data_1NH1
# 
_entry.id   1NH1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1NH1         
RCSB  RCSB017862   
WWPDB D_1000017862 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1NH1 
_pdbx_database_status.recvd_initial_deposition_date   2002-12-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lee, C.C.'     1 
'Wood, M.D.'    2 
'Ng, K.'        3 
'Luginbuhl, P.' 4 
'Spraggon, G.'  5 
'Katagiri, F.'  6 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of the Type III Effector AvrB from Pseudomonas syringae.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            12 
_citation.page_first                487 
_citation.page_last                 494 
_citation.year                      2004 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15016364 
_citation.pdbx_database_id_DOI      10.1016/j.str.2004.02.013 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lee, C.C.'     1 
primary 'Wood, M.D.'    2 
primary 'Ng, K.'        3 
primary 'Luginbuhl, P.' 4 
primary 'Spraggon, G.'  5 
primary 'Katagiri, F.'  6 
# 
_cell.entry_id           1NH1 
_cell.length_a           125.028 
_cell.length_b           125.028 
_cell.length_c           63.246 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1NH1 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                170 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Avirulence B protein' 37097.211 1   ? ? ? ? 
2 water   nat water                  18.015    151 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGCVSSKSTTVLSPQTSFNEASRTSFRALPGPSQRQLEVYDQCLIGAARWPDDSSKSNTPENRAYCQSMYNSIRSAGDEI
SRGGITSFEELWGRATEWRLSKLQRGEPLYSAFASERTSDTDAVTPLVKPYKSVLARVVDHEDAHDEIMQDNLFGDLNVK
VYRQTAYLHGNVIPLNTFRVATDTEYLRDRVAHLRTELGAKALKQHLQRYNPDRIDHTNASYLPIIKDHLNDLYRQAISS
DLSQAELISLIARTHWWAASAMPDQRGSAAKAEFAARAIASAHGIELPPFRNGNVSDIEAMLSGEEEFVEKYRSLLDSDC
FGTGHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGCVSSKSTTVLSPQTSFNEASRTSFRALPGPSQRQLEVYDQCLIGAARWPDDSSKSNTPENRAYCQSMYNSIRSAGDEI
SRGGITSFEELWGRATEWRLSKLQRGEPLYSAFASERTSDTDAVTPLVKPYKSVLARVVDHEDAHDEIMQDNLFGDLNVK
VYRQTAYLHGNVIPLNTFRVATDTEYLRDRVAHLRTELGAKALKQHLQRYNPDRIDHTNASYLPIIKDHLNDLYRQAISS
DLSQAELISLIARTHWWAASAMPDQRGSAAKAEFAARAIASAHGIELPPFRNGNVSDIEAMLSGEEEFVEKYRSLLDSDC
FGTGHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   CYS n 
1 4   VAL n 
1 5   SER n 
1 6   SER n 
1 7   LYS n 
1 8   SER n 
1 9   THR n 
1 10  THR n 
1 11  VAL n 
1 12  LEU n 
1 13  SER n 
1 14  PRO n 
1 15  GLN n 
1 16  THR n 
1 17  SER n 
1 18  PHE n 
1 19  ASN n 
1 20  GLU n 
1 21  ALA n 
1 22  SER n 
1 23  ARG n 
1 24  THR n 
1 25  SER n 
1 26  PHE n 
1 27  ARG n 
1 28  ALA n 
1 29  LEU n 
1 30  PRO n 
1 31  GLY n 
1 32  PRO n 
1 33  SER n 
1 34  GLN n 
1 35  ARG n 
1 36  GLN n 
1 37  LEU n 
1 38  GLU n 
1 39  VAL n 
1 40  TYR n 
1 41  ASP n 
1 42  GLN n 
1 43  CYS n 
1 44  LEU n 
1 45  ILE n 
1 46  GLY n 
1 47  ALA n 
1 48  ALA n 
1 49  ARG n 
1 50  TRP n 
1 51  PRO n 
1 52  ASP n 
1 53  ASP n 
1 54  SER n 
1 55  SER n 
1 56  LYS n 
1 57  SER n 
1 58  ASN n 
1 59  THR n 
1 60  PRO n 
1 61  GLU n 
1 62  ASN n 
1 63  ARG n 
1 64  ALA n 
1 65  TYR n 
1 66  CYS n 
1 67  GLN n 
1 68  SER n 
1 69  MET n 
1 70  TYR n 
1 71  ASN n 
1 72  SER n 
1 73  ILE n 
1 74  ARG n 
1 75  SER n 
1 76  ALA n 
1 77  GLY n 
1 78  ASP n 
1 79  GLU n 
1 80  ILE n 
1 81  SER n 
1 82  ARG n 
1 83  GLY n 
1 84  GLY n 
1 85  ILE n 
1 86  THR n 
1 87  SER n 
1 88  PHE n 
1 89  GLU n 
1 90  GLU n 
1 91  LEU n 
1 92  TRP n 
1 93  GLY n 
1 94  ARG n 
1 95  ALA n 
1 96  THR n 
1 97  GLU n 
1 98  TRP n 
1 99  ARG n 
1 100 LEU n 
1 101 SER n 
1 102 LYS n 
1 103 LEU n 
1 104 GLN n 
1 105 ARG n 
1 106 GLY n 
1 107 GLU n 
1 108 PRO n 
1 109 LEU n 
1 110 TYR n 
1 111 SER n 
1 112 ALA n 
1 113 PHE n 
1 114 ALA n 
1 115 SER n 
1 116 GLU n 
1 117 ARG n 
1 118 THR n 
1 119 SER n 
1 120 ASP n 
1 121 THR n 
1 122 ASP n 
1 123 ALA n 
1 124 VAL n 
1 125 THR n 
1 126 PRO n 
1 127 LEU n 
1 128 VAL n 
1 129 LYS n 
1 130 PRO n 
1 131 TYR n 
1 132 LYS n 
1 133 SER n 
1 134 VAL n 
1 135 LEU n 
1 136 ALA n 
1 137 ARG n 
1 138 VAL n 
1 139 VAL n 
1 140 ASP n 
1 141 HIS n 
1 142 GLU n 
1 143 ASP n 
1 144 ALA n 
1 145 HIS n 
1 146 ASP n 
1 147 GLU n 
1 148 ILE n 
1 149 MET n 
1 150 GLN n 
1 151 ASP n 
1 152 ASN n 
1 153 LEU n 
1 154 PHE n 
1 155 GLY n 
1 156 ASP n 
1 157 LEU n 
1 158 ASN n 
1 159 VAL n 
1 160 LYS n 
1 161 VAL n 
1 162 TYR n 
1 163 ARG n 
1 164 GLN n 
1 165 THR n 
1 166 ALA n 
1 167 TYR n 
1 168 LEU n 
1 169 HIS n 
1 170 GLY n 
1 171 ASN n 
1 172 VAL n 
1 173 ILE n 
1 174 PRO n 
1 175 LEU n 
1 176 ASN n 
1 177 THR n 
1 178 PHE n 
1 179 ARG n 
1 180 VAL n 
1 181 ALA n 
1 182 THR n 
1 183 ASP n 
1 184 THR n 
1 185 GLU n 
1 186 TYR n 
1 187 LEU n 
1 188 ARG n 
1 189 ASP n 
1 190 ARG n 
1 191 VAL n 
1 192 ALA n 
1 193 HIS n 
1 194 LEU n 
1 195 ARG n 
1 196 THR n 
1 197 GLU n 
1 198 LEU n 
1 199 GLY n 
1 200 ALA n 
1 201 LYS n 
1 202 ALA n 
1 203 LEU n 
1 204 LYS n 
1 205 GLN n 
1 206 HIS n 
1 207 LEU n 
1 208 GLN n 
1 209 ARG n 
1 210 TYR n 
1 211 ASN n 
1 212 PRO n 
1 213 ASP n 
1 214 ARG n 
1 215 ILE n 
1 216 ASP n 
1 217 HIS n 
1 218 THR n 
1 219 ASN n 
1 220 ALA n 
1 221 SER n 
1 222 TYR n 
1 223 LEU n 
1 224 PRO n 
1 225 ILE n 
1 226 ILE n 
1 227 LYS n 
1 228 ASP n 
1 229 HIS n 
1 230 LEU n 
1 231 ASN n 
1 232 ASP n 
1 233 LEU n 
1 234 TYR n 
1 235 ARG n 
1 236 GLN n 
1 237 ALA n 
1 238 ILE n 
1 239 SER n 
1 240 SER n 
1 241 ASP n 
1 242 LEU n 
1 243 SER n 
1 244 GLN n 
1 245 ALA n 
1 246 GLU n 
1 247 LEU n 
1 248 ILE n 
1 249 SER n 
1 250 LEU n 
1 251 ILE n 
1 252 ALA n 
1 253 ARG n 
1 254 THR n 
1 255 HIS n 
1 256 TRP n 
1 257 TRP n 
1 258 ALA n 
1 259 ALA n 
1 260 SER n 
1 261 ALA n 
1 262 MET n 
1 263 PRO n 
1 264 ASP n 
1 265 GLN n 
1 266 ARG n 
1 267 GLY n 
1 268 SER n 
1 269 ALA n 
1 270 ALA n 
1 271 LYS n 
1 272 ALA n 
1 273 GLU n 
1 274 PHE n 
1 275 ALA n 
1 276 ALA n 
1 277 ARG n 
1 278 ALA n 
1 279 ILE n 
1 280 ALA n 
1 281 SER n 
1 282 ALA n 
1 283 HIS n 
1 284 GLY n 
1 285 ILE n 
1 286 GLU n 
1 287 LEU n 
1 288 PRO n 
1 289 PRO n 
1 290 PHE n 
1 291 ARG n 
1 292 ASN n 
1 293 GLY n 
1 294 ASN n 
1 295 VAL n 
1 296 SER n 
1 297 ASP n 
1 298 ILE n 
1 299 GLU n 
1 300 ALA n 
1 301 MET n 
1 302 LEU n 
1 303 SER n 
1 304 GLY n 
1 305 GLU n 
1 306 GLU n 
1 307 GLU n 
1 308 PHE n 
1 309 VAL n 
1 310 GLU n 
1 311 LYS n 
1 312 TYR n 
1 313 ARG n 
1 314 SER n 
1 315 LEU n 
1 316 LEU n 
1 317 ASP n 
1 318 SER n 
1 319 ASP n 
1 320 CYS n 
1 321 PHE n 
1 322 GLY n 
1 323 THR n 
1 324 GLY n 
1 325 HIS n 
1 326 HIS n 
1 327 HIS n 
1 328 HIS n 
1 329 HIS n 
1 330 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Pseudomonas 
_entity_src_gen.pdbx_gene_src_gene                 AVRB 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pseudomonas syringae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     317 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'BL21 (DE3) pLysS' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               plasmid 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET-27b(+)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AVRB_PSESG 
_struct_ref.pdbx_db_accession          P13835 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MGCVSSKSTTVLSPQTSFNEASRTSFRALPGPSQRQLEVYDQCLIGAARWPDDSSKSNTPENRAYCQSMYNSIRSAGDEI
SRGGITSFEELWGRATEWRLSKLQRGEPLYSAFASERTSDTDAVTPLVKPYKSVLARVVDHEDAHDEIMQDNLFGDLNVK
VYRQTAYLHGNVIPLNTFRVATDTEYLRDRVAHLRTELGAKALKQHLQRYNPDRIDHTNASYLPIIKDHLNDLYRQAISS
DLSQAELISLIARTHWWAASAMPDQRGSAAKAEFAARAIASAHGIELPPFRNGNVSDIEAMLSGEEEFVEKYRSLLDSDC
F
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1NH1 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 321 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P13835 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  321 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       321 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1NH1 GLY A 322 ? UNP P13835 ? ? 'CLONING ARTIFACT' 322 1 
1 1NH1 THR A 323 ? UNP P13835 ? ? 'CLONING ARTIFACT' 323 2 
1 1NH1 GLY A 324 ? UNP P13835 ? ? 'CLONING ARTIFACT' 324 3 
1 1NH1 HIS A 325 ? UNP P13835 ? ? 'EXPRESSION TAG'   325 4 
1 1NH1 HIS A 326 ? UNP P13835 ? ? 'EXPRESSION TAG'   326 5 
1 1NH1 HIS A 327 ? UNP P13835 ? ? 'EXPRESSION TAG'   327 6 
1 1NH1 HIS A 328 ? UNP P13835 ? ? 'EXPRESSION TAG'   328 7 
1 1NH1 HIS A 329 ? UNP P13835 ? ? 'EXPRESSION TAG'   329 8 
1 1NH1 HIS A 330 ? UNP P13835 ? ? 'EXPRESSION TAG'   330 9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1NH1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.85 
_exptl_crystal.density_percent_sol   68.01 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 200.0 ? 1 
2 ?     ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 'IMAGE PLATE' RIGAKU      ? ? 
2 'IMAGE PLATE' MARRESEARCH ? ? 
# 
_diffrn_radiation.diffrn_id                        2 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 'ROTATING ANODE' RIGAKU               ?   ?     ? ? 
2 SYNCHROTRON      'ALS BEAMLINE 5.0.2' ALS 5.0.2 ? ? 
# 
_reflns.entry_id                     1NH1 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.2 
_reflns.d_resolution_low             50.0 
_reflns.number_all                   29594 
_reflns.number_obs                   27892 
_reflns.percent_possible_obs         94.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               2 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1NH1 
_refine.ls_d_res_high                            2.2 
_refine.ls_d_res_low                             50.0 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     29594 
_refine.ls_number_reflns_obs                     27892 
_refine.ls_number_reflns_R_free                  1419 
_refine.ls_percent_reflns_obs                    94.2 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.222 
_refine.ls_R_factor_R_free                       0.2751 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           2 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2249 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             151 
_refine_hist.number_atoms_total               2400 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        50.0 
# 
_struct.entry_id                  1NH1 
_struct.title                     'Crystal Structure of the Type III Effector AvrB from Pseudomonas syringae.' 
_struct.pdbx_descriptor           'Avirulence B protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1NH1 
_struct_keywords.pdbx_keywords   'Avirulence Protein' 
_struct_keywords.text            'HELIX BUNDLE, Avirulence Protein' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 38  ? CYS A 43  ? GLU A 38  CYS A 43  1 ? 6  
HELX_P HELX_P2  2  THR A 59  ? ARG A 82  ? THR A 59  ARG A 82  1 ? 24 
HELX_P HELX_P3  3  SER A 87  ? LYS A 102 ? SER A 87  LYS A 102 1 ? 16 
HELX_P HELX_P4  4  LEU A 109 ? ALA A 114 ? LEU A 109 ALA A 114 1 ? 6  
HELX_P HELX_P5  5  LYS A 132 ? ASP A 140 ? LYS A 132 ASP A 140 1 ? 9  
HELX_P HELX_P6  6  ASP A 183 ? GLY A 199 ? ASP A 183 GLY A 199 1 ? 17 
HELX_P HELX_P7  7  GLY A 199 ? ASN A 211 ? GLY A 199 ASN A 211 1 ? 13 
HELX_P HELX_P8  8  ASN A 219 ? SER A 221 ? ASN A 219 SER A 221 5 ? 3  
HELX_P HELX_P9  9  TYR A 222 ? ILE A 238 ? TYR A 222 ILE A 238 1 ? 17 
HELX_P HELX_P10 10 SER A 243 ? MET A 262 ? SER A 243 MET A 262 1 ? 20 
HELX_P HELX_P11 11 GLY A 267 ? HIS A 283 ? GLY A 267 HIS A 283 1 ? 17 
HELX_P HELX_P12 12 VAL A 295 ? LEU A 302 ? VAL A 295 LEU A 302 1 ? 8  
HELX_P HELX_P13 13 GLY A 304 ? TYR A 312 ? GLY A 304 TYR A 312 1 ? 9  
HELX_P HELX_P14 14 ARG A 313 ? LEU A 316 ? ARG A 313 LEU A 316 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           129 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            129 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    130 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     130 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.15 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 124 ? PRO A 126 ? VAL A 124 PRO A 126 
A 2 ARG A 214 ? ASP A 216 ? ARG A 214 ASP A 216 
A 3 ASN A 171 ? ALA A 181 ? ASN A 171 ALA A 181 
A 4 LEU A 157 ? LEU A 168 ? LEU A 157 LEU A 168 
A 5 HIS A 145 ? MET A 149 ? HIS A 145 MET A 149 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 125 ? N THR A 125 O ILE A 215 ? O ILE A 215 
A 2 3 O ASP A 216 ? O ASP A 216 N THR A 177 ? N THR A 177 
A 3 4 O PHE A 178 ? O PHE A 178 N TYR A 162 ? N TYR A 162 
A 4 5 O LEU A 157 ? O LEU A 157 N MET A 149 ? N MET A 149 
# 
_database_PDB_matrix.entry_id          1NH1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1NH1 
_atom_sites.fract_transf_matrix[1][1]   0.007998 
_atom_sites.fract_transf_matrix[1][2]   0.004618 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009236 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015811 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 28  ? 12.702 48.525 66.999 1.00 90.82  ? 28  ALA A N   1 
ATOM   2    C CA  . ALA A 1 28  ? 12.952 47.967 68.357 1.00 86.38  ? 28  ALA A CA  1 
ATOM   3    C C   . ALA A 1 28  ? 13.654 46.608 68.305 1.00 84.25  ? 28  ALA A C   1 
ATOM   4    O O   . ALA A 1 28  ? 13.216 45.658 67.639 1.00 82.06  ? 28  ALA A O   1 
ATOM   5    C CB  . ALA A 1 28  ? 11.630 47.853 69.151 1.00 83.17  ? 28  ALA A CB  1 
ATOM   6    N N   . LEU A 1 29  ? 14.763 46.535 69.021 1.00 73.52  ? 29  LEU A N   1 
ATOM   7    C CA  . LEU A 1 29  ? 15.529 45.319 69.091 1.00 66.38  ? 29  LEU A CA  1 
ATOM   8    C C   . LEU A 1 29  ? 15.430 44.888 70.542 1.00 63.17  ? 29  LEU A C   1 
ATOM   9    O O   . LEU A 1 29  ? 15.136 45.703 71.415 1.00 63.06  ? 29  LEU A O   1 
ATOM   10   C CB  . LEU A 1 29  ? 16.988 45.599 68.718 1.00 68.24  ? 29  LEU A CB  1 
ATOM   11   C CG  . LEU A 1 29  ? 17.300 46.074 67.299 1.00 53.66  ? 29  LEU A CG  1 
ATOM   12   C CD1 . LEU A 1 29  ? 18.736 46.553 67.236 1.00 49.15  ? 29  LEU A CD1 1 
ATOM   13   C CD2 . LEU A 1 29  ? 17.067 44.935 66.316 1.00 59.51  ? 29  LEU A CD2 1 
ATOM   14   N N   . PRO A 1 30  ? 15.682 43.600 70.816 1.00 61.35  ? 30  PRO A N   1 
ATOM   15   C CA  . PRO A 1 30  ? 15.640 42.992 72.148 1.00 56.02  ? 30  PRO A CA  1 
ATOM   16   C C   . PRO A 1 30  ? 16.357 43.793 73.229 1.00 58.03  ? 30  PRO A C   1 
ATOM   17   O O   . PRO A 1 30  ? 15.857 43.933 74.348 1.00 56.17  ? 30  PRO A O   1 
ATOM   18   C CB  . PRO A 1 30  ? 16.315 41.643 71.931 1.00 64.61  ? 30  PRO A CB  1 
ATOM   19   C CG  . PRO A 1 30  ? 15.955 41.304 70.517 1.00 66.83  ? 30  PRO A CG  1 
ATOM   20   C CD  . PRO A 1 30  ? 16.125 42.624 69.802 1.00 62.58  ? 30  PRO A CD  1 
ATOM   21   N N   . GLY A 1 31  ? 17.538 44.308 72.907 1.00 54.42  ? 31  GLY A N   1 
ATOM   22   C CA  . GLY A 1 31  ? 18.290 45.050 73.902 1.00 50.71  ? 31  GLY A CA  1 
ATOM   23   C C   . GLY A 1 31  ? 19.076 44.041 74.710 1.00 53.70  ? 31  GLY A C   1 
ATOM   24   O O   . GLY A 1 31  ? 18.894 42.840 74.519 1.00 52.27  ? 31  GLY A O   1 
ATOM   25   N N   . PRO A 1 32  ? 19.952 44.479 75.626 1.00 58.82  ? 32  PRO A N   1 
ATOM   26   C CA  . PRO A 1 32  ? 20.759 43.569 76.447 1.00 57.69  ? 32  PRO A CA  1 
ATOM   27   C C   . PRO A 1 32  ? 19.958 42.419 77.024 1.00 64.90  ? 32  PRO A C   1 
ATOM   28   O O   . PRO A 1 32  ? 18.802 42.590 77.404 1.00 67.28  ? 32  PRO A O   1 
ATOM   29   C CB  . PRO A 1 32  ? 21.305 44.487 77.522 1.00 58.91  ? 32  PRO A CB  1 
ATOM   30   C CG  . PRO A 1 32  ? 21.528 45.748 76.763 1.00 55.63  ? 32  PRO A CG  1 
ATOM   31   C CD  . PRO A 1 32  ? 20.225 45.877 75.989 1.00 62.13  ? 32  PRO A CD  1 
ATOM   32   N N   . SER A 1 33  ? 20.564 41.242 77.082 1.00 64.53  ? 33  SER A N   1 
ATOM   33   C CA  . SER A 1 33  ? 19.869 40.075 77.621 1.00 70.11  ? 33  SER A CA  1 
ATOM   34   C C   . SER A 1 33  ? 19.765 40.145 79.145 1.00 70.81  ? 33  SER A C   1 
ATOM   35   O O   . SER A 1 33  ? 20.576 40.796 79.798 1.00 69.06  ? 33  SER A O   1 
ATOM   36   C CB  . SER A 1 33  ? 20.609 38.800 77.221 1.00 64.21  ? 33  SER A CB  1 
ATOM   37   O OG  . SER A 1 33  ? 21.959 38.872 77.632 1.00 64.28  ? 33  SER A OG  1 
ATOM   38   N N   . GLN A 1 34  ? 18.760 39.482 79.710 1.00 71.00  ? 34  GLN A N   1 
ATOM   39   C CA  . GLN A 1 34  ? 18.591 39.464 81.160 1.00 72.59  ? 34  GLN A CA  1 
ATOM   40   C C   . GLN A 1 34  ? 19.739 38.657 81.753 1.00 69.96  ? 34  GLN A C   1 
ATOM   41   O O   . GLN A 1 34  ? 20.324 39.035 82.768 1.00 67.58  ? 34  GLN A O   1 
ATOM   42   C CB  . GLN A 1 34  ? 17.251 38.825 81.525 1.00 83.83  ? 34  GLN A CB  1 
ATOM   43   C CG  . GLN A 1 34  ? 16.110 39.820 81.654 1.00 93.06  ? 34  GLN A CG  1 
ATOM   44   C CD  . GLN A 1 34  ? 16.101 40.491 83.012 1.00 105.45 ? 34  GLN A CD  1 
ATOM   45   O OE1 . GLN A 1 34  ? 17.127 40.988 83.477 1.00 113.39 ? 34  GLN A OE1 1 
ATOM   46   N NE2 . GLN A 1 34  ? 14.940 40.506 83.659 1.00 111.59 ? 34  GLN A NE2 1 
ATOM   47   N N   . ARG A 1 35  ? 20.053 37.549 81.088 1.00 66.90  ? 35  ARG A N   1 
ATOM   48   C CA  . ARG A 1 35  ? 21.133 36.650 81.483 1.00 69.66  ? 35  ARG A CA  1 
ATOM   49   C C   . ARG A 1 35  ? 22.483 37.280 81.151 1.00 69.65  ? 35  ARG A C   1 
ATOM   50   O O   . ARG A 1 35  ? 22.779 37.557 79.992 1.00 75.48  ? 35  ARG A O   1 
ATOM   51   C CB  . ARG A 1 35  ? 20.994 35.318 80.746 1.00 60.93  ? 35  ARG A CB  1 
ATOM   52   N N   . GLN A 1 36  ? 23.313 37.479 82.162 1.00 62.76  ? 36  GLN A N   1 
ATOM   53   C CA  . GLN A 1 36  ? 24.608 38.094 81.947 1.00 62.34  ? 36  GLN A CA  1 
ATOM   54   C C   . GLN A 1 36  ? 25.781 37.148 82.043 1.00 63.60  ? 36  GLN A C   1 
ATOM   55   O O   . GLN A 1 36  ? 25.655 36.033 82.521 1.00 71.44  ? 36  GLN A O   1 
ATOM   56   C CB  . GLN A 1 36  ? 24.809 39.215 82.954 1.00 56.90  ? 36  GLN A CB  1 
ATOM   57   C CG  . GLN A 1 36  ? 23.700 40.223 82.924 1.00 55.37  ? 36  GLN A CG  1 
ATOM   58   C CD  . GLN A 1 36  ? 23.985 41.397 83.812 1.00 52.96  ? 36  GLN A CD  1 
ATOM   59   O OE1 . GLN A 1 36  ? 24.953 42.131 83.606 1.00 62.23  ? 36  GLN A OE1 1 
ATOM   60   N NE2 . GLN A 1 36  ? 23.137 41.593 84.808 1.00 61.42  ? 36  GLN A NE2 1 
ATOM   61   N N   . LEU A 1 37  ? 26.937 37.610 81.586 1.00 67.53  ? 37  LEU A N   1 
ATOM   62   C CA  . LEU A 1 37  ? 28.148 36.815 81.661 1.00 60.85  ? 37  LEU A CA  1 
ATOM   63   C C   . LEU A 1 37  ? 28.429 36.694 83.143 1.00 62.07  ? 37  LEU A C   1 
ATOM   64   O O   . LEU A 1 37  ? 27.838 37.391 83.958 1.00 55.73  ? 37  LEU A O   1 
ATOM   65   C CB  . LEU A 1 37  ? 29.343 37.551 81.043 1.00 56.02  ? 37  LEU A CB  1 
ATOM   66   C CG  . LEU A 1 37  ? 29.359 38.015 79.591 1.00 56.71  ? 37  LEU A CG  1 
ATOM   67   C CD1 . LEU A 1 37  ? 30.639 38.807 79.316 1.00 40.12  ? 37  LEU A CD1 1 
ATOM   68   C CD2 . LEU A 1 37  ? 29.244 36.811 78.691 1.00 46.00  ? 37  LEU A CD2 1 
ATOM   69   N N   . GLU A 1 38  ? 29.351 35.818 83.489 1.00 62.86  ? 38  GLU A N   1 
ATOM   70   C CA  . GLU A 1 38  ? 29.733 35.683 84.872 1.00 62.58  ? 38  GLU A CA  1 
ATOM   71   C C   . GLU A 1 38  ? 30.565 36.938 85.142 1.00 57.24  ? 38  GLU A C   1 
ATOM   72   O O   . GLU A 1 38  ? 31.148 37.505 84.223 1.00 57.86  ? 38  GLU A O   1 
ATOM   73   C CB  . GLU A 1 38  ? 30.587 34.424 85.048 1.00 64.64  ? 38  GLU A CB  1 
ATOM   74   C CG  . GLU A 1 38  ? 30.183 33.612 86.247 1.00 76.29  ? 38  GLU A CG  1 
ATOM   75   C CD  . GLU A 1 38  ? 28.700 33.277 86.220 1.00 80.64  ? 38  GLU A CD  1 
ATOM   76   O OE1 . GLU A 1 38  ? 28.253 32.670 85.222 1.00 72.83  ? 38  GLU A OE1 1 
ATOM   77   O OE2 . GLU A 1 38  ? 27.987 33.624 87.191 1.00 81.23  ? 38  GLU A OE2 1 
ATOM   78   N N   . VAL A 1 39  ? 30.623 37.379 86.388 1.00 56.33  ? 39  VAL A N   1 
ATOM   79   C CA  . VAL A 1 39  ? 31.413 38.554 86.711 1.00 54.16  ? 39  VAL A CA  1 
ATOM   80   C C   . VAL A 1 39  ? 32.881 38.363 86.341 1.00 60.35  ? 39  VAL A C   1 
ATOM   81   O O   . VAL A 1 39  ? 33.617 39.340 86.115 1.00 54.08  ? 39  VAL A O   1 
ATOM   82   C CB  . VAL A 1 39  ? 31.327 38.876 88.199 1.00 53.80  ? 39  VAL A CB  1 
ATOM   83   C CG1 . VAL A 1 39  ? 32.337 39.952 88.549 1.00 46.92  ? 39  VAL A CG1 1 
ATOM   84   C CG2 . VAL A 1 39  ? 29.910 39.350 88.541 1.00 58.57  ? 39  VAL A CG2 1 
ATOM   85   N N   . TYR A 1 40  ? 33.312 37.103 86.282 1.00 62.47  ? 40  TYR A N   1 
ATOM   86   C CA  . TYR A 1 40  ? 34.703 36.793 85.948 1.00 64.23  ? 40  TYR A CA  1 
ATOM   87   C C   . TYR A 1 40  ? 34.983 37.244 84.513 1.00 59.63  ? 40  TYR A C   1 
ATOM   88   O O   . TYR A 1 40  ? 35.966 37.955 84.226 1.00 53.02  ? 40  TYR A O   1 
ATOM   89   C CB  . TYR A 1 40  ? 34.965 35.281 86.102 1.00 58.32  ? 40  TYR A CB  1 
ATOM   90   N N   . ASP A 1 41  ? 34.102 36.815 83.621 1.00 52.55  ? 41  ASP A N   1 
ATOM   91   C CA  . ASP A 1 41  ? 34.198 37.155 82.221 1.00 58.18  ? 41  ASP A CA  1 
ATOM   92   C C   . ASP A 1 41  ? 33.977 38.656 81.990 1.00 57.40  ? 41  ASP A C   1 
ATOM   93   O O   . ASP A 1 41  ? 34.610 39.238 81.117 1.00 53.07  ? 41  ASP A O   1 
ATOM   94   C CB  . ASP A 1 41  ? 33.188 36.328 81.427 1.00 65.19  ? 41  ASP A CB  1 
ATOM   95   C CG  . ASP A 1 41  ? 33.551 34.850 81.388 1.00 72.22  ? 41  ASP A CG  1 
ATOM   96   O OD1 . ASP A 1 41  ? 34.701 34.522 81.018 1.00 74.30  ? 41  ASP A OD1 1 
ATOM   97   O OD2 . ASP A 1 41  ? 32.686 34.016 81.720 1.00 74.34  ? 41  ASP A OD2 1 
ATOM   98   N N   . GLN A 1 42  ? 33.085 39.273 82.765 1.00 49.56  ? 42  GLN A N   1 
ATOM   99   C CA  . GLN A 1 42  ? 32.828 40.704 82.635 1.00 49.62  ? 42  GLN A CA  1 
ATOM   100  C C   . GLN A 1 42  ? 34.139 41.452 82.847 1.00 48.77  ? 42  GLN A C   1 
ATOM   101  O O   . GLN A 1 42  ? 34.377 42.503 82.247 1.00 48.70  ? 42  GLN A O   1 
ATOM   102  C CB  . GLN A 1 42  ? 31.784 41.161 83.663 1.00 49.14  ? 42  GLN A CB  1 
ATOM   103  C CG  . GLN A 1 42  ? 30.382 40.602 83.396 1.00 46.61  ? 42  GLN A CG  1 
ATOM   104  C CD  . GLN A 1 42  ? 29.404 40.944 84.503 1.00 49.88  ? 42  GLN A CD  1 
ATOM   105  O OE1 . GLN A 1 42  ? 29.560 41.953 85.171 1.00 43.25  ? 42  GLN A OE1 1 
ATOM   106  N NE2 . GLN A 1 42  ? 28.373 40.118 84.680 1.00 49.08  ? 42  GLN A NE2 1 
ATOM   107  N N   . CYS A 1 43  ? 35.014 40.884 83.674 1.00 48.55  ? 43  CYS A N   1 
ATOM   108  C CA  . CYS A 1 43  ? 36.293 41.521 83.945 1.00 46.05  ? 43  CYS A CA  1 
ATOM   109  C C   . CYS A 1 43  ? 37.361 41.149 82.936 1.00 45.18  ? 43  CYS A C   1 
ATOM   110  O O   . CYS A 1 43  ? 38.544 41.424 83.128 1.00 54.38  ? 43  CYS A O   1 
ATOM   111  C CB  . CYS A 1 43  ? 36.732 41.201 85.364 1.00 58.28  ? 43  CYS A CB  1 
ATOM   112  S SG  . CYS A 1 43  ? 35.504 41.823 86.550 1.00 69.80  ? 43  CYS A SG  1 
ATOM   113  N N   . LEU A 1 44  ? 36.934 40.519 81.850 1.00 42.78  ? 44  LEU A N   1 
ATOM   114  C CA  . LEU A 1 44  ? 37.840 40.163 80.771 1.00 50.41  ? 44  LEU A CA  1 
ATOM   115  C C   . LEU A 1 44  ? 37.481 40.903 79.483 1.00 53.02  ? 44  LEU A C   1 
ATOM   116  O O   . LEU A 1 44  ? 38.309 41.039 78.570 1.00 50.00  ? 44  LEU A O   1 
ATOM   117  C CB  . LEU A 1 44  ? 37.818 38.656 80.547 1.00 58.43  ? 44  LEU A CB  1 
ATOM   118  C CG  . LEU A 1 44  ? 38.588 37.972 81.671 1.00 56.37  ? 44  LEU A CG  1 
ATOM   119  C CD1 . LEU A 1 44  ? 38.618 36.476 81.446 1.00 50.16  ? 44  LEU A CD1 1 
ATOM   120  C CD2 . LEU A 1 44  ? 40.007 38.570 81.711 1.00 47.44  ? 44  LEU A CD2 1 
ATOM   121  N N   . ILE A 1 45  ? 36.242 41.394 79.433 1.00 56.58  ? 45  ILE A N   1 
ATOM   122  C CA  . ILE A 1 45  ? 35.723 42.145 78.292 1.00 51.57  ? 45  ILE A CA  1 
ATOM   123  C C   . ILE A 1 45  ? 36.633 43.357 78.057 1.00 43.31  ? 45  ILE A C   1 
ATOM   124  O O   . ILE A 1 45  ? 36.819 44.168 78.938 1.00 44.83  ? 45  ILE A O   1 
ATOM   125  C CB  . ILE A 1 45  ? 34.258 42.604 78.573 1.00 50.84  ? 45  ILE A CB  1 
ATOM   126  C CG1 . ILE A 1 45  ? 33.347 41.375 78.741 1.00 49.69  ? 45  ILE A CG1 1 
ATOM   127  C CG2 . ILE A 1 45  ? 33.744 43.479 77.447 1.00 53.36  ? 45  ILE A CG2 1 
ATOM   128  C CD1 . ILE A 1 45  ? 33.211 40.504 77.489 1.00 40.08  ? 45  ILE A CD1 1 
ATOM   129  N N   . GLY A 1 46  ? 37.222 43.444 76.872 1.00 41.77  ? 46  GLY A N   1 
ATOM   130  C CA  . GLY A 1 46  ? 38.107 44.540 76.551 1.00 44.28  ? 46  GLY A CA  1 
ATOM   131  C C   . GLY A 1 46  ? 39.533 44.349 77.027 1.00 51.02  ? 46  GLY A C   1 
ATOM   132  O O   . GLY A 1 46  ? 40.363 45.256 76.891 1.00 52.18  ? 46  GLY A O   1 
ATOM   133  N N   . ALA A 1 47  ? 39.843 43.184 77.591 1.00 54.22  ? 47  ALA A N   1 
ATOM   134  C CA  . ALA A 1 47  ? 41.210 42.941 78.060 1.00 52.30  ? 47  ALA A CA  1 
ATOM   135  C C   . ALA A 1 47  ? 42.136 42.628 76.884 1.00 52.81  ? 47  ALA A C   1 
ATOM   136  O O   . ALA A 1 47  ? 41.675 42.127 75.854 1.00 51.89  ? 47  ALA A O   1 
ATOM   137  C CB  . ALA A 1 47  ? 41.221 41.794 79.042 1.00 45.66  ? 47  ALA A CB  1 
ATOM   138  N N   . ALA A 1 48  ? 43.425 42.957 77.022 1.00 54.90  ? 48  ALA A N   1 
ATOM   139  C CA  . ALA A 1 48  ? 44.425 42.659 75.980 1.00 57.93  ? 48  ALA A CA  1 
ATOM   140  C C   . ALA A 1 48  ? 45.263 41.470 76.463 1.00 61.70  ? 48  ALA A C   1 
ATOM   141  O O   . ALA A 1 48  ? 46.364 41.642 76.989 1.00 68.23  ? 48  ALA A O   1 
ATOM   142  C CB  . ALA A 1 48  ? 45.325 43.856 75.739 1.00 48.88  ? 48  ALA A CB  1 
ATOM   143  N N   . ARG A 1 49  ? 44.734 40.267 76.277 1.00 59.77  ? 49  ARG A N   1 
ATOM   144  C CA  . ARG A 1 49  ? 45.403 39.050 76.725 1.00 64.58  ? 49  ARG A CA  1 
ATOM   145  C C   . ARG A 1 49  ? 46.455 38.514 75.765 1.00 65.65  ? 49  ARG A C   1 
ATOM   146  O O   . ARG A 1 49  ? 46.264 37.469 75.138 1.00 60.39  ? 49  ARG A O   1 
ATOM   147  C CB  . ARG A 1 49  ? 44.358 37.967 76.997 1.00 64.64  ? 49  ARG A CB  1 
ATOM   148  C CG  . ARG A 1 49  ? 43.205 38.481 77.820 1.00 68.80  ? 49  ARG A CG  1 
ATOM   149  C CD  . ARG A 1 49  ? 43.107 37.808 79.173 1.00 63.91  ? 49  ARG A CD  1 
ATOM   150  N NE  . ARG A 1 49  ? 42.366 36.544 79.155 1.00 63.89  ? 49  ARG A NE  1 
ATOM   151  C CZ  . ARG A 1 49  ? 41.231 36.339 78.493 1.00 65.69  ? 49  ARG A CZ  1 
ATOM   152  N NH1 . ARG A 1 49  ? 40.699 37.313 77.764 1.00 76.78  ? 49  ARG A NH1 1 
ATOM   153  N NH2 . ARG A 1 49  ? 40.589 35.179 78.606 1.00 57.48  ? 49  ARG A NH2 1 
ATOM   154  N N   . TRP A 1 50  ? 47.568 39.231 75.651 1.00 65.64  ? 50  TRP A N   1 
ATOM   155  C CA  . TRP A 1 50  ? 48.645 38.790 74.785 1.00 69.89  ? 50  TRP A CA  1 
ATOM   156  C C   . TRP A 1 50  ? 49.073 37.382 75.165 1.00 72.02  ? 50  TRP A C   1 
ATOM   157  O O   . TRP A 1 50  ? 49.248 37.071 76.339 1.00 69.24  ? 50  TRP A O   1 
ATOM   158  C CB  . TRP A 1 50  ? 49.828 39.734 74.899 1.00 69.99  ? 50  TRP A CB  1 
ATOM   159  C CG  . TRP A 1 50  ? 49.499 41.057 74.381 1.00 73.77  ? 50  TRP A CG  1 
ATOM   160  C CD1 . TRP A 1 50  ? 49.196 42.169 75.105 1.00 81.40  ? 50  TRP A CD1 1 
ATOM   161  C CD2 . TRP A 1 50  ? 49.402 41.428 73.005 1.00 74.60  ? 50  TRP A CD2 1 
ATOM   162  N NE1 . TRP A 1 50  ? 48.919 43.222 74.261 1.00 85.03  ? 50  TRP A NE1 1 
ATOM   163  C CE2 . TRP A 1 50  ? 49.038 42.794 72.965 1.00 78.38  ? 50  TRP A CE2 1 
ATOM   164  C CE3 . TRP A 1 50  ? 49.589 40.741 71.800 1.00 64.31  ? 50  TRP A CE3 1 
ATOM   165  C CZ2 . TRP A 1 50  ? 48.860 43.486 71.767 1.00 70.31  ? 50  TRP A CZ2 1 
ATOM   166  C CZ3 . TRP A 1 50  ? 49.415 41.426 70.611 1.00 60.66  ? 50  TRP A CZ3 1 
ATOM   167  C CH2 . TRP A 1 50  ? 49.054 42.788 70.603 1.00 71.72  ? 50  TRP A CH2 1 
ATOM   168  N N   . PRO A 1 51  ? 49.241 36.507 74.166 1.00 78.62  ? 51  PRO A N   1 
ATOM   169  C CA  . PRO A 1 51  ? 49.651 35.124 74.427 1.00 80.77  ? 51  PRO A CA  1 
ATOM   170  C C   . PRO A 1 51  ? 50.940 35.064 75.239 1.00 79.05  ? 51  PRO A C   1 
ATOM   171  O O   . PRO A 1 51  ? 51.086 34.229 76.122 1.00 78.99  ? 51  PRO A O   1 
ATOM   172  C CB  . PRO A 1 51  ? 49.808 34.543 73.023 1.00 79.31  ? 51  PRO A CB  1 
ATOM   173  C CG  . PRO A 1 51  ? 50.233 35.749 72.217 1.00 81.74  ? 51  PRO A CG  1 
ATOM   174  C CD  . PRO A 1 51  ? 49.284 36.808 72.725 1.00 77.57  ? 51  PRO A CD  1 
ATOM   175  N N   . ASP A 1 52  ? 51.871 35.958 74.938 1.00 79.48  ? 52  ASP A N   1 
ATOM   176  C CA  . ASP A 1 52  ? 53.126 35.993 75.659 1.00 85.23  ? 52  ASP A CA  1 
ATOM   177  C C   . ASP A 1 52  ? 52.884 36.517 77.066 1.00 94.36  ? 52  ASP A C   1 
ATOM   178  O O   . ASP A 1 52  ? 52.555 35.745 77.967 1.00 97.53  ? 52  ASP A O   1 
ATOM   179  C CB  . ASP A 1 52  ? 54.131 36.873 74.917 1.00 84.49  ? 52  ASP A CB  1 
ATOM   180  C CG  . ASP A 1 52  ? 53.561 38.217 74.550 1.00 86.85  ? 52  ASP A CG  1 
ATOM   181  O OD1 . ASP A 1 52  ? 52.350 38.277 74.264 1.00 94.26  ? 52  ASP A OD1 1 
ATOM   182  O OD2 . ASP A 1 52  ? 54.320 39.210 74.530 1.00 88.87  ? 52  ASP A OD2 1 
ATOM   183  N N   . ASP A 1 53  ? 53.019 37.825 77.257 1.00 100.59 ? 53  ASP A N   1 
ATOM   184  C CA  . ASP A 1 53  ? 52.825 38.417 78.577 1.00 108.66 ? 53  ASP A CA  1 
ATOM   185  C C   . ASP A 1 53  ? 51.393 38.258 79.088 1.00 111.03 ? 53  ASP A C   1 
ATOM   186  O O   . ASP A 1 53  ? 50.430 38.507 78.362 1.00 112.54 ? 53  ASP A O   1 
ATOM   187  C CB  . ASP A 1 53  ? 53.207 39.898 78.545 1.00 113.13 ? 53  ASP A CB  1 
ATOM   188  C CG  . ASP A 1 53  ? 53.440 40.468 79.928 1.00 115.55 ? 53  ASP A CG  1 
ATOM   189  O OD1 . ASP A 1 53  ? 53.788 41.664 80.027 1.00 117.91 ? 53  ASP A OD1 1 
ATOM   190  O OD2 . ASP A 1 53  ? 53.278 39.718 80.914 1.00 115.13 ? 53  ASP A OD2 1 
ATOM   191  N N   . SER A 1 54  ? 51.260 37.839 80.343 1.00 114.96 ? 54  SER A N   1 
ATOM   192  C CA  . SER A 1 54  ? 49.945 37.645 80.955 1.00 120.04 ? 54  SER A CA  1 
ATOM   193  C C   . SER A 1 54  ? 49.931 38.080 82.429 1.00 121.37 ? 54  SER A C   1 
ATOM   194  O O   . SER A 1 54  ? 49.205 37.510 83.254 1.00 119.17 ? 54  SER A O   1 
ATOM   195  C CB  . SER A 1 54  ? 49.518 36.177 80.829 1.00 118.54 ? 54  SER A CB  1 
ATOM   196  N N   . SER A 1 55  ? 50.737 39.094 82.742 1.00 121.38 ? 55  SER A N   1 
ATOM   197  C CA  . SER A 1 55  ? 50.836 39.643 84.093 1.00 118.41 ? 55  SER A CA  1 
ATOM   198  C C   . SER A 1 55  ? 50.169 41.021 84.130 1.00 120.32 ? 55  SER A C   1 
ATOM   199  O O   . SER A 1 55  ? 50.760 42.001 84.594 1.00 123.62 ? 55  SER A O   1 
ATOM   200  C CB  . SER A 1 55  ? 52.309 39.763 84.500 1.00 115.30 ? 55  SER A CB  1 
ATOM   201  O OG  . SER A 1 55  ? 53.033 40.566 83.583 1.00 110.45 ? 55  SER A OG  1 
ATOM   202  N N   . LYS A 1 56  ? 48.933 41.087 83.639 1.00 116.09 ? 56  LYS A N   1 
ATOM   203  C CA  . LYS A 1 56  ? 48.192 42.337 83.594 1.00 109.63 ? 56  LYS A CA  1 
ATOM   204  C C   . LYS A 1 56  ? 46.768 42.213 84.137 1.00 107.57 ? 56  LYS A C   1 
ATOM   205  O O   . LYS A 1 56  ? 45.861 42.909 83.681 1.00 106.37 ? 56  LYS A O   1 
ATOM   206  C CB  . LYS A 1 56  ? 48.163 42.861 82.163 1.00 109.53 ? 56  LYS A CB  1 
ATOM   207  N N   . SER A 1 57  ? 46.570 41.322 85.105 1.00 102.89 ? 57  SER A N   1 
ATOM   208  C CA  . SER A 1 57  ? 45.253 41.141 85.717 1.00 95.60  ? 57  SER A CA  1 
ATOM   209  C C   . SER A 1 57  ? 45.177 41.994 86.978 1.00 92.05  ? 57  SER A C   1 
ATOM   210  O O   . SER A 1 57  ? 44.497 41.630 87.940 1.00 80.08  ? 57  SER A O   1 
ATOM   211  C CB  . SER A 1 57  ? 45.026 39.670 86.090 1.00 98.77  ? 57  SER A CB  1 
ATOM   212  O OG  . SER A 1 57  ? 43.836 39.504 86.852 1.00 89.04  ? 57  SER A OG  1 
ATOM   213  N N   . ASN A 1 58  ? 45.886 43.122 86.967 1.00 92.21  ? 58  ASN A N   1 
ATOM   214  C CA  . ASN A 1 58  ? 45.911 44.020 88.114 1.00 95.43  ? 58  ASN A CA  1 
ATOM   215  C C   . ASN A 1 58  ? 44.497 44.459 88.453 1.00 96.63  ? 58  ASN A C   1 
ATOM   216  O O   . ASN A 1 58  ? 44.111 45.609 88.245 1.00 96.10  ? 58  ASN A O   1 
ATOM   217  C CB  . ASN A 1 58  ? 46.833 45.231 87.851 1.00 97.11  ? 58  ASN A CB  1 
ATOM   218  C CG  . ASN A 1 58  ? 46.214 46.274 86.935 1.00 103.68 ? 58  ASN A CG  1 
ATOM   219  O OD1 . ASN A 1 58  ? 45.231 46.012 86.253 1.00 108.14 ? 58  ASN A OD1 1 
ATOM   220  N ND2 . ASN A 1 58  ? 46.803 47.469 86.914 1.00 103.54 ? 58  ASN A ND2 1 
ATOM   221  N N   . THR A 1 59  ? 43.736 43.508 88.986 1.00 101.00 ? 59  THR A N   1 
ATOM   222  C CA  . THR A 1 59  ? 42.353 43.719 89.378 1.00 104.74 ? 59  THR A CA  1 
ATOM   223  C C   . THR A 1 59  ? 42.026 45.197 89.497 1.00 105.59 ? 59  THR A C   1 
ATOM   224  O O   . THR A 1 59  ? 41.153 45.699 88.784 1.00 102.38 ? 59  THR A O   1 
ATOM   225  C CB  . THR A 1 59  ? 42.041 42.995 90.702 1.00 105.02 ? 59  THR A CB  1 
ATOM   226  O OG1 . THR A 1 59  ? 42.238 41.587 90.520 1.00 105.82 ? 59  THR A OG1 1 
ATOM   227  C CG2 . THR A 1 59  ? 40.598 43.250 91.136 1.00 105.06 ? 59  THR A CG2 1 
ATOM   228  N N   . PRO A 1 60  ? 42.732 45.918 90.387 1.00 104.68 ? 60  PRO A N   1 
ATOM   229  C CA  . PRO A 1 60  ? 42.452 47.345 90.528 1.00 102.18 ? 60  PRO A CA  1 
ATOM   230  C C   . PRO A 1 60  ? 42.015 47.973 89.208 1.00 95.06  ? 60  PRO A C   1 
ATOM   231  O O   . PRO A 1 60  ? 40.849 47.907 88.834 1.00 93.37  ? 60  PRO A O   1 
ATOM   232  C CB  . PRO A 1 60  ? 43.780 47.893 91.035 1.00 102.96 ? 60  PRO A CB  1 
ATOM   233  C CG  . PRO A 1 60  ? 44.206 46.819 91.975 1.00 102.86 ? 60  PRO A CG  1 
ATOM   234  C CD  . PRO A 1 60  ? 43.884 45.530 91.224 1.00 101.45 ? 60  PRO A CD  1 
ATOM   235  N N   . GLU A 1 61  ? 42.961 48.558 88.494 1.00 88.62  ? 61  GLU A N   1 
ATOM   236  C CA  . GLU A 1 61  ? 42.645 49.204 87.242 1.00 89.05  ? 61  GLU A CA  1 
ATOM   237  C C   . GLU A 1 61  ? 41.976 48.299 86.216 1.00 86.77  ? 61  GLU A C   1 
ATOM   238  O O   . GLU A 1 61  ? 40.767 48.391 85.989 1.00 83.74  ? 61  GLU A O   1 
ATOM   239  C CB  . GLU A 1 61  ? 43.910 49.805 86.635 1.00 101.78 ? 61  GLU A CB  1 
ATOM   240  C CG  . GLU A 1 61  ? 44.560 50.886 87.489 1.00 115.99 ? 61  GLU A CG  1 
ATOM   241  C CD  . GLU A 1 61  ? 43.600 52.013 87.833 1.00 121.21 ? 61  GLU A CD  1 
ATOM   242  O OE1 . GLU A 1 61  ? 42.986 52.576 86.899 1.00 121.60 ? 61  GLU A OE1 1 
ATOM   243  O OE2 . GLU A 1 61  ? 43.466 52.334 89.037 1.00 125.47 ? 61  GLU A OE2 1 
ATOM   244  N N   . ASN A 1 62  ? 42.775 47.424 85.610 1.00 81.49  ? 62  ASN A N   1 
ATOM   245  C CA  . ASN A 1 62  ? 42.320 46.523 84.552 1.00 76.44  ? 62  ASN A CA  1 
ATOM   246  C C   . ASN A 1 62  ? 40.996 45.785 84.711 1.00 67.37  ? 62  ASN A C   1 
ATOM   247  O O   . ASN A 1 62  ? 40.161 45.813 83.813 1.00 67.57  ? 62  ASN A O   1 
ATOM   248  C CB  . ASN A 1 62  ? 43.435 45.529 84.202 1.00 70.25  ? 62  ASN A CB  1 
ATOM   249  C CG  . ASN A 1 62  ? 44.671 46.226 83.647 1.00 77.62  ? 62  ASN A CG  1 
ATOM   250  O OD1 . ASN A 1 62  ? 44.596 47.360 83.172 1.00 75.38  ? 62  ASN A OD1 1 
ATOM   251  N ND2 . ASN A 1 62  ? 45.811 45.548 83.699 1.00 86.61  ? 62  ASN A ND2 1 
ATOM   252  N N   . ARG A 1 63  ? 40.790 45.121 85.831 1.00 62.80  ? 63  ARG A N   1 
ATOM   253  C CA  . ARG A 1 63  ? 39.540 44.412 86.006 1.00 63.53  ? 63  ARG A CA  1 
ATOM   254  C C   . ARG A 1 63  ? 38.388 45.418 86.102 1.00 63.20  ? 63  ARG A C   1 
ATOM   255  O O   . ARG A 1 63  ? 37.253 45.110 85.728 1.00 58.52  ? 63  ARG A O   1 
ATOM   256  C CB  . ARG A 1 63  ? 39.618 43.551 87.255 1.00 66.34  ? 63  ARG A CB  1 
ATOM   257  C CG  . ARG A 1 63  ? 40.703 42.494 87.184 1.00 74.08  ? 63  ARG A CG  1 
ATOM   258  C CD  . ARG A 1 63  ? 40.182 41.205 86.598 1.00 92.50  ? 63  ARG A CD  1 
ATOM   259  N NE  . ARG A 1 63  ? 39.089 40.659 87.402 1.00 95.98  ? 63  ARG A NE  1 
ATOM   260  C CZ  . ARG A 1 63  ? 39.196 40.314 88.683 1.00 97.69  ? 63  ARG A CZ  1 
ATOM   261  N NH1 . ARG A 1 63  ? 38.143 39.825 89.327 1.00 99.82  ? 63  ARG A NH1 1 
ATOM   262  N NH2 . ARG A 1 63  ? 40.351 40.453 89.322 1.00 99.32  ? 63  ARG A NH2 1 
ATOM   263  N N   . ALA A 1 64  ? 38.685 46.622 86.592 1.00 56.33  ? 64  ALA A N   1 
ATOM   264  C CA  . ALA A 1 64  ? 37.663 47.660 86.717 1.00 57.85  ? 64  ALA A CA  1 
ATOM   265  C C   . ALA A 1 64  ? 37.299 48.174 85.325 1.00 56.07  ? 64  ALA A C   1 
ATOM   266  O O   . ALA A 1 64  ? 36.117 48.307 84.978 1.00 55.82  ? 64  ALA A O   1 
ATOM   267  C CB  . ALA A 1 64  ? 38.179 48.821 87.575 1.00 53.29  ? 64  ALA A CB  1 
ATOM   268  N N   . TYR A 1 65  ? 38.342 48.455 84.550 1.00 43.51  ? 65  TYR A N   1 
ATOM   269  C CA  . TYR A 1 65  ? 38.260 48.959 83.181 1.00 41.65  ? 65  TYR A CA  1 
ATOM   270  C C   . TYR A 1 65  ? 37.419 48.031 82.329 1.00 44.21  ? 65  TYR A C   1 
ATOM   271  O O   . TYR A 1 65  ? 36.550 48.466 81.594 1.00 44.00  ? 65  TYR A O   1 
ATOM   272  C CB  . TYR A 1 65  ? 39.674 49.048 82.635 1.00 33.38  ? 65  TYR A CB  1 
ATOM   273  C CG  . TYR A 1 65  ? 39.798 49.307 81.173 1.00 41.03  ? 65  TYR A CG  1 
ATOM   274  C CD1 . TYR A 1 65  ? 40.106 50.587 80.690 1.00 34.91  ? 65  TYR A CD1 1 
ATOM   275  C CD2 . TYR A 1 65  ? 39.654 48.269 80.258 1.00 42.05  ? 65  TYR A CD2 1 
ATOM   276  C CE1 . TYR A 1 65  ? 40.272 50.814 79.325 1.00 30.82  ? 65  TYR A CE1 1 
ATOM   277  C CE2 . TYR A 1 65  ? 39.814 48.490 78.892 1.00 45.88  ? 65  TYR A CE2 1 
ATOM   278  C CZ  . TYR A 1 65  ? 40.123 49.765 78.433 1.00 41.10  ? 65  TYR A CZ  1 
ATOM   279  O OH  . TYR A 1 65  ? 40.262 49.976 77.077 1.00 40.42  ? 65  TYR A OH  1 
ATOM   280  N N   . CYS A 1 66  ? 37.677 46.741 82.462 1.00 35.49  ? 66  CYS A N   1 
ATOM   281  C CA  . CYS A 1 66  ? 36.957 45.732 81.726 1.00 42.91  ? 66  CYS A CA  1 
ATOM   282  C C   . CYS A 1 66  ? 35.505 45.665 82.141 1.00 43.45  ? 66  CYS A C   1 
ATOM   283  O O   . CYS A 1 66  ? 34.616 45.640 81.289 1.00 47.15  ? 66  CYS A O   1 
ATOM   284  C CB  . CYS A 1 66  ? 37.630 44.367 81.924 1.00 44.77  ? 66  CYS A CB  1 
ATOM   285  S SG  . CYS A 1 66  ? 39.215 44.250 81.022 1.00 55.88  ? 66  CYS A SG  1 
ATOM   286  N N   . GLN A 1 67  ? 35.269 45.621 83.449 1.00 49.78  ? 67  GLN A N   1 
ATOM   287  C CA  . GLN A 1 67  ? 33.912 45.573 84.002 1.00 53.53  ? 67  GLN A CA  1 
ATOM   288  C C   . GLN A 1 67  ? 33.116 46.792 83.487 1.00 48.30  ? 67  GLN A C   1 
ATOM   289  O O   . GLN A 1 67  ? 31.975 46.674 83.042 1.00 42.69  ? 67  GLN A O   1 
ATOM   290  C CB  . GLN A 1 67  ? 33.995 45.620 85.531 1.00 62.52  ? 67  GLN A CB  1 
ATOM   291  C CG  . GLN A 1 67  ? 32.667 45.813 86.237 1.00 65.70  ? 67  GLN A CG  1 
ATOM   292  C CD  . GLN A 1 67  ? 31.979 44.511 86.492 1.00 63.42  ? 67  GLN A CD  1 
ATOM   293  O OE1 . GLN A 1 67  ? 32.263 43.831 87.475 1.00 64.49  ? 67  GLN A OE1 1 
ATOM   294  N NE2 . GLN A 1 67  ? 31.074 44.136 85.597 1.00 75.55  ? 67  GLN A NE2 1 
ATOM   295  N N   . SER A 1 68  ? 33.744 47.960 83.546 1.00 42.17  ? 68  SER A N   1 
ATOM   296  C CA  . SER A 1 68  ? 33.105 49.180 83.082 1.00 40.62  ? 68  SER A CA  1 
ATOM   297  C C   . SER A 1 68  ? 32.816 49.062 81.593 1.00 48.59  ? 68  SER A C   1 
ATOM   298  O O   . SER A 1 68  ? 31.705 49.384 81.161 1.00 38.89  ? 68  SER A O   1 
ATOM   299  C CB  . SER A 1 68  ? 33.992 50.389 83.344 1.00 29.42  ? 68  SER A CB  1 
ATOM   300  O OG  . SER A 1 68  ? 33.556 51.495 82.589 1.00 43.41  ? 68  SER A OG  1 
ATOM   301  N N   . MET A 1 69  ? 33.791 48.583 80.811 1.00 41.11  ? 69  MET A N   1 
ATOM   302  C CA  . MET A 1 69  ? 33.559 48.439 79.385 1.00 40.73  ? 69  MET A CA  1 
ATOM   303  C C   . MET A 1 69  ? 32.375 47.515 79.180 1.00 37.14  ? 69  MET A C   1 
ATOM   304  O O   . MET A 1 69  ? 31.539 47.740 78.309 1.00 39.97  ? 69  MET A O   1 
ATOM   305  C CB  . MET A 1 69  ? 34.774 47.879 78.636 1.00 46.74  ? 69  MET A CB  1 
ATOM   306  C CG  . MET A 1 69  ? 34.498 47.761 77.140 1.00 50.72  ? 69  MET A CG  1 
ATOM   307  S SD  . MET A 1 69  ? 35.854 47.512 75.959 1.00 50.90  ? 69  MET A SD  1 
ATOM   308  C CE  . MET A 1 69  ? 35.387 45.952 75.416 1.00 54.01  ? 69  MET A CE  1 
ATOM   309  N N   . TYR A 1 70  ? 32.299 46.471 79.983 1.00 36.91  ? 70  TYR A N   1 
ATOM   310  C CA  . TYR A 1 70  ? 31.184 45.542 79.865 1.00 38.17  ? 70  TYR A CA  1 
ATOM   311  C C   . TYR A 1 70  ? 29.834 46.257 80.147 1.00 43.81  ? 70  TYR A C   1 
ATOM   312  O O   . TYR A 1 70  ? 28.872 46.081 79.407 1.00 43.16  ? 70  TYR A O   1 
ATOM   313  C CB  . TYR A 1 70  ? 31.375 44.386 80.844 1.00 36.79  ? 70  TYR A CB  1 
ATOM   314  C CG  . TYR A 1 70  ? 30.163 43.485 80.967 1.00 41.93  ? 70  TYR A CG  1 
ATOM   315  C CD1 . TYR A 1 70  ? 29.860 42.527 79.983 1.00 44.94  ? 70  TYR A CD1 1 
ATOM   316  C CD2 . TYR A 1 70  ? 29.289 43.624 82.043 1.00 37.92  ? 70  TYR A CD2 1 
ATOM   317  C CE1 . TYR A 1 70  ? 28.692 41.728 80.077 1.00 44.67  ? 70  TYR A CE1 1 
ATOM   318  C CE2 . TYR A 1 70  ? 28.139 42.852 82.142 1.00 39.35  ? 70  TYR A CE2 1 
ATOM   319  C CZ  . TYR A 1 70  ? 27.841 41.911 81.166 1.00 41.54  ? 70  TYR A CZ  1 
ATOM   320  O OH  . TYR A 1 70  ? 26.680 41.186 81.297 1.00 48.77  ? 70  TYR A OH  1 
ATOM   321  N N   . ASN A 1 71  ? 29.772 47.060 81.212 1.00 38.19  ? 71  ASN A N   1 
ATOM   322  C CA  . ASN A 1 71  ? 28.535 47.742 81.555 1.00 40.99  ? 71  ASN A CA  1 
ATOM   323  C C   . ASN A 1 71  ? 28.139 48.726 80.482 1.00 41.21  ? 71  ASN A C   1 
ATOM   324  O O   . ASN A 1 71  ? 26.995 48.713 80.026 1.00 45.79  ? 71  ASN A O   1 
ATOM   325  C CB  . ASN A 1 71  ? 28.658 48.444 82.911 1.00 34.08  ? 71  ASN A CB  1 
ATOM   326  C CG  . ASN A 1 71  ? 28.741 47.451 84.075 1.00 46.33  ? 71  ASN A CG  1 
ATOM   327  O OD1 . ASN A 1 71  ? 29.313 47.750 85.129 1.00 49.64  ? 71  ASN A OD1 1 
ATOM   328  N ND2 . ASN A 1 71  ? 28.165 46.266 83.887 1.00 42.13  ? 71  ASN A ND2 1 
ATOM   329  N N   . SER A 1 72  ? 29.091 49.541 80.044 1.00 32.55  ? 72  SER A N   1 
ATOM   330  C CA  . SER A 1 72  ? 28.835 50.547 79.026 1.00 40.10  ? 72  SER A CA  1 
ATOM   331  C C   . SER A 1 72  ? 28.397 49.931 77.713 1.00 43.43  ? 72  SER A C   1 
ATOM   332  O O   . SER A 1 72  ? 27.569 50.494 76.982 1.00 39.72  ? 72  SER A O   1 
ATOM   333  C CB  . SER A 1 72  ? 30.073 51.417 78.834 1.00 37.31  ? 72  SER A CB  1 
ATOM   334  O OG  . SER A 1 72  ? 30.260 52.202 80.002 1.00 32.64  ? 72  SER A OG  1 
ATOM   335  N N   . ILE A 1 73  ? 28.930 48.757 77.421 1.00 39.45  ? 73  ILE A N   1 
ATOM   336  C CA  . ILE A 1 73  ? 28.561 48.063 76.195 1.00 38.37  ? 73  ILE A CA  1 
ATOM   337  C C   . ILE A 1 73  ? 27.060 47.696 76.254 1.00 36.06  ? 73  ILE A C   1 
ATOM   338  O O   . ILE A 1 73  ? 26.321 47.851 75.268 1.00 40.39  ? 73  ILE A O   1 
ATOM   339  C CB  . ILE A 1 73  ? 29.482 46.804 76.037 1.00 46.87  ? 73  ILE A CB  1 
ATOM   340  C CG1 . ILE A 1 73  ? 30.779 47.231 75.344 1.00 54.46  ? 73  ILE A CG1 1 
ATOM   341  C CG2 . ILE A 1 73  ? 28.778 45.647 75.314 1.00 39.31  ? 73  ILE A CG2 1 
ATOM   342  C CD1 . ILE A 1 73  ? 31.908 46.185 75.412 1.00 44.15  ? 73  ILE A CD1 1 
ATOM   343  N N   . ARG A 1 74  ? 26.603 47.221 77.408 1.00 30.31  ? 74  ARG A N   1 
ATOM   344  C CA  . ARG A 1 74  ? 25.192 46.831 77.521 1.00 41.23  ? 74  ARG A CA  1 
ATOM   345  C C   . ARG A 1 74  ? 24.327 48.080 77.477 1.00 34.47  ? 74  ARG A C   1 
ATOM   346  O O   . ARG A 1 74  ? 23.235 48.072 76.931 1.00 40.33  ? 74  ARG A O   1 
ATOM   347  C CB  . ARG A 1 74  ? 24.923 46.072 78.821 1.00 34.46  ? 74  ARG A CB  1 
ATOM   348  C CG  . ARG A 1 74  ? 25.763 44.816 79.022 1.00 47.21  ? 74  ARG A CG  1 
ATOM   349  C CD  . ARG A 1 74  ? 25.329 44.073 80.297 1.00 45.80  ? 74  ARG A CD  1 
ATOM   350  N NE  . ARG A 1 74  ? 24.621 42.856 79.938 1.00 63.00  ? 74  ARG A NE  1 
ATOM   351  C CZ  . ARG A 1 74  ? 23.336 42.625 80.171 1.00 61.11  ? 74  ARG A CZ  1 
ATOM   352  N NH1 . ARG A 1 74  ? 22.585 43.527 80.782 1.00 43.17  ? 74  ARG A NH1 1 
ATOM   353  N NH2 . ARG A 1 74  ? 22.801 41.481 79.766 1.00 69.82  ? 74  ARG A NH2 1 
ATOM   354  N N   . SER A 1 75  ? 24.847 49.164 78.031 1.00 42.81  ? 75  SER A N   1 
ATOM   355  C CA  . SER A 1 75  ? 24.115 50.409 78.033 1.00 50.31  ? 75  SER A CA  1 
ATOM   356  C C   . SER A 1 75  ? 24.004 50.925 76.605 1.00 50.83  ? 75  SER A C   1 
ATOM   357  O O   . SER A 1 75  ? 22.918 51.312 76.160 1.00 50.57  ? 75  SER A O   1 
ATOM   358  C CB  . SER A 1 75  ? 24.815 51.432 78.920 1.00 41.22  ? 75  SER A CB  1 
ATOM   359  O OG  . SER A 1 75  ? 24.094 52.646 78.906 1.00 52.33  ? 75  SER A OG  1 
ATOM   360  N N   . ALA A 1 76  ? 25.112 50.910 75.871 1.00 48.65  ? 76  ALA A N   1 
ATOM   361  C CA  . ALA A 1 76  ? 25.063 51.397 74.494 1.00 47.73  ? 76  ALA A CA  1 
ATOM   362  C C   . ALA A 1 76  ? 24.159 50.484 73.679 1.00 44.39  ? 76  ALA A C   1 
ATOM   363  O O   . ALA A 1 76  ? 23.501 50.923 72.738 1.00 41.94  ? 76  ALA A O   1 
ATOM   364  C CB  . ALA A 1 76  ? 26.452 51.436 73.885 1.00 35.39  ? 76  ALA A CB  1 
ATOM   365  N N   . GLY A 1 77  ? 24.137 49.208 74.040 1.00 42.13  ? 77  GLY A N   1 
ATOM   366  C CA  . GLY A 1 77  ? 23.297 48.266 73.323 1.00 43.57  ? 77  GLY A CA  1 
ATOM   367  C C   . GLY A 1 77  ? 21.851 48.649 73.548 1.00 41.87  ? 77  GLY A C   1 
ATOM   368  O O   . GLY A 1 77  ? 21.029 48.657 72.625 1.00 45.17  ? 77  GLY A O   1 
ATOM   369  N N   . ASP A 1 78  ? 21.546 49.000 74.790 1.00 45.90  ? 78  ASP A N   1 
ATOM   370  C CA  . ASP A 1 78  ? 20.201 49.392 75.120 1.00 44.78  ? 78  ASP A CA  1 
ATOM   371  C C   . ASP A 1 78  ? 19.789 50.654 74.345 1.00 43.77  ? 78  ASP A C   1 
ATOM   372  O O   . ASP A 1 78  ? 18.663 50.722 73.858 1.00 50.18  ? 78  ASP A O   1 
ATOM   373  C CB  . ASP A 1 78  ? 20.059 49.596 76.615 1.00 48.50  ? 78  ASP A CB  1 
ATOM   374  C CG  . ASP A 1 78  ? 18.724 50.177 76.974 1.00 56.76  ? 78  ASP A CG  1 
ATOM   375  O OD1 . ASP A 1 78  ? 18.645 51.412 77.141 1.00 53.28  ? 78  ASP A OD1 1 
ATOM   376  O OD2 . ASP A 1 78  ? 17.754 49.395 77.055 1.00 63.23  ? 78  ASP A OD2 1 
ATOM   377  N N   . GLU A 1 79  ? 20.687 51.631 74.215 1.00 34.99  ? 79  GLU A N   1 
ATOM   378  C CA  . GLU A 1 79  ? 20.398 52.843 73.448 1.00 41.85  ? 79  GLU A CA  1 
ATOM   379  C C   . GLU A 1 79  ? 20.177 52.503 71.965 1.00 51.23  ? 79  GLU A C   1 
ATOM   380  O O   . GLU A 1 79  ? 19.378 53.150 71.278 1.00 54.19  ? 79  GLU A O   1 
ATOM   381  C CB  . GLU A 1 79  ? 21.556 53.837 73.485 1.00 38.64  ? 79  GLU A CB  1 
ATOM   382  C CG  . GLU A 1 79  ? 21.952 54.393 74.815 1.00 38.21  ? 79  GLU A CG  1 
ATOM   383  C CD  . GLU A 1 79  ? 23.034 55.468 74.628 1.00 56.66  ? 79  GLU A CD  1 
ATOM   384  O OE1 . GLU A 1 79  ? 24.227 55.233 74.976 1.00 39.91  ? 79  GLU A OE1 1 
ATOM   385  O OE2 . GLU A 1 79  ? 22.677 56.550 74.101 1.00 44.95  ? 79  GLU A OE2 1 
ATOM   386  N N   . ILE A 1 80  ? 20.910 51.515 71.463 1.00 45.79  ? 80  ILE A N   1 
ATOM   387  C CA  . ILE A 1 80  ? 20.763 51.120 70.076 1.00 48.74  ? 80  ILE A CA  1 
ATOM   388  C C   . ILE A 1 80  ? 19.394 50.478 69.858 1.00 42.77  ? 80  ILE A C   1 
ATOM   389  O O   . ILE A 1 80  ? 18.756 50.730 68.852 1.00 50.86  ? 80  ILE A O   1 
ATOM   390  C CB  . ILE A 1 80  ? 21.871 50.099 69.632 1.00 50.63  ? 80  ILE A CB  1 
ATOM   391  C CG1 . ILE A 1 80  ? 23.203 50.822 69.444 1.00 45.97  ? 80  ILE A CG1 1 
ATOM   392  C CG2 . ILE A 1 80  ? 21.454 49.368 68.324 1.00 34.78  ? 80  ILE A CG2 1 
ATOM   393  C CD1 . ILE A 1 80  ? 24.389 49.861 69.403 1.00 41.37  ? 80  ILE A CD1 1 
ATOM   394  N N   . SER A 1 81  ? 18.948 49.647 70.785 1.00 45.78  ? 81  SER A N   1 
ATOM   395  C CA  . SER A 1 81  ? 17.646 48.981 70.628 1.00 51.81  ? 81  SER A CA  1 
ATOM   396  C C   . SER A 1 81  ? 16.470 49.955 70.761 1.00 52.51  ? 81  SER A C   1 
ATOM   397  O O   . SER A 1 81  ? 15.338 49.620 70.420 1.00 59.80  ? 81  SER A O   1 
ATOM   398  C CB  . SER A 1 81  ? 17.492 47.894 71.681 1.00 45.47  ? 81  SER A CB  1 
ATOM   399  O OG  . SER A 1 81  ? 17.516 48.504 72.960 1.00 45.62  ? 81  SER A OG  1 
ATOM   400  N N   . ARG A 1 82  ? 16.751 51.151 71.263 1.00 50.52  ? 82  ARG A N   1 
ATOM   401  C CA  . ARG A 1 82  ? 15.743 52.181 71.466 1.00 52.73  ? 82  ARG A CA  1 
ATOM   402  C C   . ARG A 1 82  ? 15.890 53.354 70.497 1.00 55.18  ? 82  ARG A C   1 
ATOM   403  O O   . ARG A 1 82  ? 15.188 54.350 70.624 1.00 56.90  ? 82  ARG A O   1 
ATOM   404  C CB  . ARG A 1 82  ? 15.847 52.737 72.886 1.00 52.13  ? 82  ARG A CB  1 
ATOM   405  C CG  . ARG A 1 82  ? 15.333 51.844 73.993 1.00 56.99  ? 82  ARG A CG  1 
ATOM   406  C CD  . ARG A 1 82  ? 15.666 52.482 75.345 1.00 74.74  ? 82  ARG A CD  1 
ATOM   407  N NE  . ARG A 1 82  ? 14.815 51.991 76.421 1.00 86.43  ? 82  ARG A NE  1 
ATOM   408  C CZ  . ARG A 1 82  ? 14.720 50.713 76.771 1.00 101.49 ? 82  ARG A CZ  1 
ATOM   409  N NH1 . ARG A 1 82  ? 15.430 49.792 76.130 1.00 108.22 ? 82  ARG A NH1 1 
ATOM   410  N NH2 . ARG A 1 82  ? 13.903 50.352 77.752 1.00 106.60 ? 82  ARG A NH2 1 
ATOM   411  N N   . GLY A 1 83  ? 16.817 53.261 69.553 1.00 57.02  ? 83  GLY A N   1 
ATOM   412  C CA  . GLY A 1 83  ? 16.996 54.359 68.624 1.00 49.78  ? 83  GLY A CA  1 
ATOM   413  C C   . GLY A 1 83  ? 17.783 55.522 69.192 1.00 51.69  ? 83  GLY A C   1 
ATOM   414  O O   . GLY A 1 83  ? 17.915 56.561 68.539 1.00 59.99  ? 83  GLY A O   1 
ATOM   415  N N   . GLY A 1 84  ? 18.307 55.355 70.404 1.00 46.22  ? 84  GLY A N   1 
ATOM   416  C CA  . GLY A 1 84  ? 19.099 56.404 71.030 1.00 49.71  ? 84  GLY A CA  1 
ATOM   417  C C   . GLY A 1 84  ? 20.429 56.621 70.311 1.00 50.29  ? 84  GLY A C   1 
ATOM   418  O O   . GLY A 1 84  ? 20.994 57.723 70.342 1.00 56.35  ? 84  GLY A O   1 
ATOM   419  N N   . ILE A 1 85  ? 20.937 55.559 69.682 1.00 47.00  ? 85  ILE A N   1 
ATOM   420  C CA  . ILE A 1 85  ? 22.172 55.624 68.906 1.00 47.24  ? 85  ILE A CA  1 
ATOM   421  C C   . ILE A 1 85  ? 21.722 55.262 67.509 1.00 45.36  ? 85  ILE A C   1 
ATOM   422  O O   . ILE A 1 85  ? 21.171 54.193 67.289 1.00 44.75  ? 85  ILE A O   1 
ATOM   423  C CB  . ILE A 1 85  ? 23.259 54.652 69.447 1.00 41.91  ? 85  ILE A CB  1 
ATOM   424  C CG1 . ILE A 1 85  ? 23.727 55.170 70.819 1.00 32.90  ? 85  ILE A CG1 1 
ATOM   425  C CG2 . ILE A 1 85  ? 24.449 54.600 68.480 1.00 31.80  ? 85  ILE A CG2 1 
ATOM   426  C CD1 . ILE A 1 85  ? 24.858 54.436 71.425 1.00 42.61  ? 85  ILE A CD1 1 
ATOM   427  N N   . THR A 1 86  ? 21.955 56.168 66.566 1.00 39.62  ? 86  THR A N   1 
ATOM   428  C CA  . THR A 1 86  ? 21.464 55.971 65.217 1.00 40.61  ? 86  THR A CA  1 
ATOM   429  C C   . THR A 1 86  ? 22.481 55.800 64.104 1.00 48.81  ? 86  THR A C   1 
ATOM   430  O O   . THR A 1 86  ? 22.102 55.745 62.934 1.00 46.56  ? 86  THR A O   1 
ATOM   431  C CB  . THR A 1 86  ? 20.554 57.127 64.861 1.00 40.44  ? 86  THR A CB  1 
ATOM   432  O OG1 . THR A 1 86  ? 21.343 58.318 64.769 1.00 44.77  ? 86  THR A OG1 1 
ATOM   433  C CG2 . THR A 1 86  ? 19.522 57.335 65.979 1.00 33.15  ? 86  THR A CG2 1 
ATOM   434  N N   . SER A 1 87  ? 23.761 55.730 64.456 1.00 41.19  ? 87  SER A N   1 
ATOM   435  C CA  . SER A 1 87  ? 24.809 55.537 63.458 1.00 45.56  ? 87  SER A CA  1 
ATOM   436  C C   . SER A 1 87  ? 26.101 55.041 64.101 1.00 39.59  ? 87  SER A C   1 
ATOM   437  O O   . SER A 1 87  ? 26.357 55.237 65.299 1.00 41.07  ? 87  SER A O   1 
ATOM   438  C CB  . SER A 1 87  ? 25.137 56.840 62.749 1.00 31.78  ? 87  SER A CB  1 
ATOM   439  O OG  . SER A 1 87  ? 25.945 57.615 63.614 1.00 43.09  ? 87  SER A OG  1 
ATOM   440  N N   . PHE A 1 88  ? 26.930 54.422 63.285 1.00 37.75  ? 88  PHE A N   1 
ATOM   441  C CA  . PHE A 1 88  ? 28.198 53.949 63.797 1.00 42.24  ? 88  PHE A CA  1 
ATOM   442  C C   . PHE A 1 88  ? 28.970 55.145 64.374 1.00 31.32  ? 88  PHE A C   1 
ATOM   443  O O   . PHE A 1 88  ? 29.524 55.084 65.455 1.00 38.15  ? 88  PHE A O   1 
ATOM   444  C CB  . PHE A 1 88  ? 29.024 53.300 62.695 1.00 37.41  ? 88  PHE A CB  1 
ATOM   445  C CG  . PHE A 1 88  ? 30.226 52.623 63.217 1.00 38.07  ? 88  PHE A CG  1 
ATOM   446  C CD1 . PHE A 1 88  ? 30.124 51.338 63.751 1.00 37.65  ? 88  PHE A CD1 1 
ATOM   447  C CD2 . PHE A 1 88  ? 31.434 53.310 63.309 1.00 35.56  ? 88  PHE A CD2 1 
ATOM   448  C CE1 . PHE A 1 88  ? 31.211 50.744 64.378 1.00 37.89  ? 88  PHE A CE1 1 
ATOM   449  C CE2 . PHE A 1 88  ? 32.541 52.727 63.943 1.00 39.27  ? 88  PHE A CE2 1 
ATOM   450  C CZ  . PHE A 1 88  ? 32.421 51.440 64.476 1.00 33.35  ? 88  PHE A CZ  1 
ATOM   451  N N   . GLU A 1 89  ? 28.975 56.243 63.647 1.00 38.22  ? 89  GLU A N   1 
ATOM   452  C CA  . GLU A 1 89  ? 29.664 57.435 64.093 1.00 40.12  ? 89  GLU A CA  1 
ATOM   453  C C   . GLU A 1 89  ? 29.253 57.765 65.532 1.00 42.12  ? 89  GLU A C   1 
ATOM   454  O O   . GLU A 1 89  ? 30.070 58.172 66.373 1.00 40.17  ? 89  GLU A O   1 
ATOM   455  C CB  . GLU A 1 89  ? 29.282 58.559 63.146 1.00 47.54  ? 89  GLU A CB  1 
ATOM   456  C CG  . GLU A 1 89  ? 30.293 59.655 62.961 1.00 69.72  ? 89  GLU A CG  1 
ATOM   457  C CD  . GLU A 1 89  ? 30.060 60.405 61.646 1.00 80.21  ? 89  GLU A CD  1 
ATOM   458  O OE1 . GLU A 1 89  ? 30.726 61.441 61.417 1.00 85.01  ? 89  GLU A OE1 1 
ATOM   459  O OE2 . GLU A 1 89  ? 29.214 59.947 60.838 1.00 77.79  ? 89  GLU A OE2 1 
ATOM   460  N N   . GLU A 1 90  ? 27.984 57.563 65.845 1.00 35.60  ? 90  GLU A N   1 
ATOM   461  C CA  . GLU A 1 90  ? 27.542 57.910 67.178 1.00 37.01  ? 90  GLU A CA  1 
ATOM   462  C C   . GLU A 1 90  ? 27.966 56.859 68.182 1.00 30.27  ? 90  GLU A C   1 
ATOM   463  O O   . GLU A 1 90  ? 28.293 57.169 69.343 1.00 32.10  ? 90  GLU A O   1 
ATOM   464  C CB  . GLU A 1 90  ? 26.021 58.118 67.171 1.00 49.25  ? 90  GLU A CB  1 
ATOM   465  C CG  . GLU A 1 90  ? 25.387 58.347 68.526 1.00 55.38  ? 90  GLU A CG  1 
ATOM   466  C CD  . GLU A 1 90  ? 23.919 58.751 68.419 1.00 70.44  ? 90  GLU A CD  1 
ATOM   467  O OE1 . GLU A 1 90  ? 23.207 58.225 67.527 1.00 66.82  ? 90  GLU A OE1 1 
ATOM   468  O OE2 . GLU A 1 90  ? 23.481 59.591 69.238 1.00 77.23  ? 90  GLU A OE2 1 
ATOM   469  N N   . LEU A 1 91  ? 27.931 55.605 67.754 1.00 31.66  ? 91  LEU A N   1 
ATOM   470  C CA  . LEU A 1 91  ? 28.357 54.547 68.646 1.00 31.32  ? 91  LEU A CA  1 
ATOM   471  C C   . LEU A 1 91  ? 29.862 54.780 68.965 1.00 29.67  ? 91  LEU A C   1 
ATOM   472  O O   . LEU A 1 91  ? 30.296 54.701 70.122 1.00 31.04  ? 91  LEU A O   1 
ATOM   473  C CB  . LEU A 1 91  ? 28.140 53.203 67.969 1.00 28.47  ? 91  LEU A CB  1 
ATOM   474  C CG  . LEU A 1 91  ? 28.595 51.975 68.757 1.00 39.92  ? 91  LEU A CG  1 
ATOM   475  C CD1 . LEU A 1 91  ? 28.052 52.054 70.159 1.00 40.14  ? 91  LEU A CD1 1 
ATOM   476  C CD2 . LEU A 1 91  ? 28.131 50.681 68.053 1.00 42.04  ? 91  LEU A CD2 1 
ATOM   477  N N   . TRP A 1 92  ? 30.637 55.108 67.940 1.00 32.10  ? 92  TRP A N   1 
ATOM   478  C CA  . TRP A 1 92  ? 32.048 55.319 68.128 1.00 38.03  ? 92  TRP A CA  1 
ATOM   479  C C   . TRP A 1 92  ? 32.237 56.449 69.114 1.00 44.85  ? 92  TRP A C   1 
ATOM   480  O O   . TRP A 1 92  ? 33.130 56.385 69.972 1.00 37.56  ? 92  TRP A O   1 
ATOM   481  C CB  . TRP A 1 92  ? 32.717 55.632 66.797 1.00 38.28  ? 92  TRP A CB  1 
ATOM   482  C CG  . TRP A 1 92  ? 34.218 55.627 66.879 1.00 38.29  ? 92  TRP A CG  1 
ATOM   483  C CD1 . TRP A 1 92  ? 35.025 56.707 67.047 1.00 32.46  ? 92  TRP A CD1 1 
ATOM   484  C CD2 . TRP A 1 92  ? 35.086 54.488 66.764 1.00 36.08  ? 92  TRP A CD2 1 
ATOM   485  N NE1 . TRP A 1 92  ? 36.338 56.322 67.039 1.00 39.28  ? 92  TRP A NE1 1 
ATOM   486  C CE2 . TRP A 1 92  ? 36.411 54.966 66.858 1.00 36.62  ? 92  TRP A CE2 1 
ATOM   487  C CE3 . TRP A 1 92  ? 34.873 53.115 66.580 1.00 34.90  ? 92  TRP A CE3 1 
ATOM   488  C CZ2 . TRP A 1 92  ? 37.533 54.118 66.767 1.00 36.18  ? 92  TRP A CZ2 1 
ATOM   489  C CZ3 . TRP A 1 92  ? 35.987 52.261 66.484 1.00 38.84  ? 92  TRP A CZ3 1 
ATOM   490  C CH2 . TRP A 1 92  ? 37.303 52.772 66.579 1.00 37.78  ? 92  TRP A CH2 1 
ATOM   491  N N   . GLY A 1 93  ? 31.380 57.468 69.002 1.00 44.58  ? 93  GLY A N   1 
ATOM   492  C CA  . GLY A 1 93  ? 31.453 58.598 69.914 1.00 31.37  ? 93  GLY A CA  1 
ATOM   493  C C   . GLY A 1 93  ? 31.196 58.140 71.339 1.00 36.44  ? 93  GLY A C   1 
ATOM   494  O O   . GLY A 1 93  ? 31.867 58.558 72.293 1.00 36.96  ? 93  GLY A O   1 
ATOM   495  N N   . ARG A 1 94  ? 30.212 57.264 71.501 1.00 34.17  ? 94  ARG A N   1 
ATOM   496  C CA  . ARG A 1 94  ? 29.911 56.778 72.835 1.00 30.48  ? 94  ARG A CA  1 
ATOM   497  C C   . ARG A 1 94  ? 31.100 55.963 73.368 1.00 43.75  ? 94  ARG A C   1 
ATOM   498  O O   . ARG A 1 94  ? 31.481 56.128 74.521 1.00 40.94  ? 94  ARG A O   1 
ATOM   499  C CB  . ARG A 1 94  ? 28.657 55.900 72.812 1.00 30.52  ? 94  ARG A CB  1 
ATOM   500  C CG  . ARG A 1 94  ? 28.318 55.294 74.166 1.00 27.20  ? 94  ARG A CG  1 
ATOM   501  C CD  . ARG A 1 94  ? 27.688 56.327 75.123 1.00 41.27  ? 94  ARG A CD  1 
ATOM   502  N NE  . ARG A 1 94  ? 26.386 56.746 74.602 1.00 47.96  ? 94  ARG A NE  1 
ATOM   503  C CZ  . ARG A 1 94  ? 26.199 57.804 73.819 1.00 56.64  ? 94  ARG A CZ  1 
ATOM   504  N NH1 . ARG A 1 94  ? 24.969 58.104 73.364 1.00 41.37  ? 94  ARG A NH1 1 
ATOM   505  N NH2 . ARG A 1 94  ? 27.240 58.582 73.518 1.00 36.99  ? 94  ARG A NH2 1 
ATOM   506  N N   . ALA A 1 95  ? 31.660 55.080 72.527 1.00 37.73  ? 95  ALA A N   1 
ATOM   507  C CA  . ALA A 1 95  ? 32.806 54.246 72.906 1.00 45.22  ? 95  ALA A CA  1 
ATOM   508  C C   . ALA A 1 95  ? 34.013 55.118 73.312 1.00 36.56  ? 95  ALA A C   1 
ATOM   509  O O   . ALA A 1 95  ? 34.732 54.812 74.251 1.00 48.04  ? 95  ALA A O   1 
ATOM   510  C CB  . ALA A 1 95  ? 33.192 53.326 71.733 1.00 32.17  ? 95  ALA A CB  1 
ATOM   511  N N   . THR A 1 96  ? 34.198 56.222 72.607 1.00 38.33  ? 96  THR A N   1 
ATOM   512  C CA  . THR A 1 96  ? 35.298 57.129 72.860 1.00 34.73  ? 96  THR A CA  1 
ATOM   513  C C   . THR A 1 96  ? 35.235 57.853 74.201 1.00 46.14  ? 96  THR A C   1 
ATOM   514  O O   . THR A 1 96  ? 36.253 57.954 74.909 1.00 38.33  ? 96  THR A O   1 
ATOM   515  C CB  . THR A 1 96  ? 35.368 58.135 71.723 1.00 43.73  ? 96  THR A CB  1 
ATOM   516  O OG1 . THR A 1 96  ? 35.560 57.412 70.508 1.00 40.68  ? 96  THR A OG1 1 
ATOM   517  C CG2 . THR A 1 96  ? 36.515 59.105 71.903 1.00 39.09  ? 96  THR A CG2 1 
ATOM   518  N N   . GLU A 1 97  ? 34.047 58.364 74.543 1.00 45.06  ? 97  GLU A N   1 
ATOM   519  C CA  . GLU A 1 97  ? 33.848 59.064 75.809 1.00 42.30  ? 97  GLU A CA  1 
ATOM   520  C C   . GLU A 1 97  ? 34.009 58.064 76.950 1.00 35.17  ? 97  GLU A C   1 
ATOM   521  O O   . GLU A 1 97  ? 34.561 58.391 78.007 1.00 45.28  ? 97  GLU A O   1 
ATOM   522  C CB  . GLU A 1 97  ? 32.468 59.746 75.834 1.00 40.70  ? 97  GLU A CB  1 
ATOM   523  C CG  . GLU A 1 97  ? 32.385 60.883 74.823 1.00 44.22  ? 97  GLU A CG  1 
ATOM   524  C CD  . GLU A 1 97  ? 31.247 61.864 75.078 1.00 50.63  ? 97  GLU A CD  1 
ATOM   525  O OE1 . GLU A 1 97  ? 31.074 62.289 76.244 1.00 53.36  ? 97  GLU A OE1 1 
ATOM   526  O OE2 . GLU A 1 97  ? 30.538 62.227 74.108 1.00 47.77  ? 97  GLU A OE2 1 
ATOM   527  N N   . TRP A 1 98  ? 33.555 56.836 76.736 1.00 36.14  ? 98  TRP A N   1 
ATOM   528  C CA  . TRP A 1 98  ? 33.737 55.807 77.751 1.00 36.20  ? 98  TRP A CA  1 
ATOM   529  C C   . TRP A 1 98  ? 35.251 55.571 77.930 1.00 39.09  ? 98  TRP A C   1 
ATOM   530  O O   . TRP A 1 98  ? 35.757 55.465 79.044 1.00 43.34  ? 98  TRP A O   1 
ATOM   531  C CB  . TRP A 1 98  ? 33.118 54.488 77.309 1.00 38.12  ? 98  TRP A CB  1 
ATOM   532  C CG  . TRP A 1 98  ? 33.578 53.378 78.175 1.00 38.32  ? 98  TRP A CG  1 
ATOM   533  C CD1 . TRP A 1 98  ? 33.052 52.997 79.372 1.00 47.26  ? 98  TRP A CD1 1 
ATOM   534  C CD2 . TRP A 1 98  ? 34.756 52.593 77.988 1.00 46.80  ? 98  TRP A CD2 1 
ATOM   535  N NE1 . TRP A 1 98  ? 33.834 52.024 79.953 1.00 39.40  ? 98  TRP A NE1 1 
ATOM   536  C CE2 . TRP A 1 98  ? 34.891 51.761 79.125 1.00 48.06  ? 98  TRP A CE2 1 
ATOM   537  C CE3 . TRP A 1 98  ? 35.717 52.516 76.974 1.00 39.69  ? 98  TRP A CE3 1 
ATOM   538  C CZ2 . TRP A 1 98  ? 35.952 50.866 79.276 1.00 55.85  ? 98  TRP A CZ2 1 
ATOM   539  C CZ3 . TRP A 1 98  ? 36.775 51.626 77.123 1.00 49.64  ? 98  TRP A CZ3 1 
ATOM   540  C CH2 . TRP A 1 98  ? 36.884 50.811 78.269 1.00 51.80  ? 98  TRP A CH2 1 
ATOM   541  N N   . ARG A 1 99  ? 35.948 55.444 76.810 1.00 42.63  ? 99  ARG A N   1 
ATOM   542  C CA  . ARG A 1 99  ? 37.384 55.219 76.828 1.00 48.88  ? 99  ARG A CA  1 
ATOM   543  C C   . ARG A 1 99  ? 38.146 56.402 77.457 1.00 45.46  ? 99  ARG A C   1 
ATOM   544  O O   . ARG A 1 99  ? 39.044 56.209 78.275 1.00 41.11  ? 99  ARG A O   1 
ATOM   545  C CB  . ARG A 1 99  ? 37.871 54.966 75.412 1.00 41.08  ? 99  ARG A CB  1 
ATOM   546  C CG  . ARG A 1 99  ? 39.350 54.732 75.324 1.00 46.19  ? 99  ARG A CG  1 
ATOM   547  C CD  . ARG A 1 99  ? 39.719 53.468 76.038 1.00 34.31  ? 99  ARG A CD  1 
ATOM   548  N NE  . ARG A 1 99  ? 40.777 53.751 76.985 1.00 62.54  ? 99  ARG A NE  1 
ATOM   549  C CZ  . ARG A 1 99  ? 41.914 53.083 77.035 1.00 59.02  ? 99  ARG A CZ  1 
ATOM   550  N NH1 . ARG A 1 99  ? 42.126 52.079 76.198 1.00 77.12  ? 99  ARG A NH1 1 
ATOM   551  N NH2 . ARG A 1 99  ? 42.856 53.457 77.876 1.00 50.97  ? 99  ARG A NH2 1 
ATOM   552  N N   . LEU A 1 100 ? 37.787 57.623 77.087 1.00 43.23  ? 100 LEU A N   1 
ATOM   553  C CA  . LEU A 1 100 ? 38.452 58.781 77.664 1.00 42.30  ? 100 LEU A CA  1 
ATOM   554  C C   . LEU A 1 100 ? 38.244 58.839 79.174 1.00 48.49  ? 100 LEU A C   1 
ATOM   555  O O   . LEU A 1 100 ? 39.061 59.422 79.892 1.00 48.33  ? 100 LEU A O   1 
ATOM   556  C CB  . LEU A 1 100 ? 37.911 60.081 77.061 1.00 43.07  ? 100 LEU A CB  1 
ATOM   557  C CG  . LEU A 1 100 ? 38.258 60.420 75.621 1.00 48.90  ? 100 LEU A CG  1 
ATOM   558  C CD1 . LEU A 1 100 ? 37.486 61.655 75.222 1.00 37.90  ? 100 LEU A CD1 1 
ATOM   559  C CD2 . LEU A 1 100 ? 39.761 60.645 75.487 1.00 42.93  ? 100 LEU A CD2 1 
ATOM   560  N N   . SER A 1 101 ? 37.169 58.225 79.664 1.00 45.98  ? 101 SER A N   1 
ATOM   561  C CA  . SER A 1 101 ? 36.879 58.292 81.095 1.00 50.71  ? 101 SER A CA  1 
ATOM   562  C C   . SER A 1 101 ? 37.810 57.448 81.949 1.00 52.11  ? 101 SER A C   1 
ATOM   563  O O   . SER A 1 101 ? 37.946 57.680 83.157 1.00 51.57  ? 101 SER A O   1 
ATOM   564  C CB  . SER A 1 101 ? 35.423 57.888 81.361 1.00 48.28  ? 101 SER A CB  1 
ATOM   565  O OG  . SER A 1 101 ? 35.343 56.523 81.732 1.00 51.40  ? 101 SER A OG  1 
ATOM   566  N N   . LYS A 1 102 ? 38.454 56.468 81.321 1.00 55.65  ? 102 LYS A N   1 
ATOM   567  C CA  . LYS A 1 102 ? 39.355 55.581 82.038 1.00 50.92  ? 102 LYS A CA  1 
ATOM   568  C C   . LYS A 1 102 ? 40.767 56.115 82.093 1.00 47.66  ? 102 LYS A C   1 
ATOM   569  O O   . LYS A 1 102 ? 41.618 55.551 82.764 1.00 64.25  ? 102 LYS A O   1 
ATOM   570  C CB  . LYS A 1 102 ? 39.358 54.202 81.404 1.00 45.35  ? 102 LYS A CB  1 
ATOM   571  C CG  . LYS A 1 102 ? 37.985 53.581 81.307 1.00 54.68  ? 102 LYS A CG  1 
ATOM   572  C CD  . LYS A 1 102 ? 37.356 53.345 82.671 1.00 51.14  ? 102 LYS A CD  1 
ATOM   573  C CE  . LYS A 1 102 ? 35.855 53.566 82.584 1.00 55.42  ? 102 LYS A CE  1 
ATOM   574  N NZ  . LYS A 1 102 ? 35.156 53.317 83.863 1.00 53.87  ? 102 LYS A NZ  1 
ATOM   575  N N   . LEU A 1 103 ? 41.020 57.210 81.404 1.00 48.65  ? 103 LEU A N   1 
ATOM   576  C CA  . LEU A 1 103 ? 42.347 57.792 81.421 1.00 51.33  ? 103 LEU A CA  1 
ATOM   577  C C   . LEU A 1 103 ? 42.617 58.486 82.748 1.00 63.09  ? 103 LEU A C   1 
ATOM   578  O O   . LEU A 1 103 ? 41.726 59.139 83.312 1.00 63.69  ? 103 LEU A O   1 
ATOM   579  C CB  . LEU A 1 103 ? 42.485 58.824 80.309 1.00 48.46  ? 103 LEU A CB  1 
ATOM   580  C CG  . LEU A 1 103 ? 42.379 58.366 78.864 1.00 51.32  ? 103 LEU A CG  1 
ATOM   581  C CD1 . LEU A 1 103 ? 42.437 59.589 77.987 1.00 49.52  ? 103 LEU A CD1 1 
ATOM   582  C CD2 . LEU A 1 103 ? 43.491 57.389 78.524 1.00 54.22  ? 103 LEU A CD2 1 
ATOM   583  N N   . GLN A 1 104 ? 43.855 58.361 83.226 1.00 68.59  ? 104 GLN A N   1 
ATOM   584  C CA  . GLN A 1 104 ? 44.289 59.000 84.467 1.00 70.59  ? 104 GLN A CA  1 
ATOM   585  C C   . GLN A 1 104 ? 44.181 60.489 84.261 1.00 69.88  ? 104 GLN A C   1 
ATOM   586  O O   . GLN A 1 104 ? 44.395 60.978 83.159 1.00 76.33  ? 104 GLN A O   1 
ATOM   587  C CB  . GLN A 1 104 ? 45.743 58.644 84.778 1.00 78.85  ? 104 GLN A CB  1 
ATOM   588  C CG  . GLN A 1 104 ? 45.891 57.602 85.872 1.00 88.79  ? 104 GLN A CG  1 
ATOM   589  C CD  . GLN A 1 104 ? 45.062 56.359 85.606 1.00 97.15  ? 104 GLN A CD  1 
ATOM   590  O OE1 . GLN A 1 104 ? 45.328 55.607 84.664 1.00 103.56 ? 104 GLN A OE1 1 
ATOM   591  N NE2 . GLN A 1 104 ? 44.044 56.141 86.434 1.00 100.84 ? 104 GLN A NE2 1 
ATOM   592  N N   . ARG A 1 105 ? 43.842 61.222 85.309 1.00 75.88  ? 105 ARG A N   1 
ATOM   593  C CA  . ARG A 1 105 ? 43.712 62.662 85.152 1.00 80.78  ? 105 ARG A CA  1 
ATOM   594  C C   . ARG A 1 105 ? 45.031 63.260 84.673 1.00 80.60  ? 105 ARG A C   1 
ATOM   595  O O   . ARG A 1 105 ? 46.107 62.698 84.905 1.00 74.03  ? 105 ARG A O   1 
ATOM   596  C CB  . ARG A 1 105 ? 43.257 63.307 86.465 1.00 86.09  ? 105 ARG A CB  1 
ATOM   597  C CG  . ARG A 1 105 ? 43.223 64.823 86.417 1.00 92.54  ? 105 ARG A CG  1 
ATOM   598  C CD  . ARG A 1 105 ? 42.396 65.420 87.549 1.00 92.47  ? 105 ARG A CD  1 
ATOM   599  N NE  . ARG A 1 105 ? 42.839 66.776 87.869 1.00 84.98  ? 105 ARG A NE  1 
ATOM   600  C CZ  . ARG A 1 105 ? 44.015 67.046 88.428 1.00 80.49  ? 105 ARG A CZ  1 
ATOM   601  N NH1 . ARG A 1 105 ? 44.844 66.051 88.720 1.00 71.51  ? 105 ARG A NH1 1 
ATOM   602  N NH2 . ARG A 1 105 ? 44.362 68.298 88.697 1.00 73.99  ? 105 ARG A NH2 1 
ATOM   603  N N   . GLY A 1 106 ? 44.939 64.385 83.974 1.00 80.80  ? 106 GLY A N   1 
ATOM   604  C CA  . GLY A 1 106 ? 46.133 65.031 83.466 1.00 82.38  ? 106 GLY A CA  1 
ATOM   605  C C   . GLY A 1 106 ? 46.895 64.206 82.443 1.00 83.94  ? 106 GLY A C   1 
ATOM   606  O O   . GLY A 1 106 ? 48.035 64.533 82.103 1.00 84.65  ? 106 GLY A O   1 
ATOM   607  N N   . GLU A 1 107 ? 46.274 63.140 81.943 1.00 83.63  ? 107 GLU A N   1 
ATOM   608  C CA  . GLU A 1 107 ? 46.917 62.281 80.954 1.00 77.83  ? 107 GLU A CA  1 
ATOM   609  C C   . GLU A 1 107 ? 47.238 63.072 79.671 1.00 78.81  ? 107 GLU A C   1 
ATOM   610  O O   . GLU A 1 107 ? 46.370 63.722 79.082 1.00 76.50  ? 107 GLU A O   1 
ATOM   611  C CB  . GLU A 1 107 ? 46.014 61.091 80.641 1.00 78.88  ? 107 GLU A CB  1 
ATOM   612  C CG  . GLU A 1 107 ? 46.759 59.777 80.453 1.00 91.67  ? 107 GLU A CG  1 
ATOM   613  C CD  . GLU A 1 107 ? 47.724 59.836 79.294 1.00 94.22  ? 107 GLU A CD  1 
ATOM   614  O OE1 . GLU A 1 107 ? 47.335 60.400 78.258 1.00 102.21 ? 107 GLU A OE1 1 
ATOM   615  O OE2 . GLU A 1 107 ? 48.858 59.323 79.408 1.00 95.54  ? 107 GLU A OE2 1 
ATOM   616  N N   . PRO A 1 108 ? 48.510 63.035 79.238 1.00 76.17  ? 108 PRO A N   1 
ATOM   617  C CA  . PRO A 1 108 ? 49.023 63.719 78.045 1.00 71.30  ? 108 PRO A CA  1 
ATOM   618  C C   . PRO A 1 108 ? 48.443 63.204 76.719 1.00 65.89  ? 108 PRO A C   1 
ATOM   619  O O   . PRO A 1 108 ? 48.207 63.975 75.789 1.00 53.40  ? 108 PRO A O   1 
ATOM   620  C CB  . PRO A 1 108 ? 50.523 63.478 78.149 1.00 72.92  ? 108 PRO A CB  1 
ATOM   621  C CG  . PRO A 1 108 ? 50.579 62.102 78.765 1.00 74.00  ? 108 PRO A CG  1 
ATOM   622  C CD  . PRO A 1 108 ? 49.582 62.256 79.885 1.00 70.88  ? 108 PRO A CD  1 
ATOM   623  N N   . LEU A 1 109 ? 48.238 61.894 76.641 1.00 63.90  ? 109 LEU A N   1 
ATOM   624  C CA  . LEU A 1 109 ? 47.672 61.251 75.455 1.00 63.73  ? 109 LEU A CA  1 
ATOM   625  C C   . LEU A 1 109 ? 46.168 61.488 75.325 1.00 59.12  ? 109 LEU A C   1 
ATOM   626  O O   . LEU A 1 109 ? 45.550 61.047 74.355 1.00 55.97  ? 109 LEU A O   1 
ATOM   627  C CB  . LEU A 1 109 ? 47.900 59.737 75.515 1.00 59.45  ? 109 LEU A CB  1 
ATOM   628  C CG  . LEU A 1 109 ? 49.311 59.214 75.281 1.00 67.90  ? 109 LEU A CG  1 
ATOM   629  C CD1 . LEU A 1 109 ? 49.304 57.687 75.322 1.00 67.24  ? 109 LEU A CD1 1 
ATOM   630  C CD2 . LEU A 1 109 ? 49.802 59.715 73.931 1.00 55.00  ? 109 LEU A CD2 1 
ATOM   631  N N   . TYR A 1 110 ? 45.581 62.161 76.309 1.00 58.81  ? 110 TYR A N   1 
ATOM   632  C CA  . TYR A 1 110 ? 44.146 62.414 76.299 1.00 62.76  ? 110 TYR A CA  1 
ATOM   633  C C   . TYR A 1 110 ? 43.606 62.873 74.945 1.00 60.52  ? 110 TYR A C   1 
ATOM   634  O O   . TYR A 1 110 ? 42.616 62.352 74.445 1.00 59.35  ? 110 TYR A O   1 
ATOM   635  C CB  . TYR A 1 110 ? 43.777 63.468 77.335 1.00 58.78  ? 110 TYR A CB  1 
ATOM   636  C CG  . TYR A 1 110 ? 42.286 63.690 77.411 1.00 59.43  ? 110 TYR A CG  1 
ATOM   637  C CD1 . TYR A 1 110 ? 41.494 62.941 78.276 1.00 58.38  ? 110 TYR A CD1 1 
ATOM   638  C CD2 . TYR A 1 110 ? 41.658 64.627 76.589 1.00 62.57  ? 110 TYR A CD2 1 
ATOM   639  C CE1 . TYR A 1 110 ? 40.125 63.119 78.324 1.00 48.76  ? 110 TYR A CE1 1 
ATOM   640  C CE2 . TYR A 1 110 ? 40.286 64.811 76.626 1.00 53.14  ? 110 TYR A CE2 1 
ATOM   641  C CZ  . TYR A 1 110 ? 39.527 64.056 77.496 1.00 52.14  ? 110 TYR A CZ  1 
ATOM   642  O OH  . TYR A 1 110 ? 38.168 64.257 77.556 1.00 61.67  ? 110 TYR A OH  1 
ATOM   643  N N   . SER A 1 111 ? 44.255 63.865 74.363 1.00 53.09  ? 111 SER A N   1 
ATOM   644  C CA  . SER A 1 111 ? 43.826 64.396 73.088 1.00 58.86  ? 111 SER A CA  1 
ATOM   645  C C   . SER A 1 111 ? 43.847 63.356 71.952 1.00 58.31  ? 111 SER A C   1 
ATOM   646  O O   . SER A 1 111 ? 42.934 63.304 71.116 1.00 54.95  ? 111 SER A O   1 
ATOM   647  C CB  . SER A 1 111 ? 44.712 65.580 72.732 1.00 62.81  ? 111 SER A CB  1 
ATOM   648  O OG  . SER A 1 111 ? 44.213 66.228 71.588 1.00 74.20  ? 111 SER A OG  1 
ATOM   649  N N   . ALA A 1 112 ? 44.885 62.530 71.927 1.00 46.72  ? 112 ALA A N   1 
ATOM   650  C CA  . ALA A 1 112 ? 45.021 61.511 70.897 1.00 49.75  ? 112 ALA A CA  1 
ATOM   651  C C   . ALA A 1 112 ? 43.881 60.502 71.001 1.00 44.73  ? 112 ALA A C   1 
ATOM   652  O O   . ALA A 1 112 ? 43.423 59.963 69.996 1.00 51.26  ? 112 ALA A O   1 
ATOM   653  C CB  . ALA A 1 112 ? 46.380 60.789 71.033 1.00 40.85  ? 112 ALA A CB  1 
ATOM   654  N N   . PHE A 1 113 ? 43.453 60.228 72.228 1.00 51.14  ? 113 PHE A N   1 
ATOM   655  C CA  . PHE A 1 113 ? 42.365 59.293 72.477 1.00 48.66  ? 113 PHE A CA  1 
ATOM   656  C C   . PHE A 1 113 ? 41.024 59.870 72.042 1.00 47.77  ? 113 PHE A C   1 
ATOM   657  O O   . PHE A 1 113 ? 40.079 59.137 71.794 1.00 38.55  ? 113 PHE A O   1 
ATOM   658  C CB  . PHE A 1 113 ? 42.284 58.955 73.957 1.00 41.47  ? 113 PHE A CB  1 
ATOM   659  C CG  . PHE A 1 113 ? 43.195 57.858 74.371 1.00 42.14  ? 113 PHE A CG  1 
ATOM   660  C CD1 . PHE A 1 113 ? 44.472 58.142 74.871 1.00 43.02  ? 113 PHE A CD1 1 
ATOM   661  C CD2 . PHE A 1 113 ? 42.779 56.532 74.279 1.00 38.85  ? 113 PHE A CD2 1 
ATOM   662  C CE1 . PHE A 1 113 ? 45.332 57.112 75.284 1.00 40.16  ? 113 PHE A CE1 1 
ATOM   663  C CE2 . PHE A 1 113 ? 43.625 55.483 74.687 1.00 43.73  ? 113 PHE A CE2 1 
ATOM   664  C CZ  . PHE A 1 113 ? 44.909 55.777 75.192 1.00 34.74  ? 113 PHE A CZ  1 
ATOM   665  N N   . ALA A 1 114 ? 40.964 61.188 71.934 1.00 46.90  ? 114 ALA A N   1 
ATOM   666  C CA  . ALA A 1 114 ? 39.741 61.859 71.549 1.00 50.17  ? 114 ALA A CA  1 
ATOM   667  C C   . ALA A 1 114 ? 39.803 62.306 70.102 1.00 55.07  ? 114 ALA A C   1 
ATOM   668  O O   . ALA A 1 114 ? 38.861 62.916 69.592 1.00 58.35  ? 114 ALA A O   1 
ATOM   669  C CB  . ALA A 1 114 ? 39.540 63.062 72.438 1.00 51.89  ? 114 ALA A CB  1 
ATOM   670  N N   . SER A 1 115 ? 40.896 61.987 69.421 1.00 50.50  ? 115 SER A N   1 
ATOM   671  C CA  . SER A 1 115 ? 41.039 62.457 68.057 1.00 51.54  ? 115 SER A CA  1 
ATOM   672  C C   . SER A 1 115 ? 41.201 61.457 66.939 1.00 51.67  ? 115 SER A C   1 
ATOM   673  O O   . SER A 1 115 ? 41.839 60.413 67.076 1.00 52.53  ? 115 SER A O   1 
ATOM   674  C CB  . SER A 1 115 ? 42.199 63.457 67.976 1.00 55.26  ? 115 SER A CB  1 
ATOM   675  O OG  . SER A 1 115 ? 42.021 64.541 68.874 1.00 48.46  ? 115 SER A OG  1 
ATOM   676  N N   . GLU A 1 116 ? 40.613 61.832 65.813 1.00 50.50  ? 116 GLU A N   1 
ATOM   677  C CA  . GLU A 1 116 ? 40.678 61.054 64.602 1.00 51.99  ? 116 GLU A CA  1 
ATOM   678  C C   . GLU A 1 116 ? 42.074 61.241 64.037 1.00 53.55  ? 116 GLU A C   1 
ATOM   679  O O   . GLU A 1 116 ? 42.660 62.328 64.094 1.00 53.48  ? 116 GLU A O   1 
ATOM   680  C CB  . GLU A 1 116 ? 39.654 61.550 63.586 1.00 44.67  ? 116 GLU A CB  1 
ATOM   681  C CG  . GLU A 1 116 ? 39.601 60.690 62.343 1.00 71.43  ? 116 GLU A CG  1 
ATOM   682  C CD  . GLU A 1 116 ? 38.306 60.846 61.570 1.00 77.86  ? 116 GLU A CD  1 
ATOM   683  O OE1 . GLU A 1 116 ? 37.261 60.315 62.016 1.00 74.76  ? 116 GLU A OE1 1 
ATOM   684  O OE2 . GLU A 1 116 ? 38.339 61.506 60.514 1.00 87.43  ? 116 GLU A OE2 1 
ATOM   685  N N   . ARG A 1 117 ? 42.601 60.161 63.497 1.00 45.70  ? 117 ARG A N   1 
ATOM   686  C CA  . ARG A 1 117 ? 43.916 60.159 62.908 1.00 45.30  ? 117 ARG A CA  1 
ATOM   687  C C   . ARG A 1 117 ? 43.858 61.027 61.633 1.00 44.94  ? 117 ARG A C   1 
ATOM   688  O O   . ARG A 1 117 ? 42.820 61.139 60.985 1.00 47.62  ? 117 ARG A O   1 
ATOM   689  C CB  . ARG A 1 117 ? 44.252 58.696 62.599 1.00 45.82  ? 117 ARG A CB  1 
ATOM   690  C CG  . ARG A 1 117 ? 45.691 58.307 62.622 1.00 52.64  ? 117 ARG A CG  1 
ATOM   691  C CD  . ARG A 1 117 ? 45.827 56.862 63.065 1.00 45.37  ? 117 ARG A CD  1 
ATOM   692  N NE  . ARG A 1 117 ? 45.135 55.882 62.210 1.00 41.68  ? 117 ARG A NE  1 
ATOM   693  C CZ  . ARG A 1 117 ? 45.472 55.580 60.957 1.00 43.06  ? 117 ARG A CZ  1 
ATOM   694  N NH1 . ARG A 1 117 ? 44.775 54.659 60.296 1.00 44.54  ? 117 ARG A NH1 1 
ATOM   695  N NH2 . ARG A 1 117 ? 46.484 56.200 60.351 1.00 34.93  ? 117 ARG A NH2 1 
ATOM   696  N N   . THR A 1 118 ? 44.957 61.675 61.288 1.00 52.06  ? 118 THR A N   1 
ATOM   697  C CA  . THR A 1 118 ? 44.994 62.476 60.064 1.00 51.09  ? 118 THR A CA  1 
ATOM   698  C C   . THR A 1 118 ? 46.227 62.054 59.256 1.00 59.13  ? 118 THR A C   1 
ATOM   699  O O   . THR A 1 118 ? 47.085 61.302 59.749 1.00 49.80  ? 118 THR A O   1 
ATOM   700  C CB  . THR A 1 118 ? 45.090 63.979 60.357 1.00 53.39  ? 118 THR A CB  1 
ATOM   701  O OG1 . THR A 1 118 ? 46.387 64.285 60.885 1.00 63.94  ? 118 THR A OG1 1 
ATOM   702  C CG2 . THR A 1 118 ? 44.039 64.392 61.363 1.00 60.61  ? 118 THR A CG2 1 
ATOM   703  N N   . SER A 1 119 ? 46.307 62.539 58.020 1.00 64.70  ? 119 SER A N   1 
ATOM   704  C CA  . SER A 1 119 ? 47.408 62.220 57.114 1.00 73.55  ? 119 SER A CA  1 
ATOM   705  C C   . SER A 1 119 ? 48.778 62.365 57.756 1.00 78.23  ? 119 SER A C   1 
ATOM   706  O O   . SER A 1 119 ? 49.573 61.425 57.800 1.00 81.41  ? 119 SER A O   1 
ATOM   707  C CB  . SER A 1 119 ? 47.326 63.107 55.886 1.00 69.85  ? 119 SER A CB  1 
ATOM   708  O OG  . SER A 1 119 ? 46.082 62.902 55.240 1.00 91.08  ? 119 SER A OG  1 
ATOM   709  N N   . ASP A 1 120 ? 49.057 63.549 58.257 1.00 75.63  ? 120 ASP A N   1 
ATOM   710  C CA  . ASP A 1 120 ? 50.330 63.784 58.892 1.00 80.93  ? 120 ASP A CA  1 
ATOM   711  C C   . ASP A 1 120 ? 50.235 63.613 60.407 1.00 83.25  ? 120 ASP A C   1 
ATOM   712  O O   . ASP A 1 120 ? 50.454 64.555 61.169 1.00 85.76  ? 120 ASP A O   1 
ATOM   713  C CB  . ASP A 1 120 ? 50.813 65.181 58.517 1.00 88.31  ? 120 ASP A CB  1 
ATOM   714  C CG  . ASP A 1 120 ? 49.664 66.120 58.220 1.00 90.63  ? 120 ASP A CG  1 
ATOM   715  O OD1 . ASP A 1 120 ? 49.170 66.785 59.161 1.00 84.63  ? 120 ASP A OD1 1 
ATOM   716  O OD2 . ASP A 1 120 ? 49.241 66.166 57.040 1.00 91.85  ? 120 ASP A OD2 1 
ATOM   717  N N   . THR A 1 121 ? 49.892 62.403 60.834 1.00 77.42  ? 121 THR A N   1 
ATOM   718  C CA  . THR A 1 121 ? 49.789 62.081 62.250 1.00 75.55  ? 121 THR A CA  1 
ATOM   719  C C   . THR A 1 121 ? 50.413 60.685 62.345 1.00 75.11  ? 121 THR A C   1 
ATOM   720  O O   . THR A 1 121 ? 50.463 59.982 61.339 1.00 81.09  ? 121 THR A O   1 
ATOM   721  C CB  . THR A 1 121 ? 48.290 62.101 62.723 1.00 73.95  ? 121 THR A CB  1 
ATOM   722  O OG1 . THR A 1 121 ? 48.242 62.325 64.130 1.00 76.70  ? 121 THR A OG1 1 
ATOM   723  C CG2 . THR A 1 121 ? 47.588 60.797 62.439 1.00 68.92  ? 121 THR A CG2 1 
ATOM   724  N N   . ASP A 1 122 ? 50.899 60.278 63.516 1.00 72.19  ? 122 ASP A N   1 
ATOM   725  C CA  . ASP A 1 122 ? 51.537 58.962 63.640 1.00 73.44  ? 122 ASP A CA  1 
ATOM   726  C C   . ASP A 1 122 ? 50.766 57.849 62.924 1.00 73.80  ? 122 ASP A C   1 
ATOM   727  O O   . ASP A 1 122 ? 49.549 57.735 63.072 1.00 81.14  ? 122 ASP A O   1 
ATOM   728  C CB  . ASP A 1 122 ? 51.719 58.581 65.111 1.00 74.96  ? 122 ASP A CB  1 
ATOM   729  C CG  . ASP A 1 122 ? 52.537 57.302 65.288 1.00 79.78  ? 122 ASP A CG  1 
ATOM   730  O OD1 . ASP A 1 122 ? 52.462 56.676 66.372 1.00 94.65  ? 122 ASP A OD1 1 
ATOM   731  O OD2 . ASP A 1 122 ? 53.264 56.920 64.349 1.00 72.50  ? 122 ASP A OD2 1 
ATOM   732  N N   . ALA A 1 123 ? 51.483 57.022 62.161 1.00 67.74  ? 123 ALA A N   1 
ATOM   733  C CA  . ALA A 1 123 ? 50.873 55.928 61.414 1.00 59.44  ? 123 ALA A CA  1 
ATOM   734  C C   . ALA A 1 123 ? 51.639 54.591 61.531 1.00 54.09  ? 123 ALA A C   1 
ATOM   735  O O   . ALA A 1 123 ? 51.371 53.635 60.791 1.00 52.71  ? 123 ALA A O   1 
ATOM   736  C CB  . ALA A 1 123 ? 50.763 56.345 59.945 1.00 56.46  ? 123 ALA A CB  1 
ATOM   737  N N   . VAL A 1 124 ? 52.569 54.515 62.473 1.00 54.78  ? 124 VAL A N   1 
ATOM   738  C CA  . VAL A 1 124 ? 53.392 53.322 62.621 1.00 53.51  ? 124 VAL A CA  1 
ATOM   739  C C   . VAL A 1 124 ? 53.479 52.737 64.015 1.00 52.17  ? 124 VAL A C   1 
ATOM   740  O O   . VAL A 1 124 ? 53.516 53.458 65.002 1.00 58.34  ? 124 VAL A O   1 
ATOM   741  C CB  . VAL A 1 124 ? 54.851 53.610 62.172 1.00 56.78  ? 124 VAL A CB  1 
ATOM   742  C CG1 . VAL A 1 124 ? 55.666 52.343 62.208 1.00 54.30  ? 124 VAL A CG1 1 
ATOM   743  C CG2 . VAL A 1 124 ? 54.871 54.217 60.787 1.00 48.98  ? 124 VAL A CG2 1 
ATOM   744  N N   . THR A 1 125 ? 53.514 51.412 64.083 1.00 48.90  ? 125 THR A N   1 
ATOM   745  C CA  . THR A 1 125 ? 53.664 50.737 65.353 1.00 54.34  ? 125 THR A CA  1 
ATOM   746  C C   . THR A 1 125 ? 54.841 49.760 65.323 1.00 59.73  ? 125 THR A C   1 
ATOM   747  O O   . THR A 1 125 ? 54.759 48.680 64.713 1.00 50.00  ? 125 THR A O   1 
ATOM   748  C CB  . THR A 1 125 ? 52.422 49.952 65.751 1.00 53.98  ? 125 THR A CB  1 
ATOM   749  O OG1 . THR A 1 125 ? 51.374 50.866 66.080 1.00 53.04  ? 125 THR A OG1 1 
ATOM   750  C CG2 . THR A 1 125 ? 52.728 49.072 66.967 1.00 44.53  ? 125 THR A CG2 1 
ATOM   751  N N   . PRO A 1 126 ? 55.964 50.147 65.960 1.00 60.78  ? 126 PRO A N   1 
ATOM   752  C CA  . PRO A 1 126 ? 57.162 49.314 66.026 1.00 58.00  ? 126 PRO A CA  1 
ATOM   753  C C   . PRO A 1 126 ? 56.763 48.036 66.741 1.00 60.35  ? 126 PRO A C   1 
ATOM   754  O O   . PRO A 1 126 ? 56.179 48.086 67.817 1.00 66.30  ? 126 PRO A O   1 
ATOM   755  C CB  . PRO A 1 126 ? 58.111 50.166 66.848 1.00 60.58  ? 126 PRO A CB  1 
ATOM   756  C CG  . PRO A 1 126 ? 57.742 51.554 66.417 1.00 59.43  ? 126 PRO A CG  1 
ATOM   757  C CD  . PRO A 1 126 ? 56.244 51.494 66.488 1.00 54.95  ? 126 PRO A CD  1 
ATOM   758  N N   . LEU A 1 127 ? 57.042 46.889 66.143 1.00 56.48  ? 127 LEU A N   1 
ATOM   759  C CA  . LEU A 1 127 ? 56.665 45.641 66.778 1.00 64.73  ? 127 LEU A CA  1 
ATOM   760  C C   . LEU A 1 127 ? 57.588 45.217 67.933 1.00 73.39  ? 127 LEU A C   1 
ATOM   761  O O   . LEU A 1 127 ? 58.477 44.373 67.770 1.00 74.97  ? 127 LEU A O   1 
ATOM   762  C CB  . LEU A 1 127 ? 56.566 44.535 65.723 1.00 67.29  ? 127 LEU A CB  1 
ATOM   763  C CG  . LEU A 1 127 ? 55.326 44.608 64.825 1.00 67.11  ? 127 LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 127 ? 55.309 43.440 63.845 1.00 55.58  ? 127 LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 127 ? 54.080 44.572 65.696 1.00 58.32  ? 127 LEU A CD2 1 
ATOM   766  N N   . VAL A 1 128 ? 57.359 45.823 69.098 1.00 77.38  ? 128 VAL A N   1 
ATOM   767  C CA  . VAL A 1 128 ? 58.109 45.535 70.317 1.00 70.29  ? 128 VAL A CA  1 
ATOM   768  C C   . VAL A 1 128 ? 57.102 45.106 71.395 1.00 72.27  ? 128 VAL A C   1 
ATOM   769  O O   . VAL A 1 128 ? 55.912 44.968 71.107 1.00 68.30  ? 128 VAL A O   1 
ATOM   770  C CB  . VAL A 1 128 ? 58.869 46.774 70.804 1.00 69.43  ? 128 VAL A CB  1 
ATOM   771  C CG1 . VAL A 1 128 ? 59.828 46.374 71.928 1.00 83.36  ? 128 VAL A CG1 1 
ATOM   772  C CG2 . VAL A 1 128 ? 59.641 47.401 69.652 1.00 66.75  ? 128 VAL A CG2 1 
ATOM   773  N N   . LYS A 1 129 ? 57.567 44.884 72.624 1.00 71.70  ? 129 LYS A N   1 
ATOM   774  C CA  . LYS A 1 129 ? 56.677 44.476 73.710 1.00 68.51  ? 129 LYS A CA  1 
ATOM   775  C C   . LYS A 1 129 ? 55.603 45.549 73.887 1.00 66.61  ? 129 LYS A C   1 
ATOM   776  O O   . LYS A 1 129 ? 55.894 46.748 73.810 1.00 59.76  ? 129 LYS A O   1 
ATOM   777  C CB  . LYS A 1 129 ? 57.471 44.331 75.008 1.00 81.20  ? 129 LYS A CB  1 
ATOM   778  C CG  . LYS A 1 129 ? 56.724 43.643 76.165 1.00 88.27  ? 129 LYS A CG  1 
ATOM   779  C CD  . LYS A 1 129 ? 56.820 42.102 76.111 1.00 90.98  ? 129 LYS A CD  1 
ATOM   780  C CE  . LYS A 1 129 ? 55.780 41.439 75.181 1.00 91.61  ? 129 LYS A CE  1 
ATOM   781  N NZ  . LYS A 1 129 ? 55.981 41.609 73.707 1.00 76.00  ? 129 LYS A NZ  1 
ATOM   782  N N   . PRO A 1 130 ? 54.353 45.144 74.152 1.00 59.63  ? 130 PRO A N   1 
ATOM   783  C CA  . PRO A 1 130 ? 53.821 43.787 74.310 1.00 66.20  ? 130 PRO A CA  1 
ATOM   784  C C   . PRO A 1 130 ? 53.416 43.149 72.997 1.00 66.64  ? 130 PRO A C   1 
ATOM   785  O O   . PRO A 1 130 ? 52.687 42.153 72.979 1.00 67.78  ? 130 PRO A O   1 
ATOM   786  C CB  . PRO A 1 130 ? 52.611 44.006 75.203 1.00 61.48  ? 130 PRO A CB  1 
ATOM   787  C CG  . PRO A 1 130 ? 52.054 45.285 74.627 1.00 64.15  ? 130 PRO A CG  1 
ATOM   788  C CD  . PRO A 1 130 ? 53.292 46.145 74.381 1.00 60.24  ? 130 PRO A CD  1 
ATOM   789  N N   . TYR A 1 131 ? 53.902 43.720 71.902 1.00 69.37  ? 131 TYR A N   1 
ATOM   790  C CA  . TYR A 1 131 ? 53.553 43.246 70.563 1.00 72.69  ? 131 TYR A CA  1 
ATOM   791  C C   . TYR A 1 131 ? 54.519 42.237 69.931 1.00 71.11  ? 131 TYR A C   1 
ATOM   792  O O   . TYR A 1 131 ? 54.286 41.774 68.812 1.00 63.67  ? 131 TYR A O   1 
ATOM   793  C CB  . TYR A 1 131 ? 53.443 44.447 69.630 1.00 67.06  ? 131 TYR A CB  1 
ATOM   794  C CG  . TYR A 1 131 ? 52.694 45.621 70.204 1.00 66.51  ? 131 TYR A CG  1 
ATOM   795  C CD1 . TYR A 1 131 ? 53.154 46.915 69.997 1.00 63.64  ? 131 TYR A CD1 1 
ATOM   796  C CD2 . TYR A 1 131 ? 51.503 45.446 70.913 1.00 66.01  ? 131 TYR A CD2 1 
ATOM   797  C CE1 . TYR A 1 131 ? 52.461 48.005 70.470 1.00 62.52  ? 131 TYR A CE1 1 
ATOM   798  C CE2 . TYR A 1 131 ? 50.792 46.541 71.395 1.00 64.26  ? 131 TYR A CE2 1 
ATOM   799  C CZ  . TYR A 1 131 ? 51.282 47.820 71.166 1.00 71.57  ? 131 TYR A CZ  1 
ATOM   800  O OH  . TYR A 1 131 ? 50.604 48.930 71.630 1.00 74.61  ? 131 TYR A OH  1 
ATOM   801  N N   . LYS A 1 132 ? 55.595 41.903 70.637 1.00 68.25  ? 132 LYS A N   1 
ATOM   802  C CA  . LYS A 1 132 ? 56.589 40.986 70.103 1.00 62.40  ? 132 LYS A CA  1 
ATOM   803  C C   . LYS A 1 132 ? 56.016 39.644 69.603 1.00 60.37  ? 132 LYS A C   1 
ATOM   804  O O   . LYS A 1 132 ? 56.588 39.042 68.698 1.00 59.81  ? 132 LYS A O   1 
ATOM   805  C CB  . LYS A 1 132 ? 57.692 40.774 71.129 1.00 60.24  ? 132 LYS A CB  1 
ATOM   806  N N   . SER A 1 133 ? 54.890 39.181 70.148 1.00 60.93  ? 133 SER A N   1 
ATOM   807  C CA  . SER A 1 133 ? 54.293 37.922 69.662 1.00 63.13  ? 133 SER A CA  1 
ATOM   808  C C   . SER A 1 133 ? 53.750 38.081 68.226 1.00 64.74  ? 133 SER A C   1 
ATOM   809  O O   . SER A 1 133 ? 53.369 37.115 67.562 1.00 63.04  ? 133 SER A O   1 
ATOM   810  C CB  . SER A 1 133 ? 53.163 37.448 70.586 1.00 60.28  ? 133 SER A CB  1 
ATOM   811  O OG  . SER A 1 133 ? 52.189 38.462 70.781 1.00 78.86  ? 133 SER A OG  1 
ATOM   812  N N   . VAL A 1 134 ? 53.711 39.315 67.753 1.00 66.38  ? 134 VAL A N   1 
ATOM   813  C CA  . VAL A 1 134 ? 53.249 39.593 66.403 1.00 68.38  ? 134 VAL A CA  1 
ATOM   814  C C   . VAL A 1 134 ? 54.245 39.013 65.386 1.00 65.03  ? 134 VAL A C   1 
ATOM   815  O O   . VAL A 1 134 ? 53.850 38.333 64.426 1.00 54.54  ? 134 VAL A O   1 
ATOM   816  C CB  . VAL A 1 134 ? 53.120 41.121 66.191 1.00 63.72  ? 134 VAL A CB  1 
ATOM   817  C CG1 . VAL A 1 134 ? 52.842 41.441 64.729 1.00 68.25  ? 134 VAL A CG1 1 
ATOM   818  C CG2 . VAL A 1 134 ? 52.003 41.649 67.056 1.00 64.85  ? 134 VAL A CG2 1 
ATOM   819  N N   . LEU A 1 135 ? 55.528 39.289 65.628 1.00 62.18  ? 135 LEU A N   1 
ATOM   820  C CA  . LEU A 1 135 ? 56.631 38.850 64.777 1.00 61.47  ? 135 LEU A CA  1 
ATOM   821  C C   . LEU A 1 135 ? 56.436 37.419 64.283 1.00 52.30  ? 135 LEU A C   1 
ATOM   822  O O   . LEU A 1 135 ? 56.426 37.158 63.078 1.00 48.15  ? 135 LEU A O   1 
ATOM   823  C CB  . LEU A 1 135 ? 57.959 38.979 65.539 1.00 55.92  ? 135 LEU A CB  1 
ATOM   824  C CG  . LEU A 1 135 ? 58.309 40.367 66.100 1.00 55.35  ? 135 LEU A CG  1 
ATOM   825  C CD1 . LEU A 1 135 ? 59.468 40.231 67.037 1.00 55.81  ? 135 LEU A CD1 1 
ATOM   826  C CD2 . LEU A 1 135 ? 58.652 41.345 65.011 1.00 51.32  ? 135 LEU A CD2 1 
ATOM   827  N N   . ALA A 1 136 ? 56.251 36.491 65.205 1.00 54.28  ? 136 ALA A N   1 
ATOM   828  C CA  . ALA A 1 136 ? 56.052 35.103 64.802 1.00 59.32  ? 136 ALA A CA  1 
ATOM   829  C C   . ALA A 1 136 ? 54.928 35.005 63.783 1.00 64.91  ? 136 ALA A C   1 
ATOM   830  O O   . ALA A 1 136 ? 55.126 34.528 62.652 1.00 67.10  ? 136 ALA A O   1 
ATOM   831  C CB  . ALA A 1 136 ? 55.718 34.241 66.012 1.00 55.17  ? 136 ALA A CB  1 
ATOM   832  N N   . ARG A 1 137 ? 53.748 35.468 64.191 1.00 61.46  ? 137 ARG A N   1 
ATOM   833  C CA  . ARG A 1 137 ? 52.570 35.411 63.336 1.00 59.51  ? 137 ARG A CA  1 
ATOM   834  C C   . ARG A 1 137 ? 52.716 35.997 61.956 1.00 54.62  ? 137 ARG A C   1 
ATOM   835  O O   . ARG A 1 137 ? 52.089 35.503 61.012 1.00 47.00  ? 137 ARG A O   1 
ATOM   836  C CB  . ARG A 1 137 ? 51.374 36.024 64.052 1.00 53.67  ? 137 ARG A CB  1 
ATOM   837  C CG  . ARG A 1 137 ? 50.983 35.131 65.163 1.00 51.56  ? 137 ARG A CG  1 
ATOM   838  C CD  . ARG A 1 137 ? 49.676 35.464 65.707 1.00 66.98  ? 137 ARG A CD  1 
ATOM   839  N NE  . ARG A 1 137 ? 48.624 35.248 64.737 1.00 67.11  ? 137 ARG A NE  1 
ATOM   840  C CZ  . ARG A 1 137 ? 47.351 35.299 65.081 1.00 66.84  ? 137 ARG A CZ  1 
ATOM   841  N NH1 . ARG A 1 137 ? 47.045 35.546 66.344 1.00 61.78  ? 137 ARG A NH1 1 
ATOM   842  N NH2 . ARG A 1 137 ? 46.399 35.126 64.184 1.00 63.62  ? 137 ARG A NH2 1 
ATOM   843  N N   . VAL A 1 138 ? 53.528 37.045 61.830 1.00 47.39  ? 138 VAL A N   1 
ATOM   844  C CA  . VAL A 1 138 ? 53.742 37.621 60.526 1.00 45.27  ? 138 VAL A CA  1 
ATOM   845  C C   . VAL A 1 138 ? 54.577 36.626 59.721 1.00 54.91  ? 138 VAL A C   1 
ATOM   846  O O   . VAL A 1 138 ? 54.186 36.217 58.634 1.00 54.85  ? 138 VAL A O   1 
ATOM   847  C CB  . VAL A 1 138 ? 54.522 38.930 60.586 1.00 44.37  ? 138 VAL A CB  1 
ATOM   848  C CG1 . VAL A 1 138 ? 54.917 39.326 59.172 1.00 37.41  ? 138 VAL A CG1 1 
ATOM   849  C CG2 . VAL A 1 138 ? 53.692 40.023 61.247 1.00 40.91  ? 138 VAL A CG2 1 
ATOM   850  N N   . VAL A 1 139 ? 55.732 36.249 60.274 1.00 61.81  ? 139 VAL A N   1 
ATOM   851  C CA  . VAL A 1 139 ? 56.661 35.312 59.645 1.00 56.24  ? 139 VAL A CA  1 
ATOM   852  C C   . VAL A 1 139 ? 55.998 33.996 59.261 1.00 58.41  ? 139 VAL A C   1 
ATOM   853  O O   . VAL A 1 139 ? 56.245 33.476 58.181 1.00 59.94  ? 139 VAL A O   1 
ATOM   854  C CB  . VAL A 1 139 ? 57.856 34.998 60.580 1.00 60.16  ? 139 VAL A CB  1 
ATOM   855  C CG1 . VAL A 1 139 ? 58.715 33.911 59.971 1.00 58.44  ? 139 VAL A CG1 1 
ATOM   856  C CG2 . VAL A 1 139 ? 58.692 36.256 60.805 1.00 43.79  ? 139 VAL A CG2 1 
ATOM   857  N N   . ASP A 1 140 ? 55.156 33.461 60.138 1.00 56.67  ? 140 ASP A N   1 
ATOM   858  C CA  . ASP A 1 140 ? 54.473 32.198 59.852 1.00 62.81  ? 140 ASP A CA  1 
ATOM   859  C C   . ASP A 1 140 ? 53.161 32.417 59.124 1.00 62.37  ? 140 ASP A C   1 
ATOM   860  O O   . ASP A 1 140 ? 52.369 31.480 58.956 1.00 62.27  ? 140 ASP A O   1 
ATOM   861  C CB  . ASP A 1 140 ? 54.150 31.453 61.146 1.00 70.47  ? 140 ASP A CB  1 
ATOM   862  C CG  . ASP A 1 140 ? 55.373 31.191 61.995 1.00 86.08  ? 140 ASP A CG  1 
ATOM   863  O OD1 . ASP A 1 140 ? 55.210 30.541 63.057 1.00 82.78  ? 140 ASP A OD1 1 
ATOM   864  O OD2 . ASP A 1 140 ? 56.485 31.633 61.602 1.00 90.86  ? 140 ASP A OD2 1 
ATOM   865  N N   . HIS A 1 141 ? 52.916 33.649 58.702 1.00 56.10  ? 141 HIS A N   1 
ATOM   866  C CA  . HIS A 1 141 ? 51.654 33.946 58.057 1.00 58.26  ? 141 HIS A CA  1 
ATOM   867  C C   . HIS A 1 141 ? 51.465 33.318 56.692 1.00 52.92  ? 141 HIS A C   1 
ATOM   868  O O   . HIS A 1 141 ? 52.161 33.658 55.742 1.00 55.92  ? 141 HIS A O   1 
ATOM   869  C CB  . HIS A 1 141 ? 51.448 35.462 57.930 1.00 65.01  ? 141 HIS A CB  1 
ATOM   870  C CG  . HIS A 1 141 ? 50.010 35.858 57.781 1.00 68.30  ? 141 HIS A CG  1 
ATOM   871  N ND1 . HIS A 1 141 ? 49.164 35.261 56.870 1.00 61.96  ? 141 HIS A ND1 1 
ATOM   872  C CD2 . HIS A 1 141 ? 49.252 36.734 58.481 1.00 64.47  ? 141 HIS A CD2 1 
ATOM   873  C CE1 . HIS A 1 141 ? 47.945 35.744 57.024 1.00 66.48  ? 141 HIS A CE1 1 
ATOM   874  N NE2 . HIS A 1 141 ? 47.972 36.638 57.996 1.00 68.47  ? 141 HIS A NE2 1 
ATOM   875  N N   . GLU A 1 142 ? 50.495 32.418 56.612 1.00 48.70  ? 142 GLU A N   1 
ATOM   876  C CA  . GLU A 1 142 ? 50.113 31.755 55.377 1.00 50.46  ? 142 GLU A CA  1 
ATOM   877  C C   . GLU A 1 142 ? 50.181 32.746 54.216 1.00 51.31  ? 142 GLU A C   1 
ATOM   878  O O   . GLU A 1 142 ? 50.557 32.388 53.103 1.00 52.51  ? 142 GLU A O   1 
ATOM   879  C CB  . GLU A 1 142 ? 48.673 31.271 55.521 1.00 62.98  ? 142 GLU A CB  1 
ATOM   880  C CG  . GLU A 1 142 ? 48.347 29.937 54.889 1.00 80.18  ? 142 GLU A CG  1 
ATOM   881  C CD  . GLU A 1 142 ? 47.776 28.956 55.910 1.00 92.47  ? 142 GLU A CD  1 
ATOM   882  O OE1 . GLU A 1 142 ? 47.268 27.889 55.502 1.00 97.66  ? 142 GLU A OE1 1 
ATOM   883  O OE2 . GLU A 1 142 ? 47.843 29.251 57.128 1.00 98.92  ? 142 GLU A OE2 1 
ATOM   884  N N   . ASP A 1 143 ? 49.808 33.999 54.468 1.00 53.31  ? 143 ASP A N   1 
ATOM   885  C CA  . ASP A 1 143 ? 49.815 35.011 53.409 1.00 49.97  ? 143 ASP A CA  1 
ATOM   886  C C   . ASP A 1 143 ? 50.951 36.021 53.437 1.00 49.56  ? 143 ASP A C   1 
ATOM   887  O O   . ASP A 1 143 ? 50.888 37.042 52.755 1.00 45.21  ? 143 ASP A O   1 
ATOM   888  C CB  . ASP A 1 143 ? 48.473 35.742 53.391 1.00 54.60  ? 143 ASP A CB  1 
ATOM   889  C CG  . ASP A 1 143 ? 47.321 34.807 53.091 1.00 56.81  ? 143 ASP A CG  1 
ATOM   890  O OD1 . ASP A 1 143 ? 47.370 34.185 52.017 1.00 60.03  ? 143 ASP A OD1 1 
ATOM   891  O OD2 . ASP A 1 143 ? 46.383 34.679 53.913 1.00 56.64  ? 143 ASP A OD2 1 
ATOM   892  N N   . ALA A 1 144 ? 52.000 35.748 54.210 1.00 50.68  ? 144 ALA A N   1 
ATOM   893  C CA  . ALA A 1 144 ? 53.136 36.669 54.246 1.00 54.90  ? 144 ALA A CA  1 
ATOM   894  C C   . ALA A 1 144 ? 54.045 36.369 53.048 1.00 58.72  ? 144 ALA A C   1 
ATOM   895  O O   . ALA A 1 144 ? 54.099 35.238 52.568 1.00 62.28  ? 144 ALA A O   1 
ATOM   896  C CB  . ALA A 1 144 ? 53.892 36.490 55.522 1.00 60.61  ? 144 ALA A CB  1 
ATOM   897  N N   . HIS A 1 145 ? 54.747 37.372 52.546 1.00 55.14  ? 145 HIS A N   1 
ATOM   898  C CA  . HIS A 1 145 ? 55.635 37.152 51.414 1.00 58.14  ? 145 HIS A CA  1 
ATOM   899  C C   . HIS A 1 145 ? 57.002 37.769 51.720 1.00 62.80  ? 145 HIS A C   1 
ATOM   900  O O   . HIS A 1 145 ? 57.088 38.783 52.420 1.00 54.43  ? 145 HIS A O   1 
ATOM   901  C CB  . HIS A 1 145 ? 55.065 37.772 50.129 1.00 58.12  ? 145 HIS A CB  1 
ATOM   902  C CG  . HIS A 1 145 ? 55.003 39.274 50.148 1.00 73.18  ? 145 HIS A CG  1 
ATOM   903  N ND1 . HIS A 1 145 ? 53.859 39.972 50.478 1.00 72.48  ? 145 HIS A ND1 1 
ATOM   904  C CD2 . HIS A 1 145 ? 55.945 40.211 49.872 1.00 73.35  ? 145 HIS A CD2 1 
ATOM   905  C CE1 . HIS A 1 145 ? 54.097 41.271 50.400 1.00 77.89  ? 145 HIS A CE1 1 
ATOM   906  N NE2 . HIS A 1 145 ? 55.355 41.443 50.034 1.00 74.35  ? 145 HIS A NE2 1 
ATOM   907  N N   . ASP A 1 146 ? 58.056 37.148 51.184 1.00 59.57  ? 146 ASP A N   1 
ATOM   908  C CA  . ASP A 1 146 ? 59.431 37.589 51.381 1.00 54.41  ? 146 ASP A CA  1 
ATOM   909  C C   . ASP A 1 146 ? 59.645 38.801 50.502 1.00 52.17  ? 146 ASP A C   1 
ATOM   910  O O   . ASP A 1 146 ? 59.354 38.771 49.315 1.00 62.47  ? 146 ASP A O   1 
ATOM   911  C CB  . ASP A 1 146 ? 60.381 36.456 51.007 1.00 49.37  ? 146 ASP A CB  1 
ATOM   912  C CG  . ASP A 1 146 ? 60.048 35.159 51.750 1.00 67.65  ? 146 ASP A CG  1 
ATOM   913  O OD1 . ASP A 1 146 ? 60.079 35.147 53.002 1.00 75.93  ? 146 ASP A OD1 1 
ATOM   914  O OD2 . ASP A 1 146 ? 59.740 34.145 51.089 1.00 67.50  ? 146 ASP A OD2 1 
ATOM   915  N N   . GLU A 1 147 ? 60.145 39.875 51.088 1.00 51.45  ? 147 GLU A N   1 
ATOM   916  C CA  . GLU A 1 147 ? 60.344 41.121 50.353 1.00 56.38  ? 147 GLU A CA  1 
ATOM   917  C C   . GLU A 1 147 ? 61.709 41.684 50.761 1.00 56.12  ? 147 GLU A C   1 
ATOM   918  O O   . GLU A 1 147 ? 62.309 41.224 51.723 1.00 60.75  ? 147 GLU A O   1 
ATOM   919  C CB  . GLU A 1 147 ? 59.215 42.068 50.766 1.00 64.13  ? 147 GLU A CB  1 
ATOM   920  C CG  . GLU A 1 147 ? 58.929 43.261 49.884 1.00 69.72  ? 147 GLU A CG  1 
ATOM   921  C CD  . GLU A 1 147 ? 57.675 44.020 50.345 1.00 81.77  ? 147 GLU A CD  1 
ATOM   922  O OE1 . GLU A 1 147 ? 56.551 43.432 50.317 1.00 62.41  ? 147 GLU A OE1 1 
ATOM   923  O OE2 . GLU A 1 147 ? 57.821 45.206 50.739 1.00 86.56  ? 147 GLU A OE2 1 
ATOM   924  N N   . ILE A 1 148 ? 62.228 42.651 50.033 1.00 60.45  ? 148 ILE A N   1 
ATOM   925  C CA  . ILE A 1 148 ? 63.508 43.221 50.444 1.00 67.00  ? 148 ILE A CA  1 
ATOM   926  C C   . ILE A 1 148 ? 63.216 44.653 50.802 1.00 69.78  ? 148 ILE A C   1 
ATOM   927  O O   . ILE A 1 148 ? 62.529 45.346 50.062 1.00 77.21  ? 148 ILE A O   1 
ATOM   928  C CB  . ILE A 1 148 ? 64.570 43.202 49.333 1.00 63.72  ? 148 ILE A CB  1 
ATOM   929  C CG1 . ILE A 1 148 ? 64.983 41.759 49.024 1.00 65.00  ? 148 ILE A CG1 1 
ATOM   930  C CG2 . ILE A 1 148 ? 65.773 44.032 49.767 1.00 54.84  ? 148 ILE A CG2 1 
ATOM   931  C CD1 . ILE A 1 148 ? 65.590 41.026 50.198 1.00 70.19  ? 148 ILE A CD1 1 
ATOM   932  N N   . MET A 1 149 ? 63.735 45.096 51.937 1.00 68.34  ? 149 MET A N   1 
ATOM   933  C CA  . MET A 1 149 ? 63.477 46.446 52.391 1.00 72.51  ? 149 MET A CA  1 
ATOM   934  C C   . MET A 1 149 ? 64.736 47.301 52.303 1.00 75.95  ? 149 MET A C   1 
ATOM   935  O O   . MET A 1 149 ? 65.822 46.870 52.697 1.00 77.48  ? 149 MET A O   1 
ATOM   936  C CB  . MET A 1 149 ? 62.937 46.371 53.823 1.00 70.22  ? 149 MET A CB  1 
ATOM   937  C CG  . MET A 1 149 ? 62.527 47.676 54.463 1.00 78.00  ? 149 MET A CG  1 
ATOM   938  S SD  . MET A 1 149 ? 61.544 47.322 55.943 1.00 85.01  ? 149 MET A SD  1 
ATOM   939  C CE  . MET A 1 149 ? 62.770 46.590 57.016 1.00 73.91  ? 149 MET A CE  1 
ATOM   940  N N   . GLN A 1 150 ? 64.584 48.508 51.768 1.00 75.05  ? 150 GLN A N   1 
ATOM   941  C CA  . GLN A 1 150 ? 65.703 49.437 51.625 1.00 82.22  ? 150 GLN A CA  1 
ATOM   942  C C   . GLN A 1 150 ? 65.765 50.354 52.837 1.00 82.52  ? 150 GLN A C   1 
ATOM   943  O O   . GLN A 1 150 ? 64.896 51.208 53.010 1.00 85.85  ? 150 GLN A O   1 
ATOM   944  C CB  . GLN A 1 150 ? 65.537 50.271 50.349 1.00 75.23  ? 150 GLN A CB  1 
ATOM   945  N N   . ASP A 1 151 ? 66.794 50.193 53.666 1.00 84.40  ? 151 ASP A N   1 
ATOM   946  C CA  . ASP A 1 151 ? 66.930 51.019 54.865 1.00 86.41  ? 151 ASP A CA  1 
ATOM   947  C C   . ASP A 1 151 ? 68.195 51.873 54.944 1.00 85.86  ? 151 ASP A C   1 
ATOM   948  O O   . ASP A 1 151 ? 69.304 51.377 54.735 1.00 80.92  ? 151 ASP A O   1 
ATOM   949  C CB  . ASP A 1 151 ? 66.869 50.145 56.109 1.00 89.38  ? 151 ASP A CB  1 
ATOM   950  C CG  . ASP A 1 151 ? 66.975 50.953 57.375 1.00 95.83  ? 151 ASP A CG  1 
ATOM   951  O OD1 . ASP A 1 151 ? 65.954 51.526 57.816 1.00 102.98 ? 151 ASP A OD1 1 
ATOM   952  O OD2 . ASP A 1 151 ? 68.090 51.033 57.918 1.00 98.45  ? 151 ASP A OD2 1 
ATOM   953  N N   . ASN A 1 152 ? 68.021 53.151 55.277 1.00 87.42  ? 152 ASN A N   1 
ATOM   954  C CA  . ASN A 1 152 ? 69.145 54.085 55.397 1.00 90.63  ? 152 ASN A CA  1 
ATOM   955  C C   . ASN A 1 152 ? 70.144 53.715 56.490 1.00 90.11  ? 152 ASN A C   1 
ATOM   956  O O   . ASN A 1 152 ? 71.252 54.246 56.522 1.00 92.79  ? 152 ASN A O   1 
ATOM   957  C CB  . ASN A 1 152 ? 68.651 55.501 55.697 1.00 94.43  ? 152 ASN A CB  1 
ATOM   958  C CG  . ASN A 1 152 ? 67.726 56.032 54.642 1.00 98.61  ? 152 ASN A CG  1 
ATOM   959  O OD1 . ASN A 1 152 ? 68.094 56.141 53.472 1.00 99.66  ? 152 ASN A OD1 1 
ATOM   960  N ND2 . ASN A 1 152 ? 66.508 56.376 55.049 1.00 104.37 ? 152 ASN A ND2 1 
ATOM   961  N N   . LEU A 1 153 ? 69.758 52.831 57.401 1.00 87.44  ? 153 LEU A N   1 
ATOM   962  C CA  . LEU A 1 153 ? 70.666 52.459 58.476 1.00 86.36  ? 153 LEU A CA  1 
ATOM   963  C C   . LEU A 1 153 ? 71.138 51.022 58.440 1.00 84.36  ? 153 LEU A C   1 
ATOM   964  O O   . LEU A 1 153 ? 72.286 50.732 58.774 1.00 95.81  ? 153 LEU A O   1 
ATOM   965  C CB  . LEU A 1 153 ? 70.029 52.712 59.845 1.00 81.23  ? 153 LEU A CB  1 
ATOM   966  C CG  . LEU A 1 153 ? 69.745 54.151 60.254 1.00 78.00  ? 153 LEU A CG  1 
ATOM   967  C CD1 . LEU A 1 153 ? 69.387 54.154 61.719 1.00 71.21  ? 153 LEU A CD1 1 
ATOM   968  C CD2 . LEU A 1 153 ? 70.953 55.033 60.007 1.00 75.54  ? 153 LEU A CD2 1 
ATOM   969  N N   . PHE A 1 154 ? 70.263 50.113 58.048 1.00 76.83  ? 154 PHE A N   1 
ATOM   970  C CA  . PHE A 1 154 ? 70.643 48.716 58.031 1.00 73.26  ? 154 PHE A CA  1 
ATOM   971  C C   . PHE A 1 154 ? 70.925 48.224 56.637 1.00 73.48  ? 154 PHE A C   1 
ATOM   972  O O   . PHE A 1 154 ? 71.552 47.181 56.467 1.00 72.22  ? 154 PHE A O   1 
ATOM   973  C CB  . PHE A 1 154 ? 69.535 47.864 58.640 1.00 68.45  ? 154 PHE A CB  1 
ATOM   974  C CG  . PHE A 1 154 ? 69.176 48.243 60.046 1.00 66.85  ? 154 PHE A CG  1 
ATOM   975  C CD1 . PHE A 1 154 ? 68.603 49.478 60.326 1.00 62.66  ? 154 PHE A CD1 1 
ATOM   976  C CD2 . PHE A 1 154 ? 69.382 47.349 61.093 1.00 69.27  ? 154 PHE A CD2 1 
ATOM   977  C CE1 . PHE A 1 154 ? 68.237 49.819 61.620 1.00 57.70  ? 154 PHE A CE1 1 
ATOM   978  C CE2 . PHE A 1 154 ? 69.020 47.677 62.395 1.00 67.16  ? 154 PHE A CE2 1 
ATOM   979  C CZ  . PHE A 1 154 ? 68.444 48.916 62.659 1.00 60.49  ? 154 PHE A CZ  1 
ATOM   980  N N   . GLY A 1 155 ? 70.465 48.982 55.643 1.00 76.91  ? 155 GLY A N   1 
ATOM   981  C CA  . GLY A 1 155 ? 70.635 48.579 54.260 1.00 74.04  ? 155 GLY A CA  1 
ATOM   982  C C   . GLY A 1 155 ? 69.542 47.581 53.920 1.00 78.36  ? 155 GLY A C   1 
ATOM   983  O O   . GLY A 1 155 ? 68.562 47.448 54.657 1.00 79.36  ? 155 GLY A O   1 
ATOM   984  N N   . ASP A 1 156 ? 69.709 46.868 52.813 1.00 81.37  ? 156 ASP A N   1 
ATOM   985  C CA  . ASP A 1 156 ? 68.730 45.876 52.369 1.00 79.19  ? 156 ASP A CA  1 
ATOM   986  C C   . ASP A 1 156 ? 68.453 44.829 53.422 1.00 75.27  ? 156 ASP A C   1 
ATOM   987  O O   . ASP A 1 156 ? 69.369 44.157 53.882 1.00 84.15  ? 156 ASP A O   1 
ATOM   988  C CB  . ASP A 1 156 ? 69.229 45.168 51.114 1.00 79.83  ? 156 ASP A CB  1 
ATOM   989  C CG  . ASP A 1 156 ? 69.362 46.102 49.944 1.00 81.67  ? 156 ASP A CG  1 
ATOM   990  O OD1 . ASP A 1 156 ? 69.975 45.698 48.928 1.00 84.34  ? 156 ASP A OD1 1 
ATOM   991  O OD2 . ASP A 1 156 ? 68.845 47.238 50.043 1.00 81.52  ? 156 ASP A OD2 1 
ATOM   992  N N   . LEU A 1 157 ? 67.189 44.677 53.797 1.00 70.62  ? 157 LEU A N   1 
ATOM   993  C CA  . LEU A 1 157 ? 66.831 43.674 54.789 1.00 64.77  ? 157 LEU A CA  1 
ATOM   994  C C   . LEU A 1 157 ? 65.802 42.718 54.225 1.00 64.37  ? 157 LEU A C   1 
ATOM   995  O O   . LEU A 1 157 ? 64.901 43.119 53.488 1.00 66.13  ? 157 LEU A O   1 
ATOM   996  C CB  . LEU A 1 157 ? 66.250 44.339 56.037 1.00 64.84  ? 157 LEU A CB  1 
ATOM   997  C CG  . LEU A 1 157 ? 67.209 45.165 56.887 1.00 68.52  ? 157 LEU A CG  1 
ATOM   998  C CD1 . LEU A 1 157 ? 66.409 45.999 57.875 1.00 65.73  ? 157 LEU A CD1 1 
ATOM   999  C CD2 . LEU A 1 157 ? 68.192 44.228 57.608 1.00 67.59  ? 157 LEU A CD2 1 
ATOM   1000 N N   . ASN A 1 158 ? 65.942 41.445 54.548 1.00 60.15  ? 158 ASN A N   1 
ATOM   1001 C CA  . ASN A 1 158 ? 64.949 40.490 54.099 1.00 61.07  ? 158 ASN A CA  1 
ATOM   1002 C C   . ASN A 1 158 ? 63.804 40.648 55.118 1.00 58.56  ? 158 ASN A C   1 
ATOM   1003 O O   . ASN A 1 158 ? 64.004 40.555 56.332 1.00 55.89  ? 158 ASN A O   1 
ATOM   1004 C CB  . ASN A 1 158 ? 65.525 39.070 54.119 1.00 66.64  ? 158 ASN A CB  1 
ATOM   1005 C CG  . ASN A 1 158 ? 66.849 38.962 53.346 1.00 76.77  ? 158 ASN A CG  1 
ATOM   1006 O OD1 . ASN A 1 158 ? 66.929 39.331 52.174 1.00 71.28  ? 158 ASN A OD1 1 
ATOM   1007 N ND2 . ASN A 1 158 ? 67.889 38.458 54.007 1.00 71.52  ? 158 ASN A ND2 1 
ATOM   1008 N N   . VAL A 1 159 ? 62.607 40.931 54.633 1.00 53.30  ? 159 VAL A N   1 
ATOM   1009 C CA  . VAL A 1 159 ? 61.476 41.099 55.533 1.00 55.33  ? 159 VAL A CA  1 
ATOM   1010 C C   . VAL A 1 159 ? 60.325 40.218 55.091 1.00 55.72  ? 159 VAL A C   1 
ATOM   1011 O O   . VAL A 1 159 ? 60.073 40.077 53.889 1.00 62.51  ? 159 VAL A O   1 
ATOM   1012 C CB  . VAL A 1 159 ? 60.977 42.590 55.580 1.00 50.00  ? 159 VAL A CB  1 
ATOM   1013 C CG1 . VAL A 1 159 ? 62.065 43.507 56.125 1.00 57.27  ? 159 VAL A CG1 1 
ATOM   1014 C CG2 . VAL A 1 159 ? 60.617 43.060 54.195 1.00 51.09  ? 159 VAL A CG2 1 
ATOM   1015 N N   . LYS A 1 160 ? 59.678 39.577 56.059 1.00 53.42  ? 160 LYS A N   1 
ATOM   1016 C CA  . LYS A 1 160 ? 58.497 38.779 55.788 1.00 53.70  ? 160 LYS A CA  1 
ATOM   1017 C C   . LYS A 1 160 ? 57.430 39.870 55.802 1.00 58.82  ? 160 LYS A C   1 
ATOM   1018 O O   . LYS A 1 160 ? 57.430 40.728 56.686 1.00 56.77  ? 160 LYS A O   1 
ATOM   1019 C CB  . LYS A 1 160 ? 58.251 37.781 56.899 1.00 56.66  ? 160 LYS A CB  1 
ATOM   1020 C CG  . LYS A 1 160 ? 58.993 36.491 56.713 1.00 74.93  ? 160 LYS A CG  1 
ATOM   1021 C CD  . LYS A 1 160 ? 58.441 35.706 55.531 1.00 81.88  ? 160 LYS A CD  1 
ATOM   1022 C CE  . LYS A 1 160 ? 59.030 34.300 55.501 1.00 83.19  ? 160 LYS A CE  1 
ATOM   1023 N NZ  . LYS A 1 160 ? 58.387 33.466 54.455 1.00 89.77  ? 160 LYS A NZ  1 
ATOM   1024 N N   . VAL A 1 161 ? 56.534 39.860 54.822 1.00 59.84  ? 161 VAL A N   1 
ATOM   1025 C CA  . VAL A 1 161 ? 55.549 40.915 54.742 1.00 52.27  ? 161 VAL A CA  1 
ATOM   1026 C C   . VAL A 1 161 ? 54.107 40.504 54.531 1.00 53.49  ? 161 VAL A C   1 
ATOM   1027 O O   . VAL A 1 161 ? 53.781 39.790 53.594 1.00 57.71  ? 161 VAL A O   1 
ATOM   1028 C CB  . VAL A 1 161 ? 55.923 41.886 53.634 1.00 49.41  ? 161 VAL A CB  1 
ATOM   1029 C CG1 . VAL A 1 161 ? 54.837 42.923 53.473 1.00 41.95  ? 161 VAL A CG1 1 
ATOM   1030 C CG2 . VAL A 1 161 ? 57.266 42.532 53.949 1.00 43.52  ? 161 VAL A CG2 1 
ATOM   1031 N N   . TYR A 1 162 ? 53.240 40.965 55.423 1.00 56.39  ? 162 TYR A N   1 
ATOM   1032 C CA  . TYR A 1 162 ? 51.828 40.679 55.280 1.00 54.55  ? 162 TYR A CA  1 
ATOM   1033 C C   . TYR A 1 162 ? 51.100 41.979 54.994 1.00 50.88  ? 162 TYR A C   1 
ATOM   1034 O O   . TYR A 1 162 ? 51.064 42.866 55.835 1.00 53.70  ? 162 TYR A O   1 
ATOM   1035 C CB  . TYR A 1 162 ? 51.236 40.062 56.535 1.00 53.58  ? 162 TYR A CB  1 
ATOM   1036 C CG  . TYR A 1 162 ? 49.741 39.895 56.392 1.00 61.70  ? 162 TYR A CG  1 
ATOM   1037 C CD1 . TYR A 1 162 ? 49.207 39.087 55.384 1.00 63.45  ? 162 TYR A CD1 1 
ATOM   1038 C CD2 . TYR A 1 162 ? 48.860 40.527 57.270 1.00 59.44  ? 162 TYR A CD2 1 
ATOM   1039 C CE1 . TYR A 1 162 ? 47.831 38.902 55.257 1.00 54.21  ? 162 TYR A CE1 1 
ATOM   1040 C CE2 . TYR A 1 162 ? 47.491 40.348 57.158 1.00 57.43  ? 162 TYR A CE2 1 
ATOM   1041 C CZ  . TYR A 1 162 ? 46.985 39.531 56.153 1.00 60.10  ? 162 TYR A CZ  1 
ATOM   1042 O OH  . TYR A 1 162 ? 45.641 39.307 56.081 1.00 49.38  ? 162 TYR A OH  1 
ATOM   1043 N N   . ARG A 1 163 ? 50.542 42.089 53.797 1.00 47.45  ? 163 ARG A N   1 
ATOM   1044 C CA  . ARG A 1 163 ? 49.795 43.274 53.410 1.00 50.77  ? 163 ARG A CA  1 
ATOM   1045 C C   . ARG A 1 163 ? 48.296 42.982 53.561 1.00 51.74  ? 163 ARG A C   1 
ATOM   1046 O O   . ARG A 1 163 ? 47.735 42.170 52.809 1.00 52.65  ? 163 ARG A O   1 
ATOM   1047 C CB  . ARG A 1 163 ? 50.125 43.657 51.962 1.00 43.44  ? 163 ARG A CB  1 
ATOM   1048 C CG  . ARG A 1 163 ? 51.589 44.033 51.778 1.00 53.41  ? 163 ARG A CG  1 
ATOM   1049 C CD  . ARG A 1 163 ? 52.015 44.220 50.316 1.00 57.79  ? 163 ARG A CD  1 
ATOM   1050 N NE  . ARG A 1 163 ? 53.357 44.799 50.220 1.00 68.72  ? 163 ARG A NE  1 
ATOM   1051 C CZ  . ARG A 1 163 ? 53.690 45.986 50.733 1.00 78.78  ? 163 ARG A CZ  1 
ATOM   1052 N NH1 . ARG A 1 163 ? 52.777 46.714 51.370 1.00 84.07  ? 163 ARG A NH1 1 
ATOM   1053 N NH2 . ARG A 1 163 ? 54.932 46.450 50.630 1.00 73.11  ? 163 ARG A NH2 1 
ATOM   1054 N N   . GLN A 1 164 ? 47.666 43.602 54.566 1.00 45.52  ? 164 GLN A N   1 
ATOM   1055 C CA  . GLN A 1 164 ? 46.228 43.431 54.776 1.00 46.46  ? 164 GLN A CA  1 
ATOM   1056 C C   . GLN A 1 164 ? 45.529 44.317 53.737 1.00 43.71  ? 164 GLN A C   1 
ATOM   1057 O O   . GLN A 1 164 ? 45.930 45.464 53.479 1.00 36.05  ? 164 GLN A O   1 
ATOM   1058 C CB  . GLN A 1 164 ? 45.824 43.873 56.172 1.00 44.34  ? 164 GLN A CB  1 
ATOM   1059 C CG  . GLN A 1 164 ? 44.562 43.226 56.663 1.00 42.40  ? 164 GLN A CG  1 
ATOM   1060 C CD  . GLN A 1 164 ? 43.911 44.007 57.780 1.00 43.23  ? 164 GLN A CD  1 
ATOM   1061 O OE1 . GLN A 1 164 ? 43.038 43.484 58.483 1.00 43.06  ? 164 GLN A OE1 1 
ATOM   1062 N NE2 . GLN A 1 164 ? 44.326 45.273 57.956 1.00 28.62  ? 164 GLN A NE2 1 
ATOM   1063 N N   . THR A 1 165 ? 44.501 43.769 53.121 1.00 39.51  ? 165 THR A N   1 
ATOM   1064 C CA  . THR A 1 165 ? 43.764 44.486 52.091 1.00 45.63  ? 165 THR A CA  1 
ATOM   1065 C C   . THR A 1 165 ? 42.268 44.302 52.321 1.00 43.83  ? 165 THR A C   1 
ATOM   1066 O O   . THR A 1 165 ? 41.833 43.337 52.955 1.00 34.47  ? 165 THR A O   1 
ATOM   1067 C CB  . THR A 1 165 ? 44.122 43.950 50.681 1.00 46.59  ? 165 THR A CB  1 
ATOM   1068 O OG1 . THR A 1 165 ? 43.767 42.565 50.608 1.00 54.58  ? 165 THR A OG1 1 
ATOM   1069 C CG2 . THR A 1 165 ? 45.621 44.084 50.403 1.00 44.08  ? 165 THR A CG2 1 
ATOM   1070 N N   . ALA A 1 166 ? 41.468 45.220 51.798 1.00 44.03  ? 166 ALA A N   1 
ATOM   1071 C CA  . ALA A 1 166 ? 40.029 45.098 51.997 1.00 39.10  ? 166 ALA A CA  1 
ATOM   1072 C C   . ALA A 1 166 ? 39.268 45.418 50.719 1.00 38.01  ? 166 ALA A C   1 
ATOM   1073 O O   . ALA A 1 166 ? 39.729 46.178 49.866 1.00 37.81  ? 166 ALA A O   1 
ATOM   1074 C CB  . ALA A 1 166 ? 39.575 46.018 53.167 1.00 27.30  ? 166 ALA A CB  1 
ATOM   1075 N N   . TYR A 1 167 ? 38.113 44.789 50.573 1.00 41.67  ? 167 TYR A N   1 
ATOM   1076 C CA  . TYR A 1 167 ? 37.282 45.023 49.406 1.00 39.21  ? 167 TYR A CA  1 
ATOM   1077 C C   . TYR A 1 167 ? 36.273 46.122 49.791 1.00 40.02  ? 167 TYR A C   1 
ATOM   1078 O O   . TYR A 1 167 ? 35.591 46.005 50.809 1.00 33.54  ? 167 TYR A O   1 
ATOM   1079 C CB  . TYR A 1 167 ? 36.552 43.735 49.047 1.00 35.38  ? 167 TYR A CB  1 
ATOM   1080 C CG  . TYR A 1 167 ? 35.710 43.862 47.806 1.00 45.60  ? 167 TYR A CG  1 
ATOM   1081 C CD1 . TYR A 1 167 ? 36.257 43.610 46.542 1.00 41.92  ? 167 TYR A CD1 1 
ATOM   1082 C CD2 . TYR A 1 167 ? 34.360 44.284 47.888 1.00 42.49  ? 167 TYR A CD2 1 
ATOM   1083 C CE1 . TYR A 1 167 ? 35.492 43.765 45.376 1.00 39.10  ? 167 TYR A CE1 1 
ATOM   1084 C CE2 . TYR A 1 167 ? 33.590 44.449 46.737 1.00 41.25  ? 167 TYR A CE2 1 
ATOM   1085 C CZ  . TYR A 1 167 ? 34.159 44.181 45.485 1.00 42.52  ? 167 TYR A CZ  1 
ATOM   1086 O OH  . TYR A 1 167 ? 33.390 44.289 44.359 1.00 44.89  ? 167 TYR A OH  1 
ATOM   1087 N N   . LEU A 1 168 ? 36.198 47.182 48.997 1.00 40.85  ? 168 LEU A N   1 
ATOM   1088 C CA  . LEU A 1 168 ? 35.263 48.281 49.259 1.00 39.08  ? 168 LEU A CA  1 
ATOM   1089 C C   . LEU A 1 168 ? 34.691 48.805 47.946 1.00 40.12  ? 168 LEU A C   1 
ATOM   1090 O O   . LEU A 1 168 ? 35.336 49.602 47.265 1.00 32.94  ? 168 LEU A O   1 
ATOM   1091 C CB  . LEU A 1 168 ? 35.940 49.448 49.997 1.00 44.21  ? 168 LEU A CB  1 
ATOM   1092 C CG  . LEU A 1 168 ? 35.123 50.158 51.115 1.00 44.65  ? 168 LEU A CG  1 
ATOM   1093 C CD1 . LEU A 1 168 ? 35.584 51.585 51.281 1.00 44.49  ? 168 LEU A CD1 1 
ATOM   1094 C CD2 . LEU A 1 168 ? 33.641 50.151 50.797 1.00 44.20  ? 168 LEU A CD2 1 
ATOM   1095 N N   . HIS A 1 169 ? 33.492 48.338 47.585 1.00 38.97  ? 169 HIS A N   1 
ATOM   1096 C CA  . HIS A 1 169 ? 32.815 48.762 46.342 1.00 44.89  ? 169 HIS A CA  1 
ATOM   1097 C C   . HIS A 1 169 ? 33.581 48.388 45.099 1.00 35.42  ? 169 HIS A C   1 
ATOM   1098 O O   . HIS A 1 169 ? 33.413 49.017 44.037 1.00 41.88  ? 169 HIS A O   1 
ATOM   1099 C CB  . HIS A 1 169 ? 32.558 50.288 46.367 1.00 32.28  ? 169 HIS A CB  1 
ATOM   1100 C CG  . HIS A 1 169 ? 31.829 50.727 47.594 1.00 36.47  ? 169 HIS A CG  1 
ATOM   1101 N ND1 . HIS A 1 169 ? 32.038 51.947 48.198 1.00 40.36  ? 169 HIS A ND1 1 
ATOM   1102 C CD2 . HIS A 1 169 ? 30.940 50.066 48.375 1.00 33.53  ? 169 HIS A CD2 1 
ATOM   1103 C CE1 . HIS A 1 169 ? 31.316 52.016 49.304 1.00 46.91  ? 169 HIS A CE1 1 
ATOM   1104 N NE2 . HIS A 1 169 ? 30.643 50.885 49.435 1.00 27.71  ? 169 HIS A NE2 1 
ATOM   1105 N N   . GLY A 1 170 ? 34.432 47.372 45.219 1.00 41.77  ? 170 GLY A N   1 
ATOM   1106 C CA  . GLY A 1 170 ? 35.223 46.945 44.074 1.00 39.30  ? 170 GLY A CA  1 
ATOM   1107 C C   . GLY A 1 170 ? 36.655 47.458 44.134 1.00 43.21  ? 170 GLY A C   1 
ATOM   1108 O O   . GLY A 1 170 ? 37.528 46.974 43.426 1.00 45.02  ? 170 GLY A O   1 
ATOM   1109 N N   . ASN A 1 171 ? 36.908 48.452 44.967 1.00 42.06  ? 171 ASN A N   1 
ATOM   1110 C CA  . ASN A 1 171 ? 38.275 48.969 45.107 1.00 47.55  ? 171 ASN A CA  1 
ATOM   1111 C C   . ASN A 1 171 ? 38.921 48.114 46.191 1.00 50.97  ? 171 ASN A C   1 
ATOM   1112 O O   . ASN A 1 171 ? 38.377 47.982 47.282 1.00 51.21  ? 171 ASN A O   1 
ATOM   1113 C CB  . ASN A 1 171 ? 38.225 50.430 45.546 1.00 41.09  ? 171 ASN A CB  1 
ATOM   1114 C CG  . ASN A 1 171 ? 39.590 51.039 45.753 1.00 48.07  ? 171 ASN A CG  1 
ATOM   1115 O OD1 . ASN A 1 171 ? 40.572 50.620 45.152 1.00 39.23  ? 171 ASN A OD1 1 
ATOM   1116 N ND2 . ASN A 1 171 ? 39.650 52.075 46.596 1.00 50.95  ? 171 ASN A ND2 1 
ATOM   1117 N N   . VAL A 1 172 ? 40.049 47.486 45.895 1.00 53.81  ? 172 VAL A N   1 
ATOM   1118 C CA  . VAL A 1 172 ? 40.705 46.680 46.914 1.00 47.40  ? 172 VAL A CA  1 
ATOM   1119 C C   . VAL A 1 172 ? 41.780 47.567 47.491 1.00 47.69  ? 172 VAL A C   1 
ATOM   1120 O O   . VAL A 1 172 ? 42.714 47.936 46.809 1.00 51.46  ? 172 VAL A O   1 
ATOM   1121 C CB  . VAL A 1 172 ? 41.297 45.401 46.321 1.00 57.35  ? 172 VAL A CB  1 
ATOM   1122 C CG1 . VAL A 1 172 ? 42.143 44.651 47.379 1.00 43.71  ? 172 VAL A CG1 1 
ATOM   1123 C CG2 . VAL A 1 172 ? 40.144 44.519 45.834 1.00 44.72  ? 172 VAL A CG2 1 
ATOM   1124 N N   . ILE A 1 173 ? 41.629 47.930 48.757 1.00 47.09  ? 173 ILE A N   1 
ATOM   1125 C CA  . ILE A 1 173 ? 42.578 48.822 49.372 1.00 43.49  ? 173 ILE A CA  1 
ATOM   1126 C C   . ILE A 1 173 ? 43.486 48.210 50.423 1.00 48.08  ? 173 ILE A C   1 
ATOM   1127 O O   . ILE A 1 173 ? 43.145 47.205 51.080 1.00 41.16  ? 173 ILE A O   1 
ATOM   1128 C CB  . ILE A 1 173 ? 41.856 50.038 50.012 1.00 46.88  ? 173 ILE A CB  1 
ATOM   1129 C CG1 . ILE A 1 173 ? 40.868 49.570 51.080 1.00 34.56  ? 173 ILE A CG1 1 
ATOM   1130 C CG2 . ILE A 1 173 ? 41.083 50.789 48.958 1.00 41.42  ? 173 ILE A CG2 1 
ATOM   1131 C CD1 . ILE A 1 173 ? 40.250 50.713 51.854 1.00 45.00  ? 173 ILE A CD1 1 
ATOM   1132 N N   . PRO A 1 174 ? 44.677 48.804 50.574 1.00 42.09  ? 174 PRO A N   1 
ATOM   1133 C CA  . PRO A 1 174 ? 45.672 48.357 51.551 1.00 41.50  ? 174 PRO A CA  1 
ATOM   1134 C C   . PRO A 1 174 ? 45.282 48.910 52.914 1.00 45.41  ? 174 PRO A C   1 
ATOM   1135 O O   . PRO A 1 174 ? 45.101 50.117 53.072 1.00 47.89  ? 174 PRO A O   1 
ATOM   1136 C CB  . PRO A 1 174 ? 46.972 49.000 51.055 1.00 31.62  ? 174 PRO A CB  1 
ATOM   1137 C CG  . PRO A 1 174 ? 46.496 50.311 50.461 1.00 39.64  ? 174 PRO A CG  1 
ATOM   1138 C CD  . PRO A 1 174 ? 45.198 49.907 49.738 1.00 40.21  ? 174 PRO A CD  1 
ATOM   1139 N N   . LEU A 1 175 ? 45.106 48.040 53.891 1.00 41.93  ? 175 LEU A N   1 
ATOM   1140 C CA  . LEU A 1 175 ? 44.810 48.520 55.222 1.00 43.89  ? 175 LEU A CA  1 
ATOM   1141 C C   . LEU A 1 175 ? 46.182 48.542 55.890 1.00 39.50  ? 175 LEU A C   1 
ATOM   1142 O O   . LEU A 1 175 ? 47.047 49.308 55.472 1.00 41.02  ? 175 LEU A O   1 
ATOM   1143 C CB  . LEU A 1 175 ? 43.843 47.576 55.931 1.00 35.92  ? 175 LEU A CB  1 
ATOM   1144 C CG  . LEU A 1 175 ? 42.443 47.608 55.312 1.00 45.33  ? 175 LEU A CG  1 
ATOM   1145 C CD1 . LEU A 1 175 ? 41.491 46.805 56.189 1.00 38.21  ? 175 LEU A CD1 1 
ATOM   1146 C CD2 . LEU A 1 175 ? 41.964 49.066 55.158 1.00 28.27  ? 175 LEU A CD2 1 
ATOM   1147 N N   . ASN A 1 176 ? 46.392 47.675 56.874 1.00 43.71  ? 176 ASN A N   1 
ATOM   1148 C CA  . ASN A 1 176 ? 47.674 47.577 57.576 1.00 46.73  ? 176 ASN A CA  1 
ATOM   1149 C C   . ASN A 1 176 ? 48.723 46.684 56.906 1.00 49.93  ? 176 ASN A C   1 
ATOM   1150 O O   . ASN A 1 176 ? 48.407 45.609 56.388 1.00 47.12  ? 176 ASN A O   1 
ATOM   1151 C CB  . ASN A 1 176 ? 47.439 47.051 58.972 1.00 44.00  ? 176 ASN A CB  1 
ATOM   1152 C CG  . ASN A 1 176 ? 46.601 47.968 59.772 1.00 37.41  ? 176 ASN A CG  1 
ATOM   1153 O OD1 . ASN A 1 176 ? 47.080 48.995 60.257 1.00 43.78  ? 176 ASN A OD1 1 
ATOM   1154 N ND2 . ASN A 1 176 ? 45.322 47.625 59.912 1.00 44.18  ? 176 ASN A ND2 1 
ATOM   1155 N N   . THR A 1 177 ? 49.975 47.133 56.931 1.00 45.70  ? 177 THR A N   1 
ATOM   1156 C CA  . THR A 1 177 ? 51.057 46.345 56.365 1.00 43.26  ? 177 THR A CA  1 
ATOM   1157 C C   . THR A 1 177 ? 52.066 45.973 57.463 1.00 49.73  ? 177 THR A C   1 
ATOM   1158 O O   . THR A 1 177 ? 52.666 46.848 58.111 1.00 41.60  ? 177 THR A O   1 
ATOM   1159 C CB  . THR A 1 177 ? 51.756 47.127 55.262 1.00 53.67  ? 177 THR A CB  1 
ATOM   1160 O OG1 . THR A 1 177 ? 50.786 47.505 54.266 1.00 49.72  ? 177 THR A OG1 1 
ATOM   1161 C CG2 . THR A 1 177 ? 52.880 46.288 54.639 1.00 40.96  ? 177 THR A CG2 1 
ATOM   1162 N N   . PHE A 1 178 ? 52.218 44.675 57.703 1.00 45.03  ? 178 PHE A N   1 
ATOM   1163 C CA  . PHE A 1 178 ? 53.174 44.197 58.705 1.00 53.19  ? 178 PHE A CA  1 
ATOM   1164 C C   . PHE A 1 178 ? 54.548 43.910 58.048 1.00 61.47  ? 178 PHE A C   1 
ATOM   1165 O O   . PHE A 1 178 ? 54.605 43.386 56.927 1.00 56.17  ? 178 PHE A O   1 
ATOM   1166 C CB  . PHE A 1 178 ? 52.684 42.898 59.354 1.00 51.46  ? 178 PHE A CB  1 
ATOM   1167 C CG  . PHE A 1 178 ? 51.412 43.035 60.145 1.00 57.61  ? 178 PHE A CG  1 
ATOM   1168 C CD1 . PHE A 1 178 ? 50.191 43.253 59.505 1.00 57.42  ? 178 PHE A CD1 1 
ATOM   1169 C CD2 . PHE A 1 178 ? 51.420 42.869 61.534 1.00 49.22  ? 178 PHE A CD2 1 
ATOM   1170 C CE1 . PHE A 1 178 ? 48.989 43.295 60.235 1.00 54.40  ? 178 PHE A CE1 1 
ATOM   1171 C CE2 . PHE A 1 178 ? 50.237 42.910 62.271 1.00 54.68  ? 178 PHE A CE2 1 
ATOM   1172 C CZ  . PHE A 1 178 ? 49.006 43.123 61.616 1.00 45.98  ? 178 PHE A CZ  1 
ATOM   1173 N N   . ARG A 1 179 ? 55.640 44.276 58.730 1.00 65.83  ? 179 ARG A N   1 
ATOM   1174 C CA  . ARG A 1 179 ? 57.017 44.008 58.254 1.00 61.16  ? 179 ARG A CA  1 
ATOM   1175 C C   . ARG A 1 179 ? 57.740 43.312 59.401 1.00 59.94  ? 179 ARG A C   1 
ATOM   1176 O O   . ARG A 1 179 ? 57.681 43.765 60.534 1.00 58.44  ? 179 ARG A O   1 
ATOM   1177 C CB  . ARG A 1 179 ? 57.837 45.287 57.987 1.00 63.31  ? 179 ARG A CB  1 
ATOM   1178 C CG  . ARG A 1 179 ? 57.413 46.223 56.883 1.00 61.45  ? 179 ARG A CG  1 
ATOM   1179 C CD  . ARG A 1 179 ? 57.524 45.603 55.513 1.00 73.87  ? 179 ARG A CD  1 
ATOM   1180 N NE  . ARG A 1 179 ? 57.451 46.594 54.435 1.00 79.80  ? 179 ARG A NE  1 
ATOM   1181 C CZ  . ARG A 1 179 ? 56.641 47.653 54.417 1.00 83.13  ? 179 ARG A CZ  1 
ATOM   1182 N NH1 . ARG A 1 179 ? 55.814 47.894 55.428 1.00 86.95  ? 179 ARG A NH1 1 
ATOM   1183 N NH2 . ARG A 1 179 ? 56.644 48.469 53.371 1.00 87.20  ? 179 ARG A NH2 1 
ATOM   1184 N N   . VAL A 1 180 ? 58.414 42.211 59.130 1.00 64.43  ? 180 VAL A N   1 
ATOM   1185 C CA  . VAL A 1 180 ? 59.199 41.566 60.178 1.00 61.94  ? 180 VAL A CA  1 
ATOM   1186 C C   . VAL A 1 180 ? 60.526 41.213 59.543 1.00 63.81  ? 180 VAL A C   1 
ATOM   1187 O O   . VAL A 1 180 ? 60.598 40.303 58.714 1.00 60.78  ? 180 VAL A O   1 
ATOM   1188 C CB  . VAL A 1 180 ? 58.567 40.280 60.708 1.00 64.57  ? 180 VAL A CB  1 
ATOM   1189 C CG1 . VAL A 1 180 ? 59.563 39.563 61.602 1.00 55.94  ? 180 VAL A CG1 1 
ATOM   1190 C CG2 . VAL A 1 180 ? 57.311 40.600 61.497 1.00 66.09  ? 180 VAL A CG2 1 
ATOM   1191 N N   . ALA A 1 181 ? 61.564 41.963 59.899 1.00 63.43  ? 181 ALA A N   1 
ATOM   1192 C CA  . ALA A 1 181 ? 62.902 41.710 59.368 1.00 61.65  ? 181 ALA A CA  1 
ATOM   1193 C C   . ALA A 1 181 ? 63.269 40.246 59.668 1.00 58.43  ? 181 ALA A C   1 
ATOM   1194 O O   . ALA A 1 181 ? 63.067 39.757 60.776 1.00 56.71  ? 181 ALA A O   1 
ATOM   1195 C CB  . ALA A 1 181 ? 63.887 42.658 60.006 1.00 57.20  ? 181 ALA A CB  1 
ATOM   1196 N N   . THR A 1 182 ? 63.804 39.532 58.688 1.00 60.80  ? 182 THR A N   1 
ATOM   1197 C CA  . THR A 1 182 ? 64.111 38.126 58.932 1.00 67.20  ? 182 THR A CA  1 
ATOM   1198 C C   . THR A 1 182 ? 65.577 37.757 59.244 1.00 67.95  ? 182 THR A C   1 
ATOM   1199 O O   . THR A 1 182 ? 65.846 36.655 59.725 1.00 63.65  ? 182 THR A O   1 
ATOM   1200 C CB  . THR A 1 182 ? 63.585 37.262 57.766 1.00 63.07  ? 182 THR A CB  1 
ATOM   1201 O OG1 . THR A 1 182 ? 63.775 35.884 58.081 1.00 77.44  ? 182 THR A OG1 1 
ATOM   1202 C CG2 . THR A 1 182 ? 64.317 37.582 56.479 1.00 60.55  ? 182 THR A CG2 1 
ATOM   1203 N N   . ASP A 1 183 ? 66.512 38.674 58.993 1.00 63.47  ? 183 ASP A N   1 
ATOM   1204 C CA  . ASP A 1 183 ? 67.933 38.428 59.272 1.00 58.56  ? 183 ASP A CA  1 
ATOM   1205 C C   . ASP A 1 183 ? 68.269 38.777 60.729 1.00 62.87  ? 183 ASP A C   1 
ATOM   1206 O O   . ASP A 1 183 ? 68.939 39.780 61.010 1.00 62.38  ? 183 ASP A O   1 
ATOM   1207 C CB  . ASP A 1 183 ? 68.800 39.263 58.327 1.00 58.55  ? 183 ASP A CB  1 
ATOM   1208 C CG  . ASP A 1 183 ? 68.404 39.090 56.862 1.00 63.99  ? 183 ASP A CG  1 
ATOM   1209 O OD1 . ASP A 1 183 ? 68.152 37.931 56.448 1.00 60.93  ? 183 ASP A OD1 1 
ATOM   1210 O OD2 . ASP A 1 183 ? 68.356 40.108 56.126 1.00 50.02  ? 183 ASP A OD2 1 
ATOM   1211 N N   . THR A 1 184 ? 67.806 37.940 61.650 1.00 60.96  ? 184 THR A N   1 
ATOM   1212 C CA  . THR A 1 184 ? 68.014 38.155 63.079 1.00 68.83  ? 184 THR A CA  1 
ATOM   1213 C C   . THR A 1 184 ? 69.424 38.512 63.524 1.00 75.03  ? 184 THR A C   1 
ATOM   1214 O O   . THR A 1 184 ? 69.662 39.592 64.069 1.00 71.35  ? 184 THR A O   1 
ATOM   1215 C CB  . THR A 1 184 ? 67.577 36.924 63.870 1.00 71.50  ? 184 THR A CB  1 
ATOM   1216 O OG1 . THR A 1 184 ? 66.148 36.900 63.939 1.00 85.05  ? 184 THR A OG1 1 
ATOM   1217 C CG2 . THR A 1 184 ? 68.161 36.945 65.278 1.00 79.40  ? 184 THR A CG2 1 
ATOM   1218 N N   . GLU A 1 185 ? 70.343 37.572 63.315 1.00 78.12  ? 185 GLU A N   1 
ATOM   1219 C CA  . GLU A 1 185 ? 71.740 37.736 63.687 1.00 78.67  ? 185 GLU A CA  1 
ATOM   1220 C C   . GLU A 1 185 ? 72.266 39.102 63.260 1.00 69.33  ? 185 GLU A C   1 
ATOM   1221 O O   . GLU A 1 185 ? 72.667 39.903 64.099 1.00 69.94  ? 185 GLU A O   1 
ATOM   1222 C CB  . GLU A 1 185 ? 72.583 36.628 63.041 1.00 89.21  ? 185 GLU A CB  1 
ATOM   1223 C CG  . GLU A 1 185 ? 71.858 35.286 62.916 1.00 104.92 ? 185 GLU A CG  1 
ATOM   1224 C CD  . GLU A 1 185 ? 71.431 34.706 64.256 1.00 113.77 ? 185 GLU A CD  1 
ATOM   1225 O OE1 . GLU A 1 185 ? 70.569 33.796 64.267 1.00 115.87 ? 185 GLU A OE1 1 
ATOM   1226 O OE2 . GLU A 1 185 ? 71.963 35.152 65.296 1.00 119.18 ? 185 GLU A OE2 1 
ATOM   1227 N N   . TYR A 1 186 ? 72.250 39.360 61.956 1.00 61.38  ? 186 TYR A N   1 
ATOM   1228 C CA  . TYR A 1 186 ? 72.729 40.621 61.401 1.00 65.02  ? 186 TYR A CA  1 
ATOM   1229 C C   . TYR A 1 186 ? 72.182 41.845 62.122 1.00 69.57  ? 186 TYR A C   1 
ATOM   1230 O O   . TYR A 1 186 ? 72.932 42.779 62.443 1.00 72.25  ? 186 TYR A O   1 
ATOM   1231 C CB  . TYR A 1 186 ? 72.366 40.722 59.924 1.00 62.46  ? 186 TYR A CB  1 
ATOM   1232 C CG  . TYR A 1 186 ? 72.676 42.073 59.342 1.00 68.94  ? 186 TYR A CG  1 
ATOM   1233 C CD1 . TYR A 1 186 ? 73.986 42.449 59.062 1.00 68.71  ? 186 TYR A CD1 1 
ATOM   1234 C CD2 . TYR A 1 186 ? 71.663 43.005 59.129 1.00 66.52  ? 186 TYR A CD2 1 
ATOM   1235 C CE1 . TYR A 1 186 ? 74.284 43.727 58.587 1.00 71.18  ? 186 TYR A CE1 1 
ATOM   1236 C CE2 . TYR A 1 186 ? 71.945 44.277 58.659 1.00 69.73  ? 186 TYR A CE2 1 
ATOM   1237 C CZ  . TYR A 1 186 ? 73.259 44.642 58.391 1.00 74.53  ? 186 TYR A CZ  1 
ATOM   1238 O OH  . TYR A 1 186 ? 73.539 45.934 57.975 1.00 64.84  ? 186 TYR A OH  1 
ATOM   1239 N N   . LEU A 1 187 ? 70.870 41.838 62.350 1.00 70.02  ? 187 LEU A N   1 
ATOM   1240 C CA  . LEU A 1 187 ? 70.184 42.930 63.029 1.00 69.81  ? 187 LEU A CA  1 
ATOM   1241 C C   . LEU A 1 187 ? 70.611 43.033 64.476 1.00 69.34  ? 187 LEU A C   1 
ATOM   1242 O O   . LEU A 1 187 ? 70.775 44.145 64.997 1.00 67.18  ? 187 LEU A O   1 
ATOM   1243 C CB  . LEU A 1 187 ? 68.669 42.739 62.967 1.00 65.45  ? 187 LEU A CB  1 
ATOM   1244 C CG  . LEU A 1 187 ? 68.035 43.003 61.608 1.00 59.75  ? 187 LEU A CG  1 
ATOM   1245 C CD1 . LEU A 1 187 ? 66.573 42.608 61.673 1.00 66.83  ? 187 LEU A CD1 1 
ATOM   1246 C CD2 . LEU A 1 187 ? 68.184 44.466 61.238 1.00 46.37  ? 187 LEU A CD2 1 
ATOM   1247 N N   . ARG A 1 188 ? 70.776 41.878 65.123 1.00 68.33  ? 188 ARG A N   1 
ATOM   1248 C CA  . ARG A 1 188 ? 71.202 41.839 66.523 1.00 71.62  ? 188 ARG A CA  1 
ATOM   1249 C C   . ARG A 1 188 ? 72.479 42.669 66.633 1.00 73.92  ? 188 ARG A C   1 
ATOM   1250 O O   . ARG A 1 188 ? 72.642 43.464 67.562 1.00 72.78  ? 188 ARG A O   1 
ATOM   1251 C CB  . ARG A 1 188 ? 71.462 40.393 66.968 1.00 75.53  ? 188 ARG A CB  1 
ATOM   1252 N N   . ASP A 1 189 ? 73.373 42.491 65.664 1.00 72.11  ? 189 ASP A N   1 
ATOM   1253 C CA  . ASP A 1 189 ? 74.615 43.239 65.648 1.00 79.39  ? 189 ASP A CA  1 
ATOM   1254 C C   . ASP A 1 189 ? 74.339 44.701 65.347 1.00 83.62  ? 189 ASP A C   1 
ATOM   1255 O O   . ASP A 1 189 ? 74.207 45.512 66.264 1.00 89.36  ? 189 ASP A O   1 
ATOM   1256 C CB  . ASP A 1 189 ? 75.575 42.688 64.597 1.00 84.67  ? 189 ASP A CB  1 
ATOM   1257 C CG  . ASP A 1 189 ? 76.005 41.272 64.893 1.00 92.48  ? 189 ASP A CG  1 
ATOM   1258 O OD1 . ASP A 1 189 ? 75.986 40.886 66.084 1.00 97.39  ? 189 ASP A OD1 1 
ATOM   1259 O OD2 . ASP A 1 189 ? 76.374 40.548 63.940 1.00 97.69  ? 189 ASP A OD2 1 
ATOM   1260 N N   . ARG A 1 190 ? 74.249 45.023 64.058 1.00 79.33  ? 190 ARG A N   1 
ATOM   1261 C CA  . ARG A 1 190 ? 73.998 46.386 63.586 1.00 73.89  ? 190 ARG A CA  1 
ATOM   1262 C C   . ARG A 1 190 ? 73.345 47.346 64.578 1.00 67.98  ? 190 ARG A C   1 
ATOM   1263 O O   . ARG A 1 190 ? 73.761 48.496 64.706 1.00 71.30  ? 190 ARG A O   1 
ATOM   1264 C CB  . ARG A 1 190 ? 73.179 46.330 62.304 1.00 73.83  ? 190 ARG A CB  1 
ATOM   1265 C CG  . ARG A 1 190 ? 74.005 45.944 61.107 1.00 78.64  ? 190 ARG A CG  1 
ATOM   1266 C CD  . ARG A 1 190 ? 74.335 47.169 60.262 1.00 88.67  ? 190 ARG A CD  1 
ATOM   1267 N NE  . ARG A 1 190 ? 74.998 48.230 61.013 1.00 91.68  ? 190 ARG A NE  1 
ATOM   1268 C CZ  . ARG A 1 190 ? 75.279 49.433 60.517 1.00 92.86  ? 190 ARG A CZ  1 
ATOM   1269 N NH1 . ARG A 1 190 ? 74.955 49.737 59.267 1.00 83.88  ? 190 ARG A NH1 1 
ATOM   1270 N NH2 . ARG A 1 190 ? 75.891 50.335 61.270 1.00 94.85  ? 190 ARG A NH2 1 
ATOM   1271 N N   . VAL A 1 191 ? 72.327 46.879 65.282 1.00 62.50  ? 191 VAL A N   1 
ATOM   1272 C CA  . VAL A 1 191 ? 71.649 47.720 66.259 1.00 60.49  ? 191 VAL A CA  1 
ATOM   1273 C C   . VAL A 1 191 ? 72.574 48.098 67.433 1.00 64.45  ? 191 VAL A C   1 
ATOM   1274 O O   . VAL A 1 191 ? 72.635 49.259 67.832 1.00 63.37  ? 191 VAL A O   1 
ATOM   1275 C CB  . VAL A 1 191 ? 70.370 47.004 66.776 1.00 53.69  ? 191 VAL A CB  1 
ATOM   1276 C CG1 . VAL A 1 191 ? 69.811 47.699 67.986 1.00 47.69  ? 191 VAL A CG1 1 
ATOM   1277 C CG2 . VAL A 1 191 ? 69.331 46.989 65.674 1.00 64.72  ? 191 VAL A CG2 1 
ATOM   1278 N N   . ALA A 1 192 ? 73.280 47.119 67.994 1.00 69.17  ? 192 ALA A N   1 
ATOM   1279 C CA  . ALA A 1 192 ? 74.194 47.388 69.105 1.00 71.80  ? 192 ALA A CA  1 
ATOM   1280 C C   . ALA A 1 192 ? 75.214 48.373 68.558 1.00 73.58  ? 192 ALA A C   1 
ATOM   1281 O O   . ALA A 1 192 ? 75.568 49.370 69.200 1.00 66.99  ? 192 ALA A O   1 
ATOM   1282 C CB  . ALA A 1 192 ? 74.889 46.104 69.546 1.00 71.97  ? 192 ALA A CB  1 
ATOM   1283 N N   . HIS A 1 193 ? 75.660 48.079 67.343 1.00 65.76  ? 193 HIS A N   1 
ATOM   1284 C CA  . HIS A 1 193 ? 76.617 48.909 66.653 1.00 64.00  ? 193 HIS A CA  1 
ATOM   1285 C C   . HIS A 1 193 ? 76.074 50.340 66.570 1.00 65.34  ? 193 HIS A C   1 
ATOM   1286 O O   . HIS A 1 193 ? 76.599 51.282 67.182 1.00 65.33  ? 193 HIS A O   1 
ATOM   1287 C CB  . HIS A 1 193 ? 76.838 48.351 65.244 1.00 60.44  ? 193 HIS A CB  1 
ATOM   1288 C CG  . HIS A 1 193 ? 78.036 48.921 64.545 1.00 76.12  ? 193 HIS A CG  1 
ATOM   1289 N ND1 . HIS A 1 193 ? 79.236 48.245 64.454 1.00 80.03  ? 193 HIS A ND1 1 
ATOM   1290 C CD2 . HIS A 1 193 ? 78.231 50.115 63.935 1.00 74.51  ? 193 HIS A CD2 1 
ATOM   1291 C CE1 . HIS A 1 193 ? 80.117 48.999 63.818 1.00 77.70  ? 193 HIS A CE1 1 
ATOM   1292 N NE2 . HIS A 1 193 ? 79.532 50.139 63.493 1.00 74.01  ? 193 HIS A NE2 1 
ATOM   1293 N N   . LEU A 1 194 ? 75.001 50.485 65.810 1.00 65.42  ? 194 LEU A N   1 
ATOM   1294 C CA  . LEU A 1 194 ? 74.388 51.778 65.595 1.00 62.83  ? 194 LEU A CA  1 
ATOM   1295 C C   . LEU A 1 194 ? 73.969 52.504 66.857 1.00 58.36  ? 194 LEU A C   1 
ATOM   1296 O O   . LEU A 1 194 ? 74.059 53.732 66.929 1.00 61.07  ? 194 LEU A O   1 
ATOM   1297 C CB  . LEU A 1 194 ? 73.194 51.622 64.654 1.00 64.82  ? 194 LEU A CB  1 
ATOM   1298 C CG  . LEU A 1 194 ? 73.603 51.249 63.231 1.00 61.62  ? 194 LEU A CG  1 
ATOM   1299 C CD1 . LEU A 1 194 ? 72.369 50.972 62.394 1.00 74.82  ? 194 LEU A CD1 1 
ATOM   1300 C CD2 . LEU A 1 194 ? 74.418 52.379 62.633 1.00 69.80  ? 194 LEU A CD2 1 
ATOM   1301 N N   . ARG A 1 195 ? 73.517 51.753 67.848 1.00 47.85  ? 195 ARG A N   1 
ATOM   1302 C CA  . ARG A 1 195 ? 73.066 52.340 69.108 1.00 53.80  ? 195 ARG A CA  1 
ATOM   1303 C C   . ARG A 1 195 ? 74.213 53.161 69.695 1.00 60.83  ? 195 ARG A C   1 
ATOM   1304 O O   . ARG A 1 195 ? 74.027 54.269 70.226 1.00 54.71  ? 195 ARG A O   1 
ATOM   1305 C CB  . ARG A 1 195 ? 72.687 51.219 70.084 1.00 52.81  ? 195 ARG A CB  1 
ATOM   1306 C CG  . ARG A 1 195 ? 71.986 51.653 71.369 1.00 51.83  ? 195 ARG A CG  1 
ATOM   1307 C CD  . ARG A 1 195 ? 72.270 50.650 72.514 1.00 64.36  ? 195 ARG A CD  1 
ATOM   1308 N NE  . ARG A 1 195 ? 72.176 49.251 72.092 1.00 62.44  ? 195 ARG A NE  1 
ATOM   1309 C CZ  . ARG A 1 195 ? 73.062 48.313 72.413 1.00 68.56  ? 195 ARG A CZ  1 
ATOM   1310 N NH1 . ARG A 1 195 ? 72.909 47.060 71.985 1.00 65.93  ? 195 ARG A NH1 1 
ATOM   1311 N NH2 . ARG A 1 195 ? 74.110 48.626 73.164 1.00 64.31  ? 195 ARG A NH2 1 
ATOM   1312 N N   . THR A 1 196 ? 75.408 52.596 69.578 1.00 63.19  ? 196 THR A N   1 
ATOM   1313 C CA  . THR A 1 196 ? 76.605 53.208 70.107 1.00 70.51  ? 196 THR A CA  1 
ATOM   1314 C C   . THR A 1 196 ? 77.181 54.202 69.113 1.00 74.95  ? 196 THR A C   1 
ATOM   1315 O O   . THR A 1 196 ? 77.584 55.313 69.484 1.00 74.23  ? 196 THR A O   1 
ATOM   1316 C CB  . THR A 1 196 ? 77.645 52.102 70.467 1.00 71.22  ? 196 THR A CB  1 
ATOM   1317 O OG1 . THR A 1 196 ? 77.273 51.498 71.713 1.00 71.78  ? 196 THR A OG1 1 
ATOM   1318 C CG2 . THR A 1 196 ? 79.049 52.673 70.593 1.00 75.77  ? 196 THR A CG2 1 
ATOM   1319 N N   . GLU A 1 197 ? 77.193 53.808 67.847 1.00 71.68  ? 197 GLU A N   1 
ATOM   1320 C CA  . GLU A 1 197 ? 77.733 54.659 66.806 1.00 72.65  ? 197 GLU A CA  1 
ATOM   1321 C C   . GLU A 1 197 ? 76.906 55.923 66.594 1.00 71.45  ? 197 GLU A C   1 
ATOM   1322 O O   . GLU A 1 197 ? 77.409 56.917 66.078 1.00 67.26  ? 197 GLU A O   1 
ATOM   1323 C CB  . GLU A 1 197 ? 77.825 53.866 65.513 1.00 73.17  ? 197 GLU A CB  1 
ATOM   1324 C CG  . GLU A 1 197 ? 78.829 54.398 64.518 1.00 75.03  ? 197 GLU A CG  1 
ATOM   1325 C CD  . GLU A 1 197 ? 79.214 53.337 63.502 1.00 79.40  ? 197 GLU A CD  1 
ATOM   1326 O OE1 . GLU A 1 197 ? 78.307 52.833 62.805 1.00 79.23  ? 197 GLU A OE1 1 
ATOM   1327 O OE2 . GLU A 1 197 ? 80.418 52.997 63.408 1.00 84.62  ? 197 GLU A OE2 1 
ATOM   1328 N N   . LEU A 1 198 ? 75.646 55.895 67.015 1.00 70.32  ? 198 LEU A N   1 
ATOM   1329 C CA  . LEU A 1 198 ? 74.769 57.046 66.842 1.00 62.41  ? 198 LEU A CA  1 
ATOM   1330 C C   . LEU A 1 198 ? 74.163 57.491 68.154 1.00 67.62  ? 198 LEU A C   1 
ATOM   1331 O O   . LEU A 1 198 ? 73.537 58.561 68.225 1.00 67.01  ? 198 LEU A O   1 
ATOM   1332 C CB  . LEU A 1 198 ? 73.636 56.702 65.883 1.00 64.41  ? 198 LEU A CB  1 
ATOM   1333 C CG  . LEU A 1 198 ? 74.043 56.042 64.565 1.00 71.56  ? 198 LEU A CG  1 
ATOM   1334 C CD1 . LEU A 1 198 ? 72.809 55.636 63.776 1.00 68.67  ? 198 LEU A CD1 1 
ATOM   1335 C CD2 . LEU A 1 198 ? 74.901 57.008 63.775 1.00 75.34  ? 198 LEU A CD2 1 
ATOM   1336 N N   . GLY A 1 199 ? 74.345 56.680 69.193 1.00 59.16  ? 199 GLY A N   1 
ATOM   1337 C CA  . GLY A 1 199 ? 73.760 57.019 70.478 1.00 66.29  ? 199 GLY A CA  1 
ATOM   1338 C C   . GLY A 1 199 ? 72.288 56.617 70.531 1.00 66.92  ? 199 GLY A C   1 
ATOM   1339 O O   . GLY A 1 199 ? 71.541 56.805 69.570 1.00 58.98  ? 199 GLY A O   1 
ATOM   1340 N N   . ALA A 1 200 ? 71.882 56.062 71.667 1.00 69.17  ? 200 ALA A N   1 
ATOM   1341 C CA  . ALA A 1 200 ? 70.521 55.591 71.905 1.00 72.77  ? 200 ALA A CA  1 
ATOM   1342 C C   . ALA A 1 200 ? 69.363 56.485 71.446 1.00 76.26  ? 200 ALA A C   1 
ATOM   1343 O O   . ALA A 1 200 ? 68.443 56.013 70.770 1.00 69.69  ? 200 ALA A O   1 
ATOM   1344 C CB  . ALA A 1 200 ? 70.356 55.274 73.388 1.00 75.26  ? 200 ALA A CB  1 
ATOM   1345 N N   . LYS A 1 201 ? 69.400 57.760 71.822 1.00 77.89  ? 201 LYS A N   1 
ATOM   1346 C CA  . LYS A 1 201 ? 68.336 58.693 71.462 1.00 77.11  ? 201 LYS A CA  1 
ATOM   1347 C C   . LYS A 1 201 ? 68.069 58.737 69.965 1.00 76.62  ? 201 LYS A C   1 
ATOM   1348 O O   . LYS A 1 201 ? 66.938 58.534 69.513 1.00 77.93  ? 201 LYS A O   1 
ATOM   1349 C CB  . LYS A 1 201 ? 68.667 60.097 71.971 1.00 72.94  ? 201 LYS A CB  1 
ATOM   1350 N N   . ALA A 1 202 ? 69.111 59.012 69.194 1.00 74.11  ? 202 ALA A N   1 
ATOM   1351 C CA  . ALA A 1 202 ? 68.962 59.093 67.752 1.00 71.10  ? 202 ALA A CA  1 
ATOM   1352 C C   . ALA A 1 202 ? 68.349 57.806 67.226 1.00 75.19  ? 202 ALA A C   1 
ATOM   1353 O O   . ALA A 1 202 ? 67.283 57.820 66.607 1.00 70.71  ? 202 ALA A O   1 
ATOM   1354 C CB  . ALA A 1 202 ? 70.314 59.335 67.104 1.00 72.91  ? 202 ALA A CB  1 
ATOM   1355 N N   . LEU A 1 203 ? 69.026 56.694 67.499 1.00 72.05  ? 203 LEU A N   1 
ATOM   1356 C CA  . LEU A 1 203 ? 68.583 55.381 67.055 1.00 68.15  ? 203 LEU A CA  1 
ATOM   1357 C C   . LEU A 1 203 ? 67.117 55.092 67.389 1.00 67.27  ? 203 LEU A C   1 
ATOM   1358 O O   . LEU A 1 203 ? 66.375 54.581 66.551 1.00 61.55  ? 203 LEU A O   1 
ATOM   1359 C CB  . LEU A 1 203 ? 69.462 54.307 67.685 1.00 63.26  ? 203 LEU A CB  1 
ATOM   1360 C CG  . LEU A 1 203 ? 69.678 53.012 66.905 1.00 64.90  ? 203 LEU A CG  1 
ATOM   1361 C CD1 . LEU A 1 203 ? 69.528 51.845 67.856 1.00 60.30  ? 203 LEU A CD1 1 
ATOM   1362 C CD2 . LEU A 1 203 ? 68.699 52.900 65.761 1.00 59.41  ? 203 LEU A CD2 1 
ATOM   1363 N N   . LYS A 1 204 ? 66.709 55.408 68.616 1.00 68.75  ? 204 LYS A N   1 
ATOM   1364 C CA  . LYS A 1 204 ? 65.336 55.174 69.048 1.00 69.03  ? 204 LYS A CA  1 
ATOM   1365 C C   . LYS A 1 204 ? 64.382 56.044 68.242 1.00 72.00  ? 204 LYS A C   1 
ATOM   1366 O O   . LYS A 1 204 ? 63.329 55.581 67.808 1.00 75.83  ? 204 LYS A O   1 
ATOM   1367 C CB  . LYS A 1 204 ? 65.192 55.460 70.543 1.00 65.65  ? 204 LYS A CB  1 
ATOM   1368 N N   . GLN A 1 205 ? 64.751 57.303 68.031 1.00 74.51  ? 205 GLN A N   1 
ATOM   1369 C CA  . GLN A 1 205 ? 63.906 58.202 67.255 1.00 76.17  ? 205 GLN A CA  1 
ATOM   1370 C C   . GLN A 1 205 ? 63.687 57.569 65.893 1.00 73.29  ? 205 GLN A C   1 
ATOM   1371 O O   . GLN A 1 205 ? 62.574 57.521 65.383 1.00 80.69  ? 205 GLN A O   1 
ATOM   1372 C CB  . GLN A 1 205 ? 64.576 59.570 67.096 1.00 78.19  ? 205 GLN A CB  1 
ATOM   1373 N N   . HIS A 1 206 ? 64.758 57.059 65.312 1.00 67.84  ? 206 HIS A N   1 
ATOM   1374 C CA  . HIS A 1 206 ? 64.666 56.440 64.005 1.00 70.25  ? 206 HIS A CA  1 
ATOM   1375 C C   . HIS A 1 206 ? 63.795 55.186 64.038 1.00 73.31  ? 206 HIS A C   1 
ATOM   1376 O O   . HIS A 1 206 ? 62.920 54.997 63.185 1.00 74.61  ? 206 HIS A O   1 
ATOM   1377 C CB  . HIS A 1 206 ? 66.078 56.107 63.487 1.00 70.26  ? 206 HIS A CB  1 
ATOM   1378 C CG  . HIS A 1 206 ? 66.099 55.474 62.128 1.00 59.96  ? 206 HIS A CG  1 
ATOM   1379 N ND1 . HIS A 1 206 ? 66.076 54.109 61.941 1.00 59.84  ? 206 HIS A ND1 1 
ATOM   1380 C CD2 . HIS A 1 206 ? 66.118 56.022 60.890 1.00 59.23  ? 206 HIS A CD2 1 
ATOM   1381 C CE1 . HIS A 1 206 ? 66.082 53.841 60.648 1.00 54.92  ? 206 HIS A CE1 1 
ATOM   1382 N NE2 . HIS A 1 206 ? 66.108 54.985 59.987 1.00 59.69  ? 206 HIS A NE2 1 
ATOM   1383 N N   . LEU A 1 207 ? 64.026 54.332 65.025 1.00 65.23  ? 207 LEU A N   1 
ATOM   1384 C CA  . LEU A 1 207 ? 63.264 53.105 65.126 1.00 67.98  ? 207 LEU A CA  1 
ATOM   1385 C C   . LEU A 1 207 ? 61.811 53.359 65.445 1.00 71.37  ? 207 LEU A C   1 
ATOM   1386 O O   . LEU A 1 207 ? 60.984 52.452 65.332 1.00 70.46  ? 207 LEU A O   1 
ATOM   1387 C CB  . LEU A 1 207 ? 63.867 52.201 66.188 1.00 65.27  ? 207 LEU A CB  1 
ATOM   1388 C CG  . LEU A 1 207 ? 64.803 51.093 65.716 1.00 65.29  ? 207 LEU A CG  1 
ATOM   1389 C CD1 . LEU A 1 207 ? 65.424 51.408 64.374 1.00 54.97  ? 207 LEU A CD1 1 
ATOM   1390 C CD2 . LEU A 1 207 ? 65.849 50.914 66.791 1.00 52.84  ? 207 LEU A CD2 1 
ATOM   1391 N N   . GLN A 1 208 ? 61.497 54.586 65.853 1.00 72.42  ? 208 GLN A N   1 
ATOM   1392 C CA  . GLN A 1 208 ? 60.117 54.931 66.175 1.00 71.32  ? 208 GLN A CA  1 
ATOM   1393 C C   . GLN A 1 208 ? 59.309 54.765 64.893 1.00 72.79  ? 208 GLN A C   1 
ATOM   1394 O O   . GLN A 1 208 ? 58.193 54.237 64.911 1.00 69.06  ? 208 GLN A O   1 
ATOM   1395 C CB  . GLN A 1 208 ? 60.027 56.364 66.683 1.00 70.57  ? 208 GLN A CB  1 
ATOM   1396 N N   . ARG A 1 209 ? 59.891 55.199 63.776 1.00 73.17  ? 209 ARG A N   1 
ATOM   1397 C CA  . ARG A 1 209 ? 59.235 55.071 62.485 1.00 70.42  ? 209 ARG A CA  1 
ATOM   1398 C C   . ARG A 1 209 ? 59.731 53.915 61.610 1.00 73.93  ? 209 ARG A C   1 
ATOM   1399 O O   . ARG A 1 209 ? 58.926 53.238 60.950 1.00 74.39  ? 209 ARG A O   1 
ATOM   1400 C CB  . ARG A 1 209 ? 59.369 56.353 61.672 1.00 64.89  ? 209 ARG A CB  1 
ATOM   1401 C CG  . ARG A 1 209 ? 58.685 56.202 60.320 1.00 81.16  ? 209 ARG A CG  1 
ATOM   1402 C CD  . ARG A 1 209 ? 58.677 57.468 59.505 1.00 91.10  ? 209 ARG A CD  1 
ATOM   1403 N NE  . ARG A 1 209 ? 58.036 58.574 60.205 1.00 104.61 ? 209 ARG A NE  1 
ATOM   1404 C CZ  . ARG A 1 209 ? 57.675 59.711 59.619 1.00 109.08 ? 209 ARG A CZ  1 
ATOM   1405 N NH1 . ARG A 1 209 ? 57.893 59.885 58.319 1.00 108.85 ? 209 ARG A NH1 1 
ATOM   1406 N NH2 . ARG A 1 209 ? 57.097 60.672 60.330 1.00 112.21 ? 209 ARG A NH2 1 
ATOM   1407 N N   . TYR A 1 210 ? 61.043 53.679 61.610 1.00 72.58  ? 210 TYR A N   1 
ATOM   1408 C CA  . TYR A 1 210 ? 61.611 52.655 60.742 1.00 71.13  ? 210 TYR A CA  1 
ATOM   1409 C C   . TYR A 1 210 ? 62.097 51.371 61.365 1.00 67.05  ? 210 TYR A C   1 
ATOM   1410 O O   . TYR A 1 210 ? 62.942 50.678 60.805 1.00 75.37  ? 210 TYR A O   1 
ATOM   1411 C CB  . TYR A 1 210 ? 62.734 53.265 59.914 1.00 73.35  ? 210 TYR A CB  1 
ATOM   1412 C CG  . TYR A 1 210 ? 62.361 54.612 59.371 1.00 75.16  ? 210 TYR A CG  1 
ATOM   1413 C CD1 . TYR A 1 210 ? 62.730 55.775 60.038 1.00 77.14  ? 210 TYR A CD1 1 
ATOM   1414 C CD2 . TYR A 1 210 ? 61.587 54.723 58.217 1.00 82.36  ? 210 TYR A CD2 1 
ATOM   1415 C CE1 . TYR A 1 210 ? 62.338 57.023 59.572 1.00 87.26  ? 210 TYR A CE1 1 
ATOM   1416 C CE2 . TYR A 1 210 ? 61.187 55.964 57.739 1.00 88.47  ? 210 TYR A CE2 1 
ATOM   1417 C CZ  . TYR A 1 210 ? 61.566 57.112 58.422 1.00 92.95  ? 210 TYR A CZ  1 
ATOM   1418 O OH  . TYR A 1 210 ? 61.164 58.348 57.956 1.00 100.17 ? 210 TYR A OH  1 
ATOM   1419 N N   . ASN A 1 211 ? 61.568 51.041 62.523 1.00 63.26  ? 211 ASN A N   1 
ATOM   1420 C CA  . ASN A 1 211 ? 61.965 49.805 63.156 1.00 66.17  ? 211 ASN A CA  1 
ATOM   1421 C C   . ASN A 1 211 ? 61.633 48.689 62.174 1.00 70.14  ? 211 ASN A C   1 
ATOM   1422 O O   . ASN A 1 211 ? 60.484 48.499 61.821 1.00 74.30  ? 211 ASN A O   1 
ATOM   1423 C CB  . ASN A 1 211 ? 61.182 49.614 64.436 1.00 59.49  ? 211 ASN A CB  1 
ATOM   1424 C CG  . ASN A 1 211 ? 61.661 48.450 65.221 1.00 62.67  ? 211 ASN A CG  1 
ATOM   1425 O OD1 . ASN A 1 211 ? 61.498 47.307 64.815 1.00 72.16  ? 211 ASN A OD1 1 
ATOM   1426 N ND2 . ASN A 1 211 ? 62.269 48.723 66.360 1.00 69.61  ? 211 ASN A ND2 1 
ATOM   1427 N N   . PRO A 1 212 ? 62.640 47.945 61.706 1.00 74.44  ? 212 PRO A N   1 
ATOM   1428 C CA  . PRO A 1 212 ? 62.413 46.847 60.758 1.00 71.49  ? 212 PRO A CA  1 
ATOM   1429 C C   . PRO A 1 212 ? 61.217 45.950 61.094 1.00 69.17  ? 212 PRO A C   1 
ATOM   1430 O O   . PRO A 1 212 ? 60.632 45.308 60.218 1.00 69.44  ? 212 PRO A O   1 
ATOM   1431 C CB  . PRO A 1 212 ? 63.738 46.099 60.796 1.00 77.89  ? 212 PRO A CB  1 
ATOM   1432 C CG  . PRO A 1 212 ? 64.718 47.235 60.922 1.00 82.03  ? 212 PRO A CG  1 
ATOM   1433 C CD  . PRO A 1 212 ? 64.077 48.111 61.986 1.00 74.70  ? 212 PRO A CD  1 
ATOM   1434 N N   . ASP A 1 213 ? 60.856 45.891 62.366 1.00 64.78  ? 213 ASP A N   1 
ATOM   1435 C CA  . ASP A 1 213 ? 59.717 45.090 62.766 1.00 66.68  ? 213 ASP A CA  1 
ATOM   1436 C C   . ASP A 1 213 ? 58.586 46.033 63.118 1.00 66.57  ? 213 ASP A C   1 
ATOM   1437 O O   . ASP A 1 213 ? 58.499 46.523 64.237 1.00 71.34  ? 213 ASP A O   1 
ATOM   1438 C CB  . ASP A 1 213 ? 60.077 44.220 63.958 1.00 74.69  ? 213 ASP A CB  1 
ATOM   1439 C CG  . ASP A 1 213 ? 61.180 43.251 63.635 1.00 84.56  ? 213 ASP A CG  1 
ATOM   1440 O OD1 . ASP A 1 213 ? 60.940 42.355 62.798 1.00 91.90  ? 213 ASP A OD1 1 
ATOM   1441 O OD2 . ASP A 1 213 ? 62.287 43.394 64.197 1.00 88.26  ? 213 ASP A OD2 1 
ATOM   1442 N N   . ARG A 1 214 ? 57.717 46.299 62.154 1.00 61.04  ? 214 ARG A N   1 
ATOM   1443 C CA  . ARG A 1 214 ? 56.619 47.203 62.418 1.00 63.29  ? 214 ARG A CA  1 
ATOM   1444 C C   . ARG A 1 214 ? 55.370 47.047 61.584 1.00 58.70  ? 214 ARG A C   1 
ATOM   1445 O O   . ARG A 1 214 ? 55.316 46.275 60.621 1.00 54.98  ? 214 ARG A O   1 
ATOM   1446 C CB  . ARG A 1 214 ? 57.108 48.648 62.315 1.00 54.19  ? 214 ARG A CB  1 
ATOM   1447 C CG  . ARG A 1 214 ? 57.908 48.951 61.096 1.00 50.67  ? 214 ARG A CG  1 
ATOM   1448 C CD  . ARG A 1 214 ? 57.070 49.477 60.018 1.00 51.06  ? 214 ARG A CD  1 
ATOM   1449 N NE  . ARG A 1 214 ? 57.825 50.312 59.091 1.00 62.64  ? 214 ARG A NE  1 
ATOM   1450 C CZ  . ARG A 1 214 ? 58.674 49.853 58.172 1.00 72.79  ? 214 ARG A CZ  1 
ATOM   1451 N NH1 . ARG A 1 214 ? 58.906 48.548 58.040 1.00 80.12  ? 214 ARG A NH1 1 
ATOM   1452 N NH2 . ARG A 1 214 ? 59.261 50.701 57.345 1.00 60.90  ? 214 ARG A NH2 1 
ATOM   1453 N N   . ILE A 1 215 ? 54.345 47.772 62.010 1.00 56.44  ? 215 ILE A N   1 
ATOM   1454 C CA  . ILE A 1 215 ? 53.096 47.796 61.298 1.00 44.41  ? 215 ILE A CA  1 
ATOM   1455 C C   . ILE A 1 215 ? 52.945 49.207 60.784 1.00 38.18  ? 215 ILE A C   1 
ATOM   1456 O O   . ILE A 1 215 ? 52.990 50.153 61.565 1.00 42.14  ? 215 ILE A O   1 
ATOM   1457 C CB  . ILE A 1 215 ? 51.893 47.532 62.202 1.00 54.49  ? 215 ILE A CB  1 
ATOM   1458 C CG1 . ILE A 1 215 ? 52.007 46.160 62.863 1.00 46.94  ? 215 ILE A CG1 1 
ATOM   1459 C CG2 . ILE A 1 215 ? 50.596 47.617 61.357 1.00 49.45  ? 215 ILE A CG2 1 
ATOM   1460 C CD1 . ILE A 1 215 ? 50.934 45.929 63.931 1.00 40.13  ? 215 ILE A CD1 1 
ATOM   1461 N N   . ASP A 1 216 ? 52.835 49.347 59.469 1.00 44.48  ? 216 ASP A N   1 
ATOM   1462 C CA  . ASP A 1 216 ? 52.569 50.641 58.845 1.00 53.39  ? 216 ASP A CA  1 
ATOM   1463 C C   . ASP A 1 216 ? 51.034 50.554 58.724 1.00 56.48  ? 216 ASP A C   1 
ATOM   1464 O O   . ASP A 1 216 ? 50.489 49.702 58.004 1.00 52.65  ? 216 ASP A O   1 
ATOM   1465 C CB  . ASP A 1 216 ? 53.226 50.720 57.476 1.00 55.38  ? 216 ASP A CB  1 
ATOM   1466 C CG  . ASP A 1 216 ? 54.741 50.696 57.566 1.00 72.83  ? 216 ASP A CG  1 
ATOM   1467 O OD1 . ASP A 1 216 ? 55.323 51.753 57.892 1.00 61.94  ? 216 ASP A OD1 1 
ATOM   1468 O OD2 . ASP A 1 216 ? 55.344 49.617 57.331 1.00 74.55  ? 216 ASP A OD2 1 
ATOM   1469 N N   . HIS A 1 217 ? 50.347 51.411 59.468 1.00 50.33  ? 217 HIS A N   1 
ATOM   1470 C CA  . HIS A 1 217 ? 48.891 51.383 59.518 1.00 47.16  ? 217 HIS A CA  1 
ATOM   1471 C C   . HIS A 1 217 ? 48.124 51.955 58.338 1.00 40.77  ? 217 HIS A C   1 
ATOM   1472 O O   . HIS A 1 217 ? 48.687 52.640 57.491 1.00 42.84  ? 217 HIS A O   1 
ATOM   1473 C CB  . HIS A 1 217 ? 48.445 52.055 60.804 1.00 38.07  ? 217 HIS A CB  1 
ATOM   1474 C CG  . HIS A 1 217 ? 48.839 51.302 62.021 1.00 41.00  ? 217 HIS A CG  1 
ATOM   1475 N ND1 . HIS A 1 217 ? 48.297 50.075 62.339 1.00 43.68  ? 217 HIS A ND1 1 
ATOM   1476 C CD2 . HIS A 1 217 ? 49.712 51.603 63.012 1.00 38.92  ? 217 HIS A CD2 1 
ATOM   1477 C CE1 . HIS A 1 217 ? 48.814 49.657 63.482 1.00 43.21  ? 217 HIS A CE1 1 
ATOM   1478 N NE2 . HIS A 1 217 ? 49.672 50.566 63.910 1.00 43.57  ? 217 HIS A NE2 1 
ATOM   1479 N N   . THR A 1 218 ? 46.831 51.634 58.295 1.00 46.16  ? 218 THR A N   1 
ATOM   1480 C CA  . THR A 1 218 ? 45.937 52.101 57.244 1.00 39.45  ? 218 THR A CA  1 
ATOM   1481 C C   . THR A 1 218 ? 46.123 53.586 57.061 1.00 34.95  ? 218 THR A C   1 
ATOM   1482 O O   . THR A 1 218 ? 46.130 54.322 58.036 1.00 39.54  ? 218 THR A O   1 
ATOM   1483 C CB  . THR A 1 218 ? 44.490 51.868 57.611 1.00 44.24  ? 218 THR A CB  1 
ATOM   1484 O OG1 . THR A 1 218 ? 44.274 50.464 57.810 1.00 44.56  ? 218 THR A OG1 1 
ATOM   1485 C CG2 . THR A 1 218 ? 43.572 52.413 56.486 1.00 38.78  ? 218 THR A CG2 1 
ATOM   1486 N N   . ASN A 1 219 ? 46.286 54.013 55.815 1.00 35.80  ? 219 ASN A N   1 
ATOM   1487 C CA  . ASN A 1 219 ? 46.494 55.420 55.502 1.00 44.92  ? 219 ASN A CA  1 
ATOM   1488 C C   . ASN A 1 219 ? 45.262 56.213 55.930 1.00 49.23  ? 219 ASN A C   1 
ATOM   1489 O O   . ASN A 1 219 ? 44.136 55.865 55.573 1.00 46.35  ? 219 ASN A O   1 
ATOM   1490 C CB  . ASN A 1 219 ? 46.743 55.608 53.996 1.00 29.53  ? 219 ASN A CB  1 
ATOM   1491 C CG  . ASN A 1 219 ? 47.299 56.983 53.664 1.00 49.86  ? 219 ASN A CG  1 
ATOM   1492 O OD1 . ASN A 1 219 ? 46.738 58.010 54.029 1.00 52.53  ? 219 ASN A OD1 1 
ATOM   1493 N ND2 . ASN A 1 219 ? 48.419 57.003 52.967 1.00 66.92  ? 219 ASN A ND2 1 
ATOM   1494 N N   . ALA A 1 220 ? 45.486 57.272 56.701 1.00 49.90  ? 220 ALA A N   1 
ATOM   1495 C CA  . ALA A 1 220 ? 44.399 58.103 57.188 1.00 49.41  ? 220 ALA A CA  1 
ATOM   1496 C C   . ALA A 1 220 ? 43.484 58.576 56.071 1.00 45.56  ? 220 ALA A C   1 
ATOM   1497 O O   . ALA A 1 220 ? 42.288 58.790 56.273 1.00 55.36  ? 220 ALA A O   1 
ATOM   1498 C CB  . ALA A 1 220 ? 44.961 59.284 57.931 1.00 42.41  ? 220 ALA A CB  1 
ATOM   1499 N N   . SER A 1 221 ? 44.034 58.723 54.881 1.00 42.98  ? 221 SER A N   1 
ATOM   1500 C CA  . SER A 1 221 ? 43.225 59.190 53.777 1.00 44.71  ? 221 SER A CA  1 
ATOM   1501 C C   . SER A 1 221 ? 42.054 58.265 53.428 1.00 41.80  ? 221 SER A C   1 
ATOM   1502 O O   . SER A 1 221 ? 41.161 58.657 52.678 1.00 46.99  ? 221 SER A O   1 
ATOM   1503 C CB  . SER A 1 221 ? 44.106 59.448 52.552 1.00 35.99  ? 221 SER A CB  1 
ATOM   1504 O OG  . SER A 1 221 ? 44.781 58.279 52.143 1.00 70.83  ? 221 SER A OG  1 
ATOM   1505 N N   . TYR A 1 222 ? 42.047 57.054 53.975 1.00 39.53  ? 222 TYR A N   1 
ATOM   1506 C CA  . TYR A 1 222 ? 40.971 56.096 53.722 1.00 37.97  ? 222 TYR A CA  1 
ATOM   1507 C C   . TYR A 1 222 ? 39.924 56.120 54.813 1.00 40.11  ? 222 TYR A C   1 
ATOM   1508 O O   . TYR A 1 222 ? 38.895 55.439 54.721 1.00 42.57  ? 222 TYR A O   1 
ATOM   1509 C CB  . TYR A 1 222 ? 41.502 54.675 53.651 1.00 38.02  ? 222 TYR A CB  1 
ATOM   1510 C CG  . TYR A 1 222 ? 42.212 54.347 52.386 1.00 52.17  ? 222 TYR A CG  1 
ATOM   1511 C CD1 . TYR A 1 222 ? 43.567 54.023 52.403 1.00 56.16  ? 222 TYR A CD1 1 
ATOM   1512 C CD2 . TYR A 1 222 ? 41.528 54.301 51.172 1.00 48.64  ? 222 TYR A CD2 1 
ATOM   1513 C CE1 . TYR A 1 222 ? 44.229 53.647 51.246 1.00 60.40  ? 222 TYR A CE1 1 
ATOM   1514 C CE2 . TYR A 1 222 ? 42.186 53.930 49.999 1.00 56.20  ? 222 TYR A CE2 1 
ATOM   1515 C CZ  . TYR A 1 222 ? 43.540 53.598 50.048 1.00 61.51  ? 222 TYR A CZ  1 
ATOM   1516 O OH  . TYR A 1 222 ? 44.210 53.179 48.916 1.00 68.88  ? 222 TYR A OH  1 
ATOM   1517 N N   . LEU A 1 223 ? 40.179 56.882 55.866 1.00 41.26  ? 223 LEU A N   1 
ATOM   1518 C CA  . LEU A 1 223 ? 39.209 56.913 56.942 1.00 42.42  ? 223 LEU A CA  1 
ATOM   1519 C C   . LEU A 1 223 ? 37.797 57.394 56.538 1.00 37.27  ? 223 LEU A C   1 
ATOM   1520 O O   . LEU A 1 223 ? 36.810 56.860 57.020 1.00 49.26  ? 223 LEU A O   1 
ATOM   1521 C CB  . LEU A 1 223 ? 39.801 57.680 58.129 1.00 40.38  ? 223 LEU A CB  1 
ATOM   1522 C CG  . LEU A 1 223 ? 40.953 56.816 58.677 1.00 48.72  ? 223 LEU A CG  1 
ATOM   1523 C CD1 . LEU A 1 223 ? 41.709 57.553 59.763 1.00 42.18  ? 223 LEU A CD1 1 
ATOM   1524 C CD2 . LEU A 1 223 ? 40.372 55.473 59.227 1.00 42.28  ? 223 LEU A CD2 1 
ATOM   1525 N N   . PRO A 1 224 ? 37.679 58.368 55.626 1.00 39.41  ? 224 PRO A N   1 
ATOM   1526 C CA  . PRO A 1 224 ? 36.328 58.796 55.255 1.00 43.80  ? 224 PRO A CA  1 
ATOM   1527 C C   . PRO A 1 224 ? 35.468 57.690 54.631 1.00 43.77  ? 224 PRO A C   1 
ATOM   1528 O O   . PRO A 1 224 ? 34.303 57.476 55.034 1.00 41.13  ? 224 PRO A O   1 
ATOM   1529 C CB  . PRO A 1 224 ? 36.589 59.944 54.286 1.00 36.22  ? 224 PRO A CB  1 
ATOM   1530 C CG  . PRO A 1 224 ? 37.766 60.599 54.898 1.00 31.61  ? 224 PRO A CG  1 
ATOM   1531 C CD  . PRO A 1 224 ? 38.662 59.388 55.213 1.00 49.98  ? 224 PRO A CD  1 
ATOM   1532 N N   . ILE A 1 225 ? 36.010 56.979 53.649 1.00 37.15  ? 225 ILE A N   1 
ATOM   1533 C CA  . ILE A 1 225 ? 35.194 55.936 53.063 1.00 38.68  ? 225 ILE A CA  1 
ATOM   1534 C C   . ILE A 1 225 ? 35.004 54.767 53.998 1.00 33.66  ? 225 ILE A C   1 
ATOM   1535 O O   . ILE A 1 225 ? 33.955 54.131 53.981 1.00 39.01  ? 225 ILE A O   1 
ATOM   1536 C CB  . ILE A 1 225 ? 35.728 55.440 51.724 1.00 39.14  ? 225 ILE A CB  1 
ATOM   1537 C CG1 . ILE A 1 225 ? 37.179 54.990 51.853 1.00 45.57  ? 225 ILE A CG1 1 
ATOM   1538 C CG2 . ILE A 1 225 ? 35.559 56.523 50.693 1.00 35.89  ? 225 ILE A CG2 1 
ATOM   1539 C CD1 . ILE A 1 225 ? 37.800 54.595 50.510 1.00 37.43  ? 225 ILE A CD1 1 
ATOM   1540 N N   . ILE A 1 226 ? 35.990 54.502 54.843 1.00 40.36  ? 226 ILE A N   1 
ATOM   1541 C CA  . ILE A 1 226 ? 35.863 53.400 55.780 1.00 37.96  ? 226 ILE A CA  1 
ATOM   1542 C C   . ILE A 1 226 ? 34.771 53.759 56.779 1.00 38.78  ? 226 ILE A C   1 
ATOM   1543 O O   . ILE A 1 226 ? 33.934 52.917 57.129 1.00 35.38  ? 226 ILE A O   1 
ATOM   1544 C CB  . ILE A 1 226 ? 37.219 53.116 56.494 1.00 35.97  ? 226 ILE A CB  1 
ATOM   1545 C CG1 . ILE A 1 226 ? 38.192 52.521 55.480 1.00 38.92  ? 226 ILE A CG1 1 
ATOM   1546 C CG2 . ILE A 1 226 ? 37.032 52.162 57.702 1.00 29.20  ? 226 ILE A CG2 1 
ATOM   1547 C CD1 . ILE A 1 226 ? 39.604 52.215 56.026 1.00 36.14  ? 226 ILE A CD1 1 
ATOM   1548 N N   . LYS A 1 227 ? 34.763 55.007 57.246 1.00 39.96  ? 227 LYS A N   1 
ATOM   1549 C CA  . LYS A 1 227 ? 33.722 55.408 58.191 1.00 40.91  ? 227 LYS A CA  1 
ATOM   1550 C C   . LYS A 1 227 ? 32.350 55.304 57.526 1.00 43.58  ? 227 LYS A C   1 
ATOM   1551 O O   . LYS A 1 227 ? 31.368 54.842 58.144 1.00 44.87  ? 227 LYS A O   1 
ATOM   1552 C CB  . LYS A 1 227 ? 33.968 56.829 58.727 1.00 41.54  ? 227 LYS A CB  1 
ATOM   1553 C CG  . LYS A 1 227 ? 35.107 56.872 59.767 1.00 60.73  ? 227 LYS A CG  1 
ATOM   1554 C CD  . LYS A 1 227 ? 35.206 58.204 60.523 1.00 73.34  ? 227 LYS A CD  1 
ATOM   1555 C CE  . LYS A 1 227 ? 35.614 59.365 59.619 1.00 71.38  ? 227 LYS A CE  1 
ATOM   1556 N NZ  . LYS A 1 227 ? 36.996 59.178 59.110 1.00 81.29  ? 227 LYS A NZ  1 
ATOM   1557 N N   . ASP A 1 228 ? 32.265 55.699 56.261 1.00 35.77  ? 228 ASP A N   1 
ATOM   1558 C CA  . ASP A 1 228 ? 30.974 55.586 55.604 1.00 35.06  ? 228 ASP A CA  1 
ATOM   1559 C C   . ASP A 1 228 ? 30.625 54.111 55.552 1.00 40.17  ? 228 ASP A C   1 
ATOM   1560 O O   . ASP A 1 228 ? 29.480 53.724 55.798 1.00 37.18  ? 228 ASP A O   1 
ATOM   1561 C CB  . ASP A 1 228 ? 31.002 56.173 54.197 1.00 33.34  ? 228 ASP A CB  1 
ATOM   1562 C CG  . ASP A 1 228 ? 31.270 57.691 54.186 1.00 50.92  ? 228 ASP A CG  1 
ATOM   1563 O OD1 . ASP A 1 228 ? 30.846 58.404 55.125 1.00 46.39  ? 228 ASP A OD1 1 
ATOM   1564 O OD2 . ASP A 1 228 ? 31.897 58.182 53.219 1.00 48.14  ? 228 ASP A OD2 1 
ATOM   1565 N N   . HIS A 1 229 ? 31.625 53.268 55.289 1.00 41.00  ? 229 HIS A N   1 
ATOM   1566 C CA  . HIS A 1 229 ? 31.353 51.851 55.202 1.00 30.63  ? 229 HIS A CA  1 
ATOM   1567 C C   . HIS A 1 229 ? 30.867 51.307 56.546 1.00 36.31  ? 229 HIS A C   1 
ATOM   1568 O O   . HIS A 1 229 ? 29.928 50.509 56.591 1.00 34.73  ? 229 HIS A O   1 
ATOM   1569 C CB  . HIS A 1 229 ? 32.578 51.079 54.690 1.00 36.32  ? 229 HIS A CB  1 
ATOM   1570 C CG  . HIS A 1 229 ? 32.287 49.637 54.408 1.00 31.86  ? 229 HIS A CG  1 
ATOM   1571 N ND1 . HIS A 1 229 ? 32.871 48.609 55.117 1.00 44.28  ? 229 HIS A ND1 1 
ATOM   1572 C CD2 . HIS A 1 229 ? 31.359 49.059 53.608 1.00 35.99  ? 229 HIS A CD2 1 
ATOM   1573 C CE1 . HIS A 1 229 ? 32.307 47.461 54.775 1.00 37.33  ? 229 HIS A CE1 1 
ATOM   1574 N NE2 . HIS A 1 229 ? 31.384 47.707 53.864 1.00 39.94  ? 229 HIS A NE2 1 
ATOM   1575 N N   . LEU A 1 230 ? 31.494 51.770 57.629 1.00 28.80  ? 230 LEU A N   1 
ATOM   1576 C CA  . LEU A 1 230 ? 31.135 51.380 58.969 1.00 36.97  ? 230 LEU A CA  1 
ATOM   1577 C C   . LEU A 1 230 ? 29.682 51.785 59.272 1.00 45.33  ? 230 LEU A C   1 
ATOM   1578 O O   . LEU A 1 230 ? 28.936 51.032 59.915 1.00 39.38  ? 230 LEU A O   1 
ATOM   1579 C CB  . LEU A 1 230 ? 32.138 52.001 59.959 1.00 29.81  ? 230 LEU A CB  1 
ATOM   1580 C CG  . LEU A 1 230 ? 33.400 51.114 60.072 1.00 40.81  ? 230 LEU A CG  1 
ATOM   1581 C CD1 . LEU A 1 230 ? 34.561 51.816 60.668 1.00 28.54  ? 230 LEU A CD1 1 
ATOM   1582 C CD2 . LEU A 1 230 ? 33.056 49.926 60.911 1.00 27.48  ? 230 LEU A CD2 1 
ATOM   1583 N N   . ASN A 1 231 ? 29.283 52.970 58.812 1.00 39.24  ? 231 ASN A N   1 
ATOM   1584 C CA  . ASN A 1 231 ? 27.909 53.417 58.994 1.00 42.16  ? 231 ASN A CA  1 
ATOM   1585 C C   . ASN A 1 231 ? 27.003 52.477 58.202 1.00 36.82  ? 231 ASN A C   1 
ATOM   1586 O O   . ASN A 1 231 ? 25.913 52.149 58.659 1.00 41.72  ? 231 ASN A O   1 
ATOM   1587 C CB  . ASN A 1 231 ? 27.711 54.848 58.476 1.00 36.51  ? 231 ASN A CB  1 
ATOM   1588 C CG  . ASN A 1 231 ? 28.158 55.903 59.467 1.00 45.14  ? 231 ASN A CG  1 
ATOM   1589 O OD1 . ASN A 1 231 ? 28.430 57.043 59.082 1.00 56.74  ? 231 ASN A OD1 1 
ATOM   1590 N ND2 . ASN A 1 231 ? 28.225 55.544 60.744 1.00 46.87  ? 231 ASN A ND2 1 
ATOM   1591 N N   . ASP A 1 232 ? 27.432 52.041 57.017 1.00 36.85  ? 232 ASP A N   1 
ATOM   1592 C CA  . ASP A 1 232 ? 26.578 51.127 56.246 1.00 42.39  ? 232 ASP A CA  1 
ATOM   1593 C C   . ASP A 1 232 ? 26.447 49.781 56.957 1.00 43.75  ? 232 ASP A C   1 
ATOM   1594 O O   . ASP A 1 232 ? 25.364 49.179 56.980 1.00 47.98  ? 232 ASP A O   1 
ATOM   1595 C CB  . ASP A 1 232 ? 27.110 50.883 54.819 1.00 43.59  ? 232 ASP A CB  1 
ATOM   1596 C CG  . ASP A 1 232 ? 27.142 52.146 53.958 1.00 50.17  ? 232 ASP A CG  1 
ATOM   1597 O OD1 . ASP A 1 232 ? 26.425 53.126 54.262 1.00 45.74  ? 232 ASP A OD1 1 
ATOM   1598 O OD2 . ASP A 1 232 ? 27.881 52.154 52.946 1.00 47.20  ? 232 ASP A OD2 1 
ATOM   1599 N N   . LEU A 1 233 ? 27.546 49.305 57.539 1.00 39.75  ? 233 LEU A N   1 
ATOM   1600 C CA  . LEU A 1 233 ? 27.523 48.019 58.247 1.00 39.85  ? 233 LEU A CA  1 
ATOM   1601 C C   . LEU A 1 233 ? 26.607 48.129 59.447 1.00 44.98  ? 233 LEU A C   1 
ATOM   1602 O O   . LEU A 1 233 ? 25.819 47.222 59.724 1.00 41.84  ? 233 LEU A O   1 
ATOM   1603 C CB  . LEU A 1 233 ? 28.930 47.630 58.685 1.00 37.44  ? 233 LEU A CB  1 
ATOM   1604 C CG  . LEU A 1 233 ? 29.787 47.106 57.523 1.00 41.03  ? 233 LEU A CG  1 
ATOM   1605 C CD1 . LEU A 1 233 ? 31.248 46.959 57.947 1.00 43.15  ? 233 LEU A CD1 1 
ATOM   1606 C CD2 . LEU A 1 233 ? 29.195 45.754 57.072 1.00 48.01  ? 233 LEU A CD2 1 
ATOM   1607 N N   . TYR A 1 234 ? 26.714 49.259 60.146 1.00 42.23  ? 234 TYR A N   1 
ATOM   1608 C CA  . TYR A 1 234 ? 25.889 49.529 61.309 1.00 40.42  ? 234 TYR A CA  1 
ATOM   1609 C C   . TYR A 1 234 ? 24.404 49.476 60.899 1.00 47.92  ? 234 TYR A C   1 
ATOM   1610 O O   . TYR A 1 234 ? 23.610 48.727 61.495 1.00 42.77  ? 234 TYR A O   1 
ATOM   1611 C CB  . TYR A 1 234 ? 26.222 50.904 61.873 1.00 42.07  ? 234 TYR A CB  1 
ATOM   1612 C CG  . TYR A 1 234 ? 25.417 51.251 63.106 1.00 44.72  ? 234 TYR A CG  1 
ATOM   1613 C CD1 . TYR A 1 234 ? 25.669 50.613 64.328 1.00 46.98  ? 234 TYR A CD1 1 
ATOM   1614 C CD2 . TYR A 1 234 ? 24.368 52.183 63.045 1.00 45.51  ? 234 TYR A CD2 1 
ATOM   1615 C CE1 . TYR A 1 234 ? 24.906 50.886 65.452 1.00 41.46  ? 234 TYR A CE1 1 
ATOM   1616 C CE2 . TYR A 1 234 ? 23.583 52.467 64.172 1.00 42.66  ? 234 TYR A CE2 1 
ATOM   1617 C CZ  . TYR A 1 234 ? 23.863 51.812 65.364 1.00 45.54  ? 234 TYR A CZ  1 
ATOM   1618 O OH  . TYR A 1 234 ? 23.108 52.056 66.469 1.00 41.22  ? 234 TYR A OH  1 
ATOM   1619 N N   . ARG A 1 235 ? 24.030 50.242 59.871 1.00 39.21  ? 235 ARG A N   1 
ATOM   1620 C CA  . ARG A 1 235 ? 22.628 50.247 59.446 1.00 41.87  ? 235 ARG A CA  1 
ATOM   1621 C C   . ARG A 1 235 ? 22.136 48.828 59.190 1.00 46.71  ? 235 ARG A C   1 
ATOM   1622 O O   . ARG A 1 235 ? 21.030 48.483 59.573 1.00 47.35  ? 235 ARG A O   1 
ATOM   1623 C CB  . ARG A 1 235 ? 22.449 51.065 58.227 1.00 29.93  ? 235 ARG A CB  1 
ATOM   1624 N N   . GLN A 1 236 ? 22.949 48.000 58.540 1.00 42.74  ? 236 GLN A N   1 
ATOM   1625 C CA  . GLN A 1 236 ? 22.521 46.633 58.289 1.00 47.10  ? 236 GLN A CA  1 
ATOM   1626 C C   . GLN A 1 236 ? 22.348 45.928 59.623 1.00 49.23  ? 236 GLN A C   1 
ATOM   1627 O O   . GLN A 1 236 ? 21.279 45.415 59.934 1.00 49.80  ? 236 GLN A O   1 
ATOM   1628 C CB  . GLN A 1 236 ? 23.567 45.878 57.474 1.00 49.25  ? 236 GLN A CB  1 
ATOM   1629 C CG  . GLN A 1 236 ? 23.741 46.363 56.067 1.00 51.91  ? 236 GLN A CG  1 
ATOM   1630 C CD  . GLN A 1 236 ? 24.868 45.624 55.369 1.00 59.77  ? 236 GLN A CD  1 
ATOM   1631 O OE1 . GLN A 1 236 ? 24.895 44.394 55.359 1.00 63.58  ? 236 GLN A OE1 1 
ATOM   1632 N NE2 . GLN A 1 236 ? 25.807 46.369 54.784 1.00 54.07  ? 236 GLN A NE2 1 
ATOM   1633 N N   . ALA A 1 237 ? 23.430 45.924 60.398 1.00 52.08  ? 237 ALA A N   1 
ATOM   1634 C CA  . ALA A 1 237 ? 23.502 45.293 61.707 1.00 51.41  ? 237 ALA A CA  1 
ATOM   1635 C C   . ALA A 1 237 ? 22.344 45.576 62.673 1.00 54.83  ? 237 ALA A C   1 
ATOM   1636 O O   . ALA A 1 237 ? 22.025 44.746 63.532 1.00 46.39  ? 237 ALA A O   1 
ATOM   1637 C CB  . ALA A 1 237 ? 24.820 45.670 62.362 1.00 47.74  ? 237 ALA A CB  1 
ATOM   1638 N N   . ILE A 1 238 ? 21.717 46.740 62.574 1.00 50.64  ? 238 ILE A N   1 
ATOM   1639 C CA  . ILE A 1 238 ? 20.625 46.979 63.485 1.00 56.19  ? 238 ILE A CA  1 
ATOM   1640 C C   . ILE A 1 238 ? 19.306 46.481 62.902 1.00 64.01  ? 238 ILE A C   1 
ATOM   1641 O O   . ILE A 1 238 ? 18.236 46.847 63.388 1.00 66.51  ? 238 ILE A O   1 
ATOM   1642 C CB  . ILE A 1 238 ? 20.509 48.460 63.875 1.00 50.19  ? 238 ILE A CB  1 
ATOM   1643 C CG1 . ILE A 1 238 ? 20.147 49.289 62.657 1.00 51.37  ? 238 ILE A CG1 1 
ATOM   1644 C CG2 . ILE A 1 238 ? 21.804 48.926 64.531 1.00 48.87  ? 238 ILE A CG2 1 
ATOM   1645 C CD1 . ILE A 1 238 ? 19.914 50.736 62.981 1.00 45.72  ? 238 ILE A CD1 1 
ATOM   1646 N N   . SER A 1 239 ? 19.385 45.648 61.861 1.00 63.70  ? 239 SER A N   1 
ATOM   1647 C CA  . SER A 1 239 ? 18.187 45.064 61.256 1.00 70.31  ? 239 SER A CA  1 
ATOM   1648 C C   . SER A 1 239 ? 17.502 44.199 62.309 1.00 68.92  ? 239 SER A C   1 
ATOM   1649 O O   . SER A 1 239 ? 18.172 43.597 63.141 1.00 69.85  ? 239 SER A O   1 
ATOM   1650 C CB  . SER A 1 239 ? 18.545 44.192 60.057 1.00 69.94  ? 239 SER A CB  1 
ATOM   1651 O OG  . SER A 1 239 ? 18.863 44.994 58.942 1.00 81.39  ? 239 SER A OG  1 
ATOM   1652 N N   . SER A 1 240 ? 16.174 44.136 62.271 1.00 70.42  ? 240 SER A N   1 
ATOM   1653 C CA  . SER A 1 240 ? 15.420 43.351 63.252 1.00 70.68  ? 240 SER A CA  1 
ATOM   1654 C C   . SER A 1 240 ? 15.092 41.931 62.798 1.00 67.74  ? 240 SER A C   1 
ATOM   1655 O O   . SER A 1 240 ? 14.583 41.138 63.577 1.00 67.38  ? 240 SER A O   1 
ATOM   1656 C CB  . SER A 1 240 ? 14.122 44.076 63.625 1.00 76.64  ? 240 SER A CB  1 
ATOM   1657 O OG  . SER A 1 240 ? 13.234 44.157 62.523 1.00 77.92  ? 240 SER A OG  1 
ATOM   1658 N N   . ASP A 1 241 ? 15.399 41.610 61.546 1.00 68.65  ? 241 ASP A N   1 
ATOM   1659 C CA  . ASP A 1 241 ? 15.128 40.281 61.012 1.00 67.63  ? 241 ASP A CA  1 
ATOM   1660 C C   . ASP A 1 241 ? 16.408 39.618 60.475 1.00 66.71  ? 241 ASP A C   1 
ATOM   1661 O O   . ASP A 1 241 ? 16.436 39.085 59.359 1.00 62.01  ? 241 ASP A O   1 
ATOM   1662 C CB  . ASP A 1 241 ? 14.109 40.384 59.887 1.00 71.60  ? 241 ASP A CB  1 
ATOM   1663 C CG  . ASP A 1 241 ? 14.708 40.976 58.628 1.00 82.37  ? 241 ASP A CG  1 
ATOM   1664 O OD1 . ASP A 1 241 ? 15.352 42.045 58.726 1.00 82.72  ? 241 ASP A OD1 1 
ATOM   1665 O OD2 . ASP A 1 241 ? 14.542 40.364 57.547 1.00 86.67  ? 241 ASP A OD2 1 
ATOM   1666 N N   . LEU A 1 242 ? 17.468 39.658 61.266 1.00 56.93  ? 242 LEU A N   1 
ATOM   1667 C CA  . LEU A 1 242 ? 18.732 39.050 60.867 1.00 65.74  ? 242 LEU A CA  1 
ATOM   1668 C C   . LEU A 1 242 ? 18.831 37.668 61.498 1.00 66.52  ? 242 LEU A C   1 
ATOM   1669 O O   . LEU A 1 242 ? 18.434 37.481 62.641 1.00 70.47  ? 242 LEU A O   1 
ATOM   1670 C CB  . LEU A 1 242 ? 19.909 39.900 61.368 1.00 57.07  ? 242 LEU A CB  1 
ATOM   1671 C CG  . LEU A 1 242 ? 20.136 41.262 60.711 1.00 62.96  ? 242 LEU A CG  1 
ATOM   1672 C CD1 . LEU A 1 242 ? 21.036 42.137 61.571 1.00 63.05  ? 242 LEU A CD1 1 
ATOM   1673 C CD2 . LEU A 1 242 ? 20.740 41.041 59.347 1.00 57.23  ? 242 LEU A CD2 1 
ATOM   1674 N N   . SER A 1 243 ? 19.339 36.688 60.773 1.00 65.74  ? 243 SER A N   1 
ATOM   1675 C CA  . SER A 1 243 ? 19.503 35.390 61.407 1.00 66.83  ? 243 SER A CA  1 
ATOM   1676 C C   . SER A 1 243 ? 20.691 35.571 62.363 1.00 67.68  ? 243 SER A C   1 
ATOM   1677 O O   . SER A 1 243 ? 21.414 36.564 62.292 1.00 70.97  ? 243 SER A O   1 
ATOM   1678 C CB  . SER A 1 243 ? 19.855 34.325 60.382 1.00 62.61  ? 243 SER A CB  1 
ATOM   1679 O OG  . SER A 1 243 ? 21.213 34.465 59.993 1.00 72.93  ? 243 SER A OG  1 
ATOM   1680 N N   . GLN A 1 244 ? 20.896 34.612 63.253 1.00 73.45  ? 244 GLN A N   1 
ATOM   1681 C CA  . GLN A 1 244 ? 22.004 34.678 64.191 1.00 75.31  ? 244 GLN A CA  1 
ATOM   1682 C C   . GLN A 1 244 ? 23.314 34.668 63.410 1.00 68.71  ? 244 GLN A C   1 
ATOM   1683 O O   . GLN A 1 244 ? 24.306 35.271 63.810 1.00 71.23  ? 244 GLN A O   1 
ATOM   1684 C CB  . GLN A 1 244 ? 21.951 33.478 65.135 1.00 84.05  ? 244 GLN A CB  1 
ATOM   1685 C CG  . GLN A 1 244 ? 23.041 33.472 66.190 1.00 101.88 ? 244 GLN A CG  1 
ATOM   1686 C CD  . GLN A 1 244 ? 22.974 32.249 67.082 1.00 115.16 ? 244 GLN A CD  1 
ATOM   1687 O OE1 . GLN A 1 244 ? 23.152 31.116 66.622 1.00 119.80 ? 244 GLN A OE1 1 
ATOM   1688 N NE2 . GLN A 1 244 ? 22.708 32.469 68.369 1.00 119.61 ? 244 GLN A NE2 1 
ATOM   1689 N N   . ALA A 1 245 ? 23.300 33.973 62.285 1.00 65.05  ? 245 ALA A N   1 
ATOM   1690 C CA  . ALA A 1 245 ? 24.464 33.866 61.429 1.00 63.39  ? 245 ALA A CA  1 
ATOM   1691 C C   . ALA A 1 245 ? 24.802 35.236 60.846 1.00 63.14  ? 245 ALA A C   1 
ATOM   1692 O O   . ALA A 1 245 ? 25.917 35.735 60.997 1.00 62.40  ? 245 ALA A O   1 
ATOM   1693 C CB  . ALA A 1 245 ? 24.179 32.878 60.309 1.00 56.85  ? 245 ALA A CB  1 
ATOM   1694 N N   . GLU A 1 246 ? 23.831 35.830 60.166 1.00 57.57  ? 246 GLU A N   1 
ATOM   1695 C CA  . GLU A 1 246 ? 24.018 37.132 59.560 1.00 61.93  ? 246 GLU A CA  1 
ATOM   1696 C C   . GLU A 1 246 ? 24.498 38.148 60.580 1.00 61.60  ? 246 GLU A C   1 
ATOM   1697 O O   . GLU A 1 246 ? 25.415 38.925 60.316 1.00 53.56  ? 246 GLU A O   1 
ATOM   1698 C CB  . GLU A 1 246 ? 22.713 37.623 58.976 1.00 67.82  ? 246 GLU A CB  1 
ATOM   1699 C CG  . GLU A 1 246 ? 22.242 36.871 57.766 1.00 72.88  ? 246 GLU A CG  1 
ATOM   1700 C CD  . GLU A 1 246 ? 20.912 37.406 57.298 1.00 80.65  ? 246 GLU A CD  1 
ATOM   1701 O OE1 . GLU A 1 246 ? 19.890 37.053 57.948 1.00 66.49  ? 246 GLU A OE1 1 
ATOM   1702 O OE2 . GLU A 1 246 ? 20.906 38.194 56.311 1.00 70.29  ? 246 GLU A OE2 1 
ATOM   1703 N N   . LEU A 1 247 ? 23.867 38.128 61.747 1.00 59.91  ? 247 LEU A N   1 
ATOM   1704 C CA  . LEU A 1 247 ? 24.202 39.054 62.812 1.00 60.69  ? 247 LEU A CA  1 
ATOM   1705 C C   . LEU A 1 247 ? 25.657 38.967 63.251 1.00 58.14  ? 247 LEU A C   1 
ATOM   1706 O O   . LEU A 1 247 ? 26.356 39.999 63.332 1.00 48.72  ? 247 LEU A O   1 
ATOM   1707 C CB  . LEU A 1 247 ? 23.285 38.822 64.021 1.00 60.71  ? 247 LEU A CB  1 
ATOM   1708 C CG  . LEU A 1 247 ? 23.432 39.835 65.161 1.00 60.14  ? 247 LEU A CG  1 
ATOM   1709 C CD1 . LEU A 1 247 ? 23.248 41.242 64.628 1.00 59.84  ? 247 LEU A CD1 1 
ATOM   1710 C CD2 . LEU A 1 247 ? 22.407 39.546 66.236 1.00 66.33  ? 247 LEU A CD2 1 
ATOM   1711 N N   . ILE A 1 248 ? 26.117 37.750 63.536 1.00 43.79  ? 248 ILE A N   1 
ATOM   1712 C CA  . ILE A 1 248 ? 27.497 37.582 63.992 1.00 51.65  ? 248 ILE A CA  1 
ATOM   1713 C C   . ILE A 1 248 ? 28.478 38.044 62.924 1.00 49.17  ? 248 ILE A C   1 
ATOM   1714 O O   . ILE A 1 248 ? 29.518 38.666 63.225 1.00 54.14  ? 248 ILE A O   1 
ATOM   1715 C CB  . ILE A 1 248 ? 27.784 36.122 64.400 1.00 54.88  ? 248 ILE A CB  1 
ATOM   1716 C CG1 . ILE A 1 248 ? 26.860 35.737 65.553 1.00 59.45  ? 248 ILE A CG1 1 
ATOM   1717 C CG2 . ILE A 1 248 ? 29.210 35.984 64.901 1.00 54.92  ? 248 ILE A CG2 1 
ATOM   1718 C CD1 . ILE A 1 248 ? 27.020 36.623 66.806 1.00 56.71  ? 248 ILE A CD1 1 
ATOM   1719 N N   . SER A 1 249 ? 28.123 37.763 61.676 1.00 44.31  ? 249 SER A N   1 
ATOM   1720 C CA  . SER A 1 249 ? 28.923 38.159 60.533 1.00 50.85  ? 249 SER A CA  1 
ATOM   1721 C C   . SER A 1 249 ? 29.063 39.677 60.500 1.00 57.63  ? 249 SER A C   1 
ATOM   1722 O O   . SER A 1 249 ? 30.181 40.191 60.345 1.00 47.10  ? 249 SER A O   1 
ATOM   1723 C CB  . SER A 1 249 ? 28.261 37.678 59.245 1.00 56.40  ? 249 SER A CB  1 
ATOM   1724 O OG  . SER A 1 249 ? 28.033 36.282 59.318 1.00 69.92  ? 249 SER A OG  1 
ATOM   1725 N N   . LEU A 1 250 ? 27.938 40.389 60.656 1.00 47.43  ? 250 LEU A N   1 
ATOM   1726 C CA  . LEU A 1 250 ? 27.972 41.853 60.642 1.00 50.30  ? 250 LEU A CA  1 
ATOM   1727 C C   . LEU A 1 250 ? 28.814 42.436 61.772 1.00 46.20  ? 250 LEU A C   1 
ATOM   1728 O O   . LEU A 1 250 ? 29.528 43.436 61.585 1.00 45.64  ? 250 LEU A O   1 
ATOM   1729 C CB  . LEU A 1 250 ? 26.555 42.436 60.694 1.00 44.85  ? 250 LEU A CB  1 
ATOM   1730 C CG  . LEU A 1 250 ? 25.812 42.273 59.368 1.00 45.77  ? 250 LEU A CG  1 
ATOM   1731 C CD1 . LEU A 1 250 ? 24.361 42.691 59.522 1.00 54.61  ? 250 LEU A CD1 1 
ATOM   1732 C CD2 . LEU A 1 250 ? 26.532 43.099 58.289 1.00 39.64  ? 250 LEU A CD2 1 
ATOM   1733 N N   . ILE A 1 251 ? 28.724 41.806 62.937 1.00 44.19  ? 251 ILE A N   1 
ATOM   1734 C CA  . ILE A 1 251 ? 29.471 42.238 64.104 1.00 44.04  ? 251 ILE A CA  1 
ATOM   1735 C C   . ILE A 1 251 ? 30.956 42.042 63.848 1.00 46.13  ? 251 ILE A C   1 
ATOM   1736 O O   . ILE A 1 251 ? 31.764 42.924 64.139 1.00 48.83  ? 251 ILE A O   1 
ATOM   1737 C CB  . ILE A 1 251 ? 29.024 41.450 65.346 1.00 46.23  ? 251 ILE A CB  1 
ATOM   1738 C CG1 . ILE A 1 251 ? 27.607 41.897 65.734 1.00 50.51  ? 251 ILE A CG1 1 
ATOM   1739 C CG2 . ILE A 1 251 ? 30.009 41.652 66.494 1.00 37.16  ? 251 ILE A CG2 1 
ATOM   1740 C CD1 . ILE A 1 251 ? 26.715 40.807 66.292 1.00 49.95  ? 251 ILE A CD1 1 
ATOM   1741 N N   . ALA A 1 252 ? 31.315 40.902 63.265 1.00 47.26  ? 252 ALA A N   1 
ATOM   1742 C CA  . ALA A 1 252 ? 32.717 40.629 62.983 1.00 46.74  ? 252 ALA A CA  1 
ATOM   1743 C C   . ALA A 1 252 ? 33.275 41.628 61.980 1.00 40.90  ? 252 ALA A C   1 
ATOM   1744 O O   . ALA A 1 252 ? 34.355 42.188 62.183 1.00 42.65  ? 252 ALA A O   1 
ATOM   1745 C CB  . ALA A 1 252 ? 32.879 39.209 62.463 1.00 44.62  ? 252 ALA A CB  1 
ATOM   1746 N N   . ARG A 1 253 ? 32.533 41.856 60.903 1.00 37.34  ? 253 ARG A N   1 
ATOM   1747 C CA  . ARG A 1 253 ? 32.959 42.782 59.851 1.00 42.13  ? 253 ARG A CA  1 
ATOM   1748 C C   . ARG A 1 253 ? 33.156 44.185 60.397 1.00 46.45  ? 253 ARG A C   1 
ATOM   1749 O O   . ARG A 1 253 ? 34.102 44.907 60.025 1.00 41.49  ? 253 ARG A O   1 
ATOM   1750 C CB  . ARG A 1 253 ? 31.917 42.871 58.733 1.00 42.13  ? 253 ARG A CB  1 
ATOM   1751 C CG  . ARG A 1 253 ? 31.698 41.607 57.951 1.00 44.83  ? 253 ARG A CG  1 
ATOM   1752 C CD  . ARG A 1 253 ? 30.718 41.828 56.813 1.00 47.42  ? 253 ARG A CD  1 
ATOM   1753 N NE  . ARG A 1 253 ? 30.497 40.579 56.096 1.00 57.82  ? 253 ARG A NE  1 
ATOM   1754 C CZ  . ARG A 1 253 ? 31.411 39.985 55.333 1.00 69.89  ? 253 ARG A CZ  1 
ATOM   1755 N NH1 . ARG A 1 253 ? 32.607 40.538 55.174 1.00 73.69  ? 253 ARG A NH1 1 
ATOM   1756 N NH2 . ARG A 1 253 ? 31.148 38.818 54.756 1.00 73.41  ? 253 ARG A NH2 1 
ATOM   1757 N N   . THR A 1 254 ? 32.235 44.573 61.266 1.00 38.91  ? 254 THR A N   1 
ATOM   1758 C CA  . THR A 1 254 ? 32.280 45.894 61.836 1.00 43.92  ? 254 THR A CA  1 
ATOM   1759 C C   . THR A 1 254 ? 33.510 45.947 62.692 1.00 44.34  ? 254 THR A C   1 
ATOM   1760 O O   . THR A 1 254 ? 34.303 46.904 62.617 1.00 46.43  ? 254 THR A O   1 
ATOM   1761 C CB  . THR A 1 254 ? 31.036 46.161 62.677 1.00 47.24  ? 254 THR A CB  1 
ATOM   1762 O OG1 . THR A 1 254 ? 29.884 46.105 61.827 1.00 33.98  ? 254 THR A OG1 1 
ATOM   1763 C CG2 . THR A 1 254 ? 31.125 47.525 63.312 1.00 42.11  ? 254 THR A CG2 1 
ATOM   1764 N N   . HIS A 1 255 ? 33.663 44.905 63.505 1.00 36.44  ? 255 HIS A N   1 
ATOM   1765 C CA  . HIS A 1 255 ? 34.813 44.790 64.390 1.00 30.85  ? 255 HIS A CA  1 
ATOM   1766 C C   . HIS A 1 255 ? 36.070 44.859 63.506 1.00 40.75  ? 255 HIS A C   1 
ATOM   1767 O O   . HIS A 1 255 ? 36.972 45.666 63.753 1.00 39.63  ? 255 HIS A O   1 
ATOM   1768 C CB  . HIS A 1 255 ? 34.757 43.458 65.127 1.00 47.90  ? 255 HIS A CB  1 
ATOM   1769 C CG  . HIS A 1 255 ? 35.590 43.427 66.367 1.00 52.72  ? 255 HIS A CG  1 
ATOM   1770 N ND1 . HIS A 1 255 ? 36.692 44.240 66.539 1.00 41.45  ? 255 HIS A ND1 1 
ATOM   1771 C CD2 . HIS A 1 255 ? 35.461 42.715 67.513 1.00 39.62  ? 255 HIS A CD2 1 
ATOM   1772 C CE1 . HIS A 1 255 ? 37.197 44.038 67.745 1.00 35.44  ? 255 HIS A CE1 1 
ATOM   1773 N NE2 . HIS A 1 255 ? 36.467 43.122 68.355 1.00 39.24  ? 255 HIS A NE2 1 
ATOM   1774 N N   . TRP A 1 256 ? 36.085 44.051 62.440 1.00 38.16  ? 256 TRP A N   1 
ATOM   1775 C CA  . TRP A 1 256 ? 37.207 43.992 61.521 1.00 33.04  ? 256 TRP A CA  1 
ATOM   1776 C C   . TRP A 1 256 ? 37.598 45.331 60.906 1.00 44.06  ? 256 TRP A C   1 
ATOM   1777 O O   . TRP A 1 256 ? 38.776 45.727 60.934 1.00 39.10  ? 256 TRP A O   1 
ATOM   1778 C CB  . TRP A 1 256 ? 36.922 43.000 60.402 1.00 40.20  ? 256 TRP A CB  1 
ATOM   1779 C CG  . TRP A 1 256 ? 38.123 42.768 59.492 1.00 47.44  ? 256 TRP A CG  1 
ATOM   1780 C CD1 . TRP A 1 256 ? 39.177 41.939 59.727 1.00 37.24  ? 256 TRP A CD1 1 
ATOM   1781 C CD2 . TRP A 1 256 ? 38.370 43.374 58.209 1.00 50.09  ? 256 TRP A CD2 1 
ATOM   1782 N NE1 . TRP A 1 256 ? 40.057 41.979 58.674 1.00 39.04  ? 256 TRP A NE1 1 
ATOM   1783 C CE2 . TRP A 1 256 ? 39.589 42.846 57.728 1.00 35.27  ? 256 TRP A CE2 1 
ATOM   1784 C CE3 . TRP A 1 256 ? 37.677 44.314 57.420 1.00 45.39  ? 256 TRP A CE3 1 
ATOM   1785 C CZ2 . TRP A 1 256 ? 40.135 43.211 56.499 1.00 39.51  ? 256 TRP A CZ2 1 
ATOM   1786 C CZ3 . TRP A 1 256 ? 38.222 44.681 56.197 1.00 55.96  ? 256 TRP A CZ3 1 
ATOM   1787 C CH2 . TRP A 1 256 ? 39.445 44.122 55.747 1.00 49.98  ? 256 TRP A CH2 1 
ATOM   1788 N N   . TRP A 1 257 ? 36.622 46.021 60.327 1.00 35.45  ? 257 TRP A N   1 
ATOM   1789 C CA  . TRP A 1 257 ? 36.899 47.318 59.717 1.00 35.55  ? 257 TRP A CA  1 
ATOM   1790 C C   . TRP A 1 257 ? 37.328 48.404 60.707 1.00 40.60  ? 257 TRP A C   1 
ATOM   1791 O O   . TRP A 1 257 ? 38.265 49.165 60.440 1.00 39.75  ? 257 TRP A O   1 
ATOM   1792 C CB  . TRP A 1 257 ? 35.675 47.824 58.943 1.00 28.95  ? 257 TRP A CB  1 
ATOM   1793 C CG  . TRP A 1 257 ? 35.494 47.178 57.630 1.00 28.51  ? 257 TRP A CG  1 
ATOM   1794 C CD1 . TRP A 1 257 ? 34.691 46.110 57.338 1.00 22.13  ? 257 TRP A CD1 1 
ATOM   1795 C CD2 . TRP A 1 257 ? 36.098 47.578 56.400 1.00 23.46  ? 257 TRP A CD2 1 
ATOM   1796 N NE1 . TRP A 1 257 ? 34.753 45.834 56.000 1.00 25.28  ? 257 TRP A NE1 1 
ATOM   1797 C CE2 . TRP A 1 257 ? 35.613 46.719 55.402 1.00 20.91  ? 257 TRP A CE2 1 
ATOM   1798 C CE3 . TRP A 1 257 ? 37.002 48.590 56.047 1.00 32.43  ? 257 TRP A CE3 1 
ATOM   1799 C CZ2 . TRP A 1 257 ? 35.994 46.835 54.074 1.00 28.73  ? 257 TRP A CZ2 1 
ATOM   1800 C CZ3 . TRP A 1 257 ? 37.375 48.713 54.742 1.00 29.00  ? 257 TRP A CZ3 1 
ATOM   1801 C CH2 . TRP A 1 257 ? 36.873 47.840 53.759 1.00 37.33  ? 257 TRP A CH2 1 
ATOM   1802 N N   . ALA A 1 258 ? 36.637 48.495 61.842 1.00 35.84  ? 258 ALA A N   1 
ATOM   1803 C CA  . ALA A 1 258 ? 36.973 49.526 62.815 1.00 34.65  ? 258 ALA A CA  1 
ATOM   1804 C C   . ALA A 1 258 ? 38.376 49.333 63.356 1.00 41.38  ? 258 ALA A C   1 
ATOM   1805 O O   . ALA A 1 258 ? 39.155 50.289 63.446 1.00 46.11  ? 258 ALA A O   1 
ATOM   1806 C CB  . ALA A 1 258 ? 35.960 49.518 63.951 1.00 33.48  ? 258 ALA A CB  1 
ATOM   1807 N N   . ALA A 1 259 ? 38.687 48.085 63.712 1.00 39.85  ? 259 ALA A N   1 
ATOM   1808 C CA  . ALA A 1 259 ? 39.984 47.715 64.271 1.00 38.46  ? 259 ALA A CA  1 
ATOM   1809 C C   . ALA A 1 259 ? 41.096 47.856 63.251 1.00 33.53  ? 259 ALA A C   1 
ATOM   1810 O O   . ALA A 1 259 ? 42.110 48.458 63.537 1.00 42.06  ? 259 ALA A O   1 
ATOM   1811 C CB  . ALA A 1 259 ? 39.945 46.272 64.788 1.00 40.22  ? 259 ALA A CB  1 
ATOM   1812 N N   . SER A 1 260 ? 40.878 47.349 62.039 1.00 36.44  ? 260 SER A N   1 
ATOM   1813 C CA  . SER A 1 260 ? 41.917 47.412 61.027 1.00 43.39  ? 260 SER A CA  1 
ATOM   1814 C C   . SER A 1 260 ? 42.146 48.832 60.536 1.00 43.39  ? 260 SER A C   1 
ATOM   1815 O O   . SER A 1 260 ? 43.253 49.214 60.129 1.00 39.91  ? 260 SER A O   1 
ATOM   1816 C CB  . SER A 1 260 ? 41.567 46.478 59.862 1.00 37.95  ? 260 SER A CB  1 
ATOM   1817 O OG  . SER A 1 260 ? 41.284 45.173 60.349 1.00 42.97  ? 260 SER A OG  1 
ATOM   1818 N N   . ALA A 1 261 ? 41.093 49.625 60.576 1.00 42.68  ? 261 ALA A N   1 
ATOM   1819 C CA  . ALA A 1 261 ? 41.215 50.983 60.110 1.00 38.80  ? 261 ALA A CA  1 
ATOM   1820 C C   . ALA A 1 261 ? 41.946 51.848 61.113 1.00 39.32  ? 261 ALA A C   1 
ATOM   1821 O O   . ALA A 1 261 ? 42.652 52.772 60.701 1.00 38.29  ? 261 ALA A O   1 
ATOM   1822 C CB  . ALA A 1 261 ? 39.839 51.561 59.808 1.00 39.34  ? 261 ALA A CB  1 
ATOM   1823 N N   . MET A 1 262 ? 41.808 51.537 62.415 1.00 43.02  ? 262 MET A N   1 
ATOM   1824 C CA  . MET A 1 262 ? 42.429 52.347 63.491 1.00 48.27  ? 262 MET A CA  1 
ATOM   1825 C C   . MET A 1 262 ? 42.107 53.816 63.219 1.00 47.50  ? 262 MET A C   1 
ATOM   1826 O O   . MET A 1 262 ? 43.002 54.651 63.026 1.00 50.50  ? 262 MET A O   1 
ATOM   1827 C CB  . MET A 1 262 ? 43.943 52.173 63.530 1.00 59.06  ? 262 MET A CB  1 
ATOM   1828 C CG  . MET A 1 262 ? 44.420 50.934 64.266 1.00 66.92  ? 262 MET A CG  1 
ATOM   1829 S SD  . MET A 1 262 ? 45.748 51.392 65.432 1.00 93.03  ? 262 MET A SD  1 
ATOM   1830 C CE  . MET A 1 262 ? 46.608 52.795 64.553 1.00 50.84  ? 262 MET A CE  1 
ATOM   1831 N N   . PRO A 1 263 ? 40.813 54.147 63.231 1.00 40.43  ? 263 PRO A N   1 
ATOM   1832 C CA  . PRO A 1 263 ? 40.309 55.498 62.970 1.00 46.86  ? 263 PRO A CA  1 
ATOM   1833 C C   . PRO A 1 263 ? 40.899 56.600 63.824 1.00 46.79  ? 263 PRO A C   1 
ATOM   1834 O O   . PRO A 1 263 ? 41.089 57.723 63.345 1.00 51.46  ? 263 PRO A O   1 
ATOM   1835 C CB  . PRO A 1 263 ? 38.791 55.368 63.184 1.00 39.71  ? 263 PRO A CB  1 
ATOM   1836 C CG  . PRO A 1 263 ? 38.521 53.878 63.050 1.00 44.92  ? 263 PRO A CG  1 
ATOM   1837 C CD  . PRO A 1 263 ? 39.734 53.260 63.699 1.00 41.64  ? 263 PRO A CD  1 
ATOM   1838 N N   . ASP A 1 264 ? 41.191 56.299 65.085 1.00 46.97  ? 264 ASP A N   1 
ATOM   1839 C CA  . ASP A 1 264 ? 41.685 57.355 65.970 1.00 45.96  ? 264 ASP A CA  1 
ATOM   1840 C C   . ASP A 1 264 ? 43.126 57.216 66.373 1.00 44.36  ? 264 ASP A C   1 
ATOM   1841 O O   . ASP A 1 264 ? 43.680 56.120 66.393 1.00 39.12  ? 264 ASP A O   1 
ATOM   1842 C CB  . ASP A 1 264 ? 40.808 57.478 67.236 1.00 40.43  ? 264 ASP A CB  1 
ATOM   1843 C CG  . ASP A 1 264 ? 39.341 57.788 66.916 1.00 42.09  ? 264 ASP A CG  1 
ATOM   1844 O OD1 . ASP A 1 264 ? 39.067 58.444 65.890 1.00 46.99  ? 264 ASP A OD1 1 
ATOM   1845 O OD2 . ASP A 1 264 ? 38.459 57.394 67.706 1.00 48.37  ? 264 ASP A OD2 1 
ATOM   1846 N N   . GLN A 1 265 ? 43.721 58.350 66.713 1.00 43.14  ? 265 GLN A N   1 
ATOM   1847 C CA  . GLN A 1 265 ? 45.115 58.392 67.102 1.00 43.89  ? 265 GLN A CA  1 
ATOM   1848 C C   . GLN A 1 265 ? 45.379 57.437 68.238 1.00 44.46  ? 265 GLN A C   1 
ATOM   1849 O O   . GLN A 1 265 ? 46.450 56.884 68.332 1.00 50.69  ? 265 GLN A O   1 
ATOM   1850 C CB  . GLN A 1 265 ? 45.490 59.815 67.499 1.00 39.06  ? 265 GLN A CB  1 
ATOM   1851 C CG  . GLN A 1 265 ? 45.390 60.771 66.315 1.00 47.74  ? 265 GLN A CG  1 
ATOM   1852 C CD  . GLN A 1 265 ? 45.618 62.227 66.697 1.00 50.09  ? 265 GLN A CD  1 
ATOM   1853 O OE1 . GLN A 1 265 ? 46.320 62.524 67.655 1.00 60.52  ? 265 GLN A OE1 1 
ATOM   1854 N NE2 . GLN A 1 265 ? 45.035 63.138 65.931 1.00 57.60  ? 265 GLN A NE2 1 
ATOM   1855 N N   . ARG A 1 266 ? 44.389 57.214 69.089 1.00 48.09  ? 266 ARG A N   1 
ATOM   1856 C CA  . ARG A 1 266 ? 44.584 56.320 70.216 1.00 48.10  ? 266 ARG A CA  1 
ATOM   1857 C C   . ARG A 1 266 ? 43.289 55.591 70.606 1.00 41.46  ? 266 ARG A C   1 
ATOM   1858 O O   . ARG A 1 266 ? 42.210 56.084 70.337 1.00 49.72  ? 266 ARG A O   1 
ATOM   1859 C CB  . ARG A 1 266 ? 45.095 57.152 71.384 1.00 58.31  ? 266 ARG A CB  1 
ATOM   1860 C CG  . ARG A 1 266 ? 46.224 56.532 72.102 1.00 59.65  ? 266 ARG A CG  1 
ATOM   1861 C CD  . ARG A 1 266 ? 47.504 56.786 71.388 1.00 64.58  ? 266 ARG A CD  1 
ATOM   1862 N NE  . ARG A 1 266 ? 48.522 55.857 71.848 1.00 70.63  ? 266 ARG A NE  1 
ATOM   1863 C CZ  . ARG A 1 266 ? 49.826 56.084 71.760 1.00 90.50  ? 266 ARG A CZ  1 
ATOM   1864 N NH1 . ARG A 1 266 ? 50.272 57.223 71.230 1.00 90.64  ? 266 ARG A NH1 1 
ATOM   1865 N NH2 . ARG A 1 266 ? 50.684 55.166 72.193 1.00 100.53 ? 266 ARG A NH2 1 
ATOM   1866 N N   . GLY A 1 267 ? 43.404 54.411 71.214 1.00 44.81  ? 267 GLY A N   1 
ATOM   1867 C CA  . GLY A 1 267 ? 42.234 53.646 71.652 1.00 30.09  ? 267 GLY A CA  1 
ATOM   1868 C C   . GLY A 1 267 ? 41.275 53.038 70.628 1.00 41.21  ? 267 GLY A C   1 
ATOM   1869 O O   . GLY A 1 267 ? 40.192 52.521 70.988 1.00 43.59  ? 267 GLY A O   1 
ATOM   1870 N N   . SER A 1 268 ? 41.641 53.063 69.354 1.00 38.49  ? 268 SER A N   1 
ATOM   1871 C CA  . SER A 1 268 ? 40.746 52.500 68.344 1.00 33.60  ? 268 SER A CA  1 
ATOM   1872 C C   . SER A 1 268 ? 40.367 51.053 68.646 1.00 42.22  ? 268 SER A C   1 
ATOM   1873 O O   . SER A 1 268 ? 39.226 50.646 68.442 1.00 44.87  ? 268 SER A O   1 
ATOM   1874 C CB  . SER A 1 268 ? 41.382 52.574 66.953 1.00 30.49  ? 268 SER A CB  1 
ATOM   1875 O OG  . SER A 1 268 ? 41.685 53.909 66.582 1.00 44.68  ? 268 SER A OG  1 
ATOM   1876 N N   . ALA A 1 269 ? 41.316 50.271 69.145 1.00 38.70  ? 269 ALA A N   1 
ATOM   1877 C CA  . ALA A 1 269 ? 41.021 48.875 69.407 1.00 40.66  ? 269 ALA A CA  1 
ATOM   1878 C C   . ALA A 1 269 ? 39.935 48.724 70.447 1.00 33.82  ? 269 ALA A C   1 
ATOM   1879 O O   . ALA A 1 269 ? 39.063 47.881 70.315 1.00 33.28  ? 269 ALA A O   1 
ATOM   1880 C CB  . ALA A 1 269 ? 42.286 48.136 69.839 1.00 38.43  ? 269 ALA A CB  1 
ATOM   1881 N N   . ALA A 1 270 ? 40.014 49.538 71.494 1.00 38.92  ? 270 ALA A N   1 
ATOM   1882 C CA  . ALA A 1 270 ? 39.021 49.518 72.552 1.00 36.86  ? 270 ALA A CA  1 
ATOM   1883 C C   . ALA A 1 270 ? 37.684 49.993 71.965 1.00 46.30  ? 270 ALA A C   1 
ATOM   1884 O O   . ALA A 1 270 ? 36.660 49.329 72.146 1.00 32.76  ? 270 ALA A O   1 
ATOM   1885 C CB  . ALA A 1 270 ? 39.444 50.408 73.679 1.00 34.68  ? 270 ALA A CB  1 
ATOM   1886 N N   . LYS A 1 271 ? 37.700 51.111 71.234 1.00 31.75  ? 271 LYS A N   1 
ATOM   1887 C CA  . LYS A 1 271 ? 36.469 51.609 70.647 1.00 41.19  ? 271 LYS A CA  1 
ATOM   1888 C C   . LYS A 1 271 ? 35.816 50.575 69.704 1.00 45.34  ? 271 LYS A C   1 
ATOM   1889 O O   . LYS A 1 271 ? 34.590 50.382 69.731 1.00 39.13  ? 271 LYS A O   1 
ATOM   1890 C CB  . LYS A 1 271 ? 36.743 52.944 69.923 1.00 37.98  ? 271 LYS A CB  1 
ATOM   1891 C CG  . LYS A 1 271 ? 37.213 54.058 70.890 1.00 30.88  ? 271 LYS A CG  1 
ATOM   1892 C CD  . LYS A 1 271 ? 38.096 55.049 70.181 1.00 38.41  ? 271 LYS A CD  1 
ATOM   1893 C CE  . LYS A 1 271 ? 38.583 56.096 71.134 1.00 28.10  ? 271 LYS A CE  1 
ATOM   1894 N NZ  . LYS A 1 271 ? 39.541 56.920 70.429 1.00 37.20  ? 271 LYS A NZ  1 
ATOM   1895 N N   . ALA A 1 272 ? 36.629 49.879 68.909 1.00 40.35  ? 272 ALA A N   1 
ATOM   1896 C CA  . ALA A 1 272 ? 36.094 48.890 67.973 1.00 33.25  ? 272 ALA A CA  1 
ATOM   1897 C C   . ALA A 1 272 ? 35.462 47.721 68.675 1.00 36.52  ? 272 ALA A C   1 
ATOM   1898 O O   . ALA A 1 272 ? 34.369 47.255 68.287 1.00 43.14  ? 272 ALA A O   1 
ATOM   1899 C CB  . ALA A 1 272 ? 37.176 48.411 67.009 1.00 33.78  ? 272 ALA A CB  1 
ATOM   1900 N N   . GLU A 1 273 ? 36.112 47.240 69.731 1.00 39.19  ? 273 GLU A N   1 
ATOM   1901 C CA  . GLU A 1 273 ? 35.525 46.121 70.459 1.00 46.02  ? 273 GLU A CA  1 
ATOM   1902 C C   . GLU A 1 273 ? 34.253 46.600 71.156 1.00 41.64  ? 273 GLU A C   1 
ATOM   1903 O O   . GLU A 1 273 ? 33.242 45.880 71.211 1.00 33.35  ? 273 GLU A O   1 
ATOM   1904 C CB  . GLU A 1 273 ? 36.489 45.554 71.500 1.00 40.14  ? 273 GLU A CB  1 
ATOM   1905 C CG  . GLU A 1 273 ? 35.831 44.452 72.290 1.00 48.09  ? 273 GLU A CG  1 
ATOM   1906 C CD  . GLU A 1 273 ? 36.752 43.738 73.253 1.00 55.38  ? 273 GLU A CD  1 
ATOM   1907 O OE1 . GLU A 1 273 ? 36.240 42.827 73.950 1.00 48.22  ? 273 GLU A OE1 1 
ATOM   1908 O OE2 . GLU A 1 273 ? 37.959 44.085 73.312 1.00 55.92  ? 273 GLU A OE2 1 
ATOM   1909 N N   . PHE A 1 274 ? 34.325 47.813 71.703 1.00 34.42  ? 274 PHE A N   1 
ATOM   1910 C CA  . PHE A 1 274 ? 33.190 48.414 72.391 1.00 38.22  ? 274 PHE A CA  1 
ATOM   1911 C C   . PHE A 1 274 ? 32.003 48.415 71.426 1.00 35.74  ? 274 PHE A C   1 
ATOM   1912 O O   . PHE A 1 274 ? 30.922 47.899 71.743 1.00 33.35  ? 274 PHE A O   1 
ATOM   1913 C CB  . PHE A 1 274 ? 33.524 49.859 72.815 1.00 44.08  ? 274 PHE A CB  1 
ATOM   1914 C CG  . PHE A 1 274 ? 32.427 50.532 73.614 1.00 40.72  ? 274 PHE A CG  1 
ATOM   1915 C CD1 . PHE A 1 274 ? 31.236 50.929 73.009 1.00 39.51  ? 274 PHE A CD1 1 
ATOM   1916 C CD2 . PHE A 1 274 ? 32.584 50.757 74.977 1.00 37.62  ? 274 PHE A CD2 1 
ATOM   1917 C CE1 . PHE A 1 274 ? 30.214 51.546 73.767 1.00 35.44  ? 274 PHE A CE1 1 
ATOM   1918 C CE2 . PHE A 1 274 ? 31.574 51.365 75.730 1.00 43.81  ? 274 PHE A CE2 1 
ATOM   1919 C CZ  . PHE A 1 274 ? 30.386 51.758 75.112 1.00 37.69  ? 274 PHE A CZ  1 
ATOM   1920 N N   . ALA A 1 275 ? 32.228 48.963 70.232 1.00 30.18  ? 275 ALA A N   1 
ATOM   1921 C CA  . ALA A 1 275 ? 31.175 49.024 69.235 1.00 35.14  ? 275 ALA A CA  1 
ATOM   1922 C C   . ALA A 1 275 ? 30.619 47.659 68.834 1.00 42.83  ? 275 ALA A C   1 
ATOM   1923 O O   . ALA A 1 275 ? 29.395 47.461 68.823 1.00 40.34  ? 275 ALA A O   1 
ATOM   1924 C CB  . ALA A 1 275 ? 31.671 49.749 68.033 1.00 28.96  ? 275 ALA A CB  1 
ATOM   1925 N N   . ALA A 1 276 ? 31.510 46.715 68.523 1.00 39.78  ? 276 ALA A N   1 
ATOM   1926 C CA  . ALA A 1 276 ? 31.080 45.388 68.110 1.00 36.74  ? 276 ALA A CA  1 
ATOM   1927 C C   . ALA A 1 276 ? 30.161 44.761 69.157 1.00 41.84  ? 276 ALA A C   1 
ATOM   1928 O O   . ALA A 1 276 ? 29.055 44.320 68.834 1.00 34.94  ? 276 ALA A O   1 
ATOM   1929 C CB  . ALA A 1 276 ? 32.292 44.493 67.869 1.00 46.39  ? 276 ALA A CB  1 
ATOM   1930 N N   . ARG A 1 277 ? 30.609 44.744 70.414 1.00 44.13  ? 277 ARG A N   1 
ATOM   1931 C CA  . ARG A 1 277 ? 29.814 44.149 71.495 1.00 41.00  ? 277 ARG A CA  1 
ATOM   1932 C C   . ARG A 1 277 ? 28.484 44.891 71.755 1.00 46.19  ? 277 ARG A C   1 
ATOM   1933 O O   . ARG A 1 277 ? 27.472 44.244 72.065 1.00 43.61  ? 277 ARG A O   1 
ATOM   1934 C CB  . ARG A 1 277 ? 30.658 44.055 72.784 1.00 35.67  ? 277 ARG A CB  1 
ATOM   1935 C CG  . ARG A 1 277 ? 32.101 43.543 72.535 1.00 38.93  ? 277 ARG A CG  1 
ATOM   1936 C CD  . ARG A 1 277 ? 32.885 43.212 73.802 1.00 35.41  ? 277 ARG A CD  1 
ATOM   1937 N NE  . ARG A 1 277 ? 32.582 41.834 74.144 1.00 56.09  ? 277 ARG A NE  1 
ATOM   1938 C CZ  . ARG A 1 277 ? 33.452 40.838 74.076 1.00 44.82  ? 277 ARG A CZ  1 
ATOM   1939 N NH1 . ARG A 1 277 ? 33.074 39.619 74.386 1.00 52.10  ? 277 ARG A NH1 1 
ATOM   1940 N NH2 . ARG A 1 277 ? 34.706 41.072 73.741 1.00 45.18  ? 277 ARG A NH2 1 
ATOM   1941 N N   . ALA A 1 278 ? 28.470 46.223 71.620 1.00 38.55  ? 278 ALA A N   1 
ATOM   1942 C CA  . ALA A 1 278 ? 27.225 46.977 71.829 1.00 41.98  ? 278 ALA A CA  1 
ATOM   1943 C C   . ALA A 1 278 ? 26.214 46.535 70.802 1.00 37.72  ? 278 ALA A C   1 
ATOM   1944 O O   . ALA A 1 278 ? 25.048 46.280 71.136 1.00 45.50  ? 278 ALA A O   1 
ATOM   1945 C CB  . ALA A 1 278 ? 27.442 48.486 71.708 1.00 28.48  ? 278 ALA A CB  1 
ATOM   1946 N N   . ILE A 1 279 ? 26.645 46.442 69.549 1.00 33.59  ? 279 ILE A N   1 
ATOM   1947 C CA  . ILE A 1 279 ? 25.728 45.997 68.507 1.00 40.44  ? 279 ILE A CA  1 
ATOM   1948 C C   . ILE A 1 279 ? 25.208 44.596 68.820 1.00 43.69  ? 279 ILE A C   1 
ATOM   1949 O O   . ILE A 1 279 ? 24.043 44.288 68.593 1.00 44.16  ? 279 ILE A O   1 
ATOM   1950 C CB  . ILE A 1 279 ? 26.388 45.945 67.129 1.00 43.58  ? 279 ILE A CB  1 
ATOM   1951 C CG1 . ILE A 1 279 ? 26.893 47.328 66.735 1.00 35.37  ? 279 ILE A CG1 1 
ATOM   1952 C CG2 . ILE A 1 279 ? 25.354 45.440 66.091 1.00 34.73  ? 279 ILE A CG2 1 
ATOM   1953 C CD1 . ILE A 1 279 ? 27.834 47.286 65.521 1.00 32.74  ? 279 ILE A CD1 1 
ATOM   1954 N N   . ALA A 1 280 ? 26.080 43.733 69.329 1.00 50.52  ? 280 ALA A N   1 
ATOM   1955 C CA  . ALA A 1 280 ? 25.657 42.381 69.662 1.00 47.57  ? 280 ALA A CA  1 
ATOM   1956 C C   . ALA A 1 280 ? 24.674 42.441 70.827 1.00 47.45  ? 280 ALA A C   1 
ATOM   1957 O O   . ALA A 1 280 ? 23.658 41.735 70.846 1.00 44.47  ? 280 ALA A O   1 
ATOM   1958 C CB  . ALA A 1 280 ? 26.860 41.535 70.028 1.00 45.57  ? 280 ALA A CB  1 
ATOM   1959 N N   . SER A 1 281 ? 24.977 43.298 71.797 1.00 42.12  ? 281 SER A N   1 
ATOM   1960 C CA  . SER A 1 281 ? 24.126 43.423 72.961 1.00 38.79  ? 281 SER A CA  1 
ATOM   1961 C C   . SER A 1 281 ? 22.746 43.996 72.611 1.00 48.24  ? 281 SER A C   1 
ATOM   1962 O O   . SER A 1 281 ? 21.746 43.682 73.268 1.00 47.35  ? 281 SER A O   1 
ATOM   1963 C CB  . SER A 1 281 ? 24.815 44.280 74.012 1.00 42.12  ? 281 SER A CB  1 
ATOM   1964 O OG  . SER A 1 281 ? 24.004 44.378 75.172 1.00 56.54  ? 281 SER A OG  1 
ATOM   1965 N N   . ALA A 1 282 ? 22.699 44.826 71.570 1.00 47.15  ? 282 ALA A N   1 
ATOM   1966 C CA  . ALA A 1 282 ? 21.456 45.437 71.117 1.00 46.96  ? 282 ALA A CA  1 
ATOM   1967 C C   . ALA A 1 282 ? 20.479 44.322 70.751 1.00 47.39  ? 282 ALA A C   1 
ATOM   1968 O O   . ALA A 1 282 ? 19.260 44.441 70.906 1.00 52.86  ? 282 ALA A O   1 
ATOM   1969 C CB  . ALA A 1 282 ? 21.726 46.319 69.891 1.00 40.21  ? 282 ALA A CB  1 
ATOM   1970 N N   . HIS A 1 283 ? 21.028 43.229 70.256 1.00 45.66  ? 283 HIS A N   1 
ATOM   1971 C CA  . HIS A 1 283 ? 20.203 42.113 69.860 1.00 51.07  ? 283 HIS A CA  1 
ATOM   1972 C C   . HIS A 1 283 ? 20.028 41.095 70.961 1.00 50.39  ? 283 HIS A C   1 
ATOM   1973 O O   . HIS A 1 283 ? 19.415 40.059 70.741 1.00 59.09  ? 283 HIS A O   1 
ATOM   1974 C CB  . HIS A 1 283 ? 20.807 41.443 68.643 1.00 53.82  ? 283 HIS A CB  1 
ATOM   1975 C CG  . HIS A 1 283 ? 20.791 42.299 67.420 1.00 53.08  ? 283 HIS A CG  1 
ATOM   1976 N ND1 . HIS A 1 283 ? 19.682 42.417 66.611 1.00 49.04  ? 283 HIS A ND1 1 
ATOM   1977 C CD2 . HIS A 1 283 ? 21.756 43.060 66.851 1.00 50.23  ? 283 HIS A CD2 1 
ATOM   1978 C CE1 . HIS A 1 283 ? 19.964 43.211 65.593 1.00 53.63  ? 283 HIS A CE1 1 
ATOM   1979 N NE2 . HIS A 1 283 ? 21.216 43.615 65.715 1.00 58.06  ? 283 HIS A NE2 1 
ATOM   1980 N N   . GLY A 1 284 ? 20.579 41.371 72.137 1.00 52.51  ? 284 GLY A N   1 
ATOM   1981 C CA  . GLY A 1 284 ? 20.423 40.442 73.239 1.00 52.07  ? 284 GLY A CA  1 
ATOM   1982 C C   . GLY A 1 284 ? 21.498 39.377 73.241 1.00 62.48  ? 284 GLY A C   1 
ATOM   1983 O O   . GLY A 1 284 ? 21.433 38.422 74.017 1.00 62.77  ? 284 GLY A O   1 
ATOM   1984 N N   . ILE A 1 285 ? 22.482 39.527 72.359 1.00 58.60  ? 285 ILE A N   1 
ATOM   1985 C CA  . ILE A 1 285 ? 23.576 38.578 72.298 1.00 57.45  ? 285 ILE A CA  1 
ATOM   1986 C C   . ILE A 1 285 ? 24.541 39.012 73.389 1.00 62.98  ? 285 ILE A C   1 
ATOM   1987 O O   . ILE A 1 285 ? 24.911 40.180 73.462 1.00 56.90  ? 285 ILE A O   1 
ATOM   1988 C CB  . ILE A 1 285 ? 24.352 38.660 70.976 1.00 57.61  ? 285 ILE A CB  1 
ATOM   1989 C CG1 . ILE A 1 285 ? 23.403 38.625 69.771 1.00 65.73  ? 285 ILE A CG1 1 
ATOM   1990 C CG2 . ILE A 1 285 ? 25.339 37.540 70.910 1.00 52.54  ? 285 ILE A CG2 1 
ATOM   1991 C CD1 . ILE A 1 285 ? 22.636 37.358 69.605 1.00 62.62  ? 285 ILE A CD1 1 
ATOM   1992 N N   . GLU A 1 286 ? 24.946 38.083 74.245 1.00 65.52  ? 286 GLU A N   1 
ATOM   1993 C CA  . GLU A 1 286 ? 25.896 38.415 75.296 1.00 61.27  ? 286 GLU A CA  1 
ATOM   1994 C C   . GLU A 1 286 ? 27.219 37.746 74.918 1.00 59.40  ? 286 GLU A C   1 
ATOM   1995 O O   . GLU A 1 286 ? 27.481 36.602 75.276 1.00 66.50  ? 286 GLU A O   1 
ATOM   1996 C CB  . GLU A 1 286 ? 25.399 37.900 76.646 1.00 58.25  ? 286 GLU A CB  1 
ATOM   1997 C CG  . GLU A 1 286 ? 26.304 38.275 77.789 1.00 59.25  ? 286 GLU A CG  1 
ATOM   1998 C CD  . GLU A 1 286 ? 25.931 39.591 78.430 1.00 65.24  ? 286 GLU A CD  1 
ATOM   1999 O OE1 . GLU A 1 286 ? 25.391 40.486 77.733 1.00 69.52  ? 286 GLU A OE1 1 
ATOM   2000 O OE2 . GLU A 1 286 ? 26.196 39.732 79.642 1.00 60.63  ? 286 GLU A OE2 1 
ATOM   2001 N N   . LEU A 1 287 ? 28.039 38.460 74.166 1.00 52.89  ? 287 LEU A N   1 
ATOM   2002 C CA  . LEU A 1 287 ? 29.310 37.930 73.720 1.00 47.54  ? 287 LEU A CA  1 
ATOM   2003 C C   . LEU A 1 287 ? 30.284 37.718 74.872 1.00 53.43  ? 287 LEU A C   1 
ATOM   2004 O O   . LEU A 1 287 ? 30.484 38.607 75.691 1.00 49.62  ? 287 LEU A O   1 
ATOM   2005 C CB  . LEU A 1 287 ? 29.922 38.883 72.699 1.00 48.66  ? 287 LEU A CB  1 
ATOM   2006 C CG  . LEU A 1 287 ? 30.002 38.492 71.224 1.00 50.81  ? 287 LEU A CG  1 
ATOM   2007 C CD1 . LEU A 1 287 ? 28.810 37.684 70.787 1.00 54.09  ? 287 LEU A CD1 1 
ATOM   2008 C CD2 . LEU A 1 287 ? 30.098 39.764 70.419 1.00 52.65  ? 287 LEU A CD2 1 
ATOM   2009 N N   . PRO A 1 288 ? 30.893 36.520 74.958 1.00 54.50  ? 288 PRO A N   1 
ATOM   2010 C CA  . PRO A 1 288 ? 31.862 36.177 76.010 1.00 56.11  ? 288 PRO A CA  1 
ATOM   2011 C C   . PRO A 1 288 ? 33.163 36.876 75.647 1.00 44.87  ? 288 PRO A C   1 
ATOM   2012 O O   . PRO A 1 288 ? 33.325 37.291 74.515 1.00 49.62  ? 288 PRO A O   1 
ATOM   2013 C CB  . PRO A 1 288 ? 31.976 34.664 75.881 1.00 50.14  ? 288 PRO A CB  1 
ATOM   2014 C CG  . PRO A 1 288 ? 31.877 34.479 74.418 1.00 50.47  ? 288 PRO A CG  1 
ATOM   2015 C CD  . PRO A 1 288 ? 30.686 35.365 74.067 1.00 59.03  ? 288 PRO A CD  1 
ATOM   2016 N N   . PRO A 1 289 ? 34.106 37.000 76.589 1.00 42.96  ? 289 PRO A N   1 
ATOM   2017 C CA  . PRO A 1 289 ? 35.369 37.681 76.265 1.00 43.68  ? 289 PRO A CA  1 
ATOM   2018 C C   . PRO A 1 289 ? 36.225 36.972 75.228 1.00 50.62  ? 289 PRO A C   1 
ATOM   2019 O O   . PRO A 1 289 ? 36.022 35.794 74.926 1.00 46.02  ? 289 PRO A O   1 
ATOM   2020 C CB  . PRO A 1 289 ? 36.063 37.781 77.614 1.00 45.36  ? 289 PRO A CB  1 
ATOM   2021 C CG  . PRO A 1 289 ? 35.561 36.580 78.329 1.00 45.72  ? 289 PRO A CG  1 
ATOM   2022 C CD  . PRO A 1 289 ? 34.116 36.475 77.963 1.00 38.03  ? 289 PRO A CD  1 
ATOM   2023 N N   . PHE A 1 290 ? 37.185 37.683 74.663 1.00 50.32  ? 290 PHE A N   1 
ATOM   2024 C CA  . PHE A 1 290 ? 38.042 37.028 73.700 1.00 54.45  ? 290 PHE A CA  1 
ATOM   2025 C C   . PHE A 1 290 ? 38.938 36.026 74.438 1.00 59.42  ? 290 PHE A C   1 
ATOM   2026 O O   . PHE A 1 290 ? 39.291 36.244 75.596 1.00 52.75  ? 290 PHE A O   1 
ATOM   2027 C CB  . PHE A 1 290 ? 38.889 38.051 72.970 1.00 50.67  ? 290 PHE A CB  1 
ATOM   2028 C CG  . PHE A 1 290 ? 38.165 38.739 71.856 1.00 57.85  ? 290 PHE A CG  1 
ATOM   2029 C CD1 . PHE A 1 290 ? 37.628 40.014 72.034 1.00 62.65  ? 290 PHE A CD1 1 
ATOM   2030 C CD2 . PHE A 1 290 ? 38.009 38.108 70.623 1.00 61.20  ? 290 PHE A CD2 1 
ATOM   2031 C CE1 . PHE A 1 290 ? 36.946 40.651 70.998 1.00 65.82  ? 290 PHE A CE1 1 
ATOM   2032 C CE2 . PHE A 1 290 ? 37.330 38.732 69.580 1.00 65.90  ? 290 PHE A CE2 1 
ATOM   2033 C CZ  . PHE A 1 290 ? 36.797 40.007 69.766 1.00 65.54  ? 290 PHE A CZ  1 
ATOM   2034 N N   . ARG A 1 291 ? 39.289 34.923 73.781 1.00 63.00  ? 291 ARG A N   1 
ATOM   2035 C CA  . ARG A 1 291 ? 40.164 33.920 74.400 1.00 61.61  ? 291 ARG A CA  1 
ATOM   2036 C C   . ARG A 1 291 ? 41.529 34.497 74.765 1.00 60.07  ? 291 ARG A C   1 
ATOM   2037 O O   . ARG A 1 291 ? 42.042 35.387 74.086 1.00 59.97  ? 291 ARG A O   1 
ATOM   2038 C CB  . ARG A 1 291 ? 40.399 32.746 73.449 1.00 63.11  ? 291 ARG A CB  1 
ATOM   2039 C CG  . ARG A 1 291 ? 39.245 31.818 73.314 1.00 56.97  ? 291 ARG A CG  1 
ATOM   2040 C CD  . ARG A 1 291 ? 39.377 30.957 72.085 1.00 69.21  ? 291 ARG A CD  1 
ATOM   2041 N NE  . ARG A 1 291 ? 38.178 30.138 71.943 1.00 79.09  ? 291 ARG A NE  1 
ATOM   2042 C CZ  . ARG A 1 291 ? 37.917 29.070 72.685 1.00 76.56  ? 291 ARG A CZ  1 
ATOM   2043 N NH1 . ARG A 1 291 ? 38.784 28.681 73.612 1.00 77.47  ? 291 ARG A NH1 1 
ATOM   2044 N NH2 . ARG A 1 291 ? 36.769 28.419 72.530 1.00 80.46  ? 291 ARG A NH2 1 
ATOM   2045 N N   . ASN A 1 292 ? 42.113 33.970 75.838 1.00 61.20  ? 292 ASN A N   1 
ATOM   2046 C CA  . ASN A 1 292 ? 43.435 34.382 76.299 1.00 56.84  ? 292 ASN A CA  1 
ATOM   2047 C C   . ASN A 1 292 ? 44.362 34.230 75.081 1.00 59.69  ? 292 ASN A C   1 
ATOM   2048 O O   . ASN A 1 292 ? 44.170 33.323 74.260 1.00 60.96  ? 292 ASN A O   1 
ATOM   2049 C CB  . ASN A 1 292 ? 43.878 33.445 77.420 1.00 63.50  ? 292 ASN A CB  1 
ATOM   2050 C CG  . ASN A 1 292 ? 45.056 33.967 78.187 1.00 61.19  ? 292 ASN A CG  1 
ATOM   2051 O OD1 . ASN A 1 292 ? 45.970 34.570 77.628 1.00 70.69  ? 292 ASN A OD1 1 
ATOM   2052 N ND2 . ASN A 1 292 ? 45.052 33.723 79.483 1.00 77.08  ? 292 ASN A ND2 1 
ATOM   2053 N N   . GLY A 1 293 ? 45.359 35.102 74.962 1.00 58.59  ? 293 GLY A N   1 
ATOM   2054 C CA  . GLY A 1 293 ? 46.252 35.041 73.814 1.00 61.90  ? 293 GLY A CA  1 
ATOM   2055 C C   . GLY A 1 293 ? 45.613 35.605 72.543 1.00 64.80  ? 293 GLY A C   1 
ATOM   2056 O O   . GLY A 1 293 ? 46.299 35.831 71.543 1.00 60.72  ? 293 GLY A O   1 
ATOM   2057 N N   . ASN A 1 294 ? 44.298 35.829 72.581 1.00 61.11  ? 294 ASN A N   1 
ATOM   2058 C CA  . ASN A 1 294 ? 43.560 36.378 71.442 1.00 64.69  ? 294 ASN A CA  1 
ATOM   2059 C C   . ASN A 1 294 ? 43.258 37.862 71.590 1.00 65.46  ? 294 ASN A C   1 
ATOM   2060 O O   . ASN A 1 294 ? 42.263 38.233 72.213 1.00 69.84  ? 294 ASN A O   1 
ATOM   2061 C CB  . ASN A 1 294 ? 42.235 35.645 71.267 1.00 72.19  ? 294 ASN A CB  1 
ATOM   2062 C CG  . ASN A 1 294 ? 42.358 34.432 70.390 1.00 70.20  ? 294 ASN A CG  1 
ATOM   2063 O OD1 . ASN A 1 294 ? 41.452 33.598 70.325 1.00 70.76  ? 294 ASN A OD1 1 
ATOM   2064 N ND2 . ASN A 1 294 ? 43.479 34.331 69.689 1.00 77.47  ? 294 ASN A ND2 1 
ATOM   2065 N N   . VAL A 1 295 ? 44.117 38.699 71.016 1.00 55.21  ? 295 VAL A N   1 
ATOM   2066 C CA  . VAL A 1 295 ? 43.955 40.142 71.037 1.00 52.15  ? 295 VAL A CA  1 
ATOM   2067 C C   . VAL A 1 295 ? 43.207 40.547 69.728 1.00 53.41  ? 295 VAL A C   1 
ATOM   2068 O O   . VAL A 1 295 ? 43.802 40.635 68.645 1.00 54.63  ? 295 VAL A O   1 
ATOM   2069 C CB  . VAL A 1 295 ? 45.353 40.795 71.143 1.00 57.66  ? 295 VAL A CB  1 
ATOM   2070 C CG1 . VAL A 1 295 ? 45.255 42.316 71.229 1.00 53.21  ? 295 VAL A CG1 1 
ATOM   2071 C CG2 . VAL A 1 295 ? 46.061 40.238 72.371 1.00 54.02  ? 295 VAL A CG2 1 
ATOM   2072 N N   . SER A 1 296 ? 41.894 40.759 69.856 1.00 45.19  ? 296 SER A N   1 
ATOM   2073 C CA  . SER A 1 296 ? 40.986 41.106 68.750 1.00 52.04  ? 296 SER A CA  1 
ATOM   2074 C C   . SER A 1 296 ? 41.515 41.951 67.597 1.00 47.00  ? 296 SER A C   1 
ATOM   2075 O O   . SER A 1 296 ? 41.518 41.509 66.447 1.00 46.67  ? 296 SER A O   1 
ATOM   2076 C CB  . SER A 1 296 ? 39.724 41.793 69.288 1.00 60.03  ? 296 SER A CB  1 
ATOM   2077 O OG  . SER A 1 296 ? 40.038 43.061 69.851 1.00 68.43  ? 296 SER A OG  1 
ATOM   2078 N N   . ASP A 1 297 ? 41.954 43.167 67.879 1.00 41.24  ? 297 ASP A N   1 
ATOM   2079 C CA  . ASP A 1 297 ? 42.426 44.009 66.795 1.00 44.79  ? 297 ASP A CA  1 
ATOM   2080 C C   . ASP A 1 297 ? 43.618 43.438 66.039 1.00 48.50  ? 297 ASP A C   1 
ATOM   2081 O O   . ASP A 1 297 ? 43.733 43.630 64.818 1.00 51.29  ? 297 ASP A O   1 
ATOM   2082 C CB  . ASP A 1 297 ? 42.761 45.403 67.310 1.00 43.72  ? 297 ASP A CB  1 
ATOM   2083 C CG  . ASP A 1 297 ? 43.655 45.360 68.508 1.00 54.40  ? 297 ASP A CG  1 
ATOM   2084 O OD1 . ASP A 1 297 ? 44.671 46.102 68.501 1.00 43.87  ? 297 ASP A OD1 1 
ATOM   2085 O OD2 . ASP A 1 297 ? 43.326 44.586 69.451 1.00 53.83  ? 297 ASP A OD2 1 
ATOM   2086 N N   . ILE A 1 298 ? 44.521 42.767 66.751 1.00 49.96  ? 298 ILE A N   1 
ATOM   2087 C CA  . ILE A 1 298 ? 45.674 42.168 66.089 1.00 50.23  ? 298 ILE A CA  1 
ATOM   2088 C C   . ILE A 1 298 ? 45.151 41.016 65.234 1.00 44.39  ? 298 ILE A C   1 
ATOM   2089 O O   . ILE A 1 298 ? 45.546 40.873 64.071 1.00 41.54  ? 298 ILE A O   1 
ATOM   2090 C CB  . ILE A 1 298 ? 46.732 41.676 67.114 1.00 60.79  ? 298 ILE A CB  1 
ATOM   2091 C CG1 . ILE A 1 298 ? 47.524 42.876 67.636 1.00 61.13  ? 298 ILE A CG1 1 
ATOM   2092 C CG2 . ILE A 1 298 ? 47.705 40.699 66.458 1.00 53.57  ? 298 ILE A CG2 1 
ATOM   2093 C CD1 . ILE A 1 298 ? 48.392 43.537 66.577 1.00 60.82  ? 298 ILE A CD1 1 
ATOM   2094 N N   . GLU A 1 299 ? 44.242 40.213 65.788 1.00 37.33  ? 299 GLU A N   1 
ATOM   2095 C CA  . GLU A 1 299 ? 43.677 39.131 64.990 1.00 40.95  ? 299 GLU A CA  1 
ATOM   2096 C C   . GLU A 1 299 ? 43.016 39.725 63.752 1.00 45.19  ? 299 GLU A C   1 
ATOM   2097 O O   . GLU A 1 299 ? 43.102 39.166 62.659 1.00 49.18  ? 299 GLU A O   1 
ATOM   2098 C CB  . GLU A 1 299 ? 42.623 38.365 65.761 1.00 37.24  ? 299 GLU A CB  1 
ATOM   2099 C CG  . GLU A 1 299 ? 43.138 37.623 66.967 1.00 57.07  ? 299 GLU A CG  1 
ATOM   2100 C CD  . GLU A 1 299 ? 44.143 36.537 66.610 1.00 59.99  ? 299 GLU A CD  1 
ATOM   2101 O OE1 . GLU A 1 299 ? 44.088 36.003 65.476 1.00 59.63  ? 299 GLU A OE1 1 
ATOM   2102 O OE2 . GLU A 1 299 ? 44.974 36.205 67.482 1.00 64.33  ? 299 GLU A OE2 1 
ATOM   2103 N N   . ALA A 1 300 ? 42.350 40.866 63.912 1.00 47.43  ? 300 ALA A N   1 
ATOM   2104 C CA  . ALA A 1 300 ? 41.687 41.471 62.769 1.00 41.80  ? 300 ALA A CA  1 
ATOM   2105 C C   . ALA A 1 300 ? 42.719 41.968 61.771 1.00 35.60  ? 300 ALA A C   1 
ATOM   2106 O O   . ALA A 1 300 ? 42.620 41.713 60.570 1.00 36.41  ? 300 ALA A O   1 
ATOM   2107 C CB  . ALA A 1 300 ? 40.779 42.621 63.221 1.00 37.16  ? 300 ALA A CB  1 
ATOM   2108 N N   . MET A 1 301 ? 43.707 42.704 62.263 1.00 36.84  ? 301 MET A N   1 
ATOM   2109 C CA  . MET A 1 301 ? 44.714 43.228 61.373 1.00 35.46  ? 301 MET A CA  1 
ATOM   2110 C C   . MET A 1 301 ? 45.458 42.125 60.613 1.00 45.64  ? 301 MET A C   1 
ATOM   2111 O O   . MET A 1 301 ? 45.875 42.314 59.469 1.00 46.15  ? 301 MET A O   1 
ATOM   2112 C CB  . MET A 1 301 ? 45.711 44.073 62.156 1.00 35.35  ? 301 MET A CB  1 
ATOM   2113 C CG  . MET A 1 301 ? 45.129 45.319 62.766 1.00 54.16  ? 301 MET A CG  1 
ATOM   2114 S SD  . MET A 1 301 ? 46.396 46.284 63.628 1.00 55.50  ? 301 MET A SD  1 
ATOM   2115 C CE  . MET A 1 301 ? 46.333 47.782 62.800 1.00 57.53  ? 301 MET A CE  1 
ATOM   2116 N N   . LEU A 1 302 ? 45.640 40.970 61.242 1.00 47.46  ? 302 LEU A N   1 
ATOM   2117 C CA  . LEU A 1 302 ? 46.368 39.911 60.568 1.00 51.09  ? 302 LEU A CA  1 
ATOM   2118 C C   . LEU A 1 302 ? 45.525 39.131 59.597 1.00 49.13  ? 302 LEU A C   1 
ATOM   2119 O O   . LEU A 1 302 ? 46.041 38.253 58.921 1.00 55.09  ? 302 LEU A O   1 
ATOM   2120 C CB  . LEU A 1 302 ? 46.993 38.941 61.584 1.00 45.82  ? 302 LEU A CB  1 
ATOM   2121 C CG  . LEU A 1 302 ? 48.191 39.532 62.337 1.00 50.42  ? 302 LEU A CG  1 
ATOM   2122 C CD1 . LEU A 1 302 ? 48.660 38.589 63.417 1.00 48.94  ? 302 LEU A CD1 1 
ATOM   2123 C CD2 . LEU A 1 302 ? 49.285 39.820 61.355 1.00 29.44  ? 302 LEU A CD2 1 
ATOM   2124 N N   . SER A 1 303 ? 44.231 39.419 59.514 1.00 44.67  ? 303 SER A N   1 
ATOM   2125 C CA  . SER A 1 303 ? 43.431 38.637 58.591 1.00 43.87  ? 303 SER A CA  1 
ATOM   2126 C C   . SER A 1 303 ? 42.669 39.399 57.546 1.00 48.75  ? 303 SER A C   1 
ATOM   2127 O O   . SER A 1 303 ? 42.651 40.642 57.514 1.00 45.91  ? 303 SER A O   1 
ATOM   2128 C CB  . SER A 1 303 ? 42.454 37.730 59.348 1.00 44.13  ? 303 SER A CB  1 
ATOM   2129 O OG  . SER A 1 303 ? 41.414 38.466 59.951 1.00 60.35  ? 303 SER A OG  1 
ATOM   2130 N N   . GLY A 1 304 ? 42.073 38.602 56.663 1.00 49.09  ? 304 GLY A N   1 
ATOM   2131 C CA  . GLY A 1 304 ? 41.233 39.102 55.593 1.00 45.53  ? 304 GLY A CA  1 
ATOM   2132 C C   . GLY A 1 304 ? 39.849 39.101 56.218 1.00 49.83  ? 304 GLY A C   1 
ATOM   2133 O O   . GLY A 1 304 ? 39.573 38.306 57.128 1.00 43.08  ? 304 GLY A O   1 
ATOM   2134 N N   . GLU A 1 305 ? 38.999 40.006 55.748 1.00 50.59  ? 305 GLU A N   1 
ATOM   2135 C CA  . GLU A 1 305 ? 37.660 40.162 56.277 1.00 50.74  ? 305 GLU A CA  1 
ATOM   2136 C C   . GLU A 1 305 ? 36.830 38.873 56.308 1.00 49.57  ? 305 GLU A C   1 
ATOM   2137 O O   . GLU A 1 305 ? 36.223 38.553 57.336 1.00 42.34  ? 305 GLU A O   1 
ATOM   2138 C CB  . GLU A 1 305 ? 36.938 41.264 55.498 1.00 41.83  ? 305 GLU A CB  1 
ATOM   2139 C CG  . GLU A 1 305 ? 35.432 41.244 55.668 1.00 48.87  ? 305 GLU A CG  1 
ATOM   2140 C CD  . GLU A 1 305 ? 34.765 42.526 55.187 1.00 50.96  ? 305 GLU A CD  1 
ATOM   2141 O OE1 . GLU A 1 305 ? 35.216 43.079 54.155 1.00 50.03  ? 305 GLU A OE1 1 
ATOM   2142 O OE2 . GLU A 1 305 ? 33.785 42.968 55.836 1.00 43.59  ? 305 GLU A OE2 1 
ATOM   2143 N N   . GLU A 1 306 ? 36.813 38.123 55.209 1.00 47.60  ? 306 GLU A N   1 
ATOM   2144 C CA  . GLU A 1 306 ? 36.026 36.897 55.194 1.00 49.24  ? 306 GLU A CA  1 
ATOM   2145 C C   . GLU A 1 306 ? 36.612 35.888 56.164 1.00 49.67  ? 306 GLU A C   1 
ATOM   2146 O O   . GLU A 1 306 ? 35.862 35.155 56.829 1.00 49.71  ? 306 GLU A O   1 
ATOM   2147 C CB  . GLU A 1 306 ? 35.953 36.307 53.785 1.00 44.18  ? 306 GLU A CB  1 
ATOM   2148 C CG  . GLU A 1 306 ? 35.481 37.309 52.701 1.00 62.40  ? 306 GLU A CG  1 
ATOM   2149 C CD  . GLU A 1 306 ? 34.206 38.089 53.068 1.00 73.48  ? 306 GLU A CD  1 
ATOM   2150 O OE1 . GLU A 1 306 ? 33.236 37.466 53.567 1.00 73.42  ? 306 GLU A OE1 1 
ATOM   2151 O OE2 . GLU A 1 306 ? 34.169 39.328 52.840 1.00 68.83  ? 306 GLU A OE2 1 
ATOM   2152 N N   . GLU A 1 307 ? 37.944 35.856 56.257 1.00 46.85  ? 307 GLU A N   1 
ATOM   2153 C CA  . GLU A 1 307 ? 38.617 34.934 57.176 1.00 53.44  ? 307 GLU A CA  1 
ATOM   2154 C C   . GLU A 1 307 ? 38.208 35.299 58.604 1.00 55.83  ? 307 GLU A C   1 
ATOM   2155 O O   . GLU A 1 307 ? 37.844 34.434 59.418 1.00 51.10  ? 307 GLU A O   1 
ATOM   2156 C CB  . GLU A 1 307 ? 40.132 35.071 57.088 1.00 57.27  ? 307 GLU A CB  1 
ATOM   2157 C CG  . GLU A 1 307 ? 40.784 34.786 55.757 1.00 73.55  ? 307 GLU A CG  1 
ATOM   2158 C CD  . GLU A 1 307 ? 42.319 34.951 55.833 1.00 85.30  ? 307 GLU A CD  1 
ATOM   2159 O OE1 . GLU A 1 307 ? 42.810 36.106 55.897 1.00 67.43  ? 307 GLU A OE1 1 
ATOM   2160 O OE2 . GLU A 1 307 ? 43.036 33.921 55.850 1.00 88.45  ? 307 GLU A OE2 1 
ATOM   2161 N N   . PHE A 1 308 ? 38.293 36.594 58.899 1.00 49.03  ? 308 PHE A N   1 
ATOM   2162 C CA  . PHE A 1 308 ? 37.935 37.100 60.209 1.00 47.14  ? 308 PHE A CA  1 
ATOM   2163 C C   . PHE A 1 308 ? 36.492 36.741 60.555 1.00 45.67  ? 308 PHE A C   1 
ATOM   2164 O O   . PHE A 1 308 ? 36.201 36.251 61.645 1.00 50.59  ? 308 PHE A O   1 
ATOM   2165 C CB  . PHE A 1 308 ? 38.096 38.615 60.247 1.00 48.51  ? 308 PHE A CB  1 
ATOM   2166 C CG  . PHE A 1 308 ? 38.112 39.185 61.643 1.00 50.45  ? 308 PHE A CG  1 
ATOM   2167 C CD1 . PHE A 1 308 ? 39.235 39.050 62.443 1.00 45.01  ? 308 PHE A CD1 1 
ATOM   2168 C CD2 . PHE A 1 308 ? 37.001 39.833 62.163 1.00 47.14  ? 308 PHE A CD2 1 
ATOM   2169 C CE1 . PHE A 1 308 ? 39.257 39.545 63.727 1.00 43.41  ? 308 PHE A CE1 1 
ATOM   2170 C CE2 . PHE A 1 308 ? 37.024 40.333 63.464 1.00 38.67  ? 308 PHE A CE2 1 
ATOM   2171 C CZ  . PHE A 1 308 ? 38.147 40.188 64.239 1.00 48.68  ? 308 PHE A CZ  1 
ATOM   2172 N N   . VAL A 1 309 ? 35.579 36.989 59.629 1.00 43.41  ? 309 VAL A N   1 
ATOM   2173 C CA  . VAL A 1 309 ? 34.192 36.677 59.905 1.00 49.14  ? 309 VAL A CA  1 
ATOM   2174 C C   . VAL A 1 309 ? 34.089 35.200 60.253 1.00 53.73  ? 309 VAL A C   1 
ATOM   2175 O O   . VAL A 1 309 ? 33.486 34.835 61.255 1.00 55.91  ? 309 VAL A O   1 
ATOM   2176 C CB  . VAL A 1 309 ? 33.314 37.006 58.710 1.00 44.82  ? 309 VAL A CB  1 
ATOM   2177 C CG1 . VAL A 1 309 ? 31.892 36.528 58.957 1.00 46.24  ? 309 VAL A CG1 1 
ATOM   2178 C CG2 . VAL A 1 309 ? 33.349 38.509 58.467 1.00 49.48  ? 309 VAL A CG2 1 
ATOM   2179 N N   . GLU A 1 310 ? 34.710 34.354 59.439 1.00 58.10  ? 310 GLU A N   1 
ATOM   2180 C CA  . GLU A 1 310 ? 34.679 32.920 59.682 1.00 58.02  ? 310 GLU A CA  1 
ATOM   2181 C C   . GLU A 1 310 ? 35.292 32.510 61.025 1.00 55.96  ? 310 GLU A C   1 
ATOM   2182 O O   . GLU A 1 310 ? 34.769 31.628 61.700 1.00 47.90  ? 310 GLU A O   1 
ATOM   2183 C CB  . GLU A 1 310 ? 35.394 32.192 58.549 1.00 65.99  ? 310 GLU A CB  1 
ATOM   2184 C CG  . GLU A 1 310 ? 35.762 30.762 58.882 1.00 87.34  ? 310 GLU A CG  1 
ATOM   2185 C CD  . GLU A 1 310 ? 36.446 30.060 57.728 1.00 102.13 ? 310 GLU A CD  1 
ATOM   2186 O OE1 . GLU A 1 310 ? 37.248 30.722 57.028 1.00 105.99 ? 310 GLU A OE1 1 
ATOM   2187 O OE2 . GLU A 1 310 ? 36.188 28.848 57.531 1.00 106.46 ? 310 GLU A OE2 1 
ATOM   2188 N N   . LYS A 1 311 ? 36.382 33.151 61.431 1.00 53.01  ? 311 LYS A N   1 
ATOM   2189 C CA  . LYS A 1 311 ? 37.015 32.771 62.690 1.00 56.60  ? 311 LYS A CA  1 
ATOM   2190 C C   . LYS A 1 311 ? 36.551 33.587 63.888 1.00 61.17  ? 311 LYS A C   1 
ATOM   2191 O O   . LYS A 1 311 ? 37.015 33.367 65.012 1.00 60.61  ? 311 LYS A O   1 
ATOM   2192 C CB  . LYS A 1 311 ? 38.541 32.876 62.573 1.00 55.00  ? 311 LYS A CB  1 
ATOM   2193 C CG  . LYS A 1 311 ? 39.107 34.240 62.893 1.00 47.82  ? 311 LYS A CG  1 
ATOM   2194 C CD  . LYS A 1 311 ? 40.624 34.266 62.758 1.00 53.93  ? 311 LYS A CD  1 
ATOM   2195 C CE  . LYS A 1 311 ? 41.064 34.324 61.309 1.00 69.10  ? 311 LYS A CE  1 
ATOM   2196 N NZ  . LYS A 1 311 ? 42.562 34.330 61.168 1.00 72.79  ? 311 LYS A NZ  1 
ATOM   2197 N N   . TYR A 1 312 ? 35.626 34.517 63.672 1.00 57.56  ? 312 TYR A N   1 
ATOM   2198 C CA  . TYR A 1 312 ? 35.183 35.346 64.786 1.00 54.36  ? 312 TYR A CA  1 
ATOM   2199 C C   . TYR A 1 312 ? 34.737 34.583 66.024 1.00 53.69  ? 312 TYR A C   1 
ATOM   2200 O O   . TYR A 1 312 ? 35.278 34.812 67.099 1.00 45.86  ? 312 TYR A O   1 
ATOM   2201 C CB  . TYR A 1 312 ? 34.064 36.291 64.369 1.00 53.84  ? 312 TYR A CB  1 
ATOM   2202 C CG  . TYR A 1 312 ? 33.958 37.471 65.298 1.00 51.12  ? 312 TYR A CG  1 
ATOM   2203 C CD1 . TYR A 1 312 ? 35.005 38.387 65.410 1.00 47.02  ? 312 TYR A CD1 1 
ATOM   2204 C CD2 . TYR A 1 312 ? 32.813 37.687 66.059 1.00 52.43  ? 312 TYR A CD2 1 
ATOM   2205 C CE1 . TYR A 1 312 ? 34.907 39.500 66.258 1.00 43.05  ? 312 TYR A CE1 1 
ATOM   2206 C CE2 . TYR A 1 312 ? 32.710 38.799 66.915 1.00 42.74  ? 312 TYR A CE2 1 
ATOM   2207 C CZ  . TYR A 1 312 ? 33.753 39.694 67.004 1.00 46.88  ? 312 TYR A CZ  1 
ATOM   2208 O OH  . TYR A 1 312 ? 33.636 40.791 67.826 1.00 44.20  ? 312 TYR A OH  1 
ATOM   2209 N N   . ARG A 1 313 ? 33.752 33.696 65.887 1.00 51.87  ? 313 ARG A N   1 
ATOM   2210 C CA  . ARG A 1 313 ? 33.263 32.930 67.034 1.00 59.22  ? 313 ARG A CA  1 
ATOM   2211 C C   . ARG A 1 313 ? 34.363 32.169 67.770 1.00 55.77  ? 313 ARG A C   1 
ATOM   2212 O O   . ARG A 1 313 ? 34.417 32.186 68.999 1.00 59.31  ? 313 ARG A O   1 
ATOM   2213 C CB  . ARG A 1 313 ? 32.202 31.931 66.592 1.00 66.81  ? 313 ARG A CB  1 
ATOM   2214 C CG  . ARG A 1 313 ? 30.945 32.547 66.031 1.00 74.72  ? 313 ARG A CG  1 
ATOM   2215 C CD  . ARG A 1 313 ? 30.280 31.582 65.054 1.00 88.74  ? 313 ARG A CD  1 
ATOM   2216 N NE  . ARG A 1 313 ? 28.934 32.003 64.673 1.00 100.50 ? 313 ARG A NE  1 
ATOM   2217 C CZ  . ARG A 1 313 ? 27.875 31.927 65.475 1.00 106.12 ? 313 ARG A CZ  1 
ATOM   2218 N NH1 . ARG A 1 313 ? 28.006 31.442 66.704 1.00 108.29 ? 313 ARG A NH1 1 
ATOM   2219 N NH2 . ARG A 1 313 ? 26.683 32.333 65.049 1.00 106.04 ? 313 ARG A NH2 1 
ATOM   2220 N N   . SER A 1 314 ? 35.244 31.513 67.021 1.00 60.47  ? 314 SER A N   1 
ATOM   2221 C CA  . SER A 1 314 ? 36.324 30.732 67.627 1.00 57.31  ? 314 SER A CA  1 
ATOM   2222 C C   . SER A 1 314 ? 37.331 31.584 68.372 1.00 55.27  ? 314 SER A C   1 
ATOM   2223 O O   . SER A 1 314 ? 38.156 31.062 69.120 1.00 62.37  ? 314 SER A O   1 
ATOM   2224 C CB  . SER A 1 314 ? 37.056 29.884 66.570 1.00 49.68  ? 314 SER A CB  1 
ATOM   2225 O OG  . SER A 1 314 ? 37.844 30.659 65.682 1.00 51.35  ? 314 SER A OG  1 
ATOM   2226 N N   . LEU A 1 315 ? 37.278 32.891 68.161 1.00 53.33  ? 315 LEU A N   1 
ATOM   2227 C CA  . LEU A 1 315 ? 38.193 33.799 68.843 1.00 57.63  ? 315 LEU A CA  1 
ATOM   2228 C C   . LEU A 1 315 ? 37.633 34.139 70.222 1.00 59.76  ? 315 LEU A C   1 
ATOM   2229 O O   . LEU A 1 315 ? 38.331 34.712 71.069 1.00 58.35  ? 315 LEU A O   1 
ATOM   2230 C CB  . LEU A 1 315 ? 38.348 35.089 68.042 1.00 62.69  ? 315 LEU A CB  1 
ATOM   2231 C CG  . LEU A 1 315 ? 39.053 35.036 66.693 1.00 64.72  ? 315 LEU A CG  1 
ATOM   2232 C CD1 . LEU A 1 315 ? 38.686 36.272 65.902 1.00 61.83  ? 315 LEU A CD1 1 
ATOM   2233 C CD2 . LEU A 1 315 ? 40.562 34.948 66.898 1.00 61.46  ? 315 LEU A CD2 1 
ATOM   2234 N N   . LEU A 1 316 ? 36.379 33.745 70.444 1.00 66.19  ? 316 LEU A N   1 
ATOM   2235 C CA  . LEU A 1 316 ? 35.666 34.025 71.684 1.00 70.79  ? 316 LEU A CA  1 
ATOM   2236 C C   . LEU A 1 316 ? 35.652 33.004 72.842 1.00 79.88  ? 316 LEU A C   1 
ATOM   2237 O O   . LEU A 1 316 ? 36.038 31.851 72.689 1.00 80.95  ? 316 LEU A O   1 
ATOM   2238 C CB  . LEU A 1 316 ? 34.230 34.420 71.332 1.00 63.27  ? 316 LEU A CB  1 
ATOM   2239 C CG  . LEU A 1 316 ? 34.117 35.696 70.485 1.00 61.29  ? 316 LEU A CG  1 
ATOM   2240 C CD1 . LEU A 1 316 ? 32.657 36.051 70.306 1.00 54.55  ? 316 LEU A CD1 1 
ATOM   2241 C CD2 . LEU A 1 316 ? 34.869 36.855 71.143 1.00 52.44  ? 316 LEU A CD2 1 
ATOM   2242 N N   . ASP A 1 317 ? 35.184 33.491 73.996 1.00 90.88  ? 317 ASP A N   1 
ATOM   2243 C CA  . ASP A 1 317 ? 35.055 32.788 75.285 1.00 97.62  ? 317 ASP A CA  1 
ATOM   2244 C C   . ASP A 1 317 ? 36.229 31.938 75.743 1.00 102.64 ? 317 ASP A C   1 
ATOM   2245 O O   . ASP A 1 317 ? 35.978 30.912 76.418 1.00 105.62 ? 317 ASP A O   1 
ATOM   2246 C CB  . ASP A 1 317 ? 33.770 31.942 75.340 1.00 97.41  ? 317 ASP A CB  1 
ATOM   2247 C CG  . ASP A 1 317 ? 33.790 30.772 74.388 1.00 102.93 ? 317 ASP A CG  1 
ATOM   2248 O OD1 . ASP A 1 317 ? 34.741 29.966 74.440 1.00 108.97 ? 317 ASP A OD1 1 
ATOM   2249 O OD2 . ASP A 1 317 ? 32.840 30.646 73.593 1.00 107.32 ? 317 ASP A OD2 1 
HETATM 2250 O O   . HOH B 2 .   ? 39.881 41.607 53.368 1.00 37.41  ? 331 HOH A O   1 
HETATM 2251 O O   . HOH B 2 .   ? 37.917 42.952 52.453 1.00 48.30  ? 332 HOH A O   1 
HETATM 2252 O O   . HOH B 2 .   ? 34.408 44.252 51.994 1.00 44.61  ? 333 HOH A O   1 
HETATM 2253 O O   . HOH B 2 .   ? 32.101 44.687 54.200 1.00 44.97  ? 334 HOH A O   1 
HETATM 2254 O O   . HOH B 2 .   ? 48.423 46.134 53.127 1.00 45.71  ? 335 HOH A O   1 
HETATM 2255 O O   . HOH B 2 .   ? 43.966 40.973 54.028 1.00 47.81  ? 336 HOH A O   1 
HETATM 2256 O O   . HOH B 2 .   ? 46.494 52.080 53.873 1.00 46.44  ? 337 HOH A O   1 
HETATM 2257 O O   . HOH B 2 .   ? 49.635 50.260 54.718 1.00 60.37  ? 338 HOH A O   1 
HETATM 2258 O O   . HOH B 2 .   ? 66.190 40.942 57.999 1.00 63.98  ? 339 HOH A O   1 
HETATM 2259 O O   . HOH B 2 .   ? 57.090 53.381 58.031 1.00 56.16  ? 340 HOH A O   1 
HETATM 2260 O O   . HOH B 2 .   ? 25.224 54.117 60.521 1.00 47.23  ? 341 HOH A O   1 
HETATM 2261 O O   . HOH B 2 .   ? 17.565 40.442 74.828 1.00 62.56  ? 342 HOH A O   1 
HETATM 2262 O O   . HOH B 2 .   ? 45.867 65.537 75.749 1.00 62.34  ? 343 HOH A O   1 
HETATM 2263 O O   . HOH B 2 .   ? 43.902 54.133 67.726 1.00 40.66  ? 344 HOH A O   1 
HETATM 2264 O O   . HOH B 2 .   ? 35.413 40.789 51.146 1.00 47.42  ? 345 HOH A O   1 
HETATM 2265 O O   . HOH B 2 .   ? 42.088 64.842 64.395 1.00 49.07  ? 346 HOH A O   1 
HETATM 2266 O O   . HOH B 2 .   ? 48.210 58.707 64.995 1.00 55.62  ? 347 HOH A O   1 
HETATM 2267 O O   . HOH B 2 .   ? 37.658 40.199 75.565 1.00 55.76  ? 348 HOH A O   1 
HETATM 2268 O O   . HOH B 2 .   ? 34.609 60.964 78.612 1.00 56.20  ? 349 HOH A O   1 
HETATM 2269 O O   . HOH B 2 .   ? 43.830 51.326 74.604 1.00 45.20  ? 350 HOH A O   1 
HETATM 2270 O O   . HOH B 2 .   ? 33.210 57.137 63.069 1.00 52.19  ? 351 HOH A O   1 
HETATM 2271 O O   . HOH B 2 .   ? 38.441 57.854 52.421 1.00 44.70  ? 352 HOH A O   1 
HETATM 2272 O O   . HOH B 2 .   ? 23.951 52.826 54.660 1.00 41.49  ? 353 HOH A O   1 
HETATM 2273 O O   . HOH B 2 .   ? 30.853 51.872 82.780 1.00 37.30  ? 354 HOH A O   1 
HETATM 2274 O O   . HOH B 2 .   ? 25.165 46.075 83.091 1.00 49.94  ? 355 HOH A O   1 
HETATM 2275 O O   . HOH B 2 .   ? 28.442 59.602 70.163 1.00 42.82  ? 356 HOH A O   1 
HETATM 2276 O O   . HOH B 2 .   ? 32.011 62.356 78.620 1.00 49.29  ? 357 HOH A O   1 
HETATM 2277 O O   . HOH B 2 .   ? 32.781 65.128 76.004 1.00 63.29  ? 358 HOH A O   1 
HETATM 2278 O O   . HOH B 2 .   ? 47.920 58.620 60.573 1.00 48.16  ? 359 HOH A O   1 
HETATM 2279 O O   . HOH B 2 .   ? 48.337 57.767 57.557 1.00 52.45  ? 360 HOH A O   1 
HETATM 2280 O O   . HOH B 2 .   ? 27.724 55.609 54.808 1.00 42.39  ? 361 HOH A O   1 
HETATM 2281 O O   . HOH B 2 .   ? 40.063 47.355 75.406 1.00 60.98  ? 362 HOH A O   1 
HETATM 2282 O O   . HOH B 2 .   ? 30.074 41.349 75.463 1.00 44.46  ? 363 HOH A O   1 
HETATM 2283 O O   . HOH B 2 .   ? 29.862 50.507 51.821 1.00 44.47  ? 364 HOH A O   1 
HETATM 2284 O O   . HOH B 2 .   ? 44.746 37.119 54.674 1.00 54.08  ? 365 HOH A O   1 
HETATM 2285 O O   . HOH B 2 .   ? 36.073 52.252 47.548 1.00 42.29  ? 366 HOH A O   1 
HETATM 2286 O O   . HOH B 2 .   ? 51.317 59.985 58.920 1.00 60.02  ? 367 HOH A O   1 
HETATM 2287 O O   . HOH B 2 .   ? 31.984 46.767 49.109 1.00 40.84  ? 368 HOH A O   1 
HETATM 2288 O O   . HOH B 2 .   ? 80.309 58.495 68.751 1.00 55.30  ? 369 HOH A O   1 
HETATM 2289 O O   . HOH B 2 .   ? 46.838 46.923 70.031 1.00 69.64  ? 370 HOH A O   1 
HETATM 2290 O O   . HOH B 2 .   ? 28.267 48.424 51.812 1.00 57.49  ? 371 HOH A O   1 
HETATM 2291 O O   . HOH B 2 .   ? 39.561 49.501 91.750 1.00 63.45  ? 372 HOH A O   1 
HETATM 2292 O O   . HOH B 2 .   ? 44.841 57.302 48.938 1.00 59.93  ? 373 HOH A O   1 
HETATM 2293 O O   . HOH B 2 .   ? 39.331 41.763 74.531 1.00 43.04  ? 374 HOH A O   1 
HETATM 2294 O O   . HOH B 2 .   ? 42.375 57.769 49.365 1.00 54.88  ? 375 HOH A O   1 
HETATM 2295 O O   . HOH B 2 .   ? 57.472 36.215 47.960 1.00 48.56  ? 376 HOH A O   1 
HETATM 2296 O O   . HOH B 2 .   ? 52.781 34.887 68.311 1.00 67.84  ? 377 HOH A O   1 
HETATM 2297 O O   . HOH B 2 .   ? 46.722 46.976 73.554 1.00 53.02  ? 378 HOH A O   1 
HETATM 2298 O O   . HOH B 2 .   ? 28.780 54.482 80.109 1.00 48.16  ? 379 HOH A O   1 
HETATM 2299 O O   . HOH B 2 .   ? 24.448 35.515 74.392 1.00 63.02  ? 380 HOH A O   1 
HETATM 2300 O O   . HOH B 2 .   ? 32.697 53.753 51.694 1.00 39.64  ? 381 HOH A O   1 
HETATM 2301 O O   . HOH B 2 .   ? 32.575 33.251 63.547 1.00 58.70  ? 382 HOH A O   1 
HETATM 2302 O O   . HOH B 2 .   ? 50.662 39.855 52.188 1.00 55.82  ? 383 HOH A O   1 
HETATM 2303 O O   . HOH B 2 .   ? 30.093 61.825 58.637 1.00 59.48  ? 384 HOH A O   1 
HETATM 2304 O O   . HOH B 2 .   ? 36.987 60.094 68.111 1.00 52.37  ? 385 HOH A O   1 
HETATM 2305 O O   . HOH B 2 .   ? 50.565 54.077 66.629 1.00 58.16  ? 386 HOH A O   1 
HETATM 2306 O O   . HOH B 2 .   ? 31.587 62.923 82.008 1.00 45.09  ? 387 HOH A O   1 
HETATM 2307 O O   . HOH B 2 .   ? 29.487 43.291 53.715 1.00 45.86  ? 388 HOH A O   1 
HETATM 2308 O O   . HOH B 2 .   ? 43.507 59.919 48.685 1.00 64.03  ? 389 HOH A O   1 
HETATM 2309 O O   . HOH B 2 .   ? 77.981 58.813 69.522 1.00 50.37  ? 390 HOH A O   1 
HETATM 2310 O O   . HOH B 2 .   ? 32.435 59.551 57.429 1.00 68.91  ? 391 HOH A O   1 
HETATM 2311 O O   . HOH B 2 .   ? 52.699 53.808 67.889 1.00 78.60  ? 392 HOH A O   1 
HETATM 2312 O O   . HOH B 2 .   ? 46.043 53.240 71.282 1.00 66.82  ? 393 HOH A O   1 
HETATM 2313 O O   . HOH B 2 .   ? 48.722 46.536 67.992 1.00 51.59  ? 394 HOH A O   1 
HETATM 2314 O O   . HOH B 2 .   ? 65.078 54.152 56.509 1.00 70.01  ? 395 HOH A O   1 
HETATM 2315 O O   . HOH B 2 .   ? 44.812 46.167 72.719 1.00 54.83  ? 396 HOH A O   1 
HETATM 2316 O O   . HOH B 2 .   ? 53.859 53.091 70.006 1.00 59.00  ? 397 HOH A O   1 
HETATM 2317 O O   . HOH B 2 .   ? 37.517 53.704 45.819 1.00 48.67  ? 398 HOH A O   1 
HETATM 2318 O O   . HOH B 2 .   ? 77.515 59.228 67.311 1.00 62.27  ? 399 HOH A O   1 
HETATM 2319 O O   . HOH B 2 .   ? 49.636 59.706 82.751 1.00 65.90  ? 400 HOH A O   1 
HETATM 2320 O O   . HOH B 2 .   ? 48.771 32.409 58.284 1.00 68.40  ? 401 HOH A O   1 
HETATM 2321 O O   . HOH B 2 .   ? 14.011 51.922 66.447 1.00 73.21  ? 402 HOH A O   1 
HETATM 2322 O O   . HOH B 2 .   ? 32.791 62.173 70.932 1.00 67.96  ? 403 HOH A O   1 
HETATM 2323 O O   . HOH B 2 .   ? 46.120 51.938 69.306 1.00 60.90  ? 404 HOH A O   1 
HETATM 2324 O O   . HOH B 2 .   ? 32.649 54.336 83.549 1.00 47.65  ? 405 HOH A O   1 
HETATM 2325 O O   . HOH B 2 .   ? 71.612 60.029 69.920 1.00 68.75  ? 406 HOH A O   1 
HETATM 2326 O O   . HOH B 2 .   ? 57.172 34.025 49.545 1.00 63.44  ? 407 HOH A O   1 
HETATM 2327 O O   . HOH B 2 .   ? 47.341 48.849 68.682 1.00 56.44  ? 408 HOH A O   1 
HETATM 2328 O O   . HOH B 2 .   ? 70.449 57.384 58.048 1.00 78.43  ? 409 HOH A O   1 
HETATM 2329 O O   . HOH B 2 .   ? 28.415 63.732 72.964 1.00 63.02  ? 410 HOH A O   1 
HETATM 2330 O O   . HOH B 2 .   ? 66.871 35.836 56.070 1.00 65.09  ? 411 HOH A O   1 
HETATM 2331 O O   . HOH B 2 .   ? 53.135 49.462 53.877 1.00 64.78  ? 412 HOH A O   1 
HETATM 2332 O O   . HOH B 2 .   ? 33.453 64.222 81.265 1.00 56.74  ? 413 HOH A O   1 
HETATM 2333 O O   . HOH B 2 .   ? 69.184 59.146 56.618 1.00 84.03  ? 414 HOH A O   1 
HETATM 2334 O O   . HOH B 2 .   ? 35.300 59.240 63.750 1.00 71.65  ? 415 HOH A O   1 
HETATM 2335 O O   . HOH B 2 .   ? 43.132 53.113 46.192 1.00 55.85  ? 416 HOH A O   1 
HETATM 2336 O O   . HOH B 2 .   ? 42.263 39.741 74.642 1.00 50.26  ? 417 HOH A O   1 
HETATM 2337 O O   . HOH B 2 .   ? 58.463 31.335 57.793 1.00 65.08  ? 418 HOH A O   1 
HETATM 2338 O O   . HOH B 2 .   ? 62.335 38.597 47.795 1.00 63.98  ? 419 HOH A O   1 
HETATM 2339 O O   . HOH B 2 .   ? 37.443 28.740 62.104 1.00 83.61  ? 420 HOH A O   1 
HETATM 2340 O O   . HOH B 2 .   ? 46.982 57.927 49.965 1.00 65.62  ? 421 HOH A O   1 
HETATM 2341 O O   . HOH B 2 .   ? 47.347 48.374 71.750 1.00 99.37  ? 422 HOH A O   1 
HETATM 2342 O O   . HOH B 2 .   ? 21.869 52.114 55.639 1.00 72.84  ? 423 HOH A O   1 
HETATM 2343 O O   . HOH B 2 .   ? 23.635 59.630 65.391 1.00 63.17  ? 424 HOH A O   1 
HETATM 2344 O O   . HOH B 2 .   ? 28.366 44.111 85.521 1.00 60.38  ? 425 HOH A O   1 
HETATM 2345 O O   . HOH B 2 .   ? 62.030 37.495 53.239 1.00 59.59  ? 426 HOH A O   1 
HETATM 2346 O O   . HOH B 2 .   ? 34.046 60.186 68.756 1.00 63.10  ? 427 HOH A O   1 
HETATM 2347 O O   . HOH B 2 .   ? 45.562 53.747 78.939 1.00 59.26  ? 428 HOH A O   1 
HETATM 2348 O O   . HOH B 2 .   ? 54.296 51.814 54.312 1.00 65.76  ? 429 HOH A O   1 
HETATM 2349 O O   . HOH B 2 .   ? 30.229 30.492 72.706 1.00 71.39  ? 430 HOH A O   1 
HETATM 2350 O O   . HOH B 2 .   ? 47.340 64.066 72.866 1.00 61.81  ? 431 HOH A O   1 
HETATM 2351 O O   . HOH B 2 .   ? 47.622 55.201 78.425 1.00 57.57  ? 432 HOH A O   1 
HETATM 2352 O O   . HOH B 2 .   ? 72.774 57.483 73.998 1.00 57.77  ? 433 HOH A O   1 
HETATM 2353 O O   . HOH B 2 .   ? 70.968 36.616 60.370 1.00 69.96  ? 434 HOH A O   1 
HETATM 2354 O O   . HOH B 2 .   ? 33.542 64.603 78.780 1.00 65.61  ? 435 HOH A O   1 
HETATM 2355 O O   . HOH B 2 .   ? 22.875 42.712 55.445 1.00 74.52  ? 436 HOH A O   1 
HETATM 2356 O O   . HOH B 2 .   ? 42.673 50.483 72.346 1.00 56.81  ? 437 HOH A O   1 
HETATM 2357 O O   . HOH B 2 .   ? 27.891 41.555 73.762 1.00 52.18  ? 438 HOH A O   1 
HETATM 2358 O O   . HOH B 2 .   ? 25.368 60.512 71.652 1.00 52.96  ? 439 HOH A O   1 
HETATM 2359 O O   . HOH B 2 .   ? 43.465 36.348 62.665 1.00 64.67  ? 440 HOH A O   1 
HETATM 2360 O O   . HOH B 2 .   ? 22.747 50.503 53.803 1.00 74.90  ? 441 HOH A O   1 
HETATM 2361 O O   . HOH B 2 .   ? 27.864 42.100 55.209 1.00 64.14  ? 442 HOH A O   1 
HETATM 2362 O O   . HOH B 2 .   ? 41.444 61.534 56.635 1.00 56.29  ? 443 HOH A O   1 
HETATM 2363 O O   . HOH B 2 .   ? 49.648 34.167 61.440 1.00 75.01  ? 444 HOH A O   1 
HETATM 2364 O O   . HOH B 2 .   ? 26.662 65.788 74.161 1.00 66.48  ? 445 HOH A O   1 
HETATM 2365 O O   . HOH B 2 .   ? 27.739 45.446 53.092 1.00 54.87  ? 446 HOH A O   1 
HETATM 2366 O O   . HOH B 2 .   ? 41.014 59.958 48.780 1.00 63.00  ? 447 HOH A O   1 
HETATM 2367 O O   . HOH B 2 .   ? 34.764 31.288 64.149 1.00 75.50  ? 448 HOH A O   1 
HETATM 2368 O O   . HOH B 2 .   ? 45.291 36.041 59.911 1.00 72.64  ? 449 HOH A O   1 
HETATM 2369 O O   . HOH B 2 .   ? 24.782 48.407 81.985 1.00 42.03  ? 450 HOH A O   1 
HETATM 2370 O O   . HOH B 2 .   ? 27.665 53.078 77.020 1.00 52.19  ? 451 HOH A O   1 
HETATM 2371 O O   . HOH B 2 .   ? 40.618 36.554 53.610 1.00 67.98  ? 452 HOH A O   1 
HETATM 2372 O O   . HOH B 2 .   ? 32.857 41.708 51.128 1.00 56.86  ? 453 HOH A O   1 
HETATM 2373 O O   . HOH B 2 .   ? 28.211 57.891 55.983 1.00 56.77  ? 454 HOH A O   1 
HETATM 2374 O O   . HOH B 2 .   ? 37.163 61.868 58.099 1.00 54.45  ? 455 HOH A O   1 
HETATM 2375 O O   . HOH B 2 .   ? 56.842 34.542 52.063 1.00 57.91  ? 456 HOH A O   1 
HETATM 2376 O O   . HOH B 2 .   ? 25.289 48.161 52.976 1.00 66.26  ? 457 HOH A O   1 
HETATM 2377 O O   . HOH B 2 .   ? 28.065 60.424 58.224 1.00 55.37  ? 458 HOH A O   1 
HETATM 2378 O O   . HOH B 2 .   ? 53.107 53.941 57.805 1.00 62.25  ? 459 HOH A O   1 
HETATM 2379 O O   . HOH B 2 .   ? 46.806 37.897 69.498 1.00 56.47  ? 460 HOH A O   1 
HETATM 2380 O O   . HOH B 2 .   ? 74.952 52.180 73.322 1.00 62.46  ? 461 HOH A O   1 
HETATM 2381 O O   . HOH B 2 .   ? 45.757 57.033 81.498 1.00 65.84  ? 462 HOH A O   1 
HETATM 2382 O O   . HOH B 2 .   ? 27.842 39.686 56.874 1.00 60.42  ? 463 HOH A O   1 
HETATM 2383 O O   . HOH B 2 .   ? 47.192 36.569 78.599 1.00 66.53  ? 464 HOH A O   1 
HETATM 2384 O O   . HOH B 2 .   ? 50.781 54.090 56.468 1.00 57.04  ? 465 HOH A O   1 
HETATM 2385 O O   . HOH B 2 .   ? 54.511 54.969 54.485 1.00 61.54  ? 466 HOH A O   1 
HETATM 2386 O O   . HOH B 2 .   ? 49.679 46.518 50.712 1.00 59.98  ? 467 HOH A O   1 
HETATM 2387 O O   . HOH B 2 .   ? 50.884 57.020 56.274 1.00 67.83  ? 468 HOH A O   1 
HETATM 2388 O O   . HOH B 2 .   ? 43.456 51.751 42.895 1.00 65.01  ? 469 HOH A O   1 
HETATM 2389 O O   . HOH B 2 .   ? 21.355 31.695 62.042 1.00 62.58  ? 470 HOH A O   1 
HETATM 2390 O O   . HOH B 2 .   ? 32.109 68.178 75.217 1.00 81.05  ? 471 HOH A O   1 
HETATM 2391 O O   . HOH B 2 .   ? 39.142 39.172 52.362 1.00 64.06  ? 472 HOH A O   1 
HETATM 2392 O O   . HOH B 2 .   ? 54.023 61.394 60.456 1.00 68.93  ? 473 HOH A O   1 
HETATM 2393 O O   . HOH B 2 .   ? 24.976 56.351 58.913 1.00 62.18  ? 474 HOH A O   1 
HETATM 2394 O O   . HOH B 2 .   ? 40.944 31.984 54.762 1.00 79.69  ? 475 HOH A O   1 
HETATM 2395 O O   . HOH B 2 .   ? 27.179 41.437 52.682 1.00 76.65  ? 476 HOH A O   1 
HETATM 2396 O O   . HOH B 2 .   ? 43.585 50.279 45.662 1.00 56.67  ? 477 HOH A O   1 
HETATM 2397 O O   . HOH B 2 .   ? 36.894 49.167 91.282 1.00 62.60  ? 478 HOH A O   1 
HETATM 2398 O O   . HOH B 2 .   ? 75.171 38.262 65.267 1.00 68.97  ? 479 HOH A O   1 
HETATM 2399 O O   . HOH B 2 .   ? 54.840 33.750 48.443 1.00 80.19  ? 480 HOH A O   1 
HETATM 2400 O O   . HOH B 2 .   ? 29.823 40.401 52.402 1.00 64.30  ? 481 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLY 2   2   ?   ?   ?   A . n 
A 1 3   CYS 3   3   ?   ?   ?   A . n 
A 1 4   VAL 4   4   ?   ?   ?   A . n 
A 1 5   SER 5   5   ?   ?   ?   A . n 
A 1 6   SER 6   6   ?   ?   ?   A . n 
A 1 7   LYS 7   7   ?   ?   ?   A . n 
A 1 8   SER 8   8   ?   ?   ?   A . n 
A 1 9   THR 9   9   ?   ?   ?   A . n 
A 1 10  THR 10  10  ?   ?   ?   A . n 
A 1 11  VAL 11  11  ?   ?   ?   A . n 
A 1 12  LEU 12  12  ?   ?   ?   A . n 
A 1 13  SER 13  13  ?   ?   ?   A . n 
A 1 14  PRO 14  14  ?   ?   ?   A . n 
A 1 15  GLN 15  15  ?   ?   ?   A . n 
A 1 16  THR 16  16  ?   ?   ?   A . n 
A 1 17  SER 17  17  ?   ?   ?   A . n 
A 1 18  PHE 18  18  ?   ?   ?   A . n 
A 1 19  ASN 19  19  ?   ?   ?   A . n 
A 1 20  GLU 20  20  ?   ?   ?   A . n 
A 1 21  ALA 21  21  ?   ?   ?   A . n 
A 1 22  SER 22  22  ?   ?   ?   A . n 
A 1 23  ARG 23  23  ?   ?   ?   A . n 
A 1 24  THR 24  24  ?   ?   ?   A . n 
A 1 25  SER 25  25  ?   ?   ?   A . n 
A 1 26  PHE 26  26  ?   ?   ?   A . n 
A 1 27  ARG 27  27  ?   ?   ?   A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  PRO 30  30  30  PRO PRO A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  PRO 32  32  32  PRO PRO A . n 
A 1 33  SER 33  33  33  SER SER A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  ARG 35  35  35  ARG ALA A . n 
A 1 36  GLN 36  36  36  GLN GLN A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  TYR 40  40  40  TYR ALA A . n 
A 1 41  ASP 41  41  41  ASP ASP A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  CYS 43  43  43  CYS CYS A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  TRP 50  50  50  TRP TRP A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  SER 54  54  54  SER ALA A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  LYS 56  56  56  LYS ALA A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  PRO 60  60  60  PRO PRO A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  ASN 62  62  62  ASN ASN A . n 
A 1 63  ARG 63  63  63  ARG ARG A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  TYR 65  65  65  TYR TYR A . n 
A 1 66  CYS 66  66  66  CYS CYS A . n 
A 1 67  GLN 67  67  67  GLN GLN A . n 
A 1 68  SER 68  68  68  SER SER A . n 
A 1 69  MET 69  69  69  MET MET A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  ASN 71  71  71  ASN ASN A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  ALA 76  76  76  ALA ALA A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  ILE 80  80  80  ILE ILE A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  ARG 82  82  82  ARG ARG A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  GLY 84  84  84  GLY GLY A . n 
A 1 85  ILE 85  85  85  ILE ILE A . n 
A 1 86  THR 86  86  86  THR THR A . n 
A 1 87  SER 87  87  87  SER SER A . n 
A 1 88  PHE 88  88  88  PHE PHE A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  TRP 92  92  92  TRP TRP A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  TRP 98  98  98  TRP TRP A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 SER 101 101 101 SER SER A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 GLN 104 104 104 GLN GLN A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 SER 111 111 111 SER SER A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 PHE 113 113 113 PHE PHE A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 SER 115 115 115 SER SER A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 ARG 117 117 117 ARG ARG A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 SER 119 119 119 SER SER A . n 
A 1 120 ASP 120 120 120 ASP ASP A . n 
A 1 121 THR 121 121 121 THR THR A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 THR 125 125 125 THR THR A . n 
A 1 126 PRO 126 126 126 PRO PRO A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 TYR 131 131 131 TYR TYR A . n 
A 1 132 LYS 132 132 132 LYS ALA A . n 
A 1 133 SER 133 133 133 SER SER A . n 
A 1 134 VAL 134 134 134 VAL VAL A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 VAL 138 138 138 VAL VAL A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 ASP 140 140 140 ASP ASP A . n 
A 1 141 HIS 141 141 141 HIS HIS A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 ASP 143 143 143 ASP ASP A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 HIS 145 145 145 HIS HIS A . n 
A 1 146 ASP 146 146 146 ASP ASP A . n 
A 1 147 GLU 147 147 147 GLU GLU A . n 
A 1 148 ILE 148 148 148 ILE ILE A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 GLN 150 150 150 GLN ALA A . n 
A 1 151 ASP 151 151 151 ASP ASP A . n 
A 1 152 ASN 152 152 152 ASN ASN A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 PHE 154 154 154 PHE PHE A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 ASP 156 156 156 ASP ASP A . n 
A 1 157 LEU 157 157 157 LEU LEU A . n 
A 1 158 ASN 158 158 158 ASN ASN A . n 
A 1 159 VAL 159 159 159 VAL VAL A . n 
A 1 160 LYS 160 160 160 LYS LYS A . n 
A 1 161 VAL 161 161 161 VAL VAL A . n 
A 1 162 TYR 162 162 162 TYR TYR A . n 
A 1 163 ARG 163 163 163 ARG ARG A . n 
A 1 164 GLN 164 164 164 GLN GLN A . n 
A 1 165 THR 165 165 165 THR THR A . n 
A 1 166 ALA 166 166 166 ALA ALA A . n 
A 1 167 TYR 167 167 167 TYR TYR A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 HIS 169 169 169 HIS HIS A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 ASN 171 171 171 ASN ASN A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 ILE 173 173 173 ILE ILE A . n 
A 1 174 PRO 174 174 174 PRO PRO A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 ASN 176 176 176 ASN ASN A . n 
A 1 177 THR 177 177 177 THR THR A . n 
A 1 178 PHE 178 178 178 PHE PHE A . n 
A 1 179 ARG 179 179 179 ARG ARG A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 ALA 181 181 181 ALA ALA A . n 
A 1 182 THR 182 182 182 THR THR A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 THR 184 184 184 THR THR A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 TYR 186 186 186 TYR TYR A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 ARG 188 188 188 ARG ALA A . n 
A 1 189 ASP 189 189 189 ASP ASP A . n 
A 1 190 ARG 190 190 190 ARG ARG A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 ALA 192 192 192 ALA ALA A . n 
A 1 193 HIS 193 193 193 HIS HIS A . n 
A 1 194 LEU 194 194 194 LEU LEU A . n 
A 1 195 ARG 195 195 195 ARG ARG A . n 
A 1 196 THR 196 196 196 THR THR A . n 
A 1 197 GLU 197 197 197 GLU GLU A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 ALA 200 200 200 ALA ALA A . n 
A 1 201 LYS 201 201 201 LYS ALA A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 LYS 204 204 204 LYS ALA A . n 
A 1 205 GLN 205 205 205 GLN ALA A . n 
A 1 206 HIS 206 206 206 HIS HIS A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 GLN 208 208 208 GLN ALA A . n 
A 1 209 ARG 209 209 209 ARG ARG A . n 
A 1 210 TYR 210 210 210 TYR TYR A . n 
A 1 211 ASN 211 211 211 ASN ASN A . n 
A 1 212 PRO 212 212 212 PRO PRO A . n 
A 1 213 ASP 213 213 213 ASP ASP A . n 
A 1 214 ARG 214 214 214 ARG ARG A . n 
A 1 215 ILE 215 215 215 ILE ILE A . n 
A 1 216 ASP 216 216 216 ASP ASP A . n 
A 1 217 HIS 217 217 217 HIS HIS A . n 
A 1 218 THR 218 218 218 THR THR A . n 
A 1 219 ASN 219 219 219 ASN ASN A . n 
A 1 220 ALA 220 220 220 ALA ALA A . n 
A 1 221 SER 221 221 221 SER SER A . n 
A 1 222 TYR 222 222 222 TYR TYR A . n 
A 1 223 LEU 223 223 223 LEU LEU A . n 
A 1 224 PRO 224 224 224 PRO PRO A . n 
A 1 225 ILE 225 225 225 ILE ILE A . n 
A 1 226 ILE 226 226 226 ILE ILE A . n 
A 1 227 LYS 227 227 227 LYS LYS A . n 
A 1 228 ASP 228 228 228 ASP ASP A . n 
A 1 229 HIS 229 229 229 HIS HIS A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 ASN 231 231 231 ASN ASN A . n 
A 1 232 ASP 232 232 232 ASP ASP A . n 
A 1 233 LEU 233 233 233 LEU LEU A . n 
A 1 234 TYR 234 234 234 TYR TYR A . n 
A 1 235 ARG 235 235 235 ARG ALA A . n 
A 1 236 GLN 236 236 236 GLN GLN A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 ILE 238 238 238 ILE ILE A . n 
A 1 239 SER 239 239 239 SER SER A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 ASP 241 241 241 ASP ASP A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 SER 243 243 243 SER SER A . n 
A 1 244 GLN 244 244 244 GLN GLN A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 GLU 246 246 246 GLU GLU A . n 
A 1 247 LEU 247 247 247 LEU LEU A . n 
A 1 248 ILE 248 248 248 ILE ILE A . n 
A 1 249 SER 249 249 249 SER SER A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 ILE 251 251 251 ILE ILE A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 THR 254 254 254 THR THR A . n 
A 1 255 HIS 255 255 255 HIS HIS A . n 
A 1 256 TRP 256 256 256 TRP TRP A . n 
A 1 257 TRP 257 257 257 TRP TRP A . n 
A 1 258 ALA 258 258 258 ALA ALA A . n 
A 1 259 ALA 259 259 259 ALA ALA A . n 
A 1 260 SER 260 260 260 SER SER A . n 
A 1 261 ALA 261 261 261 ALA ALA A . n 
A 1 262 MET 262 262 262 MET MET A . n 
A 1 263 PRO 263 263 263 PRO PRO A . n 
A 1 264 ASP 264 264 264 ASP ASP A . n 
A 1 265 GLN 265 265 265 GLN GLN A . n 
A 1 266 ARG 266 266 266 ARG ARG A . n 
A 1 267 GLY 267 267 267 GLY GLY A . n 
A 1 268 SER 268 268 268 SER SER A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 ALA 270 270 270 ALA ALA A . n 
A 1 271 LYS 271 271 271 LYS LYS A . n 
A 1 272 ALA 272 272 272 ALA ALA A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 PHE 274 274 274 PHE PHE A . n 
A 1 275 ALA 275 275 275 ALA ALA A . n 
A 1 276 ALA 276 276 276 ALA ALA A . n 
A 1 277 ARG 277 277 277 ARG ARG A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 ILE 279 279 279 ILE ILE A . n 
A 1 280 ALA 280 280 280 ALA ALA A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 ALA 282 282 282 ALA ALA A . n 
A 1 283 HIS 283 283 283 HIS HIS A . n 
A 1 284 GLY 284 284 284 GLY GLY A . n 
A 1 285 ILE 285 285 285 ILE ILE A . n 
A 1 286 GLU 286 286 286 GLU GLU A . n 
A 1 287 LEU 287 287 287 LEU LEU A . n 
A 1 288 PRO 288 288 288 PRO PRO A . n 
A 1 289 PRO 289 289 289 PRO PRO A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 ARG 291 291 291 ARG ARG A . n 
A 1 292 ASN 292 292 292 ASN ASN A . n 
A 1 293 GLY 293 293 293 GLY GLY A . n 
A 1 294 ASN 294 294 294 ASN ASN A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 SER 296 296 296 SER SER A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 ILE 298 298 298 ILE ILE A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 ALA 300 300 300 ALA ALA A . n 
A 1 301 MET 301 301 301 MET MET A . n 
A 1 302 LEU 302 302 302 LEU LEU A . n 
A 1 303 SER 303 303 303 SER SER A . n 
A 1 304 GLY 304 304 304 GLY GLY A . n 
A 1 305 GLU 305 305 305 GLU GLU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 GLU 307 307 307 GLU GLU A . n 
A 1 308 PHE 308 308 308 PHE PHE A . n 
A 1 309 VAL 309 309 309 VAL VAL A . n 
A 1 310 GLU 310 310 310 GLU GLU A . n 
A 1 311 LYS 311 311 311 LYS LYS A . n 
A 1 312 TYR 312 312 312 TYR TYR A . n 
A 1 313 ARG 313 313 313 ARG ARG A . n 
A 1 314 SER 314 314 314 SER SER A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 LEU 316 316 316 LEU LEU A . n 
A 1 317 ASP 317 317 317 ASP ASP A . n 
A 1 318 SER 318 318 ?   ?   ?   A . n 
A 1 319 ASP 319 319 ?   ?   ?   A . n 
A 1 320 CYS 320 320 ?   ?   ?   A . n 
A 1 321 PHE 321 321 ?   ?   ?   A . n 
A 1 322 GLY 322 322 ?   ?   ?   A . n 
A 1 323 THR 323 323 ?   ?   ?   A . n 
A 1 324 GLY 324 324 ?   ?   ?   A . n 
A 1 325 HIS 325 325 ?   ?   ?   A . n 
A 1 326 HIS 326 326 ?   ?   ?   A . n 
A 1 327 HIS 327 327 ?   ?   ?   A . n 
A 1 328 HIS 328 328 ?   ?   ?   A . n 
A 1 329 HIS 329 329 ?   ?   ?   A . n 
A 1 330 HIS 330 330 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   331 1   HOH WAT A . 
B 2 HOH 2   332 2   HOH WAT A . 
B 2 HOH 3   333 3   HOH WAT A . 
B 2 HOH 4   334 4   HOH WAT A . 
B 2 HOH 5   335 5   HOH WAT A . 
B 2 HOH 6   336 6   HOH WAT A . 
B 2 HOH 7   337 7   HOH WAT A . 
B 2 HOH 8   338 8   HOH WAT A . 
B 2 HOH 9   339 9   HOH WAT A . 
B 2 HOH 10  340 10  HOH WAT A . 
B 2 HOH 11  341 11  HOH WAT A . 
B 2 HOH 12  342 12  HOH WAT A . 
B 2 HOH 13  343 13  HOH WAT A . 
B 2 HOH 14  344 15  HOH WAT A . 
B 2 HOH 15  345 16  HOH WAT A . 
B 2 HOH 16  346 17  HOH WAT A . 
B 2 HOH 17  347 18  HOH WAT A . 
B 2 HOH 18  348 19  HOH WAT A . 
B 2 HOH 19  349 20  HOH WAT A . 
B 2 HOH 20  350 21  HOH WAT A . 
B 2 HOH 21  351 22  HOH WAT A . 
B 2 HOH 22  352 23  HOH WAT A . 
B 2 HOH 23  353 24  HOH WAT A . 
B 2 HOH 24  354 25  HOH WAT A . 
B 2 HOH 25  355 26  HOH WAT A . 
B 2 HOH 26  356 27  HOH WAT A . 
B 2 HOH 27  357 28  HOH WAT A . 
B 2 HOH 28  358 29  HOH WAT A . 
B 2 HOH 29  359 30  HOH WAT A . 
B 2 HOH 30  360 31  HOH WAT A . 
B 2 HOH 31  361 32  HOH WAT A . 
B 2 HOH 32  362 34  HOH WAT A . 
B 2 HOH 33  363 35  HOH WAT A . 
B 2 HOH 34  364 37  HOH WAT A . 
B 2 HOH 35  365 38  HOH WAT A . 
B 2 HOH 36  366 39  HOH WAT A . 
B 2 HOH 37  367 42  HOH WAT A . 
B 2 HOH 38  368 1   HOH WAT A . 
B 2 HOH 39  369 3   HOH WAT A . 
B 2 HOH 40  370 4   HOH WAT A . 
B 2 HOH 41  371 5   HOH WAT A . 
B 2 HOH 42  372 8   HOH WAT A . 
B 2 HOH 43  373 9   HOH WAT A . 
B 2 HOH 44  374 10  HOH WAT A . 
B 2 HOH 45  375 12  HOH WAT A . 
B 2 HOH 46  376 15  HOH WAT A . 
B 2 HOH 47  377 16  HOH WAT A . 
B 2 HOH 48  378 18  HOH WAT A . 
B 2 HOH 49  379 20  HOH WAT A . 
B 2 HOH 50  380 21  HOH WAT A . 
B 2 HOH 51  381 23  HOH WAT A . 
B 2 HOH 52  382 24  HOH WAT A . 
B 2 HOH 53  383 25  HOH WAT A . 
B 2 HOH 54  384 26  HOH WAT A . 
B 2 HOH 55  385 27  HOH WAT A . 
B 2 HOH 56  386 29  HOH WAT A . 
B 2 HOH 57  387 31  HOH WAT A . 
B 2 HOH 58  388 32  HOH WAT A . 
B 2 HOH 59  389 33  HOH WAT A . 
B 2 HOH 60  390 35  HOH WAT A . 
B 2 HOH 61  391 36  HOH WAT A . 
B 2 HOH 62  392 37  HOH WAT A . 
B 2 HOH 63  393 39  HOH WAT A . 
B 2 HOH 64  394 41  HOH WAT A . 
B 2 HOH 65  395 44  HOH WAT A . 
B 2 HOH 66  396 45  HOH WAT A . 
B 2 HOH 67  397 49  HOH WAT A . 
B 2 HOH 68  398 50  HOH WAT A . 
B 2 HOH 69  399 51  HOH WAT A . 
B 2 HOH 70  400 57  HOH WAT A . 
B 2 HOH 71  401 59  HOH WAT A . 
B 2 HOH 72  402 62  HOH WAT A . 
B 2 HOH 73  403 73  HOH WAT A . 
B 2 HOH 74  404 77  HOH WAT A . 
B 2 HOH 75  405 80  HOH WAT A . 
B 2 HOH 76  406 81  HOH WAT A . 
B 2 HOH 77  407 85  HOH WAT A . 
B 2 HOH 78  408 86  HOH WAT A . 
B 2 HOH 79  409 90  HOH WAT A . 
B 2 HOH 80  410 94  HOH WAT A . 
B 2 HOH 81  411 98  HOH WAT A . 
B 2 HOH 82  412 108 HOH WAT A . 
B 2 HOH 83  413 113 HOH WAT A . 
B 2 HOH 84  414 115 HOH WAT A . 
B 2 HOH 85  415 117 HOH WAT A . 
B 2 HOH 86  416 125 HOH WAT A . 
B 2 HOH 87  417 130 HOH WAT A . 
B 2 HOH 88  418 144 HOH WAT A . 
B 2 HOH 89  419 146 HOH WAT A . 
B 2 HOH 90  420 147 HOH WAT A . 
B 2 HOH 91  421 164 HOH WAT A . 
B 2 HOH 92  422 166 HOH WAT A . 
B 2 HOH 93  423 11  HOH WAT A . 
B 2 HOH 94  424 12  HOH WAT A . 
B 2 HOH 95  425 19  HOH WAT A . 
B 2 HOH 96  426 20  HOH WAT A . 
B 2 HOH 97  427 28  HOH WAT A . 
B 2 HOH 98  428 38  HOH WAT A . 
B 2 HOH 99  429 39  HOH WAT A . 
B 2 HOH 100 430 40  HOH WAT A . 
B 2 HOH 101 431 54  HOH WAT A . 
B 2 HOH 102 432 59  HOH WAT A . 
B 2 HOH 103 433 62  HOH WAT A . 
B 2 HOH 104 434 82  HOH WAT A . 
B 2 HOH 105 435 85  HOH WAT A . 
B 2 HOH 106 436 152 HOH WAT A . 
B 2 HOH 107 437 167 HOH WAT A . 
B 2 HOH 108 438 172 HOH WAT A . 
B 2 HOH 109 439 174 HOH WAT A . 
B 2 HOH 110 440 187 HOH WAT A . 
B 2 HOH 111 441 194 HOH WAT A . 
B 2 HOH 112 442 209 HOH WAT A . 
B 2 HOH 113 443 211 HOH WAT A . 
B 2 HOH 114 444 221 HOH WAT A . 
B 2 HOH 115 445 232 HOH WAT A . 
B 2 HOH 116 446 235 HOH WAT A . 
B 2 HOH 117 447 258 HOH WAT A . 
B 2 HOH 118 448 271 HOH WAT A . 
B 2 HOH 119 449 279 HOH WAT A . 
B 2 HOH 120 450 280 HOH WAT A . 
B 2 HOH 121 451 281 HOH WAT A . 
B 2 HOH 122 452 282 HOH WAT A . 
B 2 HOH 123 453 283 HOH WAT A . 
B 2 HOH 124 454 284 HOH WAT A . 
B 2 HOH 125 455 285 HOH WAT A . 
B 2 HOH 126 456 286 HOH WAT A . 
B 2 HOH 127 457 287 HOH WAT A . 
B 2 HOH 128 458 289 HOH WAT A . 
B 2 HOH 129 459 290 HOH WAT A . 
B 2 HOH 130 460 291 HOH WAT A . 
B 2 HOH 131 461 292 HOH WAT A . 
B 2 HOH 132 462 293 HOH WAT A . 
B 2 HOH 133 463 294 HOH WAT A . 
B 2 HOH 134 464 296 HOH WAT A . 
B 2 HOH 135 465 297 HOH WAT A . 
B 2 HOH 136 466 299 HOH WAT A . 
B 2 HOH 137 467 300 HOH WAT A . 
B 2 HOH 138 468 301 HOH WAT A . 
B 2 HOH 139 469 302 HOH WAT A . 
B 2 HOH 140 470 304 HOH WAT A . 
B 2 HOH 141 471 306 HOH WAT A . 
B 2 HOH 142 472 307 HOH WAT A . 
B 2 HOH 143 473 308 HOH WAT A . 
B 2 HOH 144 474 310 HOH WAT A . 
B 2 HOH 145 475 311 HOH WAT A . 
B 2 HOH 146 476 313 HOH WAT A . 
B 2 HOH 147 477 314 HOH WAT A . 
B 2 HOH 148 478 316 HOH WAT A . 
B 2 HOH 149 479 317 HOH WAT A . 
B 2 HOH 150 480 320 HOH WAT A . 
B 2 HOH 151 481 321 HOH WAT A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-03-09 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
_software.name             CNS 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     368 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     387 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_664 
_pdbx_validate_symm_contact.dist              2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 52  ? ? -71.36  -92.21  
2  1 SER A 54  ? ? -141.91 32.12   
3  1 SER A 55  ? ? -108.18 51.23   
4  1 SER A 57  ? ? -94.75  31.00   
5  1 ASN A 58  ? ? -57.57  71.23   
6  1 THR A 59  ? ? -16.97  -60.03  
7  1 PRO A 60  ? ? -32.47  -95.32  
8  1 GLU A 61  ? ? -57.14  -75.13  
9  1 GLU A 142 ? ? -38.39  -36.92  
10 1 LEU A 175 ? ? -95.74  -112.43 
11 1 ASP A 189 ? ? -69.40  -85.07  
12 1 ARG A 190 ? ? -21.63  -44.14  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 35  ? CG  ? A ARG 35  CG  
2  1 Y 1 A ARG 35  ? CD  ? A ARG 35  CD  
3  1 Y 1 A ARG 35  ? NE  ? A ARG 35  NE  
4  1 Y 1 A ARG 35  ? CZ  ? A ARG 35  CZ  
5  1 Y 1 A ARG 35  ? NH1 ? A ARG 35  NH1 
6  1 Y 1 A ARG 35  ? NH2 ? A ARG 35  NH2 
7  1 Y 1 A TYR 40  ? CG  ? A TYR 40  CG  
8  1 Y 1 A TYR 40  ? CD1 ? A TYR 40  CD1 
9  1 Y 1 A TYR 40  ? CD2 ? A TYR 40  CD2 
10 1 Y 1 A TYR 40  ? CE1 ? A TYR 40  CE1 
11 1 Y 1 A TYR 40  ? CE2 ? A TYR 40  CE2 
12 1 Y 1 A TYR 40  ? CZ  ? A TYR 40  CZ  
13 1 Y 1 A TYR 40  ? OH  ? A TYR 40  OH  
14 1 Y 1 A SER 54  ? OG  ? A SER 54  OG  
15 1 Y 1 A LYS 56  ? CG  ? A LYS 56  CG  
16 1 Y 1 A LYS 56  ? CD  ? A LYS 56  CD  
17 1 Y 1 A LYS 56  ? CE  ? A LYS 56  CE  
18 1 Y 1 A LYS 56  ? NZ  ? A LYS 56  NZ  
19 1 Y 1 A LYS 132 ? CG  ? A LYS 132 CG  
20 1 Y 1 A LYS 132 ? CD  ? A LYS 132 CD  
21 1 Y 1 A LYS 132 ? CE  ? A LYS 132 CE  
22 1 Y 1 A LYS 132 ? NZ  ? A LYS 132 NZ  
23 1 Y 1 A GLN 150 ? CG  ? A GLN 150 CG  
24 1 Y 1 A GLN 150 ? CD  ? A GLN 150 CD  
25 1 Y 1 A GLN 150 ? OE1 ? A GLN 150 OE1 
26 1 Y 1 A GLN 150 ? NE2 ? A GLN 150 NE2 
27 1 Y 1 A ARG 188 ? CG  ? A ARG 188 CG  
28 1 Y 1 A ARG 188 ? CD  ? A ARG 188 CD  
29 1 Y 1 A ARG 188 ? NE  ? A ARG 188 NE  
30 1 Y 1 A ARG 188 ? CZ  ? A ARG 188 CZ  
31 1 Y 1 A ARG 188 ? NH1 ? A ARG 188 NH1 
32 1 Y 1 A ARG 188 ? NH2 ? A ARG 188 NH2 
33 1 Y 1 A LYS 201 ? CG  ? A LYS 201 CG  
34 1 Y 1 A LYS 201 ? CD  ? A LYS 201 CD  
35 1 Y 1 A LYS 201 ? CE  ? A LYS 201 CE  
36 1 Y 1 A LYS 201 ? NZ  ? A LYS 201 NZ  
37 1 Y 1 A LYS 204 ? CG  ? A LYS 204 CG  
38 1 Y 1 A LYS 204 ? CD  ? A LYS 204 CD  
39 1 Y 1 A LYS 204 ? CE  ? A LYS 204 CE  
40 1 Y 1 A LYS 204 ? NZ  ? A LYS 204 NZ  
41 1 Y 1 A GLN 205 ? CG  ? A GLN 205 CG  
42 1 Y 1 A GLN 205 ? CD  ? A GLN 205 CD  
43 1 Y 1 A GLN 205 ? OE1 ? A GLN 205 OE1 
44 1 Y 1 A GLN 205 ? NE2 ? A GLN 205 NE2 
45 1 Y 1 A GLN 208 ? CG  ? A GLN 208 CG  
46 1 Y 1 A GLN 208 ? CD  ? A GLN 208 CD  
47 1 Y 1 A GLN 208 ? OE1 ? A GLN 208 OE1 
48 1 Y 1 A GLN 208 ? NE2 ? A GLN 208 NE2 
49 1 Y 1 A ARG 235 ? CG  ? A ARG 235 CG  
50 1 Y 1 A ARG 235 ? CD  ? A ARG 235 CD  
51 1 Y 1 A ARG 235 ? NE  ? A ARG 235 NE  
52 1 Y 1 A ARG 235 ? CZ  ? A ARG 235 CZ  
53 1 Y 1 A ARG 235 ? NH1 ? A ARG 235 NH1 
54 1 Y 1 A ARG 235 ? NH2 ? A ARG 235 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A GLY 2   ? A GLY 2   
3  1 Y 1 A CYS 3   ? A CYS 3   
4  1 Y 1 A VAL 4   ? A VAL 4   
5  1 Y 1 A SER 5   ? A SER 5   
6  1 Y 1 A SER 6   ? A SER 6   
7  1 Y 1 A LYS 7   ? A LYS 7   
8  1 Y 1 A SER 8   ? A SER 8   
9  1 Y 1 A THR 9   ? A THR 9   
10 1 Y 1 A THR 10  ? A THR 10  
11 1 Y 1 A VAL 11  ? A VAL 11  
12 1 Y 1 A LEU 12  ? A LEU 12  
13 1 Y 1 A SER 13  ? A SER 13  
14 1 Y 1 A PRO 14  ? A PRO 14  
15 1 Y 1 A GLN 15  ? A GLN 15  
16 1 Y 1 A THR 16  ? A THR 16  
17 1 Y 1 A SER 17  ? A SER 17  
18 1 Y 1 A PHE 18  ? A PHE 18  
19 1 Y 1 A ASN 19  ? A ASN 19  
20 1 Y 1 A GLU 20  ? A GLU 20  
21 1 Y 1 A ALA 21  ? A ALA 21  
22 1 Y 1 A SER 22  ? A SER 22  
23 1 Y 1 A ARG 23  ? A ARG 23  
24 1 Y 1 A THR 24  ? A THR 24  
25 1 Y 1 A SER 25  ? A SER 25  
26 1 Y 1 A PHE 26  ? A PHE 26  
27 1 Y 1 A ARG 27  ? A ARG 27  
28 1 Y 1 A SER 318 ? A SER 318 
29 1 Y 1 A ASP 319 ? A ASP 319 
30 1 Y 1 A CYS 320 ? A CYS 320 
31 1 Y 1 A PHE 321 ? A PHE 321 
32 1 Y 1 A GLY 322 ? A GLY 322 
33 1 Y 1 A THR 323 ? A THR 323 
34 1 Y 1 A GLY 324 ? A GLY 324 
35 1 Y 1 A HIS 325 ? A HIS 325 
36 1 Y 1 A HIS 326 ? A HIS 326 
37 1 Y 1 A HIS 327 ? A HIS 327 
38 1 Y 1 A HIS 328 ? A HIS 328 
39 1 Y 1 A HIS 329 ? A HIS 329 
40 1 Y 1 A HIS 330 ? A HIS 330 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#