data_1O4H
# 
_entry.id   1O4H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1O4H         
RCSB  RCSB001792   
WWPDB D_1000001792 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1O4H 
_pdbx_database_status.recvd_initial_deposition_date   2003-06-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lange, G.'  1 
'Loenze, P.' 2 
'Liesum, A.' 3 
# 
_citation.id                        primary 
_citation.title                     
;Requirements for specific binding of low affinity inhibitor fragments to the SH2 domain of (pp60)Src are identical to those for high affinity binding of full length inhibitors.
;
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            46 
_citation.page_first                5184 
_citation.page_last                 5195 
_citation.year                      2003 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14613321 
_citation.pdbx_database_id_DOI      10.1021/jm020970s 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lange, G.'       1  
primary 'Lesuisse, D.'    2  
primary 'Deprez, P.'      3  
primary 'Schoot, B.'      4  
primary 'Loenze, P.'      5  
primary 'Benard, D.'      6  
primary 'Marquette, J.P.' 7  
primary 'Broto, P.'       8  
primary 'Sarubbi, E.'     9  
primary 'Mandine, E.'     10 
# 
_cell.entry_id           1O4H 
_cell.length_a           26.201 
_cell.length_b           58.361 
_cell.length_c           63.481 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1O4H 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC' 12374.964 1   2.7.1.112 ? 'SH2 DOMAIN' ? 
2 non-polymer syn '2-CYANOQUINOLIN-8-YL DIHYDROGEN PHOSPHATE'  250.147   1   ?         ? ?            ? 
3 water       nat water                                        18.015    168 ?         ? ?            ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'P60-SRC, C-SRC' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFN
SLQQLVAYYSKHADGLCHRLTTVCPTSK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFN
SLQQLVAYYSKHADGLCHRLTTVCPTSK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ILE n 
1 3   GLN n 
1 4   ALA n 
1 5   GLU n 
1 6   GLU n 
1 7   TRP n 
1 8   TYR n 
1 9   PHE n 
1 10  GLY n 
1 11  LYS n 
1 12  ILE n 
1 13  THR n 
1 14  ARG n 
1 15  ARG n 
1 16  GLU n 
1 17  SER n 
1 18  GLU n 
1 19  ARG n 
1 20  LEU n 
1 21  LEU n 
1 22  LEU n 
1 23  ASN n 
1 24  ALA n 
1 25  GLU n 
1 26  ASN n 
1 27  PRO n 
1 28  ARG n 
1 29  GLY n 
1 30  THR n 
1 31  PHE n 
1 32  LEU n 
1 33  VAL n 
1 34  ARG n 
1 35  GLU n 
1 36  SER n 
1 37  GLU n 
1 38  THR n 
1 39  THR n 
1 40  LYS n 
1 41  GLY n 
1 42  ALA n 
1 43  TYR n 
1 44  CYS n 
1 45  LEU n 
1 46  SER n 
1 47  VAL n 
1 48  SER n 
1 49  ASP n 
1 50  PHE n 
1 51  ASP n 
1 52  ASN n 
1 53  ALA n 
1 54  LYS n 
1 55  GLY n 
1 56  LEU n 
1 57  ASN n 
1 58  VAL n 
1 59  LYS n 
1 60  HIS n 
1 61  TYR n 
1 62  LYS n 
1 63  ILE n 
1 64  ARG n 
1 65  LYS n 
1 66  LEU n 
1 67  ASP n 
1 68  SER n 
1 69  GLY n 
1 70  GLY n 
1 71  PHE n 
1 72  TYR n 
1 73  ILE n 
1 74  THR n 
1 75  SER n 
1 76  ARG n 
1 77  THR n 
1 78  GLN n 
1 79  PHE n 
1 80  ASN n 
1 81  SER n 
1 82  LEU n 
1 83  GLN n 
1 84  GLN n 
1 85  LEU n 
1 86  VAL n 
1 87  ALA n 
1 88  TYR n 
1 89  TYR n 
1 90  SER n 
1 91  LYS n 
1 92  HIS n 
1 93  ALA n 
1 94  ASP n 
1 95  GLY n 
1 96  LEU n 
1 97  CYS n 
1 98  HIS n 
1 99  ARG n 
1 100 LEU n 
1 101 THR n 
1 102 THR n 
1 103 VAL n 
1 104 CYS n 
1 105 PRO n 
1 106 THR n 
1 107 SER n 
1 108 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 SRC 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'BL21 (DE3)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SRC_HUMAN 
_struct_ref.pdbx_db_accession          P12931 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFN
SLQQLVAYYSKHADGLCHRLTTVCPTSK
;
_struct_ref.pdbx_align_begin           144 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1O4H 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 108 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P12931 
_struct_ref_seq.db_align_beg                  144 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  251 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       108 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
772 non-polymer         . '2-CYANOQUINOLIN-8-YL DIHYDROGEN PHOSPHATE' RU79072 'C10 H7 N2 O4 P' 250.147 
ALA 'L-peptide linking' y ALANINE                                     ?       'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                    ?       'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                  ?       'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                             ?       'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                    ?       'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                   ?       'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                             ?       'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                     ?       'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                   ?       'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                       ?       'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                  ?       'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                     ?       'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                      ?       'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE                               ?       'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                     ?       'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                      ?       'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                   ?       'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                  ?       'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                    ?       'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                      ?       'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1O4H 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.2 
_exptl_crystal.density_percent_sol   41.9 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 5.50' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   1999-01-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'ELLIOTT GX-21' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1O4H 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.000 
_reflns.d_resolution_high            2.25 
_reflns.number_obs                   4785 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.0 
_reflns.pdbx_Rmerge_I_obs            0.064 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        20 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.25 
_reflns_shell.d_res_low              2.30 
_reflns_shell.percent_possible_all   43.9 
_reflns_shell.Rmerge_I_obs           0.174 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    6 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1O4H 
_refine.ls_number_reflns_obs                     4785 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               1000000.000 
_refine.pdbx_data_cutoff_low_absF                0.1000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.00 
_refine.ls_d_res_high                            2.25 
_refine.ls_percent_reflns_obs                    96.0 
_refine.ls_R_factor_obs                          0.156 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.156 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               29.2 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1SHD 
_refine.pdbx_method_to_determine_struct          MR 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        856 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         17 
_refine_hist.number_atoms_solvent             168 
_refine_hist.number_atoms_total               1041 
_refine_hist.d_res_high                       2.25 
_refine_hist.d_res_low                        8.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.013 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.4   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1O4H 
_struct.title                     'CRYSTAL STRUCTURE OF SH2 IN COMPLEX WITH RU79072.' 
_struct.pdbx_descriptor           'PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC, 2-CYANOQUINOLIN-8-YL DIHYDROGEN PHOSPHATE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1O4H 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'SH2 DOMAIN FRAGMENT APPROACH, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 1  ? GLU A 5  ? SER A 1  GLU A 5  5 ? 5  
HELX_P HELX_P2 2 THR A 13 ? LEU A 22 ? THR A 13 LEU A 22 1 ? 10 
HELX_P HELX_P3 3 SER A 81 ? HIS A 92 ? SER A 81 HIS A 92 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 78  ? PHE A 79  ? GLN A 78  PHE A 79  
A 2 PHE A 71  ? TYR A 72  ? PHE A 71  TYR A 72  
A 3 GLY A 55  ? LYS A 65  ? GLY A 55  LYS A 65  
A 4 ALA A 42  ? ASP A 51  ? ALA A 42  ASP A 51  
A 5 THR A 30  ? GLU A 35  ? THR A 30  GLU A 35  
A 6 THR A 102 ? VAL A 103 ? THR A 102 VAL A 103 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 79 ? O PHE A 79 N PHE A 71  ? N PHE A 71  
A 2 3 O TYR A 72 ? O TYR A 72 N ARG A 64  ? N ARG A 64  
A 3 4 O TYR A 61 ? O TYR A 61 N LEU A 45  ? N LEU A 45  
A 4 5 O CYS A 44 ? O CYS A 44 N ARG A 34  ? N ARG A 34  
A 5 6 N PHE A 31 ? N PHE A 31 O THR A 102 ? O THR A 102 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    10 
_struct_site.details              'BINDING SITE FOR RESIDUE 772 A 300' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 ARG A 14  ? ARG A 14  . ? 1_555 ? 
2  AC1 10 ARG A 34  ? ARG A 34  . ? 1_555 ? 
3  AC1 10 SER A 36  ? SER A 36  . ? 1_555 ? 
4  AC1 10 GLU A 37  ? GLU A 37  . ? 1_555 ? 
5  AC1 10 CYS A 44  ? CYS A 44  . ? 1_555 ? 
6  AC1 10 LYS A 62  ? LYS A 62  . ? 1_555 ? 
7  AC1 10 GLN A 84  ? GLN A 84  . ? 3_655 ? 
8  AC1 10 THR A 106 ? THR A 106 . ? 1_655 ? 
9  AC1 10 HOH C .   ? HOH A 308 . ? 1_555 ? 
10 AC1 10 HOH C .   ? HOH A 468 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1O4H 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1O4H 
_atom_sites.fract_transf_matrix[1][1]   0.038166 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017135 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015753 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 1   ? 2.207  14.744 5.539  1.00 69.59  ? 1   SER A N   1 
ATOM   2    C CA  . SER A 1 1   ? 2.712  16.142 5.679  1.00 68.50  ? 1   SER A CA  1 
ATOM   3    C C   . SER A 1 1   ? 2.653  16.602 7.128  1.00 66.92  ? 1   SER A C   1 
ATOM   4    O O   . SER A 1 1   ? 1.598  16.534 7.787  1.00 66.98  ? 1   SER A O   1 
ATOM   5    C CB  . SER A 1 1   ? 1.920  17.111 4.794  1.00 69.85  ? 1   SER A CB  1 
ATOM   6    O OG  . SER A 1 1   ? 2.606  18.350 4.661  1.00 71.56  ? 1   SER A OG  1 
ATOM   7    N N   . ILE A 1 2   ? 3.788  17.126 7.584  1.00 64.23  ? 2   ILE A N   1 
ATOM   8    C CA  . ILE A 1 2   ? 3.960  17.604 8.952  1.00 61.78  ? 2   ILE A CA  1 
ATOM   9    C C   . ILE A 1 2   ? 3.060  18.787 9.276  1.00 59.33  ? 2   ILE A C   1 
ATOM   10   O O   . ILE A 1 2   ? 2.667  18.988 10.413 1.00 57.93  ? 2   ILE A O   1 
ATOM   11   C CB  . ILE A 1 2   ? 5.438  17.991 9.223  1.00 61.71  ? 2   ILE A CB  1 
ATOM   12   C CG1 . ILE A 1 2   ? 5.789  19.271 8.471  1.00 61.97  ? 2   ILE A CG1 1 
ATOM   13   C CG2 . ILE A 1 2   ? 6.381  16.868 8.749  1.00 62.22  ? 2   ILE A CG2 1 
ATOM   14   C CD1 . ILE A 1 2   ? 7.189  19.725 8.683  1.00 63.08  ? 2   ILE A CD1 1 
ATOM   15   N N   . GLN A 1 3   ? 2.704  19.548 8.255  1.00 58.91  ? 3   GLN A N   1 
ATOM   16   C CA  . GLN A 1 3   ? 1.858  20.719 8.443  1.00 58.53  ? 3   GLN A CA  1 
ATOM   17   C C   . GLN A 1 3   ? 0.460  20.324 8.893  1.00 55.61  ? 3   GLN A C   1 
ATOM   18   O O   . GLN A 1 3   ? -0.271 21.115 9.498  1.00 55.17  ? 3   GLN A O   1 
ATOM   19   C CB  . GLN A 1 3   ? 1.794  21.519 7.145  1.00 62.48  ? 3   GLN A CB  1 
ATOM   20   C CG  . GLN A 1 3   ? 3.158  21.968 6.662  1.00 67.87  ? 3   GLN A CG  1 
ATOM   21   C CD  . GLN A 1 3   ? 3.083  23.245 5.857  1.00 72.01  ? 3   GLN A CD  1 
ATOM   22   O OE1 . GLN A 1 3   ? 3.485  24.330 6.320  1.00 71.42  ? 3   GLN A OE1 1 
ATOM   23   N NE2 . GLN A 1 3   ? 2.549  23.133 4.641  1.00 74.68  ? 3   GLN A NE2 1 
ATOM   24   N N   . ALA A 1 4   ? 0.119  19.073 8.605  1.00 51.93  ? 4   ALA A N   1 
ATOM   25   C CA  . ALA A 1 4   ? -1.171 18.513 8.947  1.00 46.24  ? 4   ALA A CA  1 
ATOM   26   C C   . ALA A 1 4   ? -1.112 17.971 10.383 1.00 42.31  ? 4   ALA A C   1 
ATOM   27   O O   . ALA A 1 4   ? -2.143 17.810 11.049 1.00 42.11  ? 4   ALA A O   1 
ATOM   28   C CB  . ALA A 1 4   ? -1.501 17.395 7.950  1.00 45.80  ? 4   ALA A CB  1 
ATOM   29   N N   . GLU A 1 5   ? 0.102  17.715 10.868 1.00 36.35  ? 5   GLU A N   1 
ATOM   30   C CA  . GLU A 1 5   ? 0.290  17.180 12.218 1.00 30.95  ? 5   GLU A CA  1 
ATOM   31   C C   . GLU A 1 5   ? -0.166 18.151 13.302 1.00 26.37  ? 5   GLU A C   1 
ATOM   32   O O   . GLU A 1 5   ? 0.171  19.331 13.283 1.00 24.08  ? 5   GLU A O   1 
ATOM   33   C CB  . GLU A 1 5   ? 1.764  16.800 12.438 1.00 28.72  ? 5   GLU A CB  1 
ATOM   34   C CG  . GLU A 1 5   ? 2.335  15.882 11.363 1.00 29.46  ? 5   GLU A CG  1 
ATOM   35   C CD  . GLU A 1 5   ? 1.637  14.538 11.298 1.00 30.15  ? 5   GLU A CD  1 
ATOM   36   O OE1 . GLU A 1 5   ? 1.585  13.931 10.211 1.00 33.30  ? 5   GLU A OE1 1 
ATOM   37   O OE2 . GLU A 1 5   ? 1.135  14.084 12.332 1.00 27.96  ? 5   GLU A OE2 1 
ATOM   38   N N   . GLU A 1 6   ? -0.913 17.643 14.270 1.00 24.68  ? 6   GLU A N   1 
ATOM   39   C CA  . GLU A 1 6   ? -1.368 18.495 15.364 1.00 23.66  ? 6   GLU A CA  1 
ATOM   40   C C   . GLU A 1 6   ? -0.228 19.059 16.249 1.00 22.72  ? 6   GLU A C   1 
ATOM   41   O O   . GLU A 1 6   ? -0.422 20.072 16.927 1.00 24.98  ? 6   GLU A O   1 
ATOM   42   C CB  . GLU A 1 6   ? -2.431 17.807 16.236 1.00 21.64  ? 6   GLU A CB  1 
ATOM   43   C CG  . GLU A 1 6   ? -1.913 16.722 17.198 1.00 22.25  ? 6   GLU A CG  1 
ATOM   44   C CD  . GLU A 1 6   ? -1.637 15.399 16.502 1.00 21.57  ? 6   GLU A CD  1 
ATOM   45   O OE1 . GLU A 1 6   ? -1.152 14.447 17.167 1.00 23.86  ? 6   GLU A OE1 1 
ATOM   46   O OE2 . GLU A 1 6   ? -1.903 15.310 15.281 1.00 22.32  ? 6   GLU A OE2 1 
ATOM   47   N N   . TRP A 1 7   ? 0.939  18.412 16.295 1.00 20.37  ? 7   TRP A N   1 
ATOM   48   C CA  . TRP A 1 7   ? 2.031  18.969 17.103 1.00 18.95  ? 7   TRP A CA  1 
ATOM   49   C C   . TRP A 1 7   ? 2.884  19.912 16.279 1.00 18.76  ? 7   TRP A C   1 
ATOM   50   O O   . TRP A 1 7   ? 3.898  20.369 16.758 1.00 19.63  ? 7   TRP A O   1 
ATOM   51   C CB  . TRP A 1 7   ? 2.918  17.882 17.696 1.00 19.88  ? 7   TRP A CB  1 
ATOM   52   C CG  . TRP A 1 7   ? 2.989  16.678 16.854 1.00 20.34  ? 7   TRP A CG  1 
ATOM   53   C CD1 . TRP A 1 7   ? 2.286  15.522 17.034 1.00 21.10  ? 7   TRP A CD1 1 
ATOM   54   C CD2 . TRP A 1 7   ? 3.805  16.475 15.693 1.00 22.00  ? 7   TRP A CD2 1 
ATOM   55   N NE1 . TRP A 1 7   ? 2.619  14.610 16.067 1.00 22.58  ? 7   TRP A NE1 1 
ATOM   56   C CE2 . TRP A 1 7   ? 3.557  15.162 15.230 1.00 21.81  ? 7   TRP A CE2 1 
ATOM   57   C CE3 . TRP A 1 7   ? 4.737  17.272 14.998 1.00 22.32  ? 7   TRP A CE3 1 
ATOM   58   C CZ2 . TRP A 1 7   ? 4.204  14.616 14.103 1.00 21.92  ? 7   TRP A CZ2 1 
ATOM   59   C CZ3 . TRP A 1 7   ? 5.388  16.728 13.870 1.00 21.63  ? 7   TRP A CZ3 1 
ATOM   60   C CH2 . TRP A 1 7   ? 5.117  15.412 13.443 1.00 21.73  ? 7   TRP A CH2 1 
ATOM   61   N N   . TYR A 1 8   ? 2.516  20.136 15.018 1.00 18.41  ? 8   TYR A N   1 
ATOM   62   C CA  . TYR A 1 8   ? 3.270  21.032 14.162 1.00 20.25  ? 8   TYR A CA  1 
ATOM   63   C C   . TYR A 1 8   ? 2.696  22.454 14.195 1.00 20.41  ? 8   TYR A C   1 
ATOM   64   O O   . TYR A 1 8   ? 1.685  22.735 13.563 1.00 19.85  ? 8   TYR A O   1 
ATOM   65   C CB  . TYR A 1 8   ? 3.310  20.536 12.720 1.00 19.43  ? 8   TYR A CB  1 
ATOM   66   C CG  . TYR A 1 8   ? 4.276  21.367 11.903 1.00 22.49  ? 8   TYR A CG  1 
ATOM   67   C CD1 . TYR A 1 8   ? 5.646  21.291 12.146 1.00 23.86  ? 8   TYR A CD1 1 
ATOM   68   C CD2 . TYR A 1 8   ? 3.828  22.288 10.951 1.00 20.22  ? 8   TYR A CD2 1 
ATOM   69   C CE1 . TYR A 1 8   ? 6.547  22.116 11.475 1.00 24.06  ? 8   TYR A CE1 1 
ATOM   70   C CE2 . TYR A 1 8   ? 4.718  23.109 10.279 1.00 19.81  ? 8   TYR A CE2 1 
ATOM   71   C CZ  . TYR A 1 8   ? 6.075  23.017 10.552 1.00 23.42  ? 8   TYR A CZ  1 
ATOM   72   O OH  . TYR A 1 8   ? 6.984  23.846 9.937  1.00 27.10  ? 8   TYR A OH  1 
ATOM   73   N N   . PHE A 1 9   ? 3.370  23.347 14.912 1.00 21.38  ? 9   PHE A N   1 
ATOM   74   C CA  . PHE A 1 9   ? 2.936  24.735 15.051 1.00 21.36  ? 9   PHE A CA  1 
ATOM   75   C C   . PHE A 1 9   ? 3.520  25.688 13.986 1.00 22.56  ? 9   PHE A C   1 
ATOM   76   O O   . PHE A 1 9   ? 3.329  26.903 14.048 1.00 22.35  ? 9   PHE A O   1 
ATOM   77   C CB  . PHE A 1 9   ? 3.223  25.238 16.480 1.00 19.94  ? 9   PHE A CB  1 
ATOM   78   C CG  . PHE A 1 9   ? 2.250  24.716 17.523 1.00 20.32  ? 9   PHE A CG  1 
ATOM   79   C CD1 . PHE A 1 9   ? 2.056  23.346 17.707 1.00 20.57  ? 9   PHE A CD1 1 
ATOM   80   C CD2 . PHE A 1 9   ? 1.597  25.590 18.385 1.00 22.57  ? 9   PHE A CD2 1 
ATOM   81   C CE1 . PHE A 1 9   ? 1.242  22.850 18.744 1.00 19.10  ? 9   PHE A CE1 1 
ATOM   82   C CE2 . PHE A 1 9   ? 0.781  25.094 19.428 1.00 23.28  ? 9   PHE A CE2 1 
ATOM   83   C CZ  . PHE A 1 9   ? 0.614  23.718 19.601 1.00 18.47  ? 9   PHE A CZ  1 
ATOM   84   N N   . GLY A 1 10  ? 4.263  25.113 13.044 1.00 24.67  ? 10  GLY A N   1 
ATOM   85   C CA  . GLY A 1 10  ? 4.836  25.850 11.935 1.00 23.45  ? 10  GLY A CA  1 
ATOM   86   C C   . GLY A 1 10  ? 5.720  27.003 12.298 1.00 24.36  ? 10  GLY A C   1 
ATOM   87   O O   . GLY A 1 10  ? 6.644  26.866 13.084 1.00 26.17  ? 10  GLY A O   1 
ATOM   88   N N   . LYS A 1 11  ? 5.392  28.162 11.760 1.00 23.47  ? 11  LYS A N   1 
ATOM   89   C CA  . LYS A 1 11  ? 6.176  29.348 11.985 1.00 24.28  ? 11  LYS A CA  1 
ATOM   90   C C   . LYS A 1 11  ? 5.900  30.141 13.262 1.00 24.65  ? 11  LYS A C   1 
ATOM   91   O O   . LYS A 1 11  ? 5.219  31.168 13.218 1.00 26.30  ? 11  LYS A O   1 
ATOM   92   C CB  . LYS A 1 11  ? 6.071  30.267 10.765 1.00 25.31  ? 11  LYS A CB  1 
ATOM   93   C CG  . LYS A 1 11  ? 7.094  31.375 10.783 1.00 26.65  ? 11  LYS A CG  1 
ATOM   94   C CD  . LYS A 1 11  ? 6.992  32.191 9.541  1.00 25.17  ? 11  LYS A CD  1 
ATOM   95   C CE  . LYS A 1 11  ? 7.826  33.429 9.667  1.00 23.42  ? 11  LYS A CE  1 
ATOM   96   N NZ  . LYS A 1 11  ? 7.319  34.422 8.718  1.00 22.84  ? 11  LYS A NZ  1 
ATOM   97   N N   . ILE A 1 12  ? 6.402  29.663 14.399 1.00 23.22  ? 12  ILE A N   1 
ATOM   98   C CA  . ILE A 1 12  ? 6.256  30.391 15.648 1.00 19.52  ? 12  ILE A CA  1 
ATOM   99   C C   . ILE A 1 12  ? 7.670  30.610 16.206 1.00 18.88  ? 12  ILE A C   1 
ATOM   100  O O   . ILE A 1 12  ? 8.612  29.928 15.820 1.00 17.60  ? 12  ILE A O   1 
ATOM   101  C CB  . ILE A 1 12  ? 5.254  29.725 16.650 1.00 20.74  ? 12  ILE A CB  1 
ATOM   102  C CG1 . ILE A 1 12  ? 5.690  28.328 17.078 1.00 16.67  ? 12  ILE A CG1 1 
ATOM   103  C CG2 . ILE A 1 12  ? 3.909  29.612 15.997 1.00 20.03  ? 12  ILE A CG2 1 
ATOM   104  C CD1 . ILE A 1 12  ? 4.985  27.865 18.353 1.00 15.38  ? 12  ILE A CD1 1 
ATOM   105  N N   . THR A 1 13  ? 7.843  31.631 17.025 1.00 17.42  ? 13  THR A N   1 
ATOM   106  C CA  . THR A 1 13  ? 9.149  31.949 17.545 1.00 16.62  ? 13  THR A CA  1 
ATOM   107  C C   . THR A 1 13  ? 9.435  31.112 18.783 1.00 17.58  ? 13  THR A C   1 
ATOM   108  O O   . THR A 1 13  ? 8.532  30.521 19.345 1.00 15.95  ? 13  THR A O   1 
ATOM   109  C CB  . THR A 1 13  ? 9.249  33.494 17.916 1.00 17.45  ? 13  THR A CB  1 
ATOM   110  O OG1 . THR A 1 13  ? 8.346  33.814 18.984 1.00 17.74  ? 13  THR A OG1 1 
ATOM   111  C CG2 . THR A 1 13  ? 8.915  34.376 16.718 1.00 14.92  ? 13  THR A CG2 1 
ATOM   112  N N   . ARG A 1 14  ? 10.696 31.087 19.201 1.00 17.19  ? 14  ARG A N   1 
ATOM   113  C CA  . ARG A 1 14  ? 11.142 30.399 20.405 1.00 19.11  ? 14  ARG A CA  1 
ATOM   114  C C   . ARG A 1 14  ? 10.427 30.944 21.651 1.00 19.31  ? 14  ARG A C   1 
ATOM   115  O O   . ARG A 1 14  ? 9.993  30.158 22.495 1.00 21.58  ? 14  ARG A O   1 
ATOM   116  C CB  . ARG A 1 14  ? 12.655 30.572 20.543 1.00 18.23  ? 14  ARG A CB  1 
ATOM   117  C CG  . ARG A 1 14  ? 13.283 30.114 21.822 1.00 18.67  ? 14  ARG A CG  1 
ATOM   118  C CD  . ARG A 1 14  ? 14.528 29.377 21.428 1.00 25.51  ? 14  ARG A CD  1 
ATOM   119  N NE  . ARG A 1 14  ? 15.687 29.611 22.278 1.00 28.90  ? 14  ARG A NE  1 
ATOM   120  C CZ  . ARG A 1 14  ? 16.854 28.991 22.111 1.00 29.65  ? 14  ARG A CZ  1 
ATOM   121  N NH1 . ARG A 1 14  ? 17.865 29.260 22.919 1.00 34.21  ? 14  ARG A NH1 1 
ATOM   122  N NH2 . ARG A 1 14  ? 17.012 28.094 21.143 1.00 28.90  ? 14  ARG A NH2 1 
ATOM   123  N N   . ARG A 1 15  ? 10.271 32.272 21.748 1.00 20.50  ? 15  ARG A N   1 
ATOM   124  C CA  . ARG A 1 15  ? 9.604  32.924 22.896 1.00 19.81  ? 15  ARG A CA  1 
ATOM   125  C C   . ARG A 1 15  ? 8.160  32.494 23.042 1.00 19.71  ? 15  ARG A C   1 
ATOM   126  O O   . ARG A 1 15  ? 7.652  32.325 24.132 1.00 20.40  ? 15  ARG A O   1 
ATOM   127  C CB  . ARG A 1 15  ? 9.653  34.453 22.776 1.00 21.77  ? 15  ARG A CB  1 
ATOM   128  C CG  . ARG A 1 15  ? 8.857  35.158 23.895 1.00 25.15  ? 15  ARG A CG  1 
ATOM   129  C CD  . ARG A 1 15  ? 9.073  36.680 23.991 1.00 29.29  ? 15  ARG A CD  1 
ATOM   130  N NE  . ARG A 1 15  ? 8.471  37.230 25.215 1.00 28.34  ? 15  ARG A NE  1 
ATOM   131  C CZ  . ARG A 1 15  ? 9.145  37.493 26.341 1.00 30.36  ? 15  ARG A CZ  1 
ATOM   132  N NH1 . ARG A 1 15  ? 10.464 37.284 26.410 1.00 29.89  ? 15  ARG A NH1 1 
ATOM   133  N NH2 . ARG A 1 15  ? 8.490  37.897 27.430 1.00 30.21  ? 15  ARG A NH2 1 
ATOM   134  N N   . GLU A 1 16  ? 7.490  32.422 21.912 1.00 19.87  ? 16  GLU A N   1 
ATOM   135  C CA  . GLU A 1 16  ? 6.113  32.003 21.830 1.00 21.71  ? 16  GLU A CA  1 
ATOM   136  C C   . GLU A 1 16  ? 5.942  30.524 22.187 1.00 21.96  ? 16  GLU A C   1 
ATOM   137  O O   . GLU A 1 16  ? 4.904  30.135 22.756 1.00 20.73  ? 16  GLU A O   1 
ATOM   138  C CB  . GLU A 1 16  ? 5.609  32.245 20.404 1.00 23.38  ? 16  GLU A CB  1 
ATOM   139  C CG  . GLU A 1 16  ? 4.254  31.654 20.103 1.00 24.02  ? 16  GLU A CG  1 
ATOM   140  C CD  . GLU A 1 16  ? 3.120  32.316 20.869 1.00 27.56  ? 16  GLU A CD  1 
ATOM   141  O OE1 . GLU A 1 16  ? 1.977  31.843 20.689 1.00 29.66  ? 16  GLU A OE1 1 
ATOM   142  O OE2 . GLU A 1 16  ? 3.343  33.298 21.634 1.00 27.86  ? 16  GLU A OE2 1 
ATOM   143  N N   . SER A 1 17  ? 6.914  29.692 21.794 1.00 20.36  ? 17  SER A N   1 
ATOM   144  C CA  . SER A 1 17  ? 6.854  28.262 22.099 1.00 17.60  ? 17  SER A CA  1 
ATOM   145  C C   . SER A 1 17  ? 7.043  28.138 23.585 1.00 17.39  ? 17  SER A C   1 
ATOM   146  O O   . SER A 1 17  ? 6.441  27.271 24.212 1.00 19.38  ? 17  SER A O   1 
ATOM   147  C CB  . SER A 1 17  ? 7.911  27.464 21.333 1.00 15.83  ? 17  SER A CB  1 
ATOM   148  O OG  . SER A 1 17  ? 9.216  27.714 21.805 1.00 19.24  ? 17  SER A OG  1 
ATOM   149  N N   . GLU A 1 18  ? 7.847  29.038 24.160 1.00 16.17  ? 18  GLU A N   1 
ATOM   150  C CA  . GLU A 1 18  ? 8.059  29.053 25.614 1.00 15.97  ? 18  GLU A CA  1 
ATOM   151  C C   . GLU A 1 18  ? 6.809  29.578 26.364 1.00 15.58  ? 18  GLU A C   1 
ATOM   152  O O   . GLU A 1 18  ? 6.489  29.116 27.465 1.00 15.33  ? 18  GLU A O   1 
ATOM   153  C CB  . GLU A 1 18  ? 9.303  29.868 25.971 1.00 15.32  ? 18  GLU A CB  1 
ATOM   154  C CG  . GLU A 1 18  ? 10.631 29.147 25.635 1.00 18.79  ? 18  GLU A CG  1 
ATOM   155  C CD  . GLU A 1 18  ? 11.868 30.048 25.700 1.00 17.84  ? 18  GLU A CD  1 
ATOM   156  O OE1 . GLU A 1 18  ? 12.990 29.560 25.490 1.00 16.95  ? 18  GLU A OE1 1 
ATOM   157  O OE2 . GLU A 1 18  ? 11.729 31.256 25.941 1.00 22.30  ? 18  GLU A OE2 1 
ATOM   158  N N   . ARG A 1 19  ? 6.098  30.522 25.753 1.00 15.23  ? 19  ARG A N   1 
ATOM   159  C CA  . ARG A 1 19  ? 4.890  31.050 26.343 1.00 17.40  ? 19  ARG A CA  1 
ATOM   160  C C   . ARG A 1 19  ? 3.841  29.945 26.422 1.00 17.75  ? 19  ARG A C   1 
ATOM   161  O O   . ARG A 1 19  ? 3.141  29.804 27.415 1.00 19.72  ? 19  ARG A O   1 
ATOM   162  C CB  . ARG A 1 19  ? 4.317  32.199 25.512 1.00 18.95  ? 19  ARG A CB  1 
ATOM   163  C CG  . ARG A 1 19  ? 3.237  32.968 26.293 1.00 22.17  ? 19  ARG A CG  1 
ATOM   164  C CD  . ARG A 1 19  ? 2.546  34.008 25.431 1.00 25.60  ? 19  ARG A CD  1 
ATOM   165  N NE  . ARG A 1 19  ? 1.919  33.414 24.255 1.00 28.54  ? 19  ARG A NE  1 
ATOM   166  C CZ  . ARG A 1 19  ? 0.723  32.838 24.252 1.00 29.29  ? 19  ARG A CZ  1 
ATOM   167  N NH1 . ARG A 1 19  ? 0.001  32.781 25.365 1.00 31.14  ? 19  ARG A NH1 1 
ATOM   168  N NH2 . ARG A 1 19  ? 0.277  32.262 23.147 1.00 30.62  ? 19  ARG A NH2 1 
ATOM   169  N N   . LEU A 1 20  ? 3.710  29.175 25.357 1.00 19.27  ? 20  LEU A N   1 
ATOM   170  C CA  . LEU A 1 20  ? 2.735  28.096 25.330 1.00 18.92  ? 20  LEU A CA  1 
ATOM   171  C C   . LEU A 1 20  ? 3.100  26.951 26.269 1.00 18.67  ? 20  LEU A C   1 
ATOM   172  O O   . LEU A 1 20  ? 2.238  26.442 26.970 1.00 19.34  ? 20  LEU A O   1 
ATOM   173  C CB  . LEU A 1 20  ? 2.585  27.561 23.910 1.00 19.09  ? 20  LEU A CB  1 
ATOM   174  C CG  . LEU A 1 20  ? 1.926  28.462 22.859 1.00 19.31  ? 20  LEU A CG  1 
ATOM   175  C CD1 . LEU A 1 20  ? 2.142  27.854 21.473 1.00 15.20  ? 20  LEU A CD1 1 
ATOM   176  C CD2 . LEU A 1 20  ? 0.437  28.629 23.185 1.00 19.27  ? 20  LEU A CD2 1 
ATOM   177  N N   . LEU A 1 21  ? 4.388  26.616 26.357 1.00 19.11  ? 21  LEU A N   1 
ATOM   178  C CA  . LEU A 1 21  ? 4.837  25.491 27.176 1.00 17.35  ? 21  LEU A CA  1 
ATOM   179  C C   . LEU A 1 21  ? 5.044  25.787 28.657 1.00 19.03  ? 21  LEU A C   1 
ATOM   180  O O   . LEU A 1 21  ? 4.949  24.891 29.479 1.00 18.26  ? 21  LEU A O   1 
ATOM   181  C CB  . LEU A 1 21  ? 6.082  24.835 26.543 1.00 16.12  ? 21  LEU A CB  1 
ATOM   182  C CG  . LEU A 1 21  ? 5.911  24.291 25.105 1.00 15.51  ? 21  LEU A CG  1 
ATOM   183  C CD1 . LEU A 1 21  ? 7.231  24.200 24.373 1.00 13.25  ? 21  LEU A CD1 1 
ATOM   184  C CD2 . LEU A 1 21  ? 5.231  22.938 25.132 1.00 12.83  ? 21  LEU A CD2 1 
ATOM   185  N N   . LEU A 1 22  ? 5.254  27.051 29.014 1.00 21.11  ? 22  LEU A N   1 
ATOM   186  C CA  . LEU A 1 22  ? 5.456  27.398 30.410 1.00 22.20  ? 22  LEU A CA  1 
ATOM   187  C C   . LEU A 1 22  ? 4.113  27.599 31.071 1.00 23.32  ? 22  LEU A C   1 
ATOM   188  O O   . LEU A 1 22  ? 3.783  28.683 31.552 1.00 25.63  ? 22  LEU A O   1 
ATOM   189  C CB  . LEU A 1 22  ? 6.319  28.654 30.534 1.00 24.20  ? 22  LEU A CB  1 
ATOM   190  C CG  . LEU A 1 22  ? 7.833  28.491 30.362 1.00 27.27  ? 22  LEU A CG  1 
ATOM   191  C CD1 . LEU A 1 22  ? 8.498  29.846 30.025 1.00 26.49  ? 22  LEU A CD1 1 
ATOM   192  C CD2 . LEU A 1 22  ? 8.433  27.855 31.617 1.00 25.88  ? 22  LEU A CD2 1 
ATOM   193  N N   . ASN A 1 23  ? 3.288  26.577 31.011 1.00 23.04  ? 23  ASN A N   1 
ATOM   194  C CA  . ASN A 1 23  ? 1.995  26.663 31.644 1.00 22.45  ? 23  ASN A CA  1 
ATOM   195  C C   . ASN A 1 23  ? 2.020  25.631 32.769 1.00 21.20  ? 23  ASN A C   1 
ATOM   196  O O   . ASN A 1 23  ? 2.470  24.498 32.555 1.00 19.69  ? 23  ASN A O   1 
ATOM   197  C CB  . ASN A 1 23  ? 0.907  26.389 30.636 1.00 24.93  ? 23  ASN A CB  1 
ATOM   198  C CG  . ASN A 1 23  ? -0.439 26.352 31.271 1.00 31.14  ? 23  ASN A CG  1 
ATOM   199  O OD1 . ASN A 1 23  ? -0.617 25.777 32.351 1.00 31.96  ? 23  ASN A OD1 1 
ATOM   200  N ND2 . ASN A 1 23  ? -1.408 26.985 30.627 1.00 35.95  ? 23  ASN A ND2 1 
ATOM   201  N N   . ALA A 1 24  ? 1.570  26.024 33.963 1.00 19.96  ? 24  ALA A N   1 
ATOM   202  C CA  . ALA A 1 24  ? 1.611  25.148 35.150 1.00 20.54  ? 24  ALA A CA  1 
ATOM   203  C C   . ALA A 1 24  ? 0.982  23.776 34.997 1.00 20.15  ? 24  ALA A C   1 
ATOM   204  O O   . ALA A 1 24  ? 1.313  22.845 35.711 1.00 21.44  ? 24  ALA A O   1 
ATOM   205  C CB  . ALA A 1 24  ? 1.008  25.852 36.361 1.00 19.72  ? 24  ALA A CB  1 
ATOM   206  N N   . GLU A 1 25  ? 0.039  23.675 34.090 1.00 20.13  ? 25  GLU A N   1 
ATOM   207  C CA  . GLU A 1 25  ? -0.653 22.438 33.843 1.00 22.83  ? 25  GLU A CA  1 
ATOM   208  C C   . GLU A 1 25  ? 0.019  21.450 32.890 1.00 21.91  ? 25  GLU A C   1 
ATOM   209  O O   . GLU A 1 25  ? -0.382 20.301 32.830 1.00 22.39  ? 25  GLU A O   1 
ATOM   210  C CB  . GLU A 1 25  ? -2.040 22.775 33.370 1.00 25.32  ? 25  GLU A CB  1 
ATOM   211  C CG  . GLU A 1 25  ? -2.789 23.424 34.473 1.00 31.47  ? 25  GLU A CG  1 
ATOM   212  C CD  . GLU A 1 25  ? -3.990 24.153 33.985 1.00 36.20  ? 25  GLU A CD  1 
ATOM   213  O OE1 . GLU A 1 25  ? -4.187 25.306 34.444 1.00 40.11  ? 25  GLU A OE1 1 
ATOM   214  O OE2 . GLU A 1 25  ? -4.721 23.580 33.138 1.00 38.40  ? 25  GLU A OE2 1 
ATOM   215  N N   . ASN A 1 26  ? 1.006  21.901 32.129 1.00 20.44  ? 26  ASN A N   1 
ATOM   216  C CA  . ASN A 1 26  ? 1.741  21.026 31.210 1.00 20.72  ? 26  ASN A CA  1 
ATOM   217  C C   . ASN A 1 26  ? 2.631  20.023 31.990 1.00 20.49  ? 26  ASN A C   1 
ATOM   218  O O   . ASN A 1 26  ? 3.342  20.403 32.929 1.00 20.19  ? 26  ASN A O   1 
ATOM   219  C CB  . ASN A 1 26  ? 2.631  21.866 30.292 1.00 16.63  ? 26  ASN A CB  1 
ATOM   220  C CG  . ASN A 1 26  ? 1.827  22.736 29.332 1.00 20.49  ? 26  ASN A CG  1 
ATOM   221  O OD1 . ASN A 1 26  ? 0.655  22.447 29.050 1.00 19.90  ? 26  ASN A OD1 1 
ATOM   222  N ND2 . ASN A 1 26  ? 2.467  23.770 28.776 1.00 16.79  ? 26  ASN A ND2 1 
ATOM   223  N N   . PRO A 1 27  ? 2.500  18.717 31.710 1.00 19.99  ? 27  PRO A N   1 
ATOM   224  C CA  . PRO A 1 27  ? 3.376  17.812 32.470 1.00 18.36  ? 27  PRO A CA  1 
ATOM   225  C C   . PRO A 1 27  ? 4.717  17.758 31.722 1.00 16.64  ? 27  PRO A C   1 
ATOM   226  O O   . PRO A 1 27  ? 4.801  18.260 30.599 1.00 19.17  ? 27  PRO A O   1 
ATOM   227  C CB  . PRO A 1 27  ? 2.614  16.480 32.439 1.00 16.53  ? 27  PRO A CB  1 
ATOM   228  C CG  . PRO A 1 27  ? 1.893  16.529 31.125 1.00 19.38  ? 27  PRO A CG  1 
ATOM   229  C CD  . PRO A 1 27  ? 1.434  17.976 30.986 1.00 19.87  ? 27  PRO A CD  1 
ATOM   230  N N   . ARG A 1 28  ? 5.757  17.193 32.322 1.00 15.42  ? 28  ARG A N   1 
ATOM   231  C CA  . ARG A 1 28  ? 7.052  17.096 31.643 1.00 16.22  ? 28  ARG A CA  1 
ATOM   232  C C   . ARG A 1 28  ? 6.882  16.364 30.299 1.00 15.86  ? 28  ARG A C   1 
ATOM   233  O O   . ARG A 1 28  ? 6.115  15.372 30.206 1.00 17.14  ? 28  ARG A O   1 
ATOM   234  C CB  . ARG A 1 28  ? 8.053  16.336 32.507 1.00 16.80  ? 28  ARG A CB  1 
ATOM   235  C CG  . ARG A 1 28  ? 8.147  16.805 33.931 1.00 20.04  ? 28  ARG A CG  1 
ATOM   236  C CD  . ARG A 1 28  ? 9.055  15.886 34.744 1.00 22.94  ? 28  ARG A CD  1 
ATOM   237  N NE  . ARG A 1 28  ? 10.438 15.940 34.249 1.00 33.07  ? 28  ARG A NE  1 
ATOM   238  C CZ  . ARG A 1 28  ? 11.394 15.043 34.522 1.00 33.41  ? 28  ARG A CZ  1 
ATOM   239  N NH1 . ARG A 1 28  ? 11.114 14.002 35.300 1.00 35.77  ? 28  ARG A NH1 1 
ATOM   240  N NH2 . ARG A 1 28  ? 12.632 15.196 34.042 1.00 30.68  ? 28  ARG A NH2 1 
ATOM   241  N N   . GLY A 1 29  ? 7.538  16.869 29.258 1.00 13.33  ? 29  GLY A N   1 
ATOM   242  C CA  . GLY A 1 29  ? 7.439  16.226 27.966 1.00 10.95  ? 29  GLY A CA  1 
ATOM   243  C C   . GLY A 1 29  ? 6.368  16.758 27.055 1.00 13.39  ? 29  GLY A C   1 
ATOM   244  O O   . GLY A 1 29  ? 6.059  16.129 26.055 1.00 13.62  ? 29  GLY A O   1 
ATOM   245  N N   . THR A 1 30  ? 5.712  17.848 27.448 1.00 14.94  ? 30  THR A N   1 
ATOM   246  C CA  . THR A 1 30  ? 4.700  18.490 26.588 1.00 15.83  ? 30  THR A CA  1 
ATOM   247  C C   . THR A 1 30  ? 5.586  19.064 25.477 1.00 15.64  ? 30  THR A C   1 
ATOM   248  O O   . THR A 1 30  ? 6.698  19.535 25.742 1.00 16.51  ? 30  THR A O   1 
ATOM   249  C CB  . THR A 1 30  ? 3.896  19.602 27.353 1.00 15.21  ? 30  THR A CB  1 
ATOM   250  O OG1 . THR A 1 30  ? 3.178  18.994 28.438 1.00 13.75  ? 30  THR A OG1 1 
ATOM   251  C CG2 . THR A 1 30  ? 2.919  20.312 26.435 1.00 12.03  ? 30  THR A CG2 1 
ATOM   252  N N   . PHE A 1 31  ? 5.125  19.039 24.238 1.00 15.86  ? 31  PHE A N   1 
ATOM   253  C CA  . PHE A 1 31  ? 6.011  19.463 23.173 1.00 14.12  ? 31  PHE A CA  1 
ATOM   254  C C   . PHE A 1 31  ? 5.283  20.004 21.953 1.00 14.80  ? 31  PHE A C   1 
ATOM   255  O O   . PHE A 1 31  ? 4.048  19.941 21.845 1.00 11.44  ? 31  PHE A O   1 
ATOM   256  C CB  . PHE A 1 31  ? 6.878  18.239 22.751 1.00 13.78  ? 31  PHE A CB  1 
ATOM   257  C CG  . PHE A 1 31  ? 6.112  17.196 21.942 1.00 15.21  ? 31  PHE A CG  1 
ATOM   258  C CD1 . PHE A 1 31  ? 6.201  17.174 20.529 1.00 14.87  ? 31  PHE A CD1 1 
ATOM   259  C CD2 . PHE A 1 31  ? 5.199  16.327 22.565 1.00 14.66  ? 31  PHE A CD2 1 
ATOM   260  C CE1 . PHE A 1 31  ? 5.380  16.311 19.750 1.00 14.71  ? 31  PHE A CE1 1 
ATOM   261  C CE2 . PHE A 1 31  ? 4.375  15.461 21.807 1.00 13.19  ? 31  PHE A CE2 1 
ATOM   262  C CZ  . PHE A 1 31  ? 4.462  15.455 20.395 1.00 13.97  ? 31  PHE A CZ  1 
ATOM   263  N N   . LEU A 1 32  ? 6.081  20.531 21.030 1.00 14.45  ? 32  LEU A N   1 
ATOM   264  C CA  . LEU A 1 32  ? 5.589  21.037 19.766 1.00 14.49  ? 32  LEU A CA  1 
ATOM   265  C C   . LEU A 1 32  ? 6.807  21.065 18.842 1.00 13.87  ? 32  LEU A C   1 
ATOM   266  O O   . LEU A 1 32  ? 7.944  20.939 19.310 1.00 14.31  ? 32  LEU A O   1 
ATOM   267  C CB  . LEU A 1 32  ? 4.968  22.435 19.929 1.00 12.14  ? 32  LEU A CB  1 
ATOM   268  C CG  . LEU A 1 32  ? 5.808  23.644 20.337 1.00 12.57  ? 32  LEU A CG  1 
ATOM   269  C CD1 . LEU A 1 32  ? 6.382  24.285 19.127 1.00 13.42  ? 32  LEU A CD1 1 
ATOM   270  C CD2 . LEU A 1 32  ? 4.959  24.665 21.052 1.00 14.10  ? 32  LEU A CD2 1 
ATOM   271  N N   . VAL A 1 33  ? 6.542  21.089 17.540 1.00 14.61  ? 33  VAL A N   1 
ATOM   272  C CA  . VAL A 1 33  ? 7.564  21.180 16.496 1.00 13.10  ? 33  VAL A CA  1 
ATOM   273  C C   . VAL A 1 33  ? 7.256  22.479 15.747 1.00 13.39  ? 33  VAL A C   1 
ATOM   274  O O   . VAL A 1 33  ? 6.099  22.835 15.503 1.00 15.91  ? 33  VAL A O   1 
ATOM   275  C CB  . VAL A 1 33  ? 7.536  19.943 15.530 1.00 11.71  ? 33  VAL A CB  1 
ATOM   276  C CG1 . VAL A 1 33  ? 8.488  20.150 14.369 1.00 12.55  ? 33  VAL A CG1 1 
ATOM   277  C CG2 . VAL A 1 33  ? 7.919  18.620 16.307 1.00 7.81   ? 33  VAL A CG2 1 
ATOM   278  N N   . ARG A 1 34  ? 8.283  23.258 15.491 1.00 15.23  ? 34  ARG A N   1 
ATOM   279  C CA  . ARG A 1 34  ? 8.124  24.516 14.790 1.00 15.99  ? 34  ARG A CA  1 
ATOM   280  C C   . ARG A 1 34  ? 9.334  24.711 13.872 1.00 16.51  ? 34  ARG A C   1 
ATOM   281  O O   . ARG A 1 34  ? 10.204 23.842 13.759 1.00 16.60  ? 34  ARG A O   1 
ATOM   282  C CB  . ARG A 1 34  ? 8.047  25.666 15.802 1.00 15.60  ? 34  ARG A CB  1 
ATOM   283  C CG  . ARG A 1 34  ? 9.295  25.740 16.697 1.00 16.21  ? 34  ARG A CG  1 
ATOM   284  C CD  . ARG A 1 34  ? 9.150  26.739 17.782 1.00 13.41  ? 34  ARG A CD  1 
ATOM   285  N NE  . ARG A 1 34  ? 10.307 26.727 18.680 1.00 15.48  ? 34  ARG A NE  1 
ATOM   286  C CZ  . ARG A 1 34  ? 11.494 27.273 18.403 1.00 11.94  ? 34  ARG A CZ  1 
ATOM   287  N NH1 . ARG A 1 34  ? 12.463 27.225 19.307 1.00 9.44   ? 34  ARG A NH1 1 
ATOM   288  N NH2 . ARG A 1 34  ? 11.731 27.816 17.215 1.00 9.56   ? 34  ARG A NH2 1 
ATOM   289  N N   . GLU A 1 35  ? 9.324  25.816 13.145 1.00 18.07  ? 35  GLU A N   1 
ATOM   290  C CA  . GLU A 1 35  ? 10.421 26.159 12.280 1.00 20.33  ? 35  GLU A CA  1 
ATOM   291  C C   . GLU A 1 35  ? 11.529 26.711 13.178 1.00 20.02  ? 35  GLU A C   1 
ATOM   292  O O   . GLU A 1 35  ? 11.295 27.240 14.277 1.00 19.12  ? 35  GLU A O   1 
ATOM   293  C CB  . GLU A 1 35  ? 10.012 27.271 11.324 1.00 23.58  ? 35  GLU A CB  1 
ATOM   294  C CG  . GLU A 1 35  ? 9.339  26.836 10.057 1.00 29.18  ? 35  GLU A CG  1 
ATOM   295  C CD  . GLU A 1 35  ? 8.823  28.029 9.250  1.00 33.47  ? 35  GLU A CD  1 
ATOM   296  O OE1 . GLU A 1 35  ? 7.689  27.951 8.728  1.00 37.22  ? 35  GLU A OE1 1 
ATOM   297  O OE2 . GLU A 1 35  ? 9.533  29.057 9.145  1.00 36.30  ? 35  GLU A OE2 1 
ATOM   298  N N   . SER A 1 36  ? 12.749 26.525 12.720 1.00 20.68  ? 36  SER A N   1 
ATOM   299  C CA  . SER A 1 36  ? 13.895 27.062 13.399 1.00 19.96  ? 36  SER A CA  1 
ATOM   300  C C   . SER A 1 36  ? 13.858 28.541 13.013 1.00 20.74  ? 36  SER A C   1 
ATOM   301  O O   . SER A 1 36  ? 13.505 28.900 11.884 1.00 18.12  ? 36  SER A O   1 
ATOM   302  C CB  . SER A 1 36  ? 15.148 26.419 12.832 1.00 20.23  ? 36  SER A CB  1 
ATOM   303  O OG  . SER A 1 36  ? 16.289 27.094 13.282 1.00 22.01  ? 36  SER A OG  1 
ATOM   304  N N   . GLU A 1 37  ? 14.112 29.415 13.968 1.00 24.42  ? 37  GLU A N   1 
ATOM   305  C CA  . GLU A 1 37  ? 14.129 30.831 13.651 1.00 27.63  ? 37  GLU A CA  1 
ATOM   306  C C   . GLU A 1 37  ? 15.339 31.180 12.735 1.00 32.75  ? 37  GLU A C   1 
ATOM   307  O O   . GLU A 1 37  ? 15.208 31.966 11.784 1.00 33.78  ? 37  GLU A O   1 
ATOM   308  C CB  . GLU A 1 37  ? 14.236 31.643 14.934 1.00 24.85  ? 37  GLU A CB  1 
ATOM   309  C CG  . GLU A 1 37  ? 13.015 31.691 15.820 1.00 20.68  ? 37  GLU A CG  1 
ATOM   310  C CD  . GLU A 1 37  ? 13.247 32.651 16.958 1.00 20.35  ? 37  GLU A CD  1 
ATOM   311  O OE1 . GLU A 1 37  ? 14.355 33.210 17.002 1.00 20.31  ? 37  GLU A OE1 1 
ATOM   312  O OE2 . GLU A 1 37  ? 12.353 32.879 17.807 1.00 21.45  ? 37  GLU A OE2 1 
ATOM   313  N N   . THR A 1 38  ? 16.502 30.586 13.014 1.00 36.31  ? 38  THR A N   1 
ATOM   314  C CA  . THR A 1 38  ? 17.710 30.897 12.249 1.00 39.95  ? 38  THR A CA  1 
ATOM   315  C C   . THR A 1 38  ? 18.352 29.809 11.351 1.00 42.32  ? 38  THR A C   1 
ATOM   316  O O   . THR A 1 38  ? 19.040 30.135 10.367 1.00 43.14  ? 38  THR A O   1 
ATOM   317  C CB  . THR A 1 38  ? 18.773 31.600 13.167 1.00 40.25  ? 38  THR A CB  1 
ATOM   318  O OG1 . THR A 1 38  ? 19.059 30.799 14.327 1.00 38.38  ? 38  THR A OG1 1 
ATOM   319  C CG2 . THR A 1 38  ? 18.242 32.979 13.612 1.00 39.39  ? 38  THR A CG2 1 
ATOM   320  N N   . THR A 1 39  ? 18.127 28.531 11.657 1.00 43.64  ? 39  THR A N   1 
ATOM   321  C CA  . THR A 1 39  ? 18.684 27.462 10.815 1.00 43.87  ? 39  THR A CA  1 
ATOM   322  C C   . THR A 1 39  ? 17.635 27.051 9.782  1.00 44.53  ? 39  THR A C   1 
ATOM   323  O O   . THR A 1 39  ? 16.584 26.488 10.124 1.00 44.47  ? 39  THR A O   1 
ATOM   324  C CB  . THR A 1 39  ? 19.096 26.221 11.618 1.00 43.01  ? 39  THR A CB  1 
ATOM   325  O OG1 . THR A 1 39  ? 19.984 26.591 12.685 1.00 41.86  ? 39  THR A OG1 1 
ATOM   326  C CG2 . THR A 1 39  ? 19.788 25.231 10.695 1.00 42.88  ? 39  THR A CG2 1 
ATOM   327  N N   . LYS A 1 40  ? 17.880 27.406 8.529  1.00 44.60  ? 40  LYS A N   1 
ATOM   328  C CA  . LYS A 1 40  ? 16.940 27.064 7.473  1.00 44.38  ? 40  LYS A CA  1 
ATOM   329  C C   . LYS A 1 40  ? 16.970 25.549 7.233  1.00 42.52  ? 40  LYS A C   1 
ATOM   330  O O   . LYS A 1 40  ? 18.012 24.889 7.359  1.00 40.66  ? 40  LYS A O   1 
ATOM   331  C CB  . LYS A 1 40  ? 17.223 27.860 6.185  1.00 47.51  ? 40  LYS A CB  1 
ATOM   332  C CG  . LYS A 1 40  ? 18.517 27.492 5.423  1.00 51.87  ? 40  LYS A CG  1 
ATOM   333  C CD  . LYS A 1 40  ? 19.792 27.722 6.249  1.00 54.95  ? 40  LYS A CD  1 
ATOM   334  C CE  . LYS A 1 40  ? 20.680 26.470 6.253  1.00 56.12  ? 40  LYS A CE  1 
ATOM   335  N NZ  . LYS A 1 40  ? 21.098 26.083 7.639  1.00 57.07  ? 40  LYS A NZ  1 
ATOM   336  N N   . GLY A 1 41  ? 15.797 24.992 6.974  1.00 40.17  ? 41  GLY A N   1 
ATOM   337  C CA  . GLY A 1 41  ? 15.710 23.569 6.750  1.00 36.58  ? 41  GLY A CA  1 
ATOM   338  C C   . GLY A 1 41  ? 15.827 22.780 8.033  1.00 33.39  ? 41  GLY A C   1 
ATOM   339  O O   . GLY A 1 41  ? 16.013 21.553 8.000  1.00 34.41  ? 41  GLY A O   1 
ATOM   340  N N   . ALA A 1 42  ? 15.823 23.481 9.161  1.00 27.94  ? 42  ALA A N   1 
ATOM   341  C CA  . ALA A 1 42  ? 15.874 22.798 10.433 1.00 24.05  ? 42  ALA A CA  1 
ATOM   342  C C   . ALA A 1 42  ? 14.551 23.094 11.085 1.00 23.42  ? 42  ALA A C   1 
ATOM   343  O O   . ALA A 1 42  ? 13.896 24.073 10.734 1.00 24.28  ? 42  ALA A O   1 
ATOM   344  C CB  . ALA A 1 42  ? 17.002 23.321 11.285 1.00 23.54  ? 42  ALA A CB  1 
ATOM   345  N N   . TYR A 1 43  ? 14.112 22.219 11.970 1.00 21.98  ? 43  TYR A N   1 
ATOM   346  C CA  . TYR A 1 43  ? 12.878 22.447 12.697 1.00 21.27  ? 43  TYR A CA  1 
ATOM   347  C C   . TYR A 1 43  ? 13.366 22.539 14.093 1.00 20.07  ? 43  TYR A C   1 
ATOM   348  O O   . TYR A 1 43  ? 14.547 22.334 14.344 1.00 19.27  ? 43  TYR A O   1 
ATOM   349  C CB  . TYR A 1 43  ? 11.949 21.240 12.630 1.00 23.64  ? 43  TYR A CB  1 
ATOM   350  C CG  . TYR A 1 43  ? 11.383 21.043 11.291 1.00 26.80  ? 43  TYR A CG  1 
ATOM   351  C CD1 . TYR A 1 43  ? 11.850 20.031 10.465 1.00 27.51  ? 43  TYR A CD1 1 
ATOM   352  C CD2 . TYR A 1 43  ? 10.414 21.913 10.815 1.00 28.78  ? 43  TYR A CD2 1 
ATOM   353  C CE1 . TYR A 1 43  ? 11.364 19.888 9.178  1.00 31.95  ? 43  TYR A CE1 1 
ATOM   354  C CE2 . TYR A 1 43  ? 9.916  21.793 9.543  1.00 32.07  ? 43  TYR A CE2 1 
ATOM   355  C CZ  . TYR A 1 43  ? 10.390 20.779 8.712  1.00 32.44  ? 43  TYR A CZ  1 
ATOM   356  O OH  . TYR A 1 43  ? 9.892  20.678 7.421  1.00 34.42  ? 43  TYR A OH  1 
ATOM   357  N N   . CYS A 1 44  ? 12.452 22.792 15.011 1.00 18.26  ? 44  CYS A N   1 
ATOM   358  C CA  . CYS A 1 44  ? 12.811 22.840 16.401 1.00 18.39  ? 44  CYS A CA  1 
ATOM   359  C C   . CYS A 1 44  ? 11.792 22.073 17.139 1.00 15.28  ? 44  CYS A C   1 
ATOM   360  O O   . CYS A 1 44  ? 10.617 22.206 16.847 1.00 14.91  ? 44  CYS A O   1 
ATOM   361  C CB  . CYS A 1 44  ? 12.820 24.250 16.940 1.00 22.37  ? 44  CYS A CB  1 
ATOM   362  S SG  . CYS A 1 44  ? 14.462 24.836 17.052 1.00 36.20  ? 44  CYS A SG  1 
ATOM   363  N N   . LEU A 1 45  ? 12.253 21.223 18.046 1.00 11.35  ? 45  LEU A N   1 
ATOM   364  C CA  . LEU A 1 45  ? 11.385 20.440 18.892 1.00 13.00  ? 45  LEU A CA  1 
ATOM   365  C C   . LEU A 1 45  ? 11.458 21.136 20.250 1.00 12.05  ? 45  LEU A C   1 
ATOM   366  O O   . LEU A 1 45  ? 12.491 21.099 20.914 1.00 11.35  ? 45  LEU A O   1 
ATOM   367  C CB  . LEU A 1 45  ? 11.899 18.995 18.989 1.00 10.64  ? 45  LEU A CB  1 
ATOM   368  C CG  . LEU A 1 45  ? 11.116 18.086 19.943 1.00 14.61  ? 45  LEU A CG  1 
ATOM   369  C CD1 . LEU A 1 45  ? 9.643  17.936 19.444 1.00 12.27  ? 45  LEU A CD1 1 
ATOM   370  C CD2 . LEU A 1 45  ? 11.806 16.709 20.090 1.00 13.73  ? 45  LEU A CD2 1 
ATOM   371  N N   . SER A 1 46  ? 10.404 21.847 20.629 1.00 13.26  ? 46  SER A N   1 
ATOM   372  C CA  . SER A 1 46  ? 10.393 22.541 21.924 1.00 11.96  ? 46  SER A CA  1 
ATOM   373  C C   . SER A 1 46  ? 9.696  21.626 22.936 1.00 12.92  ? 46  SER A C   1 
ATOM   374  O O   . SER A 1 46  ? 8.564  21.185 22.707 1.00 14.68  ? 46  SER A O   1 
ATOM   375  C CB  . SER A 1 46  ? 9.723  23.909 21.769 1.00 9.93   ? 46  SER A CB  1 
ATOM   376  O OG  . SER A 1 46  ? 10.509 24.718 20.900 1.00 10.74  ? 46  SER A OG  1 
ATOM   377  N N   . VAL A 1 47  ? 10.350 21.387 24.077 1.00 15.12  ? 47  VAL A N   1 
ATOM   378  C CA  . VAL A 1 47  ? 9.861  20.427 25.087 1.00 15.58  ? 47  VAL A CA  1 
ATOM   379  C C   . VAL A 1 47  ? 9.823  20.964 26.506 1.00 16.91  ? 47  VAL A C   1 
ATOM   380  O O   . VAL A 1 47  ? 10.823 21.500 26.971 1.00 20.13  ? 47  VAL A O   1 
ATOM   381  C CB  . VAL A 1 47  ? 10.834 19.151 25.110 1.00 14.40  ? 47  VAL A CB  1 
ATOM   382  C CG1 . VAL A 1 47  ? 10.289 18.067 25.998 1.00 13.36  ? 47  VAL A CG1 1 
ATOM   383  C CG2 . VAL A 1 47  ? 11.078 18.589 23.696 1.00 11.32  ? 47  VAL A CG2 1 
ATOM   384  N N   . SER A 1 48  ? 8.717  20.789 27.222 1.00 15.71  ? 48  SER A N   1 
ATOM   385  C CA  . SER A 1 48  ? 8.694  21.266 28.596 1.00 18.00  ? 48  SER A CA  1 
ATOM   386  C C   . SER A 1 48  ? 9.355  20.242 29.541 1.00 19.14  ? 48  SER A C   1 
ATOM   387  O O   . SER A 1 48  ? 9.320  19.010 29.294 1.00 19.77  ? 48  SER A O   1 
ATOM   388  C CB  . SER A 1 48  ? 7.259  21.569 29.060 1.00 15.91  ? 48  SER A CB  1 
ATOM   389  O OG  . SER A 1 48  ? 6.522  20.389 29.325 1.00 15.00  ? 48  SER A OG  1 
ATOM   390  N N   . ASP A 1 49  ? 9.962  20.753 30.609 1.00 18.25  ? 49  ASP A N   1 
ATOM   391  C CA  . ASP A 1 49  ? 10.583 19.923 31.629 1.00 17.54  ? 49  ASP A CA  1 
ATOM   392  C C   . ASP A 1 49  ? 10.160 20.504 32.970 1.00 18.87  ? 49  ASP A C   1 
ATOM   393  O O   . ASP A 1 49  ? 9.476  21.533 33.017 1.00 19.65  ? 49  ASP A O   1 
ATOM   394  C CB  . ASP A 1 49  ? 12.111 19.928 31.520 1.00 19.08  ? 49  ASP A CB  1 
ATOM   395  C CG  . ASP A 1 49  ? 12.760 18.794 32.321 1.00 20.81  ? 49  ASP A CG  1 
ATOM   396  O OD1 . ASP A 1 49  ? 12.095 17.752 32.552 1.00 18.98  ? 49  ASP A OD1 1 
ATOM   397  O OD2 . ASP A 1 49  ? 13.946 18.920 32.694 1.00 23.17  ? 49  ASP A OD2 1 
ATOM   398  N N   . PHE A 1 50  ? 10.528 19.823 34.049 1.00 19.47  ? 50  PHE A N   1 
ATOM   399  C CA  . PHE A 1 50  ? 10.215 20.263 35.400 1.00 20.82  ? 50  PHE A CA  1 
ATOM   400  C C   . PHE A 1 50  ? 11.110 19.502 36.392 1.00 22.08  ? 50  PHE A C   1 
ATOM   401  O O   . PHE A 1 50  ? 11.332 18.299 36.226 1.00 23.15  ? 50  PHE A O   1 
ATOM   402  C CB  . PHE A 1 50  ? 8.716  20.022 35.746 1.00 18.52  ? 50  PHE A CB  1 
ATOM   403  C CG  . PHE A 1 50  ? 8.339  20.447 37.158 1.00 15.73  ? 50  PHE A CG  1 
ATOM   404  C CD1 . PHE A 1 50  ? 8.556  19.588 38.242 1.00 15.43  ? 50  PHE A CD1 1 
ATOM   405  C CD2 . PHE A 1 50  ? 7.891  21.735 37.418 1.00 13.51  ? 50  PHE A CD2 1 
ATOM   406  C CE1 . PHE A 1 50  ? 8.356  20.008 39.555 1.00 15.11  ? 50  PHE A CE1 1 
ATOM   407  C CE2 . PHE A 1 50  ? 7.687  22.162 38.747 1.00 12.25  ? 50  PHE A CE2 1 
ATOM   408  C CZ  . PHE A 1 50  ? 7.925  21.302 39.807 1.00 13.96  ? 50  PHE A CZ  1 
ATOM   409  N N   . ASP A 1 51  ? 11.729 20.236 37.317 1.00 23.08  ? 51  ASP A N   1 
ATOM   410  C CA  . ASP A 1 51  ? 12.523 19.662 38.403 1.00 22.68  ? 51  ASP A CA  1 
ATOM   411  C C   . ASP A 1 51  ? 12.483 20.655 39.570 1.00 24.65  ? 51  ASP A C   1 
ATOM   412  O O   . ASP A 1 51  ? 12.040 21.799 39.365 1.00 24.07  ? 51  ASP A O   1 
ATOM   413  C CB  . ASP A 1 51  ? 13.938 19.214 37.963 1.00 25.27  ? 51  ASP A CB  1 
ATOM   414  C CG  . ASP A 1 51  ? 14.885 20.341 37.677 1.00 26.33  ? 51  ASP A CG  1 
ATOM   415  O OD1 . ASP A 1 51  ? 15.618 20.266 36.671 1.00 27.56  ? 51  ASP A OD1 1 
ATOM   416  O OD2 . ASP A 1 51  ? 15.001 21.248 38.504 1.00 28.61  ? 51  ASP A OD2 1 
ATOM   417  N N   . ASN A 1 52  ? 12.825 20.222 40.791 1.00 25.31  ? 52  ASN A N   1 
ATOM   418  C CA  . ASN A 1 52  ? 12.813 21.109 41.968 1.00 27.58  ? 52  ASN A CA  1 
ATOM   419  C C   . ASN A 1 52  ? 13.839 22.265 41.959 1.00 29.91  ? 52  ASN A C   1 
ATOM   420  O O   . ASN A 1 52  ? 13.708 23.223 42.725 1.00 29.72  ? 52  ASN A O   1 
ATOM   421  C CB  . ASN A 1 52  ? 12.993 20.306 43.260 1.00 30.72  ? 52  ASN A CB  1 
ATOM   422  C CG  . ASN A 1 52  ? 11.766 19.518 43.629 1.00 31.23  ? 52  ASN A CG  1 
ATOM   423  O OD1 . ASN A 1 52  ? 10.660 19.840 43.222 1.00 33.22  ? 52  ASN A OD1 1 
ATOM   424  N ND2 . ASN A 1 52  ? 11.957 18.474 44.399 1.00 33.08  ? 52  ASN A ND2 1 
ATOM   425  N N   . ALA A 1 53  ? 14.892 22.122 41.148 1.00 29.93  ? 53  ALA A N   1 
ATOM   426  C CA  . ALA A 1 53  ? 15.928 23.150 40.989 1.00 30.32  ? 53  ALA A CA  1 
ATOM   427  C C   . ALA A 1 53  ? 15.411 24.284 40.080 1.00 28.77  ? 53  ALA A C   1 
ATOM   428  O O   . ALA A 1 53  ? 15.324 25.424 40.500 1.00 30.34  ? 53  ALA A O   1 
ATOM   429  C CB  . ALA A 1 53  ? 17.211 22.531 40.365 1.00 28.35  ? 53  ALA A CB  1 
ATOM   430  N N   . LYS A 1 54  ? 15.138 23.959 38.822 1.00 26.97  ? 54  LYS A N   1 
ATOM   431  C CA  . LYS A 1 54  ? 14.640 24.898 37.819 1.00 26.20  ? 54  LYS A CA  1 
ATOM   432  C C   . LYS A 1 54  ? 13.126 25.097 37.814 1.00 26.35  ? 54  LYS A C   1 
ATOM   433  O O   . LYS A 1 54  ? 12.647 26.066 37.230 1.00 30.90  ? 54  LYS A O   1 
ATOM   434  C CB  . LYS A 1 54  ? 15.002 24.413 36.396 1.00 23.65  ? 54  LYS A CB  1 
ATOM   435  C CG  . LYS A 1 54  ? 16.482 24.328 36.115 1.00 25.46  ? 54  LYS A CG  1 
ATOM   436  C CD  . LYS A 1 54  ? 16.790 24.090 34.648 1.00 24.66  ? 54  LYS A CD  1 
ATOM   437  C CE  . LYS A 1 54  ? 18.276 24.297 34.392 1.00 27.06  ? 54  LYS A CE  1 
ATOM   438  N NZ  . LYS A 1 54  ? 18.680 24.184 32.971 1.00 29.25  ? 54  LYS A NZ  1 
ATOM   439  N N   . GLY A 1 55  ? 12.366 24.173 38.388 1.00 23.02  ? 55  GLY A N   1 
ATOM   440  C CA  . GLY A 1 55  ? 10.934 24.298 38.304 1.00 20.10  ? 55  GLY A CA  1 
ATOM   441  C C   . GLY A 1 55  ? 10.567 24.002 36.853 1.00 17.41  ? 55  GLY A C   1 
ATOM   442  O O   . GLY A 1 55  ? 11.278 23.265 36.174 1.00 14.91  ? 55  GLY A O   1 
ATOM   443  N N   . LEU A 1 56  ? 9.497  24.633 36.372 1.00 18.21  ? 56  LEU A N   1 
ATOM   444  C CA  . LEU A 1 56  ? 8.989  24.471 35.002 1.00 20.40  ? 56  LEU A CA  1 
ATOM   445  C C   . LEU A 1 56  ? 9.843  25.262 33.998 1.00 19.92  ? 56  LEU A C   1 
ATOM   446  O O   . LEU A 1 56  ? 10.025 26.463 34.123 1.00 22.90  ? 56  LEU A O   1 
ATOM   447  C CB  . LEU A 1 56  ? 7.499  24.889 34.940 1.00 20.29  ? 56  LEU A CB  1 
ATOM   448  C CG  . LEU A 1 56  ? 6.636  24.715 33.672 1.00 21.53  ? 56  LEU A CG  1 
ATOM   449  C CD1 . LEU A 1 56  ? 6.470  23.269 33.283 1.00 20.78  ? 56  LEU A CD1 1 
ATOM   450  C CD2 . LEU A 1 56  ? 5.276  25.341 33.869 1.00 19.89  ? 56  LEU A CD2 1 
ATOM   451  N N   . ASN A 1 57  ? 10.378 24.582 33.003 1.00 18.67  ? 57  ASN A N   1 
ATOM   452  C CA  . ASN A 1 57  ? 11.236 25.243 32.038 1.00 18.38  ? 57  ASN A CA  1 
ATOM   453  C C   . ASN A 1 57  ? 11.146 24.586 30.652 1.00 19.76  ? 57  ASN A C   1 
ATOM   454  O O   . ASN A 1 57  ? 10.580 23.494 30.511 1.00 18.67  ? 57  ASN A O   1 
ATOM   455  C CB  . ASN A 1 57  ? 12.694 25.255 32.566 1.00 16.45  ? 57  ASN A CB  1 
ATOM   456  C CG  . ASN A 1 57  ? 13.303 23.866 32.685 1.00 16.79  ? 57  ASN A CG  1 
ATOM   457  O OD1 . ASN A 1 57  ? 14.010 23.409 31.784 1.00 18.94  ? 57  ASN A OD1 1 
ATOM   458  N ND2 . ASN A 1 57  ? 13.051 23.194 33.806 1.00 18.77  ? 57  ASN A ND2 1 
ATOM   459  N N   . VAL A 1 58  ? 11.725 25.220 29.635 1.00 18.50  ? 58  VAL A N   1 
ATOM   460  C CA  . VAL A 1 58  ? 11.667 24.644 28.291 1.00 17.66  ? 58  VAL A CA  1 
ATOM   461  C C   . VAL A 1 58  ? 13.038 24.426 27.646 1.00 18.97  ? 58  VAL A C   1 
ATOM   462  O O   . VAL A 1 58  ? 13.982 25.177 27.910 1.00 19.49  ? 58  VAL A O   1 
ATOM   463  C CB  . VAL A 1 58  ? 10.796 25.539 27.377 1.00 15.48  ? 58  VAL A CB  1 
ATOM   464  C CG1 . VAL A 1 58  ? 10.691 24.971 25.938 1.00 12.92  ? 58  VAL A CG1 1 
ATOM   465  C CG2 . VAL A 1 58  ? 9.472  25.734 28.019 1.00 9.54   ? 58  VAL A CG2 1 
ATOM   466  N N   . LYS A 1 59  ? 13.126 23.411 26.792 1.00 17.40  ? 59  LYS A N   1 
ATOM   467  C CA  . LYS A 1 59  ? 14.347 23.065 26.079 1.00 18.19  ? 59  LYS A CA  1 
ATOM   468  C C   . LYS A 1 59  ? 14.006 23.023 24.593 1.00 17.33  ? 59  LYS A C   1 
ATOM   469  O O   . LYS A 1 59  ? 12.869 22.694 24.235 1.00 18.14  ? 59  LYS A O   1 
ATOM   470  C CB  . LYS A 1 59  ? 14.815 21.684 26.524 1.00 22.36  ? 59  LYS A CB  1 
ATOM   471  C CG  . LYS A 1 59  ? 15.275 21.637 27.947 1.00 25.67  ? 59  LYS A CG  1 
ATOM   472  C CD  . LYS A 1 59  ? 16.681 22.149 28.034 1.00 33.61  ? 59  LYS A CD  1 
ATOM   473  C CE  . LYS A 1 59  ? 17.139 22.181 29.491 1.00 40.05  ? 59  LYS A CE  1 
ATOM   474  N NZ  . LYS A 1 59  ? 18.566 22.603 29.715 1.00 44.84  ? 59  LYS A NZ  1 
ATOM   475  N N   . HIS A 1 60  ? 14.980 23.354 23.741 1.00 16.32  ? 60  HIS A N   1 
ATOM   476  C CA  . HIS A 1 60  ? 14.804 23.389 22.274 1.00 16.28  ? 60  HIS A CA  1 
ATOM   477  C C   . HIS A 1 60  ? 15.869 22.550 21.583 1.00 15.14  ? 60  HIS A C   1 
ATOM   478  O O   . HIS A 1 60  ? 17.052 22.798 21.754 1.00 16.98  ? 60  HIS A O   1 
ATOM   479  C CB  . HIS A 1 60  ? 14.862 24.853 21.745 1.00 15.23  ? 60  HIS A CB  1 
ATOM   480  C CG  . HIS A 1 60  ? 13.968 25.810 22.496 1.00 16.76  ? 60  HIS A CG  1 
ATOM   481  N ND1 . HIS A 1 60  ? 12.651 26.034 22.153 1.00 18.43  ? 60  HIS A ND1 1 
ATOM   482  C CD2 . HIS A 1 60  ? 14.188 26.530 23.626 1.00 14.38  ? 60  HIS A CD2 1 
ATOM   483  C CE1 . HIS A 1 60  ? 12.093 26.837 23.051 1.00 19.02  ? 60  HIS A CE1 1 
ATOM   484  N NE2 . HIS A 1 60  ? 13.007 27.148 23.953 1.00 14.84  ? 60  HIS A NE2 1 
ATOM   485  N N   . TYR A 1 61  ? 15.437 21.596 20.768 1.00 13.84  ? 61  TYR A N   1 
ATOM   486  C CA  . TYR A 1 61  ? 16.333 20.682 20.062 1.00 14.39  ? 61  TYR A CA  1 
ATOM   487  C C   . TYR A 1 61  ? 16.139 20.894 18.588 1.00 17.20  ? 61  TYR A C   1 
ATOM   488  O O   . TYR A 1 61  ? 15.018 20.903 18.101 1.00 18.20  ? 61  TYR A O   1 
ATOM   489  C CB  . TYR A 1 61  ? 15.991 19.223 20.407 1.00 13.09  ? 61  TYR A CB  1 
ATOM   490  C CG  . TYR A 1 61  ? 15.992 18.974 21.910 1.00 13.32  ? 61  TYR A CG  1 
ATOM   491  C CD1 . TYR A 1 61  ? 14.797 19.010 22.654 1.00 13.12  ? 61  TYR A CD1 1 
ATOM   492  C CD2 . TYR A 1 61  ? 17.190 18.801 22.604 1.00 9.61   ? 61  TYR A CD2 1 
ATOM   493  C CE1 . TYR A 1 61  ? 14.807 18.887 24.053 1.00 10.92  ? 61  TYR A CE1 1 
ATOM   494  C CE2 . TYR A 1 61  ? 17.202 18.675 24.002 1.00 11.91  ? 61  TYR A CE2 1 
ATOM   495  C CZ  . TYR A 1 61  ? 16.013 18.723 24.700 1.00 9.60   ? 61  TYR A CZ  1 
ATOM   496  O OH  . TYR A 1 61  ? 16.055 18.619 26.045 1.00 8.82   ? 61  TYR A OH  1 
ATOM   497  N N   . LYS A 1 62  ? 17.232 21.033 17.857 1.00 21.39  ? 62  LYS A N   1 
ATOM   498  C CA  . LYS A 1 62  ? 17.153 21.265 16.426 1.00 22.51  ? 62  LYS A CA  1 
ATOM   499  C C   . LYS A 1 62  ? 17.022 19.965 15.648 1.00 22.81  ? 62  LYS A C   1 
ATOM   500  O O   . LYS A 1 62  ? 17.744 18.996 15.892 1.00 22.45  ? 62  LYS A O   1 
ATOM   501  C CB  . LYS A 1 62  ? 18.359 22.082 15.975 1.00 25.73  ? 62  LYS A CB  1 
ATOM   502  C CG  . LYS A 1 62  ? 18.148 22.825 14.662 1.00 34.83  ? 62  LYS A CG  1 
ATOM   503  C CD  . LYS A 1 62  ? 19.228 23.864 14.460 1.00 38.71  ? 62  LYS A CD  1 
ATOM   504  C CE  . LYS A 1 62  ? 19.209 24.863 15.613 1.00 41.41  ? 62  LYS A CE  1 
ATOM   505  N NZ  . LYS A 1 62  ? 20.017 26.069 15.287 1.00 44.51  ? 62  LYS A NZ  1 
ATOM   506  N N   . ILE A 1 63  ? 15.989 19.906 14.820 1.00 22.58  ? 63  ILE A N   1 
ATOM   507  C CA  . ILE A 1 63  ? 15.750 18.748 13.995 1.00 22.12  ? 63  ILE A CA  1 
ATOM   508  C C   . ILE A 1 63  ? 16.295 19.025 12.599 1.00 26.11  ? 63  ILE A C   1 
ATOM   509  O O   . ILE A 1 63  ? 15.804 19.912 11.895 1.00 26.15  ? 63  ILE A O   1 
ATOM   510  C CB  . ILE A 1 63  ? 14.247 18.402 13.906 1.00 19.61  ? 63  ILE A CB  1 
ATOM   511  C CG1 . ILE A 1 63  ? 13.709 17.993 15.288 1.00 17.16  ? 63  ILE A CG1 1 
ATOM   512  C CG2 . ILE A 1 63  ? 14.034 17.242 12.908 1.00 14.75  ? 63  ILE A CG2 1 
ATOM   513  C CD1 . ILE A 1 63  ? 12.223 17.668 15.287 1.00 14.53  ? 63  ILE A CD1 1 
ATOM   514  N N   . ARG A 1 64  ? 17.336 18.290 12.216 1.00 29.86  ? 64  ARG A N   1 
ATOM   515  C CA  . ARG A 1 64  ? 17.923 18.442 10.889 1.00 32.60  ? 64  ARG A CA  1 
ATOM   516  C C   . ARG A 1 64  ? 17.272 17.430 9.942  1.00 34.27  ? 64  ARG A C   1 
ATOM   517  O O   . ARG A 1 64  ? 16.802 16.359 10.351 1.00 31.04  ? 64  ARG A O   1 
ATOM   518  C CB  . ARG A 1 64  ? 19.442 18.221 10.924 1.00 35.61  ? 64  ARG A CB  1 
ATOM   519  C CG  . ARG A 1 64  ? 20.186 18.829 12.148 1.00 41.75  ? 64  ARG A CG  1 
ATOM   520  C CD  . ARG A 1 64  ? 19.961 20.331 12.271 1.00 45.81  ? 64  ARG A CD  1 
ATOM   521  N NE  . ARG A 1 64  ? 19.836 20.941 10.946 1.00 52.14  ? 64  ARG A NE  1 
ATOM   522  C CZ  . ARG A 1 64  ? 20.711 21.783 10.405 1.00 54.05  ? 64  ARG A CZ  1 
ATOM   523  N NH1 . ARG A 1 64  ? 21.800 22.146 11.081 1.00 55.90  ? 64  ARG A NH1 1 
ATOM   524  N NH2 . ARG A 1 64  ? 20.506 22.236 9.167  1.00 55.98  ? 64  ARG A NH2 1 
ATOM   525  N N   . LYS A 1 65  ? 17.203 17.808 8.676  1.00 37.11  ? 65  LYS A N   1 
ATOM   526  C CA  . LYS A 1 65  ? 16.632 16.968 7.638  1.00 40.11  ? 65  LYS A CA  1 
ATOM   527  C C   . LYS A 1 65  ? 17.662 16.979 6.512  1.00 41.59  ? 65  LYS A C   1 
ATOM   528  O O   . LYS A 1 65  ? 18.055 18.043 6.045  1.00 40.86  ? 65  LYS A O   1 
ATOM   529  C CB  . LYS A 1 65  ? 15.274 17.530 7.167  1.00 39.52  ? 65  LYS A CB  1 
ATOM   530  C CG  . LYS A 1 65  ? 14.836 17.067 5.778  1.00 41.82  ? 65  LYS A CG  1 
ATOM   531  C CD  . LYS A 1 65  ? 14.569 15.566 5.721  1.00 45.97  ? 65  LYS A CD  1 
ATOM   532  C CE  . LYS A 1 65  ? 14.481 15.028 4.293  1.00 47.55  ? 65  LYS A CE  1 
ATOM   533  N NZ  . LYS A 1 65  ? 13.783 15.952 3.349  1.00 51.44  ? 65  LYS A NZ  1 
ATOM   534  N N   . LEU A 1 66  ? 18.156 15.800 6.152  1.00 44.46  ? 66  LEU A N   1 
ATOM   535  C CA  . LEU A 1 66  ? 19.141 15.645 5.090  1.00 47.97  ? 66  LEU A CA  1 
ATOM   536  C C   . LEU A 1 66  ? 18.442 15.561 3.738  1.00 51.62  ? 66  LEU A C   1 
ATOM   537  O O   . LEU A 1 66  ? 17.278 15.159 3.669  1.00 52.25  ? 66  LEU A O   1 
ATOM   538  C CB  . LEU A 1 66  ? 19.877 14.320 5.258  1.00 47.17  ? 66  LEU A CB  1 
ATOM   539  C CG  . LEU A 1 66  ? 20.513 13.893 6.567  1.00 46.46  ? 66  LEU A CG  1 
ATOM   540  C CD1 . LEU A 1 66  ? 20.980 12.456 6.427  1.00 46.38  ? 66  LEU A CD1 1 
ATOM   541  C CD2 . LEU A 1 66  ? 21.652 14.809 6.907  1.00 45.36  ? 66  LEU A CD2 1 
ATOM   542  N N   . ASP A 1 67  ? 19.171 15.853 2.659  1.00 54.84  ? 67  ASP A N   1 
ATOM   543  C CA  . ASP A 1 67  ? 18.610 15.721 1.314  1.00 57.70  ? 67  ASP A CA  1 
ATOM   544  C C   . ASP A 1 67  ? 18.683 14.248 0.940  1.00 57.33  ? 67  ASP A C   1 
ATOM   545  O O   . ASP A 1 67  ? 18.028 13.783 -0.001 1.00 56.52  ? 67  ASP A O   1 
ATOM   546  C CB  . ASP A 1 67  ? 19.337 16.612 0.324  1.00 62.73  ? 67  ASP A CB  1 
ATOM   547  C CG  . ASP A 1 67  ? 18.827 18.048 0.379  1.00 68.73  ? 67  ASP A CG  1 
ATOM   548  O OD1 . ASP A 1 67  ? 18.560 18.627 -0.705 1.00 71.88  ? 67  ASP A OD1 1 
ATOM   549  O OD2 . ASP A 1 67  ? 18.650 18.583 1.514  1.00 71.82  ? 67  ASP A OD2 1 
ATOM   550  N N   . SER A 1 68  ? 19.459 13.530 1.755  1.00 57.64  ? 68  SER A N   1 
ATOM   551  C CA  . SER A 1 68  ? 19.638 12.078 1.694  1.00 57.28  ? 68  SER A CA  1 
ATOM   552  C C   . SER A 1 68  ? 18.331 11.450 2.256  1.00 56.01  ? 68  SER A C   1 
ATOM   553  O O   . SER A 1 68  ? 18.179 10.211 2.270  1.00 57.16  ? 68  SER A O   1 
ATOM   554  C CB  . SER A 1 68  ? 20.812 11.662 2.592  1.00 57.87  ? 68  SER A CB  1 
ATOM   555  O OG  . SER A 1 68  ? 21.701 12.756 2.803  1.00 60.20  ? 68  SER A OG  1 
ATOM   556  N N   . GLY A 1 69  ? 17.469 12.305 2.837  1.00 52.90  ? 69  GLY A N   1 
ATOM   557  C CA  . GLY A 1 69  ? 16.178 11.883 3.356  1.00 45.67  ? 69  GLY A CA  1 
ATOM   558  C C   . GLY A 1 69  ? 15.908 11.744 4.842  1.00 41.69  ? 69  GLY A C   1 
ATOM   559  O O   . GLY A 1 69  ? 14.772 11.949 5.270  1.00 42.27  ? 69  GLY A O   1 
ATOM   560  N N   . GLY A 1 70  ? 16.909 11.406 5.642  1.00 35.96  ? 70  GLY A N   1 
ATOM   561  C CA  . GLY A 1 70  ? 16.635 11.226 7.051  1.00 30.07  ? 70  GLY A CA  1 
ATOM   562  C C   . GLY A 1 70  ? 16.460 12.486 7.857  1.00 26.80  ? 70  GLY A C   1 
ATOM   563  O O   . GLY A 1 70  ? 16.936 13.538 7.466  1.00 27.84  ? 70  GLY A O   1 
ATOM   564  N N   . PHE A 1 71  ? 15.758 12.365 8.976  1.00 24.83  ? 71  PHE A N   1 
ATOM   565  C CA  . PHE A 1 71  ? 15.524 13.453 9.928  1.00 23.45  ? 71  PHE A CA  1 
ATOM   566  C C   . PHE A 1 71  ? 16.233 13.048 11.213 1.00 22.63  ? 71  PHE A C   1 
ATOM   567  O O   . PHE A 1 71  ? 16.326 11.851 11.520 1.00 23.63  ? 71  PHE A O   1 
ATOM   568  C CB  . PHE A 1 71  ? 14.042 13.589 10.267 1.00 20.83  ? 71  PHE A CB  1 
ATOM   569  C CG  . PHE A 1 71  ? 13.191 14.050 9.117  1.00 24.58  ? 71  PHE A CG  1 
ATOM   570  C CD1 . PHE A 1 71  ? 12.756 13.144 8.134  1.00 25.79  ? 71  PHE A CD1 1 
ATOM   571  C CD2 . PHE A 1 71  ? 12.781 15.373 9.037  1.00 21.32  ? 71  PHE A CD2 1 
ATOM   572  C CE1 . PHE A 1 71  ? 11.926 13.550 7.097  1.00 25.56  ? 71  PHE A CE1 1 
ATOM   573  C CE2 . PHE A 1 71  ? 11.957 15.784 8.015  1.00 24.12  ? 71  PHE A CE2 1 
ATOM   574  C CZ  . PHE A 1 71  ? 11.525 14.874 7.042  1.00 25.70  ? 71  PHE A CZ  1 
ATOM   575  N N   . TYR A 1 72  ? 16.737 14.015 11.963 1.00 21.08  ? 72  TYR A N   1 
ATOM   576  C CA  . TYR A 1 72  ? 17.377 13.688 13.217 1.00 20.32  ? 72  TYR A CA  1 
ATOM   577  C C   . TYR A 1 72  ? 17.717 14.905 14.084 1.00 20.58  ? 72  TYR A C   1 
ATOM   578  O O   . TYR A 1 72  ? 17.725 16.068 13.608 1.00 18.46  ? 72  TYR A O   1 
ATOM   579  C CB  . TYR A 1 72  ? 18.650 12.865 12.957 1.00 23.47  ? 72  TYR A CB  1 
ATOM   580  C CG  . TYR A 1 72  ? 19.729 13.627 12.232 1.00 23.41  ? 72  TYR A CG  1 
ATOM   581  C CD1 . TYR A 1 72  ? 20.539 14.532 12.914 1.00 25.65  ? 72  TYR A CD1 1 
ATOM   582  C CD2 . TYR A 1 72  ? 19.880 13.512 10.857 1.00 27.04  ? 72  TYR A CD2 1 
ATOM   583  C CE1 . TYR A 1 72  ? 21.449 15.308 12.259 1.00 26.36  ? 72  TYR A CE1 1 
ATOM   584  C CE2 . TYR A 1 72  ? 20.803 14.280 10.185 1.00 30.21  ? 72  TYR A CE2 1 
ATOM   585  C CZ  . TYR A 1 72  ? 21.576 15.179 10.902 1.00 30.38  ? 72  TYR A CZ  1 
ATOM   586  O OH  . TYR A 1 72  ? 22.470 15.978 10.249 1.00 34.38  ? 72  TYR A OH  1 
ATOM   587  N N   . ILE A 1 73  ? 17.886 14.616 15.377 1.00 19.29  ? 73  ILE A N   1 
ATOM   588  C CA  . ILE A 1 73  ? 18.334 15.578 16.368 1.00 18.23  ? 73  ILE A CA  1 
ATOM   589  C C   . ILE A 1 73  ? 19.815 15.196 16.441 1.00 19.54  ? 73  ILE A C   1 
ATOM   590  O O   . ILE A 1 73  ? 20.665 16.052 16.335 1.00 22.46  ? 73  ILE A O   1 
ATOM   591  C CB  . ILE A 1 73  ? 17.657 15.399 17.728 1.00 20.07  ? 73  ILE A CB  1 
ATOM   592  C CG1 . ILE A 1 73  ? 16.167 15.754 17.626 1.00 18.38  ? 73  ILE A CG1 1 
ATOM   593  C CG2 . ILE A 1 73  ? 18.320 16.320 18.757 1.00 19.21  ? 73  ILE A CG2 1 
ATOM   594  C CD1 . ILE A 1 73  ? 15.375 15.513 18.910 1.00 17.70  ? 73  ILE A CD1 1 
ATOM   595  N N   . THR A 1 74  ? 20.137 13.908 16.578 1.00 19.46  ? 74  THR A N   1 
ATOM   596  C CA  . THR A 1 74  ? 21.540 13.496 16.550 1.00 18.92  ? 74  THR A CA  1 
ATOM   597  C C   . THR A 1 74  ? 21.747 12.659 15.287 1.00 19.91  ? 74  THR A C   1 
ATOM   598  O O   . THR A 1 74  ? 20.992 11.743 15.032 1.00 20.15  ? 74  THR A O   1 
ATOM   599  C CB  . THR A 1 74  ? 22.008 12.723 17.810 1.00 16.99  ? 74  THR A CB  1 
ATOM   600  O OG1 . THR A 1 74  ? 23.333 12.224 17.567 1.00 18.36  ? 74  THR A OG1 1 
ATOM   601  C CG2 . THR A 1 74  ? 21.103 11.564 18.146 1.00 17.68  ? 74  THR A CG2 1 
ATOM   602  N N   . SER A 1 75  ? 22.765 12.970 14.490 1.00 24.26  ? 75  SER A N   1 
ATOM   603  C CA  . SER A 1 75  ? 23.012 12.247 13.235 1.00 27.03  ? 75  SER A CA  1 
ATOM   604  C C   . SER A 1 75  ? 23.164 10.749 13.413 1.00 28.27  ? 75  SER A C   1 
ATOM   605  O O   . SER A 1 75  ? 22.992 9.992  12.448 1.00 28.62  ? 75  SER A O   1 
ATOM   606  C CB  . SER A 1 75  ? 24.223 12.809 12.478 1.00 27.13  ? 75  SER A CB  1 
ATOM   607  O OG  . SER A 1 75  ? 25.403 12.598 13.226 1.00 29.24  ? 75  SER A OG  1 
ATOM   608  N N   . ARG A 1 76  ? 23.512 10.330 14.634 1.00 28.90  ? 76  ARG A N   1 
ATOM   609  C CA  . ARG A 1 76  ? 23.667 8.907  14.960 1.00 29.45  ? 76  ARG A CA  1 
ATOM   610  C C   . ARG A 1 76  ? 22.329 8.173  14.921 1.00 28.03  ? 76  ARG A C   1 
ATOM   611  O O   . ARG A 1 76  ? 22.282 7.001  14.532 1.00 28.54  ? 76  ARG A O   1 
ATOM   612  C CB  . ARG A 1 76  ? 24.288 8.734  16.352 1.00 32.98  ? 76  ARG A CB  1 
ATOM   613  C CG  . ARG A 1 76  ? 25.706 9.274  16.441 1.00 39.45  ? 76  ARG A CG  1 
ATOM   614  C CD  . ARG A 1 76  ? 26.705 8.367  15.717 1.00 44.75  ? 76  ARG A CD  1 
ATOM   615  N NE  . ARG A 1 76  ? 27.253 7.341  16.616 1.00 50.73  ? 76  ARG A NE  1 
ATOM   616  C CZ  . ARG A 1 76  ? 28.261 7.538  17.474 1.00 52.61  ? 76  ARG A CZ  1 
ATOM   617  N NH1 . ARG A 1 76  ? 28.880 8.726  17.556 1.00 53.02  ? 76  ARG A NH1 1 
ATOM   618  N NH2 . ARG A 1 76  ? 28.568 6.583  18.347 1.00 52.98  ? 76  ARG A NH2 1 
ATOM   619  N N   . THR A 1 77  ? 21.248 8.914  15.203 1.00 24.36  ? 77  THR A N   1 
ATOM   620  C CA  . THR A 1 77  ? 19.886 8.387  15.284 1.00 19.94  ? 77  THR A CA  1 
ATOM   621  C C   . THR A 1 77  ? 18.910 9.055  14.290 1.00 20.67  ? 77  THR A C   1 
ATOM   622  O O   . THR A 1 77  ? 18.231 10.043 14.622 1.00 18.42  ? 77  THR A O   1 
ATOM   623  C CB  . THR A 1 77  ? 19.404 8.566  16.735 1.00 19.59  ? 77  THR A CB  1 
ATOM   624  O OG1 . THR A 1 77  ? 20.489 8.218  17.611 1.00 16.24  ? 77  THR A OG1 1 
ATOM   625  C CG2 . THR A 1 77  ? 18.185 7.696  17.048 1.00 11.77  ? 77  THR A CG2 1 
ATOM   626  N N   . GLN A 1 78  ? 18.816 8.472  13.095 1.00 18.48  ? 78  GLN A N   1 
ATOM   627  C CA  . GLN A 1 78  ? 17.979 8.992  12.024 1.00 18.02  ? 78  GLN A CA  1 
ATOM   628  C C   . GLN A 1 78  ? 16.659 8.292  11.789 1.00 17.65  ? 78  GLN A C   1 
ATOM   629  O O   . GLN A 1 78  ? 16.461 7.151  12.218 1.00 19.87  ? 78  GLN A O   1 
ATOM   630  C CB  . GLN A 1 78  ? 18.796 9.009  10.749 1.00 19.13  ? 78  GLN A CB  1 
ATOM   631  C CG  . GLN A 1 78  ? 20.125 9.673  10.975 1.00 20.79  ? 78  GLN A CG  1 
ATOM   632  C CD  . GLN A 1 78  ? 20.785 10.103 9.699  1.00 23.74  ? 78  GLN A CD  1 
ATOM   633  O OE1 . GLN A 1 78  ? 21.991 10.190 9.646  1.00 27.27  ? 78  GLN A OE1 1 
ATOM   634  N NE2 . GLN A 1 78  ? 20.007 10.406 8.674  1.00 25.18  ? 78  GLN A NE2 1 
ATOM   635  N N   . PHE A 1 79  ? 15.765 8.971  11.074 1.00 18.18  ? 79  PHE A N   1 
ATOM   636  C CA  . PHE A 1 79  ? 14.430 8.458  10.774 1.00 17.00  ? 79  PHE A CA  1 
ATOM   637  C C   . PHE A 1 79  ? 13.976 8.850  9.410  1.00 19.59  ? 79  PHE A C   1 
ATOM   638  O O   . PHE A 1 79  ? 14.398 9.865  8.866  1.00 21.04  ? 79  PHE A O   1 
ATOM   639  C CB  . PHE A 1 79  ? 13.414 8.981  11.774 1.00 15.36  ? 79  PHE A CB  1 
ATOM   640  C CG  . PHE A 1 79  ? 13.825 8.785  13.179 1.00 15.08  ? 79  PHE A CG  1 
ATOM   641  C CD1 . PHE A 1 79  ? 14.500 9.791  13.853 1.00 11.51  ? 79  PHE A CD1 1 
ATOM   642  C CD2 . PHE A 1 79  ? 13.604 7.561  13.818 1.00 13.53  ? 79  PHE A CD2 1 
ATOM   643  C CE1 . PHE A 1 79  ? 14.952 9.589  15.126 1.00 10.96  ? 79  PHE A CE1 1 
ATOM   644  C CE2 . PHE A 1 79  ? 14.060 7.359  15.107 1.00 11.21  ? 79  PHE A CE2 1 
ATOM   645  C CZ  . PHE A 1 79  ? 14.738 8.380  15.754 1.00 11.69  ? 79  PHE A CZ  1 
ATOM   646  N N   . ASN A 1 80  ? 13.056 8.063  8.882  1.00 22.36  ? 80  ASN A N   1 
ATOM   647  C CA  . ASN A 1 80  ? 12.520 8.293  7.551  1.00 26.91  ? 80  ASN A CA  1 
ATOM   648  C C   . ASN A 1 80  ? 11.453 9.410  7.514  1.00 27.64  ? 80  ASN A C   1 
ATOM   649  O O   . ASN A 1 80  ? 10.953 9.792  6.444  1.00 27.80  ? 80  ASN A O   1 
ATOM   650  C CB  . ASN A 1 80  ? 11.962 6.976  6.998  1.00 28.91  ? 80  ASN A CB  1 
ATOM   651  C CG  . ASN A 1 80  ? 13.046 5.935  6.768  1.00 32.95  ? 80  ASN A CG  1 
ATOM   652  O OD1 . ASN A 1 80  ? 14.114 6.244  6.239  1.00 34.20  ? 80  ASN A OD1 1 
ATOM   653  N ND2 . ASN A 1 80  ? 12.781 4.692  7.172  1.00 35.84  ? 80  ASN A ND2 1 
ATOM   654  N N   . SER A 1 81  ? 11.133 9.968  8.675  1.00 26.26  ? 81  SER A N   1 
ATOM   655  C CA  . SER A 1 81  ? 10.131 10.994 8.713  1.00 23.60  ? 81  SER A CA  1 
ATOM   656  C C   . SER A 1 81  ? 10.107 11.648 10.077 1.00 23.64  ? 81  SER A C   1 
ATOM   657  O O   . SER A 1 81  ? 10.602 11.097 11.054 1.00 21.73  ? 81  SER A O   1 
ATOM   658  C CB  . SER A 1 81  ? 8.761  10.385 8.378  1.00 22.75  ? 81  SER A CB  1 
ATOM   659  O OG  . SER A 1 81  ? 8.330  9.468  9.376  1.00 20.87  ? 81  SER A OG  1 
ATOM   660  N N   . LEU A 1 82  ? 9.529  12.845 10.111 1.00 24.40  ? 82  LEU A N   1 
ATOM   661  C CA  . LEU A 1 82  ? 9.381  13.641 11.313 1.00 22.63  ? 82  LEU A CA  1 
ATOM   662  C C   . LEU A 1 82  ? 8.467  12.856 12.226 1.00 22.56  ? 82  LEU A C   1 
ATOM   663  O O   . LEU A 1 82  ? 8.782  12.636 13.392 1.00 23.69  ? 82  LEU A O   1 
ATOM   664  C CB  . LEU A 1 82  ? 8.747  14.975 10.938 1.00 23.24  ? 82  LEU A CB  1 
ATOM   665  C CG  . LEU A 1 82  ? 8.982  16.218 11.781 1.00 25.74  ? 82  LEU A CG  1 
ATOM   666  C CD1 . LEU A 1 82  ? 10.370 16.257 12.381 1.00 24.95  ? 82  LEU A CD1 1 
ATOM   667  C CD2 . LEU A 1 82  ? 8.767  17.424 10.890 1.00 27.00  ? 82  LEU A CD2 1 
ATOM   668  N N   . GLN A 1 83  ? 7.388  12.338 11.662 1.00 22.35  ? 83  GLN A N   1 
ATOM   669  C CA  . GLN A 1 83  ? 6.421  11.543 12.420 1.00 24.05  ? 83  GLN A CA  1 
ATOM   670  C C   . GLN A 1 83  ? 7.077  10.362 13.147 1.00 24.80  ? 83  GLN A C   1 
ATOM   671  O O   . GLN A 1 83  ? 6.772  10.108 14.338 1.00 25.88  ? 83  GLN A O   1 
ATOM   672  C CB  . GLN A 1 83  ? 5.303  11.057 11.500 1.00 24.69  ? 83  GLN A CB  1 
ATOM   673  C CG  . GLN A 1 83  ? 4.462  12.182 10.936 1.00 29.90  ? 83  GLN A CG  1 
ATOM   674  C CD  . GLN A 1 83  ? 5.001  12.850 9.657  1.00 30.31  ? 83  GLN A CD  1 
ATOM   675  O OE1 . GLN A 1 83  ? 4.352  13.743 9.111  1.00 31.70  ? 83  GLN A OE1 1 
ATOM   676  N NE2 . GLN A 1 83  ? 6.138  12.394 9.156  1.00 30.64  ? 83  GLN A NE2 1 
ATOM   677  N N   . GLN A 1 84  ? 7.972  9.646  12.446 1.00 22.82  ? 84  GLN A N   1 
ATOM   678  C CA  . GLN A 1 84  ? 8.695  8.516  13.039 1.00 20.91  ? 84  GLN A CA  1 
ATOM   679  C C   . GLN A 1 84  ? 9.651  8.979  14.155 1.00 18.04  ? 84  GLN A C   1 
ATOM   680  O O   . GLN A 1 84  ? 9.805  8.296  15.193 1.00 16.52  ? 84  GLN A O   1 
ATOM   681  C CB  . GLN A 1 84  ? 9.447  7.724  11.948 1.00 25.39  ? 84  GLN A CB  1 
ATOM   682  C CG  . GLN A 1 84  ? 8.523  6.805  11.122 1.00 31.78  ? 84  GLN A CG  1 
ATOM   683  C CD  . GLN A 1 84  ? 9.203  6.131  9.931  1.00 34.88  ? 84  GLN A CD  1 
ATOM   684  O OE1 . GLN A 1 84  ? 9.783  6.785  9.059  1.00 37.86  ? 84  GLN A OE1 1 
ATOM   685  N NE2 . GLN A 1 84  ? 9.096  4.822  9.873  1.00 34.77  ? 84  GLN A NE2 1 
ATOM   686  N N   . LEU A 1 85  ? 10.274 10.144 13.949 1.00 15.21  ? 85  LEU A N   1 
ATOM   687  C CA  . LEU A 1 85  ? 11.196 10.718 14.918 1.00 13.92  ? 85  LEU A CA  1 
ATOM   688  C C   . LEU A 1 85  ? 10.421 11.011 16.191 1.00 14.67  ? 85  LEU A C   1 
ATOM   689  O O   . LEU A 1 85  ? 10.807 10.580 17.294 1.00 16.65  ? 85  LEU A O   1 
ATOM   690  C CB  . LEU A 1 85  ? 11.854 11.998 14.352 1.00 12.56  ? 85  LEU A CB  1 
ATOM   691  C CG  . LEU A 1 85  ? 12.891 12.714 15.253 1.00 16.11  ? 85  LEU A CG  1 
ATOM   692  C CD1 . LEU A 1 85  ? 13.896 13.531 14.395 1.00 14.21  ? 85  LEU A CD1 1 
ATOM   693  C CD2 . LEU A 1 85  ? 12.230 13.595 16.337 1.00 14.05  ? 85  LEU A CD2 1 
ATOM   694  N N   . VAL A 1 86  ? 9.311  11.729 16.043 1.00 14.55  ? 86  VAL A N   1 
ATOM   695  C CA  . VAL A 1 86  ? 8.484  12.075 17.180 1.00 13.84  ? 86  VAL A CA  1 
ATOM   696  C C   . VAL A 1 86  ? 8.068  10.835 17.942 1.00 17.17  ? 86  VAL A C   1 
ATOM   697  O O   . VAL A 1 86  ? 8.210  10.802 19.174 1.00 20.55  ? 86  VAL A O   1 
ATOM   698  C CB  . VAL A 1 86  ? 7.273  12.896 16.733 1.00 14.60  ? 86  VAL A CB  1 
ATOM   699  C CG1 . VAL A 1 86  ? 6.158  12.905 17.821 1.00 13.51  ? 86  VAL A CG1 1 
ATOM   700  C CG2 . VAL A 1 86  ? 7.737  14.323 16.358 1.00 15.33  ? 86  VAL A CG2 1 
ATOM   701  N N   . ALA A 1 87  ? 7.570  9.816  17.229 1.00 18.11  ? 87  ALA A N   1 
ATOM   702  C CA  . ALA A 1 87  ? 7.137  8.547  17.853 1.00 18.61  ? 87  ALA A CA  1 
ATOM   703  C C   . ALA A 1 87  ? 8.279  7.892  18.629 1.00 18.51  ? 87  ALA A C   1 
ATOM   704  O O   . ALA A 1 87  ? 8.077  7.406  19.740 1.00 21.27  ? 87  ALA A O   1 
ATOM   705  C CB  . ALA A 1 87  ? 6.566  7.550  16.783 1.00 16.10  ? 87  ALA A CB  1 
ATOM   706  N N   . TYR A 1 88  ? 9.483  7.895  18.062 1.00 18.44  ? 88  TYR A N   1 
ATOM   707  C CA  . TYR A 1 88  ? 10.647 7.309  18.737 1.00 16.85  ? 88  TYR A CA  1 
ATOM   708  C C   . TYR A 1 88  ? 10.941 8.028  20.046 1.00 15.80  ? 88  TYR A C   1 
ATOM   709  O O   . TYR A 1 88  ? 11.159 7.392  21.099 1.00 13.21  ? 88  TYR A O   1 
ATOM   710  C CB  . TYR A 1 88  ? 11.869 7.393  17.825 1.00 18.59  ? 88  TYR A CB  1 
ATOM   711  C CG  . TYR A 1 88  ? 13.137 6.944  18.488 1.00 19.74  ? 88  TYR A CG  1 
ATOM   712  C CD1 . TYR A 1 88  ? 13.536 5.602  18.457 1.00 20.69  ? 88  TYR A CD1 1 
ATOM   713  C CD2 . TYR A 1 88  ? 13.934 7.859  19.166 1.00 20.15  ? 88  TYR A CD2 1 
ATOM   714  C CE1 . TYR A 1 88  ? 14.711 5.195  19.094 1.00 22.00  ? 88  TYR A CE1 1 
ATOM   715  C CE2 . TYR A 1 88  ? 15.086 7.481  19.806 1.00 20.84  ? 88  TYR A CE2 1 
ATOM   716  C CZ  . TYR A 1 88  ? 15.486 6.154  19.781 1.00 25.11  ? 88  TYR A CZ  1 
ATOM   717  O OH  . TYR A 1 88  ? 16.637 5.813  20.481 1.00 25.70  ? 88  TYR A OH  1 
ATOM   718  N N   . TYR A 1 89  ? 10.916 9.363  19.983 1.00 16.23  ? 89  TYR A N   1 
ATOM   719  C CA  . TYR A 1 89  ? 11.178 10.203 21.155 1.00 14.49  ? 89  TYR A CA  1 
ATOM   720  C C   . TYR A 1 89  ? 10.058 10.259 22.182 1.00 13.47  ? 89  TYR A C   1 
ATOM   721  O O   . TYR A 1 89  ? 10.245 10.755 23.279 1.00 9.94   ? 89  TYR A O   1 
ATOM   722  C CB  . TYR A 1 89  ? 11.674 11.588 20.759 1.00 14.54  ? 89  TYR A CB  1 
ATOM   723  C CG  . TYR A 1 89  ? 13.105 11.525 20.260 1.00 14.34  ? 89  TYR A CG  1 
ATOM   724  C CD1 . TYR A 1 89  ? 13.400 11.764 18.922 1.00 13.61  ? 89  TYR A CD1 1 
ATOM   725  C CD2 . TYR A 1 89  ? 14.164 11.166 21.120 1.00 14.35  ? 89  TYR A CD2 1 
ATOM   726  C CE1 . TYR A 1 89  ? 14.691 11.640 18.435 1.00 12.44  ? 89  TYR A CE1 1 
ATOM   727  C CE2 . TYR A 1 89  ? 15.483 11.044 20.627 1.00 14.00  ? 89  TYR A CE2 1 
ATOM   728  C CZ  . TYR A 1 89  ? 15.718 11.282 19.275 1.00 13.17  ? 89  TYR A CZ  1 
ATOM   729  O OH  . TYR A 1 89  ? 16.966 11.130 18.726 1.00 11.25  ? 89  TYR A OH  1 
ATOM   730  N N   . SER A 1 90  ? 8.908  9.696  21.822 1.00 16.04  ? 90  SER A N   1 
ATOM   731  C CA  . SER A 1 90  ? 7.759  9.571  22.731 1.00 16.46  ? 90  SER A CA  1 
ATOM   732  C C   . SER A 1 90  ? 7.995  8.329  23.589 1.00 17.53  ? 90  SER A C   1 
ATOM   733  O O   . SER A 1 90  ? 7.389  8.162  24.631 1.00 18.69  ? 90  SER A O   1 
ATOM   734  C CB  . SER A 1 90  ? 6.486  9.394  21.933 1.00 14.65  ? 90  SER A CB  1 
ATOM   735  O OG  . SER A 1 90  ? 6.206  10.598 21.242 1.00 19.80  ? 90  SER A OG  1 
ATOM   736  N N   . LYS A 1 91  ? 8.940  7.499  23.165 1.00 18.29  ? 91  LYS A N   1 
ATOM   737  C CA  . LYS A 1 91  ? 9.281  6.285  23.880 1.00 20.03  ? 91  LYS A CA  1 
ATOM   738  C C   . LYS A 1 91  ? 10.673 6.316  24.516 1.00 19.04  ? 91  LYS A C   1 
ATOM   739  O O   . LYS A 1 91  ? 10.960 5.549  25.414 1.00 19.75  ? 91  LYS A O   1 
ATOM   740  C CB  . LYS A 1 91  ? 9.211  5.109  22.922 1.00 23.99  ? 91  LYS A CB  1 
ATOM   741  C CG  . LYS A 1 91  ? 8.264  4.050  23.368 1.00 32.37  ? 91  LYS A CG  1 
ATOM   742  C CD  . LYS A 1 91  ? 6.866  4.269  22.862 1.00 36.33  ? 91  LYS A CD  1 
ATOM   743  C CE  . LYS A 1 91  ? 6.001  3.101  23.336 1.00 42.18  ? 91  LYS A CE  1 
ATOM   744  N NZ  . LYS A 1 91  ? 6.190  2.827  24.817 1.00 43.95  ? 91  LYS A NZ  1 
ATOM   745  N N   . HIS A 1 92  ? 11.564 7.164  24.032 1.00 17.95  ? 92  HIS A N   1 
ATOM   746  C CA  . HIS A 1 92  ? 12.907 7.206  24.613 1.00 16.23  ? 92  HIS A CA  1 
ATOM   747  C C   . HIS A 1 92  ? 13.293 8.628  24.983 1.00 15.82  ? 92  HIS A C   1 
ATOM   748  O O   . HIS A 1 92  ? 13.099 9.535  24.173 1.00 15.11  ? 92  HIS A O   1 
ATOM   749  C CB  . HIS A 1 92  ? 13.951 6.732  23.603 1.00 17.33  ? 92  HIS A CB  1 
ATOM   750  C CG  . HIS A 1 92  ? 13.601 5.457  22.898 1.00 18.02  ? 92  HIS A CG  1 
ATOM   751  N ND1 . HIS A 1 92  ? 14.239 4.264  23.167 1.00 14.48  ? 92  HIS A ND1 1 
ATOM   752  C CD2 . HIS A 1 92  ? 12.721 5.199  21.898 1.00 16.37  ? 92  HIS A CD2 1 
ATOM   753  C CE1 . HIS A 1 92  ? 13.764 3.329  22.363 1.00 17.09  ? 92  HIS A CE1 1 
ATOM   754  N NE2 . HIS A 1 92  ? 12.841 3.868  21.583 1.00 14.80  ? 92  HIS A NE2 1 
ATOM   755  N N   . ALA A 1 93  ? 13.859 8.825  26.174 1.00 13.06  ? 93  ALA A N   1 
ATOM   756  C CA  . ALA A 1 93  ? 14.305 10.151 26.569 1.00 13.83  ? 93  ALA A CA  1 
ATOM   757  C C   . ALA A 1 93  ? 15.603 10.443 25.803 1.00 16.34  ? 93  ALA A C   1 
ATOM   758  O O   . ALA A 1 93  ? 15.770 11.534 25.243 1.00 14.87  ? 93  ALA A O   1 
ATOM   759  C CB  . ALA A 1 93  ? 14.564 10.216 28.075 1.00 10.91  ? 93  ALA A CB  1 
ATOM   760  N N   . ASP A 1 94  ? 16.504 9.450  25.777 1.00 16.58  ? 94  ASP A N   1 
ATOM   761  C CA  . ASP A 1 94  ? 17.811 9.584  25.142 1.00 16.23  ? 94  ASP A CA  1 
ATOM   762  C C   . ASP A 1 94  ? 18.541 10.843 25.678 1.00 18.50  ? 94  ASP A C   1 
ATOM   763  O O   . ASP A 1 94  ? 18.783 10.954 26.890 1.00 20.76  ? 94  ASP A O   1 
ATOM   764  C CB  . ASP A 1 94  ? 17.667 9.566  23.614 1.00 14.85  ? 94  ASP A CB  1 
ATOM   765  C CG  . ASP A 1 94  ? 17.570 8.132  23.046 1.00 14.94  ? 94  ASP A CG  1 
ATOM   766  O OD1 . ASP A 1 94  ? 17.359 7.181  23.834 1.00 16.98  ? 94  ASP A OD1 1 
ATOM   767  O OD2 . ASP A 1 94  ? 17.711 7.937  21.825 1.00 11.33  ? 94  ASP A OD2 1 
ATOM   768  N N   . GLY A 1 95  ? 18.880 11.795 24.816 1.00 17.96  ? 95  GLY A N   1 
ATOM   769  C CA  . GLY A 1 95  ? 19.552 12.994 25.301 1.00 17.46  ? 95  GLY A CA  1 
ATOM   770  C C   . GLY A 1 95  ? 18.587 14.122 25.634 1.00 17.36  ? 95  GLY A C   1 
ATOM   771  O O   . GLY A 1 95  ? 19.001 15.167 26.117 1.00 17.38  ? 95  GLY A O   1 
ATOM   772  N N   . LEU A 1 96  ? 17.295 13.887 25.404 1.00 17.98  ? 96  LEU A N   1 
ATOM   773  C CA  . LEU A 1 96  ? 16.254 14.871 25.661 1.00 16.10  ? 96  LEU A CA  1 
ATOM   774  C C   . LEU A 1 96  ? 15.935 15.016 27.132 1.00 14.85  ? 96  LEU A C   1 
ATOM   775  O O   . LEU A 1 96  ? 16.122 14.094 27.913 1.00 16.05  ? 96  LEU A O   1 
ATOM   776  C CB  . LEU A 1 96  ? 14.980 14.508 24.901 1.00 16.53  ? 96  LEU A CB  1 
ATOM   777  C CG  . LEU A 1 96  ? 15.042 14.312 23.385 1.00 19.22  ? 96  LEU A CG  1 
ATOM   778  C CD1 . LEU A 1 96  ? 13.598 14.225 22.850 1.00 20.67  ? 96  LEU A CD1 1 
ATOM   779  C CD2 . LEU A 1 96  ? 15.795 15.449 22.685 1.00 16.42  ? 96  LEU A CD2 1 
ATOM   780  N N   . CYS A 1 97  ? 15.390 16.165 27.501 1.00 14.34  ? 97  CYS A N   1 
ATOM   781  C CA  . CYS A 1 97  ? 15.038 16.405 28.881 1.00 12.80  ? 97  CYS A CA  1 
ATOM   782  C C   . CYS A 1 97  ? 13.954 15.449 29.365 1.00 13.50  ? 97  CYS A C   1 
ATOM   783  O O   . CYS A 1 97  ? 13.822 15.183 30.563 1.00 12.78  ? 97  CYS A O   1 
ATOM   784  C CB  . CYS A 1 97  ? 14.617 17.863 29.084 1.00 13.25  ? 97  CYS A CB  1 
ATOM   785  S SG  . CYS A 1 97  ? 13.198 18.424 28.153 1.00 15.61  ? 97  CYS A SG  1 
ATOM   786  N N   . HIS A 1 98  ? 13.200 14.886 28.435 1.00 16.05  ? 98  HIS A N   1 
ATOM   787  C CA  . HIS A 1 98  ? 12.135 13.980 28.812 1.00 14.10  ? 98  HIS A CA  1 
ATOM   788  C C   . HIS A 1 98  ? 11.542 13.432 27.537 1.00 15.83  ? 98  HIS A C   1 
ATOM   789  O O   . HIS A 1 98  ? 11.665 14.049 26.472 1.00 14.42  ? 98  HIS A O   1 
ATOM   790  C CB  . HIS A 1 98  ? 11.075 14.764 29.554 1.00 13.16  ? 98  HIS A CB  1 
ATOM   791  C CG  . HIS A 1 98  ? 10.152 13.915 30.352 1.00 12.29  ? 98  HIS A CG  1 
ATOM   792  N ND1 . HIS A 1 98  ? 9.013  13.350 29.823 1.00 13.65  ? 98  HIS A ND1 1 
ATOM   793  C CD2 . HIS A 1 98  ? 10.211 13.513 31.640 1.00 11.07  ? 98  HIS A CD2 1 
ATOM   794  C CE1 . HIS A 1 98  ? 8.414  12.628 30.752 1.00 14.30  ? 98  HIS A CE1 1 
ATOM   795  N NE2 . HIS A 1 98  ? 9.122  12.711 31.862 1.00 12.69  ? 98  HIS A NE2 1 
ATOM   796  N N   . ARG A 1 99  ? 10.919 12.265 27.640 1.00 17.02  ? 99  ARG A N   1 
ATOM   797  C CA  . ARG A 1 99  ? 10.289 11.654 26.475 1.00 16.64  ? 99  ARG A CA  1 
ATOM   798  C C   . ARG A 1 99  ? 9.082  12.524 26.155 1.00 14.68  ? 99  ARG A C   1 
ATOM   799  O O   . ARG A 1 99  ? 8.527  13.171 27.048 1.00 13.62  ? 99  ARG A O   1 
ATOM   800  C CB  . ARG A 1 99  ? 9.898  10.177 26.763 1.00 15.91  ? 99  ARG A CB  1 
ATOM   801  C CG  . ARG A 1 99  ? 8.515  9.962  27.331 1.00 18.62  ? 99  ARG A CG  1 
ATOM   802  C CD  . ARG A 1 99  ? 8.163  8.487  27.680 1.00 17.47  ? 99  ARG A CD  1 
ATOM   803  N NE  . ARG A 1 99  ? 6.889  8.466  28.404 1.00 14.13  ? 99  ARG A NE  1 
ATOM   804  C CZ  . ARG A 1 99  ? 5.686  8.511  27.829 1.00 16.07  ? 99  ARG A CZ  1 
ATOM   805  N NH1 . ARG A 1 99  ? 5.539  8.541  26.510 1.00 14.70  ? 99  ARG A NH1 1 
ATOM   806  N NH2 . ARG A 1 99  ? 4.617  8.673  28.586 1.00 17.44  ? 99  ARG A NH2 1 
ATOM   807  N N   . LEU A 1 100 ? 8.725  12.593 24.883 1.00 15.19  ? 100 LEU A N   1 
ATOM   808  C CA  . LEU A 1 100 ? 7.583  13.383 24.434 1.00 16.76  ? 100 LEU A CA  1 
ATOM   809  C C   . LEU A 1 100 ? 6.328  12.740 25.008 1.00 19.92  ? 100 LEU A C   1 
ATOM   810  O O   . LEU A 1 100 ? 6.092  11.546 24.816 1.00 22.31  ? 100 LEU A O   1 
ATOM   811  C CB  . LEU A 1 100 ? 7.526  13.427 22.890 1.00 13.24  ? 100 LEU A CB  1 
ATOM   812  C CG  . LEU A 1 100 ? 8.835  13.964 22.297 1.00 11.62  ? 100 LEU A CG  1 
ATOM   813  C CD1 . LEU A 1 100 ? 8.783  14.079 20.793 1.00 6.77   ? 100 LEU A CD1 1 
ATOM   814  C CD2 . LEU A 1 100 ? 9.194  15.306 22.996 1.00 8.69   ? 100 LEU A CD2 1 
ATOM   815  N N   . THR A 1 101 ? 5.544  13.509 25.751 1.00 20.49  ? 101 THR A N   1 
ATOM   816  C CA  . THR A 1 101 ? 4.330  12.968 26.331 1.00 20.46  ? 101 THR A CA  1 
ATOM   817  C C   . THR A 1 101 ? 3.020  13.510 25.738 1.00 21.74  ? 101 THR A C   1 
ATOM   818  O O   . THR A 1 101 ? 2.189  12.755 25.245 1.00 22.38  ? 101 THR A O   1 
ATOM   819  C CB  . THR A 1 101 ? 4.292  13.181 27.848 1.00 18.84  ? 101 THR A CB  1 
ATOM   820  O OG1 . THR A 1 101 ? 4.435  14.582 28.147 1.00 17.94  ? 101 THR A OG1 1 
ATOM   821  C CG2 . THR A 1 101 ? 5.365  12.342 28.553 1.00 12.47  ? 101 THR A CG2 1 
ATOM   822  N N   . THR A 1 102 ? 2.872  14.827 25.733 1.00 22.03  ? 102 THR A N   1 
ATOM   823  C CA  . THR A 1 102 ? 1.646  15.440 25.280 1.00 21.10  ? 102 THR A CA  1 
ATOM   824  C C   . THR A 1 102 ? 1.859  16.656 24.368 1.00 19.57  ? 102 THR A C   1 
ATOM   825  O O   . THR A 1 102 ? 2.722  17.477 24.625 1.00 17.18  ? 102 THR A O   1 
ATOM   826  C CB  . THR A 1 102 ? 0.761  15.785 26.527 1.00 22.80  ? 102 THR A CB  1 
ATOM   827  O OG1 . THR A 1 102 ? 0.164  17.078 26.374 1.00 30.51  ? 102 THR A OG1 1 
ATOM   828  C CG2 . THR A 1 102 ? 1.546  15.743 27.817 1.00 18.86  ? 102 THR A CG2 1 
ATOM   829  N N   . VAL A 1 103 ? 1.081  16.718 23.285 1.00 20.41  ? 103 VAL A N   1 
ATOM   830  C CA  . VAL A 1 103 ? 1.119  17.803 22.307 1.00 20.54  ? 103 VAL A CA  1 
ATOM   831  C C   . VAL A 1 103 ? 0.718  19.094 23.033 1.00 23.16  ? 103 VAL A C   1 
ATOM   832  O O   . VAL A 1 103 ? -0.320 19.145 23.701 1.00 24.01  ? 103 VAL A O   1 
ATOM   833  C CB  . VAL A 1 103 ? 0.108  17.555 21.124 1.00 19.48  ? 103 VAL A CB  1 
ATOM   834  C CG1 . VAL A 1 103 ? 0.040  18.787 20.214 1.00 21.87  ? 103 VAL A CG1 1 
ATOM   835  C CG2 . VAL A 1 103 ? 0.530  16.362 20.290 1.00 20.69  ? 103 VAL A CG2 1 
ATOM   836  N N   . CYS A 1 104 ? 1.543  20.129 22.906 1.00 23.93  ? 104 CYS A N   1 
ATOM   837  C CA  . CYS A 1 104 ? 1.276  21.389 23.567 1.00 24.52  ? 104 CYS A CA  1 
ATOM   838  C C   . CYS A 1 104 ? -0.089 21.948 23.232 1.00 25.02  ? 104 CYS A C   1 
ATOM   839  O O   . CYS A 1 104 ? -0.448 22.164 22.067 1.00 22.58  ? 104 CYS A O   1 
ATOM   840  C CB  . CYS A 1 104 ? 2.335  22.426 23.234 1.00 24.21  ? 104 CYS A CB  1 
ATOM   841  S SG  . CYS A 1 104 ? 2.176  23.935 24.232 1.00 22.13  ? 104 CYS A SG  1 
ATOM   842  N N   . PRO A 1 105 ? -0.880 22.160 24.263 1.00 26.23  ? 105 PRO A N   1 
ATOM   843  C CA  . PRO A 1 105 ? -2.212 22.700 24.066 1.00 31.54  ? 105 PRO A CA  1 
ATOM   844  C C   . PRO A 1 105 ? -2.039 24.108 23.548 1.00 33.86  ? 105 PRO A C   1 
ATOM   845  O O   . PRO A 1 105 ? -1.044 24.781 23.840 1.00 33.24  ? 105 PRO A O   1 
ATOM   846  C CB  . PRO A 1 105 ? -2.787 22.729 25.492 1.00 31.44  ? 105 PRO A CB  1 
ATOM   847  C CG  . PRO A 1 105 ? -2.022 21.668 26.190 1.00 31.48  ? 105 PRO A CG  1 
ATOM   848  C CD  . PRO A 1 105 ? -0.624 21.905 25.683 1.00 29.21  ? 105 PRO A CD  1 
ATOM   849  N N   . THR A 1 106 ? -3.052 24.549 22.822 1.00 38.55  ? 106 THR A N   1 
ATOM   850  C CA  . THR A 1 106 ? -3.117 25.881 22.235 1.00 42.98  ? 106 THR A CA  1 
ATOM   851  C C   . THR A 1 106 ? -3.610 26.936 23.242 1.00 43.84  ? 106 THR A C   1 
ATOM   852  O O   . THR A 1 106 ? -4.694 26.741 23.838 1.00 44.13  ? 106 THR A O   1 
ATOM   853  C CB  . THR A 1 106 ? -4.049 25.840 21.025 1.00 43.82  ? 106 THR A CB  1 
ATOM   854  O OG1 . THR A 1 106 ? -3.395 25.131 19.960 1.00 47.52  ? 106 THR A OG1 1 
ATOM   855  C CG2 . THR A 1 106 ? -4.436 27.218 20.601 1.00 43.98  ? 106 THR A CG2 1 
HETATM 856  C C1  . 772 B 2 .   ? 16.711 31.961 19.477 1.00 67.92  ? 300 772 A C1  1 
HETATM 857  C C2  . 772 B 2 .   ? 17.979 31.847 20.081 1.00 68.12  ? 300 772 A C2  1 
HETATM 858  C C3  . 772 B 2 .   ? 18.893 30.894 19.610 1.00 69.82  ? 300 772 A C3  1 
HETATM 859  C C4  . 772 B 2 .   ? 18.502 30.063 18.452 1.00 69.98  ? 300 772 A C4  1 
HETATM 860  C C5  . 772 B 2 .   ? 17.202 30.180 17.884 1.00 68.01  ? 300 772 A C5  1 
HETATM 861  C C6  . 772 B 2 .   ? 16.298 31.135 18.400 1.00 68.09  ? 300 772 A C6  1 
HETATM 862  C C7  . 772 B 2 .   ? 20.173 30.764 20.187 1.00 69.89  ? 300 772 A C7  1 
HETATM 863  C C8  . 772 B 2 .   ? 21.067 29.865 19.574 1.00 71.19  ? 300 772 A C8  1 
HETATM 864  C C9  . 772 B 2 .   ? 20.687 29.104 18.430 1.00 71.33  ? 300 772 A C9  1 
HETATM 865  N N10 . 772 B 2 .   ? 19.415 29.174 17.886 1.00 70.82  ? 300 772 A N10 1 
HETATM 866  O O11 . 772 B 2 .   ? 16.833 29.238 16.945 1.00 66.41  ? 300 772 A O11 1 
HETATM 867  P P12 . 772 B 2 .   ? 15.783 28.158 17.359 1.00 63.83  ? 300 772 A P12 1 
HETATM 868  O O13 . 772 B 2 .   ? 16.315 26.908 16.721 1.00 62.76  ? 300 772 A O13 1 
HETATM 869  O O14 . 772 B 2 .   ? 14.461 28.610 16.798 1.00 60.31  ? 300 772 A O14 1 
HETATM 870  C C15 . 772 B 2 .   ? 21.679 28.205 17.909 1.00 72.04  ? 300 772 A C15 1 
HETATM 871  N N16 . 772 B 2 .   ? 22.430 27.547 17.545 1.00 74.35  ? 300 772 A N16 1 
HETATM 872  O O17 . 772 B 2 .   ? 15.659 27.996 18.841 1.00 60.54  ? 300 772 A O17 1 
HETATM 873  O O   . HOH C 3 .   ? 4.966  13.544 32.007 1.00 13.97  ? 301 HOH A O   1 
HETATM 874  O O   . HOH C 3 .   ? 15.519 16.218 32.553 1.00 23.14  ? 302 HOH A O   1 
HETATM 875  O O   . HOH C 3 .   ? 18.780 9.751  20.475 1.00 21.12  ? 303 HOH A O   1 
HETATM 876  O O   . HOH C 3 .   ? 5.200  33.560 17.359 1.00 25.40  ? 304 HOH A O   1 
HETATM 877  O O   . HOH C 3 .   ? 6.906  20.310 31.908 1.00 18.58  ? 305 HOH A O   1 
HETATM 878  O O   . HOH C 3 .   ? 5.411  20.590 34.663 1.00 18.67  ? 306 HOH A O   1 
HETATM 879  O O   . HOH C 3 .   ? 0.173  12.706 15.546 1.00 23.83  ? 307 HOH A O   1 
HETATM 880  O O   . HOH C 3 .   ? 14.938 33.755 19.733 1.00 47.07  ? 308 HOH A O   1 
HETATM 881  O O   . HOH C 3 .   ? 20.317 18.856 16.454 1.00 31.89  ? 309 HOH A O   1 
HETATM 882  O O   . HOH C 3 .   ? 16.506 34.496 16.439 1.00 25.02  ? 310 HOH A O   1 
HETATM 883  O O   . HOH C 3 .   ? 20.444 5.029  17.344 1.00 29.04  ? 311 HOH A O   1 
HETATM 884  O O   . HOH C 3 .   ? 18.112 4.300  18.698 1.00 29.39  ? 312 HOH A O   1 
HETATM 885  O O   . HOH C 3 .   ? 5.890  6.052  20.475 1.00 26.33  ? 313 HOH A O   1 
HETATM 886  O O   . HOH C 3 .   ? 21.121 8.598  20.004 1.00 23.50  ? 314 HOH A O   1 
HETATM 887  O O   . HOH C 3 .   ? 18.801 16.130 28.815 1.00 26.11  ? 315 HOH A O   1 
HETATM 888  O O   . HOH C 3 .   ? 3.435  31.404 29.846 1.00 24.51  ? 316 HOH A O   1 
HETATM 889  O O   . HOH C 3 .   ? 3.061  11.408 20.982 1.00 21.53  ? 317 HOH A O   1 
HETATM 890  O O   . HOH C 3 .   ? 12.701 28.098 29.806 1.00 6.53   ? 318 HOH A O   1 
HETATM 891  O O   . HOH C 3 .   ? 9.657  32.805 27.263 1.00 38.50  ? 319 HOH A O   1 
HETATM 892  O O   . HOH C 3 .   ? 7.417  33.812 27.456 1.00 20.02  ? 320 HOH A O   1 
HETATM 893  O O   . HOH C 3 .   ? 10.637 30.162 14.470 1.00 17.44  ? 321 HOH A O   1 
HETATM 894  O O   . HOH C 3 .   ? 3.464  10.612 23.325 1.00 59.72  ? 322 HOH A O   1 
HETATM 895  O O   . HOH C 3 .   ? 18.751 33.897 17.655 1.00 26.62  ? 323 HOH A O   1 
HETATM 896  O O   . HOH C 3 .   ? 9.881  31.233 12.284 1.00 33.39  ? 324 HOH A O   1 
HETATM 897  O O   . HOH C 3 .   ? 11.439 30.182 10.335 1.00 28.70  ? 325 HOH A O   1 
HETATM 898  O O   . HOH C 3 .   ? 14.544 18.124 35.074 1.00 64.45  ? 326 HOH A O   1 
HETATM 899  O O   . HOH C 3 .   ? 16.168 29.327 25.932 1.00 63.01  ? 327 HOH A O   1 
HETATM 900  O O   . HOH C 3 .   ? -1.806 14.575 20.798 1.00 45.11  ? 328 HOH A O   1 
HETATM 901  O O   . HOH C 3 .   ? 5.021  35.277 21.882 1.00 37.64  ? 329 HOH A O   1 
HETATM 902  O O   . HOH C 3 .   ? -0.378 26.083 26.275 1.00 31.21  ? 330 HOH A O   1 
HETATM 903  O O   . HOH C 3 .   ? 0.409  29.107 28.840 1.00 50.24  ? 331 HOH A O   1 
HETATM 904  O O   . HOH C 3 .   ? 11.775 28.813 33.479 1.00 43.00  ? 332 HOH A O   1 
HETATM 905  O O   . HOH C 3 .   ? 2.648  11.519 13.988 1.00 40.56  ? 333 HOH A O   1 
HETATM 906  O O   . HOH C 3 .   ? -0.529 21.962 12.100 1.00 32.20  ? 334 HOH A O   1 
HETATM 907  O O   . HOH C 3 .   ? 10.202 3.641  7.479  1.00 57.55  ? 335 HOH A O   1 
HETATM 908  O O   . HOH C 3 .   ? 15.198 20.829 31.269 1.00 26.10  ? 336 HOH A O   1 
HETATM 909  O O   . HOH C 3 .   ? 8.451  8.593  31.233 1.00 32.41  ? 337 HOH A O   1 
HETATM 910  O O   . HOH C 3 .   ? 21.739 20.476 14.534 1.00 44.51  ? 338 HOH A O   1 
HETATM 911  O O   . HOH C 3 .   ? 16.028 26.600 27.102 1.00 29.80  ? 339 HOH A O   1 
HETATM 912  O O   . HOH C 3 .   ? -3.705 23.114 30.381 1.00 33.64  ? 340 HOH A O   1 
HETATM 913  O O   . HOH C 3 .   ? 4.128  10.315 15.966 1.00 38.44  ? 341 HOH A O   1 
HETATM 914  O O   . HOH C 3 .   ? 22.797 20.195 12.057 1.00 53.31  ? 342 HOH A O   1 
HETATM 915  O O   . HOH C 3 .   ? -1.241 14.783 23.796 1.00 59.83  ? 343 HOH A O   1 
HETATM 916  O O   . HOH C 3 .   ? 0.239  28.285 34.900 1.00 38.49  ? 344 HOH A O   1 
HETATM 917  O O   . HOH C 3 .   ? 15.774 24.880 30.533 1.00 38.04  ? 345 HOH A O   1 
HETATM 918  O O   . HOH C 3 .   ? -3.878 16.445 20.203 1.00 49.93  ? 346 HOH A O   1 
HETATM 919  O O   . HOH C 3 .   ? -2.606 21.171 19.319 1.00 28.85  ? 347 HOH A O   1 
HETATM 920  O O   . HOH C 3 .   ? 27.621 11.756 18.392 1.00 37.55  ? 348 HOH A O   1 
HETATM 921  O O   . HOH C 3 .   ? 5.713  8.645  31.504 1.00 31.21  ? 349 HOH A O   1 
HETATM 922  O O   . HOH C 3 .   ? 5.406  6.888  12.058 1.00 54.43  ? 350 HOH A O   1 
HETATM 923  O O   . HOH C 3 .   ? 18.563 24.889 20.797 1.00 48.18  ? 351 HOH A O   1 
HETATM 924  O O   . HOH C 3 .   ? -3.488 18.748 24.261 1.00 56.94  ? 352 HOH A O   1 
HETATM 925  O O   . HOH C 3 .   ? 30.070 8.083  19.920 1.00 46.24  ? 353 HOH A O   1 
HETATM 926  O O   . HOH C 3 .   ? 20.235 15.632 21.782 1.00 43.86  ? 354 HOH A O   1 
HETATM 927  O O   . HOH C 3 .   ? 18.066 35.526 25.947 1.00 43.22  ? 355 HOH A O   1 
HETATM 928  O O   . HOH C 3 .   ? 27.162 10.028 12.230 1.00 35.22  ? 356 HOH A O   1 
HETATM 929  O O   . HOH C 3 .   ? 0.684  24.855 11.208 1.00 34.71  ? 357 HOH A O   1 
HETATM 930  O O   . HOH C 3 .   ? 10.820 10.563 32.905 1.00 64.52  ? 358 HOH A O   1 
HETATM 931  O O   . HOH C 3 .   ? 19.031 22.528 24.713 1.00 76.80  ? 359 HOH A O   1 
HETATM 932  O O   . HOH C 3 .   ? 2.658  33.993 13.024 1.00 70.23  ? 360 HOH A O   1 
HETATM 933  O O   . HOH C 3 .   ? 0.878  30.527 33.419 1.00 82.04  ? 361 HOH A O   1 
HETATM 934  O O   . HOH C 3 .   ? 19.474 12.400 22.001 1.00 24.66  ? 362 HOH A O   1 
HETATM 935  O O   . HOH C 3 .   ? 24.463 7.408  10.629 1.00 38.96  ? 363 HOH A O   1 
HETATM 936  O O   . HOH C 3 .   ? 2.177  33.597 29.384 1.00 77.09  ? 364 HOH A O   1 
HETATM 937  O O   . HOH C 3 .   ? 2.249  32.953 17.263 1.00 36.28  ? 365 HOH A O   1 
HETATM 938  O O   . HOH C 3 .   ? 8.918  9.714  4.320  1.00 90.50  ? 366 HOH A O   1 
HETATM 939  O O   . HOH C 3 .   ? -1.768 24.293 29.027 1.00 60.85  ? 367 HOH A O   1 
HETATM 940  O O   . HOH C 3 .   ? -5.165 19.029 19.139 1.00 64.41  ? 368 HOH A O   1 
HETATM 941  O O   . HOH C 3 .   ? 0.187  29.837 18.345 1.00 33.03  ? 369 HOH A O   1 
HETATM 942  O O   . HOH C 3 .   ? -7.173 25.981 23.351 1.00 57.65  ? 370 HOH A O   1 
HETATM 943  O O   . HOH C 3 .   ? 10.487 30.177 6.731  1.00 37.15  ? 371 HOH A O   1 
HETATM 944  O O   . HOH C 3 .   ? -4.637 27.156 31.261 1.00 42.16  ? 372 HOH A O   1 
HETATM 945  O O   . HOH C 3 .   ? -5.182 22.979 21.981 1.00 36.41  ? 373 HOH A O   1 
HETATM 946  O O   . HOH C 3 .   ? -0.587 25.482 13.843 1.00 98.18  ? 374 HOH A O   1 
HETATM 947  O O   . HOH C 3 .   ? 5.284  36.368 24.386 1.00 49.09  ? 375 HOH A O   1 
HETATM 948  O O   . HOH C 3 .   ? 21.418 33.166 16.082 1.00 66.90  ? 376 HOH A O   1 
HETATM 949  O O   . HOH C 3 .   ? 16.954 22.465 32.235 1.00 100.00 ? 377 HOH A O   1 
HETATM 950  O O   . HOH C 3 .   ? 10.484 17.325 41.667 1.00 50.66  ? 378 HOH A O   1 
HETATM 951  O O   . HOH C 3 .   ? 6.577  29.779 6.866  1.00 36.68  ? 379 HOH A O   1 
HETATM 952  O O   . HOH C 3 .   ? 9.806  27.128 5.749  1.00 56.90  ? 380 HOH A O   1 
HETATM 953  O O   . HOH C 3 .   ? 20.047 20.149 26.155 1.00 29.85  ? 381 HOH A O   1 
HETATM 954  O O   . HOH C 3 .   ? -2.230 27.342 33.890 1.00 46.34  ? 382 HOH A O   1 
HETATM 955  O O   . HOH C 3 .   ? 29.411 7.039  14.059 1.00 82.26  ? 383 HOH A O   1 
HETATM 956  O O   . HOH C 3 .   ? 16.875 26.181 43.205 1.00 59.58  ? 384 HOH A O   1 
HETATM 957  O O   . HOH C 3 .   ? 20.609 6.268  12.471 1.00 20.58  ? 385 HOH A O   1 
HETATM 958  O O   . HOH C 3 .   ? 19.871 30.137 25.218 1.00 60.06  ? 386 HOH A O   1 
HETATM 959  O O   . HOH C 3 .   ? 20.511 22.127 27.693 1.00 55.31  ? 387 HOH A O   1 
HETATM 960  O O   . HOH C 3 .   ? 18.226 18.297 27.428 1.00 40.41  ? 388 HOH A O   1 
HETATM 961  O O   . HOH C 3 .   ? 17.310 5.074  25.188 1.00 54.34  ? 389 HOH A O   1 
HETATM 962  O O   . HOH C 3 .   ? 4.034  22.202 36.304 1.00 25.17  ? 390 HOH A O   1 
HETATM 963  O O   . HOH C 3 .   ? -6.106 23.317 18.943 1.00 67.34  ? 391 HOH A O   1 
HETATM 964  O O   . HOH C 3 .   ? -0.397 19.652 28.406 1.00 43.69  ? 392 HOH A O   1 
HETATM 965  O O   . HOH C 3 .   ? 0.298  34.591 27.832 1.00 56.51  ? 393 HOH A O   1 
HETATM 966  O O   . HOH C 3 .   ? 19.138 20.742 19.715 1.00 51.29  ? 394 HOH A O   1 
HETATM 967  O O   . HOH C 3 .   ? 8.119  11.524 34.300 1.00 41.13  ? 395 HOH A O   1 
HETATM 968  O O   . HOH C 3 .   ? 3.470  27.832 9.511  1.00 36.00  ? 396 HOH A O   1 
HETATM 969  O O   . HOH C 3 .   ? 5.569  26.016 8.569  1.00 29.40  ? 397 HOH A O   1 
HETATM 970  O O   . HOH C 3 .   ? 5.278  34.992 11.195 1.00 34.93  ? 398 HOH A O   1 
HETATM 971  O O   . HOH C 3 .   ? 7.540  26.062 38.051 1.00 54.50  ? 399 HOH A O   1 
HETATM 972  O O   . HOH C 3 .   ? 14.332 4.999  11.808 1.00 20.72  ? 400 HOH A O   1 
HETATM 973  O O   . HOH C 3 .   ? -1.291 29.518 26.778 1.00 73.15  ? 401 HOH A O   1 
HETATM 974  O O   . HOH C 3 .   ? -2.480 18.782 33.487 1.00 21.27  ? 402 HOH A O   1 
HETATM 975  O O   . HOH C 3 .   ? 14.221 20.673 34.581 1.00 27.08  ? 403 HOH A O   1 
HETATM 976  O O   . HOH C 3 .   ? 13.142 17.034 41.093 1.00 29.25  ? 404 HOH A O   1 
HETATM 977  O O   . HOH C 3 .   ? 17.481 24.786 24.903 1.00 15.63  ? 405 HOH A O   1 
HETATM 978  O O   . HOH C 3 .   ? 17.988 11.846 16.399 1.00 5.41   ? 406 HOH A O   1 
HETATM 979  O O   . HOH C 3 .   ? 8.095  13.909 7.494  1.00 23.88  ? 407 HOH A O   1 
HETATM 980  O O   . HOH C 3 .   ? 18.284 13.095 28.779 1.00 18.84  ? 408 HOH A O   1 
HETATM 981  O O   . HOH C 3 .   ? 12.065 22.832 6.333  1.00 50.82  ? 409 HOH A O   1 
HETATM 982  O O   . HOH C 3 .   ? 0.896  28.507 15.723 1.00 51.82  ? 410 HOH A O   1 
HETATM 983  O O   . HOH C 3 .   ? 1.502  30.040 12.623 1.00 48.55  ? 411 HOH A O   1 
HETATM 984  O O   . HOH C 3 .   ? 5.412  35.442 27.018 1.00 54.90  ? 412 HOH A O   1 
HETATM 985  O O   . HOH C 3 .   ? 8.052  29.440 3.453  1.00 49.61  ? 413 HOH A O   1 
HETATM 986  O O   . HOH C 3 .   ? -5.248 24.572 37.015 1.00 50.87  ? 414 HOH A O   1 
HETATM 987  O O   . HOH C 3 .   ? 12.621 25.817 8.870  1.00 95.70  ? 415 HOH A O   1 
HETATM 988  O O   . HOH C 3 .   ? 18.687 20.293 8.332  1.00 41.13  ? 416 HOH A O   1 
HETATM 989  O O   . HOH C 3 .   ? 14.183 27.815 35.280 1.00 38.59  ? 417 HOH A O   1 
HETATM 990  O O   . HOH C 3 .   ? 19.968 20.487 22.305 1.00 88.03  ? 418 HOH A O   1 
HETATM 991  O O   . HOH C 3 .   ? 22.610 22.538 16.354 1.00 63.76  ? 419 HOH A O   1 
HETATM 992  O O   . HOH C 3 .   ? 12.514 5.822  10.077 1.00 15.56  ? 420 HOH A O   1 
HETATM 993  O O   . HOH C 3 .   ? 16.678 24.686 19.023 1.00 96.78  ? 421 HOH A O   1 
HETATM 994  O O   . HOH C 3 .   ? 8.784  13.348 36.538 1.00 30.28  ? 422 HOH A O   1 
HETATM 995  O O   . HOH C 3 .   ? -2.959 30.854 24.084 1.00 41.20  ? 423 HOH A O   1 
HETATM 996  O O   . HOH C 3 .   ? 12.832 30.255 28.684 1.00 65.17  ? 424 HOH A O   1 
HETATM 997  O O   . HOH C 3 .   ? 4.707  9.991  6.799  1.00 39.59  ? 425 HOH A O   1 
HETATM 998  O O   . HOH C 3 .   ? 15.003 29.160 8.972  1.00 40.96  ? 426 HOH A O   1 
HETATM 999  O O   . HOH C 3 .   ? 3.716  30.650 7.989  1.00 68.96  ? 427 HOH A O   1 
HETATM 1000 O O   . HOH C 3 .   ? 9.027  8.595  33.974 1.00 54.18  ? 428 HOH A O   1 
HETATM 1001 O O   . HOH C 3 .   ? 21.302 33.835 13.231 1.00 38.94  ? 429 HOH A O   1 
HETATM 1002 O O   . HOH C 3 .   ? 17.823 2.729  26.044 1.00 29.14  ? 430 HOH A O   1 
HETATM 1003 O O   . HOH C 3 .   ? 15.048 27.550 31.153 1.00 55.22  ? 431 HOH A O   1 
HETATM 1004 O O   . HOH C 3 .   ? 1.782  31.958 9.914  1.00 59.09  ? 432 HOH A O   1 
HETATM 1005 O O   . HOH C 3 .   ? 2.851  34.235 10.287 1.00 29.87  ? 433 HOH A O   1 
HETATM 1006 O O   . HOH C 3 .   ? 5.926  26.693 1.346  1.00 86.77  ? 434 HOH A O   1 
HETATM 1007 O O   . HOH C 3 .   ? -2.482 27.721 38.670 1.00 54.11  ? 435 HOH A O   1 
HETATM 1008 O O   . HOH C 3 .   ? 22.170 14.243 23.026 1.00 82.77  ? 436 HOH A O   1 
HETATM 1009 O O   . HOH C 3 .   ? -1.630 24.178 15.944 1.00 24.26  ? 437 HOH A O   1 
HETATM 1010 O O   . HOH C 3 .   ? 2.097  24.582 8.721  1.00 69.51  ? 438 HOH A O   1 
HETATM 1011 O O   . HOH C 3 .   ? 1.132  33.991 15.083 1.00 100.00 ? 439 HOH A O   1 
HETATM 1012 O O   . HOH C 3 .   ? -1.749 33.509 14.797 1.00 63.33  ? 440 HOH A O   1 
HETATM 1013 O O   . HOH C 3 .   ? -1.364 29.588 20.670 1.00 62.98  ? 441 HOH A O   1 
HETATM 1014 O O   . HOH C 3 .   ? 4.812  26.637 4.105  1.00 91.49  ? 442 HOH A O   1 
HETATM 1015 O O   . HOH C 3 .   ? 5.327  29.269 3.806  1.00 66.88  ? 443 HOH A O   1 
HETATM 1016 O O   . HOH C 3 .   ? 13.198 29.187 6.652  1.00 71.13  ? 444 HOH A O   1 
HETATM 1017 O O   . HOH C 3 .   ? 10.708 24.877 7.167  1.00 69.49  ? 445 HOH A O   1 
HETATM 1018 O O   . HOH C 3 .   ? 6.876  33.651 30.042 1.00 76.46  ? 446 HOH A O   1 
HETATM 1019 O O   . HOH C 3 .   ? 3.555  36.437 28.823 1.00 54.59  ? 447 HOH A O   1 
HETATM 1020 O O   . HOH C 3 .   ? 10.628 33.532 29.583 1.00 57.80  ? 448 HOH A O   1 
HETATM 1021 O O   . HOH C 3 .   ? 15.073 32.874 28.105 1.00 59.90  ? 449 HOH A O   1 
HETATM 1022 O O   . HOH C 3 .   ? 25.431 7.669  8.091  1.00 75.89  ? 450 HOH A O   1 
HETATM 1023 O O   . HOH C 3 .   ? -2.886 30.405 34.985 1.00 56.85  ? 451 HOH A O   1 
HETATM 1024 O O   . HOH C 3 .   ? -4.137 28.054 35.893 1.00 100.00 ? 452 HOH A O   1 
HETATM 1025 O O   . HOH C 3 .   ? 19.518 27.872 36.642 1.00 53.06  ? 453 HOH A O   1 
HETATM 1026 O O   . HOH C 3 .   ? 19.827 25.465 29.977 1.00 100.00 ? 454 HOH A O   1 
HETATM 1027 O O   . HOH C 3 .   ? 20.034 24.620 26.767 1.00 41.25  ? 455 HOH A O   1 
HETATM 1028 O O   . HOH C 3 .   ? 21.296 20.165 6.133  1.00 79.72  ? 456 HOH A O   1 
HETATM 1029 O O   . HOH C 3 .   ? 8.605  12.971 4.758  1.00 48.81  ? 457 HOH A O   1 
HETATM 1030 O O   . HOH C 3 .   ? 5.223  8.667  9.260  1.00 71.19  ? 458 HOH A O   1 
HETATM 1031 O O   . HOH C 3 .   ? -2.722 18.152 27.866 1.00 70.78  ? 459 HOH A O   1 
HETATM 1032 O O   . HOH C 3 .   ? -0.615 13.196 26.060 1.00 39.18  ? 460 HOH A O   1 
HETATM 1033 O O   . HOH C 3 .   ? 16.647 28.924 44.713 1.00 49.63  ? 461 HOH A O   1 
HETATM 1034 O O   . HOH C 3 .   ? 10.779 28.538 37.400 1.00 33.95  ? 462 HOH A O   1 
HETATM 1035 O O   . HOH C 3 .   ? 18.756 32.840 24.994 1.00 50.50  ? 463 HOH A O   1 
HETATM 1036 O O   . HOH C 3 .   ? 25.741 12.464 8.569  1.00 47.88  ? 464 HOH A O   1 
HETATM 1037 O O   . HOH C 3 .   ? 22.505 16.552 2.051  1.00 75.46  ? 465 HOH A O   1 
HETATM 1038 O O   . HOH C 3 .   ? 26.407 6.675  12.288 1.00 67.88  ? 466 HOH A O   1 
HETATM 1039 O O   . HOH C 3 .   ? 23.313 19.295 21.318 1.00 50.50  ? 467 HOH A O   1 
HETATM 1040 O O   . HOH C 3 .   ? 17.986 28.605 14.856 1.00 76.73  ? 468 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   1   SER SER A . n 
A 1 2   ILE 2   2   2   ILE ILE A . n 
A 1 3   GLN 3   3   3   GLN GLN A . n 
A 1 4   ALA 4   4   4   ALA ALA A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   TRP 7   7   7   TRP TRP A . n 
A 1 8   TYR 8   8   8   TYR TYR A . n 
A 1 9   PHE 9   9   9   PHE PHE A . n 
A 1 10  GLY 10  10  10  GLY GLY A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  ILE 12  12  12  ILE ILE A . n 
A 1 13  THR 13  13  13  THR THR A . n 
A 1 14  ARG 14  14  14  ARG ARG A . n 
A 1 15  ARG 15  15  15  ARG ARG A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  GLU 18  18  18  GLU GLU A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  ASN 23  23  23  ASN ASN A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  ASN 26  26  26  ASN ASN A . n 
A 1 27  PRO 27  27  27  PRO PRO A . n 
A 1 28  ARG 28  28  28  ARG ARG A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  PHE 31  31  31  PHE PHE A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  ARG 34  34  34  ARG ARG A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  THR 38  38  38  THR THR A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  LYS 40  40  40  LYS LYS A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  TYR 43  43  43  TYR TYR A . n 
A 1 44  CYS 44  44  44  CYS CYS A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  SER 48  48  48  SER SER A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  ASP 51  51  51  ASP ASP A . n 
A 1 52  ASN 52  52  52  ASN ASN A . n 
A 1 53  ALA 53  53  53  ALA ALA A . n 
A 1 54  LYS 54  54  54  LYS LYS A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  HIS 60  60  60  HIS HIS A . n 
A 1 61  TYR 61  61  61  TYR TYR A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  ILE 63  63  63  ILE ILE A . n 
A 1 64  ARG 64  64  64  ARG ARG A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  SER 68  68  68  SER SER A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  PHE 71  71  71  PHE PHE A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  ARG 76  76  76  ARG ARG A . n 
A 1 77  THR 77  77  77  THR THR A . n 
A 1 78  GLN 78  78  78  GLN GLN A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  GLN 83  83  83  GLN GLN A . n 
A 1 84  GLN 84  84  84  GLN GLN A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  VAL 86  86  86  VAL VAL A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  TYR 89  89  89  TYR TYR A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  HIS 92  92  92  HIS HIS A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  ASP 94  94  94  ASP ASP A . n 
A 1 95  GLY 95  95  95  GLY GLY A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  CYS 97  97  97  CYS CYS A . n 
A 1 98  HIS 98  98  98  HIS HIS A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 THR 101 101 101 THR THR A . n 
A 1 102 THR 102 102 102 THR THR A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 CYS 104 104 104 CYS CYS A . n 
A 1 105 PRO 105 105 105 PRO PRO A . n 
A 1 106 THR 106 106 106 THR THR A . n 
A 1 107 SER 107 107 ?   ?   ?   A . n 
A 1 108 LYS 108 108 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-02-17 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
XDS    'data scaling'   .     ? 1 
XDS    'data reduction' .     ? 2 
X-PLOR 'model building' 3.851 ? 3 
X-PLOR refinement       3.851 ? 4 
X-PLOR phasing          3.851 ? 5 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASP 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     94 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             52.59 
_pdbx_validate_torsion.psi             -119.96 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 107 ? A SER 107 
2 1 Y 1 A LYS 108 ? A LYS 108 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '2-CYANOQUINOLIN-8-YL DIHYDROGEN PHOSPHATE' 772 
3 water                                       HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 772 1   300 1   772 INH A . 
C 3 HOH 1   301 1   HOH HOH A . 
C 3 HOH 2   302 2   HOH HOH A . 
C 3 HOH 3   303 3   HOH HOH A . 
C 3 HOH 4   304 4   HOH HOH A . 
C 3 HOH 5   305 5   HOH HOH A . 
C 3 HOH 6   306 6   HOH HOH A . 
C 3 HOH 7   307 7   HOH HOH A . 
C 3 HOH 8   308 8   HOH HOH A . 
C 3 HOH 9   309 9   HOH HOH A . 
C 3 HOH 10  310 10  HOH HOH A . 
C 3 HOH 11  311 11  HOH HOH A . 
C 3 HOH 12  312 12  HOH HOH A . 
C 3 HOH 13  313 13  HOH HOH A . 
C 3 HOH 14  314 14  HOH HOH A . 
C 3 HOH 15  315 15  HOH HOH A . 
C 3 HOH 16  316 16  HOH HOH A . 
C 3 HOH 17  317 17  HOH HOH A . 
C 3 HOH 18  318 18  HOH HOH A . 
C 3 HOH 19  319 19  HOH HOH A . 
C 3 HOH 20  320 20  HOH HOH A . 
C 3 HOH 21  321 21  HOH HOH A . 
C 3 HOH 22  322 22  HOH HOH A . 
C 3 HOH 23  323 23  HOH HOH A . 
C 3 HOH 24  324 24  HOH HOH A . 
C 3 HOH 25  325 25  HOH HOH A . 
C 3 HOH 26  326 26  HOH HOH A . 
C 3 HOH 27  327 27  HOH HOH A . 
C 3 HOH 28  328 28  HOH HOH A . 
C 3 HOH 29  329 30  HOH HOH A . 
C 3 HOH 30  330 31  HOH HOH A . 
C 3 HOH 31  331 32  HOH HOH A . 
C 3 HOH 32  332 33  HOH HOH A . 
C 3 HOH 33  333 34  HOH HOH A . 
C 3 HOH 34  334 35  HOH HOH A . 
C 3 HOH 35  335 36  HOH HOH A . 
C 3 HOH 36  336 37  HOH HOH A . 
C 3 HOH 37  337 39  HOH HOH A . 
C 3 HOH 38  338 40  HOH HOH A . 
C 3 HOH 39  339 41  HOH HOH A . 
C 3 HOH 40  340 42  HOH HOH A . 
C 3 HOH 41  341 43  HOH HOH A . 
C 3 HOH 42  342 44  HOH HOH A . 
C 3 HOH 43  343 45  HOH HOH A . 
C 3 HOH 44  344 46  HOH HOH A . 
C 3 HOH 45  345 47  HOH HOH A . 
C 3 HOH 46  346 48  HOH HOH A . 
C 3 HOH 47  347 49  HOH HOH A . 
C 3 HOH 48  348 50  HOH HOH A . 
C 3 HOH 49  349 51  HOH HOH A . 
C 3 HOH 50  350 52  HOH HOH A . 
C 3 HOH 51  351 53  HOH HOH A . 
C 3 HOH 52  352 54  HOH HOH A . 
C 3 HOH 53  353 55  HOH HOH A . 
C 3 HOH 54  354 56  HOH HOH A . 
C 3 HOH 55  355 57  HOH HOH A . 
C 3 HOH 56  356 58  HOH HOH A . 
C 3 HOH 57  357 59  HOH HOH A . 
C 3 HOH 58  358 60  HOH HOH A . 
C 3 HOH 59  359 61  HOH HOH A . 
C 3 HOH 60  360 62  HOH HOH A . 
C 3 HOH 61  361 64  HOH HOH A . 
C 3 HOH 62  362 65  HOH HOH A . 
C 3 HOH 63  363 66  HOH HOH A . 
C 3 HOH 64  364 67  HOH HOH A . 
C 3 HOH 65  365 68  HOH HOH A . 
C 3 HOH 66  366 69  HOH HOH A . 
C 3 HOH 67  367 70  HOH HOH A . 
C 3 HOH 68  368 71  HOH HOH A . 
C 3 HOH 69  369 72  HOH HOH A . 
C 3 HOH 70  370 73  HOH HOH A . 
C 3 HOH 71  371 74  HOH HOH A . 
C 3 HOH 72  372 75  HOH HOH A . 
C 3 HOH 73  373 76  HOH HOH A . 
C 3 HOH 74  374 77  HOH HOH A . 
C 3 HOH 75  375 78  HOH HOH A . 
C 3 HOH 76  376 79  HOH HOH A . 
C 3 HOH 77  377 80  HOH HOH A . 
C 3 HOH 78  378 81  HOH HOH A . 
C 3 HOH 79  379 82  HOH HOH A . 
C 3 HOH 80  380 83  HOH HOH A . 
C 3 HOH 81  381 84  HOH HOH A . 
C 3 HOH 82  382 85  HOH HOH A . 
C 3 HOH 83  383 86  HOH HOH A . 
C 3 HOH 84  384 87  HOH HOH A . 
C 3 HOH 85  385 89  HOH HOH A . 
C 3 HOH 86  386 90  HOH HOH A . 
C 3 HOH 87  387 91  HOH HOH A . 
C 3 HOH 88  388 92  HOH HOH A . 
C 3 HOH 89  389 93  HOH HOH A . 
C 3 HOH 90  390 94  HOH HOH A . 
C 3 HOH 91  391 95  HOH HOH A . 
C 3 HOH 92  392 96  HOH HOH A . 
C 3 HOH 93  393 98  HOH HOH A . 
C 3 HOH 94  394 99  HOH HOH A . 
C 3 HOH 95  395 100 HOH HOH A . 
C 3 HOH 96  396 101 HOH HOH A . 
C 3 HOH 97  397 102 HOH HOH A . 
C 3 HOH 98  398 103 HOH HOH A . 
C 3 HOH 99  399 104 HOH HOH A . 
C 3 HOH 100 400 105 HOH HOH A . 
C 3 HOH 101 401 106 HOH HOH A . 
C 3 HOH 102 402 107 HOH HOH A . 
C 3 HOH 103 403 108 HOH HOH A . 
C 3 HOH 104 404 109 HOH HOH A . 
C 3 HOH 105 405 110 HOH HOH A . 
C 3 HOH 106 406 111 HOH HOH A . 
C 3 HOH 107 407 112 HOH HOH A . 
C 3 HOH 108 408 114 HOH HOH A . 
C 3 HOH 109 409 115 HOH HOH A . 
C 3 HOH 110 410 116 HOH HOH A . 
C 3 HOH 111 411 117 HOH HOH A . 
C 3 HOH 112 412 118 HOH HOH A . 
C 3 HOH 113 413 119 HOH HOH A . 
C 3 HOH 114 414 120 HOH HOH A . 
C 3 HOH 115 415 122 HOH HOH A . 
C 3 HOH 116 416 123 HOH HOH A . 
C 3 HOH 117 417 124 HOH HOH A . 
C 3 HOH 118 418 126 HOH HOH A . 
C 3 HOH 119 419 127 HOH HOH A . 
C 3 HOH 120 420 128 HOH HOH A . 
C 3 HOH 121 421 130 HOH HOH A . 
C 3 HOH 122 422 132 HOH HOH A . 
C 3 HOH 123 423 133 HOH HOH A . 
C 3 HOH 124 424 136 HOH HOH A . 
C 3 HOH 125 425 137 HOH HOH A . 
C 3 HOH 126 426 141 HOH HOH A . 
C 3 HOH 127 427 148 HOH HOH A . 
C 3 HOH 128 428 149 HOH HOH A . 
C 3 HOH 129 429 150 HOH HOH A . 
C 3 HOH 130 430 151 HOH HOH A . 
C 3 HOH 131 431 152 HOH HOH A . 
C 3 HOH 132 432 153 HOH HOH A . 
C 3 HOH 133 433 154 HOH HOH A . 
C 3 HOH 134 434 155 HOH HOH A . 
C 3 HOH 135 435 156 HOH HOH A . 
C 3 HOH 136 436 157 HOH HOH A . 
C 3 HOH 137 437 160 HOH HOH A . 
C 3 HOH 138 438 161 HOH HOH A . 
C 3 HOH 139 439 162 HOH HOH A . 
C 3 HOH 140 440 163 HOH HOH A . 
C 3 HOH 141 441 164 HOH HOH A . 
C 3 HOH 142 442 165 HOH HOH A . 
C 3 HOH 143 443 166 HOH HOH A . 
C 3 HOH 144 444 167 HOH HOH A . 
C 3 HOH 145 445 168 HOH HOH A . 
C 3 HOH 146 446 169 HOH HOH A . 
C 3 HOH 147 447 170 HOH HOH A . 
C 3 HOH 148 448 171 HOH HOH A . 
C 3 HOH 149 449 172 HOH HOH A . 
C 3 HOH 150 450 173 HOH HOH A . 
C 3 HOH 151 451 174 HOH HOH A . 
C 3 HOH 152 452 175 HOH HOH A . 
C 3 HOH 153 453 177 HOH HOH A . 
C 3 HOH 154 454 178 HOH HOH A . 
C 3 HOH 155 455 179 HOH HOH A . 
C 3 HOH 156 456 180 HOH HOH A . 
C 3 HOH 157 457 181 HOH HOH A . 
C 3 HOH 158 458 182 HOH HOH A . 
C 3 HOH 159 459 184 HOH HOH A . 
C 3 HOH 160 460 185 HOH HOH A . 
C 3 HOH 161 461 186 HOH HOH A . 
C 3 HOH 162 462 187 HOH HOH A . 
C 3 HOH 163 463 188 HOH HOH A . 
C 3 HOH 164 464 189 HOH HOH A . 
C 3 HOH 165 465 190 HOH HOH A . 
C 3 HOH 166 466 191 HOH HOH A . 
C 3 HOH 167 467 192 HOH HOH A . 
C 3 HOH 168 468 193 HOH HOH A . 
#