data_1OIX
# 
_entry.id   1OIX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1OIX         
PDBE  EBI-12945    
WWPDB D_1290012945 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1OIV unspecified 'X-RAY STRUCTURE OF THE SMALL G PROTEIN RAB11A IN COMPLEX WITH GDP'       
PDB 1OIW unspecified 'X-RAY STRUCTURE OF THE SMALL G PROTEIN RAB11A IN COMPLEX WITH GTPGAMMAS' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1OIX 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2003-06-26 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pasqualato, S.'     1 
'Senic-Matuglia, F.' 2 
'Renault, L.'        3 
'Goud, B.'           4 
'Salamero, J.'       5 
'Cherfils, J.'       6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystallographic Evidence for Substrate-Assisted GTP Hydrolysis by a Small GTP Binding Protein'                  
Structure    13  533   ? 2005 STRUE6 UK 0969-2126 2005 ? 15837192 10.1016/J.STR.2005.01.014 
1       'The Structural Gdp/GTP Cycle of Rab11 Reveals a Novel Interface Involved in the Dynamics of Recycling Endosomes' 
J.Biol.Chem. 279 11480 ? 2004 JBCHA3 US 0021-9258 0071 ? 14699104 10.1074/JBC.M310558200    
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pasqualato, S.'     1 
primary 'Cherfils, J.'       2 
1       'Pasqualato, S.'     3 
1       'Senic-Matuglia, F.' 4 
1       'Renault, L.'        5 
1       'Goud, B.'           6 
1       'Salamero, J.'       7 
1       'Cherfils, J.'       8 
# 
_cell.entry_id           1OIX 
_cell.length_a           74.077 
_cell.length_b           74.077 
_cell.length_c           124.905 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1OIX 
_symmetry.space_group_name_H-M             'I 4 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                97 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'RAS-RELATED PROTEIN RAB-11A' 21525.260 1   ? YES 'RESIDUES 1-173' 
'DELETION MUTANT LACKING THE 43 C-TERMINAL RESIDUES' 
2 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE"    443.201   1   ? ?   ?                ? 
3 non-polymer syn 'PHOSPHATE ION'               94.971    1   ? ?   ?                ? 
4 non-polymer syn 'MAGNESIUM ION'               24.305    1   ? ?   ?                ? 
5 non-polymer syn 'CHLORIDE ION'                35.453    1   ? ?   ?                ? 
6 water       nat water                         18.015    163 ? ?   ?                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAB-11,24KG, YL8, RAB11A' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MRGSHHHHHHGIPLPGRAMGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKA
QIWDTAGLERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAF
AEKNGLSFIETSALDSTNVEAAFQTILTEIY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MRGSHHHHHHGIPLPGRAMGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKA
QIWDTAGLERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAF
AEKNGLSFIETSALDSTNVEAAFQTILTEIY
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   GLY n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  GLY n 
1 12  ILE n 
1 13  PRO n 
1 14  LEU n 
1 15  PRO n 
1 16  GLY n 
1 17  ARG n 
1 18  ALA n 
1 19  MET n 
1 20  GLY n 
1 21  THR n 
1 22  ARG n 
1 23  ASP n 
1 24  ASP n 
1 25  GLU n 
1 26  TYR n 
1 27  ASP n 
1 28  TYR n 
1 29  LEU n 
1 30  PHE n 
1 31  LYS n 
1 32  VAL n 
1 33  VAL n 
1 34  LEU n 
1 35  ILE n 
1 36  GLY n 
1 37  ASP n 
1 38  SER n 
1 39  GLY n 
1 40  VAL n 
1 41  GLY n 
1 42  LYS n 
1 43  SER n 
1 44  ASN n 
1 45  LEU n 
1 46  LEU n 
1 47  SER n 
1 48  ARG n 
1 49  PHE n 
1 50  THR n 
1 51  ARG n 
1 52  ASN n 
1 53  GLU n 
1 54  PHE n 
1 55  ASN n 
1 56  LEU n 
1 57  GLU n 
1 58  SER n 
1 59  LYS n 
1 60  SER n 
1 61  THR n 
1 62  ILE n 
1 63  GLY n 
1 64  VAL n 
1 65  GLU n 
1 66  PHE n 
1 67  ALA n 
1 68  THR n 
1 69  ARG n 
1 70  SER n 
1 71  ILE n 
1 72  GLN n 
1 73  VAL n 
1 74  ASP n 
1 75  GLY n 
1 76  LYS n 
1 77  THR n 
1 78  ILE n 
1 79  LYS n 
1 80  ALA n 
1 81  GLN n 
1 82  ILE n 
1 83  TRP n 
1 84  ASP n 
1 85  THR n 
1 86  ALA n 
1 87  GLY n 
1 88  LEU n 
1 89  GLU n 
1 90  ARG n 
1 91  TYR n 
1 92  ARG n 
1 93  ALA n 
1 94  ILE n 
1 95  THR n 
1 96  SER n 
1 97  ALA n 
1 98  TYR n 
1 99  TYR n 
1 100 ARG n 
1 101 GLY n 
1 102 ALA n 
1 103 VAL n 
1 104 GLY n 
1 105 ALA n 
1 106 LEU n 
1 107 LEU n 
1 108 VAL n 
1 109 TYR n 
1 110 ASP n 
1 111 ILE n 
1 112 ALA n 
1 113 LYS n 
1 114 HIS n 
1 115 LEU n 
1 116 THR n 
1 117 TYR n 
1 118 GLU n 
1 119 ASN n 
1 120 VAL n 
1 121 GLU n 
1 122 ARG n 
1 123 TRP n 
1 124 LEU n 
1 125 LYS n 
1 126 GLU n 
1 127 LEU n 
1 128 ARG n 
1 129 ASP n 
1 130 HIS n 
1 131 ALA n 
1 132 ASP n 
1 133 SER n 
1 134 ASN n 
1 135 ILE n 
1 136 VAL n 
1 137 ILE n 
1 138 MET n 
1 139 LEU n 
1 140 VAL n 
1 141 GLY n 
1 142 ASN n 
1 143 LYS n 
1 144 SER n 
1 145 ASP n 
1 146 LEU n 
1 147 ARG n 
1 148 HIS n 
1 149 LEU n 
1 150 ARG n 
1 151 ALA n 
1 152 VAL n 
1 153 PRO n 
1 154 THR n 
1 155 ASP n 
1 156 GLU n 
1 157 ALA n 
1 158 ARG n 
1 159 ALA n 
1 160 PHE n 
1 161 ALA n 
1 162 GLU n 
1 163 LYS n 
1 164 ASN n 
1 165 GLY n 
1 166 LEU n 
1 167 SER n 
1 168 PHE n 
1 169 ILE n 
1 170 GLU n 
1 171 THR n 
1 172 SER n 
1 173 ALA n 
1 174 LEU n 
1 175 ASP n 
1 176 SER n 
1 177 THR n 
1 178 ASN n 
1 179 VAL n 
1 180 GLU n 
1 181 ALA n 
1 182 ALA n 
1 183 PHE n 
1 184 GLN n 
1 185 THR n 
1 186 ILE n 
1 187 LEU n 
1 188 THR n 
1 189 GLU n 
1 190 ILE n 
1 191 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 1OIX       1 ? ? 1OIX   ? 
2 UNP R11A_HUMAN 1 ? ? P24410 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1OIX A 1  ? 18  ? 1OIX   -18 ? -1  ? -18 -1  
2 2 1OIX A 19 ? 191 ? P24410 1   ? 173 ? 1   173 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1OIX 
_struct_ref_seq_dif.mon_id                       LEU 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      88 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P24410 
_struct_ref_seq_dif.db_mon_id                    GLN 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          70 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            70 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CL  non-polymer         . 'CHLORIDE ION'             ? 'Cl -1'             35.453  
GDP 'RNA linking'       n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PO4 non-polymer         . 'PHOSPHATE ION'            ? 'O4 P -3'           94.971  
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1OIX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.99 
_exptl_crystal.density_percent_sol   38.19 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '1.4 M NACL, 0.15 M NAH2PO4, 0.15 M KH2PO4,0.1 M NAMES PH6.5, pH 6.50' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2002-11-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.934 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-1 
_diffrn_source.pdbx_wavelength             0.934 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1OIX 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            1.700 
_reflns.number_obs                   19517 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.2 
_reflns.pdbx_Rmerge_I_obs            0.04600 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.2000 
_reflns.B_iso_Wilson_estimate        17.1 
_reflns.pdbx_redundancy              12.600 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.76 
_reflns_shell.percent_possible_all   97.1 
_reflns_shell.Rmerge_I_obs           0.27900 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1OIX 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     19373 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30 
_refine.ls_d_res_high                            1.7 
_refine.ls_percent_reflns_obs                    99.1 
_refine.ls_R_factor_obs                          0.201 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.201 
_refine.ls_R_factor_R_free                       0.229 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 8.4 
_refine.ls_number_reflns_R_free                  1620 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               24.1 
_refine.aniso_B[1][1]                            0.37 
_refine.aniso_B[2][2]                            0.37 
_refine.aniso_B[3][3]                            -0.73 
_refine.aniso_B[1][2]                            0 
_refine.aniso_B[1][3]                            0 
_refine.aniso_B[2][3]                            0 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.373497 
_refine.solvent_model_param_bsol                 44.052 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'FINAL ROUND OF REFINEMENT WAS CARRIED OUT WITH REFMAC' 
_refine.pdbx_starting_model                      'PDB ENTRY 1OIW' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        1OIX 
_refine_analyze.Luzzati_coordinate_error_obs    0.20 
_refine_analyze.Luzzati_sigma_a_obs             0.12 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.23 
_refine_analyze.Luzzati_sigma_a_free            0.18 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1330 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         35 
_refine_hist.number_atoms_solvent             163 
_refine_hist.number_atoms_total               1528 
_refine_hist.d_res_high                       1.7 
_refine_hist.d_res_low                        30 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.020 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             2.1   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      25.7  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      3.97  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.70 
_refine_ls_shell.d_res_low                        1.81 
_refine_ls_shell.number_reflns_R_work             2845 
_refine_ls_shell.R_factor_R_work                  0.230 
_refine_ls_shell.percent_reflns_obs               98.3 
_refine_ls_shell.R_factor_R_free                  0.269 
_refine_ls_shell.R_factor_R_free_error            0.016 
_refine_ls_shell.percent_reflns_R_free            9.0 
_refine_ls_shell.number_reflns_R_free             281 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP       
'X-RAY DIFFRACTION' 2 GDP_XPLOR_PAR.TXT GDP_XPLOR_TOP.TXT 
'X-RAY DIFFRACTION' 3 WATER_REP.PARAM   WATER.TOP         
'X-RAY DIFFRACTION' 4 ION.PARAM         ION.TOP           
# 
_struct.entry_id                  1OIX 
_struct.title                     'X-ray structure of the small G protein Rab11a in complex with GDP and Pi' 
_struct.pdbx_descriptor           'RAS-RELATED PROTEIN RAB-11A' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1OIX 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
_struct_keywords.text            
'SMALL G PROTEIN, INTRACELLULAR TRAFFICKING, GTP-BINDING, LIPOPROTEIN, PRENYLATION, PROTEIN TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 41  ? ASN A 52  ? GLY A 23  ASN A 34  1 ? 12 
HELX_P HELX_P2 2 THR A 95  ? ARG A 100 ? THR A 77  ARG A 82  1 ? 6  
HELX_P HELX_P3 3 LYS A 113 ? ASN A 119 ? LYS A 95  ASN A 101 1 ? 7  
HELX_P HELX_P4 4 ASN A 119 ? ALA A 131 ? ASN A 101 ALA A 113 1 ? 13 
HELX_P HELX_P5 5 LYS A 143 ? ARG A 150 ? LYS A 125 ARG A 132 5 ? 8  
HELX_P HELX_P6 6 PRO A 153 ? ASN A 164 ? PRO A 135 ASN A 146 1 ? 12 
HELX_P HELX_P7 7 ASN A 178 ? TYR A 191 ? ASN A 160 TYR A 173 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B GDP . O3B ? ? ? 1_555 D MG  .  MG  ? ? A GDP 201 A MG  301  1_555 ? ? ? ? ? ? ? 2.040 ? 
metalc2 metalc ? ? D MG  . MG  ? ? ? 1_555 C PO4 .  O1  ? ? A MG  301 A PO4 202  1_555 ? ? ? ? ? ? ? 2.056 ? 
metalc3 metalc ? ? D MG  . MG  ? ? ? 1_555 F HOH .  O   ? ? A MG  301 A HOH 2069 1_555 ? ? ? ? ? ? ? 2.165 ? 
metalc4 metalc ? ? D MG  . MG  ? ? ? 1_555 F HOH .  O   ? ? A MG  301 A HOH 2161 1_555 ? ? ? ? ? ? ? 2.108 ? 
metalc5 metalc ? ? D MG  . MG  ? ? ? 1_555 A SER 43 OG  ? ? A MG  301 A SER 25   1_555 ? ? ? ? ? ? ? 2.118 ? 
metalc6 metalc ? ? D MG  . MG  ? ? ? 1_555 A THR 61 OG1 ? ? A MG  301 A THR 43   1_555 ? ? ? ? ? ? ? 2.168 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               AA 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 64  ? VAL A 73  ? VAL A 46  VAL A 55  
AA 2 LYS A 76  ? THR A 85  ? LYS A 58  THR A 67  
AA 3 TYR A 28  ? GLY A 36  ? TYR A 10  GLY A 18  
AA 4 GLY A 104 ? ASP A 110 ? GLY A 86  ASP A 92  
AA 5 VAL A 136 ? ASN A 142 ? VAL A 118 ASN A 124 
AA 6 SER A 167 ? GLU A 170 ? SER A 149 GLU A 152 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N VAL A 73  ? N VAL A 55  O LYS A 76  ? O LYS A 58  
AA 2 3 N LYS A 79  ? N LYS A 61  O TYR A 28  ? O TYR A 10  
AA 3 4 N VAL A 33  ? N VAL A 15  O GLY A 104 ? O GLY A 86  
AA 4 5 N ALA A 105 ? N ALA A 87  O VAL A 136 ? O VAL A 118 
AA 5 6 N LEU A 139 ? N LEU A 121 O SER A 167 ? O SER A 149 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE PO4 A 202' 
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 301'  
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CL A 401'  
AC4 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE GDP A 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 SER A 38  ? SER A 20   . ? 1_555 ? 
2  AC1 13 GLY A 39  ? GLY A 21   . ? 1_555 ? 
3  AC1 13 LYS A 42  ? LYS A 24   . ? 1_555 ? 
4  AC1 13 SER A 60  ? SER A 42   . ? 1_555 ? 
5  AC1 13 THR A 61  ? THR A 43   . ? 1_555 ? 
6  AC1 13 ALA A 86  ? ALA A 68   . ? 1_555 ? 
7  AC1 13 GLY A 87  ? GLY A 69   . ? 1_555 ? 
8  AC1 13 GDP B .   ? GDP A 201  . ? 1_555 ? 
9  AC1 13 MG  D .   ? MG  A 301  . ? 1_555 ? 
10 AC1 13 HOH F .   ? HOH A 2069 . ? 1_555 ? 
11 AC1 13 HOH F .   ? HOH A 2161 . ? 1_555 ? 
12 AC1 13 HOH F .   ? HOH A 2162 . ? 1_555 ? 
13 AC1 13 HOH F .   ? HOH A 2163 . ? 1_555 ? 
14 AC2 6  SER A 43  ? SER A 25   . ? 1_555 ? 
15 AC2 6  THR A 61  ? THR A 43   . ? 1_555 ? 
16 AC2 6  GDP B .   ? GDP A 201  . ? 1_555 ? 
17 AC2 6  PO4 C .   ? PO4 A 202  . ? 1_555 ? 
18 AC2 6  HOH F .   ? HOH A 2069 . ? 1_555 ? 
19 AC2 6  HOH F .   ? HOH A 2161 . ? 1_555 ? 
20 AC3 4  ARG A 90  ? ARG A 72   . ? 1_555 ? 
21 AC3 4  TYR A 91  ? TYR A 73   . ? 1_555 ? 
22 AC3 4  HOH F .   ? HOH A 2019 . ? 1_555 ? 
23 AC3 4  HOH F .   ? HOH A 2072 . ? 1_555 ? 
24 AC4 27 GLY A 39  ? GLY A 21   . ? 1_555 ? 
25 AC4 27 VAL A 40  ? VAL A 22   . ? 1_555 ? 
26 AC4 27 GLY A 41  ? GLY A 23   . ? 1_555 ? 
27 AC4 27 LYS A 42  ? LYS A 24   . ? 1_555 ? 
28 AC4 27 SER A 43  ? SER A 25   . ? 1_555 ? 
29 AC4 27 ASN A 44  ? ASN A 26   . ? 1_555 ? 
30 AC4 27 PHE A 54  ? PHE A 36   . ? 1_555 ? 
31 AC4 27 ASN A 55  ? ASN A 37   . ? 1_555 ? 
32 AC4 27 LEU A 56  ? LEU A 38   . ? 1_555 ? 
33 AC4 27 GLU A 57  ? GLU A 39   . ? 1_555 ? 
34 AC4 27 SER A 58  ? SER A 40   . ? 1_555 ? 
35 AC4 27 ASN A 142 ? ASN A 124  . ? 1_555 ? 
36 AC4 27 LYS A 143 ? LYS A 125  . ? 1_555 ? 
37 AC4 27 ASP A 145 ? ASP A 127  . ? 1_555 ? 
38 AC4 27 LEU A 146 ? LEU A 128  . ? 1_555 ? 
39 AC4 27 SER A 172 ? SER A 154  . ? 1_555 ? 
40 AC4 27 ALA A 173 ? ALA A 155  . ? 1_555 ? 
41 AC4 27 LEU A 174 ? LEU A 156  . ? 1_555 ? 
42 AC4 27 PO4 C .   ? PO4 A 202  . ? 1_555 ? 
43 AC4 27 MG  D .   ? MG  A 301  . ? 1_555 ? 
44 AC4 27 HOH F .   ? HOH A 2039 . ? 1_555 ? 
45 AC4 27 HOH F .   ? HOH A 2069 . ? 1_555 ? 
46 AC4 27 HOH F .   ? HOH A 2079 . ? 1_555 ? 
47 AC4 27 HOH F .   ? HOH A 2158 . ? 1_555 ? 
48 AC4 27 HOH F .   ? HOH A 2159 . ? 1_555 ? 
49 AC4 27 HOH F .   ? HOH A 2160 . ? 1_555 ? 
50 AC4 27 HOH F .   ? HOH A 2161 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1OIX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1OIX 
_atom_sites.fract_transf_matrix[1][1]   0.013499 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013499 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008006 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ASP A 1 24  ? -6.740 13.706 26.373  1.00 54.55 ? 6    ASP A N     1 
ATOM   2    C  CA    . ASP A 1 24  ? -7.200 12.676 27.360  1.00 54.44 ? 6    ASP A CA    1 
ATOM   3    C  C     . ASP A 1 24  ? -6.782 13.084 28.783  1.00 54.11 ? 6    ASP A C     1 
ATOM   4    O  O     . ASP A 1 24  ? -5.797 12.557 29.315  1.00 55.23 ? 6    ASP A O     1 
ATOM   5    C  CB    . ASP A 1 24  ? -6.634 11.289 26.989  1.00 54.49 ? 6    ASP A CB    1 
ATOM   6    N  N     . GLU A 1 25  ? -7.551 13.997 29.389  1.00 53.22 ? 7    GLU A N     1 
ATOM   7    C  CA    . GLU A 1 25  ? -7.189 14.669 30.658  1.00 52.31 ? 7    GLU A CA    1 
ATOM   8    C  C     . GLU A 1 25  ? -5.917 15.520 30.497  1.00 51.60 ? 7    GLU A C     1 
ATOM   9    O  O     . GLU A 1 25  ? -4.819 14.992 30.383  1.00 51.54 ? 7    GLU A O     1 
ATOM   10   C  CB    . GLU A 1 25  ? -7.040 13.660 31.839  1.00 52.43 ? 7    GLU A CB    1 
ATOM   11   N  N     . TYR A 1 26  ? -6.086 16.839 30.481  1.00 50.97 ? 8    TYR A N     1 
ATOM   12   C  CA    . TYR A 1 26  ? -4.954 17.771 30.425  1.00 50.38 ? 8    TYR A CA    1 
ATOM   13   C  C     . TYR A 1 26  ? -5.341 19.157 30.964  1.00 48.51 ? 8    TYR A C     1 
ATOM   14   O  O     . TYR A 1 26  ? -6.497 19.529 30.939  1.00 48.77 ? 8    TYR A O     1 
ATOM   15   C  CB    . TYR A 1 26  ? -4.406 17.864 28.976  1.00 50.72 ? 8    TYR A CB    1 
ATOM   16   C  CG    . TYR A 1 26  ? -5.408 18.387 27.976  1.00 54.12 ? 8    TYR A CG    1 
ATOM   17   C  CD1   . TYR A 1 26  ? -5.646 19.758 27.862  1.00 57.26 ? 8    TYR A CD1   1 
ATOM   18   C  CD2   . TYR A 1 26  ? -6.129 17.516 27.144  1.00 56.72 ? 8    TYR A CD2   1 
ATOM   19   C  CE1   . TYR A 1 26  ? -6.569 20.252 26.951  1.00 59.35 ? 8    TYR A CE1   1 
ATOM   20   C  CE2   . TYR A 1 26  ? -7.055 18.002 26.229  1.00 58.47 ? 8    TYR A CE2   1 
ATOM   21   C  CZ    . TYR A 1 26  ? -7.269 19.374 26.138  1.00 60.65 ? 8    TYR A CZ    1 
ATOM   22   O  OH    . TYR A 1 26  ? -8.190 19.894 25.248  1.00 62.99 ? 8    TYR A OH    1 
ATOM   23   N  N     . ASP A 1 27  ? -4.365 19.921 31.440  1.00 46.54 ? 9    ASP A N     1 
ATOM   24   C  CA    . ASP A 1 27  ? -4.609 21.272 31.940  1.00 45.01 ? 9    ASP A CA    1 
ATOM   25   C  C     . ASP A 1 27  ? -4.493 22.359 30.872  1.00 43.91 ? 9    ASP A C     1 
ATOM   26   O  O     . ASP A 1 27  ? -5.207 23.358 30.933  1.00 43.45 ? 9    ASP A O     1 
ATOM   27   C  CB    . ASP A 1 27  ? -3.665 21.575 33.101  1.00 45.10 ? 9    ASP A CB    1 
ATOM   28   C  CG    . ASP A 1 27  ? -3.962 20.716 34.313  1.00 44.70 ? 9    ASP A CG    1 
ATOM   29   O  OD1   . ASP A 1 27  ? -3.065 19.995 34.780  1.00 44.76 ? 9    ASP A OD1   1 
ATOM   30   O  OD2   . ASP A 1 27  ? -5.088 20.676 34.836  1.00 44.87 ? 9    ASP A OD2   1 
ATOM   31   N  N     . TYR A 1 28  ? -3.570 22.169 29.923  1.00 42.06 ? 10   TYR A N     1 
ATOM   32   C  CA    . TYR A 1 28  ? -3.388 23.077 28.777  1.00 40.57 ? 10   TYR A CA    1 
ATOM   33   C  C     . TYR A 1 28  ? -3.025 22.317 27.503  1.00 37.69 ? 10   TYR A C     1 
ATOM   34   O  O     . TYR A 1 28  ? -2.374 21.278 27.557  1.00 35.89 ? 10   TYR A O     1 
ATOM   35   C  CB    . TYR A 1 28  ? -2.290 24.092 29.052  1.00 41.39 ? 10   TYR A CB    1 
ATOM   36   C  CG    . TYR A 1 28  ? -2.454 24.874 30.326  1.00 44.77 ? 10   TYR A CG    1 
ATOM   37   C  CD1   . TYR A 1 28  ? -3.310 25.969 30.386  1.00 49.46 ? 10   TYR A CD1   1 
ATOM   38   C  CD2   . TYR A 1 28  ? -1.741 24.524 31.464  1.00 47.80 ? 10   TYR A CD2   1 
ATOM   39   C  CE1   . TYR A 1 28  ? -3.458 26.687 31.563  1.00 51.46 ? 10   TYR A CE1   1 
ATOM   40   C  CE2   . TYR A 1 28  ? -1.876 25.226 32.634  1.00 50.55 ? 10   TYR A CE2   1 
ATOM   41   C  CZ    . TYR A 1 28  ? -2.727 26.309 32.683  1.00 52.36 ? 10   TYR A CZ    1 
ATOM   42   O  OH    . TYR A 1 28  ? -2.841 27.010 33.873  1.00 55.47 ? 10   TYR A OH    1 
ATOM   43   N  N     . LEU A 1 29  ? -3.469 22.869 26.365  1.00 35.13 ? 11   LEU A N     1 
ATOM   44   C  CA    . LEU A 1 29  ? -3.153 22.383 25.029  1.00 33.62 ? 11   LEU A CA    1 
ATOM   45   C  C     . LEU A 1 29  ? -2.342 23.510 24.407  1.00 30.64 ? 11   LEU A C     1 
ATOM   46   O  O     . LEU A 1 29  ? -2.814 24.650 24.313  1.00 29.59 ? 11   LEU A O     1 
ATOM   47   C  CB    . LEU A 1 29  ? -4.436 22.124 24.232  1.00 34.60 ? 11   LEU A CB    1 
ATOM   48   C  CG    . LEU A 1 29  ? -4.437 21.586 22.791  1.00 37.68 ? 11   LEU A CG    1 
ATOM   49   C  CD1   . LEU A 1 29  ? -3.494 20.455 22.609  1.00 38.95 ? 11   LEU A CD1   1 
ATOM   50   C  CD2   . LEU A 1 29  ? -5.860 21.110 22.394  1.00 40.58 ? 11   LEU A CD2   1 
ATOM   51   N  N     . PHE A 1 30  ? -1.089 23.201 24.101  1.00 26.61 ? 12   PHE A N     1 
ATOM   52   C  CA    . PHE A 1 30  ? -0.166 24.138 23.492  1.00 23.99 ? 12   PHE A CA    1 
ATOM   53   C  C     . PHE A 1 30  ? 0.092  23.591 22.073  1.00 22.14 ? 12   PHE A C     1 
ATOM   54   O  O     . PHE A 1 30  ? 0.625  22.478 21.923  1.00 20.88 ? 12   PHE A O     1 
ATOM   55   C  CB    . PHE A 1 30  ? 1.163  24.189 24.202  1.00 23.24 ? 12   PHE A CB    1 
ATOM   56   C  CG    . PHE A 1 30  ? 1.114  24.766 25.607  1.00 26.52 ? 12   PHE A CG    1 
ATOM   57   C  CD1   . PHE A 1 30  ? 0.024  25.529 26.051  1.00 28.83 ? 12   PHE A CD1   1 
ATOM   58   C  CD2   . PHE A 1 30  ? 2.179  24.584 26.452  1.00 26.46 ? 12   PHE A CD2   1 
ATOM   59   C  CE1   . PHE A 1 30  ? 0.007  26.059 27.352  1.00 26.36 ? 12   PHE A CE1   1 
ATOM   60   C  CE2   . PHE A 1 30  ? 2.163  25.126 27.745  1.00 26.88 ? 12   PHE A CE2   1 
ATOM   61   C  CZ    . PHE A 1 30  ? 1.056  25.850 28.168  1.00 27.57 ? 12   PHE A CZ    1 
ATOM   62   N  N     . LYS A 1 31  ? -0.281 24.405 21.100  1.00 19.42 ? 13   LYS A N     1 
ATOM   63   C  CA    . LYS A 1 31  ? 0.028  24.152 19.676  1.00 16.12 ? 13   LYS A CA    1 
ATOM   64   C  C     . LYS A 1 31  ? 1.437  24.623 19.410  1.00 14.46 ? 13   LYS A C     1 
ATOM   65   O  O     . LYS A 1 31  ? 1.797  25.777 19.629  1.00 14.29 ? 13   LYS A O     1 
ATOM   66   C  CB    . LYS A 1 31  ? -0.929 24.909 18.810  1.00 14.81 ? 13   LYS A CB    1 
ATOM   67   C  CG    . LYS A 1 31  ? -0.642 24.753 17.276  1.00 14.93 ? 13   LYS A CG    1 
ATOM   68   C  CD    . LYS A 1 31  ? -1.741 25.401 16.476  1.00 14.29 ? 13   LYS A CD    1 
ATOM   69   C  CE    . LYS A 1 31  ? -1.426 25.407 14.983  1.00 13.89 ? 13   LYS A CE    1 
ATOM   70   N  NZ    . LYS A 1 31  ? -2.537 25.931 14.095  1.00 15.01 ? 13   LYS A NZ    1 
ATOM   71   N  N     . VAL A 1 32  ? 2.267  23.724 18.873  1.00 14.43 ? 14   VAL A N     1 
ATOM   72   C  CA    . VAL A 1 32  ? 3.633  24.006 18.544  1.00 12.96 ? 14   VAL A CA    1 
ATOM   73   C  C     . VAL A 1 32  ? 3.873  23.551 17.078  1.00 11.49 ? 14   VAL A C     1 
ATOM   74   O  O     . VAL A 1 32  ? 3.421  22.479 16.703  1.00 14.25 ? 14   VAL A O     1 
ATOM   75   C  CB    . VAL A 1 32  ? 4.601  23.289 19.441  1.00 13.43 ? 14   VAL A CB    1 
ATOM   76   C  CG1   . VAL A 1 32  ? 6.011  23.376 18.900  1.00 17.03 ? 14   VAL A CG1   1 
ATOM   77   C  CG2   . VAL A 1 32  ? 4.528  23.896 20.853  1.00 13.96 ? 14   VAL A CG2   1 
ATOM   78   N  N     . VAL A 1 33  ? 4.406  24.416 16.249  1.00 13.14 ? 15   VAL A N     1 
ATOM   79   C  CA    . VAL A 1 33  ? 4.604  23.997 14.847  1.00 12.25 ? 15   VAL A CA    1 
ATOM   80   C  C     . VAL A 1 33  ? 6.084  23.740 14.562  1.00 10.84 ? 15   VAL A C     1 
ATOM   81   O  O     . VAL A 1 33  ? 6.995  24.360 15.107  1.00 11.87 ? 15   VAL A O     1 
ATOM   82   C  CB    . VAL A 1 33  ? 4.075  25.090 13.849  1.00 13.36 ? 15   VAL A CB    1 
ATOM   83   C  CG1   . VAL A 1 33  ? 2.668  25.369 14.062  1.00 12.65 ? 15   VAL A CG1   1 
ATOM   84   C  CG2   . VAL A 1 33  ? 4.903  26.371 13.949  1.00 13.91 ? 15   VAL A CG2   1 
ATOM   85   N  N     . LEU A 1 34  ? 6.335  22.830 13.630  1.00 9.59  ? 16   LEU A N     1 
ATOM   86   C  CA    . LEU A 1 34  ? 7.641  22.565 13.102  1.00 10.72 ? 16   LEU A CA    1 
ATOM   87   C  C     . LEU A 1 34  ? 7.757  23.238 11.719  1.00 9.04  ? 16   LEU A C     1 
ATOM   88   O  O     . LEU A 1 34  ? 6.828  23.176 10.918  1.00 11.33 ? 16   LEU A O     1 
ATOM   89   C  CB    . LEU A 1 34  ? 7.836  21.096 12.891  1.00 11.35 ? 16   LEU A CB    1 
ATOM   90   C  CG    . LEU A 1 34  ? 8.042  20.227 14.129  1.00 15.08 ? 16   LEU A CG    1 
ATOM   91   C  CD1   . LEU A 1 34  ? 7.594  18.820 13.849  1.00 16.80 ? 16   LEU A CD1   1 
ATOM   92   C  CD2   . LEU A 1 34  ? 9.504  20.292 14.487  1.00 18.44 ? 16   LEU A CD2   1 
ATOM   93   N  N     . ILE A 1 35  ? 8.837  23.930 11.469  1.00 10.03 ? 17   ILE A N     1 
ATOM   94   C  CA    . ILE A 1 35  ? 9.117  24.569 10.172  1.00 10.27 ? 17   ILE A CA    1 
ATOM   95   C  C     . ILE A 1 35  ? 10.608 24.436 9.883   1.00 10.26 ? 17   ILE A C     1 
ATOM   96   O  O     . ILE A 1 35  ? 11.401 24.188 10.812  1.00 11.41 ? 17   ILE A O     1 
ATOM   97   C  CB    . ILE A 1 35  ? 8.737  26.026 10.141  1.00 12.03 ? 17   ILE A CB    1 
ATOM   98   C  CG1   . ILE A 1 35  ? 9.451  26.818 11.246  1.00 13.74 ? 17   ILE A CG1   1 
ATOM   99   C  CG2   . ILE A 1 35  ? 7.240  26.164 10.262  1.00 12.41 ? 17   ILE A CG2   1 
ATOM   100  C  CD1   . ILE A 1 35  ? 9.106  28.312 11.230  1.00 12.60 ? 17   ILE A CD1   1 
ATOM   101  N  N     . GLY A 1 36  ? 10.996 24.595 8.651   1.00 10.38 ? 18   GLY A N     1 
ATOM   102  C  CA    . GLY A 1 36  ? 12.378 24.381 8.277   1.00 10.39 ? 18   GLY A CA    1 
ATOM   103  C  C     . GLY A 1 36  ? 12.460 23.744 6.887   1.00 11.00 ? 18   GLY A C     1 
ATOM   104  O  O     . GLY A 1 36  ? 11.497 23.185 6.397   1.00 10.54 ? 18   GLY A O     1 
ATOM   105  N  N     . ASP A 1 37  ? 13.606 23.910 6.229   1.00 10.40 ? 19   ASP A N     1 
ATOM   106  C  CA    . ASP A 1 37  ? 13.807 23.360 4.890   1.00 11.89 ? 19   ASP A CA    1 
ATOM   107  C  C     . ASP A 1 37  ? 13.523 21.883 4.835   1.00 12.65 ? 19   ASP A C     1 
ATOM   108  O  O     . ASP A 1 37  ? 13.657 21.154 5.834   1.00 13.08 ? 19   ASP A O     1 
ATOM   109  C  CB    . ASP A 1 37  ? 15.203 23.602 4.366   1.00 10.26 ? 19   ASP A CB    1 
ATOM   110  C  CG    . ASP A 1 37  ? 15.501 25.020 3.993   1.00 12.76 ? 19   ASP A CG    1 
ATOM   111  O  OD1   . ASP A 1 37  ? 14.652 25.957 4.188   1.00 12.10 ? 19   ASP A OD1   1 
ATOM   112  O  OD2   . ASP A 1 37  ? 16.591 25.345 3.497   1.00 16.71 ? 19   ASP A OD2   1 
ATOM   113  N  N     . SER A 1 38  ? 13.138 21.427 3.647   1.00 14.12 ? 20   SER A N     1 
ATOM   114  C  CA    . SER A 1 38  ? 12.965 19.990 3.419   1.00 14.09 ? 20   SER A CA    1 
ATOM   115  C  C     . SER A 1 38  ? 14.263 19.261 3.702   1.00 14.67 ? 20   SER A C     1 
ATOM   116  O  O     . SER A 1 38  ? 15.338 19.745 3.354   1.00 15.41 ? 20   SER A O     1 
ATOM   117  C  CB    . SER A 1 38  ? 12.429 19.726 2.038   1.00 18.18 ? 20   SER A CB    1 
ATOM   118  O  OG    . SER A 1 38  ? 13.374 20.162 1.159   1.00 22.91 ? 20   SER A OG    1 
ATOM   119  N  N     . GLY A 1 39  ? 14.156 18.174 4.430   1.00 14.10 ? 21   GLY A N     1 
ATOM   120  C  CA    . GLY A 1 39  ? 15.326 17.333 4.638   1.00 14.26 ? 21   GLY A CA    1 
ATOM   121  C  C     . GLY A 1 39  ? 16.070 17.531 5.926   1.00 15.26 ? 21   GLY A C     1 
ATOM   122  O  O     . GLY A 1 39  ? 17.052 16.805 6.190   1.00 16.32 ? 21   GLY A O     1 
ATOM   123  N  N     . VAL A 1 40  ? 15.663 18.512 6.739   1.00 13.18 ? 22   VAL A N     1 
ATOM   124  C  CA    . VAL A 1 40  ? 16.380 18.812 7.997   1.00 12.74 ? 22   VAL A CA    1 
ATOM   125  C  C     . VAL A 1 40  ? 16.056 17.918 9.162   1.00 11.93 ? 22   VAL A C     1 
ATOM   126  O  O     . VAL A 1 40  ? 16.796 17.894 10.114  1.00 13.57 ? 22   VAL A O     1 
ATOM   127  C  CB    . VAL A 1 40  ? 16.217 20.328 8.381   1.00 11.40 ? 22   VAL A CB    1 
ATOM   128  C  CG1   . VAL A 1 40  ? 16.635 21.166 7.297   1.00 9.89  ? 22   VAL A CG1   1 
ATOM   129  C  CG2   . VAL A 1 40  ? 14.798 20.625 8.868   1.00 12.77 ? 22   VAL A CG2   1 
ATOM   130  N  N     . GLY A 1 41  ? 14.968 17.159 9.098   1.00 11.92 ? 23   GLY A N     1 
ATOM   131  C  CA    . GLY A 1 41  ? 14.561 16.275 10.170  1.00 12.85 ? 23   GLY A CA    1 
ATOM   132  C  C     . GLY A 1 41  ? 13.306 16.626 10.940  1.00 13.96 ? 23   GLY A C     1 
ATOM   133  O  O     . GLY A 1 41  ? 13.021 16.075 11.982  1.00 12.72 ? 23   GLY A O     1 
ATOM   134  N  N     . LYS A 1 42  ? 12.460 17.493 10.357  1.00 12.78 ? 24   LYS A N     1 
ATOM   135  C  CA    . LYS A 1 42  ? 11.241 17.876 11.076  1.00 11.34 ? 24   LYS A CA    1 
ATOM   136  C  C     . LYS A 1 42  ? 10.342 16.704 11.391  1.00 12.05 ? 24   LYS A C     1 
ATOM   137  O  O     . LYS A 1 42  ? 9.905  16.565 12.517  1.00 13.09 ? 24   LYS A O     1 
ATOM   138  C  CB    . LYS A 1 42  ? 10.443 18.855 10.168  1.00 11.52 ? 24   LYS A CB    1 
ATOM   139  C  CG    . LYS A 1 42  ? 11.149 20.180 9.921   1.00 10.44 ? 24   LYS A CG    1 
ATOM   140  C  CD    . LYS A 1 42  ? 10.324 21.162 9.059   1.00 12.95 ? 24   LYS A CD    1 
ATOM   141  C  CE    . LYS A 1 42  ? 9.944  20.679 7.685   1.00 13.09 ? 24   LYS A CE    1 
ATOM   142  N  NZ    . LYS A 1 42  ? 11.076 20.326 6.815   1.00 8.08  ? 24   LYS A NZ    1 
ATOM   143  N  N     . SER A 1 43  ? 10.094 15.841 10.385  1.00 12.11 ? 25   SER A N     1 
ATOM   144  C  CA    . SER A 1 43  ? 9.153  14.760 10.525  1.00 11.82 ? 25   SER A CA    1 
ATOM   145  C  C     . SER A 1 43  ? 9.673  13.653 11.497  1.00 12.34 ? 25   SER A C     1 
ATOM   146  O  O     . SER A 1 43  ? 8.889  13.109 12.286  1.00 13.52 ? 25   SER A O     1 
ATOM   147  C  CB    . SER A 1 43  ? 8.720  14.170 9.217   1.00 13.12 ? 25   SER A CB    1 
ATOM   148  O  OG    . SER A 1 43  ? 8.089  15.173 8.431   1.00 14.10 ? 25   SER A OG    1 
ATOM   149  N  N     . ASN A 1 44  ? 10.980 13.488 11.500  1.00 12.51 ? 26   ASN A N     1 
ATOM   150  C  CA    . ASN A 1 44  ? 11.549 12.509 12.439  1.00 15.09 ? 26   ASN A CA    1 
ATOM   151  C  C     . ASN A 1 44  ? 11.688 13.069 13.864  1.00 15.40 ? 26   ASN A C     1 
ATOM   152  O  O     . ASN A 1 44  ? 11.629 12.338 14.888  1.00 15.94 ? 26   ASN A O     1 
ATOM   153  C  CB    . ASN A 1 44  ? 12.872 12.004 11.851  1.00 14.65 ? 26   ASN A CB    1 
ATOM   154  C  CG    . ASN A 1 44  ? 12.686 10.827 10.947  1.00 16.52 ? 26   ASN A CG    1 
ATOM   155  O  OD1   . ASN A 1 44  ? 12.344 9.713  11.426  1.00 20.35 ? 26   ASN A OD1   1 
ATOM   156  N  ND2   . ASN A 1 44  ? 12.783 11.044 9.655   1.00 15.37 ? 26   ASN A ND2   1 
ATOM   157  N  N     . LEU A 1 45  ? 11.797 14.398 14.003  1.00 15.98 ? 27   LEU A N     1 
ATOM   158  C  CA    . LEU A 1 45  ? 11.716 15.016 15.310  1.00 14.80 ? 27   LEU A CA    1 
ATOM   159  C  C     . LEU A 1 45  ? 10.325 14.788 15.877  1.00 16.38 ? 27   LEU A C     1 
ATOM   160  O  O     . LEU A 1 45  ? 10.130 14.413 17.020  1.00 15.15 ? 27   LEU A O     1 
ATOM   161  C  CB    . LEU A 1 45  ? 11.984 16.500 15.209  1.00 15.37 ? 27   LEU A CB    1 
ATOM   162  C  CG    . LEU A 1 45  ? 13.241 17.224 15.597  1.00 18.50 ? 27   LEU A CG    1 
ATOM   163  C  CD1   . LEU A 1 45  ? 14.239 16.363 16.380  1.00 15.27 ? 27   LEU A CD1   1 
ATOM   164  C  CD2   . LEU A 1 45  ? 13.828 18.228 14.690  1.00 18.76 ? 27   LEU A CD2   1 
ATOM   165  N  N     . LEU A 1 46  ? 9.312  14.969 15.040  1.00 16.18 ? 28   LEU A N     1 
ATOM   166  C  CA    . LEU A 1 46  ? 7.941  14.700 15.453  1.00 16.68 ? 28   LEU A CA    1 
ATOM   167  C  C     . LEU A 1 46  ? 7.759  13.251 15.877  1.00 18.25 ? 28   LEU A C     1 
ATOM   168  O  O     . LEU A 1 46  ? 7.167  12.994 16.907  1.00 19.81 ? 28   LEU A O     1 
ATOM   169  C  CB    . LEU A 1 46  ? 6.952  15.028 14.352  1.00 16.20 ? 28   LEU A CB    1 
ATOM   170  C  CG    . LEU A 1 46  ? 5.478  14.782 14.655  1.00 17.10 ? 28   LEU A CG    1 
ATOM   171  C  CD1   . LEU A 1 46  ? 4.985  15.673 15.798  1.00 20.29 ? 28   LEU A CD1   1 
ATOM   172  C  CD2   . LEU A 1 46  ? 4.655  15.048 13.383  1.00 19.00 ? 28   LEU A CD2   1 
ATOM   173  N  N     . SER A 1 47  ? 8.211  12.317 15.055  1.00 20.19 ? 29   SER A N     1 
ATOM   174  C  CA    . SER A 1 47  ? 8.007  10.861 15.321  1.00 20.40 ? 29   SER A CA    1 
ATOM   175  C  C     . SER A 1 47  ? 8.844  10.397 16.497  1.00 22.04 ? 29   SER A C     1 
ATOM   176  O  O     . SER A 1 47  ? 8.411  9.532  17.254  1.00 23.54 ? 29   SER A O     1 
ATOM   177  C  CB    . SER A 1 47  ? 8.262  9.997  14.099  1.00 20.54 ? 29   SER A CB    1 
ATOM   178  O  OG    . SER A 1 47  ? 9.587  10.024 13.660  1.00 19.26 ? 29   SER A OG    1 
ATOM   179  N  N     . ARG A 1 48  ? 10.000 11.001 16.686  1.00 22.87 ? 30   ARG A N     1 
ATOM   180  C  CA    . ARG A 1 48  ? 10.860 10.627 17.803  1.00 24.24 ? 30   ARG A CA    1 
ATOM   181  C  C     . ARG A 1 48  ? 10.182 11.082 19.074  1.00 25.02 ? 30   ARG A C     1 
ATOM   182  O  O     . ARG A 1 48  ? 10.126 10.347 20.051  1.00 27.01 ? 30   ARG A O     1 
ATOM   183  C  CB    . ARG A 1 48  ? 12.268 11.235 17.648  1.00 23.77 ? 30   ARG A CB    1 
ATOM   184  C  CG    . ARG A 1 48  ? 13.156 11.003 18.841  1.00 25.61 ? 30   ARG A CG    1 
ATOM   185  C  CD    . ARG A 1 48  ? 13.387 9.531  19.065  1.00 24.60 ? 30   ARG A CD    1 
ATOM   186  N  NE    . ARG A 1 48  ? 14.497 9.085  18.266  1.00 26.59 ? 30   ARG A NE    1 
ATOM   187  C  CZ    . ARG A 1 48  ? 14.867 7.828  18.112  1.00 29.99 ? 30   ARG A CZ    1 
ATOM   188  N  NH1   . ARG A 1 48  ? 14.112 6.821  18.517  1.00 31.44 ? 30   ARG A NH1   1 
ATOM   189  N  NH2   . ARG A 1 48  ? 15.967 7.588  17.437  1.00 30.69 ? 30   ARG A NH2   1 
ATOM   190  N  N     . PHE A 1 49  ? 9.612  12.279 19.064  1.00 24.62 ? 31   PHE A N     1 
ATOM   191  C  CA    . PHE A 1 49  ? 8.984  12.835 20.284  1.00 25.42 ? 31   PHE A CA    1 
ATOM   192  C  C     . PHE A 1 49  ? 7.643  12.175 20.642  1.00 25.66 ? 31   PHE A C     1 
ATOM   193  O  O     . PHE A 1 49  ? 7.333  11.925 21.809  1.00 25.37 ? 31   PHE A O     1 
ATOM   194  C  CB    . PHE A 1 49  ? 8.782  14.350 20.140  1.00 24.95 ? 31   PHE A CB    1 
ATOM   195  C  CG    . PHE A 1 49  ? 8.209  15.001 21.343  1.00 26.78 ? 31   PHE A CG    1 
ATOM   196  C  CD1   . PHE A 1 49  ? 8.899  14.995 22.560  1.00 27.12 ? 31   PHE A CD1   1 
ATOM   197  C  CD2   . PHE A 1 49  ? 6.972  15.601 21.281  1.00 28.99 ? 31   PHE A CD2   1 
ATOM   198  C  CE1   . PHE A 1 49  ? 8.351  15.606 23.677  1.00 28.84 ? 31   PHE A CE1   1 
ATOM   199  C  CE2   . PHE A 1 49  ? 6.412  16.228 22.406  1.00 29.00 ? 31   PHE A CE2   1 
ATOM   200  C  CZ    . PHE A 1 49  ? 7.098  16.219 23.595  1.00 27.99 ? 31   PHE A CZ    1 
ATOM   201  N  N     . THR A 1 50  ? 6.805  11.903 19.646  1.00 25.41 ? 32   THR A N     1 
ATOM   202  C  CA    . THR A 1 50  ? 5.460  11.414 19.938  1.00 26.70 ? 32   THR A CA    1 
ATOM   203  C  C     . THR A 1 50  ? 5.372  9.884  19.932  1.00 28.44 ? 32   THR A C     1 
ATOM   204  O  O     . THR A 1 50  ? 4.547  9.321  20.633  1.00 29.95 ? 32   THR A O     1 
ATOM   205  C  CB    . THR A 1 50  ? 4.408  12.045 18.990  1.00 25.43 ? 32   THR A CB    1 
ATOM   206  O  OG1   . THR A 1 50  ? 4.684  11.659 17.633  1.00 26.18 ? 32   THR A OG1   1 
ATOM   207  C  CG2   . THR A 1 50  ? 4.486  13.538 19.028  1.00 22.25 ? 32   THR A CG2   1 
ATOM   208  N  N     . ARG A 1 51  ? 6.215  9.195  19.182  1.00 30.03 ? 33   ARG A N     1 
ATOM   209  C  CA    . ARG A 1 51  ? 6.141  7.717  19.103  1.00 31.28 ? 33   ARG A CA    1 
ATOM   210  C  C     . ARG A 1 51  ? 7.461  6.993  19.373  1.00 31.69 ? 33   ARG A C     1 
ATOM   211  O  O     . ARG A 1 51  ? 7.514  5.764  19.300  1.00 30.66 ? 33   ARG A O     1 
ATOM   212  C  CB    . ARG A 1 51  ? 5.653  7.293  17.715  1.00 32.84 ? 33   ARG A CB    1 
ATOM   213  C  CG    . ARG A 1 51  ? 4.275  7.817  17.330  1.00 35.67 ? 33   ARG A CG    1 
ATOM   214  C  CD    . ARG A 1 51  ? 3.649  7.111  16.115  1.00 40.49 ? 33   ARG A CD    1 
ATOM   215  N  NE    . ARG A 1 51  ? 4.580  6.906  15.002  1.00 43.95 ? 33   ARG A NE    1 
ATOM   216  C  CZ    . ARG A 1 51  ? 4.958  7.858  14.135  1.00 44.72 ? 33   ARG A CZ    1 
ATOM   217  N  NH1   . ARG A 1 51  ? 4.511  9.102  14.250  1.00 45.63 ? 33   ARG A NH1   1 
ATOM   218  N  NH2   . ARG A 1 51  ? 5.790  7.555  13.139  1.00 46.32 ? 33   ARG A NH2   1 
ATOM   219  N  N     . ASN A 1 52  ? 8.509  7.748  19.678  1.00 31.81 ? 34   ASN A N     1 
ATOM   220  C  CA    . ASN A 1 52  ? 9.860  7.208  19.856  1.00 32.87 ? 34   ASN A CA    1 
ATOM   221  C  C     . ASN A 1 52  ? 10.313 6.362  18.649  1.00 32.30 ? 34   ASN A C     1 
ATOM   222  O  O     . ASN A 1 52  ? 10.935 5.300  18.818  1.00 33.03 ? 34   ASN A O     1 
ATOM   223  C  CB    . ASN A 1 52  ? 9.951  6.411  21.169  1.00 34.19 ? 34   ASN A CB    1 
ATOM   224  C  CG    . ASN A 1 52  ? 11.402 6.130  21.601  1.00 37.25 ? 34   ASN A CG    1 
ATOM   225  O  OD1   . ASN A 1 52  ? 11.667 5.194  22.362  1.00 42.10 ? 34   ASN A OD1   1 
ATOM   226  N  ND2   . ASN A 1 52  ? 12.322 6.933  21.129  1.00 32.57 ? 34   ASN A ND2   1 
ATOM   227  N  N     . GLU A 1 53  ? 10.000 6.852  17.447  1.00 30.55 ? 35   GLU A N     1 
ATOM   228  C  CA    . GLU A 1 53  ? 10.308 6.175  16.187  1.00 30.43 ? 35   GLU A CA    1 
ATOM   229  C  C     . GLU A 1 53  ? 11.103 7.070  15.249  1.00 28.41 ? 35   GLU A C     1 
ATOM   230  O  O     . GLU A 1 53  ? 10.904 8.278  15.209  1.00 27.42 ? 35   GLU A O     1 
ATOM   231  C  CB    . GLU A 1 53  ? 9.033  5.731  15.502  1.00 30.47 ? 35   GLU A CB    1 
ATOM   232  C  CG    . GLU A 1 53  ? 8.300  4.667  16.317  1.00 35.76 ? 35   GLU A CG    1 
ATOM   233  C  CD    . GLU A 1 53  ? 7.108  4.074  15.606  1.00 40.88 ? 35   GLU A CD    1 
ATOM   234  O  OE1   . GLU A 1 53  ? 6.597  3.025  16.098  1.00 47.62 ? 35   GLU A OE1   1 
ATOM   235  O  OE2   . GLU A 1 53  ? 6.684  4.632  14.562  1.00 43.50 ? 35   GLU A OE2   1 
ATOM   236  N  N     . PHE A 1 54  ? 11.992 6.438  14.500  1.00 27.10 ? 36   PHE A N     1 
ATOM   237  C  CA    . PHE A 1 54  ? 12.868 7.099  13.585  1.00 25.84 ? 36   PHE A CA    1 
ATOM   238  C  C     . PHE A 1 54  ? 12.995 6.243  12.328  1.00 27.11 ? 36   PHE A C     1 
ATOM   239  O  O     . PHE A 1 54  ? 13.121 5.005  12.397  1.00 25.30 ? 36   PHE A O     1 
ATOM   240  C  CB    . PHE A 1 54  ? 14.225 7.361  14.244  1.00 25.22 ? 36   PHE A CB    1 
ATOM   241  C  CG    . PHE A 1 54  ? 15.171 8.068  13.360  1.00 25.44 ? 36   PHE A CG    1 
ATOM   242  C  CD1   . PHE A 1 54  ? 15.212 9.460  13.356  1.00 23.48 ? 36   PHE A CD1   1 
ATOM   243  C  CD2   . PHE A 1 54  ? 15.991 7.373  12.497  1.00 23.65 ? 36   PHE A CD2   1 
ATOM   244  C  CE1   . PHE A 1 54  ? 16.032 10.109 12.507  1.00 23.00 ? 36   PHE A CE1   1 
ATOM   245  C  CE2   . PHE A 1 54  ? 16.827 8.038  11.641  1.00 24.09 ? 36   PHE A CE2   1 
ATOM   246  C  CZ    . PHE A 1 54  ? 16.857 9.411  11.653  1.00 22.73 ? 36   PHE A CZ    1 
ATOM   247  N  N     . ASN A 1 55  ? 12.959 6.887  11.174  1.00 26.40 ? 37   ASN A N     1 
ATOM   248  C  CA    . ASN A 1 55  ? 13.171 6.203  9.921   1.00 27.23 ? 37   ASN A CA    1 
ATOM   249  C  C     . ASN A 1 55  ? 14.272 6.903  9.104   1.00 27.27 ? 37   ASN A C     1 
ATOM   250  O  O     . ASN A 1 55  ? 14.285 8.128  8.944   1.00 22.59 ? 37   ASN A O     1 
ATOM   251  C  CB    . ASN A 1 55  ? 11.844 6.119  9.180   1.00 28.03 ? 37   ASN A CB    1 
ATOM   252  C  CG    . ASN A 1 55  ? 10.686 5.675  10.104  1.00 34.84 ? 37   ASN A CG    1 
ATOM   253  O  OD1   . ASN A 1 55  ? 10.636 4.537  10.584  1.00 40.99 ? 37   ASN A OD1   1 
ATOM   254  N  ND2   . ASN A 1 55  ? 9.743  6.586  10.342  1.00 43.42 ? 37   ASN A ND2   1 
ATOM   255  N  N     . LEU A 1 56  ? 15.187 6.113  8.564   1.00 25.79 ? 38   LEU A N     1 
ATOM   256  C  CA    . LEU A 1 56  ? 16.288 6.637  7.793   1.00 26.80 ? 38   LEU A CA    1 
ATOM   257  C  C     . LEU A 1 56  ? 15.909 7.000  6.379   1.00 27.87 ? 38   LEU A C     1 
ATOM   258  O  O     . LEU A 1 56  ? 16.684 7.689  5.691   1.00 27.41 ? 38   LEU A O     1 
ATOM   259  C  CB    . LEU A 1 56  ? 17.454 5.602  7.768   1.00 26.36 ? 38   LEU A CB    1 
ATOM   260  C  CG    . LEU A 1 56  ? 18.145 5.416  9.124   1.00 26.01 ? 38   LEU A CG    1 
ATOM   261  C  CD1   . LEU A 1 56  ? 19.096 4.222  9.180   1.00 26.66 ? 38   LEU A CD1   1 
ATOM   262  C  CD2   . LEU A 1 56  ? 19.025 6.680  9.496   1.00 28.33 ? 38   LEU A CD2   1 
ATOM   263  N  N     . GLU A 1 57  ? 14.768 6.479  5.932   1.00 30.21 ? 39   GLU A N     1 
ATOM   264  C  CA    . GLU A 1 57  ? 14.199 6.729  4.602   1.00 32.79 ? 39   GLU A CA    1 
ATOM   265  C  C     . GLU A 1 57  ? 13.901 8.235  4.538   1.00 31.54 ? 39   GLU A C     1 
ATOM   266  O  O     . GLU A 1 57  ? 13.720 8.857  5.589   1.00 30.95 ? 39   GLU A O     1 
ATOM   267  C  CB    . GLU A 1 57  ? 12.880 5.941  4.447   1.00 33.84 ? 39   GLU A CB    1 
ATOM   268  C  CG    . GLU A 1 57  ? 12.377 5.312  5.763   1.00 40.56 ? 39   GLU A CG    1 
ATOM   269  C  CD    . GLU A 1 57  ? 11.101 4.508  5.594   1.00 50.63 ? 39   GLU A CD    1 
ATOM   270  O  OE1   . GLU A 1 57  ? 10.791 3.647  6.472   1.00 58.40 ? 39   GLU A OE1   1 
ATOM   271  O  OE2   . GLU A 1 57  ? 10.404 4.726  4.575   1.00 57.23 ? 39   GLU A OE2   1 
ATOM   272  N  N     . SER A 1 58  ? 13.864 8.818  3.337   1.00 30.96 ? 40   SER A N     1 
ATOM   273  C  CA    . SER A 1 58  ? 13.443 10.204 3.204   1.00 30.34 ? 40   SER A CA    1 
ATOM   274  C  C     . SER A 1 58  ? 12.221 10.290 2.312   1.00 30.36 ? 40   SER A C     1 
ATOM   275  O  O     . SER A 1 58  ? 12.199 9.705  1.216   1.00 29.88 ? 40   SER A O     1 
ATOM   276  C  CB    . SER A 1 58  ? 14.555 11.073 2.621   1.00 31.09 ? 40   SER A CB    1 
ATOM   277  O  OG    . SER A 1 58  ? 14.157 12.427 2.643   1.00 33.55 ? 40   SER A OG    1 
ATOM   278  N  N     . LYS A 1 59  ? 11.205 11.014 2.790   1.00 29.43 ? 41   LYS A N     1 
ATOM   279  C  CA    . LYS A 1 59  ? 9.956  11.161 2.067   1.00 29.40 ? 41   LYS A CA    1 
ATOM   280  C  C     . LYS A 1 59  ? 9.312  12.496 2.450   1.00 27.76 ? 41   LYS A C     1 
ATOM   281  O  O     . LYS A 1 59  ? 9.028  12.728 3.618   1.00 29.40 ? 41   LYS A O     1 
ATOM   282  C  CB    . LYS A 1 59  ? 9.054  9.947  2.355   1.00 30.90 ? 41   LYS A CB    1 
ATOM   283  C  CG    . LYS A 1 59  ? 7.682  10.125 2.945   1.00 36.54 ? 41   LYS A CG    1 
ATOM   284  C  CD    . LYS A 1 59  ? 6.593  9.478  2.027   1.00 42.76 ? 41   LYS A CD    1 
ATOM   285  C  CE    . LYS A 1 59  ? 5.153  9.833  2.484   1.00 45.09 ? 41   LYS A CE    1 
ATOM   286  N  NZ    . LYS A 1 59  ? 4.129  9.609  1.411   1.00 45.34 ? 41   LYS A NZ    1 
ATOM   287  N  N     . SER A 1 60  ? 9.110  13.343 1.443   1.00 24.95 ? 42   SER A N     1 
ATOM   288  C  CA    . SER A 1 60  ? 8.439  14.628 1.616   1.00 21.73 ? 42   SER A CA    1 
ATOM   289  C  C     . SER A 1 60  ? 7.095  14.460 2.338   1.00 20.14 ? 42   SER A C     1 
ATOM   290  O  O     . SER A 1 60  ? 6.273  13.565 1.996   1.00 20.63 ? 42   SER A O     1 
ATOM   291  C  CB    . SER A 1 60  ? 8.355  15.371 0.271   1.00 22.12 ? 42   SER A CB    1 
ATOM   292  O  OG    . SER A 1 60  ? 7.495  14.739 -0.643  1.00 21.32 ? 42   SER A OG    1 
ATOM   293  N  N     . THR A 1 61  ? 6.831  15.312 3.356   1.00 16.85 ? 43   THR A N     1 
ATOM   294  C  CA    . THR A 1 61  ? 5.585  15.250 4.095   1.00 15.09 ? 43   THR A CA    1 
ATOM   295  C  C     . THR A 1 61  ? 4.368  15.697 3.278   1.00 17.50 ? 43   THR A C     1 
ATOM   296  O  O     . THR A 1 61  ? 4.444  16.677 2.513   1.00 17.06 ? 43   THR A O     1 
ATOM   297  C  CB    . THR A 1 61  ? 5.719  16.158 5.370   1.00 15.86 ? 43   THR A CB    1 
ATOM   298  O  OG1   . THR A 1 61  ? 6.668  15.563 6.261   1.00 13.87 ? 43   THR A OG1   1 
ATOM   299  C  CG2   . THR A 1 61  ? 4.468  16.246 6.206   1.00 14.15 ? 43   THR A CG2   1 
ATOM   300  N  N     . ILE A 1 62  ? 3.274  14.971 3.444   1.00 18.00 ? 44   ILE A N     1 
ATOM   301  C  CA    . ILE A 1 62  ? 2.052  15.181 2.726   1.00 18.66 ? 44   ILE A CA    1 
ATOM   302  C  C     . ILE A 1 62  ? 1.104  16.081 3.489   1.00 17.13 ? 44   ILE A C     1 
ATOM   303  O  O     . ILE A 1 62  ? 0.751  15.847 4.668   1.00 17.20 ? 44   ILE A O     1 
ATOM   304  C  CB    . ILE A 1 62  ? 1.334  13.805 2.423   1.00 19.87 ? 44   ILE A CB    1 
ATOM   305  C  CG1   . ILE A 1 62  ? 2.126  13.025 1.421   1.00 24.24 ? 44   ILE A CG1   1 
ATOM   306  C  CG2   . ILE A 1 62  ? -0.108 14.093 1.974   1.00 22.30 ? 44   ILE A CG2   1 
ATOM   307  C  CD1   . ILE A 1 62  ? 1.589  11.586 1.309   1.00 29.17 ? 44   ILE A CD1   1 
ATOM   308  N  N     . GLY A 1 63  ? 0.643  17.146 2.818   1.00 17.72 ? 45   GLY A N     1 
ATOM   309  C  CA    . GLY A 1 63  ? -0.285 18.033 3.459   1.00 16.21 ? 45   GLY A CA    1 
ATOM   310  C  C     . GLY A 1 63  ? 0.172  18.596 4.801   1.00 15.66 ? 45   GLY A C     1 
ATOM   311  O  O     . GLY A 1 63  ? 1.301  19.085 4.949   1.00 14.39 ? 45   GLY A O     1 
ATOM   312  N  N     . VAL A 1 64  ? -0.699 18.502 5.795   1.00 15.01 ? 46   VAL A N     1 
ATOM   313  C  CA    . VAL A 1 64  ? -0.386 18.915 7.130   1.00 16.00 ? 46   VAL A CA    1 
ATOM   314  C  C     . VAL A 1 64  ? -0.744 17.770 8.059   1.00 14.60 ? 46   VAL A C     1 
ATOM   315  O  O     . VAL A 1 64  ? -1.799 17.133 7.894   1.00 14.72 ? 46   VAL A O     1 
ATOM   316  C  CB    . VAL A 1 64  ? -1.171 20.241 7.478   1.00 17.18 ? 46   VAL A CB    1 
ATOM   317  C  CG1   . VAL A 1 64  ? -0.909 20.653 8.869   1.00 18.04 ? 46   VAL A CG1   1 
ATOM   318  C  CG2   . VAL A 1 64  ? -0.737 21.342 6.566   1.00 17.31 ? 46   VAL A CG2   1 
ATOM   319  N  N     . GLU A 1 65  ? 0.105  17.506 9.043   1.00 14.18 ? 47   GLU A N     1 
ATOM   320  C  CA    . GLU A 1 65  ? -0.119 16.457 10.007  1.00 15.43 ? 47   GLU A CA    1 
ATOM   321  C  C     . GLU A 1 65  ? 0.080  17.070 11.371  1.00 15.34 ? 47   GLU A C     1 
ATOM   322  O  O     . GLU A 1 65  ? 0.803  18.056 11.549  1.00 16.91 ? 47   GLU A O     1 
ATOM   323  C  CB    . GLU A 1 65  ? 0.917  15.343 9.813   1.00 17.41 ? 47   GLU A CB    1 
ATOM   324  C  CG    . GLU A 1 65  ? 0.966  14.809 8.415   1.00 22.20 ? 47   GLU A CG    1 
ATOM   325  C  CD    . GLU A 1 65  ? 1.601  13.457 8.297   1.00 28.09 ? 47   GLU A CD    1 
ATOM   326  O  OE1   . GLU A 1 65  ? 2.385  13.147 9.214   1.00 31.88 ? 47   GLU A OE1   1 
ATOM   327  O  OE2   . GLU A 1 65  ? 1.323  12.741 7.275   1.00 31.97 ? 47   GLU A OE2   1 
ATOM   328  N  N     . PHE A 1 66  ? -0.518 16.456 12.368  1.00 17.24 ? 48   PHE A N     1 
ATOM   329  C  CA    . PHE A 1 66  ? -0.098 16.793 13.719  1.00 18.64 ? 48   PHE A CA    1 
ATOM   330  C  C     . PHE A 1 66  ? -0.228 15.562 14.591  1.00 20.28 ? 48   PHE A C     1 
ATOM   331  O  O     . PHE A 1 66  ? -0.984 14.633 14.288  1.00 21.24 ? 48   PHE A O     1 
ATOM   332  C  CB    . PHE A 1 66  ? -0.830 18.035 14.310  1.00 17.51 ? 48   PHE A CB    1 
ATOM   333  C  CG    . PHE A 1 66  ? -2.326 17.903 14.386  1.00 21.09 ? 48   PHE A CG    1 
ATOM   334  C  CD1   . PHE A 1 66  ? -3.125 18.530 13.447  1.00 21.43 ? 48   PHE A CD1   1 
ATOM   335  C  CD2   . PHE A 1 66  ? -2.922 17.179 15.442  1.00 21.98 ? 48   PHE A CD2   1 
ATOM   336  C  CE1   . PHE A 1 66  ? -4.530 18.396 13.552  1.00 24.09 ? 48   PHE A CE1   1 
ATOM   337  C  CE2   . PHE A 1 66  ? -4.329 17.063 15.532  1.00 21.19 ? 48   PHE A CE2   1 
ATOM   338  C  CZ    . PHE A 1 66  ? -5.097 17.671 14.631  1.00 21.81 ? 48   PHE A CZ    1 
ATOM   339  N  N     . ALA A 1 67  ? 0.567  15.544 15.647  1.00 21.75 ? 49   ALA A N     1 
ATOM   340  C  CA    . ALA A 1 67  ? 0.600  14.389 16.572  1.00 23.10 ? 49   ALA A CA    1 
ATOM   341  C  C     . ALA A 1 67  ? 0.703  15.017 17.957  1.00 23.54 ? 49   ALA A C     1 
ATOM   342  O  O     . ALA A 1 67  ? 0.965  16.211 18.099  1.00 24.70 ? 49   ALA A O     1 
ATOM   343  C  CB    . ALA A 1 67  ? 1.782  13.495 16.293  1.00 23.22 ? 49   ALA A CB    1 
ATOM   344  N  N     . THR A 1 68  ? 0.447  14.233 19.003  1.00 23.69 ? 50   THR A N     1 
ATOM   345  C  CA    . THR A 1 68  ? 0.368  14.820 20.312  1.00 24.02 ? 50   THR A CA    1 
ATOM   346  C  C     . THR A 1 68  ? 1.111  13.982 21.334  1.00 24.10 ? 50   THR A C     1 
ATOM   347  O  O     . THR A 1 68  ? 1.256  12.793 21.186  1.00 22.37 ? 50   THR A O     1 
ATOM   348  C  CB    . THR A 1 68  ? -1.056 14.950 20.770  1.00 25.15 ? 50   THR A CB    1 
ATOM   349  O  OG1   . THR A 1 68  ? -1.624 13.644 20.907  1.00 27.44 ? 50   THR A OG1   1 
ATOM   350  C  CG2   . THR A 1 68  ? -1.879 15.616 19.739  1.00 27.26 ? 50   THR A CG2   1 
ATOM   351  N  N     . ARG A 1 69  ? 1.557  14.662 22.358  1.00 24.74 ? 51   ARG A N     1 
ATOM   352  C  CA    . ARG A 1 69  ? 2.200  13.990 23.478  1.00 26.21 ? 51   ARG A CA    1 
ATOM   353  C  C     . ARG A 1 69  ? 1.911  14.873 24.677  1.00 27.51 ? 51   ARG A C     1 
ATOM   354  O  O     . ARG A 1 69  ? 2.016  16.093 24.583  1.00 27.07 ? 51   ARG A O     1 
ATOM   355  C  CB    . ARG A 1 69  ? 3.678  13.920 23.204  1.00 26.54 ? 51   ARG A CB    1 
ATOM   356  C  CG    . ARG A 1 69  ? 4.519  13.686 24.405  1.00 31.78 ? 51   ARG A CG    1 
ATOM   357  C  CD    . ARG A 1 69  ? 4.521  12.303 24.820  1.00 35.39 ? 51   ARG A CD    1 
ATOM   358  N  NE    . ARG A 1 69  ? 5.848  11.777 24.619  1.00 40.19 ? 51   ARG A NE    1 
ATOM   359  C  CZ    . ARG A 1 69  ? 6.908  12.054 25.355  1.00 41.84 ? 51   ARG A CZ    1 
ATOM   360  N  NH1   . ARG A 1 69  ? 6.832  12.876 26.381  1.00 46.53 ? 51   ARG A NH1   1 
ATOM   361  N  NH2   . ARG A 1 69  ? 8.068  11.501 25.042  1.00 45.01 ? 51   ARG A NH2   1 
ATOM   362  N  N     . SER A 1 70  ? 1.581  14.265 25.824  1.00 28.83 ? 52   SER A N     1 
ATOM   363  C  CA    . SER A 1 70  ? 1.398  15.032 27.050  1.00 30.86 ? 52   SER A CA    1 
ATOM   364  C  C     . SER A 1 70  ? 2.628  14.904 27.932  1.00 32.39 ? 52   SER A C     1 
ATOM   365  O  O     . SER A 1 70  ? 3.255  13.819 27.992  1.00 33.48 ? 52   SER A O     1 
ATOM   366  C  CB    . SER A 1 70  ? 0.128  14.587 27.768  1.00 31.27 ? 52   SER A CB    1 
ATOM   367  O  OG    . SER A 1 70  ? -0.982 15.165 27.117  1.00 33.89 ? 52   SER A OG    1 
ATOM   368  N  N     . ILE A 1 71  ? 3.034  16.019 28.529  1.00 33.06 ? 53   ILE A N     1 
ATOM   369  C  CA    . ILE A 1 71  ? 4.118  16.014 29.502  1.00 35.20 ? 53   ILE A CA    1 
ATOM   370  C  C     . ILE A 1 71  ? 3.694  16.772 30.736  1.00 35.98 ? 53   ILE A C     1 
ATOM   371  O  O     . ILE A 1 71  ? 2.685  17.449 30.723  1.00 34.84 ? 53   ILE A O     1 
ATOM   372  C  CB    . ILE A 1 71  ? 5.392  16.671 28.962  1.00 35.26 ? 53   ILE A CB    1 
ATOM   373  C  CG1   . ILE A 1 71  ? 5.155  18.158 28.715  1.00 36.26 ? 53   ILE A CG1   1 
ATOM   374  C  CG2   . ILE A 1 71  ? 5.895  15.965 27.720  1.00 36.10 ? 53   ILE A CG2   1 
ATOM   375  C  CD1   . ILE A 1 71  ? 6.451  18.935 28.647  1.00 39.05 ? 53   ILE A CD1   1 
ATOM   376  N  N     . GLN A 1 72  ? 4.525  16.694 31.772  1.00 38.06 ? 54   GLN A N     1 
ATOM   377  C  CA    . GLN A 1 72  ? 4.283  17.415 33.012  1.00 40.20 ? 54   GLN A CA    1 
ATOM   378  C  C     . GLN A 1 72  ? 5.097  18.692 33.116  1.00 40.42 ? 54   GLN A C     1 
ATOM   379  O  O     . GLN A 1 72  ? 6.302  18.675 32.876  1.00 41.43 ? 54   GLN A O     1 
ATOM   380  C  CB    . GLN A 1 72  ? 4.586  16.501 34.205  1.00 40.75 ? 54   GLN A CB    1 
ATOM   381  C  CG    . GLN A 1 72  ? 3.766  15.222 34.217  1.00 43.72 ? 54   GLN A CG    1 
ATOM   382  C  CD    . GLN A 1 72  ? 2.247  15.468 34.146  1.00 48.62 ? 54   GLN A CD    1 
ATOM   383  O  OE1   . GLN A 1 72  ? 1.478  14.535 33.877  1.00 52.55 ? 54   GLN A OE1   1 
ATOM   384  N  NE2   . GLN A 1 72  ? 1.821  16.717 34.401  1.00 53.32 ? 54   GLN A NE2   1 
ATOM   385  N  N     . VAL A 1 73  ? 4.429  19.786 33.472  1.00 41.06 ? 55   VAL A N     1 
ATOM   386  C  CA    . VAL A 1 73  ? 5.078  21.076 33.747  1.00 42.11 ? 55   VAL A CA    1 
ATOM   387  C  C     . VAL A 1 73  ? 4.431  21.757 34.965  1.00 42.88 ? 55   VAL A C     1 
ATOM   388  O  O     . VAL A 1 73  ? 3.231  22.018 34.974  1.00 42.79 ? 55   VAL A O     1 
ATOM   389  C  CB    . VAL A 1 73  ? 5.010  22.053 32.530  1.00 41.80 ? 55   VAL A CB    1 
ATOM   390  C  CG1   . VAL A 1 73  ? 5.647  23.397 32.877  1.00 42.10 ? 55   VAL A CG1   1 
ATOM   391  C  CG2   . VAL A 1 73  ? 5.695  21.475 31.328  1.00 41.05 ? 55   VAL A CG2   1 
ATOM   392  N  N     . ASP A 1 74  ? 5.252  22.079 35.973  1.00 43.99 ? 56   ASP A N     1 
ATOM   393  C  CA    . ASP A 1 74  ? 4.782  22.695 37.236  1.00 44.11 ? 56   ASP A CA    1 
ATOM   394  C  C     . ASP A 1 74  ? 3.597  21.944 37.857  1.00 43.78 ? 56   ASP A C     1 
ATOM   395  O  O     . ASP A 1 74  ? 2.614  22.544 38.265  1.00 43.85 ? 56   ASP A O     1 
ATOM   396  C  CB    . ASP A 1 74  ? 4.417  24.169 37.014  1.00 44.38 ? 56   ASP A CB    1 
ATOM   397  C  CG    . ASP A 1 74  ? 4.288  24.957 38.324  1.00 44.49 ? 56   ASP A CG    1 
ATOM   398  O  OD1   . ASP A 1 74  ? 3.500  25.945 38.318  1.00 39.62 ? 56   ASP A OD1   1 
ATOM   399  O  OD2   . ASP A 1 74  ? 4.944  24.661 39.380  1.00 44.79 ? 56   ASP A OD2   1 
ATOM   400  N  N     . GLY A 1 75  ? 3.689  20.622 37.881  1.00 44.43 ? 57   GLY A N     1 
ATOM   401  C  CA    . GLY A 1 75  ? 2.634  19.784 38.430  1.00 44.85 ? 57   GLY A CA    1 
ATOM   402  C  C     . GLY A 1 75  ? 1.337  19.682 37.654  1.00 45.45 ? 57   GLY A C     1 
ATOM   403  O  O     . GLY A 1 75  ? 0.407  19.001 38.108  1.00 46.22 ? 57   GLY A O     1 
ATOM   404  N  N     . LYS A 1 76  ? 1.276  20.347 36.488  1.00 44.80 ? 58   LYS A N     1 
ATOM   405  C  CA    . LYS A 1 76  ? 0.077  20.410 35.645  1.00 43.89 ? 58   LYS A CA    1 
ATOM   406  C  C     . LYS A 1 76  ? 0.364  19.654 34.312  1.00 41.95 ? 58   LYS A C     1 
ATOM   407  O  O     . LYS A 1 76  ? 1.520  19.394 33.967  1.00 42.10 ? 58   LYS A O     1 
ATOM   408  C  CB    . LYS A 1 76  ? -0.327 21.892 35.420  1.00 44.47 ? 58   LYS A CB    1 
ATOM   409  C  CG    . LYS A 1 76  ? -1.471 22.464 36.372  1.00 46.20 ? 58   LYS A CG    1 
ATOM   410  C  CD    . LYS A 1 76  ? -1.082 22.603 37.882  1.00 49.90 ? 58   LYS A CD    1 
ATOM   411  C  CE    . LYS A 1 76  ? -0.274 23.885 38.174  1.00 50.98 ? 58   LYS A CE    1 
ATOM   412  N  NZ    . LYS A 1 76  ? 0.481  23.846 39.487  1.00 52.14 ? 58   LYS A NZ    1 
ATOM   413  N  N     . THR A 1 77  ? -0.672 19.271 33.589  1.00 39.67 ? 59   THR A N     1 
ATOM   414  C  CA    . THR A 1 77  ? -0.510 18.392 32.428  1.00 38.14 ? 59   THR A CA    1 
ATOM   415  C  C     . THR A 1 77  ? -0.604 19.206 31.143  1.00 36.10 ? 59   THR A C     1 
ATOM   416  O  O     . THR A 1 77  ? -1.620 19.850 30.910  1.00 36.61 ? 59   THR A O     1 
ATOM   417  C  CB    . THR A 1 77  ? -1.580 17.304 32.425  1.00 38.59 ? 59   THR A CB    1 
ATOM   418  O  OG1   . THR A 1 77  ? -1.276 16.326 33.430  1.00 40.20 ? 59   THR A OG1   1 
ATOM   419  C  CG2   . THR A 1 77  ? -1.539 16.486 31.104  1.00 37.46 ? 59   THR A CG2   1 
ATOM   420  N  N     . ILE A 1 78  ? 0.457  19.189 30.339  1.00 33.39 ? 60   ILE A N     1 
ATOM   421  C  CA    . ILE A 1 78  ? 0.501  19.949 29.085  1.00 31.52 ? 60   ILE A CA    1 
ATOM   422  C  C     . ILE A 1 78  ? 0.333  18.980 27.922  1.00 28.89 ? 60   ILE A C     1 
ATOM   423  O  O     . ILE A 1 78  ? 1.166  18.111 27.744  1.00 27.56 ? 60   ILE A O     1 
ATOM   424  C  CB    . ILE A 1 78  ? 1.872  20.649 28.905  1.00 31.93 ? 60   ILE A CB    1 
ATOM   425  C  CG1   . ILE A 1 78  ? 2.252  21.535 30.106  1.00 33.12 ? 60   ILE A CG1   1 
ATOM   426  C  CG2   . ILE A 1 78  ? 1.895  21.475 27.606  1.00 30.13 ? 60   ILE A CG2   1 
ATOM   427  C  CD1   . ILE A 1 78  ? 1.172  22.447 30.596  1.00 36.68 ? 60   ILE A CD1   1 
ATOM   428  N  N     . LYS A 1 79  ? -0.731 19.140 27.148  1.00 26.52 ? 61   LYS A N     1 
ATOM   429  C  CA    . LYS A 1 79  ? -0.898 18.411 25.917  1.00 27.09 ? 61   LYS A CA    1 
ATOM   430  C  C     . LYS A 1 79  ? -0.209 19.230 24.799  1.00 24.90 ? 61   LYS A C     1 
ATOM   431  O  O     . LYS A 1 79  ? -0.637 20.331 24.497  1.00 25.12 ? 61   LYS A O     1 
ATOM   432  C  CB    . LYS A 1 79  ? -2.380 18.249 25.608  1.00 27.64 ? 61   LYS A CB    1 
ATOM   433  C  CG    . LYS A 1 79  ? -2.666 17.411 24.361  1.00 32.90 ? 61   LYS A CG    1 
ATOM   434  C  CD    . LYS A 1 79  ? -4.152 17.128 24.242  1.00 39.14 ? 61   LYS A CD    1 
ATOM   435  C  CE    . LYS A 1 79  ? -4.440 16.059 23.198  1.00 43.12 ? 61   LYS A CE    1 
ATOM   436  N  NZ    . LYS A 1 79  ? -4.468 14.661 23.773  1.00 43.06 ? 61   LYS A NZ    1 
ATOM   437  N  N     . ALA A 1 80  ? 0.855  18.693 24.244  1.00 24.56 ? 62   ALA A N     1 
ATOM   438  C  CA    . ALA A 1 80  ? 1.570  19.327 23.140  1.00 23.69 ? 62   ALA A CA    1 
ATOM   439  C  C     . ALA A 1 80  ? 0.956  18.830 21.835  1.00 23.41 ? 62   ALA A C     1 
ATOM   440  O  O     . ALA A 1 80  ? 0.930  17.617 21.568  1.00 21.44 ? 62   ALA A O     1 
ATOM   441  C  CB    . ALA A 1 80  ? 3.026  18.992 23.208  1.00 24.09 ? 62   ALA A CB    1 
ATOM   442  N  N     . GLN A 1 81  ? 0.388  19.735 21.029  1.00 22.10 ? 63   GLN A N     1 
ATOM   443  C  CA    . GLN A 1 81  ? -0.101 19.321 19.710  1.00 19.88 ? 63   GLN A CA    1 
ATOM   444  C  C     . GLN A 1 81  ? 0.886  19.879 18.704  1.00 17.42 ? 63   GLN A C     1 
ATOM   445  O  O     . GLN A 1 81  ? 0.996  21.118 18.557  1.00 16.54 ? 63   GLN A O     1 
ATOM   446  C  CB    . GLN A 1 81  ? -1.475 19.907 19.498  1.00 20.00 ? 63   GLN A CB    1 
ATOM   447  C  CG    . GLN A 1 81  ? -2.189 19.491 18.282  1.00 20.93 ? 63   GLN A CG    1 
ATOM   448  C  CD    . GLN A 1 81  ? -3.361 20.397 17.975  1.00 23.36 ? 63   GLN A CD    1 
ATOM   449  O  OE1   . GLN A 1 81  ? -3.198 21.628 17.739  1.00 22.79 ? 63   GLN A OE1   1 
ATOM   450  N  NE2   . GLN A 1 81  ? -4.560 19.815 18.007  1.00 24.92 ? 63   GLN A NE2   1 
ATOM   451  N  N     A ILE A 1 82  ? 1.625  18.990 18.036  0.50 17.29 ? 64   ILE A N     1 
ATOM   452  N  N     B ILE A 1 82  ? 1.645  18.987 18.056  0.50 17.18 ? 64   ILE A N     1 
ATOM   453  C  CA    A ILE A 1 82  ? 2.784  19.365 17.235  0.50 16.70 ? 64   ILE A CA    1 
ATOM   454  C  CA    B ILE A 1 82  ? 2.801  19.355 17.242  0.50 16.44 ? 64   ILE A CA    1 
ATOM   455  C  C     A ILE A 1 82  ? 2.451  19.193 15.756  0.50 15.57 ? 64   ILE A C     1 
ATOM   456  C  C     B ILE A 1 82  ? 2.452  19.193 15.759  0.50 15.45 ? 64   ILE A C     1 
ATOM   457  O  O     A ILE A 1 82  ? 2.097  18.117 15.319  0.50 14.87 ? 64   ILE A O     1 
ATOM   458  O  O     B ILE A 1 82  ? 2.094  18.118 15.321  0.50 14.85 ? 64   ILE A O     1 
ATOM   459  C  CB    A ILE A 1 82  ? 4.031  18.537 17.590  0.50 16.80 ? 64   ILE A CB    1 
ATOM   460  C  CB    B ILE A 1 82  ? 4.061  18.502 17.567  0.50 16.34 ? 64   ILE A CB    1 
ATOM   461  C  CG1   A ILE A 1 82  ? 4.214  18.469 19.112  0.50 18.73 ? 64   ILE A CG1   1 
ATOM   462  C  CG1   B ILE A 1 82  ? 4.330  18.430 19.083  0.50 17.22 ? 64   ILE A CG1   1 
ATOM   463  C  CG2   A ILE A 1 82  ? 5.295  19.146 16.958  0.50 18.16 ? 64   ILE A CG2   1 
ATOM   464  C  CG2   B ILE A 1 82  ? 5.301  19.062 16.842  0.50 18.00 ? 64   ILE A CG2   1 
ATOM   465  C  CD1   A ILE A 1 82  ? 4.829  17.213 19.562  0.50 19.71 ? 64   ILE A CD1   1 
ATOM   466  C  CD1   B ILE A 1 82  ? 4.571  19.750 19.733  0.50 15.54 ? 64   ILE A CD1   1 
ATOM   467  N  N     . TRP A 1 83  ? 2.519  20.291 15.017  1.00 15.17 ? 65   TRP A N     1 
ATOM   468  C  CA    . TRP A 1 83  ? 2.156  20.332 13.573  1.00 14.33 ? 65   TRP A CA    1 
ATOM   469  C  C     . TRP A 1 83  ? 3.392  20.218 12.736  1.00 11.81 ? 65   TRP A C     1 
ATOM   470  O  O     . TRP A 1 83  ? 4.495  20.704 13.064  1.00 13.32 ? 65   TRP A O     1 
ATOM   471  C  CB    . TRP A 1 83  ? 1.398  21.647 13.261  1.00 13.86 ? 65   TRP A CB    1 
ATOM   472  C  CG    . TRP A 1 83  ? 0.086  21.784 13.878  1.00 13.44 ? 65   TRP A CG    1 
ATOM   473  C  CD1   . TRP A 1 83  ? -0.220 21.599 15.207  1.00 13.62 ? 65   TRP A CD1   1 
ATOM   474  C  CD2   . TRP A 1 83  ? -1.127 22.039 13.223  1.00 15.91 ? 65   TRP A CD2   1 
ATOM   475  N  NE1   . TRP A 1 83  ? -1.560 21.774 15.409  1.00 12.84 ? 65   TRP A NE1   1 
ATOM   476  C  CE2   . TRP A 1 83  ? -2.149 22.058 14.203  1.00 17.06 ? 65   TRP A CE2   1 
ATOM   477  C  CE3   . TRP A 1 83  ? -1.475 22.285 11.893  1.00 19.37 ? 65   TRP A CE3   1 
ATOM   478  C  CZ2   . TRP A 1 83  ? -3.488 22.259 13.883  1.00 16.70 ? 65   TRP A CZ2   1 
ATOM   479  C  CZ3   . TRP A 1 83  ? -2.835 22.529 11.592  1.00 19.12 ? 65   TRP A CZ3   1 
ATOM   480  C  CH2   . TRP A 1 83  ? -3.806 22.480 12.590  1.00 19.81 ? 65   TRP A CH2   1 
ATOM   481  N  N     . ASP A 1 84  ? 3.224  19.573 11.574  1.00 11.64 ? 66   ASP A N     1 
ATOM   482  C  CA    . ASP A 1 84  ? 4.308  19.315 10.677  1.00 12.05 ? 66   ASP A CA    1 
ATOM   483  C  C     . ASP A 1 84  ? 3.785  19.471 9.255   1.00 12.09 ? 66   ASP A C     1 
ATOM   484  O  O     . ASP A 1 84  ? 2.624  19.126 8.962   1.00 11.25 ? 66   ASP A O     1 
ATOM   485  C  CB    . ASP A 1 84  ? 4.784  17.897 10.910  1.00 11.94 ? 66   ASP A CB    1 
ATOM   486  C  CG    . ASP A 1 84  ? 5.998  17.524 10.116  1.00 12.10 ? 66   ASP A CG    1 
ATOM   487  O  OD1   . ASP A 1 84  ? 6.162  16.268 9.748   1.00 14.29 ? 66   ASP A OD1   1 
ATOM   488  O  OD2   . ASP A 1 84  ? 6.897  18.350 9.805   1.00 14.23 ? 66   ASP A OD2   1 
ATOM   489  N  N     . THR A 1 85  ? 4.632  19.954 8.362   1.00 10.78 ? 67   THR A N     1 
ATOM   490  C  CA    . THR A 1 85  ? 4.254  20.109 6.943   1.00 11.32 ? 67   THR A CA    1 
ATOM   491  C  C     . THR A 1 85  ? 5.518  20.199 6.084   1.00 10.77 ? 67   THR A C     1 
ATOM   492  O  O     . THR A 1 85  ? 6.638  20.170 6.599   1.00 11.33 ? 67   THR A O     1 
ATOM   493  C  CB    . THR A 1 85  ? 3.324  21.336 6.799   1.00 10.31 ? 67   THR A CB    1 
ATOM   494  O  OG1   . THR A 1 85  ? 2.684  21.323 5.494   1.00 10.48 ? 67   THR A OG1   1 
ATOM   495  C  CG2   . THR A 1 85  ? 4.160  22.647 6.893   1.00 12.59 ? 67   THR A CG2   1 
ATOM   496  N  N     . ALA A 1 86  ? 5.378  20.176 4.763   1.00 11.43 ? 68   ALA A N     1 
ATOM   497  C  CA    . ALA A 1 86  ? 6.526  20.315 3.872   1.00 10.16 ? 68   ALA A CA    1 
ATOM   498  C  C     . ALA A 1 86  ? 7.238  21.658 3.961   1.00 10.28 ? 68   ALA A C     1 
ATOM   499  O  O     . ALA A 1 86  ? 6.594  22.710 4.044   1.00 9.88  ? 68   ALA A O     1 
ATOM   500  C  CB    . ALA A 1 86  ? 6.188  20.051 2.424   1.00 9.52  ? 68   ALA A CB    1 
ATOM   501  N  N     . GLY A 1 87  ? 8.557  21.626 3.985   1.00 8.93  ? 69   GLY A N     1 
ATOM   502  C  CA    . GLY A 1 87  ? 9.394  22.835 3.980   1.00 10.96 ? 69   GLY A CA    1 
ATOM   503  C  C     . GLY A 1 87  ? 9.398  23.541 2.648   1.00 11.90 ? 69   GLY A C     1 
ATOM   504  O  O     . GLY A 1 87  ? 9.537  24.732 2.609   1.00 13.11 ? 69   GLY A O     1 
ATOM   505  N  N     . LEU A 1 88  ? 9.183  22.841 1.540   1.00 11.15 ? 70   LEU A N     1 
ATOM   506  C  CA    . LEU A 1 88  ? 9.116  23.465 0.246   1.00 11.77 ? 70   LEU A CA    1 
ATOM   507  C  C     . LEU A 1 88  ? 7.766  24.131 0.059   1.00 10.22 ? 70   LEU A C     1 
ATOM   508  O  O     . LEU A 1 88  ? 6.736  23.514 0.312   1.00 11.85 ? 70   LEU A O     1 
ATOM   509  C  CB    . LEU A 1 88  ? 9.352  22.452 -0.875  1.00 12.06 ? 70   LEU A CB    1 
ATOM   510  C  CG    . LEU A 1 88  ? 9.317  23.005 -2.300  1.00 14.90 ? 70   LEU A CG    1 
ATOM   511  C  CD1   . LEU A 1 88  ? 10.469 23.843 -2.560  1.00 18.16 ? 70   LEU A CD1   1 
ATOM   512  C  CD2   . LEU A 1 88  ? 9.183  21.887 -3.349  1.00 19.06 ? 70   LEU A CD2   1 
ATOM   513  N  N     . GLU A 1 89  ? 7.797  25.367 -0.394  1.00 11.25 ? 71   GLU A N     1 
ATOM   514  C  CA    . GLU A 1 89  ? 6.596  26.166 -0.582  1.00 9.23  ? 71   GLU A CA    1 
ATOM   515  C  C     . GLU A 1 89  ? 6.551  26.721 -2.003  1.00 11.81 ? 71   GLU A C     1 
ATOM   516  O  O     . GLU A 1 89  ? 6.406  27.949 -2.214  1.00 16.22 ? 71   GLU A O     1 
ATOM   517  C  CB    . GLU A 1 89  ? 6.592  27.286 0.402   1.00 9.80  ? 71   GLU A CB    1 
ATOM   518  C  CG    . GLU A 1 89  ? 6.433  26.819 1.840   1.00 9.48  ? 71   GLU A CG    1 
ATOM   519  C  CD    . GLU A 1 89  ? 6.385  28.017 2.745   1.00 9.06  ? 71   GLU A CD    1 
ATOM   520  O  OE1   . GLU A 1 89  ? 7.409  28.366 3.394   1.00 10.62 ? 71   GLU A OE1   1 
ATOM   521  O  OE2   . GLU A 1 89  ? 5.303  28.649 2.812   1.00 9.92  ? 71   GLU A OE2   1 
ATOM   522  N  N     . ARG A 1 90  ? 6.741  25.906 -2.987  1.00 8.91  ? 72   ARG A N     1 
ATOM   523  C  CA    . ARG A 1 90  ? 6.811  26.393 -4.349  1.00 9.49  ? 72   ARG A CA    1 
ATOM   524  C  C     . ARG A 1 90  ? 5.423  26.626 -4.957  1.00 8.85  ? 72   ARG A C     1 
ATOM   525  O  O     . ARG A 1 90  ? 5.074  27.773 -5.321  1.00 11.08 ? 72   ARG A O     1 
ATOM   526  C  CB    . ARG A 1 90  ? 7.599  25.447 -5.196  1.00 10.89 ? 72   ARG A CB    1 
ATOM   527  C  CG    . ARG A 1 90  ? 7.686  25.798 -6.671  1.00 14.44 ? 72   ARG A CG    1 
ATOM   528  C  CD    . ARG A 1 90  ? 8.842  25.029 -7.376  1.00 16.55 ? 72   ARG A CD    1 
ATOM   529  N  NE    . ARG A 1 90  ? 10.094 25.386 -6.728  1.00 16.05 ? 72   ARG A NE    1 
ATOM   530  C  CZ    . ARG A 1 90  ? 11.094 24.557 -6.471  1.00 16.71 ? 72   ARG A CZ    1 
ATOM   531  N  NH1   . ARG A 1 90  ? 11.069 23.313 -6.898  1.00 20.99 ? 72   ARG A NH1   1 
ATOM   532  N  NH2   . ARG A 1 90  ? 12.135 25.036 -5.827  1.00 25.97 ? 72   ARG A NH2   1 
ATOM   533  N  N     . TYR A 1 91  ? 4.641  25.546 -5.014  1.00 9.22  ? 73   TYR A N     1 
ATOM   534  C  CA    . TYR A 1 91  ? 3.269  25.592 -5.616  1.00 8.52  ? 73   TYR A CA    1 
ATOM   535  C  C     . TYR A 1 91  ? 2.176  25.873 -4.627  1.00 7.05  ? 73   TYR A C     1 
ATOM   536  O  O     . TYR A 1 91  ? 1.130  26.368 -5.010  1.00 9.07  ? 73   TYR A O     1 
ATOM   537  C  CB    . TYR A 1 91  ? 2.933  24.309 -6.387  1.00 8.23  ? 73   TYR A CB    1 
ATOM   538  C  CG    . TYR A 1 91  ? 4.008  23.953 -7.410  1.00 8.66  ? 73   TYR A CG    1 
ATOM   539  C  CD1   . TYR A 1 91  ? 4.949  22.970 -7.129  1.00 12.98 ? 73   TYR A CD1   1 
ATOM   540  C  CD2   . TYR A 1 91  ? 4.170  24.681 -8.568  1.00 11.22 ? 73   TYR A CD2   1 
ATOM   541  C  CE1   . TYR A 1 91  ? 5.932  22.706 -7.987  1.00 13.96 ? 73   TYR A CE1   1 
ATOM   542  C  CE2   . TYR A 1 91  ? 5.199  24.369 -9.452  1.00 13.50 ? 73   TYR A CE2   1 
ATOM   543  C  CZ    . TYR A 1 91  ? 6.046  23.408 -9.159  1.00 16.32 ? 73   TYR A CZ    1 
ATOM   544  O  OH    . TYR A 1 91  ? 7.158  23.119 -10.013 1.00 16.00 ? 73   TYR A OH    1 
ATOM   545  N  N     . ARG A 1 92  ? 2.386  25.563 -3.363  1.00 9.25  ? 74   ARG A N     1 
ATOM   546  C  CA    . ARG A 1 92  ? 1.423  25.806 -2.297  1.00 9.91  ? 74   ARG A CA    1 
ATOM   547  C  C     . ARG A 1 92  ? 2.257  26.308 -1.145  1.00 11.41 ? 74   ARG A C     1 
ATOM   548  O  O     . ARG A 1 92  ? 3.254  25.678 -0.785  1.00 13.71 ? 74   ARG A O     1 
ATOM   549  C  CB    . ARG A 1 92  ? 0.649  24.544 -1.935  1.00 10.73 ? 74   ARG A CB    1 
ATOM   550  C  CG    . ARG A 1 92  ? -0.121 23.999 -3.115  1.00 13.97 ? 74   ARG A CG    1 
ATOM   551  C  CD    . ARG A 1 92  ? -0.999 22.816 -2.740  1.00 16.96 ? 74   ARG A CD    1 
ATOM   552  N  NE    . ARG A 1 92  ? -2.042 23.248 -1.820  1.00 17.12 ? 74   ARG A NE    1 
ATOM   553  C  CZ    . ARG A 1 92  ? -3.329 23.308 -2.124  1.00 14.39 ? 74   ARG A CZ    1 
ATOM   554  N  NH1   . ARG A 1 92  ? -3.751 22.879 -3.316  1.00 13.32 ? 74   ARG A NH1   1 
ATOM   555  N  NH2   . ARG A 1 92  ? -4.180 23.749 -1.226  1.00 15.14 ? 74   ARG A NH2   1 
ATOM   556  N  N     . ALA A 1 93  ? 1.868  27.433 -0.596  1.00 9.23  ? 75   ALA A N     1 
ATOM   557  C  CA    . ALA A 1 93  ? 2.599  28.065 0.439   1.00 9.70  ? 75   ALA A CA    1 
ATOM   558  C  C     . ALA A 1 93  ? 1.864  28.004 1.781   1.00 8.44  ? 75   ALA A C     1 
ATOM   559  O  O     . ALA A 1 93  ? 0.646  28.036 1.793   1.00 10.11 ? 75   ALA A O     1 
ATOM   560  C  CB    . ALA A 1 93  ? 2.785  29.464 0.074   1.00 11.10 ? 75   ALA A CB    1 
ATOM   561  N  N     . ILE A 1 94  ? 2.597  27.965 2.878   1.00 7.38  ? 76   ILE A N     1 
ATOM   562  C  CA    . ILE A 1 94  ? 2.010  27.869 4.206   1.00 7.58  ? 76   ILE A CA    1 
ATOM   563  C  C     . ILE A 1 94  ? 1.257  29.141 4.529   1.00 7.92  ? 76   ILE A C     1 
ATOM   564  O  O     . ILE A 1 94  ? 1.771  30.237 4.278   1.00 10.23 ? 76   ILE A O     1 
ATOM   565  C  CB    . ILE A 1 94  ? 3.060  27.514 5.223   1.00 6.14  ? 76   ILE A CB    1 
ATOM   566  C  CG1   . ILE A 1 94  ? 3.778  26.196 4.903   1.00 8.14  ? 76   ILE A CG1   1 
ATOM   567  C  CG2   . ILE A 1 94  ? 2.477  27.488 6.624   1.00 7.55  ? 76   ILE A CG2   1 
ATOM   568  C  CD1   . ILE A 1 94  ? 5.063  25.935 5.632   1.00 10.52 ? 76   ILE A CD1   1 
ATOM   569  N  N     . THR A 1 95  ? 0.075  29.010 5.121   1.00 8.06  ? 77   THR A N     1 
ATOM   570  C  CA    . THR A 1 95  ? -0.762 30.174 5.431   1.00 6.52  ? 77   THR A CA    1 
ATOM   571  C  C     . THR A 1 95  ? -0.732 30.477 6.934   1.00 7.71  ? 77   THR A C     1 
ATOM   572  O  O     . THR A 1 95  ? -0.211 29.752 7.753   1.00 7.64  ? 77   THR A O     1 
ATOM   573  C  CB    . THR A 1 95  ? -2.206 29.952 5.040   1.00 9.20  ? 77   THR A CB    1 
ATOM   574  O  OG1   . THR A 1 95  ? -2.761 28.988 5.921   1.00 8.86  ? 77   THR A OG1   1 
ATOM   575  C  CG2   . THR A 1 95  ? -2.366 29.432 3.600   1.00 8.53  ? 77   THR A CG2   1 
ATOM   576  N  N     A SER A 1 96  ? -1.324 31.607 7.285   0.50 8.18  ? 78   SER A N     1 
ATOM   577  N  N     B SER A 1 96  ? -1.320 31.609 7.278   0.50 7.73  ? 78   SER A N     1 
ATOM   578  C  CA    A SER A 1 96  ? -1.425 31.940 8.695   0.50 10.11 ? 78   SER A CA    1 
ATOM   579  C  CA    B SER A 1 96  ? -1.431 31.958 8.680   0.50 8.03  ? 78   SER A CA    1 
ATOM   580  C  C     A SER A 1 96  ? -2.277 30.922 9.456   0.50 9.41  ? 78   SER A C     1 
ATOM   581  C  C     B SER A 1 96  ? -2.277 30.928 9.451   0.50 8.90  ? 78   SER A C     1 
ATOM   582  O  O     A SER A 1 96  ? -2.107 30.774 10.641  0.50 8.59  ? 78   SER A O     1 
ATOM   583  O  O     B SER A 1 96  ? -2.103 30.778 10.637  0.50 8.95  ? 78   SER A O     1 
ATOM   584  C  CB    A SER A 1 96  ? -2.003 33.336 8.853   0.50 10.70 ? 78   SER A CB    1 
ATOM   585  C  CB    B SER A 1 96  ? -2.049 33.347 8.792   0.50 8.40  ? 78   SER A CB    1 
ATOM   586  O  OG    A SER A 1 96  ? -2.045 33.713 10.229  0.50 18.52 ? 78   SER A OG    1 
ATOM   587  O  OG    B SER A 1 96  ? -1.242 34.369 8.213   0.50 2.49  ? 78   SER A OG    1 
ATOM   588  N  N     . ALA A 1 97  ? -3.174 30.197 8.781   1.00 9.24  ? 79   ALA A N     1 
ATOM   589  C  CA    . ALA A 1 97  ? -3.948 29.132 9.480   1.00 8.95  ? 79   ALA A CA    1 
ATOM   590  C  C     . ALA A 1 97  ? -3.098 27.991 10.028  1.00 7.87  ? 79   ALA A C     1 
ATOM   591  O  O     . ALA A 1 97  ? -3.418 27.415 11.060  1.00 9.84  ? 79   ALA A O     1 
ATOM   592  C  CB    . ALA A 1 97  ? -5.050 28.564 8.621   1.00 9.85  ? 79   ALA A CB    1 
ATOM   593  N  N     . TYR A 1 98  ? -1.968 27.710 9.394   1.00 8.13  ? 80   TYR A N     1 
ATOM   594  C  CA    . TYR A 1 98  ? -1.033 26.744 9.894   1.00 8.27  ? 80   TYR A CA    1 
ATOM   595  C  C     . TYR A 1 98  ? -0.508 27.220 11.225  1.00 8.20  ? 80   TYR A C     1 
ATOM   596  O  O     . TYR A 1 98  ? -0.396 26.448 12.219  1.00 9.95  ? 80   TYR A O     1 
ATOM   597  C  CB    . TYR A 1 98  ? 0.124  26.534 8.930   1.00 7.84  ? 80   TYR A CB    1 
ATOM   598  C  CG    . TYR A 1 98  ? 1.175  25.571 9.380   1.00 9.59  ? 80   TYR A CG    1 
ATOM   599  C  CD1   . TYR A 1 98  ? 0.949  24.199 9.303   1.00 9.32  ? 80   TYR A CD1   1 
ATOM   600  C  CD2   . TYR A 1 98  ? 2.397  26.003 9.864   1.00 10.32 ? 80   TYR A CD2   1 
ATOM   601  C  CE1   . TYR A 1 98  ? 1.886  23.261 9.746   1.00 8.67  ? 80   TYR A CE1   1 
ATOM   602  C  CE2   . TYR A 1 98  ? 3.349  25.061 10.248  1.00 10.49 ? 80   TYR A CE2   1 
ATOM   603  C  CZ    . TYR A 1 98  ? 3.085  23.708 10.239  1.00 10.97 ? 80   TYR A CZ    1 
ATOM   604  O  OH    . TYR A 1 98  ? 4.065  22.749 10.568  1.00 9.83  ? 80   TYR A OH    1 
ATOM   605  N  N     . TYR A 1 99  ? -0.169 28.510 11.291  1.00 8.40  ? 81   TYR A N     1 
ATOM   606  C  CA    . TYR A 1 99  ? 0.433  29.061 12.500  1.00 9.43  ? 81   TYR A CA    1 
ATOM   607  C  C     . TYR A 1 99  ? -0.571 29.498 13.546  1.00 12.04 ? 81   TYR A C     1 
ATOM   608  O  O     . TYR A 1 99  ? -0.148 29.829 14.646  1.00 11.75 ? 81   TYR A O     1 
ATOM   609  C  CB    . TYR A 1 99  ? 1.307  30.257 12.147  1.00 10.46 ? 81   TYR A CB    1 
ATOM   610  C  CG    . TYR A 1 99  ? 2.495  29.911 11.289  1.00 8.31  ? 81   TYR A CG    1 
ATOM   611  C  CD1   . TYR A 1 99  ? 2.472  30.054 9.917   1.00 9.36  ? 81   TYR A CD1   1 
ATOM   612  C  CD2   . TYR A 1 99  ? 3.676  29.464 11.860  1.00 9.42  ? 81   TYR A CD2   1 
ATOM   613  C  CE1   . TYR A 1 99  ? 3.576  29.773 9.123   1.00 10.46 ? 81   TYR A CE1   1 
ATOM   614  C  CE2   . TYR A 1 99  ? 4.786  29.180 11.072  1.00 9.38  ? 81   TYR A CE2   1 
ATOM   615  C  CZ    . TYR A 1 99  ? 4.756  29.351 9.729   1.00 11.25 ? 81   TYR A CZ    1 
ATOM   616  O  OH    . TYR A 1 99  ? 5.890  29.052 8.986   1.00 11.09 ? 81   TYR A OH    1 
ATOM   617  N  N     . ARG A 1 100 ? -1.867 29.514 13.200  1.00 13.31 ? 82   ARG A N     1 
ATOM   618  C  CA    . ARG A 1 100 ? -2.905 30.175 14.014  1.00 14.95 ? 82   ARG A CA    1 
ATOM   619  C  C     . ARG A 1 100 ? -2.951 29.576 15.382  1.00 15.26 ? 82   ARG A C     1 
ATOM   620  O  O     . ARG A 1 100 ? -3.141 28.372 15.534  1.00 15.51 ? 82   ARG A O     1 
ATOM   621  C  CB    . ARG A 1 100 ? -4.261 30.053 13.333  1.00 16.91 ? 82   ARG A CB    1 
ATOM   622  C  CG    . ARG A 1 100 ? -5.396 30.805 14.138  1.00 22.07 ? 82   ARG A CG    1 
ATOM   623  C  CD    . ARG A 1 100 ? -6.633 31.093 13.329  1.00 30.58 ? 82   ARG A CD    1 
ATOM   624  N  NE    . ARG A 1 100 ? -6.395 31.390 11.896  1.00 37.43 ? 82   ARG A NE    1 
ATOM   625  C  CZ    . ARG A 1 100 ? -5.481 32.268 11.368  1.00 41.24 ? 82   ARG A CZ    1 
ATOM   626  N  NH1   . ARG A 1 100 ? -5.408 32.391 10.058  1.00 40.07 ? 82   ARG A NH1   1 
ATOM   627  N  NH2   . ARG A 1 100 ? -4.618 32.999 12.104  1.00 43.64 ? 82   ARG A NH2   1 
ATOM   628  N  N     . GLY A 1 101 ? -2.765 30.438 16.385  1.00 17.66 ? 83   GLY A N     1 
ATOM   629  C  CA    . GLY A 1 101 ? -2.855 29.993 17.763  1.00 18.09 ? 83   GLY A CA    1 
ATOM   630  C  C     . GLY A 1 101 ? -1.626 29.253 18.248  1.00 17.69 ? 83   GLY A C     1 
ATOM   631  O  O     . GLY A 1 101 ? -1.574 28.832 19.442  1.00 18.72 ? 83   GLY A O     1 
ATOM   632  N  N     . ALA A 1 102 ? -0.616 29.111 17.384  1.00 14.09 ? 84   ALA A N     1 
ATOM   633  C  CA    . ALA A 1 102 ? 0.617  28.415 17.794  1.00 14.05 ? 84   ALA A CA    1 
ATOM   634  C  C     . ALA A 1 102 ? 1.306  29.289 18.840  1.00 13.52 ? 84   ALA A C     1 
ATOM   635  O  O     . ALA A 1 102 ? 1.463  30.494 18.687  1.00 14.18 ? 84   ALA A O     1 
ATOM   636  C  CB    . ALA A 1 102 ? 1.540  28.153 16.638  1.00 13.70 ? 84   ALA A CB    1 
ATOM   637  N  N     . VAL A 1 103 ? 1.700  28.640 19.939  1.00 14.98 ? 85   VAL A N     1 
ATOM   638  C  CA    . VAL A 1 103 ? 2.474  29.316 20.973  1.00 15.44 ? 85   VAL A CA    1 
ATOM   639  C  C     . VAL A 1 103 ? 3.967  29.042 20.924  1.00 13.72 ? 85   VAL A C     1 
ATOM   640  O  O     . VAL A 1 103 ? 4.792  29.772 21.534  1.00 14.13 ? 85   VAL A O     1 
ATOM   641  C  CB    . VAL A 1 103 ? 1.872  28.968 22.410  1.00 14.17 ? 85   VAL A CB    1 
ATOM   642  C  CG1   . VAL A 1 103 ? 0.547  29.739 22.551  1.00 18.57 ? 85   VAL A CG1   1 
ATOM   643  C  CG2   . VAL A 1 103 ? 1.672  27.503 22.622  1.00 16.04 ? 85   VAL A CG2   1 
ATOM   644  N  N     . GLY A 1 104 ? 4.354  28.013 20.179  1.00 14.28 ? 86   GLY A N     1 
ATOM   645  C  CA    . GLY A 1 104 ? 5.757  27.797 19.907  1.00 12.74 ? 86   GLY A CA    1 
ATOM   646  C  C     . GLY A 1 104 ? 6.049  27.376 18.479  1.00 12.40 ? 86   GLY A C     1 
ATOM   647  O  O     . GLY A 1 104 ? 5.176  26.806 17.844  1.00 13.25 ? 86   GLY A O     1 
ATOM   648  N  N     . ALA A 1 105 ? 7.277  27.635 18.047  1.00 12.40 ? 87   ALA A N     1 
ATOM   649  C  CA    . ALA A 1 105 ? 7.771  27.134 16.749  1.00 12.62 ? 87   ALA A CA    1 
ATOM   650  C  C     . ALA A 1 105 ? 9.176  26.557 16.946  1.00 12.17 ? 87   ALA A C     1 
ATOM   651  O  O     . ALA A 1 105 ? 10.024 27.199 17.575  1.00 13.39 ? 87   ALA A O     1 
ATOM   652  C  CB    . ALA A 1 105 ? 7.812  28.202 15.730  1.00 12.85 ? 87   ALA A CB    1 
ATOM   653  N  N     A LEU A 1 106 ? 9.362  25.347 16.430  0.50 12.50 ? 88   LEU A N     1 
ATOM   654  N  N     B LEU A 1 106 ? 9.365  25.352 16.417  0.50 12.93 ? 88   LEU A N     1 
ATOM   655  C  CA    A LEU A 1 106 ? 10.645 24.682 16.319  0.50 11.82 ? 88   LEU A CA    1 
ATOM   656  C  CA    B LEU A 1 106 ? 10.649 24.687 16.307  0.50 12.54 ? 88   LEU A CA    1 
ATOM   657  C  C     A LEU A 1 106 ? 11.128 24.939 14.899  0.50 11.64 ? 88   LEU A C     1 
ATOM   658  C  C     B LEU A 1 106 ? 11.126 24.944 14.894  0.50 12.10 ? 88   LEU A C     1 
ATOM   659  O  O     A LEU A 1 106 ? 10.571 24.402 13.965  0.50 12.48 ? 88   LEU A O     1 
ATOM   660  O  O     B LEU A 1 106 ? 10.571 24.403 13.960  0.50 13.02 ? 88   LEU A O     1 
ATOM   661  C  CB    A LEU A 1 106 ? 10.514 23.177 16.629  0.50 12.72 ? 88   LEU A CB    1 
ATOM   662  C  CB    B LEU A 1 106 ? 10.530 23.176 16.583  0.50 13.80 ? 88   LEU A CB    1 
ATOM   663  C  CG    A LEU A 1 106 ? 9.985  22.852 18.059  0.50 14.97 ? 88   LEU A CG    1 
ATOM   664  C  CG    B LEU A 1 106 ? 10.399 22.737 18.062  0.50 16.63 ? 88   LEU A CG    1 
ATOM   665  C  CD1   A LEU A 1 106 ? 9.422  21.463 18.181  0.50 16.75 ? 88   LEU A CD1   1 
ATOM   666  C  CD1   B LEU A 1 106 ? 11.676 22.887 18.791  0.50 21.97 ? 88   LEU A CD1   1 
ATOM   667  C  CD2   A LEU A 1 106 ? 10.972 23.087 19.133  0.50 17.09 ? 88   LEU A CD2   1 
ATOM   668  C  CD2   B LEU A 1 106 ? 9.336  23.540 18.742  0.50 21.38 ? 88   LEU A CD2   1 
ATOM   669  N  N     . LEU A 1 107 ? 12.082 25.840 14.746  1.00 11.06 ? 89   LEU A N     1 
ATOM   670  C  CA    . LEU A 1 107 ? 12.615 26.207 13.475  1.00 11.12 ? 89   LEU A CA    1 
ATOM   671  C  C     . LEU A 1 107 ? 13.898 25.381 13.281  1.00 11.04 ? 89   LEU A C     1 
ATOM   672  O  O     . LEU A 1 107 ? 14.898 25.646 13.934  1.00 12.42 ? 89   LEU A O     1 
ATOM   673  C  CB    . LEU A 1 107 ? 12.896 27.691 13.461  1.00 12.86 ? 89   LEU A CB    1 
ATOM   674  C  CG    . LEU A 1 107 ? 13.192 28.427 12.144  1.00 12.25 ? 89   LEU A CG    1 
ATOM   675  C  CD1   . LEU A 1 107 ? 13.282 29.851 12.362  1.00 13.49 ? 89   LEU A CD1   1 
ATOM   676  C  CD2   . LEU A 1 107 ? 14.388 27.855 11.469  1.00 11.99 ? 89   LEU A CD2   1 
ATOM   677  N  N     . VAL A 1 108 ? 13.821 24.412 12.421  1.00 9.43  ? 90   VAL A N     1 
ATOM   678  C  CA    . VAL A 1 108 ? 14.873 23.384 12.306  1.00 11.33 ? 90   VAL A CA    1 
ATOM   679  C  C     . VAL A 1 108 ? 15.743 23.579 11.082  1.00 12.31 ? 90   VAL A C     1 
ATOM   680  O  O     . VAL A 1 108 ? 15.286 23.916 9.997   1.00 11.23 ? 90   VAL A O     1 
ATOM   681  C  CB    . VAL A 1 108 ? 14.238 21.983 12.257  1.00 12.50 ? 90   VAL A CB    1 
ATOM   682  C  CG1   . VAL A 1 108 ? 15.385 20.875 12.266  1.00 13.43 ? 90   VAL A CG1   1 
ATOM   683  C  CG2   . VAL A 1 108 ? 13.189 21.782 13.309  1.00 13.80 ? 90   VAL A CG2   1 
ATOM   684  N  N     . TYR A 1 109 ? 17.061 23.360 11.270  1.00 13.68 ? 91   TYR A N     1 
ATOM   685  C  CA    . TYR A 1 109 ? 18.027 23.284 10.150  1.00 13.76 ? 91   TYR A CA    1 
ATOM   686  C  C     . TYR A 1 109 ? 18.891 22.051 10.403  1.00 13.93 ? 91   TYR A C     1 
ATOM   687  O  O     . TYR A 1 109 ? 18.780 21.449 11.448  1.00 13.62 ? 91   TYR A O     1 
ATOM   688  C  CB    . TYR A 1 109 ? 18.871 24.535 10.028  1.00 14.96 ? 91   TYR A CB    1 
ATOM   689  C  CG    . TYR A 1 109 ? 19.810 24.756 11.189  1.00 15.44 ? 91   TYR A CG    1 
ATOM   690  C  CD1   . TYR A 1 109 ? 19.391 25.395 12.372  1.00 14.81 ? 91   TYR A CD1   1 
ATOM   691  C  CD2   . TYR A 1 109 ? 21.124 24.329 11.106  1.00 15.63 ? 91   TYR A CD2   1 
ATOM   692  C  CE1   . TYR A 1 109 ? 20.271 25.563 13.459  1.00 14.33 ? 91   TYR A CE1   1 
ATOM   693  C  CE2   . TYR A 1 109 ? 21.981 24.482 12.149  1.00 17.83 ? 91   TYR A CE2   1 
ATOM   694  C  CZ    . TYR A 1 109 ? 21.581 25.122 13.324  1.00 18.70 ? 91   TYR A CZ    1 
ATOM   695  O  OH    . TYR A 1 109 ? 22.481 25.285 14.361  1.00 18.74 ? 91   TYR A OH    1 
ATOM   696  N  N     . ASP A 1 110 ? 19.693 21.704 9.401   1.00 15.27 ? 92   ASP A N     1 
ATOM   697  C  CA    . ASP A 1 110 ? 20.583 20.526 9.359   1.00 15.79 ? 92   ASP A CA    1 
ATOM   698  C  C     . ASP A 1 110 ? 21.990 21.023 9.554   1.00 15.03 ? 92   ASP A C     1 
ATOM   699  O  O     . ASP A 1 110 ? 22.461 21.826 8.767   1.00 17.03 ? 92   ASP A O     1 
ATOM   700  C  CB    . ASP A 1 110 ? 20.435 19.879 7.978   1.00 14.66 ? 92   ASP A CB    1 
ATOM   701  C  CG    . ASP A 1 110 ? 21.292 18.633 7.785   1.00 17.11 ? 92   ASP A CG    1 
ATOM   702  O  OD1   . ASP A 1 110 ? 21.041 17.871 6.796   1.00 17.56 ? 92   ASP A OD1   1 
ATOM   703  O  OD2   . ASP A 1 110 ? 22.178 18.415 8.584   1.00 17.73 ? 92   ASP A OD2   1 
ATOM   704  N  N     . ILE A 1 111 ? 22.609 20.638 10.657  1.00 17.99 ? 93   ILE A N     1 
ATOM   705  C  CA    . ILE A 1 111 ? 23.966 21.202 10.959  1.00 19.63 ? 93   ILE A CA    1 
ATOM   706  C  C     . ILE A 1 111 ? 24.988 20.857 9.839   1.00 20.03 ? 93   ILE A C     1 
ATOM   707  O  O     . ILE A 1 111 ? 26.010 21.538 9.693   1.00 20.53 ? 93   ILE A O     1 
ATOM   708  C  CB    . ILE A 1 111 ? 24.486 20.710 12.307  1.00 21.07 ? 93   ILE A CB    1 
ATOM   709  C  CG1   . ILE A 1 111 ? 24.739 19.223 12.287  1.00 24.06 ? 93   ILE A CG1   1 
ATOM   710  C  CG2   . ILE A 1 111 ? 23.572 21.069 13.425  1.00 19.82 ? 93   ILE A CG2   1 
ATOM   711  C  CD1   . ILE A 1 111 ? 25.847 18.788 13.291  1.00 25.71 ? 93   ILE A CD1   1 
ATOM   712  N  N     . ALA A 1 112 ? 24.694 19.808 9.063   1.00 20.06 ? 94   ALA A N     1 
ATOM   713  C  CA    . ALA A 1 112 ? 25.522 19.364 7.908   1.00 20.75 ? 94   ALA A CA    1 
ATOM   714  C  C     . ALA A 1 112 ? 25.245 20.018 6.591   1.00 20.87 ? 94   ALA A C     1 
ATOM   715  O  O     . ALA A 1 112 ? 25.939 19.720 5.588   1.00 20.73 ? 94   ALA A O     1 
ATOM   716  C  CB    . ALA A 1 112 ? 25.394 17.831 7.739   1.00 21.08 ? 94   ALA A CB    1 
ATOM   717  N  N     . LYS A 1 113 ? 24.200 20.867 6.503   1.00 19.79 ? 95   LYS A N     1 
ATOM   718  C  CA    . LYS A 1 113 ? 23.900 21.503 5.255   1.00 19.90 ? 95   LYS A CA    1 
ATOM   719  C  C     . LYS A 1 113 ? 23.760 22.977 5.525   1.00 20.19 ? 95   LYS A C     1 
ATOM   720  O  O     . LYS A 1 113 ? 22.708 23.432 6.042   1.00 18.91 ? 95   LYS A O     1 
ATOM   721  C  CB    . LYS A 1 113 ? 22.638 20.958 4.576   1.00 21.13 ? 95   LYS A CB    1 
ATOM   722  C  CG    . LYS A 1 113 ? 22.783 19.476 4.159   1.00 24.34 ? 95   LYS A CG    1 
ATOM   723  C  CD    . LYS A 1 113 ? 22.315 19.226 2.713   1.00 31.02 ? 95   LYS A CD    1 
ATOM   724  C  CE    . LYS A 1 113 ? 22.404 17.718 2.352   1.00 30.37 ? 95   LYS A CE    1 
ATOM   725  N  NZ    . LYS A 1 113 ? 23.738 17.278 2.860   1.00 32.26 ? 95   LYS A NZ    1 
ATOM   726  N  N     . HIS A 1 114 ? 24.808 23.723 5.196   1.00 18.47 ? 96   HIS A N     1 
ATOM   727  C  CA    . HIS A 1 114 ? 24.796 25.156 5.430   1.00 19.85 ? 96   HIS A CA    1 
ATOM   728  C  C     . HIS A 1 114 ? 23.616 25.920 4.863   1.00 19.40 ? 96   HIS A C     1 
ATOM   729  O  O     . HIS A 1 114 ? 23.168 26.909 5.471   1.00 21.86 ? 96   HIS A O     1 
ATOM   730  C  CB    . HIS A 1 114 ? 26.112 25.817 4.946   1.00 20.73 ? 96   HIS A CB    1 
ATOM   731  C  CG    . HIS A 1 114 ? 26.374 27.147 5.590   1.00 22.12 ? 96   HIS A CG    1 
ATOM   732  N  ND1   . HIS A 1 114 ? 25.930 28.321 5.033   1.00 23.43 ? 96   HIS A ND1   1 
ATOM   733  C  CD2   . HIS A 1 114 ? 27.025 27.488 6.726   1.00 24.19 ? 96   HIS A CD2   1 
ATOM   734  C  CE1   . HIS A 1 114 ? 26.284 29.332 5.811   1.00 24.64 ? 96   HIS A CE1   1 
ATOM   735  N  NE2   . HIS A 1 114 ? 26.968 28.853 6.830   1.00 25.23 ? 96   HIS A NE2   1 
ATOM   736  N  N     . LEU A 1 115 ? 23.127 25.514 3.681   1.00 19.59 ? 97   LEU A N     1 
ATOM   737  C  CA    . LEU A 1 115 ? 22.017 26.249 3.063   1.00 18.58 ? 97   LEU A CA    1 
ATOM   738  C  C     . LEU A 1 115 ? 20.788 26.278 3.962   1.00 17.94 ? 97   LEU A C     1 
ATOM   739  O  O     . LEU A 1 115 ? 20.110 27.297 4.008   1.00 15.56 ? 97   LEU A O     1 
ATOM   740  C  CB    . LEU A 1 115 ? 21.663 25.619 1.740   1.00 18.70 ? 97   LEU A CB    1 
ATOM   741  C  CG    . LEU A 1 115 ? 21.126 26.410 0.585   1.00 21.69 ? 97   LEU A CG    1 
ATOM   742  C  CD1   . LEU A 1 115 ? 20.081 25.609 -0.106  1.00 21.05 ? 97   LEU A CD1   1 
ATOM   743  C  CD2   . LEU A 1 115 ? 20.749 27.834 0.871   1.00 21.13 ? 97   LEU A CD2   1 
ATOM   744  N  N     . THR A 1 116 ? 20.543 25.196 4.686   1.00 15.60 ? 98   THR A N     1 
ATOM   745  C  CA    . THR A 1 116 ? 19.336 25.104 5.534   1.00 16.16 ? 98   THR A CA    1 
ATOM   746  C  C     . THR A 1 116 ? 19.402 26.071 6.695   1.00 16.51 ? 98   THR A C     1 
ATOM   747  O  O     . THR A 1 116 ? 18.369 26.572 7.218   1.00 15.53 ? 98   THR A O     1 
ATOM   748  C  CB    . THR A 1 116 ? 19.076 23.686 6.022   1.00 15.77 ? 98   THR A CB    1 
ATOM   749  O  OG1   . THR A 1 116 ? 20.102 23.265 6.957   1.00 14.26 ? 98   THR A OG1   1 
ATOM   750  C  CG2   . THR A 1 116 ? 18.972 22.718 4.865   1.00 16.53 ? 98   THR A CG2   1 
ATOM   751  N  N     . TYR A 1 117 ? 20.635 26.412 7.081   1.00 16.67 ? 99   TYR A N     1 
ATOM   752  C  CA    . TYR A 1 117 ? 20.902 27.415 8.094   1.00 17.04 ? 99   TYR A CA    1 
ATOM   753  C  C     . TYR A 1 117 ? 20.835 28.799 7.513   1.00 18.25 ? 99   TYR A C     1 
ATOM   754  O  O     . TYR A 1 117 ? 20.259 29.685 8.140   1.00 18.34 ? 99   TYR A O     1 
ATOM   755  C  CB    . TYR A 1 117 ? 22.282 27.211 8.668   1.00 17.63 ? 99   TYR A CB    1 
ATOM   756  C  CG    . TYR A 1 117 ? 22.650 28.235 9.717   1.00 18.99 ? 99   TYR A CG    1 
ATOM   757  C  CD1   . TYR A 1 117 ? 22.071 28.203 10.985  1.00 20.88 ? 99   TYR A CD1   1 
ATOM   758  C  CD2   . TYR A 1 117 ? 23.591 29.234 9.427   1.00 21.04 ? 99   TYR A CD2   1 
ATOM   759  C  CE1   . TYR A 1 117 ? 22.405 29.161 11.967  1.00 20.93 ? 99   TYR A CE1   1 
ATOM   760  C  CE2   . TYR A 1 117 ? 23.902 30.190 10.369  1.00 20.12 ? 99   TYR A CE2   1 
ATOM   761  C  CZ    . TYR A 1 117 ? 23.330 30.129 11.640  1.00 22.40 ? 99   TYR A CZ    1 
ATOM   762  O  OH    . TYR A 1 117 ? 23.693 31.083 12.574  1.00 23.64 ? 99   TYR A OH    1 
ATOM   763  N  N     . GLU A 1 118 ? 21.367 29.011 6.301   1.00 17.98 ? 100  GLU A N     1 
ATOM   764  C  CA    . GLU A 1 118 ? 21.249 30.298 5.603   1.00 19.58 ? 100  GLU A CA    1 
ATOM   765  C  C     . GLU A 1 118 ? 19.773 30.705 5.467   1.00 18.13 ? 100  GLU A C     1 
ATOM   766  O  O     . GLU A 1 118 ? 19.433 31.869 5.643   1.00 18.05 ? 100  GLU A O     1 
ATOM   767  C  CB    . GLU A 1 118 ? 21.849 30.256 4.213   1.00 21.22 ? 100  GLU A CB    1 
ATOM   768  C  CG    . GLU A 1 118 ? 23.354 30.154 4.218   1.00 25.97 ? 100  GLU A CG    1 
ATOM   769  C  CD    . GLU A 1 118 ? 23.929 29.787 2.858   1.00 31.27 ? 100  GLU A CD    1 
ATOM   770  O  OE1   . GLU A 1 118 ? 23.534 30.453 1.867   1.00 34.95 ? 100  GLU A OE1   1 
ATOM   771  O  OE2   . GLU A 1 118 ? 24.759 28.812 2.797   1.00 32.20 ? 100  GLU A OE2   1 
ATOM   772  N  N     . ASN A 1 119 ? 18.916 29.723 5.196   1.00 16.13 ? 101  ASN A N     1 
ATOM   773  C  CA    . ASN A 1 119 ? 17.487 29.945 4.978   1.00 16.64 ? 101  ASN A CA    1 
ATOM   774  C  C     . ASN A 1 119 ? 16.708 30.191 6.259   1.00 16.54 ? 101  ASN A C     1 
ATOM   775  O  O     . ASN A 1 119 ? 15.501 30.439 6.216   1.00 14.55 ? 101  ASN A O     1 
ATOM   776  C  CB    . ASN A 1 119 ? 16.876 28.769 4.214   1.00 16.67 ? 101  ASN A CB    1 
ATOM   777  C  CG    . ASN A 1 119 ? 17.228 28.791 2.723   1.00 17.45 ? 101  ASN A CG    1 
ATOM   778  O  OD1   . ASN A 1 119 ? 17.473 29.847 2.152   1.00 20.47 ? 101  ASN A OD1   1 
ATOM   779  N  ND2   . ASN A 1 119 ? 17.263 27.625 2.085   1.00 18.24 ? 101  ASN A ND2   1 
ATOM   780  N  N     . VAL A 1 120 ? 17.365 30.110 7.416   1.00 14.55 ? 102  VAL A N     1 
ATOM   781  C  CA    . VAL A 1 120 ? 16.664 30.395 8.668   1.00 13.96 ? 102  VAL A CA    1 
ATOM   782  C  C     . VAL A 1 120 ? 16.016 31.794 8.625   1.00 14.49 ? 102  VAL A C     1 
ATOM   783  O  O     . VAL A 1 120 ? 14.900 31.978 9.172   1.00 14.18 ? 102  VAL A O     1 
ATOM   784  C  CB    . VAL A 1 120 ? 17.592 30.271 9.901   1.00 14.58 ? 102  VAL A CB    1 
ATOM   785  C  CG1   . VAL A 1 120 ? 16.958 30.842 11.100  1.00 16.55 ? 102  VAL A CG1   1 
ATOM   786  C  CG2   . VAL A 1 120 ? 17.952 28.831 10.137  1.00 12.76 ? 102  VAL A CG2   1 
ATOM   787  N  N     . GLU A 1 121 ? 16.685 32.761 8.008   1.00 15.34 ? 103  GLU A N     1 
ATOM   788  C  CA    . GLU A 1 121 ? 16.146 34.120 7.963   1.00 19.03 ? 103  GLU A CA    1 
ATOM   789  C  C     . GLU A 1 121 ? 14.822 34.134 7.228   1.00 17.13 ? 103  GLU A C     1 
ATOM   790  O  O     . GLU A 1 121 ? 13.954 34.873 7.601   1.00 15.59 ? 103  GLU A O     1 
ATOM   791  C  CB    . GLU A 1 121 ? 17.132 35.119 7.311   1.00 20.34 ? 103  GLU A CB    1 
ATOM   792  C  CG    . GLU A 1 121 ? 18.311 35.348 8.218   1.00 28.94 ? 103  GLU A CG    1 
ATOM   793  C  CD    . GLU A 1 121 ? 18.113 36.461 9.243   1.00 36.09 ? 103  GLU A CD    1 
ATOM   794  O  OE1   . GLU A 1 121 ? 16.935 36.751 9.638   1.00 39.21 ? 103  GLU A OE1   1 
ATOM   795  O  OE2   . GLU A 1 121 ? 19.184 37.007 9.654   1.00 39.94 ? 103  GLU A OE2   1 
ATOM   796  N  N     . ARG A 1 122 ? 14.698 33.349 6.171   1.00 17.23 ? 104  ARG A N     1 
ATOM   797  C  CA    . ARG A 1 122 ? 13.467 33.297 5.433   1.00 16.98 ? 104  ARG A CA    1 
ATOM   798  C  C     . ARG A 1 122 ? 12.331 32.749 6.353   1.00 13.81 ? 104  ARG A C     1 
ATOM   799  O  O     . ARG A 1 122 ? 11.206 33.181 6.253   1.00 12.36 ? 104  ARG A O     1 
ATOM   800  C  CB    . ARG A 1 122 ? 13.613 32.385 4.229   1.00 18.49 ? 104  ARG A CB    1 
ATOM   801  C  CG    . ARG A 1 122 ? 12.737 32.773 3.101   1.00 27.97 ? 104  ARG A CG    1 
ATOM   802  C  CD    . ARG A 1 122 ? 12.869 31.887 1.841   1.00 38.05 ? 104  ARG A CD    1 
ATOM   803  N  NE    . ARG A 1 122 ? 14.261 31.597 1.476   1.00 47.28 ? 104  ARG A NE    1 
ATOM   804  C  CZ    . ARG A 1 122 ? 14.632 31.103 0.298   1.00 53.69 ? 104  ARG A CZ    1 
ATOM   805  N  NH1   . ARG A 1 122 ? 13.723 30.855 -0.646  1.00 56.47 ? 104  ARG A NH1   1 
ATOM   806  N  NH2   . ARG A 1 122 ? 15.920 30.866 0.055   1.00 56.18 ? 104  ARG A NH2   1 
ATOM   807  N  N     . TRP A 1 123 ? 12.594 31.738 7.160   1.00 12.59 ? 105  TRP A N     1 
ATOM   808  C  CA    . TRP A 1 123 ? 11.635 31.135 8.060   1.00 10.84 ? 105  TRP A CA    1 
ATOM   809  C  C     . TRP A 1 123 ? 11.204 32.145 9.125   1.00 10.86 ? 105  TRP A C     1 
ATOM   810  O  O     . TRP A 1 123 ? 10.018 32.237 9.497   1.00 12.60 ? 105  TRP A O     1 
ATOM   811  C  CB    . TRP A 1 123 ? 12.129 29.827 8.698   1.00 8.50  ? 105  TRP A CB    1 
ATOM   812  C  CG    . TRP A 1 123 ? 12.191 28.767 7.687   1.00 11.27 ? 105  TRP A CG    1 
ATOM   813  C  CD1   . TRP A 1 123 ? 13.326 28.174 7.153   1.00 9.92  ? 105  TRP A CD1   1 
ATOM   814  C  CD2   . TRP A 1 123 ? 11.065 28.093 7.076   1.00 9.23  ? 105  TRP A CD2   1 
ATOM   815  N  NE1   . TRP A 1 123 ? 12.938 27.249 6.195   1.00 9.53  ? 105  TRP A NE1   1 
ATOM   816  C  CE2   . TRP A 1 123 ? 11.566 27.152 6.170   1.00 8.68  ? 105  TRP A CE2   1 
ATOM   817  C  CE3   . TRP A 1 123 ? 9.652  28.212 7.209   1.00 10.47 ? 105  TRP A CE3   1 
ATOM   818  C  CZ2   . TRP A 1 123 ? 10.725 26.339 5.409   1.00 10.76 ? 105  TRP A CZ2   1 
ATOM   819  C  CZ3   . TRP A 1 123 ? 8.841  27.426 6.496   1.00 9.07  ? 105  TRP A CZ3   1 
ATOM   820  C  CH2   . TRP A 1 123 ? 9.375  26.466 5.583   1.00 12.05 ? 105  TRP A CH2   1 
ATOM   821  N  N     . LEU A 1 124 ? 12.185 32.926 9.585   1.00 11.89 ? 106  LEU A N     1 
ATOM   822  C  CA    . LEU A 1 124 ? 11.879 33.978 10.567  1.00 11.23 ? 106  LEU A CA    1 
ATOM   823  C  C     . LEU A 1 124 ? 10.937 35.011 9.951   1.00 11.87 ? 106  LEU A C     1 
ATOM   824  O  O     . LEU A 1 124 ? 10.001 35.476 10.633  1.00 11.76 ? 106  LEU A O     1 
ATOM   825  C  CB    . LEU A 1 124 ? 13.143 34.704 11.082  1.00 12.85 ? 106  LEU A CB    1 
ATOM   826  C  CG    . LEU A 1 124 ? 14.005 33.828 11.984  1.00 11.41 ? 106  LEU A CG    1 
ATOM   827  C  CD1   . LEU A 1 124 ? 15.287 34.583 12.329  1.00 14.65 ? 106  LEU A CD1   1 
ATOM   828  C  CD2   . LEU A 1 124 ? 13.354 33.404 13.249  1.00 13.09 ? 106  LEU A CD2   1 
ATOM   829  N  N     . LYS A 1 125 ? 11.151 35.329 8.693   1.00 11.71 ? 107  LYS A N     1 
ATOM   830  C  CA    . LYS A 1 125 ? 10.322 36.289 7.984   1.00 15.12 ? 107  LYS A CA    1 
ATOM   831  C  C     . LYS A 1 125 ? 8.933  35.713 7.891   1.00 13.03 ? 107  LYS A C     1 
ATOM   832  O  O     . LYS A 1 125 ? 7.921  36.407 8.154   1.00 12.64 ? 107  LYS A O     1 
ATOM   833  C  CB    . LYS A 1 125 ? 10.919 36.500 6.590   1.00 16.46 ? 107  LYS A CB    1 
ATOM   834  C  CG    . LYS A 1 125 ? 10.622 37.696 5.831   1.00 27.32 ? 107  LYS A CG    1 
ATOM   835  C  CD    . LYS A 1 125 ? 9.260  37.894 5.510   1.00 31.69 ? 107  LYS A CD    1 
ATOM   836  C  CE    . LYS A 1 125 ? 9.123  39.188 4.637   1.00 35.60 ? 107  LYS A CE    1 
ATOM   837  N  NZ    . LYS A 1 125 ? 9.504  38.899 3.228   1.00 34.38 ? 107  LYS A NZ    1 
ATOM   838  N  N     . GLU A 1 126 ? 8.867  34.420 7.601   1.00 11.08 ? 108  GLU A N     1 
ATOM   839  C  CA    . GLU A 1 126 ? 7.576  33.764 7.477   1.00 11.39 ? 108  GLU A CA    1 
ATOM   840  C  C     . GLU A 1 126 ? 6.841  33.762 8.821   1.00 9.77  ? 108  GLU A C     1 
ATOM   841  O  O     . GLU A 1 126 ? 5.610  34.004 8.886   1.00 11.21 ? 108  GLU A O     1 
ATOM   842  C  CB    . GLU A 1 126 ? 7.740  32.337 6.957   1.00 11.93 ? 108  GLU A CB    1 
ATOM   843  C  CG    . GLU A 1 126 ? 6.429  31.672 6.689   1.00 13.12 ? 108  GLU A CG    1 
ATOM   844  C  CD    . GLU A 1 126 ? 6.625  30.356 5.926   1.00 9.01  ? 108  GLU A CD    1 
ATOM   845  O  OE1   . GLU A 1 126 ? 6.017  29.344 6.374   1.00 12.91 ? 108  GLU A OE1   1 
ATOM   846  O  OE2   . GLU A 1 126 ? 7.342  30.385 4.869   1.00 11.76 ? 108  GLU A OE2   1 
ATOM   847  N  N     . LEU A 1 127 ? 7.567  33.572 9.922   1.00 9.42  ? 109  LEU A N     1 
ATOM   848  C  CA    . LEU A 1 127 ? 6.975  33.622 11.237  1.00 9.59  ? 109  LEU A CA    1 
ATOM   849  C  C     . LEU A 1 127 ? 6.466  35.048 11.536  1.00 9.73  ? 109  LEU A C     1 
ATOM   850  O  O     . LEU A 1 127 ? 5.389  35.201 12.091  1.00 11.92 ? 109  LEU A O     1 
ATOM   851  C  CB    . LEU A 1 127 ? 7.973  33.221 12.301  1.00 10.76 ? 109  LEU A CB    1 
ATOM   852  C  CG    . LEU A 1 127 ? 8.204  31.720 12.485  1.00 12.04 ? 109  LEU A CG    1 
ATOM   853  C  CD1   . LEU A 1 127 ? 9.441  31.429 13.311  1.00 12.36 ? 109  LEU A CD1   1 
ATOM   854  C  CD2   . LEU A 1 127 ? 7.031  31.076 13.108  1.00 13.70 ? 109  LEU A CD2   1 
ATOM   855  N  N     . ARG A 1 128 ? 7.246  36.043 11.184  1.00 14.42 ? 110  ARG A N     1 
ATOM   856  C  CA    . ARG A 1 128 ? 6.786  37.439 11.437  1.00 15.55 ? 110  ARG A CA    1 
ATOM   857  C  C     . ARG A 1 128 ? 5.535  37.711 10.652  1.00 16.49 ? 110  ARG A C     1 
ATOM   858  O  O     . ARG A 1 128 ? 4.619  38.410 11.189  1.00 18.61 ? 110  ARG A O     1 
ATOM   859  C  CB    . ARG A 1 128 ? 7.870  38.456 11.079  1.00 17.28 ? 110  ARG A CB    1 
ATOM   860  C  CG    . ARG A 1 128 ? 8.944  38.587 12.131  1.00 24.85 ? 110  ARG A CG    1 
ATOM   861  C  CD    . ARG A 1 128 ? 9.910  39.747 11.752  1.00 27.66 ? 110  ARG A CD    1 
ATOM   862  N  NE    . ARG A 1 128 ? 10.142 39.913 10.319  1.00 33.38 ? 110  ARG A NE    1 
ATOM   863  C  CZ    . ARG A 1 128 ? 11.176 39.388 9.635   1.00 37.04 ? 110  ARG A CZ    1 
ATOM   864  N  NH1   . ARG A 1 128 ? 12.065 38.601 10.236  1.00 35.70 ? 110  ARG A NH1   1 
ATOM   865  N  NH2   . ARG A 1 128 ? 11.318 39.619 8.337   1.00 40.83 ? 110  ARG A NH2   1 
ATOM   866  N  N     . ASP A 1 129 ? 5.450  37.236 9.423   1.00 14.02 ? 111  ASP A N     1 
ATOM   867  C  CA    . ASP A 1 129 ? 4.304  37.558 8.533   1.00 14.08 ? 111  ASP A CA    1 
ATOM   868  C  C     . ASP A 1 129 ? 3.028  36.803 8.969   1.00 13.01 ? 111  ASP A C     1 
ATOM   869  O  O     . ASP A 1 129 ? 1.901  37.326 8.807   1.00 13.66 ? 111  ASP A O     1 
ATOM   870  C  CB    . ASP A 1 129 ? 4.584  37.175 7.107   1.00 16.65 ? 111  ASP A CB    1 
ATOM   871  C  CG    . ASP A 1 129 ? 5.669  38.039 6.411   1.00 20.50 ? 111  ASP A CG    1 
ATOM   872  O  OD1   . ASP A 1 129 ? 5.998  39.146 6.876   1.00 27.19 ? 111  ASP A OD1   1 
ATOM   873  O  OD2   . ASP A 1 129 ? 6.211  37.663 5.332   1.00 30.36 ? 111  ASP A OD2   1 
ATOM   874  N  N     . HIS A 1 130 ? 3.210  35.549 9.443   1.00 10.62 ? 112  HIS A N     1 
ATOM   875  C  CA    . HIS A 1 130 ? 2.096  34.575 9.576   1.00 10.86 ? 112  HIS A CA    1 
ATOM   876  C  C     . HIS A 1 130 ? 1.821  34.063 10.982  1.00 11.55 ? 112  HIS A C     1 
ATOM   877  O  O     . HIS A 1 130 ? 0.790  33.394 11.207  1.00 11.95 ? 112  HIS A O     1 
ATOM   878  C  CB    . HIS A 1 130 ? 2.227  33.344 8.605   1.00 11.18 ? 112  HIS A CB    1 
ATOM   879  C  CG    . HIS A 1 130 ? 2.141  33.706 7.162   1.00 11.81 ? 112  HIS A CG    1 
ATOM   880  N  ND1   . HIS A 1 130 ? 0.990  34.201 6.582   1.00 13.80 ? 112  HIS A ND1   1 
ATOM   881  C  CD2   . HIS A 1 130 ? 3.078  33.691 6.181   1.00 13.23 ? 112  HIS A CD2   1 
ATOM   882  C  CE1   . HIS A 1 130 ? 1.229  34.464 5.298   1.00 15.15 ? 112  HIS A CE1   1 
ATOM   883  N  NE2   . HIS A 1 130 ? 2.497  34.176 5.043   1.00 14.86 ? 112  HIS A NE2   1 
ATOM   884  N  N     . ALA A 1 131 ? 2.692  34.347 11.919  1.00 9.40  ? 113  ALA A N     1 
ATOM   885  C  CA    . ALA A 1 131 ? 2.581  33.846 13.268  1.00 10.71 ? 113  ALA A CA    1 
ATOM   886  C  C     . ALA A 1 131 ? 2.494  34.998 14.288  1.00 12.31 ? 113  ALA A C     1 
ATOM   887  O  O     . ALA A 1 131 ? 2.891  36.128 13.976  1.00 12.19 ? 113  ALA A O     1 
ATOM   888  C  CB    . ALA A 1 131 ? 3.685  32.862 13.626  1.00 11.52 ? 113  ALA A CB    1 
ATOM   889  N  N     . ASP A 1 132 ? 2.011  34.694 15.490  1.00 12.29 ? 114  ASP A N     1 
ATOM   890  C  CA    . ASP A 1 132 ? 1.902  35.696 16.536  1.00 13.36 ? 114  ASP A CA    1 
ATOM   891  C  C     . ASP A 1 132 ? 3.207  36.296 16.931  1.00 16.14 ? 114  ASP A C     1 
ATOM   892  O  O     . ASP A 1 132 ? 4.222  35.580 17.010  1.00 15.87 ? 114  ASP A O     1 
ATOM   893  C  CB    . ASP A 1 132 ? 1.268  35.091 17.796  1.00 16.38 ? 114  ASP A CB    1 
ATOM   894  C  CG    . ASP A 1 132 ? -0.202 34.789 17.615  1.00 17.26 ? 114  ASP A CG    1 
ATOM   895  O  OD1   . ASP A 1 132 ? -0.835 35.148 16.557  1.00 16.75 ? 114  ASP A OD1   1 
ATOM   896  O  OD2   . ASP A 1 132 ? -0.848 34.170 18.504  1.00 21.22 ? 114  ASP A OD2   1 
ATOM   897  N  N     . SER A 1 133 ? 3.227  37.612 17.159  1.00 17.10 ? 115  SER A N     1 
ATOM   898  C  CA    . SER A 1 133 ? 4.506  38.326 17.432  1.00 19.50 ? 115  SER A CA    1 
ATOM   899  C  C     . SER A 1 133 ? 5.216  37.801 18.673  1.00 20.63 ? 115  SER A C     1 
ATOM   900  O  O     . SER A 1 133 ? 6.484  37.898 18.760  1.00 21.82 ? 115  SER A O     1 
ATOM   901  C  CB    . SER A 1 133 ? 4.260  39.834 17.517  1.00 20.03 ? 115  SER A CB    1 
ATOM   902  O  OG    . SER A 1 133 ? 3.546  40.080 18.677  1.00 20.99 ? 115  SER A OG    1 
ATOM   903  N  N     . ASN A 1 134 ? 4.472  37.170 19.585  1.00 20.25 ? 116  ASN A N     1 
ATOM   904  C  CA    . ASN A 1 134 ? 5.068  36.641 20.797  1.00 23.62 ? 116  ASN A CA    1 
ATOM   905  C  C     . ASN A 1 134 ? 5.293  35.127 20.842  1.00 21.96 ? 116  ASN A C     1 
ATOM   906  O  O     . ASN A 1 134 ? 5.475  34.570 21.893  1.00 23.95 ? 116  ASN A O     1 
ATOM   907  C  CB    . ASN A 1 134 ? 4.207  37.076 21.987  1.00 25.04 ? 116  ASN A CB    1 
ATOM   908  C  CG    . ASN A 1 134 ? 4.186  38.582 22.141  1.00 30.65 ? 116  ASN A CG    1 
ATOM   909  O  OD1   . ASN A 1 134 ? 5.179  39.249 21.851  1.00 38.32 ? 116  ASN A OD1   1 
ATOM   910  N  ND2   . ASN A 1 134 ? 3.053  39.132 22.608  1.00 38.52 ? 116  ASN A ND2   1 
ATOM   911  N  N     . ILE A 1 135 ? 5.248  34.455 19.688  1.00 19.64 ? 117  ILE A N     1 
ATOM   912  C  CA    . ILE A 1 135 ? 5.426  33.030 19.677  1.00 17.99 ? 117  ILE A CA    1 
ATOM   913  C  C     . ILE A 1 135 ? 6.813  32.712 20.211  1.00 16.46 ? 117  ILE A C     1 
ATOM   914  O  O     . ILE A 1 135 ? 7.678  33.482 19.937  1.00 18.43 ? 117  ILE A O     1 
ATOM   915  C  CB    . ILE A 1 135 ? 5.253  32.512 18.216  1.00 16.82 ? 117  ILE A CB    1 
ATOM   916  C  CG1   . ILE A 1 135 ? 5.096  31.012 18.192  1.00 15.56 ? 117  ILE A CG1   1 
ATOM   917  C  CG2   . ILE A 1 135 ? 6.353  33.009 17.295  1.00 18.28 ? 117  ILE A CG2   1 
ATOM   918  C  CD1   . ILE A 1 135 ? 4.723  30.500 16.840  1.00 16.17 ? 117  ILE A CD1   1 
ATOM   919  N  N     . VAL A 1 136 ? 6.964  31.601 20.929  1.00 16.14 ? 118  VAL A N     1 
ATOM   920  C  CA    . VAL A 1 136 ? 8.266  31.155 21.419  1.00 16.43 ? 118  VAL A CA    1 
ATOM   921  C  C     . VAL A 1 136 ? 8.960  30.390 20.283  1.00 14.61 ? 118  VAL A C     1 
ATOM   922  O  O     . VAL A 1 136 ? 8.400  29.401 19.834  1.00 16.27 ? 118  VAL A O     1 
ATOM   923  C  CB    . VAL A 1 136 ? 8.132  30.297 22.660  1.00 17.24 ? 118  VAL A CB    1 
ATOM   924  C  CG1   . VAL A 1 136 ? 9.494  29.791 23.106  1.00 17.93 ? 118  VAL A CG1   1 
ATOM   925  C  CG2   . VAL A 1 136 ? 7.561  31.159 23.802  1.00 20.04 ? 118  VAL A CG2   1 
ATOM   926  N  N     . ILE A 1 137 ? 10.120 30.854 19.887  1.00 16.09 ? 119  ILE A N     1 
ATOM   927  C  CA    . ILE A 1 137 ? 10.846 30.272 18.739  1.00 15.62 ? 119  ILE A CA    1 
ATOM   928  C  C     . ILE A 1 137 ? 12.106 29.596 19.277  1.00 16.95 ? 119  ILE A C     1 
ATOM   929  O  O     . ILE A 1 137 ? 12.960 30.261 19.866  1.00 17.40 ? 119  ILE A O     1 
ATOM   930  C  CB    . ILE A 1 137 ? 11.218 31.270 17.670  1.00 15.36 ? 119  ILE A CB    1 
ATOM   931  C  CG1   . ILE A 1 137 ? 10.022 32.069 17.150  1.00 15.25 ? 119  ILE A CG1   1 
ATOM   932  C  CG2   . ILE A 1 137 ? 11.896 30.542 16.548  1.00 16.15 ? 119  ILE A CG2   1 
ATOM   933  C  CD1   . ILE A 1 137 ? 10.378 33.295 16.444  1.00 15.68 ? 119  ILE A CD1   1 
ATOM   934  N  N     A MET A 1 138 ? 12.190 28.287 19.077  0.50 17.21 ? 120  MET A N     1 
ATOM   935  N  N     B MET A 1 138 ? 12.188 28.286 19.087  0.50 16.98 ? 120  MET A N     1 
ATOM   936  C  CA    A MET A 1 138 ? 13.397 27.518 19.313  0.50 17.72 ? 120  MET A CA    1 
ATOM   937  C  CA    B MET A 1 138 ? 13.407 27.540 19.312  0.50 17.33 ? 120  MET A CA    1 
ATOM   938  C  C     A MET A 1 138 ? 14.105 27.141 17.997  0.50 17.09 ? 120  MET A C     1 
ATOM   939  C  C     B MET A 1 138 ? 14.106 27.142 18.000  0.50 16.87 ? 120  MET A C     1 
ATOM   940  O  O     A MET A 1 138 ? 13.566 26.379 17.166  0.50 16.36 ? 120  MET A O     1 
ATOM   941  O  O     B MET A 1 138 ? 13.564 26.376 17.173  0.50 16.14 ? 120  MET A O     1 
ATOM   942  C  CB    A MET A 1 138 ? 13.042 26.261 20.070  0.50 18.77 ? 120  MET A CB    1 
ATOM   943  C  CB    B MET A 1 138 ? 13.101 26.304 20.110  0.50 18.18 ? 120  MET A CB    1 
ATOM   944  C  CG    A MET A 1 138 ? 14.180 25.254 20.192  0.50 20.35 ? 120  MET A CG    1 
ATOM   945  C  CG    B MET A 1 138 ? 14.340 25.587 20.576  0.50 18.87 ? 120  MET A CG    1 
ATOM   946  S  SD    A MET A 1 138 ? 15.281 25.572 21.566  0.50 22.36 ? 120  MET A SD    1 
ATOM   947  S  SD    B MET A 1 138 ? 13.917 24.174 21.485  0.50 20.21 ? 120  MET A SD    1 
ATOM   948  C  CE    A MET A 1 138 ? 14.173 25.249 22.926  0.50 21.61 ? 120  MET A CE    1 
ATOM   949  C  CE    B MET A 1 138 ? 13.848 24.857 23.071  0.50 20.80 ? 120  MET A CE    1 
ATOM   950  N  N     . LEU A 1 139 ? 15.336 27.606 17.863  1.00 16.44 ? 121  LEU A N     1 
ATOM   951  C  CA    . LEU A 1 139 ? 16.162 27.276 16.727  1.00 16.69 ? 121  LEU A CA    1 
ATOM   952  C  C     . LEU A 1 139 ? 16.795 25.947 17.038  1.00 16.66 ? 121  LEU A C     1 
ATOM   953  O  O     . LEU A 1 139 ? 17.404 25.778 18.097  1.00 18.07 ? 121  LEU A O     1 
ATOM   954  C  CB    . LEU A 1 139 ? 17.183 28.358 16.425  1.00 15.39 ? 121  LEU A CB    1 
ATOM   955  C  CG    . LEU A 1 139 ? 18.207 28.117 15.329  1.00 14.10 ? 121  LEU A CG    1 
ATOM   956  C  CD1   . LEU A 1 139 ? 17.481 28.120 13.949  1.00 13.88 ? 121  LEU A CD1   1 
ATOM   957  C  CD2   . LEU A 1 139 ? 19.375 29.157 15.331  1.00 17.10 ? 121  LEU A CD2   1 
ATOM   958  N  N     . VAL A 1 140 ? 16.599 24.991 16.128  1.00 13.94 ? 122  VAL A N     1 
ATOM   959  C  CA    . VAL A 1 140 ? 16.993 23.622 16.364  1.00 14.91 ? 122  VAL A CA    1 
ATOM   960  C  C     . VAL A 1 140 ? 17.981 23.176 15.289  1.00 15.77 ? 122  VAL A C     1 
ATOM   961  O  O     . VAL A 1 140 ? 17.656 23.060 14.091  1.00 12.85 ? 122  VAL A O     1 
ATOM   962  C  CB    . VAL A 1 140 ? 15.817 22.615 16.365  1.00 14.05 ? 122  VAL A CB    1 
ATOM   963  C  CG1   . VAL A 1 140 ? 16.369 21.174 16.513  1.00 16.99 ? 122  VAL A CG1   1 
ATOM   964  C  CG2   . VAL A 1 140 ? 14.790 22.942 17.423  1.00 16.31 ? 122  VAL A CG2   1 
ATOM   965  N  N     . GLY A 1 141 ? 19.250 22.990 15.705  1.00 15.79 ? 123  GLY A N     1 
ATOM   966  C  CA    . GLY A 1 141 ? 20.231 22.427 14.802  1.00 16.51 ? 123  GLY A CA    1 
ATOM   967  C  C     . GLY A 1 141 ? 20.204 20.928 14.875  1.00 16.57 ? 123  GLY A C     1 
ATOM   968  O  O     . GLY A 1 141 ? 20.746 20.318 15.805  1.00 17.17 ? 123  GLY A O     1 
ATOM   969  N  N     . ASN A 1 142 ? 19.535 20.284 13.929  1.00 15.74 ? 124  ASN A N     1 
ATOM   970  C  CA    . ASN A 1 142 ? 19.304 18.846 14.006  1.00 15.72 ? 124  ASN A CA    1 
ATOM   971  C  C     . ASN A 1 142 ? 20.441 18.086 13.288  1.00 14.76 ? 124  ASN A C     1 
ATOM   972  O  O     . ASN A 1 142 ? 21.196 18.687 12.531  1.00 14.35 ? 124  ASN A O     1 
ATOM   973  C  CB    . ASN A 1 142 ? 17.947 18.480 13.392  1.00 15.33 ? 124  ASN A CB    1 
ATOM   974  C  CG    . ASN A 1 142 ? 17.574 17.058 13.598  1.00 14.81 ? 124  ASN A CG    1 
ATOM   975  O  OD1   . ASN A 1 142 ? 17.630 16.530 14.706  1.00 15.16 ? 124  ASN A OD1   1 
ATOM   976  N  ND2   . ASN A 1 142 ? 17.182 16.406 12.514  1.00 12.92 ? 124  ASN A ND2   1 
ATOM   977  N  N     . LYS A 1 143 ? 20.510 16.781 13.498  1.00 16.78 ? 125  LYS A N     1 
ATOM   978  C  CA    . LYS A 1 143 ? 21.559 15.895 12.930  1.00 16.69 ? 125  LYS A CA    1 
ATOM   979  C  C     . LYS A 1 143 ? 22.908 16.051 13.620  1.00 18.01 ? 125  LYS A C     1 
ATOM   980  O  O     . LYS A 1 143 ? 23.929 15.948 12.943  1.00 20.17 ? 125  LYS A O     1 
ATOM   981  C  CB    . LYS A 1 143 ? 21.706 16.048 11.393  1.00 16.74 ? 125  LYS A CB    1 
ATOM   982  C  CG    . LYS A 1 143 ? 20.349 15.939 10.720  1.00 15.66 ? 125  LYS A CG    1 
ATOM   983  C  CD    . LYS A 1 143 ? 20.498 15.628 9.237   1.00 14.49 ? 125  LYS A CD    1 
ATOM   984  C  CE    . LYS A 1 143 ? 19.179 15.663 8.519   1.00 13.29 ? 125  LYS A CE    1 
ATOM   985  N  NZ    . LYS A 1 143 ? 19.288 15.442 7.036   1.00 15.74 ? 125  LYS A NZ    1 
ATOM   986  N  N     . SER A 1 144 ? 22.897 16.287 14.937  1.00 19.24 ? 126  SER A N     1 
ATOM   987  C  CA    . SER A 1 144 ? 24.132 16.482 15.709  1.00 21.81 ? 126  SER A CA    1 
ATOM   988  C  C     . SER A 1 144 ? 25.026 15.232 15.610  1.00 23.68 ? 126  SER A C     1 
ATOM   989  O  O     . SER A 1 144 ? 26.264 15.362 15.823  1.00 25.44 ? 126  SER A O     1 
ATOM   990  C  CB    . SER A 1 144 ? 23.883 16.866 17.189  1.00 20.86 ? 126  SER A CB    1 
ATOM   991  O  OG    . SER A 1 144 ? 23.237 15.865 17.890  1.00 23.82 ? 126  SER A OG    1 
ATOM   992  N  N     . ASP A 1 145 ? 24.421 14.075 15.320  1.00 24.94 ? 127  ASP A N     1 
ATOM   993  C  CA    . ASP A 1 145 ? 25.189 12.822 15.122  1.00 25.61 ? 127  ASP A CA    1 
ATOM   994  C  C     . ASP A 1 145 ? 26.108 12.870 13.919  1.00 26.21 ? 127  ASP A C     1 
ATOM   995  O  O     . ASP A 1 145 ? 27.040 12.039 13.798  1.00 27.80 ? 127  ASP A O     1 
ATOM   996  C  CB    . ASP A 1 145 ? 24.285 11.626 15.013  1.00 25.81 ? 127  ASP A CB    1 
ATOM   997  C  CG    . ASP A 1 145 ? 23.310 11.758 13.885  1.00 27.36 ? 127  ASP A CG    1 
ATOM   998  O  OD1   . ASP A 1 145 ? 23.575 11.201 12.802  1.00 27.46 ? 127  ASP A OD1   1 
ATOM   999  O  OD2   . ASP A 1 145 ? 22.317 12.538 14.000  1.00 27.25 ? 127  ASP A OD2   1 
ATOM   1000 N  N     . LEU A 1 146 ? 25.881 13.836 13.030  1.00 24.97 ? 128  LEU A N     1 
ATOM   1001 C  CA    . LEU A 1 146 ? 26.701 14.090 11.870  1.00 25.13 ? 128  LEU A CA    1 
ATOM   1002 C  C     . LEU A 1 146 ? 27.738 15.174 12.153  1.00 25.04 ? 128  LEU A C     1 
ATOM   1003 O  O     . LEU A 1 146 ? 28.182 15.889 11.271  1.00 24.83 ? 128  LEU A O     1 
ATOM   1004 C  CB    . LEU A 1 146 ? 25.838 14.454 10.654  1.00 23.39 ? 128  LEU A CB    1 
ATOM   1005 C  CG    . LEU A 1 146 ? 24.767 13.492 10.173  1.00 23.46 ? 128  LEU A CG    1 
ATOM   1006 C  CD1   . LEU A 1 146 ? 24.054 14.049 8.986   1.00 20.55 ? 128  LEU A CD1   1 
ATOM   1007 C  CD2   . LEU A 1 146 ? 25.343 12.156 9.811   1.00 22.44 ? 128  LEU A CD2   1 
ATOM   1008 N  N     . ARG A 1 147 ? 28.145 15.266 13.401  1.00 28.78 ? 129  ARG A N     1 
ATOM   1009 C  CA    . ARG A 1 147 ? 29.126 16.263 13.834  1.00 32.03 ? 129  ARG A CA    1 
ATOM   1010 C  C     . ARG A 1 147 ? 30.417 16.241 13.001  1.00 30.64 ? 129  ARG A C     1 
ATOM   1011 O  O     . ARG A 1 147 ? 31.002 17.276 12.721  1.00 28.83 ? 129  ARG A O     1 
ATOM   1012 C  CB    . ARG A 1 147 ? 29.453 16.089 15.325  1.00 33.92 ? 129  ARG A CB    1 
ATOM   1013 C  CG    . ARG A 1 147 ? 30.009 14.711 15.687  1.00 42.94 ? 129  ARG A CG    1 
ATOM   1014 C  CD    . ARG A 1 147 ? 29.669 14.297 17.107  1.00 52.55 ? 129  ARG A CD    1 
ATOM   1015 N  NE    . ARG A 1 147 ? 30.479 15.069 18.048  1.00 60.06 ? 129  ARG A NE    1 
ATOM   1016 C  CZ    . ARG A 1 147 ? 30.863 14.656 19.258  1.00 65.99 ? 129  ARG A CZ    1 
ATOM   1017 N  NH1   . ARG A 1 147 ? 31.612 15.461 20.011  1.00 67.78 ? 129  ARG A NH1   1 
ATOM   1018 N  NH2   . ARG A 1 147 ? 30.501 13.459 19.733  1.00 68.57 ? 129  ARG A NH2   1 
ATOM   1019 N  N     . HIS A 1 148 ? 30.828 15.064 12.554  1.00 31.10 ? 130  HIS A N     1 
ATOM   1020 C  CA    . HIS A 1 148 ? 32.010 14.975 11.719  1.00 32.14 ? 130  HIS A CA    1 
ATOM   1021 C  C     . HIS A 1 148 ? 31.813 15.578 10.318  1.00 31.61 ? 130  HIS A C     1 
ATOM   1022 O  O     . HIS A 1 148 ? 32.769 15.764 9.589   1.00 31.45 ? 130  HIS A O     1 
ATOM   1023 C  CB    . HIS A 1 148 ? 32.425 13.511 11.623  1.00 32.75 ? 130  HIS A CB    1 
ATOM   1024 C  CG    . HIS A 1 148 ? 31.438 12.681 10.863  1.00 38.44 ? 130  HIS A CG    1 
ATOM   1025 N  ND1   . HIS A 1 148 ? 30.234 12.273 11.405  1.00 41.54 ? 130  HIS A ND1   1 
ATOM   1026 C  CD2   . HIS A 1 148 ? 31.436 12.257 9.572   1.00 41.19 ? 130  HIS A CD2   1 
ATOM   1027 C  CE1   . HIS A 1 148 ? 29.558 11.592 10.493  1.00 43.16 ? 130  HIS A CE1   1 
ATOM   1028 N  NE2   . HIS A 1 148 ? 30.263 11.570 9.373   1.00 42.09 ? 130  HIS A NE2   1 
ATOM   1029 N  N     . LEU A 1 149 ? 30.568 15.877 9.935   1.00 31.14 ? 131  LEU A N     1 
ATOM   1030 C  CA    . LEU A 1 149 ? 30.210 16.515 8.648   1.00 30.28 ? 131  LEU A CA    1 
ATOM   1031 C  C     . LEU A 1 149 ? 29.680 17.944 8.822   1.00 28.42 ? 131  LEU A C     1 
ATOM   1032 O  O     . LEU A 1 149 ? 29.156 18.543 7.888   1.00 27.75 ? 131  LEU A O     1 
ATOM   1033 C  CB    . LEU A 1 149 ? 29.097 15.701 7.974   1.00 30.42 ? 131  LEU A CB    1 
ATOM   1034 C  CG    . LEU A 1 149 ? 29.498 14.281 7.601   1.00 34.26 ? 131  LEU A CG    1 
ATOM   1035 C  CD1   . LEU A 1 149 ? 28.356 13.586 6.876   1.00 37.12 ? 131  LEU A CD1   1 
ATOM   1036 C  CD2   . LEU A 1 149 ? 30.755 14.303 6.738   1.00 36.14 ? 131  LEU A CD2   1 
ATOM   1037 N  N     . ARG A 1 150 ? 29.849 18.487 10.011  1.00 27.74 ? 132  ARG A N     1 
ATOM   1038 C  CA    . ARG A 1 150 ? 29.270 19.779 10.359  1.00 27.02 ? 132  ARG A CA    1 
ATOM   1039 C  C     . ARG A 1 150 ? 29.626 20.891 9.390   1.00 27.39 ? 132  ARG A C     1 
ATOM   1040 O  O     . ARG A 1 150 ? 30.805 21.050 9.017   1.00 26.50 ? 132  ARG A O     1 
ATOM   1041 C  CB    . ARG A 1 150 ? 29.676 20.122 11.790  1.00 27.44 ? 132  ARG A CB    1 
ATOM   1042 C  CG    . ARG A 1 150 ? 29.394 21.538 12.218  1.00 26.08 ? 132  ARG A CG    1 
ATOM   1043 C  CD    . ARG A 1 150 ? 29.778 21.782 13.652  1.00 22.71 ? 132  ARG A CD    1 
ATOM   1044 N  NE    . ARG A 1 150 ? 29.281 20.855 14.655  1.00 23.75 ? 132  ARG A NE    1 
ATOM   1045 C  CZ    . ARG A 1 150 ? 28.087 20.923 15.243  1.00 28.51 ? 132  ARG A CZ    1 
ATOM   1046 N  NH1   . ARG A 1 150 ? 27.188 21.830 14.836  1.00 26.59 ? 132  ARG A NH1   1 
ATOM   1047 N  NH2   . ARG A 1 150 ? 27.775 20.064 16.220  1.00 26.65 ? 132  ARG A NH2   1 
ATOM   1048 N  N     . ALA A 1 151 ? 28.605 21.632 8.926   1.00 24.73 ? 133  ALA A N     1 
ATOM   1049 C  CA    . ALA A 1 151 ? 28.764 22.829 8.083   1.00 24.52 ? 133  ALA A CA    1 
ATOM   1050 C  C     . ALA A 1 151 ? 28.391 24.139 8.786   1.00 25.56 ? 133  ALA A C     1 
ATOM   1051 O  O     . ALA A 1 151 ? 28.621 25.210 8.253   1.00 25.11 ? 133  ALA A O     1 
ATOM   1052 C  CB    . ALA A 1 151 ? 27.943 22.712 6.826   1.00 25.14 ? 133  ALA A CB    1 
ATOM   1053 N  N     . VAL A 1 152 ? 27.811 24.018 9.964   1.00 26.02 ? 134  VAL A N     1 
ATOM   1054 C  CA    . VAL A 1 152 ? 27.320 25.155 10.758  1.00 26.03 ? 134  VAL A CA    1 
ATOM   1055 C  C     . VAL A 1 152 ? 27.882 25.042 12.186  1.00 26.32 ? 134  VAL A C     1 
ATOM   1056 O  O     . VAL A 1 152 ? 27.447 24.249 13.035  1.00 26.29 ? 134  VAL A O     1 
ATOM   1057 C  CB    . VAL A 1 152 ? 25.731 25.219 10.812  1.00 24.73 ? 134  VAL A CB    1 
ATOM   1058 C  CG1   . VAL A 1 152 ? 25.280 26.519 11.411  1.00 25.66 ? 134  VAL A CG1   1 
ATOM   1059 C  CG2   . VAL A 1 152 ? 25.123 25.055 9.477   1.00 25.66 ? 134  VAL A CG2   1 
ATOM   1060 N  N     . PRO A 1 153 ? 28.901 25.848 12.462  1.00 28.59 ? 135  PRO A N     1 
ATOM   1061 C  CA    . PRO A 1 153 ? 29.514 25.836 13.781  1.00 29.13 ? 135  PRO A CA    1 
ATOM   1062 C  C     . PRO A 1 153 ? 28.533 26.156 14.870  1.00 28.80 ? 135  PRO A C     1 
ATOM   1063 O  O     . PRO A 1 153 ? 27.784 27.124 14.759  1.00 28.08 ? 135  PRO A O     1 
ATOM   1064 C  CB    . PRO A 1 153 ? 30.642 26.879 13.685  1.00 28.77 ? 135  PRO A CB    1 
ATOM   1065 C  CG    . PRO A 1 153 ? 30.613 27.469 12.351  1.00 30.45 ? 135  PRO A CG    1 
ATOM   1066 C  CD    . PRO A 1 153 ? 29.545 26.776 11.518  1.00 29.63 ? 135  PRO A CD    1 
ATOM   1067 N  N     . THR A 1 154 ? 28.480 25.324 15.903  1.00 29.95 ? 136  THR A N     1 
ATOM   1068 C  CA    . THR A 1 154 ? 27.612 25.558 17.042  1.00 30.23 ? 136  THR A CA    1 
ATOM   1069 C  C     . THR A 1 154 ? 27.633 26.983 17.606  1.00 31.97 ? 136  THR A C     1 
ATOM   1070 O  O     . THR A 1 154 ? 26.576 27.580 17.871  1.00 29.48 ? 136  THR A O     1 
ATOM   1071 C  CB    . THR A 1 154 ? 27.940 24.558 18.171  1.00 30.39 ? 136  THR A CB    1 
ATOM   1072 O  OG1   . THR A 1 154 ? 27.786 23.209 17.711  1.00 30.20 ? 136  THR A OG1   1 
ATOM   1073 C  CG2   . THR A 1 154 ? 26.958 24.698 19.323  1.00 30.84 ? 136  THR A CG2   1 
ATOM   1074 N  N     . ASP A 1 155 ? 28.835 27.521 17.838  1.00 33.90 ? 137  ASP A N     1 
ATOM   1075 C  CA    . ASP A 1 155 ? 28.968 28.838 18.447  1.00 34.78 ? 137  ASP A CA    1 
ATOM   1076 C  C     . ASP A 1 155 ? 28.309 29.913 17.591  1.00 33.20 ? 137  ASP A C     1 
ATOM   1077 O  O     . ASP A 1 155 ? 27.704 30.841 18.132  1.00 33.33 ? 137  ASP A O     1 
ATOM   1078 C  CB    . ASP A 1 155 ? 30.451 29.210 18.702  1.00 36.38 ? 137  ASP A CB    1 
ATOM   1079 C  CG    . ASP A 1 155 ? 31.005 28.563 19.965  1.00 41.68 ? 137  ASP A CG    1 
ATOM   1080 O  OD1   . ASP A 1 155 ? 32.252 28.483 20.124  1.00 49.14 ? 137  ASP A OD1   1 
ATOM   1081 O  OD2   . ASP A 1 155 ? 30.270 28.098 20.865  1.00 50.14 ? 137  ASP A OD2   1 
ATOM   1082 N  N     . GLU A 1 156 ? 28.432 29.776 16.271  1.00 31.72 ? 138  GLU A N     1 
ATOM   1083 C  CA    . GLU A 1 156 ? 27.840 30.728 15.334  1.00 30.69 ? 138  GLU A CA    1 
ATOM   1084 C  C     . GLU A 1 156 ? 26.311 30.707 15.409  1.00 29.60 ? 138  GLU A C     1 
ATOM   1085 O  O     . GLU A 1 156 ? 25.675 31.748 15.514  1.00 28.64 ? 138  GLU A O     1 
ATOM   1086 C  CB    . GLU A 1 156 ? 28.272 30.454 13.912  1.00 30.58 ? 138  GLU A CB    1 
ATOM   1087 C  CG    . GLU A 1 156 ? 27.708 31.470 12.958  1.00 31.70 ? 138  GLU A CG    1 
ATOM   1088 C  CD    . GLU A 1 156 ? 28.020 31.197 11.512  1.00 33.94 ? 138  GLU A CD    1 
ATOM   1089 O  OE1   . GLU A 1 156 ? 27.492 31.931 10.647  1.00 31.63 ? 138  GLU A OE1   1 
ATOM   1090 O  OE2   . GLU A 1 156 ? 28.806 30.263 11.230  1.00 38.45 ? 138  GLU A OE2   1 
ATOM   1091 N  N     . ALA A 1 157 ? 25.732 29.524 15.399  1.00 27.88 ? 139  ALA A N     1 
ATOM   1092 C  CA    . ALA A 1 157 ? 24.271 29.411 15.433  1.00 28.18 ? 139  ALA A CA    1 
ATOM   1093 C  C     . ALA A 1 157 ? 23.731 29.894 16.772  1.00 28.11 ? 139  ALA A C     1 
ATOM   1094 O  O     . ALA A 1 157 ? 22.694 30.552 16.835  1.00 28.01 ? 139  ALA A O     1 
ATOM   1095 C  CB    . ALA A 1 157 ? 23.843 27.947 15.190  1.00 26.80 ? 139  ALA A CB    1 
ATOM   1096 N  N     . ARG A 1 158 ? 24.422 29.529 17.845  1.00 28.82 ? 140  ARG A N     1 
ATOM   1097 C  CA    . ARG A 1 158 ? 24.069 29.967 19.192  1.00 30.07 ? 140  ARG A CA    1 
ATOM   1098 C  C     . ARG A 1 158 ? 24.068 31.497 19.323  1.00 29.61 ? 140  ARG A C     1 
ATOM   1099 O  O     . ARG A 1 158 ? 23.133 32.055 19.917  1.00 29.10 ? 140  ARG A O     1 
ATOM   1100 C  CB    . ARG A 1 158 ? 25.036 29.369 20.220  1.00 32.34 ? 140  ARG A CB    1 
ATOM   1101 C  CG    . ARG A 1 158 ? 24.612 29.551 21.645  1.00 36.53 ? 140  ARG A CG    1 
ATOM   1102 C  CD    . ARG A 1 158 ? 25.413 28.674 22.606  1.00 44.03 ? 140  ARG A CD    1 
ATOM   1103 N  NE    . ARG A 1 158 ? 24.932 27.293 22.500  1.00 50.52 ? 140  ARG A NE    1 
ATOM   1104 C  CZ    . ARG A 1 158 ? 25.640 26.193 22.730  1.00 55.08 ? 140  ARG A CZ    1 
ATOM   1105 N  NH1   . ARG A 1 158 ? 25.044 25.011 22.591  1.00 57.04 ? 140  ARG A NH1   1 
ATOM   1106 N  NH2   . ARG A 1 158 ? 26.918 26.248 23.105  1.00 57.68 ? 140  ARG A NH2   1 
ATOM   1107 N  N     . ALA A 1 159 ? 25.076 32.175 18.767  1.00 28.67 ? 141  ALA A N     1 
ATOM   1108 C  CA    . ALA A 1 159 ? 25.112 33.633 18.814  1.00 29.00 ? 141  ALA A CA    1 
ATOM   1109 C  C     . ALA A 1 159 ? 23.970 34.211 17.987  1.00 28.18 ? 141  ALA A C     1 
ATOM   1110 O  O     . ALA A 1 159 ? 23.380 35.242 18.351  1.00 26.73 ? 141  ALA A O     1 
ATOM   1111 C  CB    . ALA A 1 159 ? 26.445 34.178 18.263  1.00 30.13 ? 141  ALA A CB    1 
ATOM   1112 N  N     . PHE A 1 160 ? 23.688 33.555 16.850  1.00 26.86 ? 142  PHE A N     1 
ATOM   1113 C  CA    . PHE A 1 160 ? 22.617 33.977 15.955  1.00 26.37 ? 142  PHE A CA    1 
ATOM   1114 C  C     . PHE A 1 160 ? 21.288 33.933 16.649  1.00 25.77 ? 142  PHE A C     1 
ATOM   1115 O  O     . PHE A 1 160 ? 20.494 34.875 16.519  1.00 26.30 ? 142  PHE A O     1 
ATOM   1116 C  CB    . PHE A 1 160 ? 22.574 33.080 14.705  1.00 26.19 ? 142  PHE A CB    1 
ATOM   1117 C  CG    . PHE A 1 160 ? 21.444 33.395 13.806  1.00 26.55 ? 142  PHE A CG    1 
ATOM   1118 C  CD1   . PHE A 1 160 ? 21.604 34.283 12.780  1.00 24.73 ? 142  PHE A CD1   1 
ATOM   1119 C  CD2   . PHE A 1 160 ? 20.204 32.804 13.994  1.00 22.17 ? 142  PHE A CD2   1 
ATOM   1120 C  CE1   . PHE A 1 160 ? 20.547 34.565 11.926  1.00 24.70 ? 142  PHE A CE1   1 
ATOM   1121 C  CE2   . PHE A 1 160 ? 19.139 33.134 13.155  1.00 21.97 ? 142  PHE A CE2   1 
ATOM   1122 C  CZ    . PHE A 1 160 ? 19.302 33.965 12.146  1.00 21.04 ? 142  PHE A CZ    1 
ATOM   1123 N  N     . ALA A 1 161 ? 21.036 32.856 17.386  1.00 25.43 ? 143  ALA A N     1 
ATOM   1124 C  CA    . ALA A 1 161 ? 19.819 32.689 18.160  1.00 26.98 ? 143  ALA A CA    1 
ATOM   1125 C  C     . ALA A 1 161 ? 19.668 33.816 19.180  1.00 30.20 ? 143  ALA A C     1 
ATOM   1126 O  O     . ALA A 1 161 ? 18.601 34.443 19.283  1.00 28.86 ? 143  ALA A O     1 
ATOM   1127 C  CB    . ALA A 1 161 ? 19.791 31.339 18.858  1.00 26.16 ? 143  ALA A CB    1 
ATOM   1128 N  N     . GLU A 1 162 ? 20.773 34.079 19.874  1.00 33.51 ? 144  GLU A N     1 
ATOM   1129 C  CA    . GLU A 1 162 ? 20.890 35.142 20.875  1.00 36.97 ? 144  GLU A CA    1 
ATOM   1130 C  C     . GLU A 1 162 ? 20.456 36.466 20.293  1.00 36.08 ? 144  GLU A C     1 
ATOM   1131 O  O     . GLU A 1 162 ? 19.534 37.070 20.821  1.00 36.11 ? 144  GLU A O     1 
ATOM   1132 C  CB    . GLU A 1 162 ? 22.339 35.244 21.386  1.00 38.56 ? 144  GLU A CB    1 
ATOM   1133 C  CG    . GLU A 1 162 ? 22.610 36.346 22.416  1.00 46.67 ? 144  GLU A CG    1 
ATOM   1134 C  CD    . GLU A 1 162 ? 22.362 35.903 23.859  1.00 55.61 ? 144  GLU A CD    1 
ATOM   1135 O  OE1   . GLU A 1 162 ? 22.944 34.870 24.282  1.00 61.46 ? 144  GLU A OE1   1 
ATOM   1136 O  OE2   . GLU A 1 162 ? 21.585 36.592 24.581  1.00 62.04 ? 144  GLU A OE2   1 
ATOM   1137 N  N     . LYS A 1 163 ? 21.100 36.898 19.213  1.00 35.61 ? 145  LYS A N     1 
ATOM   1138 C  CA    . LYS A 1 163 ? 20.798 38.189 18.572  1.00 36.24 ? 145  LYS A CA    1 
ATOM   1139 C  C     . LYS A 1 163 ? 19.366 38.290 18.041  1.00 34.88 ? 145  LYS A C     1 
ATOM   1140 O  O     . LYS A 1 163 ? 18.855 39.392 17.898  1.00 35.15 ? 145  LYS A O     1 
ATOM   1141 C  CB    . LYS A 1 163 ? 21.736 38.448 17.394  1.00 36.63 ? 145  LYS A CB    1 
ATOM   1142 C  CG    . LYS A 1 163 ? 23.194 38.821 17.758  1.00 42.33 ? 145  LYS A CG    1 
ATOM   1143 C  CD    . LYS A 1 163 ? 24.121 38.949 16.517  1.00 46.66 ? 145  LYS A CD    1 
ATOM   1144 C  CE    . LYS A 1 163 ? 23.991 37.712 15.580  1.00 50.67 ? 145  LYS A CE    1 
ATOM   1145 N  NZ    . LYS A 1 163 ? 25.075 37.520 14.563  1.00 52.01 ? 145  LYS A NZ    1 
ATOM   1146 N  N     . ASN A 1 164 ? 18.741 37.162 17.702  1.00 33.04 ? 146  ASN A N     1 
ATOM   1147 C  CA    . ASN A 1 164 ? 17.389 37.157 17.130  1.00 31.61 ? 146  ASN A CA    1 
ATOM   1148 C  C     . ASN A 1 164 ? 16.265 36.804 18.102  1.00 30.31 ? 146  ASN A C     1 
ATOM   1149 O  O     . ASN A 1 164 ? 15.113 36.615 17.680  1.00 29.64 ? 146  ASN A O     1 
ATOM   1150 C  CB    . ASN A 1 164 ? 17.339 36.200 15.944  1.00 32.03 ? 146  ASN A CB    1 
ATOM   1151 C  CG    . ASN A 1 164 ? 18.056 36.745 14.749  1.00 31.91 ? 146  ASN A CG    1 
ATOM   1152 O  OD1   . ASN A 1 164 ? 19.235 36.477 14.538  1.00 32.74 ? 146  ASN A OD1   1 
ATOM   1153 N  ND2   . ASN A 1 164 ? 17.365 37.551 13.982  1.00 31.64 ? 146  ASN A ND2   1 
ATOM   1154 N  N     . GLY A 1 165 ? 16.590 36.704 19.390  1.00 29.59 ? 147  GLY A N     1 
ATOM   1155 C  CA    . GLY A 1 165 ? 15.622 36.402 20.422  1.00 28.13 ? 147  GLY A CA    1 
ATOM   1156 C  C     . GLY A 1 165 ? 15.008 35.034 20.310  1.00 27.31 ? 147  GLY A C     1 
ATOM   1157 O  O     . GLY A 1 165 ? 13.791 34.840 20.521  1.00 25.97 ? 147  GLY A O     1 
ATOM   1158 N  N     . LEU A 1 166 ? 15.842 34.056 19.953  1.00 24.80 ? 148  LEU A N     1 
ATOM   1159 C  CA    . LEU A 1 166 ? 15.391 32.659 19.878  1.00 23.05 ? 148  LEU A CA    1 
ATOM   1160 C  C     . LEU A 1 166 ? 16.097 31.820 20.942  1.00 21.15 ? 148  LEU A C     1 
ATOM   1161 O  O     . LEU A 1 166 ? 17.219 32.134 21.273  1.00 22.31 ? 148  LEU A O     1 
ATOM   1162 C  CB    . LEU A 1 166 ? 15.748 32.127 18.478  1.00 21.65 ? 148  LEU A CB    1 
ATOM   1163 C  CG    . LEU A 1 166 ? 15.621 33.029 17.284  1.00 22.68 ? 148  LEU A CG    1 
ATOM   1164 C  CD1   . LEU A 1 166 ? 16.118 32.330 16.014  1.00 20.50 ? 148  LEU A CD1   1 
ATOM   1165 C  CD2   . LEU A 1 166 ? 14.180 33.433 17.133  1.00 20.05 ? 148  LEU A CD2   1 
ATOM   1166 N  N     . SER A 1 167 ? 15.477 30.728 21.386  1.00 20.05 ? 149  SER A N     1 
ATOM   1167 C  CA    . SER A 1 167 ? 16.138 29.643 22.104  1.00 22.58 ? 149  SER A CA    1 
ATOM   1168 C  C     . SER A 1 167 ? 16.940 28.839 21.130  1.00 22.89 ? 149  SER A C     1 
ATOM   1169 O  O     . SER A 1 167 ? 16.744 28.999 19.935  1.00 22.81 ? 149  SER A O     1 
ATOM   1170 C  CB    . SER A 1 167 ? 15.100 28.737 22.759  1.00 22.97 ? 149  SER A CB    1 
ATOM   1171 O  OG    . SER A 1 167 ? 14.281 29.527 23.596  1.00 32.82 ? 149  SER A OG    1 
ATOM   1172 N  N     . PHE A 1 168 ? 17.859 28.016 21.623  1.00 23.30 ? 150  PHE A N     1 
ATOM   1173 C  CA    . PHE A 1 168 ? 18.759 27.262 20.732  1.00 24.07 ? 150  PHE A CA    1 
ATOM   1174 C  C     . PHE A 1 168 ? 19.110 25.935 21.362  1.00 24.27 ? 150  PHE A C     1 
ATOM   1175 O  O     . PHE A 1 168 ? 19.404 25.845 22.573  1.00 23.95 ? 150  PHE A O     1 
ATOM   1176 C  CB    . PHE A 1 168 ? 20.030 28.031 20.392  1.00 24.49 ? 150  PHE A CB    1 
ATOM   1177 C  CG    . PHE A 1 168 ? 21.005 27.239 19.567  1.00 25.66 ? 150  PHE A CG    1 
ATOM   1178 C  CD1   . PHE A 1 168 ? 20.756 26.991 18.230  1.00 28.61 ? 150  PHE A CD1   1 
ATOM   1179 C  CD2   . PHE A 1 168 ? 22.104 26.639 20.144  1.00 27.62 ? 150  PHE A CD2   1 
ATOM   1180 C  CE1   . PHE A 1 168 ? 21.619 26.217 17.474  1.00 29.54 ? 150  PHE A CE1   1 
ATOM   1181 C  CE2   . PHE A 1 168 ? 22.974 25.864 19.344  1.00 28.08 ? 150  PHE A CE2   1 
ATOM   1182 C  CZ    . PHE A 1 168 ? 22.722 25.685 18.037  1.00 28.50 ? 150  PHE A CZ    1 
ATOM   1183 N  N     . ILE A 1 169 ? 19.071 24.891 20.535  1.00 21.75 ? 151  ILE A N     1 
ATOM   1184 C  CA    . ILE A 1 169 ? 19.452 23.589 20.967  1.00 20.84 ? 151  ILE A CA    1 
ATOM   1185 C  C     . ILE A 1 169 ? 19.890 22.789 19.721  1.00 20.91 ? 151  ILE A C     1 
ATOM   1186 O  O     . ILE A 1 169 ? 19.397 23.024 18.613  1.00 19.85 ? 151  ILE A O     1 
ATOM   1187 C  CB    . ILE A 1 169 ? 18.334 22.938 21.718  1.00 20.12 ? 151  ILE A CB    1 
ATOM   1188 C  CG1   . ILE A 1 169 ? 18.869 21.723 22.523  1.00 20.29 ? 151  ILE A CG1   1 
ATOM   1189 C  CG2   . ILE A 1 169 ? 17.201 22.529 20.743  1.00 23.18 ? 151  ILE A CG2   1 
ATOM   1190 C  CD1   . ILE A 1 169 ? 17.844 21.081 23.454  1.00 21.47 ? 151  ILE A CD1   1 
ATOM   1191 N  N     . GLU A 1 170 ? 20.859 21.891 19.891  1.00 20.51 ? 152  GLU A N     1 
ATOM   1192 C  CA    . GLU A 1 170 ? 21.245 20.936 18.836  1.00 20.21 ? 152  GLU A CA    1 
ATOM   1193 C  C     . GLU A 1 170 ? 20.665 19.566 19.201  1.00 20.73 ? 152  GLU A C     1 
ATOM   1194 O  O     . GLU A 1 170 ? 20.706 19.126 20.356  1.00 21.70 ? 152  GLU A O     1 
ATOM   1195 C  CB    . GLU A 1 170 ? 22.758 20.902 18.588  1.00 19.80 ? 152  GLU A CB    1 
ATOM   1196 C  CG    . GLU A 1 170 ? 23.356 22.120 17.939  1.00 20.26 ? 152  GLU A CG    1 
ATOM   1197 C  CD    . GLU A 1 170 ? 24.754 21.914 17.392  1.00 23.72 ? 152  GLU A CD    1 
ATOM   1198 O  OE1   . GLU A 1 170 ? 25.331 22.830 16.801  1.00 23.03 ? 152  GLU A OE1   1 
ATOM   1199 O  OE2   . GLU A 1 170 ? 25.279 20.783 17.574  1.00 26.42 ? 152  GLU A OE2   1 
ATOM   1200 N  N     . THR A 1 171 ? 20.084 18.882 18.223  1.00 18.32 ? 153  THR A N     1 
ATOM   1201 C  CA    . THR A 1 171 ? 19.410 17.645 18.452  1.00 19.30 ? 153  THR A CA    1 
ATOM   1202 C  C     . THR A 1 171 ? 19.905 16.603 17.439  1.00 18.96 ? 153  THR A C     1 
ATOM   1203 O  O     . THR A 1 171 ? 20.515 16.944 16.444  1.00 18.97 ? 153  THR A O     1 
ATOM   1204 C  CB    . THR A 1 171 ? 17.883 17.744 18.295  1.00 19.92 ? 153  THR A CB    1 
ATOM   1205 O  OG1   . THR A 1 171 ? 17.564 18.142 16.941  1.00 20.78 ? 153  THR A OG1   1 
ATOM   1206 C  CG2   . THR A 1 171 ? 17.271 18.849 19.187  1.00 20.15 ? 153  THR A CG2   1 
ATOM   1207 N  N     . SER A 1 172 ? 19.574 15.353 17.736  1.00 20.64 ? 154  SER A N     1 
ATOM   1208 C  CA    . SER A 1 172 ? 19.660 14.256 16.813  1.00 19.99 ? 154  SER A CA    1 
ATOM   1209 C  C     . SER A 1 172 ? 18.418 13.411 16.999  1.00 22.23 ? 154  SER A C     1 
ATOM   1210 O  O     . SER A 1 172 ? 18.282 12.689 17.986  1.00 21.93 ? 154  SER A O     1 
ATOM   1211 C  CB    . SER A 1 172 ? 20.915 13.391 17.097  1.00 21.69 ? 154  SER A CB    1 
ATOM   1212 O  OG    . SER A 1 172 ? 20.994 12.375 16.150  1.00 22.38 ? 154  SER A OG    1 
ATOM   1213 N  N     . ALA A 1 173 ? 17.486 13.472 16.031  1.00 21.15 ? 155  ALA A N     1 
ATOM   1214 C  CA    . ALA A 1 173 ? 16.401 12.563 16.022  1.00 22.57 ? 155  ALA A CA    1 
ATOM   1215 C  C     . ALA A 1 173 ? 16.874 11.140 15.891  1.00 22.40 ? 155  ALA A C     1 
ATOM   1216 O  O     . ALA A 1 173 ? 16.223 10.269 16.360  1.00 23.06 ? 155  ALA A O     1 
ATOM   1217 C  CB    . ALA A 1 173 ? 15.400 12.876 14.939  1.00 22.18 ? 155  ALA A CB    1 
ATOM   1218 N  N     A LEU A 1 174 ? 18.006 10.926 15.222  0.50 23.13 ? 156  LEU A N     1 
ATOM   1219 N  N     B LEU A 1 174 ? 18.010 10.938 15.221  0.50 23.23 ? 156  LEU A N     1 
ATOM   1220 C  CA    A LEU A 1 174 ? 18.468 9.563  14.948  0.50 23.97 ? 156  LEU A CA    1 
ATOM   1221 C  CA    B LEU A 1 174 ? 18.517 9.590  14.946  0.50 24.21 ? 156  LEU A CA    1 
ATOM   1222 C  C     A LEU A 1 174 ? 18.925 8.847  16.212  0.50 24.61 ? 156  LEU A C     1 
ATOM   1223 C  C     B LEU A 1 174 ? 18.908 8.868  16.222  0.50 24.72 ? 156  LEU A C     1 
ATOM   1224 O  O     A LEU A 1 174 ? 18.480 7.738  16.484  0.50 25.52 ? 156  LEU A O     1 
ATOM   1225 O  O     B LEU A 1 174 ? 18.419 7.781  16.506  0.50 25.61 ? 156  LEU A O     1 
ATOM   1226 C  CB    A LEU A 1 174 ? 19.564 9.592  13.907  0.50 23.47 ? 156  LEU A CB    1 
ATOM   1227 C  CB    B LEU A 1 174 ? 19.708 9.675  14.004  0.50 23.79 ? 156  LEU A CB    1 
ATOM   1228 C  CG    A LEU A 1 174 ? 20.032 8.218  13.414  0.50 22.72 ? 156  LEU A CG    1 
ATOM   1229 C  CG    B LEU A 1 174 ? 20.411 8.365  13.604  0.50 24.16 ? 156  LEU A CG    1 
ATOM   1230 C  CD1   A LEU A 1 174 ? 20.493 8.366  11.980  0.50 22.07 ? 156  LEU A CD1   1 
ATOM   1231 C  CD1   B LEU A 1 174 ? 21.060 7.647  14.784  0.50 23.07 ? 156  LEU A CD1   1 
ATOM   1232 C  CD2   A LEU A 1 174 ? 21.177 7.734  14.294  0.50 24.49 ? 156  LEU A CD2   1 
ATOM   1233 C  CD2   B LEU A 1 174 ? 19.476 7.520  12.923  0.50 25.24 ? 156  LEU A CD2   1 
ATOM   1234 N  N     . ASP A 1 175 ? 19.785 9.475  16.988  1.00 25.31 ? 157  ASP A N     1 
ATOM   1235 C  CA    . ASP A 1 175 ? 20.281 8.824  18.214  1.00 28.15 ? 157  ASP A CA    1 
ATOM   1236 C  C     . ASP A 1 175 ? 19.586 9.353  19.421  1.00 29.77 ? 157  ASP A C     1 
ATOM   1237 O  O     . ASP A 1 175 ? 20.001 9.110  20.550  1.00 29.93 ? 157  ASP A O     1 
ATOM   1238 C  CB    . ASP A 1 175 ? 21.813 8.914  18.317  1.00 29.06 ? 157  ASP A CB    1 
ATOM   1239 C  CG    . ASP A 1 175 ? 22.329 10.315 18.492  1.00 32.00 ? 157  ASP A CG    1 
ATOM   1240 O  OD1   . ASP A 1 175 ? 21.651 11.160 19.154  1.00 32.96 ? 157  ASP A OD1   1 
ATOM   1241 O  OD2   . ASP A 1 175 ? 23.451 10.656 18.017  1.00 31.47 ? 157  ASP A OD2   1 
ATOM   1242 N  N     . SER A 1 176 ? 18.529 10.132 19.162  1.00 29.57 ? 158  SER A N     1 
ATOM   1243 C  CA    . SER A 1 176 ? 17.644 10.649 20.194  1.00 30.51 ? 158  SER A CA    1 
ATOM   1244 C  C     . SER A 1 176 ? 18.182 11.812 21.068  1.00 28.39 ? 158  SER A C     1 
ATOM   1245 O  O     . SER A 1 176 ? 17.431 12.404 21.826  1.00 30.36 ? 158  SER A O     1 
ATOM   1246 C  CB    . SER A 1 176 ? 17.088 9.482  21.010  1.00 30.32 ? 158  SER A CB    1 
ATOM   1247 O  OG    . SER A 1 176 ? 16.020 9.999  21.742  1.00 39.09 ? 158  SER A OG    1 
ATOM   1248 N  N     . THR A 1 177 ? 19.426 12.238 20.894  1.00 28.96 ? 159  THR A N     1 
ATOM   1249 C  CA    . THR A 1 177 ? 20.000 13.326 21.690  1.00 28.27 ? 159  THR A CA    1 
ATOM   1250 C  C     . THR A 1 177 ? 19.175 14.630 21.697  1.00 27.74 ? 159  THR A C     1 
ATOM   1251 O  O     . THR A 1 177 ? 18.942 15.235 20.644  1.00 26.16 ? 159  THR A O     1 
ATOM   1252 C  CB    . THR A 1 177 ? 21.430 13.671 21.204  1.00 29.95 ? 159  THR A CB    1 
ATOM   1253 O  OG1   . THR A 1 177 ? 22.263 12.493 21.212  1.00 32.03 ? 159  THR A OG1   1 
ATOM   1254 C  CG2   . THR A 1 177 ? 22.131 14.600 22.161  1.00 30.69 ? 159  THR A CG2   1 
ATOM   1255 N  N     . ASN A 1 178 ? 18.822 15.076 22.901  1.00 25.12 ? 160  ASN A N     1 
ATOM   1256 C  CA    . ASN A 1 178 ? 18.218 16.385 23.155  1.00 24.87 ? 160  ASN A CA    1 
ATOM   1257 C  C     . ASN A 1 178 ? 16.827 16.548 22.567  1.00 24.66 ? 160  ASN A C     1 
ATOM   1258 O  O     . ASN A 1 178 ? 16.286 17.651 22.658  1.00 24.91 ? 160  ASN A O     1 
ATOM   1259 C  CB    . ASN A 1 178 ? 19.118 17.541 22.702  1.00 24.99 ? 160  ASN A CB    1 
ATOM   1260 C  CG    . ASN A 1 178 ? 20.196 17.880 23.708  1.00 27.95 ? 160  ASN A CG    1 
ATOM   1261 O  OD1   . ASN A 1 178 ? 20.124 17.457 24.859  1.00 32.14 ? 160  ASN A OD1   1 
ATOM   1262 N  ND2   . ASN A 1 178 ? 21.191 18.660 23.289  1.00 26.06 ? 160  ASN A ND2   1 
ATOM   1263 N  N     . VAL A 1 179 ? 16.232 15.490 22.036  1.00 24.97 ? 161  VAL A N     1 
ATOM   1264 C  CA    . VAL A 1 179 ? 14.916 15.656 21.374  1.00 25.40 ? 161  VAL A CA    1 
ATOM   1265 C  C     . VAL A 1 179 ? 13.892 15.949 22.468  1.00 26.74 ? 161  VAL A C     1 
ATOM   1266 O  O     . VAL A 1 179 ? 13.140 16.932 22.420  1.00 25.31 ? 161  VAL A O     1 
ATOM   1267 C  CB    . VAL A 1 179 ? 14.501 14.416 20.556  1.00 24.62 ? 161  VAL A CB    1 
ATOM   1268 C  CG1   . VAL A 1 179 ? 13.113 14.605 20.013  1.00 24.01 ? 161  VAL A CG1   1 
ATOM   1269 C  CG2   . VAL A 1 179 ? 15.501 14.156 19.436  1.00 24.11 ? 161  VAL A CG2   1 
ATOM   1270 N  N     . GLU A 1 180 ? 13.876 15.118 23.493  1.00 27.10 ? 162  GLU A N     1 
ATOM   1271 C  CA    . GLU A 1 180 ? 12.984 15.362 24.630  1.00 29.31 ? 162  GLU A CA    1 
ATOM   1272 C  C     . GLU A 1 180 ? 13.257 16.706 25.268  1.00 27.76 ? 162  GLU A C     1 
ATOM   1273 O  O     . GLU A 1 180 ? 12.329 17.402 25.620  1.00 28.98 ? 162  GLU A O     1 
ATOM   1274 C  CB    . GLU A 1 180 ? 13.117 14.254 25.691  1.00 29.87 ? 162  GLU A CB    1 
ATOM   1275 C  CG    . GLU A 1 180 ? 12.002 13.238 25.613  1.00 38.49 ? 162  GLU A CG    1 
ATOM   1276 C  CD    . GLU A 1 180 ? 10.715 13.795 26.190  1.00 49.18 ? 162  GLU A CD    1 
ATOM   1277 O  OE1   . GLU A 1 180 ? 10.679 15.001 26.610  1.00 58.26 ? 162  GLU A OE1   1 
ATOM   1278 O  OE2   . GLU A 1 180 ? 9.733  13.037 26.236  1.00 56.13 ? 162  GLU A OE2   1 
ATOM   1279 N  N     . ALA A 1 181 ? 14.520 17.078 25.392  1.00 27.74 ? 163  ALA A N     1 
ATOM   1280 C  CA    . ALA A 1 181 ? 14.903 18.334 26.029  1.00 26.64 ? 163  ALA A CA    1 
ATOM   1281 C  C     . ALA A 1 181 ? 14.382 19.525 25.217  1.00 25.91 ? 163  ALA A C     1 
ATOM   1282 O  O     . ALA A 1 181 ? 13.808 20.469 25.766  1.00 25.13 ? 163  ALA A O     1 
ATOM   1283 C  CB    . ALA A 1 181 ? 16.426 18.416 26.189  1.00 27.68 ? 163  ALA A CB    1 
ATOM   1284 N  N     . ALA A 1 182 ? 14.507 19.453 23.895  1.00 23.29 ? 164  ALA A N     1 
ATOM   1285 C  CA    . ALA A 1 182 ? 14.022 20.553 23.066  1.00 22.69 ? 164  ALA A CA    1 
ATOM   1286 C  C     . ALA A 1 182 ? 12.539 20.818 23.284  1.00 21.14 ? 164  ALA A C     1 
ATOM   1287 O  O     . ALA A 1 182 ? 12.165 21.972 23.472  1.00 20.21 ? 164  ALA A O     1 
ATOM   1288 C  CB    . ALA A 1 182 ? 14.291 20.308 21.577  1.00 22.09 ? 164  ALA A CB    1 
ATOM   1289 N  N     . PHE A 1 183 ? 11.727 19.781 23.296  1.00 21.65 ? 165  PHE A N     1 
ATOM   1290 C  CA    . PHE A 1 183 ? 10.275 19.946 23.404  1.00 21.89 ? 165  PHE A CA    1 
ATOM   1291 C  C     . PHE A 1 183 ? 9.884  20.329 24.815  1.00 22.97 ? 165  PHE A C     1 
ATOM   1292 O  O     . PHE A 1 183 ? 9.097  21.210 25.057  1.00 22.49 ? 165  PHE A O     1 
ATOM   1293 C  CB    . PHE A 1 183 ? 9.548  18.653 22.999  1.00 22.01 ? 165  PHE A CB    1 
ATOM   1294 C  CG    . PHE A 1 183 ? 9.448  18.467 21.509  1.00 20.34 ? 165  PHE A CG    1 
ATOM   1295 C  CD1   . PHE A 1 183 ? 10.450 17.795 20.832  1.00 23.60 ? 165  PHE A CD1   1 
ATOM   1296 C  CD2   . PHE A 1 183 ? 8.360  18.967 20.796  1.00 23.97 ? 165  PHE A CD2   1 
ATOM   1297 C  CE1   . PHE A 1 183 ? 10.370 17.613 19.476  1.00 23.28 ? 165  PHE A CE1   1 
ATOM   1298 C  CE2   . PHE A 1 183 ? 8.272  18.797 19.403  1.00 23.19 ? 165  PHE A CE2   1 
ATOM   1299 C  CZ    . PHE A 1 183 ? 9.253  18.117 18.754  1.00 22.21 ? 165  PHE A CZ    1 
ATOM   1300 N  N     . GLN A 1 184 ? 10.517 19.675 25.763  1.00 24.10 ? 166  GLN A N     1 
ATOM   1301 C  CA    . GLN A 1 184 ? 10.331 20.072 27.172  1.00 25.15 ? 166  GLN A CA    1 
ATOM   1302 C  C     . GLN A 1 184 ? 10.637 21.529 27.457  1.00 22.96 ? 166  GLN A C     1 
ATOM   1303 O  O     . GLN A 1 184 ? 9.857  22.217 28.151  1.00 23.09 ? 166  GLN A O     1 
ATOM   1304 C  CB    . GLN A 1 184 ? 11.207 19.178 28.028  1.00 27.02 ? 166  GLN A CB    1 
ATOM   1305 C  CG    . GLN A 1 184 ? 10.437 18.003 28.527  1.00 35.10 ? 166  GLN A CG    1 
ATOM   1306 C  CD    . GLN A 1 184 ? 10.061 18.179 29.974  1.00 43.50 ? 166  GLN A CD    1 
ATOM   1307 O  OE1   . GLN A 1 184 ? 9.435  17.303 30.554  1.00 51.33 ? 166  GLN A OE1   1 
ATOM   1308 N  NE2   . GLN A 1 184 ? 10.468 19.304 30.575  1.00 46.91 ? 166  GLN A NE2   1 
ATOM   1309 N  N     . THR A 1 185 ? 11.744 22.005 26.927  1.00 22.08 ? 167  THR A N     1 
ATOM   1310 C  CA    . THR A 1 185 ? 12.186 23.357 27.144  1.00 22.95 ? 167  THR A CA    1 
ATOM   1311 C  C     . THR A 1 185 ? 11.213 24.318 26.506  1.00 23.46 ? 167  THR A C     1 
ATOM   1312 O  O     . THR A 1 185 ? 10.790 25.284 27.125  1.00 22.83 ? 167  THR A O     1 
ATOM   1313 C  CB    . THR A 1 185 ? 13.577 23.586 26.623  1.00 22.23 ? 167  THR A CB    1 
ATOM   1314 O  OG1   . THR A 1 185 ? 14.494 22.762 27.379  1.00 25.59 ? 167  THR A OG1   1 
ATOM   1315 C  CG2   . THR A 1 185 ? 13.992 24.983 26.873  1.00 24.97 ? 167  THR A CG2   1 
ATOM   1316 N  N     . ILE A 1 186 ? 10.837 24.071 25.238  1.00 22.28 ? 168  ILE A N     1 
ATOM   1317 C  CA    . ILE A 1 186 ? 9.943  25.037 24.647  1.00 21.18 ? 168  ILE A CA    1 
ATOM   1318 C  C     . ILE A 1 186 ? 8.610  25.085 25.368  1.00 19.79 ? 168  ILE A C     1 
ATOM   1319 O  O     . ILE A 1 186 ? 8.033  26.164 25.542  1.00 21.12 ? 168  ILE A O     1 
ATOM   1320 C  CB    . ILE A 1 186 ? 9.757  24.828 23.085  1.00 20.25 ? 168  ILE A CB    1 
ATOM   1321 C  CG1   . ILE A 1 186 ? 9.351  26.171 22.483  1.00 20.77 ? 168  ILE A CG1   1 
ATOM   1322 C  CG2   . ILE A 1 186 ? 8.794  23.747 22.808  1.00 19.40 ? 168  ILE A CG2   1 
ATOM   1323 C  CD1   . ILE A 1 186 ? 9.155  26.125 20.918  1.00 19.85 ? 168  ILE A CD1   1 
ATOM   1324 N  N     . LEU A 1 187 ? 8.101  23.934 25.782  1.00 20.62 ? 169  LEU A N     1 
ATOM   1325 C  CA    . LEU A 1 187 ? 6.782  23.881 26.397  1.00 20.98 ? 169  LEU A CA    1 
ATOM   1326 C  C     . LEU A 1 187 ? 6.839  24.531 27.779  1.00 23.11 ? 169  LEU A C     1 
ATOM   1327 O  O     . LEU A 1 187 ? 5.895  25.176 28.217  1.00 23.19 ? 169  LEU A O     1 
ATOM   1328 C  CB    . LEU A 1 187 ? 6.289  22.427 26.489  1.00 20.93 ? 169  LEU A CB    1 
ATOM   1329 C  CG    . LEU A 1 187 ? 6.001  21.763 25.112  1.00 19.74 ? 169  LEU A CG    1 
ATOM   1330 C  CD1   . LEU A 1 187 ? 5.906  20.316 25.234  1.00 19.38 ? 169  LEU A CD1   1 
ATOM   1331 C  CD2   . LEU A 1 187 ? 4.736  22.312 24.530  1.00 21.48 ? 169  LEU A CD2   1 
ATOM   1332 N  N     . THR A 1 188 ? 7.985  24.413 28.429  1.00 23.81 ? 170  THR A N     1 
ATOM   1333 C  CA    . THR A 1 188 ? 8.156  25.077 29.722  1.00 24.69 ? 170  THR A CA    1 
ATOM   1334 C  C     . THR A 1 188 ? 8.315  26.579 29.585  1.00 24.98 ? 170  THR A C     1 
ATOM   1335 O  O     . THR A 1 188 ? 7.803  27.340 30.406  1.00 23.60 ? 170  THR A O     1 
ATOM   1336 C  CB    . THR A 1 188 ? 9.385  24.488 30.419  1.00 25.20 ? 170  THR A CB    1 
ATOM   1337 O  OG1   . THR A 1 188 ? 9.150  23.108 30.617  1.00 24.44 ? 170  THR A OG1   1 
ATOM   1338 C  CG2   . THR A 1 188 ? 9.545  25.074 31.847  1.00 27.96 ? 170  THR A CG2   1 
ATOM   1339 N  N     . GLU A 1 189 ? 9.038  27.025 28.559  1.00 24.47 ? 171  GLU A N     1 
ATOM   1340 C  CA    . GLU A 1 189 ? 9.162  28.439 28.254  1.00 25.45 ? 171  GLU A CA    1 
ATOM   1341 C  C     . GLU A 1 189 ? 7.780  29.006 28.013  1.00 25.94 ? 171  GLU A C     1 
ATOM   1342 O  O     . GLU A 1 189 ? 7.441  30.080 28.530  1.00 24.73 ? 171  GLU A O     1 
ATOM   1343 C  CB    . GLU A 1 189 ? 10.063 28.686 27.035  1.00 25.95 ? 171  GLU A CB    1 
ATOM   1344 C  CG    . GLU A 1 189 ? 11.533 28.441 27.285  1.00 26.79 ? 171  GLU A CG    1 
ATOM   1345 C  CD    . GLU A 1 189 ? 12.398 28.451 26.043  1.00 32.93 ? 171  GLU A CD    1 
ATOM   1346 O  OE1   . GLU A 1 189 ? 13.603 28.754 26.180  1.00 38.54 ? 171  GLU A OE1   1 
ATOM   1347 O  OE2   . GLU A 1 189 ? 11.909 28.121 24.957  1.00 35.08 ? 171  GLU A OE2   1 
ATOM   1348 N  N     . ILE A 1 190 ? 6.968  28.287 27.231  1.00 25.17 ? 172  ILE A N     1 
ATOM   1349 C  CA    . ILE A 1 190 ? 5.615  28.738 26.922  1.00 26.31 ? 172  ILE A CA    1 
ATOM   1350 C  C     . ILE A 1 190 ? 4.721  28.838 28.192  1.00 27.55 ? 172  ILE A C     1 
ATOM   1351 O  O     . ILE A 1 190 ? 3.966  29.798 28.363  1.00 26.24 ? 172  ILE A O     1 
ATOM   1352 C  CB    . ILE A 1 190 ? 4.964  27.755 25.891  1.00 26.32 ? 172  ILE A CB    1 
ATOM   1353 C  CG1   . ILE A 1 190 ? 5.694  27.860 24.530  1.00 23.98 ? 172  ILE A CG1   1 
ATOM   1354 C  CG2   . ILE A 1 190 ? 3.476  28.047 25.773  1.00 25.84 ? 172  ILE A CG2   1 
ATOM   1355 C  CD1   . ILE A 1 190 ? 5.247  26.816 23.574  1.00 22.83 ? 172  ILE A CD1   1 
ATOM   1356 N  N     . TYR A 1 191 ? 4.843  27.837 29.064  1.00 29.38 ? 173  TYR A N     1 
ATOM   1357 C  CA    . TYR A 1 191 ? 4.026  27.708 30.278  1.00 31.19 ? 173  TYR A CA    1 
ATOM   1358 C  C     . TYR A 1 191 ? 4.035  29.006 31.070  1.00 31.36 ? 173  TYR A C     1 
ATOM   1359 O  O     . TYR A 1 191 ? 2.952  29.618 31.184  1.00 24.31 ? 173  TYR A O     1 
ATOM   1360 C  CB    . TYR A 1 191 ? 4.588  26.621 31.154  1.00 31.93 ? 173  TYR A CB    1 
ATOM   1361 C  CG    . TYR A 1 191 ? 3.870  26.457 32.486  1.00 36.54 ? 173  TYR A CG    1 
ATOM   1362 C  CD1   . TYR A 1 191 ? 2.654  25.806 32.549  1.00 39.88 ? 173  TYR A CD1   1 
ATOM   1363 C  CD2   . TYR A 1 191 ? 4.437  26.935 33.677  1.00 40.13 ? 173  TYR A CD2   1 
ATOM   1364 C  CE1   . TYR A 1 191 ? 1.989  25.625 33.746  1.00 42.73 ? 173  TYR A CE1   1 
ATOM   1365 C  CE2   . TYR A 1 191 ? 3.779  26.766 34.892  1.00 42.61 ? 173  TYR A CE2   1 
ATOM   1366 C  CZ    . TYR A 1 191 ? 2.545  26.100 34.916  1.00 44.26 ? 173  TYR A CZ    1 
ATOM   1367 O  OH    . TYR A 1 191 ? 1.844  25.907 36.093  1.00 43.15 ? 173  TYR A OH    1 
ATOM   1368 O  OXT   . TYR A 1 191 ? 5.104  29.407 31.569  1.00 24.31 ? 173  TYR A OXT   1 
HETATM 1369 P  PB    . GDP B 2 .   ? 11.948 16.741 6.912   1.00 12.58 ? 201  GDP A PB    1 
HETATM 1370 O  O1B   . GDP B 2 .   ? 12.532 18.018 7.497   1.00 11.16 ? 201  GDP A O1B   1 
HETATM 1371 O  O2B   . GDP B 2 .   ? 12.171 16.637 5.387   1.00 14.21 ? 201  GDP A O2B   1 
HETATM 1372 O  O3B   . GDP B 2 .   ? 10.590 16.404 7.429   1.00 13.11 ? 201  GDP A O3B   1 
HETATM 1373 O  O3A   . GDP B 2 .   ? 13.019 15.660 7.525   1.00 14.46 ? 201  GDP A O3A   1 
HETATM 1374 P  PA    . GDP B 2 .   ? 12.780 14.080 7.674   1.00 14.84 ? 201  GDP A PA    1 
HETATM 1375 O  O1A   . GDP B 2 .   ? 11.901 13.543 6.640   1.00 15.06 ? 201  GDP A O1A   1 
HETATM 1376 O  O2A   . GDP B 2 .   ? 12.441 13.741 9.096   1.00 15.71 ? 201  GDP A O2A   1 
HETATM 1377 O  "O5'" . GDP B 2 .   ? 14.331 13.539 7.515   1.00 11.54 ? 201  GDP A "O5'" 1 
HETATM 1378 C  "C5'" . GDP B 2 .   ? 14.989 13.774 6.266   1.00 12.82 ? 201  GDP A "C5'" 1 
HETATM 1379 C  "C4'" . GDP B 2 .   ? 16.143 12.749 6.260   1.00 14.57 ? 201  GDP A "C4'" 1 
HETATM 1380 O  "O4'" . GDP B 2 .   ? 17.098 13.051 7.241   1.00 16.48 ? 201  GDP A "O4'" 1 
HETATM 1381 C  "C3'" . GDP B 2 .   ? 15.699 11.320 6.497   1.00 18.26 ? 201  GDP A "C3'" 1 
HETATM 1382 O  "O3'" . GDP B 2 .   ? 16.528 10.430 5.653   1.00 15.82 ? 201  GDP A "O3'" 1 
HETATM 1383 C  "C2'" . GDP B 2 .   ? 15.989 11.123 7.952   1.00 18.16 ? 201  GDP A "C2'" 1 
HETATM 1384 O  "O2'" . GDP B 2 .   ? 16.164 9.777  8.355   1.00 22.65 ? 201  GDP A "O2'" 1 
HETATM 1385 C  "C1'" . GDP B 2 .   ? 17.227 11.978 8.174   1.00 17.25 ? 201  GDP A "C1'" 1 
HETATM 1386 N  N9    . GDP B 2 .   ? 17.318 12.452 9.550   1.00 17.30 ? 201  GDP A N9    1 
HETATM 1387 C  C8    . GDP B 2 .   ? 16.321 13.092 10.304  1.00 14.48 ? 201  GDP A C8    1 
HETATM 1388 N  N7    . GDP B 2 .   ? 16.798 13.391 11.487  1.00 14.59 ? 201  GDP A N7    1 
HETATM 1389 C  C5    . GDP B 2 .   ? 18.149 12.978 11.498  1.00 18.42 ? 201  GDP A C5    1 
HETATM 1390 C  C6    . GDP B 2 .   ? 19.140 13.040 12.465  1.00 17.53 ? 201  GDP A C6    1 
HETATM 1391 O  O6    . GDP B 2 .   ? 19.009 13.518 13.579  1.00 20.25 ? 201  GDP A O6    1 
HETATM 1392 N  N1    . GDP B 2 .   ? 20.399 12.508 12.130  1.00 19.39 ? 201  GDP A N1    1 
HETATM 1393 C  C2    . GDP B 2 .   ? 20.640 11.965 10.897  1.00 18.12 ? 201  GDP A C2    1 
HETATM 1394 N  N2    . GDP B 2 .   ? 21.873 11.475 10.581  1.00 18.07 ? 201  GDP A N2    1 
HETATM 1395 N  N3    . GDP B 2 .   ? 19.682 11.908 9.929   1.00 16.80 ? 201  GDP A N3    1 
HETATM 1396 C  C4    . GDP B 2 .   ? 18.442 12.419 10.267  1.00 17.77 ? 201  GDP A C4    1 
HETATM 1397 P  P     . PO4 C 3 .   ? 9.506  17.877 3.893   1.00 14.33 ? 202  PO4 A P     1 
HETATM 1398 O  O1    . PO4 C 3 .   ? 8.765  17.102 4.839   1.00 12.01 ? 202  PO4 A O1    1 
HETATM 1399 O  O2    . PO4 C 3 .   ? 8.708  18.018 2.605   1.00 12.68 ? 202  PO4 A O2    1 
HETATM 1400 O  O3    . PO4 C 3 .   ? 9.945  19.201 4.408   1.00 13.35 ? 202  PO4 A O3    1 
HETATM 1401 O  O4    . PO4 C 3 .   ? 10.782 17.127 3.435   1.00 13.55 ? 202  PO4 A O4    1 
HETATM 1402 MG MG    . MG  D 4 .   ? 8.721  16.139 6.655   1.00 14.05 ? 301  MG  A MG    1 
HETATM 1403 CL CL    . CL  E 5 .   ? 5.069  22.993 -3.278  1.00 14.69 ? 401  CL  A CL    1 
HETATM 1404 O  O     . HOH F 6 .   ? -5.861 24.853 26.775  1.00 36.20 ? 2001 HOH A O     1 
HETATM 1405 O  O     . HOH F 6 .   ? -2.257 27.977 24.018  1.00 34.93 ? 2002 HOH A O     1 
HETATM 1406 O  O     . HOH F 6 .   ? -4.996 25.346 14.924  1.00 29.89 ? 2003 HOH A O     1 
HETATM 1407 O  O     . HOH F 6 .   ? 19.771 22.136 1.436   1.00 17.33 ? 2004 HOH A O     1 
HETATM 1408 O  O     . HOH F 6 .   ? 11.673 29.321 3.052   1.00 39.76 ? 2005 HOH A O     1 
HETATM 1409 O  O     . HOH F 6 .   ? 17.432 23.780 1.382   1.00 17.94 ? 2006 HOH A O     1 
HETATM 1410 O  O     . HOH F 6 .   ? 13.665 27.792 2.506   1.00 23.70 ? 2007 HOH A O     1 
HETATM 1411 O  O     . HOH F 6 .   ? 18.309 19.583 3.295   1.00 32.45 ? 2008 HOH A O     1 
HETATM 1412 O  O     . HOH F 6 .   ? 13.756 21.951 -1.320  1.00 42.99 ? 2009 HOH A O     1 
HETATM 1413 O  O     . HOH F 6 .   ? 12.929 23.255 1.155   1.00 16.15 ? 2010 HOH A O     1 
HETATM 1414 O  O     . HOH F 6 .   ? 15.934 21.582 1.259   1.00 30.24 ? 2011 HOH A O     1 
HETATM 1415 O  O     . HOH F 6 .   ? 14.810 16.711 1.154   1.00 37.12 ? 2012 HOH A O     1 
HETATM 1416 O  O     . HOH F 6 .   ? 3.152  16.102 -1.577  1.00 23.10 ? 2013 HOH A O     1 
HETATM 1417 O  O     . HOH F 6 .   ? 6.749  18.755 -1.083  1.00 24.79 ? 2014 HOH A O     1 
HETATM 1418 O  O     . HOH F 6 .   ? 14.100 36.627 3.755   1.00 37.54 ? 2015 HOH A O     1 
HETATM 1419 O  O     . HOH F 6 .   ? 3.311  19.964 0.381   1.00 25.06 ? 2016 HOH A O     1 
HETATM 1420 O  O     . HOH F 6 .   ? -6.372 20.445 5.063   1.00 18.51 ? 2017 HOH A O     1 
HETATM 1421 O  O     . HOH F 6 .   ? -3.481 16.457 4.329   1.00 40.59 ? 2018 HOH A O     1 
HETATM 1422 O  O     . HOH F 6 .   ? -2.514 21.268 3.247   1.00 18.36 ? 2019 HOH A O     1 
HETATM 1423 O  O     . HOH F 6 .   ? 6.566  12.191 11.388  1.00 20.39 ? 2020 HOH A O     1 
HETATM 1424 O  O     . HOH F 6 .   ? 10.389 10.302 22.781  1.00 39.99 ? 2021 HOH A O     1 
HETATM 1425 O  O     . HOH F 6 .   ? 15.193 3.860  17.521  1.00 34.73 ? 2022 HOH A O     1 
HETATM 1426 O  O     . HOH F 6 .   ? 4.185  32.479 -1.751  1.00 36.36 ? 2023 HOH A O     1 
HETATM 1427 O  O     . HOH F 6 .   ? 8.595  29.762 -6.832  1.00 42.42 ? 2024 HOH A O     1 
HETATM 1428 O  O     . HOH F 6 .   ? 8.622  27.301 -10.166 1.00 33.20 ? 2025 HOH A O     1 
HETATM 1429 O  O     . HOH F 6 .   ? -1.910 32.924 2.327   1.00 27.19 ? 2026 HOH A O     1 
HETATM 1430 O  O     . HOH F 6 .   ? 13.145 3.683  15.857  1.00 37.81 ? 2027 HOH A O     1 
HETATM 1431 O  O     . HOH F 6 .   ? 14.289 2.607  11.169  1.00 26.35 ? 2028 HOH A O     1 
HETATM 1432 O  O     . HOH F 6 .   ? 11.551 3.256  14.370  1.00 42.19 ? 2029 HOH A O     1 
HETATM 1433 O  O     . HOH F 6 .   ? 9.729  9.047  11.121  1.00 25.80 ? 2030 HOH A O     1 
HETATM 1434 O  O     . HOH F 6 .   ? 11.201 2.642  12.400  1.00 42.49 ? 2031 HOH A O     1 
HETATM 1435 O  O     . HOH F 6 .   ? 9.412  7.543  7.291   1.00 28.78 ? 2032 HOH A O     1 
HETATM 1436 O  O     . HOH F 6 .   ? 17.832 8.018  2.882   1.00 35.82 ? 2033 HOH A O     1 
HETATM 1437 O  O     . HOH F 6 .   ? 11.566 9.325  7.154   1.00 21.40 ? 2034 HOH A O     1 
HETATM 1438 O  O     . HOH F 6 .   ? 11.101 1.237  4.938   1.00 50.12 ? 2035 HOH A O     1 
HETATM 1439 O  O     . HOH F 6 .   ? 12.692 2.951  8.224   1.00 33.28 ? 2036 HOH A O     1 
HETATM 1440 O  O     . HOH F 6 .   ? 26.079 13.656 1.861   1.00 46.51 ? 2037 HOH A O     1 
HETATM 1441 O  O     . HOH F 6 .   ? 12.934 12.940 0.034   0.50 27.25 ? 2038 HOH A O     1 
HETATM 1442 O  O     . HOH F 6 .   ? 12.326 14.350 3.667   1.00 26.89 ? 2039 HOH A O     1 
HETATM 1443 O  O     . HOH F 6 .   ? 16.315 14.396 2.646   1.00 34.01 ? 2040 HOH A O     1 
HETATM 1444 O  O     . HOH F 6 .   ? 22.395 22.396 -0.002  0.50 21.99 ? 2041 HOH A O     1 
HETATM 1445 O  O     . HOH F 6 .   ? 25.503 25.522 -0.025  0.50 39.71 ? 2042 HOH A O     1 
HETATM 1446 O  O     . HOH F 6 .   ? 8.068  11.360 6.295   1.00 27.49 ? 2043 HOH A O     1 
HETATM 1447 O  O     . HOH F 6 .   ? 5.651  11.979 0.091   1.00 34.74 ? 2044 HOH A O     1 
HETATM 1448 O  O     . HOH F 6 .   ? 5.453  16.550 -0.105  1.00 19.69 ? 2045 HOH A O     1 
HETATM 1449 O  O     . HOH F 6 .   ? 12.090 35.665 2.462   1.00 44.60 ? 2046 HOH A O     1 
HETATM 1450 O  O     . HOH F 6 .   ? 5.791  13.163 7.091   1.00 17.59 ? 2047 HOH A O     1 
HETATM 1451 O  O     . HOH F 6 .   ? 8.425  36.484 15.301  1.00 21.94 ? 2048 HOH A O     1 
HETATM 1452 O  O     . HOH F 6 .   ? 6.758  39.834 15.020  1.00 42.86 ? 2049 HOH A O     1 
HETATM 1453 O  O     . HOH F 6 .   ? 1.344  17.693 0.005   1.00 20.16 ? 2050 HOH A O     1 
HETATM 1454 O  O     . HOH F 6 .   ? 3.158  19.236 3.008   1.00 14.69 ? 2051 HOH A O     1 
HETATM 1455 O  O     . HOH F 6 .   ? -3.248 14.950 8.808   1.00 19.40 ? 2052 HOH A O     1 
HETATM 1456 O  O     . HOH F 6 .   ? -3.698 19.159 4.558   1.00 34.82 ? 2053 HOH A O     1 
HETATM 1457 O  O     . HOH F 6 .   ? 3.391  12.599 5.457   1.00 21.66 ? 2054 HOH A O     1 
HETATM 1458 O  O     . HOH F 6 .   ? -0.166 13.796 5.753   1.00 33.54 ? 2055 HOH A O     1 
HETATM 1459 O  O     . HOH F 6 .   ? -0.499 12.292 11.836  1.00 46.32 ? 2056 HOH A O     1 
HETATM 1460 O  O     . HOH F 6 .   ? -2.917 13.768 13.704  1.00 33.95 ? 2057 HOH A O     1 
HETATM 1461 O  O     . HOH F 6 .   ? -0.919 11.840 17.998  1.00 40.33 ? 2058 HOH A O     1 
HETATM 1462 O  O     . HOH F 6 .   ? 19.617 12.229 3.195   1.00 36.15 ? 2059 HOH A O     1 
HETATM 1463 O  O     . HOH F 6 .   ? 0.926  11.490 25.898  1.00 30.00 ? 2060 HOH A O     1 
HETATM 1464 O  O     . HOH F 6 .   ? -1.169 13.446 24.470  1.00 38.18 ? 2061 HOH A O     1 
HETATM 1465 O  O     . HOH F 6 .   ? 1.277  13.433 31.322  1.00 39.68 ? 2062 HOH A O     1 
HETATM 1466 O  O     . HOH F 6 .   ? 3.718  25.586 41.579  1.00 25.49 ? 2063 HOH A O     1 
HETATM 1467 O  O     . HOH F 6 .   ? 7.670  19.715 36.154  1.00 49.12 ? 2064 HOH A O     1 
HETATM 1468 O  O     . HOH F 6 .   ? -3.902 14.870 33.994  1.00 47.40 ? 2065 HOH A O     1 
HETATM 1469 O  O     . HOH F 6 .   ? -4.964 16.861 19.466  1.00 19.70 ? 2066 HOH A O     1 
HETATM 1470 O  O     . HOH F 6 .   ? -5.410 23.059 17.127  0.50 31.91 ? 2067 HOH A O     1 
HETATM 1471 O  O     . HOH F 6 .   ? 7.007  21.009 9.235   1.00 29.81 ? 2068 HOH A O     1 
HETATM 1472 O  O     . HOH F 6 .   ? 7.946  17.998 7.448   1.00 10.18 ? 2069 HOH A O     1 
HETATM 1473 O  O     . HOH F 6 .   ? 5.151  13.917 9.775   1.00 19.98 ? 2070 HOH A O     1 
HETATM 1474 O  O     . HOH F 6 .   ? 9.965  27.419 2.384   1.00 22.67 ? 2071 HOH A O     1 
HETATM 1475 O  O     . HOH F 6 .   ? 5.606  21.327 -0.773  1.00 15.40 ? 2072 HOH A O     1 
HETATM 1476 O  O     . HOH F 6 .   ? 4.412  31.051 3.800   1.00 10.32 ? 2073 HOH A O     1 
HETATM 1477 O  O     . HOH F 6 .   ? 5.959  31.361 0.849   1.00 37.61 ? 2074 HOH A O     1 
HETATM 1478 O  O     . HOH F 6 .   ? 6.028  30.456 -1.728  1.00 28.14 ? 2075 HOH A O     1 
HETATM 1479 O  O     . HOH F 6 .   ? 13.496 22.354 -5.139  1.00 31.50 ? 2076 HOH A O     1 
HETATM 1480 O  O     . HOH F 6 .   ? 10.679 27.764 -4.809  1.00 28.67 ? 2077 HOH A O     1 
HETATM 1481 O  O     . HOH F 6 .   ? 6.416  30.019 -5.257  1.00 21.19 ? 2078 HOH A O     1 
HETATM 1482 O  O     . HOH F 6 .   ? 9.337  22.014 -8.731  1.00 24.00 ? 2079 HOH A O     1 
HETATM 1483 O  O     . HOH F 6 .   ? 6.735  24.681 -12.593 1.00 29.67 ? 2080 HOH A O     1 
HETATM 1484 O  O     . HOH F 6 .   ? 7.521  24.534 -12.046 0.50 37.09 ? 2081 HOH A O     1 
HETATM 1485 O  O     . HOH F 6 .   ? -1.258 21.223 0.664   1.00 21.21 ? 2082 HOH A O     1 
HETATM 1486 O  O     . HOH F 6 .   ? 20.312 8.540  6.408   1.00 27.42 ? 2083 HOH A O     1 
HETATM 1487 O  O     . HOH F 6 .   ? 0.953  31.987 2.171   1.00 23.61 ? 2084 HOH A O     1 
HETATM 1488 O  O     . HOH F 6 .   ? -1.459 32.997 12.550  1.00 16.02 ? 2085 HOH A O     1 
HETATM 1489 O  O     . HOH F 6 .   ? -2.221 33.592 5.112   1.00 13.90 ? 2086 HOH A O     1 
HETATM 1490 O  O     . HOH F 6 .   ? -4.708 31.891 6.449   1.00 16.68 ? 2087 HOH A O     1 
HETATM 1491 O  O     . HOH F 6 .   ? -5.875 27.187 11.999  1.00 16.26 ? 2088 HOH A O     1 
HETATM 1492 O  O     . HOH F 6 .   ? 1.164  31.901 16.169  1.00 13.01 ? 2089 HOH A O     1 
HETATM 1493 O  O     . HOH F 6 .   ? -5.781 33.325 8.359   1.00 21.65 ? 2090 HOH A O     1 
HETATM 1494 O  O     . HOH F 6 .   ? -2.870 31.109 21.298  1.00 31.69 ? 2091 HOH A O     1 
HETATM 1495 O  O     . HOH F 6 .   ? -1.779 26.999 21.552  1.00 23.23 ? 2092 HOH A O     1 
HETATM 1496 O  O     . HOH F 6 .   ? 24.943 24.501 14.312  1.00 22.35 ? 2093 HOH A O     1 
HETATM 1497 O  O     . HOH F 6 .   ? 19.199 18.392 5.111   1.00 35.52 ? 2094 HOH A O     1 
HETATM 1498 O  O     . HOH F 6 .   ? 22.692 16.223 5.696   1.00 28.07 ? 2095 HOH A O     1 
HETATM 1499 O  O     . HOH F 6 .   ? 28.344 20.533 3.453   1.00 42.55 ? 2096 HOH A O     1 
HETATM 1500 O  O     . HOH F 6 .   ? 25.224 16.687 0.547   1.00 31.86 ? 2097 HOH A O     1 
HETATM 1501 O  O     . HOH F 6 .   ? 26.782 22.674 3.197   1.00 18.65 ? 2098 HOH A O     1 
HETATM 1502 O  O     . HOH F 6 .   ? 24.261 23.462 2.159   1.00 23.06 ? 2099 HOH A O     1 
HETATM 1503 O  O     . HOH F 6 .   ? 15.955 25.170 7.499   1.00 14.13 ? 2100 HOH A O     1 
HETATM 1504 O  O     . HOH F 6 .   ? 21.004 31.757 9.804   1.00 26.44 ? 2101 HOH A O     1 
HETATM 1505 O  O     . HOH F 6 .   ? 19.720 33.098 8.058   1.00 27.25 ? 2102 HOH A O     1 
HETATM 1506 O  O     . HOH F 6 .   ? 24.122 32.079 6.923   1.00 35.31 ? 2103 HOH A O     1 
HETATM 1507 O  O     . HOH F 6 .   ? 17.367 27.913 -1.225  1.00 32.05 ? 2104 HOH A O     1 
HETATM 1508 O  O     . HOH F 6 .   ? 14.190 37.485 8.651   1.00 32.11 ? 2105 HOH A O     1 
HETATM 1509 O  O     . HOH F 6 .   ? 15.241 38.570 10.868  1.00 42.45 ? 2106 HOH A O     1 
HETATM 1510 O  O     . HOH F 6 .   ? 9.648  34.062 4.159   1.00 29.36 ? 2107 HOH A O     1 
HETATM 1511 O  O     . HOH F 6 .   ? 10.504 35.944 13.525  1.00 29.28 ? 2108 HOH A O     1 
HETATM 1512 O  O     . HOH F 6 .   ? 8.299  31.979 3.137   1.00 40.86 ? 2109 HOH A O     1 
HETATM 1513 O  O     . HOH F 6 .   ? 5.982  35.961 14.756  1.00 21.52 ? 2110 HOH A O     1 
HETATM 1514 O  O     . HOH F 6 .   ? 4.795  38.586 14.254  1.00 39.10 ? 2111 HOH A O     1 
HETATM 1515 O  O     . HOH F 6 .   ? 13.989 39.765 6.269   1.00 40.28 ? 2112 HOH A O     1 
HETATM 1516 O  O     . HOH F 6 .   ? 9.180  41.147 7.698   1.00 37.36 ? 2113 HOH A O     1 
HETATM 1517 O  O     . HOH F 6 .   ? 2.295  38.167 12.319  1.00 21.60 ? 2114 HOH A O     1 
HETATM 1518 O  O     . HOH F 6 .   ? 12.093 38.106 13.051  1.00 37.55 ? 2115 HOH A O     1 
HETATM 1519 O  O     . HOH F 6 .   ? 0.010  37.021 11.116  0.50 27.92 ? 2116 HOH A O     1 
HETATM 1520 O  O     . HOH F 6 .   ? 6.505  34.954 4.312   1.00 34.56 ? 2117 HOH A O     1 
HETATM 1521 O  O     . HOH F 6 .   ? 2.243  34.546 2.312   1.00 37.54 ? 2118 HOH A O     1 
HETATM 1522 O  O     . HOH F 6 .   ? 1.947  37.766 4.803   1.00 27.95 ? 2119 HOH A O     1 
HETATM 1523 O  O     . HOH F 6 .   ? 0.007  37.038 6.423   0.50 28.45 ? 2120 HOH A O     1 
HETATM 1524 O  O     . HOH F 6 .   ? 4.974  33.317 3.017   1.00 32.28 ? 2121 HOH A O     1 
HETATM 1525 O  O     . HOH F 6 .   ? -1.790 33.068 15.430  1.00 27.61 ? 2122 HOH A O     1 
HETATM 1526 O  O     . HOH F 6 .   ? -0.353 35.747 13.756  1.00 31.70 ? 2123 HOH A O     1 
HETATM 1527 O  O     . HOH F 6 .   ? -1.228 36.568 20.172  1.00 39.57 ? 2124 HOH A O     1 
HETATM 1528 O  O     . HOH F 6 .   ? 0.126  32.517 20.039  1.00 30.42 ? 2125 HOH A O     1 
HETATM 1529 O  O     . HOH F 6 .   ? 8.503  35.825 18.266  1.00 27.07 ? 2126 HOH A O     1 
HETATM 1530 O  O     . HOH F 6 .   ? 18.496 14.761 4.229   1.00 32.99 ? 2127 HOH A O     1 
HETATM 1531 O  O     . HOH F 6 .   ? 22.497 17.082 20.193  1.00 36.09 ? 2128 HOH A O     1 
HETATM 1532 O  O     . HOH F 6 .   ? 25.481 9.525  12.869  1.00 30.75 ? 2129 HOH A O     1 
HETATM 1533 O  O     . HOH F 6 .   ? 28.421 9.899  12.907  1.00 43.16 ? 2130 HOH A O     1 
HETATM 1534 O  O     . HOH F 6 .   ? 33.335 18.842 12.045  1.00 39.04 ? 2131 HOH A O     1 
HETATM 1535 O  O     . HOH F 6 .   ? 28.545 9.747  8.203   1.00 30.15 ? 2132 HOH A O     1 
HETATM 1536 O  O     . HOH F 6 .   ? 33.136 17.228 7.837   1.00 46.32 ? 2133 HOH A O     1 
HETATM 1537 O  O     . HOH F 6 .   ? 28.826 18.379 18.740  1.00 42.53 ? 2134 HOH A O     1 
HETATM 1538 O  O     . HOH F 6 .   ? 32.948 19.604 9.166   1.00 44.38 ? 2135 HOH A O     1 
HETATM 1539 O  O     . HOH F 6 .   ? 31.493 24.015 10.617  1.00 39.59 ? 2136 HOH A O     1 
HETATM 1540 O  O     . HOH F 6 .   ? 31.034 23.820 16.040  1.00 29.42 ? 2137 HOH A O     1 
HETATM 1541 O  O     . HOH F 6 .   ? 31.377 26.004 17.615  1.00 31.87 ? 2138 HOH A O     1 
HETATM 1542 O  O     . HOH F 6 .   ? 25.227 33.160 11.441  1.00 28.42 ? 2139 HOH A O     1 
HETATM 1543 O  O     . HOH F 6 .   ? 26.310 34.107 14.503  1.00 41.95 ? 2140 HOH A O     1 
HETATM 1544 O  O     . HOH F 6 .   ? 29.304 29.069 8.752   1.00 39.35 ? 2141 HOH A O     1 
HETATM 1545 O  O     . HOH F 6 .   ? 21.948 31.170 22.317  1.00 40.56 ? 2142 HOH A O     1 
HETATM 1546 O  O     . HOH F 6 .   ? 23.852 32.820 23.852  1.00 35.43 ? 2143 HOH A O     1 
HETATM 1547 O  O     . HOH F 6 .   ? 17.206 40.737 15.322  1.00 40.83 ? 2144 HOH A O     1 
HETATM 1548 O  O     . HOH F 6 .   ? 14.942 38.769 13.106  1.00 38.06 ? 2145 HOH A O     1 
HETATM 1549 O  O     . HOH F 6 .   ? 21.797 25.069 23.777  1.00 43.09 ? 2146 HOH A O     1 
HETATM 1550 O  O     . HOH F 6 .   ? 18.924 28.778 24.330  1.00 32.93 ? 2147 HOH A O     1 
HETATM 1551 O  O     . HOH F 6 .   ? 22.792 22.092 22.339  1.00 28.28 ? 2148 HOH A O     1 
HETATM 1552 O  O     . HOH F 6 .   ? 25.737 19.039 19.801  1.00 38.79 ? 2149 HOH A O     1 
HETATM 1553 O  O     . HOH F 6 .   ? 19.387 13.567 25.384  1.00 33.27 ? 2150 HOH A O     1 
HETATM 1554 O  O     . HOH F 6 .   ? 15.292 12.633 23.801  1.00 32.05 ? 2151 HOH A O     1 
HETATM 1555 O  O     . HOH F 6 .   ? 16.361 14.958 25.715  1.00 27.73 ? 2152 HOH A O     1 
HETATM 1556 O  O     . HOH F 6 .   ? 9.637  21.316 32.786  1.00 36.19 ? 2153 HOH A O     1 
HETATM 1557 O  O     . HOH F 6 .   ? 15.740 28.574 27.333  1.00 41.90 ? 2154 HOH A O     1 
HETATM 1558 O  O     . HOH F 6 .   ? 5.201  32.740 26.598  1.00 34.99 ? 2155 HOH A O     1 
HETATM 1559 O  O     . HOH F 6 .   ? 7.334  29.608 31.239  0.50 17.67 ? 2156 HOH A O     1 
HETATM 1560 O  O     . HOH F 6 .   ? 5.038  31.385 33.342  1.00 30.61 ? 2157 HOH A O     1 
HETATM 1561 O  O     . HOH F 6 .   ? 20.313 12.673 7.288   1.00 18.27 ? 2158 HOH A O     1 
HETATM 1562 O  O     . HOH F 6 .   ? 19.353 10.944 5.230   1.00 21.72 ? 2159 HOH A O     1 
HETATM 1563 O  O     . HOH F 6 .   ? 11.039 11.202 5.759   1.00 31.43 ? 2160 HOH A O     1 
HETATM 1564 O  O     . HOH F 6 .   ? 9.429  14.296 5.917   1.00 13.60 ? 2161 HOH A O     1 
HETATM 1565 O  O     . HOH F 6 .   ? 9.264  19.621 0.681   1.00 18.48 ? 2162 HOH A O     1 
HETATM 1566 O  O     . HOH F 6 .   ? 11.934 16.006 1.040   1.00 35.66 ? 2163 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -18 ?   ?   ?   A . n 
A 1 2   ARG 2   -17 ?   ?   ?   A . n 
A 1 3   GLY 3   -16 ?   ?   ?   A . n 
A 1 4   SER 4   -15 ?   ?   ?   A . n 
A 1 5   HIS 5   -14 ?   ?   ?   A . n 
A 1 6   HIS 6   -13 ?   ?   ?   A . n 
A 1 7   HIS 7   -12 ?   ?   ?   A . n 
A 1 8   HIS 8   -11 ?   ?   ?   A . n 
A 1 9   HIS 9   -10 ?   ?   ?   A . n 
A 1 10  HIS 10  -9  ?   ?   ?   A . n 
A 1 11  GLY 11  -8  ?   ?   ?   A . n 
A 1 12  ILE 12  -7  ?   ?   ?   A . n 
A 1 13  PRO 13  -6  ?   ?   ?   A . n 
A 1 14  LEU 14  -5  ?   ?   ?   A . n 
A 1 15  PRO 15  -4  ?   ?   ?   A . n 
A 1 16  GLY 16  -3  ?   ?   ?   A . n 
A 1 17  ARG 17  -2  ?   ?   ?   A . n 
A 1 18  ALA 18  -1  ?   ?   ?   A . n 
A 1 19  MET 19  1   ?   ?   ?   A . n 
A 1 20  GLY 20  2   ?   ?   ?   A . n 
A 1 21  THR 21  3   ?   ?   ?   A . n 
A 1 22  ARG 22  4   ?   ?   ?   A . n 
A 1 23  ASP 23  5   ?   ?   ?   A . n 
A 1 24  ASP 24  6   6   ASP ASP A . n 
A 1 25  GLU 25  7   7   GLU GLU A . n 
A 1 26  TYR 26  8   8   TYR TYR A . n 
A 1 27  ASP 27  9   9   ASP ASP A . n 
A 1 28  TYR 28  10  10  TYR TYR A . n 
A 1 29  LEU 29  11  11  LEU LEU A . n 
A 1 30  PHE 30  12  12  PHE PHE A . n 
A 1 31  LYS 31  13  13  LYS LYS A . n 
A 1 32  VAL 32  14  14  VAL VAL A . n 
A 1 33  VAL 33  15  15  VAL VAL A . n 
A 1 34  LEU 34  16  16  LEU LEU A . n 
A 1 35  ILE 35  17  17  ILE ILE A . n 
A 1 36  GLY 36  18  18  GLY GLY A . n 
A 1 37  ASP 37  19  19  ASP ASP A . n 
A 1 38  SER 38  20  20  SER SER A . n 
A 1 39  GLY 39  21  21  GLY GLY A . n 
A 1 40  VAL 40  22  22  VAL VAL A . n 
A 1 41  GLY 41  23  23  GLY GLY A . n 
A 1 42  LYS 42  24  24  LYS LYS A . n 
A 1 43  SER 43  25  25  SER SER A . n 
A 1 44  ASN 44  26  26  ASN ASN A . n 
A 1 45  LEU 45  27  27  LEU LEU A . n 
A 1 46  LEU 46  28  28  LEU LEU A . n 
A 1 47  SER 47  29  29  SER SER A . n 
A 1 48  ARG 48  30  30  ARG ARG A . n 
A 1 49  PHE 49  31  31  PHE PHE A . n 
A 1 50  THR 50  32  32  THR THR A . n 
A 1 51  ARG 51  33  33  ARG ARG A . n 
A 1 52  ASN 52  34  34  ASN ASN A . n 
A 1 53  GLU 53  35  35  GLU GLU A . n 
A 1 54  PHE 54  36  36  PHE PHE A . n 
A 1 55  ASN 55  37  37  ASN ASN A . n 
A 1 56  LEU 56  38  38  LEU LEU A . n 
A 1 57  GLU 57  39  39  GLU GLU A . n 
A 1 58  SER 58  40  40  SER SER A . n 
A 1 59  LYS 59  41  41  LYS LYS A . n 
A 1 60  SER 60  42  42  SER SER A . n 
A 1 61  THR 61  43  43  THR THR A . n 
A 1 62  ILE 62  44  44  ILE ILE A . n 
A 1 63  GLY 63  45  45  GLY GLY A . n 
A 1 64  VAL 64  46  46  VAL VAL A . n 
A 1 65  GLU 65  47  47  GLU GLU A . n 
A 1 66  PHE 66  48  48  PHE PHE A . n 
A 1 67  ALA 67  49  49  ALA ALA A . n 
A 1 68  THR 68  50  50  THR THR A . n 
A 1 69  ARG 69  51  51  ARG ARG A . n 
A 1 70  SER 70  52  52  SER SER A . n 
A 1 71  ILE 71  53  53  ILE ILE A . n 
A 1 72  GLN 72  54  54  GLN GLN A . n 
A 1 73  VAL 73  55  55  VAL VAL A . n 
A 1 74  ASP 74  56  56  ASP ASP A . n 
A 1 75  GLY 75  57  57  GLY GLY A . n 
A 1 76  LYS 76  58  58  LYS LYS A . n 
A 1 77  THR 77  59  59  THR THR A . n 
A 1 78  ILE 78  60  60  ILE ILE A . n 
A 1 79  LYS 79  61  61  LYS LYS A . n 
A 1 80  ALA 80  62  62  ALA ALA A . n 
A 1 81  GLN 81  63  63  GLN GLN A . n 
A 1 82  ILE 82  64  64  ILE ILE A . n 
A 1 83  TRP 83  65  65  TRP TRP A . n 
A 1 84  ASP 84  66  66  ASP ASP A . n 
A 1 85  THR 85  67  67  THR THR A . n 
A 1 86  ALA 86  68  68  ALA ALA A . n 
A 1 87  GLY 87  69  69  GLY GLY A . n 
A 1 88  LEU 88  70  70  LEU LEU A . n 
A 1 89  GLU 89  71  71  GLU GLU A . n 
A 1 90  ARG 90  72  72  ARG ARG A . n 
A 1 91  TYR 91  73  73  TYR TYR A . n 
A 1 92  ARG 92  74  74  ARG ARG A . n 
A 1 93  ALA 93  75  75  ALA ALA A . n 
A 1 94  ILE 94  76  76  ILE ILE A . n 
A 1 95  THR 95  77  77  THR THR A . n 
A 1 96  SER 96  78  78  SER SER A . n 
A 1 97  ALA 97  79  79  ALA ALA A . n 
A 1 98  TYR 98  80  80  TYR TYR A . n 
A 1 99  TYR 99  81  81  TYR TYR A . n 
A 1 100 ARG 100 82  82  ARG ARG A . n 
A 1 101 GLY 101 83  83  GLY GLY A . n 
A 1 102 ALA 102 84  84  ALA ALA A . n 
A 1 103 VAL 103 85  85  VAL VAL A . n 
A 1 104 GLY 104 86  86  GLY GLY A . n 
A 1 105 ALA 105 87  87  ALA ALA A . n 
A 1 106 LEU 106 88  88  LEU LEU A . n 
A 1 107 LEU 107 89  89  LEU LEU A . n 
A 1 108 VAL 108 90  90  VAL VAL A . n 
A 1 109 TYR 109 91  91  TYR TYR A . n 
A 1 110 ASP 110 92  92  ASP ASP A . n 
A 1 111 ILE 111 93  93  ILE ILE A . n 
A 1 112 ALA 112 94  94  ALA ALA A . n 
A 1 113 LYS 113 95  95  LYS LYS A . n 
A 1 114 HIS 114 96  96  HIS HIS A . n 
A 1 115 LEU 115 97  97  LEU LEU A . n 
A 1 116 THR 116 98  98  THR THR A . n 
A 1 117 TYR 117 99  99  TYR TYR A . n 
A 1 118 GLU 118 100 100 GLU GLU A . n 
A 1 119 ASN 119 101 101 ASN ASN A . n 
A 1 120 VAL 120 102 102 VAL VAL A . n 
A 1 121 GLU 121 103 103 GLU GLU A . n 
A 1 122 ARG 122 104 104 ARG ARG A . n 
A 1 123 TRP 123 105 105 TRP TRP A . n 
A 1 124 LEU 124 106 106 LEU LEU A . n 
A 1 125 LYS 125 107 107 LYS LYS A . n 
A 1 126 GLU 126 108 108 GLU GLU A . n 
A 1 127 LEU 127 109 109 LEU LEU A . n 
A 1 128 ARG 128 110 110 ARG ARG A . n 
A 1 129 ASP 129 111 111 ASP ASP A . n 
A 1 130 HIS 130 112 112 HIS HIS A . n 
A 1 131 ALA 131 113 113 ALA ALA A . n 
A 1 132 ASP 132 114 114 ASP ASP A . n 
A 1 133 SER 133 115 115 SER SER A . n 
A 1 134 ASN 134 116 116 ASN ASN A . n 
A 1 135 ILE 135 117 117 ILE ILE A . n 
A 1 136 VAL 136 118 118 VAL VAL A . n 
A 1 137 ILE 137 119 119 ILE ILE A . n 
A 1 138 MET 138 120 120 MET MET A . n 
A 1 139 LEU 139 121 121 LEU LEU A . n 
A 1 140 VAL 140 122 122 VAL VAL A . n 
A 1 141 GLY 141 123 123 GLY GLY A . n 
A 1 142 ASN 142 124 124 ASN ASN A . n 
A 1 143 LYS 143 125 125 LYS LYS A . n 
A 1 144 SER 144 126 126 SER SER A . n 
A 1 145 ASP 145 127 127 ASP ASP A . n 
A 1 146 LEU 146 128 128 LEU LEU A . n 
A 1 147 ARG 147 129 129 ARG ARG A . n 
A 1 148 HIS 148 130 130 HIS HIS A . n 
A 1 149 LEU 149 131 131 LEU LEU A . n 
A 1 150 ARG 150 132 132 ARG ARG A . n 
A 1 151 ALA 151 133 133 ALA ALA A . n 
A 1 152 VAL 152 134 134 VAL VAL A . n 
A 1 153 PRO 153 135 135 PRO PRO A . n 
A 1 154 THR 154 136 136 THR THR A . n 
A 1 155 ASP 155 137 137 ASP ASP A . n 
A 1 156 GLU 156 138 138 GLU GLU A . n 
A 1 157 ALA 157 139 139 ALA ALA A . n 
A 1 158 ARG 158 140 140 ARG ARG A . n 
A 1 159 ALA 159 141 141 ALA ALA A . n 
A 1 160 PHE 160 142 142 PHE PHE A . n 
A 1 161 ALA 161 143 143 ALA ALA A . n 
A 1 162 GLU 162 144 144 GLU GLU A . n 
A 1 163 LYS 163 145 145 LYS LYS A . n 
A 1 164 ASN 164 146 146 ASN ASN A . n 
A 1 165 GLY 165 147 147 GLY GLY A . n 
A 1 166 LEU 166 148 148 LEU LEU A . n 
A 1 167 SER 167 149 149 SER SER A . n 
A 1 168 PHE 168 150 150 PHE PHE A . n 
A 1 169 ILE 169 151 151 ILE ILE A . n 
A 1 170 GLU 170 152 152 GLU GLU A . n 
A 1 171 THR 171 153 153 THR THR A . n 
A 1 172 SER 172 154 154 SER SER A . n 
A 1 173 ALA 173 155 155 ALA ALA A . n 
A 1 174 LEU 174 156 156 LEU LEU A . n 
A 1 175 ASP 175 157 157 ASP ASP A . n 
A 1 176 SER 176 158 158 SER SER A . n 
A 1 177 THR 177 159 159 THR THR A . n 
A 1 178 ASN 178 160 160 ASN ASN A . n 
A 1 179 VAL 179 161 161 VAL VAL A . n 
A 1 180 GLU 180 162 162 GLU GLU A . n 
A 1 181 ALA 181 163 163 ALA ALA A . n 
A 1 182 ALA 182 164 164 ALA ALA A . n 
A 1 183 PHE 183 165 165 PHE PHE A . n 
A 1 184 GLN 184 166 166 GLN GLN A . n 
A 1 185 THR 185 167 167 THR THR A . n 
A 1 186 ILE 186 168 168 ILE ILE A . n 
A 1 187 LEU 187 169 169 LEU LEU A . n 
A 1 188 THR 188 170 170 THR THR A . n 
A 1 189 GLU 189 171 171 GLU GLU A . n 
A 1 190 ILE 190 172 172 ILE ILE A . n 
A 1 191 TYR 191 173 173 TYR TYR A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 GDP 1   201  201  GDP GDP A . 
C 3 PO4 1   202  202  PO4 PO4 A . 
D 4 MG  1   301  301  MG  MG  A . 
E 5 CL  1   401  401  CL  CL  A . 
F 6 HOH 1   2001 2001 HOH HOH A . 
F 6 HOH 2   2002 2002 HOH HOH A . 
F 6 HOH 3   2003 2003 HOH HOH A . 
F 6 HOH 4   2004 2004 HOH HOH A . 
F 6 HOH 5   2005 2005 HOH HOH A . 
F 6 HOH 6   2006 2006 HOH HOH A . 
F 6 HOH 7   2007 2007 HOH HOH A . 
F 6 HOH 8   2008 2008 HOH HOH A . 
F 6 HOH 9   2009 2009 HOH HOH A . 
F 6 HOH 10  2010 2010 HOH HOH A . 
F 6 HOH 11  2011 2011 HOH HOH A . 
F 6 HOH 12  2012 2012 HOH HOH A . 
F 6 HOH 13  2013 2013 HOH HOH A . 
F 6 HOH 14  2014 2014 HOH HOH A . 
F 6 HOH 15  2015 2015 HOH HOH A . 
F 6 HOH 16  2016 2016 HOH HOH A . 
F 6 HOH 17  2017 2017 HOH HOH A . 
F 6 HOH 18  2018 2018 HOH HOH A . 
F 6 HOH 19  2019 2019 HOH HOH A . 
F 6 HOH 20  2020 2020 HOH HOH A . 
F 6 HOH 21  2021 2021 HOH HOH A . 
F 6 HOH 22  2022 2022 HOH HOH A . 
F 6 HOH 23  2023 2023 HOH HOH A . 
F 6 HOH 24  2024 2024 HOH HOH A . 
F 6 HOH 25  2025 2025 HOH HOH A . 
F 6 HOH 26  2026 2026 HOH HOH A . 
F 6 HOH 27  2027 2027 HOH HOH A . 
F 6 HOH 28  2028 2028 HOH HOH A . 
F 6 HOH 29  2029 2029 HOH HOH A . 
F 6 HOH 30  2030 2030 HOH HOH A . 
F 6 HOH 31  2031 2031 HOH HOH A . 
F 6 HOH 32  2032 2032 HOH HOH A . 
F 6 HOH 33  2033 2033 HOH HOH A . 
F 6 HOH 34  2034 2034 HOH HOH A . 
F 6 HOH 35  2035 2035 HOH HOH A . 
F 6 HOH 36  2036 2036 HOH HOH A . 
F 6 HOH 37  2037 2037 HOH HOH A . 
F 6 HOH 38  2038 2038 HOH HOH A . 
F 6 HOH 39  2039 2039 HOH HOH A . 
F 6 HOH 40  2040 2040 HOH HOH A . 
F 6 HOH 41  2041 2041 HOH HOH A . 
F 6 HOH 42  2042 2042 HOH HOH A . 
F 6 HOH 43  2043 2043 HOH HOH A . 
F 6 HOH 44  2044 2044 HOH HOH A . 
F 6 HOH 45  2045 2045 HOH HOH A . 
F 6 HOH 46  2046 2046 HOH HOH A . 
F 6 HOH 47  2047 2047 HOH HOH A . 
F 6 HOH 48  2048 2048 HOH HOH A . 
F 6 HOH 49  2049 2049 HOH HOH A . 
F 6 HOH 50  2050 2050 HOH HOH A . 
F 6 HOH 51  2051 2051 HOH HOH A . 
F 6 HOH 52  2052 2052 HOH HOH A . 
F 6 HOH 53  2053 2053 HOH HOH A . 
F 6 HOH 54  2054 2054 HOH HOH A . 
F 6 HOH 55  2055 2055 HOH HOH A . 
F 6 HOH 56  2056 2056 HOH HOH A . 
F 6 HOH 57  2057 2057 HOH HOH A . 
F 6 HOH 58  2058 2058 HOH HOH A . 
F 6 HOH 59  2059 2059 HOH HOH A . 
F 6 HOH 60  2060 2060 HOH HOH A . 
F 6 HOH 61  2061 2061 HOH HOH A . 
F 6 HOH 62  2062 2062 HOH HOH A . 
F 6 HOH 63  2063 2063 HOH HOH A . 
F 6 HOH 64  2064 2064 HOH HOH A . 
F 6 HOH 65  2065 2065 HOH HOH A . 
F 6 HOH 66  2066 2066 HOH HOH A . 
F 6 HOH 67  2067 2067 HOH HOH A . 
F 6 HOH 68  2068 2068 HOH HOH A . 
F 6 HOH 69  2069 2069 HOH HOH A . 
F 6 HOH 70  2070 2070 HOH HOH A . 
F 6 HOH 71  2071 2071 HOH HOH A . 
F 6 HOH 72  2072 2072 HOH HOH A . 
F 6 HOH 73  2073 2073 HOH HOH A . 
F 6 HOH 74  2074 2074 HOH HOH A . 
F 6 HOH 75  2075 2075 HOH HOH A . 
F 6 HOH 76  2076 2076 HOH HOH A . 
F 6 HOH 77  2077 2077 HOH HOH A . 
F 6 HOH 78  2078 2078 HOH HOH A . 
F 6 HOH 79  2079 2079 HOH HOH A . 
F 6 HOH 80  2080 2080 HOH HOH A . 
F 6 HOH 81  2081 2081 HOH HOH A . 
F 6 HOH 82  2082 2082 HOH HOH A . 
F 6 HOH 83  2083 2083 HOH HOH A . 
F 6 HOH 84  2084 2084 HOH HOH A . 
F 6 HOH 85  2085 2085 HOH HOH A . 
F 6 HOH 86  2086 2086 HOH HOH A . 
F 6 HOH 87  2087 2087 HOH HOH A . 
F 6 HOH 88  2088 2088 HOH HOH A . 
F 6 HOH 89  2089 2089 HOH HOH A . 
F 6 HOH 90  2090 2090 HOH HOH A . 
F 6 HOH 91  2091 2091 HOH HOH A . 
F 6 HOH 92  2092 2092 HOH HOH A . 
F 6 HOH 93  2093 2093 HOH HOH A . 
F 6 HOH 94  2094 2094 HOH HOH A . 
F 6 HOH 95  2095 2095 HOH HOH A . 
F 6 HOH 96  2096 2096 HOH HOH A . 
F 6 HOH 97  2097 2097 HOH HOH A . 
F 6 HOH 98  2098 2098 HOH HOH A . 
F 6 HOH 99  2099 2099 HOH HOH A . 
F 6 HOH 100 2100 2100 HOH HOH A . 
F 6 HOH 101 2101 2101 HOH HOH A . 
F 6 HOH 102 2102 2102 HOH HOH A . 
F 6 HOH 103 2103 2103 HOH HOH A . 
F 6 HOH 104 2104 2104 HOH HOH A . 
F 6 HOH 105 2105 2105 HOH HOH A . 
F 6 HOH 106 2106 2106 HOH HOH A . 
F 6 HOH 107 2107 2107 HOH HOH A . 
F 6 HOH 108 2108 2108 HOH HOH A . 
F 6 HOH 109 2109 2109 HOH HOH A . 
F 6 HOH 110 2110 2110 HOH HOH A . 
F 6 HOH 111 2111 2111 HOH HOH A . 
F 6 HOH 112 2112 2112 HOH HOH A . 
F 6 HOH 113 2113 2113 HOH HOH A . 
F 6 HOH 114 2114 2114 HOH HOH A . 
F 6 HOH 115 2115 2115 HOH HOH A . 
F 6 HOH 116 2116 2116 HOH HOH A . 
F 6 HOH 117 2117 2117 HOH HOH A . 
F 6 HOH 118 2118 2118 HOH HOH A . 
F 6 HOH 119 2119 2119 HOH HOH A . 
F 6 HOH 120 2120 2120 HOH HOH A . 
F 6 HOH 121 2121 2121 HOH HOH A . 
F 6 HOH 122 2122 2122 HOH HOH A . 
F 6 HOH 123 2123 2123 HOH HOH A . 
F 6 HOH 124 2124 2124 HOH HOH A . 
F 6 HOH 125 2125 2125 HOH HOH A . 
F 6 HOH 126 2126 2126 HOH HOH A . 
F 6 HOH 127 2127 2127 HOH HOH A . 
F 6 HOH 128 2128 2128 HOH HOH A . 
F 6 HOH 129 2129 2129 HOH HOH A . 
F 6 HOH 130 2130 2130 HOH HOH A . 
F 6 HOH 131 2131 2131 HOH HOH A . 
F 6 HOH 132 2132 2132 HOH HOH A . 
F 6 HOH 133 2133 2133 HOH HOH A . 
F 6 HOH 134 2134 2134 HOH HOH A . 
F 6 HOH 135 2135 2135 HOH HOH A . 
F 6 HOH 136 2136 2136 HOH HOH A . 
F 6 HOH 137 2137 2137 HOH HOH A . 
F 6 HOH 138 2138 2138 HOH HOH A . 
F 6 HOH 139 2139 2139 HOH HOH A . 
F 6 HOH 140 2140 2140 HOH HOH A . 
F 6 HOH 141 2141 2141 HOH HOH A . 
F 6 HOH 142 2142 2142 HOH HOH A . 
F 6 HOH 143 2143 2143 HOH HOH A . 
F 6 HOH 144 2144 2144 HOH HOH A . 
F 6 HOH 145 2145 2145 HOH HOH A . 
F 6 HOH 146 2146 2146 HOH HOH A . 
F 6 HOH 147 2147 2147 HOH HOH A . 
F 6 HOH 148 2148 2148 HOH HOH A . 
F 6 HOH 149 2149 2149 HOH HOH A . 
F 6 HOH 150 2150 2150 HOH HOH A . 
F 6 HOH 151 2151 2151 HOH HOH A . 
F 6 HOH 152 2152 2152 HOH HOH A . 
F 6 HOH 153 2153 2153 HOH HOH A . 
F 6 HOH 154 2154 2154 HOH HOH A . 
F 6 HOH 155 2155 2155 HOH HOH A . 
F 6 HOH 156 2156 2156 HOH HOH A . 
F 6 HOH 157 2157 2157 HOH HOH A . 
F 6 HOH 158 2158 2158 HOH HOH A . 
F 6 HOH 159 2159 2159 HOH HOH A . 
F 6 HOH 160 2160 2160 HOH HOH A . 
F 6 HOH 161 2161 2161 HOH HOH A . 
F 6 HOH 162 2162 2162 HOH HOH A . 
F 6 HOH 163 2163 2163 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 2038 ? F HOH . 
2 1 A HOH 2041 ? F HOH . 
3 1 A HOH 2042 ? F HOH . 
4 1 A HOH 2116 ? F HOH . 
5 1 A HOH 2120 ? F HOH . 
6 1 A HOH 2156 ? F HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O3B ? B GDP .  ? A GDP 201  ? 1_555 MG ? D MG . ? A MG 301 ? 1_555 O1  ? C PO4 .  ? A PO4 202  ? 1_555 104.8 ? 
2  O3B ? B GDP .  ? A GDP 201  ? 1_555 MG ? D MG . ? A MG 301 ? 1_555 O   ? F HOH .  ? A HOH 2069 ? 1_555 94.4  ? 
3  O1  ? C PO4 .  ? A PO4 202  ? 1_555 MG ? D MG . ? A MG 301 ? 1_555 O   ? F HOH .  ? A HOH 2069 ? 1_555 85.9  ? 
4  O3B ? B GDP .  ? A GDP 201  ? 1_555 MG ? D MG . ? A MG 301 ? 1_555 O   ? F HOH .  ? A HOH 2161 ? 1_555 86.5  ? 
5  O1  ? C PO4 .  ? A PO4 202  ? 1_555 MG ? D MG . ? A MG 301 ? 1_555 O   ? F HOH .  ? A HOH 2161 ? 1_555 95.3  ? 
6  O   ? F HOH .  ? A HOH 2069 ? 1_555 MG ? D MG . ? A MG 301 ? 1_555 O   ? F HOH .  ? A HOH 2161 ? 1_555 178.2 ? 
7  O3B ? B GDP .  ? A GDP 201  ? 1_555 MG ? D MG . ? A MG 301 ? 1_555 OG  ? A SER 43 ? A SER 25   ? 1_555 90.8  ? 
8  O1  ? C PO4 .  ? A PO4 202  ? 1_555 MG ? D MG . ? A MG 301 ? 1_555 OG  ? A SER 43 ? A SER 25   ? 1_555 163.9 ? 
9  O   ? F HOH .  ? A HOH 2069 ? 1_555 MG ? D MG . ? A MG 301 ? 1_555 OG  ? A SER 43 ? A SER 25   ? 1_555 88.7  ? 
10 O   ? F HOH .  ? A HOH 2161 ? 1_555 MG ? D MG . ? A MG 301 ? 1_555 OG  ? A SER 43 ? A SER 25   ? 1_555 89.7  ? 
11 O3B ? B GDP .  ? A GDP 201  ? 1_555 MG ? D MG . ? A MG 301 ? 1_555 OG1 ? A THR 61 ? A THR 43   ? 1_555 166.1 ? 
12 O1  ? C PO4 .  ? A PO4 202  ? 1_555 MG ? D MG . ? A MG 301 ? 1_555 OG1 ? A THR 61 ? A THR 43   ? 1_555 89.1  ? 
13 O   ? F HOH .  ? A HOH 2069 ? 1_555 MG ? D MG . ? A MG 301 ? 1_555 OG1 ? A THR 61 ? A THR 43   ? 1_555 87.5  ? 
14 O   ? F HOH .  ? A HOH 2161 ? 1_555 MG ? D MG . ? A MG 301 ? 1_555 OG1 ? A THR 61 ? A THR 43   ? 1_555 91.3  ? 
15 OG  ? A SER 43 ? A SER 25   ? 1_555 MG ? D MG . ? A MG 301 ? 1_555 OG1 ? A THR 61 ? A THR 43   ? 1_555 75.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-01-25 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
AMoRE     phasing          .   ? 4 
# 
_pdbx_entry_details.entry_id             1OIX 
_pdbx_entry_details.compound_details     'ENGINEERED MUTATION GLN 70 LEU IN CHAIN A' 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;RESIDUES OF THE N-TERMINAL HIS6-TAG AND LINKER WERE
 DISORDERED AND NOT VISIBLE IN THE ELECTRON DENSITY MAP, AS
 WELL AS THE FIRST 5 RESIDUES OF RAB11A. ASP6 AND GLU7 WERE
 MODELLED AS ALANINES BECAUSE SIDE CHAINS WERE NOT VISIBLE.
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NH1 A ARG 82   ? ? O A HOH 2090 ? ? 1.97 
2 1 O   A HOH 2029 ? ? O A HOH 2031 ? ? 2.09 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 2064 ? ? 1_555 O A HOH 2154 ? ? 16_555 2.05 
2 1 O A HOH 2024 ? ? 1_555 O A HOH 2132 ? ? 7_555  2.17 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              82 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              82 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              82 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                124.22 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            3.92 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 7   ? ? 63.32 107.23 
2 1 LYS A 125 ? ? 74.47 35.60  
3 1 SER A 158 ? ? 74.63 -3.40  
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2017 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.04 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ASP 6 ? CG  ? A ASP 24 CG  
2 1 Y 1 A ASP 6 ? OD1 ? A ASP 24 OD1 
3 1 Y 1 A ASP 6 ? OD2 ? A ASP 24 OD2 
4 1 Y 1 A GLU 7 ? CG  ? A GLU 25 CG  
5 1 Y 1 A GLU 7 ? CD  ? A GLU 25 CD  
6 1 Y 1 A GLU 7 ? OE1 ? A GLU 25 OE1 
7 1 Y 1 A GLU 7 ? OE2 ? A GLU 25 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -18 ? A MET 1  
2  1 Y 1 A ARG -17 ? A ARG 2  
3  1 Y 1 A GLY -16 ? A GLY 3  
4  1 Y 1 A SER -15 ? A SER 4  
5  1 Y 1 A HIS -14 ? A HIS 5  
6  1 Y 1 A HIS -13 ? A HIS 6  
7  1 Y 1 A HIS -12 ? A HIS 7  
8  1 Y 1 A HIS -11 ? A HIS 8  
9  1 Y 1 A HIS -10 ? A HIS 9  
10 1 Y 1 A HIS -9  ? A HIS 10 
11 1 Y 1 A GLY -8  ? A GLY 11 
12 1 Y 1 A ILE -7  ? A ILE 12 
13 1 Y 1 A PRO -6  ? A PRO 13 
14 1 Y 1 A LEU -5  ? A LEU 14 
15 1 Y 1 A PRO -4  ? A PRO 15 
16 1 Y 1 A GLY -3  ? A GLY 16 
17 1 Y 1 A ARG -2  ? A ARG 17 
18 1 Y 1 A ALA -1  ? A ALA 18 
19 1 Y 1 A MET 1   ? A MET 19 
20 1 Y 1 A GLY 2   ? A GLY 20 
21 1 Y 1 A THR 3   ? A THR 21 
22 1 Y 1 A ARG 4   ? A ARG 22 
23 1 Y 1 A ASP 5   ? A ASP 23 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "GUANOSINE-5'-DIPHOSPHATE" GDP 
3 'PHOSPHATE ION'            PO4 
4 'MAGNESIUM ION'            MG  
5 'CHLORIDE ION'             CL  
6 water                      HOH 
#