  ? 22.420  24.218  40.809  1.00 94.20  ? 164 THR B O   1 
ATOM   1701 C  CB  . THR B 2 35  ? 19.985  25.244  42.966  1.00 98.65  ? 164 THR B CB  1 
ATOM   1702 O  OG1 . THR B 2 35  ? 19.924  26.666  42.789  1.00 98.65  ? 164 THR B OG1 1 
ATOM   1703 C  CG2 . THR B 2 35  ? 21.131  24.882  43.917  1.00 98.65  ? 164 THR B CG2 1 
ATOM   1704 N  N   . SER B 2 36  ? 21.499  26.265  40.493  1.00 85.79  ? 165 SER B N   1 
ATOM   1705 C  CA  . SER B 2 36  ? 22.662  26.858  39.817  1.00 85.79  ? 165 SER B CA  1 
ATOM   1706 C  C   . SER B 2 36  ? 22.934  26.126  38.500  1.00 85.79  ? 165 SER B C   1 
ATOM   1707 O  O   . SER B 2 36  ? 24.085  25.951  38.089  1.00 85.79  ? 165 SER B O   1 
ATOM   1708 C  CB  . SER B 2 36  ? 23.916  26.836  40.714  1.00 98.65  ? 165 SER B CB  1 
ATOM   1709 O  OG  . SER B 2 36  ? 23.876  27.832  41.732  1.00 98.65  ? 165 SER B OG  1 
ATOM   1710 N  N   . TYR B 2 37  ? 21.852  25.703  37.851  1.00 98.65  ? 166 TYR B N   1 
ATOM   1711 C  CA  . TYR B 2 37  ? 21.931  24.986  36.586  1.00 98.65  ? 166 TYR B CA  1 
ATOM   1712 C  C   . TYR B 2 37  ? 20.777  25.394  35.678  1.00 98.65  ? 166 TYR B C   1 
ATOM   1713 O  O   . TYR B 2 37  ? 19.643  24.931  35.838  1.00 98.65  ? 166 TYR B O   1 
ATOM   1714 C  CB  . TYR B 2 37  ? 21.914  23.478  36.831  1.00 98.55  ? 166 TYR B CB  1 
ATOM   1715 C  CG  . TYR B 2 37  ? 23.044  22.753  36.144  1.00 98.55  ? 166 TYR B CG  1 
ATOM   1716 C  CD1 . TYR B 2 37  ? 23.759  23.359  35.108  1.00 98.55  ? 166 TYR B CD1 1 
ATOM   1717 C  CD2 . TYR B 2 37  ? 23.400  21.458  36.522  1.00 98.55  ? 166 TYR B CD2 1 
ATOM   1718 C  CE1 . TYR B 2 37  ? 24.802  22.695  34.462  1.00 98.55  ? 166 TYR B CE1 1 
ATOM   1719 C  CE2 . TYR B 2 37  ? 24.444  20.780  35.881  1.00 98.55  ? 166 TYR B CE2 1 
ATOM   1720 C  CZ  . TYR B 2 37  ? 25.138  21.408  34.852  1.00 98.55  ? 166 TYR B CZ  1 
ATOM   1721 O  OH  . TYR B 2 37  ? 26.161  20.750  34.210  1.00 98.55  ? 166 TYR B OH  1 
ATOM   1722 N  N   . GLN B 2 38  ? 21.084  26.286  34.739  1.00 98.65  ? 167 GLN B N   1 
ATOM   1723 C  CA  . GLN B 2 38  ? 20.109  26.813  33.784  1.00 98.65  ? 167 GLN B CA  1 
ATOM   1724 C  C   . GLN B 2 38  ? 20.232  26.186  32.384  1.00 98.65  ? 167 GLN B C   1 
ATOM   1725 O  O   . GLN B 2 38  ? 21.335  25.886  31.917  1.00 98.65  ? 167 GLN B O   1 
ATOM   1726 C  CB  . GLN B 2 38  ? 20.225  28.351  33.694  1.00 98.65  ? 167 GLN B CB  1 
ATOM   1727 C  CG  . GLN B 2 38  ? 19.762  29.135  34.944  1.00 98.65  ? 167 GLN B CG  1 
ATOM   1728 C  CD  . GLN B 2 38  ? 20.789  29.165  36.083  1.00 98.65  ? 167 GLN B CD  1 
ATOM   1729 O  OE1 . GLN B 2 38  ? 20.491  28.775  37.223  1.00 98.65  ? 167 GLN B OE1 1 
ATOM   1730 N  NE2 . GLN B 2 38  ? 21.993  29.656  35.784  1.00 98.65  ? 167 GLN B NE2 1 
ATOM   1731 N  N   . PHE B 2 39  ? 19.089  25.999  31.721  1.00 58.98  ? 168 PHE B N   1 
ATOM   1732 C  CA  . PHE B 2 39  ? 19.047  25.410  30.386  1.00 58.98  ? 168 PHE B CA  1 
ATOM   1733 C  C   . PHE B 2 39  ? 18.064  26.110  29.443  1.00 58.98  ? 168 PHE B C   1 
ATOM   1734 O  O   . PHE B 2 39  ? 17.235  26.930  29.857  1.00 58.98  ? 168 PHE B O   1 
ATOM   1735 C  CB  . PHE B 2 39  ? 18.655  23.925  30.464  1.00 98.65  ? 168 PHE B CB  1 
ATOM   1736 C  CG  . PHE B 2 39  ? 19.531  23.095  31.356  1.00 98.65  ? 168 PHE B CG  1 
ATOM   1737 C  CD1 . PHE B 2 39  ? 20.911  23.065  31.181  1.00 98.65  ? 168 PHE B CD1 1 
ATOM   1738 C  CD2 . PHE B 2 39  ? 18.964  22.308  32.354  1.00 98.65  ? 168 PHE B CD2 1 
ATOM   1739 C  CE1 . PHE B 2 39  ? 21.719  22.259  31.991  1.00 98.65  ? 168 PHE B CE1 1 
ATOM   1740 C  CE2 . PHE B 2 39  ? 19.757  21.498  33.170  1.00 98.65  ? 168 PHE B CE2 1 
ATOM   1741 C  CZ  . PHE B 2 39  ? 21.141  21.472  32.985  1.00 98.65  ? 168 PHE B CZ  1 
ATOM   1742 N  N   . ALA B 2 40  ? 18.136  25.715  28.171  1.00 55.56  ? 169 ALA B N   1 
ATOM   1743 C  CA  . ALA B 2 40  ? 17.289  26.247  27.100  1.00 55.56  ? 169 ALA B CA  1 
ATOM   1744 C  C   . ALA B 2 40  ? 17.129  25.190  25.997  1.00 55.56  ? 169 ALA B C   1 
ATOM   1745 O  O   . ALA B 2 40  ? 17.687  24.092  26.085  1.00 55.56  ? 169 ALA B O   1 
ATOM   1746 C  CB  . ALA B 2 40  ? 17.913  27.515  26.536  1.00 24.23  ? 169 ALA B CB  1 
ATOM   1747 N  N   . ALA B 2 41  ? 16.369  25.526  24.959  1.00 43.71  ? 170 ALA B N   1 
ATOM   1748 C  CA  . ALA B 2 41  ? 16.123  24.586  23.876  1.00 43.71  ? 170 ALA B CA  1 
ATOM   1749 C  C   . ALA B 2 41  ? 15.739  25.281  22.577  1.00 43.71  ? 170 ALA B C   1 
ATOM   1750 O  O   . ALA B 2 41  ? 14.815  26.111  22.534  1.00 43.71  ? 170 ALA B O   1 
ATOM   1751 C  CB  . ALA B 2 41  ? 15.085  23.539  24.262  1.00 98.65  ? 170 ALA B CB  1 
ATOM   1752 N  N   . VAL B 2 42  ? 16.434  24.911  21.509  1.00 65.15  ? 171 VAL B N   1 
ATOM   1753 C  CA  . VAL B 2 42  ? 16.189  25.454  20.184  1.00 65.15  ? 171 VAL B CA  1 
ATOM   1754 C  C   . VAL B 2 42  ? 16.195  24.361  19.128  1.00 65.15  ? 171 VAL B C   1 
ATOM   1755 O  O   . VAL B 2 42  ? 17.235  23.778  18.808  1.00 65.15  ? 171 VAL B O   1 
ATOM   1756 C  CB  . VAL B 2 42  ? 17.205  26.547  19.823  1.00 98.65  ? 171 VAL B CB  1 
ATOM   1757 C  CG1 . VAL B 2 42  ? 16.636  27.924  20.134  1.00 98.65  ? 171 VAL B CG1 1 
ATOM   1758 C  CG2 . VAL B 2 42  ? 18.528  26.348  20.566  1.00 98.65  ? 171 VAL B CG2 1 
ATOM   1759 N  N   . GLN B 2 43  ? 15.005  24.088  18.601  1.00 93.10  ? 172 GLN B N   1 
ATOM   1760 C  CA  . GLN B 2 43  ? 14.821  23.088  17.559  1.00 93.10  ? 172 GLN B CA  1 
ATOM   1761 C  C   . GLN B 2 43  ? 15.134  23.724  16.218  1.00 93.10  ? 172 GLN B C   1 
ATOM   1762 O  O   . GLN B 2 43  ? 14.485  24.699  15.829  1.00 93.10  ? 172 GLN B O   1 
ATOM   1763 C  CB  . GLN B 2 43  ? 13.375  22.589  17.573  1.00 75.51  ? 172 GLN B CB  1 
ATOM   1764 C  CG  . GLN B 2 43  ? 13.074  21.462  16.615  1.00 75.51  ? 172 GLN B CG  1 
ATOM   1765 C  CD  . GLN B 2 43  ? 11.980  21.817  15.640  1.00 75.51  ? 172 GLN B CD  1 
ATOM   1766 O  OE1 . GLN B 2 43  ? 11.761  21.111  14.655  1.00 75.51  ? 172 GLN B OE1 1 
ATOM   1767 N  NE2 . GLN B 2 43  ? 11.286  22.921  15.903  1.00 75.51  ? 172 GLN B NE2 1 
ATOM   1768 N  N   . PHE B 2 44  ? 16.130  23.186  15.520  1.00 25.19  ? 173 PHE B N   1 
ATOM   1769 C  CA  . PHE B 2 44  ? 16.496  23.744  14.229  1.00 25.19  ? 173 PHE B CA  1 
ATOM   1770 C  C   . PHE B 2 44  ? 16.226  22.815  13.066  1.00 25.19  ? 173 PHE B C   1 
ATOM   1771 O  O   . PHE B 2 44  ? 16.442  21.608  13.158  1.00 25.19  ? 173 PHE B O   1 
ATOM   1772 C  CB  . PHE B 2 44  ? 17.960  24.170  14.221  1.00 15.87  ? 173 PHE B CB  1 
ATOM   1773 C  CG  . PHE B 2 44  ? 18.937  23.029  14.138  1.00 15.87  ? 173 PHE B CG  1 
ATOM   1774 C  CD1 . PHE B 2 44  ? 19.360  22.373  15.276  1.00 15.87  ? 173 PHE B CD1 1 
ATOM   1775 C  CD2 . PHE B 2 44  ? 19.472  22.646  12.917  1.00 15.87  ? 173 PHE B CD2 1 
ATOM   1776 C  CE1 . PHE B 2 44  ? 20.306  21.358  15.194  1.00 15.87  ? 173 PHE B CE1 1 
ATOM   1777 C  CE2 . PHE B 2 44  ? 20.410  21.636  12.837  1.00 15.87  ? 173 PHE B CE2 1 
ATOM   1778 C  CZ  . PHE B 2 44  ? 20.828  20.994  13.975  1.00 15.87  ? 173 PHE B CZ  1 
ATOM   1779 N  N   . SER B 2 45  ? 15.772  23.402  11.965  1.00 51.11  ? 174 SER B N   1 
ATOM   1780 C  CA  . SER B 2 45  ? 15.474  22.683  10.737  1.00 51.11  ? 174 SER B CA  1 
ATOM   1781 C  C   . SER B 2 45  ? 15.785  23.683  9.620   1.00 51.11  ? 174 SER B C   1 
ATOM   1782 O  O   . SER B 2 45  ? 16.950  24.008  9.393   1.00 51.11  ? 174 SER B O   1 
ATOM   1783 C  CB  . SER B 2 45  ? 14.013  22.241  10.728  1.00 44.87  ? 174 SER B CB  1 
ATOM   1784 O  OG  . SER B 2 45  ? 13.147  23.345  10.888  1.00 44.87  ? 174 SER B OG  1 
ATOM   1785 N  N   . THR B 2 46  ? 14.765  24.177  8.928   1.00 33.49  ? 175 THR B N   1 
ATOM   1786 C  CA  . THR B 2 46  ? 14.984  25.173  7.880   1.00 33.49  ? 175 THR B CA  1 
ATOM   1787 C  C   . THR B 2 46  ? 14.895  26.532  8.561   1.00 33.49  ? 175 THR B C   1 
ATOM   1788 O  O   . THR B 2 46  ? 15.460  27.526  8.095   1.00 33.49  ? 175 THR B O   1 
ATOM   1789 C  CB  . THR B 2 46  ? 13.923  25.068  6.752   1.00 33.46  ? 175 THR B CB  1 
ATOM   1790 O  OG1 . THR B 2 46  ? 14.111  23.848  6.028   1.00 33.46  ? 175 THR B OG1 1 
ATOM   1791 C  CG2 . THR B 2 46  ? 14.024  26.233  5.771   1.00 33.46  ? 175 THR B CG2 1 
ATOM   1792 N  N   . SER B 2 47  ? 14.220  26.545  9.706   1.00 65.03  ? 176 SER B N   1 
ATOM   1793 C  CA  . SER B 2 47  ? 14.025  27.755  10.496  1.00 65.03  ? 176 SER B CA  1 
ATOM   1794 C  C   . SER B 2 47  ? 14.394  27.496  11.963  1.00 65.03  ? 176 SER B C   1 
ATOM   1795 O  O   . SER B 2 47  ? 14.820  26.398  12.305  1.00 65.03  ? 176 SER B O   1 
ATOM   1796 C  CB  . SER B 2 47  ? 12.575  28.205  10.370  1.00 98.65  ? 176 SER B CB  1 
ATOM   1797 O  OG  . SER B 2 47  ? 11.722  27.077  10.224  1.00 98.65  ? 176 SER B OG  1 
ATOM   1798 N  N   . TYR B 2 48  ? 14.230  28.510  12.815  1.00 69.41  ? 177 TYR B N   1 
ATOM   1799 C  CA  . TYR B 2 48  ? 14.565  28.371  14.235  1.00 69.41  ? 177 TYR B CA  1 
ATOM   1800 C  C   . TYR B 2 48  ? 13.491  28.940  15.151  1.00 69.41  ? 177 TYR B C   1 
ATOM   1801 O  O   . TYR B 2 48  ? 12.679  29.787  14.743  1.00 69.41  ? 177 TYR B O   1 
ATOM   1802 C  CB  . TYR B 2 48  ? 15.882  29.042  14.581  1.00 61.40  ? 177 TYR B CB  1 
ATOM   1803 C  CG  . TYR B 2 48  ? 16.925  29.000  13.493  1.00 61.40  ? 177 TYR B CG  1 
ATOM   1804 C  CD1 . TYR B 2 48  ? 17.812  27.940  13.381  1.00 61.40  ? 177 TYR B CD1 1 
ATOM   1805 C  CD2 . TYR B 2 48  ? 17.002  30.021  12.554  1.00 61.40  ? 177 TYR B CD2 1 
ATOM   1806 C  CE1 . TYR B 2 48  ? 18.727  27.892  12.359  1.00 61.40  ? 177 TYR B CE1 1 
ATOM   1807 C  CE2 . TYR B 2 48  ? 17.910  29.983  11.535  1.00 61.40  ? 177 TYR B CE2 1 
ATOM   1808 C  CZ  . TYR B 2 48  ? 18.780  28.923  11.438  1.00 61.40  ? 177 TYR B CZ  1 
ATOM   1809 O  OH  . TYR B 2 48  ? 19.714  28.907  10.429  1.00 61.40  ? 177 TYR B OH  1 
ATOM   1810 N  N   . LYS B 2 49  ? 13.472  28.433  16.379  1.00 71.78  ? 178 LYS B N   1 
ATOM   1811 C  CA  . LYS B 2 49  ? 12.556  28.848  17.416  1.00 71.78  ? 178 LYS B CA  1 
ATOM   1812 C  C   . LYS B 2 49  ? 13.074  28.358  18.755  1.00 71.78  ? 178 LYS B C   1 
ATOM   1813 O  O   . LYS B 2 49  ? 13.588  27.237  18.876  1.00 71.78  ? 178 LYS B O   1 
ATOM   1814 C  CB  . LYS B 2 49  ? 11.153  28.288  17.188  1.00 54.19  ? 178 LYS B CB  1 
ATOM   1815 C  CG  . LYS B 2 49  ? 11.052  26.767  17.385  1.00 54.19  ? 178 LYS B CG  1 
ATOM   1816 C  CD  . LYS B 2 49  ? 9.605   26.287  17.502  1.00 54.19  ? 178 LYS B CD  1 
ATOM   1817 C  CE  . LYS B 2 49  ? 8.878   26.929  18.687  1.00 54.19  ? 178 LYS B CE  1 
ATOM   1818 N  NZ  . LYS B 2 49  ? 7.606   26.211  19.035  1.00 54.19  ? 178 LYS B NZ  1 
ATOM   1819 N  N   . THR B 2 50  ? 12.978  29.222  19.752  1.00 98.37  ? 179 THR B N   1 
ATOM   1820 C  CA  . THR B 2 50  ? 13.394  28.871  21.100  1.00 98.37  ? 179 THR B CA  1 
ATOM   1821 C  C   . THR B 2 50  ? 12.176  28.161  21.705  1.00 98.37  ? 179 THR B C   1 
ATOM   1822 O  O   . THR B 2 50  ? 11.129  28.783  21.931  1.00 98.37  ? 179 THR B O   1 
ATOM   1823 C  CB  . THR B 2 50  ? 13.765  30.133  21.904  1.00 98.65  ? 179 THR B CB  1 
ATOM   1824 O  OG1 . THR B 2 50  ? 12.735  31.120  21.759  1.00 98.65  ? 179 THR B OG1 1 
ATOM   1825 C  CG2 . THR B 2 50  ? 15.084  30.721  21.421  1.00 98.65  ? 179 THR B CG2 1 
ATOM   1826 N  N   . GLU B 2 51  ? 12.292  26.842  21.870  1.00 98.65  ? 180 GLU B N   1 
ATOM   1827 C  CA  . GLU B 2 51  ? 11.219  26.010  22.427  1.00 98.65  ? 180 GLU B CA  1 
ATOM   1828 C  C   . GLU B 2 51  ? 10.795  26.509  23.798  1.00 98.65  ? 180 GLU B C   1 
ATOM   1829 O  O   . GLU B 2 51  ? 9.606   26.699  24.066  1.00 98.65  ? 180 GLU B O   1 
ATOM   1830 C  CB  . GLU B 2 51  ? 11.671  24.553  22.506  1.00 61.46  ? 180 GLU B CB  1 
ATOM   1831 C  CG  . GLU B 2 51  ? 12.050  23.968  21.159  1.00 61.46  ? 180 GLU B CG  1 
ATOM   1832 C  CD  . GLU B 2 51  ? 10.850  23.556  20.327  1.00 61.46  ? 180 GLU B CD  1 
ATOM   1833 O  OE1 . GLU B 2 51  ? 9.943   24.383  20.123  1.00 61.46  ? 180 GLU B OE1 1 
ATOM   1834 O  OE2 . GLU B 2 51  ? 10.815  22.393  19.868  1.00 61.46  ? 180 GLU B OE2 1 
ATOM   1835 N  N   . PHE B 2 52  ? 11.782  26.683  24.669  1.00 87.98  ? 181 PHE B N   1 
ATOM   1836 C  CA  . PHE B 2 52  ? 11.553  27.211  26.000  1.00 87.98  ? 181 PHE B CA  1 
ATOM   1837 C  C   . PHE B 2 52  ? 12.730  28.090  26.393  1.00 87.98  ? 181 PHE B C   1 
ATOM   1838 O  O   . PHE B 2 52  ? 13.895  27.692  26.285  1.00 87.98  ? 181 PHE B O   1 
ATOM   1839 C  CB  . PHE B 2 52  ? 11.262  26.106  27.038  1.00 88.27  ? 181 PHE B CB  1 
ATOM   1840 C  CG  . PHE B 2 52  ? 12.448  25.232  27.402  1.00 88.27  ? 181 PHE B CG  1 
ATOM   1841 C  CD1 . PHE B 2 52  ? 13.428  25.679  28.288  1.00 88.27  ? 181 PHE B CD1 1 
ATOM   1842 C  CD2 . PHE B 2 52  ? 12.527  23.925  26.935  1.00 88.27  ? 181 PHE B CD2 1 
ATOM   1843 C  CE1 . PHE B 2 52  ? 14.453  24.840  28.702  1.00 88.27  ? 181 PHE B CE1 1 
ATOM   1844 C  CE2 . PHE B 2 52  ? 13.554  23.079  27.350  1.00 88.27  ? 181 PHE B CE2 1 
ATOM   1845 C  CZ  . PHE B 2 52  ? 14.514  23.540  28.233  1.00 88.27  ? 181 PHE B CZ  1 
ATOM   1846 N  N   . ASP B 2 53  ? 12.411  29.330  26.744  1.00 71.24  ? 182 ASP B N   1 
ATOM   1847 C  CA  . ASP B 2 53  ? 13.413  30.313  27.145  1.00 71.24  ? 182 ASP B CA  1 
ATOM   1848 C  C   . ASP B 2 53  ? 13.741  30.123  28.624  1.00 71.24  ? 182 ASP B C   1 
ATOM   1849 O  O   . ASP B 2 53  ? 13.127  29.298  29.306  1.00 71.24  ? 182 ASP B O   1 
ATOM   1850 C  CB  . ASP B 2 53  ? 12.870  31.732  26.907  1.00 98.65  ? 182 ASP B CB  1 
ATOM   1851 C  CG  . ASP B 2 53  ? 12.243  31.900  25.524  1.00 98.65  ? 182 ASP B CG  1 
ATOM   1852 O  OD1 . ASP B 2 53  ? 12.783  31.327  24.555  1.00 98.65  ? 182 ASP B OD1 1 
ATOM   1853 O  OD2 . ASP B 2 53  ? 11.210  32.599  25.404  1.00 98.65  ? 182 ASP B OD2 1 
ATOM   1854 N  N   . PHE B 2 54  ? 14.715  30.878  29.118  1.00 98.65  ? 183 PHE B N   1 
ATOM   1855 C  CA  . PHE B 2 54  ? 15.092  30.791  30.527  1.00 98.65  ? 183 PHE B CA  1 
ATOM   1856 C  C   . PHE B 2 54  ? 13.947  31.285  31.417  1.00 98.65  ? 183 PHE B C   1 
ATOM   1857 O  O   . PHE B 2 54  ? 13.657  30.680  32.444  1.00 98.65  ? 183 PHE B O   1 
ATOM   1858 C  CB  . PHE B 2 54  ? 16.358  31.617  30.810  1.00 98.12  ? 183 PHE B CB  1 
ATOM   1859 C  CG  . PHE B 2 54  ? 17.651  30.927  30.434  1.00 98.12  ? 183 PHE B CG  1 
ATOM   1860 C  CD1 . PHE B 2 54  ? 17.923  29.636  30.876  1.00 98.12  ? 183 PHE B CD1 1 
ATOM   1861 C  CD2 . PHE B 2 54  ? 18.603  31.581  29.652  1.00 98.12  ? 183 PHE B CD2 1 
ATOM   1862 C  CE1 . PHE B 2 54  ? 19.120  29.008  30.547  1.00 98.12  ? 183 PHE B CE1 1 
ATOM   1863 C  CE2 . PHE B 2 54  ? 19.801  30.957  29.320  1.00 98.12  ? 183 PHE B CE2 1 
ATOM   1864 C  CZ  . PHE B 2 54  ? 20.058  29.666  29.770  1.00 98.12  ? 183 PHE B CZ  1 
ATOM   1865 N  N   . SER B 2 55  ? 13.295  32.371  30.994  1.00 98.65  ? 184 SER B N   1 
ATOM   1866 C  CA  . SER B 2 55  ? 12.179  32.985  31.723  1.00 98.65  ? 184 SER B CA  1 
ATOM   1867 C  C   . SER B 2 55  ? 11.124  31.976  32.162  1.00 98.65  ? 184 SER B C   1 
ATOM   1868 O  O   . SER B 2 55  ? 10.780  31.903  33.343  1.00 98.65  ? 184 SER B O   1 
ATOM   1869 C  CB  . SER B 2 55  ? 11.508  34.079  30.877  1.00 79.22  ? 184 SER B CB  1 
ATOM   1870 O  OG  . SER B 2 55  ? 12.348  35.205  30.680  1.00 79.22  ? 184 SER B OG  1 
ATOM   1871 N  N   . ASP B 2 56  ? 10.588  31.228  31.201  1.00 98.65  ? 185 ASP B N   1 
ATOM   1872 C  CA  . ASP B 2 56  ? 9.579   30.214  31.489  1.00 98.65  ? 185 ASP B CA  1 
ATOM   1873 C  C   . ASP B 2 56  ? 10.230  28.910  31.936  1.00 98.65  ? 185 ASP B C   1 
ATOM   1874 O  O   . ASP B 2 56  ? 9.534   27.976  32.341  1.00 98.65  ? 185 ASP B O   1 
ATOM   1875 C  CB  . ASP B 2 56  ? 8.685   29.965  30.265  1.00 98.55  ? 185 ASP B CB  1 
ATOM   1876 C  CG  . ASP B 2 56  ? 7.526   30.960  30.161  1.00 98.55  ? 185 ASP B CG  1 
ATOM   1877 O  OD1 . ASP B 2 56  ? 6.380   30.570  30.478  1.00 98.55  ? 185 ASP B OD1 1 
ATOM   1878 O  OD2 . ASP B 2 56  ? 7.750   32.121  29.752  1.00 98.55  ? 185 ASP B OD2 1 
ATOM   1879 N  N   . TYR B 2 57  ? 11.563  28.863  31.874  1.00 98.27  ? 186 TYR B N   1 
ATOM   1880 C  CA  . TYR B 2 57  ? 12.336  27.682  32.270  1.00 98.27  ? 186 TYR B CA  1 
ATOM   1881 C  C   . TYR B 2 57  ? 12.362  27.431  33.784  1.00 98.27  ? 186 TYR B C   1 
ATOM   1882 O  O   . TYR B 2 57  ? 11.945  26.375  34.251  1.00 98.27  ? 186 TYR B O   1 
ATOM   1883 C  CB  . TYR B 2 57  ? 13.770  27.771  31.720  1.00 98.65  ? 186 TYR B CB  1 
ATOM   1884 C  CG  . TYR B 2 57  ? 14.746  26.821  32.374  1.00 98.65  ? 186 TYR B CG  1 
ATOM   1885 C  CD1 . TYR B 2 57  ? 15.876  27.302  33.026  1.00 98.65  ? 186 TYR B CD1 1 
ATOM   1886 C  CD2 . TYR B 2 57  ? 14.504  25.446  32.402  1.00 98.65  ? 186 TYR B CD2 1 
ATOM   1887 C  CE1 . TYR B 2 57  ? 16.742  26.441  33.692  1.00 98.65  ? 186 TYR B CE1 1 
ATOM   1888 C  CE2 . TYR B 2 57  ? 15.364  24.575  33.064  1.00 98.65  ? 186 TYR B CE2 1 
ATOM   1889 C  CZ  . TYR B 2 57  ? 16.479  25.080  33.713  1.00 98.65  ? 186 TYR B CZ  1 
ATOM   1890 O  OH  . TYR B 2 57  ? 17.328  24.232  34.390  1.00 98.65  ? 186 TYR B OH  1 
ATOM   1891 N  N   . VAL B 2 58  ? 12.862  28.403  34.537  1.00 98.65  ? 187 VAL B N   1 
ATOM   1892 C  CA  . VAL B 2 58  ? 12.948  28.268  35.990  1.00 98.65  ? 187 VAL B CA  1 
ATOM   1893 C  C   . VAL B 2 58  ? 11.632  28.632  36.710  1.00 98.65  ? 187 VAL B C   1 
ATOM   1894 O  O   . VAL B 2 58  ? 11.638  29.019  37.881  1.00 98.65  ? 187 VAL B O   1 
ATOM   1895 C  CB  . VAL B 2 58  ? 14.128  29.100  36.563  1.00 35.07  ? 187 VAL B CB  1 
ATOM   1896 C  CG1 . VAL B 2 58  ? 14.850  28.321  37.625  1.00 35.07  ? 187 VAL B CG1 1 
ATOM   1897 C  CG2 . VAL B 2 58  ? 15.116  29.493  35.476  1.00 35.07  ? 187 VAL B CG2 1 
ATOM   1898 N  N   . LYS B 2 59  ? 10.515  28.437  36.005  1.00 98.65  ? 188 LYS B N   1 
ATOM   1899 C  CA  . LYS B 2 59  ? 9.175   28.737  36.523  1.00 98.65  ? 188 LYS B CA  1 
ATOM   1900 C  C   . LYS B 2 59  ? 8.458   27.449  36.888  1.00 98.65  ? 188 LYS B C   1 
ATOM   1901 O  O   . LYS B 2 59  ? 7.802   27.373  37.929  1.00 98.65  ? 188 LYS B O   1 
ATOM   1902 C  CB  . LYS B 2 59  ? 8.356   29.500  35.487  1.00 83.20  ? 188 LYS B CB  1 
ATOM   1903 C  CG  . LYS B 2 59  ? 6.906   29.812  35.882  1.00 83.20  ? 188 LYS B CG  1 
ATOM   1904 C  CD  . LYS B 2 59  ? 6.106   30.382  34.737  1.00 83.20  ? 188 LYS B CD  1 
ATOM   1905 C  CE  . LYS B 2 59  ? 6.626   31.752  34.335  1.00 83.20  ? 188 LYS B CE  1 
ATOM   1906 N  NZ  . LYS B 2 59  ? 7.976   31.742  33.707  1.00 83.20  ? 188 LYS B NZ  1 
ATOM   1907 N  N   . ARG B 2 60  ? 8.567   26.447  36.026  1.00 98.14  ? 189 ARG B N   1 
ATOM   1908 C  CA  . ARG B 2 60  ? 7.954   25.151  36.242  1.00 98.14  ? 189 ARG B CA  1 
ATOM   1909 C  C   . ARG B 2 60  ? 8.972   24.101  35.807  1.00 98.14  ? 189 ARG B C   1 
ATOM   1910 O  O   . ARG B 2 60  ? 8.732   23.322  34.886  1.00 98.14  ? 189 ARG B O   1 
ATOM   1911 C  CB  . ARG B 2 60  ? 6.649   25.038  35.446  1.00 98.65  ? 189 ARG B CB  1 
ATOM   1912 C  CG  . ARG B 2 60  ? 5.773   23.851  35.841  1.00 98.65  ? 189 ARG B CG  1 
ATOM   1913 C  CD  . ARG B 2 60  ? 4.378   23.987  35.261  1.00 98.65  ? 189 ARG B CD  1 
ATOM   1914 N  NE  . ARG B 2 60  ? 3.734   25.233  35.682  1.00 98.65  ? 189 ARG B NE  1 
ATOM   1915 C  CZ  . ARG B 2 60  ? 2.438   25.508  35.533  1.00 98.65  ? 189 ARG B CZ  1 
ATOM   1916 N  NH1 . ARG B 2 60  ? 1.618   24.622  34.971  1.00 98.65  ? 189 ARG B NH1 1 
ATOM   1917 N  NH2 . ARG B 2 60  ? 1.961   26.684  35.934  1.00 98.65  ? 189 ARG B NH2 1 
ATOM   1918 N  N   . LYS B 2 61  ? 10.117  24.118  36.493  1.00 54.19  ? 190 LYS B N   1 
ATOM   1919 C  CA  . LYS B 2 61  ? 11.244  23.223  36.253  1.00 54.19  ? 190 LYS B CA  1 
ATOM   1920 C  C   . LYS B 2 61  ? 10.907  21.732  36.132  1.00 54.19  ? 190 LYS B C   1 
ATOM   1921 O  O   . LYS B 2 61  ? 10.742  21.035  37.143  1.00 54.19  ? 190 LYS B O   1 
ATOM   1922 C  CB  . LYS B 2 61  ? 12.309  23.428  37.342  1.00 62.46  ? 190 LYS B CB  1 
ATOM   1923 C  CG  . LYS B 2 61  ? 12.858  24.852  37.452  1.00 62.46  ? 190 LYS B CG  1 
ATOM   1924 C  CD  . LYS B 2 61  ? 13.780  24.995  38.660  1.00 62.46  ? 190 LYS B CD  1 
ATOM   1925 C  CE  . LYS B 2 61  ? 15.038  24.133  38.529  1.00 62.46  ? 190 LYS B CE  1 
ATOM   1926 N  NZ  . LYS B 2 61  ? 15.892  24.111  39.759  1.00 62.46  ? 190 LYS B NZ  1 
ATOM   1927 N  N   . ASP B 2 62  ? 10.829  21.274  34.876  1.00 75.73  ? 191 ASP B N   1 
ATOM   1928 C  CA  . ASP B 2 62  ? 10.527  19.886  34.494  1.00 75.73  ? 191 ASP B CA  1 
ATOM   1929 C  C   . ASP B 2 62  ? 10.356  19.819  32.958  1.00 75.73  ? 191 ASP B C   1 
ATOM   1930 O  O   . ASP B 2 62  ? 9.524   20.530  32.377  1.00 75.73  ? 191 ASP B O   1 
ATOM   1931 C  CB  . ASP B 2 62  ? 9.249   19.373  35.201  1.00 91.47  ? 191 ASP B CB  1 
ATOM   1932 C  CG  . ASP B 2 62  ? 9.071   17.840  35.094  1.00 91.47  ? 191 ASP B CG  1 
ATOM   1933 O  OD1 . ASP B 2 62  ? 9.908   17.086  35.638  1.00 91.47  ? 191 ASP B OD1 1 
ATOM   1934 O  OD2 . ASP B 2 62  ? 8.071   17.385  34.496  1.00 91.47  ? 191 ASP B OD2 1 
ATOM   1935 N  N   . PRO B 2 63  ? 11.162  18.974  32.285  1.00 98.65  ? 192 PRO B N   1 
ATOM   1936 C  CA  . PRO B 2 63  ? 11.136  18.778  30.828  1.00 98.65  ? 192 PRO B CA  1 
ATOM   1937 C  C   . PRO B 2 63  ? 9.871   18.072  30.307  1.00 98.65  ? 192 PRO B C   1 
ATOM   1938 O  O   . PRO B 2 63  ? 9.937   17.261  29.381  1.00 98.65  ? 192 PRO B O   1 
ATOM   1939 C  CB  . PRO B 2 63  ? 12.387  17.928  30.586  1.00 61.26  ? 192 PRO B CB  1 
ATOM   1940 C  CG  . PRO B 2 63  ? 12.508  17.133  31.850  1.00 61.26  ? 192 PRO B CG  1 
ATOM   1941 C  CD  . PRO B 2 63  ? 12.261  18.195  32.890  1.00 61.26  ? 192 PRO B CD  1 
ATOM   1942 N  N   . ASP B 2 64  ? 8.725   18.389  30.902  1.00 69.95  ? 193 ASP B N   1 
ATOM   1943 C  CA  . ASP B 2 64  ? 7.436   17.800  30.529  1.00 69.95  ? 193 ASP B CA  1 
ATOM   1944 C  C   . ASP B 2 64  ? 6.399   18.916  30.675  1.00 69.95  ? 193 ASP B C   1 
ATOM   1945 O  O   . ASP B 2 64  ? 5.195   18.718  30.502  1.00 69.95  ? 193 ASP B O   1 
ATOM   1946 C  CB  . ASP B 2 64  ? 7.094   16.628  31.470  1.00 66.43  ? 193 ASP B CB  1 
ATOM   1947 C  CG  . ASP B 2 64  ? 8.199   15.554  31.526  1.00 66.43  ? 193 ASP B CG  1 
ATOM   1948 O  OD1 . ASP B 2 64  ? 9.132   15.693  32.345  1.00 66.43  ? 193 ASP B OD1 1 
ATOM   1949 O  OD2 . ASP B 2 64  ? 8.130   14.562  30.767  1.00 66.43  ? 193 ASP B OD2 1 
ATOM   1950 N  N   . ALA B 2 65  ? 6.904   20.097  31.004  1.00 98.65  ? 194 ALA B N   1 
ATOM   1951 C  CA  . ALA B 2 65  ? 6.087   21.280  31.193  1.00 98.65  ? 194 ALA B CA  1 
ATOM   1952 C  C   . ALA B 2 65  ? 6.591   22.392  30.278  1.00 98.65  ? 194 ALA B C   1 
ATOM   1953 O  O   . ALA B 2 65  ? 5.926   23.417  30.110  1.00 98.65  ? 194 ALA B O   1 
ATOM   1954 C  CB  . ALA B 2 65  ? 6.160   21.729  32.653  1.00 74.58  ? 194 ALA B CB  1 
ATOM   1955 N  N   . LEU B 2 66  ? 7.777   22.188  29.706  1.00 90.19  ? 195 LEU B N   1 
ATOM   1956 C  CA  . LEU B 2 66  ? 8.400   23.165  28.811  1.00 90.19  ? 195 LEU B CA  1 
ATOM   1957 C  C   . LEU B 2 66  ? 8.310   22.740  27.353  1.00 90.19  ? 195 LEU B C   1 
ATOM   1958 O  O   . LEU B 2 66  ? 8.676   23.492  26.450  1.00 90.19  ? 195 LEU B O   1 
ATOM   1959 C  CB  . LEU B 2 66  ? 9.863   23.379  29.203  1.00 98.65  ? 195 LEU B CB  1 
ATOM   1960 C  CG  . LEU B 2 66  ? 10.096  24.008  30.577  1.00 98.65  ? 195 LEU B CG  1 
ATOM   1961 C  CD1 . LEU B 2 66  ? 11.572  23.946  30.937  1.00 98.65  ? 195 LEU B CD1 1 
ATOM   1962 C  CD2 . LEU B 2 66  ? 9.575   25.439  30.584  1.00 98.65  ? 195 LEU B CD2 1 
ATOM   1963 N  N   . LEU B 2 67  ? 7.831   21.519  27.141  1.00 74.27  ? 196 LEU B N   1 
ATOM   1964 C  CA  . LEU B 2 67  ? 7.669   20.957  25.808  1.00 74.27  ? 196 LEU B CA  1 
ATOM   1965 C  C   . LEU B 2 67  ? 6.173   20.800  25.548  1.00 74.27  ? 196 LEU B C   1 
ATOM   1966 O  O   . LEU B 2 67  ? 5.723   19.831  24.922  1.00 74.27  ? 196 LEU B O   1 
ATOM   1967 C  CB  . LEU B 2 67  ? 8.375   19.601  25.723  1.00 98.65  ? 196 LEU B CB  1 
ATOM   1968 C  CG  . LEU B 2 67  ? 9.874   19.604  26.041  1.00 98.65  ? 196 LEU B CG  1 
ATOM   1969 C  CD1 . LEU B 2 67  ? 10.391  18.179  26.037  1.00 98.65  ? 196 LEU B CD1 1 
ATOM   1970 C  CD2 . LEU B 2 67  ? 10.649  20.465  25.046  1.00 98.65  ? 196 LEU B CD2 1 
ATOM   1971 N  N   . LYS B 2 68  ? 5.419   21.789  26.027  1.00 98.32  ? 197 LYS B N   1 
ATOM   1972 C  CA  . LYS B 2 68  ? 3.963   21.836  25.914  1.00 98.32  ? 197 LYS B CA  1 
ATOM   1973 C  C   . LYS B 2 68  ? 3.422   21.879  24.501  1.00 98.32  ? 197 LYS B C   1 
ATOM   1974 O  O   . LYS B 2 68  ? 2.464   21.171  24.174  1.00 98.32  ? 197 LYS B O   1 
ATOM   1975 C  CB  . LYS B 2 68  ? 3.391   23.026  26.704  1.00 98.52  ? 197 LYS B CB  1 
ATOM   1976 C  CG  . LYS B 2 68  ? 4.091   24.385  26.487  1.00 98.52  ? 197 LYS B CG  1 
ATOM   1977 C  CD  . LYS B 2 68  ? 5.298   24.539  27.423  1.00 98.52  ? 197 LYS B CD  1 
ATOM   1978 C  CE  . LYS B 2 68  ? 5.902   25.944  27.417  1.00 98.52  ? 197 LYS B CE  1 
ATOM   1979 N  NZ  . LYS B 2 68  ? 7.075   26.049  28.345  1.00 98.52  ? 197 LYS B NZ  1 
ATOM   1980 N  N   . HIS B 2 69  ? 4.022   22.725  23.670  1.00 98.65  ? 198 HIS B N   1 
ATOM   1981 C  CA  . HIS B 2 69  ? 3.566   22.863  22.298  1.00 98.65  ? 198 HIS B CA  1 
ATOM   1982 C  C   . HIS B 2 69  ? 4.630   22.602  21.232  1.00 98.65  ? 198 HIS B C   1 
ATOM   1983 O  O   . HIS B 2 69  ? 4.739   23.330  20.242  1.00 98.65  ? 198 HIS B O   1 
ATOM   1984 C  CB  . HIS B 2 69  ? 2.880   24.224  22.119  1.00 98.65  ? 198 HIS B CB  1 
ATOM   1985 C  CG  . HIS B 2 69  ? 1.696   24.410  23.016  1.00 98.65  ? 198 HIS B CG  1 
ATOM   1986 N  ND1 . HIS B 2 69  ? 0.645   23.519  23.054  1.00 98.65  ? 198 HIS B ND1 1 
ATOM   1987 C  CD2 . HIS B 2 69  ? 1.421   25.356  23.950  1.00 98.65  ? 198 HIS B CD2 1 
ATOM   1988 C  CE1 . HIS B 2 69  ? -0.224  23.901  23.973  1.00 98.65  ? 198 HIS B CE1 1 
ATOM   1989 N  NE2 . HIS B 2 69  ? 0.225   25.014  24.530  1.00 98.65  ? 198 HIS B NE2 1 
ATOM   1990 N  N   . VAL B 2 70  ? 5.391   21.530  21.431  1.00 97.11  ? 199 VAL B N   1 
ATOM   1991 C  CA  . VAL B 2 70  ? 6.427   21.137  20.487  1.00 97.11  ? 199 VAL B CA  1 
ATOM   1992 C  C   . VAL B 2 70  ? 5.728   20.496  19.294  1.00 97.11  ? 199 VAL B C   1 
ATOM   1993 O  O   . VAL B 2 70  ? 4.820   19.671  19.460  1.00 97.11  ? 199 VAL B O   1 
ATOM   1994 C  CB  . VAL B 2 70  ? 7.414   20.096  21.095  1.00 30.04  ? 199 VAL B CB  1 
ATOM   1995 C  CG1 . VAL B 2 70  ? 8.591   19.849  20.154  1.00 30.04  ? 199 VAL B CG1 1 
ATOM   1996 C  CG2 . VAL B 2 70  ? 7.922   20.561  22.430  1.00 30.04  ? 199 VAL B CG2 1 
ATOM   1997 N  N   . LYS B 2 71  ? 6.110   20.933  18.097  1.00 84.98  ? 200 LYS B N   1 
ATOM   1998 C  CA  . LYS B 2 71  ? 5.560   20.396  16.850  1.00 84.98  ? 200 LYS B CA  1 
ATOM   1999 C  C   . LYS B 2 71  ? 6.723   20.059  15.917  1.00 84.98  ? 200 LYS B C   1 
ATOM   2000 O  O   . LYS B 2 71  ? 7.522   20.933  15.568  1.00 84.98  ? 200 LYS B O   1 
ATOM   2001 C  CB  . LYS B 2 71  ? 4.626   21.402  16.162  1.00 98.35  ? 200 LYS B CB  1 
ATOM   2002 C  CG  . LYS B 2 71  ? 3.258   21.642  16.827  1.00 98.35  ? 200 LYS B CG  1 
ATOM   2003 C  CD  . LYS B 2 71  ? 2.414   22.630  16.000  1.00 98.35  ? 200 LYS B CD  1 
ATOM   2004 C  CE  . LYS B 2 71  ? 1.105   23.032  16.687  1.00 98.35  ? 200 LYS B CE  1 
ATOM   2005 N  NZ  . LYS B 2 71  ? 0.333   24.063  15.913  1.00 98.35  ? 200 LYS B NZ  1 
ATOM   2006 N  N   . HIS B 2 72  ? 6.848   18.780  15.573  1.00 98.65  ? 201 HIS B N   1 
ATOM   2007 C  CA  . HIS B 2 72  ? 7.902   18.307  14.673  1.00 98.65  ? 201 HIS B CA  1 
ATOM   2008 C  C   . HIS B 2 72  ? 7.725   18.939  13.278  1.00 98.65  ? 201 HIS B C   1 
ATOM   2009 O  O   . HIS B 2 72  ? 6.809   18.573  12.520  1.00 98.65  ? 201 HIS B O   1 
ATOM   2010 C  CB  . HIS B 2 72  ? 7.885   16.765  14.588  1.00 98.38  ? 201 HIS B CB  1 
ATOM   2011 C  CG  . HIS B 2 72  ? 6.619   16.140  15.095  1.00 98.38  ? 201 HIS B CG  1 
ATOM   2012 N  ND1 . HIS B 2 72  ? 6.172   16.292  16.394  1.00 98.38  ? 201 HIS B ND1 1 
ATOM   2013 C  CD2 . HIS B 2 72  ? 5.703   15.357  14.476  1.00 98.38  ? 201 HIS B CD2 1 
ATOM   2014 C  CE1 . HIS B 2 72  ? 5.043   15.627  16.552  1.00 98.38  ? 201 HIS B CE1 1 
ATOM   2015 N  NE2 . HIS B 2 72  ? 4.737   15.050  15.403  1.00 98.38  ? 201 HIS B NE2 1 
ATOM   2016 N  N   . MET B 2 73  ? 8.591   19.916  12.976  1.00 63.95  ? 202 MET B N   1 
ATOM   2017 C  CA  . MET B 2 73  ? 8.589   20.666  11.707  1.00 63.95  ? 202 MET B CA  1 
ATOM   2018 C  C   . MET B 2 73  ? 9.004   19.824  10.506  1.00 63.95  ? 202 MET B C   1 
ATOM   2019 O  O   . MET B 2 73  ? 8.350   19.840  9.466   1.00 63.95  ? 202 MET B O   1 
ATOM   2020 C  CB  . MET B 2 73  ? 9.507   21.876  11.839  1.00 98.65  ? 202 MET B CB  1 
ATOM   2021 C  CG  . MET B 2 73  ? 9.179   22.754  13.020  1.00 98.65  ? 202 MET B CG  1 
ATOM   2022 S  SD  . MET B 2 73  ? 10.435  23.997  13.282  1.00 98.65  ? 202 MET B SD  1 
ATOM   2023 C  CE  . MET B 2 73  ? 10.139  25.063  11.842  1.00 98.65  ? 202 MET B CE  1 
ATOM   2024 N  N   . LEU B 2 74  ? 10.130  19.137  10.666  1.00 27.53  ? 203 LEU B N   1 
ATOM   2025 C  CA  . LEU B 2 74  ? 10.704  18.229  9.677   1.00 27.53  ? 203 LEU B CA  1 
ATOM   2026 C  C   . LEU B 2 74  ? 11.043  18.808  8.320   1.00 27.53  ? 203 LEU B C   1 
ATOM   2027 O  O   . LEU B 2 74  ? 10.667  18.244  7.298   1.00 27.53  ? 203 LEU B O   1 
ATOM   2028 C  CB  . LEU B 2 74  ? 9.812   16.994  9.468   1.00 57.53  ? 203 LEU B CB  1 
ATOM   2029 C  CG  . LEU B 2 74  ? 9.310   16.095  10.610  1.00 57.53  ? 203 LEU B CG  1 
ATOM   2030 C  CD1 . LEU B 2 74  ? 8.902   14.769  9.968   1.00 57.53  ? 203 LEU B CD1 1 
ATOM   2031 C  CD2 . LEU B 2 74  ? 10.354  15.855  11.737  1.00 57.53  ? 203 LEU B CD2 1 
ATOM   2032 N  N   . LEU B 2 75  ? 11.747  19.929  8.294   1.00 51.82  ? 204 LEU B N   1 
ATOM   2033 C  CA  . LEU B 2 75  ? 12.132  20.521  7.025   1.00 51.82  ? 204 LEU B CA  1 
ATOM   2034 C  C   . LEU B 2 75  ? 13.621  20.274  6.837   1.00 51.82  ? 204 LEU B C   1 
ATOM   2035 O  O   . LEU B 2 75  ? 14.064  19.139  7.001   1.00 51.82  ? 204 LEU B O   1 
ATOM   2036 C  CB  . LEU B 2 75  ? 11.778  22.002  6.987   1.00 20.54  ? 204 LEU B CB  1 
ATOM   2037 C  CG  . LEU B 2 75  ? 10.278  22.281  7.110   1.00 20.54  ? 204 LEU B CG  1 
ATOM   2038 C  CD1 . LEU B 2 75  ? 9.999   23.739  7.373   1.00 20.54  ? 204 LEU B CD1 1 
ATOM   2039 C  CD2 . LEU B 2 75  ? 9.568   21.849  5.866   1.00 20.54  ? 204 LEU B CD2 1 
ATOM   2040 N  N   . LEU B 2 76  ? 14.397  21.300  6.500   1.00 41.43  ? 205 LEU B N   1 
ATOM   2041 C  CA  . LEU B 2 76  ? 15.837  21.112  6.302   1.00 41.43  ? 205 LEU B CA  1 
ATOM   2042 C  C   . LEU B 2 76  ? 16.672  21.082  7.584   1.00 41.43  ? 205 LEU B C   1 
ATOM   2043 O  O   . LEU B 2 76  ? 16.145  20.792  8.646   1.00 41.43  ? 205 LEU B O   1 
ATOM   2044 C  CB  . LEU B 2 76  ? 16.383  22.128  5.318   1.00 2.19   ? 205 LEU B CB  1 
ATOM   2045 C  CG  . LEU B 2 76  ? 15.793  22.038  3.924   1.00 2.19   ? 205 LEU B CG  1 
ATOM   2046 C  CD1 . LEU B 2 76  ? 16.502  23.049  3.076   1.00 2.19   ? 205 LEU B CD1 1 
ATOM   2047 C  CD2 . LEU B 2 76  ? 15.966  20.670  3.337   1.00 2.19   ? 205 LEU B CD2 1 
ATOM   2048 N  N   . THR B 2 77  ? 17.955  21.419  7.502   1.00 49.74  ? 206 THR B N   1 
ATOM   2049 C  CA  . THR B 2 77  ? 18.803  21.359  8.685   1.00 49.74  ? 206 THR B CA  1 
ATOM   2050 C  C   . THR B 2 77  ? 19.878  22.447  8.688   1.00 49.74  ? 206 THR B C   1 
ATOM   2051 O  O   . THR B 2 77  ? 21.046  22.175  8.396   1.00 49.74  ? 206 THR B O   1 
ATOM   2052 C  CB  . THR B 2 77  ? 19.496  19.999  8.743   1.00 56.19  ? 206 THR B CB  1 
ATOM   2053 O  OG1 . THR B 2 77  ? 18.537  18.973  8.472   1.00 56.19  ? 206 THR B OG1 1 
ATOM   2054 C  CG2 . THR B 2 77  ? 20.123  19.773  10.102  1.00 56.19  ? 206 THR B CG2 1 
ATOM   2055 N  N   . ASN B 2 78  ? 19.468  23.680  8.950   1.00 14.88  ? 207 ASN B N   1 
ATOM   2056 C  CA  . ASN B 2 78  ? 20.409  24.784  8.959   1.00 14.88  ? 207 ASN B CA  1 
ATOM   2057 C  C   . ASN B 2 78  ? 21.220  24.716  10.233  1.00 14.88  ? 207 ASN B C   1 
ATOM   2058 O  O   . ASN B 2 78  ? 20.920  25.406  11.197  1.00 14.88  ? 207 ASN B O   1 
ATOM   2059 C  CB  . ASN B 2 78  ? 19.676  26.117  8.830   1.00 81.01  ? 207 ASN B CB  1 
ATOM   2060 C  CG  . ASN B 2 78  ? 19.063  26.309  7.455   1.00 81.01  ? 207 ASN B CG  1 
ATOM   2061 O  OD1 . ASN B 2 78  ? 19.520  27.139  6.670   1.00 81.01  ? 207 ASN B OD1 1 
ATOM   2062 N  ND2 . ASN B 2 78  ? 18.030  25.535  7.155   1.00 81.01  ? 207 ASN B ND2 1 
ATOM   2063 N  N   . THR B 2 79  ? 22.241  23.860  10.232  1.00 63.71  ? 208 THR B N   1 
ATOM   2064 C  CA  . THR B 2 79  ? 23.090  23.665  11.404  1.00 63.71  ? 208 THR B CA  1 
ATOM   2065 C  C   . THR B 2 79  ? 23.877  24.900  11.804  1.00 63.71  ? 208 THR B C   1 
ATOM   2066 O  O   . THR B 2 79  ? 23.928  25.260  12.981  1.00 63.71  ? 208 THR B O   1 
ATOM   2067 C  CB  . THR B 2 79  ? 24.049  22.461  11.234  1.00 82.19  ? 208 THR B CB  1 
ATOM   2068 O  OG1 . THR B 2 79  ? 23.293  21.238  11.193  1.00 82.19  ? 208 THR B OG1 1 
ATOM   2069 C  CG2 . THR B 2 79  ? 25.019  22.394  12.396  1.00 82.19  ? 208 THR B CG2 1 
ATOM   2070 N  N   . PHE B 2 80  ? 24.474  25.563  10.831  1.00 31.85  ? 209 PHE B N   1 
ATOM   2071 C  CA  . PHE B 2 80  ? 25.235  26.749  11.144  1.00 31.85  ? 209 PHE B CA  1 
ATOM   2072 C  C   . PHE B 2 80  ? 24.376  27.875  11.686  1.00 31.85  ? 209 PHE B C   1 
ATOM   2073 O  O   . PHE B 2 80  ? 24.570  28.325  12.817  1.00 31.85  ? 209 PHE B O   1 
ATOM   2074 C  CB  . PHE B 2 80  ? 26.022  27.183  9.931   1.00 40.96  ? 209 PHE B CB  1 
ATOM   2075 C  CG  . PHE B 2 80  ? 27.060  26.199  9.543   1.00 40.96  ? 209 PHE B CG  1 
ATOM   2076 C  CD1 . PHE B 2 80  ? 26.725  25.083  8.803   1.00 40.96  ? 209 PHE B CD1 1 
ATOM   2077 C  CD2 . PHE B 2 80  ? 28.372  26.355  9.959   1.00 40.96  ? 209 PHE B CD2 1 
ATOM   2078 C  CE1 . PHE B 2 80  ? 27.685  24.127  8.482   1.00 40.96  ? 209 PHE B CE1 1 
ATOM   2079 C  CE2 . PHE B 2 80  ? 29.337  25.405  9.643   1.00 40.96  ? 209 PHE B CE2 1 
ATOM   2080 C  CZ  . PHE B 2 80  ? 28.992  24.291  8.903   1.00 40.96  ? 209 PHE B CZ  1 
ATOM   2081 N  N   . GLY B 2 81  ? 23.372  28.265  10.909  1.00 48.60  ? 210 GLY B N   1 
ATOM   2082 C  CA  . GLY B 2 81  ? 22.483  29.339  11.313  1.00 48.60  ? 210 GLY B CA  1 
ATOM   2083 C  C   . GLY B 2 81  ? 21.747  29.053  12.596  1.00 48.60  ? 210 GLY B C   1 
ATOM   2084 O  O   . GLY B 2 81  ? 21.058  29.913  13.122  1.00 48.60  ? 210 GLY B O   1 
ATOM   2085 N  N   . ALA B 2 82  ? 21.840  27.817  13.062  1.00 51.02  ? 211 ALA B N   1 
ATOM   2086 C  CA  . ALA B 2 82  ? 21.195  27.418  14.298  1.00 51.02  ? 211 ALA B CA  1 
ATOM   2087 C  C   . ALA B 2 82  ? 22.084  27.873  15.439  1.00 51.02  ? 211 ALA B C   1 
ATOM   2088 O  O   . ALA B 2 82  ? 21.620  28.506  16.397  1.00 51.02  ? 211 ALA B O   1 
ATOM   2089 C  CB  . ALA B 2 82  ? 21.022  25.918  14.335  1.00 98.65  ? 211 ALA B CB  1 
ATOM   2090 N  N   . ILE B 2 83  ? 23.368  27.548  15.315  1.00 98.65  ? 212 ILE B N   1 
ATOM   2091 C  CA  . ILE B 2 83  ? 24.379  27.913  16.301  1.00 98.65  ? 212 ILE B CA  1 
ATOM   2092 C  C   . ILE B 2 83  ? 24.448  29.440  16.416  1.00 98.65  ? 212 ILE B C   1 
ATOM   2093 O  O   . ILE B 2 83  ? 24.632  29.990  17.498  1.00 98.65  ? 212 ILE B O   1 
ATOM   2094 C  CB  . ILE B 2 83  ? 25.764  27.369  15.880  1.00 70.01  ? 212 ILE B CB  1 
ATOM   2095 C  CG1 . ILE B 2 83  ? 25.730  25.843  15.866  1.00 70.01  ? 212 ILE B CG1 1 
ATOM   2096 C  CG2 . ILE B 2 83  ? 26.855  27.893  16.807  1.00 70.01  ? 212 ILE B CG2 1 
ATOM   2097 C  CD1 . ILE B 2 83  ? 27.055  25.194  15.564  1.00 70.01  ? 212 ILE B CD1 1 
ATOM   2098 N  N   . ASN B 2 84  ? 24.256  30.110  15.287  1.00 78.19  ? 213 ASN B N   1 
ATOM   2099 C  CA  . ASN B 2 84  ? 24.288  31.561  15.242  1.00 78.19  ? 213 ASN B CA  1 
ATOM   2100 C  C   . ASN B 2 84  ? 22.967  32.190  15.710  1.00 78.19  ? 213 ASN B C   1 
ATOM   2101 O  O   . ASN B 2 84  ? 22.767  33.387  15.558  1.00 78.19  ? 213 ASN B O   1 
ATOM   2102 C  CB  . ASN B 2 84  ? 24.673  32.020  13.829  1.00 55.34  ? 213 ASN B CB  1 
ATOM   2103 C  CG  . ASN B 2 84  ? 26.078  31.532  13.405  1.00 55.34  ? 213 ASN B CG  1 
ATOM   2104 O  OD1 . ASN B 2 84  ? 26.976  31.444  14.229  1.00 55.34  ? 213 ASN B OD1 1 
ATOM   2105 N  ND2 . ASN B 2 84  ? 26.248  31.183  12.128  1.00 55.34  ? 213 ASN B ND2 1 
ATOM   2106 N  N   . TYR B 2 85  ? 22.087  31.363  16.280  1.00 97.95  ? 214 TYR B N   1 
ATOM   2107 C  CA  . TYR B 2 85  ? 20.799  31.817  16.813  1.00 97.95  ? 214 TYR B CA  1 
ATOM   2108 C  C   . TYR B 2 85  ? 20.912  31.726  18.309  1.00 97.95  ? 214 TYR B C   1 
ATOM   2109 O  O   . TYR B 2 85  ? 20.388  32.583  19.028  1.00 97.95  ? 214 TYR B O   1 
ATOM   2110 C  CB  . TYR B 2 85  ? 19.633  30.946  16.365  1.00 42.05  ? 214 TYR B CB  1 
ATOM   2111 C  CG  . TYR B 2 85  ? 18.273  31.497  16.760  1.00 42.05  ? 214 TYR B CG  1 
ATOM   2112 C  CD1 . TYR B 2 85  ? 17.701  31.185  17.990  1.00 42.05  ? 214 TYR B CD1 1 
ATOM   2113 C  CD2 . TYR B 2 85  ? 17.546  32.313  15.891  1.00 42.05  ? 214 TYR B CD2 1 
ATOM   2114 C  CE1 . TYR B 2 85  ? 16.432  31.672  18.343  1.00 42.05  ? 214 TYR B CE1 1 
ATOM   2115 C  CE2 . TYR B 2 85  ? 16.281  32.797  16.232  1.00 42.05  ? 214 TYR B CE2 1 
ATOM   2116 C  CZ  . TYR B 2 85  ? 15.732  32.472  17.455  1.00 42.05  ? 214 TYR B CZ  1 
ATOM   2117 O  OH  . TYR B 2 85  ? 14.473  32.923  17.776  1.00 42.05  ? 214 TYR B OH  1 
ATOM   2118 N  N   . VAL B 2 86  ? 21.578  30.670  18.777  1.00 74.64  ? 215 VAL B N   1 
ATOM   2119 C  CA  . VAL B 2 86  ? 21.814  30.456  20.202  1.00 74.64  ? 215 VAL B CA  1 
ATOM   2120 C  C   . VAL B 2 86  ? 22.650  31.645  20.667  1.00 74.64  ? 215 VAL B C   1 
ATOM   2121 O  O   . VAL B 2 86  ? 22.467  32.167  21.766  1.00 74.64  ? 215 VAL B O   1 
ATOM   2122 C  CB  . VAL B 2 86  ? 22.611  29.140  20.485  1.00 40.56  ? 215 VAL B CB  1 
ATOM   2123 C  CG1 . VAL B 2 86  ? 22.415  28.703  21.936  1.00 40.56  ? 215 VAL B CG1 1 
ATOM   2124 C  CG2 . VAL B 2 86  ? 22.191  28.037  19.540  1.00 40.56  ? 215 VAL B CG2 1 
ATOM   2125 N  N   . ALA B 2 87  ? 23.548  32.086  19.794  1.00 56.53  ? 216 ALA B N   1 
ATOM   2126 C  CA  . ALA B 2 87  ? 24.407  33.216  20.078  1.00 56.53  ? 216 ALA B CA  1 
ATOM   2127 C  C   . ALA B 2 87  ? 23.581  34.505  20.167  1.00 56.53  ? 216 ALA B C   1 
ATOM   2128 O  O   . ALA B 2 87  ? 23.215  34.930  21.267  1.00 56.53  ? 216 ALA B O   1 
ATOM   2129 C  CB  . ALA B 2 87  ? 25.489  33.336  19.004  1.00 45.89  ? 216 ALA B CB  1 
ATOM   2130 N  N   . THR B 2 88  ? 23.213  35.065  19.012  1.00 27.72  ? 217 THR B N   1 
ATOM   2131 C  CA  . THR B 2 88  ? 22.470  36.323  18.962  1.00 27.72  ? 217 THR B CA  1 
ATOM   2132 C  C   . THR B 2 88  ? 21.097  36.407  19.600  1.00 27.72  ? 217 THR B C   1 
ATOM   2133 O  O   . THR B 2 88  ? 20.863  37.317  20.378  1.00 27.72  ? 217 THR B O   1 
ATOM   2134 C  CB  . THR B 2 88  ? 22.364  36.900  17.537  1.00 98.65  ? 217 THR B CB  1 
ATOM   2135 O  OG1 . THR B 2 88  ? 21.323  36.228  16.817  1.00 98.65  ? 217 THR B OG1 1 
ATOM   2136 C  CG2 . THR B 2 88  ? 23.691  36.758  16.804  1.00 98.65  ? 217 THR B CG2 1 
ATOM   2137 N  N   . GLU B 2 89  ? 20.171  35.513  19.276  1.00 69.46  ? 218 GLU B N   1 
ATOM   2138 C  CA  . GLU B 2 89  ? 18.848  35.638  19.883  1.00 69.46  ? 218 GLU B CA  1 
ATOM   2139 C  C   . GLU B 2 89  ? 18.440  34.557  20.892  1.00 69.46  ? 218 GLU B C   1 
ATOM   2140 O  O   . GLU B 2 89  ? 17.289  34.108  20.899  1.00 69.46  ? 218 GLU B O   1 
ATOM   2141 C  CB  . GLU B 2 89  ? 17.771  35.844  18.801  1.00 67.86  ? 218 GLU B CB  1 
ATOM   2142 C  CG  . GLU B 2 89  ? 17.836  37.228  18.113  1.00 67.86  ? 218 GLU B CG  1 
ATOM   2143 C  CD  . GLU B 2 89  ? 16.641  38.157  18.431  1.00 67.86  ? 218 GLU B CD  1 
ATOM   2144 O  OE1 . GLU B 2 89  ? 15.599  37.662  18.928  1.00 67.86  ? 218 GLU B OE1 1 
ATOM   2145 O  OE2 . GLU B 2 89  ? 16.742  39.385  18.160  1.00 67.86  ? 218 GLU B OE2 1 
ATOM   2146 N  N   . VAL B 2 90  ? 19.356  34.221  21.802  1.00 34.83  ? 219 VAL B N   1 
ATOM   2147 C  CA  . VAL B 2 90  ? 19.107  33.202  22.831  1.00 34.83  ? 219 VAL B CA  1 
ATOM   2148 C  C   . VAL B 2 90  ? 19.816  33.528  24.155  1.00 34.83  ? 219 VAL B C   1 
ATOM   2149 O  O   . VAL B 2 90  ? 19.198  33.554  25.228  1.00 34.83  ? 219 VAL B O   1 
ATOM   2150 C  CB  . VAL B 2 90  ? 19.590  31.792  22.353  1.00 46.93  ? 219 VAL B CB  1 
ATOM   2151 C  CG1 . VAL B 2 90  ? 19.702  30.830  23.535  1.00 46.93  ? 219 VAL B CG1 1 
ATOM   2152 C  CG2 . VAL B 2 90  ? 18.639  31.227  21.300  1.00 46.93  ? 219 VAL B CG2 1 
ATOM   2153 N  N   . PHE B 2 91  ? 21.133  33.705  24.074  1.00 98.65  ? 220 PHE B N   1 
ATOM   2154 C  CA  . PHE B 2 91  ? 21.960  34.030  25.234  1.00 98.65  ? 220 PHE B CA  1 
ATOM   2155 C  C   . PHE B 2 91  ? 21.893  35.498  25.639  1.00 98.65  ? 220 PHE B C   1 
ATOM   2156 O  O   . PHE B 2 91  ? 22.685  35.959  26.464  1.00 98.65  ? 220 PHE B O   1 
ATOM   2157 C  CB  . PHE B 2 91  ? 23.417  33.632  24.976  1.00 81.46  ? 220 PHE B CB  1 
ATOM   2158 C  CG  . PHE B 2 91  ? 23.688  32.181  25.184  1.00 81.46  ? 220 PHE B CG  1 
ATOM   2159 C  CD1 . PHE B 2 91  ? 22.955  31.448  26.117  1.00 81.46  ? 220 PHE B CD1 1 
ATOM   2160 C  CD2 . PHE B 2 91  ? 24.689  31.542  24.462  1.00 81.46  ? 220 PHE B CD2 1 
ATOM   2161 C  CE1 . PHE B 2 91  ? 23.225  30.096  26.331  1.00 81.46  ? 220 PHE B CE1 1 
ATOM   2162 C  CE2 . PHE B 2 91  ? 24.967  30.184  24.669  1.00 81.46  ? 220 PHE B CE2 1 
ATOM   2163 C  CZ  . PHE B 2 91  ? 24.233  29.461  25.603  1.00 81.46  ? 220 PHE B CZ  1 
ATOM   2164 N  N   . ARG B 2 92  ? 20.963  36.232  25.038  1.00 98.65  ? 221 ARG B N   1 
ATOM   2165 C  CA  . ARG B 2 92  ? 20.785  37.645  25.356  1.00 98.65  ? 221 ARG B CA  1 
ATOM   2166 C  C   . ARG B 2 92  ? 20.303  37.760  26.797  1.00 98.65  ? 221 ARG B C   1 
ATOM   2167 O  O   . ARG B 2 92  ? 19.329  37.103  27.188  1.00 98.65  ? 221 ARG B O   1 
ATOM   2168 C  CB  . ARG B 2 92  ? 19.774  38.296  24.404  1.00 98.65  ? 221 ARG B CB  1 
ATOM   2169 C  CG  . ARG B 2 92  ? 20.358  38.594  23.040  1.00 98.65  ? 221 ARG B CG  1 
ATOM   2170 C  CD  . ARG B 2 92  ? 19.499  39.560  22.242  1.00 98.65  ? 221 ARG B CD  1 
ATOM   2171 N  NE  . ARG B 2 92  ? 20.191  39.984  21.024  1.00 98.65  ? 221 ARG B NE  1 
ATOM   2172 C  CZ  . ARG B 2 92  ? 19.685  40.803  20.103  1.00 98.65  ? 221 ARG B CZ  1 
ATOM   2173 N  NH1 . ARG B 2 92  ? 18.464  41.311  20.240  1.00 98.65  ? 221 ARG B NH1 1 
ATOM   2174 N  NH2 . ARG B 2 92  ? 20.406  41.111  19.034  1.00 98.65  ? 221 ARG B NH2 1 
ATOM   2175 N  N   . GLU B 2 93  ? 21.015  38.564  27.586  1.00 79.68  ? 222 GLU B N   1 
ATOM   2176 C  CA  . GLU B 2 93  ? 20.689  38.779  28.993  1.00 79.68  ? 222 GLU B CA  1 
ATOM   2177 C  C   . GLU B 2 93  ? 19.206  39.070  29.190  1.00 79.68  ? 222 GLU B C   1 
ATOM   2178 O  O   . GLU B 2 93  ? 18.611  38.598  30.164  1.00 79.68  ? 222 GLU B O   1 
ATOM   2179 C  CB  . GLU B 2 93  ? 21.534  39.924  29.574  1.00 98.65  ? 222 GLU B CB  1 
ATOM   2180 C  CG  . GLU B 2 93  ? 21.217  40.291  31.038  1.00 98.65  ? 222 GLU B CG  1 
ATOM   2181 C  CD  . GLU B 2 93  ? 22.360  40.008  32.020  1.00 98.65  ? 222 GLU B CD  1 
ATOM   2182 O  OE1 . GLU B 2 93  ? 23.509  40.433  31.759  1.00 98.65  ? 222 GLU B OE1 1 
ATOM   2183 O  OE2 . GLU B 2 93  ? 22.091  39.383  33.072  1.00 98.65  ? 222 GLU B OE2 1 
ATOM   2184 N  N   . GLU B 2 94  ? 18.608  39.786  28.233  1.00 98.65  ? 223 GLU B N   1 
ATOM   2185 C  CA  . GLU B 2 94  ? 17.187  40.144  28.287  1.00 98.65  ? 223 GLU B CA  1 
ATOM   2186 C  C   . GLU B 2 94  ? 16.269  38.973  28.633  1.00 98.65  ? 223 GLU B C   1 
ATOM   2187 O  O   . GLU B 2 94  ? 15.434  39.084  29.536  1.00 98.65  ? 223 GLU B O   1 
ATOM   2188 C  CB  . GLU B 2 94  ? 16.708  40.777  26.971  1.00 98.65  ? 223 GLU B CB  1 
ATOM   2189 C  CG  . GLU B 2 94  ? 15.269  41.338  27.070  1.00 98.65  ? 223 GLU B CG  1 
ATOM   2190 C  CD  . GLU B 2 94  ? 14.685  41.804  25.743  1.00 98.65  ? 223 GLU B CD  1 
ATOM   2191 O  OE1 . GLU B 2 94  ? 15.441  41.928  24.751  1.00 98.65  ? 223 GLU B OE1 1 
ATOM   2192 O  OE2 . GLU B 2 94  ? 13.457  42.046  25.701  1.00 98.65  ? 223 GLU B OE2 1 
ATOM   2193 N  N   . LEU B 2 95  ? 16.407  37.863  27.913  1.00 98.65  ? 224 LEU B N   1 
ATOM   2194 C  CA  . LEU B 2 95  ? 15.572  36.703  28.188  1.00 98.65  ? 224 LEU B CA  1 
ATOM   2195 C  C   . LEU B 2 95  ? 15.695  36.261  29.650  1.00 98.65  ? 224 LEU B C   1 
ATOM   2196 O  O   . LEU B 2 95  ? 14.746  36.416  30.422  1.00 98.65  ? 224 LEU B O   1 
ATOM   2197 C  CB  . LEU B 2 95  ? 15.886  35.545  27.230  1.00 98.65  ? 224 LEU B CB  1 
ATOM   2198 C  CG  . LEU B 2 95  ? 15.214  35.586  25.854  1.00 98.65  ? 224 LEU B CG  1 
ATOM   2199 C  CD1 . LEU B 2 95  ? 15.752  36.755  25.041  1.00 98.65  ? 224 LEU B CD1 1 
ATOM   2200 C  CD2 . LEU B 2 95  ? 15.456  34.270  25.132  1.00 98.65  ? 224 LEU B CD2 1 
ATOM   2201 N  N   . GLY B 2 96  ? 16.869  35.766  30.041  1.00 72.48  ? 225 GLY B N   1 
ATOM   2202 C  CA  . GLY B 2 96  ? 17.047  35.326  31.411  1.00 72.48  ? 225 GLY B CA  1 
ATOM   2203 C  C   . GLY B 2 96  ? 18.323  34.554  31.655  1.00 72.48  ? 225 GLY B C   1 
ATOM   2204 O  O   . GLY B 2 96  ? 18.290  33.444  32.191  1.00 72.48  ? 225 GLY B O   1 
ATOM   2205 N  N   . ALA B 2 97  ? 19.450  35.152  31.272  1.00 98.65  ? 226 ALA B N   1 
ATOM   2206 C  CA  . ALA B 2 97  ? 20.773  34.542  31.447  1.00 98.65  ? 226 ALA B CA  1 
ATOM   2207 C  C   . ALA B 2 97  ? 21.604  35.273  32.509  1.00 98.65  ? 226 ALA B C   1 
ATOM   2208 O  O   . ALA B 2 97  ? 21.517  36.502  32.646  1.00 98.65  ? 226 ALA B O   1 
ATOM   2209 C  CB  . ALA B 2 97  ? 21.528  34.524  30.124  1.00 64.55  ? 226 ALA B CB  1 
ATOM   2210 N  N   . ARG B 2 98  ? 22.402  34.507  33.255  1.00 98.65  ? 227 ARG B N   1 
ATOM   2211 C  CA  . ARG B 2 98  ? 23.261  35.050  34.313  1.00 98.65  ? 227 ARG B CA  1 
ATOM   2212 C  C   . ARG B 2 98  ? 24.680  35.266  33.765  1.00 98.65  ? 227 ARG B C   1 
ATOM   2213 O  O   . ARG B 2 98  ? 25.312  34.321  33.287  1.00 98.65  ? 227 ARG B O   1 
ATOM   2214 C  CB  . ARG B 2 98  ? 23.289  34.094  35.520  1.00 98.65  ? 227 ARG B CB  1 
ATOM   2215 C  CG  . ARG B 2 98  ? 21.905  33.692  36.057  1.00 98.65  ? 227 ARG B CG  1 
ATOM   2216 C  CD  . ARG B 2 98  ? 21.999  32.973  37.409  1.00 98.65  ? 227 ARG B CD  1 
ATOM   2217 N  NE  . ARG B 2 98  ? 20.697  32.507  37.904  1.00 98.65  ? 227 ARG B NE  1 
ATOM   2218 C  CZ  . ARG B 2 98  ? 20.320  32.493  39.186  1.00 98.65  ? 227 ARG B CZ  1 
ATOM   2219 N  NH1 . ARG B 2 98  ? 21.132  32.925  40.149  1.00 98.65  ? 227 ARG B NH1 1 
ATOM   2220 N  NH2 . ARG B 2 98  ? 19.114  32.043  39.510  1.00 98.65  ? 227 ARG B NH2 1 
ATOM   2221 N  N   . PRO B 2 99  ? 25.194  36.515  33.823  1.00 98.65  ? 228 PRO B N   1 
ATOM   2222 C  CA  . PRO B 2 99  ? 26.527  36.920  33.346  1.00 98.65  ? 228 PRO B CA  1 
ATOM   2223 C  C   . PRO B 2 99  ? 27.694  36.066  33.834  1.00 98.65  ? 228 PRO B C   1 
ATOM   2224 O  O   . PRO B 2 99  ? 28.428  35.489  33.022  1.00 98.65  ? 228 PRO B O   1 
ATOM   2225 C  CB  . PRO B 2 99  ? 26.649  38.354  33.858  1.00 98.65  ? 228 PRO B CB  1 
ATOM   2226 C  CG  . PRO B 2 99  ? 25.259  38.838  33.781  1.00 98.65  ? 228 PRO B CG  1 
ATOM   2227 C  CD  . PRO B 2 99  ? 24.476  37.680  34.367  1.00 98.65  ? 228 PRO B CD  1 
ATOM   2228 N  N   . ASP B 2 100 ? 27.871  36.006  35.154  1.00 98.65  ? 229 ASP B N   1 
ATOM   2229 C  CA  . ASP B 2 100 ? 28.950  35.228  35.761  1.00 98.65  ? 229 ASP B CA  1 
ATOM   2230 C  C   . ASP B 2 100 ? 28.622  33.725  35.743  1.00 98.65  ? 229 ASP B C   1 
ATOM   2231 O  O   . ASP B 2 100 ? 28.580  33.064  36.789  1.00 98.65  ? 229 ASP B O   1 
ATOM   2232 C  CB  . ASP B 2 100 ? 29.206  35.712  37.198  1.00 98.64  ? 229 ASP B CB  1 
ATOM   2233 C  CG  . ASP B 2 100 ? 30.669  35.562  37.629  1.00 98.64  ? 229 ASP B CG  1 
ATOM   2234 O  OD1 . ASP B 2 100 ? 31.398  34.712  37.061  1.00 98.64  ? 229 ASP B OD1 1 
ATOM   2235 O  OD2 . ASP B 2 100 ? 31.090  36.307  38.544  1.00 98.64  ? 229 ASP B OD2 1 
ATOM   2236 N  N   . ALA B 2 101 ? 28.396  33.200  34.539  1.00 98.65  ? 230 ALA B N   1 
ATOM   2237 C  CA  . ALA B 2 101 ? 28.073  31.791  34.329  1.00 98.65  ? 230 ALA B CA  1 
ATOM   2238 C  C   . ALA B 2 101 ? 28.565  31.345  32.948  1.00 98.65  ? 230 ALA B C   1 
ATOM   2239 O  O   . ALA B 2 101 ? 28.573  32.136  31.997  1.00 98.65  ? 230 ALA B O   1 
ATOM   2240 C  CB  . ALA B 2 101 ? 26.570  31.571  34.462  1.00 78.31  ? 230 ALA B CB  1 
ATOM   2241 N  N   . THR B 2 102 ? 28.979  30.081  32.849  1.00 98.64  ? 231 THR B N   1 
ATOM   2242 C  CA  . THR B 2 102 ? 29.499  29.527  31.599  1.00 98.64  ? 231 THR B CA  1 
ATOM   2243 C  C   . THR B 2 102 ? 28.382  29.116  30.622  1.00 98.64  ? 231 THR B C   1 
ATOM   2244 O  O   . THR B 2 102 ? 27.504  28.322  30.967  1.00 98.64  ? 231 THR B O   1 
ATOM   2245 C  CB  . THR B 2 102 ? 30.457  28.327  31.877  1.00 96.04  ? 231 THR B CB  1 
ATOM   2246 O  OG1 . THR B 2 102 ? 31.330  28.646  32.970  1.00 96.04  ? 231 THR B OG1 1 
ATOM   2247 C  CG2 . THR B 2 102 ? 31.321  28.032  30.664  1.00 96.04  ? 231 THR B CG2 1 
ATOM   2248 N  N   . LYS B 2 103 ? 28.427  29.678  29.411  1.00 98.65  ? 232 LYS B N   1 
ATOM   2249 C  CA  . LYS B 2 103 ? 27.445  29.406  28.356  1.00 98.65  ? 232 LYS B CA  1 
ATOM   2250 C  C   . LYS B 2 103 ? 27.757  28.142  27.532  1.00 98.65  ? 232 LYS B C   1 
ATOM   2251 O  O   . LYS B 2 103 ? 28.613  28.148  26.641  1.00 98.65  ? 232 LYS B O   1 
ATOM   2252 C  CB  . LYS B 2 103 ? 27.309  30.635  27.439  1.00 86.73  ? 232 LYS B CB  1 
ATOM   2253 C  CG  . LYS B 2 103 ? 28.566  31.012  26.658  1.00 86.73  ? 232 LYS B CG  1 
ATOM   2254 C  CD  . LYS B 2 103 ? 28.894  32.498  26.762  1.00 86.73  ? 232 LYS B CD  1 
ATOM   2255 C  CE  . LYS B 2 103 ? 29.541  32.823  28.102  1.00 86.73  ? 232 LYS B CE  1 
ATOM   2256 N  NZ  . LYS B 2 103 ? 29.943  34.254  28.212  1.00 86.73  ? 232 LYS B NZ  1 
ATOM   2257 N  N   . VAL B 2 104 ? 27.060  27.056  27.848  1.00 68.95  ? 233 VAL B N   1 
ATOM   2258 C  CA  . VAL B 2 104 ? 27.255  25.787  27.158  1.00 68.95  ? 233 VAL B CA  1 
ATOM   2259 C  C   . VAL B 2 104 ? 26.304  25.631  25.973  1.00 68.95  ? 233 VAL B C   1 
ATOM   2260 O  O   . VAL B 2 104 ? 25.221  26.216  25.933  1.00 68.95  ? 233 VAL B O   1 
ATOM   2261 C  CB  . VAL B 2 104 ? 27.121  24.585  28.141  1.00 47.04  ? 233 VAL B CB  1 
ATOM   2262 C  CG1 . VAL B 2 104 ? 27.450  23.259  27.451  1.00 47.04  ? 233 VAL B CG1 1 
ATOM   2263 C  CG2 . VAL B 2 104 ? 28.034  24.793  29.328  1.00 47.04  ? 233 VAL B CG2 1 
ATOM   2264 N  N   . LEU B 2 105 ? 26.729  24.817  25.017  1.00 98.65  ? 234 LEU B N   1 
ATOM   2265 C  CA  . LEU B 2 105 ? 25.974  24.572  23.804  1.00 98.65  ? 234 LEU B CA  1 
ATOM   2266 C  C   . LEU B 2 105 ? 25.902  23.068  23.559  1.00 98.65  ? 234 LEU B C   1 
ATOM   2267 O  O   . LEU B 2 105 ? 26.924  22.422  23.340  1.00 98.65  ? 234 LEU B O   1 
ATOM   2268 C  CB  . LEU B 2 105 ? 26.712  25.256  22.644  1.00 39.18  ? 234 LEU B CB  1 
ATOM   2269 C  CG  . LEU B 2 105 ? 26.141  25.540  21.255  1.00 39.18  ? 234 LEU B CG  1 
ATOM   2270 C  CD1 . LEU B 2 105 ? 25.032  26.581  21.281  1.00 39.18  ? 234 LEU B CD1 1 
ATOM   2271 C  CD2 . LEU B 2 105 ? 27.290  26.065  20.430  1.00 39.18  ? 234 LEU B CD2 1 
ATOM   2272 N  N   . ILE B 2 106 ? 24.703  22.508  23.683  1.00 47.90  ? 235 ILE B N   1 
ATOM   2273 C  CA  . ILE B 2 106 ? 24.471  21.087  23.434  1.00 47.90  ? 235 ILE B CA  1 
ATOM   2274 C  C   . ILE B 2 106 ? 23.735  20.963  22.111  1.00 47.90  ? 235 ILE B C   1 
ATOM   2275 O  O   . ILE B 2 106 ? 22.513  21.096  22.076  1.00 47.90  ? 235 ILE B O   1 
ATOM   2276 C  CB  . ILE B 2 106 ? 23.588  20.451  24.518  1.00 33.70  ? 235 ILE B CB  1 
ATOM   2277 C  CG1 . ILE B 2 106 ? 24.385  20.265  25.800  1.00 33.70  ? 235 ILE B CG1 1 
ATOM   2278 C  CG2 . ILE B 2 106 ? 23.042  19.099  24.048  1.00 33.70  ? 235 ILE B CG2 1 
ATOM   2279 C  CD1 . ILE B 2 106 ? 25.225  19.004  25.812  1.00 33.70  ? 235 ILE B CD1 1 
ATOM   2280 N  N   . ILE B 2 107 ? 24.479  20.724  21.031  1.00 58.83  ? 236 ILE B N   1 
ATOM   2281 C  CA  . ILE B 2 107 ? 23.896  20.578  19.694  1.00 58.83  ? 236 ILE B CA  1 
ATOM   2282 C  C   . ILE B 2 107 ? 23.523  19.122  19.452  1.00 58.83  ? 236 ILE B C   1 
ATOM   2283 O  O   . ILE B 2 107 ? 24.315  18.210  19.692  1.00 58.83  ? 236 ILE B O   1 
ATOM   2284 C  CB  . ILE B 2 107 ? 24.879  20.983  18.598  1.00 78.17  ? 236 ILE B CB  1 
ATOM   2285 C  CG1 . ILE B 2 107 ? 25.554  22.303  18.954  1.00 78.17  ? 236 ILE B CG1 1 
ATOM   2286 C  CG2 . ILE B 2 107 ? 24.141  21.087  17.270  1.00 78.17  ? 236 ILE B CG2 1 
ATOM   2287 C  CD1 . ILE B 2 107 ? 26.807  22.575  18.150  1.00 78.17  ? 236 ILE B CD1 1 
ATOM   2288 N  N   . ILE B 2 108 ? 22.309  18.902  18.973  1.00 78.06  ? 237 ILE B N   1 
ATOM   2289 C  CA  . ILE B 2 108 ? 21.828  17.553  18.704  1.00 78.06  ? 237 ILE B CA  1 
ATOM   2290 C  C   . ILE B 2 108 ? 21.393  17.513  17.248  1.00 78.06  ? 237 ILE B C   1 
ATOM   2291 O  O   . ILE B 2 108 ? 20.476  18.226  16.851  1.00 78.06  ? 237 ILE B O   1 
ATOM   2292 C  CB  . ILE B 2 108 ? 20.645  17.190  19.620  1.00 54.85  ? 237 ILE B CB  1 
ATOM   2293 C  CG1 . ILE B 2 108 ? 20.879  17.751  21.027  1.00 54.85  ? 237 ILE B CG1 1 
ATOM   2294 C  CG2 . ILE B 2 108 ? 20.477  15.669  19.690  1.00 54.85  ? 237 ILE B CG2 1 
ATOM   2295 C  CD1 . ILE B 2 108 ? 19.700  17.640  21.967  1.00 54.85  ? 237 ILE B CD1 1 
ATOM   2296 N  N   . THR B 2 109 ? 22.104  16.728  16.444  1.00 98.65  ? 238 THR B N   1 
ATOM   2297 C  CA  . THR B 2 109 ? 21.817  16.592  15.010  1.00 98.65  ? 238 THR B CA  1 
ATOM   2298 C  C   . THR B 2 109 ? 22.587  15.411  14.398  1.00 98.65  ? 238 THR B C   1 
ATOM   2299 O  O   . THR B 2 109 ? 23.668  15.045  14.870  1.00 98.65  ? 238 THR B O   1 
ATOM   2300 C  CB  . THR B 2 109 ? 22.079  17.927  14.234  1.00 48.67  ? 238 THR B CB  1 
ATOM   2301 O  OG1 . THR B 2 109 ? 21.675  17.786  12.867  1.00 48.67  ? 238 THR B OG1 1 
ATOM   2302 C  CG2 . THR B 2 109 ? 23.557  18.329  14.287  1.00 48.67  ? 238 THR B CG2 1 
ATOM   2303 N  N   . ASP B 2 110 ? 22.012  14.792  13.363  1.00 62.76  ? 239 ASP B N   1 
ATOM   2304 C  CA  . ASP B 2 110 ? 22.647  13.648  12.687  1.00 62.76  ? 239 ASP B CA  1 
ATOM   2305 C  C   . ASP B 2 110 ? 23.965  14.018  12.007  1.00 62.76  ? 239 ASP B C   1 
ATOM   2306 O  O   . ASP B 2 110 ? 24.608  13.175  11.386  1.00 62.76  ? 239 ASP B O   1 
ATOM   2307 C  CB  . ASP B 2 110 ? 21.696  13.025  11.661  1.00 98.65  ? 239 ASP B CB  1 
ATOM   2308 C  CG  . ASP B 2 110 ? 21.229  14.030  10.603  1.00 98.65  ? 239 ASP B CG  1 
ATOM   2309 O  OD1 . ASP B 2 110 ? 21.680  15.207  10.629  1.00 98.65  ? 239 ASP B OD1 1 
ATOM   2310 O  OD2 . ASP B 2 110 ? 20.406  13.652  9.745   1.00 98.65  ? 239 ASP B OD2 1 
ATOM   2311 N  N   . GLY B 2 111 ? 24.343  15.290  12.136  1.00 90.91  ? 240 GLY B N   1 
ATOM   2312 C  CA  . GLY B 2 111 ? 25.560  15.782  11.533  1.00 90.91  ? 240 GLY B CA  1 
ATOM   2313 C  C   . GLY B 2 111 ? 25.480  15.912  10.025  1.00 90.91  ? 240 GLY B C   1 
ATOM   2314 O  O   . GLY B 2 111 ? 26.406  15.536  9.320   1.00 90.91  ? 240 GLY B O   1 
ATOM   2315 N  N   . GLU B 2 112 ? 24.371  16.459  9.539   1.00 69.52  ? 241 GLU B N   1 
ATOM   2316 C  CA  . GLU B 2 112 ? 24.141  16.666  8.110   1.00 69.52  ? 241 GLU B CA  1 
ATOM   2317 C  C   . GLU B 2 112 ? 23.645  18.100  7.903   1.00 69.52  ? 241 GLU B C   1 
ATOM   2318 O  O   . GLU B 2 112 ? 22.494  18.427  8.219   1.00 69.52  ? 241 GLU B O   1 
ATOM   2319 C  CB  . GLU B 2 112 ? 23.093  15.677  7.603   1.00 71.31  ? 241 GLU B CB  1 
ATOM   2320 C  CG  . GLU B 2 112 ? 22.633  15.930  6.181   1.00 71.31  ? 241 GLU B CG  1 
ATOM   2321 C  CD  . GLU B 2 112 ? 21.404  15.121  5.812   1.00 71.31  ? 241 GLU B CD  1 
ATOM   2322 O  OE1 . GLU B 2 112 ? 21.146  14.974  4.599   1.00 71.31  ? 241 GLU B OE1 1 
ATOM   2323 O  OE2 . GLU B 2 112 ? 20.686  14.650  6.728   1.00 71.31  ? 241 GLU B OE2 1 
ATOM   2324 N  N   . ALA B 2 113 ? 24.510  18.951  7.365   1.00 42.62  ? 242 ALA B N   1 
ATOM   2325 C  CA  . ALA B 2 113 ? 24.140  20.338  7.150   1.00 42.62  ? 242 ALA B CA  1 
ATOM   2326 C  C   . ALA B 2 113 ? 23.476  20.555  5.801   1.00 42.62  ? 242 ALA B C   1 
ATOM   2327 O  O   . ALA B 2 113 ? 23.801  19.865  4.826   1.00 42.62  ? 242 ALA B O   1 
ATOM   2328 C  CB  . ALA B 2 113 ? 25.356  21.225  7.285   1.00 98.65  ? 242 ALA B CB  1 
ATOM   2329 N  N   . THR B 2 114 ? 22.527  21.496  5.773   1.00 81.69  ? 243 THR B N   1 
ATOM   2330 C  CA  . THR B 2 114 ? 21.803  21.874  4.552   1.00 81.69  ? 243 THR B CA  1 
ATOM   2331 C  C   . THR B 2 114 ? 22.265  23.244  4.085   1.00 81.69  ? 243 THR B C   1 
ATOM   2332 O  O   . THR B 2 114 ? 21.642  23.867  3.226   1.00 81.69  ? 243 THR B O   1 
ATOM   2333 C  CB  . THR B 2 114 ? 20.289  21.961  4.755   1.00 51.89  ? 243 THR B CB  1 
ATOM   2334 O  OG1 . THR B 2 114 ? 19.990  22.935  5.762   1.00 51.89  ? 243 THR B OG1 1 
ATOM   2335 C  CG2 . THR B 2 114 ? 19.738  20.620  5.137   1.00 51.89  ? 243 THR B CG2 1 
ATOM   2336 N  N   . ASP B 2 115 ? 23.320  23.734  4.718   1.00 61.64  ? 244 ASP B N   1 
ATOM   2337 C  CA  . ASP B 2 115 ? 23.903  25.015  4.378   1.00 61.64  ? 244 ASP B CA  1 
ATOM   2338 C  C   . ASP B 2 115 ? 25.314  25.090  4.955   1.00 61.64  ? 244 ASP B C   1 
ATOM   2339 O  O   . ASP B 2 115 ? 25.670  24.310  5.836   1.00 61.64  ? 244 ASP B O   1 
ATOM   2340 C  CB  . ASP B 2 115 ? 23.025  26.170  4.878   1.00 40.45  ? 244 ASP B CB  1 
ATOM   2341 C  CG  . ASP B 2 115 ? 22.842  26.172  6.376   1.00 40.45  ? 244 ASP B CG  1 
ATOM   2342 O  OD1 . ASP B 2 115 ? 23.194  25.172  7.027   1.00 40.45  ? 244 ASP B OD1 1 
ATOM   2343 O  OD2 . ASP B 2 115 ? 22.332  27.180  6.906   1.00 40.45  ? 244 ASP B OD2 1 
ATOM   2344 N  N   . SER B 2 116 ? 26.137  25.975  4.404   1.00 65.85  ? 245 SER B N   1 
ATOM   2345 C  CA  . SER B 2 116 ? 27.499  26.136  4.879   1.00 65.85  ? 245 SER B CA  1 
ATOM   2346 C  C   . SER B 2 116 ? 27.624  27.524  5.468   1.00 65.85  ? 245 SER B C   1 
ATOM   2347 O  O   . SER B 2 116 ? 27.659  28.509  4.734   1.00 65.85  ? 245 SER B O   1 
ATOM   2348 C  CB  . SER B 2 116 ? 28.489  25.957  3.726   1.00 98.65  ? 245 SER B CB  1 
ATOM   2349 O  OG  . SER B 2 116 ? 28.228  26.873  2.676   1.00 98.65  ? 245 SER B OG  1 
ATOM   2350 N  N   . GLY B 2 117 ? 27.622  27.606  6.793   1.00 76.08  ? 246 GLY B N   1 
ATOM   2351 C  CA  . GLY B 2 117 ? 27.741  28.892  7.452   1.00 76.08  ? 246 GLY B CA  1 
ATOM   2352 C  C   . GLY B 2 117 ? 29.049  29.008  8.208   1.00 76.08  ? 246 GLY B C   1 
ATOM   2353 O  O   . GLY B 2 117 ? 30.033  28.345  7.876   1.00 76.08  ? 246 GLY B O   1 
ATOM   2354 N  N   . ASN B 2 118 ? 29.057  29.846  9.240   1.00 98.65  ? 247 ASN B N   1 
ATOM   2355 C  CA  . ASN B 2 118 ? 30.246  30.047  10.061  1.00 98.65  ? 247 ASN B CA  1 
ATOM   2356 C  C   . ASN B 2 118 ? 29.812  30.363  11.495  1.00 98.65  ? 247 ASN B C   1 
ATOM   2357 O  O   . ASN B 2 118 ? 28.905  31.176  11.720  1.00 98.65  ? 247 ASN B O   1 
ATOM   2358 C  CB  . ASN B 2 118 ? 31.105  31.185  9.485   1.00 98.65  ? 247 ASN B CB  1 
ATOM   2359 C  CG  . ASN B 2 118 ? 32.563  31.100  9.918   1.00 98.65  ? 247 ASN B CG  1 
ATOM   2360 O  OD1 . ASN B 2 118 ? 32.939  30.228  10.709  1.00 98.65  ? 247 ASN B OD1 1 
ATOM   2361 N  ND2 . ASN B 2 118 ? 33.394  32.000  9.389   1.00 98.65  ? 247 ASN B ND2 1 
ATOM   2362 N  N   . ILE B 2 119 ? 30.451  29.699  12.455  1.00 93.55  ? 248 ILE B N   1 
ATOM   2363 C  CA  . ILE B 2 119 ? 30.133  29.882  13.865  1.00 93.55  ? 248 ILE B CA  1 
ATOM   2364 C  C   . ILE B 2 119 ? 31.100  30.767  14.634  1.00 93.55  ? 248 ILE B C   1 
ATOM   2365 O  O   . ILE B 2 119 ? 31.068  30.792  15.862  1.00 93.55  ? 248 ILE B O   1 
ATOM   2366 C  CB  . ILE B 2 119 ? 30.071  28.542  14.592  1.00 55.72  ? 248 ILE B CB  1 
ATOM   2367 C  CG1 . ILE B 2 119 ? 31.413  27.827  14.464  1.00 55.72  ? 248 ILE B CG1 1 
ATOM   2368 C  CG2 . ILE B 2 119 ? 28.962  27.706  14.019  1.00 55.72  ? 248 ILE B CG2 1 
ATOM   2369 C  CD1 . ILE B 2 119 ? 31.522  26.577  15.297  1.00 55.72  ? 248 ILE B CD1 1 
ATOM   2370 N  N   . ASP B 2 120 ? 31.962  31.487  13.925  1.00 84.70  ? 249 ASP B N   1 
ATOM   2371 C  CA  . ASP B 2 120 ? 32.921  32.368  14.583  1.00 84.70  ? 249 ASP B CA  1 
ATOM   2372 C  C   . ASP B 2 120 ? 32.198  33.370  15.472  1.00 84.70  ? 249 ASP B C   1 
ATOM   2373 O  O   . ASP B 2 120 ? 32.781  33.893  16.415  1.00 84.70  ? 249 ASP B O   1 
ATOM   2374 C  CB  . ASP B 2 120 ? 33.787  33.119  13.568  1.00 87.62  ? 249 ASP B CB  1 
ATOM   2375 C  CG  . ASP B 2 120 ? 34.982  32.302  13.083  1.00 87.62  ? 249 ASP B CG  1 
ATOM   2376 O  OD1 . ASP B 2 120 ? 35.727  32.806  12.210  1.00 87.62  ? 249 ASP B OD1 1 
ATOM   2377 O  OD2 . ASP B 2 120 ? 35.182  31.167  13.566  1.00 87.62  ? 249 ASP B OD2 1 
ATOM   2378 N  N   . ALA B 2 121 ? 30.916  33.600  15.188  1.00 91.37  ? 250 ALA B N   1 
ATOM   2379 C  CA  . ALA B 2 121 ? 30.101  34.530  15.967  1.00 91.37  ? 250 ALA B CA  1 
ATOM   2380 C  C   . ALA B 2 121 ? 29.848  34.065  17.401  1.00 91.37  ? 250 ALA B C   1 
ATOM   2381 O  O   . ALA B 2 121 ? 29.221  34.773  18.182  1.00 91.37  ? 250 ALA B O   1 
ATOM   2382 C  CB  . ALA B 2 121 ? 28.789  34.814  15.236  1.00 83.91  ? 250 ALA B CB  1 
ATOM   2383 N  N   . ALA B 2 122 ? 30.352  32.874  17.723  1.00 46.71  ? 251 ALA B N   1 
ATOM   2384 C  CA  . ALA B 2 122 ? 30.188  32.264  19.042  1.00 46.71  ? 251 ALA B CA  1 
ATOM   2385 C  C   . ALA B 2 122 ? 31.200  31.124  19.233  1.00 46.71  ? 251 ALA B C   1 
ATOM   2386 O  O   . ALA B 2 122 ? 30.906  30.138  19.911  1.00 46.71  ? 251 ALA B O   1 
ATOM   2387 C  CB  . ALA B 2 122 ? 28.749  31.763  19.254  1.00 96.98  ? 251 ALA B CB  1 
ATOM   2388 N  N   . LYS B 2 123 ? 32.389  31.274  18.634  1.00 98.65  ? 252 LYS B N   1 
ATOM   2389 C  CA  . LYS B 2 123 ? 33.475  30.282  18.703  1.00 98.65  ? 252 LYS B CA  1 
ATOM   2390 C  C   . LYS B 2 123 ? 34.011  30.027  20.127  1.00 98.65  ? 252 LYS B C   1 
ATOM   2391 O  O   . LYS B 2 123 ? 34.807  29.099  20.359  1.00 98.65  ? 252 LYS B O   1 
ATOM   2392 C  CB  . LYS B 2 123 ? 34.647  30.703  17.804  1.00 98.50  ? 252 LYS B CB  1 
ATOM   2393 C  CG  . LYS B 2 123 ? 34.724  29.955  16.475  1.00 98.50  ? 252 LYS B CG  1 
ATOM   2394 C  CD  . LYS B 2 123 ? 35.346  28.562  16.610  1.00 98.50  ? 252 LYS B CD  1 
ATOM   2395 C  CE  . LYS B 2 123 ? 35.411  27.821  15.274  1.00 98.50  ? 252 LYS B CE  1 
ATOM   2396 N  NZ  . LYS B 2 123 ? 36.323  28.455  14.284  1.00 98.50  ? 252 LYS B NZ  1 
ATOM   2397 N  N   . ASP B 2 124 ? 33.565  30.846  21.075  1.00 98.65  ? 253 ASP B N   1 
ATOM   2398 C  CA  . ASP B 2 124 ? 33.969  30.759  22.479  1.00 98.65  ? 253 ASP B CA  1 
ATOM   2399 C  C   . ASP B 2 124 ? 33.075  29.819  23.307  1.00 98.65  ? 253 ASP B C   1 
ATOM   2400 O  O   . ASP B 2 124 ? 33.507  29.289  24.331  1.00 98.65  ? 253 ASP B O   1 
ATOM   2401 C  CB  . ASP B 2 124 ? 33.964  32.174  23.084  1.00 79.13  ? 253 ASP B CB  1 
ATOM   2402 C  CG  . ASP B 2 124 ? 32.602  32.867  22.975  1.00 79.13  ? 253 ASP B CG  1 
ATOM   2403 O  OD1 . ASP B 2 124 ? 31.728  32.405  22.210  1.00 79.13  ? 253 ASP B OD1 1 
ATOM   2404 O  OD2 . ASP B 2 124 ? 32.409  33.889  23.665  1.00 79.13  ? 253 ASP B OD2 1 
ATOM   2405 N  N   . ILE B 2 125 ? 31.845  29.601  22.840  1.00 94.13  ? 254 ILE B N   1 
ATOM   2406 C  CA  . ILE B 2 125 ? 30.868  28.751  23.526  1.00 94.13  ? 254 ILE B CA  1 
ATOM   2407 C  C   . ILE B 2 125 ? 31.229  27.268  23.594  1.00 94.13  ? 254 ILE B C   1 
ATOM   2408 O  O   . ILE B 2 125 ? 31.759  26.696  22.638  1.00 94.13  ? 254 ILE B O   1 
ATOM   2409 C  CB  . ILE B 2 125 ? 29.469  28.892  22.887  1.00 98.65  ? 254 ILE B CB  1 
ATOM   2410 C  CG1 . ILE B 2 125 ? 28.998  30.345  22.980  1.00 98.65  ? 254 ILE B CG1 1 
ATOM   2411 C  CG2 . ILE B 2 125 ? 28.474  27.977  23.579  1.00 98.65  ? 254 ILE B CG2 1 
ATOM   2412 C  CD1 . ILE B 2 125 ? 27.671  30.612  22.309  1.00 98.65  ? 254 ILE B CD1 1 
ATOM   2413 N  N   . ILE B 2 126 ? 30.912  26.654  24.733  1.00 91.60  ? 255 ILE B N   1 
ATOM   2414 C  CA  . ILE B 2 126 ? 31.186  25.241  24.951  1.00 91.60  ? 255 ILE B CA  1 
ATOM   2415 C  C   . ILE B 2 126 ? 30.264  24.395  24.081  1.00 91.60  ? 255 ILE B C   1 
ATOM   2416 O  O   . ILE B 2 126 ? 29.090  24.230  24.399  1.00 91.60  ? 255 ILE B O   1 
ATOM   2417 C  CB  . ILE B 2 126 ? 30.971  24.844  26.432  1.00 98.65  ? 255 ILE B CB  1 
ATOM   2418 C  CG1 . ILE B 2 126 ? 31.828  25.713  27.352  1.00 98.65  ? 255 ILE B CG1 1 
ATOM   2419 C  CG2 . ILE B 2 126 ? 31.331  23.378  26.642  1.00 98.65  ? 255 ILE B CG2 1 
ATOM   2420 C  CD1 . ILE B 2 126 ? 31.786  25.273  28.807  1.00 98.65  ? 255 ILE B CD1 1 
ATOM   2421 N  N   . ARG B 2 127 ? 30.803  23.867  22.983  1.00 98.65  ? 256 ARG B N   1 
ATOM   2422 C  CA  . ARG B 2 127 ? 30.034  23.032  22.058  1.00 98.65  ? 256 ARG B CA  1 
ATOM   2423 C  C   . ARG B 2 127 ? 29.856  21.607  22.576  1.00 98.65  ? 256 ARG B C   1 
ATOM   2424 O  O   . ARG B 2 127 ? 30.650  21.138  23.388  1.00 98.65  ? 256 ARG B O   1 
ATOM   2425 C  CB  . ARG B 2 127 ? 30.690  23.031  20.674  1.00 98.65  ? 256 ARG B CB  1 
ATOM   2426 C  CG  . ARG B 2 127 ? 30.488  24.340  19.915  1.00 98.65  ? 256 ARG B CG  1 
ATOM   2427 C  CD  . ARG B 2 127 ? 31.753  24.787  19.212  1.00 98.65  ? 256 ARG B CD  1 
ATOM   2428 N  NE  . ARG B 2 127 ? 32.832  25.026  20.166  1.00 98.65  ? 256 ARG B NE  1 
ATOM   2429 C  CZ  . ARG B 2 127 ? 33.950  25.691  19.890  1.00 98.65  ? 256 ARG B CZ  1 
ATOM   2430 N  NH1 . ARG B 2 127 ? 34.151  26.194  18.678  1.00 98.65  ? 256 ARG B NH1 1 
ATOM   2431 N  NH2 . ARG B 2 127 ? 34.869  25.858  20.834  1.00 98.65  ? 256 ARG B NH2 1 
ATOM   2432 N  N   . TYR B 2 128 ? 28.811  20.930  22.105  1.00 87.28  ? 257 TYR B N   1 
ATOM   2433 C  CA  . TYR B 2 128 ? 28.501  19.566  22.528  1.00 87.28  ? 257 TYR B CA  1 
ATOM   2434 C  C   . TYR B 2 128 ? 27.533  18.868  21.577  1.00 87.28  ? 257 TYR B C   1 
ATOM   2435 O  O   . TYR B 2 128 ? 26.404  18.550  21.955  1.00 87.28  ? 257 TYR B O   1 
ATOM   2436 C  CB  . TYR B 2 128 ? 27.889  19.590  23.927  1.00 74.31  ? 257 TYR B CB  1 
ATOM   2437 C  CG  . TYR B 2 128 ? 28.873  19.412  25.058  1.00 74.31  ? 257 TYR B CG  1 
ATOM   2438 C  CD1 . TYR B 2 128 ? 29.792  18.363  25.044  1.00 74.31  ? 257 TYR B CD1 1 
ATOM   2439 C  CD2 . TYR B 2 128 ? 28.856  20.259  26.167  1.00 74.31  ? 257 TYR B CD2 1 
ATOM   2440 C  CE1 . TYR B 2 128 ? 30.658  18.152  26.102  1.00 74.31  ? 257 TYR B CE1 1 
ATOM   2441 C  CE2 . TYR B 2 128 ? 29.721  20.053  27.233  1.00 74.31  ? 257 TYR B CE2 1 
ATOM   2442 C  CZ  . TYR B 2 128 ? 30.618  18.996  27.187  1.00 74.31  ? 257 TYR B CZ  1 
ATOM   2443 O  OH  . TYR B 2 128 ? 31.478  18.756  28.227  1.00 74.31  ? 257 TYR B OH  1 
ATOM   2444 N  N   . ILE B 2 129 ? 27.991  18.599  20.357  1.00 73.58  ? 258 ILE B N   1 
ATOM   2445 C  CA  . ILE B 2 129 ? 27.168  17.942  19.338  1.00 73.58  ? 258 ILE B CA  1 
ATOM   2446 C  C   . ILE B 2 129 ? 27.038  16.410  19.457  1.00 73.58  ? 258 ILE B C   1 
ATOM   2447 O  O   . ILE B 2 129 ? 28.030  15.682  19.580  1.00 73.58  ? 258 ILE B O   1 
ATOM   2448 C  CB  . ILE B 2 129 ? 27.618  18.341  17.901  1.00 98.65  ? 258 ILE B CB  1 
ATOM   2449 C  CG1 . ILE B 2 129 ? 26.719  17.664  16.860  1.00 98.65  ? 258 ILE B CG1 1 
ATOM   2450 C  CG2 . ILE B 2 129 ? 29.094  18.010  17.679  1.00 98.65  ? 258 ILE B CG2 1 
ATOM   2451 C  CD1 . ILE B 2 129 ? 26.963  18.122  15.440  1.00 98.65  ? 258 ILE B CD1 1 
ATOM   2452 N  N   . ILE B 2 130 ? 25.796  15.936  19.380  1.00 98.65  ? 259 ILE B N   1 
ATOM   2453 C  CA  . ILE B 2 130 ? 25.492  14.511  19.493  1.00 98.65  ? 259 ILE B CA  1 
ATOM   2454 C  C   . ILE B 2 130 ? 24.773  13.903  18.284  1.00 98.65  ? 259 ILE B C   1 
ATOM   2455 O  O   . ILE B 2 130 ? 23.620  14.237  18.001  1.00 98.65  ? 259 ILE B O   1 
ATOM   2456 C  CB  . ILE B 2 130 ? 24.666  14.234  20.765  1.00 59.37  ? 259 ILE B CB  1 
ATOM   2457 C  CG1 . ILE B 2 130 ? 23.668  15.368  20.994  1.00 59.37  ? 259 ILE B CG1 1 
ATOM   2458 C  CG2 . ILE B 2 130 ? 25.587  14.062  21.962  1.00 59.37  ? 259 ILE B CG2 1 
ATOM   2459 C  CD1 . ILE B 2 130 ? 22.934  15.264  22.280  1.00 59.37  ? 259 ILE B CD1 1 
ATOM   2460 N  N   . GLY B 2 131 ? 25.462  12.982  17.605  1.00 73.41  ? 260 GLY B N   1 
ATOM   2461 C  CA  . GLY B 2 131 ? 24.913  12.310  16.438  1.00 73.41  ? 260 GLY B CA  1 
ATOM   2462 C  C   . GLY B 2 131 ? 23.702  11.469  16.786  1.00 73.41  ? 260 GLY B C   1 
ATOM   2463 O  O   . GLY B 2 131 ? 23.431  11.232  17.968  1.00 73.41  ? 260 GLY B O   1 
ATOM   2464 N  N   . ILE B 2 132 ? 22.981  10.996  15.769  1.00 89.24  ? 261 ILE B N   1 
ATOM   2465 C  CA  . ILE B 2 132 ? 21.779  10.193  16.015  1.00 89.24  ? 261 ILE B CA  1 
ATOM   2466 C  C   . ILE B 2 132 ? 21.229  9.443   14.802  1.00 89.24  ? 261 ILE B C   1 
ATOM   2467 O  O   . ILE B 2 132 ? 20.500  8.457   14.945  1.00 89.24  ? 261 ILE B O   1 
ATOM   2468 C  CB  . ILE B 2 132 ? 20.630  11.082  16.614  1.00 65.43  ? 261 ILE B CB  1 
ATOM   2469 C  CG1 . ILE B 2 132 ? 19.412  10.232  16.978  1.00 65.43  ? 261 ILE B CG1 1 
ATOM   2470 C  CG2 . ILE B 2 132 ? 20.227  12.186  15.626  1.00 65.43  ? 261 ILE B CG2 1 
ATOM   2471 C  CD1 . ILE B 2 132 ? 19.675  9.221   18.074  1.00 65.43  ? 261 ILE B CD1 1 
ATOM   2472 N  N   . GLY B 2 133 ? 21.608  9.880   13.608  1.00 62.74  ? 262 GLY B N   1 
ATOM   2473 C  CA  . GLY B 2 133 ? 21.094  9.252   12.398  1.00 62.74  ? 262 GLY B CA  1 
ATOM   2474 C  C   . GLY B 2 133 ? 21.699  7.970   11.847  1.00 62.74  ? 262 GLY B C   1 
ATOM   2475 O  O   . GLY B 2 133 ? 21.799  6.950   12.541  1.00 62.74  ? 262 GLY B O   1 
ATOM   2476 N  N   . LYS B 2 134 ? 22.002  8.029   10.548  1.00 73.41  ? 263 LYS B N   1 
ATOM   2477 C  CA  . LYS B 2 134 ? 22.582  6.936   9.768   1.00 73.41  ? 263 LYS B CA  1 
ATOM   2478 C  C   . LYS B 2 134 ? 23.604  7.581   8.844   1.00 73.41  ? 263 LYS B C   1 
ATOM   2479 O  O   . LYS B 2 134 ? 24.652  7.007   8.557   1.00 73.41  ? 263 LYS B O   1 
ATOM   2480 C  CB  . LYS B 2 134 ? 21.486  6.254   8.926   1.00 98.56  ? 263 LYS B CB  1 
ATOM   2481 C  CG  . LYS B 2 134 ? 21.750  4.792   8.532   1.00 98.56  ? 263 LYS B CG  1 
ATOM   2482 C  CD  . LYS B 2 134 ? 22.746  4.648   7.382   1.00 98.56  ? 263 LYS B CD  1 
ATOM   2483 C  CE  . LYS B 2 134 ? 23.138  3.186   7.145   1.00 98.56  ? 263 LYS B CE  1 
ATOM   2484 N  NZ  . LYS B 2 134 ? 24.183  3.033   6.083   1.00 98.56  ? 263 LYS B NZ  1 
ATOM   2485 N  N   . HIS B 2 135 ? 23.300  8.803   8.415   1.00 98.65  ? 264 HIS B N   1 
ATOM   2486 C  CA  . HIS B 2 135 ? 24.157  9.567   7.516   1.00 98.65  ? 264 HIS B CA  1 
ATOM   2487 C  C   . HIS B 2 135 ? 25.588  9.720   8.032   1.00 98.65  ? 264 HIS B C   1 
ATOM   2488 O  O   . HIS B 2 135 ? 26.525  9.713   7.230   1.00 98.65  ? 264 HIS B O   1 
ATOM   2489 C  CB  . HIS B 2 135 ? 23.561  10.969  7.298   1.00 98.65  ? 264 HIS B CB  1 
ATOM   2490 C  CG  . HIS B 2 135 ? 22.108  10.957  6.941   1.00 98.65  ? 264 HIS B CG  1 
ATOM   2491 N  ND1 . HIS B 2 135 ? 21.671  10.817  5.636   1.00 98.65  ? 264 HIS B ND1 1 
ATOM   2492 C  CD2 . HIS B 2 135 ? 20.993  11.026  7.702   1.00 98.65  ? 264 HIS B CD2 1 
ATOM   2493 C  CE1 . HIS B 2 135 ? 20.340  10.795  5.624   1.00 98.65  ? 264 HIS B CE1 1 
ATOM   2494 N  NE2 . HIS B 2 135 ? 19.915  10.920  6.866   1.00 98.65  ? 264 HIS B NE2 1 
ATOM   2495 N  N   . PHE B 2 136 ? 25.754  9.671   9.360   1.00 77.37  ? 265 PHE B N   1 
ATOM   2496 C  CA  . PHE B 2 136 ? 27.054  9.949   10.012  1.00 77.37  ? 265 PHE B CA  1 
ATOM   2497 C  C   . PHE B 2 136 ? 27.851  8.658   9.752   1.00 77.37  ? 265 PHE B C   1 
ATOM   2498 O  O   . PHE B 2 136 ? 27.903  7.755   10.599  1.00 77.37  ? 265 PHE B O   1 
ATOM   2499 C  CB  . PHE B 2 136 ? 26.869  10.189  11.527  1.00 62.45  ? 265 PHE B CB  1 
ATOM   2500 C  CG  . PHE B 2 136 ? 28.159  10.466  12.289  1.00 62.45  ? 265 PHE B CG  1 
ATOM   2501 C  CD1 . PHE B 2 136 ? 29.367  10.690  11.628  1.00 62.45  ? 265 PHE B CD1 1 
ATOM   2502 C  CD2 . PHE B 2 136 ? 28.152  10.514  13.679  1.00 62.45  ? 265 PHE B CD2 1 
ATOM   2503 C  CE1 . PHE B 2 136 ? 30.541  10.942  12.341  1.00 62.45  ? 265 PHE B CE1 1 
ATOM   2504 C  CE2 . PHE B 2 136 ? 29.321  10.763  14.391  1.00 62.45  ? 265 PHE B CE2 1 
ATOM   2505 C  CZ  . PHE B 2 136 ? 30.511  10.982  13.718  1.00 62.45  ? 265 PHE B CZ  1 
ATOM   2506 N  N   . GLN B 2 137 ? 28.376  8.510   8.493   1.00 98.21  ? 266 GLN B N   1 
ATOM   2507 C  CA  . GLN B 2 137 ? 29.321  7.429   8.181   1.00 98.21  ? 266 GLN B CA  1 
ATOM   2508 C  C   . GLN B 2 137 ? 30.700  7.762   7.554   1.00 98.21  ? 266 GLN B C   1 
ATOM   2509 O  O   . GLN B 2 137 ? 31.718  7.536   8.195   1.00 98.21  ? 266 GLN B O   1 
ATOM   2510 C  CB  . GLN B 2 137 ? 28.488  6.543   7.264   1.00 97.88  ? 266 GLN B CB  1 
ATOM   2511 C  CG  . GLN B 2 137 ? 28.983  5.115   7.275   1.00 97.88  ? 266 GLN B CG  1 
ATOM   2512 C  CD  . GLN B 2 137 ? 28.022  4.134   6.615   1.00 97.88  ? 266 GLN B CD  1 
ATOM   2513 O  OE1 . GLN B 2 137 ? 28.131  3.858   5.422   1.00 97.88  ? 266 GLN B OE1 1 
ATOM   2514 N  NE2 . GLN B 2 137 ? 27.115  3.559   7.402   1.00 97.88  ? 266 GLN B NE2 1 
ATOM   2515 N  N   . THR B 2 138 ? 30.733  8.203   6.290   1.00 98.21  ? 267 THR B N   1 
ATOM   2516 C  CA  . THR B 2 138 ? 32.054  8.187   5.537   1.00 98.21  ? 267 THR B CA  1 
ATOM   2517 C  C   . THR B 2 138 ? 32.588  9.629   5.710   1.00 98.21  ? 267 THR B C   1 
ATOM   2518 O  O   . THR B 2 138 ? 31.840  10.560  6.042   1.00 98.21  ? 267 THR B O   1 
ATOM   2519 C  CB  . THR B 2 138 ? 32.017  7.832   4.014   1.00 98.21  ? 267 THR B CB  1 
ATOM   2520 O  OG1 . THR B 2 138 ? 30.842  8.377   3.397   1.00 98.21  ? 267 THR B OG1 1 
ATOM   2521 C  CG2 . THR B 2 138 ? 32.063  6.353   3.803   1.00 98.21  ? 267 THR B CG2 1 
ATOM   2522 N  N   . LYS B 2 139 ? 33.903  9.788   5.514   1.00 98.65  ? 268 LYS B N   1 
ATOM   2523 C  CA  . LYS B 2 139 ? 34.568  11.089  5.630   1.00 98.65  ? 268 LYS B CA  1 
ATOM   2524 C  C   . LYS B 2 139 ? 34.314  11.945  4.383   1.00 98.65  ? 268 LYS B C   1 
ATOM   2525 O  O   . LYS B 2 139 ? 34.159  13.158  4.496   1.00 98.65  ? 268 LYS B O   1 
ATOM   2526 C  CB  . LYS B 2 139 ? 36.062  10.876  5.832   1.00 98.65  ? 268 LYS B CB  1 
ATOM   2527 C  CG  . LYS B 2 139 ? 36.897  12.154  5.883   1.00 98.65  ? 268 LYS B CG  1 
ATOM   2528 C  CD  . LYS B 2 139 ? 38.391  11.847  5.934   1.00 98.65  ? 268 LYS B CD  1 
ATOM   2529 C  CE  . LYS B 2 139 ? 38.902  11.210  4.640   1.00 98.65  ? 268 LYS B CE  1 
ATOM   2530 N  NZ  . LYS B 2 139 ? 40.387  11.036  4.648   1.00 98.65  ? 268 LYS B NZ  1 
ATOM   2531 N  N   . GLU B 2 140 ? 34.260  11.295  3.214   1.00 98.65  ? 269 GLU B N   1 
ATOM   2532 C  CA  . GLU B 2 140 ? 34.037  11.942  1.906   1.00 98.65  ? 269 GLU B CA  1 
ATOM   2533 C  C   . GLU B 2 140 ? 32.856  12.927  1.899   1.00 98.65  ? 269 GLU B C   1 
ATOM   2534 O  O   . GLU B 2 140 ? 32.873  13.944  1.191   1.00 98.65  ? 269 GLU B O   1 
ATOM   2535 C  CB  . GLU B 2 140 ? 33.778  10.871  0.837   1.00 98.61  ? 269 GLU B CB  1 
ATOM   2536 C  CG  . GLU B 2 140 ? 34.831  9.772   0.740   1.00 98.61  ? 269 GLU B CG  1 
ATOM   2537 C  CD  . GLU B 2 140 ? 34.364  8.602   -0.106  1.00 98.61  ? 269 GLU B CD  1 
ATOM   2538 O  OE1 . GLU B 2 140 ? 34.776  8.502   -1.283  1.00 98.61  ? 269 GLU B OE1 1 
ATOM   2539 O  OE2 . GLU B 2 140 ? 33.573  7.784   0.409   1.00 98.61  ? 269 GLU B OE2 1 
ATOM   2540 N  N   . SER B 2 141 ? 31.829  12.590  2.676   1.00 98.65  ? 270 SER B N   1 
ATOM   2541 C  CA  . SER B 2 141 ? 30.623  13.393  2.796   1.00 98.65  ? 270 SER B CA  1 
ATOM   2542 C  C   . SER B 2 141 ? 30.497  13.903  4.231   1.00 98.65  ? 270 SER B C   1 
ATOM   2543 O  O   . SER B 2 141 ? 30.464  15.112  4.477   1.00 98.65  ? 270 SER B O   1 
ATOM   2544 C  CB  . SER B 2 141 ? 29.403  12.540  2.441   1.00 95.58  ? 270 SER B CB  1 
ATOM   2545 O  OG  . SER B 2 141 ? 29.588  11.864  1.206   1.00 95.58  ? 270 SER B OG  1 
ATOM   2546 N  N   . GLN B 2 142 ? 30.434  12.972  5.176   1.00 98.65  ? 271 GLN B N   1 
ATOM   2547 C  CA  . GLN B 2 142 ? 30.316  13.331  6.577   1.00 98.65  ? 271 GLN B CA  1 
ATOM   2548 C  C   . GLN B 2 142 ? 31.640  13.732  7.211   1.00 98.65  ? 271 GLN B C   1 
ATOM   2549 O  O   . GLN B 2 142 ? 32.514  12.894  7.452   1.00 98.65  ? 271 GLN B O   1 
ATOM   2550 C  CB  . GLN B 2 142 ? 29.644  12.207  7.360   1.00 98.65  ? 271 GLN B CB  1 
ATOM   2551 C  CG  . GLN B 2 142 ? 28.151  12.123  7.100   1.00 98.65  ? 271 GLN B CG  1 
ATOM   2552 C  CD  . GLN B 2 142 ? 27.377  13.345  7.595   1.00 98.65  ? 271 GLN B CD  1 
ATOM   2553 O  OE1 . GLN B 2 142 ? 26.151  13.306  7.728   1.00 98.65  ? 271 GLN B OE1 1 
ATOM   2554 N  NE2 . GLN B 2 142 ? 28.091  14.433  7.873   1.00 98.65  ? 271 GLN B NE2 1 
ATOM   2555 N  N   . GLU B 2 143 ? 31.765  15.033  7.469   1.00 98.65  ? 272 GLU B N   1 
ATOM   2556 C  CA  . GLU B 2 143 ? 32.964  15.628  8.061   1.00 98.65  ? 272 GLU B CA  1 
ATOM   2557 C  C   . GLU B 2 143 ? 32.624  16.807  8.966   1.00 98.65  ? 272 GLU B C   1 
ATOM   2558 O  O   . GLU B 2 143 ? 33.418  17.164  9.842   1.00 98.65  ? 272 GLU B O   1 
ATOM   2559 C  CB  . GLU B 2 143 ? 33.913  16.138  6.961   1.00 98.65  ? 272 GLU B CB  1 
ATOM   2560 C  CG  . GLU B 2 143 ? 34.904  15.115  6.417   1.00 98.65  ? 272 GLU B CG  1 
ATOM   2561 C  CD  . GLU B 2 143 ? 35.823  15.690  5.344   1.00 98.65  ? 272 GLU B CD  1 
ATOM   2562 O  OE1 . GLU B 2 143 ? 35.351  16.485  4.500   1.00 98.65  ? 272 GLU B OE1 1 
ATOM   2563 O  OE2 . GLU B 2 143 ? 37.024  15.340  5.344   1.00 98.65  ? 272 GLU B OE2 1 
ATOM   2564 N  N   . THR B 2 144 ? 31.460  17.421  8.732   1.00 98.24  ? 273 THR B N   1 
ATOM   2565 C  CA  . THR B 2 144 ? 31.013  18.595  9.497   1.00 98.24  ? 273 THR B CA  1 
ATOM   2566 C  C   . THR B 2 144 ? 30.788  18.330  10.989  1.00 98.24  ? 273 THR B C   1 
ATOM   2567 O  O   . THR B 2 144 ? 30.579  19.261  11.778  1.00 98.24  ? 273 THR B O   1 
ATOM   2568 C  CB  . THR B 2 144 ? 29.766  19.258  8.846   1.00 98.65  ? 273 THR B CB  1 
ATOM   2569 O  OG1 . THR B 2 144 ? 30.052  19.556  7.469   1.00 98.65  ? 273 THR B OG1 1 
ATOM   2570 C  CG2 . THR B 2 144 ? 29.406  20.563  9.560   1.00 98.65  ? 273 THR B CG2 1 
ATOM   2571 N  N   . LEU B 2 145 ? 30.842  17.054  11.368  1.00 49.96  ? 274 LEU B N   1 
ATOM   2572 C  CA  . LEU B 2 145 ? 30.712  16.678  12.764  1.00 49.96  ? 274 LEU B CA  1 
ATOM   2573 C  C   . LEU B 2 145 ? 32.036  17.076  13.451  1.00 49.96  ? 274 LEU B C   1 
ATOM   2574 O  O   . LEU B 2 145 ? 32.127  17.121  14.675  1.00 49.96  ? 274 LEU B O   1 
ATOM   2575 C  CB  . LEU B 2 145 ? 30.450  15.173  12.885  1.00 83.88  ? 274 LEU B CB  1 
ATOM   2576 C  CG  . LEU B 2 145 ? 29.278  14.725  13.779  1.00 83.88  ? 274 LEU B CG  1 
ATOM   2577 C  CD1 . LEU B 2 145 ? 29.565  14.932  15.255  1.00 83.88  ? 274 LEU B CD1 1 
ATOM   2578 C  CD2 . LEU B 2 145 ? 28.033  15.478  13.400  1.00 83.88  ? 274 LEU B CD2 1 
ATOM   2579 N  N   . HIS B 2 146 ? 33.051  17.383  12.640  1.00 98.47  ? 275 HIS B N   1 
ATOM   2580 C  CA  . HIS B 2 146 ? 34.371  17.812  13.121  1.00 98.47  ? 275 HIS B CA  1 
ATOM   2581 C  C   . HIS B 2 146 ? 34.468  19.340  13.144  1.00 98.47  ? 275 HIS B C   1 
ATOM   2582 O  O   . HIS B 2 146 ? 35.280  19.902  13.878  1.00 98.47  ? 275 HIS B O   1 
ATOM   2583 C  CB  . HIS B 2 146 ? 35.492  17.250  12.231  1.00 98.65  ? 275 HIS B CB  1 
ATOM   2584 C  CG  . HIS B 2 146 ? 35.768  15.789  12.442  1.00 98.65  ? 275 HIS B CG  1 
ATOM   2585 N  ND1 . HIS B 2 146 ? 35.956  14.910  11.394  1.00 98.65  ? 275 HIS B ND1 1 
ATOM   2586 C  CD2 . HIS B 2 146 ? 35.899  15.060  13.573  1.00 98.65  ? 275 HIS B CD2 1 
ATOM   2587 C  CE1 . HIS B 2 146 ? 36.190  13.702  11.876  1.00 98.65  ? 275 HIS B CE1 1 
ATOM   2588 N  NE2 . HIS B 2 146 ? 36.162  13.763  13.194  1.00 98.65  ? 275 HIS B NE2 1 
ATOM   2589 N  N   . LYS B 2 147 ? 33.640  19.992  12.327  1.00 94.02  ? 276 LYS B N   1 
ATOM   2590 C  CA  . LYS B 2 147 ? 33.579  21.453  12.207  1.00 94.02  ? 276 LYS B CA  1 
ATOM   2591 C  C   . LYS B 2 147 ? 33.337  22.198  13.515  1.00 94.02  ? 276 LYS B C   1 
ATOM   2592 O  O   . LYS B 2 147 ? 33.962  23.230  13.774  1.00 94.02  ? 276 LYS B O   1 
ATOM   2593 C  CB  . LYS B 2 147 ? 32.471  21.850  11.230  1.00 89.68  ? 276 LYS B CB  1 
ATOM   2594 C  CG  . LYS B 2 147 ? 32.899  21.953  9.780   1.00 89.68  ? 276 LYS B CG  1 
ATOM   2595 C  CD  . LYS B 2 147 ? 33.702  23.223  9.494   1.00 89.68  ? 276 LYS B CD  1 
ATOM   2596 C  CE  . LYS B 2 147 ? 32.849  24.487  9.592   1.00 89.68  ? 276 LYS B CE  1 
ATOM   2597 N  NZ  . LYS B 2 147 ? 32.456  24.834  10.992  1.00 89.68  ? 276 LYS B NZ  1 
ATOM   2598 N  N   . PHE B 2 148 ? 32.392  21.699  14.308  1.00 99.01  ? 277 PHE B N   1 
ATOM   2599 C  CA  . PHE B 2 148 ? 32.040  22.321  15.584  1.00 99.01  ? 277 PHE B CA  1 
ATOM   2600 C  C   . PHE B 2 148 ? 32.792  21.697  16.758  1.00 99.01  ? 277 PHE B C   1 
ATOM   2601 O  O   . PHE B 2 148 ? 32.450  21.926  17.924  1.00 99.01  ? 277 PHE B O   1 
ATOM   2602 C  CB  . PHE B 2 148 ? 30.531  22.220  15.824  1.00 98.80  ? 277 PHE B CB  1 
ATOM   2603 C  CG  . PHE B 2 148 ? 29.703  22.419  14.586  1.00 98.80  ? 277 PHE B CG  1 
ATOM   2604 C  CD1 . PHE B 2 148 ? 28.802  21.440  14.176  1.00 98.80  ? 277 PHE B CD1 1 
ATOM   2605 C  CD2 . PHE B 2 148 ? 29.836  23.569  13.817  1.00 98.80  ? 277 PHE B CD2 1 
ATOM   2606 C  CE1 . PHE B 2 148 ? 28.049  21.601  13.020  1.00 98.80  ? 277 PHE B CE1 1 
ATOM   2607 C  CE2 . PHE B 2 148 ? 29.084  23.737  12.656  1.00 98.80  ? 277 PHE B CE2 1 
ATOM   2608 C  CZ  . PHE B 2 148 ? 28.190  22.751  12.258  1.00 98.80  ? 277 PHE B CZ  1 
ATOM   2609 N  N   . ALA B 2 149 ? 33.808  20.896  16.445  1.00 104.07 ? 278 ALA B N   1 
ATOM   2610 C  CA  . ALA B 2 149 ? 34.625  20.248  17.467  1.00 104.07 ? 278 ALA B CA  1 
ATOM   2611 C  C   . ALA B 2 149 ? 35.553  21.257  18.156  1.00 104.07 ? 278 ALA B C   1 
ATOM   2612 O  O   . ALA B 2 149 ? 36.021  22.224  17.539  1.00 104.07 ? 278 ALA B O   1 
ATOM   2613 C  CB  . ALA B 2 149 ? 35.438  19.107  16.855  1.00 104.07 ? 278 ALA B CB  1 
ATOM   2614 N  N   . SER B 2 150 ? 35.823  21.011  19.434  1.00 103.10 ? 279 SER B N   1 
ATOM   2615 C  CA  . SER B 2 150 ? 36.673  21.881  20.231  1.00 103.10 ? 279 SER B CA  1 
ATOM   2616 C  C   . SER B 2 150 ? 38.029  21.233  20.555  1.00 103.10 ? 279 SER B C   1 
ATOM   2617 O  O   . SER B 2 150 ? 39.025  21.509  19.880  1.00 103.10 ? 279 SER B O   1 
ATOM   2618 C  CB  . SER B 2 150 ? 35.935  22.296  21.512  1.00 99.28  ? 279 SER B CB  1 
ATOM   2619 O  OG  . SER B 2 150 ? 34.647  22.820  21.220  1.00 99.28  ? 279 SER B OG  1 
ATOM   2620 N  N   . LYS B 2 151 ? 38.065  20.376  21.577  1.00 96.28  ? 280 LYS B N   1 
ATOM   2621 C  CA  . LYS B 2 151 ? 39.296  19.695  21.994  1.00 96.28  ? 280 LYS B CA  1 
ATOM   2622 C  C   . LYS B 2 151 ? 39.500  18.381  21.224  1.00 96.28  ? 280 LYS B C   1 
ATOM   2623 O  O   . LYS B 2 151 ? 38.543  17.858  20.636  1.00 96.28  ? 280 LYS B O   1 
ATOM   2624 C  CB  . LYS B 2 151 ? 39.278  19.448  23.508  1.00 104.07 ? 280 LYS B CB  1 
ATOM   2625 C  CG  . LYS B 2 151 ? 39.250  20.738  24.325  1.00 104.07 ? 280 LYS B CG  1 
ATOM   2626 C  CD  . LYS B 2 151 ? 39.196  20.462  25.821  1.00 104.07 ? 280 LYS B CD  1 
ATOM   2627 C  CE  . LYS B 2 151 ? 38.908  21.734  26.642  1.00 104.07 ? 280 LYS B CE  1 
ATOM   2628 N  NZ  . LYS B 2 151 ? 39.995  22.773  26.658  1.00 104.07 ? 280 LYS B NZ  1 
ATOM   2629 N  N   . PRO B 2 152 ? 40.749  17.847  21.201  1.00 104.07 ? 281 PRO B N   1 
ATOM   2630 C  CA  . PRO B 2 152 ? 41.109  16.599  20.506  1.00 104.07 ? 281 PRO B CA  1 
ATOM   2631 C  C   . PRO B 2 152 ? 40.088  15.453  20.562  1.00 104.07 ? 281 PRO B C   1 
ATOM   2632 O  O   . PRO B 2 152 ? 39.253  15.383  21.480  1.00 104.07 ? 281 PRO B O   1 
ATOM   2633 C  CB  . PRO B 2 152 ? 42.440  16.236  21.154  1.00 104.07 ? 281 PRO B CB  1 
ATOM   2634 C  CG  . PRO B 2 152 ? 43.089  17.573  21.277  1.00 104.07 ? 281 PRO B CG  1 
ATOM   2635 C  CD  . PRO B 2 152 ? 41.946  18.427  21.850  1.00 104.07 ? 281 PRO B CD  1 
ATOM   2636 N  N   . ALA B 2 153 ? 40.122  14.606  19.529  1.00 104.07 ? 282 ALA B N   1 
ATOM   2637 C  CA  . ALA B 2 153 ? 39.220  13.463  19.409  1.00 104.07 ? 282 ALA B CA  1 
ATOM   2638 C  C   . ALA B 2 153 ? 39.222  12.601  20.675  1.00 104.07 ? 282 ALA B C   1 
ATOM   2639 O  O   . ALA B 2 153 ? 40.038  11.673  20.822  1.00 104.07 ? 282 ALA B O   1 
ATOM   2640 C  CB  . ALA B 2 153 ? 39.589  12.635  18.192  1.00 86.20  ? 282 ALA B CB  1 
ATOM   2641 N  N   . SER B 2 154 ? 38.288  12.917  21.573  1.00 95.97  ? 283 SER B N   1 
ATOM   2642 C  CA  . SER B 2 154 ? 38.155  12.212  22.847  1.00 95.97  ? 283 SER B CA  1 
ATOM   2643 C  C   . SER B 2 154 ? 36.739  11.662  23.022  1.00 95.97  ? 283 SER B C   1 
ATOM   2644 O  O   . SER B 2 154 ? 36.432  10.543  22.603  1.00 95.97  ? 283 SER B O   1 
ATOM   2645 C  CB  . SER B 2 154 ? 38.492  13.167  24.005  1.00 34.75  ? 283 SER B CB  1 
ATOM   2646 O  OG  . SER B 2 154 ? 38.318  12.530  25.267  1.00 34.75  ? 283 SER B OG  1 
ATOM   2647 N  N   . GLU B 2 155 ? 35.906  12.445  23.700  1.00 104.07 ? 284 GLU B N   1 
ATOM   2648 C  CA  . GLU B 2 155 ? 34.520  12.092  23.957  1.00 104.07 ? 284 GLU B CA  1 
ATOM   2649 C  C   . GLU B 2 155 ? 33.650  13.218  23.411  1.00 104.07 ? 284 GLU B C   1 
ATOM   2650 O  O   . GLU B 2 155 ? 32.699  13.653  24.069  1.00 104.07 ? 284 GLU B O   1 
ATOM   2651 C  CB  . GLU B 2 155 ? 34.266  11.923  25.465  1.00 104.07 ? 284 GLU B CB  1 
ATOM   2652 C  CG  . GLU B 2 155 ? 35.022  10.773  26.138  1.00 104.07 ? 284 GLU B CG  1 
ATOM   2653 C  CD  . GLU B 2 155 ? 34.416  10.361  27.491  1.00 104.07 ? 284 GLU B CD  1 
ATOM   2654 O  OE1 . GLU B 2 155 ? 33.921  11.236  28.241  1.00 104.07 ? 284 GLU B OE1 1 
ATOM   2655 O  OE2 . GLU B 2 155 ? 34.435  9.146   27.802  1.00 104.07 ? 284 GLU B OE2 1 
ATOM   2656 N  N   . PHE B 2 156 ? 34.020  13.722  22.231  1.00 80.38  ? 285 PHE B N   1 
ATOM   2657 C  CA  . PHE B 2 156 ? 33.274  14.800  21.569  1.00 80.38  ? 285 PHE B CA  1 
ATOM   2658 C  C   . PHE B 2 156 ? 32.406  14.205  20.456  1.00 80.38  ? 285 PHE B C   1 
ATOM   2659 O  O   . PHE B 2 156 ? 31.229  14.552  20.300  1.00 80.38  ? 285 PHE B O   1 
ATOM   2660 C  CB  . PHE B 2 156 ? 34.236  15.844  20.981  1.00 104.07 ? 285 PHE B CB  1 
ATOM   2661 C  CG  . PHE B 2 156 ? 33.649  17.238  20.884  1.00 104.07 ? 285 PHE B CG  1 
ATOM   2662 C  CD1 . PHE B 2 156 ? 34.479  18.357  20.919  1.00 104.07 ? 285 PHE B CD1 1 
ATOM   2663 C  CD2 . PHE B 2 156 ? 32.268  17.435  20.770  1.00 104.07 ? 285 PHE B CD2 1 
ATOM   2664 C  CE1 . PHE B 2 156 ? 33.946  19.643  20.840  1.00 104.07 ? 285 PHE B CE1 1 
ATOM   2665 C  CE2 . PHE B 2 156 ? 31.729  18.721  20.689  1.00 104.07 ? 285 PHE B CE2 1 
ATOM   2666 C  CZ  . PHE B 2 156 ? 32.573  19.828  20.725  1.00 104.07 ? 285 PHE B CZ  1 
ATOM   2667 N  N   . VAL B 2 157 ? 33.012  13.293  19.702  0.50 104.07 ? 286 VAL B N   1 
ATOM   2668 C  CA  . VAL B 2 157 ? 32.356  12.605  18.599  0.50 104.07 ? 286 VAL B CA  1 
ATOM   2669 C  C   . VAL B 2 157 ? 32.713  11.121  18.636  0.50 104.07 ? 286 VAL B C   1 
ATOM   2670 O  O   . VAL B 2 157 ? 33.828  10.730  18.277  0.50 104.07 ? 286 VAL B O   1 
ATOM   2671 C  CB  . VAL B 2 157 ? 32.804  13.173  17.241  0.50 104.07 ? 286 VAL B CB  1 
ATOM   2672 C  CG1 . VAL B 2 157 ? 32.212  12.351  16.111  0.50 104.07 ? 286 VAL B CG1 1 
ATOM   2673 C  CG2 . VAL B 2 157 ? 32.395  14.631  17.117  0.50 104.07 ? 286 VAL B CG2 1 
ATOM   2674 N  N   . LYS B 2 158 ? 31.765  10.305  19.086  0.50 104.07 ? 287 LYS B N   1 
ATOM   2675 C  CA  . LYS B 2 158 ? 31.964  8.862   19.167  0.50 104.07 ? 287 LYS B CA  1 
ATOM   2676 C  C   . LYS B 2 158 ? 30.912  8.125   18.339  0.50 104.07 ? 287 LYS B C   1 
ATOM   2677 O  O   . LYS B 2 158 ? 30.288  8.708   17.450  0.50 104.07 ? 287 LYS B O   1 
ATOM   2678 C  CB  . LYS B 2 158 ? 31.943  8.389   20.631  0.50 101.22 ? 287 LYS B CB  1 
ATOM   2679 C  CG  . LYS B 2 158 ? 33.167  8.816   21.440  0.50 101.22 ? 287 LYS B CG  1 
ATOM   2680 C  CD  . LYS B 2 158 ? 33.206  8.160   22.813  0.50 101.22 ? 287 LYS B CD  1 
ATOM   2681 C  CE  . LYS B 2 158 ? 34.545  8.409   23.497  0.50 101.22 ? 287 LYS B CE  1 
ATOM   2682 N  NZ  . LYS B 2 158 ? 34.668  7.746   24.830  0.50 101.22 ? 287 LYS B NZ  1 
ATOM   2683 N  N   . ILE B 2 159 ? 30.737  6.839   18.622  0.50 91.04  ? 288 ILE B N   1 
ATOM   2684 C  CA  . ILE B 2 159 ? 29.771  6.006   17.910  0.50 91.04  ? 288 ILE B CA  1 
ATOM   2685 C  C   . ILE B 2 159 ? 28.324  6.318   18.294  0.50 91.04  ? 288 ILE B C   1 
ATOM   2686 O  O   . ILE B 2 159 ? 27.398  5.950   17.574  0.50 91.04  ? 288 ILE B O   1 
ATOM   2687 C  CB  . ILE B 2 159 ? 30.021  4.506   18.201  0.50 93.53  ? 288 ILE B CB  1 
ATOM   2688 C  CG1 . ILE B 2 159 ? 31.423  4.099   17.749  0.50 93.53  ? 288 ILE B CG1 1 
ATOM   2689 C  CG2 . ILE B 2 159 ? 28.977  3.639   17.503  0.50 93.53  ? 288 ILE B CG2 1 
ATOM   2690 C  CD1 . ILE B 2 159 ? 31.792  2.664   18.107  0.50 93.53  ? 288 ILE B CD1 1 
ATOM   2691 N  N   . LEU B 2 160 ? 28.103  7.043   19.375  0.50 104.07 ? 289 LEU B N   1 
ATOM   2692 C  CA  . LEU B 2 160 ? 26.826  7.358   20.023  0.50 104.07 ? 289 LEU B CA  1 
ATOM   2693 C  C   . LEU B 2 160 ? 25.809  7.918   19.027  0.50 104.07 ? 289 LEU B C   1 
ATOM   2694 O  O   . LEU B 2 160 ? 25.250  9.037   19.287  0.50 104.07 ? 289 LEU B O   1 
ATOM   2695 C  CB  . LEU B 2 160 ? 27.033  8.356   21.168  0.50 103.80 ? 289 LEU B CB  1 
ATOM   2696 C  CG  . LEU B 2 160 ? 27.955  7.910   22.306  0.50 103.80 ? 289 LEU B CG  1 
ATOM   2697 C  CD1 . LEU B 2 160 ? 28.072  8.999   23.362  0.50 103.80 ? 289 LEU B CD1 1 
ATOM   2698 C  CD2 . LEU B 2 160 ? 27.453  6.615   22.927  0.50 103.80 ? 289 LEU B CD2 1 
ATOM   2699 N  N   . ASP B 2 161 ? 25.362  7.104   18.056  0.50 104.07 ? 290 ASP B N   1 
ATOM   2700 C  CA  . ASP B 2 161 ? 24.323  7.549   17.115  0.50 104.07 ? 290 ASP B CA  1 
ATOM   2701 C  C   . ASP B 2 161 ? 22.995  7.394   17.862  0.50 104.07 ? 290 ASP B C   1 
ATOM   2702 O  O   . ASP B 2 161 ? 21.909  7.480   17.287  0.50 104.07 ? 290 ASP B O   1 
ATOM   2703 C  CB  . ASP B 2 161 ? 24.343  6.717   15.816  0.50 104.07 ? 290 ASP B CB  1 
ATOM   2704 C  CG  . ASP B 2 161 ? 23.675  5.360   15.964  0.50 104.07 ? 290 ASP B CG  1 
ATOM   2705 O  OD1 . ASP B 2 161 ? 24.305  4.449   16.539  0.50 104.07 ? 290 ASP B OD1 1 
ATOM   2706 O  OD2 . ASP B 2 161 ? 22.523  5.201   15.496  0.50 104.07 ? 290 ASP B OD2 1 
ATOM   2707 N  N   . THR B 2 162 ? 23.141  7.129   19.156  1.00 103.66 ? 291 THR B N   1 
ATOM   2708 C  CA  . THR B 2 162 ? 22.064  6.950   20.108  1.00 103.66 ? 291 THR B CA  1 
ATOM   2709 C  C   . THR B 2 162 ? 22.773  7.285   21.424  1.00 103.66 ? 291 THR B C   1 
ATOM   2710 O  O   . THR B 2 162 ? 23.461  6.444   22.020  1.00 103.66 ? 291 THR B O   1 
ATOM   2711 C  CB  . THR B 2 162 ? 21.505  5.499   20.134  1.00 104.07 ? 291 THR B CB  1 
ATOM   2712 O  OG1 . THR B 2 162 ? 21.037  5.123   18.842  1.00 104.07 ? 291 THR B OG1 1 
ATOM   2713 C  CG2 . THR B 2 162 ? 20.344  5.378   21.113  1.00 104.07 ? 291 THR B CG2 1 
ATOM   2714 N  N   . PHE B 2 163 ? 22.722  8.567   21.766  1.00 89.65  ? 292 PHE B N   1 
ATOM   2715 C  CA  . PHE B 2 163 ? 23.302  9.116   22.988  1.00 89.65  ? 292 PHE B CA  1 
ATOM   2716 C  C   . PHE B 2 163 ? 22.757  8.452   24.257  1.00 89.65  ? 292 PHE B C   1 
ATOM   2717 O  O   . PHE B 2 163 ? 23.181  8.779   25.369  1.00 89.65  ? 292 PHE B O   1 
ATOM   2718 C  CB  . PHE B 2 163 ? 23.021  10.607  23.019  1.00 104.07 ? 292 PHE B CB  1 
ATOM   2719 C  CG  . PHE B 2 163 ? 21.708  10.982  22.393  1.00 104.07 ? 292 PHE B CG  1 
ATOM   2720 C  CD1 . PHE B 2 163 ? 20.565  10.215  22.623  1.00 104.07 ? 292 PHE B CD1 1 
ATOM   2721 C  CD2 . PHE B 2 163 ? 21.627  12.068  21.527  1.00 104.07 ? 292 PHE B CD2 1 
ATOM   2722 C  CE1 . PHE B 2 163 ? 19.372  10.514  22.001  1.00 104.07 ? 292 PHE B CE1 1 
ATOM   2723 C  CE2 . PHE B 2 163 ? 20.434  12.378  20.898  1.00 104.07 ? 292 PHE B CE2 1 
ATOM   2724 C  CZ  . PHE B 2 163 ? 19.306  11.596  21.136  1.00 104.07 ? 292 PHE B CZ  1 
ATOM   2725 N  N   . GLU B 2 164 ? 21.754  7.588   24.073  1.00 104.07 ? 293 GLU B N   1 
ATOM   2726 C  CA  . GLU B 2 164 ? 21.129  6.812   25.150  1.00 104.07 ? 293 GLU B CA  1 
ATOM   2727 C  C   . GLU B 2 164 ? 22.195  5.806   25.610  1.00 104.07 ? 293 GLU B C   1 
ATOM   2728 O  O   . GLU B 2 164 ? 22.173  5.314   26.741  1.00 104.07 ? 293 GLU B O   1 
ATOM   2729 C  CB  . GLU B 2 164 ? 19.882  6.079   24.607  1.00 104.07 ? 293 GLU B CB  1 
ATOM   2730 C  CG  . GLU B 2 164 ? 19.269  5.005   25.517  1.00 104.07 ? 293 GLU B CG  1 
ATOM   2731 C  CD  . GLU B 2 164 ? 18.790  5.552   26.847  1.00 104.07 ? 293 GLU B CD  1 
ATOM   2732 O  OE1 . GLU B 2 164 ? 19.457  5.288   27.868  1.00 104.07 ? 293 GLU B OE1 1 
ATOM   2733 O  OE2 . GLU B 2 164 ? 17.748  6.241   26.878  1.00 104.07 ? 293 GLU B OE2 1 
ATOM   2734 N  N   . LYS B 2 165 ? 23.126  5.516   24.705  1.00 99.80  ? 294 LYS B N   1 
ATOM   2735 C  CA  . LYS B 2 165 ? 24.223  4.618   24.990  1.00 99.80  ? 294 LYS B CA  1 
ATOM   2736 C  C   . LYS B 2 165 ? 25.223  5.455   25.794  1.00 99.80  ? 294 LYS B C   1 
ATOM   2737 O  O   . LYS B 2 165 ? 26.322  5.749   25.326  1.00 99.80  ? 294 LYS B O   1 
ATOM   2738 C  CB  . LYS B 2 165 ? 24.847  4.134   23.676  1.00 99.71  ? 294 LYS B CB  1 
ATOM   2739 C  CG  . LYS B 2 165 ? 23.874  3.458   22.719  1.00 99.71  ? 294 LYS B CG  1 
ATOM   2740 C  CD  . LYS B 2 165 ? 24.563  3.133   21.398  1.00 99.71  ? 294 LYS B CD  1 
ATOM   2741 C  CE  . LYS B 2 165 ? 23.614  2.490   20.403  1.00 99.71  ? 294 LYS B CE  1 
ATOM   2742 N  NZ  . LYS B 2 165 ? 24.341  2.047   19.187  1.00 99.71  ? 294 LYS B NZ  1 
ATOM   2743 N  N   . LEU B 2 166 ? 24.805  5.866   26.990  1.00 99.80  ? 295 LEU B N   1 
ATOM   2744 C  CA  . LEU B 2 166 ? 25.610  6.682   27.895  1.00 99.80  ? 295 LEU B CA  1 
ATOM   2745 C  C   . LEU B 2 166 ? 24.809  6.936   29.169  1.00 99.80  ? 295 LEU B C   1 
ATOM   2746 O  O   . LEU B 2 166 ? 23.615  7.247   29.101  1.00 99.80  ? 295 LEU B O   1 
ATOM   2747 C  CB  . LEU B 2 166 ? 25.978  8.021   27.237  1.00 99.80  ? 295 LEU B CB  1 
ATOM   2748 C  CG  . LEU B 2 166 ? 26.661  9.136   28.038  1.00 99.80  ? 295 LEU B CG  1 
ATOM   2749 C  CD1 . LEU B 2 166 ? 27.895  8.630   28.798  1.00 99.80  ? 295 LEU B CD1 1 
ATOM   2750 C  CD2 . LEU B 2 166 ? 27.046  10.260  27.081  1.00 99.80  ? 295 LEU B CD2 1 
ATOM   2751 N  N   . LYS B 2 167 ? 25.460  6.807   30.326  1.00 99.80  ? 296 LYS B N   1 
ATOM   2752 C  CA  . LYS B 2 167 ? 24.783  7.029   31.604  1.00 99.80  ? 296 LYS B CA  1 
ATOM   2753 C  C   . LYS B 2 167 ? 24.527  8.521   31.876  1.00 99.80  ? 296 LYS B C   1 
ATOM   2754 O  O   . LYS B 2 167 ? 24.489  9.346   30.944  1.00 99.80  ? 296 LYS B O   1 
ATOM   2755 C  CB  . LYS B 2 167 ? 25.569  6.391   32.763  1.00 86.68  ? 296 LYS B CB  1 
ATOM   2756 C  CG  . LYS B 2 167 ? 26.754  7.212   33.291  1.00 86.68  ? 296 LYS B CG  1 
ATOM   2757 C  CD  . LYS B 2 167 ? 27.382  6.629   34.562  1.00 86.68  ? 296 LYS B CD  1 
ATOM   2758 C  CE  . LYS B 2 167 ? 26.361  6.344   35.662  1.00 86.68  ? 296 LYS B CE  1 
ATOM   2759 N  NZ  . LYS B 2 167 ? 25.667  5.028   35.494  1.00 86.68  ? 296 LYS B NZ  1 
ATOM   2760 N  N   . ASP B 2 168 ? 24.330  8.844   33.156  1.00 99.80  ? 297 ASP B N   1 
ATOM   2761 C  CA  . ASP B 2 168 ? 24.077  10.210  33.609  1.00 99.80  ? 297 ASP B CA  1 
ATOM   2762 C  C   . ASP B 2 168 ? 25.298  11.127  33.457  1.00 99.80  ? 297 ASP B C   1 
ATOM   2763 O  O   . ASP B 2 168 ? 26.302  11.007  34.175  1.00 99.80  ? 297 ASP B O   1 
ATOM   2764 C  CB  . ASP B 2 168 ? 23.586  10.205  35.057  1.00 62.08  ? 297 ASP B CB  1 
ATOM   2765 C  CG  . ASP B 2 168 ? 23.242  11.591  35.559  1.00 62.08  ? 297 ASP B CG  1 
ATOM   2766 O  OD1 . ASP B 2 168 ? 22.528  12.329  34.850  1.00 62.08  ? 297 ASP B OD1 1 
ATOM   2767 O  OD2 . ASP B 2 168 ? 23.690  11.936  36.669  1.00 62.08  ? 297 ASP B OD2 1 
ATOM   2768 N  N   . LEU B 2 169 ? 25.173  12.059  32.517  1.00 99.33  ? 298 LEU B N   1 
ATOM   2769 C  CA  . LEU B 2 169 ? 26.218  13.020  32.206  1.00 99.33  ? 298 LEU B CA  1 
ATOM   2770 C  C   . LEU B 2 169 ? 26.311  14.168  33.222  1.00 99.33  ? 298 LEU B C   1 
ATOM   2771 O  O   . LEU B 2 169 ? 26.610  15.302  32.858  1.00 99.33  ? 298 LEU B O   1 
ATOM   2772 C  CB  . LEU B 2 169 ? 26.004  13.555  30.778  1.00 99.80  ? 298 LEU B CB  1 
ATOM   2773 C  CG  . LEU B 2 169 ? 26.603  12.884  29.524  1.00 99.80  ? 298 LEU B CG  1 
ATOM   2774 C  CD1 . LEU B 2 169 ? 26.174  13.643  28.248  1.00 99.80  ? 298 LEU B CD1 1 
ATOM   2775 C  CD2 . LEU B 2 169 ? 28.134  12.845  29.630  1.00 99.80  ? 298 LEU B CD2 1 
ATOM   2776 N  N   . CYS B 2 170 ? 26.031  13.894  34.493  1.00 81.94  ? 299 CYS B N   1 
ATOM   2777 C  CA  . CYS B 2 170 ? 26.140  14.964  35.470  1.00 81.94  ? 299 CYS B CA  1 
ATOM   2778 C  C   . CYS B 2 170 ? 27.627  15.131  35.736  1.00 81.94  ? 299 CYS B C   1 
ATOM   2779 O  O   . CYS B 2 170 ? 28.281  15.890  35.025  1.00 81.94  ? 299 CYS B O   1 
ATOM   2780 C  CB  . CYS B 2 170 ? 25.352  14.676  36.754  1.00 99.80  ? 299 CYS B CB  1 
ATOM   2781 S  SG  . CYS B 2 170 ? 24.320  16.089  37.311  1.00 99.80  ? 299 CYS B SG  1 
ATOM   2782 N  N   . THR B 2 171 ? 28.178  14.333  36.654  1.00 99.80  ? 300 THR B N   1 
ATOM   2783 C  CA  . THR B 2 171 ? 29.611  14.407  36.998  1.00 99.80  ? 300 THR B CA  1 
ATOM   2784 C  C   . THR B 2 171 ? 30.536  14.165  35.774  1.00 99.80  ? 300 THR B C   1 
ATOM   2785 O  O   . THR B 2 171 ? 31.750  14.396  35.848  1.00 99.80  ? 300 THR B O   1 
ATOM   2786 C  CB  . THR B 2 171 ? 29.984  13.435  38.181  1.00 98.10  ? 300 THR B CB  1 
ATOM   2787 O  OG1 . THR B 2 171 ? 29.057  13.593  39.264  1.00 98.10  ? 300 THR B OG1 1 
ATOM   2788 C  CG2 . THR B 2 171 ? 31.388  13.722  38.723  1.00 98.10  ? 300 THR B CG2 1 
ATOM   2789 N  N   . GLU B 2 172 ? 29.937  13.749  34.653  1.00 99.80  ? 301 GLU B N   1 
ATOM   2790 C  CA  . GLU B 2 172 ? 30.674  13.494  33.413  1.00 99.80  ? 301 GLU B CA  1 
ATOM   2791 C  C   . GLU B 2 172 ? 30.731  14.748  32.526  1.00 99.80  ? 301 GLU B C   1 
ATOM   2792 O  O   . GLU B 2 172 ? 31.794  15.066  31.968  1.00 99.80  ? 301 GLU B O   1 
ATOM   2793 C  CB  . GLU B 2 172 ? 30.069  12.323  32.635  1.00 95.94  ? 301 GLU B CB  1 
ATOM   2794 C  CG  . GLU B 2 172 ? 30.134  10.977  33.373  1.00 95.94  ? 301 GLU B CG  1 
ATOM   2795 C  CD  . GLU B 2 172 ? 29.846  9.786   32.465  1.00 95.94  ? 301 GLU B CD  1 
ATOM   2796 O  OE1 . GLU B 2 172 ? 29.061  9.934   31.499  1.00 95.94  ? 301 GLU B OE1 1 
ATOM   2797 O  OE2 . GLU B 2 172 ? 30.409  8.698   32.726  1.00 95.94  ? 301 GLU B OE2 1 
ATOM   2798 N  N   . LEU B 2 173 ? 29.606  15.461  32.408  1.00 98.35  ? 302 LEU B N   1 
ATOM   2799 C  CA  . LEU B 2 173 ? 29.555  16.689  31.611  1.00 98.35  ? 302 LEU B CA  1 
ATOM   2800 C  C   . LEU B 2 173 ? 30.163  17.884  32.321  1.00 98.35  ? 302 LEU B C   1 
ATOM   2801 O  O   . LEU B 2 173 ? 30.308  18.960  31.726  1.00 98.35  ? 302 LEU B O   1 
ATOM   2802 C  CB  . LEU B 2 173 ? 28.134  17.045  31.181  0.50 99.55  ? 302 LEU B CB  1 
ATOM   2803 C  CG  . LEU B 2 173 ? 27.497  16.172  30.110  0.50 99.55  ? 302 LEU B CG  1 
ATOM   2804 C  CD1 . LEU B 2 173 ? 26.093  16.657  29.811  0.50 99.55  ? 302 LEU B CD1 1 
ATOM   2805 C  CD2 . LEU B 2 173 ? 28.337  16.148  28.842  0.50 99.55  ? 302 LEU B CD2 1 
ATOM   2806 N  N   . GLN B 2 174 ? 30.454  17.729  33.607  1.00 98.29  ? 303 GLN B N   1 
ATOM   2807 C  CA  . GLN B 2 174 ? 31.071  18.803  34.366  1.00 98.29  ? 303 GLN B CA  1 
ATOM   2808 C  C   . GLN B 2 174 ? 32.564  18.708  34.049  1.00 98.29  ? 303 GLN B C   1 
ATOM   2809 O  O   . GLN B 2 174 ? 33.305  17.974  34.701  1.00 98.29  ? 303 GLN B O   1 
ATOM   2810 C  CB  . GLN B 2 174 ? 30.809  18.635  35.865  1.00 88.60  ? 303 GLN B CB  1 
ATOM   2811 C  CG  . GLN B 2 174 ? 29.381  18.215  36.232  1.00 88.60  ? 303 GLN B CG  1 
ATOM   2812 C  CD  . GLN B 2 174 ? 28.302  18.961  35.456  1.00 88.60  ? 303 GLN B CD  1 
ATOM   2813 O  OE1 . GLN B 2 174 ? 28.176  20.172  35.568  1.00 88.60  ? 303 GLN B OE1 1 
ATOM   2814 N  NE2 . GLN B 2 174 ? 27.514  18.232  34.674  1.00 88.60  ? 303 GLN B NE2 1 
ATOM   2815 N  N   . LYS B 2 175 ? 32.964  19.358  32.962  1.00 98.65  ? 304 LYS B N   1 
ATOM   2816 C  CA  . LYS B 2 175 ? 34.359  19.371  32.527  1.00 98.65  ? 304 LYS B CA  1 
ATOM   2817 C  C   . LYS B 2 175 ? 35.032  20.639  33.061  1.00 98.65  ? 304 LYS B C   1 
ATOM   2818 O  O   . LYS B 2 175 ? 36.261  20.727  33.151  1.00 98.65  ? 304 LYS B O   1 
ATOM   2819 C  CB  . LYS B 2 175 ? 34.437  19.339  30.989  1.00 92.80  ? 304 LYS B CB  1 
ATOM   2820 C  CG  . LYS B 2 175 ? 33.728  18.148  30.315  1.00 92.80  ? 304 LYS B CG  1 
ATOM   2821 C  CD  . LYS B 2 175 ? 34.416  16.796  30.551  1.00 92.80  ? 304 LYS B CD  1 
ATOM   2822 C  CE  . LYS B 2 175 ? 33.746  15.681  29.748  1.00 92.80  ? 304 LYS B CE  1 
ATOM   2823 N  NZ  . LYS B 2 175 ? 33.652  16.009  28.297  1.00 92.80  ? 304 LYS B NZ  1 
ATOM   2824 N  N   . LYS B 2 176 ? 34.189  21.592  33.450  1.00 98.65  ? 305 LYS B N   1 
ATOM   2825 C  CA  . LYS B 2 176 ? 34.605  22.871  34.005  1.00 98.65  ? 305 LYS B CA  1 
ATOM   2826 C  C   . LYS B 2 176 ? 33.366  23.485  34.672  1.00 98.65  ? 305 LYS B C   1 
ATOM   2827 O  O   . LYS B 2 176 ? 33.138  24.706  34.620  1.00 98.65  ? 305 LYS B O   1 
ATOM   2828 C  CB  . LYS B 2 176 ? 35.135  23.780  32.892  1.00 80.30  ? 305 LYS B CB  1 
ATOM   2829 C  CG  . LYS B 2 176 ? 35.812  25.049  33.376  1.00 80.30  ? 305 LYS B CG  1 
ATOM   2830 C  CD  . LYS B 2 176 ? 36.255  25.910  32.218  1.00 80.30  ? 305 LYS B CD  1 
ATOM   2831 C  CE  . LYS B 2 176 ? 36.775  27.252  32.722  1.00 80.30  ? 305 LYS B CE  1 
ATOM   2832 N  NZ  . LYS B 2 176 ? 37.235  28.187  31.642  1.00 80.30  ? 305 LYS B NZ  1 
ATOM   2833 N  N   . ILE B 2 177 ? 32.568  22.629  35.305  1.00 98.65  ? 306 ILE B N   1 
ATOM   2834 C  CA  . ILE B 2 177 ? 31.338  23.053  35.979  1.00 98.65  ? 306 ILE B CA  1 
ATOM   2835 C  C   . ILE B 2 177 ? 31.431  22.848  37.495  1.00 98.65  ? 306 ILE B C   1 
ATOM   2836 O  O   . ILE B 2 177 ? 30.556  22.168  38.084  1.00 98.65  ? 306 ILE B O   1 
ATOM   2837 C  CB  . ILE B 2 177 ? 30.110  22.297  35.413  1.00 88.27  ? 306 ILE B CB  1 
ATOM   2838 C  CG1 . ILE B 2 177 ? 30.294  21.977  33.923  1.00 88.27  ? 306 ILE B CG1 1 
ATOM   2839 C  CG2 . ILE B 2 177 ? 28.836  23.114  35.653  1.00 88.27  ? 306 ILE B CG2 1 
ATOM   2840 C  CD1 . ILE B 2 177 ? 30.572  23.171  33.023  1.00 88.27  ? 306 ILE B CD1 1 
ATOM   2841 N  N   . GLN C 1 1   ? 14.809  -13.507 -17.111 1.00 51.21  ? 1   GLN C N   1 
ATOM   2842 C  CA  . GLN C 1 1   ? 14.803  -13.182 -15.663 1.00 51.21  ? 1   GLN C CA  1 
ATOM   2843 C  C   . GLN C 1 1   ? 15.051  -11.687 -15.458 1.00 51.21  ? 1   GLN C C   1 
ATOM   2844 O  O   . GLN C 1 1   ? 15.438  -11.256 -14.357 1.00 51.21  ? 1   GLN C O   1 
ATOM   2845 C  CB  . GLN C 1 1   ? 15.891  -14.001 -14.946 1.00 98.46  ? 1   GLN C CB  1 
ATOM   2846 C  CG  . GLN C 1 1   ? 15.949  -15.500 -15.309 1.00 98.46  ? 1   GLN C CG  1 
ATOM   2847 C  CD  . GLN C 1 1   ? 14.807  -16.335 -14.720 1.00 98.46  ? 1   GLN C CD  1 
ATOM   2848 O  OE1 . GLN C 1 1   ? 14.602  -17.492 -15.108 1.00 98.46  ? 1   GLN C OE1 1 
ATOM   2849 N  NE2 . GLN C 1 1   ? 14.071  -15.757 -13.776 1.00 98.46  ? 1   GLN C NE2 1 
ATOM   2850 N  N   . THR C 1 2   ? 14.808  -10.894 -16.509 1.00 56.49  ? 2   THR C N   1 
ATOM   2851 C  CA  . THR C 1 2   ? 15.018  -9.437  -16.476 1.00 56.49  ? 2   THR C CA  1 
ATOM   2852 C  C   . THR C 1 2   ? 13.998  -8.715  -15.614 1.00 56.49  ? 2   THR C C   1 
ATOM   2853 O  O   . THR C 1 2   ? 13.119  -9.350  -15.047 1.00 56.49  ? 2   THR C O   1 
ATOM   2854 C  CB  . THR C 1 2   ? 14.980  -8.817  -17.886 1.00 78.41  ? 2   THR C CB  1 
ATOM   2855 O  OG1 . THR C 1 2   ? 15.695  -9.666  -18.786 1.00 78.41  ? 2   THR C OG1 1 
ATOM   2856 C  CG2 . THR C 1 2   ? 15.679  -7.471  -17.869 1.00 78.41  ? 2   THR C CG2 1 
ATOM   2857 N  N   . SER C 1 3   ? 14.091  -7.389  -15.584 1.00 7.34   ? 3   SER C N   1 
ATOM   2858 C  CA  . SER C 1 3   ? 13.237  -6.525  -14.792 1.00 7.34   ? 3   SER C CA  1 
ATOM   2859 C  C   . SER C 1 3   ? 13.613  -5.067  -15.031 1.00 7.34   ? 3   SER C C   1 
ATOM   2860 O  O   . SER C 1 3   ? 14.754  -4.750  -15.411 1.00 7.34   ? 3   SER C O   1 
ATOM   2861 C  CB  . SER C 1 3   ? 13.359  -6.855  -13.307 1.00 39.35  ? 3   SER C CB  1 
ATOM   2862 O  OG  . SER C 1 3   ? 14.720  -6.999  -12.862 1.00 39.35  ? 3   SER C OG  1 
ATOM   2863 N  N   . VAL C 1 4   ? 12.668  -4.167  -14.829 1.00 49.83  ? 4   VAL C N   1 
ATOM   2864 C  CA  . VAL C 1 4   ? 12.966  -2.784  -15.068 1.00 49.83  ? 4   VAL C CA  1 
ATOM   2865 C  C   . VAL C 1 4   ? 12.039  -1.876  -14.311 1.00 49.83  ? 4   VAL C C   1 
ATOM   2866 O  O   . VAL C 1 4   ? 10.905  -2.229  -13.998 1.00 49.83  ? 4   VAL C O   1 
ATOM   2867 C  CB  . VAL C 1 4   ? 12.866  -2.467  -16.559 1.00 6.45   ? 4   VAL C CB  1 
ATOM   2868 C  CG1 . VAL C 1 4   ? 11.405  -2.406  -17.002 1.00 6.45   ? 4   VAL C CG1 1 
ATOM   2869 C  CG2 . VAL C 1 4   ? 13.551  -1.163  -16.863 1.00 6.45   ? 4   VAL C CG2 1 
ATOM   2870 N  N   . SER C 1 5   ? 12.542  -0.691  -14.012 1.00 15.18  ? 5   SER C N   1 
ATOM   2871 C  CA  . SER C 1 5   ? 11.746  0.290   -13.323 1.00 15.18  ? 5   SER C CA  1 
ATOM   2872 C  C   . SER C 1 5   ? 12.178  1.711   -13.648 1.00 15.18  ? 5   SER C C   1 
ATOM   2873 O  O   . SER C 1 5   ? 13.309  1.942   -14.103 1.00 15.18  ? 5   SER C O   1 
ATOM   2874 C  CB  . SER C 1 5   ? 11.708  0.033   -11.803 1.00 19.07  ? 5   SER C CB  1 
ATOM   2875 O  OG  . SER C 1 5   ? 12.871  0.453   -11.132 1.00 19.07  ? 5   SER C OG  1 
ATOM   2876 N  N   . PRO C 1 6   ? 11.215  2.654   -13.582 1.00 8.29   ? 6   PRO C N   1 
ATOM   2877 C  CA  . PRO C 1 6   ? 9.799   2.417   -13.229 1.00 8.29   ? 6   PRO C CA  1 
ATOM   2878 C  C   . PRO C 1 6   ? 9.049   1.711   -14.359 1.00 8.29   ? 6   PRO C C   1 
ATOM   2879 O  O   . PRO C 1 6   ? 9.444   1.828   -15.513 1.00 8.29   ? 6   PRO C O   1 
ATOM   2880 C  CB  . PRO C 1 6   ? 9.281   3.817   -13.019 1.00 28.61  ? 6   PRO C CB  1 
ATOM   2881 C  CG  . PRO C 1 6   ? 10.069  4.604   -14.047 1.00 28.61  ? 6   PRO C CG  1 
ATOM   2882 C  CD  . PRO C 1 6   ? 11.459  4.078   -13.879 1.00 28.61  ? 6   PRO C CD  1 
ATOM   2883 N  N   . SER C 1 7   ? 7.976   0.990   -14.055 1.00 25.47  ? 7   SER C N   1 
ATOM   2884 C  CA  . SER C 1 7   ? 7.293   0.275   -15.121 1.00 25.47  ? 7   SER C CA  1 
ATOM   2885 C  C   . SER C 1 7   ? 6.421   1.186   -15.929 1.00 25.47  ? 7   SER C C   1 
ATOM   2886 O  O   . SER C 1 7   ? 6.140   0.913   -17.095 1.00 25.47  ? 7   SER C O   1 
ATOM   2887 C  CB  . SER C 1 7   ? 6.467   -0.855  -14.582 1.00 35.78  ? 7   SER C CB  1 
ATOM   2888 O  OG  . SER C 1 7   ? 5.493   -0.286  -13.762 1.00 35.78  ? 7   SER C OG  1 
ATOM   2889 N  N   . LYS C 1 8   ? 5.923   2.232   -15.299 1.00 2.19   ? 8   LYS C N   1 
ATOM   2890 C  CA  . LYS C 1 8   ? 5.108   3.174   -16.027 1.00 2.19   ? 8   LYS C CA  1 
ATOM   2891 C  C   . LYS C 1 8   ? 5.575   4.557   -15.687 1.00 2.19   ? 8   LYS C C   1 
ATOM   2892 O  O   . LYS C 1 8   ? 6.195   4.754   -14.664 1.00 2.19   ? 8   LYS C O   1 
ATOM   2893 C  CB  . LYS C 1 8   ? 3.614   2.977   -15.753 1.00 61.59  ? 8   LYS C CB  1 
ATOM   2894 C  CG  . LYS C 1 8   ? 3.083   1.716   -16.422 1.00 61.59  ? 8   LYS C CG  1 
ATOM   2895 C  CD  . LYS C 1 8   ? 1.586   1.650   -16.524 1.00 61.59  ? 8   LYS C CD  1 
ATOM   2896 C  CE  . LYS C 1 8   ? 1.178   0.371   -17.231 1.00 61.59  ? 8   LYS C CE  1 
ATOM   2897 N  NZ  . LYS C 1 8   ? 1.633   -0.857  -16.512 1.00 61.59  ? 8   LYS C NZ  1 
ATOM   2898 N  N   . VAL C 1 9   ? 5.391   5.499   -16.602 1.00 53.51  ? 9   VAL C N   1 
ATOM   2899 C  CA  . VAL C 1 9   ? 5.822   6.870   -16.380 1.00 53.51  ? 9   VAL C CA  1 
ATOM   2900 C  C   . VAL C 1 9   ? 4.945   7.771   -17.235 1.00 53.51  ? 9   VAL C C   1 
ATOM   2901 O  O   . VAL C 1 9   ? 4.393   7.327   -18.238 1.00 53.51  ? 9   VAL C O   1 
ATOM   2902 C  CB  . VAL C 1 9   ? 7.286   7.091   -16.845 1.00 2.19   ? 9   VAL C CB  1 
ATOM   2903 C  CG1 . VAL C 1 9   ? 7.849   8.290   -16.191 1.00 2.19   ? 9   VAL C CG1 1 
ATOM   2904 C  CG2 . VAL C 1 9   ? 8.156   5.912   -16.556 1.00 2.19   ? 9   VAL C CG2 1 
ATOM   2905 N  N   . ILE C 1 10  ? 4.757   9.010   -16.800 1.00 11.03  ? 10  ILE C N   1 
ATOM   2906 C  CA  . ILE C 1 10  ? 3.991   9.986   -17.570 1.00 11.03  ? 10  ILE C CA  1 
ATOM   2907 C  C   . ILE C 1 10  ? 4.844   11.215  -17.519 1.00 11.03  ? 10  ILE C C   1 
ATOM   2908 O  O   . ILE C 1 10  ? 5.297   11.573  -16.451 1.00 11.03  ? 10  ILE C O   1 
ATOM   2909 C  CB  . ILE C 1 10  ? 2.592   10.277  -16.961 1.00 27.10  ? 10  ILE C CB  1 
ATOM   2910 C  CG1 . ILE C 1 10  ? 1.640   9.109   -17.260 1.00 27.10  ? 10  ILE C CG1 1 
ATOM   2911 C  CG2 . ILE C 1 10  ? 2.015   11.566  -17.530 1.00 27.10  ? 10  ILE C CG2 1 
ATOM   2912 C  CD1 . ILE C 1 10  ? 0.151   9.478   -17.292 1.00 27.10  ? 10  ILE C CD1 1 
ATOM   2913 N  N   . LEU C 1 11  ? 5.162   11.798  -18.666 1.00 7.62   ? 11  LEU C N   1 
ATOM   2914 C  CA  . LEU C 1 11  ? 5.989   13.004  -18.669 1.00 7.62   ? 11  LEU C CA  1 
ATOM   2915 C  C   . LEU C 1 11  ? 5.845   13.896  -19.903 1.00 7.62   ? 11  LEU C C   1 
ATOM   2916 O  O   . LEU C 1 11  ? 5.442   13.434  -20.978 1.00 7.62   ? 11  LEU C O   1 
ATOM   2917 C  CB  . LEU C 1 11  ? 7.466   12.667  -18.460 1.00 17.13  ? 11  LEU C CB  1 
ATOM   2918 C  CG  . LEU C 1 11  ? 8.225   12.080  -19.634 1.00 17.13  ? 11  LEU C CG  1 
ATOM   2919 C  CD1 . LEU C 1 11  ? 9.662   12.423  -19.465 1.00 17.13  ? 11  LEU C CD1 1 
ATOM   2920 C  CD2 . LEU C 1 11  ? 8.023   10.593  -19.730 1.00 17.13  ? 11  LEU C CD2 1 
ATOM   2921 N  N   . PRO C 1 12  ? 6.201   15.188  -19.768 1.00 14.09  ? 12  PRO C N   1 
ATOM   2922 C  CA  . PRO C 1 12  ? 6.112   16.140  -20.868 1.00 14.09  ? 12  PRO C CA  1 
ATOM   2923 C  C   . PRO C 1 12  ? 7.246   15.963  -21.869 1.00 14.09  ? 12  PRO C C   1 
ATOM   2924 O  O   . PRO C 1 12  ? 8.272   15.327  -21.586 1.00 14.09  ? 12  PRO C O   1 
ATOM   2925 C  CB  . PRO C 1 12  ? 6.227   17.471  -20.149 1.00 12.89  ? 12  PRO C CB  1 
ATOM   2926 C  CG  . PRO C 1 12  ? 7.217   17.168  -19.099 1.00 12.89  ? 12  PRO C CG  1 
ATOM   2927 C  CD  . PRO C 1 12  ? 6.701   15.859  -18.559 1.00 12.89  ? 12  PRO C CD  1 
ATOM   2928 N  N   . ARG C 1 13  ? 7.063   16.557  -23.039 1.00 57.29  ? 13  ARG C N   1 
ATOM   2929 C  CA  . ARG C 1 13  ? 8.059   16.473  -24.087 1.00 57.29  ? 13  ARG C CA  1 
ATOM   2930 C  C   . ARG C 1 13  ? 9.375   17.087  -23.644 1.00 57.29  ? 13  ARG C C   1 
ATOM   2931 O  O   . ARG C 1 13  ? 9.418   17.959  -22.776 1.00 57.29  ? 13  ARG C O   1 
ATOM   2932 C  CB  . ARG C 1 13  ? 7.574   17.182  -25.361 1.00 86.01  ? 13  ARG C CB  1 
ATOM   2933 C  CG  . ARG C 1 13  ? 6.789   16.304  -26.332 1.00 86.01  ? 13  ARG C CG  1 
ATOM   2934 C  CD  . ARG C 1 13  ? 5.302   16.558  -26.269 1.00 86.01  ? 13  ARG C CD  1 
ATOM   2935 N  NE  . ARG C 1 13  ? 4.758   16.848  -27.589 1.00 86.01  ? 13  ARG C NE  1 
ATOM   2936 C  CZ  . ARG C 1 13  ? 4.728   18.058  -28.132 1.00 86.01  ? 13  ARG C CZ  1 
ATOM   2937 N  NH1 . ARG C 1 13  ? 5.207   19.103  -27.472 1.00 86.01  ? 13  ARG C NH1 1 
ATOM   2938 N  NH2 . ARG C 1 13  ? 4.226   18.222  -29.342 1.00 86.01  ? 13  ARG C NH2 1 
ATOM   2939 N  N   . GLY C 1 14  ? 10.452  16.572  -24.223 1.00 13.12  ? 14  GLY C N   1 
ATOM   2940 C  CA  . GLY C 1 14  ? 11.785  17.071  -23.935 1.00 13.12  ? 14  GLY C CA  1 
ATOM   2941 C  C   . GLY C 1 14  ? 12.242  16.675  -22.549 1.00 13.12  ? 14  GLY C C   1 
ATOM   2942 O  O   . GLY C 1 14  ? 13.402  16.865  -22.170 1.00 13.12  ? 14  GLY C O   1 
ATOM   2943 N  N   . GLY C 1 15  ? 11.285  16.195  -21.755 1.00 36.11  ? 15  GLY C N   1 
ATOM   2944 C  CA  . GLY C 1 15  ? 11.613  15.792  -20.413 1.00 36.11  ? 15  GLY C CA  1 
ATOM   2945 C  C   . GLY C 1 15  ? 12.604  14.651  -20.480 1.00 36.11  ? 15  GLY C C   1 
ATOM   2946 O  O   . GLY C 1 15  ? 12.955  14.156  -21.559 1.00 36.11  ? 15  GLY C O   1 
ATOM   2947 N  N   . SER C 1 16  ? 13.120  14.277  -19.320 1.00 61.84  ? 16  SER C N   1 
ATOM   2948 C  CA  . SER C 1 16  ? 14.064  13.168  -19.282 1.00 61.84  ? 16  SER C CA  1 
ATOM   2949 C  C   . SER C 1 16  ? 13.655  12.254  -18.149 1.00 61.84  ? 16  SER C C   1 
ATOM   2950 O  O   . SER C 1 16  ? 12.948  12.660  -17.217 1.00 61.84  ? 16  SER C O   1 
ATOM   2951 C  CB  . SER C 1 16  ? 15.502  13.667  -19.081 1.00 35.32  ? 16  SER C CB  1 
ATOM   2952 O  OG  . SER C 1 16  ? 15.684  14.223  -17.791 1.00 35.32  ? 16  SER C OG  1 
ATOM   2953 N  N   . VAL C 1 17  ? 14.006  10.990  -18.311 1.00 2.19   ? 17  VAL C N   1 
ATOM   2954 C  CA  . VAL C 1 17  ? 13.732  9.979   -17.305 1.00 2.19   ? 17  VAL C CA  1 
ATOM   2955 C  C   . VAL C 1 17  ? 14.945  9.073   -17.057 1.00 2.19   ? 17  VAL C C   1 
ATOM   2956 O  O   . VAL C 1 17  ? 15.903  9.064   -17.827 1.00 2.19   ? 17  VAL C O   1 
ATOM   2957 C  CB  . VAL C 1 17  ? 12.490  9.125   -17.662 1.00 24.28  ? 17  VAL C CB  1 
ATOM   2958 C  CG1 . VAL C 1 17  ? 11.319  9.570   -16.818 1.00 24.28  ? 17  VAL C CG1 1 
ATOM   2959 C  CG2 . VAL C 1 17  ? 12.145  9.251   -19.125 1.00 24.28  ? 17  VAL C CG2 1 
ATOM   2960 N  N   . LEU C 1 18  ? 14.916  8.372   -15.934 1.00 44.75  ? 18  LEU C N   1 
ATOM   2961 C  CA  . LEU C 1 18  ? 15.976  7.447   -15.560 1.00 44.75  ? 18  LEU C CA  1 
ATOM   2962 C  C   . LEU C 1 18  ? 15.361  6.053   -15.535 1.00 44.75  ? 18  LEU C C   1 
ATOM   2963 O  O   . LEU C 1 18  ? 14.204  5.889   -15.134 1.00 44.75  ? 18  LEU C O   1 
ATOM   2964 C  CB  . LEU C 1 18  ? 16.490  7.795   -14.162 1.00 12.52  ? 18  LEU C CB  1 
ATOM   2965 C  CG  . LEU C 1 18  ? 17.733  8.661   -13.946 1.00 12.52  ? 18  LEU C CG  1 
ATOM   2966 C  CD1 . LEU C 1 18  ? 17.826  9.776   -14.955 1.00 12.52  ? 18  LEU C CD1 1 
ATOM   2967 C  CD2 . LEU C 1 18  ? 17.696  9.211   -12.541 1.00 12.52  ? 18  LEU C CD2 1 
ATOM   2968 N  N   . VAL C 1 19  ? 16.092  5.050   -16.003 1.00 24.15  ? 19  VAL C N   1 
ATOM   2969 C  CA  . VAL C 1 19  ? 15.543  3.690   -15.963 1.00 24.15  ? 19  VAL C CA  1 
ATOM   2970 C  C   . VAL C 1 19  ? 16.588  2.686   -15.505 1.00 24.15  ? 19  VAL C C   1 
ATOM   2971 O  O   . VAL C 1 19  ? 17.758  2.768   -15.885 1.00 24.15  ? 19  VAL C O   1 
ATOM   2972 C  CB  . VAL C 1 19  ? 14.955  3.227   -17.315 1.00 8.25   ? 19  VAL C CB  1 
ATOM   2973 C  CG1 . VAL C 1 19  ? 13.777  2.297   -17.070 1.00 8.25   ? 19  VAL C CG1 1 
ATOM   2974 C  CG2 . VAL C 1 19  ? 14.533  4.412   -18.163 1.00 8.25   ? 19  VAL C CG2 1 
ATOM   2975 N  N   . THR C 1 20  ? 16.174  1.744   -14.671 1.00 41.47  ? 20  THR C N   1 
ATOM   2976 C  CA  . THR C 1 20  ? 17.130  0.782   -14.189 1.00 41.47  ? 20  THR C CA  1 
ATOM   2977 C  C   . THR C 1 20  ? 16.914  -0.630  -14.737 1.00 41.47  ? 20  THR C C   1 
ATOM   2978 O  O   . THR C 1 20  ? 15.986  -1.341  -14.344 1.00 41.47  ? 20  THR C O   1 
ATOM   2979 C  CB  . THR C 1 20  ? 17.220  0.780   -12.645 1.00 68.83  ? 20  THR C CB  1 
ATOM   2980 O  OG1 . THR C 1 20  ? 16.210  -0.074  -12.106 1.00 68.83  ? 20  THR C OG1 1 
ATOM   2981 C  CG2 . THR C 1 20  ? 17.015  2.185   -12.080 1.00 68.83  ? 20  THR C CG2 1 
ATOM   2982 N  N   . CYS C 1 21  ? 17.733  -0.999  -15.715 1.00 47.55  ? 21  CYS C N   1 
ATOM   2983 C  CA  . CYS C 1 21  ? 17.669  -2.327  -16.283 1.00 47.55  ? 21  CYS C CA  1 
ATOM   2984 C  C   . CYS C 1 21  ? 18.357  -3.225  -15.272 1.00 47.55  ? 21  CYS C C   1 
ATOM   2985 O  O   . CYS C 1 21  ? 19.577  -3.182  -15.123 1.00 47.55  ? 21  CYS C O   1 
ATOM   2986 C  CB  . CYS C 1 21  ? 18.419  -2.396  -17.610 1.00 86.87  ? 21  CYS C CB  1 
ATOM   2987 S  SG  . CYS C 1 21  ? 17.708  -1.480  -19.011 1.00 86.87  ? 21  CYS C SG  1 
ATOM   2988 N  N   . SER C 1 22  ? 17.557  -3.933  -14.479 1.00 38.56  ? 22  SER C N   1 
ATOM   2989 C  CA  . SER C 1 22  ? 18.065  -4.870  -13.467 1.00 38.56  ? 22  SER C CA  1 
ATOM   2990 C  C   . SER C 1 22  ? 17.969  -6.291  -14.033 1.00 38.56  ? 22  SER C C   1 
ATOM   2991 O  O   . SER C 1 22  ? 17.395  -6.511  -15.094 1.00 38.56  ? 22  SER C O   1 
ATOM   2992 C  CB  . SER C 1 22  ? 17.222  -4.794  -12.185 1.00 64.47  ? 22  SER C CB  1 
ATOM   2993 O  OG  . SER C 1 22  ? 17.080  -3.461  -11.747 1.00 64.47  ? 22  SER C OG  1 
ATOM   2994 N  N   . THR C 1 23  ? 18.537  -7.248  -13.313 1.00 51.13  ? 23  THR C N   1 
ATOM   2995 C  CA  . THR C 1 23  ? 18.482  -8.644  -13.739 1.00 51.13  ? 23  THR C CA  1 
ATOM   2996 C  C   . THR C 1 23  ? 18.944  -9.551  -12.616 1.00 51.13  ? 23  THR C C   1 
ATOM   2997 O  O   . THR C 1 23  ? 19.644  -9.112  -11.693 1.00 51.13  ? 23  THR C O   1 
ATOM   2998 C  CB  . THR C 1 23  ? 19.296  -8.917  -15.047 1.00 35.22  ? 23  THR C CB  1 
ATOM   2999 O  OG1 . THR C 1 23  ? 19.337  -10.326 -15.298 1.00 35.22  ? 23  THR C OG1 1 
ATOM   3000 C  CG2 . THR C 1 23  ? 20.708  -8.358  -14.976 1.00 35.22  ? 23  THR C CG2 1 
ATOM   3001 N  N   . SER C 1 24  ? 18.485  -10.796 -12.652 1.00 50.83  ? 24  SER C N   1 
ATOM   3002 C  CA  . SER C 1 24  ? 18.842  -11.763 -11.628 1.00 50.83  ? 24  SER C CA  1 
ATOM   3003 C  C   . SER C 1 24  ? 19.501  -12.979 -12.221 1.00 50.83  ? 24  SER C C   1 
ATOM   3004 O  O   . SER C 1 24  ? 18.841  -13.966 -12.523 1.00 50.83  ? 24  SER C O   1 
ATOM   3005 C  CB  . SER C 1 24  ? 17.614  -12.181 -10.814 1.00 14.51  ? 24  SER C CB  1 
ATOM   3006 O  OG  . SER C 1 24  ? 16.641  -12.831 -11.604 1.00 14.51  ? 24  SER C OG  1 
ATOM   3007 N  N   . CYS C 1 25  ? 20.805  -12.890 -12.426 1.00 69.03  ? 25  CYS C N   1 
ATOM   3008 C  CA  . CYS C 1 25  ? 21.542  -14.022 -12.962 1.00 69.03  ? 25  CYS C CA  1 
ATOM   3009 C  C   . CYS C 1 25  ? 22.841  -14.222 -12.193 1.00 69.03  ? 25  CYS C C   1 
ATOM   3010 O  O   . CYS C 1 25  ? 23.363  -13.290 -11.565 1.00 69.03  ? 25  CYS C O   1 
ATOM   3011 C  CB  . CYS C 1 25  ? 21.772  -13.853 -14.475 1.00 97.98  ? 25  CYS C CB  1 
ATOM   3012 S  SG  . CYS C 1 25  ? 20.213  -14.077 -15.388 1.00 97.98  ? 25  CYS C SG  1 
ATOM   3013 N  N   . ASP C 1 26  ? 23.299  -15.471 -12.168 1.00 98.65  ? 26  ASP C N   1 
ATOM   3014 C  CA  . ASP C 1 26  ? 24.538  -15.828 -11.474 1.00 98.65  ? 26  ASP C CA  1 
ATOM   3015 C  C   . ASP C 1 26  ? 25.667  -14.975 -12.067 1.00 98.65  ? 26  ASP C C   1 
ATOM   3016 O  O   . ASP C 1 26  ? 26.518  -14.459 -11.339 1.00 98.65  ? 26  ASP C O   1 
ATOM   3017 C  CB  . ASP C 1 26  ? 24.828  -17.330 -11.659 1.00 94.31  ? 26  ASP C CB  1 
ATOM   3018 C  CG  . ASP C 1 26  ? 25.434  -17.978 -10.417 1.00 94.31  ? 26  ASP C CG  1 
ATOM   3019 O  OD1 . ASP C 1 26  ? 24.986  -17.663 -9.292  1.00 94.31  ? 26  ASP C OD1 1 
ATOM   3020 O  OD2 . ASP C 1 26  ? 26.353  -18.812 -10.567 1.00 94.31  ? 26  ASP C OD2 1 
ATOM   3021 N  N   . GLN C 1 27  ? 25.609  -14.770 -13.386 1.00 85.25  ? 27  GLN C N   1 
ATOM   3022 C  CA  . GLN C 1 27  ? 26.589  -13.967 -14.122 1.00 85.25  ? 27  GLN C CA  1 
ATOM   3023 C  C   . GLN C 1 27  ? 26.096  -13.750 -15.561 1.00 85.25  ? 27  GLN C C   1 
ATOM   3024 O  O   . GLN C 1 27  ? 26.345  -14.571 -16.445 1.00 85.25  ? 27  GLN C O   1 
ATOM   3025 C  CB  . GLN C 1 27  ? 27.960  -14.664 -14.116 1.00 96.57  ? 27  GLN C CB  1 
ATOM   3026 C  CG  . GLN C 1 27  ? 29.133  -13.787 -14.562 1.00 96.57  ? 27  GLN C CG  1 
ATOM   3027 C  CD  . GLN C 1 27  ? 29.410  -12.618 -13.619 1.00 96.57  ? 27  GLN C CD  1 
ATOM   3028 O  OE1 . GLN C 1 27  ? 29.162  -11.453 -13.953 1.00 96.57  ? 27  GLN C OE1 1 
ATOM   3029 N  NE2 . GLN C 1 27  ? 29.948  -12.924 -12.444 1.00 96.57  ? 27  GLN C NE2 1 
ATOM   3030 N  N   . PRO C 1 28  ? 25.359  -12.650 -15.800 1.00 56.58  ? 28  PRO C N   1 
ATOM   3031 C  CA  . PRO C 1 28  ? 24.815  -12.299 -17.118 1.00 56.58  ? 28  PRO C CA  1 
ATOM   3032 C  C   . PRO C 1 28  ? 25.910  -11.887 -18.114 1.00 56.58  ? 28  PRO C C   1 
ATOM   3033 O  O   . PRO C 1 28  ? 26.830  -11.142 -17.762 1.00 56.58  ? 28  PRO C O   1 
ATOM   3034 C  CB  . PRO C 1 28  ? 23.888  -11.130 -16.789 1.00 87.29  ? 28  PRO C CB  1 
ATOM   3035 C  CG  . PRO C 1 28  ? 24.584  -10.463 -15.646 1.00 87.29  ? 28  PRO C CG  1 
ATOM   3036 C  CD  . PRO C 1 28  ? 24.965  -11.646 -14.795 1.00 87.29  ? 28  PRO C CD  1 
ATOM   3037 N  N   . LYS C 1 29  ? 25.802  -12.346 -19.359 1.00 72.47  ? 29  LYS C N   1 
ATOM   3038 C  CA  . LYS C 1 29  ? 26.814  -12.003 -20.357 1.00 72.47  ? 29  LYS C CA  1 
ATOM   3039 C  C   . LYS C 1 29  ? 26.558  -10.659 -21.067 1.00 72.47  ? 29  LYS C C   1 
ATOM   3040 O  O   . LYS C 1 29  ? 27.419  -10.178 -21.810 1.00 72.47  ? 29  LYS C O   1 
ATOM   3041 C  CB  . LYS C 1 29  ? 26.974  -13.136 -21.375 1.00 66.27  ? 29  LYS C CB  1 
ATOM   3042 C  CG  . LYS C 1 29  ? 28.235  -13.046 -22.265 1.00 66.27  ? 29  LYS C CG  1 
ATOM   3043 C  CD  . LYS C 1 29  ? 29.533  -13.089 -21.440 1.00 66.27  ? 29  LYS C CD  1 
ATOM   3044 C  CE  . LYS C 1 29  ? 30.677  -12.304 -22.088 1.00 66.27  ? 29  LYS C CE  1 
ATOM   3045 N  NZ  . LYS C 1 29  ? 30.483  -12.090 -23.545 1.00 66.27  ? 29  LYS C NZ  1 
ATOM   3046 N  N   . LEU C 1 30  ? 25.426  -10.015 -20.785 1.00 22.93  ? 30  LEU C N   1 
ATOM   3047 C  CA  . LEU C 1 30  ? 25.088  -8.740  -21.417 1.00 22.93  ? 30  LEU C CA  1 
ATOM   3048 C  C   . LEU C 1 30  ? 23.850  -8.106  -20.796 1.00 22.93  ? 30  LEU C C   1 
ATOM   3049 O  O   . LEU C 1 30  ? 22.915  -8.803  -20.380 1.00 22.93  ? 30  LEU C O   1 
ATOM   3050 C  CB  . LEU C 1 30  ? 24.868  -8.924  -22.912 1.00 67.15  ? 30  LEU C CB  1 
ATOM   3051 C  CG  . LEU C 1 30  ? 25.548  -7.939  -23.862 1.00 67.15  ? 30  LEU C CG  1 
ATOM   3052 C  CD1 . LEU C 1 30  ? 24.800  -6.624  -23.932 1.00 67.15  ? 30  LEU C CD1 1 
ATOM   3053 C  CD2 . LEU C 1 30  ? 27.001  -7.710  -23.424 1.00 67.15  ? 30  LEU C CD2 1 
ATOM   3054 N  N   . LEU C 1 31  ? 23.875  -6.778  -20.704 1.00 46.44  ? 31  LEU C N   1 
ATOM   3055 C  CA  . LEU C 1 31  ? 22.768  -5.986  -20.177 1.00 46.44  ? 31  LEU C CA  1 
ATOM   3056 C  C   . LEU C 1 31  ? 22.712  -4.651  -20.905 1.00 46.44  ? 31  LEU C C   1 
ATOM   3057 O  O   . LEU C 1 31  ? 23.742  -3.993  -21.096 1.00 46.44  ? 31  LEU C O   1 
ATOM   3058 C  CB  . LEU C 1 31  ? 22.890  -5.759  -18.667 1.00 31.41  ? 31  LEU C CB  1 
ATOM   3059 C  CG  . LEU C 1 31  ? 21.830  -4.856  -18.005 1.00 31.41  ? 31  LEU C CG  1 
ATOM   3060 C  CD1 . LEU C 1 31  ? 20.453  -5.290  -18.427 1.00 31.41  ? 31  LEU C CD1 1 
ATOM   3061 C  CD2 . LEU C 1 31  ? 21.940  -4.889  -16.485 1.00 31.41  ? 31  LEU C CD2 1 
ATOM   3062 N  N   . GLY C 1 32  ? 21.502  -4.273  -21.315 1.00 38.54  ? 32  GLY C N   1 
ATOM   3063 C  CA  . GLY C 1 32  ? 21.297  -3.023  -22.027 1.00 38.54  ? 32  GLY C CA  1 
ATOM   3064 C  C   . GLY C 1 32  ? 19.840  -2.632  -22.129 1.00 38.54  ? 32  GLY C C   1 
ATOM   3065 O  O   . GLY C 1 32  ? 18.956  -3.345  -21.655 1.00 38.54  ? 32  GLY C O   1 
ATOM   3066 N  N   . ILE C 1 33  ? 19.597  -1.476  -22.738 1.00 34.36  ? 33  ILE C N   1 
ATOM   3067 C  CA  . ILE C 1 33  ? 18.240  -0.957  -22.916 1.00 34.36  ? 33  ILE C CA  1 
ATOM   3068 C  C   . ILE C 1 33  ? 17.991  -0.742  -24.419 1.00 34.36  ? 33  ILE C C   1 
ATOM   3069 O  O   . ILE C 1 33  ? 18.925  -0.454  -25.163 1.00 34.36  ? 33  ILE C O   1 
ATOM   3070 C  CB  . ILE C 1 33  ? 18.034  0.357   -22.086 1.00 40.70  ? 33  ILE C CB  1 
ATOM   3071 C  CG1 . ILE C 1 33  ? 16.559  0.750   -22.039 1.00 40.70  ? 33  ILE C CG1 1 
ATOM   3072 C  CG2 . ILE C 1 33  ? 18.859  1.473   -22.649 1.00 40.70  ? 33  ILE C CG2 1 
ATOM   3073 C  CD1 . ILE C 1 33  ? 16.253  1.832   -21.055 1.00 40.70  ? 33  ILE C CD1 1 
ATOM   3074 N  N   . GLU C 1 34  ? 16.757  -0.935  -24.872 1.00 28.20  ? 34  GLU C N   1 
ATOM   3075 C  CA  . GLU C 1 34  ? 16.429  -0.784  -26.277 1.00 28.20  ? 34  GLU C CA  1 
ATOM   3076 C  C   . GLU C 1 34  ? 15.477  0.360   -26.535 1.00 28.20  ? 34  GLU C C   1 
ATOM   3077 O  O   . GLU C 1 34  ? 14.262  0.184   -26.367 1.00 28.20  ? 34  GLU C O   1 
ATOM   3078 C  CB  . GLU C 1 34  ? 15.794  -2.076  -26.791 1.00 25.94  ? 34  GLU C CB  1 
ATOM   3079 C  CG  . GLU C 1 34  ? 15.531  -2.119  -28.292 1.00 25.94  ? 34  GLU C CG  1 
ATOM   3080 C  CD  . GLU C 1 34  ? 16.776  -2.406  -29.099 1.00 25.94  ? 34  GLU C CD  1 
ATOM   3081 O  OE1 . GLU C 1 34  ? 17.821  -2.711  -28.507 1.00 25.94  ? 34  GLU C OE1 1 
ATOM   3082 O  OE2 . GLU C 1 34  ? 16.719  -2.355  -30.333 1.00 25.94  ? 34  GLU C OE2 1 
ATOM   3083 N  N   . THR C 1 35  ? 15.991  1.498   -27.007 1.00 50.82  ? 35  THR C N   1 
ATOM   3084 C  CA  . THR C 1 35  ? 15.124  2.640   -27.289 1.00 50.82  ? 35  THR C CA  1 
ATOM   3085 C  C   . THR C 1 35  ? 15.635  3.510   -28.403 1.00 50.82  ? 35  THR C C   1 
ATOM   3086 O  O   . THR C 1 35  ? 16.835  3.535   -28.672 1.00 50.82  ? 35  THR C O   1 
ATOM   3087 C  CB  . THR C 1 35  ? 15.024  3.637   -26.122 1.00 18.34  ? 35  THR C CB  1 
ATOM   3088 O  OG1 . THR C 1 35  ? 16.246  4.382   -26.025 1.00 18.34  ? 35  THR C OG1 1 
ATOM   3089 C  CG2 . THR C 1 35  ? 14.727  2.953   -24.820 1.00 18.34  ? 35  THR C CG2 1 
ATOM   3090 N  N   . PRO C 1 36  ? 14.717  4.267   -29.043 1.00 43.04  ? 36  PRO C N   1 
ATOM   3091 C  CA  . PRO C 1 36  ? 14.981  5.208   -30.136 1.00 43.04  ? 36  PRO C CA  1 
ATOM   3092 C  C   . PRO C 1 36  ? 15.431  6.523   -29.472 1.00 43.04  ? 36  PRO C C   1 
ATOM   3093 O  O   . PRO C 1 36  ? 16.030  7.390   -30.105 1.00 43.04  ? 36  PRO C O   1 
ATOM   3094 C  CB  . PRO C 1 36  ? 13.602  5.381   -30.785 1.00 93.45  ? 36  PRO C CB  1 
ATOM   3095 C  CG  . PRO C 1 36  ? 12.845  4.159   -30.376 1.00 93.45  ? 36  PRO C CG  1 
ATOM   3096 C  CD  . PRO C 1 36  ? 13.270  3.999   -28.952 1.00 93.45  ? 36  PRO C CD  1 
ATOM   3097 N  N   . LEU C 1 37  ? 15.132  6.642   -28.179 1.00 36.49  ? 37  LEU C N   1 
ATOM   3098 C  CA  . LEU C 1 37  ? 15.476  7.811   -27.384 1.00 36.49  ? 37  LEU C CA  1 
ATOM   3099 C  C   . LEU C 1 37  ? 16.964  7.898   -27.085 1.00 36.49  ? 37  LEU C C   1 
ATOM   3100 O  O   . LEU C 1 37  ? 17.653  6.877   -27.011 1.00 36.49  ? 37  LEU C O   1 
ATOM   3101 C  CB  . LEU C 1 37  ? 14.760  7.788   -26.032 1.00 33.23  ? 37  LEU C CB  1 
ATOM   3102 C  CG  . LEU C 1 37  ? 13.251  7.800   -25.894 1.00 33.23  ? 37  LEU C CG  1 
ATOM   3103 C  CD1 . LEU C 1 37  ? 12.750  6.397   -26.042 1.00 33.23  ? 37  LEU C CD1 1 
ATOM   3104 C  CD2 . LEU C 1 37  ? 12.903  8.319   -24.515 1.00 33.23  ? 37  LEU C CD2 1 
ATOM   3105 N  N   . PRO C 1 38  ? 17.469  9.133   -26.882 1.00 26.86  ? 38  PRO C N   1 
ATOM   3106 C  CA  . PRO C 1 38  ? 18.876  9.397   -26.571 1.00 26.86  ? 38  PRO C CA  1 
ATOM   3107 C  C   . PRO C 1 38  ? 19.235  8.751   -25.235 1.00 26.86  ? 38  PRO C C   1 
ATOM   3108 O  O   . PRO C 1 38  ? 18.631  9.072   -24.207 1.00 26.86  ? 38  PRO C O   1 
ATOM   3109 C  CB  . PRO C 1 38  ? 18.918  10.923  -26.455 1.00 27.45  ? 38  PRO C CB  1 
ATOM   3110 C  CG  . PRO C 1 38  ? 17.850  11.376  -27.396 1.00 27.45  ? 38  PRO C CG  1 
ATOM   3111 C  CD  . PRO C 1 38  ? 16.739  10.396  -27.127 1.00 27.45  ? 38  PRO C CD  1 
ATOM   3112 N  N   . LYS C 1 39  ? 20.189  7.821   -25.251 1.00 66.81  ? 39  LYS C N   1 
ATOM   3113 C  CA  . LYS C 1 39  ? 20.601  7.167   -24.015 1.00 66.81  ? 39  LYS C CA  1 
ATOM   3114 C  C   . LYS C 1 39  ? 21.904  7.747   -23.437 1.00 66.81  ? 39  LYS C C   1 
ATOM   3115 O  O   . LYS C 1 39  ? 22.788  8.209   -24.170 1.00 66.81  ? 39  LYS C O   1 
ATOM   3116 C  CB  . LYS C 1 39  ? 20.698  5.643   -24.199 1.00 69.03  ? 39  LYS C CB  1 
ATOM   3117 C  CG  . LYS C 1 39  ? 21.886  5.156   -25.026 1.00 69.03  ? 39  LYS C CG  1 
ATOM   3118 C  CD  . LYS C 1 39  ? 21.987  3.614   -25.030 1.00 69.03  ? 39  LYS C CD  1 
ATOM   3119 C  CE  . LYS C 1 39  ? 23.326  3.081   -25.610 1.00 69.03  ? 39  LYS C CE  1 
ATOM   3120 N  NZ  . LYS C 1 39  ? 23.251  2.496   -26.996 1.00 69.03  ? 39  LYS C NZ  1 
ATOM   3121 N  N   . LYS C 1 40  ? 21.967  7.782   -22.109 1.00 2.19   ? 40  LYS C N   1 
ATOM   3122 C  CA  . LYS C 1 40  ? 23.123  8.271   -21.382 1.00 2.19   ? 40  LYS C CA  1 
ATOM   3123 C  C   . LYS C 1 40  ? 23.199  7.417   -20.127 1.00 2.19   ? 40  LYS C C   1 
ATOM   3124 O  O   . LYS C 1 40  ? 22.326  7.539   -19.274 1.00 2.19   ? 40  LYS C O   1 
ATOM   3125 C  CB  . LYS C 1 40  ? 22.921  9.735   -20.976 1.00 61.89  ? 40  LYS C CB  1 
ATOM   3126 C  CG  . LYS C 1 40  ? 23.906  10.248  -19.910 1.00 61.89  ? 40  LYS C CG  1 
ATOM   3127 C  CD  . LYS C 1 40  ? 25.252  10.678  -20.494 1.00 61.89  ? 40  LYS C CD  1 
ATOM   3128 C  CE  . LYS C 1 40  ? 25.155  12.040  -21.189 1.00 61.89  ? 40  LYS C CE  1 
ATOM   3129 N  NZ  . LYS C 1 40  ? 26.437  12.509  -21.809 1.00 61.89  ? 40  LYS C NZ  1 
ATOM   3130 N  N   . GLU C 1 41  ? 24.229  6.577   -19.993 1.00 25.82  ? 41  GLU C N   1 
ATOM   3131 C  CA  . GLU C 1 41  ? 24.354  5.726   -18.808 1.00 25.82  ? 41  GLU C CA  1 
ATOM   3132 C  C   . GLU C 1 41  ? 24.905  6.419   -17.550 1.00 25.82  ? 41  GLU C C   1 
ATOM   3133 O  O   . GLU C 1 41  ? 25.656  7.399   -17.644 1.00 25.82  ? 41  GLU C O   1 
ATOM   3134 C  CB  . GLU C 1 41  ? 25.183  4.484   -19.120 1.00 93.29  ? 41  GLU C CB  1 
ATOM   3135 C  CG  . GLU C 1 41  ? 26.644  4.753   -19.452 1.00 93.29  ? 41  GLU C CG  1 
ATOM   3136 C  CD  . GLU C 1 41  ? 27.508  3.496   -19.354 1.00 93.29  ? 41  GLU C CD  1 
ATOM   3137 O  OE1 . GLU C 1 41  ? 28.748  3.614   -19.535 1.00 93.29  ? 41  GLU C OE1 1 
ATOM   3138 O  OE2 . GLU C 1 41  ? 26.953  2.396   -19.084 1.00 93.29  ? 41  GLU C OE2 1 
ATOM   3139 N  N   . LEU C 1 42  ? 24.524  5.893   -16.375 1.00 43.82  ? 42  LEU C N   1 
ATOM   3140 C  CA  . LEU C 1 42  ? 24.957  6.420   -15.083 1.00 43.82  ? 42  LEU C CA  1 
ATOM   3141 C  C   . LEU C 1 42  ? 26.139  5.701   -14.422 1.00 43.82  ? 42  LEU C C   1 
ATOM   3142 O  O   . LEU C 1 42  ? 27.093  5.298   -15.104 1.00 43.82  ? 42  LEU C O   1 
ATOM   3143 C  CB  . LEU C 1 42  ? 23.788  6.482   -14.106 1.00 87.68  ? 42  LEU C CB  1 
ATOM   3144 C  CG  . LEU C 1 42  ? 22.800  7.613   -14.378 1.00 87.68  ? 42  LEU C CG  1 
ATOM   3145 C  CD1 . LEU C 1 42  ? 21.669  7.588   -13.377 1.00 87.68  ? 42  LEU C CD1 1 
ATOM   3146 C  CD2 . LEU C 1 42  ? 23.517  8.944   -14.315 1.00 87.68  ? 42  LEU C CD2 1 
ATOM   3147 N  N   . LEU C 1 43  ? 26.083  5.567   -13.119 1.00 98.21  ? 43  LEU C N   1 
ATOM   3148 C  CA  . LEU C 1 43  ? 27.146  4.943   -12.322 1.00 98.21  ? 43  LEU C CA  1 
ATOM   3149 C  C   . LEU C 1 43  ? 27.706  3.588   -12.740 1.00 98.21  ? 43  LEU C C   1 
ATOM   3150 O  O   . LEU C 1 43  ? 27.050  2.788   -13.414 1.00 98.21  ? 43  LEU C O   1 
ATOM   3151 C  CB  . LEU C 1 43  ? 26.746  4.860   -10.839 1.00 98.21  ? 43  LEU C CB  1 
ATOM   3152 C  CG  . LEU C 1 43  ? 27.161  6.006   -9.911  1.00 98.21  ? 43  LEU C CG  1 
ATOM   3153 C  CD1 . LEU C 1 43  ? 26.992  5.586   -8.448  1.00 98.21  ? 43  LEU C CD1 1 
ATOM   3154 C  CD2 . LEU C 1 43  ? 28.615  6.378   -10.176 1.00 98.21  ? 43  LEU C CD2 1 
ATOM   3155 N  N   . LEU C 1 44  ? 28.937  3.354   -12.276 1.00 63.60  ? 44  LEU C N   1 
ATOM   3156 C  CA  . LEU C 1 44  ? 29.709  2.123   -12.489 1.00 63.60  ? 44  LEU C CA  1 
ATOM   3157 C  C   . LEU C 1 44  ? 29.440  1.067   -11.385 1.00 63.60  ? 44  LEU C C   1 
ATOM   3158 O  O   . LEU C 1 44  ? 29.449  -0.138  -11.667 1.00 63.60  ? 44  LEU C O   1 
ATOM   3159 C  CB  . LEU C 1 44  ? 31.211  2.469   -12.574 1.00 98.21  ? 44  LEU C CB  1 
ATOM   3160 C  CG  . LEU C 1 44  ? 32.319  1.416   -12.736 1.00 98.21  ? 44  LEU C CG  1 
ATOM   3161 C  CD1 . LEU C 1 44  ? 31.998  0.432   -13.860 1.00 98.21  ? 44  LEU C CD1 1 
ATOM   3162 C  CD2 . LEU C 1 44  ? 33.646  2.141   -13.000 1.00 98.21  ? 44  LEU C CD2 1 
ATOM   3163 N  N   . PRO C 1 45  ? 29.252  1.506   -10.113 1.00 68.74  ? 45  PRO C N   1 
ATOM   3164 C  CA  . PRO C 1 45  ? 28.979  0.612   -8.979  1.00 68.74  ? 45  PRO C CA  1 
ATOM   3165 C  C   . PRO C 1 45  ? 27.763  -0.274  -9.207  1.00 68.74  ? 45  PRO C C   1 
ATOM   3166 O  O   . PRO C 1 45  ? 26.646  0.225   -9.395  1.00 68.74  ? 45  PRO C O   1 
ATOM   3167 C  CB  . PRO C 1 45  ? 28.733  1.589   -7.841  1.00 79.88  ? 45  PRO C CB  1 
ATOM   3168 C  CG  . PRO C 1 45  ? 29.747  2.643   -8.129  1.00 79.88  ? 45  PRO C CG  1 
ATOM   3169 C  CD  . PRO C 1 45  ? 29.551  2.863   -9.613  1.00 79.88  ? 45  PRO C CD  1 
ATOM   3170 N  N   . GLY C 1 46  ? 27.999  -1.584  -9.109  1.00 98.21  ? 46  GLY C N   1 
ATOM   3171 C  CA  . GLY C 1 46  ? 26.976  -2.593  -9.341  1.00 98.21  ? 46  GLY C CA  1 
ATOM   3172 C  C   . GLY C 1 46  ? 27.449  -3.455  -10.505 1.00 98.21  ? 46  GLY C C   1 
ATOM   3173 O  O   . GLY C 1 46  ? 28.505  -3.170  -11.082 1.00 98.21  ? 46  GLY C O   1 
ATOM   3174 N  N   . ASN C 1 47  ? 26.666  -4.466  -10.883 1.00 49.93  ? 47  ASN C N   1 
ATOM   3175 C  CA  . ASN C 1 47  ? 27.028  -5.370  -11.989 1.00 49.93  ? 47  ASN C CA  1 
ATOM   3176 C  C   . ASN C 1 47  ? 25.806  -5.874  -12.736 1.00 49.93  ? 47  ASN C C   1 
ATOM   3177 O  O   . ASN C 1 47  ? 25.780  -5.892  -13.963 1.00 49.93  ? 47  ASN C O   1 
ATOM   3178 C  CB  . ASN C 1 47  ? 27.847  -6.570  -11.469 1.00 72.34  ? 47  ASN C CB  1 
ATOM   3179 C  CG  . ASN C 1 47  ? 27.395  -7.061  -10.080 1.00 72.34  ? 47  ASN C CG  1 
ATOM   3180 O  OD1 . ASN C 1 47  ? 26.503  -6.483  -9.444  1.00 72.34  ? 47  ASN C OD1 1 
ATOM   3181 N  ND2 . ASN C 1 47  ? 28.043  -8.116  -9.596  1.00 72.34  ? 47  ASN C ND2 1 
ATOM   3182 N  N   . ASN C 1 48  ? 24.806  -6.304  -11.979 1.00 58.42  ? 48  ASN C N   1 
ATOM   3183 C  CA  . ASN C 1 48  ? 23.557  -6.828  -12.526 1.00 58.42  ? 48  ASN C CA  1 
ATOM   3184 C  C   . ASN C 1 48  ? 22.450  -5.811  -12.346 1.00 58.42  ? 48  ASN C C   1 
ATOM   3185 O  O   . ASN C 1 48  ? 21.307  -6.160  -12.047 1.00 58.42  ? 48  ASN C O   1 
ATOM   3186 C  CB  . ASN C 1 48  ? 23.174  -8.128  -11.798 1.00 98.21  ? 48  ASN C CB  1 
ATOM   3187 C  CG  . ASN C 1 48  ? 24.162  -9.253  -12.038 1.00 98.21  ? 48  ASN C CG  1 
ATOM   3188 O  OD1 . ASN C 1 48  ? 25.115  -9.116  -12.785 1.00 98.21  ? 48  ASN C OD1 1 
ATOM   3189 N  ND2 . ASN C 1 48  ? 23.916  -10.396 -11.386 1.00 98.21  ? 48  ASN C ND2 1 
ATOM   3190 N  N   . ARG C 1 49  ? 22.799  -4.522  -12.455 1.00 25.10  ? 49  ARG C N   1 
ATOM   3191 C  CA  . ARG C 1 49  ? 21.876  -3.388  -12.308 1.00 25.10  ? 49  ARG C CA  1 
ATOM   3192 C  C   . ARG C 1 49  ? 22.514  -2.222  -13.046 1.00 25.10  ? 49  ARG C C   1 
ATOM   3193 O  O   . ARG C 1 49  ? 23.678  -1.880  -12.810 1.00 25.10  ? 49  ARG C O   1 
ATOM   3194 C  CB  . ARG C 1 49  ? 21.678  -3.018  -10.842 1.00 83.27  ? 49  ARG C CB  1 
ATOM   3195 C  CG  . ARG C 1 49  ? 20.686  -1.902  -10.608 1.00 83.27  ? 49  ARG C CG  1 
ATOM   3196 C  CD  . ARG C 1 49  ? 20.670  -1.465  -9.157  1.00 83.27  ? 49  ARG C CD  1 
ATOM   3197 N  NE  . ARG C 1 49  ? 19.865  -2.335  -8.307  1.00 83.27  ? 49  ARG C NE  1 
ATOM   3198 C  CZ  . ARG C 1 49  ? 18.772  -1.939  -7.656  1.00 83.27  ? 49  ARG C CZ  1 
ATOM   3199 N  NH1 . ARG C 1 49  ? 18.344  -0.684  -7.755  1.00 83.27  ? 49  ARG C NH1 1 
ATOM   3200 N  NH2 . ARG C 1 49  ? 18.106  -2.795  -6.895  1.00 83.27  ? 49  ARG C NH2 1 
ATOM   3201 N  N   . LYS C 1 50  ? 21.748  -1.632  -13.955 1.00 43.78  ? 50  LYS C N   1 
ATOM   3202 C  CA  . LYS C 1 50  ? 22.232  -0.551  -14.795 1.00 43.78  ? 50  LYS C CA  1 
ATOM   3203 C  C   . LYS C 1 50  ? 21.201  0.561   -14.964 1.00 43.78  ? 50  LYS C C   1 
ATOM   3204 O  O   . LYS C 1 50  ? 20.062  0.320   -15.305 1.00 43.78  ? 50  LYS C O   1 
ATOM   3205 C  CB  . LYS C 1 50  ? 22.564  -1.130  -16.164 1.00 32.72  ? 50  LYS C CB  1 
ATOM   3206 C  CG  . LYS C 1 50  ? 23.399  -0.245  -17.071 1.00 32.72  ? 50  LYS C CG  1 
ATOM   3207 C  CD  . LYS C 1 50  ? 23.594  -0.894  -18.454 1.00 32.72  ? 50  LYS C CD  1 
ATOM   3208 C  CE  . LYS C 1 50  ? 24.076  -2.346  -18.379 1.00 32.72  ? 50  LYS C CE  1 
ATOM   3209 N  NZ  . LYS C 1 50  ? 25.368  -2.499  -17.675 1.00 32.72  ? 50  LYS C NZ  1 
ATOM   3210 N  N   . VAL C 1 51  ? 21.618  1.798   -14.746 1.00 36.75  ? 51  VAL C N   1 
ATOM   3211 C  CA  . VAL C 1 51  ? 20.716  2.931   -14.886 1.00 36.75  ? 51  VAL C CA  1 
ATOM   3212 C  C   . VAL C 1 51  ? 21.135  3.831   -16.046 1.00 36.75  ? 51  VAL C C   1 
ATOM   3213 O  O   . VAL C 1 51  ? 22.319  4.035   -16.336 1.00 36.75  ? 51  VAL C O   1 
ATOM   3214 C  CB  . VAL C 1 51  ? 20.678  3.761   -13.611 1.00 20.11  ? 51  VAL C CB  1 
ATOM   3215 C  CG1 . VAL C 1 51  ? 19.650  4.863   -13.705 1.00 20.11  ? 51  VAL C CG1 1 
ATOM   3216 C  CG2 . VAL C 1 51  ? 20.393  2.883   -12.403 1.00 20.11  ? 51  VAL C CG2 1 
ATOM   3217 N  N   . TYR C 1 52  ? 20.144  4.316   -16.762 1.00 12.50  ? 52  TYR C N   1 
ATOM   3218 C  CA  . TYR C 1 52  ? 20.375  5.231   -17.885 1.00 12.50  ? 52  TYR C CA  1 
ATOM   3219 C  C   . TYR C 1 52  ? 19.564  6.508   -17.652 1.00 12.50  ? 52  TYR C C   1 
ATOM   3220 O  O   . TYR C 1 52  ? 18.949  6.712   -16.604 1.00 12.50  ? 52  TYR C O   1 
ATOM   3221 C  CB  . TYR C 1 52  ? 19.830  4.618   -19.182 1.00 33.60  ? 52  TYR C CB  1 
ATOM   3222 C  CG  . TYR C 1 52  ? 20.468  3.337   -19.591 1.00 33.60  ? 52  TYR C CG  1 
ATOM   3223 C  CD1 . TYR C 1 52  ? 21.098  3.252   -20.806 1.00 33.60  ? 52  TYR C CD1 1 
ATOM   3224 C  CD2 . TYR C 1 52  ? 20.364  2.184   -18.818 1.00 33.60  ? 52  TYR C CD2 1 
ATOM   3225 C  CE1 . TYR C 1 52  ? 21.620  2.056   -21.261 1.00 33.60  ? 52  TYR C CE1 1 
ATOM   3226 C  CE2 . TYR C 1 52  ? 20.892  0.974   -19.276 1.00 33.60  ? 52  TYR C CE2 1 
ATOM   3227 C  CZ  . TYR C 1 52  ? 21.507  0.930   -20.498 1.00 33.60  ? 52  TYR C CZ  1 
ATOM   3228 O  OH  . TYR C 1 52  ? 22.024  -0.254  -20.915 1.00 33.60  ? 52  TYR C OH  1 
ATOM   3229 N  N   . GLU C 1 53  ? 19.485  7.285   -18.721 1.00 23.20  ? 53  GLU C N   1 
ATOM   3230 C  CA  . GLU C 1 53  ? 18.691  8.503   -18.726 1.00 23.20  ? 53  GLU C CA  1 
ATOM   3231 C  C   . GLU C 1 53  ? 18.214  8.779   -20.130 1.00 23.20  ? 53  GLU C C   1 
ATOM   3232 O  O   . GLU C 1 53  ? 18.987  9.178   -21.021 1.00 23.20  ? 53  GLU C O   1 
ATOM   3233 C  CB  . GLU C 1 53  ? 19.463  9.729   -18.214 1.00 79.33  ? 53  GLU C CB  1 
ATOM   3234 C  CG  . GLU C 1 53  ? 18.546  10.944  -18.166 1.00 79.33  ? 53  GLU C CG  1 
ATOM   3235 C  CD  . GLU C 1 53  ? 19.310  12.255  -18.096 1.00 79.33  ? 53  GLU C CD  1 
ATOM   3236 O  OE1 . GLU C 1 53  ? 20.224  12.452  -18.925 1.00 79.33  ? 53  GLU C OE1 1 
ATOM   3237 O  OE2 . GLU C 1 53  ? 18.957  13.097  -17.237 1.00 79.33  ? 53  GLU C OE2 1 
ATOM   3238 N  N   . LEU C 1 54  ? 16.940  8.516   -20.333 1.00 10.10  ? 54  LEU C N   1 
ATOM   3239 C  CA  . LEU C 1 54  ? 16.270  8.734   -21.620 1.00 10.10  ? 54  LEU C CA  1 
ATOM   3240 C  C   . LEU C 1 54  ? 15.902  10.209  -21.659 1.00 10.10  ? 54  LEU C C   1 
ATOM   3241 O  O   . LEU C 1 54  ? 15.088  10.692  -20.870 1.00 10.10  ? 54  LEU C O   1 
ATOM   3242 C  CB  . LEU C 1 54  ? 15.040  7.849   -21.685 1.00 12.43  ? 54  LEU C CB  1 
ATOM   3243 C  CG  . LEU C 1 54  ? 15.404  6.377   -21.579 1.00 12.43  ? 54  LEU C CG  1 
ATOM   3244 C  CD1 . LEU C 1 54  ? 14.179  5.546   -21.433 1.00 12.43  ? 54  LEU C CD1 1 
ATOM   3245 C  CD2 . LEU C 1 54  ? 16.178  5.992   -22.825 1.00 12.43  ? 54  LEU C CD2 1 
ATOM   3246 N  N   . SER C 1 55  ? 16.505  10.923  -22.592 1.00 52.53  ? 55  SER C N   1 
ATOM   3247 C  CA  . SER C 1 55  ? 16.273  12.347  -22.702 1.00 52.53  ? 55  SER C CA  1 
ATOM   3248 C  C   . SER C 1 55  ? 15.556  12.781  -23.947 1.00 52.53  ? 55  SER C C   1 
ATOM   3249 O  O   . SER C 1 55  ? 15.520  12.062  -24.932 1.00 52.53  ? 55  SER C O   1 
ATOM   3250 C  CB  . SER C 1 55  ? 17.603  13.075  -22.609 1.00 13.77  ? 55  SER C CB  1 
ATOM   3251 O  OG  . SER C 1 55  ? 18.644  12.282  -23.157 1.00 13.77  ? 55  SER C OG  1 
ATOM   3252 N  N   . ASN C 1 56  ? 14.974  13.972  -23.871 1.00 25.38  ? 56  ASN C N   1 
ATOM   3253 C  CA  . ASN C 1 56  ? 14.252  14.592  -24.987 1.00 25.38  ? 56  ASN C CA  1 
ATOM   3254 C  C   . ASN C 1 56  ? 13.157  13.714  -25.636 1.00 25.38  ? 56  ASN C C   1 
ATOM   3255 O  O   . ASN C 1 56  ? 13.031  13.682  -26.868 1.00 25.38  ? 56  ASN C O   1 
ATOM   3256 C  CB  . ASN C 1 56  ? 15.255  15.069  -26.067 1.00 98.65  ? 56  ASN C CB  1 
ATOM   3257 C  CG  . ASN C 1 56  ? 16.263  16.101  -25.543 1.00 98.65  ? 56  ASN C CG  1 
ATOM   3258 O  OD1 . ASN C 1 56  ? 15.887  17.096  -24.919 1.00 98.65  ? 56  ASN C OD1 1 
ATOM   3259 N  ND2 . ASN C 1 56  ? 17.546  15.876  -25.824 1.00 98.65  ? 56  ASN C ND2 1 
ATOM   3260 N  N   . VAL C 1 57  ? 12.363  13.018  -24.817 1.00 25.04  ? 57  VAL C N   1 
ATOM   3261 C  CA  . VAL C 1 57  ? 11.290  12.145  -25.324 1.00 25.04  ? 57  VAL C CA  1 
ATOM   3262 C  C   . VAL C 1 57  ? 10.080  12.964  -25.751 1.00 25.04  ? 57  VAL C C   1 
ATOM   3263 O  O   . VAL C 1 57  ? 9.518   13.689  -24.949 1.00 25.04  ? 57  VAL C O   1 
ATOM   3264 C  CB  . VAL C 1 57  ? 10.892  11.042  -24.262 1.00 13.19  ? 57  VAL C CB  1 
ATOM   3265 C  CG1 . VAL C 1 57  ? 10.625  11.657  -22.945 1.00 13.19  ? 57  VAL C CG1 1 
ATOM   3266 C  CG2 . VAL C 1 57  ? 9.688   10.242  -24.713 1.00 13.19  ? 57  VAL C CG2 1 
ATOM   3267 N  N   . GLN C 1 58  ? 9.698   12.875  -27.018 1.00 23.33  ? 58  GLN C N   1 
ATOM   3268 C  CA  . GLN C 1 58  ? 8.554   13.651  -27.488 1.00 23.33  ? 58  GLN C CA  1 
ATOM   3269 C  C   . GLN C 1 58  ? 7.292   12.812  -27.750 1.00 23.33  ? 58  GLN C C   1 
ATOM   3270 O  O   . GLN C 1 58  ? 6.168   13.286  -27.530 1.00 23.33  ? 58  GLN C O   1 
ATOM   3271 C  CB  . GLN C 1 58  ? 8.925   14.499  -28.719 1.00 42.06  ? 58  GLN C CB  1 
ATOM   3272 C  CG  . GLN C 1 58  ? 10.315  15.172  -28.653 1.00 42.06  ? 58  GLN C CG  1 
ATOM   3273 C  CD  . GLN C 1 58  ? 10.294  16.698  -28.536 1.00 42.06  ? 58  GLN C CD  1 
ATOM   3274 O  OE1 . GLN C 1 58  ? 9.237   17.336  -28.538 1.00 42.06  ? 58  GLN C OE1 1 
ATOM   3275 N  NE2 . GLN C 1 58  ? 11.483  17.287  -28.433 1.00 42.06  ? 58  GLN C NE2 1 
ATOM   3276 N  N   . GLU C 1 59  ? 7.470   11.578  -28.224 1.00 26.55  ? 59  GLU C N   1 
ATOM   3277 C  CA  . GLU C 1 59  ? 6.336   10.686  -28.480 1.00 26.55  ? 59  GLU C CA  1 
ATOM   3278 C  C   . GLU C 1 59  ? 6.232   9.629   -27.374 1.00 26.55  ? 59  GLU C C   1 
ATOM   3279 O  O   . GLU C 1 59  ? 7.211   9.364   -26.674 1.00 26.55  ? 59  GLU C O   1 
ATOM   3280 C  CB  . GLU C 1 59  ? 6.474   10.011  -29.854 1.00 78.60  ? 59  GLU C CB  1 
ATOM   3281 C  CG  . GLU C 1 59  ? 6.395   10.973  -31.050 1.00 78.60  ? 59  GLU C CG  1 
ATOM   3282 C  CD  . GLU C 1 59  ? 5.868   10.308  -32.317 1.00 78.60  ? 59  GLU C CD  1 
ATOM   3283 O  OE1 . GLU C 1 59  ? 6.525   9.366   -32.821 1.00 78.60  ? 59  GLU C OE1 1 
ATOM   3284 O  OE2 . GLU C 1 59  ? 4.793   10.730  -32.806 1.00 78.60  ? 59  GLU C OE2 1 
ATOM   3285 N  N   . ASP C 1 60  ? 5.046   9.060   -27.171 1.00 13.81  ? 60  ASP C N   1 
ATOM   3286 C  CA  . ASP C 1 60  ? 4.886   8.035   -26.136 1.00 13.81  ? 60  ASP C CA  1 
ATOM   3287 C  C   . ASP C 1 60  ? 5.807   6.851   -26.449 1.00 13.81  ? 60  ASP C C   1 
ATOM   3288 O  O   . ASP C 1 60  ? 5.435   5.932   -27.199 1.00 13.81  ? 60  ASP C O   1 
ATOM   3289 C  CB  . ASP C 1 60  ? 3.436   7.549   -26.067 1.00 75.07  ? 60  ASP C CB  1 
ATOM   3290 C  CG  . ASP C 1 60  ? 2.494   8.574   -25.456 1.00 75.07  ? 60  ASP C CG  1 
ATOM   3291 O  OD1 . ASP C 1 60  ? 2.919   9.710   -25.188 1.00 75.07  ? 60  ASP C OD1 1 
ATOM   3292 O  OD2 . ASP C 1 60  ? 1.313   8.237   -25.235 1.00 75.07  ? 60  ASP C OD2 1 
ATOM   3293 N  N   . SER C 1 61  ? 7.032   6.896   -25.931 1.00 23.16  ? 61  SER C N   1 
ATOM   3294 C  CA  . SER C 1 61  ? 7.988   5.822   -26.178 1.00 23.16  ? 61  SER C CA  1 
ATOM   3295 C  C   . SER C 1 61  ? 7.811   4.662   -25.184 1.00 23.16  ? 61  SER C C   1 
ATOM   3296 O  O   . SER C 1 61  ? 7.059   4.771   -24.212 1.00 23.16  ? 61  SER C O   1 
ATOM   3297 C  CB  . SER C 1 61  ? 9.416   6.362   -26.140 1.00 59.98  ? 61  SER C CB  1 
ATOM   3298 O  OG  . SER C 1 61  ? 10.289  5.465   -26.796 1.00 59.98  ? 61  SER C OG  1 
ATOM   3299 N  N   . GLN C 1 62  ? 8.486   3.547   -25.458 1.00 52.17  ? 62  GLN C N   1 
ATOM   3300 C  CA  . GLN C 1 62  ? 8.399   2.346   -24.624 1.00 52.17  ? 62  GLN C CA  1 
ATOM   3301 C  C   . GLN C 1 62  ? 9.706   1.541   -24.637 1.00 52.17  ? 62  GLN C C   1 
ATOM   3302 O  O   . GLN C 1 62  ? 9.834   0.542   -25.340 1.00 52.17  ? 62  GLN C O   1 
ATOM   3303 C  CB  . GLN C 1 62  ? 7.206   1.484   -25.076 1.00 93.52  ? 62  GLN C CB  1 
ATOM   3304 C  CG  . GLN C 1 62  ? 7.125   1.281   -26.586 1.00 93.52  ? 62  GLN C CG  1 
ATOM   3305 C  CD  . GLN C 1 62  ? 5.702   1.242   -27.105 1.00 93.52  ? 62  GLN C CD  1 
ATOM   3306 O  OE1 . GLN C 1 62  ? 5.026   0.208   -27.037 1.00 93.52  ? 62  GLN C OE1 1 
ATOM   3307 N  NE2 . GLN C 1 62  ? 5.232   2.374   -27.617 1.00 93.52  ? 62  GLN C NE2 1 
ATOM   3308 N  N   . PRO C 1 63  ? 10.689  1.973   -23.828 1.00 24.71  ? 63  PRO C N   1 
ATOM   3309 C  CA  . PRO C 1 63  ? 12.014  1.363   -23.680 1.00 24.71  ? 63  PRO C CA  1 
ATOM   3310 C  C   . PRO C 1 63  ? 11.935  -0.114  -23.362 1.00 24.71  ? 63  PRO C C   1 
ATOM   3311 O  O   . PRO C 1 63  ? 11.004  -0.577  -22.716 1.00 24.71  ? 63  PRO C O   1 
ATOM   3312 C  CB  . PRO C 1 63  ? 12.614  2.139   -22.509 1.00 55.42  ? 63  PRO C CB  1 
ATOM   3313 C  CG  . PRO C 1 63  ? 12.000  3.475   -22.649 1.00 55.42  ? 63  PRO C CG  1 
ATOM   3314 C  CD  . PRO C 1 63  ? 10.563  3.144   -22.941 1.00 55.42  ? 63  PRO C CD  1 
ATOM   3315 N  N   . MET C 1 64  ? 12.973  -0.836  -23.741 1.00 21.56  ? 64  MET C N   1 
ATOM   3316 C  CA  . MET C 1 64  ? 12.995  -2.262  -23.518 1.00 21.56  ? 64  MET C CA  1 
ATOM   3317 C  C   . MET C 1 64  ? 14.334  -2.761  -22.973 1.00 21.56  ? 64  MET C C   1 
ATOM   3318 O  O   . MET C 1 64  ? 15.336  -2.802  -23.696 1.00 21.56  ? 64  MET C O   1 
ATOM   3319 C  CB  . MET C 1 64  ? 12.668  -2.935  -24.840 1.00 48.43  ? 64  MET C CB  1 
ATOM   3320 C  CG  . MET C 1 64  ? 11.905  -4.210  -24.729 1.00 48.43  ? 64  MET C CG  1 
ATOM   3321 S  SD  . MET C 1 64  ? 11.195  -4.536  -26.312 1.00 48.43  ? 64  MET C SD  1 
ATOM   3322 C  CE  . MET C 1 64  ? 12.632  -4.690  -27.272 1.00 48.43  ? 64  MET C CE  1 
ATOM   3323 N  N   . CYS C 1 65  ? 14.351  -3.112  -21.687 1.00 8.14   ? 65  CYS C N   1 
ATOM   3324 C  CA  . CYS C 1 65  ? 15.560  -3.622  -21.051 1.00 8.14   ? 65  CYS C CA  1 
ATOM   3325 C  C   . CYS C 1 65  ? 15.714  -5.092  -21.384 1.00 8.14   ? 65  CYS C C   1 
ATOM   3326 O  O   . CYS C 1 65  ? 14.769  -5.882  -21.217 1.00 8.14   ? 65  CYS C O   1 
ATOM   3327 C  CB  . CYS C 1 65  ? 15.481  -3.465  -19.532 1.00 65.68  ? 65  CYS C CB  1 
ATOM   3328 S  SG  . CYS C 1 65  ? 15.709  -1.781  -18.882 1.00 65.68  ? 65  CYS C SG  1 
ATOM   3329 N  N   . TYR C 1 66  ? 16.898  -5.459  -21.872 1.00 38.32  ? 66  TYR C N   1 
ATOM   3330 C  CA  . TYR C 1 66  ? 17.186  -6.855  -22.231 1.00 38.32  ? 66  TYR C CA  1 
ATOM   3331 C  C   . TYR C 1 66  ? 18.301  -7.414  -21.349 1.00 38.32  ? 66  TYR C C   1 
ATOM   3332 O  O   . TYR C 1 66  ? 18.855  -6.700  -20.526 1.00 38.32  ? 66  TYR C O   1 
ATOM   3333 C  CB  . TYR C 1 66  ? 17.597  -6.977  -23.707 1.00 48.61  ? 66  TYR C CB  1 
ATOM   3334 C  CG  . TYR C 1 66  ? 18.899  -6.305  -24.099 1.00 48.61  ? 66  TYR C CG  1 
ATOM   3335 C  CD1 . TYR C 1 66  ? 20.103  -6.683  -23.532 1.00 48.61  ? 66  TYR C CD1 1 
ATOM   3336 C  CD2 . TYR C 1 66  ? 18.915  -5.271  -25.014 1.00 48.61  ? 66  TYR C CD2 1 
ATOM   3337 C  CE1 . TYR C 1 66  ? 21.286  -6.043  -23.847 1.00 48.61  ? 66  TYR C CE1 1 
ATOM   3338 C  CE2 . TYR C 1 66  ? 20.097  -4.619  -25.342 1.00 48.61  ? 66  TYR C CE2 1 
ATOM   3339 C  CZ  . TYR C 1 66  ? 21.281  -5.008  -24.749 1.00 48.61  ? 66  TYR C CZ  1 
ATOM   3340 O  OH  . TYR C 1 66  ? 22.451  -4.326  -25.013 1.00 48.61  ? 66  TYR C OH  1 
ATOM   3341 N  N   . SER C 1 67  ? 18.677  -8.659  -21.597 1.00 48.21  ? 67  SER C N   1 
ATOM   3342 C  CA  . SER C 1 67  ? 19.733  -9.297  -20.865 1.00 48.21  ? 67  SER C CA  1 
ATOM   3343 C  C   . SER C 1 67  ? 20.046  -10.671 -21.429 1.00 48.21  ? 67  SER C C   1 
ATOM   3344 O  O   . SER C 1 67  ? 19.157  -11.515 -21.581 1.00 48.21  ? 67  SER C O   1 
ATOM   3345 C  CB  . SER C 1 67  ? 19.392  -9.419  -19.376 1.00 48.65  ? 67  SER C CB  1 
ATOM   3346 O  OG  . SER C 1 67  ? 18.372  -10.381 -19.110 1.00 48.65  ? 67  SER C OG  1 
ATOM   3347 N  N   . ASN C 1 68  ? 21.293  -10.873 -21.810 1.00 19.11  ? 68  ASN C N   1 
ATOM   3348 C  CA  . ASN C 1 68  ? 21.689  -12.161 -22.307 1.00 19.11  ? 68  ASN C CA  1 
ATOM   3349 C  C   . ASN C 1 68  ? 22.250  -12.881 -21.104 1.00 19.11  ? 68  ASN C C   1 
ATOM   3350 O  O   . ASN C 1 68  ? 23.366  -12.612 -20.648 1.00 19.11  ? 68  ASN C O   1 
ATOM   3351 C  CB  . ASN C 1 68  ? 22.749  -12.029 -23.370 1.00 31.63  ? 68  ASN C CB  1 
ATOM   3352 C  CG  . ASN C 1 68  ? 22.342  -11.106 -24.481 1.00 31.63  ? 68  ASN C CG  1 
ATOM   3353 O  OD1 . ASN C 1 68  ? 21.167  -10.982 -24.802 1.00 31.63  ? 68  ASN C OD1 1 
ATOM   3354 N  ND2 . ASN C 1 68  ? 23.316  -10.425 -25.064 1.00 31.63  ? 68  ASN C ND2 1 
ATOM   3355 N  N   . CYS C 1 69  ? 21.398  -13.693 -20.498 1.00 40.71  ? 69  CYS C N   1 
ATOM   3356 C  CA  . CYS C 1 69  ? 21.797  -14.499 -19.362 1.00 40.71  ? 69  CYS C CA  1 
ATOM   3357 C  C   . CYS C 1 69  ? 22.157  -15.879 -19.914 1.00 40.71  ? 69  CYS C C   1 
ATOM   3358 O  O   . CYS C 1 69  ? 21.752  -16.237 -21.026 1.00 40.71  ? 69  CYS C O   1 
ATOM   3359 C  CB  . CYS C 1 69  ? 20.647  -14.612 -18.357 1.00 98.65  ? 69  CYS C CB  1 
ATOM   3360 S  SG  . CYS C 1 69  ? 20.498  -13.208 -17.205 1.00 98.65  ? 69  CYS C SG  1 
ATOM   3361 N  N   . PRO C 1 70  ? 22.965  -16.649 -19.174 1.00 76.48  ? 70  PRO C N   1 
ATOM   3362 C  CA  . PRO C 1 70  ? 23.344  -17.981 -19.635 1.00 76.48  ? 70  PRO C CA  1 
ATOM   3363 C  C   . PRO C 1 70  ? 22.072  -18.756 -19.982 1.00 76.48  ? 70  PRO C C   1 
ATOM   3364 O  O   . PRO C 1 70  ? 21.946  -19.322 -21.073 1.00 76.48  ? 70  PRO C O   1 
ATOM   3365 C  CB  . PRO C 1 70  ? 24.041  -18.563 -18.409 1.00 33.71  ? 70  PRO C CB  1 
ATOM   3366 C  CG  . PRO C 1 70  ? 23.407  -17.787 -17.249 1.00 33.71  ? 70  PRO C CG  1 
ATOM   3367 C  CD  . PRO C 1 70  ? 23.442  -16.418 -17.804 1.00 33.71  ? 70  PRO C CD  1 
ATOM   3368 N  N   . ASP C 1 71  ? 21.103  -18.693 -19.071 1.00 64.50  ? 71  ASP C N   1 
ATOM   3369 C  CA  . ASP C 1 71  ? 19.818  -19.354 -19.241 1.00 64.50  ? 71  ASP C CA  1 
ATOM   3370 C  C   . ASP C 1 71  ? 19.210  -18.888 -20.552 1.00 64.50  ? 71  ASP C C   1 
ATOM   3371 O  O   . ASP C 1 71  ? 18.675  -19.681 -21.318 1.00 64.50  ? 71  ASP C O   1 
ATOM   3372 C  CB  . ASP C 1 71  ? 18.897  -18.994 -18.076 1.00 98.57  ? 71  ASP C CB  1 
ATOM   3373 C  CG  . ASP C 1 71  ? 17.574  -19.721 -18.134 1.00 98.57  ? 71  ASP C CG  1 
ATOM   3374 O  OD1 . ASP C 1 71  ? 16.533  -19.033 -18.143 1.00 98.57  ? 71  ASP C OD1 1 
ATOM   3375 O  OD2 . ASP C 1 71  ? 17.575  -20.974 -18.169 1.00 98.57  ? 71  ASP C OD2 1 
ATOM   3376 N  N   . GLY C 1 72  ? 19.322  -17.590 -20.805 1.00 69.94  ? 72  GLY C N   1 
ATOM   3377 C  CA  . GLY C 1 72  ? 18.803  -17.023 -22.033 1.00 69.94  ? 72  GLY C CA  1 
ATOM   3378 C  C   . GLY C 1 72  ? 18.631  -15.518 -21.981 1.00 69.94  ? 72  GLY C C   1 
ATOM   3379 O  O   . GLY C 1 72  ? 18.899  -14.885 -20.956 1.00 69.94  ? 72  GLY C O   1 
ATOM   3380 N  N   . GLN C 1 73  ? 18.214  -14.943 -23.106 1.00 29.52  ? 73  GLN C N   1 
ATOM   3381 C  CA  . GLN C 1 73  ? 17.977  -13.512 -23.193 1.00 29.52  ? 73  GLN C CA  1 
ATOM   3382 C  C   . GLN C 1 73  ? 16.517  -13.274 -22.857 1.00 29.52  ? 73  GLN C C   1 
ATOM   3383 O  O   . GLN C 1 73  ? 15.634  -13.915 -23.425 1.00 29.52  ? 73  GLN C O   1 
ATOM   3384 C  CB  . GLN C 1 73  ? 18.276  -13.002 -24.607 1.00 36.66  ? 73  GLN C CB  1 
ATOM   3385 C  CG  . GLN C 1 73  ? 18.173  -11.490 -24.787 1.00 36.66  ? 73  GLN C CG  1 
ATOM   3386 C  CD  . GLN C 1 73  ? 18.152  -11.070 -26.247 1.00 36.66  ? 73  GLN C CD  1 
ATOM   3387 O  OE1 . GLN C 1 73  ? 17.110  -11.097 -26.884 1.00 36.66  ? 73  GLN C OE1 1 
ATOM   3388 N  NE2 . GLN C 1 73  ? 19.299  -10.667 -26.774 1.00 36.66  ? 73  GLN C NE2 1 
ATOM   3389 N  N   . SER C 1 74  ? 16.276  -12.398 -21.891 1.00 12.83  ? 74  SER C N   1 
ATOM   3390 C  CA  . SER C 1 74  ? 14.916  -12.052 -21.487 1.00 12.83  ? 74  SER C CA  1 
ATOM   3391 C  C   . SER C 1 74  ? 14.653  -10.541 -21.668 1.00 12.83  ? 74  SER C C   1 
ATOM   3392 O  O   . SER C 1 74  ? 15.567  -9.752  -21.957 1.00 12.83  ? 74  SER C O   1 
ATOM   3393 C  CB  . SER C 1 74  ? 14.681  -12.449 -20.040 1.00 39.70  ? 74  SER C CB  1 
ATOM   3394 O  OG  . SER C 1 74  ? 15.486  -13.552 -19.693 1.00 39.70  ? 74  SER C OG  1 
ATOM   3395 N  N   . THR C 1 75  ? 13.408  -10.125 -21.460 1.00 42.50  ? 75  THR C N   1 
ATOM   3396 C  CA  . THR C 1 75  ? 13.075  -8.721  -21.636 1.00 42.50  ? 75  THR C CA  1 
ATOM   3397 C  C   . THR C 1 75  ? 12.075  -8.137  -20.641 1.00 42.50  ? 75  THR C C   1 
ATOM   3398 O  O   . THR C 1 75  ? 11.093  -8.788  -20.260 1.00 42.50  ? 75  THR C O   1 
ATOM   3399 C  CB  . THR C 1 75  ? 12.609  -8.475  -23.078 1.00 27.18  ? 75  THR C CB  1 
ATOM   3400 O  OG1 . THR C 1 75  ? 13.718  -8.663  -23.960 1.00 27.18  ? 75  THR C OG1 1 
ATOM   3401 C  CG2 . THR C 1 75  ? 12.086  -7.082  -23.256 1.00 27.18  ? 75  THR C CG2 1 
ATOM   3402 N  N   . ALA C 1 76  ? 12.374  -6.902  -20.222 1.00 39.52  ? 76  ALA C N   1 
ATOM   3403 C  CA  . ALA C 1 76  ? 11.570  -6.117  -19.286 1.00 39.52  ? 76  ALA C CA  1 
ATOM   3404 C  C   . ALA C 1 76  ? 11.220  -4.817  -19.983 1.00 39.52  ? 76  ALA C C   1 
ATOM   3405 O  O   . ALA C 1 76  ? 12.102  -4.059  -20.374 1.00 39.52  ? 76  ALA C O   1 
ATOM   3406 C  CB  . ALA C 1 76  ? 12.354  -5.839  -18.040 1.00 98.65  ? 76  ALA C CB  1 
ATOM   3407 N  N   . LYS C 1 77  ? 9.921   -4.568  -20.123 1.00 40.09  ? 77  LYS C N   1 
ATOM   3408 C  CA  . LYS C 1 77  ? 9.419   -3.386  -20.817 1.00 40.09  ? 77  LYS C CA  1 
ATOM   3409 C  C   . LYS C 1 77  ? 8.770   -2.335  -19.933 1.00 40.09  ? 77  LYS C C   1 
ATOM   3410 O  O   . LYS C 1 77  ? 7.962   -2.635  -19.055 1.00 40.09  ? 77  LYS C O   1 
ATOM   3411 C  CB  . LYS C 1 77  ? 8.440   -3.817  -21.920 1.00 71.24  ? 77  LYS C CB  1 
ATOM   3412 C  CG  . LYS C 1 77  ? 8.006   -2.721  -22.895 1.00 71.24  ? 77  LYS C CG  1 
ATOM   3413 C  CD  . LYS C 1 77  ? 7.053   -3.264  -23.961 1.00 71.24  ? 77  LYS C CD  1 
ATOM   3414 C  CE  . LYS C 1 77  ? 6.550   -2.147  -24.860 1.00 71.24  ? 77  LYS C CE  1 
ATOM   3415 N  NZ  . LYS C 1 77  ? 5.373   -2.550  -25.674 1.00 71.24  ? 77  LYS C NZ  1 
ATOM   3416 N  N   . THR C 1 78  ? 9.174   -1.096  -20.169 1.00 64.02  ? 78  THR C N   1 
ATOM   3417 C  CA  . THR C 1 78  ? 8.650   0.042   -19.449 1.00 64.02  ? 78  THR C CA  1 
ATOM   3418 C  C   . THR C 1 78  ? 7.820   0.830   -20.458 1.00 64.02  ? 78  THR C C   1 
ATOM   3419 O  O   . THR C 1 78  ? 7.897   0.581   -21.659 1.00 64.02  ? 78  THR C O   1 
ATOM   3420 C  CB  . THR C 1 78  ? 9.792   0.897   -18.844 1.00 22.94  ? 78  THR C CB  1 
ATOM   3421 O  OG1 . THR C 1 78  ? 9.258   2.074   -18.231 1.00 22.94  ? 78  THR C OG1 1 
ATOM   3422 C  CG2 . THR C 1 78  ? 10.768  1.305   -19.895 1.00 22.94  ? 78  THR C CG2 1 
ATOM   3423 N  N   . PHE C 1 79  ? 6.999   1.749   -19.962 1.00 16.49  ? 79  PHE C N   1 
ATOM   3424 C  CA  . PHE C 1 79  ? 6.124   2.562   -20.805 1.00 16.49  ? 79  PHE C CA  1 
ATOM   3425 C  C   . PHE C 1 79  ? 6.218   4.071   -20.538 1.00 16.49  ? 79  PHE C C   1 
ATOM   3426 O  O   . PHE C 1 79  ? 5.816   4.543   -19.475 1.00 16.49  ? 79  PHE C O   1 
ATOM   3427 C  CB  . PHE C 1 79  ? 4.690   2.110   -20.594 1.00 16.51  ? 79  PHE C CB  1 
ATOM   3428 C  CG  . PHE C 1 79  ? 4.444   0.718   -21.032 1.00 16.51  ? 79  PHE C CG  1 
ATOM   3429 C  CD1 . PHE C 1 79  ? 4.419   0.401   -22.383 1.00 16.51  ? 79  PHE C CD1 1 
ATOM   3430 C  CD2 . PHE C 1 79  ? 4.193   -0.274  -20.107 1.00 16.51  ? 79  PHE C CD2 1 
ATOM   3431 C  CE1 . PHE C 1 79  ? 4.147   -0.895  -22.805 1.00 16.51  ? 79  PHE C CE1 1 
ATOM   3432 C  CE2 . PHE C 1 79  ? 3.920   -1.569  -20.528 1.00 16.51  ? 79  PHE C CE2 1 
ATOM   3433 C  CZ  . PHE C 1 79  ? 3.893   -1.877  -21.880 1.00 16.51  ? 79  PHE C CZ  1 
ATOM   3434 N  N   . LEU C 1 80  ? 6.726   4.829   -21.505 1.00 42.34  ? 80  LEU C N   1 
ATOM   3435 C  CA  . LEU C 1 80  ? 6.841   6.267   -21.327 1.00 42.34  ? 80  LEU C CA  1 
ATOM   3436 C  C   . LEU C 1 80  ? 5.673   6.962   -21.995 1.00 42.34  ? 80  LEU C C   1 
ATOM   3437 O  O   . LEU C 1 80  ? 5.393   6.726   -23.169 1.00 42.34  ? 80  LEU C O   1 
ATOM   3438 C  CB  . LEU C 1 80  ? 8.164   6.785   -21.879 1.00 6.74   ? 80  LEU C CB  1 
ATOM   3439 C  CG  . LEU C 1 80  ? 9.459   6.153   -21.370 1.00 6.74   ? 80  LEU C CG  1 
ATOM   3440 C  CD1 . LEU C 1 80  ? 10.510  7.213   -21.359 1.00 6.74   ? 80  LEU C CD1 1 
ATOM   3441 C  CD2 . LEU C 1 80  ? 9.310   5.611   -19.971 1.00 6.74   ? 80  LEU C CD2 1 
ATOM   3442 N  N   . THR C 1 81  ? 4.963   7.770   -21.209 1.00 44.70  ? 81  THR C N   1 
ATOM   3443 C  CA  . THR C 1 81  ? 3.798   8.516   -21.672 1.00 44.70  ? 81  THR C CA  1 
ATOM   3444 C  C   . THR C 1 81  ? 4.102   9.997   -21.676 1.00 44.70  ? 81  THR C C   1 
ATOM   3445 O  O   . THR C 1 81  ? 4.521   10.551  -20.662 1.00 44.70  ? 81  THR C O   1 
ATOM   3446 C  CB  . THR C 1 81  ? 2.585   8.341   -20.738 1.00 59.73  ? 81  THR C CB  1 
ATOM   3447 O  OG1 . THR C 1 81  ? 2.265   6.953   -20.591 1.00 59.73  ? 81  THR C OG1 1 
ATOM   3448 C  CG2 . THR C 1 81  ? 1.383   9.077   -21.301 1.00 59.73  ? 81  THR C CG2 1 
ATOM   3449 N  N   . VAL C 1 82  ? 3.863   10.646  -22.811 1.00 33.78  ? 82  VAL C N   1 
ATOM   3450 C  CA  . VAL C 1 82  ? 4.104   12.076  -22.920 1.00 33.78  ? 82  VAL C CA  1 
ATOM   3451 C  C   . VAL C 1 82  ? 2.762   12.806  -22.913 1.00 33.78  ? 82  VAL C C   1 
ATOM   3452 O  O   . VAL C 1 82  ? 1.802   12.359  -23.566 1.00 33.78  ? 82  VAL C O   1 
ATOM   3453 C  CB  . VAL C 1 82  ? 4.901   12.451  -24.189 1.00 14.82  ? 82  VAL C CB  1 
ATOM   3454 C  CG1 . VAL C 1 82  ? 5.360   13.849  -24.093 1.00 14.82  ? 82  VAL C CG1 1 
ATOM   3455 C  CG2 . VAL C 1 82  ? 6.096   11.577  -24.346 1.00 14.82  ? 82  VAL C CG2 1 
ATOM   3456 N  N   . TYR C 1 83  ? 2.693   13.894  -22.132 1.00 45.16  ? 83  TYR C N   1 
ATOM   3457 C  CA  . TYR C 1 83  ? 1.487   14.726  -21.995 1.00 45.16  ? 83  TYR C CA  1 
ATOM   3458 C  C   . TYR C 1 83  ? 1.828   16.186  -22.269 1.00 45.16  ? 83  TYR C C   1 
ATOM   3459 O  O   . TYR C 1 83  ? 2.874   16.655  -21.838 1.00 45.16  ? 83  TYR C O   1 
ATOM   3460 C  CB  . TYR C 1 83  ? 0.909   14.596  -20.587 1.00 18.55  ? 83  TYR C CB  1 
ATOM   3461 C  CG  . TYR C 1 83  ? 1.566   15.485  -19.583 1.00 18.55  ? 83  TYR C CG  1 
ATOM   3462 C  CD1 . TYR C 1 83  ? 1.067   16.751  -19.333 1.00 18.55  ? 83  TYR C CD1 1 
ATOM   3463 C  CD2 . TYR C 1 83  ? 2.683   15.075  -18.884 1.00 18.55  ? 83  TYR C CD2 1 
ATOM   3464 C  CE1 . TYR C 1 83  ? 1.674   17.598  -18.426 1.00 18.55  ? 83  TYR C CE1 1 
ATOM   3465 C  CE2 . TYR C 1 83  ? 3.299   15.915  -17.970 1.00 18.55  ? 83  TYR C CE2 1 
ATOM   3466 C  CZ  . TYR C 1 83  ? 2.778   17.169  -17.744 1.00 18.55  ? 83  TYR C CZ  1 
ATOM   3467 O  OH  . TYR C 1 83  ? 3.359   18.013  -16.842 1.00 18.55  ? 83  TYR C OH  1 
ATOM   3468 N  N   . TRP C 1 84  ? 0.928   16.905  -22.933 1.00 37.01  ? 84  TRP C N   1 
ATOM   3469 C  CA  . TRP C 1 84  ? 1.158   18.309  -23.268 1.00 37.01  ? 84  TRP C CA  1 
ATOM   3470 C  C   . TRP C 1 84  ? -0.089  19.172  -23.550 1.00 37.01  ? 84  TRP C C   1 
ATOM   3471 O  O   . TRP C 1 84  ? -1.099  18.638  -24.042 1.00 37.01  ? 84  TRP C O   1 
ATOM   3472 C  CB  . TRP C 1 84  ? 2.154   18.432  -24.429 1.00 56.28  ? 84  TRP C CB  1 
ATOM   3473 C  CG  . TRP C 1 84  ? 1.834   17.555  -25.627 1.00 56.28  ? 84  TRP C CG  1 
ATOM   3474 C  CD1 . TRP C 1 84  ? 1.883   16.194  -25.681 1.00 56.28  ? 84  TRP C CD1 1 
ATOM   3475 C  CD2 . TRP C 1 84  ? 1.395   17.992  -26.917 1.00 56.28  ? 84  TRP C CD2 1 
ATOM   3476 N  NE1 . TRP C 1 84  ? 1.491   15.751  -26.921 1.00 56.28  ? 84  TRP C NE1 1 
ATOM   3477 C  CE2 . TRP C 1 84  ? 1.182   16.832  -27.700 1.00 56.28  ? 84  TRP C CE2 1 
ATOM   3478 C  CE3 . TRP C 1 84  ? 1.148   19.244  -27.494 1.00 56.28  ? 84  TRP C CE3 1 
ATOM   3479 C  CZ2 . TRP C 1 84  ? 0.740   16.893  -29.019 1.00 56.28  ? 84  TRP C CZ2 1 
ATOM   3480 C  CZ3 . TRP C 1 84  ? 0.710   19.305  -28.803 1.00 56.28  ? 84  TRP C CZ3 1 
ATOM   3481 C  CH2 . TRP C 1 84  ? 0.505   18.133  -29.550 1.00 56.28  ? 84  TRP C CH2 1 
ATOM   3482 N  N   . THR C 1 85  ? -0.039  20.439  -23.209 1.00 20.62  ? 85  THR C N   1 
ATOM   3483 C  CA  . THR C 1 85  ? -1.144  21.371  -23.438 1.00 20.62  ? 85  THR C CA  1 
ATOM   3484 C  C   . THR C 1 85  ? -1.142  21.891  -24.876 1.00 20.62  ? 85  THR C C   1 
ATOM   3485 O  O   . THR C 1 85  ? -0.124  22.354  -25.395 1.00 20.62  ? 85  THR C O   1 
ATOM   3486 C  CB  . THR C 1 85  ? -1.077  22.608  -22.499 1.00 65.31  ? 85  THR C CB  1 
ATOM   3487 O  OG1 . THR C 1 85  ? 0.030   23.427  -22.900 1.00 65.31  ? 85  THR C OG1 1 
ATOM   3488 C  CG2 . THR C 1 85  ? -0.935  22.169  -21.074 1.00 65.31  ? 85  THR C CG2 1 
ATOM   3489 N  N   . PRO C 1 86  ? -2.312  21.741  -25.597 1.00 13.17  ? 86  PRO C N   1 
ATOM   3490 C  CA  . PRO C 1 86  ? -2.472  22.161  -27.018 1.00 13.17  ? 86  PRO C CA  1 
ATOM   3491 C  C   . PRO C 1 86  ? -1.859  23.508  -27.509 1.00 13.17  ? 86  PRO C C   1 
ATOM   3492 O  O   . PRO C 1 86  ? -1.491  24.427  -26.689 1.00 13.17  ? 86  PRO C O   1 
ATOM   3493 C  CB  . PRO C 1 86  ? -3.994  22.033  -27.271 1.00 15.46  ? 86  PRO C CB  1 
ATOM   3494 C  CG  . PRO C 1 86  ? -4.607  22.061  -25.937 1.00 15.46  ? 86  PRO C CG  1 
ATOM   3495 C  CD  . PRO C 1 86  ? -3.642  21.292  -25.070 1.00 15.46  ? 86  PRO C CD  1 
ATOM   3496 N  N   . GLU C 1 87  ? -1.680  23.591  -28.801 1.00 39.42  ? 87  GLU C N   1 
ATOM   3497 C  CA  . GLU C 1 87  ? -1.154  24.754  -29.522 1.00 39.42  ? 87  GLU C CA  1 
ATOM   3498 C  C   . GLU C 1 87  ? -2.165  25.873  -29.385 1.00 39.42  ? 87  GLU C C   1 
ATOM   3499 O  O   . GLU C 1 87  ? -1.850  26.905  -28.824 1.00 39.42  ? 87  GLU C O   1 
ATOM   3500 C  CB  . GLU C 1 87  ? -0.880  24.463  -30.981 1.00 98.65  ? 87  GLU C CB  1 
ATOM   3501 C  CG  . GLU C 1 87  ? 0.351   23.587  -31.237 1.00 98.65  ? 87  GLU C CG  1 
ATOM   3502 C  CD  . GLU C 1 87  ? 0.599   23.324  -32.720 1.00 98.65  ? 87  GLU C CD  1 
ATOM   3503 O  OE1 . GLU C 1 87  ? 0.671   24.302  -33.507 1.00 98.65  ? 87  GLU C OE1 1 
ATOM   3504 O  OE2 . GLU C 1 87  ? 0.728   22.130  -33.086 1.00 98.65  ? 87  GLU C OE2 1 
ATOM   3505 N  N   . ARG C 1 88  ? -3.360  25.681  -29.926 1.00 63.27  ? 88  ARG C N   1 
ATOM   3506 C  CA  . ARG C 1 88  ? -4.385  26.690  -29.782 1.00 63.27  ? 88  ARG C CA  1 
ATOM   3507 C  C   . ARG C 1 88  ? -5.747  26.062  -29.580 1.00 63.27  ? 88  ARG C C   1 
ATOM   3508 O  O   . ARG C 1 88  ? -6.101  25.071  -30.230 1.00 63.27  ? 88  ARG C O   1 
ATOM   3509 C  CB  . ARG C 1 88  ? -4.394  27.690  -30.942 1.00 98.65  ? 88  ARG C CB  1 
ATOM   3510 C  CG  . ARG C 1 88  ? -4.720  27.109  -32.288 1.00 98.65  ? 88  ARG C CG  1 
ATOM   3511 C  CD  . ARG C 1 88  ? -4.929  28.213  -33.307 1.00 98.65  ? 88  ARG C CD  1 
ATOM   3512 N  NE  . ARG C 1 88  ? -6.273  28.787  -33.250 1.00 98.65  ? 88  ARG C NE  1 
ATOM   3513 C  CZ  . ARG C 1 88  ? -7.353  28.217  -33.780 1.00 98.65  ? 88  ARG C CZ  1 
ATOM   3514 N  NH1 . ARG C 1 88  ? -7.259  27.046  -34.406 1.00 98.65  ? 88  ARG C NH1 1 
ATOM   3515 N  NH2 . ARG C 1 88  ? -8.524  28.836  -33.718 1.00 98.65  ? 88  ARG C NH2 1 
ATOM   3516 N  N   . VAL C 1 89  ? -6.485  26.632  -28.633 1.00 57.22  ? 89  VAL C N   1 
ATOM   3517 C  CA  . VAL C 1 89  ? -7.816  26.179  -28.267 1.00 57.22  ? 89  VAL C CA  1 
ATOM   3518 C  C   . VAL C 1 89  ? -8.893  27.088  -28.873 1.00 57.22  ? 89  VAL C C   1 
ATOM   3519 O  O   . VAL C 1 89  ? -10.068 26.737  -28.892 1.00 57.22  ? 89  VAL C O   1 
ATOM   3520 C  CB  . VAL C 1 89  ? -7.943  26.195  -26.736 1.00 28.07  ? 89  VAL C CB  1 
ATOM   3521 C  CG1 . VAL C 1 89  ? -7.696  27.574  -26.241 1.00 28.07  ? 89  VAL C CG1 1 
ATOM   3522 C  CG2 . VAL C 1 89  ? -9.299  25.703  -26.278 1.00 28.07  ? 89  VAL C CG2 1 
ATOM   3523 N  N   . GLU C 1 90  ? -8.476  28.233  -29.407 1.00 39.77  ? 90  GLU C N   1 
ATOM   3524 C  CA  . GLU C 1 90  ? -9.391  29.198  -30.013 1.00 39.77  ? 90  GLU C CA  1 
ATOM   3525 C  C   . GLU C 1 90  ? -10.531 28.630  -30.881 1.00 39.77  ? 90  GLU C C   1 
ATOM   3526 O  O   . GLU C 1 90  ? -10.396 27.599  -31.550 1.00 39.77  ? 90  GLU C O   1 
ATOM   3527 C  CB  . GLU C 1 90  ? -8.613  30.253  -30.813 1.00 98.39  ? 90  GLU C CB  1 
ATOM   3528 C  CG  . GLU C 1 90  ? -9.444  31.491  -31.166 1.00 98.39  ? 90  GLU C CG  1 
ATOM   3529 C  CD  . GLU C 1 90  ? -8.890  32.293  -32.342 1.00 98.39  ? 90  GLU C CD  1 
ATOM   3530 O  OE1 . GLU C 1 90  ? -8.308  31.684  -33.267 1.00 98.39  ? 90  GLU C OE1 1 
ATOM   3531 O  OE2 . GLU C 1 90  ? -9.059  33.535  -32.350 1.00 98.39  ? 90  GLU C OE2 1 
ATOM   3532 N  N   . LEU C 1 91  ? -11.690 29.270  -30.752 1.00 51.93  ? 91  LEU C N   1 
ATOM   3533 C  CA  . LEU C 1 91  ? -12.889 28.937  -31.521 1.00 51.93  ? 91  LEU C CA  1 
ATOM   3534 C  C   . LEU C 1 91  ? -12.989 30.142  -32.433 1.00 51.93  ? 91  LEU C C   1 
ATOM   3535 O  O   . LEU C 1 91  ? -12.494 31.213  -32.082 1.00 51.93  ? 91  LEU C O   1 
ATOM   3536 C  CB  . LEU C 1 91  ? -14.135 28.881  -30.629 1.00 19.59  ? 91  LEU C CB  1 
ATOM   3537 C  CG  . LEU C 1 91  ? -14.720 30.195  -30.116 1.00 19.59  ? 91  LEU C CG  1 
ATOM   3538 C  CD1 . LEU C 1 91  ? -16.092 29.930  -29.570 1.00 19.59  ? 91  LEU C CD1 1 
ATOM   3539 C  CD2 . LEU C 1 91  ? -13.807 30.827  -29.074 1.00 19.59  ? 91  LEU C CD2 1 
ATOM   3540 N  N   . ALA C 1 92  ? -13.655 30.006  -33.572 1.00 25.06  ? 92  ALA C N   1 
ATOM   3541 C  CA  . ALA C 1 92  ? -13.721 31.149  -34.462 1.00 25.06  ? 92  ALA C CA  1 
ATOM   3542 C  C   . ALA C 1 92  ? -14.928 31.237  -35.380 1.00 25.06  ? 92  ALA C C   1 
ATOM   3543 O  O   . ALA C 1 92  ? -15.748 30.302  -35.450 1.00 25.06  ? 92  ALA C O   1 
ATOM   3544 C  CB  . ALA C 1 92  ? -12.414 31.211  -35.306 1.00 44.02  ? 92  ALA C CB  1 
ATOM   3545 N  N   . PRO C 1 93  ? -15.231 32.471  -35.868 1.00 79.34  ? 93  PRO C N   1 
ATOM   3546 C  CA  . PRO C 1 93  ? -14.599 33.810  -35.775 1.00 79.34  ? 93  PRO C CA  1 
ATOM   3547 C  C   . PRO C 1 93  ? -15.667 34.903  -36.071 1.00 79.34  ? 93  PRO C C   1 
ATOM   3548 O  O   . PRO C 1 93  ? -15.353 36.035  -36.420 1.00 79.34  ? 93  PRO C O   1 
ATOM   3549 C  CB  . PRO C 1 93  ? -13.555 33.762  -36.875 1.00 35.70  ? 93  PRO C CB  1 
ATOM   3550 C  CG  . PRO C 1 93  ? -14.249 32.909  -37.976 1.00 35.70  ? 93  PRO C CG  1 
ATOM   3551 C  CD  . PRO C 1 93  ? -15.488 32.250  -37.305 1.00 35.70  ? 93  PRO C CD  1 
ATOM   3552 N  N   . LEU C 1 94  ? -16.914 34.538  -35.764 1.00 60.97  ? 94  LEU C N   1 
ATOM   3553 C  CA  . LEU C 1 94  ? -18.129 35.268  -36.066 1.00 60.97  ? 94  LEU C CA  1 
ATOM   3554 C  C   . LEU C 1 94  ? -18.107 36.717  -35.665 1.00 60.97  ? 94  LEU C C   1 
ATOM   3555 O  O   . LEU C 1 94  ? -17.324 37.099  -34.795 1.00 60.97  ? 94  LEU C O   1 
ATOM   3556 C  CB  . LEU C 1 94  ? -19.297 34.544  -35.392 1.00 96.92  ? 94  LEU C CB  1 
ATOM   3557 C  CG  . LEU C 1 94  ? -19.388 33.050  -35.717 1.00 96.92  ? 94  LEU C CG  1 
ATOM   3558 C  CD1 . LEU C 1 94  ? -20.516 32.401  -34.924 1.00 96.92  ? 94  LEU C CD1 1 
ATOM   3559 C  CD2 . LEU C 1 94  ? -19.592 32.840  -37.229 1.00 96.92  ? 94  LEU C CD2 1 
ATOM   3560 N  N   . PRO C 1 95  ? -18.876 37.570  -36.360 1.00 48.04  ? 95  PRO C N   1 
ATOM   3561 C  CA  . PRO C 1 95  ? -18.854 39.011  -36.055 1.00 48.04  ? 95  PRO C CA  1 
ATOM   3562 C  C   . PRO C 1 95  ? -19.726 39.324  -34.803 1.00 48.04  ? 95  PRO C C   1 
ATOM   3563 O  O   . PRO C 1 95  ? -20.730 38.665  -34.531 1.00 48.04  ? 95  PRO C O   1 
ATOM   3564 C  CB  . PRO C 1 95  ? -19.423 39.646  -37.305 1.00 91.36  ? 95  PRO C CB  1 
ATOM   3565 C  CG  . PRO C 1 95  ? -20.354 38.605  -37.841 1.00 91.36  ? 95  PRO C CG  1 
ATOM   3566 C  CD  . PRO C 1 95  ? -19.582 37.320  -37.636 1.00 91.36  ? 95  PRO C CD  1 
ATOM   3567 N  N   . SER C 1 96  ? -19.296 40.358  -34.091 1.00 98.65  ? 96  SER C N   1 
ATOM   3568 C  CA  . SER C 1 96  ? -19.947 40.813  -32.850 1.00 98.65  ? 96  SER C CA  1 
ATOM   3569 C  C   . SER C 1 96  ? -21.475 40.899  -32.786 1.00 98.65  ? 96  SER C C   1 
ATOM   3570 O  O   . SER C 1 96  ? -22.077 40.402  -31.839 1.00 98.65  ? 96  SER C O   1 
ATOM   3571 C  CB  . SER C 1 96  ? -19.355 42.180  -32.434 1.00 98.65  ? 96  SER C CB  1 
ATOM   3572 O  OG  . SER C 1 96  ? -17.946 42.142  -32.258 1.00 98.65  ? 96  SER C OG  1 
ATOM   3573 N  N   . TRP C 1 97  ? -22.094 41.538  -33.775 1.00 51.90  ? 97  TRP C N   1 
ATOM   3574 C  CA  . TRP C 1 97  ? -23.544 41.729  -33.786 1.00 51.90  ? 97  TRP C CA  1 
ATOM   3575 C  C   . TRP C 1 97  ? -24.283 40.619  -34.505 1.00 51.90  ? 97  TRP C C   1 
ATOM   3576 O  O   . TRP C 1 97  ? -23.810 40.117  -35.524 1.00 51.90  ? 97  TRP C O   1 
ATOM   3577 C  CB  . TRP C 1 97  ? -23.872 43.083  -34.418 1.00 58.85  ? 97  TRP C CB  1 
ATOM   3578 C  CG  . TRP C 1 97  ? -22.879 44.115  -34.034 1.00 58.85  ? 97  TRP C CG  1 
ATOM   3579 C  CD1 . TRP C 1 97  ? -21.627 44.288  -34.569 1.00 58.85  ? 97  TRP C CD1 1 
ATOM   3580 C  CD2 . TRP C 1 97  ? -22.986 45.066  -32.977 1.00 58.85  ? 97  TRP C CD2 1 
ATOM   3581 N  NE1 . TRP C 1 97  ? -20.949 45.276  -33.900 1.00 58.85  ? 97  TRP C NE1 1 
ATOM   3582 C  CE2 . TRP C 1 97  ? -21.764 45.772  -32.916 1.00 58.85  ? 97  TRP C CE2 1 
ATOM   3583 C  CE3 . TRP C 1 97  ? -24.001 45.378  -32.065 1.00 58.85  ? 97  TRP C CE3 1 
ATOM   3584 C  CZ2 . TRP C 1 97  ? -21.523 46.785  -31.980 1.00 58.85  ? 97  TRP C CZ2 1 
ATOM   3585 C  CZ3 . TRP C 1 97  ? -23.758 46.387  -31.128 1.00 58.85  ? 97  TRP C CZ3 1 
ATOM   3586 C  CH2 . TRP C 1 97  ? -22.528 47.076  -31.094 1.00 58.85  ? 97  TRP C CH2 1 
ATOM   3587 N  N   . GLN C 1 98  ? -25.448 40.252  -33.969 1.00 48.05  ? 98  GLN C N   1 
ATOM   3588 C  CA  . GLN C 1 98  ? -26.290 39.195  -34.537 1.00 48.05  ? 98  GLN C CA  1 
ATOM   3589 C  C   . GLN C 1 98  ? -27.790 39.358  -34.221 1.00 48.05  ? 98  GLN C C   1 
ATOM   3590 O  O   . GLN C 1 98  ? -28.158 39.777  -33.125 1.00 48.05  ? 98  GLN C O   1 
ATOM   3591 C  CB  . GLN C 1 98  ? -25.827 37.823  -34.027 1.00 78.77  ? 98  GLN C CB  1 
ATOM   3592 C  CG  . GLN C 1 98  ? -24.513 37.309  -34.606 1.00 78.77  ? 98  GLN C CG  1 
ATOM   3593 C  CD  . GLN C 1 98  ? -24.657 36.766  -36.015 1.00 78.77  ? 98  GLN C CD  1 
ATOM   3594 O  OE1 . GLN C 1 98  ? -25.600 36.033  -36.321 1.00 78.77  ? 98  GLN C OE1 1 
ATOM   3595 N  NE2 . GLN C 1 98  ? -23.709 37.111  -36.878 1.00 78.77  ? 98  GLN C NE2 1 
ATOM   3596 N  N   . PRO C 1 99  ? -28.671 39.016  -35.187 1.00 98.65  ? 99  PRO C N   1 
ATOM   3597 C  CA  . PRO C 1 99  ? -30.144 39.082  -35.097 1.00 98.65  ? 99  PRO C CA  1 
ATOM   3598 C  C   . PRO C 1 99  ? -30.678 38.026  -34.116 1.00 98.65  ? 99  PRO C C   1 
ATOM   3599 O  O   . PRO C 1 99  ? -30.435 36.833  -34.327 1.00 98.65  ? 99  PRO C O   1 
ATOM   3600 C  CB  . PRO C 1 99  ? -30.585 38.718  -36.518 1.00 39.75  ? 99  PRO C CB  1 
ATOM   3601 C  CG  . PRO C 1 99  ? -29.406 39.120  -37.377 1.00 39.75  ? 99  PRO C CG  1 
ATOM   3602 C  CD  . PRO C 1 99  ? -28.248 38.665  -36.558 1.00 39.75  ? 99  PRO C CD  1 
ATOM   3603 N  N   . VAL C 1 100 ? -31.432 38.430  -33.087 1.00 61.68  ? 100 VAL C N   1 
ATOM   3604 C  CA  . VAL C 1 100 ? -31.943 37.443  -32.116 1.00 61.68  ? 100 VAL C CA  1 
ATOM   3605 C  C   . VAL C 1 100 ? -32.834 36.383  -32.751 1.00 61.68  ? 100 VAL C C   1 
ATOM   3606 O  O   . VAL C 1 100 ? -33.542 36.651  -33.730 1.00 61.68  ? 100 VAL C O   1 
ATOM   3607 C  CB  . VAL C 1 100 ? -32.675 38.057  -30.878 1.00 29.35  ? 100 VAL C CB  1 
ATOM   3608 C  CG1 . VAL C 1 100 ? -31.909 39.249  -30.329 1.00 29.35  ? 100 VAL C CG1 1 
ATOM   3609 C  CG2 . VAL C 1 100 ? -34.131 38.377  -31.193 1.00 29.35  ? 100 VAL C CG2 1 
ATOM   3610 N  N   . GLY C 1 101 ? -32.793 35.181  -32.176 1.00 89.31  ? 101 GLY C N   1 
ATOM   3611 C  CA  . GLY C 1 101 ? -33.562 34.069  -32.703 1.00 89.31  ? 101 GLY C CA  1 
ATOM   3612 C  C   . GLY C 1 101 ? -32.875 33.576  -33.965 1.00 89.31  ? 101 GLY C C   1 
ATOM   3613 O  O   . GLY C 1 101 ? -33.485 33.480  -35.032 1.00 89.31  ? 101 GLY C O   1 
ATOM   3614 N  N   . LYS C 1 102 ? -31.576 33.322  -33.844 1.00 77.30  ? 102 LYS C N   1 
ATOM   3615 C  CA  . LYS C 1 102 ? -30.766 32.848  -34.954 1.00 77.30  ? 102 LYS C CA  1 
ATOM   3616 C  C   . LYS C 1 102 ? -30.112 31.548  -34.485 1.00 77.30  ? 102 LYS C C   1 
ATOM   3617 O  O   . LYS C 1 102 ? -29.431 31.541  -33.461 1.00 77.30  ? 102 LYS C O   1 
ATOM   3618 C  CB  . LYS C 1 102 ? -29.704 33.902  -35.279 1.00 98.61  ? 102 LYS C CB  1 
ATOM   3619 C  CG  . LYS C 1 102 ? -29.183 33.874  -36.702 1.00 98.61  ? 102 LYS C CG  1 
ATOM   3620 C  CD  . LYS C 1 102 ? -28.318 32.655  -36.976 1.00 98.61  ? 102 LYS C CD  1 
ATOM   3621 C  CE  . LYS C 1 102 ? -27.696 32.722  -38.362 1.00 98.61  ? 102 LYS C CE  1 
ATOM   3622 N  NZ  . LYS C 1 102 ? -26.902 33.976  -38.568 1.00 98.61  ? 102 LYS C NZ  1 
ATOM   3623 N  N   . ASN C 1 103 ? -30.340 30.446  -35.201 1.00 98.65  ? 103 ASN C N   1 
ATOM   3624 C  CA  . ASN C 1 103 ? -29.754 29.154  -34.819 1.00 98.65  ? 103 ASN C CA  1 
ATOM   3625 C  C   . ASN C 1 103 ? -28.287 29.071  -35.265 1.00 98.65  ? 103 ASN C C   1 
ATOM   3626 O  O   . ASN C 1 103 ? -27.844 28.067  -35.839 1.00 98.65  ? 103 ASN C O   1 
ATOM   3627 C  CB  . ASN C 1 103 ? -30.572 27.995  -35.408 1.00 98.50  ? 103 ASN C CB  1 
ATOM   3628 C  CG  . ASN C 1 103 ? -30.239 26.653  -34.768 1.00 98.50  ? 103 ASN C CG  1 
ATOM   3629 O  OD1 . ASN C 1 103 ? -30.443 26.464  -33.564 1.00 98.50  ? 103 ASN C OD1 1 
ATOM   3630 N  ND2 . ASN C 1 103 ? -29.738 25.721  -35.573 1.00 98.50  ? 103 ASN C ND2 1 
ATOM   3631 N  N   . LEU C 1 104 ? -27.544 30.136  -34.972 1.00 66.14  ? 104 LEU C N   1 
ATOM   3632 C  CA  . LEU C 1 104 ? -26.138 30.240  -35.319 1.00 66.14  ? 104 LEU C CA  1 
ATOM   3633 C  C   . LEU C 1 104 ? -25.291 29.135  -34.675 1.00 66.14  ? 104 LEU C C   1 
ATOM   3634 O  O   . LEU C 1 104 ? -25.650 28.585  -33.628 1.00 66.14  ? 104 LEU C O   1 
ATOM   3635 C  CB  . LEU C 1 104 ? -25.608 31.638  -34.959 1.00 31.52  ? 104 LEU C CB  1 
ATOM   3636 C  CG  . LEU C 1 104 ? -24.503 31.810  -33.905 1.00 31.52  ? 104 LEU C CG  1 
ATOM   3637 C  CD1 . LEU C 1 104 ? -23.976 33.246  -33.887 1.00 31.52  ? 104 LEU C CD1 1 
ATOM   3638 C  CD2 . LEU C 1 104 ? -25.020 31.390  -32.524 1.00 31.52  ? 104 LEU C CD2 1 
ATOM   3639 N  N   . THR C 1 105 ? -24.156 28.846  -35.315 1.00 73.37  ? 105 THR C N   1 
ATOM   3640 C  CA  . THR C 1 105 ? -23.215 27.810  -34.887 1.00 73.37  ? 105 THR C CA  1 
ATOM   3641 C  C   . THR C 1 105 ? -21.963 28.293  -34.149 1.00 73.37  ? 105 THR C C   1 
ATOM   3642 O  O   . THR C 1 105 ? -21.309 29.254  -34.550 1.00 73.37  ? 105 THR C O   1 
ATOM   3643 C  CB  . THR C 1 105 ? -22.759 26.942  -36.098 1.00 98.65  ? 105 THR C CB  1 
ATOM   3644 O  OG1 . THR C 1 105 ? -22.444 27.787  -37.213 1.00 98.65  ? 105 THR C OG1 1 
ATOM   3645 C  CG2 . THR C 1 105 ? -23.848 25.967  -36.506 1.00 98.65  ? 105 THR C CG2 1 
ATOM   3646 N  N   . LEU C 1 106 ? -21.655 27.614  -33.052 1.00 69.27  ? 106 LEU C N   1 
ATOM   3647 C  CA  . LEU C 1 106 ? -20.474 27.900  -32.256 1.00 69.27  ? 106 LEU C CA  1 
ATOM   3648 C  C   . LEU C 1 106 ? -19.508 26.777  -32.546 1.00 69.27  ? 106 LEU C C   1 
ATOM   3649 O  O   . LEU C 1 106 ? -19.755 25.635  -32.164 1.00 69.27  ? 106 LEU C O   1 
ATOM   3650 C  CB  . LEU C 1 106 ? -20.776 27.842  -30.772 1.00 14.77  ? 106 LEU C CB  1 
ATOM   3651 C  CG  . LEU C 1 106 ? -21.341 29.003  -29.991 1.00 14.77  ? 106 LEU C CG  1 
ATOM   3652 C  CD1 . LEU C 1 106 ? -21.238 28.567  -28.543 1.00 14.77  ? 106 LEU C CD1 1 
ATOM   3653 C  CD2 . LEU C 1 106 ? -20.555 30.276  -30.210 1.00 14.77  ? 106 LEU C CD2 1 
ATOM   3654 N  N   . ARG C 1 107 ? -18.404 27.096  -33.202 1.00 48.93  ? 107 ARG C N   1 
ATOM   3655 C  CA  . ARG C 1 107 ? -17.416 26.081  -33.525 1.00 48.93  ? 107 ARG C CA  1 
ATOM   3656 C  C   . ARG C 1 107 ? -16.103 26.373  -32.811 1.00 48.93  ? 107 ARG C C   1 
ATOM   3657 O  O   . ARG C 1 107 ? -15.669 27.520  -32.719 1.00 48.93  ? 107 ARG C O   1 
ATOM   3658 C  CB  . ARG C 1 107 ? -17.207 26.012  -35.042 1.00 98.65  ? 107 ARG C CB  1 
ATOM   3659 C  CG  . ARG C 1 107 ? -16.781 24.642  -35.549 1.00 98.65  ? 107 ARG C CG  1 
ATOM   3660 C  CD  . ARG C 1 107 ? -17.549 24.267  -36.817 1.00 98.65  ? 107 ARG C CD  1 
ATOM   3661 N  NE  . ARG C 1 107 ? -17.286 22.893  -37.243 1.00 98.65  ? 107 ARG C NE  1 
ATOM   3662 C  CZ  . ARG C 1 107 ? -18.180 22.091  -37.815 1.00 98.65  ? 107 ARG C CZ  1 
ATOM   3663 N  NH1 . ARG C 1 107 ? -19.420 22.506  -38.044 1.00 98.65  ? 107 ARG C NH1 1 
ATOM   3664 N  NH2 . ARG C 1 107 ? -17.830 20.864  -38.163 1.00 98.65  ? 107 ARG C NH2 1 
ATOM   3665 N  N   . CYS C 1 108 ? -15.495 25.329  -32.272 1.00 73.72  ? 108 CYS C N   1 
ATOM   3666 C  CA  . CYS C 1 108 ? -14.233 25.470  -31.580 1.00 73.72  ? 108 CYS C CA  1 
ATOM   3667 C  C   . CYS C 1 108 ? -13.287 24.383  -32.026 1.00 73.72  ? 108 CYS C C   1 
ATOM   3668 O  O   . CYS C 1 108 ? -13.694 23.234  -32.224 1.00 73.72  ? 108 CYS C O   1 
ATOM   3669 C  CB  . CYS C 1 108 ? -14.426 25.354  -30.075 1.00 48.39  ? 108 CYS C CB  1 
ATOM   3670 S  SG  . CYS C 1 108 ? -12.833 25.329  -29.204 1.00 48.39  ? 108 CYS C SG  1 
ATOM   3671 N  N   . GLN C 1 109 ? -12.024 24.747  -32.203 1.00 15.04  ? 109 GLN C N   1 
ATOM   3672 C  CA  . GLN C 1 109 ? -11.024 23.756  -32.596 1.00 15.04  ? 109 GLN C CA  1 
ATOM   3673 C  C   . GLN C 1 109 ? -9.748  23.775  -31.728 1.00 15.04  ? 109 GLN C C   1 
ATOM   3674 O  O   . GLN C 1 109 ? -9.199  24.832  -31.414 1.00 15.04  ? 109 GLN C O   1 
ATOM   3675 C  CB  . GLN C 1 109 ? -10.675 23.882  -34.089 1.00 88.81  ? 109 GLN C CB  1 
ATOM   3676 C  CG  . GLN C 1 109 ? -11.766 23.379  -35.053 1.00 88.81  ? 109 GLN C CG  1 
ATOM   3677 C  CD  . GLN C 1 109 ? -11.235 23.056  -36.454 1.00 88.81  ? 109 GLN C CD  1 
ATOM   3678 O  OE1 . GLN C 1 109 ? -11.775 22.185  -37.144 1.00 88.81  ? 109 GLN C OE1 1 
ATOM   3679 N  NE2 . GLN C 1 109 ? -10.170 23.749  -36.872 1.00 88.81  ? 109 GLN C NE2 1 
ATOM   3680 N  N   . VAL C 1 110 ? -9.296  22.597  -31.318 1.00 31.40  ? 110 VAL C N   1 
ATOM   3681 C  CA  . VAL C 1 110 ? -8.096  22.500  -30.500 1.00 31.40  ? 110 VAL C CA  1 
ATOM   3682 C  C   . VAL C 1 110 ? -7.052  21.679  -31.276 1.00 31.40  ? 110 VAL C C   1 
ATOM   3683 O  O   . VAL C 1 110 ? -7.399  20.701  -31.940 1.00 31.40  ? 110 VAL C O   1 
ATOM   3684 C  CB  . VAL C 1 110 ? -8.427  21.887  -29.105 1.00 28.45  ? 110 VAL C CB  1 
ATOM   3685 C  CG1 . VAL C 1 110 ? -9.762  22.411  -28.604 1.00 28.45  ? 110 VAL C CG1 1 
ATOM   3686 C  CG2 . VAL C 1 110 ? -8.459  20.383  -29.148 1.00 28.45  ? 110 VAL C CG2 1 
ATOM   3687 N  N   . GLU C 1 111 ? -5.803  22.135  -31.287 1.00 65.03  ? 111 GLU C N   1 
ATOM   3688 C  CA  . GLU C 1 111 ? -4.767  21.415  -32.017 1.00 65.03  ? 111 GLU C CA  1 
ATOM   3689 C  C   . GLU C 1 111 ? -3.630  20.923  -31.148 1.00 65.03  ? 111 GLU C C   1 
ATOM   3690 O  O   . GLU C 1 111 ? -2.758  21.687  -30.750 1.00 65.03  ? 111 GLU C O   1 
ATOM   3691 C  CB  . GLU C 1 111 ? -4.240  22.231  -33.208 1.00 98.65  ? 111 GLU C CB  1 
ATOM   3692 C  CG  . GLU C 1 111 ? -3.710  23.621  -32.892 1.00 98.65  ? 111 GLU C CG  1 
ATOM   3693 C  CD  . GLU C 1 111 ? -3.266  24.385  -34.140 1.00 98.65  ? 111 GLU C CD  1 
ATOM   3694 O  OE1 . GLU C 1 111 ? -4.077  24.519  -35.084 1.00 98.65  ? 111 GLU C OE1 1 
ATOM   3695 O  OE2 . GLU C 1 111 ? -2.112  24.869  -34.172 1.00 98.65  ? 111 GLU C OE2 1 
ATOM   3696 N  N   . GLY C 1 112 ? -3.651  19.624  -30.868 1.00 80.90  ? 112 GLY C N   1 
ATOM   3697 C  CA  . GLY C 1 112 ? -2.631  19.016  -30.036 1.00 80.90  ? 112 GLY C CA  1 
ATOM   3698 C  C   . GLY C 1 112 ? -3.193  18.511  -28.720 1.00 80.90  ? 112 GLY C C   1 
ATOM   3699 O  O   . GLY C 1 112 ? -4.389  18.257  -28.607 1.00 80.90  ? 112 GLY C O   1 
ATOM   3700 N  N   . GLY C 1 113 ? -2.333  18.372  -27.719 1.00 46.35  ? 113 GLY C N   1 
ATOM   3701 C  CA  . GLY C 1 113 ? -2.774  17.893  -26.420 1.00 46.35  ? 113 GLY C CA  1 
ATOM   3702 C  C   . GLY C 1 113 ? -2.726  16.382  -26.285 1.00 46.35  ? 113 GLY C C   1 
ATOM   3703 O  O   . GLY C 1 113 ? -3.317  15.668  -27.084 1.00 46.35  ? 113 GLY C O   1 
ATOM   3704 N  N   . ALA C 1 114 ? -2.015  15.896  -25.272 1.00 42.42  ? 114 ALA C N   1 
ATOM   3705 C  CA  . ALA C 1 114 ? -1.883  14.461  -25.015 1.00 42.42  ? 114 ALA C CA  1 
ATOM   3706 C  C   . ALA C 1 114 ? -1.664  14.252  -23.509 1.00 42.42  ? 114 ALA C C   1 
ATOM   3707 O  O   . ALA C 1 114 ? -1.191  15.170  -22.826 1.00 42.42  ? 114 ALA C O   1 
ATOM   3708 C  CB  . ALA C 1 114 ? -0.711  13.882  -25.815 1.00 101.64 ? 114 ALA C CB  1 
ATOM   3709 N  N   . PRO C 1 115 ? -2.058  13.072  -22.962 1.00 35.69  ? 115 PRO C N   1 
ATOM   3710 C  CA  . PRO C 1 115 ? -2.687  11.963  -23.683 1.00 35.69  ? 115 PRO C CA  1 
ATOM   3711 C  C   . PRO C 1 115 ? -4.127  12.255  -24.123 1.00 35.69  ? 115 PRO C C   1 
ATOM   3712 O  O   . PRO C 1 115 ? -4.985  12.628  -23.326 1.00 35.69  ? 115 PRO C O   1 
ATOM   3713 C  CB  . PRO C 1 115 ? -2.563  10.798  -22.692 1.00 24.30  ? 115 PRO C CB  1 
ATOM   3714 C  CG  . PRO C 1 115 ? -2.626  11.457  -21.384 1.00 24.30  ? 115 PRO C CG  1 
ATOM   3715 C  CD  . PRO C 1 115 ? -1.772  12.672  -21.568 1.00 24.30  ? 115 PRO C CD  1 
ATOM   3716 N  N   . ARG C 1 116 ? -4.357  12.085  -25.418 1.00 54.25  ? 116 ARG C N   1 
ATOM   3717 C  CA  . ARG C 1 116 ? -5.639  12.351  -26.032 1.00 54.25  ? 116 ARG C CA  1 
ATOM   3718 C  C   . ARG C 1 116 ? -6.858  11.627  -25.530 1.00 54.25  ? 116 ARG C C   1 
ATOM   3719 O  O   . ARG C 1 116 ? -7.969  11.963  -25.936 1.00 54.25  ? 116 ARG C O   1 
ATOM   3720 C  CB  . ARG C 1 116 ? -5.547  12.189  -27.537 1.00 28.62  ? 116 ARG C CB  1 
ATOM   3721 C  CG  . ARG C 1 116 ? -5.141  13.458  -28.243 1.00 28.62  ? 116 ARG C CG  1 
ATOM   3722 C  CD  . ARG C 1 116 ? -6.155  14.585  -28.028 1.00 28.62  ? 116 ARG C CD  1 
ATOM   3723 N  NE  . ARG C 1 116 ? -5.800  15.755  -28.825 1.00 28.62  ? 116 ARG C NE  1 
ATOM   3724 C  CZ  . ARG C 1 116 ? -6.352  16.056  -29.995 1.00 28.62  ? 116 ARG C CZ  1 
ATOM   3725 N  NH1 . ARG C 1 116 ? -7.309  15.283  -30.492 1.00 28.62  ? 116 ARG C NH1 1 
ATOM   3726 N  NH2 . ARG C 1 116 ? -5.873  17.063  -30.719 1.00 28.62  ? 116 ARG C NH2 1 
ATOM   3727 N  N   . ALA C 1 117 ? -6.674  10.614  -24.696 1.00 48.10  ? 117 ALA C N   1 
ATOM   3728 C  CA  . ALA C 1 117 ? -7.825  9.899   -24.158 1.00 48.10  ? 117 ALA C CA  1 
ATOM   3729 C  C   . ALA C 1 117 ? -8.238  10.546  -22.840 1.00 48.10  ? 117 ALA C C   1 
ATOM   3730 O  O   . ALA C 1 117 ? -9.210  10.140  -22.215 1.00 48.10  ? 117 ALA C O   1 
ATOM   3731 C  CB  . ALA C 1 117 ? -7.501  8.436   -23.955 1.00 98.65  ? 117 ALA C CB  1 
ATOM   3732 N  N   . ASN C 1 118 ? -7.498  11.574  -22.436 1.00 49.35  ? 118 ASN C N   1 
ATOM   3733 C  CA  . ASN C 1 118 ? -7.776  12.286  -21.196 1.00 49.35  ? 118 ASN C CA  1 
ATOM   3734 C  C   . ASN C 1 118 ? -8.231  13.742  -21.430 1.00 49.35  ? 118 ASN C C   1 
ATOM   3735 O  O   . ASN C 1 118 ? -8.838  14.367  -20.553 1.00 49.35  ? 118 ASN C O   1 
ATOM   3736 C  CB  . ASN C 1 118 ? -6.531  12.273  -20.303 1.00 65.46  ? 118 ASN C CB  1 
ATOM   3737 C  CG  . ASN C 1 118 ? -6.062  10.855  -19.923 1.00 65.46  ? 118 ASN C CG  1 
ATOM   3738 O  OD1 . ASN C 1 118 ? -5.124  10.710  -19.152 1.00 65.46  ? 118 ASN C OD1 1 
ATOM   3739 N  ND2 . ASN C 1 118 ? -6.693  9.826   -20.473 1.00 65.46  ? 118 ASN C ND2 1 
ATOM   3740 N  N   . LEU C 1 119 ? -7.937  14.265  -22.620 1.00 25.74  ? 119 LEU C N   1 
ATOM   3741 C  CA  . LEU C 1 119 ? -8.282  15.637  -23.017 1.00 25.74  ? 119 LEU C CA  1 
ATOM   3742 C  C   . LEU C 1 119 ? -9.718  15.825  -23.516 1.00 25.74  ? 119 LEU C C   1 
ATOM   3743 O  O   . LEU C 1 119 ? -10.109 15.252  -24.543 1.00 25.74  ? 119 LEU C O   1 
ATOM   3744 C  CB  . LEU C 1 119 ? -7.318  16.098  -24.120 1.00 5.74   ? 119 LEU C CB  1 
ATOM   3745 C  CG  . LEU C 1 119 ? -7.314  17.510  -24.700 1.00 5.74   ? 119 LEU C CG  1 
ATOM   3746 C  CD1 . LEU C 1 119 ? -6.744  18.474  -23.691 1.00 5.74   ? 119 LEU C CD1 1 
ATOM   3747 C  CD2 . LEU C 1 119 ? -6.483  17.521  -25.960 1.00 5.74   ? 119 LEU C CD2 1 
ATOM   3748 N  N   . THR C 1 120 ? -10.497 16.611  -22.766 1.00 30.66  ? 120 THR C N   1 
ATOM   3749 C  CA  . THR C 1 120 ? -11.876 16.941  -23.149 1.00 30.66  ? 120 THR C CA  1 
ATOM   3750 C  C   . THR C 1 120 ? -11.982 18.413  -23.528 1.00 30.66  ? 120 THR C C   1 
ATOM   3751 O  O   . THR C 1 120 ? -11.179 19.253  -23.119 1.00 30.66  ? 120 THR C O   1 
ATOM   3752 C  CB  . THR C 1 120 ? -12.964 16.646  -22.055 1.00 27.23  ? 120 THR C CB  1 
ATOM   3753 O  OG1 . THR C 1 120 ? -12.561 17.176  -20.787 1.00 27.23  ? 120 THR C OG1 1 
ATOM   3754 C  CG2 . THR C 1 120 ? -13.256 15.170  -21.945 1.00 27.23  ? 120 THR C CG2 1 
ATOM   3755 N  N   . VAL C 1 121 ? -12.991 18.702  -24.329 1.00 84.14  ? 121 VAL C N   1 
ATOM   3756 C  CA  . VAL C 1 121 ? -13.238 20.044  -24.790 1.00 84.14  ? 121 VAL C CA  1 
ATOM   3757 C  C   . VAL C 1 121 ? -14.638 20.459  -24.389 1.00 84.14  ? 121 VAL C C   1 
ATOM   3758 O  O   . VAL C 1 121 ? -15.552 19.636  -24.346 1.00 84.14  ? 121 VAL C O   1 
ATOM   3759 C  CB  . VAL C 1 121 ? -13.107 20.123  -26.300 1.00 13.77  ? 121 VAL C CB  1 
ATOM   3760 C  CG1 . VAL C 1 121 ? -13.601 21.441  -26.779 1.00 13.77  ? 121 VAL C CG1 1 
ATOM   3761 C  CG2 . VAL C 1 121 ? -11.656 19.967  -26.705 1.00 13.77  ? 121 VAL C CG2 1 
ATOM   3762 N  N   . VAL C 1 122 ? -14.800 21.746  -24.103 1.00 11.05  ? 122 VAL C N   1 
ATOM   3763 C  CA  . VAL C 1 122 ? -16.101 22.266  -23.705 1.00 11.05  ? 122 VAL C CA  1 
ATOM   3764 C  C   . VAL C 1 122 ? -16.408 23.693  -24.194 1.00 11.05  ? 122 VAL C C   1 
ATOM   3765 O  O   . VAL C 1 122 ? -15.630 24.633  -23.997 1.00 11.05  ? 122 VAL C O   1 
ATOM   3766 C  CB  . VAL C 1 122 ? -16.303 22.143  -22.184 1.00 21.07  ? 122 VAL C CB  1 
ATOM   3767 C  CG1 . VAL C 1 122 ? -15.113 22.703  -21.452 1.00 21.07  ? 122 VAL C CG1 1 
ATOM   3768 C  CG2 . VAL C 1 122 ? -17.567 22.854  -21.775 1.00 21.07  ? 122 VAL C CG2 1 
ATOM   3769 N  N   . LEU C 1 123 ? -17.508 23.815  -24.920 1.00 57.70  ? 123 LEU C N   1 
ATOM   3770 C  CA  . LEU C 1 123 ? -17.937 25.104  -25.418 1.00 57.70  ? 123 LEU C CA  1 
ATOM   3771 C  C   . LEU C 1 123 ? -18.816 25.674  -24.314 1.00 57.70  ? 123 LEU C C   1 
ATOM   3772 O  O   . LEU C 1 123 ? -19.485 24.906  -23.617 1.00 57.70  ? 123 LEU C O   1 
ATOM   3773 C  CB  . LEU C 1 123 ? -18.723 24.930  -26.721 1.00 85.61  ? 123 LEU C CB  1 
ATOM   3774 C  CG  . LEU C 1 123 ? -17.851 24.801  -27.974 1.00 85.61  ? 123 LEU C CG  1 
ATOM   3775 C  CD1 . LEU C 1 123 ? -18.616 24.137  -29.102 1.00 85.61  ? 123 LEU C CD1 1 
ATOM   3776 C  CD2 . LEU C 1 123 ? -17.375 26.178  -28.383 1.00 85.61  ? 123 LEU C CD2 1 
ATOM   3777 N  N   . LEU C 1 124 ? -18.798 26.994  -24.129 1.00 31.47  ? 124 LEU C N   1 
ATOM   3778 C  CA  . LEU C 1 124 ? -19.599 27.602  -23.082 1.00 31.47  ? 124 LEU C CA  1 
ATOM   3779 C  C   . LEU C 1 124 ? -19.786 29.109  -23.162 1.00 31.47  ? 124 LEU C C   1 
ATOM   3780 O  O   . LEU C 1 124 ? -18.874 29.834  -23.566 1.00 31.47  ? 124 LEU C O   1 
ATOM   3781 C  CB  . LEU C 1 124 ? -19.023 27.232  -21.713 1.00 64.79  ? 124 LEU C CB  1 
ATOM   3782 C  CG  . LEU C 1 124 ? -17.658 27.709  -21.209 1.00 64.79  ? 124 LEU C CG  1 
ATOM   3783 C  CD1 . LEU C 1 124 ? -17.363 27.040  -19.871 1.00 64.79  ? 124 LEU C CD1 1 
ATOM   3784 C  CD2 . LEU C 1 124 ? -16.575 27.370  -22.212 1.00 64.79  ? 124 LEU C CD2 1 
ATOM   3785 N  N   . ARG C 1 125 ? -20.989 29.559  -22.804 1.00 60.39  ? 125 ARG C N   1 
ATOM   3786 C  CA  . ARG C 1 125 ? -21.335 30.974  -22.768 1.00 60.39  ? 125 ARG C CA  1 
ATOM   3787 C  C   . ARG C 1 125 ? -21.172 31.388  -21.311 1.00 60.39  ? 125 ARG C C   1 
ATOM   3788 O  O   . ARG C 1 125 ? -22.140 31.448  -20.560 1.00 60.39  ? 125 ARG C O   1 
ATOM   3789 C  CB  . ARG C 1 125 ? -22.786 31.191  -23.205 1.00 74.94  ? 125 ARG C CB  1 
ATOM   3790 C  CG  . ARG C 1 125 ? -23.230 32.660  -23.174 1.00 74.94  ? 125 ARG C CG  1 
ATOM   3791 C  CD  . ARG C 1 125 ? -24.727 32.827  -23.416 1.00 74.94  ? 125 ARG C CD  1 
ATOM   3792 N  NE  . ARG C 1 125 ? -25.521 32.234  -22.349 1.00 74.94  ? 125 ARG C NE  1 
ATOM   3793 C  CZ  . ARG C 1 125 ? -26.491 31.350  -22.545 1.00 74.94  ? 125 ARG C CZ  1 
ATOM   3794 N  NH1 . ARG C 1 125 ? -26.795 30.957  -23.775 1.00 74.94  ? 125 ARG C NH1 1 
ATOM   3795 N  NH2 . ARG C 1 125 ? -27.138 30.833  -21.507 1.00 74.94  ? 125 ARG C NH2 1 
ATOM   3796 N  N   . GLY C 1 126 ? -19.940 31.666  -20.912 1.00 87.97  ? 126 GLY C N   1 
ATOM   3797 C  CA  . GLY C 1 126 ? -19.693 32.020  -19.530 1.00 87.97  ? 126 GLY C CA  1 
ATOM   3798 C  C   . GLY C 1 126 ? -19.572 30.733  -18.732 1.00 87.97  ? 126 GLY C C   1 
ATOM   3799 O  O   . GLY C 1 126 ? -19.506 29.648  -19.311 1.00 87.97  ? 126 GLY C O   1 
ATOM   3800 N  N   . GLU C 1 127 ? -19.582 30.842  -17.406 1.00 53.97  ? 127 GLU C N   1 
ATOM   3801 C  CA  . GLU C 1 127 ? -19.447 29.679  -16.523 1.00 53.97  ? 127 GLU C CA  1 
ATOM   3802 C  C   . GLU C 1 127 ? -20.554 28.628  -16.633 1.00 53.97  ? 127 GLU C C   1 
ATOM   3803 O  O   . GLU C 1 127 ? -20.824 27.902  -15.665 1.00 53.97  ? 127 GLU C O   1 
ATOM   3804 C  CB  . GLU C 1 127 ? -19.317 30.124  -15.063 1.00 94.87  ? 127 GLU C CB  1 
ATOM   3805 C  CG  . GLU C 1 127 ? -17.940 30.652  -14.660 1.00 94.87  ? 127 GLU C CG  1 
ATOM   3806 C  CD  . GLU C 1 127 ? -16.968 29.564  -14.207 1.00 94.87  ? 127 GLU C CD  1 
ATOM   3807 O  OE1 . GLU C 1 127 ? -16.313 29.759  -13.158 1.00 94.87  ? 127 GLU C OE1 1 
ATOM   3808 O  OE2 . GLU C 1 127 ? -16.842 28.527  -14.898 1.00 94.87  ? 127 GLU C OE2 1 
ATOM   3809 N  N   . LYS C 1 128 ? -21.201 28.536  -17.792 1.00 17.37  ? 128 LYS C N   1 
ATOM   3810 C  CA  . LYS C 1 128 ? -22.261 27.543  -17.964 1.00 17.37  ? 128 LYS C CA  1 
ATOM   3811 C  C   . LYS C 1 128 ? -21.789 26.556  -18.991 1.00 17.37  ? 128 LYS C C   1 
ATOM   3812 O  O   . LYS C 1 128 ? -21.385 26.955  -20.065 1.00 17.37  ? 128 LYS C O   1 
ATOM   3813 C  CB  . LYS C 1 128 ? -23.548 28.213  -18.427 1.00 85.41  ? 128 LYS C CB  1 
ATOM   3814 C  CG  . LYS C 1 128 ? -24.744 27.270  -18.537 1.00 85.41  ? 128 LYS C CG  1 
ATOM   3815 C  CD  . LYS C 1 128 ? -26.019 27.907  -17.991 1.00 85.41  ? 128 LYS C CD  1 
ATOM   3816 C  CE  . LYS C 1 128 ? -26.152 27.735  -16.471 1.00 85.41  ? 128 LYS C CE  1 
ATOM   3817 N  NZ  . LYS C 1 128 ? -25.086 28.397  -15.654 1.00 85.41  ? 128 LYS C NZ  1 
ATOM   3818 N  N   . GLU C 1 129 ? -21.740 25.278  -18.627 1.00 63.28  ? 129 GLU C N   1 
ATOM   3819 C  CA  . GLU C 1 129 ? -21.307 24.224  -19.556 1.00 63.28  ? 129 GLU C CA  1 
ATOM   3820 C  C   . GLU C 1 129 ? -22.265 24.045  -20.770 1.00 63.28  ? 129 GLU C C   1 
ATOM   3821 O  O   . GLU C 1 129 ? -23.412 23.567  -20.642 1.00 63.28  ? 129 GLU C O   1 
ATOM   3822 C  CB  . GLU C 1 129 ? -21.119 22.885  -18.811 1.00 72.04  ? 129 GLU C CB  1 
ATOM   3823 C  CG  . GLU C 1 129 ? -21.856 22.782  -17.470 1.00 72.04  ? 129 GLU C CG  1 
ATOM   3824 C  CD  . GLU C 1 129 ? -23.362 22.973  -17.583 1.00 72.04  ? 129 GLU C CD  1 
ATOM   3825 O  OE1 . GLU C 1 129 ? -23.845 24.099  -17.326 1.00 72.04  ? 129 GLU C OE1 1 
ATOM   3826 O  OE2 . GLU C 1 129 ? -24.060 21.997  -17.929 1.00 72.04  ? 129 GLU C OE2 1 
ATOM   3827 N  N   . LEU C 1 130 ? -21.794 24.419  -21.955 1.00 32.05  ? 130 LEU C N   1 
ATOM   3828 C  CA  . LEU C 1 130 ? -22.640 24.278  -23.140 1.00 32.05  ? 130 LEU C CA  1 
ATOM   3829 C  C   . LEU C 1 130 ? -22.488 22.910  -23.811 1.00 32.05  ? 130 LEU C C   1 
ATOM   3830 O  O   . LEU C 1 130 ? -23.450 22.408  -24.393 1.00 32.05  ? 130 LEU C O   1 
ATOM   3831 C  CB  . LEU C 1 130 ? -22.340 25.376  -24.165 1.00 25.18  ? 130 LEU C CB  1 
ATOM   3832 C  CG  . LEU C 1 130 ? -23.505 26.040  -24.888 1.00 25.18  ? 130 LEU C CG  1 
ATOM   3833 C  CD1 . LEU C 1 130 ? -24.790 25.218  -24.751 1.00 25.18  ? 130 LEU C CD1 1 
ATOM   3834 C  CD2 . LEU C 1 130 ? -23.704 27.417  -24.298 1.00 25.18  ? 130 LEU C CD2 1 
ATOM   3835 N  N   . LYS C 1 131 ? -21.300 22.310  -23.737 1.00 98.65  ? 131 LYS C N   1 
ATOM   3836 C  CA  . LYS C 1 131 ? -21.064 21.004  -24.334 1.00 98.65  ? 131 LYS C CA  1 
ATOM   3837 C  C   . LYS C 1 131 ? -19.646 20.497  -24.055 1.00 98.65  ? 131 LYS C C   1 
ATOM   3838 O  O   . LYS C 1 131 ? -18.658 21.153  -24.414 1.00 98.65  ? 131 LYS C O   1 
ATOM   3839 C  CB  . LYS C 1 131 ? -21.301 21.048  -25.842 1.00 40.10  ? 131 LYS C CB  1 
ATOM   3840 C  CG  . LYS C 1 131 ? -21.677 19.694  -26.448 1.00 40.10  ? 131 LYS C CG  1 
ATOM   3841 C  CD  . LYS C 1 131 ? -21.921 19.776  -27.932 1.00 40.10  ? 131 LYS C CD  1 
ATOM   3842 C  CE  . LYS C 1 131 ? -22.465 18.475  -28.466 1.00 40.10  ? 131 LYS C CE  1 
ATOM   3843 N  NZ  . LYS C 1 131 ? -22.813 18.596  -29.897 1.00 40.10  ? 131 LYS C NZ  1 
ATOM   3844 N  N   . ARG C 1 132 ? -19.552 19.360  -23.364 1.00 60.29  ? 132 ARG C N   1 
ATOM   3845 C  CA  . ARG C 1 132 ? -18.263 18.748  -23.041 1.00 60.29  ? 132 ARG C CA  1 
ATOM   3846 C  C   . ARG C 1 132 ? -18.059 17.490  -23.884 1.00 60.29  ? 132 ARG C C   1 
ATOM   3847 O  O   . ARG C 1 132 ? -18.782 16.507  -23.721 1.00 60.29  ? 132 ARG C O   1 
ATOM   3848 C  CB  . ARG C 1 132 ? -18.187 18.376  -21.563 1.00 87.03  ? 132 ARG C CB  1 
ATOM   3849 C  CG  . ARG C 1 132 ? -18.308 19.536  -20.599 1.00 87.03  ? 132 ARG C CG  1 
ATOM   3850 C  CD  . ARG C 1 132 ? -18.117 19.096  -19.148 1.00 87.03  ? 132 ARG C CD  1 
ATOM   3851 N  NE  . ARG C 1 132 ? -16.791 18.522  -18.903 1.00 87.03  ? 132 ARG C NE  1 
ATOM   3852 C  CZ  . ARG C 1 132 ? -16.368 18.063  -17.726 1.00 87.03  ? 132 ARG C CZ  1 
ATOM   3853 N  NH1 . ARG C 1 132 ? -17.162 18.106  -16.658 1.00 87.03  ? 132 ARG C NH1 1 
ATOM   3854 N  NH2 . ARG C 1 132 ? -15.155 17.535  -17.619 1.00 87.03  ? 132 ARG C NH2 1 
ATOM   3855 N  N   . GLU C 1 133 ? -17.085 17.530  -24.791 1.00 57.64  ? 133 GLU C N   1 
ATOM   3856 C  CA  . GLU C 1 133 ? -16.771 16.386  -25.642 1.00 57.64  ? 133 GLU C CA  1 
ATOM   3857 C  C   . GLU C 1 133 ? -15.260 16.205  -25.806 1.00 57.64  ? 133 GLU C C   1 
ATOM   3858 O  O   . GLU C 1 133 ? -14.514 17.187  -25.840 1.00 57.64  ? 133 GLU C O   1 
ATOM   3859 C  CB  . GLU C 1 133 ? -17.448 16.508  -27.010 1.00 98.62  ? 133 GLU C CB  1 
ATOM   3860 C  CG  . GLU C 1 133 ? -18.927 16.130  -27.002 1.00 98.62  ? 133 GLU C CG  1 
ATOM   3861 C  CD  . GLU C 1 133 ? -19.486 15.888  -28.397 1.00 98.62  ? 133 GLU C CD  1 
ATOM   3862 O  OE1 . GLU C 1 133 ? -20.603 15.327  -28.501 1.00 98.62  ? 133 GLU C OE1 1 
ATOM   3863 O  OE2 . GLU C 1 133 ? -18.813 16.252  -29.390 1.00 98.62  ? 133 GLU C OE2 1 
ATOM   3864 N  N   . PRO C 1 134 ? -14.794 14.940  -25.892 1.00 41.76  ? 134 PRO C N   1 
ATOM   3865 C  CA  . PRO C 1 134 ? -13.380 14.573  -26.048 1.00 41.76  ? 134 PRO C CA  1 
ATOM   3866 C  C   . PRO C 1 134 ? -12.763 14.999  -27.381 1.00 41.76  ? 134 PRO C C   1 
ATOM   3867 O  O   . PRO C 1 134 ? -13.384 14.830  -28.434 1.00 41.76  ? 134 PRO C O   1 
ATOM   3868 C  CB  . PRO C 1 134 ? -13.407 13.057  -25.896 1.00 98.65  ? 134 PRO C CB  1 
ATOM   3869 C  CG  . PRO C 1 134 ? -14.749 12.683  -26.428 1.00 98.65  ? 134 PRO C CG  1 
ATOM   3870 C  CD  . PRO C 1 134 ? -15.636 13.733  -25.820 1.00 98.65  ? 134 PRO C CD  1 
ATOM   3871 N  N   . ALA C 1 135 ? -11.549 15.556  -27.319 1.00 47.61  ? 135 ALA C N   1 
ATOM   3872 C  CA  . ALA C 1 135 ? -10.832 16.025  -28.502 1.00 47.61  ? 135 ALA C CA  1 
ATOM   3873 C  C   . ALA C 1 135 ? -10.654 14.934  -29.553 1.00 47.61  ? 135 ALA C C   1 
ATOM   3874 O  O   . ALA C 1 135 ? -9.925  13.947  -29.339 1.00 47.61  ? 135 ALA C O   1 
ATOM   3875 C  CB  . ALA C 1 135 ? -9.500  16.566  -28.110 1.00 28.68  ? 135 ALA C CB  1 
ATOM   3876 N  N   . VAL C 1 136 ? -11.328 15.140  -30.691 1.00 95.28  ? 136 VAL C N   1 
ATOM   3877 C  CA  . VAL C 1 136 ? -11.316 14.228  -31.845 1.00 95.28  ? 136 VAL C CA  1 
ATOM   3878 C  C   . VAL C 1 136 ? -10.585 14.831  -33.043 1.00 95.28  ? 136 VAL C C   1 
ATOM   3879 O  O   . VAL C 1 136 ? -10.952 15.898  -33.534 1.00 95.28  ? 136 VAL C O   1 
ATOM   3880 C  CB  . VAL C 1 136 ? -12.767 13.853  -32.298 1.00 98.65  ? 136 VAL C CB  1 
ATOM   3881 C  CG1 . VAL C 1 136 ? -13.591 15.109  -32.593 1.00 98.65  ? 136 VAL C CG1 1 
ATOM   3882 C  CG2 . VAL C 1 136 ? -12.730 12.951  -33.526 1.00 98.65  ? 136 VAL C CG2 1 
ATOM   3883 N  N   . GLY C 1 137 ? -9.549  14.140  -33.498 1.00 43.05  ? 137 GLY C N   1 
ATOM   3884 C  CA  . GLY C 1 137 ? -8.787  14.598  -34.647 1.00 43.05  ? 137 GLY C CA  1 
ATOM   3885 C  C   . GLY C 1 137 ? -7.784  15.726  -34.453 1.00 43.05  ? 137 GLY C C   1 
ATOM   3886 O  O   . GLY C 1 137 ? -7.350  16.019  -33.340 1.00 43.05  ? 137 GLY C O   1 
ATOM   3887 N  N   . GLU C 1 138 ? -7.412  16.358  -35.560 1.00 38.62  ? 138 GLU C N   1 
ATOM   3888 C  CA  . GLU C 1 138 ? -6.452  17.448  -35.542 1.00 38.62  ? 138 GLU C CA  1 
ATOM   3889 C  C   . GLU C 1 138 ? -6.725  18.394  -36.706 1.00 38.62  ? 138 GLU C C   1 
ATOM   3890 O  O   . GLU C 1 138 ? -6.533  18.029  -37.866 1.00 38.62  ? 138 GLU C O   1 
ATOM   3891 C  CB  . GLU C 1 138 ? -5.022  16.883  -35.610 1.00 85.54  ? 138 GLU C CB  1 
ATOM   3892 C  CG  . GLU C 1 138 ? -3.960  17.773  -36.284 1.00 85.54  ? 138 GLU C CG  1 
ATOM   3893 C  CD  . GLU C 1 138 ? -3.671  19.080  -35.545 1.00 85.54  ? 138 GLU C CD  1 
ATOM   3894 O  OE1 . GLU C 1 138 ? -3.272  19.020  -34.355 1.00 85.54  ? 138 GLU C OE1 1 
ATOM   3895 O  OE2 . GLU C 1 138 ? -3.814  20.160  -36.174 1.00 85.54  ? 138 GLU C OE2 1 
ATOM   3896 N  N   . PRO C 1 139 ? -7.269  19.591  -36.415 1.00 47.25  ? 139 PRO C N   1 
ATOM   3897 C  CA  . PRO C 1 139 ? -7.635  20.050  -35.068 1.00 47.25  ? 139 PRO C CA  1 
ATOM   3898 C  C   . PRO C 1 139 ? -8.936  19.391  -34.612 1.00 47.25  ? 139 PRO C C   1 
ATOM   3899 O  O   . PRO C 1 139 ? -9.673  18.822  -35.426 1.00 47.25  ? 139 PRO C O   1 
ATOM   3900 C  CB  . PRO C 1 139 ? -7.818  21.557  -35.260 1.00 65.99  ? 139 PRO C CB  1 
ATOM   3901 C  CG  . PRO C 1 139 ? -6.956  21.876  -36.457 1.00 65.99  ? 139 PRO C CG  1 
ATOM   3902 C  CD  . PRO C 1 139 ? -7.270  20.721  -37.360 1.00 65.99  ? 139 PRO C CD  1 
ATOM   3903 N  N   . ALA C 1 140 ? -9.223  19.473  -33.319 1.00 61.32  ? 140 ALA C N   1 
ATOM   3904 C  CA  . ALA C 1 140 ? -10.426 18.858  -32.781 1.00 61.32  ? 140 ALA C CA  1 
ATOM   3905 C  C   . ALA C 1 140 ? -11.686 19.642  -33.080 1.00 61.32  ? 140 ALA C C   1 
ATOM   3906 O  O   . ALA C 1 140 ? -11.949 20.696  -32.503 1.00 61.32  ? 140 ALA C O   1 
ATOM   3907 C  CB  . ALA C 1 140 ? -10.291 18.621  -31.297 1.00 101.64 ? 140 ALA C CB  1 
ATOM   3908 N  N   . GLU C 1 141 ? -12.463 19.111  -34.007 1.00 98.65  ? 141 GLU C N   1 
ATOM   3909 C  CA  . GLU C 1 141 ? -13.719 19.720  -34.409 1.00 98.65  ? 141 GLU C CA  1 
ATOM   3910 C  C   . GLU C 1 141 ? -14.752 19.550  -33.298 1.00 98.65  ? 141 GLU C C   1 
ATOM   3911 O  O   . GLU C 1 141 ? -14.930 18.450  -32.768 1.00 98.65  ? 141 GLU C O   1 
ATOM   3912 C  CB  . GLU C 1 141 ? -14.215 19.037  -35.691 1.00 98.65  ? 141 GLU C CB  1 
ATOM   3913 C  CG  . GLU C 1 141 ? -15.646 19.361  -36.123 1.00 98.65  ? 141 GLU C CG  1 
ATOM   3914 C  CD  . GLU C 1 141 ? -16.204 18.326  -37.096 1.00 98.65  ? 141 GLU C CD  1 
ATOM   3915 O  OE1 . GLU C 1 141 ? -15.850 18.373  -38.296 1.00 98.65  ? 141 GLU C OE1 1 
ATOM   3916 O  OE2 . GLU C 1 141 ? -16.992 17.456  -36.655 1.00 98.65  ? 141 GLU C OE2 1 
ATOM   3917 N  N   . VAL C 1 142 ? -15.407 20.647  -32.931 1.00 90.77  ? 142 VAL C N   1 
ATOM   3918 C  CA  . VAL C 1 142 ? -16.453 20.606  -31.915 1.00 90.77  ? 142 VAL C CA  1 
ATOM   3919 C  C   . VAL C 1 142 ? -17.445 21.732  -32.185 1.00 90.77  ? 142 VAL C C   1 
ATOM   3920 O  O   . VAL C 1 142 ? -17.044 22.871  -32.429 1.00 90.77  ? 142 VAL C O   1 
ATOM   3921 C  CB  . VAL C 1 142 ? -15.878 20.683  -30.500 1.00 12.80  ? 142 VAL C CB  1 
ATOM   3922 C  CG1 . VAL C 1 142 ? -15.816 22.130  -30.003 1.00 12.80  ? 142 VAL C CG1 1 
ATOM   3923 C  CG2 . VAL C 1 142 ? -16.683 19.768  -29.583 1.00 12.80  ? 142 VAL C CG2 1 
ATOM   3924 N  N   . THR C 1 143 ? -18.738 21.416  -32.155 1.00 96.18  ? 143 THR C N   1 
ATOM   3925 C  CA  . THR C 1 143 ? -19.753 22.423  -32.467 1.00 96.18  ? 143 THR C CA  1 
ATOM   3926 C  C   . THR C 1 143 ? -21.117 22.247  -31.797 1.00 96.18  ? 143 THR C C   1 
ATOM   3927 O  O   . THR C 1 143 ? -21.616 21.125  -31.660 1.00 96.18  ? 143 THR C O   1 
ATOM   3928 C  CB  . THR C 1 143 ? -20.000 22.473  -33.997 1.00 94.04  ? 143 THR C CB  1 
ATOM   3929 O  OG1 . THR C 1 143 ? -18.746 22.469  -34.691 1.00 94.04  ? 143 THR C OG1 1 
ATOM   3930 C  CG2 . THR C 1 143 ? -20.791 23.724  -34.380 1.00 94.04  ? 143 THR C CG2 1 
ATOM   3931 N  N   . THR C 1 144 ? -21.725 23.376  -31.426 1.00 54.33  ? 144 THR C N   1 
ATOM   3932 C  CA  . THR C 1 144 ? -23.050 23.391  -30.811 1.00 54.33  ? 144 THR C CA  1 
ATOM   3933 C  C   . THR C 1 144 ? -23.764 24.665  -31.232 1.00 54.33  ? 144 THR C C   1 
ATOM   3934 O  O   . THR C 1 144 ? -23.293 25.768  -30.973 1.00 54.33  ? 144 THR C O   1 
ATOM   3935 C  CB  . THR C 1 144 ? -22.998 23.277  -29.260 1.00 98.64  ? 144 THR C CB  1 
ATOM   3936 O  OG1 . THR C 1 144 ? -24.332 23.245  -28.732 1.00 98.64  ? 144 THR C OG1 1 
ATOM   3937 C  CG2 . THR C 1 144 ? -22.238 24.442  -28.641 1.00 98.64  ? 144 THR C CG2 1 
ATOM   3938 N  N   . THR C 1 145 ? -24.890 24.491  -31.918 1.00 64.53  ? 145 THR C N   1 
ATOM   3939 C  CA  . THR C 1 145 ? -25.685 25.611  -32.416 1.00 64.53  ? 145 THR C CA  1 
ATOM   3940 C  C   . THR C 1 145 ? -26.400 26.374  -31.309 1.00 64.53  ? 145 THR C C   1 
ATOM   3941 O  O   . THR C 1 145 ? -27.379 25.891  -30.739 1.00 64.53  ? 145 THR C O   1 
ATOM   3942 C  CB  . THR C 1 145 ? -26.744 25.142  -33.447 1.00 75.13  ? 145 THR C CB  1 
ATOM   3943 O  OG1 . THR C 1 145 ? -27.758 24.371  -32.786 1.00 75.13  ? 145 THR C OG1 1 
ATOM   3944 C  CG2 . THR C 1 145 ? -26.096 24.287  -34.532 1.00 75.13  ? 145 THR C CG2 1 
ATOM   3945 N  N   . VAL C 1 146 ? -25.924 27.581  -31.032 1.00 98.65  ? 146 VAL C N   1 
ATOM   3946 C  CA  . VAL C 1 146 ? -26.521 28.414  -30.002 1.00 98.65  ? 146 VAL C CA  1 
ATOM   3947 C  C   . VAL C 1 146 ? -27.551 29.369  -30.597 1.00 98.65  ? 146 VAL C C   1 
ATOM   3948 O  O   . VAL C 1 146 ? -27.446 29.803  -31.728 1.00 98.65  ? 146 VAL C O   1 
ATOM   3949 C  CB  . VAL C 1 146 ? -25.450 29.199  -29.229 1.00 98.65  ? 146 VAL C CB  1 
ATOM   3950 C  CG1 . VAL C 1 146 ? -26.084 30.208  -28.292 1.00 98.65  ? 146 VAL C CG1 1 
ATOM   3951 C  CG2 . VAL C 1 146 ? -24.608 28.247  -28.427 1.00 98.65  ? 146 VAL C CG2 1 
ATOM   3952 N  N   . LEU C 1 147 ? -28.543 29.624  -29.783 1.00 42.80  ? 147 LEU C N   1 
ATOM   3953 C  CA  . LEU C 1 147 ? -29.679 30.503  -30.077 1.00 42.80  ? 147 LEU C CA  1 
ATOM   3954 C  C   . LEU C 1 147 ? -29.452 31.919  -29.544 1.00 42.80  ? 147 LEU C C   1 
ATOM   3955 O  O   . LEU C 1 147 ? -28.634 32.047  -28.626 1.00 42.80  ? 147 LEU C O   1 
ATOM   3956 C  CB  . LEU C 1 147 ? -30.972 29.929  -29.488 1.00 98.65  ? 147 LEU C CB  1 
ATOM   3957 C  CG  . LEU C 1 147 ? -31.399 28.548  -29.991 1.00 98.65  ? 147 LEU C CG  1 
ATOM   3958 C  CD1 . LEU C 1 147 ? -32.689 28.105  -29.317 1.00 98.65  ? 147 LEU C CD1 1 
ATOM   3959 C  CD2 . LEU C 1 147 ? -31.562 28.554  -31.503 1.00 98.65  ? 147 LEU C CD2 1 
ATOM   3960 N  N   . VAL C 1 148 ? -30.271 32.843  -29.954 1.00 77.40  ? 148 VAL C N   1 
ATOM   3961 C  CA  . VAL C 1 148 ? -30.169 34.193  -29.421 1.00 77.40  ? 148 VAL C CA  1 
ATOM   3962 C  C   . VAL C 1 148 ? -31.547 34.555  -28.850 1.00 77.40  ? 148 VAL C C   1 
ATOM   3963 O  O   . VAL C 1 148 ? -32.454 34.939  -29.597 1.00 77.40  ? 148 VAL C O   1 
ATOM   3964 C  CB  . VAL C 1 148 ? -29.741 35.201  -30.521 1.00 63.39  ? 148 VAL C CB  1 
ATOM   3965 C  CG1 . VAL C 1 148 ? -29.086 36.417  -29.887 1.00 63.39  ? 148 VAL C CG1 1 
ATOM   3966 C  CG2 . VAL C 1 148 ? -28.791 34.543  -31.530 1.00 63.39  ? 148 VAL C CG2 1 
ATOM   3967 N  N   . ARG C 1 149 ? -31.707 34.387  -27.534 1.00 85.25  ? 149 ARG C N   1 
ATOM   3968 C  CA  . ARG C 1 149 ? -32.916 34.856  -26.852 1.00 85.25  ? 149 ARG C CA  1 
ATOM   3969 C  C   . ARG C 1 149 ? -32.880 35.834  -25.660 1.00 85.25  ? 149 ARG C C   1 
ATOM   3970 O  O   . ARG C 1 149 ? -33.106 37.038  -25.819 1.00 85.25  ? 149 ARG C O   1 
ATOM   3971 C  CB  . ARG C 1 149 ? -33.634 33.554  -26.431 1.00 97.25  ? 149 ARG C CB  1 
ATOM   3972 C  CG  . ARG C 1 149 ? -34.003 32.607  -27.588 1.00 97.25  ? 149 ARG C CG  1 
ATOM   3973 C  CD  . ARG C 1 149 ? -35.007 31.520  -27.169 1.00 97.25  ? 149 ARG C CD  1 
ATOM   3974 N  NE  . ARG C 1 149 ? -36.376 32.027  -26.983 1.00 97.25  ? 149 ARG C NE  1 
ATOM   3975 C  CZ  . ARG C 1 149 ? -37.465 31.258  -26.891 1.00 97.25  ? 149 ARG C CZ  1 
ATOM   3976 N  NH1 . ARG C 1 149 ? -37.362 29.936  -26.963 1.00 97.25  ? 149 ARG C NH1 1 
ATOM   3977 N  NH2 . ARG C 1 149 ? -38.667 31.809  -26.741 1.00 97.25  ? 149 ARG C NH2 1 
ATOM   3978 N  N   . ARG C 1 150 ? -32.624 35.295  -24.467 1.00 98.54  ? 150 ARG C N   1 
ATOM   3979 C  CA  . ARG C 1 150 ? -32.794 36.062  -23.207 1.00 98.54  ? 150 ARG C CA  1 
ATOM   3980 C  C   . ARG C 1 150 ? -31.463 36.206  -22.490 1.00 98.54  ? 150 ARG C C   1 
ATOM   3981 O  O   . ARG C 1 150 ? -31.221 37.202  -21.797 1.00 98.54  ? 150 ARG C O   1 
ATOM   3982 C  CB  . ARG C 1 150 ? -33.837 35.459  -22.245 1.00 98.65  ? 150 ARG C CB  1 
ATOM   3983 C  CG  . ARG C 1 150 ? -33.914 33.934  -22.256 1.00 98.65  ? 150 ARG C CG  1 
ATOM   3984 C  CD  . ARG C 1 150 ? -34.983 33.424  -21.322 1.00 98.65  ? 150 ARG C CD  1 
ATOM   3985 N  NE  . ARG C 1 150 ? -34.612 33.598  -19.919 1.00 98.65  ? 150 ARG C NE  1 
ATOM   3986 C  CZ  . ARG C 1 150 ? -34.309 32.597  -19.091 1.00 98.65  ? 150 ARG C CZ  1 
ATOM   3987 N  NH1 . ARG C 1 150 ? -34.332 31.340  -19.519 1.00 98.65  ? 150 ARG C NH1 1 
ATOM   3988 N  NH2 . ARG C 1 150 ? -33.969 32.850  -17.830 1.00 98.65  ? 150 ARG C NH2 1 
ATOM   3989 N  N   . ASP C 1 151 ? -30.678 35.126  -22.521 1.00 98.65  ? 151 ASP C N   1 
ATOM   3990 C  CA  . ASP C 1 151 ? -29.345 35.093  -21.908 1.00 98.65  ? 151 ASP C CA  1 
ATOM   3991 C  C   . ASP C 1 151 ? -28.386 35.662  -22.961 1.00 98.65  ? 151 ASP C C   1 
ATOM   3992 O  O   . ASP C 1 151 ? -27.166 35.720  -22.768 1.00 98.65  ? 151 ASP C O   1 
ATOM   3993 C  CB  . ASP C 1 151 ? -28.947 33.647  -21.552 1.00 98.65  ? 151 ASP C CB  1 
ATOM   3994 C  CG  . ASP C 1 151 ? -29.932 32.972  -20.593 1.00 98.65  ? 151 ASP C CG  1 
ATOM   3995 O  OD1 . ASP C 1 151 ? -29.639 32.904  -19.376 1.00 98.65  ? 151 ASP C OD1 1 
ATOM   3996 O  OD2 . ASP C 1 151 ? -30.989 32.494  -21.063 1.00 98.65  ? 151 ASP C OD2 1 
ATOM   3997 N  N   . HIS C 1 152 ? -28.986 36.082  -24.075 1.00 98.42  ? 152 HIS C N   1 
ATOM   3998 C  CA  . HIS C 1 152 ? -28.294 36.659  -25.218 1.00 98.42  ? 152 HIS C CA  1 
ATOM   3999 C  C   . HIS C 1 152 ? -28.780 38.100  -25.323 1.00 98.42  ? 152 HIS C C   1 
ATOM   4000 O  O   . HIS C 1 152 ? -29.949 38.368  -25.643 1.00 98.42  ? 152 HIS C O   1 
ATOM   4001 C  CB  . HIS C 1 152 ? -28.641 35.859  -26.468 1.00 98.65  ? 152 HIS C CB  1 
ATOM   4002 C  CG  . HIS C 1 152 ? -28.671 34.381  -26.228 1.00 98.65  ? 152 HIS C CG  1 
ATOM   4003 N  ND1 . HIS C 1 152 ? -29.754 33.746  -25.653 1.00 98.65  ? 152 HIS C ND1 1 
ATOM   4004 C  CD2 . HIS C 1 152 ? -27.736 33.428  -26.427 1.00 98.65  ? 152 HIS C CD2 1 
ATOM   4005 C  CE1 . HIS C 1 152 ? -29.479 32.463  -25.508 1.00 98.65  ? 152 HIS C CE1 1 
ATOM   4006 N  NE2 . HIS C 1 152 ? -28.263 32.240  -25.968 1.00 98.65  ? 152 HIS C NE2 1 
ATOM   4007 N  N   . HIS C 1 153 ? -27.861 39.012  -25.012 1.00 96.11  ? 153 HIS C N   1 
ATOM   4008 C  CA  . HIS C 1 153 ? -28.112 40.449  -24.982 1.00 96.11  ? 153 HIS C CA  1 
ATOM   4009 C  C   . HIS C 1 153 ? -26.805 41.241  -25.062 1.00 96.11  ? 153 HIS C C   1 
ATOM   4010 O  O   . HIS C 1 153 ? -26.817 42.460  -25.238 1.00 96.11  ? 153 HIS C O   1 
ATOM   4011 C  CB  . HIS C 1 153 ? -28.829 40.799  -23.669 1.00 97.25  ? 153 HIS C CB  1 
ATOM   4012 C  CG  . HIS C 1 153 ? -28.360 40.006  -22.479 1.00 97.25  ? 153 HIS C CG  1 
ATOM   4013 N  ND1 . HIS C 1 153 ? -27.174 39.293  -22.464 1.00 97.25  ? 153 HIS C ND1 1 
ATOM   4014 C  CD2 . HIS C 1 153 ? -28.930 39.794  -21.266 1.00 97.25  ? 153 HIS C CD2 1 
ATOM   4015 C  CE1 . HIS C 1 153 ? -27.040 38.681  -21.304 1.00 97.25  ? 153 HIS C CE1 1 
ATOM   4016 N  NE2 . HIS C 1 153 ? -28.094 38.968  -20.556 1.00 97.25  ? 153 HIS C NE2 1 
ATOM   4017 N  N   . GLY C 1 154 ? -25.690 40.532  -24.901 1.00 86.60  ? 154 GLY C N   1 
ATOM   4018 C  CA  . GLY C 1 154 ? -24.368 41.136  -24.931 1.00 86.60  ? 154 GLY C CA  1 
ATOM   4019 C  C   . GLY C 1 154 ? -23.447 40.221  -24.148 1.00 86.60  ? 154 GLY C C   1 
ATOM   4020 O  O   . GLY C 1 154 ? -22.710 40.660  -23.265 1.00 86.60  ? 154 GLY C O   1 
ATOM   4021 N  N   . ALA C 1 155 ? -23.507 38.936  -24.494 1.00 98.39  ? 155 ALA C N   1 
ATOM   4022 C  CA  . ALA C 1 155 ? -22.740 37.880  -23.838 1.00 98.39  ? 155 ALA C CA  1 
ATOM   4023 C  C   . ALA C 1 155 ? -21.331 37.614  -24.372 1.00 98.39  ? 155 ALA C C   1 
ATOM   4024 O  O   . ALA C 1 155 ? -20.947 38.113  -25.429 1.00 98.39  ? 155 ALA C O   1 
ATOM   4025 C  CB  . ALA C 1 155 ? -23.552 36.591  -23.856 1.00 98.65  ? 155 ALA C CB  1 
ATOM   4026 N  N   . ASN C 1 156 ? -20.575 36.821  -23.613 1.00 43.54  ? 156 ASN C N   1 
ATOM   4027 C  CA  . ASN C 1 156 ? -19.214 36.430  -23.964 1.00 43.54  ? 156 ASN C CA  1 
ATOM   4028 C  C   . ASN C 1 156 ? -19.091 34.894  -23.974 1.00 43.54  ? 156 ASN C C   1 
ATOM   4029 O  O   . ASN C 1 156 ? -19.176 34.259  -22.917 1.00 43.54  ? 156 ASN C O   1 
ATOM   4030 C  CB  . ASN C 1 156 ? -18.210 37.031  -22.973 1.00 66.07  ? 156 ASN C CB  1 
ATOM   4031 C  CG  . ASN C 1 156 ? -17.593 38.329  -23.472 1.00 66.07  ? 156 ASN C CG  1 
ATOM   4032 O  OD1 . ASN C 1 156 ? -16.849 38.325  -24.450 1.00 66.07  ? 156 ASN C OD1 1 
ATOM   4033 N  ND2 . ASN C 1 156 ? -17.901 39.438  -22.799 1.00 66.07  ? 156 ASN C ND2 1 
ATOM   4034 N  N   . PHE C 1 157 ? -18.943 34.313  -25.173 1.00 32.26  ? 157 PHE C N   1 
ATOM   4035 C  CA  . PHE C 1 157 ? -18.805 32.864  -25.368 1.00 32.26  ? 157 PHE C CA  1 
ATOM   4036 C  C   . PHE C 1 157 ? -17.334 32.520  -25.437 1.00 32.26  ? 157 PHE C C   1 
ATOM   4037 O  O   . PHE C 1 157 ? -16.536 33.326  -25.921 1.00 32.26  ? 157 PHE C O   1 
ATOM   4038 C  CB  . PHE C 1 157 ? -19.459 32.415  -26.675 1.00 61.12  ? 157 PHE C CB  1 
ATOM   4039 C  CG  . PHE C 1 157 ? -20.958 32.511  -26.683 1.00 61.12  ? 157 PHE C CG  1 
ATOM   4040 C  CD1 . PHE C 1 157 ? -21.736 31.364  -26.714 1.00 61.12  ? 157 PHE C CD1 1 
ATOM   4041 C  CD2 . PHE C 1 157 ? -21.592 33.744  -26.707 1.00 61.12  ? 157 PHE C CD2 1 
ATOM   4042 C  CE1 . PHE C 1 157 ? -23.113 31.440  -26.774 1.00 61.12  ? 157 PHE C CE1 1 
ATOM   4043 C  CE2 . PHE C 1 157 ? -22.970 33.829  -26.766 1.00 61.12  ? 157 PHE C CE2 1 
ATOM   4044 C  CZ  . PHE C 1 157 ? -23.731 32.676  -26.801 1.00 61.12  ? 157 PHE C CZ  1 
ATOM   4045 N  N   . SER C 1 158 ? -16.985 31.306  -25.009 1.00 23.55  ? 158 SER C N   1 
ATOM   4046 C  CA  . SER C 1 158 ? -15.593 30.871  -25.004 1.00 23.55  ? 158 SER C CA  1 
ATOM   4047 C  C   . SER C 1 158 ? -15.459 29.370  -25.085 1.00 23.55  ? 158 SER C C   1 
ATOM   4048 O  O   . SER C 1 158 ? -16.437 28.658  -24.913 1.00 23.55  ? 158 SER C O   1 
ATOM   4049 C  CB  . SER C 1 158 ? -14.889 31.377  -23.749 1.00 85.95  ? 158 SER C CB  1 
ATOM   4050 O  OG  . SER C 1 158 ? -15.580 30.931  -22.599 1.00 85.95  ? 158 SER C OG  1 
ATOM   4051 N  N   . CYS C 1 159 ? -14.224 28.913  -25.316 1.00 41.91  ? 159 CYS C N   1 
ATOM   4052 C  CA  . CYS C 1 159 ? -13.887 27.494  -25.453 1.00 41.91  ? 159 CYS C CA  1 
ATOM   4053 C  C   . CYS C 1 159 ? -12.682 27.097  -24.628 1.00 41.91  ? 159 CYS C C   1 
ATOM   4054 O  O   . CYS C 1 159 ? -11.594 27.618  -24.827 1.00 41.91  ? 159 CYS C O   1 
ATOM   4055 C  CB  . CYS C 1 159 ? -13.568 27.169  -26.911 1.00 39.32  ? 159 CYS C CB  1 
ATOM   4056 S  SG  . CYS C 1 159 ? -13.300 25.399  -27.236 1.00 39.32  ? 159 CYS C SG  1 
ATOM   4057 N  N   . ARG C 1 160 ? -12.863 26.114  -23.757 1.00 15.39  ? 160 ARG C N   1 
ATOM   4058 C  CA  . ARG C 1 160 ? -11.774 25.635  -22.910 1.00 15.39  ? 160 ARG C CA  1 
ATOM   4059 C  C   . ARG C 1 160 ? -11.476 24.162  -23.100 1.00 15.39  ? 160 ARG C C   1 
ATOM   4060 O  O   . ARG C 1 160 ? -12.289 23.428  -23.665 1.00 15.39  ? 160 ARG C O   1 
ATOM   4061 C  CB  . ARG C 1 160 ? -12.088 25.892  -21.443 1.00 55.02  ? 160 ARG C CB  1 
ATOM   4062 C  CG  . ARG C 1 160 ? -11.073 25.314  -20.477 1.00 55.02  ? 160 ARG C CG  1 
ATOM   4063 C  CD  . ARG C 1 160 ? -11.336 25.809  -19.085 1.00 55.02  ? 160 ARG C CD  1 
ATOM   4064 N  NE  . ARG C 1 160 ? -12.763 25.790  -18.801 1.00 55.02  ? 160 ARG C NE  1 
ATOM   4065 C  CZ  . ARG C 1 160 ? -13.298 25.380  -17.662 1.00 55.02  ? 160 ARG C CZ  1 
ATOM   4066 N  NH1 . ARG C 1 160 ? -12.530 24.944  -16.671 1.00 55.02  ? 160 ARG C NH1 1 
ATOM   4067 N  NH2 . ARG C 1 160 ? -14.610 25.416  -17.522 1.00 55.02  ? 160 ARG C NH2 1 
ATOM   4068 N  N   . THR C 1 161 ? -10.278 23.763  -22.669 1.00 20.25  ? 161 THR C N   1 
ATOM   4069 C  CA  . THR C 1 161 ? -9.813  22.376  -22.735 1.00 20.25  ? 161 THR C CA  1 
ATOM   4070 C  C   . THR C 1 161 ? -9.493  21.964  -21.319 1.00 20.25  ? 161 THR C C   1 
ATOM   4071 O  O   . THR C 1 161 ? -8.966  22.779  -20.577 1.00 20.25  ? 161 THR C O   1 
ATOM   4072 C  CB  . THR C 1 161 ? -8.475  22.222  -23.473 1.00 26.70  ? 161 THR C CB  1 
ATOM   4073 O  OG1 . THR C 1 161 ? -7.461  22.971  -22.783 1.00 26.70  ? 161 THR C OG1 1 
ATOM   4074 C  CG2 . THR C 1 161 ? -8.598  22.633  -24.918 1.00 26.70  ? 161 THR C CG2 1 
ATOM   4075 N  N   . GLU C 1 162 ? -9.763  20.696  -20.985 1.00 50.64  ? 162 GLU C N   1 
ATOM   4076 C  CA  . GLU C 1 162 ? -9.484  20.113  -19.666 1.00 50.64  ? 162 GLU C CA  1 
ATOM   4077 C  C   . GLU C 1 162 ? -8.787  18.740  -19.827 1.00 50.64  ? 162 GLU C C   1 
ATOM   4078 O  O   . GLU C 1 162 ? -9.389  17.780  -20.309 1.00 50.64  ? 162 GLU C O   1 
ATOM   4079 C  CB  . GLU C 1 162 ? -10.778 19.975  -18.847 1.00 80.19  ? 162 GLU C CB  1 
ATOM   4080 C  CG  . GLU C 1 162 ? -11.442 21.306  -18.480 1.00 80.19  ? 162 GLU C CG  1 
ATOM   4081 C  CD  . GLU C 1 162 ? -12.695 21.150  -17.623 1.00 80.19  ? 162 GLU C CD  1 
ATOM   4082 O  OE1 . GLU C 1 162 ? -12.738 21.724  -16.514 1.00 80.19  ? 162 GLU C OE1 1 
ATOM   4083 O  OE2 . GLU C 1 162 ? -13.646 20.468  -18.056 1.00 80.19  ? 162 GLU C OE2 1 
ATOM   4084 N  N   . LEU C 1 163 ? -7.499  18.684  -19.478 1.00 32.06  ? 163 LEU C N   1 
ATOM   4085 C  CA  . LEU C 1 163 ? -6.675  17.466  -19.558 1.00 32.06  ? 163 LEU C CA  1 
ATOM   4086 C  C   . LEU C 1 163 ? -6.470  16.936  -18.151 1.00 32.06  ? 163 LEU C C   1 
ATOM   4087 O  O   . LEU C 1 163 ? -5.624  17.430  -17.419 1.00 32.06  ? 163 LEU C O   1 
ATOM   4088 C  CB  . LEU C 1 163 ? -5.316  17.774  -20.176 1.00 45.47  ? 163 LEU C CB  1 
ATOM   4089 C  CG  . LEU C 1 163 ? -4.347  16.611  -20.378 1.00 45.47  ? 163 LEU C CG  1 
ATOM   4090 C  CD1 . LEU C 1 163 ? -4.878  15.643  -21.414 1.00 45.47  ? 163 LEU C CD1 1 
ATOM   4091 C  CD2 . LEU C 1 163 ? -3.012  17.165  -20.821 1.00 45.47  ? 163 LEU C CD2 1 
ATOM   4092 N  N   . ASP C 1 164 ? -7.224  15.902  -17.804 1.00 48.23  ? 164 ASP C N   1 
ATOM   4093 C  CA  . ASP C 1 164 ? -7.199  15.326  -16.471 1.00 48.23  ? 164 ASP C CA  1 
ATOM   4094 C  C   . ASP C 1 164 ? -6.123  14.301  -16.200 1.00 48.23  ? 164 ASP C C   1 
ATOM   4095 O  O   . ASP C 1 164 ? -6.241  13.146  -16.587 1.00 48.23  ? 164 ASP C O   1 
ATOM   4096 C  CB  . ASP C 1 164 ? -8.576  14.727  -16.143 1.00 58.78  ? 164 ASP C CB  1 
ATOM   4097 C  CG  . ASP C 1 164 ? -8.926  14.824  -14.668 1.00 58.78  ? 164 ASP C CG  1 
ATOM   4098 O  OD1 . ASP C 1 164 ? -8.352  15.678  -13.965 1.00 58.78  ? 164 ASP C OD1 1 
ATOM   4099 O  OD2 . ASP C 1 164 ? -9.798  14.055  -14.214 1.00 58.78  ? 164 ASP C OD2 1 
ATOM   4100 N  N   . LEU C 1 165 ? -5.059  14.735  -15.541 1.00 56.23  ? 165 LEU C N   1 
ATOM   4101 C  CA  . LEU C 1 165 ? -3.983  13.835  -15.167 1.00 56.23  ? 165 LEU C CA  1 
ATOM   4102 C  C   . LEU C 1 165 ? -4.019  13.736  -13.669 1.00 56.23  ? 165 LEU C C   1 
ATOM   4103 O  O   . LEU C 1 165 ? -3.044  13.384  -13.023 1.00 56.23  ? 165 LEU C O   1 
ATOM   4104 C  CB  . LEU C 1 165 ? -2.643  14.354  -15.624 1.00 5.48   ? 165 LEU C CB  1 
ATOM   4105 C  CG  . LEU C 1 165 ? -2.544  14.390  -17.146 1.00 5.48   ? 165 LEU C CG  1 
ATOM   4106 C  CD1 . LEU C 1 165 ? -1.150  14.825  -17.551 1.00 5.48   ? 165 LEU C CD1 1 
ATOM   4107 C  CD2 . LEU C 1 165 ? -2.913  13.036  -17.750 1.00 5.48   ? 165 LEU C CD2 1 
ATOM   4108 N  N   . ARG C 1 166 ? -5.161  14.124  -13.125 1.00 17.25  ? 166 ARG C N   1 
ATOM   4109 C  CA  . ARG C 1 166 ? -5.405  14.062  -11.704 1.00 17.25  ? 166 ARG C CA  1 
ATOM   4110 C  C   . ARG C 1 166 ? -5.530  12.591  -11.315 1.00 17.25  ? 166 ARG C C   1 
ATOM   4111 O  O   . ARG C 1 166 ? -5.104  12.225  -10.240 1.00 17.25  ? 166 ARG C O   1 
ATOM   4112 C  CB  . ARG C 1 166 ? -6.650  14.867  -11.329 1.00 49.60  ? 166 ARG C CB  1 
ATOM   4113 C  CG  . ARG C 1 166 ? -6.497  16.343  -11.620 1.00 49.60  ? 166 ARG C CG  1 
ATOM   4114 C  CD  . ARG C 1 166 ? -7.634  17.143  -11.053 1.00 49.60  ? 166 ARG C CD  1 
ATOM   4115 N  NE  . ARG C 1 166 ? -8.884  16.960  -11.784 1.00 49.60  ? 166 ARG C NE  1 
ATOM   4116 C  CZ  . ARG C 1 166 ? -10.023 17.606  -11.503 1.00 49.60  ? 166 ARG C CZ  1 
ATOM   4117 N  NH1 . ARG C 1 166 ? -10.077 18.479  -10.493 1.00 49.60  ? 166 ARG C NH1 1 
ATOM   4118 N  NH2 . ARG C 1 166 ? -11.104 17.420  -12.262 1.00 49.60  ? 166 ARG C NH2 1 
ATOM   4119 N  N   . PRO C 1 167 ? -6.090  11.719  -12.187 1.00 40.47  ? 167 PRO C N   1 
ATOM   4120 C  CA  . PRO C 1 167 ? -6.164  10.320  -11.756 1.00 40.47  ? 167 PRO C CA  1 
ATOM   4121 C  C   . PRO C 1 167 ? -4.771  9.707   -11.550 1.00 40.47  ? 167 PRO C C   1 
ATOM   4122 O  O   . PRO C 1 167 ? -4.648  8.555   -11.166 1.00 40.47  ? 167 PRO C O   1 
ATOM   4123 C  CB  . PRO C 1 167 ? -6.923  9.642   -12.902 1.00 33.37  ? 167 PRO C CB  1 
ATOM   4124 C  CG  . PRO C 1 167 ? -6.671  10.512  -14.069 1.00 33.37  ? 167 PRO C CG  1 
ATOM   4125 C  CD  . PRO C 1 167 ? -6.793  11.880  -13.470 1.00 33.37  ? 167 PRO C CD  1 
ATOM   4126 N  N   . GLN C 1 168 ? -3.729  10.488  -11.819 1.00 11.04  ? 168 GLN C N   1 
ATOM   4127 C  CA  . GLN C 1 168 ? -2.356  10.053  -11.618 1.00 11.04  ? 168 GLN C CA  1 
ATOM   4128 C  C   . GLN C 1 168 ? -1.487  11.155  -10.983 1.00 11.04  ? 168 GLN C C   1 
ATOM   4129 O  O   . GLN C 1 168 ? -0.418  11.515  -11.484 1.00 11.04  ? 168 GLN C O   1 
ATOM   4130 C  CB  . GLN C 1 168 ? -1.740  9.503   -12.904 1.00 30.71  ? 168 GLN C CB  1 
ATOM   4131 C  CG  . GLN C 1 168 ? -2.241  10.148  -14.160 1.00 30.71  ? 168 GLN C CG  1 
ATOM   4132 C  CD  . GLN C 1 168 ? -3.334  9.347   -14.814 1.00 30.71  ? 168 GLN C CD  1 
ATOM   4133 O  OE1 . GLN C 1 168 ? -4.275  9.895   -15.370 1.00 30.71  ? 168 GLN C OE1 1 
ATOM   4134 N  NE2 . GLN C 1 168 ? -3.202  8.037   -14.773 1.00 30.71  ? 168 GLN C NE2 1 
ATOM   4135 N  N   . GLY C 1 169 ? -1.971  11.684  -9.868  1.00 89.98  ? 169 GLY C N   1 
ATOM   4136 C  CA  . GLY C 1 169 ? -1.230  12.692  -9.139  1.00 89.98  ? 169 GLY C CA  1 
ATOM   4137 C  C   . GLY C 1 169 ? -0.909  14.044  -9.751  1.00 89.98  ? 169 GLY C C   1 
ATOM   4138 O  O   . GLY C 1 169 ? -0.535  14.953  -9.007  1.00 89.98  ? 169 GLY C O   1 
ATOM   4139 N  N   . LEU C 1 170 ? -0.990  14.206  -11.070 1.00 56.50  ? 170 LEU C N   1 
ATOM   4140 C  CA  . LEU C 1 170 ? -0.693  15.524  -11.643 1.00 56.50  ? 170 LEU C CA  1 
ATOM   4141 C  C   . LEU C 1 170 ? -1.863  16.477  -11.397 1.00 56.50  ? 170 LEU C C   1 
ATOM   4142 O  O   . LEU C 1 170 ? -2.676  16.260  -10.490 1.00 56.50  ? 170 LEU C O   1 
ATOM   4143 C  CB  . LEU C 1 170 ? -0.372  15.429  -13.137 1.00 9.24   ? 170 LEU C CB  1 
ATOM   4144 C  CG  . LEU C 1 170 ? 0.891   14.654  -13.481 1.00 9.24   ? 170 LEU C CG  1 
ATOM   4145 C  CD1 . LEU C 1 170 ? 1.162   14.724  -14.960 1.00 9.24   ? 170 LEU C CD1 1 
ATOM   4146 C  CD2 . LEU C 1 170 ? 2.021   15.242  -12.731 1.00 9.24   ? 170 LEU C CD2 1 
ATOM   4147 N  N   . GLU C 1 171 ? -1.926  17.555  -12.167 1.00 36.02  ? 171 GLU C N   1 
ATOM   4148 C  CA  . GLU C 1 171 ? -3.019  18.506  -12.017 1.00 36.02  ? 171 GLU C CA  1 
ATOM   4149 C  C   . GLU C 1 171 ? -3.953  18.455  -13.232 1.00 36.02  ? 171 GLU C C   1 
ATOM   4150 O  O   . GLU C 1 171 ? -3.777  17.623  -14.127 1.00 36.02  ? 171 GLU C O   1 
ATOM   4151 C  CB  . GLU C 1 171 ? -2.466  19.925  -11.817 1.00 98.65  ? 171 GLU C CB  1 
ATOM   4152 C  CG  . GLU C 1 171 ? -1.571  20.100  -10.576 1.00 98.65  ? 171 GLU C CG  1 
ATOM   4153 C  CD  . GLU C 1 171 ? -2.315  19.988  -9.237  1.00 98.65  ? 171 GLU C CD  1 
ATOM   4154 O  OE1 . GLU C 1 171 ? -3.549  19.779  -9.224  1.00 98.65  ? 171 GLU C OE1 1 
ATOM   4155 O  OE2 . GLU C 1 171 ? -1.657  20.121  -8.183  1.00 98.65  ? 171 GLU C OE2 1 
ATOM   4156 N  N   . LEU C 1 172 ? -4.996  19.278  -13.215 1.00 38.91  ? 172 LEU C N   1 
ATOM   4157 C  CA  . LEU C 1 172 ? -5.910  19.348  -14.344 1.00 38.91  ? 172 LEU C CA  1 
ATOM   4158 C  C   . LEU C 1 172 ? -5.334  20.447  -15.221 1.00 38.91  ? 172 LEU C C   1 
ATOM   4159 O  O   . LEU C 1 172 ? -5.210  21.588  -14.788 1.00 38.91  ? 172 LEU C O   1 
ATOM   4160 C  CB  . LEU C 1 172 ? -7.306  19.726  -13.876 1.00 9.12   ? 172 LEU C CB  1 
ATOM   4161 C  CG  . LEU C 1 172 ? -8.427  19.832  -14.911 1.00 9.12   ? 172 LEU C CG  1 
ATOM   4162 C  CD1 . LEU C 1 172 ? -8.702  18.500  -15.584 1.00 9.12   ? 172 LEU C CD1 1 
ATOM   4163 C  CD2 . LEU C 1 172 ? -9.684  20.314  -14.201 1.00 9.12   ? 172 LEU C CD2 1 
ATOM   4164 N  N   . PHE C 1 173 ? -4.901  20.086  -16.419 1.00 28.45  ? 173 PHE C N   1 
ATOM   4165 C  CA  . PHE C 1 173 ? -4.317  21.058  -17.319 1.00 28.45  ? 173 PHE C CA  1 
ATOM   4166 C  C   . PHE C 1 173 ? -5.316  21.561  -18.312 1.00 28.45  ? 173 PHE C C   1 
ATOM   4167 O  O   . PHE C 1 173 ? -5.569  20.908  -19.329 1.00 28.45  ? 173 PHE C O   1 
ATOM   4168 C  CB  . PHE C 1 173 ? -3.150  20.448  -18.048 1.00 4.32   ? 173 PHE C CB  1 
ATOM   4169 C  CG  . PHE C 1 173 ? -2.071  20.028  -17.144 1.00 4.32   ? 173 PHE C CG  1 
ATOM   4170 C  CD1 . PHE C 1 173 ? -1.864  18.685  -16.876 1.00 4.32   ? 173 PHE C CD1 1 
ATOM   4171 C  CD2 . PHE C 1 173 ? -1.297  20.980  -16.500 1.00 4.32   ? 173 PHE C CD2 1 
ATOM   4172 C  CE1 . PHE C 1 173 ? -0.907  18.291  -15.978 1.00 4.32   ? 173 PHE C CE1 1 
ATOM   4173 C  CE2 . PHE C 1 173 ? -0.340  20.606  -15.604 1.00 4.32   ? 173 PHE C CE2 1 
ATOM   4174 C  CZ  . PHE C 1 173 ? -0.142  19.254  -15.338 1.00 4.32   ? 173 PHE C CZ  1 
ATOM   4175 N  N   . GLU C 1 174 ? -5.812  22.771  -18.054 1.00 57.12  ? 174 GLU C N   1 
ATOM   4176 C  CA  . GLU C 1 174 ? -6.815  23.417  -18.894 1.00 57.12  ? 174 GLU C CA  1 
ATOM   4177 C  C   . GLU C 1 174 ? -6.377  24.751  -19.477 1.00 57.12  ? 174 GLU C C   1 
ATOM   4178 O  O   . GLU C 1 174 ? -5.560  25.450  -18.884 1.00 57.12  ? 174 GLU C O   1 
ATOM   4179 C  CB  . GLU C 1 174 ? -8.101  23.598  -18.084 1.00 50.12  ? 174 GLU C CB  1 
ATOM   4180 C  CG  . GLU C 1 174 ? -7.927  24.319  -16.769 1.00 50.12  ? 174 GLU C CG  1 
ATOM   4181 C  CD  . GLU C 1 174 ? -8.938  23.879  -15.733 1.00 50.12  ? 174 GLU C CD  1 
ATOM   4182 O  OE1 . GLU C 1 174 ? -8.741  24.197  -14.542 1.00 50.12  ? 174 GLU C OE1 1 
ATOM   4183 O  OE2 . GLU C 1 174 ? -9.920  23.200  -16.098 1.00 50.12  ? 174 GLU C OE2 1 
ATOM   4184 N  N   . ASN C 1 175 ? -6.886  25.076  -20.662 1.00 32.69  ? 175 ASN C N   1 
ATOM   4185 C  CA  . ASN C 1 175 ? -6.562  26.350  -21.295 1.00 32.69  ? 175 ASN C CA  1 
ATOM   4186 C  C   . ASN C 1 175 ? -7.817  27.042  -21.841 1.00 32.69  ? 175 ASN C C   1 
ATOM   4187 O  O   . ASN C 1 175 ? -8.546  26.462  -22.650 1.00 32.69  ? 175 ASN C O   1 
ATOM   4188 C  CB  . ASN C 1 175 ? -5.537  26.168  -22.417 1.00 42.19  ? 175 ASN C CB  1 
ATOM   4189 C  CG  . ASN C 1 175 ? -4.215  25.656  -21.914 1.00 42.19  ? 175 ASN C CG  1 
ATOM   4190 O  OD1 . ASN C 1 175 ? -4.129  24.503  -21.530 1.00 42.19  ? 175 ASN C OD1 1 
ATOM   4191 N  ND2 . ASN C 1 175 ? -3.183  26.514  -21.919 1.00 42.19  ? 175 ASN C ND2 1 
ATOM   4192 N  N   . THR C 1 176 ? -8.088  28.265  -21.378 1.00 19.91  ? 176 THR C N   1 
ATOM   4193 C  CA  . THR C 1 176 ? -9.251  29.015  -21.844 1.00 19.91  ? 176 THR C CA  1 
ATOM   4194 C  C   . THR C 1 176 ? -8.895  29.689  -23.167 1.00 19.91  ? 176 THR C C   1 
ATOM   4195 O  O   . THR C 1 176 ? -7.707  29.898  -23.454 1.00 19.91  ? 176 THR C O   1 
ATOM   4196 C  CB  . THR C 1 176 ? -9.687  30.079  -20.814 1.00 98.65  ? 176 THR C CB  1 
ATOM   4197 O  OG1 . THR C 1 176 ? -10.914 30.695  -21.235 1.00 98.65  ? 176 THR C OG1 1 
ATOM   4198 C  CG2 . THR C 1 176 ? -8.604  31.143  -20.650 1.00 98.65  ? 176 THR C CG2 1 
ATOM   4199 N  N   . SER C 1 177 ? -9.917  30.008  -23.972 1.00 70.53  ? 177 SER C N   1 
ATOM   4200 C  CA  . SER C 1 177 ? -9.737  30.663  -25.277 1.00 70.53  ? 177 SER C CA  1 
ATOM   4201 C  C   . SER C 1 177 ? -10.278 32.093  -25.358 1.00 70.53  ? 177 SER C C   1 
ATOM   4202 O  O   . SER C 1 177 ? -11.135 32.499  -24.557 1.00 70.53  ? 177 SER C O   1 
ATOM   4203 C  CB  . SER C 1 177 ? -10.366 29.825  -26.402 1.00 24.30  ? 177 SER C CB  1 
ATOM   4204 O  OG  . SER C 1 177 ? -11.772 29.707  -26.272 1.00 24.30  ? 177 SER C OG  1 
ATOM   4205 N  N   . ALA C 1 178 ? -9.767  32.845  -26.335 1.00 41.37  ? 178 ALA C N   1 
ATOM   4206 C  CA  . ALA C 1 178 ? -10.184 34.225  -26.572 1.00 41.37  ? 178 ALA C CA  1 
ATOM   4207 C  C   . ALA C 1 178 ? -11.694 34.232  -26.672 1.00 41.37  ? 178 ALA C C   1 
ATOM   4208 O  O   . ALA C 1 178 ? -12.267 33.506  -27.481 1.00 41.37  ? 178 ALA C O   1 
ATOM   4209 C  CB  . ALA C 1 178 ? -9.593  34.727  -27.839 1.00 15.50  ? 178 ALA C CB  1 
ATOM   4210 N  N   . PRO C 1 179 ? -12.347 35.098  -25.888 1.00 6.77   ? 179 PRO C N   1 
ATOM   4211 C  CA  . PRO C 1 179 ? -13.797 35.288  -25.781 1.00 6.77   ? 179 PRO C CA  1 
ATOM   4212 C  C   . PRO C 1 179 ? -14.525 35.653  -27.041 1.00 6.77   ? 179 PRO C C   1 
ATOM   4213 O  O   . PRO C 1 179 ? -13.926 36.121  -27.999 1.00 6.77   ? 179 PRO C O   1 
ATOM   4214 C  CB  . PRO C 1 179 ? -13.911 36.422  -24.768 1.00 98.61  ? 179 PRO C CB  1 
ATOM   4215 C  CG  . PRO C 1 179 ? -12.710 37.250  -25.085 1.00 98.61  ? 179 PRO C CG  1 
ATOM   4216 C  CD  . PRO C 1 179 ? -11.638 36.193  -25.202 1.00 98.61  ? 179 PRO C CD  1 
ATOM   4217 N  N   . TYR C 1 180 ? -15.837 35.483  -27.021 1.00 90.98  ? 180 TYR C N   1 
ATOM   4218 C  CA  . TYR C 1 180 ? -16.659 35.831  -28.164 1.00 90.98  ? 180 TYR C CA  1 
ATOM   4219 C  C   . TYR C 1 180 ? -17.566 36.981  -27.755 1.00 90.98  ? 180 TYR C C   1 
ATOM   4220 O  O   . TYR C 1 180 ? -18.544 36.784  -27.041 1.00 90.98  ? 180 TYR C O   1 
ATOM   4221 C  CB  . TYR C 1 180 ? -17.490 34.633  -28.610 1.00 72.87  ? 180 TYR C CB  1 
ATOM   4222 C  CG  . TYR C 1 180 ? -18.454 34.925  -29.741 1.00 72.87  ? 180 TYR C CG  1 
ATOM   4223 C  CD1 . TYR C 1 180 ? -17.997 35.315  -30.994 1.00 72.87  ? 180 TYR C CD1 1 
ATOM   4224 C  CD2 . TYR C 1 180 ? -19.827 34.791  -29.561 1.00 72.87  ? 180 TYR C CD2 1 
ATOM   4225 C  CE1 . TYR C 1 180 ? -18.879 35.556  -32.031 1.00 72.87  ? 180 TYR C CE1 1 
ATOM   4226 C  CE2 . TYR C 1 180 ? -20.711 35.031  -30.594 1.00 72.87  ? 180 TYR C CE2 1 
ATOM   4227 C  CZ  . TYR C 1 180 ? -20.229 35.413  -31.821 1.00 72.87  ? 180 TYR C CZ  1 
ATOM   4228 O  OH  . TYR C 1 180 ? -21.100 35.647  -32.848 1.00 72.87  ? 180 TYR C OH  1 
ATOM   4229 N  N   . GLN C 1 181 ? -17.192 38.190  -28.158 1.00 43.65  ? 181 GLN C N   1 
ATOM   4230 C  CA  . GLN C 1 181 ? -17.964 39.392  -27.857 1.00 43.65  ? 181 GLN C CA  1 
ATOM   4231 C  C   . GLN C 1 181 ? -19.261 39.445  -28.694 1.00 43.65  ? 181 GLN C C   1 
ATOM   4232 O  O   . GLN C 1 181 ? -19.280 39.966  -29.810 1.00 43.65  ? 181 GLN C O   1 
ATOM   4233 C  CB  . GLN C 1 181 ? -17.088 40.652  -28.062 1.00 94.40  ? 181 GLN C CB  1 
ATOM   4234 C  CG  . GLN C 1 181 ? -16.037 40.909  -26.940 1.00 94.40  ? 181 GLN C CG  1 
ATOM   4235 C  CD  . GLN C 1 181 ? -14.560 40.874  -27.403 1.00 94.40  ? 181 GLN C CD  1 
ATOM   4236 O  OE1 . GLN C 1 181 ? -13.697 41.563  -26.839 1.00 94.40  ? 181 GLN C OE1 1 
ATOM   4237 N  NE2 . GLN C 1 181 ? -14.270 40.053  -28.406 1.00 94.40  ? 181 GLN C NE2 1 
ATOM   4238 N  N   . LEU C 1 182 ? -20.325 38.841  -28.160 1.00 51.06  ? 182 LEU C N   1 
ATOM   4239 C  CA  . LEU C 1 182 ? -21.629 38.814  -28.821 1.00 51.06  ? 182 LEU C CA  1 
ATOM   4240 C  C   . LEU C 1 182 ? -22.448 39.982  -28.324 1.00 51.06  ? 182 LEU C C   1 
ATOM   4241 O  O   . LEU C 1 182 ? -22.510 40.234  -27.125 1.00 51.06  ? 182 LEU C O   1 
ATOM   4242 C  CB  . LEU C 1 182 ? -22.374 37.516  -28.500 1.00 34.38  ? 182 LEU C CB  1 
ATOM   4243 C  CG  . LEU C 1 182 ? -23.781 37.343  -29.088 1.00 34.38  ? 182 LEU C CG  1 
ATOM   4244 C  CD1 . LEU C 1 182 ? -23.710 37.532  -30.582 1.00 34.38  ? 182 LEU C CD1 1 
ATOM   4245 C  CD2 . LEU C 1 182 ? -24.377 35.968  -28.759 1.00 34.38  ? 182 LEU C CD2 1 
ATOM   4246 N  N   . GLN C 1 183 ? -23.082 40.682  -29.254 1.00 51.03  ? 183 GLN C N   1 
ATOM   4247 C  CA  . GLN C 1 183 ? -23.898 41.839  -28.929 1.00 51.03  ? 183 GLN C CA  1 
ATOM   4248 C  C   . GLN C 1 183 ? -25.267 41.778  -29.583 1.00 51.03  ? 183 GLN C C   1 
ATOM   4249 O  O   . GLN C 1 183 ? -25.393 41.331  -30.721 1.00 51.03  ? 183 GLN C O   1 
ATOM   4250 C  CB  . GLN C 1 183 ? -23.180 43.122  -29.352 1.00 67.71  ? 183 GLN C CB  1 
ATOM   4251 C  CG  . GLN C 1 183 ? -21.985 43.472  -28.483 1.00 67.71  ? 183 GLN C CG  1 
ATOM   4252 C  CD  . GLN C 1 183 ? -21.216 44.689  -28.973 1.00 67.71  ? 183 GLN C CD  1 
ATOM   4253 O  OE1 . GLN C 1 183 ? -20.415 44.589  -29.903 1.00 67.71  ? 183 GLN C OE1 1 
ATOM   4254 N  NE2 . GLN C 1 183 ? -21.433 45.839  -28.328 1.00 67.71  ? 183 GLN C NE2 1 
ATOM   4255 N  N   . THR C 1 184 ? -26.283 42.204  -28.832 1.00 98.65  ? 184 THR C N   1 
ATOM   4256 C  CA  . THR C 1 184 ? -27.681 42.244  -29.278 1.00 98.65  ? 184 THR C CA  1 
ATOM   4257 C  C   . THR C 1 184 ? -28.640 42.384  -28.082 1.00 98.65  ? 184 THR C C   1 
ATOM   4258 O  O   . THR C 1 184 ? -28.534 43.380  -27.324 1.00 98.65  ? 184 THR C O   1 
ATOM   4259 C  CB  . THR C 1 184 ? -28.081 40.981  -30.111 1.00 55.83  ? 184 THR C CB  1 
ATOM   4260 O  OG1 . THR C 1 184 ? -29.276 41.260  -30.859 1.00 55.83  ? 184 THR C OG1 1 
ATOM   4261 C  CG2 . THR C 1 184 ? -28.300 39.749  -29.198 1.00 55.83  ? 184 THR C CG2 1 
ATOM   4262 N  N   . VAL D 2 1   ? 26.501  -12.848 -58.845 1.00 98.62  ? 130 VAL D N   1 
ATOM   4263 C  CA  . VAL D 2 1   ? 26.663  -12.525 -57.401 1.00 98.62  ? 130 VAL D CA  1 
ATOM   4264 C  C   . VAL D 2 1   ? 25.335  -12.543 -56.679 1.00 98.62  ? 130 VAL D C   1 
ATOM   4265 O  O   . VAL D 2 1   ? 24.413  -11.792 -57.012 1.00 98.62  ? 130 VAL D O   1 
ATOM   4266 C  CB  . VAL D 2 1   ? 27.346  -11.157 -57.196 1.00 72.21  ? 130 VAL D CB  1 
ATOM   4267 C  CG1 . VAL D 2 1   ? 27.096  -10.616 -55.801 1.00 72.21  ? 130 VAL D CG1 1 
ATOM   4268 C  CG2 . VAL D 2 1   ? 28.838  -11.285 -57.445 1.00 72.21  ? 130 VAL D CG2 1 
ATOM   4269 N  N   . ASP D 2 2   ? 25.239  -13.427 -55.697 1.00 77.40  ? 131 ASP D N   1 
ATOM   4270 C  CA  . ASP D 2 2   ? 24.028  -13.549 -54.907 1.00 77.40  ? 131 ASP D CA  1 
ATOM   4271 C  C   . ASP D 2 2   ? 24.167  -12.674 -53.663 1.00 77.40  ? 131 ASP D C   1 
ATOM   4272 O  O   . ASP D 2 2   ? 24.730  -13.089 -52.638 1.00 77.40  ? 131 ASP D O   1 
ATOM   4273 C  CB  . ASP D 2 2   ? 23.789  -15.014 -54.544 1.00 98.65  ? 131 ASP D CB  1 
ATOM   4274 C  CG  . ASP D 2 2   ? 23.691  -15.905 -55.781 1.00 98.65  ? 131 ASP D CG  1 
ATOM   4275 O  OD1 . ASP D 2 2   ? 22.965  -15.538 -56.733 1.00 98.65  ? 131 ASP D OD1 1 
ATOM   4276 O  OD2 . ASP D 2 2   ? 24.341  -16.972 -55.807 1.00 98.65  ? 131 ASP D OD2 1 
ATOM   4277 N  N   . LEU D 2 3   ? 23.731  -11.423 -53.801 1.00 65.85  ? 132 LEU D N   1 
ATOM   4278 C  CA  . LEU D 2 3   ? 23.783  -10.434 -52.732 1.00 65.85  ? 132 LEU D CA  1 
ATOM   4279 C  C   . LEU D 2 3   ? 22.585  -10.526 -51.781 1.00 65.85  ? 132 LEU D C   1 
ATOM   4280 O  O   . LEU D 2 3   ? 21.489  -10.944 -52.163 1.00 65.85  ? 132 LEU D O   1 
ATOM   4281 C  CB  . LEU D 2 3   ? 23.893  -9.020  -53.338 1.00 80.05  ? 132 LEU D CB  1 
ATOM   4282 C  CG  . LEU D 2 3   ? 24.132  -7.805  -52.415 1.00 80.05  ? 132 LEU D CG  1 
ATOM   4283 C  CD1 . LEU D 2 3   ? 24.807  -6.689  -53.205 1.00 80.05  ? 132 LEU D CD1 1 
ATOM   4284 C  CD2 . LEU D 2 3   ? 22.832  -7.330  -51.804 1.00 80.05  ? 132 LEU D CD2 1 
ATOM   4285 N  N   . VAL D 2 4   ? 22.821  -10.106 -50.541 1.00 73.66  ? 133 VAL D N   1 
ATOM   4286 C  CA  . VAL D 2 4   ? 21.782  -10.117 -49.519 1.00 73.66  ? 133 VAL D CA  1 
ATOM   4287 C  C   . VAL D 2 4   ? 21.749  -8.848  -48.668 1.00 73.66  ? 133 VAL D C   1 
ATOM   4288 O  O   . VAL D 2 4   ? 22.780  -8.303  -48.285 1.00 73.66  ? 133 VAL D O   1 
ATOM   4289 C  CB  . VAL D 2 4   ? 21.922  -11.364 -48.594 1.00 98.65  ? 133 VAL D CB  1 
ATOM   4290 C  CG1 . VAL D 2 4   ? 21.152  -11.170 -47.294 1.00 98.65  ? 133 VAL D CG1 1 
ATOM   4291 C  CG2 . VAL D 2 4   ? 21.382  -12.587 -49.311 1.00 98.65  ? 133 VAL D CG2 1 
ATOM   4292 N  N   . PHE D 2 5   ? 20.535  -8.367  -48.436 1.00 38.06  ? 134 PHE D N   1 
ATOM   4293 C  CA  . PHE D 2 5   ? 20.286  -7.201  -47.620 1.00 38.06  ? 134 PHE D CA  1 
ATOM   4294 C  C   . PHE D 2 5   ? 19.847  -7.730  -46.252 1.00 38.06  ? 134 PHE D C   1 
ATOM   4295 O  O   . PHE D 2 5   ? 18.948  -8.568  -46.141 1.00 38.06  ? 134 PHE D O   1 
ATOM   4296 C  CB  . PHE D 2 5   ? 19.176  -6.343  -48.240 1.00 48.59  ? 134 PHE D CB  1 
ATOM   4297 C  CG  . PHE D 2 5   ? 19.581  -5.633  -49.512 1.00 48.59  ? 134 PHE D CG  1 
ATOM   4298 C  CD1 . PHE D 2 5   ? 20.882  -5.182  -49.693 1.00 48.59  ? 134 PHE D CD1 1 
ATOM   4299 C  CD2 . PHE D 2 5   ? 18.657  -5.404  -50.527 1.00 48.59  ? 134 PHE D CD2 1 
ATOM   4300 C  CE1 . PHE D 2 5   ? 21.262  -4.513  -50.868 1.00 48.59  ? 134 PHE D CE1 1 
ATOM   4301 C  CE2 . PHE D 2 5   ? 19.033  -4.734  -51.708 1.00 48.59  ? 134 PHE D CE2 1 
ATOM   4302 C  CZ  . PHE D 2 5   ? 20.335  -4.291  -51.873 1.00 48.59  ? 134 PHE D CZ  1 
ATOM   4303 N  N   . LEU D 2 6   ? 20.535  -7.282  -45.216 1.00 39.96  ? 135 LEU D N   1 
ATOM   4304 C  CA  . LEU D 2 6   ? 20.238  -7.679  -43.846 1.00 39.96  ? 135 LEU D CA  1 
ATOM   4305 C  C   . LEU D 2 6   ? 19.946  -6.381  -43.060 1.00 39.96  ? 135 LEU D C   1 
ATOM   4306 O  O   . LEU D 2 6   ? 20.849  -5.764  -42.477 1.00 39.96  ? 135 LEU D O   1 
ATOM   4307 C  CB  . LEU D 2 6   ? 21.447  -8.430  -43.273 1.00 10.99  ? 135 LEU D CB  1 
ATOM   4308 C  CG  . LEU D 2 6   ? 21.376  -8.837  -41.803 1.00 10.99  ? 135 LEU D CG  1 
ATOM   4309 C  CD1 . LEU D 2 6   ? 20.290  -9.906  -41.555 1.00 10.99  ? 135 LEU D CD1 1 
ATOM   4310 C  CD2 . LEU D 2 6   ? 22.745  -9.308  -41.376 1.00 10.99  ? 135 LEU D CD2 1 
ATOM   4311 N  N   . PHE D 2 7   ? 18.683  -5.962  -43.065 1.00 45.54  ? 136 PHE D N   1 
ATOM   4312 C  CA  . PHE D 2 7   ? 18.291  -4.727  -42.403 1.00 45.54  ? 136 PHE D CA  1 
ATOM   4313 C  C   . PHE D 2 7   ? 17.791  -4.880  -40.980 1.00 45.54  ? 136 PHE D C   1 
ATOM   4314 O  O   . PHE D 2 7   ? 17.155  -5.886  -40.638 1.00 45.54  ? 136 PHE D O   1 
ATOM   4315 C  CB  . PHE D 2 7   ? 17.263  -3.988  -43.241 1.00 50.44  ? 136 PHE D CB  1 
ATOM   4316 C  CG  . PHE D 2 7   ? 16.045  -4.788  -43.527 1.00 50.44  ? 136 PHE D CG  1 
ATOM   4317 C  CD1 . PHE D 2 7   ? 16.141  -6.020  -44.150 1.00 50.44  ? 136 PHE D CD1 1 
ATOM   4318 C  CD2 . PHE D 2 7   ? 14.791  -4.304  -43.195 1.00 50.44  ? 136 PHE D CD2 1 
ATOM   4319 C  CE1 . PHE D 2 7   ? 15.006  -6.758  -44.437 1.00 50.44  ? 136 PHE D CE1 1 
ATOM   4320 C  CE2 . PHE D 2 7   ? 13.646  -5.035  -43.477 1.00 50.44  ? 136 PHE D CE2 1 
ATOM   4321 C  CZ  . PHE D 2 7   ? 13.755  -6.259  -44.101 1.00 50.44  ? 136 PHE D CZ  1 
ATOM   4322 N  N   . ASP D 2 8   ? 18.064  -3.832  -40.189 1.00 29.23  ? 137 ASP D N   1 
ATOM   4323 C  CA  . ASP D 2 8   ? 17.736  -3.692  -38.758 1.00 29.23  ? 137 ASP D CA  1 
ATOM   4324 C  C   . ASP D 2 8   ? 16.281  -3.281  -38.462 1.00 29.23  ? 137 ASP D C   1 
ATOM   4325 O  O   . ASP D 2 8   ? 15.903  -2.117  -38.599 1.00 29.23  ? 137 ASP D O   1 
ATOM   4326 C  CB  . ASP D 2 8   ? 18.725  -2.685  -38.150 1.00 29.27  ? 137 ASP D CB  1 
ATOM   4327 C  CG  . ASP D 2 8   ? 18.492  -2.407  -36.680 1.00 29.27  ? 137 ASP D CG  1 
ATOM   4328 O  OD1 . ASP D 2 8   ? 19.311  -1.666  -36.102 1.00 29.27  ? 137 ASP D OD1 1 
ATOM   4329 O  OD2 . ASP D 2 8   ? 17.512  -2.896  -36.092 1.00 29.27  ? 137 ASP D OD2 1 
ATOM   4330 N  N   . GLY D 2 9   ? 15.499  -4.232  -37.966 1.00 49.33  ? 138 GLY D N   1 
ATOM   4331 C  CA  . GLY D 2 9   ? 14.114  -3.951  -37.652 1.00 49.33  ? 138 GLY D CA  1 
ATOM   4332 C  C   . GLY D 2 9   ? 13.880  -3.883  -36.159 1.00 49.33  ? 138 GLY D C   1 
ATOM   4333 O  O   . GLY D 2 9   ? 12.858  -4.355  -35.665 1.00 49.33  ? 138 GLY D O   1 
ATOM   4334 N  N   . SER D 2 10  ? 14.831  -3.299  -35.440 1.00 60.10  ? 139 SER D N   1 
ATOM   4335 C  CA  . SER D 2 10  ? 14.743  -3.161  -33.986 1.00 60.10  ? 139 SER D CA  1 
ATOM   4336 C  C   . SER D 2 10  ? 14.135  -1.840  -33.554 1.00 60.10  ? 139 SER D C   1 
ATOM   4337 O  O   . SER D 2 10  ? 14.190  -0.860  -34.283 1.00 60.10  ? 139 SER D O   1 
ATOM   4338 C  CB  . SER D 2 10  ? 16.127  -3.307  -33.352 1.00 22.48  ? 139 SER D CB  1 
ATOM   4339 O  OG  . SER D 2 10  ? 16.924  -2.150  -33.504 1.00 22.48  ? 139 SER D OG  1 
ATOM   4340 N  N   . MET D 2 11  ? 13.600  -1.811  -32.334 1.00 25.05  ? 140 MET D N   1 
ATOM   4341 C  CA  . MET D 2 11  ? 12.982  -0.613  -31.743 1.00 25.05  ? 140 MET D CA  1 
ATOM   4342 C  C   . MET D 2 11  ? 13.834  0.648   -31.829 1.00 25.05  ? 140 MET D C   1 
ATOM   4343 O  O   . MET D 2 11  ? 13.340  1.721   -32.175 1.00 25.05  ? 140 MET D O   1 
ATOM   4344 C  CB  . MET D 2 11  ? 12.641  -0.851  -30.265 1.00 55.50  ? 140 MET D CB  1 
ATOM   4345 C  CG  . MET D 2 11  ? 12.314  0.433   -29.513 1.00 55.50  ? 140 MET D CG  1 
ATOM   4346 S  SD  . MET D 2 11  ? 11.739  0.268   -27.812 1.00 55.50  ? 140 MET D SD  1 
ATOM   4347 C  CE  . MET D 2 11  ? 10.117  -0.448  -28.095 1.00 55.50  ? 140 MET D CE  1 
ATOM   4348 N  N   . SER D 2 12  ? 15.113  0.490   -31.528 1.00 38.24  ? 141 SER D N   1 
ATOM   4349 C  CA  . SER D 2 12  ? 16.073  1.567   -31.524 1.00 38.24  ? 141 SER D CA  1 
ATOM   4350 C  C   . SER D 2 12  ? 16.191  2.501   -32.705 1.00 38.24  ? 141 SER D C   1 
ATOM   4351 O  O   . SER D 2 12  ? 16.955  3.477   -32.665 1.00 38.24  ? 141 SER D O   1 
ATOM   4352 C  CB  . SER D 2 12  ? 17.418  1.030   -31.154 1.00 42.88  ? 141 SER D CB  1 
ATOM   4353 O  OG  . SER D 2 12  ? 18.018  0.155   -32.092 1.00 42.88  ? 141 SER D OG  1 
ATOM   4354 N  N   . LEU D 2 13  ? 15.491  2.180   -33.784 1.00 45.18  ? 142 LEU D N   1 
ATOM   4355 C  CA  . LEU D 2 13  ? 15.496  3.043   -34.949 1.00 45.18  ? 142 LEU D CA  1 
ATOM   4356 C  C   . LEU D 2 13  ? 14.169  3.797   -34.976 1.00 45.18  ? 142 LEU D C   1 
ATOM   4357 O  O   . LEU D 2 13  ? 13.107  3.216   -34.700 1.00 45.18  ? 142 LEU D O   1 
ATOM   4358 C  CB  . LEU D 2 13  ? 15.669  2.229   -36.231 1.00 32.35  ? 142 LEU D CB  1 
ATOM   4359 C  CG  . LEU D 2 13  ? 17.027  1.586   -36.523 1.00 32.35  ? 142 LEU D CG  1 
ATOM   4360 C  CD1 . LEU D 2 13  ? 16.932  0.883   -37.880 1.00 32.35  ? 142 LEU D CD1 1 
ATOM   4361 C  CD2 . LEU D 2 13  ? 18.156  2.637   -36.511 1.00 32.35  ? 142 LEU D CD2 1 
ATOM   4362 N  N   . GLN D 2 14  ? 14.248  5.100   -35.257 1.00 59.54  ? 143 GLN D N   1 
ATOM   4363 C  CA  . GLN D 2 14  ? 13.067  5.959   -35.332 1.00 59.54  ? 143 GLN D CA  1 
ATOM   4364 C  C   . GLN D 2 14  ? 12.140  5.319   -36.354 1.00 59.54  ? 143 GLN D C   1 
ATOM   4365 O  O   . GLN D 2 14  ? 12.592  4.871   -37.406 1.00 59.54  ? 143 GLN D O   1 
ATOM   4366 C  CB  . GLN D 2 14  ? 13.430  7.371   -35.815 1.00 80.12  ? 143 GLN D CB  1 
ATOM   4367 C  CG  . GLN D 2 14  ? 14.639  8.029   -35.166 1.00 80.12  ? 143 GLN D CG  1 
ATOM   4368 C  CD  . GLN D 2 14  ? 14.393  8.508   -33.767 1.00 80.12  ? 143 GLN D CD  1 
ATOM   4369 O  OE1 . GLN D 2 14  ? 13.253  8.579   -33.307 1.00 80.12  ? 143 GLN D OE1 1 
ATOM   4370 N  NE2 . GLN D 2 14  ? 15.470  8.856   -33.075 1.00 80.12  ? 143 GLN D NE2 1 
ATOM   4371 N  N   . PRO D 2 15  ? 10.831  5.284   -36.064 1.00 35.29  ? 144 PRO D N   1 
ATOM   4372 C  CA  . PRO D 2 15  ? 9.822   4.693   -36.952 1.00 35.29  ? 144 PRO D CA  1 
ATOM   4373 C  C   . PRO D 2 15  ? 9.953   5.105   -38.418 1.00 35.29  ? 144 PRO D C   1 
ATOM   4374 O  O   . PRO D 2 15  ? 9.451   4.428   -39.324 1.00 35.29  ? 144 PRO D O   1 
ATOM   4375 C  CB  . PRO D 2 15  ? 8.500   5.145   -36.324 1.00 97.66  ? 144 PRO D CB  1 
ATOM   4376 C  CG  . PRO D 2 15  ? 8.889   6.331   -35.452 1.00 97.66  ? 144 PRO D CG  1 
ATOM   4377 C  CD  . PRO D 2 15  ? 10.195  5.898   -34.888 1.00 97.66  ? 144 PRO D CD  1 
ATOM   4378 N  N   . ASP D 2 16  ? 10.661  6.205   -38.643 1.00 39.94  ? 145 ASP D N   1 
ATOM   4379 C  CA  . ASP D 2 16  ? 10.881  6.704   -39.986 1.00 39.94  ? 145 ASP D CA  1 
ATOM   4380 C  C   . ASP D 2 16  ? 12.081  6.016   -40.586 1.00 39.94  ? 145 ASP D C   1 
ATOM   4381 O  O   . ASP D 2 16  ? 11.980  5.461   -41.672 1.00 39.94  ? 145 ASP D O   1 
ATOM   4382 C  CB  . ASP D 2 16  ? 11.088  8.221   -39.983 1.00 78.96  ? 145 ASP D CB  1 
ATOM   4383 C  CG  . ASP D 2 16  ? 12.168  8.665   -39.021 1.00 78.96  ? 145 ASP D CG  1 
ATOM   4384 O  OD1 . ASP D 2 16  ? 11.808  9.061   -37.898 1.00 78.96  ? 145 ASP D OD1 1 
ATOM   4385 O  OD2 . ASP D 2 16  ? 13.365  8.634   -39.388 1.00 78.96  ? 145 ASP D OD2 1 
ATOM   4386 N  N   . GLU D 2 17  ? 13.189  6.008   -39.840 1.00 43.60  ? 146 GLU D N   1 
ATOM   4387 C  CA  . GLU D 2 17  ? 14.462  5.402   -40.247 1.00 43.60  ? 146 GLU D CA  1 
ATOM   4388 C  C   . GLU D 2 17  ? 14.343  4.019   -40.886 1.00 43.60  ? 146 GLU D C   1 
ATOM   4389 O  O   . GLU D 2 17  ? 15.244  3.583   -41.601 1.00 43.60  ? 146 GLU D O   1 
ATOM   4390 C  CB  . GLU D 2 17  ? 15.408  5.334   -39.052 1.00 60.23  ? 146 GLU D CB  1 
ATOM   4391 C  CG  . GLU D 2 17  ? 15.813  6.700   -38.507 1.00 60.23  ? 146 GLU D CG  1 
ATOM   4392 C  CD  . GLU D 2 17  ? 16.595  6.620   -37.193 1.00 60.23  ? 146 GLU D CD  1 
ATOM   4393 O  OE1 . GLU D 2 17  ? 16.532  5.568   -36.513 1.00 60.23  ? 146 GLU D OE1 1 
ATOM   4394 O  OE2 . GLU D 2 17  ? 17.260  7.624   -36.826 1.00 60.23  ? 146 GLU D OE2 1 
ATOM   4395 N  N   . PHE D 2 18  ? 13.226  3.344   -40.616 1.00 38.16  ? 147 PHE D N   1 
ATOM   4396 C  CA  . PHE D 2 18  ? 12.918  2.020   -41.152 1.00 38.16  ? 147 PHE D CA  1 
ATOM   4397 C  C   . PHE D 2 18  ? 12.669  2.161   -42.641 1.00 38.16  ? 147 PHE D C   1 
ATOM   4398 O  O   . PHE D 2 18  ? 13.194  1.382   -43.441 1.00 38.16  ? 147 PHE D O   1 
ATOM   4399 C  CB  . PHE D 2 18  ? 11.645  1.484   -40.478 1.00 42.53  ? 147 PHE D CB  1 
ATOM   4400 C  CG  . PHE D 2 18  ? 11.259  0.083   -40.891 1.00 42.53  ? 147 PHE D CG  1 
ATOM   4401 C  CD1 . PHE D 2 18  ? 12.167  -0.967  -40.790 1.00 42.53  ? 147 PHE D CD1 1 
ATOM   4402 C  CD2 . PHE D 2 18  ? 9.966   -0.194  -41.334 1.00 42.53  ? 147 PHE D CD2 1 
ATOM   4403 C  CE1 . PHE D 2 18  ? 11.790  -2.271  -41.117 1.00 42.53  ? 147 PHE D CE1 1 
ATOM   4404 C  CE2 . PHE D 2 18  ? 9.583   -1.496  -41.664 1.00 42.53  ? 147 PHE D CE2 1 
ATOM   4405 C  CZ  . PHE D 2 18  ? 10.496  -2.534  -41.555 1.00 42.53  ? 147 PHE D CZ  1 
ATOM   4406 N  N   . GLN D 2 19  ? 11.859  3.166   -42.988 1.00 53.51  ? 148 GLN D N   1 
ATOM   4407 C  CA  . GLN D 2 19  ? 11.488  3.471   -44.365 1.00 53.51  ? 148 GLN D CA  1 
ATOM   4408 C  C   . GLN D 2 19  ? 12.596  4.209   -45.117 1.00 53.51  ? 148 GLN D C   1 
ATOM   4409 O  O   . GLN D 2 19  ? 12.648  4.160   -46.335 1.00 53.51  ? 148 GLN D O   1 
ATOM   4410 C  CB  . GLN D 2 19  ? 10.183  4.269   -44.395 1.00 88.14  ? 148 GLN D CB  1 
ATOM   4411 C  CG  . GLN D 2 19  ? 9.327   4.041   -45.646 1.00 88.14  ? 148 GLN D CG  1 
ATOM   4412 C  CD  . GLN D 2 19  ? 8.764   2.613   -45.766 1.00 88.14  ? 148 GLN D CD  1 
ATOM   4413 O  OE1 . GLN D 2 19  ? 8.376   1.994   -44.771 1.00 88.14  ? 148 GLN D OE1 1 
ATOM   4414 N  NE2 . GLN D 2 19  ? 8.701   2.101   -46.997 1.00 88.14  ? 148 GLN D NE2 1 
ATOM   4415 N  N   . LYS D 2 20  ? 13.478  4.896   -44.395 1.00 68.30  ? 149 LYS D N   1 
ATOM   4416 C  CA  . LYS D 2 20  ? 14.600  5.597   -45.028 1.00 68.30  ? 149 LYS D CA  1 
ATOM   4417 C  C   . LYS D 2 20  ? 15.621  4.540   -45.442 1.00 68.30  ? 149 LYS D C   1 
ATOM   4418 O  O   . LYS D 2 20  ? 16.395  4.737   -46.379 1.00 68.30  ? 149 LYS D O   1 
ATOM   4419 C  CB  . LYS D 2 20  ? 15.261  6.586   -44.058 1.00 71.99  ? 149 LYS D CB  1 
ATOM   4420 C  CG  . LYS D 2 20  ? 14.315  7.605   -43.427 1.00 71.99  ? 149 LYS D CG  1 
ATOM   4421 C  CD  . LYS D 2 20  ? 13.653  8.500   -44.462 1.00 71.99  ? 149 LYS D CD  1 
ATOM   4422 C  CE  . LYS D 2 20  ? 12.634  9.417   -43.810 1.00 71.99  ? 149 LYS D CE  1 
ATOM   4423 N  NZ  . LYS D 2 20  ? 11.911  10.231  -44.811 1.00 71.99  ? 149 LYS D NZ  1 
ATOM   4424 N  N   . ILE D 2 21  ? 15.621  3.432   -44.698 1.00 69.43  ? 150 ILE D N   1 
ATOM   4425 C  CA  . ILE D 2 21  ? 16.497  2.286   -44.940 1.00 69.43  ? 150 ILE D CA  1 
ATOM   4426 C  C   . ILE D 2 21  ? 16.081  1.596   -46.236 1.00 69.43  ? 150 ILE D C   1 
ATOM   4427 O  O   . ILE D 2 21  ? 16.913  1.328   -47.108 1.00 69.43  ? 150 ILE D O   1 
ATOM   4428 C  CB  . ILE D 2 21  ? 16.448  1.266   -43.741 1.00 81.20  ? 150 ILE D CB  1 
ATOM   4429 C  CG1 . ILE D 2 21  ? 17.540  1.587   -42.719 1.00 81.20  ? 150 ILE D CG1 1 
ATOM   4430 C  CG2 . ILE D 2 21  ? 16.602  -0.175  -44.218 1.00 81.20  ? 150 ILE D CG2 1 
ATOM   4431 C  CD1 . ILE D 2 21  ? 17.663  0.566   -41.617 1.00 81.20  ? 150 ILE D CD1 1 
ATOM   4432 N  N   . LEU D 2 22  ? 14.783  1.335   -46.360 1.00 60.24  ? 151 LEU D N   1 
ATOM   4433 C  CA  . LEU D 2 22  ? 14.238  0.680   -47.539 1.00 60.24  ? 151 LEU D CA  1 
ATOM   4434 C  C   . LEU D 2 22  ? 14.598  1.467   -48.805 1.00 60.24  ? 151 LEU D C   1 
ATOM   4435 O  O   . LEU D 2 22  ? 15.032  0.899   -49.811 1.00 60.24  ? 151 LEU D O   1 
ATOM   4436 C  CB  . LEU D 2 22  ? 12.721  0.551   -47.407 1.00 14.02  ? 151 LEU D CB  1 
ATOM   4437 C  CG  . LEU D 2 22  ? 12.126  0.130   -46.065 1.00 14.02  ? 151 LEU D CG  1 
ATOM   4438 C  CD1 . LEU D 2 22  ? 10.729  -0.467  -46.314 1.00 14.02  ? 151 LEU D CD1 1 
ATOM   4439 C  CD2 . LEU D 2 22  ? 13.008  -0.888  -45.389 1.00 14.02  ? 151 LEU D CD2 1 
ATOM   4440 N  N   . ASP D 2 23  ? 14.438  2.785   -48.731 1.00 95.88  ? 152 ASP D N   1 
ATOM   4441 C  CA  . ASP D 2 23  ? 14.761  3.669   -49.840 1.00 95.88  ? 152 ASP D CA  1 
ATOM   4442 C  C   . ASP D 2 23  ? 16.165  3.341   -50.345 1.00 95.88  ? 152 ASP D C   1 
ATOM   4443 O  O   . ASP D 2 23  ? 16.388  3.233   -51.549 1.00 95.88  ? 152 ASP D O   1 
ATOM   4444 C  CB  . ASP D 2 23  ? 14.699  5.128   -49.375 1.00 48.43  ? 152 ASP D CB  1 
ATOM   4445 C  CG  . ASP D 2 23  ? 13.312  5.541   -48.920 1.00 48.43  ? 152 ASP D CG  1 
ATOM   4446 O  OD1 . ASP D 2 23  ? 13.186  6.681   -48.431 1.00 48.43  ? 152 ASP D OD1 1 
ATOM   4447 O  OD2 . ASP D 2 23  ? 12.353  4.745   -49.063 1.00 48.43  ? 152 ASP D OD2 1 
ATOM   4448 N  N   . PHE D 2 24  ? 17.095  3.145   -49.411 1.00 58.81  ? 153 PHE D N   1 
ATOM   4449 C  CA  . PHE D 2 24  ? 18.471  2.810   -49.757 1.00 58.81  ? 153 PHE D CA  1 
ATOM   4450 C  C   . PHE D 2 24  ? 18.541  1.446   -50.393 1.00 58.81  ? 153 PHE D C   1 
ATOM   4451 O  O   . PHE D 2 24  ? 19.303  1.242   -51.332 1.00 58.81  ? 153 PHE D O   1 
ATOM   4452 C  CB  . PHE D 2 24  ? 19.381  2.798   -48.532 1.00 81.39  ? 153 PHE D CB  1 
ATOM   4453 C  CG  . PHE D 2 24  ? 20.720  2.167   -48.793 1.00 81.39  ? 153 PHE D CG  1 
ATOM   4454 C  CD1 . PHE D 2 24  ? 21.771  2.926   -49.296 1.00 81.39  ? 153 PHE D CD1 1 
ATOM   4455 C  CD2 . PHE D 2 24  ? 20.904  0.797   -48.614 1.00 81.39  ? 153 PHE D CD2 1 
ATOM   4456 C  CE1 . PHE D 2 24  ? 22.985  2.335   -49.614 1.00 81.39  ? 153 PHE D CE1 1 
ATOM   4457 C  CE2 . PHE D 2 24  ? 22.111  0.195   -48.930 1.00 81.39  ? 153 PHE D CE2 1 
ATOM   4458 C  CZ  . PHE D 2 24  ? 23.153  0.961   -49.435 1.00 81.39  ? 153 PHE D CZ  1 
ATOM   4459 N  N   . MET D 2 25  ? 17.843  0.481   -49.804 1.00 29.82  ? 154 MET D N   1 
ATOM   4460 C  CA  . MET D 2 25  ? 17.852  -0.848  -50.372 1.00 29.82  ? 154 MET D CA  1 
ATOM   4461 C  C   . MET D 2 25  ? 17.527  -0.682  -51.856 1.00 29.82  ? 154 MET D C   1 
ATOM   4462 O  O   . MET D 2 25  ? 18.278  -1.133  -52.718 1.00 29.82  ? 154 MET D O   1 
ATOM   4463 C  CB  . MET D 2 25  ? 16.836  -1.759  -49.680 1.00 83.74  ? 154 MET D CB  1 
ATOM   4464 C  CG  . MET D 2 25  ? 17.142  -2.026  -48.215 1.00 83.74  ? 154 MET D CG  1 
ATOM   4465 S  SD  . MET D 2 25  ? 16.578  -3.651  -47.640 1.00 83.74  ? 154 MET D SD  1 
ATOM   4466 C  CE  . MET D 2 25  ? 14.783  -3.471  -47.643 1.00 83.74  ? 154 MET D CE  1 
ATOM   4467 N  N   . LYS D 2 26  ? 16.497  0.104   -52.147 1.00 82.93  ? 155 LYS D N   1 
ATOM   4468 C  CA  . LYS D 2 26  ? 16.090  0.358   -53.528 1.00 82.93  ? 155 LYS D CA  1 
ATOM   4469 C  C   . LYS D 2 26  ? 17.123  1.207   -54.306 1.00 82.93  ? 155 LYS D C   1 
ATOM   4470 O  O   . LYS D 2 26  ? 17.260  1.064   -55.516 1.00 82.93  ? 155 LYS D O   1 
ATOM   4471 C  CB  . LYS D 2 26  ? 14.712  1.018   -53.538 1.00 98.65  ? 155 LYS D CB  1 
ATOM   4472 C  CG  . LYS D 2 26  ? 13.665  0.201   -52.778 1.00 98.65  ? 155 LYS D CG  1 
ATOM   4473 C  CD  . LYS D 2 26  ? 12.383  0.981   -52.507 1.00 98.65  ? 155 LYS D CD  1 
ATOM   4474 C  CE  . LYS D 2 26  ? 11.450  0.203   -51.584 1.00 98.65  ? 155 LYS D CE  1 
ATOM   4475 N  NZ  . LYS D 2 26  ? 10.197  0.940   -51.238 1.00 98.65  ? 155 LYS D NZ  1 
ATOM   4476 N  N   . ASP D 2 27  ? 17.876  2.052   -53.604 1.00 98.65  ? 156 ASP D N   1 
ATOM   4477 C  CA  . ASP D 2 27  ? 18.896  2.891   -54.243 1.00 98.65  ? 156 ASP D CA  1 
ATOM   4478 C  C   . ASP D 2 27  ? 19.966  2.026   -54.928 1.00 98.65  ? 156 ASP D C   1 
ATOM   4479 O  O   . ASP D 2 27  ? 20.638  2.472   -55.850 1.00 98.65  ? 156 ASP D O   1 
ATOM   4480 C  CB  . ASP D 2 27  ? 19.538  3.835   -53.202 1.00 98.65  ? 156 ASP D CB  1 
ATOM   4481 C  CG  . ASP D 2 27  ? 20.531  4.832   -53.825 1.00 98.65  ? 156 ASP D CG  1 
ATOM   4482 O  OD1 . ASP D 2 27  ? 20.094  5.920   -54.271 1.00 98.65  ? 156 ASP D OD1 1 
ATOM   4483 O  OD2 . ASP D 2 27  ? 21.756  4.546   -53.833 1.00 98.65  ? 156 ASP D OD2 1 
ATOM   4484 N  N   . VAL D 2 28  ? 20.084  0.775   -54.489 1.00 95.26  ? 157 VAL D N   1 
ATOM   4485 C  CA  . VAL D 2 28  ? 21.089  -0.125  -55.064 1.00 95.26  ? 157 VAL D CA  1 
ATOM   4486 C  C   . VAL D 2 28  ? 20.413  -1.229  -55.858 1.00 95.26  ? 157 VAL D C   1 
ATOM   4487 O  O   . VAL D 2 28  ? 20.789  -1.494  -57.009 1.00 95.26  ? 157 VAL D O   1 
ATOM   4488 C  CB  . VAL D 2 28  ? 21.994  -0.784  -54.000 1.00 98.65  ? 157 VAL D CB  1 
ATOM   4489 C  CG1 . VAL D 2 28  ? 23.292  -1.255  -54.629 1.00 98.65  ? 157 VAL D CG1 1 
ATOM   4490 C  CG2 . VAL D 2 28  ? 22.278  0.173   -52.833 1.00 98.65  ? 157 VAL D CG2 1 
ATOM   4491 N  N   . MET D 2 29  ? 19.395  -1.843  -55.258 1.00 98.65  ? 158 MET D N   1 
ATOM   4492 C  CA  . MET D 2 29  ? 18.639  -2.940  -55.854 1.00 98.65  ? 158 MET D CA  1 
ATOM   4493 C  C   . MET D 2 29  ? 17.974  -2.621  -57.197 1.00 98.65  ? 158 MET D C   1 
ATOM   4494 O  O   . MET D 2 29  ? 18.438  -3.086  -58.242 1.00 98.65  ? 158 MET D O   1 
ATOM   4495 C  CB  . MET D 2 29  ? 17.587  -3.441  -54.865 1.00 87.55  ? 158 MET D CB  1 
ATOM   4496 C  CG  . MET D 2 29  ? 16.788  -4.631  -55.366 1.00 87.55  ? 158 MET D CG  1 
ATOM   4497 S  SD  . MET D 2 29  ? 15.629  -5.220  -54.123 1.00 87.55  ? 158 MET D SD  1 
ATOM   4498 C  CE  . MET D 2 29  ? 16.638  -6.380  -53.252 1.00 87.55  ? 158 MET D CE  1 
ATOM   4499 N  N   . LYS D 2 30  ? 16.872  -1.867  -57.168 1.00 69.90  ? 159 LYS D N   1 
ATOM   4500 C  CA  . LYS D 2 30  ? 16.133  -1.504  -58.390 1.00 69.90  ? 159 LYS D CA  1 
ATOM   4501 C  C   . LYS D 2 30  ? 16.999  -0.731  -59.392 1.00 69.90  ? 159 LYS D C   1 
ATOM   4502 O  O   . LYS D 2 30  ? 16.782  -0.809  -60.607 1.00 69.90  ? 159 LYS D O   1 
ATOM   4503 C  CB  . LYS D 2 30  ? 14.871  -0.688  -58.050 1.00 79.49  ? 159 LYS D CB  1 
ATOM   4504 C  CG  . LYS D 2 30  ? 13.871  -0.585  -59.204 1.00 79.49  ? 159 LYS D CG  1 
ATOM   4505 C  CD  . LYS D 2 30  ? 13.351  -1.977  -59.570 1.00 79.49  ? 159 LYS D CD  1 
ATOM   4506 C  CE  . LYS D 2 30  ? 12.574  -1.982  -60.870 1.00 79.49  ? 159 LYS D CE  1 
ATOM   4507 N  NZ  . LYS D 2 30  ? 12.097  -3.362  -61.201 1.00 79.49  ? 159 LYS D NZ  1 
ATOM   4508 N  N   . LYS D 2 31  ? 17.963  0.033   -58.881 1.00 98.65  ? 160 LYS D N   1 
ATOM   4509 C  CA  . LYS D 2 31  ? 18.848  0.783   -59.750 1.00 98.65  ? 160 LYS D CA  1 
ATOM   4510 C  C   . LYS D 2 31  ? 19.718  -0.200  -60.510 1.00 98.65  ? 160 LYS D C   1 
ATOM   4511 O  O   . LYS D 2 31  ? 20.074  0.044   -61.662 1.00 98.65  ? 160 LYS D O   1 
ATOM   4512 C  CB  . LYS D 2 31  ? 19.683  1.781   -58.956 1.00 98.65  ? 160 LYS D CB  1 
ATOM   4513 C  CG  . LYS D 2 31  ? 18.871  2.979   -58.474 1.00 98.65  ? 160 LYS D CG  1 
ATOM   4514 C  CD  . LYS D 2 31  ? 19.772  4.140   -58.059 1.00 98.65  ? 160 LYS D CD  1 
ATOM   4515 C  CE  . LYS D 2 31  ? 18.972  5.351   -57.586 1.00 98.65  ? 160 LYS D CE  1 
ATOM   4516 N  NZ  . LYS D 2 31  ? 19.869  6.449   -57.118 1.00 98.65  ? 160 LYS D NZ  1 
ATOM   4517 N  N   . CYS D 2 32  ? 20.016  -1.333  -59.878 1.00 50.62  ? 161 CYS D N   1 
ATOM   4518 C  CA  . CYS D 2 32  ? 20.808  -2.370  -60.529 1.00 50.62  ? 161 CYS D CA  1 
ATOM   4519 C  C   . CYS D 2 32  ? 19.977  -3.639  -60.779 1.00 50.62  ? 161 CYS D C   1 
ATOM   4520 O  O   . CYS D 2 32  ? 20.396  -4.755  -60.452 1.00 50.62  ? 161 CYS D O   1 
ATOM   4521 C  CB  . CYS D 2 32  ? 22.081  -2.678  -59.731 1.00 98.65  ? 161 CYS D CB  1 
ATOM   4522 S  SG  . CYS D 2 32  ? 23.065  -1.199  -59.308 1.00 98.65  ? 161 CYS D SG  1 
ATOM   4523 N  N   . SER D 2 33  ? 18.807  -3.449  -61.395 1.00 57.61  ? 162 SER D N   1 
ATOM   4524 C  CA  . SER D 2 33  ? 17.884  -4.547  -61.712 1.00 57.61  ? 162 SER D CA  1 
ATOM   4525 C  C   . SER D 2 33  ? 18.373  -5.364  -62.904 1.00 57.61  ? 162 SER D C   1 
ATOM   4526 O  O   . SER D 2 33  ? 17.682  -6.262  -63.389 1.00 57.61  ? 162 SER D O   1 
ATOM   4527 C  CB  . SER D 2 33  ? 16.463  -4.014  -61.983 1.00 98.65  ? 162 SER D CB  1 
ATOM   4528 O  OG  . SER D 2 33  ? 16.410  -3.182  -63.133 1.00 98.65  ? 162 SER D OG  1 
ATOM   4529 N  N   . ASN D 2 34  ? 19.569  -5.031  -63.373 1.00 86.14  ? 163 ASN D N   1 
ATOM   4530 C  CA  . ASN D 2 34  ? 20.197  -5.717  -64.493 1.00 86.14  ? 163 ASN D CA  1 
ATOM   4531 C  C   . ASN D 2 34  ? 20.333  -7.212  -64.196 1.00 86.14  ? 163 ASN D C   1 
ATOM   4532 O  O   . ASN D 2 34  ? 20.552  -7.611  -63.048 1.00 86.14  ? 163 ASN D O   1 
ATOM   4533 C  CB  . ASN D 2 34  ? 21.579  -5.111  -64.787 1.00 98.65  ? 163 ASN D CB  1 
ATOM   4534 C  CG  . ASN D 2 34  ? 22.044  -4.142  -63.702 1.00 98.65  ? 163 ASN D CG  1 
ATOM   4535 O  OD1 . ASN D 2 34  ? 23.122  -4.296  -63.119 1.00 98.65  ? 163 ASN D OD1 1 
ATOM   4536 N  ND2 . ASN D 2 34  ? 21.232  -3.128  -63.440 1.00 98.65  ? 163 ASN D ND2 1 
ATOM   4537 N  N   . THR D 2 35  ? 20.204  -8.030  -65.238 1.00 94.20  ? 164 THR D N   1 
ATOM   4538 C  CA  . THR D 2 35  ? 20.298  -9.482  -65.109 1.00 94.20  ? 164 THR D CA  1 
ATOM   4539 C  C   . THR D 2 35  ? 21.604  -9.931  -64.448 1.00 94.20  ? 164 THR D C   1 
ATOM   4540 O  O   . THR D 2 35  ? 22.553  -9.144  -64.326 1.00 94.20  ? 164 THR D O   1 
ATOM   4541 C  CB  . THR D 2 35  ? 20.124  -10.172 -66.486 1.00 98.65  ? 164 THR D CB  1 
ATOM   4542 O  OG1 . THR D 2 35  ? 20.063  -11.594 -66.306 1.00 98.65  ? 164 THR D OG1 1 
ATOM   4543 C  CG2 . THR D 2 35  ? 21.274  -9.807  -67.434 1.00 98.65  ? 164 THR D CG2 1 
ATOM   4544 N  N   . SER D 2 36  ? 21.632  -11.193 -64.010 1.00 85.79  ? 165 SER D N   1 
ATOM   4545 C  CA  . SER D 2 36  ? 22.794  -11.784 -63.330 1.00 85.79  ? 165 SER D CA  1 
ATOM   4546 C  C   . SER D 2 36  ? 23.060  -11.055 -62.012 1.00 85.79  ? 165 SER D C   1 
ATOM   4547 O  O   . SER D 2 36  ? 24.209  -10.880 -61.598 1.00 85.79  ? 165 SER D O   1 
ATOM   4548 C  CB  . SER D 2 36  ? 24.052  -11.760 -64.223 1.00 98.65  ? 165 SER D CB  1 
ATOM   4549 O  OG  . SER D 2 36  ? 24.019  -12.754 -65.240 1.00 98.65  ? 165 SER D OG  1 
ATOM   4550 N  N   . TYR D 2 37  ? 21.977  -10.632 -61.365 1.00 98.65  ? 166 TYR D N   1 
ATOM   4551 C  CA  . TYR D 2 37  ? 22.052  -9.916  -60.103 1.00 98.65  ? 166 TYR D CA  1 
ATOM   4552 C  C   . TYR D 2 37  ? 20.898  -10.323 -59.201 1.00 98.65  ? 166 TYR D C   1 
ATOM   4553 O  O   . TYR D 2 37  ? 19.767  -9.857  -59.364 1.00 98.65  ? 166 TYR D O   1 
ATOM   4554 C  CB  . TYR D 2 37  ? 22.034  -8.407  -60.346 1.00 98.55  ? 166 TYR D CB  1 
ATOM   4555 C  CG  . TYR D 2 37  ? 23.162  -7.679  -59.655 1.00 98.55  ? 166 TYR D CG  1 
ATOM   4556 C  CD1 . TYR D 2 37  ? 23.876  -8.285  -58.615 1.00 98.55  ? 166 TYR D CD1 1 
ATOM   4557 C  CD2 . TYR D 2 37  ? 23.519  -6.383  -60.032 1.00 98.55  ? 166 TYR D CD2 1 
ATOM   4558 C  CE1 . TYR D 2 37  ? 24.919  -7.621  -57.968 1.00 98.55  ? 166 TYR D CE1 1 
ATOM   4559 C  CE2 . TYR D 2 37  ? 24.562  -5.706  -59.388 1.00 98.55  ? 166 TYR D CE2 1 
ATOM   4560 C  CZ  . TYR D 2 37  ? 25.255  -6.333  -58.358 1.00 98.55  ? 166 TYR D CZ  1 
ATOM   4561 O  OH  . TYR D 2 37  ? 26.278  -5.677  -57.715 1.00 98.55  ? 166 TYR D OH  1 
ATOM   4562 N  N   . GLN D 2 38  ? 21.202  -11.216 -58.261 1.00 98.65  ? 167 GLN D N   1 
ATOM   4563 C  CA  . GLN D 2 38  ? 20.226  -11.744 -57.304 1.00 98.65  ? 167 GLN D CA  1 
ATOM   4564 C  C   . GLN D 2 38  ? 20.345  -11.118 -55.903 1.00 98.65  ? 167 GLN D C   1 
ATOM   4565 O  O   . GLN D 2 38  ? 21.446  -10.815 -55.432 1.00 98.65  ? 167 GLN D O   1 
ATOM   4566 C  CB  . GLN D 2 38  ? 20.338  -13.281 -57.214 1.00 98.65  ? 167 GLN D CB  1 
ATOM   4567 C  CG  . GLN D 2 38  ? 19.880  -14.066 -58.466 1.00 98.65  ? 167 GLN D CG  1 
ATOM   4568 C  CD  . GLN D 2 38  ? 20.911  -14.094 -59.604 1.00 98.65  ? 167 GLN D CD  1 
ATOM   4569 O  OE1 . GLN D 2 38  ? 20.616  -13.705 -60.744 1.00 98.65  ? 167 GLN D OE1 1 
ATOM   4570 N  NE2 . GLN D 2 38  ? 22.113  -14.585 -59.304 1.00 98.65  ? 167 GLN D NE2 1 
ATOM   4571 N  N   . PHE D 2 39  ? 19.202  -10.930 -55.246 1.00 58.98  ? 168 PHE D N   1 
ATOM   4572 C  CA  . PHE D 2 39  ? 19.157  -10.339 -53.910 1.00 58.98  ? 168 PHE D CA  1 
ATOM   4573 C  C   . PHE D 2 39  ? 18.172  -11.041 -52.965 1.00 58.98  ? 168 PHE D C   1 
ATOM   4574 O  O   . PHE D 2 39  ? 17.342  -11.866 -53.383 1.00 58.98  ? 168 PHE D O   1 
ATOM   4575 C  CB  . PHE D 2 39  ? 18.762  -8.854  -53.988 1.00 98.65  ? 168 PHE D CB  1 
ATOM   4576 C  CG  . PHE D 2 39  ? 19.639  -8.025  -54.879 1.00 98.65  ? 168 PHE D CG  1 
ATOM   4577 C  CD1 . PHE D 2 39  ? 21.020  -7.995  -54.701 1.00 98.65  ? 168 PHE D CD1 1 
ATOM   4578 C  CD2 . PHE D 2 39  ? 19.075  -7.237  -55.877 1.00 98.65  ? 168 PHE D CD2 1 
ATOM   4579 C  CE1 . PHE D 2 39  ? 21.830  -7.189  -55.509 1.00 98.65  ? 168 PHE D CE1 1 
ATOM   4580 C  CE2 . PHE D 2 39  ? 19.869  -6.427  -56.691 1.00 98.65  ? 168 PHE D CE2 1 
ATOM   4581 C  CZ  . PHE D 2 39  ? 21.253  -6.401  -56.503 1.00 98.65  ? 168 PHE D CZ  1 
ATOM   4582 N  N   . ALA D 2 40  ? 18.242  -10.645 -51.693 1.00 55.56  ? 169 ALA D N   1 
ATOM   4583 C  CA  . ALA D 2 40  ? 17.389  -11.179 -50.631 1.00 55.56  ? 169 ALA D CA  1 
ATOM   4584 C  C   . ALA D 2 40  ? 17.225  -10.124 -49.522 1.00 55.56  ? 169 ALA D C   1 
ATOM   4585 O  O   . ALA D 2 40  ? 17.783  -9.027  -49.612 1.00 55.56  ? 169 ALA D O   1 
ATOM   4586 C  CB  . ALA D 2 40  ? 18.014  -12.451 -50.071 1.00 24.23  ? 169 ALA D CB  1 
ATOM   4587 N  N   . ALA D 2 41  ? 16.457  -10.457 -48.487 1.00 43.71  ? 170 ALA D N   1 
ATOM   4588 C  CA  . ALA D 2 41  ? 16.209  -9.521  -47.406 1.00 43.71  ? 170 ALA D CA  1 
ATOM   4589 C  C   . ALA D 2 41  ? 15.825  -10.215 -46.110 1.00 43.71  ? 170 ALA D C   1 
ATOM   4590 O  O   . ALA D 2 41  ? 14.905  -11.045 -46.075 1.00 43.71  ? 170 ALA D O   1 
ATOM   4591 C  CB  . ALA D 2 41  ? 15.170  -8.471  -47.795 1.00 98.65  ? 170 ALA D CB  1 
ATOM   4592 N  N   . VAL D 2 42  ? 16.520  -9.844  -45.040 1.00 65.15  ? 171 VAL D N   1 
ATOM   4593 C  CA  . VAL D 2 42  ? 16.271  -10.383 -43.718 1.00 65.15  ? 171 VAL D CA  1 
ATOM   4594 C  C   . VAL D 2 42  ? 16.271  -9.295  -42.657 1.00 65.15  ? 171 VAL D C   1 
ATOM   4595 O  O   . VAL D 2 42  ? 17.309  -8.711  -42.333 1.00 65.15  ? 171 VAL D O   1 
ATOM   4596 C  CB  . VAL D 2 42  ? 17.287  -11.479 -43.353 1.00 98.65  ? 171 VAL D CB  1 
ATOM   4597 C  CG1 . VAL D 2 42  ? 16.720  -12.859 -43.666 1.00 98.65  ? 171 VAL D CG1 1 
ATOM   4598 C  CG2 . VAL D 2 42  ? 18.609  -11.280 -44.090 1.00 98.65  ? 171 VAL D CG2 1 
ATOM   4599 N  N   . GLN D 2 43  ? 15.081  -9.024  -42.137 1.00 93.10  ? 172 GLN D N   1 
ATOM   4600 C  CA  . GLN D 2 43  ? 14.895  -8.026  -41.096 1.00 93.10  ? 172 GLN D CA  1 
ATOM   4601 C  C   . GLN D 2 43  ? 15.207  -8.660  -39.752 1.00 93.10  ? 172 GLN D C   1 
ATOM   4602 O  O   . GLN D 2 43  ? 14.559  -9.636  -39.362 1.00 93.10  ? 172 GLN D O   1 
ATOM   4603 C  CB  . GLN D 2 43  ? 13.447  -7.526  -41.115 1.00 75.51  ? 172 GLN D CB  1 
ATOM   4604 C  CG  . GLN D 2 43  ? 13.144  -6.396  -40.152 1.00 75.51  ? 172 GLN D CG  1 
ATOM   4605 C  CD  . GLN D 2 43  ? 12.046  -6.752  -39.179 1.00 75.51  ? 172 GLN D CD  1 
ATOM   4606 O  OE1 . GLN D 2 43  ? 11.823  -6.050  -38.194 1.00 75.51  ? 172 GLN D OE1 1 
ATOM   4607 N  NE2 . GLN D 2 43  ? 11.353  -7.855  -39.447 1.00 75.51  ? 172 GLN D NE2 1 
ATOM   4608 N  N   . PHE D 2 44  ? 16.201  -8.119  -39.049 1.00 25.19  ? 173 PHE D N   1 
ATOM   4609 C  CA  . PHE D 2 44  ? 16.561  -8.677  -37.760 1.00 25.19  ? 173 PHE D CA  1 
ATOM   4610 C  C   . PHE D 2 44  ? 16.292  -7.749  -36.598 1.00 25.19  ? 173 PHE D C   1 
ATOM   4611 O  O   . PHE D 2 44  ? 16.511  -6.546  -36.692 1.00 25.19  ? 173 PHE D O   1 
ATOM   4612 C  CB  . PHE D 2 44  ? 18.021  -9.099  -37.753 1.00 15.87  ? 173 PHE D CB  1 
ATOM   4613 C  CG  . PHE D 2 44  ? 18.992  -7.957  -37.663 1.00 15.87  ? 173 PHE D CG  1 
ATOM   4614 C  CD1 . PHE D 2 44  ? 19.417  -7.302  -38.800 1.00 15.87  ? 173 PHE D CD1 1 
ATOM   4615 C  CD2 . PHE D 2 44  ? 19.528  -7.575  -36.436 1.00 15.87  ? 173 PHE D CD2 1 
ATOM   4616 C  CE1 . PHE D 2 44  ? 20.368  -6.282  -38.715 1.00 15.87  ? 173 PHE D CE1 1 
ATOM   4617 C  CE2 . PHE D 2 44  ? 20.471  -6.564  -36.352 1.00 15.87  ? 173 PHE D CE2 1 
ATOM   4618 C  CZ  . PHE D 2 44  ? 20.891  -5.919  -37.488 1.00 15.87  ? 173 PHE D CZ  1 
ATOM   4619 N  N   . SER D 2 45  ? 15.832  -8.334  -35.499 1.00 51.11  ? 174 SER D N   1 
ATOM   4620 C  CA  . SER D 2 45  ? 15.529  -7.618  -34.271 1.00 51.11  ? 174 SER D CA  1 
ATOM   4621 C  C   . SER D 2 45  ? 15.835  -8.617  -33.151 1.00 51.11  ? 174 SER D C   1 
ATOM   4622 O  O   . SER D 2 45  ? 17.000  -8.936  -32.920 1.00 51.11  ? 174 SER D O   1 
ATOM   4623 C  CB  . SER D 2 45  ? 14.065  -7.179  -34.268 1.00 44.87  ? 174 SER D CB  1 
ATOM   4624 O  OG  . SER D 2 45  ? 13.197  -8.282  -34.431 1.00 44.87  ? 174 SER D OG  1 
ATOM   4625 N  N   . THR D 2 46  ? 14.811  -9.116  -32.464 1.00 33.49  ? 175 THR D N   1 
ATOM   4626 C  CA  . THR D 2 46  ? 15.026  -10.109 -31.416 1.00 33.49  ? 175 THR D CA  1 
ATOM   4627 C  C   . THR D 2 46  ? 14.941  -11.465 -32.096 1.00 33.49  ? 175 THR D C   1 
ATOM   4628 O  O   . THR D 2 46  ? 15.508  -12.459 -31.630 1.00 33.49  ? 175 THR D O   1 
ATOM   4629 C  CB  . THR D 2 46  ? 13.966  -10.005 -30.294 1.00 33.46  ? 175 THR D CB  1 
ATOM   4630 O  OG1 . THR D 2 46  ? 14.154  -8.784  -29.571 1.00 33.46  ? 175 THR D OG1 1 
ATOM   4631 C  CG2 . THR D 2 46  ? 14.064  -11.171 -29.311 1.00 33.46  ? 175 THR D CG2 1 
ATOM   4632 N  N   . SER D 2 47  ? 14.271  -11.478 -33.243 1.00 65.03  ? 176 SER D N   1 
ATOM   4633 C  CA  . SER D 2 47  ? 14.083  -12.690 -34.033 1.00 65.03  ? 176 SER D CA  1 
ATOM   4634 C  C   . SER D 2 47  ? 14.459  -12.431 -35.497 1.00 65.03  ? 176 SER D C   1 
ATOM   4635 O  O   . SER D 2 47  ? 14.887  -11.329 -35.838 1.00 65.03  ? 176 SER D O   1 
ATOM   4636 C  CB  . SER D 2 47  ? 12.634  -13.144 -33.916 1.00 98.65  ? 176 SER D CB  1 
ATOM   4637 O  OG  . SER D 2 47  ? 11.775  -12.020 -33.764 1.00 98.65  ? 176 SER D OG  1 
ATOM   4638 N  N   . TYR D 2 48  ? 14.298  -13.445 -36.344 1.00 69.41  ? 177 TYR D N   1 
ATOM   4639 C  CA  . TYR D 2 48  ? 14.628  -13.306 -37.763 1.00 69.41  ? 177 TYR D CA  1 
ATOM   4640 C  C   . TYR D 2 48  ? 13.562  -13.877 -38.694 1.00 69.41  ? 177 TYR D C   1 
ATOM   4641 O  O   . TYR D 2 48  ? 12.754  -14.732 -38.296 1.00 69.41  ? 177 TYR D O   1 
ATOM   4642 C  CB  . TYR D 2 48  ? 15.960  -13.983 -38.111 1.00 61.40  ? 177 TYR D CB  1 
ATOM   4643 C  CG  . TYR D 2 48  ? 16.988  -13.933 -37.016 1.00 61.40  ? 177 TYR D CG  1 
ATOM   4644 C  CD1 . TYR D 2 48  ? 17.872  -12.871 -36.904 1.00 61.40  ? 177 TYR D CD1 1 
ATOM   4645 C  CD2 . TYR D 2 48  ? 17.062  -14.953 -36.079 1.00 61.40  ? 177 TYR D CD2 1 
ATOM   4646 C  CE1 . TYR D 2 48  ? 18.788  -12.827 -35.884 1.00 61.40  ? 177 TYR D CE1 1 
ATOM   4647 C  CE2 . TYR D 2 48  ? 17.974  -14.916 -35.064 1.00 61.40  ? 177 TYR D CE2 1 
ATOM   4648 C  CZ  . TYR D 2 48  ? 18.841  -13.858 -34.967 1.00 61.40  ? 177 TYR D CZ  1 
ATOM   4649 O  OH  . TYR D 2 48  ? 19.771  -13.837 -33.956 1.00 61.40  ? 177 TYR D OH  1 
ATOM   4650 N  N   . LYS D 2 49  ? 13.549  -13.379 -39.926 1.00 71.78  ? 178 LYS D N   1 
ATOM   4651 C  CA  . LYS D 2 49  ? 12.626  -13.789 -40.965 1.00 71.78  ? 178 LYS D CA  1 
ATOM   4652 C  C   . LYS D 2 49  ? 13.155  -13.295 -42.295 1.00 71.78  ? 178 LYS D C   1 
ATOM   4653 O  O   . LYS D 2 49  ? 13.673  -12.177 -42.409 1.00 71.78  ? 178 LYS D O   1 
ATOM   4654 C  CB  . LYS D 2 49  ? 11.239  -13.230 -40.734 1.00 54.19  ? 178 LYS D CB  1 
ATOM   4655 C  CG  . LYS D 2 49  ? 11.120  -11.703 -40.926 1.00 54.19  ? 178 LYS D CG  1 
ATOM   4656 C  CD  . LYS D 2 49  ? 9.677   -11.218 -41.052 1.00 54.19  ? 178 LYS D CD  1 
ATOM   4657 C  CE  . LYS D 2 49  ? 8.949   -11.868 -42.237 1.00 54.19  ? 178 LYS D CE  1 
ATOM   4658 N  NZ  . LYS D 2 49  ? 7.677   -11.151 -42.587 1.00 54.19  ? 178 LYS D NZ  1 
ATOM   4659 N  N   . THR D 2 50  ? 13.059  -14.157 -43.294 1.00 98.37  ? 179 THR D N   1 
ATOM   4660 C  CA  . THR D 2 50  ? 13.474  -13.806 -44.629 1.00 98.37  ? 179 THR D CA  1 
ATOM   4661 C  C   . THR D 2 50  ? 12.262  -13.097 -45.242 1.00 98.37  ? 179 THR D C   1 
ATOM   4662 O  O   . THR D 2 50  ? 11.218  -13.720 -45.469 1.00 98.37  ? 179 THR D O   1 
ATOM   4663 C  CB  . THR D 2 50  ? 13.854  -15.068 -45.437 1.00 98.65  ? 179 THR D CB  1 
ATOM   4664 O  OG1 . THR D 2 50  ? 12.826  -16.059 -45.300 1.00 98.65  ? 179 THR D OG1 1 
ATOM   4665 C  CG2 . THR D 2 50  ? 15.175  -15.656 -44.960 1.00 98.65  ? 179 THR D CG2 1 
ATOM   4666 N  N   . GLU D 2 51  ? 12.379  -11.779 -45.409 1.00 98.65  ? 180 GLU D N   1 
ATOM   4667 C  CA  . GLU D 2 51  ? 11.305  -10.950 -45.971 1.00 98.65  ? 180 GLU D CA  1 
ATOM   4668 C  C   . GLU D 2 51  ? 10.884  -11.448 -47.343 1.00 98.65  ? 180 GLU D C   1 
ATOM   4669 O  O   . GLU D 2 51  ? 9.695   -11.635 -47.614 1.00 98.65  ? 180 GLU D O   1 
ATOM   4670 C  CB  . GLU D 2 51  ? 11.755  -9.492  -46.049 1.00 61.46  ? 180 GLU D CB  1 
ATOM   4671 C  CG  . GLU D 2 51  ? 12.132  -8.902  -44.700 1.00 61.46  ? 180 GLU D CG  1 
ATOM   4672 C  CD  . GLU D 2 51  ? 10.928  -8.492  -43.870 1.00 61.46  ? 180 GLU D CD  1 
ATOM   4673 O  OE1 . GLU D 2 51  ? 10.015  -9.320  -43.671 1.00 61.46  ? 180 GLU D OE1 1 
ATOM   4674 O  OE2 . GLU D 2 51  ? 10.895  -7.329  -43.411 1.00 61.46  ? 180 GLU D OE2 1 
ATOM   4675 N  N   . PHE D 2 52  ? 11.874  -11.621 -48.211 1.00 87.98  ? 181 PHE D N   1 
ATOM   4676 C  CA  . PHE D 2 52  ? 11.649  -12.148 -49.545 1.00 87.98  ? 181 PHE D CA  1 
ATOM   4677 C  C   . PHE D 2 52  ? 12.829  -13.026 -49.935 1.00 87.98  ? 181 PHE D C   1 
ATOM   4678 O  O   . PHE D 2 52  ? 13.989  -12.628 -49.823 1.00 87.98  ? 181 PHE D O   1 
ATOM   4679 C  CB  . PHE D 2 52  ? 11.359  -11.044 -50.582 1.00 88.27  ? 181 PHE D CB  1 
ATOM   4680 C  CG  . PHE D 2 52  ? 12.545  -10.167 -50.943 1.00 88.27  ? 181 PHE D CG  1 
ATOM   4681 C  CD1 . PHE D 2 52  ? 13.530  -10.615 -51.826 1.00 88.27  ? 181 PHE D CD1 1 
ATOM   4682 C  CD2 . PHE D 2 52  ? 12.623  -8.858  -50.475 1.00 88.27  ? 181 PHE D CD2 1 
ATOM   4683 C  CE1 . PHE D 2 52  ? 14.556  -9.774  -52.237 1.00 88.27  ? 181 PHE D CE1 1 
ATOM   4684 C  CE2 . PHE D 2 52  ? 13.650  -8.012  -50.887 1.00 88.27  ? 181 PHE D CE2 1 
ATOM   4685 C  CZ  . PHE D 2 52  ? 14.614  -8.472  -51.767 1.00 88.27  ? 181 PHE D CZ  1 
ATOM   4686 N  N   . ASP D 2 53  ? 12.514  -14.265 -50.285 1.00 71.24  ? 182 ASP D N   1 
ATOM   4687 C  CA  . ASP D 2 53  ? 13.517  -15.246 -50.682 1.00 71.24  ? 182 ASP D CA  1 
ATOM   4688 C  C   . ASP D 2 53  ? 13.844  -15.056 -52.160 1.00 71.24  ? 182 ASP D C   1 
ATOM   4689 O  O   . ASP D 2 53  ? 13.229  -14.229 -52.841 1.00 71.24  ? 182 ASP D O   1 
ATOM   4690 C  CB  . ASP D 2 53  ? 12.974  -16.665 -50.448 1.00 98.65  ? 182 ASP D CB  1 
ATOM   4691 C  CG  . ASP D 2 53  ? 12.344  -16.837 -49.064 1.00 98.65  ? 182 ASP D CG  1 
ATOM   4692 O  OD1 . ASP D 2 53  ? 12.880  -16.264 -48.095 1.00 98.65  ? 182 ASP D OD1 1 
ATOM   4693 O  OD2 . ASP D 2 53  ? 11.314  -17.540 -48.945 1.00 98.65  ? 182 ASP D OD2 1 
ATOM   4694 N  N   . PHE D 2 54  ? 14.822  -15.811 -52.652 1.00 98.65  ? 183 PHE D N   1 
ATOM   4695 C  CA  . PHE D 2 54  ? 15.204  -15.725 -54.062 1.00 98.65  ? 183 PHE D CA  1 
ATOM   4696 C  C   . PHE D 2 54  ? 14.062  -16.220 -54.955 1.00 98.65  ? 183 PHE D C   1 
ATOM   4697 O  O   . PHE D 2 54  ? 13.775  -15.612 -55.983 1.00 98.65  ? 183 PHE D O   1 
ATOM   4698 C  CB  . PHE D 2 54  ? 16.472  -16.549 -54.343 1.00 98.12  ? 183 PHE D CB  1 
ATOM   4699 C  CG  . PHE D 2 54  ? 17.761  -15.858 -53.963 1.00 98.12  ? 183 PHE D CG  1 
ATOM   4700 C  CD1 . PHE D 2 54  ? 18.033  -14.565 -54.404 1.00 98.12  ? 183 PHE D CD1 1 
ATOM   4701 C  CD2 . PHE D 2 54  ? 18.712  -16.511 -53.179 1.00 98.12  ? 183 PHE D CD2 1 
ATOM   4702 C  CE1 . PHE D 2 54  ? 19.231  -13.935 -54.071 1.00 98.12  ? 183 PHE D CE1 1 
ATOM   4703 C  CE2 . PHE D 2 54  ? 19.913  -15.886 -52.841 1.00 98.12  ? 183 PHE D CE2 1 
ATOM   4704 C  CZ  . PHE D 2 54  ? 20.170  -14.593 -53.290 1.00 98.12  ? 183 PHE D CZ  1 
ATOM   4705 N  N   . SER D 2 55  ? 13.408  -17.305 -54.533 1.00 98.65  ? 184 SER D N   1 
ATOM   4706 C  CA  . SER D 2 55  ? 12.296  -17.920 -55.265 1.00 98.65  ? 184 SER D CA  1 
ATOM   4707 C  C   . SER D 2 55  ? 11.240  -16.911 -55.707 1.00 98.65  ? 184 SER D C   1 
ATOM   4708 O  O   . SER D 2 55  ? 10.899  -16.839 -56.888 1.00 98.65  ? 184 SER D O   1 
ATOM   4709 C  CB  . SER D 2 55  ? 11.626  -19.014 -54.419 1.00 79.22  ? 184 SER D CB  1 
ATOM   4710 O  OG  . SER D 2 55  ? 12.469  -20.139 -54.218 1.00 79.22  ? 184 SER D OG  1 
ATOM   4711 N  N   . ASP D 2 56  ? 10.702  -16.164 -54.747 1.00 98.65  ? 185 ASP D N   1 
ATOM   4712 C  CA  . ASP D 2 56  ? 9.693   -15.151 -55.038 1.00 98.65  ? 185 ASP D CA  1 
ATOM   4713 C  C   . ASP D 2 56  ? 10.346  -13.847 -55.486 1.00 98.65  ? 185 ASP D C   1 
ATOM   4714 O  O   . ASP D 2 56  ? 9.652   -12.913 -55.894 1.00 98.65  ? 185 ASP D O   1 
ATOM   4715 C  CB  . ASP D 2 56  ? 8.797   -14.902 -53.814 1.00 98.55  ? 185 ASP D CB  1 
ATOM   4716 C  CG  . ASP D 2 56  ? 7.640   -15.895 -53.713 1.00 98.55  ? 185 ASP D CG  1 
ATOM   4717 O  OD1 . ASP D 2 56  ? 6.495   -15.506 -54.034 1.00 98.55  ? 185 ASP D OD1 1 
ATOM   4718 O  OD2 . ASP D 2 56  ? 7.866   -17.056 -53.301 1.00 98.55  ? 185 ASP D OD2 1 
ATOM   4719 N  N   . TYR D 2 57  ? 11.677  -13.798 -55.417 1.00 98.27  ? 186 TYR D N   1 
ATOM   4720 C  CA  . TYR D 2 57  ? 12.447  -12.616 -55.811 1.00 98.27  ? 186 TYR D CA  1 
ATOM   4721 C  C   . TYR D 2 57  ? 12.476  -12.366 -57.325 1.00 98.27  ? 186 TYR D C   1 
ATOM   4722 O  O   . TYR D 2 57  ? 12.059  -11.309 -57.792 1.00 98.27  ? 186 TYR D O   1 
ATOM   4723 C  CB  . TYR D 2 57  ? 13.882  -12.704 -55.254 1.00 98.65  ? 186 TYR D CB  1 
ATOM   4724 C  CG  . TYR D 2 57  ? 14.861  -11.753 -55.906 1.00 98.65  ? 186 TYR D CG  1 
ATOM   4725 C  CD1 . TYR D 2 57  ? 15.995  -12.233 -56.554 1.00 98.65  ? 186 TYR D CD1 1 
ATOM   4726 C  CD2 . TYR D 2 57  ? 14.620  -10.378 -55.931 1.00 98.65  ? 186 TYR D CD2 1 
ATOM   4727 C  CE1 . TYR D 2 57  ? 16.858  -11.372 -57.221 1.00 98.65  ? 186 TYR D CE1 1 
ATOM   4728 C  CE2 . TYR D 2 57  ? 15.480  -9.507  -56.595 1.00 98.65  ? 186 TYR D CE2 1 
ATOM   4729 C  CZ  . TYR D 2 57  ? 16.598  -10.011 -57.239 1.00 98.65  ? 186 TYR D CZ  1 
ATOM   4730 O  OH  . TYR D 2 57  ? 17.446  -9.164  -57.916 1.00 98.65  ? 186 TYR D OH  1 
ATOM   4731 N  N   . VAL D 2 58  ? 12.982  -13.337 -58.078 1.00 98.65  ? 187 VAL D N   1 
ATOM   4732 C  CA  . VAL D 2 58  ? 13.072  -13.203 -59.530 1.00 98.65  ? 187 VAL D CA  1 
ATOM   4733 C  C   . VAL D 2 58  ? 11.759  -13.566 -60.250 1.00 98.65  ? 187 VAL D C   1 
ATOM   4734 O  O   . VAL D 2 58  ? 11.772  -13.960 -61.420 1.00 98.65  ? 187 VAL D O   1 
ATOM   4735 C  CB  . VAL D 2 58  ? 14.256  -14.030 -60.096 1.00 35.07  ? 187 VAL D CB  1 
ATOM   4736 C  CG1 . VAL D 2 58  ? 14.978  -13.247 -61.157 1.00 35.07  ? 187 VAL D CG1 1 
ATOM   4737 C  CG2 . VAL D 2 58  ? 15.234  -14.423 -59.009 1.00 35.07  ? 187 VAL D CG2 1 
ATOM   4738 N  N   . LYS D 2 59  ? 10.641  -13.375 -59.547 1.00 98.65  ? 188 LYS D N   1 
ATOM   4739 C  CA  . LYS D 2 59  ? 9.303   -13.672 -60.073 1.00 98.65  ? 188 LYS D CA  1 
ATOM   4740 C  C   . LYS D 2 59  ? 8.580   -12.384 -60.439 1.00 98.65  ? 188 LYS D C   1 
ATOM   4741 O  O   . LYS D 2 59  ? 7.921   -12.307 -61.479 1.00 98.65  ? 188 LYS D O   1 
ATOM   4742 C  CB  . LYS D 2 59  ? 8.479   -14.444 -59.035 1.00 83.20  ? 188 LYS D CB  1 
ATOM   4743 C  CG  . LYS D 2 59  ? 7.039   -14.752 -59.441 1.00 83.20  ? 188 LYS D CG  1 
ATOM   4744 C  CD  . LYS D 2 59  ? 6.232   -15.324 -58.293 1.00 83.20  ? 188 LYS D CD  1 
ATOM   4745 C  CE  . LYS D 2 59  ? 6.746   -16.692 -57.889 1.00 83.20  ? 188 LYS D CE  1 
ATOM   4746 N  NZ  . LYS D 2 59  ? 8.093   -16.673 -57.256 1.00 83.20  ? 188 LYS D NZ  1 
ATOM   4747 N  N   . ARG D 2 60  ? 8.682   -11.384 -59.575 1.00 98.14  ? 189 ARG D N   1 
ATOM   4748 C  CA  . ARG D 2 60  ? 8.072   -10.086 -59.803 1.00 98.14  ? 189 ARG D CA  1 
ATOM   4749 C  C   . ARG D 2 60  ? 9.096   -9.037  -59.359 1.00 98.14  ? 189 ARG D C   1 
ATOM   4750 O  O   . ARG D 2 60  ? 8.852   -8.259  -58.435 1.00 98.14  ? 189 ARG D O   1 
ATOM   4751 C  CB  . ARG D 2 60  ? 6.763   -9.976  -59.001 1.00 98.65  ? 189 ARG D CB  1 
ATOM   4752 C  CG  . ARG D 2 60  ? 5.900   -8.791  -59.399 1.00 98.65  ? 189 ARG D CG  1 
ATOM   4753 C  CD  . ARG D 2 60  ? 4.498   -8.927  -58.818 1.00 98.65  ? 189 ARG D CD  1 
ATOM   4754 N  NE  . ARG D 2 60  ? 3.854   -10.172 -59.244 1.00 98.65  ? 189 ARG D NE  1 
ATOM   4755 C  CZ  . ARG D 2 60  ? 2.557   -10.449 -59.099 1.00 98.65  ? 189 ARG D CZ  1 
ATOM   4756 N  NH1 . ARG D 2 60  ? 1.736   -9.567  -58.538 1.00 98.65  ? 189 ARG D NH1 1 
ATOM   4757 N  NH2 . ARG D 2 60  ? 2.083   -11.625 -59.501 1.00 98.65  ? 189 ARG D NH2 1 
ATOM   4758 N  N   . LYS D 2 61  ? 10.241  -9.049  -60.041 1.00 54.19  ? 190 LYS D N   1 
ATOM   4759 C  CA  . LYS D 2 61  ? 11.372  -8.156  -59.795 1.00 54.19  ? 190 LYS D CA  1 
ATOM   4760 C  C   . LYS D 2 61  ? 11.031  -6.666  -59.675 1.00 54.19  ? 190 LYS D C   1 
ATOM   4761 O  O   . LYS D 2 61  ? 10.880  -5.963  -60.683 1.00 54.19  ? 190 LYS D O   1 
ATOM   4762 C  CB  . LYS D 2 61  ? 12.432  -8.363  -60.891 1.00 62.46  ? 190 LYS D CB  1 
ATOM   4763 C  CG  . LYS D 2 61  ? 12.977  -9.789  -60.992 1.00 62.46  ? 190 LYS D CG  1 
ATOM   4764 C  CD  . LYS D 2 61  ? 13.908  -9.930  -62.195 1.00 62.46  ? 190 LYS D CD  1 
ATOM   4765 C  CE  . LYS D 2 61  ? 15.168  -9.066  -62.060 1.00 62.46  ? 190 LYS D CE  1 
ATOM   4766 N  NZ  . LYS D 2 61  ? 16.022  -9.043  -63.290 1.00 62.46  ? 190 LYS D NZ  1 
ATOM   4767 N  N   . ASP D 2 62  ? 10.949  -6.210  -58.422 1.00 75.73  ? 191 ASP D N   1 
ATOM   4768 C  CA  . ASP D 2 62  ? 10.646  -4.820  -58.037 1.00 75.73  ? 191 ASP D CA  1 
ATOM   4769 C  C   . ASP D 2 62  ? 10.463  -4.753  -56.502 1.00 75.73  ? 191 ASP D C   1 
ATOM   4770 O  O   . ASP D 2 62  ? 9.627   -5.470  -55.917 1.00 75.73  ? 191 ASP D O   1 
ATOM   4771 C  CB  . ASP D 2 62  ? 9.365   -4.312  -58.746 1.00 91.47  ? 191 ASP D CB  1 
ATOM   4772 C  CG  . ASP D 2 62  ? 9.182   -2.774  -58.649 1.00 91.47  ? 191 ASP D CG  1 
ATOM   4773 O  OD1 . ASP D 2 62  ? 10.022  -2.022  -59.182 1.00 91.47  ? 191 ASP D OD1 1 
ATOM   4774 O  OD2 . ASP D 2 62  ? 8.181   -2.320  -58.043 1.00 91.47  ? 191 ASP D OD2 1 
ATOM   4775 N  N   . PRO D 2 63  ? 11.272  -3.911  -55.830 1.00 98.65  ? 192 PRO D N   1 
ATOM   4776 C  CA  . PRO D 2 63  ? 11.240  -3.714  -54.373 1.00 98.65  ? 192 PRO D CA  1 
ATOM   4777 C  C   . PRO D 2 63  ? 9.972   -3.012  -53.852 1.00 98.65  ? 192 PRO D C   1 
ATOM   4778 O  O   . PRO D 2 63  ? 10.037  -2.202  -52.926 1.00 98.65  ? 192 PRO D O   1 
ATOM   4779 C  CB  . PRO D 2 63  ? 12.489  -2.866  -54.129 1.00 61.26  ? 192 PRO D CB  1 
ATOM   4780 C  CG  . PRO D 2 63  ? 12.616  -2.066  -55.392 1.00 61.26  ? 192 PRO D CG  1 
ATOM   4781 C  CD  . PRO D 2 63  ? 12.370  -3.131  -56.434 1.00 61.26  ? 192 PRO D CD  1 
ATOM   4782 N  N   . ASP D 2 64  ? 8.826   -3.330  -54.452 1.00 69.95  ? 193 ASP D N   1 
ATOM   4783 C  CA  . ASP D 2 64  ? 7.541   -2.741  -54.080 1.00 69.95  ? 193 ASP D CA  1 
ATOM   4784 C  C   . ASP D 2 64  ? 6.506   -3.854  -54.229 1.00 69.95  ? 193 ASP D C   1 
ATOM   4785 O  O   . ASP D 2 64  ? 5.300   -3.655  -54.057 1.00 69.95  ? 193 ASP D O   1 
ATOM   4786 C  CB  . ASP D 2 64  ? 7.200   -1.567  -55.022 1.00 66.43  ? 193 ASP D CB  1 
ATOM   4787 C  CG  . ASP D 2 64  ? 8.304   -0.492  -55.074 1.00 66.43  ? 193 ASP D CG  1 
ATOM   4788 O  OD1 . ASP D 2 64  ? 9.240   -0.627  -55.891 1.00 66.43  ? 193 ASP D OD1 1 
ATOM   4789 O  OD2 . ASP D 2 64  ? 8.232   0.498   -54.312 1.00 66.43  ? 193 ASP D OD2 1 
ATOM   4790 N  N   . ALA D 2 65  ? 7.012   -5.034  -54.562 1.00 98.65  ? 194 ALA D N   1 
ATOM   4791 C  CA  . ALA D 2 65  ? 6.197   -6.220  -54.753 1.00 98.65  ? 194 ALA D CA  1 
ATOM   4792 C  C   . ALA D 2 65  ? 6.699   -7.334  -53.835 1.00 98.65  ? 194 ALA D C   1 
ATOM   4793 O  O   . ALA D 2 65  ? 6.032   -8.360  -53.667 1.00 98.65  ? 194 ALA D O   1 
ATOM   4794 C  CB  . ALA D 2 65  ? 6.271   -6.669  -56.209 1.00 74.58  ? 194 ALA D CB  1 
ATOM   4795 N  N   . LEU D 2 66  ? 7.884   -7.129  -53.259 1.00 90.19  ? 195 LEU D N   1 
ATOM   4796 C  CA  . LEU D 2 66  ? 8.504   -8.104  -52.361 1.00 90.19  ? 195 LEU D CA  1 
ATOM   4797 C  C   . LEU D 2 66  ? 8.409   -7.679  -50.902 1.00 90.19  ? 195 LEU D C   1 
ATOM   4798 O  O   . LEU D 2 66  ? 8.771   -8.431  -50.000 1.00 90.19  ? 195 LEU D O   1 
ATOM   4799 C  CB  . LEU D 2 66  ? 9.968   -8.316  -52.749 1.00 98.65  ? 195 LEU D CB  1 
ATOM   4800 C  CG  . LEU D 2 66  ? 10.205  -8.945  -54.123 1.00 98.65  ? 195 LEU D CG  1 
ATOM   4801 C  CD1 . LEU D 2 66  ? 11.680  -8.884  -54.481 1.00 98.65  ? 195 LEU D CD1 1 
ATOM   4802 C  CD2 . LEU D 2 66  ? 9.688   -10.376 -54.131 1.00 98.65  ? 195 LEU D CD2 1 
ATOM   4803 N  N   . LEU D 2 67  ? 7.930   -6.459  -50.689 1.00 74.27  ? 196 LEU D N   1 
ATOM   4804 C  CA  . LEU D 2 67  ? 7.762   -5.897  -49.356 1.00 74.27  ? 196 LEU D CA  1 
ATOM   4805 C  C   . LEU D 2 67  ? 6.265   -5.743  -49.102 1.00 74.27  ? 196 LEU D C   1 
ATOM   4806 O  O   . LEU D 2 67  ? 5.813   -4.776  -48.482 1.00 74.27  ? 196 LEU D O   1 
ATOM   4807 C  CB  . LEU D 2 67  ? 8.466   -4.541  -49.272 1.00 98.65  ? 196 LEU D CB  1 
ATOM   4808 C  CG  . LEU D 2 67  ? 9.966   -4.542  -49.587 1.00 98.65  ? 196 LEU D CG  1 
ATOM   4809 C  CD1 . LEU D 2 67  ? 10.483  -3.117  -49.580 1.00 98.65  ? 196 LEU D CD1 1 
ATOM   4810 C  CD2 . LEU D 2 67  ? 10.739  -5.401  -48.589 1.00 98.65  ? 196 LEU D CD2 1 
ATOM   4811 N  N   . LYS D 2 68  ? 5.515   -6.731  -49.584 1.00 98.32  ? 197 LYS D N   1 
ATOM   4812 C  CA  . LYS D 2 68  ? 4.058   -6.778  -49.476 1.00 98.32  ? 197 LYS D CA  1 
ATOM   4813 C  C   . LYS D 2 68  ? 3.513   -6.824  -48.064 1.00 98.32  ? 197 LYS D C   1 
ATOM   4814 O  O   . LYS D 2 68  ? 2.552   -6.116  -47.740 1.00 98.32  ? 197 LYS D O   1 
ATOM   4815 C  CB  . LYS D 2 68  ? 3.488   -7.969  -50.267 1.00 98.52  ? 197 LYS D CB  1 
ATOM   4816 C  CG  . LYS D 2 68  ? 4.189   -9.326  -50.048 1.00 98.52  ? 197 LYS D CG  1 
ATOM   4817 C  CD  . LYS D 2 68  ? 5.398   -9.478  -50.981 1.00 98.52  ? 197 LYS D CD  1 
ATOM   4818 C  CE  . LYS D 2 68  ? 6.002   -10.881 -50.976 1.00 98.52  ? 197 LYS D CE  1 
ATOM   4819 N  NZ  . LYS D 2 68  ? 7.177   -10.985 -51.900 1.00 98.52  ? 197 LYS D NZ  1 
ATOM   4820 N  N   . HIS D 2 69  ? 4.112   -7.671  -47.233 1.00 98.65  ? 198 HIS D N   1 
ATOM   4821 C  CA  . HIS D 2 69  ? 3.652   -7.810  -45.862 1.00 98.65  ? 198 HIS D CA  1 
ATOM   4822 C  C   . HIS D 2 69  ? 4.711   -7.548  -44.793 1.00 98.65  ? 198 HIS D C   1 
ATOM   4823 O  O   . HIS D 2 69  ? 4.815   -8.280  -43.804 1.00 98.65  ? 198 HIS D O   1 
ATOM   4824 C  CB  . HIS D 2 69  ? 2.967   -9.168  -45.686 1.00 98.65  ? 198 HIS D CB  1 
ATOM   4825 C  CG  . HIS D 2 69  ? 1.786   -9.354  -46.587 1.00 98.65  ? 198 HIS D CG  1 
ATOM   4826 N  ND1 . HIS D 2 69  ? 0.734   -8.463  -46.629 1.00 98.65  ? 198 HIS D ND1 1 
ATOM   4827 C  CD2 . HIS D 2 69  ? 1.513   -10.299 -47.521 1.00 98.65  ? 198 HIS D CD2 1 
ATOM   4828 C  CE1 . HIS D 2 69  ? -0.132  -8.846  -47.550 1.00 98.65  ? 198 HIS D CE1 1 
ATOM   4829 N  NE2 . HIS D 2 69  ? 0.318   -9.958  -48.105 1.00 98.65  ? 198 HIS D NE2 1 
ATOM   4830 N  N   . VAL D 2 70  ? 5.469   -6.471  -44.989 1.00 97.11  ? 199 VAL D N   1 
ATOM   4831 C  CA  . VAL D 2 70  ? 6.505   -6.075  -44.042 1.00 97.11  ? 199 VAL D CA  1 
ATOM   4832 C  C   . VAL D 2 70  ? 5.806   -5.436  -42.849 1.00 97.11  ? 199 VAL D C   1 
ATOM   4833 O  O   . VAL D 2 70  ? 4.900   -4.612  -43.021 1.00 97.11  ? 199 VAL D O   1 
ATOM   4834 C  CB  . VAL D 2 70  ? 7.493   -5.034  -44.646 1.00 30.04  ? 199 VAL D CB  1 
ATOM   4835 C  CG1 . VAL D 2 70  ? 8.663   -4.790  -43.703 1.00 30.04  ? 199 VAL D CG1 1 
ATOM   4836 C  CG2 . VAL D 2 70  ? 8.015   -5.502  -45.982 1.00 30.04  ? 199 VAL D CG2 1 
ATOM   4837 N  N   . LYS D 2 71  ? 6.185   -5.869  -41.651 1.00 84.98  ? 200 LYS D N   1 
ATOM   4838 C  CA  . LYS D 2 71  ? 5.632   -5.334  -40.410 1.00 84.98  ? 200 LYS D CA  1 
ATOM   4839 C  C   . LYS D 2 71  ? 6.794   -5.002  -39.473 1.00 84.98  ? 200 LYS D C   1 
ATOM   4840 O  O   . LYS D 2 71  ? 7.587   -5.879  -39.116 1.00 84.98  ? 200 LYS D O   1 
ATOM   4841 C  CB  . LYS D 2 71  ? 4.692   -6.346  -39.723 1.00 98.35  ? 200 LYS D CB  1 
ATOM   4842 C  CG  . LYS D 2 71  ? 3.327   -6.581  -40.394 1.00 98.35  ? 200 LYS D CG  1 
ATOM   4843 C  CD  . LYS D 2 71  ? 2.483   -7.574  -39.565 1.00 98.35  ? 200 LYS D CD  1 
ATOM   4844 C  CE  . LYS D 2 71  ? 1.176   -7.979  -40.254 1.00 98.35  ? 200 LYS D CE  1 
ATOM   4845 N  NZ  . LYS D 2 71  ? 0.404   -9.012  -39.482 1.00 98.35  ? 200 LYS D NZ  1 
ATOM   4846 N  N   . HIS D 2 72  ? 6.913   -3.723  -39.124 1.00 98.65  ? 201 HIS D N   1 
ATOM   4847 C  CA  . HIS D 2 72  ? 7.962   -3.246  -38.220 1.00 98.65  ? 201 HIS D CA  1 
ATOM   4848 C  C   . HIS D 2 72  ? 7.790   -3.879  -36.832 1.00 98.65  ? 201 HIS D C   1 
ATOM   4849 O  O   . HIS D 2 72  ? 6.863   -3.520  -36.088 1.00 98.65  ? 201 HIS D O   1 
ATOM   4850 C  CB  . HIS D 2 72  ? 7.948   -1.712  -38.143 1.00 98.38  ? 201 HIS D CB  1 
ATOM   4851 C  CG  . HIS D 2 72  ? 6.679   -1.084  -38.649 1.00 98.38  ? 201 HIS D CG  1 
ATOM   4852 N  ND1 . HIS D 2 72  ? 6.239   -1.234  -39.948 1.00 98.38  ? 201 HIS D ND1 1 
ATOM   4853 C  CD2 . HIS D 2 72  ? 5.762   -0.296  -38.033 1.00 98.38  ? 201 HIS D CD2 1 
ATOM   4854 C  CE1 . HIS D 2 72  ? 5.107   -0.573  -40.111 1.00 98.38  ? 201 HIS D CE1 1 
ATOM   4855 N  NE2 . HIS D 2 72  ? 4.795   0.005   -38.966 1.00 98.38  ? 201 HIS D NE2 1 
ATOM   4856 N  N   . MET D 2 73  ? 8.650   -4.863  -36.531 1.00 63.95  ? 202 MET D N   1 
ATOM   4857 C  CA  . MET D 2 73  ? 8.637   -5.614  -35.260 1.00 63.95  ? 202 MET D CA  1 
ATOM   4858 C  C   . MET D 2 73  ? 9.055   -4.767  -34.056 1.00 63.95  ? 202 MET D C   1 
ATOM   4859 O  O   . MET D 2 73  ? 8.401   -4.786  -33.014 1.00 63.95  ? 202 MET D O   1 
ATOM   4860 C  CB  . MET D 2 73  ? 9.565   -6.814  -35.384 1.00 98.65  ? 202 MET D CB  1 
ATOM   4861 C  CG  . MET D 2 73  ? 9.240   -7.690  -36.567 1.00 98.65  ? 202 MET D CG  1 
ATOM   4862 S  SD  . MET D 2 73  ? 10.494  -8.942  -36.822 1.00 98.65  ? 202 MET D SD  1 
ATOM   4863 C  CE  . MET D 2 73  ? 10.194  -10.002 -35.388 1.00 98.65  ? 202 MET D CE  1 
ATOM   4864 N  N   . LEU D 2 74  ? 10.184  -4.079  -34.212 1.00 27.53  ? 203 LEU D N   1 
ATOM   4865 C  CA  . LEU D 2 74  ? 10.754  -3.171  -33.218 1.00 27.53  ? 203 LEU D CA  1 
ATOM   4866 C  C   . LEU D 2 74  ? 11.090  -3.753  -31.865 1.00 27.53  ? 203 LEU D C   1 
ATOM   4867 O  O   . LEU D 2 74  ? 10.709  -3.187  -30.847 1.00 27.53  ? 203 LEU D O   1 
ATOM   4868 C  CB  . LEU D 2 74  ? 9.855   -1.939  -33.014 1.00 57.53  ? 203 LEU D CB  1 
ATOM   4869 C  CG  . LEU D 2 74  ? 9.355   -1.038  -34.157 1.00 57.53  ? 203 LEU D CG  1 
ATOM   4870 C  CD1 . LEU D 2 74  ? 8.943   0.291   -33.514 1.00 57.53  ? 203 LEU D CD1 1 
ATOM   4871 C  CD2 . LEU D 2 74  ? 10.409  -0.795  -35.284 1.00 57.53  ? 203 LEU D CD2 1 
ATOM   4872 N  N   . LEU D 2 75  ? 11.800  -4.871  -31.837 1.00 51.82  ? 204 LEU D N   1 
ATOM   4873 C  CA  . LEU D 2 75  ? 12.178  -5.458  -30.564 1.00 51.82  ? 204 LEU D CA  1 
ATOM   4874 C  C   . LEU D 2 75  ? 13.661  -5.211  -30.371 1.00 51.82  ? 204 LEU D C   1 
ATOM   4875 O  O   . LEU D 2 75  ? 14.102  -4.081  -30.536 1.00 51.82  ? 204 LEU D O   1 
ATOM   4876 C  CB  . LEU D 2 75  ? 11.825  -6.937  -30.523 1.00 20.54  ? 204 LEU D CB  1 
ATOM   4877 C  CG  . LEU D 2 75  ? 10.324  -7.219  -30.656 1.00 20.54  ? 204 LEU D CG  1 
ATOM   4878 C  CD1 . LEU D 2 75  ? 10.047  -8.679  -30.929 1.00 20.54  ? 204 LEU D CD1 1 
ATOM   4879 C  CD2 . LEU D 2 75  ? 9.608   -6.787  -29.412 1.00 20.54  ? 204 LEU D CD2 1 
ATOM   4880 N  N   . LEU D 2 76  ? 14.437  -6.237  -30.034 1.00 41.43  ? 205 LEU D N   1 
ATOM   4881 C  CA  . LEU D 2 76  ? 15.879  -6.051  -29.834 1.00 41.43  ? 205 LEU D CA  1 
ATOM   4882 C  C   . LEU D 2 76  ? 16.719  -6.023  -31.113 1.00 41.43  ? 205 LEU D C   1 
ATOM   4883 O  O   . LEU D 2 76  ? 16.199  -5.734  -32.176 1.00 41.43  ? 205 LEU D O   1 
ATOM   4884 C  CB  . LEU D 2 76  ? 16.424  -7.065  -28.845 1.00 2.19   ? 205 LEU D CB  1 
ATOM   4885 C  CG  . LEU D 2 76  ? 15.825  -6.973  -27.445 1.00 2.19   ? 205 LEU D CG  1 
ATOM   4886 C  CD1 . LEU D 2 76  ? 16.524  -7.977  -26.589 1.00 2.19   ? 205 LEU D CD1 1 
ATOM   4887 C  CD2 . LEU D 2 76  ? 15.995  -5.612  -26.858 1.00 2.19   ? 205 LEU D CD2 1 
ATOM   4888 N  N   . THR D 2 77  ? 18.003  -6.355  -31.030 1.00 49.74  ? 206 THR D N   1 
ATOM   4889 C  CA  . THR D 2 77  ? 18.853  -6.293  -32.210 1.00 49.74  ? 206 THR D CA  1 
ATOM   4890 C  C   . THR D 2 77  ? 19.928  -7.381  -32.209 1.00 49.74  ? 206 THR D C   1 
ATOM   4891 O  O   . THR D 2 77  ? 21.095  -7.109  -31.915 1.00 49.74  ? 206 THR D O   1 
ATOM   4892 C  CB  . THR D 2 77  ? 19.544  -4.933  -32.265 1.00 56.19  ? 206 THR D CB  1 
ATOM   4893 O  OG1 . THR D 2 77  ? 18.584  -3.908  -31.996 1.00 56.19  ? 206 THR D OG1 1 
ATOM   4894 C  CG2 . THR D 2 77  ? 20.176  -4.706  -33.622 1.00 56.19  ? 206 THR D CG2 1 
ATOM   4895 N  N   . ASN D 2 78  ? 19.524  -8.615  -32.468 1.00 14.88  ? 207 ASN D N   1 
ATOM   4896 C  CA  . ASN D 2 78  ? 20.467  -9.717  -32.475 1.00 14.88  ? 207 ASN D CA  1 
ATOM   4897 C  C   . ASN D 2 78  ? 21.278  -9.647  -33.747 1.00 14.88  ? 207 ASN D C   1 
ATOM   4898 O  O   . ASN D 2 78  ? 20.978  -10.337 -34.714 1.00 14.88  ? 207 ASN D O   1 
ATOM   4899 C  CB  . ASN D 2 78  ? 19.731  -11.052 -32.352 1.00 81.01  ? 207 ASN D CB  1 
ATOM   4900 C  CG  . ASN D 2 78  ? 19.109  -11.247 -30.980 1.00 81.01  ? 207 ASN D CG  1 
ATOM   4901 O  OD1 . ASN D 2 78  ? 19.560  -12.080 -30.195 1.00 81.01  ? 207 ASN D OD1 1 
ATOM   4902 N  ND2 . ASN D 2 78  ? 18.077  -10.471 -30.681 1.00 81.01  ? 207 ASN D ND2 1 
ATOM   4903 N  N   . THR D 2 79  ? 22.295  -8.787  -33.746 1.00 63.71  ? 208 THR D N   1 
ATOM   4904 C  CA  . THR D 2 79  ? 23.143  -8.594  -34.918 1.00 63.71  ? 208 THR D CA  1 
ATOM   4905 C  C   . THR D 2 79  ? 23.933  -9.830  -35.319 1.00 63.71  ? 208 THR D C   1 
ATOM   4906 O  O   . THR D 2 79  ? 23.987  -10.192 -36.497 1.00 63.71  ? 208 THR D O   1 
ATOM   4907 C  CB  . THR D 2 79  ? 24.101  -7.391  -34.745 1.00 82.19  ? 208 THR D CB  1 
ATOM   4908 O  OG1 . THR D 2 79  ? 23.343  -6.172  -34.704 1.00 82.19  ? 208 THR D OG1 1 
ATOM   4909 C  CG2 . THR D 2 79  ? 25.075  -7.319  -35.905 1.00 82.19  ? 208 THR D CG2 1 
ATOM   4910 N  N   . PHE D 2 80  ? 24.531  -10.492 -34.344 1.00 31.85  ? 209 PHE D N   1 
ATOM   4911 C  CA  . PHE D 2 80  ? 25.297  -11.678 -34.656 1.00 31.85  ? 209 PHE D CA  1 
ATOM   4912 C  C   . PHE D 2 80  ? 24.440  -12.805 -35.195 1.00 31.85  ? 209 PHE D C   1 
ATOM   4913 O  O   . PHE D 2 80  ? 24.647  -13.253 -36.319 1.00 31.85  ? 209 PHE D O   1 
ATOM   4914 C  CB  . PHE D 2 80  ? 26.083  -12.108 -33.439 1.00 40.96  ? 209 PHE D CB  1 
ATOM   4915 C  CG  . PHE D 2 80  ? 27.119  -11.123 -33.047 1.00 40.96  ? 209 PHE D CG  1 
ATOM   4916 C  CD1 . PHE D 2 80  ? 26.779  -10.008 -32.310 1.00 40.96  ? 209 PHE D CD1 1 
ATOM   4917 C  CD2 . PHE D 2 80  ? 28.429  -11.279 -33.459 1.00 40.96  ? 209 PHE D CD2 1 
ATOM   4918 C  CE1 . PHE D 2 80  ? 27.732  -9.053  -31.986 1.00 40.96  ? 209 PHE D CE1 1 
ATOM   4919 C  CE2 . PHE D 2 80  ? 29.388  -10.335 -33.142 1.00 40.96  ? 209 PHE D CE2 1 
ATOM   4920 C  CZ  . PHE D 2 80  ? 29.039  -9.216  -32.403 1.00 40.96  ? 209 PHE D CZ  1 
ATOM   4921 N  N   . GLY D 2 81  ? 23.433  -13.199 -34.421 1.00 48.60  ? 210 GLY D N   1 
ATOM   4922 C  CA  . GLY D 2 81  ? 22.546  -14.273 -34.828 1.00 48.60  ? 210 GLY D CA  1 
ATOM   4923 C  C   . GLY D 2 81  ? 21.811  -13.988 -36.114 1.00 48.60  ? 210 GLY D C   1 
ATOM   4924 O  O   . GLY D 2 81  ? 21.126  -14.850 -36.645 1.00 48.60  ? 210 GLY D O   1 
ATOM   4925 N  N   . ALA D 2 82  ? 21.901  -12.750 -36.578 1.00 51.02  ? 211 ALA D N   1 
ATOM   4926 C  CA  . ALA D 2 82  ? 21.258  -12.350 -37.817 1.00 51.02  ? 211 ALA D CA  1 
ATOM   4927 C  C   . ALA D 2 82  ? 22.151  -12.805 -38.956 1.00 51.02  ? 211 ALA D C   1 
ATOM   4928 O  O   . ALA D 2 82  ? 21.689  -13.440 -39.913 1.00 51.02  ? 211 ALA D O   1 
ATOM   4929 C  CB  . ALA D 2 82  ? 21.088  -10.850 -37.853 1.00 98.65  ? 211 ALA D CB  1 
ATOM   4930 N  N   . ILE D 2 83  ? 23.436  -12.478 -38.828 1.00 98.65  ? 212 ILE D N   1 
ATOM   4931 C  CA  . ILE D 2 83  ? 24.451  -12.843 -39.811 1.00 98.65  ? 212 ILE D CA  1 
ATOM   4932 C  C   . ILE D 2 83  ? 24.521  -14.368 -39.926 1.00 98.65  ? 212 ILE D C   1 
ATOM   4933 O  O   . ILE D 2 83  ? 24.708  -14.916 -41.009 1.00 98.65  ? 212 ILE D O   1 
ATOM   4934 C  CB  . ILE D 2 83  ? 25.833  -12.295 -39.388 1.00 70.01  ? 212 ILE D CB  1 
ATOM   4935 C  CG1 . ILE D 2 83  ? 25.799  -10.769 -39.372 1.00 70.01  ? 212 ILE D CG1 1 
ATOM   4936 C  CG2 . ILE D 2 83  ? 26.926  -12.814 -40.316 1.00 70.01  ? 212 ILE D CG2 1 
ATOM   4937 C  CD1 . ILE D 2 83  ? 27.122  -10.119 -39.065 1.00 70.01  ? 212 ILE D CD1 1 
ATOM   4938 N  N   . ASN D 2 84  ? 24.328  -15.040 -38.797 1.00 78.19  ? 213 ASN D N   1 
ATOM   4939 C  CA  . ASN D 2 84  ? 24.355  -16.493 -38.749 1.00 78.19  ? 213 ASN D CA  1 
ATOM   4940 C  C   . ASN D 2 84  ? 23.037  -17.118 -39.223 1.00 78.19  ? 213 ASN D C   1 
ATOM   4941 O  O   . ASN D 2 84  ? 22.827  -18.314 -39.065 1.00 78.19  ? 213 ASN D O   1 
ATOM   4942 C  CB  . ASN D 2 84  ? 24.744  -16.957 -37.336 1.00 55.34  ? 213 ASN D CB  1 
ATOM   4943 C  CG  . ASN D 2 84  ? 26.140  -16.462 -36.911 1.00 55.34  ? 213 ASN D CG  1 
ATOM   4944 O  OD1 . ASN D 2 84  ? 27.040  -16.370 -37.736 1.00 55.34  ? 213 ASN D OD1 1 
ATOM   4945 N  ND2 . ASN D 2 84  ? 26.306  -16.116 -35.635 1.00 55.34  ? 213 ASN D ND2 1 
ATOM   4946 N  N   . TYR D 2 85  ? 22.160  -16.290 -39.791 1.00 97.95  ? 214 TYR D N   1 
ATOM   4947 C  CA  . TYR D 2 85  ? 20.877  -16.752 -40.329 1.00 97.95  ? 214 TYR D CA  1 
ATOM   4948 C  C   . TYR D 2 85  ? 20.994  -16.658 -41.831 1.00 97.95  ? 214 TYR D C   1 
ATOM   4949 O  O   . TYR D 2 85  ? 20.468  -17.513 -42.556 1.00 97.95  ? 214 TYR D O   1 
ATOM   4950 C  CB  . TYR D 2 85  ? 19.705  -15.877 -39.890 1.00 42.05  ? 214 TYR D CB  1 
ATOM   4951 C  CG  . TYR D 2 85  ? 18.344  -16.427 -40.289 1.00 42.05  ? 214 TYR D CG  1 
ATOM   4952 C  CD1 . TYR D 2 85  ? 17.775  -16.115 -41.517 1.00 42.05  ? 214 TYR D CD1 1 
ATOM   4953 C  CD2 . TYR D 2 85  ? 17.617  -17.245 -39.423 1.00 42.05  ? 214 TYR D CD2 1 
ATOM   4954 C  CE1 . TYR D 2 85  ? 16.515  -16.603 -41.870 1.00 42.05  ? 214 TYR D CE1 1 
ATOM   4955 C  CE2 . TYR D 2 85  ? 16.359  -17.732 -39.768 1.00 42.05  ? 214 TYR D CE2 1 
ATOM   4956 C  CZ  . TYR D 2 85  ? 15.816  -17.406 -40.987 1.00 42.05  ? 214 TYR D CZ  1 
ATOM   4957 O  OH  . TYR D 2 85  ? 14.563  -17.867 -41.310 1.00 42.05  ? 214 TYR D OH  1 
ATOM   4958 N  N   . VAL D 2 86  ? 21.660  -15.601 -42.298 1.00 74.64  ? 215 VAL D N   1 
ATOM   4959 C  CA  . VAL D 2 86  ? 21.898  -15.386 -43.725 1.00 74.64  ? 215 VAL D CA  1 
ATOM   4960 C  C   . VAL D 2 86  ? 22.737  -16.574 -44.184 1.00 74.64  ? 215 VAL D C   1 
ATOM   4961 O  O   . VAL D 2 86  ? 22.556  -17.092 -45.284 1.00 74.64  ? 215 VAL D O   1 
ATOM   4962 C  CB  . VAL D 2 86  ? 22.695  -14.065 -44.002 1.00 40.56  ? 215 VAL D CB  1 
ATOM   4963 C  CG1 . VAL D 2 86  ? 22.497  -13.626 -45.447 1.00 40.56  ? 215 VAL D CG1 1 
ATOM   4964 C  CG2 . VAL D 2 86  ? 22.276  -12.963 -43.061 1.00 40.56  ? 215 VAL D CG2 1 
ATOM   4965 N  N   . ALA D 2 87  ? 23.635  -17.016 -43.308 1.00 56.53  ? 216 ALA D N   1 
ATOM   4966 C  CA  . ALA D 2 87  ? 24.498  -18.146 -43.589 1.00 56.53  ? 216 ALA D CA  1 
ATOM   4967 C  C   . ALA D 2 87  ? 23.675  -19.437 -43.680 1.00 56.53  ? 216 ALA D C   1 
ATOM   4968 O  O   . ALA D 2 87  ? 23.315  -19.863 -44.782 1.00 56.53  ? 216 ALA D O   1 
ATOM   4969 C  CB  . ALA D 2 87  ? 25.571  -18.265 -42.511 1.00 45.89  ? 216 ALA D CB  1 
ATOM   4970 N  N   . THR D 2 88  ? 23.305  -19.999 -42.527 1.00 27.72  ? 217 THR D N   1 
ATOM   4971 C  CA  . THR D 2 88  ? 22.558  -21.252 -42.478 1.00 27.72  ? 217 THR D CA  1 
ATOM   4972 C  C   . THR D 2 88  ? 21.184  -21.333 -43.123 1.00 27.72  ? 217 THR D C   1 
ATOM   4973 O  O   . THR D 2 88  ? 20.953  -22.242 -43.908 1.00 27.72  ? 217 THR D O   1 
ATOM   4974 C  CB  . THR D 2 88  ? 22.445  -21.827 -41.053 1.00 98.65  ? 217 THR D CB  1 
ATOM   4975 O  OG1 . THR D 2 88  ? 21.403  -21.152 -40.336 1.00 98.65  ? 217 THR D OG1 1 
ATOM   4976 C  CG2 . THR D 2 88  ? 23.769  -21.689 -40.317 1.00 98.65  ? 217 THR D CG2 1 
ATOM   4977 N  N   . GLU D 2 89  ? 20.257  -20.442 -42.798 1.00 69.46  ? 218 GLU D N   1 
ATOM   4978 C  CA  . GLU D 2 89  ? 18.939  -20.566 -43.410 1.00 69.46  ? 218 GLU D CA  1 
ATOM   4979 C  C   . GLU D 2 89  ? 18.531  -19.492 -44.419 1.00 69.46  ? 218 GLU D C   1 
ATOM   4980 O  O   . GLU D 2 89  ? 17.383  -19.042 -44.430 1.00 69.46  ? 218 GLU D O   1 
ATOM   4981 C  CB  . GLU D 2 89  ? 17.859  -20.779 -42.333 1.00 67.86  ? 218 GLU D CB  1 
ATOM   4982 C  CG  . GLU D 2 89  ? 17.920  -22.163 -41.640 1.00 67.86  ? 218 GLU D CG  1 
ATOM   4983 C  CD  . GLU D 2 89  ? 16.728  -23.092 -41.959 1.00 67.86  ? 218 GLU D CD  1 
ATOM   4984 O  OE1 . GLU D 2 89  ? 15.689  -22.601 -42.463 1.00 67.86  ? 218 GLU D OE1 1 
ATOM   4985 O  OE2 . GLU D 2 89  ? 16.828  -24.315 -41.682 1.00 67.86  ? 218 GLU D OE2 1 
ATOM   4986 N  N   . VAL D 2 90  ? 19.447  -19.157 -45.324 1.00 34.83  ? 219 VAL D N   1 
ATOM   4987 C  CA  . VAL D 2 90  ? 19.195  -18.137 -46.353 1.00 34.83  ? 219 VAL D CA  1 
ATOM   4988 C  C   . VAL D 2 90  ? 19.905  -18.463 -47.678 1.00 34.83  ? 219 VAL D C   1 
ATOM   4989 O  O   . VAL D 2 90  ? 19.284  -18.492 -48.750 1.00 34.83  ? 219 VAL D O   1 
ATOM   4990 C  CB  . VAL D 2 90  ? 19.676  -16.726 -45.875 1.00 46.93  ? 219 VAL D CB  1 
ATOM   4991 C  CG1 . VAL D 2 90  ? 19.799  -15.756 -47.059 1.00 46.93  ? 219 VAL D CG1 1 
ATOM   4992 C  CG2 . VAL D 2 90  ? 18.728  -16.156 -44.821 1.00 46.93  ? 219 VAL D CG2 1 
ATOM   4993 N  N   . PHE D 2 91  ? 21.223  -18.650 -47.594 1.00 98.65  ? 220 PHE D N   1 
ATOM   4994 C  CA  . PHE D 2 91  ? 22.058  -18.963 -48.751 1.00 98.65  ? 220 PHE D CA  1 
ATOM   4995 C  C   . PHE D 2 91  ? 21.994  -20.424 -49.156 1.00 98.65  ? 220 PHE D C   1 
ATOM   4996 O  O   . PHE D 2 91  ? 22.787  -20.878 -49.978 1.00 98.65  ? 220 PHE D O   1 
ATOM   4997 C  CB  . PHE D 2 91  ? 23.512  -18.563 -48.488 1.00 81.46  ? 220 PHE D CB  1 
ATOM   4998 C  CG  . PHE D 2 91  ? 23.789  -17.104 -48.697 1.00 81.46  ? 220 PHE D CG  1 
ATOM   4999 C  CD1 . PHE D 2 91  ? 23.061  -16.372 -49.629 1.00 81.46  ? 220 PHE D CD1 1 
ATOM   5000 C  CD2 . PHE D 2 91  ? 24.792  -16.463 -47.972 1.00 81.46  ? 220 PHE D CD2 1 
ATOM   5001 C  CE1 . PHE D 2 91  ? 23.329  -15.024 -49.844 1.00 81.46  ? 220 PHE D CE1 1 
ATOM   5002 C  CE2 . PHE D 2 91  ? 25.068  -15.112 -48.177 1.00 81.46  ? 220 PHE D CE2 1 
ATOM   5003 C  CZ  . PHE D 2 91  ? 24.335  -14.390 -49.115 1.00 81.46  ? 220 PHE D CZ  1 
ATOM   5004 N  N   . ARG D 2 92  ? 21.058  -21.160 -48.560 1.00 98.65  ? 221 ARG D N   1 
ATOM   5005 C  CA  . ARG D 2 92  ? 20.885  -22.567 -48.877 1.00 98.65  ? 221 ARG D CA  1 
ATOM   5006 C  C   . ARG D 2 92  ? 20.410  -22.691 -50.317 1.00 98.65  ? 221 ARG D C   1 
ATOM   5007 O  O   . ARG D 2 92  ? 19.436  -22.033 -50.708 1.00 98.65  ? 221 ARG D O   1 
ATOM   5008 C  CB  . ARG D 2 92  ? 19.878  -23.227 -47.927 1.00 98.65  ? 221 ARG D CB  1 
ATOM   5009 C  CG  . ARG D 2 92  ? 20.459  -23.527 -46.561 1.00 98.65  ? 221 ARG D CG  1 
ATOM   5010 C  CD  . ARG D 2 92  ? 19.599  -24.494 -45.767 1.00 98.65  ? 221 ARG D CD  1 
ATOM   5011 N  NE  . ARG D 2 92  ? 20.286  -24.917 -44.547 1.00 98.65  ? 221 ARG D NE  1 
ATOM   5012 C  CZ  . ARG D 2 92  ? 19.777  -25.736 -43.628 1.00 98.65  ? 221 ARG D CZ  1 
ATOM   5013 N  NH1 . ARG D 2 92  ? 18.556  -26.246 -43.768 1.00 98.65  ? 221 ARG D NH1 1 
ATOM   5014 N  NH2 . ARG D 2 92  ? 20.495  -26.045 -42.555 1.00 98.65  ? 221 ARG D NH2 1 
ATOM   5015 N  N   . GLU D 2 93  ? 21.127  -23.497 -51.106 1.00 79.68  ? 222 GLU D N   1 
ATOM   5016 C  CA  . GLU D 2 93  ? 20.805  -23.711 -52.514 1.00 79.68  ? 222 GLU D CA  1 
ATOM   5017 C  C   . GLU D 2 93  ? 19.321  -24.000 -52.716 1.00 79.68  ? 222 GLU D C   1 
ATOM   5018 O  O   . GLU D 2 93  ? 18.726  -23.526 -53.691 1.00 79.68  ? 222 GLU D O   1 
ATOM   5019 C  CB  . GLU D 2 93  ? 21.651  -24.852 -53.092 1.00 98.65  ? 222 GLU D CB  1 
ATOM   5020 C  CG  . GLU D 2 93  ? 21.336  -25.217 -54.557 1.00 98.65  ? 222 GLU D CG  1 
ATOM   5021 C  CD  . GLU D 2 93  ? 22.483  -24.932 -55.536 1.00 98.65  ? 222 GLU D CD  1 
ATOM   5022 O  OE1 . GLU D 2 93  ? 23.632  -25.359 -55.276 1.00 98.65  ? 222 GLU D OE1 1 
ATOM   5023 O  OE2 . GLU D 2 93  ? 22.220  -24.306 -56.586 1.00 98.65  ? 222 GLU D OE2 1 
ATOM   5024 N  N   . GLU D 2 94  ? 18.720  -24.716 -51.760 1.00 98.65  ? 223 GLU D N   1 
ATOM   5025 C  CA  . GLU D 2 94  ? 17.298  -25.076 -51.817 1.00 98.65  ? 223 GLU D CA  1 
ATOM   5026 C  C   . GLU D 2 94  ? 16.380  -23.906 -52.166 1.00 98.65  ? 223 GLU D C   1 
ATOM   5027 O  O   . GLU D 2 94  ? 15.549  -24.018 -53.069 1.00 98.65  ? 223 GLU D O   1 
ATOM   5028 C  CB  . GLU D 2 94  ? 16.816  -25.711 -50.505 1.00 98.65  ? 223 GLU D CB  1 
ATOM   5029 C  CG  . GLU D 2 94  ? 15.380  -26.271 -50.607 1.00 98.65  ? 223 GLU D CG  1 
ATOM   5030 C  CD  . GLU D 2 94  ? 14.792  -26.738 -49.281 1.00 98.65  ? 223 GLU D CD  1 
ATOM   5031 O  OE1 . GLU D 2 94  ? 15.545  -26.865 -48.288 1.00 98.65  ? 223 GLU D OE1 1 
ATOM   5032 O  OE2 . GLU D 2 94  ? 13.564  -26.977 -49.237 1.00 98.65  ? 223 GLU D OE2 1 
ATOM   5033 N  N   . LEU D 2 95  ? 16.516  -22.796 -51.447 1.00 98.65  ? 224 LEU D N   1 
ATOM   5034 C  CA  . LEU D 2 95  ? 15.681  -21.636 -51.723 1.00 98.65  ? 224 LEU D CA  1 
ATOM   5035 C  C   . LEU D 2 95  ? 15.808  -21.192 -53.183 1.00 98.65  ? 224 LEU D C   1 
ATOM   5036 O  O   . LEU D 2 95  ? 14.861  -21.346 -53.957 1.00 98.65  ? 224 LEU D O   1 
ATOM   5037 C  CB  . LEU D 2 95  ? 15.992  -20.478 -50.764 1.00 98.65  ? 224 LEU D CB  1 
ATOM   5038 C  CG  . LEU D 2 95  ? 15.318  -20.519 -49.388 1.00 98.65  ? 224 LEU D CG  1 
ATOM   5039 C  CD1 . LEU D 2 95  ? 15.853  -21.690 -48.573 1.00 98.65  ? 224 LEU D CD1 1 
ATOM   5040 C  CD2 . LEU D 2 95  ? 15.559  -19.202 -48.665 1.00 98.65  ? 224 LEU D CD2 1 
ATOM   5041 N  N   . GLY D 2 96  ? 16.982  -20.697 -53.570 1.00 72.48  ? 225 GLY D N   1 
ATOM   5042 C  CA  . GLY D 2 96  ? 17.164  -20.255 -54.939 1.00 72.48  ? 225 GLY D CA  1 
ATOM   5043 C  C   . GLY D 2 96  ? 18.440  -19.482 -55.180 1.00 72.48  ? 225 GLY D C   1 
ATOM   5044 O  O   . GLY D 2 96  ? 18.407  -18.372 -55.716 1.00 72.48  ? 225 GLY D O   1 
ATOM   5045 N  N   . ALA D 2 97  ? 19.567  -20.081 -54.796 1.00 98.65  ? 226 ALA D N   1 
ATOM   5046 C  CA  . ALA D 2 97  ? 20.888  -19.469 -54.967 1.00 98.65  ? 226 ALA D CA  1 
ATOM   5047 C  C   . ALA D 2 97  ? 21.723  -20.199 -56.026 1.00 98.65  ? 226 ALA D C   1 
ATOM   5048 O  O   . ALA D 2 97  ? 21.639  -21.428 -56.161 1.00 98.65  ? 226 ALA D O   1 
ATOM   5049 C  CB  . ALA D 2 97  ? 21.635  -19.451 -53.643 1.00 64.55  ? 226 ALA D CB  1 
ATOM   5050 N  N   . ARG D 2 98  ? 22.524  -19.432 -56.770 1.00 98.65  ? 227 ARG D N   1 
ATOM   5051 C  CA  . ARG D 2 98  ? 23.385  -19.974 -57.824 1.00 98.65  ? 227 ARG D CA  1 
ATOM   5052 C  C   . ARG D 2 98  ? 24.802  -20.192 -57.272 1.00 98.65  ? 227 ARG D C   1 
ATOM   5053 O  O   . ARG D 2 98  ? 25.430  -19.248 -56.791 1.00 98.65  ? 227 ARG D O   1 
ATOM   5054 C  CB  . ARG D 2 98  ? 23.416  -19.018 -59.030 1.00 98.65  ? 227 ARG D CB  1 
ATOM   5055 C  CG  . ARG D 2 98  ? 22.034  -18.620 -59.574 1.00 98.65  ? 227 ARG D CG  1 
ATOM   5056 C  CD  . ARG D 2 98  ? 22.130  -17.900 -60.926 1.00 98.65  ? 227 ARG D CD  1 
ATOM   5057 N  NE  . ARG D 2 98  ? 20.830  -17.435 -61.425 1.00 98.65  ? 227 ARG D NE  1 
ATOM   5058 C  CZ  . ARG D 2 98  ? 20.456  -17.423 -62.707 1.00 98.65  ? 227 ARG D CZ  1 
ATOM   5059 N  NH1 . ARG D 2 98  ? 21.271  -17.852 -63.665 1.00 98.65  ? 227 ARG D NH1 1 
ATOM   5060 N  NH2 . ARG D 2 98  ? 19.253  -16.974 -63.036 1.00 98.65  ? 227 ARG D NH2 1 
ATOM   5061 N  N   . PRO D 2 99  ? 25.316  -21.441 -57.330 1.00 98.65  ? 228 PRO D N   1 
ATOM   5062 C  CA  . PRO D 2 99  ? 26.648  -21.845 -56.850 1.00 98.65  ? 228 PRO D CA  1 
ATOM   5063 C  C   . PRO D 2 99  ? 27.816  -20.988 -57.335 1.00 98.65  ? 228 PRO D C   1 
ATOM   5064 O  O   . PRO D 2 99  ? 28.546  -20.411 -56.521 1.00 98.65  ? 228 PRO D O   1 
ATOM   5065 C  CB  . PRO D 2 99  ? 26.773  -23.278 -57.362 1.00 98.65  ? 228 PRO D CB  1 
ATOM   5066 C  CG  . PRO D 2 99  ? 25.381  -23.762 -57.291 1.00 98.65  ? 228 PRO D CG  1 
ATOM   5067 C  CD  . PRO D 2 99  ? 24.601  -22.607 -57.876 1.00 98.65  ? 228 PRO D CD  1 
ATOM   5068 N  N   . ASP D 2 100 ? 27.997  -20.929 -58.656 1.00 98.65  ? 229 ASP D N   1 
ATOM   5069 C  CA  . ASP D 2 100 ? 29.078  -20.150 -59.260 1.00 98.65  ? 229 ASP D CA  1 
ATOM   5070 C  C   . ASP D 2 100 ? 28.750  -18.648 -59.244 1.00 98.65  ? 229 ASP D C   1 
ATOM   5071 O  O   . ASP D 2 100 ? 28.709  -17.987 -60.290 1.00 98.65  ? 229 ASP D O   1 
ATOM   5072 C  CB  . ASP D 2 100 ? 29.339  -20.636 -60.695 1.00 98.64  ? 229 ASP D CB  1 
ATOM   5073 C  CG  . ASP D 2 100 ? 30.804  -20.484 -61.122 1.00 98.64  ? 229 ASP D CG  1 
ATOM   5074 O  OD1 . ASP D 2 100 ? 31.532  -19.634 -60.553 1.00 98.64  ? 229 ASP D OD1 1 
ATOM   5075 O  OD2 . ASP D 2 100 ? 31.228  -21.227 -62.038 1.00 98.64  ? 229 ASP D OD2 1 
ATOM   5076 N  N   . ALA D 2 101 ? 28.524  -18.122 -58.040 1.00 98.65  ? 230 ALA D N   1 
ATOM   5077 C  CA  . ALA D 2 101 ? 28.199  -16.713 -57.832 1.00 98.65  ? 230 ALA D CA  1 
ATOM   5078 C  C   . ALA D 2 101 ? 28.688  -16.268 -56.448 1.00 98.65  ? 230 ALA D C   1 
ATOM   5079 O  O   . ALA D 2 101 ? 28.698  -17.061 -55.496 1.00 98.65  ? 230 ALA D O   1 
ATOM   5080 C  CB  . ALA D 2 101 ? 26.691  -16.492 -57.972 1.00 78.31  ? 230 ALA D CB  1 
ATOM   5081 N  N   . THR D 2 102 ? 29.099  -15.004 -56.346 1.00 98.64  ? 231 THR D N   1 
ATOM   5082 C  CA  . THR D 2 102 ? 29.612  -14.450 -55.094 1.00 98.64  ? 231 THR D CA  1 
ATOM   5083 C  C   . THR D 2 102 ? 28.493  -14.039 -54.122 1.00 98.64  ? 231 THR D C   1 
ATOM   5084 O  O   . THR D 2 102 ? 27.616  -13.245 -54.467 1.00 98.64  ? 231 THR D O   1 
ATOM   5085 C  CB  . THR D 2 102 ? 30.571  -13.248 -55.369 1.00 96.04  ? 231 THR D CB  1 
ATOM   5086 O  OG1 . THR D 2 102 ? 31.446  -13.566 -56.461 1.00 96.04  ? 231 THR D OG1 1 
ATOM   5087 C  CG2 . THR D 2 102 ? 31.433  -12.956 -54.155 1.00 96.04  ? 231 THR D CG2 1 
ATOM   5088 N  N   . LYS D 2 103 ? 28.535  -14.605 -52.912 1.00 98.65  ? 232 LYS D N   1 
ATOM   5089 C  CA  . LYS D 2 103 ? 27.550  -14.333 -51.856 1.00 98.65  ? 232 LYS D CA  1 
ATOM   5090 C  C   . LYS D 2 103 ? 27.860  -13.067 -51.035 1.00 98.65  ? 232 LYS D C   1 
ATOM   5091 O  O   . LYS D 2 103 ? 28.721  -13.070 -50.148 1.00 98.65  ? 232 LYS D O   1 
ATOM   5092 C  CB  . LYS D 2 103 ? 27.413  -15.557 -50.941 1.00 86.73  ? 232 LYS D CB  1 
ATOM   5093 C  CG  . LYS D 2 103 ? 28.671  -15.935 -50.158 1.00 86.73  ? 232 LYS D CG  1 
ATOM   5094 C  CD  . LYS D 2 103 ? 28.997  -17.418 -50.260 1.00 86.73  ? 232 LYS D CD  1 
ATOM   5095 C  CE  . LYS D 2 103 ? 29.650  -17.744 -51.601 1.00 86.73  ? 232 LYS D CE  1 
ATOM   5096 N  NZ  . LYS D 2 103 ? 30.057  -19.175 -51.715 1.00 86.73  ? 232 LYS D NZ  1 
ATOM   5097 N  N   . VAL D 2 104 ? 27.165  -11.979 -51.354 1.00 68.95  ? 233 VAL D N   1 
ATOM   5098 C  CA  . VAL D 2 104 ? 27.362  -10.708 -50.663 1.00 68.95  ? 233 VAL D CA  1 
ATOM   5099 C  C   . VAL D 2 104 ? 26.402  -10.559 -49.478 1.00 68.95  ? 233 VAL D C   1 
ATOM   5100 O  O   . VAL D 2 104 ? 25.312  -11.146 -49.438 1.00 68.95  ? 233 VAL D O   1 
ATOM   5101 C  CB  . VAL D 2 104 ? 27.223  -9.509  -51.645 1.00 47.04  ? 233 VAL D CB  1 
ATOM   5102 C  CG1 . VAL D 2 104 ? 27.550  -8.185  -50.953 1.00 47.04  ? 233 VAL D CG1 1 
ATOM   5103 C  CG2 . VAL D 2 104 ? 28.138  -9.721  -52.827 1.00 47.04  ? 233 VAL D CG2 1 
ATOM   5104 N  N   . LEU D 2 105 ? 26.823  -9.743  -48.522 1.00 98.65  ? 234 LEU D N   1 
ATOM   5105 C  CA  . LEU D 2 105 ? 26.065  -9.500  -47.308 1.00 98.65  ? 234 LEU D CA  1 
ATOM   5106 C  C   . LEU D 2 105 ? 25.992  -7.993  -47.064 1.00 98.65  ? 234 LEU D C   1 
ATOM   5107 O  O   . LEU D 2 105 ? 27.013  -7.349  -46.840 1.00 98.65  ? 234 LEU D O   1 
ATOM   5108 C  CB  . LEU D 2 105 ? 26.799  -10.184 -46.147 1.00 39.18  ? 234 LEU D CB  1 
ATOM   5109 C  CG  . LEU D 2 105 ? 26.226  -10.470 -44.760 1.00 39.18  ? 234 LEU D CG  1 
ATOM   5110 C  CD1 . LEU D 2 105 ? 25.117  -11.514 -44.794 1.00 39.18  ? 234 LEU D CD1 1 
ATOM   5111 C  CD2 . LEU D 2 105 ? 27.372  -10.992 -43.927 1.00 39.18  ? 234 LEU D CD2 1 
ATOM   5112 N  N   . ILE D 2 106 ? 24.794  -7.432  -47.192 1.00 47.90  ? 235 ILE D N   1 
ATOM   5113 C  CA  . ILE D 2 106 ? 24.558  -6.013  -46.944 1.00 47.90  ? 235 ILE D CA  1 
ATOM   5114 C  C   . ILE D 2 106 ? 23.812  -5.889  -45.620 1.00 47.90  ? 235 ILE D C   1 
ATOM   5115 O  O   . ILE D 2 106 ? 22.588  -6.019  -45.588 1.00 47.90  ? 235 ILE D O   1 
ATOM   5116 C  CB  . ILE D 2 106 ? 23.674  -5.379  -48.028 1.00 33.70  ? 235 ILE D CB  1 
ATOM   5117 C  CG1 . ILE D 2 106 ? 24.478  -5.194  -49.308 1.00 33.70  ? 235 ILE D CG1 1 
ATOM   5118 C  CG2 . ILE D 2 106 ? 23.127  -4.026  -47.557 1.00 33.70  ? 235 ILE D CG2 1 
ATOM   5119 C  CD1 . ILE D 2 106 ? 25.318  -3.930  -49.314 1.00 33.70  ? 235 ILE D CD1 1 
ATOM   5120 N  N   . ILE D 2 107 ? 24.556  -5.643  -44.539 1.00 58.83  ? 236 ILE D N   1 
ATOM   5121 C  CA  . ILE D 2 107 ? 23.973  -5.497  -43.204 1.00 58.83  ? 236 ILE D CA  1 
ATOM   5122 C  C   . ILE D 2 107 ? 23.598  -4.049  -42.957 1.00 58.83  ? 236 ILE D C   1 
ATOM   5123 O  O   . ILE D 2 107 ? 24.390  -3.148  -43.194 1.00 58.83  ? 236 ILE D O   1 
ATOM   5124 C  CB  . ILE D 2 107 ? 24.953  -5.910  -42.104 1.00 78.17  ? 236 ILE D CB  1 
ATOM   5125 C  CG1 . ILE D 2 107 ? 25.633  -7.234  -42.459 1.00 78.17  ? 236 ILE D CG1 1 
ATOM   5126 C  CG2 . ILE D 2 107 ? 24.213  -6.017  -40.779 1.00 78.17  ? 236 ILE D CG2 1 
ATOM   5127 C  CD1 . ILE D 2 107 ? 26.881  -7.498  -41.650 1.00 78.17  ? 236 ILE D CD1 1 
ATOM   5128 N  N   . ILE D 2 108 ? 22.381  -3.833  -42.484 1.00 78.06  ? 237 ILE D N   1 
ATOM   5129 C  CA  . ILE D 2 108 ? 21.904  -2.491  -42.215 1.00 78.06  ? 237 ILE D CA  1 
ATOM   5130 C  C   . ILE D 2 108 ? 21.462  -2.447  -40.764 1.00 78.06  ? 237 ILE D C   1 
ATOM   5131 O  O   . ILE D 2 108 ? 20.546  -3.164  -40.368 1.00 78.06  ? 237 ILE D O   1 
ATOM   5132 C  CB  . ILE D 2 108 ? 20.720  -2.125  -43.138 1.00 54.85  ? 237 ILE D CB  1 
ATOM   5133 C  CG1 . ILE D 2 108 ? 20.959  -2.683  -44.545 1.00 54.85  ? 237 ILE D CG1 1 
ATOM   5134 C  CG2 . ILE D 2 108 ? 20.544  -0.602  -43.205 1.00 54.85  ? 237 ILE D CG2 1 
ATOM   5135 C  CD1 . ILE D 2 108 ? 19.781  -2.571  -45.489 1.00 54.85  ? 237 ILE D CD1 1 
ATOM   5136 N  N   . THR D 2 109 ? 22.170  -1.659  -39.959 1.00 98.65  ? 238 THR D N   1 
ATOM   5137 C  CA  . THR D 2 109 ? 21.874  -1.517  -38.528 1.00 98.65  ? 238 THR D CA  1 
ATOM   5138 C  C   . THR D 2 109 ? 22.643  -0.340  -37.910 1.00 98.65  ? 238 THR D C   1 
ATOM   5139 O  O   . THR D 2 109 ? 23.723  0.030   -38.387 1.00 98.65  ? 238 THR D O   1 
ATOM   5140 C  CB  . THR D 2 109 ? 22.134  -2.853  -37.747 1.00 48.67  ? 238 THR D CB  1 
ATOM   5141 O  OG1 . THR D 2 109 ? 21.722  -2.710  -36.379 1.00 48.67  ? 238 THR D OG1 1 
ATOM   5142 C  CG2 . THR D 2 109 ? 23.626  -3.264  -37.797 1.00 48.67  ? 238 THR D CG2 1 
ATOM   5143 N  N   . ASP D 2 110 ? 22.064  0.278   -36.879 1.00 62.76  ? 239 ASP D N   1 
ATOM   5144 C  CA  . ASP D 2 110 ? 22.703  1.415   -36.201 1.00 62.76  ? 239 ASP D CA  1 
ATOM   5145 C  C   . ASP D 2 110 ? 24.018  1.049   -35.516 1.00 62.76  ? 239 ASP D C   1 
ATOM   5146 O  O   . ASP D 2 110 ? 24.653  1.892   -34.879 1.00 62.76  ? 239 ASP D O   1 
ATOM   5147 C  CB  . ASP D 2 110 ? 21.738  2.042   -35.176 1.00 98.65  ? 239 ASP D CB  1 
ATOM   5148 C  CG  . ASP D 2 110 ? 21.280  1.047   -34.123 1.00 98.65  ? 239 ASP D CG  1 
ATOM   5149 O  OD1 . ASP D 2 110 ? 21.738  -0.132  -34.146 1.00 98.65  ? 239 ASP D OD1 1 
ATOM   5150 O  OD2 . ASP D 2 110 ? 20.461  1.420   -33.266 1.00 98.65  ? 239 ASP D OD2 1 
ATOM   5151 N  N   . GLY D 2 111 ? 24.394  -0.224  -35.636 1.00 90.91  ? 240 GLY D N   1 
ATOM   5152 C  CA  . GLY D 2 111 ? 25.614  -0.713  -35.029 1.00 90.91  ? 240 GLY D CA  1 
ATOM   5153 C  C   . GLY D 2 111 ? 25.536  -0.849  -33.534 1.00 90.91  ? 240 GLY D C   1 
ATOM   5154 O  O   . GLY D 2 111 ? 26.456  -0.471  -32.836 1.00 90.91  ? 240 GLY D O   1 
ATOM   5155 N  N   . GLU D 2 112 ? 24.421  -1.395  -33.058 1.00 69.52  ? 241 GLU D N   1 
ATOM   5156 C  CA  . GLU D 2 112 ? 24.186  -1.599  -31.630 1.00 69.52  ? 241 GLU D CA  1 
ATOM   5157 C  C   . GLU D 2 112 ? 23.691  -3.029  -31.413 1.00 69.52  ? 241 GLU D C   1 
ATOM   5158 O  O   . GLU D 2 112 ? 22.543  -3.356  -31.734 1.00 69.52  ? 241 GLU D O   1 
ATOM   5159 C  CB  . GLU D 2 112 ? 23.134  -0.610  -31.113 1.00 71.31  ? 241 GLU D CB  1 
ATOM   5160 C  CG  . GLU D 2 112 ? 22.673  -0.861  -29.692 1.00 71.31  ? 241 GLU D CG  1 
ATOM   5161 C  CD  . GLU D 2 112 ? 21.442  -0.053  -29.330 1.00 71.31  ? 241 GLU D CD  1 
ATOM   5162 O  OE1 . GLU D 2 112 ? 21.179  0.094   -28.118 1.00 71.31  ? 241 GLU D OE1 1 
ATOM   5163 O  OE2 . GLU D 2 112 ? 20.728  0.419   -30.249 1.00 71.31  ? 241 GLU D OE2 1 
ATOM   5164 N  N   . ALA D 2 113 ? 24.557  -3.883  -30.878 1.00 42.62  ? 242 ALA D N   1 
ATOM   5165 C  CA  . ALA D 2 113 ? 24.187  -5.271  -30.660 1.00 42.62  ? 242 ALA D CA  1 
ATOM   5166 C  C   . ALA D 2 113 ? 23.518  -5.494  -29.311 1.00 42.62  ? 242 ALA D C   1 
ATOM   5167 O  O   . ALA D 2 113 ? 23.838  -4.807  -28.333 1.00 42.62  ? 242 ALA D O   1 
ATOM   5168 C  CB  . ALA D 2 113 ? 25.404  -6.152  -30.793 1.00 98.65  ? 242 ALA D CB  1 
ATOM   5169 N  N   . THR D 2 114 ? 22.569  -6.433  -29.285 1.00 81.69  ? 243 THR D N   1 
ATOM   5170 C  CA  . THR D 2 114 ? 21.843  -6.809  -28.067 1.00 81.69  ? 243 THR D CA  1 
ATOM   5171 C  C   . THR D 2 114 ? 22.303  -8.177  -27.600 1.00 81.69  ? 243 THR D C   1 
ATOM   5172 O  O   . THR D 2 114 ? 21.678  -8.802  -26.743 1.00 81.69  ? 243 THR D O   1 
ATOM   5173 C  CB  . THR D 2 114 ? 20.329  -6.898  -28.276 1.00 51.89  ? 243 THR D CB  1 
ATOM   5174 O  OG1 . THR D 2 114 ? 20.030  -7.870  -29.285 1.00 51.89  ? 243 THR D OG1 1 
ATOM   5175 C  CG2 . THR D 2 114 ? 19.776  -5.553  -28.656 1.00 51.89  ? 243 THR D CG2 1 
ATOM   5176 N  N   . ASP D 2 115 ? 23.362  -8.664  -28.229 1.00 61.64  ? 244 ASP D N   1 
ATOM   5177 C  CA  . ASP D 2 115 ? 23.946  -9.945  -27.889 1.00 61.64  ? 244 ASP D CA  1 
ATOM   5178 C  C   . ASP D 2 115 ? 25.354  -10.020 -28.461 1.00 61.64  ? 244 ASP D C   1 
ATOM   5179 O  O   . ASP D 2 115 ? 25.711  -9.242  -29.341 1.00 61.64  ? 244 ASP D O   1 
ATOM   5180 C  CB  . ASP D 2 115 ? 23.067  -11.097 -28.390 1.00 40.45  ? 244 ASP D CB  1 
ATOM   5181 C  CG  . ASP D 2 115 ? 22.892  -11.101 -29.895 1.00 40.45  ? 244 ASP D CG  1 
ATOM   5182 O  OD1 . ASP D 2 115 ? 23.250  -10.101 -30.546 1.00 40.45  ? 244 ASP D OD1 1 
ATOM   5183 O  OD2 . ASP D 2 115 ? 22.383  -12.112 -30.432 1.00 40.45  ? 244 ASP D OD2 1 
ATOM   5184 N  N   . SER D 2 116 ? 26.172  -10.903 -27.908 1.00 65.85  ? 245 SER D N   1 
ATOM   5185 C  CA  . SER D 2 116 ? 27.538  -11.065 -28.378 1.00 65.85  ? 245 SER D CA  1 
ATOM   5186 C  C   . SER D 2 116 ? 27.664  -12.455 -28.969 1.00 65.85  ? 245 SER D C   1 
ATOM   5187 O  O   . SER D 2 116 ? 27.693  -13.440 -28.234 1.00 65.85  ? 245 SER D O   1 
ATOM   5188 C  CB  . SER D 2 116 ? 28.528  -10.886 -27.224 1.00 98.65  ? 245 SER D CB  1 
ATOM   5189 O  OG  . SER D 2 116 ? 28.265  -11.801 -26.172 1.00 98.65  ? 245 SER D OG  1 
ATOM   5190 N  N   . GLY D 2 117 ? 27.668  -12.535 -30.295 1.00 76.08  ? 246 GLY D N   1 
ATOM   5191 C  CA  . GLY D 2 117 ? 27.793  -13.820 -30.954 1.00 76.08  ? 246 GLY D CA  1 
ATOM   5192 C  C   . GLY D 2 117 ? 29.103  -13.933 -31.709 1.00 76.08  ? 246 GLY D C   1 
ATOM   5193 O  O   . GLY D 2 117 ? 30.085  -13.263 -31.379 1.00 76.08  ? 246 GLY D O   1 
ATOM   5194 N  N   . ASN D 2 118 ? 29.114  -14.773 -32.738 1.00 98.65  ? 247 ASN D N   1 
ATOM   5195 C  CA  . ASN D 2 118 ? 30.305  -14.973 -33.557 1.00 98.65  ? 247 ASN D CA  1 
ATOM   5196 C  C   . ASN D 2 118 ? 29.874  -15.288 -34.992 1.00 98.65  ? 247 ASN D C   1 
ATOM   5197 O  O   . ASN D 2 118 ? 28.970  -16.102 -35.219 1.00 98.65  ? 247 ASN D O   1 
ATOM   5198 C  CB  . ASN D 2 118 ? 31.164  -16.110 -32.979 1.00 98.65  ? 247 ASN D CB  1 
ATOM   5199 C  CG  . ASN D 2 118 ? 32.625  -16.022 -33.407 1.00 98.65  ? 247 ASN D CG  1 
ATOM   5200 O  OD1 . ASN D 2 118 ? 33.005  -15.152 -34.196 1.00 98.65  ? 247 ASN D OD1 1 
ATOM   5201 N  ND2 . ASN D 2 118 ? 33.454  -16.920 -32.873 1.00 98.65  ? 247 ASN D ND2 1 
ATOM   5202 N  N   . ILE D 2 119 ? 30.514  -14.623 -35.952 1.00 93.55  ? 248 ILE D N   1 
ATOM   5203 C  CA  . ILE D 2 119 ? 30.200  -14.806 -37.363 1.00 93.55  ? 248 ILE D CA  1 
ATOM   5204 C  C   . ILE D 2 119 ? 31.167  -15.690 -38.124 1.00 93.55  ? 248 ILE D C   1 
ATOM   5205 O  O   . ILE D 2 119 ? 31.134  -15.710 -39.356 1.00 93.55  ? 248 ILE D O   1 
ATOM   5206 C  CB  . ILE D 2 119 ? 30.138  -13.470 -38.091 1.00 55.72  ? 248 ILE D CB  1 
ATOM   5207 C  CG1 . ILE D 2 119 ? 31.479  -12.756 -37.957 1.00 55.72  ? 248 ILE D CG1 1 
ATOM   5208 C  CG2 . ILE D 2 119 ? 29.032  -12.637 -37.524 1.00 55.72  ? 248 ILE D CG2 1 
ATOM   5209 C  CD1 . ILE D 2 119 ? 31.591  -11.506 -38.793 1.00 55.72  ? 248 ILE D CD1 1 
ATOM   5210 N  N   . ASP D 2 120 ? 32.034  -16.410 -37.412 1.00 84.70  ? 249 ASP D N   1 
ATOM   5211 C  CA  . ASP D 2 120 ? 32.995  -17.297 -38.070 1.00 84.70  ? 249 ASP D CA  1 
ATOM   5212 C  C   . ASP D 2 120 ? 32.271  -18.292 -38.961 1.00 84.70  ? 249 ASP D C   1 
ATOM   5213 O  O   . ASP D 2 120 ? 32.868  -18.832 -39.892 1.00 84.70  ? 249 ASP D O   1 
ATOM   5214 C  CB  . ASP D 2 120 ? 33.862  -18.045 -37.047 1.00 87.62  ? 249 ASP D CB  1 
ATOM   5215 C  CG  . ASP D 2 120 ? 35.050  -17.226 -36.569 1.00 87.62  ? 249 ASP D CG  1 
ATOM   5216 O  OD1 . ASP D 2 120 ? 35.792  -17.724 -35.703 1.00 87.62  ? 249 ASP D OD1 1 
ATOM   5217 O  OD2 . ASP D 2 120 ? 35.252  -16.086 -37.057 1.00 87.62  ? 249 ASP D OD2 1 
ATOM   5218 N  N   . ALA D 2 121 ? 30.992  -18.528 -38.669 1.00 91.37  ? 250 ALA D N   1 
ATOM   5219 C  CA  . ALA D 2 121 ? 30.180  -19.457 -39.453 1.00 91.37  ? 250 ALA D CA  1 
ATOM   5220 C  C   . ALA D 2 121 ? 29.914  -18.980 -40.889 1.00 91.37  ? 250 ALA D C   1 
ATOM   5221 O  O   . ALA D 2 121 ? 29.285  -19.688 -41.689 1.00 91.37  ? 250 ALA D O   1 
ATOM   5222 C  CB  . ALA D 2 121 ? 28.874  -19.741 -38.742 1.00 83.91  ? 250 ALA D CB  1 
ATOM   5223 N  N   . ALA D 2 122 ? 30.423  -17.794 -41.218 1.00 46.71  ? 251 ALA D N   1 
ATOM   5224 C  CA  . ALA D 2 122 ? 30.261  -17.198 -42.553 1.00 46.71  ? 251 ALA D CA  1 
ATOM   5225 C  C   . ALA D 2 122 ? 31.286  -16.053 -42.738 1.00 46.71  ? 251 ALA D C   1 
ATOM   5226 O  O   . ALA D 2 122 ? 31.001  -15.065 -43.425 1.00 46.71  ? 251 ALA D O   1 
ATOM   5227 C  CB  . ALA D 2 122 ? 28.849  -16.687 -42.744 1.00 96.98  ? 251 ALA D CB  1 
ATOM   5228 N  N   . LYS D 2 123 ? 32.478  -16.199 -42.140 1.00 98.65  ? 252 LYS D N   1 
ATOM   5229 C  CA  . LYS D 2 123 ? 33.572  -15.199 -42.210 1.00 98.65  ? 252 LYS D CA  1 
ATOM   5230 C  C   . LYS D 2 123 ? 34.096  -14.939 -43.614 1.00 98.65  ? 252 LYS D C   1 
ATOM   5231 O  O   . LYS D 2 123 ? 34.892  -14.023 -43.836 1.00 98.65  ? 252 LYS D O   1 
ATOM   5232 C  CB  . LYS D 2 123 ? 34.724  -15.617 -41.280 1.00 98.50  ? 252 LYS D CB  1 
ATOM   5233 C  CG  . LYS D 2 123 ? 34.807  -14.878 -39.949 1.00 98.50  ? 252 LYS D CG  1 
ATOM   5234 C  CD  . LYS D 2 123 ? 35.421  -13.484 -40.091 1.00 98.50  ? 252 LYS D CD  1 
ATOM   5235 C  CE  . LYS D 2 123 ? 35.481  -12.740 -38.755 1.00 98.50  ? 252 LYS D CE  1 
ATOM   5236 N  NZ  . LYS D 2 123 ? 36.393  -13.372 -37.765 1.00 98.50  ? 252 LYS D NZ  1 
ATOM   5237 N  N   . ASP D 2 124 ? 33.649  -15.770 -44.553 1.00 98.65  ? 253 ASP D N   1 
ATOM   5238 C  CA  . ASP D 2 124 ? 34.057  -15.682 -45.954 1.00 98.65  ? 253 ASP D CA  1 
ATOM   5239 C  C   . ASP D 2 124 ? 33.170  -14.742 -46.794 1.00 98.65  ? 253 ASP D C   1 
ATOM   5240 O  O   . ASP D 2 124 ? 33.606  -14.209 -47.817 1.00 98.65  ? 253 ASP D O   1 
ATOM   5241 C  CB  . ASP D 2 124 ? 34.058  -17.095 -46.569 1.00 79.13  ? 253 ASP D CB  1 
ATOM   5242 C  CG  . ASP D 2 124 ? 32.700  -17.789 -46.463 1.00 79.13  ? 253 ASP D CG  1 
ATOM   5243 O  OD1 . ASP D 2 124 ? 31.823  -17.328 -45.698 1.00 79.13  ? 253 ASP D OD1 1 
ATOM   5244 O  OD2 . ASP D 2 124 ? 32.506  -18.811 -47.151 1.00 79.13  ? 253 ASP D OD2 1 
ATOM   5245 N  N   . ILE D 2 125 ? 31.939  -14.523 -46.331 1.00 94.13  ? 254 ILE D N   1 
ATOM   5246 C  CA  . ILE D 2 125 ? 30.962  -13.673 -47.018 1.00 94.13  ? 254 ILE D CA  1 
ATOM   5247 C  C   . ILE D 2 125 ? 31.323  -12.190 -47.088 1.00 94.13  ? 254 ILE D C   1 
ATOM   5248 O  O   . ILE D 2 125 ? 31.853  -11.619 -46.132 1.00 94.13  ? 254 ILE D O   1 
ATOM   5249 C  CB  . ILE D 2 125 ? 29.560  -13.816 -46.379 1.00 98.65  ? 254 ILE D CB  1 
ATOM   5250 C  CG1 . ILE D 2 125 ? 29.090  -15.269 -46.474 1.00 98.65  ? 254 ILE D CG1 1 
ATOM   5251 C  CG2 . ILE D 2 125 ? 28.563  -12.901 -47.073 1.00 98.65  ? 254 ILE D CG2 1 
ATOM   5252 C  CD1 . ILE D 2 125 ? 27.758  -15.533 -45.807 1.00 98.65  ? 254 ILE D CD1 1 
ATOM   5253 N  N   . ILE D 2 126 ? 31.008  -11.577 -48.228 1.00 91.60  ? 255 ILE D N   1 
ATOM   5254 C  CA  . ILE D 2 126 ? 31.282  -10.165 -48.445 1.00 91.60  ? 255 ILE D CA  1 
ATOM   5255 C  C   . ILE D 2 126 ? 30.356  -9.319  -47.574 1.00 91.60  ? 255 ILE D C   1 
ATOM   5256 O  O   . ILE D 2 126 ? 29.181  -9.156  -47.894 1.00 91.60  ? 255 ILE D O   1 
ATOM   5257 C  CB  . ILE D 2 126 ? 31.068  -9.769  -49.923 1.00 98.65  ? 255 ILE D CB  1 
ATOM   5258 C  CG1 . ILE D 2 126 ? 31.926  -10.636 -50.841 1.00 98.65  ? 255 ILE D CG1 1 
ATOM   5259 C  CG2 . ILE D 2 126 ? 31.433  -8.305  -50.135 1.00 98.65  ? 255 ILE D CG2 1 
ATOM   5260 C  CD1 . ILE D 2 126 ? 31.891  -10.192 -52.294 1.00 98.65  ? 255 ILE D CD1 1 
ATOM   5261 N  N   . ARG D 2 127 ? 30.889  -8.791  -46.474 1.00 98.65  ? 256 ARG D N   1 
ATOM   5262 C  CA  . ARG D 2 127 ? 30.115  -7.957  -45.553 1.00 98.65  ? 256 ARG D CA  1 
ATOM   5263 C  C   . ARG D 2 127 ? 29.939  -6.532  -46.072 1.00 98.65  ? 256 ARG D C   1 
ATOM   5264 O  O   . ARG D 2 127 ? 30.732  -6.063  -46.882 1.00 98.65  ? 256 ARG D O   1 
ATOM   5265 C  CB  . ARG D 2 127 ? 30.768  -7.957  -44.169 1.00 98.65  ? 256 ARG D CB  1 
ATOM   5266 C  CG  . ARG D 2 127 ? 30.565  -9.266  -43.410 1.00 98.65  ? 256 ARG D CG  1 
ATOM   5267 C  CD  . ARG D 2 127 ? 31.831  -9.712  -42.703 1.00 98.65  ? 256 ARG D CD  1 
ATOM   5268 N  NE  . ARG D 2 127 ? 32.914  -9.948  -43.656 1.00 98.65  ? 256 ARG D NE  1 
ATOM   5269 C  CZ  . ARG D 2 127 ? 34.031  -10.612 -43.378 1.00 98.65  ? 256 ARG D CZ  1 
ATOM   5270 N  NH1 . ARG D 2 127 ? 34.226  -11.115 -42.165 1.00 98.65  ? 256 ARG D NH1 1 
ATOM   5271 N  NH2 . ARG D 2 127 ? 34.950  -10.780 -44.319 1.00 98.65  ? 256 ARG D NH2 1 
ATOM   5272 N  N   . TYR D 2 128 ? 28.893  -5.856  -45.604 1.00 87.28  ? 257 TYR D N   1 
ATOM   5273 C  CA  . TYR D 2 128 ? 28.586  -4.491  -46.027 1.00 87.28  ? 257 TYR D CA  1 
ATOM   5274 C  C   . TYR D 2 128 ? 27.614  -3.793  -45.077 1.00 87.28  ? 257 TYR D C   1 
ATOM   5275 O  O   . TYR D 2 128 ? 26.485  -3.480  -45.458 1.00 87.28  ? 257 TYR D O   1 
ATOM   5276 C  CB  . TYR D 2 128 ? 27.976  -4.516  -47.426 1.00 74.31  ? 257 TYR D CB  1 
ATOM   5277 C  CG  . TYR D 2 128 ? 28.963  -4.339  -48.556 1.00 74.31  ? 257 TYR D CG  1 
ATOM   5278 C  CD1 . TYR D 2 128 ? 29.879  -3.288  -48.539 1.00 74.31  ? 257 TYR D CD1 1 
ATOM   5279 C  CD2 . TYR D 2 128 ? 28.948  -5.183  -49.665 1.00 74.31  ? 257 TYR D CD2 1 
ATOM   5280 C  CE1 . TYR D 2 128 ? 30.749  -3.077  -49.594 1.00 74.31  ? 257 TYR D CE1 1 
ATOM   5281 C  CE2 . TYR D 2 128 ? 29.815  -4.977  -50.725 1.00 74.31  ? 257 TYR D CE2 1 
ATOM   5282 C  CZ  . TYR D 2 128 ? 30.712  -3.918  -50.679 1.00 74.31  ? 257 TYR D CZ  1 
ATOM   5283 O  OH  . TYR D 2 128 ? 31.575  -3.673  -51.717 1.00 74.31  ? 257 TYR D OH  1 
ATOM   5284 N  N   . ILE D 2 129 ? 28.069  -3.523  -43.855 1.00 73.58  ? 258 ILE D N   1 
ATOM   5285 C  CA  . ILE D 2 129 ? 27.241  -2.869  -42.838 1.00 73.58  ? 258 ILE D CA  1 
ATOM   5286 C  C   . ILE D 2 129 ? 27.108  -1.339  -42.958 1.00 73.58  ? 258 ILE D C   1 
ATOM   5287 O  O   . ILE D 2 129 ? 28.100  -0.611  -43.081 1.00 73.58  ? 258 ILE D O   1 
ATOM   5288 C  CB  . ILE D 2 129 ? 27.687  -3.267  -41.401 1.00 98.65  ? 258 ILE D CB  1 
ATOM   5289 C  CG1 . ILE D 2 129 ? 26.788  -2.589  -40.362 1.00 98.65  ? 258 ILE D CG1 1 
ATOM   5290 C  CG2 . ILE D 2 129 ? 29.160  -2.934  -41.175 1.00 98.65  ? 258 ILE D CG2 1 
ATOM   5291 C  CD1 . ILE D 2 129 ? 27.026  -3.049  -38.939 1.00 98.65  ? 258 ILE D CD1 1 
ATOM   5292 N  N   . ILE D 2 130 ? 25.866  -0.865  -42.883 1.00 98.65  ? 259 ILE D N   1 
ATOM   5293 C  CA  . ILE D 2 130 ? 25.562  0.559   -42.998 1.00 98.65  ? 259 ILE D CA  1 
ATOM   5294 C  C   . ILE D 2 130 ? 24.844  1.168   -41.790 1.00 98.65  ? 259 ILE D C   1 
ATOM   5295 O  O   . ILE D 2 130 ? 23.692  0.832   -41.504 1.00 98.65  ? 259 ILE D O   1 
ATOM   5296 C  CB  . ILE D 2 130 ? 24.739  0.836   -44.272 1.00 59.37  ? 259 ILE D CB  1 
ATOM   5297 C  CG1 . ILE D 2 130 ? 23.746  -0.295  -44.505 1.00 59.37  ? 259 ILE D CG1 1 
ATOM   5298 C  CG2 . ILE D 2 130 ? 25.661  1.004   -45.468 1.00 59.37  ? 259 ILE D CG2 1 
ATOM   5299 C  CD1 . ILE D 2 130 ? 23.014  -0.189  -45.788 1.00 59.37  ? 259 ILE D CD1 1 
ATOM   5300 N  N   . GLY D 2 131 ? 25.531  2.091   -41.112 1.00 73.41  ? 260 GLY D N   1 
ATOM   5301 C  CA  . GLY D 2 131 ? 24.977  2.763   -39.948 1.00 73.41  ? 260 GLY D CA  1 
ATOM   5302 C  C   . GLY D 2 131 ? 23.765  3.604   -40.298 1.00 73.41  ? 260 GLY D C   1 
ATOM   5303 O  O   . GLY D 2 131 ? 23.497  3.844   -41.479 1.00 73.41  ? 260 GLY D O   1 
ATOM   5304 N  N   . ILE D 2 132 ? 23.041  4.076   -39.283 1.00 89.24  ? 261 ILE D N   1 
ATOM   5305 C  CA  . ILE D 2 132 ? 21.842  4.878   -39.531 1.00 89.24  ? 261 ILE D CA  1 
ATOM   5306 C  C   . ILE D 2 132 ? 21.288  5.625   -38.318 1.00 89.24  ? 261 ILE D C   1 
ATOM   5307 O  O   . ILE D 2 132 ? 20.556  6.611   -38.463 1.00 89.24  ? 261 ILE D O   1 
ATOM   5308 C  CB  . ILE D 2 132 ? 20.695  3.989   -40.129 1.00 65.43  ? 261 ILE D CB  1 
ATOM   5309 C  CG1 . ILE D 2 132 ? 19.473  4.840   -40.495 1.00 65.43  ? 261 ILE D CG1 1 
ATOM   5310 C  CG2 . ILE D 2 132 ? 20.290  2.885   -39.141 1.00 65.43  ? 261 ILE D CG2 1 
ATOM   5311 C  CD1 . ILE D 2 132 ? 19.734  5.850   -41.593 1.00 65.43  ? 261 ILE D CD1 1 
ATOM   5312 N  N   . GLY D 2 133 ? 21.662  5.186   -37.122 1.00 62.74  ? 262 GLY D N   1 
ATOM   5313 C  CA  . GLY D 2 133 ? 21.143  5.814   -35.912 1.00 62.74  ? 262 GLY D CA  1 
ATOM   5314 C  C   . GLY D 2 133 ? 21.742  7.097   -35.359 1.00 62.74  ? 262 GLY D C   1 
ATOM   5315 O  O   . GLY D 2 133 ? 21.839  8.119   -36.054 1.00 62.74  ? 262 GLY D O   1 
ATOM   5316 N  N   . LYS D 2 134 ? 22.045  7.037   -34.060 1.00 73.41  ? 263 LYS D N   1 
ATOM   5317 C  CA  . LYS D 2 134 ? 22.625  8.132   -33.278 1.00 73.41  ? 263 LYS D CA  1 
ATOM   5318 C  C   . LYS D 2 134 ? 23.646  7.485   -32.349 1.00 73.41  ? 263 LYS D C   1 
ATOM   5319 O  O   . LYS D 2 134 ? 24.690  8.064   -32.061 1.00 73.41  ? 263 LYS D O   1 
ATOM   5320 C  CB  . LYS D 2 134 ? 21.525  8.814   -32.438 1.00 98.56  ? 263 LYS D CB  1 
ATOM   5321 C  CG  . LYS D 2 134 ? 21.789  10.278  -32.044 1.00 98.56  ? 263 LYS D CG  1 
ATOM   5322 C  CD  . LYS D 2 134 ? 22.780  10.422  -30.890 1.00 98.56  ? 263 LYS D CD  1 
ATOM   5323 C  CE  . LYS D 2 134 ? 23.165  11.884  -30.652 1.00 98.56  ? 263 LYS D CE  1 
ATOM   5324 N  NZ  . LYS D 2 134 ? 24.209  12.034  -29.588 1.00 98.56  ? 263 LYS D NZ  1 
ATOM   5325 N  N   . HIS D 2 135 ? 23.343  6.260   -31.923 1.00 98.65  ? 264 HIS D N   1 
ATOM   5326 C  CA  . HIS D 2 135 ? 24.194  5.481   -31.024 1.00 98.65  ? 264 HIS D CA  1 
ATOM   5327 C  C   . HIS D 2 135 ? 25.625  5.353   -31.534 1.00 98.65  ? 264 HIS D C   1 
ATOM   5328 O  O   . HIS D 2 135 ? 26.563  5.366   -30.734 1.00 98.65  ? 264 HIS D O   1 
ATOM   5329 C  CB  . HIS D 2 135 ? 23.595  4.087   -30.809 1.00 98.65  ? 264 HIS D CB  1 
ATOM   5330 C  CG  . HIS D 2 135 ? 22.144  4.108   -30.454 1.00 98.65  ? 264 HIS D CG  1 
ATOM   5331 N  ND1 . HIS D 2 135 ? 21.705  4.251   -29.150 1.00 98.65  ? 264 HIS D ND1 1 
ATOM   5332 C  CD2 . HIS D 2 135 ? 21.032  4.040   -31.217 1.00 98.65  ? 264 HIS D CD2 1 
ATOM   5333 C  CE1 . HIS D 2 135 ? 20.375  4.268   -29.141 1.00 98.65  ? 264 HIS D CE1 1 
ATOM   5334 N  NE2 . HIS D 2 135 ? 19.953  4.142   -30.384 1.00 98.65  ? 264 HIS D NE2 1 
ATOM   5335 N  N   . PHE D 2 136 ? 25.779  5.212   -32.855 1.00 77.37  ? 265 PHE D N   1 
ATOM   5336 C  CA  . PHE D 2 136 ? 27.087  5.114   -33.519 1.00 77.37  ? 265 PHE D CA  1 
ATOM   5337 C  C   . PHE D 2 136 ? 27.905  6.387   -33.249 1.00 77.37  ? 265 PHE D C   1 
ATOM   5338 O  O   . PHE D 2 136 ? 28.167  7.175   -34.167 1.00 77.37  ? 265 PHE D O   1 
ATOM   5339 C  CB  . PHE D 2 136 ? 26.895  4.915   -35.037 1.00 62.45  ? 265 PHE D CB  1 
ATOM   5340 C  CG  . PHE D 2 136 ? 28.184  4.657   -35.806 1.00 62.45  ? 265 PHE D CG  1 
ATOM   5341 C  CD1 . PHE D 2 136 ? 29.389  4.396   -35.147 1.00 62.45  ? 265 PHE D CD1 1 
ATOM   5342 C  CD2 . PHE D 2 136 ? 28.181  4.644   -37.197 1.00 62.45  ? 265 PHE D CD2 1 
ATOM   5343 C  CE1 . PHE D 2 136 ? 30.569  4.148   -35.862 1.00 62.45  ? 265 PHE D CE1 1 
ATOM   5344 C  CE2 . PHE D 2 136 ? 29.358  4.398   -37.913 1.00 62.45  ? 265 PHE D CE2 1 
ATOM   5345 C  CZ  . PHE D 2 136 ? 30.545  4.140   -37.240 1.00 62.45  ? 265 PHE D CZ  1 
ATOM   5346 N  N   . GLN D 2 137 ? 28.328  6.569   -31.994 1.00 98.65  ? 266 GLN D N   1 
ATOM   5347 C  CA  . GLN D 2 137 ? 29.276  7.653   -31.680 1.00 98.65  ? 266 GLN D CA  1 
ATOM   5348 C  C   . GLN D 2 137 ? 30.666  7.392   -31.080 1.00 98.65  ? 266 GLN D C   1 
ATOM   5349 O  O   . GLN D 2 137 ? 31.671  7.523   -31.786 1.00 98.65  ? 266 GLN D O   1 
ATOM   5350 C  CB  . GLN D 2 137 ? 28.451  8.593   -30.780 1.00 98.32  ? 266 GLN D CB  1 
ATOM   5351 C  CG  . GLN D 2 137 ? 28.976  10.040  -30.758 1.00 98.32  ? 266 GLN D CG  1 
ATOM   5352 C  CD  . GLN D 2 137 ? 28.005  11.041  -30.124 1.00 98.32  ? 266 GLN D CD  1 
ATOM   5353 O  OE1 . GLN D 2 137 ? 28.030  11.265  -28.915 1.00 98.32  ? 266 GLN D OE1 1 
ATOM   5354 N  NE2 . GLN D 2 137 ? 27.157  11.654  -30.946 1.00 98.32  ? 266 GLN D NE2 1 
ATOM   5355 N  N   . THR D 2 138 ? 30.727  7.037   -29.792 1.00 98.65  ? 267 THR D N   1 
ATOM   5356 C  CA  . THR D 2 138 ? 32.012  6.794   -29.109 1.00 98.65  ? 267 THR D CA  1 
ATOM   5357 C  C   . THR D 2 138 ? 32.561  5.369   -29.248 1.00 98.65  ? 267 THR D C   1 
ATOM   5358 O  O   . THR D 2 138 ? 31.833  4.425   -29.553 1.00 98.65  ? 267 THR D O   1 
ATOM   5359 C  CB  . THR D 2 138 ? 31.971  7.177   -27.579 1.00 98.65  ? 267 THR D CB  1 
ATOM   5360 O  OG1 . THR D 2 138 ? 30.774  6.668   -26.965 1.00 98.65  ? 267 THR D OG1 1 
ATOM   5361 C  CG2 . THR D 2 138 ? 32.069  8.698   -27.379 1.00 98.65  ? 267 THR D CG2 1 
ATOM   5362 N  N   . LYS D 2 139 ? 33.869  5.239   -29.043 1.00 98.65  ? 268 LYS D N   1 
ATOM   5363 C  CA  . LYS D 2 139 ? 34.569  3.959   -29.118 1.00 98.65  ? 268 LYS D CA  1 
ATOM   5364 C  C   . LYS D 2 139 ? 34.310  3.110   -27.863 1.00 98.65  ? 268 LYS D C   1 
ATOM   5365 O  O   . LYS D 2 139 ? 34.131  1.898   -27.962 1.00 98.65  ? 268 LYS D O   1 
ATOM   5366 C  CB  . LYS D 2 139 ? 36.076  4.204   -29.283 1.00 98.65  ? 268 LYS D CB  1 
ATOM   5367 C  CG  . LYS D 2 139 ? 36.930  2.944   -29.358 1.00 98.65  ? 268 LYS D CG  1 
ATOM   5368 C  CD  . LYS D 2 139 ? 38.429  3.254   -29.431 1.00 98.65  ? 268 LYS D CD  1 
ATOM   5369 C  CE  . LYS D 2 139 ? 38.967  3.837   -28.132 1.00 98.65  ? 268 LYS D CE  1 
ATOM   5370 N  NZ  . LYS D 2 139 ? 40.440  4.048   -28.198 1.00 98.65  ? 268 LYS D NZ  1 
ATOM   5371 N  N   . GLU D 2 140 ? 34.274  3.762   -26.696 1.00 98.65  ? 269 GLU D N   1 
ATOM   5372 C  CA  . GLU D 2 140 ? 34.041  3.119   -25.387 1.00 98.65  ? 269 GLU D CA  1 
ATOM   5373 C  C   . GLU D 2 140 ? 32.857  2.140   -25.375 1.00 98.65  ? 269 GLU D C   1 
ATOM   5374 O  O   . GLU D 2 140 ? 32.856  1.140   -24.648 1.00 98.65  ? 269 GLU D O   1 
ATOM   5375 C  CB  . GLU D 2 140 ? 33.779  4.193   -24.320 1.00 98.61  ? 269 GLU D CB  1 
ATOM   5376 C  CG  . GLU D 2 140 ? 34.818  5.304   -24.236 1.00 98.61  ? 269 GLU D CG  1 
ATOM   5377 C  CD  . GLU D 2 140 ? 34.350  6.453   -23.368 1.00 98.61  ? 269 GLU D CD  1 
ATOM   5378 O  OE1 . GLU D 2 140 ? 34.708  6.494   -22.172 1.00 98.61  ? 269 GLU D OE1 1 
ATOM   5379 O  OE2 . GLU D 2 140 ? 33.607  7.309   -23.884 1.00 98.61  ? 269 GLU D OE2 1 
ATOM   5380 N  N   . SER D 2 141 ? 31.844  2.465   -26.172 1.00 98.65  ? 270 SER D N   1 
ATOM   5381 C  CA  . SER D 2 141 ? 30.637  1.664   -26.280 1.00 98.65  ? 270 SER D CA  1 
ATOM   5382 C  C   . SER D 2 141 ? 30.480  1.144   -27.712 1.00 98.65  ? 270 SER D C   1 
ATOM   5383 O  O   . SER D 2 141 ? 30.352  -0.062  -27.938 1.00 98.65  ? 270 SER D O   1 
ATOM   5384 C  CB  . SER D 2 141 ? 29.431  2.524   -25.895 1.00 95.58  ? 270 SER D CB  1 
ATOM   5385 O  OG  . SER D 2 141 ? 29.690  3.264   -24.708 1.00 95.58  ? 270 SER D OG  1 
ATOM   5386 N  N   . GLN D 2 142 ? 30.494  2.063   -28.674 1.00 98.65  ? 271 GLN D N   1 
ATOM   5387 C  CA  . GLN D 2 142 ? 30.363  1.704   -30.078 1.00 98.65  ? 271 GLN D CA  1 
ATOM   5388 C  C   . GLN D 2 142 ? 31.685  1.327   -30.717 1.00 98.65  ? 271 GLN D C   1 
ATOM   5389 O  O   . GLN D 2 142 ? 32.539  2.183   -30.969 1.00 98.65  ? 271 GLN D O   1 
ATOM   5390 C  CB  . GLN D 2 142 ? 29.696  2.827   -30.866 1.00 98.65  ? 271 GLN D CB  1 
ATOM   5391 C  CG  . GLN D 2 142 ? 28.209  2.927   -30.611 1.00 98.65  ? 271 GLN D CG  1 
ATOM   5392 C  CD  . GLN D 2 142 ? 27.435  1.717   -31.105 1.00 98.65  ? 271 GLN D CD  1 
ATOM   5393 O  OE1 . GLN D 2 142 ? 26.213  1.771   -31.246 1.00 98.65  ? 271 GLN D OE1 1 
ATOM   5394 N  NE2 . GLN D 2 142 ? 28.142  0.622   -31.378 1.00 98.65  ? 271 GLN D NE2 1 
ATOM   5395 N  N   . GLU D 2 143 ? 31.826  0.032   -30.990 1.00 98.65  ? 272 GLU D N   1 
ATOM   5396 C  CA  . GLU D 2 143 ? 33.031  -0.541  -31.591 1.00 98.65  ? 272 GLU D CA  1 
ATOM   5397 C  C   . GLU D 2 143 ? 32.697  -1.725  -32.493 1.00 98.65  ? 272 GLU D C   1 
ATOM   5398 O  O   . GLU D 2 143 ? 33.489  -2.081  -33.372 1.00 98.65  ? 272 GLU D O   1 
ATOM   5399 C  CB  . GLU D 2 143 ? 33.982  -1.051  -30.500 1.00 98.65  ? 272 GLU D CB  1 
ATOM   5400 C  CG  . GLU D 2 143 ? 34.932  -0.029  -29.921 1.00 98.65  ? 272 GLU D CG  1 
ATOM   5401 C  CD  . GLU D 2 143 ? 35.813  -0.621  -28.839 1.00 98.65  ? 272 GLU D CD  1 
ATOM   5402 O  OE1 . GLU D 2 143 ? 35.289  -1.383  -27.991 1.00 98.65  ? 272 GLU D OE1 1 
ATOM   5403 O  OE2 . GLU D 2 143 ? 37.031  -0.327  -28.843 1.00 98.65  ? 272 GLU D OE2 1 
ATOM   5404 N  N   . THR D 2 144 ? 31.544  -2.351  -32.240 1.00 98.24  ? 273 THR D N   1 
ATOM   5405 C  CA  . THR D 2 144 ? 31.087  -3.529  -32.993 1.00 98.24  ? 273 THR D CA  1 
ATOM   5406 C  C   . THR D 2 144 ? 30.844  -3.274  -34.487 1.00 98.24  ? 273 THR D C   1 
ATOM   5407 O  O   . THR D 2 144 ? 30.603  -4.206  -35.264 1.00 98.24  ? 273 THR D O   1 
ATOM   5408 C  CB  . THR D 2 144 ? 29.850  -4.177  -32.309 1.00 98.65  ? 273 THR D CB  1 
ATOM   5409 O  OG1 . THR D 2 144 ? 30.167  -4.456  -30.933 1.00 98.65  ? 273 THR D OG1 1 
ATOM   5410 C  CG2 . THR D 2 144 ? 29.453  -5.489  -33.010 1.00 98.65  ? 273 THR D CG2 1 
ATOM   5411 N  N   . LEU D 2 145 ? 30.918  -2.002  -34.876 1.00 49.96  ? 274 LEU D N   1 
ATOM   5412 C  CA  . LEU D 2 145 ? 30.776  -1.615  -36.270 1.00 49.96  ? 274 LEU D CA  1 
ATOM   5413 C  C   . LEU D 2 145 ? 32.114  -1.988  -36.970 1.00 49.96  ? 274 LEU D C   1 
ATOM   5414 O  O   . LEU D 2 145 ? 32.228  -1.978  -38.200 1.00 49.96  ? 274 LEU D O   1 
ATOM   5415 C  CB  . LEU D 2 145 ? 30.486  -0.111  -36.363 1.00 83.88  ? 274 LEU D CB  1 
ATOM   5416 C  CG  . LEU D 2 145 ? 29.319  0.356   -37.253 1.00 83.88  ? 274 LEU D CG  1 
ATOM   5417 C  CD1 . LEU D 2 145 ? 29.602  0.155   -38.737 1.00 83.88  ? 274 LEU D CD1 1 
ATOM   5418 C  CD2 . LEU D 2 145 ? 28.072  -0.384  -36.875 1.00 83.88  ? 274 LEU D CD2 1 
ATOM   5419 N  N   . HIS D 2 146 ? 33.116  -2.333  -36.161 1.00 98.47  ? 275 HIS D N   1 
ATOM   5420 C  CA  . HIS D 2 146 ? 34.432  -2.743  -36.650 1.00 98.47  ? 275 HIS D CA  1 
ATOM   5421 C  C   . HIS D 2 146 ? 34.516  -4.267  -36.677 1.00 98.47  ? 275 HIS D C   1 
ATOM   5422 O  O   . HIS D 2 146 ? 35.300  -4.839  -37.430 1.00 98.47  ? 275 HIS D O   1 
ATOM   5423 C  CB  . HIS D 2 146 ? 35.543  -2.195  -35.747 1.00 98.65  ? 275 HIS D CB  1 
ATOM   5424 C  CG  . HIS D 2 146 ? 35.821  -0.736  -35.946 1.00 98.65  ? 275 HIS D CG  1 
ATOM   5425 N  ND1 . HIS D 2 146 ? 36.018  0.132   -34.890 1.00 98.65  ? 275 HIS D ND1 1 
ATOM   5426 C  CD2 . HIS D 2 146 ? 35.940  0.001   -37.071 1.00 98.65  ? 275 HIS D CD2 1 
ATOM   5427 C  CE1 . HIS D 2 146 ? 36.246  1.345   -35.364 1.00 98.65  ? 275 HIS D CE1 1 
ATOM   5428 N  NE2 . HIS D 2 146 ? 36.205  1.296   -36.683 1.00 98.65  ? 275 HIS D NE2 1 
ATOM   5429 N  N   . LYS D 2 147 ? 33.705  -4.905  -35.837 1.00 94.02  ? 276 LYS D N   1 
ATOM   5430 C  CA  . LYS D 2 147 ? 33.644  -6.361  -35.715 1.00 94.02  ? 276 LYS D CA  1 
ATOM   5431 C  C   . LYS D 2 147 ? 33.406  -7.106  -37.023 1.00 94.02  ? 276 LYS D C   1 
ATOM   5432 O  O   . LYS D 2 147 ? 34.066  -8.110  -37.302 1.00 94.02  ? 276 LYS D O   1 
ATOM   5433 C  CB  . LYS D 2 147 ? 32.545  -6.754  -34.728 1.00 89.68  ? 276 LYS D CB  1 
ATOM   5434 C  CG  . LYS D 2 147 ? 33.004  -6.893  -33.289 1.00 89.68  ? 276 LYS D CG  1 
ATOM   5435 C  CD  . LYS D 2 147 ? 33.815  -8.174  -33.064 1.00 89.68  ? 276 LYS D CD  1 
ATOM   5436 C  CE  . LYS D 2 147 ? 32.964  -9.447  -33.168 1.00 89.68  ? 276 LYS D CE  1 
ATOM   5437 N  NZ  . LYS D 2 147 ? 32.586  -9.825  -34.565 1.00 89.68  ? 276 LYS D NZ  1 
ATOM   5438 N  N   . PHE D 2 148 ? 32.435  -6.633  -37.800 1.00 99.01  ? 277 PHE D N   1 
ATOM   5439 C  CA  . PHE D 2 148 ? 32.087  -7.257  -39.078 1.00 99.01  ? 277 PHE D CA  1 
ATOM   5440 C  C   . PHE D 2 148 ? 32.848  -6.625  -40.241 1.00 99.01  ? 277 PHE D C   1 
ATOM   5441 O  O   . PHE D 2 148 ? 32.486  -6.806  -41.408 1.00 99.01  ? 277 PHE D O   1 
ATOM   5442 C  CB  . PHE D 2 148 ? 30.578  -7.157  -39.328 1.00 98.80  ? 277 PHE D CB  1 
ATOM   5443 C  CG  . PHE D 2 148 ? 29.747  -7.351  -38.093 1.00 98.80  ? 277 PHE D CG  1 
ATOM   5444 C  CD1 . PHE D 2 148 ? 28.882  -6.352  -37.661 1.00 98.80  ? 277 PHE D CD1 1 
ATOM   5445 C  CD2 . PHE D 2 148 ? 29.858  -8.509  -37.339 1.00 98.80  ? 277 PHE D CD2 1 
ATOM   5446 C  CE1 . PHE D 2 148 ? 28.145  -6.502  -36.494 1.00 98.80  ? 277 PHE D CE1 1 
ATOM   5447 C  CE2 . PHE D 2 148 ? 29.123  -8.668  -36.171 1.00 98.80  ? 277 PHE D CE2 1 
ATOM   5448 C  CZ  . PHE D 2 148 ? 28.266  -7.663  -35.748 1.00 98.80  ? 277 PHE D CZ  1 
ATOM   5449 N  N   . ALA D 2 149 ? 33.889  -5.861  -39.911 1.00 104.07 ? 278 ALA D N   1 
ATOM   5450 C  CA  . ALA D 2 149 ? 34.719  -5.212  -40.922 1.00 104.07 ? 278 ALA D CA  1 
ATOM   5451 C  C   . ALA D 2 149 ? 35.649  -6.227  -41.605 1.00 104.07 ? 278 ALA D C   1 
ATOM   5452 O  O   . ALA D 2 149 ? 36.092  -7.214  -40.989 1.00 104.07 ? 278 ALA D O   1 
ATOM   5453 C  CB  . ALA D 2 149 ? 35.529  -4.064  -40.303 1.00 104.07 ? 278 ALA D CB  1 
ATOM   5454 N  N   . SER D 2 150 ? 35.933  -5.970  -42.880 1.00 103.10 ? 279 SER D N   1 
ATOM   5455 C  CA  . SER D 2 150 ? 36.783  -6.832  -43.684 1.00 103.10 ? 279 SER D CA  1 
ATOM   5456 C  C   . SER D 2 150 ? 38.129  -6.169  -44.026 1.00 103.10 ? 279 SER D C   1 
ATOM   5457 O  O   . SER D 2 150 ? 39.137  -6.442  -43.372 1.00 103.10 ? 279 SER D O   1 
ATOM   5458 C  CB  . SER D 2 150 ? 36.027  -7.256  -44.949 1.00 99.28  ? 279 SER D CB  1 
ATOM   5459 O  OG  . SER D 2 150 ? 34.766  -7.821  -44.623 1.00 99.28  ? 279 SER D OG  1 
ATOM   5460 N  N   . LYS D 2 151 ? 38.144  -5.300  -45.035 1.00 96.28  ? 280 LYS D N   1 
ATOM   5461 C  CA  . LYS D 2 151 ? 39.372  -4.611  -45.450 1.00 96.28  ? 280 LYS D CA  1 
ATOM   5462 C  C   . LYS D 2 151 ? 39.566  -3.293  -44.681 1.00 96.28  ? 280 LYS D C   1 
ATOM   5463 O  O   . LYS D 2 151 ? 38.607  -2.774  -44.093 1.00 96.28  ? 280 LYS D O   1 
ATOM   5464 C  CB  . LYS D 2 151 ? 39.358  -4.364  -46.965 1.00 104.07 ? 280 LYS D CB  1 
ATOM   5465 C  CG  . LYS D 2 151 ? 39.391  -5.638  -47.797 1.00 104.07 ? 280 LYS D CG  1 
ATOM   5466 C  CD  . LYS D 2 151 ? 39.344  -5.329  -49.287 1.00 104.07 ? 280 LYS D CD  1 
ATOM   5467 C  CE  . LYS D 2 151 ? 39.072  -6.584  -50.135 1.00 104.07 ? 280 LYS D CE  1 
ATOM   5468 N  NZ  . LYS D 2 151 ? 40.161  -7.622  -50.136 1.00 104.07 ? 280 LYS D NZ  1 
ATOM   5469 N  N   . PRO D 2 152 ? 40.813  -2.746  -44.666 1.00 104.07 ? 281 PRO D N   1 
ATOM   5470 C  CA  . PRO D 2 152 ? 41.190  -1.495  -43.982 1.00 104.07 ? 281 PRO D CA  1 
ATOM   5471 C  C   . PRO D 2 152 ? 40.175  -0.350  -44.063 1.00 104.07 ? 281 PRO D C   1 
ATOM   5472 O  O   . PRO D 2 152 ? 39.445  -0.224  -45.057 1.00 104.07 ? 281 PRO D O   1 
ATOM   5473 C  CB  . PRO D 2 152 ? 42.517  -1.139  -44.648 1.00 104.07 ? 281 PRO D CB  1 
ATOM   5474 C  CG  . PRO D 2 152 ? 43.150  -2.484  -44.786 1.00 104.07 ? 281 PRO D CG  1 
ATOM   5475 C  CD  . PRO D 2 152 ? 42.000  -3.334  -45.324 1.00 104.07 ? 281 PRO D CD  1 
ATOM   5476 N  N   . ALA D 2 153 ? 40.136  0.465   -43.004 1.00 104.07 ? 282 ALA D N   1 
ATOM   5477 C  CA  . ALA D 2 153 ? 39.211  1.595   -42.906 1.00 104.07 ? 282 ALA D CA  1 
ATOM   5478 C  C   . ALA D 2 153 ? 39.246  2.469   -44.151 1.00 104.07 ? 282 ALA D C   1 
ATOM   5479 O  O   . ALA D 2 153 ? 40.106  3.347   -44.292 1.00 104.07 ? 282 ALA D O   1 
ATOM   5480 C  CB  . ALA D 2 153 ? 39.509  2.421   -41.667 1.00 86.20  ? 282 ALA D CB  1 
ATOM   5481 N  N   . SER D 2 154 ? 38.314  2.185   -45.062 1.00 95.97  ? 283 SER D N   1 
ATOM   5482 C  CA  . SER D 2 154 ? 38.189  2.904   -46.330 1.00 95.97  ? 283 SER D CA  1 
ATOM   5483 C  C   . SER D 2 154 ? 36.758  3.397   -46.473 1.00 95.97  ? 283 SER D C   1 
ATOM   5484 O  O   . SER D 2 154 ? 36.385  4.443   -45.938 1.00 95.97  ? 283 SER D O   1 
ATOM   5485 C  CB  . SER D 2 154 ? 38.540  1.979   -47.519 1.00 34.75  ? 283 SER D CB  1 
ATOM   5486 O  OG  . SER D 2 154 ? 38.528  2.683   -48.764 1.00 34.75  ? 283 SER D OG  1 
ATOM   5487 N  N   . GLU D 2 155 ? 35.966  2.630   -47.211 1.00 104.07 ? 284 GLU D N   1 
ATOM   5488 C  CA  . GLU D 2 155 ? 34.574  2.957   -47.443 1.00 104.07 ? 284 GLU D CA  1 
ATOM   5489 C  C   . GLU D 2 155 ? 33.710  1.833   -46.894 1.00 104.07 ? 284 GLU D C   1 
ATOM   5490 O  O   . GLU D 2 155 ? 32.763  1.391   -47.551 1.00 104.07 ? 284 GLU D O   1 
ATOM   5491 C  CB  . GLU D 2 155 ? 34.301  3.143   -48.940 1.00 104.07 ? 284 GLU D CB  1 
ATOM   5492 C  CG  . GLU D 2 155 ? 35.064  4.287   -49.603 1.00 104.07 ? 284 GLU D CG  1 
ATOM   5493 C  CD  . GLU D 2 155 ? 34.458  4.715   -50.941 1.00 104.07 ? 284 GLU D CD  1 
ATOM   5494 O  OE1 . GLU D 2 155 ? 33.929  3.853   -51.681 1.00 104.07 ? 284 GLU D OE1 1 
ATOM   5495 O  OE2 . GLU D 2 155 ? 34.509  5.926   -51.254 1.00 104.07 ? 284 GLU D OE2 1 
ATOM   5496 N  N   . PHE D 2 156 ? 34.073  1.345   -45.707 1.00 80.38  ? 285 PHE D N   1 
ATOM   5497 C  CA  . PHE D 2 156 ? 33.329  0.270   -45.037 1.00 80.38  ? 285 PHE D CA  1 
ATOM   5498 C  C   . PHE D 2 156 ? 32.462  0.883   -43.932 1.00 80.38  ? 285 PHE D C   1 
ATOM   5499 O  O   . PHE D 2 156 ? 31.272  0.574   -43.796 1.00 80.38  ? 285 PHE D O   1 
ATOM   5500 C  CB  . PHE D 2 156 ? 34.300  -0.756  -44.430 1.00 104.07 ? 285 PHE D CB  1 
ATOM   5501 C  CG  . PHE D 2 156 ? 33.729  -2.149  -44.320 1.00 104.07 ? 285 PHE D CG  1 
ATOM   5502 C  CD1 . PHE D 2 156 ? 34.562  -3.261  -44.424 1.00 104.07 ? 285 PHE D CD1 1 
ATOM   5503 C  CD2 . PHE D 2 156 ? 32.360  -2.353  -44.127 1.00 104.07 ? 285 PHE D CD2 1 
ATOM   5504 C  CE1 . PHE D 2 156 ? 34.041  -4.551  -44.333 1.00 104.07 ? 285 PHE D CE1 1 
ATOM   5505 C  CE2 . PHE D 2 156 ? 31.831  -3.642  -44.034 1.00 104.07 ? 285 PHE D CE2 1 
ATOM   5506 C  CZ  . PHE D 2 156 ? 32.675  -4.744  -44.139 1.00 104.07 ? 285 PHE D CZ  1 
ATOM   5507 N  N   . VAL D 2 157 ? 33.080  1.776   -43.167 0.50 104.07 ? 286 VAL D N   1 
ATOM   5508 C  CA  . VAL D 2 157 ? 32.422  2.471   -42.073 0.50 104.07 ? 286 VAL D CA  1 
ATOM   5509 C  C   . VAL D 2 157 ? 32.776  3.955   -42.122 0.50 104.07 ? 286 VAL D C   1 
ATOM   5510 O  O   . VAL D 2 157 ? 33.894  4.349   -41.779 0.50 104.07 ? 286 VAL D O   1 
ATOM   5511 C  CB  . VAL D 2 157 ? 32.865  1.907   -40.712 0.50 104.07 ? 286 VAL D CB  1 
ATOM   5512 C  CG1 . VAL D 2 157 ? 32.273  2.730   -39.586 0.50 104.07 ? 286 VAL D CG1 1 
ATOM   5513 C  CG2 . VAL D 2 157 ? 32.452  0.451   -40.587 0.50 104.07 ? 286 VAL D CG2 1 
ATOM   5514 N  N   . LYS D 2 158 ? 31.824  4.766   -42.573 0.50 104.07 ? 287 LYS D N   1 
ATOM   5515 C  CA  . LYS D 2 158 ? 32.018  6.208   -42.664 0.50 104.07 ? 287 LYS D CA  1 
ATOM   5516 C  C   . LYS D 2 158 ? 30.962  6.942   -41.840 0.50 104.07 ? 287 LYS D C   1 
ATOM   5517 O  O   . LYS D 2 158 ? 30.322  6.351   -40.967 0.50 104.07 ? 287 LYS D O   1 
ATOM   5518 C  CB  . LYS D 2 158 ? 31.993  6.669   -44.130 0.50 101.22 ? 287 LYS D CB  1 
ATOM   5519 C  CG  . LYS D 2 158 ? 33.211  6.227   -44.939 0.50 101.22 ? 287 LYS D CG  1 
ATOM   5520 C  CD  . LYS D 2 158 ? 33.241  6.872   -46.317 0.50 101.22 ? 287 LYS D CD  1 
ATOM   5521 C  CE  . LYS D 2 158 ? 34.585  6.650   -46.994 0.50 101.22 ? 287 LYS D CE  1 
ATOM   5522 N  NZ  . LYS D 2 158 ? 34.689  7.331   -48.318 0.50 101.22 ? 287 LYS D NZ  1 
ATOM   5523 N  N   . ILE D 2 159 ? 30.799  8.233   -42.104 0.50 91.04  ? 288 ILE D N   1 
ATOM   5524 C  CA  . ILE D 2 159 ? 29.830  9.059   -41.389 0.50 91.04  ? 288 ILE D CA  1 
ATOM   5525 C  C   . ILE D 2 159 ? 28.385  8.752   -41.783 0.50 91.04  ? 288 ILE D C   1 
ATOM   5526 O  O   . ILE D 2 159 ? 27.455  9.298   -41.194 0.50 91.04  ? 288 ILE D O   1 
ATOM   5527 C  CB  . ILE D 2 159 ? 30.080  10.559  -41.670 0.50 93.53  ? 288 ILE D CB  1 
ATOM   5528 C  CG1 . ILE D 2 159 ? 31.480  10.962  -41.204 0.50 93.53  ? 288 ILE D CG1 1 
ATOM   5529 C  CG2 . ILE D 2 159 ? 29.027  11.423  -40.982 0.50 93.53  ? 288 ILE D CG2 1 
ATOM   5530 C  CD1 . ILE D 2 159 ? 31.873  12.380  -41.603 0.50 93.53  ? 288 ILE D CD1 1 
ATOM   5531 N  N   . LEU D 2 160 ? 28.212  7.859   -42.757 0.50 104.07 ? 289 LEU D N   1 
ATOM   5532 C  CA  . LEU D 2 160 ? 26.900  7.703   -43.456 0.50 104.07 ? 289 LEU D CA  1 
ATOM   5533 C  C   . LEU D 2 160 ? 25.814  7.133   -42.537 0.50 104.07 ? 289 LEU D C   1 
ATOM   5534 O  O   . LEU D 2 160 ? 25.428  5.966   -42.678 0.50 104.07 ? 289 LEU D O   1 
ATOM   5535 C  CB  . LEU D 2 160 ? 27.073  6.791   -44.679 0.50 103.80 ? 289 LEU D CB  1 
ATOM   5536 C  CG  . LEU D 2 160 ? 28.040  7.307   -45.748 0.50 103.80 ? 289 LEU D CG  1 
ATOM   5537 C  CD1 . LEU D 2 160 ? 28.062  6.368   -46.945 0.50 103.80 ? 289 LEU D CD1 1 
ATOM   5538 C  CD2 . LEU D 2 160 ? 27.649  8.715   -46.171 0.50 103.80 ? 289 LEU D CD2 1 
ATOM   5539 N  N   . ASP D 2 161 ? 25.388  7.933   -41.550 0.50 104.07 ? 290 ASP D N   1 
ATOM   5540 C  CA  . ASP D 2 161 ? 24.327  7.523   -40.614 0.50 104.07 ? 290 ASP D CA  1 
ATOM   5541 C  C   . ASP D 2 161 ? 22.992  7.715   -41.353 0.50 104.07 ? 290 ASP D C   1 
ATOM   5542 O  O   . ASP D 2 161 ? 21.904  7.708   -40.771 0.50 104.07 ? 290 ASP D O   1 
ATOM   5543 C  CB  . ASP D 2 161 ? 24.371  8.350   -39.318 0.50 104.07 ? 290 ASP D CB  1 
ATOM   5544 C  CG  . ASP D 2 161 ? 23.725  9.717   -39.457 0.50 104.07 ? 290 ASP D CG  1 
ATOM   5545 O  OD1 . ASP D 2 161 ? 24.361  10.634  -40.022 0.50 104.07 ? 290 ASP D OD1 1 
ATOM   5546 O  OD2 . ASP D 2 161 ? 22.587  9.879   -38.969 0.50 104.07 ? 290 ASP D OD2 1 
ATOM   5547 N  N   . THR D 2 162 ? 23.140  7.925   -42.659 1.00 103.66 ? 291 THR D N   1 
ATOM   5548 C  CA  . THR D 2 162 ? 22.072  8.106   -43.619 1.00 103.66 ? 291 THR D CA  1 
ATOM   5549 C  C   . THR D 2 162 ? 22.804  7.767   -44.923 1.00 103.66 ? 291 THR D C   1 
ATOM   5550 O  O   . THR D 2 162 ? 23.513  8.595   -45.507 1.00 103.66 ? 291 THR D O   1 
ATOM   5551 C  CB  . THR D 2 162 ? 21.536  9.556   -43.653 1.00 104.07 ? 291 THR D CB  1 
ATOM   5552 O  OG1 . THR D 2 162 ? 21.107  9.938   -42.340 1.00 104.07 ? 291 THR D OG1 1 
ATOM   5553 C  CG2 . THR D 2 162 ? 20.359  9.665   -44.606 1.00 104.07 ? 291 THR D CG2 1 
ATOM   5554 N  N   . PHE D 2 163 ? 22.757  6.485   -45.263 1.00 89.65  ? 292 PHE D N   1 
ATOM   5555 C  CA  . PHE D 2 163 ? 23.365  5.952   -46.470 1.00 89.65  ? 292 PHE D CA  1 
ATOM   5556 C  C   . PHE D 2 163 ? 22.832  6.651   -47.734 1.00 89.65  ? 292 PHE D C   1 
ATOM   5557 O  O   . PHE D 2 163 ? 23.307  6.383   -48.843 1.00 89.65  ? 292 PHE D O   1 
ATOM   5558 C  CB  . PHE D 2 163 ? 23.076  4.458   -46.534 0.50 104.07 ? 292 PHE D CB  1 
ATOM   5559 C  CG  . PHE D 2 163 ? 21.764  4.077   -45.909 0.50 104.07 ? 292 PHE D CG  1 
ATOM   5560 C  CD1 . PHE D 2 163 ? 20.624  4.845   -46.131 0.50 104.07 ? 292 PHE D CD1 1 
ATOM   5561 C  CD2 . PHE D 2 163 ? 21.678  2.982   -45.063 0.50 104.07 ? 292 PHE D CD2 1 
ATOM   5562 C  CE1 . PHE D 2 163 ? 19.431  4.530   -45.523 0.50 104.07 ? 292 PHE D CE1 1 
ATOM   5563 C  CE2 . PHE D 2 163 ? 20.483  2.660   -44.450 0.50 104.07 ? 292 PHE D CE2 1 
ATOM   5564 C  CZ  . PHE D 2 163 ? 19.361  3.439   -44.681 0.50 104.07 ? 292 PHE D CZ  1 
ATOM   5565 N  N   . GLU D 2 164 ? 21.812  7.500   -47.562 1.00 104.07 ? 293 GLU D N   1 
ATOM   5566 C  CA  . GLU D 2 164 ? 21.212  8.282   -48.655 1.00 104.07 ? 293 GLU D CA  1 
ATOM   5567 C  C   . GLU D 2 164 ? 22.282  9.262   -49.132 1.00 104.07 ? 293 GLU D C   1 
ATOM   5568 O  O   . GLU D 2 164 ? 22.278  9.711   -50.282 1.00 104.07 ? 293 GLU D O   1 
ATOM   5569 C  CB  . GLU D 2 164 ? 19.966  9.039   -48.149 1.00 104.07 ? 293 GLU D CB  1 
ATOM   5570 C  CG  . GLU D 2 164 ? 19.372  10.106  -49.098 1.00 104.07 ? 293 GLU D CG  1 
ATOM   5571 C  CD  . GLU D 2 164 ? 18.849  9.548   -50.427 1.00 104.07 ? 293 GLU D CD  1 
ATOM   5572 O  OE1 . GLU D 2 164 ? 19.510  9.775   -51.461 1.00 104.07 ? 293 GLU D OE1 1 
ATOM   5573 O  OE2 . GLU D 2 164 ? 17.771  8.909   -50.451 1.00 104.07 ? 293 GLU D OE2 1 
ATOM   5574 N  N   . LYS D 2 165 ? 23.198  9.586   -48.222 1.00 99.80  ? 294 LYS D N   1 
ATOM   5575 C  CA  . LYS D 2 165 ? 24.312  10.471  -48.518 1.00 99.80  ? 294 LYS D CA  1 
ATOM   5576 C  C   . LYS D 2 165 ? 25.306  9.596   -49.297 1.00 99.80  ? 294 LYS D C   1 
ATOM   5577 O  O   . LYS D 2 165 ? 26.370  9.226   -48.790 1.00 99.80  ? 294 LYS D O   1 
ATOM   5578 C  CB  . LYS D 2 165 ? 24.945  10.982  -47.213 1.00 99.71  ? 294 LYS D CB  1 
ATOM   5579 C  CG  . LYS D 2 165 ? 23.991  11.693  -46.254 1.00 99.71  ? 294 LYS D CG  1 
ATOM   5580 C  CD  . LYS D 2 165 ? 24.663  11.946  -44.904 1.00 99.71  ? 294 LYS D CD  1 
ATOM   5581 C  CE  . LYS D 2 165 ? 23.699  12.557  -43.894 1.00 99.71  ? 294 LYS D CE  1 
ATOM   5582 N  NZ  . LYS D 2 165 ? 24.354  12.867  -42.592 1.00 99.71  ? 294 LYS D NZ  1 
ATOM   5583 N  N   . LEU D 2 166 ? 24.903  9.220   -50.510 1.00 99.80  ? 295 LEU D N   1 
ATOM   5584 C  CA  . LEU D 2 166 ? 25.699  8.377   -51.399 1.00 99.80  ? 295 LEU D CA  1 
ATOM   5585 C  C   . LEU D 2 166 ? 24.901  8.120   -52.671 1.00 99.80  ? 295 LEU D C   1 
ATOM   5586 O  O   . LEU D 2 166 ? 23.714  7.794   -52.604 1.00 99.80  ? 295 LEU D O   1 
ATOM   5587 C  CB  . LEU D 2 166 ? 26.034  7.042   -50.720 1.00 99.80  ? 295 LEU D CB  1 
ATOM   5588 C  CG  . LEU D 2 166 ? 26.752  5.950   -51.518 1.00 99.80  ? 295 LEU D CG  1 
ATOM   5589 C  CD1 . LEU D 2 166 ? 27.987  6.501   -52.233 1.00 99.80  ? 295 LEU D CD1 1 
ATOM   5590 C  CD2 . LEU D 2 166 ? 27.134  4.832   -50.560 1.00 99.80  ? 295 LEU D CD2 1 
ATOM   5591 N  N   . LYS D 2 167 ? 25.558  8.255   -53.823 1.00 99.80  ? 296 LYS D N   1 
ATOM   5592 C  CA  . LYS D 2 167 ? 24.899  8.039   -55.111 1.00 99.80  ? 296 LYS D CA  1 
ATOM   5593 C  C   . LYS D 2 167 ? 24.641  6.553   -55.384 1.00 99.80  ? 296 LYS D C   1 
ATOM   5594 O  O   . LYS D 2 167 ? 24.625  5.723   -54.459 1.00 99.80  ? 296 LYS D O   1 
ATOM   5595 C  CB  . LYS D 2 167 ? 25.721  8.661   -56.258 1.00 86.68  ? 296 LYS D CB  1 
ATOM   5596 C  CG  . LYS D 2 167 ? 26.915  7.824   -56.757 1.00 86.68  ? 296 LYS D CG  1 
ATOM   5597 C  CD  . LYS D 2 167 ? 27.553  8.386   -58.038 1.00 86.68  ? 296 LYS D CD  1 
ATOM   5598 C  CE  . LYS D 2 167 ? 26.537  8.672   -59.149 1.00 86.68  ? 296 LYS D CE  1 
ATOM   5599 N  NZ  . LYS D 2 167 ? 25.798  9.970   -58.973 1.00 86.68  ? 296 LYS D NZ  1 
ATOM   5600 N  N   . ASP D 2 168 ? 24.428  6.236   -56.661 1.00 99.80  ? 297 ASP D N   1 
ATOM   5601 C  CA  . ASP D 2 168 ? 24.177  4.870   -57.096 1.00 99.80  ? 297 ASP D CA  1 
ATOM   5602 C  C   . ASP D 2 168 ? 25.403  3.964   -56.934 1.00 99.80  ? 297 ASP D C   1 
ATOM   5603 O  O   . ASP D 2 168 ? 26.400  4.090   -57.662 1.00 99.80  ? 297 ASP D O   1 
ATOM   5604 C  CB  . ASP D 2 168 ? 23.704  4.860   -58.549 1.00 62.08  ? 297 ASP D CB  1 
ATOM   5605 C  CG  . ASP D 2 168 ? 23.344  3.469   -59.031 1.00 62.08  ? 297 ASP D CG  1 
ATOM   5606 O  OD1 . ASP D 2 168 ? 22.567  2.775   -58.338 1.00 62.08  ? 297 ASP D OD1 1 
ATOM   5607 O  OD2 . ASP D 2 168 ? 23.855  3.067   -60.097 1.00 62.08  ? 297 ASP D OD2 1 
ATOM   5608 N  N   . LEU D 2 169 ? 25.305  3.049   -55.969 1.00 99.33  ? 298 LEU D N   1 
ATOM   5609 C  CA  . LEU D 2 169 ? 26.367  2.092   -55.673 1.00 99.33  ? 298 LEU D CA  1 
ATOM   5610 C  C   . LEU D 2 169 ? 26.453  0.955   -56.699 1.00 99.33  ? 298 LEU D C   1 
ATOM   5611 O  O   . LEU D 2 169 ? 26.727  -0.189  -56.333 1.00 99.33  ? 298 LEU D O   1 
ATOM   5612 C  CB  . LEU D 2 169 ? 26.176  1.497   -54.265 1.00 99.80  ? 298 LEU D CB  1 
ATOM   5613 C  CG  . LEU D 2 169 ? 26.744  2.190   -53.014 1.00 99.80  ? 298 LEU D CG  1 
ATOM   5614 C  CD1 . LEU D 2 169 ? 26.360  1.392   -51.759 1.00 99.80  ? 298 LEU D CD1 1 
ATOM   5615 C  CD2 . LEU D 2 169 ? 28.264  2.310   -53.109 1.00 99.80  ? 298 LEU D CD2 1 
ATOM   5616 N  N   . CYS D 2 170 ? 26.196  1.241   -57.975 1.00 81.94  ? 299 CYS D N   1 
ATOM   5617 C  CA  . CYS D 2 170 ? 26.295  0.173   -58.953 1.00 81.94  ? 299 CYS D CA  1 
ATOM   5618 C  C   . CYS D 2 170 ? 27.776  0.003   -59.229 1.00 81.94  ? 299 CYS D C   1 
ATOM   5619 O  O   . CYS D 2 170 ? 28.437  -0.735  -58.499 1.00 81.94  ? 299 CYS D O   1 
ATOM   5620 C  CB  . CYS D 2 170 ? 25.480  0.443   -60.225 1.00 99.80  ? 299 CYS D CB  1 
ATOM   5621 S  SG  . CYS D 2 170 ? 24.476  -1.000  -60.766 1.00 99.80  ? 299 CYS D SG  1 
ATOM   5622 N  N   . THR D 2 171 ? 28.325  0.774   -60.167 1.00 99.80  ? 300 THR D N   1 
ATOM   5623 C  CA  . THR D 2 171 ? 29.755  0.679   -60.502 1.00 99.80  ? 300 THR D CA  1 
ATOM   5624 C  C   . THR D 2 171 ? 30.666  0.943   -59.281 1.00 99.80  ? 300 THR D C   1 
ATOM   5625 O  O   . THR D 2 171 ? 31.896  0.821   -59.371 1.00 99.80  ? 300 THR D O   1 
ATOM   5626 C  CB  . THR D 2 171 ? 30.144  1.634   -61.687 1.00 98.10  ? 300 THR D CB  1 
ATOM   5627 O  OG1 . THR D 2 171 ? 29.221  1.461   -62.771 1.00 98.10  ? 300 THR D OG1 1 
ATOM   5628 C  CG2 . THR D 2 171 ? 31.551  1.324   -62.215 1.00 98.10  ? 300 THR D CG2 1 
ATOM   5629 N  N   . GLU D 2 172 ? 30.055  1.290   -58.144 1.00 99.80  ? 301 GLU D N   1 
ATOM   5630 C  CA  . GLU D 2 172 ? 30.794  1.538   -56.903 1.00 99.80  ? 301 GLU D CA  1 
ATOM   5631 C  C   . GLU D 2 172 ? 30.822  0.295   -55.999 1.00 99.80  ? 301 GLU D C   1 
ATOM   5632 O  O   . GLU D 2 172 ? 31.851  -0.012  -55.397 1.00 99.80  ? 301 GLU D O   1 
ATOM   5633 C  CB  . GLU D 2 172 ? 30.211  2.737   -56.137 1.00 95.94  ? 301 GLU D CB  1 
ATOM   5634 C  CG  . GLU D 2 172 ? 30.304  4.071   -56.875 1.00 95.94  ? 301 GLU D CG  1 
ATOM   5635 C  CD  . GLU D 2 172 ? 29.949  5.265   -56.002 1.00 95.94  ? 301 GLU D CD  1 
ATOM   5636 O  OE1 . GLU D 2 172 ? 29.115  5.119   -55.081 1.00 95.94  ? 301 GLU D OE1 1 
ATOM   5637 O  OE2 . GLU D 2 172 ? 30.508  6.357   -56.245 1.00 95.94  ? 301 GLU D OE2 1 
ATOM   5638 N  N   . LEU D 2 173 ? 29.699  -0.419  -55.909 1.00 98.35  ? 302 LEU D N   1 
ATOM   5639 C  CA  . LEU D 2 173 ? 29.635  -1.623  -55.081 1.00 98.35  ? 302 LEU D CA  1 
ATOM   5640 C  C   . LEU D 2 173 ? 30.255  -2.814  -55.810 1.00 98.35  ? 302 LEU D C   1 
ATOM   5641 O  O   . LEU D 2 173 ? 30.438  -3.884  -55.229 1.00 98.35  ? 302 LEU D O   1 
ATOM   5642 C  CB  . LEU D 2 173 ? 28.192  -1.933  -54.652 0.50 99.55  ? 302 LEU D CB  1 
ATOM   5643 C  CG  . LEU D 2 173 ? 27.919  -2.911  -53.496 0.50 99.55  ? 302 LEU D CG  1 
ATOM   5644 C  CD1 . LEU D 2 173 ? 26.678  -2.473  -52.740 0.50 99.55  ? 302 LEU D CD1 1 
ATOM   5645 C  CD2 . LEU D 2 173 ? 27.762  -4.341  -53.991 0.50 99.55  ? 302 LEU D CD2 1 
ATOM   5646 N  N   . GLN D 2 174 ? 30.560  -2.636  -57.092 1.00 98.29  ? 303 GLN D N   1 
ATOM   5647 C  CA  . GLN D 2 174 ? 31.190  -3.700  -57.857 1.00 98.29  ? 303 GLN D CA  1 
ATOM   5648 C  C   . GLN D 2 174 ? 32.684  -3.602  -57.559 1.00 98.29  ? 303 GLN D C   1 
ATOM   5649 O  O   . GLN D 2 174 ? 33.426  -2.878  -58.233 1.00 98.29  ? 303 GLN D O   1 
ATOM   5650 C  CB  . GLN D 2 174 ? 30.932  -3.540  -59.358 1.00 88.60  ? 303 GLN D CB  1 
ATOM   5651 C  CG  . GLN D 2 174 ? 29.521  -3.096  -59.733 1.00 88.60  ? 303 GLN D CG  1 
ATOM   5652 C  CD  . GLN D 2 174 ? 28.426  -3.865  -59.012 1.00 88.60  ? 303 GLN D CD  1 
ATOM   5653 O  OE1 . GLN D 2 174 ? 28.306  -5.076  -59.158 1.00 88.60  ? 303 GLN D OE1 1 
ATOM   5654 N  NE2 . GLN D 2 174 ? 27.611  -3.155  -58.241 1.00 88.60  ? 303 GLN D NE2 1 
ATOM   5655 N  N   . LYS D 2 175 ? 33.097  -4.263  -56.481 1.00 98.65  ? 304 LYS D N   1 
ATOM   5656 C  CA  . LYS D 2 175 ? 34.495  -4.271  -56.044 1.00 98.65  ? 304 LYS D CA  1 
ATOM   5657 C  C   . LYS D 2 175 ? 35.176  -5.550  -56.545 1.00 98.65  ? 304 LYS D C   1 
ATOM   5658 O  O   . LYS D 2 175 ? 36.407  -5.668  -56.538 1.00 98.65  ? 304 LYS D O   1 
ATOM   5659 C  CB  . LYS D 2 175 ? 34.564  -4.198  -54.510 1.00 92.80  ? 304 LYS D CB  1 
ATOM   5660 C  CG  . LYS D 2 175 ? 33.981  -2.908  -53.906 1.00 92.80  ? 304 LYS D CG  1 
ATOM   5661 C  CD  . LYS D 2 175 ? 34.773  -1.672  -54.318 1.00 92.80  ? 304 LYS D CD  1 
ATOM   5662 C  CE  . LYS D 2 175 ? 34.181  -0.409  -53.714 1.00 92.80  ? 304 LYS D CE  1 
ATOM   5663 N  NZ  . LYS D 2 175 ? 34.226  0.704   -54.704 1.00 92.80  ? 304 LYS D NZ  1 
ATOM   5664 N  N   . LYS D 2 176 ? 34.338  -6.478  -56.992 1.00 98.65  ? 305 LYS D N   1 
ATOM   5665 C  CA  . LYS D 2 176 ? 34.755  -7.772  -57.524 1.00 98.65  ? 305 LYS D CA  1 
ATOM   5666 C  C   . LYS D 2 176 ? 33.506  -8.384  -58.186 1.00 98.65  ? 305 LYS D C   1 
ATOM   5667 O  O   . LYS D 2 176 ? 33.275  -9.599  -58.132 1.00 98.65  ? 305 LYS D O   1 
ATOM   5668 C  CB  . LYS D 2 176 ? 35.268  -8.664  -56.383 1.00 80.30  ? 305 LYS D CB  1 
ATOM   5669 C  CG  . LYS D 2 176 ? 35.967  -9.919  -56.846 1.00 80.30  ? 305 LYS D CG  1 
ATOM   5670 C  CD  . LYS D 2 176 ? 36.363  -10.811 -55.684 1.00 80.30  ? 305 LYS D CD  1 
ATOM   5671 C  CE  . LYS D 2 176 ? 36.832  -12.174 -56.221 1.00 80.30  ? 305 LYS D CE  1 
ATOM   5672 N  NZ  . LYS D 2 176 ? 37.239  -13.186 -55.180 1.00 80.30  ? 305 LYS D NZ  1 
ATOM   5673 N  N   . ILE D 2 177 ? 32.691  -7.522  -58.797 1.00 98.65  ? 306 ILE D N   1 
ATOM   5674 C  CA  . ILE D 2 177 ? 31.464  -7.954  -59.452 1.00 98.65  ? 306 ILE D CA  1 
ATOM   5675 C  C   . ILE D 2 177 ? 31.546  -7.741  -60.967 1.00 98.65  ? 306 ILE D C   1 
ATOM   5676 O  O   . ILE D 2 177 ? 30.740  -6.957  -61.517 1.00 98.65  ? 306 ILE D O   1 
ATOM   5677 C  CB  . ILE D 2 177 ? 30.242  -7.204  -58.887 1.00 88.27  ? 306 ILE D CB  1 
ATOM   5678 C  CG1 . ILE D 2 177 ? 30.430  -6.894  -57.397 1.00 88.27  ? 306 ILE D CG1 1 
ATOM   5679 C  CG2 . ILE D 2 177 ? 28.981  -8.019  -59.126 1.00 88.27  ? 306 ILE D CG2 1 
ATOM   5680 C  CD1 . ILE D 2 177 ? 30.648  -8.097  -56.504 1.00 88.27  ? 306 ILE D CD1 1 
HETATM 5681 C  C1  . NAG E 3 .   ? -6.667  6.534   -3.788  1.00 72.51  ? 1   NAG E C1  1 
HETATM 5682 C  C2  . NAG E 3 .   ? -7.987  6.689   -4.537  1.00 72.51  ? 1   NAG E C2  1 
HETATM 5683 C  C3  . NAG E 3 .   ? -8.107  8.065   -5.146  1.00 72.51  ? 1   NAG E C3  1 
HETATM 5684 C  C4  . NAG E 3 .   ? -8.219  8.894   -3.897  1.00 72.51  ? 1   NAG E C4  1 
HETATM 5685 C  C5  . NAG E 3 .   ? -6.818  8.944   -3.265  1.00 72.51  ? 1   NAG E C5  1 
HETATM 5686 C  C6  . NAG E 3 .   ? -6.706  9.812   -2.018  1.00 72.51  ? 1   NAG E C6  1 
HETATM 5687 C  C7  . NAG E 3 .   ? -9.207  4.848   -5.427  1.00 72.51  ? 1   NAG E C7  1 
HETATM 5688 C  C8  . NAG E 3 .   ? -10.186 4.847   -6.587  1.00 72.51  ? 1   NAG E C8  1 
HETATM 5689 N  N2  . NAG E 3 .   ? -8.158  5.654   -5.534  1.00 72.51  ? 1   NAG E N2  1 
HETATM 5690 O  O3  . NAG E 3 .   ? -9.274  8.156   -5.963  1.00 72.51  ? 1   NAG E O3  1 
HETATM 5691 O  O4  . NAG E 3 .   ? -8.870  10.170  -4.119  1.00 72.51  ? 1   NAG E O4  1 
HETATM 5692 O  O5  . NAG E 3 .   ? -6.424  7.606   -2.844  1.00 72.51  ? 1   NAG E O5  1 
HETATM 5693 O  O6  . NAG E 3 .   ? -7.874  9.733   -1.210  1.00 72.51  ? 1   NAG E O6  1 
HETATM 5694 O  O7  . NAG E 3 .   ? -9.446  4.192   -4.412  1.00 72.51  ? 1   NAG E O7  1 
HETATM 5695 C  C1  . NAG E 3 .   ? -8.242  11.379  -4.369  1.00 81.26  ? 2   NAG E C1  1 
HETATM 5696 C  C2  . NAG E 3 .   ? -9.365  12.408  -4.563  1.00 81.26  ? 2   NAG E C2  1 
HETATM 5697 C  C3  . NAG E 3 .   ? -8.934  13.862  -4.391  1.00 81.26  ? 2   NAG E C3  1 
HETATM 5698 C  C4  . NAG E 3 .   ? -7.989  14.026  -3.214  1.00 81.26  ? 2   NAG E C4  1 
HETATM 5699 C  C5  . NAG E 3 .   ? -6.881  13.007  -3.315  1.00 81.26  ? 2   NAG E C5  1 
HETATM 5700 C  C6  . NAG E 3 .   ? -5.857  13.131  -2.195  1.00 81.26  ? 2   NAG E C6  1 
HETATM 5701 C  C7  . NAG E 3 .   ? -11.066 11.582  -6.075  1.00 81.26  ? 2   NAG E C7  1 
HETATM 5702 C  C8  . NAG E 3 .   ? -11.234 10.239  -5.377  1.00 81.26  ? 2   NAG E C8  1 
HETATM 5703 N  N2  . NAG E 3 .   ? -9.921  12.239  -5.890  1.00 81.26  ? 2   NAG E N2  1 
HETATM 5704 O  O3  . NAG E 3 .   ? -10.092 14.652  -4.163  1.00 81.26  ? 2   NAG E O3  1 
HETATM 5705 O  O4  . NAG E 3 .   ? -7.437  15.330  -3.219  1.00 81.26  ? 2   NAG E O4  1 
HETATM 5706 O  O5  . NAG E 3 .   ? -7.457  11.706  -3.228  1.00 81.26  ? 2   NAG E O5  1 
HETATM 5707 O  O6  . NAG E 3 .   ? -4.893  12.088  -2.249  1.00 81.26  ? 2   NAG E O6  1 
HETATM 5708 O  O7  . NAG E 3 .   ? -11.952 11.986  -6.835  1.00 81.26  ? 2   NAG E O7  1 
HETATM 5709 C  C1  . NAG F 3 .   ? -1.902  -11.034 -2.038  1.00 36.23  ? 1   NAG F C1  1 
HETATM 5710 C  C2  . NAG F 3 .   ? -0.882  -12.082 -1.605  1.00 36.23  ? 1   NAG F C2  1 
HETATM 5711 C  C3  . NAG F 3 .   ? 0.502   -11.790 -2.191  1.00 36.23  ? 1   NAG F C3  1 
HETATM 5712 C  C4  . NAG F 3 .   ? 0.406   -11.605 -3.707  1.00 36.23  ? 1   NAG F C4  1 
HETATM 5713 C  C5  . NAG F 3 .   ? -0.626  -10.497 -3.969  1.00 36.23  ? 1   NAG F C5  1 
HETATM 5714 C  C6  . NAG F 3 .   ? -0.836  -10.152 -5.437  1.00 36.23  ? 1   NAG F C6  1 
HETATM 5715 C  C7  . NAG F 3 .   ? -0.624  -13.226 0.517   1.00 36.23  ? 1   NAG F C7  1 
HETATM 5716 C  C8  . NAG F 3 .   ? -0.954  -13.185 1.995   1.00 36.23  ? 1   NAG F C8  1 
HETATM 5717 N  N2  . NAG F 3 .   ? -0.784  -12.086 -0.153  1.00 36.23  ? 1   NAG F N2  1 
HETATM 5718 O  O3  . NAG F 3 .   ? 1.369   -12.872 -1.880  1.00 36.23  ? 1   NAG F O3  1 
HETATM 5719 O  O4  . NAG F 3 .   ? 1.710   -11.286 -4.279  1.00 36.23  ? 1   NAG F O4  1 
HETATM 5720 O  O5  . NAG F 3 .   ? -1.904  -10.906 -3.453  1.00 36.23  ? 1   NAG F O5  1 
HETATM 5721 O  O6  . NAG F 3 .   ? -2.187  -9.774  -5.702  1.00 36.23  ? 1   NAG F O6  1 
HETATM 5722 O  O7  . NAG F 3 .   ? -0.221  -14.271 0.003   1.00 36.23  ? 1   NAG F O7  1 
HETATM 5723 C  C1  . NAG F 3 .   ? 2.369   -12.390 -4.836  1.00 96.52  ? 2   NAG F C1  1 
HETATM 5724 C  C2  . NAG F 3 .   ? 3.777   -12.032 -5.376  1.00 96.52  ? 2   NAG F C2  1 
HETATM 5725 C  C3  . NAG F 3 .   ? 4.469   -13.332 -5.844  1.00 96.52  ? 2   NAG F C3  1 
HETATM 5726 C  C4  . NAG F 3 .   ? 4.492   -14.336 -4.688  1.00 96.52  ? 2   NAG F C4  1 
HETATM 5727 C  C5  . NAG F 3 .   ? 3.066   -14.605 -4.264  1.00 96.52  ? 2   NAG F C5  1 
HETATM 5728 C  C6  . NAG F 3 .   ? 2.963   -15.607 -3.124  1.00 96.52  ? 2   NAG F C6  1 
HETATM 5729 C  C7  . NAG F 3 .   ? 4.752   -10.769 -7.211  1.00 96.52  ? 2   NAG F C7  1 
HETATM 5730 C  C8  . NAG F 3 .   ? 5.655   -9.660  -6.690  1.00 96.52  ? 2   NAG F C8  1 
HETATM 5731 N  N2  . NAG F 3 .   ? 3.680   -11.083 -6.478  1.00 96.52  ? 2   NAG F N2  1 
HETATM 5732 O  O3  . NAG F 3 .   ? 5.797   -13.074 -6.296  1.00 96.52  ? 2   NAG F O3  1 
HETATM 5733 O  O4  . NAG F 3 .   ? 5.113   -15.552 -5.084  1.00 96.52  ? 2   NAG F O4  1 
HETATM 5734 O  O5  . NAG F 3 .   ? 2.474   -13.382 -3.811  1.00 96.52  ? 2   NAG F O5  1 
HETATM 5735 O  O6  . NAG F 3 .   ? 1.638   -16.113 -2.994  1.00 96.52  ? 2   NAG F O6  1 
HETATM 5736 O  O7  . NAG F 3 .   ? 5.037   -11.343 -8.272  1.00 96.52  ? 2   NAG F O7  1 
HETATM 5737 C  C1  . NAG G 3 .   ? -6.643  8.523   -19.848 1.00 59.43  ? 1   NAG G C1  1 
HETATM 5738 C  C2  . NAG G 3 .   ? -7.932  8.333   -19.119 1.00 59.43  ? 1   NAG G C2  1 
HETATM 5739 C  C3  . NAG G 3 .   ? -7.904  7.017   -18.381 1.00 59.43  ? 1   NAG G C3  1 
HETATM 5740 C  C4  . NAG G 3 .   ? -7.643  5.842   -19.346 1.00 59.43  ? 1   NAG G C4  1 
HETATM 5741 C  C5  . NAG G 3 .   ? -6.446  6.160   -20.291 1.00 59.43  ? 1   NAG G C5  1 
HETATM 5742 C  C6  . NAG G 3 .   ? -6.396  5.237   -21.502 1.00 59.43  ? 1   NAG G C6  1 
HETATM 5743 C  C7  . NAG G 3 .   ? -9.223  10.174  -18.318 1.00 59.43  ? 1   NAG G C7  1 
HETATM 5744 C  C8  . NAG G 3 .   ? -10.255 10.023  -17.211 1.00 59.43  ? 1   NAG G C8  1 
HETATM 5745 N  N2  . NAG G 3 .   ? -8.131  9.434   -18.203 1.00 59.43  ? 1   NAG G N2  1 
HETATM 5746 O  O3  . NAG G 3 .   ? -9.140  6.823   -17.701 1.00 59.43  ? 1   NAG G O3  1 
HETATM 5747 O  O4  . NAG G 3 .   ? -7.324  4.687   -18.524 1.00 59.43  ? 1   NAG G O4  1 
HETATM 5748 O  O5  . NAG G 3 .   ? -6.516  7.501   -20.833 1.00 59.43  ? 1   NAG G O5  1 
HETATM 5749 O  O6  . NAG G 3 .   ? -7.690  5.037   -22.068 1.00 59.43  ? 1   NAG G O6  1 
HETATM 5750 O  O7  . NAG G 3 .   ? -9.448  10.898  -19.289 1.00 59.43  ? 1   NAG G O7  1 
HETATM 5751 C  C1  . NAG G 3 .   ? -7.437  3.369   -18.966 1.00 78.78  ? 2   NAG G C1  1 
HETATM 5752 C  C2  . NAG G 3 .   ? -8.878  2.916   -19.098 1.00 78.78  ? 2   NAG G C2  1 
HETATM 5753 C  C3  . NAG G 3 .   ? -8.854  1.437   -19.429 1.00 78.78  ? 2   NAG G C3  1 
HETATM 5754 C  C4  . NAG G 3 .   ? -7.976  1.170   -20.652 1.00 78.78  ? 2   NAG G C4  1 
HETATM 5755 C  C5  . NAG G 3 .   ? -6.599  1.822   -20.523 1.00 78.78  ? 2   NAG G C5  1 
HETATM 5756 C  C6  . NAG G 3 .   ? -5.782  1.757   -21.807 1.00 78.78  ? 2   NAG G C6  1 
HETATM 5757 C  C7  . NAG G 3 .   ? -10.703 3.787   -17.784 1.00 78.78  ? 2   NAG G C7  1 
HETATM 5758 C  C8  . NAG G 3 .   ? -10.898 4.933   -18.768 1.00 78.78  ? 2   NAG G C8  1 
HETATM 5759 N  N2  . NAG G 3 .   ? -9.555  3.121   -17.837 1.00 78.78  ? 2   NAG G N2  1 
HETATM 5760 O  O3  . NAG G 3 .   ? -10.174 0.985   -19.685 1.00 78.78  ? 2   NAG G O3  1 
HETATM 5761 O  O4  . NAG G 3 .   ? -7.803  -0.227  -20.803 1.00 78.78  ? 2   NAG G O4  1 
HETATM 5762 O  O5  . NAG G 3 .   ? -6.748  3.206   -20.191 1.00 78.78  ? 2   NAG G O5  1 
HETATM 5763 O  O6  . NAG G 3 .   ? -4.713  2.695   -21.795 1.00 78.78  ? 2   NAG G O6  1 
HETATM 5764 O  O7  . NAG G 3 .   ? -11.574 3.543   -16.944 1.00 78.78  ? 2   NAG G O7  1 
HETATM 5765 C  C1  . NAG H 3 .   ? -1.898  26.142  -21.338 1.00 30.58  ? 1   NAG H C1  1 
HETATM 5766 C  C2  . NAG H 3 .   ? -0.783  27.092  -21.781 1.00 30.58  ? 1   NAG H C2  1 
HETATM 5767 C  C3  . NAG H 3 .   ? 0.575   26.723  -21.130 1.00 30.58  ? 1   NAG H C3  1 
HETATM 5768 C  C4  . NAG H 3 .   ? 0.483   26.336  -19.653 1.00 30.58  ? 1   NAG H C4  1 
HETATM 5769 C  C5  . NAG H 3 .   ? -0.785  25.532  -19.328 1.00 30.58  ? 1   NAG H C5  1 
HETATM 5770 C  C6  . NAG H 3 .   ? -1.032  25.541  -17.832 1.00 30.58  ? 1   NAG H C6  1 
HETATM 5771 C  C7  . NAG H 3 .   ? -0.896  28.055  -23.990 1.00 30.58  ? 1   NAG H C7  1 
HETATM 5772 C  C8  . NAG H 3 .   ? -2.165  28.000  -24.824 1.00 30.58  ? 1   NAG H C8  1 
HETATM 5773 N  N2  . NAG H 3 .   ? -0.632  27.004  -23.222 1.00 30.58  ? 1   NAG H N2  1 
HETATM 5774 O  O3  . NAG H 3 .   ? 1.469   27.826  -21.237 1.00 30.58  ? 1   NAG H O3  1 
HETATM 5775 O  O4  . NAG H 3 .   ? 1.665   25.571  -19.270 1.00 30.58  ? 1   NAG H O4  1 
HETATM 5776 O  O5  . NAG H 3 .   ? -1.955  26.130  -19.919 1.00 30.58  ? 1   NAG H O5  1 
HETATM 5777 O  O6  . NAG H 3 .   ? -1.825  24.436  -17.438 1.00 30.58  ? 1   NAG H O6  1 
HETATM 5778 O  O7  . NAG H 3 .   ? -0.161  29.042  -24.051 1.00 30.58  ? 1   NAG H O7  1 
HETATM 5779 C  C1  . NAG H 3 .   ? 2.355   26.073  -18.166 1.00 96.52  ? 2   NAG H C1  1 
HETATM 5780 C  C2  . NAG H 3 .   ? 3.349   25.042  -17.552 1.00 96.52  ? 2   NAG H C2  1 
HETATM 5781 C  C3  . NAG H 3 .   ? 4.111   25.723  -16.375 1.00 96.52  ? 2   NAG H C3  1 
HETATM 5782 C  C4  . NAG H 3 .   ? 4.734   27.046  -16.825 1.00 96.52  ? 2   NAG H C4  1 
HETATM 5783 C  C5  . NAG H 3 .   ? 3.666   27.942  -17.481 1.00 96.52  ? 2   NAG H C5  1 
HETATM 5784 C  C6  . NAG H 3 .   ? 4.219   29.241  -18.044 1.00 96.52  ? 2   NAG H C6  1 
HETATM 5785 C  C7  . NAG H 3 .   ? 3.020   23.129  -16.041 1.00 96.52  ? 2   NAG H C7  1 
HETATM 5786 C  C8  . NAG H 3 .   ? 4.028   22.003  -16.282 1.00 96.52  ? 2   NAG H C8  1 
HETATM 5787 N  N2  . NAG H 3 .   ? 2.627   23.849  -17.101 1.00 96.52  ? 2   NAG H N2  1 
HETATM 5788 O  O3  . NAG H 3 .   ? 5.142   24.881  -15.868 1.00 96.52  ? 2   NAG H O3  1 
HETATM 5789 O  O4  . NAG H 3 .   ? 5.319   27.699  -15.701 1.00 96.52  ? 2   NAG H O4  1 
HETATM 5790 O  O5  . NAG H 3 .   ? 3.048   27.249  -18.583 1.00 96.52  ? 2   NAG H O5  1 
HETATM 5791 O  O6  . NAG H 3 .   ? 3.770   29.463  -19.377 1.00 96.52  ? 2   NAG H O6  1 
HETATM 5792 O  O7  . NAG H 3 .   ? 2.576   23.314  -14.897 1.00 96.52  ? 2   NAG H O7  1 
HETATM 5793 C  C1  . NAG I 4 .   ? -30.463 -9.333  12.154  1.00 96.52  ? 401 NAG A C1  1 
HETATM 5794 C  C2  . NAG I 4 .   ? -29.856 -8.526  13.307  1.00 96.52  ? 401 NAG A C2  1 
HETATM 5795 C  C3  . NAG I 4 .   ? -30.574 -7.173  13.422  1.00 96.52  ? 401 NAG A C3  1 
HETATM 5796 C  C4  . NAG I 4 .   ? -30.487 -6.432  12.091  1.00 96.52  ? 401 NAG A C4  1 
HETATM 5797 C  C5  . NAG I 4 .   ? -31.070 -7.314  10.976  1.00 96.52  ? 401 NAG A C5  1 
HETATM 5798 C  C6  . NAG I 4 .   ? -30.959 -6.686  9.586   1.00 96.52  ? 401 NAG A C6  1 
HETATM 5799 C  C7  . NAG I 4 .   ? -29.120 -9.063  15.549  1.00 96.52  ? 401 NAG A C7  1 
HETATM 5800 C  C8  . NAG I 4 .   ? -27.728 -9.670  15.424  1.00 96.52  ? 401 NAG A C8  1 
HETATM 5801 N  N2  . NAG I 4 .   ? -29.970 -9.278  14.547  1.00 96.52  ? 401 NAG A N2  1 
HETATM 5802 O  O3  . NAG I 4 .   ? -29.984 -6.382  14.448  1.00 96.52  ? 401 NAG A O3  1 
HETATM 5803 O  O4  . NAG I 4 .   ? -31.197 -5.197  12.174  1.00 96.52  ? 401 NAG A O4  1 
HETATM 5804 O  O5  . NAG I 4 .   ? -30.376 -8.590  10.927  1.00 96.52  ? 401 NAG A O5  1 
HETATM 5805 O  O6  . NAG I 4 .   ? -30.921 -5.262  9.632   1.00 96.52  ? 401 NAG A O6  1 
HETATM 5806 O  O7  . NAG I 4 .   ? -29.425 -8.424  16.563  1.00 96.52  ? 401 NAG A O7  1 
HETATM 5807 C  C1  . NAG J 4 .   ? -16.909 -25.207 -1.326  1.00 95.71  ? 404 NAG A C1  1 
HETATM 5808 C  C2  . NAG J 4 .   ? -16.757 -24.882 -2.832  1.00 95.71  ? 404 NAG A C2  1 
HETATM 5809 C  C3  . NAG J 4 .   ? -15.664 -25.744 -3.475  1.00 95.71  ? 404 NAG A C3  1 
HETATM 5810 C  C4  . NAG J 4 .   ? -14.376 -25.639 -2.670  1.00 95.71  ? 404 NAG A C4  1 
HETATM 5811 C  C5  . NAG J 4 .   ? -14.649 -25.996 -1.211  1.00 95.71  ? 404 NAG A C5  1 
HETATM 5812 C  C6  . NAG J 4 .   ? -13.406 -25.884 -0.340  1.00 95.71  ? 404 NAG A C6  1 
HETATM 5813 C  C7  . NAG J 4 .   ? -18.887 -25.998 -3.195  1.00 95.71  ? 404 NAG A C7  1 
HETATM 5814 C  C8  . NAG J 4 .   ? -20.163 -25.494 -2.537  1.00 95.71  ? 404 NAG A C8  1 
HETATM 5815 N  N2  . NAG J 4 .   ? -18.003 -25.073 -3.561  1.00 95.71  ? 404 NAG A N2  1 
HETATM 5816 O  O3  . NAG J 4 .   ? -15.428 -25.307 -4.808  1.00 95.71  ? 404 NAG A O3  1 
HETATM 5817 O  O4  . NAG J 4 .   ? -13.409 -26.526 -3.205  1.00 95.71  ? 404 NAG A O4  1 
HETATM 5818 O  O5  . NAG J 4 .   ? -15.642 -25.104 -0.659  1.00 95.71  ? 404 NAG A O5  1 
HETATM 5819 O  O6  . NAG J 4 .   ? -12.431 -25.031 -0.928  1.00 95.71  ? 404 NAG A O6  1 
HETATM 5820 O  O7  . NAG J 4 .   ? -18.721 -27.206 -3.385  1.00 95.71  ? 404 NAG A O7  1 
HETATM 5821 MG MG  . MG  K 5 .   ? 18.274  16.947  8.310   1.00 95.37  ? 901 MG  B MG  1 
HETATM 5822 C  C1  . NAG L 4 .   ? -30.409 24.442  -35.708 1.00 96.52  ? 407 NAG C C1  1 
HETATM 5823 C  C2  . NAG L 4 .   ? -29.859 23.665  -36.905 1.00 96.52  ? 407 NAG C C2  1 
HETATM 5824 C  C3  . NAG L 4 .   ? -30.683 22.381  -37.050 1.00 96.52  ? 407 NAG C C3  1 
HETATM 5825 C  C4  . NAG L 4 .   ? -30.539 21.565  -35.760 1.00 96.52  ? 407 NAG C C4  1 
HETATM 5826 C  C5  . NAG L 4 .   ? -30.980 22.414  -34.546 1.00 96.52  ? 407 NAG C C5  1 
HETATM 5827 C  C6  . NAG L 4 .   ? -30.716 21.726  -33.206 1.00 96.52  ? 407 NAG C C6  1 
HETATM 5828 C  C7  . NAG L 4 .   ? -29.023 24.287  -39.078 1.00 96.52  ? 407 NAG C C7  1 
HETATM 5829 C  C8  . NAG L 4 .   ? -27.641 24.875  -38.844 1.00 96.52  ? 407 NAG C C8  1 
HETATM 5830 N  N2  . NAG L 4 .   ? -29.919 24.468  -38.112 1.00 96.52  ? 407 NAG C N2  1 
HETATM 5831 O  O3  . NAG L 4 .   ? -30.240 21.622  -38.171 1.00 96.52  ? 407 NAG C O3  1 
HETATM 5832 O  O4  . NAG L 4 .   ? -31.317 20.369  -35.842 1.00 96.52  ? 407 NAG C O4  1 
HETATM 5833 O  O5  . NAG L 4 .   ? -30.256 23.671  -34.511 1.00 96.52  ? 407 NAG C O5  1 
HETATM 5834 O  O6  . NAG L 4 .   ? -31.315 20.435  -33.140 1.00 96.52  ? 407 NAG C O6  1 
HETATM 5835 O  O7  . NAG L 4 .   ? -29.267 23.677  -40.123 1.00 96.52  ? 407 NAG C O7  1 
HETATM 5836 C  C1  . NAG M 4 .   ? -16.866 40.253  -22.163 1.00 96.29  ? 410 NAG C C1  1 
HETATM 5837 C  C2  . NAG M 4 .   ? -16.752 39.929  -20.661 1.00 96.29  ? 410 NAG C C2  1 
HETATM 5838 C  C3  . NAG M 4 .   ? -15.695 40.807  -20.000 1.00 96.29  ? 410 NAG C C3  1 
HETATM 5839 C  C4  . NAG M 4 .   ? -14.375 40.683  -20.757 1.00 96.29  ? 410 NAG C C4  1 
HETATM 5840 C  C5  . NAG M 4 .   ? -14.583 40.983  -22.246 1.00 96.29  ? 410 NAG C C5  1 
HETATM 5841 C  C6  . NAG M 4 .   ? -13.311 40.796  -23.062 1.00 96.29  ? 410 NAG C C6  1 
HETATM 5842 C  C7  . NAG M 4 .   ? -18.933 40.939  -20.493 1.00 96.29  ? 410 NAG C C7  1 
HETATM 5843 C  C8  . NAG M 4 .   ? -20.223 40.298  -20.988 1.00 96.29  ? 410 NAG C C8  1 
HETATM 5844 N  N2  . NAG M 4 .   ? -18.018 40.128  -19.981 1.00 96.29  ? 410 NAG C N2  1 
HETATM 5845 O  O3  . NAG M 4 .   ? -15.518 40.399  -18.651 1.00 96.29  ? 410 NAG C O3  1 
HETATM 5846 O  O4  . NAG M 4 .   ? -13.427 41.590  -20.215 1.00 96.29  ? 410 NAG C O4  1 
HETATM 5847 O  O5  . NAG M 4 .   ? -15.588 40.104  -22.803 1.00 96.29  ? 410 NAG C O5  1 
HETATM 5848 O  O6  . NAG M 4 .   ? -12.370 39.970  -22.387 1.00 96.29  ? 410 NAG C O6  1 
HETATM 5849 O  O7  . NAG M 4 .   ? -18.758 42.151  -20.615 1.00 96.29  ? 410 NAG C O7  1 
HETATM 5850 MG MG  . MG  N 5 .   ? 18.310  -1.833  -31.847 1.00 95.37  ? 902 MG  D MG  1 
HETATM 5851 O  O   . HOH O 6 .   ? 19.686  16.916  6.928   1.00 68.11  ? 1   HOH B O   1 
HETATM 5852 O  O   . HOH O 6 .   ? 19.657  16.406  9.756   1.00 37.36  ? 2   HOH B O   1 
HETATM 5853 O  O   . HOH P 6 .   ? 19.738  -1.973  -30.449 1.00 68.11  ? 3   HOH D O   1 
HETATM 5854 O  O   . HOH P 6 .   ? 19.749  -1.113  -33.294 1.00 37.36  ? 4   HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLN 1   1   1   GLN GLN A . n 
A 1 2   THR 2   2   2   THR THR A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   VAL 4   4   4   VAL VAL A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   SER 7   7   7   SER SER A . n 
A 1 8   LYS 8   8   8   LYS LYS A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  PRO 12  12  12  PRO PRO A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  SER 16  16  16  SER SER A . n 
A 1 17  VAL 17  17  17  VAL VAL A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  THR 20  20  20  THR THR A . n 
A 1 21  CYS 21  21  21  CYS CYS A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  THR 23  23  23  THR THR A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  CYS 25  25  25  CYS CYS A . n 
A 1 26  ASP 26  26  26  ASP ASP A . n 
A 1 27  GLN 27  27  27  GLN GLN A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  THR 35  35  35  THR THR A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  LYS 40  40  40  LYS LYS A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  PRO 45  45  45  PRO PRO A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  ASN 47  47  47  ASN ASN A . n 
A 1 48  ASN 48  48  48  ASN ASN A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  LYS 50  50  50  LYS LYS A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  TYR 52  52  52  TYR TYR A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  ASN 56  56  56  ASN ASN A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  GLN 58  58  58  GLN GLN A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  GLN 62  62  62  GLN GLN A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  MET 64  64  64  MET MET A . n 
A 1 65  CYS 65  65  65  CYS CYS A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  ASN 68  68  68  ASN ASN A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  PRO 70  70  70  PRO PRO A . n 
A 1 71  ASP 71  71  71  ASP ASP A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  GLN 73  73  73  GLN GLN A . n 
A 1 74  SER 74  74  74  SER SER A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  ALA 76  76  76  ALA ALA A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  THR 78  78  78  THR THR A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  THR 81  81  81  THR THR A . n 
A 1 82  VAL 82  82  82  VAL VAL A . n 
A 1 83  TYR 83  83  83  TYR TYR A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  THR 85  85  85  THR THR A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  PRO 93  93  93  PRO PRO A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  SER 96  96  96  SER SER A . n 
A 1 97  TRP 97  97  97  TRP TRP A . n 
A 1 98  GLN 98  98  98  GLN GLN A . n 
A 1 99  PRO 99  99  99  PRO PRO A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 ASN 103 103 103 ASN ASN A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 THR 105 105 105 THR THR A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 CYS 108 108 108 CYS CYS A . n 
A 1 109 GLN 109 109 109 GLN GLN A . n 
A 1 110 VAL 110 110 110 VAL VAL A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 GLY 113 113 113 GLY GLY A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 PRO 115 115 115 PRO PRO A . n 
A 1 116 ARG 116 116 116 ARG ARG A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 ASN 118 118 118 ASN ASN A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 VAL 121 121 121 VAL VAL A . n 
A 1 122 VAL 122 122 122 VAL VAL A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 ARG 125 125 125 ARG ARG A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 LYS 128 128 128 LYS LYS A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 ARG 132 132 132 ARG ARG A . n 
A 1 133 GLU 133 133 133 GLU GLU A . n 
A 1 134 PRO 134 134 134 PRO PRO A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 GLY 137 137 137 GLY GLY A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 PRO 139 139 139 PRO PRO A . n 
A 1 140 ALA 140 140 140 ALA ALA A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 THR 144 144 144 THR THR A . n 
A 1 145 THR 145 145 145 THR THR A . n 
A 1 146 VAL 146 146 146 VAL VAL A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 ARG 150 150 150 ARG ARG A . n 
A 1 151 ASP 151 151 151 ASP ASP A . n 
A 1 152 HIS 152 152 152 HIS HIS A . n 
A 1 153 HIS 153 153 153 HIS HIS A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 ASN 156 156 156 ASN ASN A . n 
A 1 157 PHE 157 157 157 PHE PHE A . n 
A 1 158 SER 158 158 158 SER SER A . n 
A 1 159 CYS 159 159 159 CYS CYS A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 THR 161 161 161 THR THR A . n 
A 1 162 GLU 162 162 162 GLU GLU A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 ASP 164 164 164 ASP ASP A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 ARG 166 166 166 ARG ARG A . n 
A 1 167 PRO 167 167 167 PRO PRO A . n 
A 1 168 GLN 168 168 168 GLN GLN A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 GLU 171 171 171 GLU GLU A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 PHE 173 173 173 PHE PHE A . n 
A 1 174 GLU 174 174 174 GLU GLU A . n 
A 1 175 ASN 175 175 175 ASN ASN A . n 
A 1 176 THR 176 176 176 THR THR A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 ALA 178 178 178 ALA ALA A . n 
A 1 179 PRO 179 179 179 PRO PRO A . n 
A 1 180 TYR 180 180 180 TYR TYR A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 GLN 183 183 183 GLN GLN A . n 
A 1 184 THR 184 184 184 THR THR A . n 
A 1 185 PHE 185 185 ?   ?   ?   A . n 
A 1 186 VAL 186 186 ?   ?   ?   A . n 
A 1 187 LEU 187 187 ?   ?   ?   A . n 
A 1 188 PRO 188 188 ?   ?   ?   A . n 
A 1 189 ALA 189 189 ?   ?   ?   A . n 
A 1 190 THR 190 190 ?   ?   ?   A . n 
A 1 191 PRO 191 191 ?   ?   ?   A . n 
A 1 192 PRO 192 192 ?   ?   ?   A . n 
A 1 193 GLN 193 193 ?   ?   ?   A . n 
A 1 194 LEU 194 194 ?   ?   ?   A . n 
A 1 195 VAL 195 195 ?   ?   ?   A . n 
A 1 196 SER 196 196 ?   ?   ?   A . n 
A 1 197 PRO 197 197 ?   ?   ?   A . n 
A 1 198 ARG 198 198 ?   ?   ?   A . n 
A 1 199 VAL 199 199 ?   ?   ?   A . n 
A 1 200 LEU 200 200 ?   ?   ?   A . n 
A 1 201 GLU 201 201 ?   ?   ?   A . n 
A 1 202 VAL 202 202 ?   ?   ?   A . n 
A 1 203 ASP 203 203 ?   ?   ?   A . n 
A 1 204 THR 204 204 ?   ?   ?   A . n 
A 1 205 GLN 205 205 ?   ?   ?   A . n 
A 1 206 GLY 206 206 ?   ?   ?   A . n 
A 1 207 THR 207 207 ?   ?   ?   A . n 
A 1 208 VAL 208 208 ?   ?   ?   A . n 
A 1 209 VAL 209 209 ?   ?   ?   A . n 
A 1 210 CYS 210 210 ?   ?   ?   A . n 
A 1 211 SER 211 211 ?   ?   ?   A . n 
A 1 212 LEU 212 212 ?   ?   ?   A . n 
A 1 213 ASP 213 213 ?   ?   ?   A . n 
A 1 214 GLY 214 214 ?   ?   ?   A . n 
A 1 215 LEU 215 215 ?   ?   ?   A . n 
A 1 216 PHE 216 216 ?   ?   ?   A . n 
A 1 217 PRO 217 217 ?   ?   ?   A . n 
A 1 218 VAL 218 218 ?   ?   ?   A . n 
A 1 219 SER 219 219 ?   ?   ?   A . n 
A 1 220 GLU 220 220 ?   ?   ?   A . n 
A 1 221 ALA 221 221 ?   ?   ?   A . n 
A 1 222 GLN 222 222 ?   ?   ?   A . n 
A 1 223 VAL 223 223 ?   ?   ?   A . n 
A 1 224 HIS 224 224 ?   ?   ?   A . n 
A 1 225 LEU 225 225 ?   ?   ?   A . n 
A 1 226 ALA 226 226 ?   ?   ?   A . n 
A 1 227 LEU 227 227 ?   ?   ?   A . n 
A 1 228 GLY 228 228 ?   ?   ?   A . n 
A 1 229 ASP 229 229 ?   ?   ?   A . n 
A 1 230 GLN 230 230 ?   ?   ?   A . n 
A 1 231 ARG 231 231 ?   ?   ?   A . n 
A 1 232 LEU 232 232 ?   ?   ?   A . n 
A 1 233 ASN 233 233 ?   ?   ?   A . n 
A 1 234 PRO 234 234 ?   ?   ?   A . n 
A 1 235 THR 235 235 ?   ?   ?   A . n 
A 1 236 VAL 236 236 ?   ?   ?   A . n 
A 1 237 THR 237 237 ?   ?   ?   A . n 
A 1 238 TYR 238 238 ?   ?   ?   A . n 
A 1 239 GLY 239 239 ?   ?   ?   A . n 
A 1 240 ASN 240 240 ?   ?   ?   A . n 
A 1 241 ASP 241 241 ?   ?   ?   A . n 
A 1 242 SER 242 242 ?   ?   ?   A . n 
A 1 243 PHE 243 243 ?   ?   ?   A . n 
A 1 244 SER 244 244 ?   ?   ?   A . n 
A 1 245 ALA 245 245 ?   ?   ?   A . n 
A 1 246 LYS 246 246 ?   ?   ?   A . n 
A 1 247 ALA 247 247 ?   ?   ?   A . n 
A 1 248 SER 248 248 ?   ?   ?   A . n 
A 1 249 VAL 249 249 ?   ?   ?   A . n 
A 1 250 SER 250 250 ?   ?   ?   A . n 
A 1 251 VAL 251 251 ?   ?   ?   A . n 
A 1 252 THR 252 252 ?   ?   ?   A . n 
A 1 253 ALA 253 253 ?   ?   ?   A . n 
A 1 254 GLU 254 254 ?   ?   ?   A . n 
A 1 255 ASP 255 255 ?   ?   ?   A . n 
A 1 256 GLU 256 256 ?   ?   ?   A . n 
A 1 257 GLY 257 257 ?   ?   ?   A . n 
A 1 258 THR 258 258 ?   ?   ?   A . n 
A 1 259 GLN 259 259 ?   ?   ?   A . n 
A 1 260 ARG 260 260 ?   ?   ?   A . n 
A 1 261 LEU 261 261 ?   ?   ?   A . n 
A 1 262 THR 262 262 ?   ?   ?   A . n 
A 1 263 CYS 263 263 ?   ?   ?   A . n 
A 1 264 ALA 264 264 ?   ?   ?   A . n 
A 1 265 VAL 265 265 ?   ?   ?   A . n 
A 1 266 ILE 266 266 ?   ?   ?   A . n 
A 1 267 LEU 267 267 ?   ?   ?   A . n 
A 1 268 GLY 268 268 ?   ?   ?   A . n 
A 1 269 ASN 269 269 ?   ?   ?   A . n 
A 1 270 GLN 270 270 ?   ?   ?   A . n 
A 1 271 SER 271 271 ?   ?   ?   A . n 
A 1 272 GLN 272 272 ?   ?   ?   A . n 
A 1 273 GLU 273 273 ?   ?   ?   A . n 
A 1 274 THR 274 274 ?   ?   ?   A . n 
A 1 275 LEU 275 275 ?   ?   ?   A . n 
A 1 276 GLN 276 276 ?   ?   ?   A . n 
A 1 277 THR 277 277 ?   ?   ?   A . n 
A 1 278 VAL 278 278 ?   ?   ?   A . n 
A 1 279 THR 279 279 ?   ?   ?   A . n 
A 1 280 ILE 280 280 ?   ?   ?   A . n 
A 1 281 TYR 281 281 ?   ?   ?   A . n 
A 1 282 SER 282 282 ?   ?   ?   A . n 
A 1 283 PHE 283 283 ?   ?   ?   A . n 
A 1 284 PRO 284 284 ?   ?   ?   A . n 
A 1 285 ALA 285 285 ?   ?   ?   A . n 
A 1 286 PRO 286 286 ?   ?   ?   A . n 
A 1 287 ASN 287 287 ?   ?   ?   A . n 
A 1 288 VAL 288 288 ?   ?   ?   A . n 
A 1 289 ILE 289 289 ?   ?   ?   A . n 
A 1 290 LEU 290 290 ?   ?   ?   A . n 
A 1 291 THR 291 291 ?   ?   ?   A . n 
B 2 1   VAL 1   130 130 VAL VAL B . n 
B 2 2   ASP 2   131 131 ASP ASP B . n 
B 2 3   LEU 3   132 132 LEU LEU B . n 
B 2 4   VAL 4   133 133 VAL VAL B . n 
B 2 5   PHE 5   134 134 PHE PHE B . n 
B 2 6   LEU 6   135 135 LEU LEU B . n 
B 2 7   PHE 7   136 136 PHE PHE B . n 
B 2 8   ASP 8   137 137 ASP ASP B . n 
B 2 9   GLY 9   138 138 GLY GLY B . n 
B 2 10  SER 10  139 139 SER SER B . n 
B 2 11  MET 11  140 140 MET MET B . n 
B 2 12  SER 12  141 141 SER SER B . n 
B 2 13  LEU 13  142 142 LEU LEU B . n 
B 2 14  GLN 14  143 143 GLN GLN B . n 
B 2 15  PRO 15  144 144 PRO PRO B . n 
B 2 16  ASP 16  145 145 ASP ASP B . n 
B 2 17  GLU 17  146 146 GLU GLU B . n 
B 2 18  PHE 18  147 147 PHE PHE B . n 
B 2 19  GLN 19  148 148 GLN GLN B . n 
B 2 20  LYS 20  149 149 LYS LYS B . n 
B 2 21  ILE 21  150 150 ILE ILE B . n 
B 2 22  LEU 22  151 151 LEU LEU B . n 
B 2 23  ASP 23  152 152 ASP ASP B . n 
B 2 24  PHE 24  153 153 PHE PHE B . n 
B 2 25  MET 25  154 154 MET MET B . n 
B 2 26  LYS 26  155 155 LYS LYS B . n 
B 2 27  ASP 27  156 156 ASP ASP B . n 
B 2 28  VAL 28  157 157 VAL VAL B . n 
B 2 29  MET 29  158 158 MET MET B . n 
B 2 30  LYS 30  159 159 LYS LYS B . n 
B 2 31  LYS 31  160 160 LYS LYS B . n 
B 2 32  CYS 32  161 161 CYS CYS B . n 
B 2 33  SER 33  162 162 SER SER B . n 
B 2 34  ASN 34  163 163 ASN ASN B . n 
B 2 35  THR 35  164 164 THR THR B . n 
B 2 36  SER 36  165 165 SER SER B . n 
B 2 37  TYR 37  166 166 TYR TYR B . n 
B 2 38  GLN 38  167 167 GLN GLN B . n 
B 2 39  PHE 39  168 168 PHE PHE B . n 
B 2 40  ALA 40  169 169 ALA ALA B . n 
B 2 41  ALA 41  170 170 ALA ALA B . n 
B 2 42  VAL 42  171 171 VAL VAL B . n 
B 2 43  GLN 43  172 172 GLN GLN B . n 
B 2 44  PHE 44  173 173 PHE PHE B . n 
B 2 45  SER 45  174 174 SER SER B . n 
B 2 46  THR 46  175 175 THR THR B . n 
B 2 47  SER 47  176 176 SER SER B . n 
B 2 48  TYR 48  177 177 TYR TYR B . n 
B 2 49  LYS 49  178 178 LYS LYS B . n 
B 2 50  THR 50  179 179 THR THR B . n 
B 2 51  GLU 51  180 180 GLU GLU B . n 
B 2 52  PHE 52  181 181 PHE PHE B . n 
B 2 53  ASP 53  182 182 ASP ASP B . n 
B 2 54  PHE 54  183 183 PHE PHE B . n 
B 2 55  SER 55  184 184 SER SER B . n 
B 2 56  ASP 56  185 185 ASP ASP B . n 
B 2 57  TYR 57  186 186 TYR TYR B . n 
B 2 58  VAL 58  187 187 VAL VAL B . n 
B 2 59  LYS 59  188 188 LYS LYS B . n 
B 2 60  ARG 60  189 189 ARG ARG B . n 
B 2 61  LYS 61  190 190 LYS LYS B . n 
B 2 62  ASP 62  191 191 ASP ASP B . n 
B 2 63  PRO 63  192 192 PRO PRO B . n 
B 2 64  ASP 64  193 193 ASP ASP B . n 
B 2 65  ALA 65  194 194 ALA ALA B . n 
B 2 66  LEU 66  195 195 LEU LEU B . n 
B 2 67  LEU 67  196 196 LEU LEU B . n 
B 2 68  LYS 68  197 197 LYS LYS B . n 
B 2 69  HIS 69  198 198 HIS HIS B . n 
B 2 70  VAL 70  199 199 VAL VAL B . n 
B 2 71  LYS 71  200 200 LYS LYS B . n 
B 2 72  HIS 72  201 201 HIS HIS B . n 
B 2 73  MET 73  202 202 MET MET B . n 
B 2 74  LEU 74  203 203 LEU LEU B . n 
B 2 75  LEU 75  204 204 LEU LEU B . n 
B 2 76  LEU 76  205 205 LEU LEU B . n 
B 2 77  THR 77  206 206 THR THR B . n 
B 2 78  ASN 78  207 207 ASN ASN B . n 
B 2 79  THR 79  208 208 THR THR B . n 
B 2 80  PHE 80  209 209 PHE PHE B . n 
B 2 81  GLY 81  210 210 GLY GLY B . n 
B 2 82  ALA 82  211 211 ALA ALA B . n 
B 2 83  ILE 83  212 212 ILE ILE B . n 
B 2 84  ASN 84  213 213 ASN ASN B . n 
B 2 85  TYR 85  214 214 TYR TYR B . n 
B 2 86  VAL 86  215 215 VAL VAL B . n 
B 2 87  ALA 87  216 216 ALA ALA B . n 
B 2 88  THR 88  217 217 THR THR B . n 
B 2 89  GLU 89  218 218 GLU GLU B . n 
B 2 90  VAL 90  219 219 VAL VAL B . n 
B 2 91  PHE 91  220 220 PHE PHE B . n 
B 2 92  ARG 92  221 221 ARG ARG B . n 
B 2 93  GLU 93  222 222 GLU GLU B . n 
B 2 94  GLU 94  223 223 GLU GLU B . n 
B 2 95  LEU 95  224 224 LEU LEU B . n 
B 2 96  GLY 96  225 225 GLY GLY B . n 
B 2 97  ALA 97  226 226 ALA ALA B . n 
B 2 98  ARG 98  227 227 ARG ARG B . n 
B 2 99  PRO 99  228 228 PRO PRO B . n 
B 2 100 ASP 100 229 229 ASP ASP B . n 
B 2 101 ALA 101 230 230 ALA ALA B . n 
B 2 102 THR 102 231 231 THR THR B . n 
B 2 103 LYS 103 232 232 LYS LYS B . n 
B 2 104 VAL 104 233 233 VAL VAL B . n 
B 2 105 LEU 105 234 234 LEU LEU B . n 
B 2 106 ILE 106 235 235 ILE ILE B . n 
B 2 107 ILE 107 236 236 ILE ILE B . n 
B 2 108 ILE 108 237 237 ILE ILE B . n 
B 2 109 THR 109 238 238 THR THR B . n 
B 2 110 ASP 110 239 239 ASP ASP B . n 
B 2 111 GLY 111 240 240 GLY GLY B . n 
B 2 112 GLU 112 241 241 GLU GLU B . n 
B 2 113 ALA 113 242 242 ALA ALA B . n 
B 2 114 THR 114 243 243 THR THR B . n 
B 2 115 ASP 115 244 244 ASP ASP B . n 
B 2 116 SER 116 245 245 SER SER B . n 
B 2 117 GLY 117 246 246 GLY GLY B . n 
B 2 118 ASN 118 247 247 ASN ASN B . n 
B 2 119 ILE 119 248 248 ILE ILE B . n 
B 2 120 ASP 120 249 249 ASP ASP B . n 
B 2 121 ALA 121 250 250 ALA ALA B . n 
B 2 122 ALA 122 251 251 ALA ALA B . n 
B 2 123 LYS 123 252 252 LYS LYS B . n 
B 2 124 ASP 124 253 253 ASP ASP B . n 
B 2 125 ILE 125 254 254 ILE ILE B . n 
B 2 126 ILE 126 255 255 ILE ILE B . n 
B 2 127 ARG 127 256 256 ARG ARG B . n 
B 2 128 TYR 128 257 257 TYR TYR B . n 
B 2 129 ILE 129 258 258 ILE ILE B . n 
B 2 130 ILE 130 259 259 ILE ILE B . n 
B 2 131 GLY 131 260 260 GLY GLY B . n 
B 2 132 ILE 132 261 261 ILE ILE B . n 
B 2 133 GLY 133 262 262 GLY GLY B . n 
B 2 134 LYS 134 263 263 LYS LYS B . n 
B 2 135 HIS 135 264 264 HIS HIS B . n 
B 2 136 PHE 136 265 265 PHE PHE B . n 
B 2 137 GLN 137 266 266 GLN GLN B . n 
B 2 138 THR 138 267 267 THR THR B . n 
B 2 139 LYS 139 268 268 LYS LYS B . n 
B 2 140 GLU 140 269 269 GLU GLU B . n 
B 2 141 SER 141 270 270 SER SER B . n 
B 2 142 GLN 142 271 271 GLN GLN B . n 
B 2 143 GLU 143 272 272 GLU GLU B . n 
B 2 144 THR 144 273 273 THR THR B . n 
B 2 145 LEU 145 274 274 LEU LEU B . n 
B 2 146 HIS 146 275 275 HIS HIS B . n 
B 2 147 LYS 147 276 276 LYS LYS B . n 
B 2 148 PHE 148 277 277 PHE PHE B . n 
B 2 149 ALA 149 278 278 ALA ALA B . n 
B 2 150 SER 150 279 279 SER SER B . n 
B 2 151 LYS 151 280 280 LYS LYS B . n 
B 2 152 PRO 152 281 281 PRO PRO B . n 
B 2 153 ALA 153 282 282 ALA ALA B . n 
B 2 154 SER 154 283 283 SER SER B . n 
B 2 155 GLU 155 284 284 GLU GLU B . n 
B 2 156 PHE 156 285 285 PHE PHE B . n 
B 2 157 VAL 157 286 286 VAL VAL B . n 
B 2 158 LYS 158 287 287 LYS LYS B . n 
B 2 159 ILE 159 288 288 ILE ILE B . n 
B 2 160 LEU 160 289 289 LEU LEU B . n 
B 2 161 ASP 161 290 290 ASP ASP B . n 
B 2 162 THR 162 291 291 THR THR B . n 
B 2 163 PHE 163 292 292 PHE PHE B . n 
B 2 164 GLU 164 293 293 GLU GLU B . n 
B 2 165 LYS 165 294 294 LYS LYS B . n 
B 2 166 LEU 166 295 295 LEU LEU B . n 
B 2 167 LYS 167 296 296 LYS LYS B . n 
B 2 168 ASP 168 297 297 ASP ASP B . n 
B 2 169 LEU 169 298 298 LEU LEU B . n 
B 2 170 CYS 170 299 299 CYS CYS B . n 
B 2 171 THR 171 300 300 THR THR B . n 
B 2 172 GLU 172 301 301 GLU GLU B . n 
B 2 173 LEU 173 302 302 LEU LEU B . n 
B 2 174 GLN 174 303 303 GLN GLN B . n 
B 2 175 LYS 175 304 304 LYS LYS B . n 
B 2 176 LYS 176 305 305 LYS LYS B . n 
B 2 177 ILE 177 306 306 ILE ILE B . n 
C 1 1   GLN 1   1   1   GLN GLN C . n 
C 1 2   THR 2   2   2   THR THR C . n 
C 1 3   SER 3   3   3   SER SER C . n 
C 1 4   VAL 4   4   4   VAL VAL C . n 
C 1 5   SER 5   5   5   SER SER C . n 
C 1 6   PRO 6   6   6   PRO PRO C . n 
C 1 7   SER 7   7   7   SER SER C . n 
C 1 8   LYS 8   8   8   LYS LYS C . n 
C 1 9   VAL 9   9   9   VAL VAL C . n 
C 1 10  ILE 10  10  10  ILE ILE C . n 
C 1 11  LEU 11  11  11  LEU LEU C . n 
C 1 12  PRO 12  12  12  PRO PRO C . n 
C 1 13  ARG 13  13  13  ARG ARG C . n 
C 1 14  GLY 14  14  14  GLY GLY C . n 
C 1 15  GLY 15  15  15  GLY GLY C . n 
C 1 16  SER 16  16  16  SER SER C . n 
C 1 17  VAL 17  17  17  VAL VAL C . n 
C 1 18  LEU 18  18  18  LEU LEU C . n 
C 1 19  VAL 19  19  19  VAL VAL C . n 
C 1 20  THR 20  20  20  THR THR C . n 
C 1 21  CYS 21  21  21  CYS CYS C . n 
C 1 22  SER 22  22  22  SER SER C . n 
C 1 23  THR 23  23  23  THR THR C . n 
C 1 24  SER 24  24  24  SER SER C . n 
C 1 25  CYS 25  25  25  CYS CYS C . n 
C 1 26  ASP 26  26  26  ASP ASP C . n 
C 1 27  GLN 27  27  27  GLN GLN C . n 
C 1 28  PRO 28  28  28  PRO PRO C . n 
C 1 29  LYS 29  29  29  LYS LYS C . n 
C 1 30  LEU 30  30  30  LEU LEU C . n 
C 1 31  LEU 31  31  31  LEU LEU C . n 
C 1 32  GLY 32  32  32  GLY GLY C . n 
C 1 33  ILE 33  33  33  ILE ILE C . n 
C 1 34  GLU 34  34  34  GLU GLU C . n 
C 1 35  THR 35  35  35  THR THR C . n 
C 1 36  PRO 36  36  36  PRO PRO C . n 
C 1 37  LEU 37  37  37  LEU LEU C . n 
C 1 38  PRO 38  38  38  PRO PRO C . n 
C 1 39  LYS 39  39  39  LYS LYS C . n 
C 1 40  LYS 40  40  40  LYS LYS C . n 
C 1 41  GLU 41  41  41  GLU GLU C . n 
C 1 42  LEU 42  42  42  LEU LEU C . n 
C 1 43  LEU 43  43  43  LEU LEU C . n 
C 1 44  LEU 44  44  44  LEU LEU C . n 
C 1 45  PRO 45  45  45  PRO PRO C . n 
C 1 46  GLY 46  46  46  GLY GLY C . n 
C 1 47  ASN 47  47  47  ASN ASN C . n 
C 1 48  ASN 48  48  48  ASN ASN C . n 
C 1 49  ARG 49  49  49  ARG ARG C . n 
C 1 50  LYS 50  50  50  LYS LYS C . n 
C 1 51  VAL 51  51  51  VAL VAL C . n 
C 1 52  TYR 52  52  52  TYR TYR C . n 
C 1 53  GLU 53  53  53  GLU GLU C . n 
C 1 54  LEU 54  54  54  LEU LEU C . n 
C 1 55  SER 55  55  55  SER SER C . n 
C 1 56  ASN 56  56  56  ASN ASN C . n 
C 1 57  VAL 57  57  57  VAL VAL C . n 
C 1 58  GLN 58  58  58  GLN GLN C . n 
C 1 59  GLU 59  59  59  GLU GLU C . n 
C 1 60  ASP 60  60  60  ASP ASP C . n 
C 1 61  SER 61  61  61  SER SER C . n 
C 1 62  GLN 62  62  62  GLN GLN C . n 
C 1 63  PRO 63  63  63  PRO PRO C . n 
C 1 64  MET 64  64  64  MET MET C . n 
C 1 65  CYS 65  65  65  CYS CYS C . n 
C 1 66  TYR 66  66  66  TYR TYR C . n 
C 1 67  SER 67  67  67  SER SER C . n 
C 1 68  ASN 68  68  68  ASN ASN C . n 
C 1 69  CYS 69  69  69  CYS CYS C . n 
C 1 70  PRO 70  70  70  PRO PRO C . n 
C 1 71  ASP 71  71  71  ASP ASP C . n 
C 1 72  GLY 72  72  72  GLY GLY C . n 
C 1 73  GLN 73  73  73  GLN GLN C . n 
C 1 74  SER 74  74  74  SER SER C . n 
C 1 75  THR 75  75  75  THR THR C . n 
C 1 76  ALA 76  76  76  ALA ALA C . n 
C 1 77  LYS 77  77  77  LYS LYS C . n 
C 1 78  THR 78  78  78  THR THR C . n 
C 1 79  PHE 79  79  79  PHE PHE C . n 
C 1 80  LEU 80  80  80  LEU LEU C . n 
C 1 81  THR 81  81  81  THR THR C . n 
C 1 82  VAL 82  82  82  VAL VAL C . n 
C 1 83  TYR 83  83  83  TYR TYR C . n 
C 1 84  TRP 84  84  84  TRP TRP C . n 
C 1 85  THR 85  85  85  THR THR C . n 
C 1 86  PRO 86  86  86  PRO PRO C . n 
C 1 87  GLU 87  87  87  GLU GLU C . n 
C 1 88  ARG 88  88  88  ARG ARG C . n 
C 1 89  VAL 89  89  89  VAL VAL C . n 
C 1 90  GLU 90  90  90  GLU GLU C . n 
C 1 91  LEU 91  91  91  LEU LEU C . n 
C 1 92  ALA 92  92  92  ALA ALA C . n 
C 1 93  PRO 93  93  93  PRO PRO C . n 
C 1 94  LEU 94  94  94  LEU LEU C . n 
C 1 95  PRO 95  95  95  PRO PRO C . n 
C 1 96  SER 96  96  96  SER SER C . n 
C 1 97  TRP 97  97  97  TRP TRP C . n 
C 1 98  GLN 98  98  98  GLN GLN C . n 
C 1 99  PRO 99  99  99  PRO PRO C . n 
C 1 100 VAL 100 100 100 VAL VAL C . n 
C 1 101 GLY 101 101 101 GLY GLY C . n 
C 1 102 LYS 102 102 102 LYS LYS C . n 
C 1 103 ASN 103 103 103 ASN ASN C . n 
C 1 104 LEU 104 104 104 LEU LEU C . n 
C 1 105 THR 105 105 105 THR THR C . n 
C 1 106 LEU 106 106 106 LEU LEU C . n 
C 1 107 ARG 107 107 107 ARG ARG C . n 
C 1 108 CYS 108 108 108 CYS CYS C . n 
C 1 109 GLN 109 109 109 GLN GLN C . n 
C 1 110 VAL 110 110 110 VAL VAL C . n 
C 1 111 GLU 111 111 111 GLU GLU C . n 
C 1 112 GLY 112 112 112 GLY GLY C . n 
C 1 113 GLY 113 113 113 GLY GLY C . n 
C 1 114 ALA 114 114 114 ALA ALA C . n 
C 1 115 PRO 115 115 115 PRO PRO C . n 
C 1 116 ARG 116 116 116 ARG ARG C . n 
C 1 117 ALA 117 117 117 ALA ALA C . n 
C 1 118 ASN 118 118 118 ASN ASN C . n 
C 1 119 LEU 119 119 119 LEU LEU C . n 
C 1 120 THR 120 120 120 THR THR C . n 
C 1 121 VAL 121 121 121 VAL VAL C . n 
C 1 122 VAL 122 122 122 VAL VAL C . n 
C 1 123 LEU 123 123 123 LEU LEU C . n 
C 1 124 LEU 124 124 124 LEU LEU C . n 
C 1 125 ARG 125 125 125 ARG ARG C . n 
C 1 126 GLY 126 126 126 GLY GLY C . n 
C 1 127 GLU 127 127 127 GLU GLU C . n 
C 1 128 LYS 128 128 128 LYS LYS C . n 
C 1 129 GLU 129 129 129 GLU GLU C . n 
C 1 130 LEU 130 130 130 LEU LEU C . n 
C 1 131 LYS 131 131 131 LYS LYS C . n 
C 1 132 ARG 132 132 132 ARG ARG C . n 
C 1 133 GLU 133 133 133 GLU GLU C . n 
C 1 134 PRO 134 134 134 PRO PRO C . n 
C 1 135 ALA 135 135 135 ALA ALA C . n 
C 1 136 VAL 136 136 136 VAL VAL C . n 
C 1 137 GLY 137 137 137 GLY GLY C . n 
C 1 138 GLU 138 138 138 GLU GLU C . n 
C 1 139 PRO 139 139 139 PRO PRO C . n 
C 1 140 ALA 140 140 140 ALA ALA C . n 
C 1 141 GLU 141 141 141 GLU GLU C . n 
C 1 142 VAL 142 142 142 VAL VAL C . n 
C 1 143 THR 143 143 143 THR THR C . n 
C 1 144 THR 144 144 144 THR THR C . n 
C 1 145 THR 145 145 145 THR THR C . n 
C 1 146 VAL 146 146 146 VAL VAL C . n 
C 1 147 LEU 147 147 147 LEU LEU C . n 
C 1 148 VAL 148 148 148 VAL VAL C . n 
C 1 149 ARG 149 149 149 ARG ARG C . n 
C 1 150 ARG 150 150 150 ARG ARG C . n 
C 1 151 ASP 151 151 151 ASP ASP C . n 
C 1 152 HIS 152 152 152 HIS HIS C . n 
C 1 153 HIS 153 153 153 HIS HIS C . n 
C 1 154 GLY 154 154 154 GLY GLY C . n 
C 1 155 ALA 155 155 155 ALA ALA C . n 
C 1 156 ASN 156 156 156 ASN ASN C . n 
C 1 157 PHE 157 157 157 PHE PHE C . n 
C 1 158 SER 158 158 158 SER SER C . n 
C 1 159 CYS 159 159 159 CYS CYS C . n 
C 1 160 ARG 160 160 160 ARG ARG C . n 
C 1 161 THR 161 161 161 THR THR C . n 
C 1 162 GLU 162 162 162 GLU GLU C . n 
C 1 163 LEU 163 163 163 LEU LEU C . n 
C 1 164 ASP 164 164 164 ASP ASP C . n 
C 1 165 LEU 165 165 165 LEU LEU C . n 
C 1 166 ARG 166 166 166 ARG ARG C . n 
C 1 167 PRO 167 167 167 PRO PRO C . n 
C 1 168 GLN 168 168 168 GLN GLN C . n 
C 1 169 GLY 169 169 169 GLY GLY C . n 
C 1 170 LEU 170 170 170 LEU LEU C . n 
C 1 171 GLU 171 171 171 GLU GLU C . n 
C 1 172 LEU 172 172 172 LEU LEU C . n 
C 1 173 PHE 173 173 173 PHE PHE C . n 
C 1 174 GLU 174 174 174 GLU GLU C . n 
C 1 175 ASN 175 175 175 ASN ASN C . n 
C 1 176 THR 176 176 176 THR THR C . n 
C 1 177 SER 177 177 177 SER SER C . n 
C 1 178 ALA 178 178 178 ALA ALA C . n 
C 1 179 PRO 179 179 179 PRO PRO C . n 
C 1 180 TYR 180 180 180 TYR TYR C . n 
C 1 181 GLN 181 181 181 GLN GLN C . n 
C 1 182 LEU 182 182 182 LEU LEU C . n 
C 1 183 GLN 183 183 183 GLN GLN C . n 
C 1 184 THR 184 184 184 THR THR C . n 
C 1 185 PHE 185 185 ?   ?   ?   C . n 
C 1 186 VAL 186 186 ?   ?   ?   C . n 
C 1 187 LEU 187 187 ?   ?   ?   C . n 
C 1 188 PRO 188 188 ?   ?   ?   C . n 
C 1 189 ALA 189 189 ?   ?   ?   C . n 
C 1 190 THR 190 190 ?   ?   ?   C . n 
C 1 191 PRO 191 191 ?   ?   ?   C . n 
C 1 192 PRO 192 192 ?   ?   ?   C . n 
C 1 193 GLN 193 193 ?   ?   ?   C . n 
C 1 194 LEU 194 194 ?   ?   ?   C . n 
C 1 195 VAL 195 195 ?   ?   ?   C . n 
C 1 196 SER 196 196 ?   ?   ?   C . n 
C 1 197 PRO 197 197 ?   ?   ?   C . n 
C 1 198 ARG 198 198 ?   ?   ?   C . n 
C 1 199 VAL 199 199 ?   ?   ?   C . n 
C 1 200 LEU 200 200 ?   ?   ?   C . n 
C 1 201 GLU 201 201 ?   ?   ?   C . n 
C 1 202 VAL 202 202 ?   ?   ?   C . n 
C 1 203 ASP 203 203 ?   ?   ?   C . n 
C 1 204 THR 204 204 ?   ?   ?   C . n 
C 1 205 GLN 205 205 ?   ?   ?   C . n 
C 1 206 GLY 206 206 ?   ?   ?   C . n 
C 1 207 THR 207 207 ?   ?   ?   C . n 
C 1 208 VAL 208 208 ?   ?   ?   C . n 
C 1 209 VAL 209 209 ?   ?   ?   C . n 
C 1 210 CYS 210 210 ?   ?   ?   C . n 
C 1 211 SER 211 211 ?   ?   ?   C . n 
C 1 212 LEU 212 212 ?   ?   ?   C . n 
C 1 213 ASP 213 213 ?   ?   ?   C . n 
C 1 214 GLY 214 214 ?   ?   ?   C . n 
C 1 215 LEU 215 215 ?   ?   ?   C . n 
C 1 216 PHE 216 216 ?   ?   ?   C . n 
C 1 217 PRO 217 217 ?   ?   ?   C . n 
C 1 218 VAL 218 218 ?   ?   ?   C . n 
C 1 219 SER 219 219 ?   ?   ?   C . n 
C 1 220 GLU 220 220 ?   ?   ?   C . n 
C 1 221 ALA 221 221 ?   ?   ?   C . n 
C 1 222 GLN 222 222 ?   ?   ?   C . n 
C 1 223 VAL 223 223 ?   ?   ?   C . n 
C 1 224 HIS 224 224 ?   ?   ?   C . n 
C 1 225 LEU 225 225 ?   ?   ?   C . n 
C 1 226 ALA 226 226 ?   ?   ?   C . n 
C 1 227 LEU 227 227 ?   ?   ?   C . n 
C 1 228 GLY 228 228 ?   ?   ?   C . n 
C 1 229 ASP 229 229 ?   ?   ?   C . n 
C 1 230 GLN 230 230 ?   ?   ?   C . n 
C 1 231 ARG 231 231 ?   ?   ?   C . n 
C 1 232 LEU 232 232 ?   ?   ?   C . n 
C 1 233 ASN 233 233 ?   ?   ?   C . n 
C 1 234 PRO 234 234 ?   ?   ?   C . n 
C 1 235 THR 235 235 ?   ?   ?   C . n 
C 1 236 VAL 236 236 ?   ?   ?   C . n 
C 1 237 THR 237 237 ?   ?   ?   C . n 
C 1 238 TYR 238 238 ?   ?   ?   C . n 
C 1 239 GLY 239 239 ?   ?   ?   C . n 
C 1 240 ASN 240 240 ?   ?   ?   C . n 
C 1 241 ASP 241 241 ?   ?   ?   C . n 
C 1 242 SER 242 242 ?   ?   ?   C . n 
C 1 243 PHE 243 243 ?   ?   ?   C . n 
C 1 244 SER 244 244 ?   ?   ?   C . n 
C 1 245 ALA 245 245 ?   ?   ?   C . n 
C 1 246 LYS 246 246 ?   ?   ?   C . n 
C 1 247 ALA 247 247 ?   ?   ?   C . n 
C 1 248 SER 248 248 ?   ?   ?   C . n 
C 1 249 VAL 249 249 ?   ?   ?   C . n 
C 1 250 SER 250 250 ?   ?   ?   C . n 
C 1 251 VAL 251 251 ?   ?   ?   C . n 
C 1 252 THR 252 252 ?   ?   ?   C . n 
C 1 253 ALA 253 253 ?   ?   ?   C . n 
C 1 254 GLU 254 254 ?   ?   ?   C . n 
C 1 255 ASP 255 255 ?   ?   ?   C . n 
C 1 256 GLU 256 256 ?   ?   ?   C . n 
C 1 257 GLY 257 257 ?   ?   ?   C . n 
C 1 258 THR 258 258 ?   ?   ?   C . n 
C 1 259 GLN 259 259 ?   ?   ?   C . n 
C 1 260 ARG 260 260 ?   ?   ?   C . n 
C 1 261 LEU 261 261 ?   ?   ?   C . n 
C 1 262 THR 262 262 ?   ?   ?   C . n 
C 1 263 CYS 263 263 ?   ?   ?   C . n 
C 1 264 ALA 264 264 ?   ?   ?   C . n 
C 1 265 VAL 265 265 ?   ?   ?   C . n 
C 1 266 ILE 266 266 ?   ?   ?   C . n 
C 1 267 LEU 267 267 ?   ?   ?   C . n 
C 1 268 GLY 268 268 ?   ?   ?   C . n 
C 1 269 ASN 269 269 ?   ?   ?   C . n 
C 1 270 GLN 270 270 ?   ?   ?   C . n 
C 1 271 SER 271 271 ?   ?   ?   C . n 
C 1 272 GLN 272 272 ?   ?   ?   C . n 
C 1 273 GLU 273 273 ?   ?   ?   C . n 
C 1 274 THR 274 274 ?   ?   ?   C . n 
C 1 275 LEU 275 275 ?   ?   ?   C . n 
C 1 276 GLN 276 276 ?   ?   ?   C . n 
C 1 277 THR 277 277 ?   ?   ?   C . n 
C 1 278 VAL 278 278 ?   ?   ?   C . n 
C 1 279 THR 279 279 ?   ?   ?   C . n 
C 1 280 ILE 280 280 ?   ?   ?   C . n 
C 1 281 TYR 281 281 ?   ?   ?   C . n 
C 1 282 SER 282 282 ?   ?   ?   C . n 
C 1 283 PHE 283 283 ?   ?   ?   C . n 
C 1 284 PRO 284 284 ?   ?   ?   C . n 
C 1 285 ALA 285 285 ?   ?   ?   C . n 
C 1 286 PRO 286 286 ?   ?   ?   C . n 
C 1 287 ASN 287 287 ?   ?   ?   C . n 
C 1 288 VAL 288 288 ?   ?   ?   C . n 
C 1 289 ILE 289 289 ?   ?   ?   C . n 
C 1 290 LEU 290 290 ?   ?   ?   C . n 
C 1 291 THR 291 291 ?   ?   ?   C . n 
D 2 1   VAL 1   130 130 VAL VAL D . n 
D 2 2   ASP 2   131 131 ASP ASP D . n 
D 2 3   LEU 3   132 132 LEU LEU D . n 
D 2 4   VAL 4   133 133 VAL VAL D . n 
D 2 5   PHE 5   134 134 PHE PHE D . n 
D 2 6   LEU 6   135 135 LEU LEU D . n 
D 2 7   PHE 7   136 136 PHE PHE D . n 
D 2 8   ASP 8   137 137 ASP ASP D . n 
D 2 9   GLY 9   138 138 GLY GLY D . n 
D 2 10  SER 10  139 139 SER SER D . n 
D 2 11  MET 11  140 140 MET MET D . n 
D 2 12  SER 12  141 141 SER SER D . n 
D 2 13  LEU 13  142 142 LEU LEU D . n 
D 2 14  GLN 14  143 143 GLN GLN D . n 
D 2 15  PRO 15  144 144 PRO PRO D . n 
D 2 16  ASP 16  145 145 ASP ASP D . n 
D 2 17  GLU 17  146 146 GLU GLU D . n 
D 2 18  PHE 18  147 147 PHE PHE D . n 
D 2 19  GLN 19  148 148 GLN GLN D . n 
D 2 20  LYS 20  149 149 LYS LYS D . n 
D 2 21  ILE 21  150 150 ILE ILE D . n 
D 2 22  LEU 22  151 151 LEU LEU D . n 
D 2 23  ASP 23  152 152 ASP ASP D . n 
D 2 24  PHE 24  153 153 PHE PHE D . n 
D 2 25  MET 25  154 154 MET MET D . n 
D 2 26  LYS 26  155 155 LYS LYS D . n 
D 2 27  ASP 27  156 156 ASP ASP D . n 
D 2 28  VAL 28  157 157 VAL VAL D . n 
D 2 29  MET 29  158 158 MET MET D . n 
D 2 30  LYS 30  159 159 LYS LYS D . n 
D 2 31  LYS 31  160 160 LYS LYS D . n 
D 2 32  CYS 32  161 161 CYS CYS D . n 
D 2 33  SER 33  162 162 SER SER D . n 
D 2 34  ASN 34  163 163 ASN ASN D . n 
D 2 35  THR 35  164 164 THR THR D . n 
D 2 36  SER 36  165 165 SER SER D . n 
D 2 37  TYR 37  166 166 TYR TYR D . n 
D 2 38  GLN 38  167 167 GLN GLN D . n 
D 2 39  PHE 39  168 168 PHE PHE D . n 
D 2 40  ALA 40  169 169 ALA ALA D . n 
D 2 41  ALA 41  170 170 ALA ALA D . n 
D 2 42  VAL 42  171 171 VAL VAL D . n 
D 2 43  GLN 43  172 172 GLN GLN D . n 
D 2 44  PHE 44  173 173 PHE PHE D . n 
D 2 45  SER 45  174 174 SER SER D . n 
D 2 46  THR 46  175 175 THR THR D . n 
D 2 47  SER 47  176 176 SER SER D . n 
D 2 48  TYR 48  177 177 TYR TYR D . n 
D 2 49  LYS 49  178 178 LYS LYS D . n 
D 2 50  THR 50  179 179 THR THR D . n 
D 2 51  GLU 51  180 180 GLU GLU D . n 
D 2 52  PHE 52  181 181 PHE PHE D . n 
D 2 53  ASP 53  182 182 ASP ASP D . n 
D 2 54  PHE 54  183 183 PHE PHE D . n 
D 2 55  SER 55  184 184 SER SER D . n 
D 2 56  ASP 56  185 185 ASP ASP D . n 
D 2 57  TYR 57  186 186 TYR TYR D . n 
D 2 58  VAL 58  187 187 VAL VAL D . n 
D 2 59  LYS 59  188 188 LYS LYS D . n 
D 2 60  ARG 60  189 189 ARG ARG D . n 
D 2 61  LYS 61  190 190 LYS LYS D . n 
D 2 62  ASP 62  191 191 ASP ASP D . n 
D 2 63  PRO 63  192 192 PRO PRO D . n 
D 2 64  ASP 64  193 193 ASP ASP D . n 
D 2 65  ALA 65  194 194 ALA ALA D . n 
D 2 66  LEU 66  195 195 LEU LEU D . n 
D 2 67  LEU 67  196 196 LEU LEU D . n 
D 2 68  LYS 68  197 197 LYS LYS D . n 
D 2 69  HIS 69  198 198 HIS HIS D . n 
D 2 70  VAL 70  199 199 VAL VAL D . n 
D 2 71  LYS 71  200 200 LYS LYS D . n 
D 2 72  HIS 72  201 201 HIS HIS D . n 
D 2 73  MET 73  202 202 MET MET D . n 
D 2 74  LEU 74  203 203 LEU LEU D . n 
D 2 75  LEU 75  204 204 LEU LEU D . n 
D 2 76  LEU 76  205 205 LEU LEU D . n 
D 2 77  THR 77  206 206 THR THR D . n 
D 2 78  ASN 78  207 207 ASN ASN D . n 
D 2 79  THR 79  208 208 THR THR D . n 
D 2 80  PHE 80  209 209 PHE PHE D . n 
D 2 81  GLY 81  210 210 GLY GLY D . n 
D 2 82  ALA 82  211 211 ALA ALA D . n 
D 2 83  ILE 83  212 212 ILE ILE D . n 
D 2 84  ASN 84  213 213 ASN ASN D . n 
D 2 85  TYR 85  214 214 TYR TYR D . n 
D 2 86  VAL 86  215 215 VAL VAL D . n 
D 2 87  ALA 87  216 216 ALA ALA D . n 
D 2 88  THR 88  217 217 THR THR D . n 
D 2 89  GLU 89  218 218 GLU GLU D . n 
D 2 90  VAL 90  219 219 VAL VAL D . n 
D 2 91  PHE 91  220 220 PHE PHE D . n 
D 2 92  ARG 92  221 221 ARG ARG D . n 
D 2 93  GLU 93  222 222 GLU GLU D . n 
D 2 94  GLU 94  223 223 GLU GLU D . n 
D 2 95  LEU 95  224 224 LEU LEU D . n 
D 2 96  GLY 96  225 225 GLY GLY D . n 
D 2 97  ALA 97  226 226 ALA ALA D . n 
D 2 98  ARG 98  227 227 ARG ARG D . n 
D 2 99  PRO 99  228 228 PRO PRO D . n 
D 2 100 ASP 100 229 229 ASP ASP D . n 
D 2 101 ALA 101 230 230 ALA ALA D . n 
D 2 102 THR 102 231 231 THR THR D . n 
D 2 103 LYS 103 232 232 LYS LYS D . n 
D 2 104 VAL 104 233 233 VAL VAL D . n 
D 2 105 LEU 105 234 234 LEU LEU D . n 
D 2 106 ILE 106 235 235 ILE ILE D . n 
D 2 107 ILE 107 236 236 ILE ILE D . n 
D 2 108 ILE 108 237 237 ILE ILE D . n 
D 2 109 THR 109 238 238 THR THR D . n 
D 2 110 ASP 110 239 239 ASP ASP D . n 
D 2 111 GLY 111 240 240 GLY GLY D . n 
D 2 112 GLU 112 241 241 GLU GLU D . n 
D 2 113 ALA 113 242 242 ALA ALA D . n 
D 2 114 THR 114 243 243 THR THR D . n 
D 2 115 ASP 115 244 244 ASP ASP D . n 
D 2 116 SER 116 245 245 SER SER D . n 
D 2 117 GLY 117 246 246 GLY GLY D . n 
D 2 118 ASN 118 247 247 ASN ASN D . n 
D 2 119 ILE 119 248 248 ILE ILE D . n 
D 2 120 ASP 120 249 249 ASP ASP D . n 
D 2 121 ALA 121 250 250 ALA ALA D . n 
D 2 122 ALA 122 251 251 ALA ALA D . n 
D 2 123 LYS 123 252 252 LYS LYS D . n 
D 2 124 ASP 124 253 253 ASP ASP D . n 
D 2 125 ILE 125 254 254 ILE ILE D . n 
D 2 126 ILE 126 255 255 ILE ILE D . n 
D 2 127 ARG 127 256 256 ARG ARG D . n 
D 2 128 TYR 128 257 257 TYR TYR D . n 
D 2 129 ILE 129 258 258 ILE ILE D . n 
D 2 130 ILE 130 259 259 ILE ILE D . n 
D 2 131 GLY 131 260 260 GLY GLY D . n 
D 2 132 ILE 132 261 261 ILE ILE D . n 
D 2 133 GLY 133 262 262 GLY GLY D . n 
D 2 134 LYS 134 263 263 LYS LYS D . n 
D 2 135 HIS 135 264 264 HIS HIS D . n 
D 2 136 PHE 136 265 265 PHE PHE D . n 
D 2 137 GLN 137 266 266 GLN GLN D . n 
D 2 138 THR 138 267 267 THR THR D . n 
D 2 139 LYS 139 268 268 LYS LYS D . n 
D 2 140 GLU 140 269 269 GLU GLU D . n 
D 2 141 SER 141 270 270 SER SER D . n 
D 2 142 GLN 142 271 271 GLN GLN D . n 
D 2 143 GLU 143 272 272 GLU GLU D . n 
D 2 144 THR 144 273 273 THR THR D . n 
D 2 145 LEU 145 274 274 LEU LEU D . n 
D 2 146 HIS 146 275 275 HIS HIS D . n 
D 2 147 LYS 147 276 276 LYS LYS D . n 
D 2 148 PHE 148 277 277 PHE PHE D . n 
D 2 149 ALA 149 278 278 ALA ALA D . n 
D 2 150 SER 150 279 279 SER SER D . n 
D 2 151 LYS 151 280 280 LYS LYS D . n 
D 2 152 PRO 152 281 281 PRO PRO D . n 
D 2 153 ALA 153 282 282 ALA ALA D . n 
D 2 154 SER 154 283 283 SER SER D . n 
D 2 155 GLU 155 284 284 GLU GLU D . n 
D 2 156 PHE 156 285 285 PHE PHE D . n 
D 2 157 VAL 157 286 286 VAL VAL D . n 
D 2 158 LYS 158 287 287 LYS LYS D . n 
D 2 159 ILE 159 288 288 ILE ILE D . n 
D 2 160 LEU 160 289 289 LEU LEU D . n 
D 2 161 ASP 161 290 290 ASP ASP D . n 
D 2 162 THR 162 291 291 THR THR D . n 
D 2 163 PHE 163 292 292 PHE PHE D . n 
D 2 164 GLU 164 293 293 GLU GLU D . n 
D 2 165 LYS 165 294 294 LYS LYS D . n 
D 2 166 LEU 166 295 295 LEU LEU D . n 
D 2 167 LYS 167 296 296 LYS LYS D . n 
D 2 168 ASP 168 297 297 ASP ASP D . n 
D 2 169 LEU 169 298 298 LEU LEU D . n 
D 2 170 CYS 170 299 299 CYS CYS D . n 
D 2 171 THR 171 300 300 THR THR D . n 
D 2 172 GLU 172 301 301 GLU GLU D . n 
D 2 173 LEU 173 302 302 LEU LEU D . n 
D 2 174 GLN 174 303 303 GLN GLN D . n 
D 2 175 LYS 175 304 304 LYS LYS D . n 
D 2 176 LYS 176 305 305 LYS LYS D . n 
D 2 177 ILE 177 306 306 ILE ILE D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
I 4 NAG 1 401 401 NAG NAG A . 
J 4 NAG 1 404 404 NAG NAG A . 
K 5 MG  1 901 901 MG  MG  B . 
L 4 NAG 1 407 407 NAG NAG C . 
M 4 NAG 1 410 410 NAG NAG C . 
N 5 MG  1 902 902 MG  MG  D . 
O 6 HOH 1 1   1   HOH HOH B . 
O 6 HOH 2 2   2   HOH HOH B . 
P 6 HOH 1 3   3   HOH HOH D . 
P 6 HOH 2 4   4   HOH HOH D . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 103 A ASN 103 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 118 A ASN 118 ? ASN 'GLYCOSYLATION SITE' 
3 A ASN 156 A ASN 156 ? ASN 'GLYCOSYLATION SITE' 
4 A ASN 175 A ASN 175 ? ASN 'GLYCOSYLATION SITE' 
5 C ASN 103 C ASN 103 ? ASN 'GLYCOSYLATION SITE' 
6 C ASN 118 C ASN 118 ? ASN 'GLYCOSYLATION SITE' 
7 C ASN 156 C ASN 156 ? ASN 'GLYCOSYLATION SITE' 
8 C ASN 175 C ASN 175 ? ASN 'GLYCOSYLATION SITE' 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,I,J,K,O 
2 1 C,D,G,H,L,M,N,P 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2560  ? 
1 MORE         0     ? 
1 'SSA (A^2)'  20070 ? 
2 'ABSA (A^2)' 2680  ? 
2 MORE         1     ? 
2 'SSA (A^2)'  19960 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE2 ? A GLU 34 ? A GLU 34  ? 1_555 MG ? K MG . ? B MG 901 ? 1_555 O   ? O HOH .  ? B HOH 1   ? 1_555 92.2  ? 
2  OE2 ? A GLU 34 ? A GLU 34  ? 1_555 MG ? K MG . ? B MG 901 ? 1_555 O   ? O HOH .  ? B HOH 2   ? 1_555 176.9 ? 
3  O   ? O HOH .  ? B HOH 1   ? 1_555 MG ? K MG . ? B MG 901 ? 1_555 O   ? O HOH .  ? B HOH 2   ? 1_555 90.4  ? 
4  OE2 ? A GLU 34 ? A GLU 34  ? 1_555 MG ? K MG . ? B MG 901 ? 1_555 OG  ? B SER 10 ? B SER 139 ? 1_555 91.8  ? 
5  O   ? O HOH .  ? B HOH 1   ? 1_555 MG ? K MG . ? B MG 901 ? 1_555 OG  ? B SER 10 ? B SER 139 ? 1_555 171.7 ? 
6  O   ? O HOH .  ? B HOH 2   ? 1_555 MG ? K MG . ? B MG 901 ? 1_555 OG  ? B SER 10 ? B SER 139 ? 1_555 85.8  ? 
7  OE2 ? A GLU 34 ? A GLU 34  ? 1_555 MG ? K MG . ? B MG 901 ? 1_555 OG  ? B SER 12 ? B SER 141 ? 1_555 102.2 ? 
8  O   ? O HOH .  ? B HOH 1   ? 1_555 MG ? K MG . ? B MG 901 ? 1_555 OG  ? B SER 12 ? B SER 141 ? 1_555 100.1 ? 
9  O   ? O HOH .  ? B HOH 2   ? 1_555 MG ? K MG . ? B MG 901 ? 1_555 OG  ? B SER 12 ? B SER 141 ? 1_555 75.7  ? 
10 OG  ? B SER 10 ? B SER 139 ? 1_555 MG ? K MG . ? B MG 901 ? 1_555 OG  ? B SER 12 ? B SER 141 ? 1_555 86.1  ? 
11 OE2 ? A GLU 34 ? A GLU 34  ? 1_555 MG ? K MG . ? B MG 901 ? 1_555 OG1 ? B THR 77 ? B THR 206 ? 1_555 84.9  ? 
12 O   ? O HOH .  ? B HOH 1   ? 1_555 MG ? K MG . ? B MG 901 ? 1_555 OG1 ? B THR 77 ? B THR 206 ? 1_555 88.8  ? 
13 O   ? O HOH .  ? B HOH 2   ? 1_555 MG ? K MG . ? B MG 901 ? 1_555 OG1 ? B THR 77 ? B THR 206 ? 1_555 96.7  ? 
14 OG  ? B SER 10 ? B SER 139 ? 1_555 MG ? K MG . ? B MG 901 ? 1_555 OG1 ? B THR 77 ? B THR 206 ? 1_555 84.4  ? 
15 OG  ? B SER 12 ? B SER 141 ? 1_555 MG ? K MG . ? B MG 901 ? 1_555 OG1 ? B THR 77 ? B THR 206 ? 1_555 168.3 ? 
16 OE2 ? C GLU 34 ? C GLU 34  ? 1_555 MG ? N MG . ? D MG 902 ? 1_555 O   ? P HOH .  ? D HOH 3   ? 1_555 91.0  ? 
17 OE2 ? C GLU 34 ? C GLU 34  ? 1_555 MG ? N MG . ? D MG 902 ? 1_555 O   ? P HOH .  ? D HOH 4   ? 1_555 173.8 ? 
18 O   ? P HOH .  ? D HOH 3   ? 1_555 MG ? N MG . ? D MG 902 ? 1_555 O   ? P HOH .  ? D HOH 4   ? 1_555 90.9  ? 
19 OE2 ? C GLU 34 ? C GLU 34  ? 1_555 MG ? N MG . ? D MG 902 ? 1_555 OG  ? D SER 10 ? D SER 139 ? 1_555 91.6  ? 
20 O   ? P HOH .  ? D HOH 3   ? 1_555 MG ? N MG . ? D MG 902 ? 1_555 OG  ? D SER 10 ? D SER 139 ? 1_555 166.4 ? 
21 O   ? P HOH .  ? D HOH 4   ? 1_555 MG ? N MG . ? D MG 902 ? 1_555 OG  ? D SER 10 ? D SER 139 ? 1_555 87.9  ? 
22 OE2 ? C GLU 34 ? C GLU 34  ? 1_555 MG ? N MG . ? D MG 902 ? 1_555 OG  ? D SER 12 ? D SER 141 ? 1_555 101.9 ? 
23 O   ? P HOH .  ? D HOH 3   ? 1_555 MG ? N MG . ? D MG 902 ? 1_555 OG  ? D SER 12 ? D SER 141 ? 1_555 104.8 ? 
24 O   ? P HOH .  ? D HOH 4   ? 1_555 MG ? N MG . ? D MG 902 ? 1_555 OG  ? D SER 12 ? D SER 141 ? 1_555 71.8  ? 
25 OG  ? D SER 10 ? D SER 139 ? 1_555 MG ? N MG . ? D MG 902 ? 1_555 OG  ? D SER 12 ? D SER 141 ? 1_555 87.7  ? 
26 OE2 ? C GLU 34 ? C GLU 34  ? 1_555 MG ? N MG . ? D MG 902 ? 1_555 OG1 ? D THR 77 ? D THR 206 ? 1_555 84.9  ? 
27 O   ? P HOH .  ? D HOH 3   ? 1_555 MG ? N MG . ? D MG 902 ? 1_555 OG1 ? D THR 77 ? D THR 206 ? 1_555 83.5  ? 
28 O   ? P HOH .  ? D HOH 4   ? 1_555 MG ? N MG . ? D MG 902 ? 1_555 OG1 ? D THR 77 ? D THR 206 ? 1_555 101.2 ? 
29 OG  ? D SER 10 ? D SER 139 ? 1_555 MG ? N MG . ? D MG 902 ? 1_555 OG1 ? D THR 77 ? D THR 206 ? 1_555 83.4  ? 
30 OG  ? D SER 12 ? D SER 141 ? 1_555 MG ? N MG . ? D MG 902 ? 1_555 OG1 ? D THR 77 ? D THR 206 ? 1_555 168.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-01-14 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Atomic model'              
5 4 'Structure model' 'Data collection'           
6 4 'Structure model' 'Derived calculations'      
7 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' entity                        
4  4 'Structure model' pdbx_branch_scheme            
5  4 'Structure model' pdbx_chem_comp_identifier     
6  4 'Structure model' pdbx_entity_branch            
7  4 'Structure model' pdbx_entity_branch_descriptor 
8  4 'Structure model' pdbx_entity_branch_link       
9  4 'Structure model' pdbx_entity_branch_list       
10 4 'Structure model' pdbx_entity_nonpoly           
11 4 'Structure model' pdbx_nonpoly_scheme           
12 4 'Structure model' pdbx_struct_assembly_gen      
13 4 'Structure model' pdbx_struct_conn_angle        
14 4 'Structure model' struct_asym                   
15 4 'Structure model' struct_conn                   
16 4 'Structure model' struct_site                   
17 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'                   
2  4 'Structure model' '_atom_site.Cartn_x'                          
3  4 'Structure model' '_atom_site.Cartn_y'                          
4  4 'Structure model' '_atom_site.Cartn_z'                          
5  4 'Structure model' '_atom_site.auth_asym_id'                     
6  4 'Structure model' '_atom_site.auth_atom_id'                     
7  4 'Structure model' '_atom_site.auth_comp_id'                     
8  4 'Structure model' '_atom_site.auth_seq_id'                      
9  4 'Structure model' '_atom_site.label_asym_id'                    
10 4 'Structure model' '_atom_site.label_atom_id'                    
11 4 'Structure model' '_atom_site.label_comp_id'                    
12 4 'Structure model' '_atom_site.label_entity_id'                  
13 4 'Structure model' '_atom_site.type_symbol'                      
14 4 'Structure model' '_chem_comp.name'                             
15 4 'Structure model' '_chem_comp.type'                             
16 4 'Structure model' '_pdbx_entity_nonpoly.entity_id'              
17 4 'Structure model' '_pdbx_entity_nonpoly.name'                   
18 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id'  
20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
23 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
24 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
25 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
26 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
27 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id'  
28 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
29 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
30 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
31 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
32 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
33 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
34 4 'Structure model' '_pdbx_struct_conn_angle.value'               
35 4 'Structure model' '_struct_conn.pdbx_dist_value'                
36 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
37 4 'Structure model' '_struct_conn.pdbx_role'                      
38 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
39 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
40 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
41 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
42 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
43 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
44 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
45 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
46 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
47 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
48 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
49 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
50 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
51 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' .   ? 1 
SCALEPACK 'data scaling'    .   ? 2 
AMoRE     phasing           .   ? 3 
CNS       refinement        1.0 ? 4 
HKL-2000  'data reduction'  .   ? 5 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             C 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ALA 
_pdbx_validate_rmsd_angle.auth_seq_id_1              92 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             C 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              93 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CD 
_pdbx_validate_rmsd_angle.auth_asym_id_3             C 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              93 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                104.60 
_pdbx_validate_rmsd_angle.angle_target_value         120.60 
_pdbx_validate_rmsd_angle.angle_deviation            -16.00 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.20 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 27  ? ? -170.73 90.75   
2  1 LEU A 30  ? ? -171.92 144.43  
3  1 LEU A 42  ? ? -98.64  -142.53 
4  1 LEU A 43  ? ? -48.31  157.71  
5  1 ASN A 47  ? ? -139.93 -47.06  
6  1 TYR A 52  ? ? -126.15 -168.99 
7  1 ASP A 60  ? ? -60.82  91.27   
8  1 SER A 67  ? ? -174.87 123.15  
9  1 PRO A 86  ? ? -46.34  165.40  
10 1 GLU A 90  ? ? -42.70  150.53  
11 1 ASN A 103 ? ? -79.38  47.37   
12 1 GLU A 127 ? ? -62.23  26.86   
13 1 LYS A 131 ? ? -177.35 119.27  
14 1 ARG A 149 ? ? -121.50 -75.61  
15 1 HIS A 153 ? ? -160.79 -11.44  
16 1 LEU A 170 ? ? -76.08  -161.37 
17 1 SER B 141 ? ? -59.94  -4.83   
18 1 PRO B 144 ? ? -46.13  -19.30  
19 1 MET B 158 ? ? -58.10  -75.64  
20 1 CYS B 161 ? ? -113.60 51.36   
21 1 SER B 174 ? ? -148.12 -110.24 
22 1 LYS B 190 ? ? -48.16  99.51   
23 1 ASP B 191 ? ? 172.90  122.42  
24 1 PRO B 192 ? ? -69.06  37.84   
25 1 LEU B 204 ? ? -106.49 -130.74 
26 1 LEU B 205 ? ? -80.74  -155.06 
27 1 ALA B 216 ? ? -67.16  -78.79  
28 1 VAL B 219 ? ? -146.04 -56.09  
29 1 ASP B 239 ? ? -63.87  0.67    
30 1 ALA B 251 ? ? -163.45 32.91   
31 1 TYR B 257 ? ? -163.23 67.29   
32 1 ILE B 261 ? ? -166.31 -19.65  
33 1 LYS B 263 ? ? -140.25 -33.54  
34 1 GLN B 266 ? ? -125.35 -69.83  
35 1 GLU B 272 ? ? -146.30 -23.34  
36 1 SER B 279 ? ? -109.20 -81.52  
37 1 PRO B 281 ? ? -38.64  152.40  
38 1 ALA B 282 ? ? -51.58  92.37   
39 1 SER B 283 ? ? -124.70 -94.41  
40 1 LYS B 287 ? ? -121.67 -161.39 
41 1 LEU B 289 ? ? -51.39  65.99   
42 1 THR B 291 ? ? -156.48 89.89   
43 1 PHE B 292 ? ? -57.36  -6.60   
44 1 LEU B 295 ? ? -179.22 135.97  
45 1 LYS B 296 ? ? -74.07  -158.94 
46 1 LEU B 298 ? ? -77.51  33.65   
47 1 CYS B 299 ? ? -76.99  -85.20  
48 1 THR B 300 ? ? -58.50  -8.90   
49 1 LYS B 305 ? ? -164.36 38.07   
50 1 GLN C 27  ? ? -170.73 91.26   
51 1 LEU C 30  ? ? -171.99 143.66  
52 1 LEU C 42  ? ? -97.70  -141.99 
53 1 LEU C 43  ? ? -49.49  156.87  
54 1 ASN C 47  ? ? -147.82 -46.25  
55 1 TYR C 52  ? ? -124.43 -167.18 
56 1 ASP C 60  ? ? -60.37  90.19   
57 1 SER C 67  ? ? -174.88 123.04  
58 1 PRO C 86  ? ? -41.03  159.43  
59 1 PRO C 93  ? ? -158.50 27.77   
60 1 ASN C 103 ? ? -79.49  47.29   
61 1 GLU C 127 ? ? -62.22  26.44   
62 1 LYS C 131 ? ? -177.14 118.66  
63 1 ARG C 149 ? ? -123.60 -81.59  
64 1 HIS C 153 ? ? -160.77 -11.61  
65 1 LEU C 170 ? ? -75.74  -160.93 
66 1 SER D 141 ? ? -49.98  -7.80   
67 1 PRO D 144 ? ? -46.32  -19.24  
68 1 MET D 158 ? ? -58.04  -75.58  
69 1 CYS D 161 ? ? -113.33 50.97   
70 1 SER D 174 ? ? -148.00 -110.03 
71 1 LYS D 190 ? ? -48.50  99.63   
72 1 ASP D 191 ? ? 172.65  122.21  
73 1 PRO D 192 ? ? -68.55  37.64   
74 1 LEU D 204 ? ? -106.85 -130.35 
75 1 LEU D 205 ? ? -80.84  -155.37 
76 1 ALA D 216 ? ? -67.19  -78.86  
77 1 VAL D 219 ? ? -145.96 -55.51  
78 1 ASP D 239 ? ? -63.68  0.37    
79 1 ALA D 251 ? ? -163.67 33.60   
80 1 TYR D 257 ? ? -163.20 67.44   
81 1 ILE D 261 ? ? -166.38 -19.67  
82 1 LYS D 263 ? ? -140.46 -33.28  
83 1 PHE D 265 ? ? -60.28  68.93   
84 1 GLN D 266 ? ? -119.48 -73.61  
85 1 GLU D 272 ? ? -147.05 -23.44  
86 1 SER D 279 ? ? -110.91 -80.52  
87 1 PRO D 281 ? ? -39.78  148.01  
88 1 ALA D 282 ? ? -49.94  95.06   
89 1 SER D 283 ? ? -127.00 -97.51  
90 1 LYS D 287 ? ? -121.91 -162.97 
91 1 LEU D 289 ? ? -67.82  68.99   
92 1 THR D 291 ? ? -159.48 89.93   
93 1 PHE D 292 ? ? -57.08  -7.50   
94 1 LEU D 295 ? ? 178.13  134.39  
95 1 LYS D 296 ? ? -73.50  -160.57 
96 1 LEU D 298 ? ? -75.62  35.75   
97 1 CYS D 299 ? ? -78.63  -86.64  
98 1 THR D 300 ? ? -58.29  -3.81   
99 1 LYS D 305 ? ? -168.30 35.88   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A PHE 185 ? A PHE 185 
2   1 Y 1 A VAL 186 ? A VAL 186 
3   1 Y 1 A LEU 187 ? A LEU 187 
4   1 Y 1 A PRO 188 ? A PRO 188 
5   1 Y 1 A ALA 189 ? A ALA 189 
6   1 Y 1 A THR 190 ? A THR 190 
7   1 Y 1 A PRO 191 ? A PRO 191 
8   1 Y 1 A PRO 192 ? A PRO 192 
9   1 Y 1 A GLN 193 ? A GLN 193 
10  1 Y 1 A LEU 194 ? A LEU 194 
11  1 Y 1 A VAL 195 ? A VAL 195 
12  1 Y 1 A SER 196 ? A SER 196 
13  1 Y 1 A PRO 197 ? A PRO 197 
14  1 Y 1 A ARG 198 ? A ARG 198 
15  1 Y 1 A VAL 199 ? A VAL 199 
16  1 Y 1 A LEU 200 ? A LEU 200 
17  1 Y 1 A GLU 201 ? A GLU 201 
18  1 Y 1 A VAL 202 ? A VAL 202 
19  1 Y 1 A ASP 203 ? A ASP 203 
20  1 Y 1 A THR 204 ? A THR 204 
21  1 Y 1 A GLN 205 ? A GLN 205 
22  1 Y 1 A GLY 206 ? A GLY 206 
23  1 Y 1 A THR 207 ? A THR 207 
24  1 Y 1 A VAL 208 ? A VAL 208 
25  1 Y 1 A VAL 209 ? A VAL 209 
26  1 Y 1 A CYS 210 ? A CYS 210 
27  1 Y 1 A SER 211 ? A SER 211 
28  1 Y 1 A LEU 212 ? A LEU 212 
29  1 Y 1 A ASP 213 ? A ASP 213 
30  1 Y 1 A GLY 214 ? A GLY 214 
31  1 Y 1 A LEU 215 ? A LEU 215 
32  1 Y 1 A PHE 216 ? A PHE 216 
33  1 Y 1 A PRO 217 ? A PRO 217 
34  1 Y 1 A VAL 218 ? A VAL 218 
35  1 Y 1 A SER 219 ? A SER 219 
36  1 Y 1 A GLU 220 ? A GLU 220 
37  1 Y 1 A ALA 221 ? A ALA 221 
38  1 Y 1 A GLN 222 ? A GLN 222 
39  1 Y 1 A VAL 223 ? A VAL 223 
40  1 Y 1 A HIS 224 ? A HIS 224 
41  1 Y 1 A LEU 225 ? A LEU 225 
42  1 Y 1 A ALA 226 ? A ALA 226 
43  1 Y 1 A LEU 227 ? A LEU 227 
44  1 Y 1 A GLY 228 ? A GLY 228 
45  1 Y 1 A ASP 229 ? A ASP 229 
46  1 Y 1 A GLN 230 ? A GLN 230 
47  1 Y 1 A ARG 231 ? A ARG 231 
48  1 Y 1 A LEU 232 ? A LEU 232 
49  1 Y 1 A ASN 233 ? A ASN 233 
50  1 Y 1 A PRO 234 ? A PRO 234 
51  1 Y 1 A THR 235 ? A THR 235 
52  1 Y 1 A VAL 236 ? A VAL 236 
53  1 Y 1 A THR 237 ? A THR 237 
54  1 Y 1 A TYR 238 ? A TYR 238 
55  1 Y 1 A GLY 239 ? A GLY 239 
56  1 Y 1 A ASN 240 ? A ASN 240 
57  1 Y 1 A ASP 241 ? A ASP 241 
58  1 Y 1 A SER 242 ? A SER 242 
59  1 Y 1 A PHE 243 ? A PHE 243 
60  1 Y 1 A SER 244 ? A SER 244 
61  1 Y 1 A ALA 245 ? A ALA 245 
62  1 Y 1 A LYS 246 ? A LYS 246 
63  1 Y 1 A ALA 247 ? A ALA 247 
64  1 Y 1 A SER 248 ? A SER 248 
65  1 Y 1 A VAL 249 ? A VAL 249 
66  1 Y 1 A SER 250 ? A SER 250 
67  1 Y 1 A VAL 251 ? A VAL 251 
68  1 Y 1 A THR 252 ? A THR 252 
69  1 Y 1 A ALA 253 ? A ALA 253 
70  1 Y 1 A GLU 254 ? A GLU 254 
71  1 Y 1 A ASP 255 ? A ASP 255 
72  1 Y 1 A GLU 256 ? A GLU 256 
73  1 Y 1 A GLY 257 ? A GLY 257 
74  1 Y 1 A THR 258 ? A THR 258 
75  1 Y 1 A GLN 259 ? A GLN 259 
76  1 Y 1 A ARG 260 ? A ARG 260 
77  1 Y 1 A LEU 261 ? A LEU 261 
78  1 Y 1 A THR 262 ? A THR 262 
79  1 Y 1 A CYS 263 ? A CYS 263 
80  1 Y 1 A ALA 264 ? A ALA 264 
81  1 Y 1 A VAL 265 ? A VAL 265 
82  1 Y 1 A ILE 266 ? A ILE 266 
83  1 Y 1 A LEU 267 ? A LEU 267 
84  1 Y 1 A GLY 268 ? A GLY 268 
85  1 Y 1 A ASN 269 ? A ASN 269 
86  1 Y 1 A GLN 270 ? A GLN 270 
87  1 Y 1 A SER 271 ? A SER 271 
88  1 Y 1 A GLN 272 ? A GLN 272 
89  1 Y 1 A GLU 273 ? A GLU 273 
90  1 Y 1 A THR 274 ? A THR 274 
91  1 Y 1 A LEU 275 ? A LEU 275 
92  1 Y 1 A GLN 276 ? A GLN 276 
93  1 Y 1 A THR 277 ? A THR 277 
94  1 Y 1 A VAL 278 ? A VAL 278 
95  1 Y 1 A THR 279 ? A THR 279 
96  1 Y 1 A ILE 280 ? A ILE 280 
97  1 Y 1 A TYR 281 ? A TYR 281 
98  1 Y 1 A SER 282 ? A SER 282 
99  1 Y 1 A PHE 283 ? A PHE 283 
100 1 Y 1 A PRO 284 ? A PRO 284 
101 1 Y 1 A ALA 285 ? A ALA 285 
102 1 Y 1 A PRO 286 ? A PRO 286 
103 1 Y 1 A ASN 287 ? A ASN 287 
104 1 Y 1 A VAL 288 ? A VAL 288 
105 1 Y 1 A ILE 289 ? A ILE 289 
106 1 Y 1 A LEU 290 ? A LEU 290 
107 1 Y 1 A THR 291 ? A THR 291 
108 1 Y 1 C PHE 185 ? C PHE 185 
109 1 Y 1 C VAL 186 ? C VAL 186 
110 1 Y 1 C LEU 187 ? C LEU 187 
111 1 Y 1 C PRO 188 ? C PRO 188 
112 1 Y 1 C ALA 189 ? C ALA 189 
113 1 Y 1 C THR 190 ? C THR 190 
114 1 Y 1 C PRO 191 ? C PRO 191 
115 1 Y 1 C PRO 192 ? C PRO 192 
116 1 Y 1 C GLN 193 ? C GLN 193 
117 1 Y 1 C LEU 194 ? C LEU 194 
118 1 Y 1 C VAL 195 ? C VAL 195 
119 1 Y 1 C SER 196 ? C SER 196 
120 1 Y 1 C PRO 197 ? C PRO 197 
121 1 Y 1 C ARG 198 ? C ARG 198 
122 1 Y 1 C VAL 199 ? C VAL 199 
123 1 Y 1 C LEU 200 ? C LEU 200 
124 1 Y 1 C GLU 201 ? C GLU 201 
125 1 Y 1 C VAL 202 ? C VAL 202 
126 1 Y 1 C ASP 203 ? C ASP 203 
127 1 Y 1 C THR 204 ? C THR 204 
128 1 Y 1 C GLN 205 ? C GLN 205 
129 1 Y 1 C GLY 206 ? C GLY 206 
130 1 Y 1 C THR 207 ? C THR 207 
131 1 Y 1 C VAL 208 ? C VAL 208 
132 1 Y 1 C VAL 209 ? C VAL 209 
133 1 Y 1 C CYS 210 ? C CYS 210 
134 1 Y 1 C SER 211 ? C SER 211 
135 1 Y 1 C LEU 212 ? C LEU 212 
136 1 Y 1 C ASP 213 ? C ASP 213 
137 1 Y 1 C GLY 214 ? C GLY 214 
138 1 Y 1 C LEU 215 ? C LEU 215 
139 1 Y 1 C PHE 216 ? C PHE 216 
140 1 Y 1 C PRO 217 ? C PRO 217 
141 1 Y 1 C VAL 218 ? C VAL 218 
142 1 Y 1 C SER 219 ? C SER 219 
143 1 Y 1 C GLU 220 ? C GLU 220 
144 1 Y 1 C ALA 221 ? C ALA 221 
145 1 Y 1 C GLN 222 ? C GLN 222 
146 1 Y 1 C VAL 223 ? C VAL 223 
147 1 Y 1 C HIS 224 ? C HIS 224 
148 1 Y 1 C LEU 225 ? C LEU 225 
149 1 Y 1 C ALA 226 ? C ALA 226 
150 1 Y 1 C LEU 227 ? C LEU 227 
151 1 Y 1 C GLY 228 ? C GLY 228 
152 1 Y 1 C ASP 229 ? C ASP 229 
153 1 Y 1 C GLN 230 ? C GLN 230 
154 1 Y 1 C ARG 231 ? C ARG 231 
155 1 Y 1 C LEU 232 ? C LEU 232 
156 1 Y 1 C ASN 233 ? C ASN 233 
157 1 Y 1 C PRO 234 ? C PRO 234 
158 1 Y 1 C THR 235 ? C THR 235 
159 1 Y 1 C VAL 236 ? C VAL 236 
160 1 Y 1 C THR 237 ? C THR 237 
161 1 Y 1 C TYR 238 ? C TYR 238 
162 1 Y 1 C GLY 239 ? C GLY 239 
163 1 Y 1 C ASN 240 ? C ASN 240 
164 1 Y 1 C ASP 241 ? C ASP 241 
165 1 Y 1 C SER 242 ? C SER 242 
166 1 Y 1 C PHE 243 ? C PHE 243 
167 1 Y 1 C SER 244 ? C SER 244 
168 1 Y 1 C ALA 245 ? C ALA 245 
169 1 Y 1 C LYS 246 ? C LYS 246 
170 1 Y 1 C ALA 247 ? C ALA 247 
171 1 Y 1 C SER 248 ? C SER 248 
172 1 Y 1 C VAL 249 ? C VAL 249 
173 1 Y 1 C SER 250 ? C SER 250 
174 1 Y 1 C VAL 251 ? C VAL 251 
175 1 Y 1 C THR 252 ? C THR 252 
176 1 Y 1 C ALA 253 ? C ALA 253 
177 1 Y 1 C GLU 254 ? C GLU 254 
178 1 Y 1 C ASP 255 ? C ASP 255 
179 1 Y 1 C GLU 256 ? C GLU 256 
180 1 Y 1 C GLY 257 ? C GLY 257 
181 1 Y 1 C THR 258 ? C THR 258 
182 1 Y 1 C GLN 259 ? C GLN 259 
183 1 Y 1 C ARG 260 ? C ARG 260 
184 1 Y 1 C LEU 261 ? C LEU 261 
185 1 Y 1 C THR 262 ? C THR 262 
186 1 Y 1 C CYS 263 ? C CYS 263 
187 1 Y 1 C ALA 264 ? C ALA 264 
188 1 Y 1 C VAL 265 ? C VAL 265 
189 1 Y 1 C ILE 266 ? C ILE 266 
190 1 Y 1 C LEU 267 ? C LEU 267 
191 1 Y 1 C GLY 268 ? C GLY 268 
192 1 Y 1 C ASN 269 ? C ASN 269 
193 1 Y 1 C GLN 270 ? C GLN 270 
194 1 Y 1 C SER 271 ? C SER 271 
195 1 Y 1 C GLN 272 ? C GLN 272 
196 1 Y 1 C GLU 273 ? C GLU 273 
197 1 Y 1 C THR 274 ? C THR 274 
198 1 Y 1 C LEU 275 ? C LEU 275 
199 1 Y 1 C GLN 276 ? C GLN 276 
200 1 Y 1 C THR 277 ? C THR 277 
201 1 Y 1 C VAL 278 ? C VAL 278 
202 1 Y 1 C THR 279 ? C THR 279 
203 1 Y 1 C ILE 280 ? C ILE 280 
204 1 Y 1 C TYR 281 ? C TYR 281 
205 1 Y 1 C SER 282 ? C SER 282 
206 1 Y 1 C PHE 283 ? C PHE 283 
207 1 Y 1 C PRO 284 ? C PRO 284 
208 1 Y 1 C ALA 285 ? C ALA 285 
209 1 Y 1 C PRO 286 ? C PRO 286 
210 1 Y 1 C ASN 287 ? C ASN 287 
211 1 Y 1 C VAL 288 ? C VAL 288 
212 1 Y 1 C ILE 289 ? C ILE 289 
213 1 Y 1 C LEU 290 ? C LEU 290 
214 1 Y 1 C THR 291 ? C THR 291 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
E 3 NAG 1 E NAG 1 S NAG 402 n 
E 3 NAG 2 E NAG 2 S NAG 403 n 
F 3 NAG 1 F NAG 1 S NAG 405 n 
F 3 NAG 2 F NAG 2 S NAG 406 n 
G 3 NAG 1 G NAG 1 T NAG 408 n 
G 3 NAG 2 G NAG 2 T NAG 409 n 
H 3 NAG 1 H NAG 1 T NAG 411 n 
H 3 NAG 2 H NAG 2 T NAG 412 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   3 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 3 DGlcpNAcb1-4DGlcpNAcb1-                               'Glycam Condensed Sequence' GMML       1.0   
2 3 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS                       PDB2Glycan 1.1.0 
3 3 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}'    LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  3 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  NAG 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  NAG 
_pdbx_entity_branch_link.atom_id_2                  O4 
_pdbx_entity_branch_link.leaving_atom_id_2          HO4 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
3 NAG 1 n 
3 NAG 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
5 'MAGNESIUM ION'                          MG  
6 water                                    HOH 
#