data_1OSL
# 
_entry.id   1OSL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1OSL         
RCSB  RCSB018627   
WWPDB D_1000018627 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1L1M 
_pdbx_database_related.details        'The same protein complexed to a nonspecific DNA operator' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1OSL 
_pdbx_database_status.recvd_initial_deposition_date   2003-03-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kalodimos, C.G.'  1 
'Bonvin, A.M.J.J.' 2 
'Boelens, R.'      3 
'Kaptein, R.'      4 
# 
_citation.id                        primary 
_citation.title                     'Structure and flexibility adaptation in nonspecific and specific protein-DNA complexes.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            305 
_citation.page_first                386 
_citation.page_last                 389 
_citation.year                      2004 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15256668 
_citation.pdbx_database_id_DOI      10.1126/science.1097064 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kalodimos, C.G.'  1 
primary 'Biris, N.'        2 
primary 'Bonvin, A.M.'     3 
primary 'Levandoski, M.M.' 4 
primary 'Guennuegues, M.'  5 
primary 'Boelens, R.'      6 
primary 'Kaptein, R.'      7 
# 
_cell.entry_id           1OSL 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1OSL 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn "5'-D(*CP*GP*AP*TP*AP*AP*GP*AP*TP*AP*TP*CP*TP*TP*AP*TP*CP*G)-3'" 5514.603 2 ? ?    ? ? 
2 polymer man 'Lactose operon repressor'                                       6822.755 2 ? V52C 
'N-terminal DNA-binding domain, residues 1-62' ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DC)(DG)(DA)(DT)(DA)(DA)(DG)(DA)(DT)(DA)(DT)(DC)(DT)(DT)(DA)(DT)(DC)(DG)' CGATAAGATATCTTATCG C,D 
? 
2 'polypeptide(L)'        no no MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRCAQQLAGKQSL             
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRCAQQLAGKQSL A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  DC  n 
1 2  DG  n 
1 3  DA  n 
1 4  DT  n 
1 5  DA  n 
1 6  DA  n 
1 7  DG  n 
1 8  DA  n 
1 9  DT  n 
1 10 DA  n 
1 11 DT  n 
1 12 DC  n 
1 13 DT  n 
1 14 DT  n 
1 15 DA  n 
1 16 DT  n 
1 17 DC  n 
1 18 DG  n 
2 1  MET n 
2 2  LYS n 
2 3  PRO n 
2 4  VAL n 
2 5  THR n 
2 6  LEU n 
2 7  TYR n 
2 8  ASP n 
2 9  VAL n 
2 10 ALA n 
2 11 GLU n 
2 12 TYR n 
2 13 ALA n 
2 14 GLY n 
2 15 VAL n 
2 16 SER n 
2 17 TYR n 
2 18 GLN n 
2 19 THR n 
2 20 VAL n 
2 21 SER n 
2 22 ARG n 
2 23 VAL n 
2 24 VAL n 
2 25 ASN n 
2 26 GLN n 
2 27 ALA n 
2 28 SER n 
2 29 HIS n 
2 30 VAL n 
2 31 SER n 
2 32 ALA n 
2 33 LYS n 
2 34 THR n 
2 35 ARG n 
2 36 GLU n 
2 37 LYS n 
2 38 VAL n 
2 39 GLU n 
2 40 ALA n 
2 41 ALA n 
2 42 MET n 
2 43 ALA n 
2 44 GLU n 
2 45 LEU n 
2 46 ASN n 
2 47 TYR n 
2 48 ILE n 
2 49 PRO n 
2 50 ASN n 
2 51 ARG n 
2 52 CYS n 
2 53 ALA n 
2 54 GLN n 
2 55 GLN n 
2 56 LEU n 
2 57 ALA n 
2 58 GLY n 
2 59 LYS n 
2 60 GLN n 
2 61 SER n 
2 62 LEU n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 LACI 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               DH9 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET-HP62-V52C 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP LACI_ECOLI 2 MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSL 1 P03023 ? 
2 PDB 1OSL       1 ?                                                              ? 1OSL   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1OSL A 1 ? 62 ? P03023 1 ? 62 ? 1 62 
2 1 1OSL B 1 ? 62 ? P03023 1 ? 62 ? 1 62 
3 2 1OSL C 1 ? 18 ? 1OSL   1 ? 18 ? 1 18 
4 2 1OSL D 1 ? 18 ? 1OSL   1 ? 18 ? 1 18 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1OSL CYS A 52 ? UNP P03023 VAL 52 ENGINEERED 52 1 
2 1OSL CYS B 52 ? UNP P03023 VAL 52 ENGINEERED 52 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_15N-separated_NOESY             
2 1 1 3D_13C-separated_NOESY             
3 1 1 '13C-15N double-half noesy filter' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         300 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  5.8 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '400mM KCl, 60mM KPi' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '2mM LAC-HP62-V52C U-15N,13C, 60mM KPI, 400mM KCL' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             DRX 
_pdbx_nmr_spectrometer.field_strength    750 
# 
_pdbx_nmr_refine.entry_id           1OSL 
_pdbx_nmr_refine.method             
;THE STRUCTURE OF THE COMPLEX WAS CALCULATED AS FOLLOWS. FIRST THE STRUCTURE OF THE DIMERIC LACHP62-V52C WAS CALCULATED USING ONLY PROTEIN NMR RESTRAINTS. THE 100 BEST STRUCTURES WERE SELECTED AND DOCKED ONTO THE NONSPECIFIC LAC OPERATOR B-DNA USING SIMULATED ANNEALING. DISTANCE AND PLANARITY RESTRAINTS FOR THE DNA WERE INCORPORATED IN ORDER TO KEEP DNA CLOSE TO B-DNA CONFORMATION.
;
_pdbx_nmr_refine.details            'THE STRUCTURE OF THE COMPLEX WAS SOLVED ON THE BASIS OF 70 INTERMOLECULAR RESTRAINTS' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1OSL 
_pdbx_nmr_details.text       
;THIS STRUCTURE WAS DETERMINED USING STANDARD 2D AND 3D HOMO- AND HETERONUCLEAR TECHNIQUES. 13C-15N LABELED PROTEIN AND UNLABELED NUCLEOTIDE WERE USED. IN ADDITION ISOTOPE FILTER EXPERIMENTS WERE APPLIED TO OBTAIN ADDITIONAL ASSIGNMENTS AND TO ASSIGN INTER-MOLECULAR NOES. FOR FURTHER DETAILS SEE THE REFERENCE DESCRIBING THE STRUCTURES.
;
# 
_pdbx_nmr_ensemble.entry_id                                      1OSL 
_pdbx_nmr_ensemble.conformers_calculated_total_number            400 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1OSL 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XWINNMR 3.0   collection           bruker   1 
NMRPipe 2.1   processing           delaglio 2 
NMRVIEW 5.0.3 'data analysis'      Johnson  3 
CNS     1.1   'structure solution' brunger  4 
CNS     1.1   refinement           brunger  5 
# 
_exptl.entry_id          1OSL 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1OSL 
_struct.title                     
'Solution structure of a dimeric lactose DNA-binding domain complexed to a nonspecific DNA sequence' 
_struct.pdbx_descriptor           'Lactose operon repressor' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1OSL 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            'Protein-DNA complex, Lac repressor, nonspecific interaction, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR C 5  ? GLY C 14 ? THR A 5  GLY A 14 1 ? 10 
HELX_P HELX_P2 2 SER C 16 ? GLN C 26 ? SER A 16 GLN A 26 1 ? 11 
HELX_P HELX_P3 3 SER C 31 ? LEU C 45 ? SER A 31 LEU A 45 1 ? 15 
HELX_P HELX_P4 4 THR D 5  ? GLY D 14 ? THR B 5  GLY B 14 1 ? 10 
HELX_P HELX_P5 5 SER D 16 ? GLN D 26 ? SER B 16 GLN B 26 1 ? 11 
HELX_P HELX_P6 6 SER D 31 ? LEU D 45 ? SER B 31 LEU B 45 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? C CYS 52 SG ? ? ? 1_555 D CYS 52 SG ? ? A CYS 52 B CYS 52 1_555 ? ? ? ? ? ? ?            2.031 ? 
hydrog1  hydrog ? ? A DC  1  N3 ? ? ? 1_555 B DG  18 N1 ? ? C DC  1  D DG  18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DC  1  N4 ? ? ? 1_555 B DG  18 O6 ? ? C DC  1  D DG  18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DC  1  O2 ? ? ? 1_555 B DG  18 N2 ? ? C DC  1  D DG  18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DG  2  N1 ? ? ? 1_555 B DC  17 N3 ? ? C DG  2  D DC  17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DG  2  N2 ? ? ? 1_555 B DC  17 O2 ? ? C DG  2  D DC  17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DG  2  O6 ? ? ? 1_555 B DC  17 N4 ? ? C DG  2  D DC  17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DA  3  N1 ? ? ? 1_555 B DT  16 N3 ? ? C DA  3  D DT  16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DA  3  N6 ? ? ? 1_555 B DT  16 O4 ? ? C DA  3  D DT  16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DT  4  N3 ? ? ? 1_555 B DA  15 N1 ? ? C DT  4  D DA  15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DT  4  O4 ? ? ? 1_555 B DA  15 N6 ? ? C DT  4  D DA  15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DA  5  N1 ? ? ? 1_555 B DT  14 N3 ? ? C DA  5  D DT  14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DA  5  N6 ? ? ? 1_555 B DT  14 O4 ? ? C DA  5  D DT  14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DA  6  N1 ? ? ? 1_555 B DT  13 N3 ? ? C DA  6  D DT  13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DA  6  N6 ? ? ? 1_555 B DT  13 O4 ? ? C DA  6  D DT  13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DG  7  N1 ? ? ? 1_555 B DC  12 N3 ? ? C DG  7  D DC  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DG  7  N2 ? ? ? 1_555 B DC  12 O2 ? ? C DG  7  D DC  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DG  7  O6 ? ? ? 1_555 B DC  12 N4 ? ? C DG  7  D DC  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DA  8  N1 ? ? ? 1_555 B DT  11 N3 ? ? C DA  8  D DT  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DA  8  N6 ? ? ? 1_555 B DT  11 O4 ? ? C DA  8  D DT  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DT  9  N3 ? ? ? 1_555 B DA  10 N1 ? ? C DT  9  D DA  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DT  9  O4 ? ? ? 1_555 B DA  10 N6 ? ? C DT  9  D DA  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DA  10 N1 ? ? ? 1_555 B DT  9  N3 ? ? C DA  10 D DT  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DA  10 N6 ? ? ? 1_555 B DT  9  O4 ? ? C DA  10 D DT  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DT  11 N3 ? ? ? 1_555 B DA  8  N1 ? ? C DT  11 D DA  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DT  11 O4 ? ? ? 1_555 B DA  8  N6 ? ? C DT  11 D DA  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DC  12 N3 ? ? ? 1_555 B DG  7  N1 ? ? C DC  12 D DG  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DC  12 N4 ? ? ? 1_555 B DG  7  O6 ? ? C DC  12 D DG  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DC  12 O2 ? ? ? 1_555 B DG  7  N2 ? ? C DC  12 D DG  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DT  13 N3 ? ? ? 1_555 B DA  6  N1 ? ? C DT  13 D DA  6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DT  13 O4 ? ? ? 1_555 B DA  6  N6 ? ? C DT  13 D DA  6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A DT  14 N3 ? ? ? 1_555 B DA  5  N1 ? ? C DT  14 D DA  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? A DT  14 O4 ? ? ? 1_555 B DA  5  N6 ? ? C DT  14 D DA  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? A DA  15 N1 ? ? ? 1_555 B DT  4  N3 ? ? C DA  15 D DT  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? A DA  15 N6 ? ? ? 1_555 B DT  4  O4 ? ? C DA  15 D DT  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? A DT  16 N3 ? ? ? 1_555 B DA  3  N1 ? ? C DT  16 D DA  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? A DT  16 O4 ? ? ? 1_555 B DA  3  N6 ? ? C DT  16 D DA  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? A DC  17 N3 ? ? ? 1_555 B DG  2  N1 ? ? C DC  17 D DG  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? A DC  17 N4 ? ? ? 1_555 B DG  2  O6 ? ? C DC  17 D DG  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? A DC  17 O2 ? ? ? 1_555 B DG  2  N2 ? ? C DC  17 D DG  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? A DG  18 N1 ? ? ? 1_555 B DC  1  N3 ? ? C DG  18 D DC  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? A DG  18 N2 ? ? ? 1_555 B DC  1  O2 ? ? C DG  18 D DC  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? A DG  18 O6 ? ? ? 1_555 B DC  1  N4 ? ? C DG  18 D DC  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
hydrog ? ? 
# 
_database_PDB_matrix.entry_id          1OSL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1OSL 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     O "O5'"  . DC  A 1 1  ? -28.101 -5.745  8.339   1.00 6.37  ? 1  DC  C "O5'"  1  
ATOM 2     C "C5'"  . DC  A 1 1  ? -29.288 -6.092  7.620   1.00 6.29  ? 1  DC  C "C5'"  1  
ATOM 3     C "C4'"  . DC  A 1 1  ? -29.409 -5.281  6.351   1.00 5.91  ? 1  DC  C "C4'"  1  
ATOM 4     O "O4'"  . DC  A 1 1  ? -29.690 -3.906  6.712   1.00 5.98  ? 1  DC  C "O4'"  1  
ATOM 5     C "C3'"  . DC  A 1 1  ? -28.138 -5.214  5.511   1.00 5.57  ? 1  DC  C "C3'"  1  
ATOM 6     O "O3'"  . DC  A 1 1  ? -28.449 -4.953  4.142   1.00 5.22  ? 1  DC  C "O3'"  1  
ATOM 7     C "C2'"  . DC  A 1 1  ? -27.397 -4.041  6.118   1.00 5.63  ? 1  DC  C "C2'"  1  
ATOM 8     C "C1'"  . DC  A 1 1  ? -28.532 -3.100  6.500   1.00 5.81  ? 1  DC  C "C1'"  1  
ATOM 9     N N1     . DC  A 1 1  ? -28.274 -2.322  7.725   1.00 6.13  ? 1  DC  C N1     1  
ATOM 10    C C2     . DC  A 1 1  ? -28.539 -0.947  7.721   1.00 6.18  ? 1  DC  C C2     1  
ATOM 11    O O2     . DC  A 1 1  ? -29.011 -0.427  6.699   1.00 5.95  ? 1  DC  C O2     1  
ATOM 12    N N3     . DC  A 1 1  ? -28.272 -0.220  8.830   1.00 6.48  ? 1  DC  C N3     1  
ATOM 13    C C4     . DC  A 1 1  ? -27.766 -0.816  9.912   1.00 6.72  ? 1  DC  C C4     1  
ATOM 14    N N4     . DC  A 1 1  ? -27.512 -0.057  10.982  1.00 7.02  ? 1  DC  C N4     1  
ATOM 15    C C5     . DC  A 1 1  ? -27.496 -2.216  9.947   1.00 6.67  ? 1  DC  C C5     1  
ATOM 16    C C6     . DC  A 1 1  ? -27.767 -2.923  8.842   1.00 6.38  ? 1  DC  C C6     1  
ATOM 17    H "H5'"  . DC  A 1 1  ? -30.160 -5.903  8.247   1.00 6.54  ? 1  DC  C "H5'"  1  
ATOM 18    H "H5''" . DC  A 1 1  ? -29.260 -7.150  7.362   1.00 6.26  ? 1  DC  C "H5''" 1  
ATOM 19    H "H4'"  . DC  A 1 1  ? -30.184 -5.735  5.731   1.00 5.83  ? 1  DC  C "H4'"  1  
ATOM 20    H "H3'"  . DC  A 1 1  ? -27.568 -6.140  5.582   1.00 5.59  ? 1  DC  C "H3'"  1  
ATOM 21    H "H2'"  . DC  A 1 1  ? -26.806 -4.348  6.980   1.00 5.83  ? 1  DC  C "H2'"  1  
ATOM 22    H "H2''" . DC  A 1 1  ? -26.717 -3.590  5.399   1.00 5.38  ? 1  DC  C "H2''" 1  
ATOM 23    H "H1'"  . DC  A 1 1  ? -28.751 -2.405  5.689   1.00 5.61  ? 1  DC  C "H1'"  1  
ATOM 24    H H41    . DC  A 1 1  ? -27.702 0.935   10.958  1.00 7.08  ? 1  DC  C H41    1  
ATOM 25    H H42    . DC  A 1 1  ? -27.129 -0.475  11.817  1.00 7.21  ? 1  DC  C H42    1  
ATOM 26    H H5     . DC  A 1 1  ? -27.083 -2.691  10.836  1.00 6.88  ? 1  DC  C H5     1  
ATOM 27    H H6     . DC  A 1 1  ? -27.576 -3.997  8.837   1.00 6.37  ? 1  DC  C H6     1  
ATOM 28    H "HO5'" . DC  A 1 1  ? -27.473 -6.460  8.203   1.00 6.58  ? 1  DC  C "HO5'" 1  
ATOM 29    P P      . DG  A 1 2  ? -27.262 -4.815  3.068   1.00 4.83  ? 2  DG  C P      1  
ATOM 30    O OP1    . DG  A 1 2  ? -27.763 -5.363  1.781   1.00 4.58  ? 2  DG  C OP1    1  
ATOM 31    O OP2    . DG  A 1 2  ? -26.002 -5.348  3.650   1.00 4.91  ? 2  DG  C OP2    1  
ATOM 32    O "O5'"  . DG  A 1 2  ? -27.121 -3.236  2.908   1.00 4.73  ? 2  DG  C "O5'"  1  
ATOM 33    C "C5'"  . DG  A 1 2  ? -28.225 -2.475  2.426   1.00 4.67  ? 2  DG  C "C5'"  1  
ATOM 34    C "C4'"  . DG  A 1 2  ? -27.775 -1.123  1.925   1.00 4.53  ? 2  DG  C "C4'"  1  
ATOM 35    O "O4'"  . DG  A 1 2  ? -27.562 -0.244  3.057   1.00 4.84  ? 2  DG  C "O4'"  1  
ATOM 36    C "C3'"  . DG  A 1 2  ? -26.434 -1.152  1.199   1.00 4.27  ? 2  DG  C "C3'"  1  
ATOM 37    O "O3'"  . DG  A 1 2  ? -26.370 -0.066  0.279   1.00 4.08  ? 2  DG  C "O3'"  1  
ATOM 38    C "C2'"  . DG  A 1 2  ? -25.432 -0.991  2.327   1.00 4.50  ? 2  DG  C "C2'"  1  
ATOM 39    C "C1'"  . DG  A 1 2  ? -26.167 -0.043  3.263   1.00 4.82  ? 2  DG  C "C1'"  1  
ATOM 40    N N9     . DG  A 1 2  ? -25.864 -0.202  4.684   1.00 5.17  ? 2  DG  C N9     1  
ATOM 41    C C8     . DG  A 1 2  ? -25.560 -1.360  5.354   1.00 5.30  ? 2  DG  C C8     1  
ATOM 42    N N7     . DG  A 1 2  ? -25.293 -1.169  6.618   1.00 5.63  ? 2  DG  C N7     1  
ATOM 43    C C5     . DG  A 1 2  ? -25.433 0.202   6.795   1.00 5.74  ? 2  DG  C C5     1  
ATOM 44    C C6     . DG  A 1 2  ? -25.265 1.008   7.958   1.00 6.09  ? 2  DG  C C6     1  
ATOM 45    O O6     . DG  A 1 2  ? -24.940 0.660   9.103   1.00 6.37  ? 2  DG  C O6     1  
ATOM 46    N N1     . DG  A 1 2  ? -25.509 2.351   7.688   1.00 6.12  ? 2  DG  C N1     1  
ATOM 47    C C2     . DG  A 1 2  ? -25.869 2.857   6.463   1.00 5.85  ? 2  DG  C C2     1  
ATOM 48    N N2     . DG  A 1 2  ? -26.064 4.183   6.400   1.00 5.98  ? 2  DG  C N2     1  
ATOM 49    N N3     . DG  A 1 2  ? -26.025 2.120   5.375   1.00 5.51  ? 2  DG  C N3     1  
ATOM 50    C C4     . DG  A 1 2  ? -25.795 0.812   5.612   1.00 5.47  ? 2  DG  C C4     1  
ATOM 51    H "H5'"  . DG  A 1 2  ? -28.946 -2.332  3.232   1.00 4.93  ? 2  DG  C "H5'"  1  
ATOM 52    H "H5''" . DG  A 1 2  ? -28.709 -3.011  1.610   1.00 4.50  ? 2  DG  C "H5''" 1  
ATOM 53    H "H4'"  . DG  A 1 2  ? -28.520 -0.755  1.216   1.00 4.41  ? 2  DG  C "H4'"  1  
ATOM 54    H "H3'"  . DG  A 1 2  ? -26.298 -2.088  0.662   1.00 4.11  ? 2  DG  C "H3'"  1  
ATOM 55    H "H2'"  . DG  A 1 2  ? -25.210 -1.948  2.798   1.00 4.59  ? 2  DG  C "H2'"  1  
ATOM 56    H "H2''" . DG  A 1 2  ? -24.491 -0.576  1.969   1.00 4.38  ? 2  DG  C "H2''" 1  
ATOM 57    H "H1'"  . DG  A 1 2  ? -25.950 0.992   2.990   1.00 4.80  ? 2  DG  C "H1'"  1  
ATOM 58    H H8     . DG  A 1 2  ? -25.534 -2.328  4.880   1.00 5.15  ? 2  DG  C H8     1  
ATOM 59    H H1     . DG  A 1 2  ? -25.415 3.003   8.455   1.00 6.38  ? 2  DG  C H1     1  
ATOM 60    H H21    . DG  A 1 2  ? -25.950 4.763   7.222   1.00 6.25  ? 2  DG  C H21    1  
ATOM 61    H H22    . DG  A 1 2  ? -26.330 4.609   5.524   1.00 5.81  ? 2  DG  C H22    1  
ATOM 62    P P      . DA  A 1 3  ? -25.020 0.212   -0.540  1.00 3.85  ? 3  DA  C P      1  
ATOM 63    O OP1    . DA  A 1 3  ? -25.374 0.405   -1.969  1.00 3.56  ? 3  DA  C OP1    1  
ATOM 64    O OP2    . DA  A 1 3  ? -23.994 -0.799  -0.169  1.00 3.83  ? 3  DA  C OP2    1  
ATOM 65    O "O5'"  . DA  A 1 3  ? -24.599 1.632   0.039   1.00 4.07  ? 3  DA  C "O5'"  1  
ATOM 66    C "C5'"  . DA  A 1 3  ? -25.589 2.654   0.131   1.00 4.23  ? 3  DA  C "C5'"  1  
ATOM 67    C "C4'"  . DA  A 1 3  ? -24.969 3.985   0.479   1.00 4.45  ? 3  DA  C "C4'"  1  
ATOM 68    O "O4'"  . DA  A 1 3  ? -24.693 4.022   1.901   1.00 4.78  ? 3  DA  C "O4'"  1  
ATOM 69    C "C3'"  . DA  A 1 3  ? -23.622 4.230   -0.187  1.00 4.31  ? 3  DA  C "C3'"  1  
ATOM 70    O "O3'"  . DA  A 1 3  ? -23.415 5.632   -0.310  1.00 4.50  ? 3  DA  C "O3'"  1  
ATOM 71    C "C2'"  . DA  A 1 3  ? -22.643 3.597   0.786   1.00 4.40  ? 3  DA  C "C2'"  1  
ATOM 72    C "C1'"  . DA  A 1 3  ? -23.293 3.905   2.129   1.00 4.77  ? 3  DA  C "C1'"  1  
ATOM 73    N N9     . DA  A 1 3  ? -23.065 2.918   3.186   1.00 4.90  ? 3  DA  C N9     1  
ATOM 74    C C8     . DA  A 1 3  ? -23.057 1.548   3.106   1.00 4.75  ? 3  DA  C C8     1  
ATOM 75    N N7     . DA  A 1 3  ? -22.774 0.954   4.243   1.00 4.98  ? 3  DA  C N7     1  
ATOM 76    C C5     . DA  A 1 3  ? -22.592 2.005   5.133   1.00 5.29  ? 3  DA  C C5     1  
ATOM 77    C C6     . DA  A 1 3  ? -22.266 2.045   6.505   1.00 5.64  ? 3  DA  C C6     1  
ATOM 78    N N6     . DA  A 1 3  ? -22.043 0.959   7.249   1.00 5.74  ? 3  DA  C N6     1  
ATOM 79    N N1     . DA  A 1 3  ? -22.168 3.259   7.093   1.00 5.90  ? 3  DA  C N1     1  
ATOM 80    C C2     . DA  A 1 3  ? -22.379 4.350   6.345   1.00 5.83  ? 3  DA  C C2     1  
ATOM 81    N N3     . DA  A 1 3  ? -22.684 4.440   5.051   1.00 5.53  ? 3  DA  C N3     1  
ATOM 82    C C4     . DA  A 1 3  ? -22.778 3.219   4.497   1.00 5.25  ? 3  DA  C C4     1  
ATOM 83    H "H5'"  . DA  A 1 3  ? -26.313 2.389   0.902   1.00 4.41  ? 3  DA  C "H5'"  1  
ATOM 84    H "H5''" . DA  A 1 3  ? -26.107 2.745   -0.823  1.00 4.05  ? 3  DA  C "H5''" 1  
ATOM 85    H "H4'"  . DA  A 1 3  ? -25.645 4.774   0.143   1.00 4.51  ? 3  DA  C "H4'"  1  
ATOM 86    H "H3'"  . DA  A 1 3  ? -23.576 3.770   -1.174  1.00 4.03  ? 3  DA  C "H3'"  1  
ATOM 87    H "H2'"  . DA  A 1 3  ? -22.545 2.526   0.610   1.00 4.22  ? 3  DA  C "H2'"  1  
ATOM 88    H "H2''" . DA  A 1 3  ? -21.650 4.037   0.696   1.00 4.42  ? 3  DA  C "H2''" 1  
ATOM 89    H "H1'"  . DA  A 1 3  ? -22.947 4.874   2.496   1.00 4.98  ? 3  DA  C "H1'"  1  
ATOM 90    H H8     . DA  A 1 3  ? -23.262 1.010   2.193   1.00 4.48  ? 3  DA  C H8     1  
ATOM 91    H H61    . DA  A 1 3  ? -21.807 1.054   8.228   1.00 6.00  ? 3  DA  C H61    1  
ATOM 92    H H62    . DA  A 1 3  ? -22.104 0.041   6.834   1.00 5.58  ? 3  DA  C H62    1  
ATOM 93    H H2     . DA  A 1 3  ? -22.291 5.301   6.872   1.00 6.08  ? 3  DA  C H2     1  
ATOM 94    P P      . DT  A 1 4  ? -22.036 6.185   -0.902  1.00 4.47  ? 4  DT  C P      1  
ATOM 95    O OP1    . DT  A 1 4  ? -22.370 7.202   -1.932  1.00 4.48  ? 4  DT  C OP1    1  
ATOM 96    O OP2    . DT  A 1 4  ? -21.173 5.031   -1.262  1.00 4.20  ? 4  DT  C OP2    1  
ATOM 97    O "O5'"  . DT  A 1 4  ? -21.436 6.922   0.373   1.00 4.86  ? 4  DT  C "O5'"  1  
ATOM 98    C "C5'"  . DT  A 1 4  ? -22.284 7.781   1.132   1.00 5.17  ? 4  DT  C "C5'"  1  
ATOM 99    C "C4'"  . DT  A 1 4  ? -21.479 8.664   2.052   1.00 5.54  ? 4  DT  C "C4'"  1  
ATOM 100   O "O4'"  . DT  A 1 4  ? -21.125 7.912   3.240   1.00 5.63  ? 4  DT  C "O4'"  1  
ATOM 101   C "C3'"  . DT  A 1 4  ? -20.148 9.101   1.452   1.00 5.55  ? 4  DT  C "C3'"  1  
ATOM 102   O "O3'"  . DT  A 1 4  ? -19.753 10.338  2.031   1.00 5.94  ? 4  DT  C "O3'"  1  
ATOM 103   C "C2'"  . DT  A 1 4  ? -19.215 7.967   1.833   1.00 5.40  ? 4  DT  C "C2'"  1  
ATOM 104   C "C1'"  . DT  A 1 4  ? -19.741 7.577   3.211   1.00 5.57  ? 4  DT  C "C1'"  1  
ATOM 105   N N1     . DT  A 1 4  ? -19.577 6.153   3.589   1.00 5.39  ? 4  DT  C N1     1  
ATOM 106   C C2     . DT  A 1 4  ? -19.301 5.872   4.915   1.00 5.63  ? 4  DT  C C2     1  
ATOM 107   O O2     . DT  A 1 4  ? -19.250 6.726   5.785   1.00 5.97  ? 4  DT  C O2     1  
ATOM 108   N N3     . DT  A 1 4  ? -19.087 4.547   5.189   1.00 5.48  ? 4  DT  C N3     1  
ATOM 109   C C4     . DT  A 1 4  ? -19.127 3.497   4.299   1.00 5.12  ? 4  DT  C C4     1  
ATOM 110   O O4     . DT  A 1 4  ? -18.855 2.360   4.684   1.00 5.06  ? 4  DT  C O4     1  
ATOM 111   C C5     . DT  A 1 4  ? -19.449 3.856   2.933   1.00 4.86  ? 4  DT  C C5     1  
ATOM 112   C C7     . DT  A 1 4  ? -19.482 2.782   1.892   1.00 4.47  ? 4  DT  C C7     1  
ATOM 113   C C6     . DT  A 1 4  ? -19.664 5.149   2.647   1.00 5.01  ? 4  DT  C C6     1  
ATOM 114   H "H5'"  . DT  A 1 4  ? -22.969 7.178   1.728   1.00 5.16  ? 4  DT  C "H5'"  1  
ATOM 115   H "H5''" . DT  A 1 4  ? -22.863 8.410   0.456   1.00 5.16  ? 4  DT  C "H5''" 1  
ATOM 116   H "H4'"  . DT  A 1 4  ? -22.058 9.567   2.255   1.00 5.75  ? 4  DT  C "H4'"  1  
ATOM 117   H "H3'"  . DT  A 1 4  ? -20.224 9.219   0.370   1.00 5.40  ? 4  DT  C "H3'"  1  
ATOM 118   H "H2'"  . DT  A 1 4  ? -19.277 7.146   1.120   1.00 5.09  ? 4  DT  C "H2'"  1  
ATOM 119   H "H2''" . DT  A 1 4  ? -18.177 8.296   1.864   1.00 5.50  ? 4  DT  C "H2''" 1  
ATOM 120   H "H1'"  . DT  A 1 4  ? -19.252 8.183   3.979   1.00 5.86  ? 4  DT  C "H1'"  1  
ATOM 121   H H3     . DT  A 1 4  ? -18.862 4.322   6.151   1.00 5.68  ? 4  DT  C H3     1  
ATOM 122   H H71    . DT  A 1 4  ? -19.282 3.218   0.914   1.00 4.37  ? 4  DT  C H71    1  
ATOM 123   H H72    . DT  A 1 4  ? -18.721 2.034   2.117   1.00 4.43  ? 4  DT  C H72    1  
ATOM 124   H H73    . DT  A 1 4  ? -20.464 2.310   1.886   1.00 4.51  ? 4  DT  C H73    1  
ATOM 125   H H6     . DT  A 1 4  ? -19.924 5.418   1.623   1.00 4.84  ? 4  DT  C H6     1  
ATOM 126   P P      . DA  A 1 5  ? -18.332 10.978  1.660   1.00 6.08  ? 5  DA  C P      1  
ATOM 127   O OP1    . DA  A 1 5  ? -18.558 12.405  1.315   1.00 6.36  ? 5  DA  C OP1    1  
ATOM 128   O OP2    . DA  A 1 5  ? -17.609 10.096  0.708   1.00 5.74  ? 5  DA  C OP2    1  
ATOM 129   O "O5'"  . DA  A 1 5  ? -17.611 10.910  3.073   1.00 6.32  ? 5  DA  C "O5'"  1  
ATOM 130   C "C5'"  . DA  A 1 5  ? -18.329 11.318  4.233   1.00 6.63  ? 5  DA  C "C5'"  1  
ATOM 131   C "C4'"  . DA  A 1 5  ? -17.412 11.415  5.426   1.00 6.88  ? 5  DA  C "C4'"  1  
ATOM 132   O "O4'"  . DA  A 1 5  ? -17.205 10.086  5.971   1.00 6.71  ? 5  DA  C "O4'"  1  
ATOM 133   C "C3'"  . DA  A 1 5  ? -16.020 11.916  5.066   1.00 6.92  ? 5  DA  C "C3'"  1  
ATOM 134   O "O3'"  . DA  A 1 5  ? -15.448 12.563  6.195   1.00 7.27  ? 5  DA  C "O3'"  1  
ATOM 135   C "C2'"  . DA  A 1 5  ? -15.289 10.640  4.689   1.00 6.57  ? 5  DA  C "C2'"  1  
ATOM 136   C "C1'"  . DA  A 1 5  ? -15.893 9.629   5.659   1.00 6.54  ? 5  DA  C "C1'"  1  
ATOM 137   N N9     . DA  A 1 5  ? -15.973 8.251   5.165   1.00 6.17  ? 5  DA  C N9     1  
ATOM 138   C C8     . DA  A 1 5  ? -16.316 7.815   3.909   1.00 5.84  ? 5  DA  C C8     1  
ATOM 139   N N7     . DA  A 1 5  ? -16.248 6.512   3.764   1.00 5.55  ? 5  DA  C N7     1  
ATOM 140   C C5     . DA  A 1 5  ? -15.840 6.057   5.011   1.00 5.72  ? 5  DA  C C5     1  
ATOM 141   C C6     . DA  A 1 5  ? -15.577 4.763   5.511   1.00 5.59  ? 5  DA  C C6     1  
ATOM 142   N N6     . DA  A 1 5  ? -15.674 3.651   4.777   1.00 5.26  ? 5  DA  C N6     1  
ATOM 143   N N1     . DA  A 1 5  ? -15.197 4.651   6.803   1.00 5.86  ? 5  DA  C N1     1  
ATOM 144   C C2     . DA  A 1 5  ? -15.085 5.768   7.535   1.00 6.20  ? 5  DA  C C2     1  
ATOM 145   N N3     . DA  A 1 5  ? -15.297 7.039   7.177   1.00 6.34  ? 5  DA  C N3     1  
ATOM 146   C C4     . DA  A 1 5  ? -15.678 7.115   5.888   1.00 6.09  ? 5  DA  C C4     1  
ATOM 147   H "H5'"  . DA  A 1 5  ? -19.115 10.593  4.448   1.00 6.53  ? 5  DA  C "H5'"  1  
ATOM 148   H "H5''" . DA  A 1 5  ? -18.784 12.292  4.056   1.00 6.81  ? 5  DA  C "H5''" 1  
ATOM 149   H "H4'"  . DA  A 1 5  ? -17.843 12.123  6.136   1.00 7.17  ? 5  DA  C "H4'"  1  
ATOM 150   H "H3'"  . DA  A 1 5  ? -16.062 12.619  4.234   1.00 6.93  ? 5  DA  C "H3'"  1  
ATOM 151   H "H2'"  . DA  A 1 5  ? -15.470 10.372  3.649   1.00 6.32  ? 5  DA  C "H2'"  1  
ATOM 152   H "H2''" . DA  A 1 5  ? -14.213 10.744  4.818   1.00 6.61  ? 5  DA  C "H2''" 1  
ATOM 153   H "H1'"  . DA  A 1 5  ? -15.326 9.619   6.593   1.00 6.72  ? 5  DA  C "H1'"  1  
ATOM 154   H H8     . DA  A 1 5  ? -16.611 8.483   3.114   1.00 5.83  ? 5  DA  C H8     1  
ATOM 155   H H61    . DA  A 1 5  ? -15.454 2.752   5.182   1.00 5.21  ? 5  DA  C H61    1  
ATOM 156   H H62    . DA  A 1 5  ? -15.949 3.715   3.808   1.00 5.07  ? 5  DA  C H62    1  
ATOM 157   H H2     . DA  A 1 5  ? -14.777 5.618   8.571   1.00 6.41  ? 5  DA  C H2     1  
ATOM 158   P P      . DA  A 1 6  ? -13.944 13.105  6.127   1.00 7.38  ? 6  DA  C P      1  
ATOM 159   O OP1    . DA  A 1 6  ? -13.945 14.498  6.642   1.00 7.80  ? 6  DA  C OP1    1  
ATOM 160   O OP2    . DA  A 1 6  ? -13.350 12.814  4.797   1.00 7.10  ? 6  DA  C OP2    1  
ATOM 161   O "O5'"  . DA  A 1 6  ? -13.258 12.173  7.212   1.00 7.35  ? 6  DA  C "O5'"  1  
ATOM 162   C "C5'"  . DA  A 1 6  ? -13.923 11.952  8.452   1.00 7.57  ? 6  DA  C "C5'"  1  
ATOM 163   C "C4'"  . DA  A 1 6  ? -13.009 11.257  9.427   1.00 7.58  ? 6  DA  C "C4'"  1  
ATOM 164   O "O4'"  . DA  A 1 6  ? -12.994 9.838   9.125   1.00 7.22  ? 6  DA  C "O4'"  1  
ATOM 165   C "C3'"  . DA  A 1 6  ? -11.562 11.708  9.295   1.00 7.61  ? 6  DA  C "C3'"  1  
ATOM 166   O "O3'"  . DA  A 1 6  ? -10.894 11.542  10.536  1.00 7.79  ? 6  DA  C "O3'"  1  
ATOM 167   C "C2'"  . DA  A 1 6  ? -11.017 10.784  8.220   1.00 7.18  ? 6  DA  C "C2'"  1  
ATOM 168   C "C1'"  . DA  A 1 6  ? -11.756 9.483   8.517   1.00 6.98  ? 6  DA  C "C1'"  1  
ATOM 169   N N9     . DA  A 1 6  ? -12.022 8.634   7.351   1.00 6.57  ? 6  DA  C N9     1  
ATOM 170   C C8     . DA  A 1 6  ? -12.448 9.011   6.102   1.00 6.41  ? 6  DA  C C8     1  
ATOM 171   N N7     . DA  A 1 6  ? -12.548 8.014   5.253   1.00 6.03  ? 6  DA  C N7     1  
ATOM 172   C C5     . DA  A 1 6  ? -12.170 6.903   5.995   1.00 5.94  ? 6  DA  C C5     1  
ATOM 173   C C6     . DA  A 1 6  ? -12.058 5.534   5.667   1.00 5.61  ? 6  DA  C C6     1  
ATOM 174   N N6     . DA  A 1 6  ? -12.311 5.040   4.453   1.00 5.26  ? 6  DA  C N6     1  
ATOM 175   N N1     . DA  A 1 6  ? -11.663 4.682   6.641   1.00 5.66  ? 6  DA  C N1     1  
ATOM 176   C C2     . DA  A 1 6  ? -11.394 5.182   7.855   1.00 6.01  ? 6  DA  C C2     1  
ATOM 177   N N3     . DA  A 1 6  ? -11.454 6.447   8.282   1.00 6.33  ? 6  DA  C N3     1  
ATOM 178   C C4     . DA  A 1 6  ? -11.854 7.267   7.293   1.00 6.28  ? 6  DA  C C4     1  
ATOM 179   H "H5'"  . DA  A 1 6  ? -14.805 11.334  8.287   1.00 7.43  ? 6  DA  C "H5'"  1  
ATOM 180   H "H5''" . DA  A 1 6  ? -14.233 12.908  8.875   1.00 7.87  ? 6  DA  C "H5''" 1  
ATOM 181   H "H4'"  . DA  A 1 6  ? -13.338 11.494  10.441  1.00 7.85  ? 6  DA  C "H4'"  1  
ATOM 182   H "H3'"  . DA  A 1 6  ? -11.506 12.755  8.995   1.00 7.79  ? 6  DA  C "H3'"  1  
ATOM 183   H "H2'"  . DA  A 1 6  ? -11.236 11.165  7.223   1.00 7.08  ? 6  DA  C "H2'"  1  
ATOM 184   H "H2''" . DA  A 1 6  ? -9.937  10.675  8.299   1.00 7.14  ? 6  DA  C "H2''" 1  
ATOM 185   H "H1'"  . DA  A 1 6  ? -11.197 8.890   9.245   1.00 6.99  ? 6  DA  C "H1'"  1  
ATOM 186   H H8     . DA  A 1 6  ? -12.678 10.033  5.841   1.00 6.58  ? 6  DA  C H8     1  
ATOM 187   H H61    . DA  A 1 6  ? -12.199 4.054   4.263   1.00 5.04  ? 6  DA  C H61    1  
ATOM 188   H H62    . DA  A 1 6  ? -12.601 5.659   3.710   1.00 5.24  ? 6  DA  C H62    1  
ATOM 189   H H2     . DA  A 1 6  ? -11.081 4.450   8.601   1.00 6.05  ? 6  DA  C H2     1  
ATOM 190   P P      . DG  A 1 7  ? -9.330  11.861  10.644  1.00 7.83  ? 7  DG  C P      1  
ATOM 191   O OP1    . DG  A 1 7  ? -9.117  12.668  11.872  1.00 8.24  ? 7  DG  C OP1    1  
ATOM 192   O OP2    . DG  A 1 7  ? -8.820  12.356  9.340   1.00 7.69  ? 7  DG  C OP2    1  
ATOM 193   O "O5'"  . DG  A 1 7  ? -8.762  10.402  10.903  1.00 7.54  ? 7  DG  C "O5'"  1  
ATOM 194   C "C5'"  . DG  A 1 7  ? -9.414  9.567   11.854  1.00 7.59  ? 7  DG  C "C5'"  1  
ATOM 195   C "C4'"  . DG  A 1 7  ? -8.564  8.364   12.172  1.00 7.39  ? 7  DG  C "C4'"  1  
ATOM 196   O "O4'"  . DG  A 1 7  ? -8.744  7.373   11.129  1.00 6.98  ? 7  DG  C "O4'"  1  
ATOM 197   C "C3'"  . DG  A 1 7  ? -7.078  8.692   12.159  1.00 7.39  ? 7  DG  C "C3'"  1  
ATOM 198   O "O3'"  . DG  A 1 7  ? -6.386  7.796   13.015  1.00 7.37  ? 7  DG  C "O3'"  1  
ATOM 199   C "C2'"  . DG  A 1 7  ? -6.702  8.498   10.701  1.00 7.03  ? 7  DG  C "C2'"  1  
ATOM 200   C "C1'"  . DG  A 1 7  ? -7.587  7.321   10.303  1.00 6.75  ? 7  DG  C "C1'"  1  
ATOM 201   N N9     . DG  A 1 7  ? -8.003  7.285   8.901   1.00 6.45  ? 7  DG  C N9     1  
ATOM 202   C C8     . DG  A 1 7  ? -8.400  8.339   8.115   1.00 6.51  ? 7  DG  C C8     1  
ATOM 203   N N7     . DG  A 1 7  ? -8.663  7.993   6.882   1.00 6.19  ? 7  DG  C N7     1  
ATOM 204   C C5     . DG  A 1 7  ? -8.435  6.623   6.852   1.00 5.90  ? 7  DG  C C5     1  
ATOM 205   C C6     . DG  A 1 7  ? -8.549  5.686   5.780   1.00 5.49  ? 7  DG  C C6     1  
ATOM 206   O O6     . DG  A 1 7  ? -8.877  5.890   4.603   1.00 5.31  ? 7  DG  C O6     1  
ATOM 207   N N1     . DG  A 1 7  ? -8.226  4.395   6.190   1.00 5.33  ? 7  DG  C N1     1  
ATOM 208   C C2     . DG  A 1 7  ? -7.844  4.046   7.463   1.00 5.53  ? 7  DG  C C2     1  
ATOM 209   N N2     . DG  A 1 7  ? -7.583  2.745   7.666   1.00 5.35  ? 7  DG  C N2     1  
ATOM 210   N N3     . DG  A 1 7  ? -7.728  4.905   8.466   1.00 5.90  ? 7  DG  C N3     1  
ATOM 211   C C4     . DG  A 1 7  ? -8.037  6.167   8.092   1.00 6.06  ? 7  DG  C C4     1  
ATOM 212   H "H5'"  . DG  A 1 7  ? -10.369 9.230   11.451  1.00 7.47  ? 7  DG  C "H5'"  1  
ATOM 213   H "H5''" . DG  A 1 7  ? -9.594  10.128  12.772  1.00 7.91  ? 7  DG  C "H5''" 1  
ATOM 214   H "H4'"  . DG  A 1 7  ? -8.818  8.012   13.174  1.00 7.56  ? 7  DG  C "H4'"  1  
ATOM 215   H "H3'"  . DG  A 1 7  ? -6.900  9.715   12.491  1.00 7.66  ? 7  DG  C "H3'"  1  
ATOM 216   H "H2'"  . DG  A 1 7  ? -6.915  9.392   10.115  1.00 7.11  ? 7  DG  C "H2'"  1  
ATOM 217   H "H2''" . DG  A 1 7  ? -5.641  8.279   10.588  1.00 6.93  ? 7  DG  C "H2''" 1  
ATOM 218   H "H1'"  . DG  A 1 7  ? -7.078  6.380   10.525  1.00 6.60  ? 7  DG  C "H1'"  1  
ATOM 219   H H8     . DG  A 1 7  ? -8.484  9.352   8.479   1.00 6.80  ? 7  DG  C H8     1  
ATOM 220   H H1     . DG  A 1 7  ? -8.277  3.661   5.495   1.00 5.05  ? 7  DG  C H1     1  
ATOM 221   H H21    . DG  A 1 7  ? -7.668  2.075   6.914   1.00 5.08  ? 7  DG  C H21    1  
ATOM 222   H H22    . DG  A 1 7  ? -7.300  2.430   8.584   1.00 5.51  ? 7  DG  C H22    1  
ATOM 223   P P      . DA  A 1 8  ? -4.791  7.862   13.111  1.00 7.34  ? 8  DA  C P      1  
ATOM 224   O OP1    . DA  A 1 8  ? -4.423  7.823   14.549  1.00 7.64  ? 8  DA  C OP1    1  
ATOM 225   O OP2    . DA  A 1 8  ? -4.277  8.959   12.251  1.00 7.36  ? 8  DA  C OP2    1  
ATOM 226   O "O5'"  . DA  A 1 8  ? -4.409  6.469   12.454  1.00 6.91  ? 8  DA  C "O5'"  1  
ATOM 227   C "C5'"  . DA  A 1 8  ? -5.111  5.299   12.860  1.00 6.83  ? 8  DA  C "C5'"  1  
ATOM 228   C "C4'"  . DA  A 1 8  ? -4.407  4.060   12.370  1.00 6.47  ? 8  DA  C "C4'"  1  
ATOM 229   O "O4'"  . DA  A 1 8  ? -4.777  3.823   10.988  1.00 6.13  ? 8  DA  C "O4'"  1  
ATOM 230   C "C3'"  . DA  A 1 8  ? -2.894  4.222   12.354  1.00 6.42  ? 8  DA  C "C3'"  1  
ATOM 231   O "O3'"  . DA  A 1 8  ? -2.276  2.954   12.499  1.00 6.21  ? 8  DA  C "O3'"  1  
ATOM 232   C "C2'"  . DA  A 1 8  ? -2.633  4.835   10.989  1.00 6.21  ? 8  DA  C "C2'"  1  
ATOM 233   C "C1'"  . DA  A 1 8  ? -3.689  4.147   10.128  1.00 5.94  ? 8  DA  C "C1'"  1  
ATOM 234   N N9     . DA  A 1 8  ? -4.193  4.931   8.996   1.00 5.85  ? 8  DA  C N9     1  
ATOM 235   C C8     . DA  A 1 8  ? -4.535  6.260   8.965   1.00 6.11  ? 8  DA  C C8     1  
ATOM 236   N N7     . DA  A 1 8  ? -4.918  6.681   7.782   1.00 5.96  ? 8  DA  C N7     1  
ATOM 237   C C5     . DA  A 1 8  ? -4.831  5.551   6.980   1.00 5.57  ? 8  DA  C C5     1  
ATOM 238   C C6     . DA  A 1 8  ? -5.099  5.336   5.610   1.00 5.26  ? 8  DA  C C6     1  
ATOM 239   N N6     . DA  A 1 8  ? -5.515  6.293   4.778   1.00 5.31  ? 8  DA  C N6     1  
ATOM 240   N N1     . DA  A 1 8  ? -4.917  4.088   5.120   1.00 4.91  ? 8  DA  C N1     1  
ATOM 241   C C2     . DA  A 1 8  ? -4.490  3.131   5.955   1.00 4.88  ? 8  DA  C C2     1  
ATOM 242   N N3     . DA  A 1 8  ? -4.199  3.212   7.258   1.00 5.16  ? 8  DA  C N3     1  
ATOM 243   C C4     . DA  A 1 8  ? -4.394  4.463   7.715   1.00 5.50  ? 8  DA  C C4     1  
ATOM 244   H "H5'"  . DA  A 1 8  ? -6.121  5.319   12.450  1.00 6.79  ? 8  DA  C "H5'"  1  
ATOM 245   H "H5''" . DA  A 1 8  ? -5.171  5.267   13.948  1.00 7.09  ? 8  DA  C "H5''" 1  
ATOM 246   H "H4'"  . DA  A 1 8  ? -4.644  3.235   13.044  1.00 6.52  ? 8  DA  C "H4'"  1  
ATOM 247   H "H3'"  . DA  A 1 8  ? -2.563  4.876   13.161  1.00 6.70  ? 8  DA  C "H3'"  1  
ATOM 248   H "H2'"  . DA  A 1 8  ? -2.758  5.917   11.010  1.00 6.42  ? 8  DA  C "H2'"  1  
ATOM 249   H "H2''" . DA  A 1 8  ? -1.620  4.628   10.646  1.00 6.05  ? 8  DA  C "H2''" 1  
ATOM 250   H "H1'"  . DA  A 1 8  ? -3.298  3.206   9.737   1.00 5.67  ? 8  DA  C "H1'"  1  
ATOM 251   H H8     . DA  A 1 8  ? -4.489  6.901   9.833   1.00 6.42  ? 8  DA  C H8     1  
ATOM 252   H H61    . DA  A 1 8  ? -5.689  6.089   3.804   1.00 5.10  ? 8  DA  C H61    1  
ATOM 253   H H62    . DA  A 1 8  ? -5.653  7.232   5.128   1.00 5.58  ? 8  DA  C H62    1  
ATOM 254   H H2     . DA  A 1 8  ? -4.365  2.143   5.507   1.00 4.61  ? 8  DA  C H2     1  
ATOM 255   P P      . DT  A 1 9  ? -0.684  2.833   12.405  1.00 6.09  ? 9  DT  C P      1  
ATOM 256   O OP1    . DT  A 1 9  ? -0.243  1.915   13.486  1.00 6.21  ? 9  DT  C OP1    1  
ATOM 257   O OP2    . DT  A 1 9  ? -0.078  4.184   12.290  1.00 6.24  ? 9  DT  C OP2    1  
ATOM 258   O "O5'"  . DT  A 1 9  ? -0.545  2.082   11.013  1.00 5.64  ? 9  DT  C "O5'"  1  
ATOM 259   C "C5'"  . DT  A 1 9  ? -1.394  0.970   10.745  1.00 5.46  ? 9  DT  C "C5'"  1  
ATOM 260   C "C4'"  . DT  A 1 9  ? -0.831  0.133   9.626   1.00 5.04  ? 9  DT  C "C4'"  1  
ATOM 261   O "O4'"  . DT  A 1 9  ? -1.212  0.724   8.360   1.00 4.86  ? 9  DT  C "O4'"  1  
ATOM 262   C "C3'"  . DT  A 1 9  ? 0.690   0.112   9.620   1.00 4.94  ? 9  DT  C "C3'"  1  
ATOM 263   O "O3'"  . DT  A 1 9  ? 1.146   -1.100  9.036   1.00 4.61  ? 9  DT  C "O3'"  1  
ATOM 264   C "C2'"  . DT  A 1 9  ? 1.036   1.339   8.794   1.00 4.92  ? 9  DT  C "C2'"  1  
ATOM 265   C "C1'"  . DT  A 1 9  ? -0.086  1.350   7.758   1.00 4.77  ? 9  DT  C "C1'"  1  
ATOM 266   N N1     . DT  A 1 9  ? -0.496  2.685   7.254   1.00 4.93  ? 9  DT  C N1     1  
ATOM 267   C C2     . DT  A 1 9  ? -0.869  2.779   5.924   1.00 4.69  ? 9  DT  C C2     1  
ATOM 268   O O2     . DT  A 1 9  ? -0.918  1.816   5.171   1.00 4.36  ? 9  DT  C O2     1  
ATOM 269   N N3     . DT  A 1 9  ? -1.185  4.045   5.504   1.00 4.89  ? 9  DT  C N3     1  
ATOM 270   C C4     . DT  A 1 9  ? -1.176  5.199   6.259   1.00 5.28  ? 9  DT  C C4     1  
ATOM 271   O O4     . DT  A 1 9  ? -1.450  6.275   5.730   1.00 5.43  ? 9  DT  C O4     1  
ATOM 272   C C5     . DT  A 1 9  ? -0.797  5.029   7.647   1.00 5.49  ? 9  DT  C C5     1  
ATOM 273   C C7     . DT  A 1 9  ? -0.739  6.234   8.533   1.00 5.91  ? 9  DT  C C7     1  
ATOM 274   C C6     . DT  A 1 9  ? -0.484  3.795   8.076   1.00 5.31  ? 9  DT  C C6     1  
ATOM 275   H "H5'"  . DT  A 1 9  ? -2.383  1.328   10.459  1.00 5.51  ? 9  DT  C "H5'"  1  
ATOM 276   H "H5''" . DT  A 1 9  ? -1.484  0.355   11.639  1.00 5.60  ? 9  DT  C "H5''" 1  
ATOM 277   H "H4'"  . DT  A 1 9  ? -1.174  -0.896  9.759   1.00 4.97  ? 9  DT  C "H4'"  1  
ATOM 278   H "H3'"  . DT  A 1 9  ? 1.083   0.188   10.635  1.00 5.16  ? 9  DT  C "H3'"  1  
ATOM 279   H "H2'"  . DT  A 1 9  ? 1.043   2.239   9.407   1.00 5.21  ? 9  DT  C "H2'"  1  
ATOM 280   H "H2''" . DT  A 1 9  ? 2.021   1.247   8.340   1.00 4.76  ? 9  DT  C "H2''" 1  
ATOM 281   H "H1'"  . DT  A 1 9  ? 0.197   0.741   6.897   1.00 4.47  ? 9  DT  C "H1'"  1  
ATOM 282   H H3     . DT  A 1 9  ? -1.444  4.152   4.531   1.00 4.75  ? 9  DT  C H3     1  
ATOM 283   H H71    . DT  A 1 9  ? -0.164  6.000   9.429   1.00 5.99  ? 9  DT  C H71    1  
ATOM 284   H H72    . DT  A 1 9  ? -1.750  6.527   8.816   1.00 6.04  ? 9  DT  C H72    1  
ATOM 285   H H73    . DT  A 1 9  ? -0.260  7.055   8.000   1.00 6.06  ? 9  DT  C H73    1  
ATOM 286   H H6     . DT  A 1 9  ? -0.213  3.664   9.123   1.00 5.49  ? 9  DT  C H6     1  
ATOM 287   P P      . DA  A 1 10 ? 2.715   -1.346  8.826   1.00 4.43  ? 10 DA  C P      1  
ATOM 288   O OP1    . DA  A 1 10 ? 3.043   -2.685  9.376   1.00 4.39  ? 10 DA  C OP1    1  
ATOM 289   O OP2    . DA  A 1 10 ? 3.484   -0.157  9.274   1.00 4.66  ? 10 DA  C OP2    1  
ATOM 290   O "O5'"  . DA  A 1 10 ? 2.776   -1.433  7.242   1.00 4.06  ? 10 DA  C "O5'"  1  
ATOM 291   C "C5'"  . DA  A 1 10 ? 1.837   -2.263  6.570   1.00 3.83  ? 10 DA  C "C5'"  1  
ATOM 292   C "C4'"  . DA  A 1 10 ? 2.169   -2.377  5.104   1.00 3.50  ? 10 DA  C "C4'"  1  
ATOM 293   O "O4'"  . DA  A 1 10 ? 1.706   -1.179  4.425   1.00 3.59  ? 10 DA  C "O4'"  1  
ATOM 294   C "C3'"  . DA  A 1 10 ? 3.665   -2.438  4.828   1.00 3.38  ? 10 DA  C "C3'"  1  
ATOM 295   O "O3'"  . DA  A 1 10 ? 3.898   -3.156  3.622   1.00 3.05  ? 10 DA  C "O3'"  1  
ATOM 296   C "C2'"  . DA  A 1 10 ? 4.047   -0.972  4.733   1.00 3.59  ? 10 DA  C "C2'"  1  
ATOM 297   C "C1'"  . DA  A 1 10 ? 2.816   -0.355  4.075   1.00 3.64  ? 10 DA  C "C1'"  1  
ATOM 298   N N9     . DA  A 1 10 ? 2.529   1.029   4.470   1.00 3.99  ? 10 DA  C N9     1  
ATOM 299   C C8     . DA  A 1 10 ? 2.587   1.578   5.728   1.00 4.31  ? 10 DA  C C8     1  
ATOM 300   N N7     . DA  A 1 10 ? 2.328   2.864   5.758   1.00 4.59  ? 10 DA  C N7     1  
ATOM 301   C C5     . DA  A 1 10 ? 2.073   3.186   4.432   1.00 4.47  ? 10 DA  C C5     1  
ATOM 302   C C6     . DA  A 1 10 ? 1.741   4.405   3.796   1.00 4.68  ? 10 DA  C C6     1  
ATOM 303   N N6     . DA  A 1 10 ? 1.625   5.570   4.440   1.00 5.05  ? 10 DA  C N6     1  
ATOM 304   N N1     . DA  A 1 10 ? 1.541   4.383   2.459   1.00 4.52  ? 10 DA  C N1     1  
ATOM 305   C C2     . DA  A 1 10 ? 1.676   3.218   1.812   1.00 4.16  ? 10 DA  C C2     1  
ATOM 306   N N3     . DA  A 1 10 ? 1.992   2.011   2.296   1.00 3.92  ? 10 DA  C N3     1  
ATOM 307   C C4     . DA  A 1 10 ? 2.179   2.064   3.628   1.00 4.10  ? 10 DA  C C4     1  
ATOM 308   H "H5'"  . DA  A 1 10 ? 0.837   -1.842  6.676   1.00 3.96  ? 10 DA  C "H5'"  1  
ATOM 309   H "H5''" . DA  A 1 10 ? 1.851   -3.259  7.013   1.00 3.81  ? 10 DA  C "H5''" 1  
ATOM 310   H "H4'"  . DA  A 1 10 ? 1.728   -3.300  4.722   1.00 3.33  ? 10 DA  C "H4'"  1  
ATOM 311   H "H3'"  . DA  A 1 10 ? 4.190   -2.934  5.645   1.00 3.43  ? 10 DA  C "H3'"  1  
ATOM 312   H "H2'"  . DA  A 1 10 ? 4.246   -0.549  5.717   1.00 3.83  ? 10 DA  C "H2'"  1  
ATOM 313   H "H2''" . DA  A 1 10 ? 4.943   -0.833  4.129   1.00 3.50  ? 10 DA  C "H2''" 1  
ATOM 314   H "H1'"  . DA  A 1 10 ? 2.913   -0.384  2.988   1.00 3.48  ? 10 DA  C "H1'"  1  
ATOM 315   H H8     . DA  A 1 10 ? 2.829   1.004   6.610   1.00 4.34  ? 10 DA  C H8     1  
ATOM 316   H H61    . DA  A 1 10 ? 1.400   6.415   3.932   1.00 5.20  ? 10 DA  C H61    1  
ATOM 317   H H62    . DA  A 1 10 ? 1.777   5.613   5.438   1.00 5.19  ? 10 DA  C H62    1  
ATOM 318   H H2     . DA  A 1 10 ? 1.500   3.260   0.736   1.00 4.07  ? 10 DA  C H2     1  
ATOM 319   P P      . DT  A 1 11 ? 5.391   -3.315  3.068   1.00 2.90  ? 11 DT  C P      1  
ATOM 320   O OP1    . DT  A 1 11 ? 5.630   -4.739  2.687   1.00 2.64  ? 11 DT  C OP1    1  
ATOM 321   O OP2    . DT  A 1 11 ? 6.346   -2.639  3.977   1.00 3.10  ? 11 DT  C OP2    1  
ATOM 322   O "O5'"  . DT  A 1 11 ? 5.293   -2.447  1.743   1.00 2.91  ? 11 DT  C "O5'"  1  
ATOM 323   C "C5'"  . DT  A 1 11 ? 4.200   -2.644  0.849   1.00 2.80  ? 11 DT  C "C5'"  1  
ATOM 324   C "C4'"  . DT  A 1 11 ? 4.483   -1.977  -0.473  1.00 2.86  ? 11 DT  C "C4'"  1  
ATOM 325   O "O4'"  . DT  A 1 11 ? 4.163   -0.563  -0.356  1.00 3.15  ? 11 DT  C "O4'"  1  
ATOM 326   C "C3'"  . DT  A 1 11 ? 5.968   -2.031  -0.805  1.00 2.87  ? 11 DT  C "C3'"  1  
ATOM 327   O "O3'"  . DT  A 1 11 ? 6.189   -2.023  -2.207  1.00 2.91  ? 11 DT  C "O3'"  1  
ATOM 328   C "C2'"  . DT  A 1 11 ? 6.508   -0.787  -0.124  1.00 3.15  ? 11 DT  C "C2'"  1  
ATOM 329   C "C1'"  . DT  A 1 11 ? 5.362   0.204   -0.304  1.00 3.35  ? 11 DT  C "C1'"  1  
ATOM 330   N N1     . DT  A 1 11 ? 5.244   1.240   0.758   1.00 3.63  ? 11 DT  C N1     1  
ATOM 331   C C2     . DT  A 1 11 ? 4.918   2.535   0.377   1.00 3.92  ? 11 DT  C C2     1  
ATOM 332   O O2     . DT  A 1 11 ? 4.654   2.858   -0.771  1.00 3.95  ? 11 DT  C O2     1  
ATOM 333   N N3     . DT  A 1 11 ? 4.911   3.447   1.399   1.00 4.21  ? 11 DT  C N3     1  
ATOM 334   C C4     . DT  A 1 11 ? 5.174   3.212   2.729   1.00 4.26  ? 11 DT  C C4     1  
ATOM 335   O O4     . DT  A 1 11 ? 5.165   4.145   3.527   1.00 4.57  ? 11 DT  C O4     1  
ATOM 336   C C5     . DT  A 1 11 ? 5.478   1.840   3.066   1.00 3.96  ? 11 DT  C C5     1  
ATOM 337   C C7     . DT  A 1 11 ? 5.833   1.514   4.481   1.00 4.05  ? 11 DT  C C7     1  
ATOM 338   C C6     . DT  A 1 11 ? 5.490   0.926   2.081   1.00 3.65  ? 11 DT  C C6     1  
ATOM 339   H "H5'"  . DT  A 1 11 ? 3.294   -2.215  1.278   1.00 2.92  ? 11 DT  C "H5'"  1  
ATOM 340   H "H5''" . DT  A 1 11 ? 4.048   -3.710  0.685   1.00 2.62  ? 11 DT  C "H5''" 1  
ATOM 341   H "H4'"  . DT  A 1 11 ? 3.940   -2.503  -1.260  1.00 2.74  ? 11 DT  C "H4'"  1  
ATOM 342   H "H3'"  . DT  A 1 11 ? 6.413   -2.934  -0.390  1.00 2.71  ? 11 DT  C "H3'"  1  
ATOM 343   H "H2'"  . DT  A 1 11 ? 6.730   -0.974  0.926   1.00 3.15  ? 11 DT  C "H2'"  1  
ATOM 344   H "H2''" . DT  A 1 11 ? 7.425   -0.438  -0.596  1.00 3.24  ? 11 DT  C "H2''" 1  
ATOM 345   H "H1'"  . DT  A 1 11 ? 5.457   0.718   -1.264  1.00 3.46  ? 11 DT  C "H1'"  1  
ATOM 346   H H3     . DT  A 1 11 ? 4.713   4.408   1.152   1.00 4.44  ? 11 DT  C H3     1  
ATOM 347   H H71    . DT  A 1 11 ? 4.923   1.391   5.066   1.00 4.18  ? 11 DT  C H71    1  
ATOM 348   H H72    . DT  A 1 11 ? 6.411   0.591   4.509   1.00 4.22  ? 11 DT  C H72    1  
ATOM 349   H H73    . DT  A 1 11 ? 6.426   2.326   4.902   1.00 4.16  ? 11 DT  C H73    1  
ATOM 350   H H6     . DT  A 1 11 ? 5.697   -0.112  2.339   1.00 3.44  ? 11 DT  C H6     1  
ATOM 351   P P      . DC  A 1 12 ? 7.689   -1.923  -2.770  1.00 3.03  ? 12 DC  C P      1  
ATOM 352   O OP1    . DC  A 1 12 ? 7.892   -2.950  -3.833  1.00 2.99  ? 12 DC  C OP1    1  
ATOM 353   O OP2    . DC  A 1 12 ? 8.645   -1.855  -1.637  1.00 2.97  ? 12 DC  C OP2    1  
ATOM 354   O "O5'"  . DC  A 1 12 ? 7.599   -0.489  -3.440  1.00 3.38  ? 12 DC  C "O5'"  1  
ATOM 355   C "C5'"  . DC  A 1 12 ? 6.359   -0.083  -4.018  1.00 3.47  ? 12 DC  C "C5'"  1  
ATOM 356   C "C4'"  . DC  A 1 12 ? 6.511   1.235   -4.729  1.00 3.83  ? 12 DC  C "C4'"  1  
ATOM 357   O "O4'"  . DC  A 1 12 ? 6.404   2.308   -3.759  1.00 4.03  ? 12 DC  C "O4'"  1  
ATOM 358   C "C3'"  . DC  A 1 12 ? 7.893   1.381   -5.344  1.00 3.98  ? 12 DC  C "C3'"  1  
ATOM 359   O "O3'"  . DC  A 1 12 ? 7.837   2.244   -6.466  1.00 4.31  ? 12 DC  C "O3'"  1  
ATOM 360   C "C2'"  . DC  A 1 12 ? 8.707   1.970   -4.205  1.00 4.06  ? 12 DC  C "C2'"  1  
ATOM 361   C "C1'"  . DC  A 1 12 ? 7.686   2.882   -3.527  1.00 4.21  ? 12 DC  C "C1'"  1  
ATOM 362   N N1     . DC  A 1 12 ? 7.866   3.092   -2.074  1.00 4.22  ? 12 DC  C N1     1  
ATOM 363   C C2     . DC  A 1 12 ? 7.781   4.404   -1.568  1.00 4.57  ? 12 DC  C C2     1  
ATOM 364   O O2     . DC  A 1 12 ? 7.516   5.335   -2.345  1.00 4.81  ? 12 DC  C O2     1  
ATOM 365   N N3     . DC  A 1 12 ? 7.992   4.623   -0.248  1.00 4.65  ? 12 DC  C N3     1  
ATOM 366   C C4     . DC  A 1 12 ? 8.271   3.597   0.560   1.00 4.41  ? 12 DC  C C4     1  
ATOM 367   N N4     . DC  A 1 12 ? 8.496   3.865   1.851   1.00 4.56  ? 12 DC  C N4     1  
ATOM 368   C C5     . DC  A 1 12 ? 8.340   2.252   0.080   1.00 4.05  ? 12 DC  C C5     1  
ATOM 369   C C6     . DC  A 1 12 ? 8.129   2.048   -1.231  1.00 3.96  ? 12 DC  C C6     1  
ATOM 370   H "H5'"  . DC  A 1 12 ? 5.609   0.020   -3.234  1.00 3.42  ? 12 DC  C "H5'"  1  
ATOM 371   H "H5''" . DC  A 1 12 ? 6.025   -0.836  -4.731  1.00 3.35  ? 12 DC  C "H5''" 1  
ATOM 372   H "H4'"  . DC  A 1 12 ? 5.779   1.283   -5.538  1.00 3.88  ? 12 DC  C "H4'"  1  
ATOM 373   H "H3'"  . DC  A 1 12 ? 8.283   0.412   -5.658  1.00 3.82  ? 12 DC  C "H3'"  1  
ATOM 374   H "H2'"  . DC  A 1 12 ? 9.075   1.192   -3.537  1.00 3.84  ? 12 DC  C "H2'"  1  
ATOM 375   H "H2''" . DC  A 1 12 ? 9.571   2.519   -4.577  1.00 4.26  ? 12 DC  C "H2''" 1  
ATOM 376   H "H1'"  . DC  A 1 12 ? 7.688   3.862   -4.008  1.00 4.48  ? 12 DC  C "H1'"  1  
ATOM 377   H H41    . DC  A 1 12 ? 8.457   4.816   2.190   1.00 4.84  ? 12 DC  C H41    1  
ATOM 378   H H42    . DC  A 1 12 ? 8.716   3.118   2.495   1.00 4.42  ? 12 DC  C H42    1  
ATOM 379   H H5     . DC  A 1 12 ? 8.557   1.422   0.753   1.00 3.87  ? 12 DC  C H5     1  
ATOM 380   H H6     . DC  A 1 12 ? 8.169   1.034   -1.628  1.00 3.70  ? 12 DC  C H6     1  
ATOM 381   P P      . DT  A 1 13 ? 9.183   2.609   -7.245  1.00 4.57  ? 13 DT  C P      1  
ATOM 382   O OP1    . DT  A 1 13 ? 8.880   2.505   -8.697  1.00 4.73  ? 13 DT  C OP1    1  
ATOM 383   O OP2    . DT  A 1 13 ? 10.329  1.857   -6.675  1.00 4.41  ? 13 DT  C OP2    1  
ATOM 384   O "O5'"  . DT  A 1 13 ? 9.324   4.141   -6.863  1.00 4.91  ? 13 DT  C "O5'"  1  
ATOM 385   C "C5'"  . DT  A 1 13 ? 8.205   5.002   -7.029  1.00 5.05  ? 13 DT  C "C5'"  1  
ATOM 386   C "C4'"  . DT  A 1 13 ? 8.648   6.441   -7.035  1.00 5.46  ? 13 DT  C "C4'"  1  
ATOM 387   O "O4'"  . DT  A 1 13 ? 8.813   6.884   -5.663  1.00 5.48  ? 13 DT  C "O4'"  1  
ATOM 388   C "C3'"  . DT  A 1 13 ? 10.018  6.606   -7.678  1.00 5.68  ? 13 DT  C "C3'"  1  
ATOM 389   O "O3'"  . DT  A 1 13 ? 10.155  7.906   -8.225  1.00 6.08  ? 13 DT  C "O3'"  1  
ATOM 390   C "C2'"  . DT  A 1 13 ? 10.966  6.379   -6.514  1.00 5.58  ? 13 DT  C "C2'"  1  
ATOM 391   C "C1'"  . DT  A 1 13 ? 10.198  7.004   -5.354  1.00 5.59  ? 13 DT  C "C1'"  1  
ATOM 392   N N1     . DT  A 1 13 ? 10.454  6.401   -4.022  1.00 5.36  ? 13 DT  C N1     1  
ATOM 393   C C2     . DT  A 1 13 ? 10.534  7.252   -2.930  1.00 5.56  ? 13 DT  C C2     1  
ATOM 394   O O2     . DT  A 1 13 ? 10.349  8.456   -2.996  1.00 5.88  ? 13 DT  C O2     1  
ATOM 395   N N3     . DT  A 1 13 ? 10.842  6.636   -1.748  1.00 5.38  ? 13 DT  C N3     1  
ATOM 396   C C4     . DT  A 1 13 ? 11.069  5.294   -1.543  1.00 5.02  ? 13 DT  C C4     1  
ATOM 397   O O4     . DT  A 1 13 ? 11.390  4.897   -0.432  1.00 4.93  ? 13 DT  C O4     1  
ATOM 398   C C5     . DT  A 1 13 ? 10.948  4.457   -2.717  1.00 4.81  ? 13 DT  C C5     1  
ATOM 399   C C7     . DT  A 1 13 ? 11.248  2.996   -2.592  1.00 4.43  ? 13 DT  C C7     1  
ATOM 400   C C6     . DT  A 1 13 ? 10.639  5.040   -3.885  1.00 5.00  ? 13 DT  C C6     1  
ATOM 401   H "H5'"  . DT  A 1 13 ? 7.501   4.849   -6.211  1.00 4.88  ? 13 DT  C "H5'"  1  
ATOM 402   H "H5''" . DT  A 1 13 ? 7.709   4.779   -7.974  1.00 5.06  ? 13 DT  C "H5''" 1  
ATOM 403   H "H4'"  . DT  A 1 13 ? 7.933   7.027   -7.616  1.00 5.61  ? 13 DT  C "H4'"  1  
ATOM 404   H "H3'"  . DT  A 1 13 ? 10.167  5.869   -8.468  1.00 5.59  ? 13 DT  C "H3'"  1  
ATOM 405   H "H2'"  . DT  A 1 13 ? 11.157  5.318   -6.361  1.00 5.30  ? 13 DT  C "H2'"  1  
ATOM 406   H "H2''" . DT  A 1 13 ? 11.927  6.864   -6.683  1.00 5.80  ? 13 DT  C "H2''" 1  
ATOM 407   H "H1'"  . DT  A 1 13 ? 10.421  8.071   -5.287  1.00 5.89  ? 13 DT  C "H1'"  1  
ATOM 408   H H3     . DT  A 1 13 ? 10.921  7.239   -0.937  1.00 5.55  ? 13 DT  C H3     1  
ATOM 409   H H71    . DT  A 1 13 ? 10.445  2.505   -2.043  1.00 4.39  ? 13 DT  C H71    1  
ATOM 410   H H72    . DT  A 1 13 ? 11.330  2.555   -3.586  1.00 4.34  ? 13 DT  C H72    1  
ATOM 411   H H73    . DT  A 1 13 ? 12.188  2.862   -2.058  1.00 4.63  ? 13 DT  C H73    1  
ATOM 412   H H6     . DT  A 1 13 ? 10.525  4.408   -4.765  1.00 4.87  ? 13 DT  C H6     1  
ATOM 413   P P      . DT  A 1 14 ? 11.562  8.358   -8.838  1.00 6.39  ? 14 DT  C P      1  
ATOM 414   O OP1    . DT  A 1 14 ? 11.299  9.111   -10.091 1.00 6.68  ? 14 DT  C OP1    1  
ATOM 415   O OP2    . DT  A 1 14 ? 12.495  7.202   -8.855  1.00 6.17  ? 14 DT  C OP2    1  
ATOM 416   O "O5'"  . DT  A 1 14 ? 12.029  9.379   -7.716  1.00 6.61  ? 14 DT  C "O5'"  1  
ATOM 417   C "C5'"  . DT  A 1 14 ? 11.084  10.311  -7.203  1.00 6.76  ? 14 DT  C "C5'"  1  
ATOM 418   C "C4'"  . DT  A 1 14 ? 11.780  11.419  -6.456  1.00 7.05  ? 14 DT  C "C4'"  1  
ATOM 419   O "O4'"  . DT  A 1 14 ? 12.069  10.971  -5.108  1.00 6.86  ? 14 DT  C "O4'"  1  
ATOM 420   C "C3'"  . DT  A 1 14 ? 13.134  11.756  -7.065  1.00 7.28  ? 14 DT  C "C3'"  1  
ATOM 421   O "O3'"  . DT  A 1 14 ? 13.454  13.111  -6.785  1.00 7.65  ? 14 DT  C "O3'"  1  
ATOM 422   C "C2'"  . DT  A 1 14 ? 14.069  10.783  -6.368  1.00 7.02  ? 14 DT  C "C2'"  1  
ATOM 423   C "C1'"  . DT  A 1 14 ? 13.460  10.714  -4.969  1.00 6.87  ? 14 DT  C "C1'"  1  
ATOM 424   N N1     . DT  A 1 14 ? 13.647  9.438   -4.233  1.00 6.48  ? 14 DT  C N1     1  
ATOM 425   C C2     . DT  A 1 14 ? 13.874  9.520   -2.870  1.00 6.46  ? 14 DT  C C2     1  
ATOM 426   O O2     . DT  A 1 14 ? 13.872  10.572  -2.252  1.00 6.74  ? 14 DT  C O2     1  
ATOM 427   N N3     . DT  A 1 14 ? 14.103  8.318   -2.251  1.00 6.11  ? 14 DT  C N3     1  
ATOM 428   C C4     . DT  A 1 14 ? 14.120  7.071   -2.837  1.00 5.79  ? 14 DT  C C4     1  
ATOM 429   O O4     . DT  A 1 14 ? 14.381  6.080   -2.155  1.00 5.50  ? 14 DT  C O4     1  
ATOM 430   C C5     . DT  A 1 14 ? 13.853  7.053   -4.262  1.00 5.84  ? 14 DT  C C5     1  
ATOM 431   C C7     . DT  A 1 14 ? 13.891  5.743   -4.986  1.00 5.54  ? 14 DT  C C7     1  
ATOM 432   C C6     . DT  A 1 14 ? 13.624  8.221   -4.884  1.00 6.19  ? 14 DT  C C6     1  
ATOM 433   H "H5'"  . DT  A 1 14 ? 10.400  9.802   -6.525  1.00 6.53  ? 14 DT  C "H5'"  1  
ATOM 434   H "H5''" . DT  A 1 14 ? 10.514  10.742  -8.026  1.00 6.91  ? 14 DT  C "H5''" 1  
ATOM 435   H "H4'"  . DT  A 1 14 ? 11.162  12.316  -6.508  1.00 7.27  ? 14 DT  C "H4'"  1  
ATOM 436   H "H3'"  . DT  A 1 14 ? 13.125  11.606  -8.145  1.00 7.34  ? 14 DT  C "H3'"  1  
ATOM 437   H "H2'"  . DT  A 1 14 ? 14.072  9.813   -6.865  1.00 6.80  ? 14 DT  C "H2'"  1  
ATOM 438   H "H2''" . DT  A 1 14 ? 15.093  11.149  -6.362  1.00 7.19  ? 14 DT  C "H2''" 1  
ATOM 439   H "H1'"  . DT  A 1 14 ? 13.869  11.516  -4.349  1.00 7.08  ? 14 DT  C "H1'"  1  
ATOM 440   H H3     . DT  A 1 14 ? 14.293  8.359   -1.257  1.00 6.11  ? 14 DT  C H3     1  
ATOM 441   H H71    . DT  A 1 14 ? 13.879  5.921   -6.062  1.00 5.65  ? 14 DT  C H71    1  
ATOM 442   H H72    . DT  A 1 14 ? 14.801  5.206   -4.718  1.00 5.56  ? 14 DT  C H72    1  
ATOM 443   H H73    . DT  A 1 14 ? 13.023  5.147   -4.708  1.00 5.33  ? 14 DT  C H73    1  
ATOM 444   H H6     . DT  A 1 14 ? 13.407  8.207   -5.952  1.00 6.25  ? 14 DT  C H6     1  
ATOM 445   P P      . DA  A 1 15 ? 14.873  13.701  -7.233  1.00 7.95  ? 15 DA  C P      1  
ATOM 446   O OP1    . DA  A 1 15 ? 14.635  14.997  -7.917  1.00 8.35  ? 15 DA  C OP1    1  
ATOM 447   O OP2    . DA  A 1 15 ? 15.671  12.647  -7.909  1.00 7.77  ? 15 DA  C OP2    1  
ATOM 448   O "O5'"  . DA  A 1 15 ? 15.514  13.999  -5.811  1.00 7.97  ? 15 DA  C "O5'"  1  
ATOM 449   C "C5'"  . DA  A 1 15 ? 14.723  14.650  -4.822  1.00 8.07  ? 15 DA  C "C5'"  1  
ATOM 450   C "C4'"  . DA  A 1 15 ? 15.569  15.045  -3.639  1.00 8.17  ? 15 DA  C "C4'"  1  
ATOM 451   O "O4'"  . DA  A 1 15 ? 15.754  13.886  -2.786  1.00 7.81  ? 15 DA  C "O4'"  1  
ATOM 452   C "C3'"  . DA  A 1 15 ? 16.974  15.470  -4.043  1.00 8.38  ? 15 DA  C "C3'"  1  
ATOM 453   O "O3'"  . DA  A 1 15 ? 17.499  16.369  -3.077  1.00 8.63  ? 15 DA  C "O3'"  1  
ATOM 454   C "C2'"  . DA  A 1 15 ? 17.730  14.154  -4.067  1.00 8.04  ? 15 DA  C "C2'"  1  
ATOM 455   C "C1'"  . DA  A 1 15 ? 17.085  13.398  -2.911  1.00 7.73  ? 15 DA  C "C1'"  1  
ATOM 456   N N9     . DA  A 1 15 ? 17.047  11.939  -3.049  1.00 7.31  ? 15 DA  C N9     1  
ATOM 457   C C8     . DA  A 1 15 ? 16.740  11.188  -4.156  1.00 7.14  ? 15 DA  C C8     1  
ATOM 458   N N7     . DA  A 1 15 ? 16.843  9.893   -3.962  1.00 6.76  ? 15 DA  C N7     1  
ATOM 459   C C5     . DA  A 1 15 ? 17.238  9.783   -2.635  1.00 6.68  ? 15 DA  C C5     1  
ATOM 460   C C6     . DA  A 1 15 ? 17.524  8.668   -1.818  1.00 6.35  ? 15 DA  C C6     1  
ATOM 461   N N6     . DA  A 1 15 ? 17.468  7.403   -2.242  1.00 6.00  ? 15 DA  C N6     1  
ATOM 462   N N1     . DA  A 1 15 ? 17.882  8.903   -0.535  1.00 6.40  ? 15 DA  C N1     1  
ATOM 463   C C2     . DA  A 1 15 ? 17.953  10.174  -0.114  1.00 6.76  ? 15 DA  C C2     1  
ATOM 464   N N3     . DA  A 1 15 ? 17.716  11.302  -0.788  1.00 7.09  ? 15 DA  C N3     1  
ATOM 465   C C4     . DA  A 1 15 ? 17.357  11.034  -2.057  1.00 7.03  ? 15 DA  C C4     1  
ATOM 466   H "H5'"  . DA  A 1 15 ? 13.934  13.977  -4.486  1.00 7.82  ? 15 DA  C "H5'"  1  
ATOM 467   H "H5''" . DA  A 1 15 ? 14.269  15.545  -5.248  1.00 8.33  ? 15 DA  C "H5''" 1  
ATOM 468   H "H4'"  . DA  A 1 15 ? 15.096  15.894  -3.142  1.00 8.38  ? 15 DA  C "H4'"  1  
ATOM 469   H "H3'"  . DA  A 1 15 ? 16.970  15.954  -5.020  1.00 8.58  ? 15 DA  C "H3'"  1  
ATOM 470   H "H2'"  . DA  A 1 15 ? 17.601  13.640  -5.020  1.00 7.94  ? 15 DA  C "H2'"  1  
ATOM 471   H "H2''" . DA  A 1 15 ? 18.798  14.305  -3.918  1.00 8.13  ? 15 DA  C "H2''" 1  
ATOM 472   H "H1'"  . DA  A 1 15 ? 17.600  13.633  -1.977  1.00 7.79  ? 15 DA  C "H1'"  1  
ATOM 473   H H8     . DA  A 1 15 ? 16.446  11.622  -5.099  1.00 7.30  ? 15 DA  C H8     1  
ATOM 474   H H61    . DA  A 1 15 ? 17.695  6.646   -1.613  1.00 5.78  ? 15 DA  C H61    1  
ATOM 475   H H62    . DA  A 1 15 ? 17.208  7.208   -3.198  1.00 5.98  ? 15 DA  C H62    1  
ATOM 476   H H2     . DA  A 1 15 ? 18.244  10.304  0.929   1.00 6.81  ? 15 DA  C H2     1  
ATOM 477   P P      . DT  A 1 16 ? 18.999  16.908  -3.224  1.00 8.87  ? 16 DT  C P      1  
ATOM 478   O OP1    . DT  A 1 16 ? 18.967  18.379  -3.032  1.00 9.30  ? 16 DT  C OP1    1  
ATOM 479   O OP2    . DT  A 1 16 ? 19.624  16.339  -4.447  1.00 8.79  ? 16 DT  C OP2    1  
ATOM 480   O "O5'"  . DT  A 1 16 ? 19.675  16.245  -1.949  1.00 8.65  ? 16 DT  C "O5'"  1  
ATOM 481   C "C5'"  . DT  A 1 16 ? 18.987  16.284  -0.703  1.00 8.59  ? 16 DT  C "C5'"  1  
ATOM 482   C "C4'"  . DT  A 1 16 ? 19.905  15.890  0.427   1.00 8.49  ? 16 DT  C "C4'"  1  
ATOM 483   O "O4'"  . DT  A 1 16 ? 19.994  14.444  0.475   1.00 8.07  ? 16 DT  C "O4'"  1  
ATOM 484   C "C3'"  . DT  A 1 16 ? 21.335  16.371  0.216   1.00 8.71  ? 16 DT  C "C3'"  1  
ATOM 485   O "O3'"  . DT  A 1 16 ? 21.977  16.538  1.476   1.00 8.76  ? 16 DT  C "O3'"  1  
ATOM 486   C "C2'"  . DT  A 1 16 ? 21.951  15.246  -0.597  1.00 8.42  ? 16 DT  C "C2'"  1  
ATOM 487   C "C1'"  . DT  A 1 16 ? 21.262  14.018  -0.007  1.00 8.01  ? 16 DT  C "C1'"  1  
ATOM 488   N N1     . DT  A 1 16 ? 21.065  12.871  -0.928  1.00 7.70  ? 16 DT  C N1     1  
ATOM 489   C C2     . DT  A 1 16 ? 21.259  11.605  -0.406  1.00 7.32  ? 16 DT  C C2     1  
ATOM 490   O O2     . DT  A 1 16 ? 21.532  11.398  0.765   1.00 7.25  ? 16 DT  C O2     1  
ATOM 491   N N3     . DT  A 1 16 ? 21.121  10.583  -1.309  1.00 7.06  ? 16 DT  C N3     1  
ATOM 492   C C4     . DT  A 1 16 ? 20.811  10.691  -2.647  1.00 7.14  ? 16 DT  C C4     1  
ATOM 493   O O4     . DT  A 1 16 ? 20.764  9.679   -3.345  1.00 6.91  ? 16 DT  C O4     1  
ATOM 494   C C5     . DT  A 1 16 ? 20.599  12.043  -3.126  1.00 7.54  ? 16 DT  C C5     1  
ATOM 495   C C7     . DT  A 1 16 ? 20.295  12.254  -4.576  1.00 7.68  ? 16 DT  C C7     1  
ATOM 496   C C6     . DT  A 1 16 ? 20.727  13.057  -2.253  1.00 7.79  ? 16 DT  C C6     1  
ATOM 497   H "H5'"  . DT  A 1 16 ? 18.143  15.596  -0.732  1.00 8.35  ? 16 DT  C "H5'"  1  
ATOM 498   H "H5''" . DT  A 1 16 ? 18.616  17.293  -0.522  1.00 8.87  ? 16 DT  C "H5''" 1  
ATOM 499   H "H4'"  . DT  A 1 16 ? 19.536  16.345  1.347   1.00 8.60  ? 16 DT  C "H4'"  1  
ATOM 500   H "H3'"  . DT  A 1 16 ? 21.353  17.318  -0.324  1.00 9.00  ? 16 DT  C "H3'"  1  
ATOM 501   H "H2'"  . DT  A 1 16 ? 21.742  15.367  -1.660  1.00 8.48  ? 16 DT  C "H2'"  1  
ATOM 502   H "H2''" . DT  A 1 16 ? 23.032  15.216  -0.478  1.00 8.46  ? 16 DT  C "H2''" 1  
ATOM 503   H "H1'"  . DT  A 1 16 ? 21.824  13.657  0.857   1.00 7.92  ? 16 DT  C "H1'"  1  
ATOM 504   H H3     . DT  A 1 16 ? 21.275  9.647   -0.952  1.00 6.79  ? 16 DT  C H3     1  
ATOM 505   H H71    . DT  A 1 16 ? 19.256  11.992  -4.773  1.00 7.73  ? 16 DT  C H71    1  
ATOM 506   H H72    . DT  A 1 16 ? 20.461  13.300  -4.835  1.00 7.96  ? 16 DT  C H72    1  
ATOM 507   H H73    . DT  A 1 16 ? 20.948  11.624  -5.180  1.00 7.57  ? 16 DT  C H73    1  
ATOM 508   H H6     . DT  A 1 16 ? 20.551  14.072  -2.608  1.00 8.09  ? 16 DT  C H6     1  
ATOM 509   P P      . DC  A 1 17 ? 23.509  17.009  1.536   1.00 8.97  ? 17 DC  C P      1  
ATOM 510   O OP1    . DC  A 1 17 ? 23.590  18.134  2.501   1.00 9.29  ? 17 DC  C OP1    1  
ATOM 511   O OP2    . DC  A 1 17 ? 24.030  17.184  0.156   1.00 9.08  ? 17 DC  C OP2    1  
ATOM 512   O "O5'"  . DC  A 1 17 ? 24.209  15.738  2.184   1.00 8.62  ? 17 DC  C "O5'"  1  
ATOM 513   C "C5'"  . DC  A 1 17 ? 23.627  15.128  3.332   1.00 8.41  ? 17 DC  C "C5'"  1  
ATOM 514   C "C4'"  . DC  A 1 17 ? 24.524  14.043  3.877   1.00 8.15  ? 17 DC  C "C4'"  1  
ATOM 515   O "O4'"  . DC  A 1 17 ? 24.394  12.867  3.042   1.00 7.79  ? 17 DC  C "O4'"  1  
ATOM 516   C "C3'"  . DC  A 1 17 ? 26.006  14.400  3.831   1.00 8.34  ? 17 DC  C "C3'"  1  
ATOM 517   O "O3'"  . DC  A 1 17 ? 26.709  13.682  4.847   1.00 8.19  ? 17 DC  C "O3'"  1  
ATOM 518   C "C2'"  . DC  A 1 17 ? 26.414  13.953  2.438   1.00 8.23  ? 17 DC  C "C2'"  1  
ATOM 519   C "C1'"  . DC  A 1 17 ? 25.560  12.705  2.243   1.00 7.81  ? 17 DC  C "C1'"  1  
ATOM 520   N N1     . DC  A 1 17 ? 25.151  12.414  0.854   1.00 7.71  ? 17 DC  C N1     1  
ATOM 521   C C2     . DC  A 1 17 ? 25.165  11.080  0.424   1.00 7.34  ? 17 DC  C C2     1  
ATOM 522   O O2     . DC  A 1 17 ? 25.467  10.189  1.232   1.00 7.09  ? 17 DC  C O2     1  
ATOM 523   N N3     . DC  A 1 17 ? 24.849  10.793  -0.859  1.00 7.27  ? 17 DC  C N3     1  
ATOM 524   C C4     . DC  A 1 17 ? 24.524  11.774  -1.701  1.00 7.56  ? 17 DC  C C4     1  
ATOM 525   N N4     . DC  A 1 17 ? 24.249  11.440  -2.966  1.00 7.51  ? 17 DC  C N4     1  
ATOM 526   C C5     . DC  A 1 17 ? 24.475  13.141  -1.286  1.00 7.93  ? 17 DC  C C5     1  
ATOM 527   C C6     . DC  A 1 17 ? 24.790  13.411  -0.009  1.00 7.99  ? 17 DC  C C6     1  
ATOM 528   H "H5'"  . DC  A 1 17 ? 22.664  14.692  3.064   1.00 8.22  ? 17 DC  C "H5'"  1  
ATOM 529   H "H5''" . DC  A 1 17 ? 23.471  15.881  4.105   1.00 8.63  ? 17 DC  C "H5''" 1  
ATOM 530   H "H4'"  . DC  A 1 17 ? 24.261  13.874  4.922   1.00 8.11  ? 17 DC  C "H4'"  1  
ATOM 531   H "H3'"  . DC  A 1 17 ? 26.157  15.470  3.975   1.00 8.66  ? 17 DC  C "H3'"  1  
ATOM 532   H "H2'"  . DC  A 1 17 ? 26.198  14.722  1.697   1.00 8.44  ? 17 DC  C "H2'"  1  
ATOM 533   H "H2''" . DC  A 1 17 ? 27.481  13.738  2.386   1.00 8.23  ? 17 DC  C "H2''" 1  
ATOM 534   H "H1'"  . DC  A 1 17 ? 26.089  11.829  2.625   1.00 7.59  ? 17 DC  C "H1'"  1  
ATOM 535   H H41    . DC  A 1 17 ? 24.300  10.474  -3.257  1.00 7.27  ? 17 DC  C H41    1  
ATOM 536   H H42    . DC  A 1 17 ? 24.004  12.154  -3.638  1.00 7.74  ? 17 DC  C H42    1  
ATOM 537   H H5     . DC  A 1 17 ? 24.195  13.933  -1.981  1.00 8.17  ? 17 DC  C H5     1  
ATOM 538   H H6     . DC  A 1 17 ? 24.752  14.442  0.343   1.00 8.28  ? 17 DC  C H6     1  
ATOM 539   P P      . DG  A 1 18 ? 28.293  13.881  5.018   1.00 8.34  ? 18 DG  C P      1  
ATOM 540   O OP1    . DG  A 1 18 ? 28.555  14.138  6.458   1.00 8.46  ? 18 DG  C OP1    1  
ATOM 541   O OP2    . DG  A 1 18 ? 28.782  14.845  3.999   1.00 8.65  ? 18 DG  C OP2    1  
ATOM 542   O "O5'"  . DG  A 1 18 ? 28.864  12.439  4.662   1.00 7.96  ? 18 DG  C "O5'"  1  
ATOM 543   C "C5'"  . DG  A 1 18 ? 28.358  11.285  5.331   1.00 7.61  ? 18 DG  C "C5'"  1  
ATOM 544   C "C4'"  . DG  A 1 18 ? 29.225  10.082  5.044   1.00 7.32  ? 18 DG  C "C4'"  1  
ATOM 545   O "O4'"  . DG  A 1 18 ? 28.936  9.611   3.707   1.00 7.15  ? 18 DG  C "O4'"  1  
ATOM 546   C "C3'"  . DG  A 1 18 ? 30.721  10.384  5.046   1.00 7.52  ? 18 DG  C "C3'"  1  
ATOM 547   O "O3'"  . DG  A 1 18 ? 31.483  9.211   5.338   1.00 7.25  ? 18 DG  C "O3'"  1  
ATOM 548   C "C2'"  . DG  A 1 18 ? 30.969  10.832  3.618   1.00 7.65  ? 18 DG  C "C2'"  1  
ATOM 549   C "C1'"  . DG  A 1 18 ? 30.008  9.942   2.835   1.00 7.32  ? 18 DG  C "C1'"  1  
ATOM 550   N N9     . DG  A 1 18 ? 29.451  10.526  1.616   1.00 7.45  ? 18 DG  C N9     1  
ATOM 551   C C8     . DG  A 1 18 ? 29.114  11.837  1.382   1.00 7.80  ? 18 DG  C C8     1  
ATOM 552   N N7     . DG  A 1 18 ? 28.683  12.048  0.167   1.00 7.85  ? 18 DG  C N7     1  
ATOM 553   C C5     . DG  A 1 18 ? 28.730  10.797  -0.435  1.00 7.52  ? 18 DG  C C5     1  
ATOM 554   C C6     . DG  A 1 18 ? 28.386  10.390  -1.756  1.00 7.43  ? 18 DG  C C6     1  
ATOM 555   O O6     . DG  A 1 18 ? 27.959  11.080  -2.692  1.00 7.63  ? 18 DG  C O6     1  
ATOM 556   N N1     . DG  A 1 18 ? 28.586  9.025   -1.939  1.00 7.08  ? 18 DG  C N1     1  
ATOM 557   C C2     . DG  A 1 18 ? 29.054  8.160   -0.979  1.00 6.84  ? 18 DG  C C2     1  
ATOM 558   N N2     . DG  A 1 18 ? 29.180  6.876   -1.341  1.00 6.52  ? 18 DG  C N2     1  
ATOM 559   N N3     . DG  A 1 18 ? 29.378  8.525   0.249   1.00 6.92  ? 18 DG  C N3     1  
ATOM 560   C C4     . DG  A 1 18 ? 29.193  9.846   0.450   1.00 7.27  ? 18 DG  C C4     1  
ATOM 561   H "H5'"  . DG  A 1 18 ? 27.343  11.081  4.989   1.00 7.47  ? 18 DG  C "H5'"  1  
ATOM 562   H "H5''" . DG  A 1 18 ? 28.342  11.463  6.406   1.00 7.70  ? 18 DG  C "H5''" 1  
ATOM 563   H "H4'"  . DG  A 1 18 ? 29.043  9.338   5.821   1.00 7.13  ? 18 DG  C "H4'"  1  
ATOM 564   H "H3'"  . DG  A 1 18 ? 30.965  11.164  5.768   1.00 7.77  ? 18 DG  C "H3'"  1  
ATOM 565   H "HO3'" . DG  A 1 18 ? 31.731  9.253   6.266   1.00 7.26  ? 18 DG  C "HO3'" 1  
ATOM 566   H "H2'"  . DG  A 1 18 ? 30.747  11.892  3.491   1.00 7.93  ? 18 DG  C "H2'"  1  
ATOM 567   H "H2''" . DG  A 1 18 ? 32.008  10.678  3.328   1.00 7.69  ? 18 DG  C "H2''" 1  
ATOM 568   H "H1'"  . DG  A 1 18 ? 30.502  9.006   2.563   1.00 7.10  ? 18 DG  C "H1'"  1  
ATOM 569   H H8     . DG  A 1 18 ? 29.201  12.615  2.125   1.00 8.03  ? 18 DG  C H8     1  
ATOM 570   H H1     . DG  A 1 18 ? 28.370  8.640   -2.849  1.00 7.02  ? 18 DG  C H1     1  
ATOM 571   H H21    . DG  A 1 18 ? 28.938  6.573   -2.276  1.00 6.48  ? 18 DG  C H21    1  
ATOM 572   H H22    . DG  A 1 18 ? 29.519  6.198   -0.674  1.00 6.34  ? 18 DG  C H22    1  
ATOM 573   O "O5'"  . DC  B 1 1  ? 28.022  4.559   -9.117  1.00 6.69  ? 1  DC  D "O5'"  1  
ATOM 574   C "C5'"  . DC  B 1 1  ? 29.177  3.736   -8.926  1.00 6.58  ? 1  DC  D "C5'"  1  
ATOM 575   C "C4'"  . DC  B 1 1  ? 29.131  3.020   -7.596  1.00 6.22  ? 1  DC  D "C4'"  1  
ATOM 576   O "O4'"  . DC  B 1 1  ? 29.367  3.993   -6.547  1.00 6.31  ? 1  DC  D "O4'"  1  
ATOM 577   C "C3'"  . DC  B 1 1  ? 27.778  2.400   -7.259  1.00 5.89  ? 1  DC  D "C3'"  1  
ATOM 578   O "O3'"  . DC  B 1 1  ? 27.920  1.306   -6.347  1.00 5.54  ? 1  DC  D "O3'"  1  
ATOM 579   C "C2'"  . DC  B 1 1  ? 27.039  3.548   -6.600  1.00 5.98  ? 1  DC  D "C2'"  1  
ATOM 580   C "C1'"  . DC  B 1 1  ? 28.152  4.268   -5.852  1.00 6.16  ? 1  DC  D "C1'"  1  
ATOM 581   N N1     . DC  B 1 1  ? 27.973  5.729   -5.768  1.00 6.49  ? 1  DC  D N1     1  
ATOM 582   C C2     . DC  B 1 1  ? 28.252  6.373   -4.557  1.00 6.55  ? 1  DC  D C2     1  
ATOM 583   O O2     . DC  B 1 1  ? 28.685  5.706   -3.606  1.00 6.34  ? 1  DC  D O2     1  
ATOM 584   N N3     . DC  B 1 1  ? 28.043  7.707   -4.452  1.00 6.87  ? 1  DC  D N3     1  
ATOM 585   C C4     . DC  B 1 1  ? 27.580  8.393   -5.500  1.00 7.09  ? 1  DC  D C4     1  
ATOM 586   N N4     . DC  B 1 1  ? 27.380  9.705   -5.347  1.00 7.40  ? 1  DC  D N4     1  
ATOM 587   C C5     . DC  B 1 1  ? 27.301  7.765   -6.750  1.00 7.03  ? 1  DC  D C5     1  
ATOM 588   C C6     . DC  B 1 1  ? 27.515  6.445   -6.840  1.00 6.74  ? 1  DC  D C6     1  
ATOM 589   H "H5'"  . DC  B 1 1  ? 30.073  4.355   -8.964  1.00 6.83  ? 1  DC  D "H5'"  1  
ATOM 590   H "H5''" . DC  B 1 1  ? 29.228  2.994   -9.723  1.00 6.54  ? 1  DC  D "H5''" 1  
ATOM 591   H "H4'"  . DC  B 1 1  ? 29.864  2.212   -7.617  1.00 6.13  ? 1  DC  D "H4'"  1  
ATOM 592   H "H3'"  . DC  B 1 1  ? 27.271  2.054   -8.159  1.00 5.89  ? 1  DC  D "H3'"  1  
ATOM 593   H "H2'"  . DC  B 1 1  ? 26.557  4.185   -7.340  1.00 6.17  ? 1  DC  D "H2'"  1  
ATOM 594   H "H2''" . DC  B 1 1  ? 26.265  3.186   -5.926  1.00 5.73  ? 1  DC  D "H2''" 1  
ATOM 595   H "H1'"  . DC  B 1 1  ? 28.253  3.875   -4.839  1.00 5.97  ? 1  DC  D "H1'"  1  
ATOM 596   H H41    . DC  B 1 1  ? 27.575  10.153  -4.463  1.00 7.47  ? 1  DC  D H41    1  
ATOM 597   H H42    . DC  B 1 1  ? 27.030  10.254  -6.120  1.00 7.58  ? 1  DC  D H42    1  
ATOM 598   H H5     . DC  B 1 1  ? 26.924  8.336   -7.598  1.00 7.23  ? 1  DC  D H5     1  
ATOM 599   H H6     . DC  B 1 1  ? 27.317  5.936   -7.783  1.00 6.71  ? 1  DC  D H6     1  
ATOM 600   H "HO5'" . DC  B 1 1  ? 28.335  5.405   -9.453  1.00 6.83  ? 1  DC  D "HO5'" 1  
ATOM 601   P P      . DG  B 1 2  ? 26.610  0.532   -5.829  1.00 5.16  ? 2  DG  D P      1  
ATOM 602   O OP1    . DG  B 1 2  ? 26.871  -0.932  -5.773  1.00 4.91  ? 2  DG  D OP1    1  
ATOM 603   O OP2    . DG  B 1 2  ? 25.458  1.035   -6.615  1.00 5.20  ? 2  DG  D OP2    1  
ATOM 604   O "O5'"  . DG  B 1 2  ? 26.456  1.068   -4.339  1.00 5.09  ? 2  DG  D "O5'"  1  
ATOM 605   C "C5'"  . DG  B 1 2  ? 27.502  0.855   -3.398  1.00 5.02  ? 2  DG  D "C5'"  1  
ATOM 606   C "C4'"  . DG  B 1 2  ? 26.987  0.986   -1.984  1.00 4.86  ? 2  DG  D "C4'"  1  
ATOM 607   O "O4'"  . DG  B 1 2  ? 26.870  2.393   -1.655  1.00 5.18  ? 2  DG  D "O4'"  1  
ATOM 608   C "C3'"  . DG  B 1 2  ? 25.585  0.420   -1.782  1.00 4.60  ? 2  DG  D "C3'"  1  
ATOM 609   O "O3'"  . DG  B 1 2  ? 25.431  -0.004  -0.428  1.00 4.38  ? 2  DG  D "O3'"  1  
ATOM 610   C "C2'"  . DG  B 1 2  ? 24.693  1.592   -2.143  1.00 4.85  ? 2  DG  D "C2'"  1  
ATOM 611   C "C1'"  . DG  B 1 2  ? 25.499  2.779   -1.631  1.00 5.17  ? 2  DG  D "C1'"  1  
ATOM 612   N N9     . DG  B 1 2  ? 25.338  4.015   -2.395  1.00 5.54  ? 2  DG  D N9     1  
ATOM 613   C C8     . DG  B 1 2  ? 25.125  4.141   -3.746  1.00 5.68  ? 2  DG  D C8     1  
ATOM 614   N N7     . DG  B 1 2  ? 24.967  5.379   -4.131  1.00 6.03  ? 2  DG  D N7     1  
ATOM 615   C C5     . DG  B 1 2  ? 25.094  6.120   -2.963  1.00 6.13  ? 2  DG  D C5     1  
ATOM 616   C C6     . DG  B 1 2  ? 25.013  7.528   -2.745  1.00 6.49  ? 2  DG  D C6     1  
ATOM 617   O O6     . DG  B 1 2  ? 24.797  8.430   -3.569  1.00 6.78  ? 2  DG  D O6     1  
ATOM 618   N N1     . DG  B 1 2  ? 25.207  7.849   -1.406  1.00 6.50  ? 2  DG  D N1     1  
ATOM 619   C C2     . DG  B 1 2  ? 25.448  6.942   -0.403  1.00 6.22  ? 2  DG  D C2     1  
ATOM 620   N N2     . DG  B 1 2  ? 25.619  7.449   0.827   1.00 6.33  ? 2  DG  D N2     1  
ATOM 621   N N3     . DG  B 1 2  ? 25.519  5.633   -0.589  1.00 5.87  ? 2  DG  D N3     1  
ATOM 622   C C4     . DG  B 1 2  ? 25.335  5.295   -1.884  1.00 5.84  ? 2  DG  D C4     1  
ATOM 623   H "H5'"  . DG  B 1 2  ? 28.290  1.591   -3.557  1.00 5.28  ? 2  DG  D "H5'"  1  
ATOM 624   H "H5''" . DG  B 1 2  ? 27.917  -0.144  -3.533  1.00 4.84  ? 2  DG  D "H5''" 1  
ATOM 625   H "H4'"  . DG  B 1 2  ? 27.659  0.435   -1.323  1.00 4.72  ? 2  DG  D "H4'"  1  
ATOM 626   H "H3'"  . DG  B 1 2  ? 25.415  -0.431  -2.441  1.00 4.44  ? 2  DG  D "H3'"  1  
ATOM 627   H "H2'"  . DG  B 1 2  ? 24.520  1.643   -3.217  1.00 4.96  ? 2  DG  D "H2'"  1  
ATOM 628   H "H2''" . DG  B 1 2  ? 23.721  1.518   -1.657  1.00 4.72  ? 2  DG  D "H2''" 1  
ATOM 629   H "H1'"  . DG  B 1 2  ? 25.240  2.990   -0.591  1.00 5.14  ? 2  DG  D "H1'"  1  
ATOM 630   H H8     . DG  B 1 2  ? 25.088  3.300   -4.422  1.00 5.54  ? 2  DG  D H8     1  
ATOM 631   H H1     . DG  B 1 2  ? 25.166  8.827   -1.153  1.00 6.76  ? 2  DG  D H1     1  
ATOM 632   H H21    . DG  B 1 2  ? 25.569  8.447   0.986   1.00 6.61  ? 2  DG  D H21    1  
ATOM 633   H H22    . DG  B 1 2  ? 25.801  6.831   1.604   1.00 6.15  ? 2  DG  D H22    1  
ATOM 634   P P      . DA  B 1 3  ? 24.021  -0.577  0.082   1.00 4.12  ? 3  DA  D P      1  
ATOM 635   O OP1    . DA  B 1 3  ? 24.299  -1.892  0.715   1.00 3.78  ? 3  DA  D OP1    1  
ATOM 636   O OP2    . DA  B 1 3  ? 23.017  -0.487  -1.009  1.00 4.16  ? 3  DA  D OP2    1  
ATOM 637   O "O5'"  . DA  B 1 3  ? 23.642  0.472   1.216   1.00 4.32  ? 3  DA  D "O5'"  1  
ATOM 638   C "C5'"  . DA  B 1 3  ? 24.638  0.847   2.164   1.00 4.41  ? 3  DA  D "C5'"  1  
ATOM 639   C "C4'"  . DA  B 1 3  ? 24.074  1.742   3.238   1.00 4.62  ? 3  DA  D "C4'"  1  
ATOM 640   O "O4'"  . DA  B 1 3  ? 23.925  3.084   2.705   1.00 4.98  ? 3  DA  D "O4'"  1  
ATOM 641   C "C3'"  . DA  B 1 3  ? 22.676  1.364   3.721   1.00 4.48  ? 3  DA  D "C3'"  1  
ATOM 642   O "O3'"  . DA  B 1 3  ? 22.515  1.824   5.061   1.00 4.62  ? 3  DA  D "O3'"  1  
ATOM 643   C "C2'"  . DA  B 1 3  ? 21.773  2.090   2.744   1.00 4.65  ? 3  DA  D "C2'"  1  
ATOM 644   C "C1'"  . DA  B 1 3  ? 22.549  3.376   2.478   1.00 5.03  ? 3  DA  D "C1'"  1  
ATOM 645   N N9     . DA  B 1 3  ? 22.389  3.933   1.131   1.00 5.21  ? 3  DA  D N9     1  
ATOM 646   C C8     . DA  B 1 3  ? 22.357  3.264   -0.067  1.00 5.09  ? 3  DA  D C8     1  
ATOM 647   N N7     . DA  B 1 3  ? 22.132  4.041   -1.101  1.00 5.35  ? 3  DA  D N7     1  
ATOM 648   C C5     . DA  B 1 3  ? 22.024  5.311   -0.550  1.00 5.64  ? 3  DA  D C5     1  
ATOM 649   C C6     . DA  B 1 3  ? 21.781  6.580   -1.122  1.00 6.00  ? 3  DA  D C6     1  
ATOM 650   N N6     . DA  B 1 3  ? 21.580  6.781   -2.427  1.00 6.14  ? 3  DA  D N6     1  
ATOM 651   N N1     . DA  B 1 3  ? 21.744  7.648   -0.294  1.00 6.24  ? 3  DA  D N1     1  
ATOM 652   C C2     . DA  B 1 3  ? 21.930  7.446   1.018   1.00 6.14  ? 3  DA  D C2     1  
ATOM 653   N N3     . DA  B 1 3  ? 22.157  6.304   1.674   1.00 5.82  ? 3  DA  D N3     1  
ATOM 654   C C4     . DA  B 1 3  ? 22.194  5.263   0.823   1.00 5.57  ? 3  DA  D C4     1  
ATOM 655   H "H5'"  . DA  B 1 3  ? 25.443  1.374   1.650   1.00 4.60  ? 3  DA  D "H5'"  1  
ATOM 656   H "H5''" . DA  B 1 3  ? 25.047  -0.049  2.631   1.00 4.18  ? 3  DA  D "H5''" 1  
ATOM 657   H "H4'"  . DA  B 1 3  ? 24.737  1.691   4.103   1.00 4.63  ? 3  DA  D "H4'"  1  
ATOM 658   H "H3'"  . DA  B 1 3  ? 22.528  0.285   3.691   1.00 4.20  ? 3  DA  D "H3'"  1  
ATOM 659   H "H2'"  . DA  B 1 3  ? 21.619  1.506   1.836   1.00 4.51  ? 3  DA  D "H2'"  1  
ATOM 660   H "H2''" . DA  B 1 3  ? 20.794  2.288   3.176   1.00 4.69  ? 3  DA  D "H2''" 1  
ATOM 661   H "H1'"  . DA  B 1 3  ? 22.260  4.145   3.198   1.00 5.23  ? 3  DA  D "H1'"  1  
ATOM 662   H H8     . DA  B 1 3  ? 22.503  2.198   -0.150  1.00 4.83  ? 3  DA  D H8     1  
ATOM 663   H H61    . DA  B 1 3  ? 21.400  7.711   -2.779  1.00 6.41  ? 3  DA  D H61    1  
ATOM 664   H H62    . DA  B 1 3  ? 21.597  5.998   -3.066  1.00 6.00  ? 3  DA  D H62    1  
ATOM 665   H H2     . DA  B 1 3  ? 21.893  8.344   1.638   1.00 6.37  ? 3  DA  D H2     1  
ATOM 666   P P      . DT  B 1 4  ? 21.104  1.664   5.809   1.00 4.60  ? 4  DT  D P      1  
ATOM 667   O OP1    . DT  B 1 4  ? 21.392  1.197   7.188   1.00 4.51  ? 4  DT  D OP1    1  
ATOM 668   O OP2    . DT  B 1 4  ? 20.121  0.920   4.979   1.00 4.43  ? 4  DT  D OP2    1  
ATOM 669   O "O5'"  . DT  B 1 4  ? 20.664  3.189   5.894   1.00 5.01  ? 4  DT  D "O5'"  1  
ATOM 670   C "C5'"  . DT  B 1 4  ? 21.638  4.162   6.270   1.00 5.28  ? 4  DT  D "C5'"  1  
ATOM 671   C "C4'"  . DT  B 1 4  ? 20.984  5.477   6.612   1.00 5.67  ? 4  DT  D "C4'"  1  
ATOM 672   O "O4'"  . DT  B 1 4  ? 20.731  6.212   5.389   1.00 5.79  ? 4  DT  D "O4'"  1  
ATOM 673   C "C3'"  . DT  B 1 4  ? 19.619  5.306   7.264   1.00 5.71  ? 4  DT  D "C3'"  1  
ATOM 674   O "O3'"  . DT  B 1 4  ? 19.337  6.433   8.081   1.00 6.10  ? 4  DT  D "O3'"  1  
ATOM 675   C "C2'"  . DT  B 1 4  ? 18.684  5.226   6.070   1.00 5.60  ? 4  DT  D "C2'"  1  
ATOM 676   C "C1'"  . DT  B 1 4  ? 19.340  6.200   5.093   1.00 5.78  ? 4  DT  D "C1'"  1  
ATOM 677   N N1     . DT  B 1 4  ? 19.155  5.899   3.654   1.00 5.61  ? 4  DT  D N1     1  
ATOM 678   C C2     . DT  B 1 4  ? 18.901  6.964   2.806   1.00 5.88  ? 4  DT  D C2     1  
ATOM 679   O O2     . DT  B 1 4  ? 18.871  8.125   3.179   1.00 6.22  ? 4  DT  D O2     1  
ATOM 680   N N3     . DT  B 1 4  ? 18.682  6.618   1.499   1.00 5.75  ? 4  DT  D N3     1  
ATOM 681   C C4     . DT  B 1 4  ? 18.694  5.349   0.961   1.00 5.39  ? 4  DT  D C4     1  
ATOM 682   O O4     . DT  B 1 4  ? 18.437  5.188   -0.233  1.00 5.35  ? 4  DT  D O4     1  
ATOM 683   C C5     . DT  B 1 4  ? 18.986  4.282   1.897   1.00 5.11  ? 4  DT  D C5     1  
ATOM 684   C C7     . DT  B 1 4  ? 18.961  2.868   1.410   1.00 4.72  ? 4  DT  D C7     1  
ATOM 685   C C6     . DT  B 1 4  ? 19.210  4.604   3.182   1.00 5.23  ? 4  DT  D C6     1  
ATOM 686   H "H5'"  . DT  B 1 4  ? 22.332  4.316   5.443   1.00 5.26  ? 4  DT  D "H5'"  1  
ATOM 687   H "H5''" . DT  B 1 4  ? 22.193  3.806   7.137   1.00 5.24  ? 4  DT  D "H5''" 1  
ATOM 688   H "H4'"  . DT  B 1 4  ? 21.623  6.004   7.323   1.00 5.86  ? 4  DT  D "H4'"  1  
ATOM 689   H "H3'"  . DT  B 1 4  ? 19.583  4.402   7.872   1.00 5.55  ? 4  DT  D "H3'"  1  
ATOM 690   H "H2'"  . DT  B 1 4  ? 18.636  4.212   5.673   1.00 5.30  ? 4  DT  D "H2'"  1  
ATOM 691   H "H2''" . DT  B 1 4  ? 17.670  5.518   6.340   1.00 5.72  ? 4  DT  D "H2''" 1  
ATOM 692   H "H1'"  . DT  B 1 4  ? 18.968  7.212   5.272   1.00 6.07  ? 4  DT  D "H1'"  1  
ATOM 693   H H3     . DT  B 1 4  ? 18.480  7.383   0.866   1.00 5.96  ? 4  DT  D H3     1  
ATOM 694   H H71    . DT  B 1 4  ? 19.887  2.648   0.880   1.00 4.61  ? 4  DT  D H71    1  
ATOM 695   H H72    . DT  B 1 4  ? 18.116  2.731   0.735   1.00 4.84  ? 4  DT  D H72    1  
ATOM 696   H H73    . DT  B 1 4  ? 18.859  2.191   2.259   1.00 4.66  ? 4  DT  D H73    1  
ATOM 697   H H6     . DT  B 1 4  ? 19.451  3.806   3.883   1.00 5.05  ? 4  DT  D H6     1  
ATOM 698   P P      . DA  B 1 5  ? 17.925  6.541   8.826   1.00 6.25  ? 5  DA  D P      1  
ATOM 699   O OP1    . DA  B 1 5  ? 18.188  6.931   10.235  1.00 6.53  ? 5  DA  D OP1    1  
ATOM 700   O OP2    . DA  B 1 5  ? 17.107  5.336   8.538   1.00 5.93  ? 5  DA  D OP2    1  
ATOM 701   O "O5'"  . DA  B 1 5  ? 17.287  7.786   8.073   1.00 6.49  ? 5  DA  D "O5'"  1  
ATOM 702   C "C5'"  . DA  B 1 5  ? 18.046  8.984   7.937   1.00 6.83  ? 5  DA  D "C5'"  1  
ATOM 703   C "C4'"  . DA  B 1 5  ? 17.161  10.121  7.497   1.00 7.10  ? 5  DA  D "C4'"  1  
ATOM 704   O "O4'"  . DA  B 1 5  ? 16.956  10.029  6.064   1.00 6.94  ? 5  DA  D "O4'"  1  
ATOM 705   C "C3'"  . DA  B 1 5  ? 15.767  10.046  8.104   1.00 7.11  ? 5  DA  D "C3'"  1  
ATOM 706   O "O3'"  . DA  B 1 5  ? 15.209  11.349  8.193   1.00 7.47  ? 5  DA  D "O3'"  1  
ATOM 707   C "C2'"  . DA  B 1 5  ? 15.018  9.164   7.119   1.00 6.76  ? 5  DA  D "C2'"  1  
ATOM 708   C "C1'"  . DA  B 1 5  ? 15.633  9.581   5.787   1.00 6.76  ? 5  DA  D "C1'"  1  
ATOM 709   N N9     . DA  B 1 5  ? 15.689  8.526   4.769   1.00 6.39  ? 5  DA  D N9     1  
ATOM 710   C C8     . DA  B 1 5  ? 16.016  7.205   4.941   1.00 6.03  ? 5  DA  D C8     1  
ATOM 711   N N7     . DA  B 1 5  ? 15.931  6.491   3.842   1.00 5.75  ? 5  DA  D N7     1  
ATOM 712   C C5     . DA  B 1 5  ? 15.529  7.406   2.879   1.00 5.96  ? 5  DA  D C5     1  
ATOM 713   C C6     . DA  B 1 5  ? 15.255  7.274   1.500   1.00 5.87  ? 5  DA  D C6     1  
ATOM 714   N N6     . DA  B 1 5  ? 15.334  6.117   0.837   1.00 5.52  ? 5  DA  D N6     1  
ATOM 715   N N1     . DA  B 1 5  ? 14.884  8.383   0.822   1.00 6.17  ? 5  DA  D N1     1  
ATOM 716   C C2     . DA  B 1 5  ? 14.791  9.540   1.493   1.00 6.52  ? 5  DA  D C2     1  
ATOM 717   N N3     . DA  B 1 5  ? 15.015  9.788   2.787   1.00 6.64  ? 5  DA  D N3     1  
ATOM 718   C C4     . DA  B 1 5  ? 15.387  8.667   3.432   1.00 6.35  ? 5  DA  D C4     1  
ATOM 719   H "H5'"  . DA  B 1 5  ? 18.831  8.836   7.195   1.00 6.75  ? 5  DA  D "H5'"  1  
ATOM 720   H "H5''" . DA  B 1 5  ? 18.503  9.238   8.893   1.00 7.01  ? 5  DA  D "H5''" 1  
ATOM 721   H "H4'"  . DA  B 1 5  ? 17.613  11.060  7.823   1.00 7.40  ? 5  DA  D "H4'"  1  
ATOM 722   H "H3'"  . DA  B 1 5  ? 15.799  9.602   9.099   1.00 7.11  ? 5  DA  D "H3'"  1  
ATOM 723   H "H2'"  . DA  B 1 5  ? 15.177  8.108   7.335   1.00 6.49  ? 5  DA  D "H2'"  1  
ATOM 724   H "H2''" . DA  B 1 5  ? 13.946  9.348   7.156   1.00 6.80  ? 5  DA  D "H2''" 1  
ATOM 725   H "H1'"  . DA  B 1 5  ? 15.085  10.428  5.367   1.00 6.96  ? 5  DA  D "H1'"  1  
ATOM 726   H H8     . DA  B 1 5  ? 16.311  6.790   5.893   1.00 5.99  ? 5  DA  D H8     1  
ATOM 727   H H61    . DA  B 1 5  ? 15.117  6.077   -0.149  1.00 5.50  ? 5  DA  D H61    1  
ATOM 728   H H62    . DA  B 1 5  ? 15.604  5.279   1.332   1.00 5.30  ? 5  DA  D H62    1  
ATOM 729   H H2     . DA  B 1 5  ? 14.489  10.402  0.896   1.00 6.75  ? 5  DA  D H2     1  
ATOM 730   P P      . DA  B 1 6  ? 13.710  11.535  8.721   1.00 7.56  ? 6  DA  D P      1  
ATOM 731   O OP1    . DA  B 1 6  ? 13.712  12.617  9.740   1.00 7.97  ? 6  DA  D OP1    1  
ATOM 732   O OP2    . DA  B 1 6  ? 13.124  10.213  9.057   1.00 7.26  ? 6  DA  D OP2    1  
ATOM 733   O "O5'"  . DA  B 1 6  ? 13.011  12.086  7.407   1.00 7.53  ? 6  DA  D "O5'"  1  
ATOM 734   C "C5'"  . DA  B 1 6  ? 13.652  13.115  6.661   1.00 7.75  ? 6  DA  D "C5'"  1  
ATOM 735   C "C4'"  . DA  B 1 6  ? 12.713  13.686  5.631   1.00 7.77  ? 6  DA  D "C4'"  1  
ATOM 736   O "O4'"  . DA  B 1 6  ? 12.696  12.810  4.473   1.00 7.43  ? 6  DA  D "O4'"  1  
ATOM 737   C "C3'"  . DA  B 1 6  ? 11.273  13.724  6.121   1.00 7.77  ? 6  DA  D "C3'"  1  
ATOM 738   O "O3'"  . DA  B 1 6  ? 10.571  14.764  5.463   1.00 7.95  ? 6  DA  D "O3'"  1  
ATOM 739   C "C2'"  . DA  B 1 6  ? 10.749  12.349  5.745   1.00 7.34  ? 6  DA  D "C2'"  1  
ATOM 740   C "C1'"  . DA  B 1 6  ? 11.469  12.086  4.427   1.00 7.17  ? 6  DA  D "C1'"  1  
ATOM 741   N N9     . DA  B 1 6  ? 11.753  10.676  4.138   1.00 6.78  ? 6  DA  D N9     1  
ATOM 742   C C8     . DA  B 1 6  ? 12.220  9.712   4.996   1.00 6.60  ? 6  DA  D C8     1  
ATOM 743   N N7     . DA  B 1 6  ? 12.324  8.523   4.449   1.00 6.23  ? 6  DA  D N7     1  
ATOM 744   C C5     . DA  B 1 6  ? 11.905  8.718   3.141   1.00 6.16  ? 6  DA  D C5     1  
ATOM 745   C C6     . DA  B 1 6  ? 11.777  7.837   2.044   1.00 5.84  ? 6  DA  D C6     1  
ATOM 746   N N6     . DA  B 1 6  ? 12.058  6.534   2.109   1.00 5.50  ? 6  DA  D N6     1  
ATOM 747   N N1     . DA  B 1 6  ? 11.338  8.347   0.870   1.00 5.91  ? 6  DA  D N1     1  
ATOM 748   C C2     . DA  B 1 6  ? 11.044  9.654   0.814   1.00 6.26  ? 6  DA  D C2     1  
ATOM 749   N N3     . DA  B 1 6  ? 11.117  10.580  1.778   1.00 6.57  ? 6  DA  D N3     1  
ATOM 750   C C4     . DA  B 1 6  ? 11.560  10.041  2.928   1.00 6.50  ? 6  DA  D C4     1  
ATOM 751   H "H5'"  . DA  B 1 6  ? 14.529  12.707  6.157   1.00 7.64  ? 6  DA  D "H5'"  1  
ATOM 752   H "H5''" . DA  B 1 6  ? 13.969  13.912  7.335   1.00 8.05  ? 6  DA  D "H5''" 1  
ATOM 753   H "H4'"  . DA  B 1 6  ? 13.017  14.711  5.412   1.00 8.04  ? 6  DA  D "H4'"  1  
ATOM 754   H "H3'"  . DA  B 1 6  ? 11.232  13.891  7.198   1.00 7.93  ? 6  DA  D "H3'"  1  
ATOM 755   H "H2'"  . DA  B 1 6  ? 10.998  11.609  6.506   1.00 7.24  ? 6  DA  D "H2'"  1  
ATOM 756   H "H2''" . DA  B 1 6  ? 9.666   12.351  5.633   1.00 7.29  ? 6  DA  D "H2''" 1  
ATOM 757   H "H1'"  . DA  B 1 6  ? 10.888  12.490  3.595   1.00 7.19  ? 6  DA  D "H1'"  1  
ATOM 758   H H8     . DA  B 1 6  ? 12.474  9.912   6.026   1.00 6.77  ? 6  DA  D H8     1  
ATOM 759   H H61    . DA  B 1 6  ? 11.933  5.947   1.296   1.00 5.29  ? 6  DA  D H61    1  
ATOM 760   H H62    . DA  B 1 6  ? 12.380  6.141   2.982   1.00 5.46  ? 6  DA  D H62    1  
ATOM 761   H H2     . DA  B 1 6  ? 10.697  10.011  -0.157  1.00 6.31  ? 6  DA  D H2     1  
ATOM 762   P P      . DG  B 1 7  ? 8.998   14.926  5.693   1.00 7.95  ? 7  DG  D P      1  
ATOM 763   O OP1    . DG  B 1 7  ? 8.708   16.374  5.844   1.00 8.35  ? 7  DG  D OP1    1  
ATOM 764   O OP2    . DG  B 1 7  ? 8.530   13.969  6.729   1.00 7.79  ? 7  DG  D OP2    1  
ATOM 765   O "O5'"  . DG  B 1 7  ? 8.472   14.450  4.274   1.00 7.66  ? 7  DG  D "O5'"  1  
ATOM 766   C "C5'"  . DG  B 1 7  ? 9.144   14.911  3.106   1.00 7.74  ? 7  DG  D "C5'"  1  
ATOM 767   C "C4'"  . DG  B 1 7  ? 8.297   14.682  1.882   1.00 7.55  ? 7  DG  D "C4'"  1  
ATOM 768   O "O4'"  . DG  B 1 7  ? 8.478   13.314  1.433   1.00 7.14  ? 7  DG  D "O4'"  1  
ATOM 769   C "C3'"  . DG  B 1 7  ? 6.812   14.812  2.185   1.00 7.53  ? 7  DG  D "C3'"  1  
ATOM 770   O "O3'"  . DG  B 1 7  ? 6.123   15.215  1.013   1.00 7.52  ? 7  DG  D "O3'"  1  
ATOM 771   C "C2'"  . DG  B 1 7  ? 6.436   13.410  2.634   1.00 7.15  ? 7  DG  D "C2'"  1  
ATOM 772   C "C1'"  . DG  B 1 7  ? 7.320   12.546  1.738   1.00 6.89  ? 7  DG  D "C1'"  1  
ATOM 773   N N9     . DG  B 1 7  ? 7.736   11.260  2.298   1.00 6.59  ? 7  DG  D N9     1  
ATOM 774   C C8     . DG  B 1 7  ? 8.137   10.995  3.585   1.00 6.62  ? 7  DG  D C8     1  
ATOM 775   N N7     . DG  B 1 7  ? 8.403   9.732   3.793   1.00 6.30  ? 7  DG  D N7     1  
ATOM 776   C C5     . DG  B 1 7  ? 8.173   9.123   2.565   1.00 6.03  ? 7  DG  D C5     1  
ATOM 777   C C6     . DG  B 1 7  ? 8.291   7.754   2.171   1.00 5.63  ? 7  DG  D C6     1  
ATOM 778   O O6     . DG  B 1 7  ? 8.626   6.776   2.853   1.00 5.43  ? 7  DG  D O6     1  
ATOM 779   N N1     . DG  B 1 7  ? 7.965   7.577   0.829   1.00 5.49  ? 7  DG  D N1     1  
ATOM 780   C C2     . DG  B 1 7  ? 7.578   8.581   -0.026  1.00 5.71  ? 7  DG  D C2     1  
ATOM 781   N N2     . DG  B 1 7  ? 7.316   8.211   -1.290  1.00 5.56  ? 7  DG  D N2     1  
ATOM 782   N N3     . DG  B 1 7  ? 7.460   9.854   0.327   1.00 6.08  ? 7  DG  D N3     1  
ATOM 783   C C4     . DG  B 1 7  ? 7.771   10.052  1.627   1.00 6.21  ? 7  DG  D C4     1  
ATOM 784   H "H5'"  . DG  B 1 7  ? 10.086  14.376  2.991   1.00 7.63  ? 7  DG  D "H5'"  1  
ATOM 785   H "H5''" . DG  B 1 7  ? 9.350   15.978  3.200   1.00 8.06  ? 7  DG  D "H5''" 1  
ATOM 786   H "H4'"  . DG  B 1 7  ? 8.551   15.436  1.135   1.00 7.73  ? 7  DG  D "H4'"  1  
ATOM 787   H "H3'"  . DG  B 1 7  ? 6.639   15.547  2.972   1.00 7.78  ? 7  DG  D "H3'"  1  
ATOM 788   H "H2'"  . DG  B 1 7  ? 6.651   13.261  3.692   1.00 7.21  ? 7  DG  D "H2'"  1  
ATOM 789   H "H2''" . DG  B 1 7  ? 5.376   13.214  2.484   1.00 7.04  ? 7  DG  D "H2''" 1  
ATOM 790   H "H1'"  . DG  B 1 7  ? 6.811   12.348  0.791   1.00 6.75  ? 7  DG  D "H1'"  1  
ATOM 791   H H8     . DG  B 1 7  ? 8.222   11.753  4.348   1.00 6.90  ? 7  DG  D H8     1  
ATOM 792   H H1     . DG  B 1 7  ? 8.017   6.636   0.460   1.00 5.22  ? 7  DG  D H1     1  
ATOM 793   H H21    . DG  B 1 7  ? 7.401   7.247   -1.580  1.00 5.29  ? 7  DG  D H21    1  
ATOM 794   H H22    . DG  B 1 7  ? 7.030   8.909   -1.963  1.00 5.73  ? 7  DG  D H22    1  
ATOM 795   P P      . DA  B 1 8  ? 4.530   15.331  1.031   1.00 7.47  ? 8  DA  D P      1  
ATOM 796   O OP1    . DA  B 1 8  ? 4.163   16.632  0.414   1.00 7.77  ? 8  DA  D OP1    1  
ATOM 797   O OP2    . DA  B 1 8  ? 4.005   14.980  2.375   1.00 7.45  ? 8  DA  D OP2    1  
ATOM 798   O "O5'"  . DA  B 1 8  ? 4.161   14.171  0.014   1.00 7.06  ? 8  DA  D "O5'"  1  
ATOM 799   C "C5'"  . DA  B 1 8  ? 4.892   14.063  -1.203  1.00 7.01  ? 8  DA  D "C5'"  1  
ATOM 800   C "C4'"  . DA  B 1 8  ? 4.199   13.121  -2.151  1.00 6.67  ? 8  DA  D "C4'"  1  
ATOM 801   O "O4'"  . DA  B 1 8  ? 4.553   11.759  -1.800  1.00 6.32  ? 8  DA  D "O4'"  1  
ATOM 802   C "C3'"  . DA  B 1 8  ? 2.686   13.189  -2.020  1.00 6.62  ? 8  DA  D "C3'"  1  
ATOM 803   O "O3'"  . DA  B 1 8  ? 2.074   12.828  -3.246  1.00 6.44  ? 8  DA  D "O3'"  1  
ATOM 804   C "C2'"  . DA  B 1 8  ? 2.399   12.190  -0.913  1.00 6.37  ? 8  DA  D "C2'"  1  
ATOM 805   C "C1'"  . DA  B 1 8  ? 3.448   11.113  -1.177  1.00 6.11  ? 8  DA  D "C1'"  1  
ATOM 806   N N9     . DA  B 1 8  ? 3.922   10.398  0.013   1.00 5.99  ? 8  DA  D N9     1  
ATOM 807   C C8     . DA  B 1 8  ? 4.231   10.916  1.246   1.00 6.22  ? 8  DA  D C8     1  
ATOM 808   N N7     . DA  B 1 8  ? 4.582   10.010  2.128   1.00 6.04  ? 8  DA  D N7     1  
ATOM 809   C C5     . DA  B 1 8  ? 4.510   8.814   1.427   1.00 5.66  ? 8  DA  D C5     1  
ATOM 810   C C6     . DA  B 1 8  ? 4.759   7.477   1.805   1.00 5.33  ? 8  DA  D C6     1  
ATOM 811   N N6     . DA  B 1 8  ? 5.129   7.114   3.035   1.00 5.34  ? 8  DA  D N6     1  
ATOM 812   N N1     . DA  B 1 8  ? 4.604   6.516   0.865   1.00 4.99  ? 8  DA  D N1     1  
ATOM 813   C C2     . DA  B 1 8  ? 4.219   6.883   -0.364  1.00 5.01  ? 8  DA  D C2     1  
ATOM 814   N N3     . DA  B 1 8  ? 3.948   8.104   -0.837  1.00 5.31  ? 8  DA  D N3     1  
ATOM 815   C C4     . DA  B 1 8  ? 4.116   9.036   0.120   1.00 5.62  ? 8  DA  D C4     1  
ATOM 816   H "H5'"  . DA  B 1 8  ? 5.894   13.686  -0.995  1.00 6.96  ? 8  DA  D "H5'"  1  
ATOM 817   H "H5''" . DA  B 1 8  ? 4.972   15.045  -1.670  1.00 7.28  ? 8  DA  D "H5''" 1  
ATOM 818   H "H4'"  . DA  B 1 8  ? 4.457   13.403  -3.174  1.00 6.75  ? 8  DA  D "H4'"  1  
ATOM 819   H "H3'"  . DA  B 1 8  ? 2.366   14.195  -1.745  1.00 6.90  ? 8  DA  D "H3'"  1  
ATOM 820   H "H2'"  . DA  B 1 8  ? 2.512   12.644  0.071   1.00 6.56  ? 8  DA  D "H2'"  1  
ATOM 821   H "H2''" . DA  B 1 8  ? 1.383   11.801  -0.980  1.00 6.22  ? 8  DA  D "H2''" 1  
ATOM 822   H "H1'"  . DA  B 1 8  ? 3.063   10.376  -1.884  1.00 5.86  ? 8  DA  D "H1'"  1  
ATOM 823   H H8     . DA  B 1 8  ? 4.188   11.971  1.470   1.00 6.53  ? 8  DA  D H8     1  
ATOM 824   H H61    . DA  B 1 8  ? 5.284   6.140   3.259   1.00 5.11  ? 8  DA  D H61    1  
ATOM 825   H H62    . DA  B 1 8  ? 5.244   7.818   3.751   1.00 5.60  ? 8  DA  D H62    1  
ATOM 826   H H2     . DA  B 1 8  ? 4.115   6.066   -1.082  1.00 4.75  ? 8  DA  D H2     1  
ATOM 827   P P      . DT  B 1 9  ? 0.483   12.709  -3.327  1.00 6.32  ? 9  DT  D P      1  
ATOM 828   O OP1    . DT  B 1 9  ? 0.044   13.278  -4.626  1.00 6.48  ? 9  DT  D OP1    1  
ATOM 829   O OP2    . DT  B 1 9  ? -0.128  13.200  -2.064  1.00 6.44  ? 9  DT  D OP2    1  
ATOM 830   O "O5'"  . DT  B 1 9  ? 0.334   11.131  -3.390  1.00 5.87  ? 9  DT  D "O5'"  1  
ATOM 831   C "C5'"  . DT  B 1 9  ? 1.164   10.400  -4.287  1.00 5.72  ? 9  DT  D "C5'"  1  
ATOM 832   C "C4'"  . DT  B 1 9  ? 0.569   9.045   -4.564  1.00 5.31  ? 9  DT  D "C4'"  1  
ATOM 833   O "O4'"  . DT  B 1 9  ? 0.942   8.142   -3.493  1.00 5.09  ? 9  DT  D "O4'"  1  
ATOM 834   C "C3'"  . DT  B 1 9  ? -0.952  9.075   -4.557  1.00 5.19  ? 9  DT  D "C3'"  1  
ATOM 835   O "O3'"  . DT  B 1 9  ? -1.454  8.053   -5.401  1.00 4.88  ? 9  DT  D "O3'"  1  
ATOM 836   C "C2'"  . DT  B 1 9  ? -1.283  8.854   -3.091  1.00 5.13  ? 9  DT  D "C2'"  1  
ATOM 837   C "C1'"  . DT  B 1 9  ? -0.181  7.888   -2.658  1.00 4.96  ? 9  DT  D "C1'"  1  
ATOM 838   N N1     . DT  B 1 9  ? 0.246   7.985   -1.238  1.00 5.08  ? 9  DT  D N1     1  
ATOM 839   C C2     . DT  B 1 9  ? 0.602   6.815   -0.588  1.00 4.82  ? 9  DT  D C2     1  
ATOM 840   O O2     . DT  B 1 9  ? 0.630   5.722   -1.136  1.00 4.49  ? 9  DT  D O2     1  
ATOM 841   N N3     . DT  B 1 9  ? 0.927   6.969   0.735   1.00 4.97  ? 9  DT  D N3     1  
ATOM 842   C C4     . DT  B 1 9  ? 0.942   8.143   1.458   1.00 5.34  ? 9  DT  D C4     1  
ATOM 843   O O4     . DT  B 1 9  ? 1.214   8.116   2.657   1.00 5.47  ? 9  DT  D O4     1  
ATOM 844   C C5     . DT  B 1 9  ? 0.583   9.333   0.713   1.00 5.58  ? 9  DT  D C5     1  
ATOM 845   C C7     . DT  B 1 9  ? 0.550   10.649  1.427   1.00 6.00  ? 9  DT  D C7     1  
ATOM 846   C C6     . DT  B 1 9  ? 0.263   9.202   -0.584  1.00 5.44  ? 9  DT  D C6     1  
ATOM 847   H "H5'"  . DT  B 1 9  ? 2.153   10.272  -3.847  1.00 5.76  ? 9  DT  D "H5'"  1  
ATOM 848   H "H5''" . DT  B 1 9  ? 1.259   10.946  -5.225  1.00 5.89  ? 9  DT  D "H5''" 1  
ATOM 849   H "H4'"  . DT  B 1 9  ? 0.890   8.721   -5.556  1.00 5.26  ? 9  DT  D "H4'"  1  
ATOM 850   H "H3'"  . DT  B 1 9  ? -1.321  10.039  -4.909  1.00 5.42  ? 9  DT  D "H3'"  1  
ATOM 851   H "H2'"  . DT  B 1 9  ? -1.255  9.790   -2.534  1.00 5.40  ? 9  DT  D "H2'"  1  
ATOM 852   H "H2''" . DT  B 1 9  ? -2.278  8.431   -2.967  1.00 4.95  ? 9  DT  D "H2''" 1  
ATOM 853   H "H1'"  . DT  B 1 9  ? -0.493  6.857   -2.844  1.00 4.66  ? 9  DT  D "H1'"  1  
ATOM 854   H H3     . DT  B 1 9  ? 1.174   6.129   1.244   1.00 4.81  ? 9  DT  D H3     1  
ATOM 855   H H71    . DT  B 1 9  ? 1.569   10.989  1.609   1.00 6.19  ? 9  DT  D H71    1  
ATOM 856   H H72    . DT  B 1 9  ? 0.031   10.534  2.378   1.00 6.06  ? 9  DT  D H72    1  
ATOM 857   H H73    . DT  B 1 9  ? 0.027   11.382  0.814   1.00 6.21  ? 9  DT  D H73    1  
ATOM 858   H H6     . DT  B 1 9  ? 0.009   10.099  -1.148  1.00 5.65  ? 9  DT  D H6     1  
ATOM 859   P P      . DA  B 1 10 ? -3.032  7.809   -5.501  1.00 4.69  ? 10 DA  D P      1  
ATOM 860   O OP1    . DA  B 1 10 ? -3.393  7.730   -6.939  1.00 4.69  ? 10 DA  D OP1    1  
ATOM 861   O OP2    . DA  B 1 10 ? -3.755  8.752   -4.610  1.00 4.90  ? 10 DA  D OP2    1  
ATOM 862   O "O5'"  . DA  B 1 10 ? -3.120  6.352   -4.884  1.00 4.29  ? 10 DA  D "O5'"  1  
ATOM 863   C "C5'"  . DA  B 1 10 ? -2.184  5.372   -5.314  1.00 4.08  ? 10 DA  D "C5'"  1  
ATOM 864   C "C4'"  . DA  B 1 10 ? -2.563  4.012   -4.790  1.00 3.70  ? 10 DA  D "C4'"  1  
ATOM 865   O "O4'"  . DA  B 1 10 ? -2.106  3.896   -3.417  1.00 3.74  ? 10 DA  D "O4'"  1  
ATOM 866   C "C3'"  . DA  B 1 10 ? -4.069  3.805   -4.730  1.00 3.55  ? 10 DA  D "C3'"  1  
ATOM 867   O "O3'"  . DA  B 1 10 ? -4.363  2.424   -4.861  1.00 3.19  ? 10 DA  D "O3'"  1  
ATOM 868   C "C2'"  . DA  B 1 10 ? -4.429  4.361   -3.364  1.00 3.73  ? 10 DA  D "C2'"  1  
ATOM 869   C "C1'"  . DA  B 1 10 ? -3.216  3.971   -2.526  1.00 3.75  ? 10 DA  D "C1'"  1  
ATOM 870   N N9     . DA  B 1 10 ? -2.895  4.899   -1.436  1.00 4.09  ? 10 DA  D N9     1  
ATOM 871   C C8     . DA  B 1 10 ? -2.936  6.271   -1.460  1.00 4.43  ? 10 DA  D C8     1  
ATOM 872   N N7     . DA  B 1 10 ? -2.650  6.831   -0.308  1.00 4.69  ? 10 DA  D N7     1  
ATOM 873   C C5     . DA  B 1 10 ? -2.393  5.756   0.532   1.00 4.53  ? 10 DA  D C5     1  
ATOM 874   C C6     . DA  B 1 10 ? -2.038  5.682   1.896   1.00 4.70  ? 10 DA  D C6     1  
ATOM 875   N N6     . DA  B 1 10 ? -1.895  6.751   2.683   1.00 5.07  ? 10 DA  D N6     1  
ATOM 876   N N1     . DA  B 1 10 ? -1.843  4.456   2.431   1.00 4.50  ? 10 DA  D N1     1  
ATOM 877   C C2     . DA  B 1 10 ? -2.004  3.383   1.644   1.00 4.14  ? 10 DA  D C2     1  
ATOM 878   N N3     . DA  B 1 10 ? -2.345  3.324   0.352   1.00 3.93  ? 10 DA  D N3     1  
ATOM 879   C C4     . DA  B 1 10 ? -2.526  4.559   -0.151  1.00 4.15  ? 10 DA  D C4     1  
ATOM 880   H "H5'"  . DA  B 1 10 ? -1.190  5.630   -4.947  1.00 4.21  ? 10 DA  D "H5'"  1  
ATOM 881   H "H5''" . DA  B 1 10 ? -2.163  5.340   -6.403  1.00 4.08  ? 10 DA  D "H5''" 1  
ATOM 882   H "H4'"  . DA  B 1 10 ? -2.153  3.257   -5.462  1.00 3.54  ? 10 DA  D "H4'"  1  
ATOM 883   H "H3'"  . DA  B 1 10 ? -4.567  4.353   -5.530  1.00 3.64  ? 10 DA  D "H3'"  1  
ATOM 884   H "H2'"  . DA  B 1 10 ? -4.576  5.440   -3.401  1.00 3.99  ? 10 DA  D "H2'"  1  
ATOM 885   H "H2''" . DA  B 1 10 ? -5.347  3.917   -2.982  1.00 3.59  ? 10 DA  D "H2''" 1  
ATOM 886   H "H1'"  . DA  B 1 10 ? -3.357  2.978   -2.095  1.00 3.54  ? 10 DA  D "H1'"  1  
ATOM 887   H H8     . DA  B 1 10 ? -3.185  6.838   -2.345  1.00 4.49  ? 10 DA  D H8     1  
ATOM 888   H H61    . DA  B 1 10 ? -1.654  6.641   3.659   1.00 5.20  ? 10 DA  D H61    1  
ATOM 889   H H62    . DA  B 1 10 ? -2.044  7.676   2.306   1.00 5.24  ? 10 DA  D H62    1  
ATOM 890   H H2     . DA  B 1 10 ? -1.831  2.420   2.129   1.00 4.01  ? 10 DA  D H2     1  
ATOM 891   P P      . DT  B 1 11 ? -5.870  1.913   -4.703  1.00 3.00  ? 11 DT  D P      1  
ATOM 892   O OP1    . DT  B 1 11 ? -6.171  1.010   -5.846  1.00 2.75  ? 11 DT  D OP1    1  
ATOM 893   O OP2    . DT  B 1 11 ? -6.775  3.057   -4.416  1.00 3.23  ? 11 DT  D OP2    1  
ATOM 894   O "O5'"  . DT  B 1 11 ? -5.712  1.048   -3.384  1.00 2.93  ? 11 DT  D "O5'"  1  
ATOM 895   C "C5'"  . DT  B 1 11 ? -4.524  0.280   -3.206  1.00 2.81  ? 11 DT  D "C5'"  1  
ATOM 896   C "C4'"  . DT  B 1 11 ? -4.660  -0.637  -2.019  1.00 2.79  ? 11 DT  D "C4'"  1  
ATOM 897   O "O4'"  . DT  B 1 11 ? -4.368  0.112   -0.811  1.00 3.09  ? 11 DT  D "O4'"  1  
ATOM 898   C "C3'"  . DT  B 1 11 ? -6.088  -1.131  -1.852  1.00 2.74  ? 11 DT  D "C3'"  1  
ATOM 899   O "O3'"  . DT  B 1 11 ? -6.095  -2.388  -1.199  1.00 2.71  ? 11 DT  D "O3'"  1  
ATOM 900   C "C2'"  . DT  B 1 11 ? -6.725  -0.042  -1.007  1.00 3.05  ? 11 DT  D "C2'"  1  
ATOM 901   C "C1'"  . DT  B 1 11 ? -5.572  0.362   -0.093  1.00 3.26  ? 11 DT  D "C1'"  1  
ATOM 902   N N1     . DT  B 1 11 ? -5.578  1.774   0.368   1.00 3.59  ? 11 DT  D N1     1  
ATOM 903   C C2     . DT  B 1 11 ? -5.249  2.022   1.692   1.00 3.86  ? 11 DT  D C2     1  
ATOM 904   O O2     . DT  B 1 11 ? -4.905  1.151   2.476   1.00 3.85  ? 11 DT  D O2     1  
ATOM 905   N N3     . DT  B 1 11 ? -5.337  3.337   2.068   1.00 4.18  ? 11 DT  D N3     1  
ATOM 906   C C4     . DT  B 1 11 ? -5.697  4.407   1.278   1.00 4.27  ? 11 DT  D C4     1  
ATOM 907   O O4     . DT  B 1 11 ? -5.754  5.533   1.766   1.00 4.60  ? 11 DT  D O4     1  
ATOM 908   C C5     . DT  B 1 11 ? -6.005  4.083   -0.100  1.00 3.99  ? 11 DT  D C5     1  
ATOM 909   C C7     . DT  B 1 11 ? -6.446  5.182   -1.016  1.00 4.12  ? 11 DT  D C7     1  
ATOM 910   C C6     . DT  B 1 11 ? -5.925  2.800   -0.487  1.00 3.66  ? 11 DT  D C6     1  
ATOM 911   H "H5'"  . DT  B 1 11 ? -3.678  0.948   -3.044  1.00 2.96  ? 11 DT  D "H5'"  1  
ATOM 912   H "H5''" . DT  B 1 11 ? -4.337  -0.318  -4.098  1.00 2.62  ? 11 DT  D "H5''" 1  
ATOM 913   H "H4'"  . DT  B 1 11 ? -4.021  -1.509  -2.175  1.00 2.64  ? 11 DT  D "H4'"  1  
ATOM 914   H "H3'"  . DT  B 1 11 ? -6.580  -1.229  -2.820  1.00 2.59  ? 11 DT  D "H3'"  1  
ATOM 915   H "H2'"  . DT  B 1 11 ? -7.072  0.785   -1.625  1.00 3.09  ? 11 DT  D "H2'"  1  
ATOM 916   H "H2''" . DT  B 1 11 ? -7.584  -0.419  -0.454  1.00 3.10  ? 11 DT  D "H2''" 1  
ATOM 917   H "H1'"  . DT  B 1 11 ? -5.556  -0.278  0.792   1.00 3.32  ? 11 DT  D "H1'"  1  
ATOM 918   H H3     . DT  B 1 11 ? -5.136  3.546   3.039   1.00 4.40  ? 11 DT  D H3     1  
ATOM 919   H H71    . DT  B 1 11 ? -5.576  5.742   -1.358  1.00 4.30  ? 11 DT  D H71    1  
ATOM 920   H H72    . DT  B 1 11 ? -7.121  5.851   -0.482  1.00 4.20  ? 11 DT  D H72    1  
ATOM 921   H H73    . DT  B 1 11 ? -6.964  4.754   -1.874  1.00 4.27  ? 11 DT  D H73    1  
ATOM 922   H H6     . DT  B 1 11 ? -6.141  2.558   -1.528  1.00 3.46  ? 11 DT  D H6     1  
ATOM 923   P P      . DC  B 1 12 ? -7.490  -3.058  -0.803  1.00 2.77  ? 12 DC  D P      1  
ATOM 924   O OP1    . DC  B 1 12 ? -7.392  -4.517  -1.059  1.00 2.66  ? 12 DC  D OP1    1  
ATOM 925   O OP2    . DC  B 1 12 ? -8.612  -2.281  -1.391  1.00 2.76  ? 12 DC  D OP2    1  
ATOM 926   O "O5'"  . DC  B 1 12 ? -7.466  -2.818  0.765   1.00 3.11  ? 12 DC  D "O5'"  1  
ATOM 927   C "C5'"  . DC  B 1 12 ? -6.290  -3.151  1.495   1.00 3.21  ? 12 DC  D "C5'"  1  
ATOM 928   C "C4'"  . DC  B 1 12 ? -6.602  -3.270  2.963   1.00 3.55  ? 12 DC  D "C4'"  1  
ATOM 929   O "O4'"  . DC  B 1 12 ? -6.596  -1.944  3.551   1.00 3.79  ? 12 DC  D "O4'"  1  
ATOM 930   C "C3'"  . DC  B 1 12 ? -8.004  -3.811  3.201   1.00 3.65  ? 12 DC  D "C3'"  1  
ATOM 931   O "O3'"  . DC  B 1 12 ? -8.064  -4.478  4.450   1.00 3.94  ? 12 DC  D "O3'"  1  
ATOM 932   C "C2'"  . DC  B 1 12 ? -8.856  -2.554  3.181   1.00 3.74  ? 12 DC  D "C2'"  1  
ATOM 933   C "C1'"  . DC  B 1 12 ? -7.929  -1.533  3.834   1.00 3.94  ? 12 DC  D "C1'"  1  
ATOM 934   N N1     . DC  B 1 12 ? -8.102  -0.132  3.397   1.00 4.00  ? 12 DC  D N1     1  
ATOM 935   C C2     . DC  B 1 12 ? -8.017  0.888   4.362   1.00 4.36  ? 12 DC  D C2     1  
ATOM 936   O O2     . DC  B 1 12 ? -7.751  0.587   5.536   1.00 4.58  ? 12 DC  D O2     1  
ATOM 937   N N3     . DC  B 1 12 ? -8.228  2.173   3.991   1.00 4.47  ? 12 DC  D N3     1  
ATOM 938   C C4     . DC  B 1 12 ? -8.507  2.461   2.718   1.00 4.25  ? 12 DC  D C4     1  
ATOM 939   N N4     . DC  B 1 12 ? -8.734  3.741   2.404   1.00 4.43  ? 12 DC  D N4     1  
ATOM 940   C C5     . DC  B 1 12 ? -8.574  1.449   1.710   1.00 3.88  ? 12 DC  D C5     1  
ATOM 941   C C6     . DC  B 1 12 ? -8.362  0.179   2.091   1.00 3.76  ? 12 DC  D C6     1  
ATOM 942   H "H5'"  . DC  B 1 12 ? -5.539  -2.375  1.352   1.00 3.21  ? 12 DC  D "H5'"  1  
ATOM 943   H "H5''" . DC  B 1 12 ? -5.894  -4.101  1.137   1.00 3.06  ? 12 DC  D "H5''" 1  
ATOM 944   H "H4'"  . DC  B 1 12 ? -5.895  -3.967  3.416   1.00 3.59  ? 12 DC  D "H4'"  1  
ATOM 945   H "H3'"  . DC  B 1 12 ? -8.292  -4.505  2.411   1.00 3.45  ? 12 DC  D "H3'"  1  
ATOM 946   H "H2'"  . DC  B 1 12 ? -9.127  -2.275  2.163   1.00 3.53  ? 12 DC  D "H2'"  1  
ATOM 947   H "H2''" . DC  B 1 12 ? -9.780  -2.690  3.741   1.00 3.92  ? 12 DC  D "H2''" 1  
ATOM 948   H "H1'"  . DC  B 1 12 ? -8.048  -1.562  4.919   1.00 4.21  ? 12 DC  D "H1'"  1  
ATOM 949   H H41    . DC  B 1 12 ? -8.703  4.455   3.118   1.00 4.71  ? 12 DC  D H41    1  
ATOM 950   H H42    . DC  B 1 12 ? -8.953  3.995   1.452   1.00 4.31  ? 12 DC  D H42    1  
ATOM 951   H H5     . DC  B 1 12 ? -8.791  1.699   0.671   1.00 3.72  ? 12 DC  D H5     1  
ATOM 952   H H6     . DC  B 1 12 ? -8.399  -0.615  1.345   1.00 3.49  ? 12 DC  D H6     1  
ATOM 953   P P      . DT  B 1 13 ? -9.461  -5.056  4.972   1.00 4.16  ? 13 DT  D P      1  
ATOM 954   O OP1    . DT  B 1 13 ? -9.228  -6.441  5.453   1.00 4.28  ? 13 DT  D OP1    1  
ATOM 955   O OP2    . DT  B 1 13 ? -10.536 -4.790  3.982   1.00 3.98  ? 13 DT  D OP2    1  
ATOM 956   O "O5'"  . DT  B 1 13 ? -9.689  -4.122  6.233   1.00 4.51  ? 13 DT  D "O5'"  1  
ATOM 957   C "C5'"  . DT  B 1 13 ? -8.594  -3.866  7.105   1.00 4.67  ? 13 DT  D "C5'"  1  
ATOM 958   C "C4'"  . DT  B 1 13 ? -9.072  -3.220  8.379   1.00 5.07  ? 13 DT  D "C4'"  1  
ATOM 959   O "O4'"  . DT  B 1 13 ? -9.245  -1.798  8.147   1.00 5.12  ? 13 DT  D "O4'"  1  
ATOM 960   C "C3'"  . DT  B 1 13 ? -10.444 -3.728  8.797   1.00 5.26  ? 13 DT  D "C3'"  1  
ATOM 961   O "O3'"  . DT  B 1 13 ? -10.589 -3.617  10.202  1.00 5.65  ? 13 DT  D "O3'"  1  
ATOM 962   C "C2'"  . DT  B 1 13 ? -11.388 -2.805  8.046   1.00 5.17  ? 13 DT  D "C2'"  1  
ATOM 963   C "C1'"  . DT  B 1 13 ? -10.630 -1.480  8.083   1.00 5.21  ? 13 DT  D "C1'"  1  
ATOM 964   N N1     . DT  B 1 13 ? -10.866 -0.562  6.940   1.00 5.01  ? 13 DT  D N1     1  
ATOM 965   C C2     . DT  B 1 13 ? -10.946 0.792   7.217   1.00 5.23  ? 13 DT  D C2     1  
ATOM 966   O O2     . DT  B 1 13 ? -10.785 1.259   8.333   1.00 5.56  ? 13 DT  D O2     1  
ATOM 967   N N3     . DT  B 1 13 ? -11.225 1.585   6.134   1.00 5.08  ? 13 DT  D N3     1  
ATOM 968   C C4     . DT  B 1 13 ? -11.422 1.176   4.833   1.00 4.72  ? 13 DT  D C4     1  
ATOM 969   O O4     . DT  B 1 13 ? -11.710 2.005   3.972   1.00 4.65  ? 13 DT  D O4     1  
ATOM 970   C C5     . DT  B 1 13 ? -11.306 -0.250  4.607   1.00 4.48  ? 13 DT  D C5     1  
ATOM 971   C C7     . DT  B 1 13 ? -11.562 -0.785  3.232   1.00 4.11  ? 13 DT  D C7     1  
ATOM 972   C C6     . DT  B 1 13 ? -11.027 -1.042  5.656   1.00 4.65  ? 13 DT  D C6     1  
ATOM 973   H "H5'"  . DT  B 1 13 ? -7.884  -3.202  6.613   1.00 4.54  ? 13 DT  D "H5'"  1  
ATOM 974   H "H5''" . DT  B 1 13 ? -8.094  -4.804  7.348   1.00 4.67  ? 13 DT  D "H5''" 1  
ATOM 975   H "H4'"  . DT  B 1 13 ? -8.370  -3.463  9.179   1.00 5.22  ? 13 DT  D "H4'"  1  
ATOM 976   H "H3'"  . DT  B 1 13 ? -10.580 -4.769  8.504   1.00 5.16  ? 13 DT  D "H3'"  1  
ATOM 977   H "H2'"  . DT  B 1 13 ? -11.559 -3.155  7.028   1.00 4.90  ? 13 DT  D "H2'"  1  
ATOM 978   H "H2''" . DT  B 1 13 ? -12.357 -2.740  8.537   1.00 5.37  ? 13 DT  D "H2''" 1  
ATOM 979   H "H1'"  . DT  B 1 13 ? -10.874 -0.939  9.001   1.00 5.51  ? 13 DT  D "H1'"  1  
ATOM 980   H H3     . DT  B 1 13 ? -11.303 2.579   6.310   1.00 5.26  ? 13 DT  D H3     1  
ATOM 981   H H71    . DT  B 1 13 ? -11.721 -1.862  3.284   1.00 4.06  ? 13 DT  D H71    1  
ATOM 982   H H72    . DT  B 1 13 ? -12.448 -0.307  2.815   1.00 4.04  ? 13 DT  D H72    1  
ATOM 983   H H73    . DT  B 1 13 ? -10.704 -0.576  2.594   1.00 4.12  ? 13 DT  D H73    1  
ATOM 984   H H6     . DT  B 1 13 ? -10.919 -2.113  5.483   1.00 4.51  ? 13 DT  D H6     1  
ATOM 985   P P      . DT  B 1 14 ? -11.983 -3.994  10.888  1.00 5.93  ? 14 DT  D P      1  
ATOM 986   O OP1    . DT  B 1 14 ? -11.698 -4.862  12.059  1.00 6.20  ? 14 DT  D OP1    1  
ATOM 987   O OP2    . DT  B 1 14 ? -12.954 -4.444  9.858   1.00 5.72  ? 14 DT  D OP2    1  
ATOM 988   O "O5'"  . DT  B 1 14 ? -12.423 -2.565  11.419  1.00 6.17  ? 14 DT  D "O5'"  1  
ATOM 989   C "C5'"  . DT  B 1 14 ? -11.449 -1.737  12.048  1.00 6.33  ? 14 DT  D "C5'"  1  
ATOM 990   C "C4'"  . DT  B 1 14 ? -12.110 -0.575  12.741  1.00 6.64  ? 14 DT  D "C4'"  1  
ATOM 991   O "O4'"  . DT  B 1 14 ? -12.392 0.456   11.761  1.00 6.46  ? 14 DT  D "O4'"  1  
ATOM 992   C "C3'"  . DT  B 1 14 ? -13.462 -0.949  13.331  1.00 6.86  ? 14 DT  D "C3'"  1  
ATOM 993   O "O3'"  . DT  B 1 14 ? -13.746 -0.115  14.444  1.00 7.24  ? 14 DT  D "O3'"  1  
ATOM 994   C "C2'"  . DT  B 1 14 ? -14.411 -0.717  12.168  1.00 6.61  ? 14 DT  D "C2'"  1  
ATOM 995   C "C1'"  . DT  B 1 14 ? -13.788 0.500   11.489  1.00 6.47  ? 14 DT  D "C1'"  1  
ATOM 996   N N1     . DT  B 1 14 ? -13.989 0.599   10.021  1.00 6.10  ? 14 DT  D N1     1  
ATOM 997   C C2     . DT  B 1 14 ? -14.202 1.859   9.487   1.00 6.09  ? 14 DT  D C2     1  
ATOM 998   O O2     . DT  B 1 14 ? -14.180 2.882   10.152  1.00 6.38  ? 14 DT  D O2     1  
ATOM 999   N N3     . DT  B 1 14 ? -14.442 1.879   8.138   1.00 5.76  ? 14 DT  D N3     1  
ATOM 1000  C C4     . DT  B 1 14 ? -14.485 0.798   7.285   1.00 5.43  ? 14 DT  D C4     1  
ATOM 1001  O O4     . DT  B 1 14 ? -14.765 0.967   6.099   1.00 5.16  ? 14 DT  D O4     1  
ATOM 1002  C C5     . DT  B 1 14 ? -14.232 -0.489  7.901   1.00 5.46  ? 14 DT  D C5     1  
ATOM 1003  C C7     . DT  B 1 14 ? -14.295 -1.720  7.052   1.00 5.15  ? 14 DT  D C7     1  
ATOM 1004  C C6     . DT  B 1 14 ? -13.991 -0.527  9.222   1.00 5.79  ? 14 DT  D C6     1  
ATOM 1005  H "H5'"  . DT  B 1 14 ? -10.755 -1.357  11.298  1.00 6.11  ? 14 DT  D "H5'"  1  
ATOM 1006  H "H5''" . DT  B 1 14 ? -10.893 -2.320  12.782  1.00 6.47  ? 14 DT  D "H5''" 1  
ATOM 1007  H "H4'"  . DT  B 1 14 ? -11.469 -0.249  13.563  1.00 6.85  ? 14 DT  D "H4'"  1  
ATOM 1008  H "H3'"  . DT  B 1 14 ? -13.470 -1.991  13.654  1.00 6.90  ? 14 DT  D "H3'"  1  
ATOM 1009  H "H2'"  . DT  B 1 14 ? -14.448 -1.584  11.509  1.00 6.38  ? 14 DT  D "H2'"  1  
ATOM 1010  H "H2''" . DT  B 1 14 ? -15.425 -0.528  12.514  1.00 6.78  ? 14 DT  D "H2''" 1  
ATOM 1011  H "H1'"  . DT  B 1 14 ? -14.172 1.418   11.941  1.00 6.70  ? 14 DT  D "H1'"  1  
ATOM 1012  H H3     . DT  B 1 14 ? -14.616 2.788   7.728   1.00 5.78  ? 14 DT  D H3     1  
ATOM 1013  H H71    . DT  B 1 14 ? -13.397 -1.784  6.437   1.00 4.98  ? 14 DT  D H71    1  
ATOM 1014  H H72    . DT  B 1 14 ? -15.173 -1.673  6.408   1.00 5.03  ? 14 DT  D H72    1  
ATOM 1015  H H73    . DT  B 1 14 ? -14.361 -2.601  7.691   1.00 5.27  ? 14 DT  D H73    1  
ATOM 1016  H H6     . DT  B 1 14 ? -13.783 -1.492  9.683   1.00 5.83  ? 14 DT  D H6     1  
ATOM 1017  P P      . DA  B 1 15 ? -15.148 -0.253  15.205  1.00 7.52  ? 15 DA  D P      1  
ATOM 1018  O OP1    . DA  B 1 15 ? -14.869 -0.344  16.660  1.00 7.92  ? 15 DA  D OP1    1  
ATOM 1019  O OP2    . DA  B 1 15 ? -15.979 -1.295  14.548  1.00 7.34  ? 15 DA  D OP2    1  
ATOM 1020  O "O5'"  . DA  B 1 15 ? -15.782 1.171   14.904  1.00 7.56  ? 15 DA  D "O5'"  1  
ATOM 1021  C "C5'"  . DA  B 1 15 ? -14.983 2.337   15.086  1.00 7.67  ? 15 DA  D "C5'"  1  
ATOM 1022  C "C4'"  . DA  B 1 15 ? -15.821 3.583   14.959  1.00 7.79  ? 15 DA  D "C4'"  1  
ATOM 1023  O "O4'"  . DA  B 1 15 ? -16.024 3.870   13.552  1.00 7.44  ? 15 DA  D "O4'"  1  
ATOM 1024  C "C3'"  . DA  B 1 15 ? -17.220 3.417   15.538  1.00 7.99  ? 15 DA  D "C3'"  1  
ATOM 1025  O "O3'"  . DA  B 1 15 ? -17.724 4.680   15.953  1.00 8.25  ? 15 DA  D "O3'"  1  
ATOM 1026  C "C2'"  . DA  B 1 15 ? -18.001 2.847   14.368  1.00 7.65  ? 15 DA  D "C2'"  1  
ATOM 1027  C "C1'"  . DA  B 1 15 ? -17.363 3.561   13.181  1.00 7.36  ? 15 DA  D "C1'"  1  
ATOM 1028  N N9     . DA  B 1 15 ? -17.347 2.802   11.927  1.00 6.95  ? 15 DA  D N9     1  
ATOM 1029  C C8     . DA  B 1 15 ? -17.051 1.475   11.738  1.00 6.75  ? 15 DA  D C8     1  
ATOM 1030  N N7     . DA  B 1 15 ? -17.171 1.079   10.492  1.00 6.39  ? 15 DA  D N7     1  
ATOM 1031  C C5     . DA  B 1 15 ? -17.566 2.224   9.813   1.00 6.33  ? 15 DA  D C5     1  
ATOM 1032  C C6     . DA  B 1 15 ? -17.866 2.467   8.456   1.00 6.01  ? 15 DA  D C6     1  
ATOM 1033  N N6     . DA  B 1 15 ? -17.828 1.527   7.508   1.00 5.66  ? 15 DA  D N6     1  
ATOM 1034  N N1     . DA  B 1 15 ? -18.219 3.724   8.104   1.00 6.08  ? 15 DA  D N1     1  
ATOM 1035  C C2     . DA  B 1 15 ? -18.271 4.663   9.059   1.00 6.44  ? 15 DA  D C2     1  
ATOM 1036  N N3     . DA  B 1 15 ? -18.020 4.555   10.366  1.00 6.76  ? 15 DA  D N3     1  
ATOM 1037  C C4     . DA  B 1 15 ? -17.667 3.296   10.682  1.00 6.68  ? 15 DA  D C4     1  
ATOM 1038  H "H5'"  . DA  B 1 15 ? -14.195 2.360   14.333  1.00 7.43  ? 15 DA  D "H5'"  1  
ATOM 1039  H "H5''" . DA  B 1 15 ? -14.527 2.315   16.076  1.00 7.93  ? 15 DA  D "H5''" 1  
ATOM 1040  H "H4'"  . DA  B 1 15 ? -15.330 4.388   15.511  1.00 8.00  ? 15 DA  D "H4'"  1  
ATOM 1041  H "H3'"  . DA  B 1 15 ? -17.212 2.736   16.389  1.00 8.18  ? 15 DA  D "H3'"  1  
ATOM 1042  H "H2'"  . DA  B 1 15 ? -17.890 1.765   14.307  1.00 7.54  ? 15 DA  D "H2'"  1  
ATOM 1043  H "H2''" . DA  B 1 15 ? -19.064 3.063   14.457  1.00 7.74  ? 15 DA  D "H2''" 1  
ATOM 1044  H "H1'"  . DA  B 1 15 ? -17.873 4.509   12.994  1.00 7.43  ? 15 DA  D "H1'"  1  
ATOM 1045  H H8     . DA  B 1 15 ? -16.752 0.818   12.540  1.00 6.91  ? 15 DA  D H8     1  
ATOM 1046  H H61    . DA  B 1 15 ? -18.062 1.759   6.554   1.00 5.45  ? 15 DA  D H61    1  
ATOM 1047  H H62    . DA  B 1 15 ? -17.573 0.581   7.754   1.00 5.63  ? 15 DA  D H62    1  
ATOM 1048  H H2     . DA  B 1 15 ? -18.558 5.659   8.718   1.00 6.50  ? 15 DA  D H2     1  
ATOM 1049  P P      . DT  B 1 16 ? -19.211 4.790   16.540  1.00 8.48  ? 16 DT  D P      1  
ATOM 1050  O OP1    . DT  B 1 16 ? -19.142 5.580   17.795  1.00 8.91  ? 16 DT  D OP1    1  
ATOM 1051  O OP2    . DT  B 1 16 ? -19.855 3.450   16.548  1.00 8.39  ? 16 DT  D OP2    1  
ATOM 1052  O "O5'"  . DT  B 1 16 ? -19.909 5.681   15.425  1.00 8.28  ? 16 DT  D "O5'"  1  
ATOM 1053  C "C5'"  . DT  B 1 16 ? -19.225 6.827   14.928  1.00 8.25  ? 16 DT  D "C5'"  1  
ATOM 1054  C "C4'"  . DT  B 1 16 ? -20.134 7.657   14.055  1.00 8.16  ? 16 DT  D "C4'"  1  
ATOM 1055  O "O4'"  . DT  B 1 16 ? -20.208 7.045   12.742  1.00 7.74  ? 16 DT  D "O4'"  1  
ATOM 1056  C "C3'"  . DT  B 1 16 ? -21.571 7.686   14.562  1.00 8.35  ? 16 DT  D "C3'"  1  
ATOM 1057  O "O3'"  . DT  B 1 16 ? -22.209 8.884   14.128  1.00 8.42  ? 16 DT  D "O3'"  1  
ATOM 1058  C "C2'"  . DT  B 1 16 ? -22.180 6.453   13.920  1.00 8.06  ? 16 DT  D "C2'"  1  
ATOM 1059  C "C1'"  . DT  B 1 16 ? -21.476 6.424   12.568  1.00 7.67  ? 16 DT  D "C1'"  1  
ATOM 1060  N N1     . DT  B 1 16 ? -21.285 5.086   11.960  1.00 7.34  ? 16 DT  D N1     1  
ATOM 1061  C C2     . DT  B 1 16 ? -21.502 4.985   10.601  1.00 6.98  ? 16 DT  D C2     1  
ATOM 1062  O O2     . DT  B 1 16 ? -21.778 5.942   9.897   1.00 6.92  ? 16 DT  D O2     1  
ATOM 1063  N N3     . DT  B 1 16 ? -21.386 3.720   10.091  1.00 6.70  ? 16 DT  D N3     1  
ATOM 1064  C C4     . DT  B 1 16 ? -21.071 2.570   10.781  1.00 6.77  ? 16 DT  D C4     1  
ATOM 1065  O O4     . DT  B 1 16 ? -21.051 1.491   10.189  1.00 6.52  ? 16 DT  D O4     1  
ATOM 1066  C C5     . DT  B 1 16 ? -20.829 2.746   12.198  1.00 7.16  ? 16 DT  D C5     1  
ATOM 1067  C C7     . DT  B 1 16 ? -20.527 1.541   13.032  1.00 7.28  ? 16 DT  D C7     1  
ATOM 1068  C C6     . DT  B 1 16 ? -20.937 3.983   12.715  1.00 7.42  ? 16 DT  D C6     1  
ATOM 1069  H "H5'"  . DT  B 1 16 ? -18.362 6.510   14.342  1.00 8.01  ? 16 DT  D "H5'"  1  
ATOM 1070  H "H5''" . DT  B 1 16 ? -18.882 7.438   15.763  1.00 8.53  ? 16 DT  D "H5''" 1  
ATOM 1071  H "H4'"  . DT  B 1 16 ? -19.765 8.684   14.048  1.00 8.28  ? 16 DT  D "H4'"  1  
ATOM 1072  H "H3'"  . DT  B 1 16 ? -21.603 7.636   15.651  1.00 8.64  ? 16 DT  D "H3'"  1  
ATOM 1073  H "H2'"  . DT  B 1 16 ? -21.977 5.559   14.510  1.00 8.11  ? 16 DT  D "H2'"  1  
ATOM 1074  H "H2''" . DT  B 1 16 ? -23.260 6.545   13.827  1.00 8.10  ? 16 DT  D "H2''" 1  
ATOM 1075  H "H1'"  . DT  B 1 16 ? -22.030 7.036   11.851  1.00 7.58  ? 16 DT  D "H1'"  1  
ATOM 1076  H H3     . DT  B 1 16 ? -21.567 3.618   9.101   1.00 6.44  ? 16 DT  D H3     1  
ATOM 1077  H H71    . DT  B 1 16 ? -19.494 1.234   12.868  1.00 7.19  ? 16 DT  D H71    1  
ATOM 1078  H H72    . DT  B 1 16 ? -21.195 0.727   12.750  1.00 7.26  ? 16 DT  D H72    1  
ATOM 1079  H H73    . DT  B 1 16 ? -20.671 1.780   14.086  1.00 7.56  ? 16 DT  D H73    1  
ATOM 1080  H H6     . DT  B 1 16 ? -20.735 4.122   13.777  1.00 7.71  ? 16 DT  D H6     1  
ATOM 1081  P P      . DC  B 1 17 ? -23.756 9.135   14.469  1.00 8.61  ? 17 DC  D P      1  
ATOM 1082  O OP1    . DC  B 1 17 ? -23.886 10.501  15.039  1.00 8.94  ? 17 DC  D OP1    1  
ATOM 1083  O OP2    . DC  B 1 17 ? -24.293 7.973   15.221  1.00 8.70  ? 17 DC  D OP2    1  
ATOM 1084  O "O5'"  . DC  B 1 17 ? -24.402 9.140   13.016  1.00 8.25  ? 17 DC  D "O5'"  1  
ATOM 1085  C "C5'"  . DC  B 1 17 ? -23.774 9.881   11.972  1.00 8.07  ? 17 DC  D "C5'"  1  
ATOM 1086  C "C4'"  . DC  B 1 17 ? -24.641 9.908   10.737  1.00 7.81  ? 17 DC  D "C4'"  1  
ATOM 1087  O "O4'"  . DC  B 1 17 ? -24.518 8.639   10.052  1.00 7.44  ? 17 DC  D "O4'"  1  
ATOM 1088  C "C3'"  . DC  B 1 17 ? -26.128 10.055  11.039  1.00 7.97  ? 17 DC  D "C3'"  1  
ATOM 1089  O "O3'"  . DC  B 1 17 ? -26.790 10.660  9.926   1.00 7.82  ? 17 DC  D "O3'"  1  
ATOM 1090  C "C2'"  . DC  B 1 17 ? -26.569 8.616   11.242  1.00 7.83  ? 17 DC  D "C2'"  1  
ATOM 1091  C "C1'"  . DC  B 1 17 ? -25.703 7.872   10.230  1.00 7.43  ? 17 DC  D "C1'"  1  
ATOM 1092  N N1     . DC  B 1 17 ? -25.321 6.494   10.595  1.00 7.33  ? 17 DC  D N1     1  
ATOM 1093  C C2     . DC  B 1 17 ? -25.390 5.502   9.607   1.00 6.96  ? 17 DC  D C2     1  
ATOM 1094  O O2     . DC  B 1 17 ? -25.739 5.820   8.459   1.00 6.72  ? 17 DC  D O2     1  
ATOM 1095  N N3     . DC  B 1 17 ? -25.077 4.226   9.924   1.00 6.88  ? 17 DC  D N3     1  
ATOM 1096  C C4     . DC  B 1 17 ? -24.704 3.921   11.167  1.00 7.16  ? 17 DC  D C4     1  
ATOM 1097  N N4     . DC  B 1 17 ? -24.421 2.641   11.434  1.00 7.10  ? 17 DC  D N4     1  
ATOM 1098  C C5     . DC  B 1 17 ? -24.608 4.911   12.192  1.00 7.53  ? 17 DC  D C5     1  
ATOM 1099  C C6     . DC  B 1 17 ? -24.921 6.175   11.863  1.00 7.60  ? 17 DC  D C6     1  
ATOM 1100  H "H5'"  . DC  B 1 17 ? -22.817 9.422   11.725  1.00 7.89  ? 17 DC  D "H5'"  1  
ATOM 1101  H "H5''" . DC  B 1 17 ? -23.600 10.904  12.306  1.00 8.30  ? 17 DC  D "H5''" 1  
ATOM 1102  H "H4'"  . DC  B 1 17 ? -24.346 10.767  10.131  1.00 7.79  ? 17 DC  D "H4'"  1  
ATOM 1103  H "H3'"  . DC  B 1 17 ? -26.291 10.662  11.929  1.00 8.28  ? 17 DC  D "H3'"  1  
ATOM 1104  H "H2'"  . DC  B 1 17 ? -26.385 8.287   12.265  1.00 8.04  ? 17 DC  D "H2'"  1  
ATOM 1105  H "H2''" . DC  B 1 17 ? -27.634 8.496   11.047  1.00 7.82  ? 17 DC  D "H2''" 1  
ATOM 1106  H "H1'"  . DC  B 1 17 ? -26.208 7.834   9.263   1.00 7.21  ? 17 DC  D "H1'"  1  
ATOM 1107  H H41    . DC  B 1 17 ? -24.502 1.943   10.708  1.00 6.86  ? 17 DC  D H41    1  
ATOM 1108  H H42    . DC  B 1 17 ? -24.137 2.367   12.363  1.00 7.32  ? 17 DC  D H42    1  
ATOM 1109  H H5     . DC  B 1 17 ? -24.293 4.651   13.203  1.00 7.75  ? 17 DC  D H5     1  
ATOM 1110  H H6     . DC  B 1 17 ? -24.853 6.956   12.619  1.00 7.88  ? 17 DC  D H6     1  
ATOM 1111  P P      . DG  B 1 18 ? -28.366 10.959  9.999   1.00 7.95  ? 18 DG  D P      1  
ATOM 1112  O OP1    . DG  B 1 18 ? -28.572 12.367  9.570   1.00 8.08  ? 18 DG  D OP1    1  
ATOM 1113  O OP2    . DG  B 1 18 ? -28.886 10.511  11.317  1.00 8.23  ? 18 DG  D OP2    1  
ATOM 1114  O "O5'"  . DG  B 1 18 ? -28.962 10.006  8.872   1.00 7.55  ? 18 DG  D "O5'"  1  
ATOM 1115  C "C5'"  . DG  B 1 18 ? -28.496 10.105  7.527   1.00 7.23  ? 18 DG  D "C5'"  1  
ATOM 1116  C "C4'"  . DG  B 1 18 ? -29.402 9.336   6.594   1.00 6.93  ? 18 DG  D "C4'"  1  
ATOM 1117  O "O4'"  . DG  B 1 18 ? -29.134 7.924   6.752   1.00 6.75  ? 18 DG  D "O4'"  1  
ATOM 1118  C "C3'"  . DG  B 1 18 ? -30.889 9.496   6.893   1.00 7.08  ? 18 DG  D "C3'"  1  
ATOM 1119  O "O3'"  . DG  B 1 18 ? -31.679 9.266   5.721   1.00 6.80  ? 18 DG  D "O3'"  1  
ATOM 1120  C "C2'"  . DG  B 1 18 ? -31.133 8.414   7.929   1.00 7.19  ? 18 DG  D "C2'"  1  
ATOM 1121  C "C1'"  . DG  B 1 18 ? -30.197 7.303   7.462   1.00 6.89  ? 18 DG  D "C1'"  1  
ATOM 1122  N N9     . DG  B 1 18 ? -29.620 6.480   8.522   1.00 7.02  ? 18 DG  D N9     1  
ATOM 1123  C C8     . DG  B 1 18 ? -29.225 6.878   9.776   1.00 7.37  ? 18 DG  D C8     1  
ATOM 1124  N N7     . DG  B 1 18 ? -28.772 5.897   10.509  1.00 7.43  ? 18 DG  D N7     1  
ATOM 1125  C C5     . DG  B 1 18 ? -28.870 4.782   9.687   1.00 7.10  ? 18 DG  D C5     1  
ATOM 1126  C C6     . DG  B 1 18 ? -28.531 3.421   9.930   1.00 7.02  ? 18 DG  D C6     1  
ATOM 1127  O O6     . DG  B 1 18 ? -28.061 2.913   10.957  1.00 7.23  ? 18 DG  D O6     1  
ATOM 1128  N N1     . DG  B 1 18 ? -28.792 2.623   8.819   1.00 6.68  ? 18 DG  D N1     1  
ATOM 1129  C C2     . DG  B 1 18 ? -29.311 3.073   7.629   1.00 6.43  ? 18 DG  D C2     1  
ATOM 1130  N N2     . DG  B 1 18 ? -29.491 2.152   6.671   1.00 6.12  ? 18 DG  D N2     1  
ATOM 1131  N N3     . DG  B 1 18 ? -29.630 4.334   7.391   1.00 6.50  ? 18 DG  D N3     1  
ATOM 1132  C C4     . DG  B 1 18 ? -29.386 5.127   8.455   1.00 6.84  ? 18 DG  D C4     1  
ATOM 1133  H "H5'"  . DG  B 1 18 ? -27.487 9.698   7.460   1.00 7.12  ? 18 DG  D "H5'"  1  
ATOM 1134  H "H5''" . DG  B 1 18 ? -28.477 11.152  7.222   1.00 7.33  ? 18 DG  D "H5''" 1  
ATOM 1135  H "H4'"  . DG  B 1 18 ? -29.234 9.703   5.580   1.00 6.74  ? 18 DG  D "H4'"  1  
ATOM 1136  H "H3'"  . DG  B 1 18 ? -31.106 10.490  7.284   1.00 7.33  ? 18 DG  D "H3'"  1  
ATOM 1137  H "HO3'" . DG  B 1 18 ? -32.274 10.017  5.641   1.00 6.78  ? 18 DG  D "HO3'" 1  
ATOM 1138  H "H2'"  . DG  B 1 18 ? -30.889 8.765   8.932   1.00 7.48  ? 18 DG  D "H2'"  1  
ATOM 1139  H "H2''" . DG  B 1 18 ? -32.176 8.100   7.937   1.00 7.20  ? 18 DG  D "H2''" 1  
ATOM 1140  H "H1'"  . DG  B 1 18 ? -30.713 6.642   6.762   1.00 6.65  ? 18 DG  D "H1'"  1  
ATOM 1141  H H8     . DG  B 1 18 ? -29.285 7.899   10.121  1.00 7.59  ? 18 DG  D H8     1  
ATOM 1142  H H1     . DG  B 1 18 ? -28.584 1.637   8.897   1.00 6.62  ? 18 DG  D H1     1  
ATOM 1143  H H21    . DG  B 1 18 ? -29.255 1.181   6.829   1.00 6.08  ? 18 DG  D H21    1  
ATOM 1144  H H22    . DG  B 1 18 ? -29.870 2.431   5.776   1.00 5.93  ? 18 DG  D H22    1  
ATOM 1145  N N      . MET C 2 1  ? 1.312   7.333   -17.570 1.00 6.61  ? 1  MET A N      1  
ATOM 1146  C CA     . MET C 2 1  ? 0.416   6.185   -17.837 1.00 6.29  ? 1  MET A CA     1  
ATOM 1147  C C      . MET C 2 1  ? 0.060   5.485   -16.535 1.00 5.80  ? 1  MET A C      1  
ATOM 1148  O O      . MET C 2 1  ? 0.943   5.087   -15.779 1.00 5.96  ? 1  MET A O      1  
ATOM 1149  C CB     . MET C 2 1  ? 1.083   5.191   -18.795 1.00 6.58  ? 1  MET A CB     1  
ATOM 1150  C CG     . MET C 2 1  ? 0.233   3.962   -19.090 1.00 6.98  ? 1  MET A CG     1  
ATOM 1151  S SD     . MET C 2 1  ? 1.105   2.724   -20.073 1.00 7.35  ? 1  MET A SD     1  
ATOM 1152  C CE     . MET C 2 1  ? 2.459   2.305   -18.978 1.00 8.11  ? 1  MET A CE     1  
ATOM 1153  H H1     . MET C 2 1  ? 1.898   7.539   -18.409 1.00 6.85  ? 1  MET A H1     1  
ATOM 1154  H H2     . MET C 2 1  ? 1.936   7.120   -16.768 1.00 6.72  ? 1  MET A H2     1  
ATOM 1155  H H3     . MET C 2 1  ? 0.750   8.180   -17.338 1.00 6.83  ? 1  MET A H3     1  
ATOM 1156  H HA     . MET C 2 1  ? -0.491  6.561   -18.290 1.00 6.54  ? 1  MET A HA     1  
ATOM 1157  H HB2    . MET C 2 1  ? 1.290   5.692   -19.729 1.00 6.87  ? 1  MET A HB2    1  
ATOM 1158  H HB3    . MET C 2 1  ? 2.015   4.861   -18.360 1.00 6.62  ? 1  MET A HB3    1  
ATOM 1159  H HG2    . MET C 2 1  ? -0.061  3.513   -18.154 1.00 7.25  ? 1  MET A HG2    1  
ATOM 1160  H HG3    . MET C 2 1  ? -0.649  4.274   -19.630 1.00 7.18  ? 1  MET A HG3    1  
ATOM 1161  H HE1    . MET C 2 1  ? 3.083   1.557   -19.446 1.00 8.46  ? 1  MET A HE1    1  
ATOM 1162  H HE2    . MET C 2 1  ? 2.065   1.915   -18.051 1.00 8.28  ? 1  MET A HE2    1  
ATOM 1163  H HE3    . MET C 2 1  ? 3.046   3.189   -18.776 1.00 8.36  ? 1  MET A HE3    1  
ATOM 1164  N N      . LYS C 2 2  ? -1.231  5.343   -16.271 1.00 5.48  ? 2  LYS A N      1  
ATOM 1165  C CA     . LYS C 2 2  ? -1.692  4.682   -15.060 1.00 5.17  ? 2  LYS A CA     1  
ATOM 1166  C C      . LYS C 2 2  ? -3.004  3.952   -15.318 1.00 4.60  ? 2  LYS A C      1  
ATOM 1167  O O      . LYS C 2 2  ? -4.003  4.573   -15.681 1.00 4.73  ? 2  LYS A O      1  
ATOM 1168  C CB     . LYS C 2 2  ? -1.871  5.693   -13.918 1.00 5.62  ? 2  LYS A CB     1  
ATOM 1169  C CG     . LYS C 2 2  ? -2.538  5.111   -12.675 1.00 5.98  ? 2  LYS A CG     1  
ATOM 1170  C CD     . LYS C 2 2  ? -1.669  4.055   -12.004 1.00 6.39  ? 2  LYS A CD     1  
ATOM 1171  C CE     . LYS C 2 2  ? -2.430  3.305   -10.917 1.00 6.72  ? 2  LYS A CE     1  
ATOM 1172  N NZ     . LYS C 2 2  ? -3.373  2.297   -11.481 1.00 7.29  ? 2  LYS A NZ     1  
ATOM 1173  H H      . LYS C 2 2  ? -1.894  5.689   -16.909 1.00 5.65  ? 2  LYS A H      1  
ATOM 1174  H HA     . LYS C 2 2  ? -0.943  3.958   -14.774 1.00 5.28  ? 2  LYS A HA     1  
ATOM 1175  H HB2    . LYS C 2 2  ? -0.900  6.071   -13.634 1.00 5.96  ? 2  LYS A HB2    1  
ATOM 1176  H HB3    . LYS C 2 2  ? -2.476  6.514   -14.273 1.00 5.72  ? 2  LYS A HB3    1  
ATOM 1177  H HG2    . LYS C 2 2  ? -2.721  5.909   -11.971 1.00 6.17  ? 2  LYS A HG2    1  
ATOM 1178  H HG3    . LYS C 2 2  ? -3.478  4.661   -12.962 1.00 6.16  ? 2  LYS A HG3    1  
ATOM 1179  H HD2    . LYS C 2 2  ? -1.340  3.348   -12.750 1.00 6.78  ? 2  LYS A HD2    1  
ATOM 1180  H HD3    . LYS C 2 2  ? -0.811  4.539   -11.561 1.00 6.45  ? 2  LYS A HD3    1  
ATOM 1181  H HE2    . LYS C 2 2  ? -1.718  2.800   -10.282 1.00 6.67  ? 2  LYS A HE2    1  
ATOM 1182  H HE3    . LYS C 2 2  ? -2.989  4.019   -10.330 1.00 6.92  ? 2  LYS A HE3    1  
ATOM 1183  H HZ1    . LYS C 2 2  ? -3.967  2.731   -12.223 1.00 7.55  ? 2  LYS A HZ1    1  
ATOM 1184  H HZ2    . LYS C 2 2  ? -3.996  1.929   -10.734 1.00 7.51  ? 2  LYS A HZ2    1  
ATOM 1185  H HZ3    . LYS C 2 2  ? -2.846  1.502   -11.894 1.00 7.50  ? 2  LYS A HZ3    1  
ATOM 1186  N N      . PRO C 2 3  ? -3.001  2.619   -15.153 1.00 4.22  ? 3  PRO A N      1  
ATOM 1187  C CA     . PRO C 2 3  ? -4.198  1.791   -15.342 1.00 3.97  ? 3  PRO A CA     1  
ATOM 1188  C C      . PRO C 2 3  ? -5.262  2.069   -14.285 1.00 3.83  ? 3  PRO A C      1  
ATOM 1189  O O      . PRO C 2 3  ? -5.106  2.968   -13.452 1.00 4.13  ? 3  PRO A O      1  
ATOM 1190  C CB     . PRO C 2 3  ? -3.671  0.358   -15.209 1.00 4.05  ? 3  PRO A CB     1  
ATOM 1191  C CG     . PRO C 2 3  ? -2.415  0.484   -14.419 1.00 4.26  ? 3  PRO A CG     1  
ATOM 1192  C CD     . PRO C 2 3  ? -1.821  1.809   -14.801 1.00 4.37  ? 3  PRO A CD     1  
ATOM 1193  H HA     . PRO C 2 3  ? -4.630  1.930   -16.321 1.00 4.12  ? 3  PRO A HA     1  
ATOM 1194  H HB2    . PRO C 2 3  ? -4.401  -0.250  -14.695 1.00 4.23  ? 3  PRO A HB2    1  
ATOM 1195  H HB3    . PRO C 2 3  ? -3.480  -0.050  -16.190 1.00 4.13  ? 3  PRO A HB3    1  
ATOM 1196  H HG2    . PRO C 2 3  ? -2.641  0.464   -13.363 1.00 4.56  ? 3  PRO A HG2    1  
ATOM 1197  H HG3    . PRO C 2 3  ? -1.738  -0.318  -14.675 1.00 4.30  ? 3  PRO A HG3    1  
ATOM 1198  H HD2    . PRO C 2 3  ? -1.292  2.241   -13.965 1.00 4.55  ? 3  PRO A HD2    1  
ATOM 1199  H HD3    . PRO C 2 3  ? -1.164  1.698   -15.651 1.00 4.58  ? 3  PRO A HD3    1  
ATOM 1200  N N      . VAL C 2 4  ? -6.319  1.272   -14.309 1.00 3.45  ? 4  VAL A N      1  
ATOM 1201  C CA     . VAL C 2 4  ? -7.435  1.423   -13.385 1.00 3.31  ? 4  VAL A CA     1  
ATOM 1202  C C      . VAL C 2 4  ? -7.012  1.417   -11.923 1.00 3.06  ? 4  VAL A C      1  
ATOM 1203  O O      . VAL C 2 4  ? -6.023  0.797   -11.519 1.00 2.85  ? 4  VAL A O      1  
ATOM 1204  C CB     . VAL C 2 4  ? -8.477  0.297   -13.558 1.00 3.15  ? 4  VAL A CB     1  
ATOM 1205  C CG1    . VAL C 2 4  ? -9.722  0.563   -12.729 1.00 3.02  ? 4  VAL A CG1    1  
ATOM 1206  C CG2    . VAL C 2 4  ? -8.857  0.129   -15.006 1.00 3.43  ? 4  VAL A CG2    1  
ATOM 1207  H H      . VAL C 2 4  ? -6.352  0.555   -14.974 1.00 3.34  ? 4  VAL A H      1  
ATOM 1208  H HA     . VAL C 2 4  ? -7.929  2.362   -13.602 1.00 3.54  ? 4  VAL A HA     1  
ATOM 1209  H HB     . VAL C 2 4  ? -8.037  -0.624  -13.213 1.00 2.96  ? 4  VAL A HB     1  
ATOM 1210  H HG11   . VAL C 2 4  ? -9.437  0.764   -11.703 1.00 3.17  ? 4  VAL A HG11   1  
ATOM 1211  H HG12   . VAL C 2 4  ? -10.370 -0.299  -12.762 1.00 3.22  ? 4  VAL A HG12   1  
ATOM 1212  H HG13   . VAL C 2 4  ? -10.243 1.423   -13.130 1.00 3.08  ? 4  VAL A HG13   1  
ATOM 1213  H HG21   . VAL C 2 4  ? -9.241  1.066   -15.379 1.00 3.42  ? 4  VAL A HG21   1  
ATOM 1214  H HG22   . VAL C 2 4  ? -9.621  -0.633  -15.082 1.00 3.82  ? 4  VAL A HG22   1  
ATOM 1215  H HG23   . VAL C 2 4  ? -7.991  -0.164  -15.576 1.00 3.65  ? 4  VAL A HG23   1  
ATOM 1216  N N      . THR C 2 5  ? -7.780  2.149   -11.164 1.00 3.14  ? 5  THR A N      1  
ATOM 1217  C CA     . THR C 2 5  ? -7.650  2.238   -9.731  1.00 3.01  ? 5  THR A CA     1  
ATOM 1218  C C      . THR C 2 5  ? -8.998  1.867   -9.180  1.00 2.85  ? 5  THR A C      1  
ATOM 1219  O O      . THR C 2 5  ? -9.980  1.871   -9.922  1.00 2.89  ? 5  THR A O      1  
ATOM 1220  C CB     . THR C 2 5  ? -7.266  3.649   -9.242  1.00 3.29  ? 5  THR A CB     1  
ATOM 1221  O OG1    . THR C 2 5  ? -8.188  4.624   -9.744  1.00 3.55  ? 5  THR A OG1    1  
ATOM 1222  C CG2    . THR C 2 5  ? -5.853  4.003   -9.664  1.00 3.52  ? 5  THR A CG2    1  
ATOM 1223  H H      . THR C 2 5  ? -8.497  2.665   -11.605 1.00 3.33  ? 5  THR A H      1  
ATOM 1224  H HA     . THR C 2 5  ? -6.917  1.520   -9.388  1.00 2.86  ? 5  THR A HA     1  
ATOM 1225  H HB     . THR C 2 5  ? -7.309  3.656   -8.162  1.00 3.25  ? 5  THR A HB     1  
ATOM 1226  H HG1    . THR C 2 5  ? -8.239  4.566   -10.718 1.00 3.59  ? 5  THR A HG1    1  
ATOM 1227  H HG21   . THR C 2 5  ? -5.164  3.298   -9.224  1.00 3.69  ? 5  THR A HG21   1  
ATOM 1228  H HG22   . THR C 2 5  ? -5.616  5.000   -9.325  1.00 3.76  ? 5  THR A HG22   1  
ATOM 1229  H HG23   . THR C 2 5  ? -5.777  3.959   -10.740 1.00 3.70  ? 5  THR A HG23   1  
ATOM 1230  N N      . LEU C 2 6  ? -9.080  1.520   -7.921  1.00 2.72  ? 6  LEU A N      1  
ATOM 1231  C CA     . LEU C 2 6  ? -10.372 1.167   -7.369  1.00 2.62  ? 6  LEU A CA     1  
ATOM 1232  C C      . LEU C 2 6  ? -11.343 2.339   -7.484  1.00 2.85  ? 6  LEU A C      1  
ATOM 1233  O O      . LEU C 2 6  ? -12.558 2.159   -7.491  1.00 2.79  ? 6  LEU A O      1  
ATOM 1234  C CB     . LEU C 2 6  ? -10.240 0.676   -5.946  1.00 2.55  ? 6  LEU A CB     1  
ATOM 1235  C CG     . LEU C 2 6  ? -10.615 -0.781  -5.757  1.00 2.31  ? 6  LEU A CG     1  
ATOM 1236  C CD1    . LEU C 2 6  ? -10.719 -1.120  -4.281  1.00 2.37  ? 6  LEU A CD1    1  
ATOM 1237  C CD2    . LEU C 2 6  ? -11.917 -1.094  -6.481  1.00 2.25  ? 6  LEU A CD2    1  
ATOM 1238  H H      . LEU C 2 6  ? -8.271  1.500   -7.358  1.00 2.71  ? 6  LEU A H      1  
ATOM 1239  H HA     . LEU C 2 6  ? -10.756 0.367   -7.966  1.00 2.47  ? 6  LEU A HA     1  
ATOM 1240  H HB2    . LEU C 2 6  ? -9.210  0.810   -5.641  1.00 2.61  ? 6  LEU A HB2    1  
ATOM 1241  H HB3    . LEU C 2 6  ? -10.879 1.271   -5.316  1.00 2.69  ? 6  LEU A HB3    1  
ATOM 1242  H HG     . LEU C 2 6  ? -9.839  -1.389  -6.189  1.00 2.21  ? 6  LEU A HG     1  
ATOM 1243  H HD11   . LEU C 2 6  ? -11.429 -0.455  -3.810  1.00 2.76  ? 6  LEU A HD11   1  
ATOM 1244  H HD12   . LEU C 2 6  ? -9.751  -1.002  -3.815  1.00 2.47  ? 6  LEU A HD12   1  
ATOM 1245  H HD13   . LEU C 2 6  ? -11.052 -2.141  -4.168  1.00 2.50  ? 6  LEU A HD13   1  
ATOM 1246  H HD21   . LEU C 2 6  ? -12.669 -0.372  -6.194  1.00 2.34  ? 6  LEU A HD21   1  
ATOM 1247  H HD22   . LEU C 2 6  ? -12.250 -2.086  -6.215  1.00 2.39  ? 6  LEU A HD22   1  
ATOM 1248  H HD23   . LEU C 2 6  ? -11.760 -1.040  -7.551  1.00 2.51  ? 6  LEU A HD23   1  
ATOM 1249  N N      . TYR C 2 7  ? -10.779 3.534   -7.592  1.00 3.13  ? 7  TYR A N      1  
ATOM 1250  C CA     . TYR C 2 7  ? -11.559 4.761   -7.748  1.00 3.41  ? 7  TYR A CA     1  
ATOM 1251  C C      . TYR C 2 7  ? -12.304 4.748   -9.081  1.00 3.42  ? 7  TYR A C      1  
ATOM 1252  O O      . TYR C 2 7  ? -13.439 5.208   -9.187  1.00 3.50  ? 7  TYR A O      1  
ATOM 1253  C CB     . TYR C 2 7  ? -10.652 5.993   -7.700  1.00 3.74  ? 7  TYR A CB     1  
ATOM 1254  C CG     . TYR C 2 7  ? -10.098 6.308   -6.335  1.00 3.86  ? 7  TYR A CG     1  
ATOM 1255  C CD1    . TYR C 2 7  ? -10.919 6.781   -5.320  1.00 3.98  ? 7  TYR A CD1    1  
ATOM 1256  C CD2    . TYR C 2 7  ? -8.748  6.140   -6.066  1.00 3.89  ? 7  TYR A CD2    1  
ATOM 1257  C CE1    . TYR C 2 7  ? -10.405 7.078   -4.071  1.00 4.16  ? 7  TYR A CE1    1  
ATOM 1258  C CE2    . TYR C 2 7  ? -8.227  6.434   -4.824  1.00 4.04  ? 7  TYR A CE2    1  
ATOM 1259  C CZ     . TYR C 2 7  ? -9.058  6.904   -3.829  1.00 4.20  ? 7  TYR A CZ     1  
ATOM 1260  O OH     . TYR C 2 7  ? -8.540  7.195   -2.589  1.00 4.39  ? 7  TYR A OH     1  
ATOM 1261  H H      . TYR C 2 7  ? -9.802  3.584   -7.597  1.00 3.16  ? 7  TYR A H      1  
ATOM 1262  H HA     . TYR C 2 7  ? -12.272 4.809   -6.938  1.00 3.41  ? 7  TYR A HA     1  
ATOM 1263  H HB2    . TYR C 2 7  ? -9.813  5.836   -8.360  1.00 3.72  ? 7  TYR A HB2    1  
ATOM 1264  H HB3    . TYR C 2 7  ? -11.211 6.853   -8.037  1.00 3.94  ? 7  TYR A HB3    1  
ATOM 1265  H HD1    . TYR C 2 7  ? -11.978 6.908   -5.514  1.00 3.96  ? 7  TYR A HD1    1  
ATOM 1266  H HD2    . TYR C 2 7  ? -8.099  5.772   -6.847  1.00 3.82  ? 7  TYR A HD2    1  
ATOM 1267  H HE1    . TYR C 2 7  ? -11.057 7.446   -3.293  1.00 4.30  ? 7  TYR A HE1    1  
ATOM 1268  H HE2    . TYR C 2 7  ? -7.174  6.297   -4.636  1.00 4.07  ? 7  TYR A HE2    1  
ATOM 1269  H HH     . TYR C 2 7  ? -7.803  7.805   -2.686  1.00 4.61  ? 7  TYR A HH     1  
ATOM 1270  N N      . ASP C 2 8  ? -11.633 4.198   -10.084 1.00 3.37  ? 8  ASP A N      1  
ATOM 1271  C CA     . ASP C 2 8  ? -12.151 4.105   -11.446 1.00 3.45  ? 8  ASP A CA     1  
ATOM 1272  C C      . ASP C 2 8  ? -13.349 3.190   -11.484 1.00 3.21  ? 8  ASP A C      1  
ATOM 1273  O O      . ASP C 2 8  ? -14.374 3.512   -12.083 1.00 3.31  ? 8  ASP A O      1  
ATOM 1274  C CB     . ASP C 2 8  ? -11.064 3.586   -12.392 1.00 3.49  ? 8  ASP A CB     1  
ATOM 1275  C CG     . ASP C 2 8  ? -10.018 4.630   -12.722 1.00 3.79  ? 8  ASP A CG     1  
ATOM 1276  O OD1    . ASP C 2 8  ? -10.343 5.603   -13.438 1.00 4.13  ? 8  ASP A OD1    1  
ATOM 1277  O OD2    . ASP C 2 8  ? -8.861  4.467   -12.269 1.00 3.72  ? 8  ASP A OD2    1  
ATOM 1278  H H      . ASP C 2 8  ? -10.767 3.804   -9.893  1.00 3.28  ? 8  ASP A H      1  
ATOM 1279  H HA     . ASP C 2 8  ? -12.452 5.081   -11.768 1.00 3.70  ? 8  ASP A HA     1  
ATOM 1280  H HB2    . ASP C 2 8  ? -10.566 2.752   -11.923 1.00 3.28  ? 8  ASP A HB2    1  
ATOM 1281  H HB3    . ASP C 2 8  ? -11.515 3.253   -13.314 1.00 3.52  ? 8  ASP A HB3    1  
ATOM 1282  N N      . VAL C 2 9  ? -13.221 2.053   -10.817 1.00 2.91  ? 9  VAL A N      1  
ATOM 1283  C CA     . VAL C 2 9  ? -14.286 1.085   -10.769 1.00 2.70  ? 9  VAL A CA     1  
ATOM 1284  C C      . VAL C 2 9  ? -15.438 1.667   -9.985  1.00 2.72  ? 9  VAL A C      1  
ATOM 1285  O O      . VAL C 2 9  ? -16.598 1.516   -10.340 1.00 2.70  ? 9  VAL A O      1  
ATOM 1286  C CB     . VAL C 2 9  ? -13.811 -0.215  -10.110 1.00 2.43  ? 9  VAL A CB     1  
ATOM 1287  C CG1    . VAL C 2 9  ? -14.954 -1.188  -9.960  1.00 2.28  ? 9  VAL A CG1    1  
ATOM 1288  C CG2    . VAL C 2 9  ? -12.686 -0.841  -10.913 1.00 2.45  ? 9  VAL A CG2    1  
ATOM 1289  H H      . VAL C 2 9  ? -12.411 1.893   -10.288 1.00 2.85  ? 9  VAL A H      1  
ATOM 1290  H HA     . VAL C 2 9  ? -14.608 0.873   -11.780 1.00 2.77  ? 9  VAL A HA     1  
ATOM 1291  H HB     . VAL C 2 9  ? -13.435 0.025   -9.126  1.00 2.40  ? 9  VAL A HB     1  
ATOM 1292  H HG11   . VAL C 2 9  ? -15.495 -1.245  -10.897 1.00 2.36  ? 9  VAL A HG11   1  
ATOM 1293  H HG12   . VAL C 2 9  ? -15.615 -0.849  -9.178  1.00 2.36  ? 9  VAL A HG12   1  
ATOM 1294  H HG13   . VAL C 2 9  ? -14.563 -2.163  -9.711  1.00 2.64  ? 9  VAL A HG13   1  
ATOM 1295  H HG21   . VAL C 2 9  ? -12.805 -1.919  -10.916 1.00 2.71  ? 9  VAL A HG21   1  
ATOM 1296  H HG22   . VAL C 2 9  ? -11.740 -0.581  -10.464 1.00 2.80  ? 9  VAL A HG22   1  
ATOM 1297  H HG23   . VAL C 2 9  ? -12.716 -0.472  -11.929 1.00 2.48  ? 9  VAL A HG23   1  
ATOM 1298  N N      . ALA C 2 10 ? -15.079 2.358   -8.925  1.00 2.80  ? 10 ALA A N      1  
ATOM 1299  C CA     . ALA C 2 10 ? -16.045 3.000   -8.048  1.00 2.91  ? 10 ALA A CA     1  
ATOM 1300  C C      . ALA C 2 10 ? -16.889 4.011   -8.811  1.00 3.14  ? 10 ALA A C      1  
ATOM 1301  O O      . ALA C 2 10 ? -18.121 3.992   -8.745  1.00 3.12  ? 10 ALA A O      1  
ATOM 1302  C CB     . ALA C 2 10 ? -15.296 3.667   -6.907  1.00 3.09  ? 10 ALA A CB     1  
ATOM 1303  H H      . ALA C 2 10 ? -14.112 2.442   -8.723  1.00 2.83  ? 10 ALA A H      1  
ATOM 1304  H HA     . ALA C 2 10 ? -16.699 2.245   -7.639  1.00 2.75  ? 10 ALA A HA     1  
ATOM 1305  H HB1    . ALA C 2 10 ? -15.640 4.683   -6.790  1.00 3.39  ? 10 ALA A HB1    1  
ATOM 1306  H HB2    . ALA C 2 10 ? -14.234 3.668   -7.137  1.00 3.18  ? 10 ALA A HB2    1  
ATOM 1307  H HB3    . ALA C 2 10 ? -15.467 3.116   -5.992  1.00 3.24  ? 10 ALA A HB3    1  
ATOM 1308  N N      . GLU C 2 11 ? -16.219 4.851   -9.573  1.00 3.37  ? 11 GLU A N      1  
ATOM 1309  C CA     . GLU C 2 11 ? -16.881 5.880   -10.353 1.00 3.64  ? 11 GLU A CA     1  
ATOM 1310  C C      . GLU C 2 11 ? -17.739 5.234   -11.424 1.00 3.52  ? 11 GLU A C      1  
ATOM 1311  O O      . GLU C 2 11 ? -18.917 5.555   -11.583 1.00 3.57  ? 11 GLU A O      1  
ATOM 1312  C CB     . GLU C 2 11 ? -15.842 6.802   -10.994 1.00 3.95  ? 11 GLU A CB     1  
ATOM 1313  C CG     . GLU C 2 11 ? -16.206 8.274   -10.940 1.00 4.31  ? 11 GLU A CG     1  
ATOM 1314  C CD     . GLU C 2 11 ? -17.356 8.633   -11.861 1.00 4.89  ? 11 GLU A CD     1  
ATOM 1315  O OE1    . GLU C 2 11 ? -17.219 8.468   -13.093 1.00 5.24  ? 11 GLU A OE1    1  
ATOM 1316  O OE2    . GLU C 2 11 ? -18.402 9.091   -11.360 1.00 5.23  ? 11 GLU A OE2    1  
ATOM 1317  H H      . GLU C 2 11 ? -15.244 4.758   -9.634  1.00 3.37  ? 11 GLU A H      1  
ATOM 1318  H HA     . GLU C 2 11 ? -17.515 6.450   -9.688  1.00 3.74  ? 11 GLU A HA     1  
ATOM 1319  H HB2    . GLU C 2 11 ? -14.899 6.669   -10.485 1.00 3.90  ? 11 GLU A HB2    1  
ATOM 1320  H HB3    . GLU C 2 11 ? -15.721 6.522   -12.030 1.00 4.15  ? 11 GLU A HB3    1  
ATOM 1321  H HG2    . GLU C 2 11 ? -16.486 8.519   -9.927  1.00 4.29  ? 11 GLU A HG2    1  
ATOM 1322  H HG3    . GLU C 2 11 ? -15.341 8.854   -11.223 1.00 4.50  ? 11 GLU A HG3    1  
ATOM 1323  N N      . TYR C 2 12 ? -17.124 4.322   -12.151 1.00 3.40  ? 12 TYR A N      1  
ATOM 1324  C CA     . TYR C 2 12 ? -17.783 3.601   -13.221 1.00 3.35  ? 12 TYR A CA     1  
ATOM 1325  C C      . TYR C 2 12 ? -18.966 2.778   -12.704 1.00 3.08  ? 12 TYR A C      1  
ATOM 1326  O O      . TYR C 2 12 ? -19.927 2.536   -13.436 1.00 3.11  ? 12 TYR A O      1  
ATOM 1327  C CB     . TYR C 2 12 ? -16.764 2.695   -13.898 1.00 3.31  ? 12 TYR A CB     1  
ATOM 1328  C CG     . TYR C 2 12 ? -17.267 2.023   -15.142 1.00 3.39  ? 12 TYR A CG     1  
ATOM 1329  C CD1    . TYR C 2 12 ? -17.587 2.751   -16.276 1.00 3.70  ? 12 TYR A CD1    1  
ATOM 1330  C CD2    . TYR C 2 12 ? -17.401 0.651   -15.179 1.00 3.19  ? 12 TYR A CD2    1  
ATOM 1331  C CE1    . TYR C 2 12 ? -18.035 2.122   -17.418 1.00 3.82  ? 12 TYR A CE1    1  
ATOM 1332  C CE2    . TYR C 2 12 ? -17.844 0.007   -16.312 1.00 3.34  ? 12 TYR A CE2    1  
ATOM 1333  C CZ     . TYR C 2 12 ? -18.162 0.750   -17.434 1.00 3.64  ? 12 TYR A CZ     1  
ATOM 1334  O OH     . TYR C 2 12 ? -18.603 0.125   -18.573 1.00 3.82  ? 12 TYR A OH     1  
ATOM 1335  H H      . TYR C 2 12 ? -16.179 4.123   -11.960 1.00 3.37  ? 12 TYR A H      1  
ATOM 1336  H HA     . TYR C 2 12 ? -18.143 4.322   -13.939 1.00 3.57  ? 12 TYR A HA     1  
ATOM 1337  H HB2    . TYR C 2 12 ? -15.897 3.277   -14.166 1.00 3.49  ? 12 TYR A HB2    1  
ATOM 1338  H HB3    . TYR C 2 12 ? -16.469 1.922   -13.204 1.00 3.08  ? 12 TYR A HB3    1  
ATOM 1339  H HD1    . TYR C 2 12 ? -17.485 3.826   -16.257 1.00 3.88  ? 12 TYR A HD1    1  
ATOM 1340  H HD2    . TYR C 2 12 ? -17.154 0.073   -14.284 1.00 2.97  ? 12 TYR A HD2    1  
ATOM 1341  H HE1    . TYR C 2 12 ? -18.283 2.703   -18.293 1.00 4.08  ? 12 TYR A HE1    1  
ATOM 1342  H HE2    . TYR C 2 12 ? -17.935 -1.075  -16.316 1.00 3.25  ? 12 TYR A HE2    1  
ATOM 1343  H HH     . TYR C 2 12 ? -19.164 -0.632  -18.329 1.00 4.13  ? 12 TYR A HH     1  
ATOM 1344  N N      . ALA C 2 13 ? -18.907 2.359   -11.443 1.00 2.87  ? 13 ALA A N      1  
ATOM 1345  C CA     . ALA C 2 13 ? -19.989 1.568   -10.866 1.00 2.66  ? 13 ALA A CA     1  
ATOM 1346  C C      . ALA C 2 13 ? -21.080 2.496   -10.362 1.00 2.78  ? 13 ALA A C      1  
ATOM 1347  O O      . ALA C 2 13 ? -22.256 2.134   -10.280 1.00 2.70  ? 13 ALA A O      1  
ATOM 1348  C CB     . ALA C 2 13 ? -19.480 0.733   -9.717  1.00 2.47  ? 13 ALA A CB     1  
ATOM 1349  H H      . ALA C 2 13 ? -18.126 2.604   -10.880 1.00 2.89  ? 13 ALA A H      1  
ATOM 1350  H HA     . ALA C 2 13 ? -20.378 0.897   -11.631 1.00 2.61  ? 13 ALA A HA     1  
ATOM 1351  H HB1    . ALA C 2 13 ? -20.319 0.265   -9.216  1.00 2.73  ? 13 ALA A HB1    1  
ATOM 1352  H HB2    . ALA C 2 13 ? -18.956 1.371   -9.022  1.00 2.66  ? 13 ALA A HB2    1  
ATOM 1353  H HB3    . ALA C 2 13 ? -18.809 -0.028  -10.095 1.00 2.52  ? 13 ALA A HB3    1  
ATOM 1354  N N      . GLY C 2 14 ? -20.659 3.698   -10.010 1.00 3.02  ? 14 GLY A N      1  
ATOM 1355  C CA     . GLY C 2 14 ? -21.572 4.701   -9.524  1.00 3.22  ? 14 GLY A CA     1  
ATOM 1356  C C      . GLY C 2 14 ? -21.739 4.594   -8.038  1.00 3.21  ? 14 GLY A C      1  
ATOM 1357  O O      . GLY C 2 14 ? -22.826 4.801   -7.495  1.00 3.28  ? 14 GLY A O      1  
ATOM 1358  H H      . GLY C 2 14 ? -19.696 3.883   -10.016 1.00 3.08  ? 14 GLY A H      1  
ATOM 1359  H HA2    . GLY C 2 14 ? -21.188 5.674   -9.771  1.00 3.45  ? 14 GLY A HA2    1  
ATOM 1360  H HA3    . GLY C 2 14 ? -22.527 4.556   -9.995  1.00 3.18  ? 14 GLY A HA3    1  
ATOM 1361  N N      . VAL C 2 15 ? -20.646 4.233   -7.395  1.00 3.16  ? 15 VAL A N      1  
ATOM 1362  C CA     . VAL C 2 15 ? -20.605 4.040   -5.958  1.00 3.22  ? 15 VAL A CA     1  
ATOM 1363  C C      . VAL C 2 15 ? -19.318 4.596   -5.389  1.00 3.39  ? 15 VAL A C      1  
ATOM 1364  O O      . VAL C 2 15 ? -18.296 4.604   -6.068  1.00 3.33  ? 15 VAL A O      1  
ATOM 1365  C CB     . VAL C 2 15 ? -20.706 2.558   -5.602  1.00 2.96  ? 15 VAL A CB     1  
ATOM 1366  C CG1    . VAL C 2 15 ? -22.113 2.057   -5.803  1.00 2.89  ? 15 VAL A CG1    1  
ATOM 1367  C CG2    . VAL C 2 15 ? -19.749 1.777   -6.458  1.00 2.72  ? 15 VAL A CG2    1  
ATOM 1368  H H      . VAL C 2 15 ? -19.806 4.109   -7.916  1.00 3.12  ? 15 VAL A H      1  
ATOM 1369  H HA     . VAL C 2 15 ? -21.445 4.560   -5.520  1.00 3.38  ? 15 VAL A HA     1  
ATOM 1370  H HB     . VAL C 2 15 ? -20.432 2.425   -4.567  1.00 3.04  ? 15 VAL A HB     1  
ATOM 1371  H HG11   . VAL C 2 15 ? -22.174 1.030   -5.478  1.00 2.96  ? 15 VAL A HG11   1  
ATOM 1372  H HG12   . VAL C 2 15 ? -22.363 2.123   -6.856  1.00 3.04  ? 15 VAL A HG12   1  
ATOM 1373  H HG13   . VAL C 2 15 ? -22.796 2.662   -5.228  1.00 3.14  ? 15 VAL A HG13   1  
ATOM 1374  H HG21   . VAL C 2 15 ? -19.897 0.721   -6.299  1.00 2.95  ? 15 VAL A HG21   1  
ATOM 1375  H HG22   . VAL C 2 15 ? -18.739 2.049   -6.188  1.00 2.86  ? 15 VAL A HG22   1  
ATOM 1376  H HG23   . VAL C 2 15 ? -19.922 2.020   -7.499  1.00 2.74  ? 15 VAL A HG23   1  
ATOM 1377  N N      . SER C 2 16 ? -19.371 5.104   -4.175  1.00 3.63  ? 16 SER A N      1  
ATOM 1378  C CA     . SER C 2 16 ? -18.179 5.643   -3.549  1.00 3.82  ? 16 SER A CA     1  
ATOM 1379  C C      . SER C 2 16 ? -17.083 4.591   -3.515  1.00 3.58  ? 16 SER A C      1  
ATOM 1380  O O      . SER C 2 16 ? -17.345 3.386   -3.483  1.00 3.34  ? 16 SER A O      1  
ATOM 1381  C CB     . SER C 2 16 ? -18.469 6.151   -2.143  1.00 4.13  ? 16 SER A CB     1  
ATOM 1382  O OG     . SER C 2 16 ? -19.512 7.107   -2.158  1.00 4.34  ? 16 SER A OG     1  
ATOM 1383  H H      . SER C 2 16 ? -20.203 5.053   -3.668  1.00 3.69  ? 16 SER A H      1  
ATOM 1384  H HA     . SER C 2 16 ? -17.832 6.469   -4.153  1.00 3.95  ? 16 SER A HA     1  
ATOM 1385  H HB2    . SER C 2 16 ? -18.757 5.324   -1.517  1.00 4.23  ? 16 SER A HB2    1  
ATOM 1386  H HB3    . SER C 2 16 ? -17.580 6.613   -1.740  1.00 4.25  ? 16 SER A HB3    1  
ATOM 1387  H HG     . SER C 2 16 ? -19.756 7.305   -3.067  1.00 4.52  ? 16 SER A HG     1  
ATOM 1388  N N      . TYR C 2 17 ? -15.867 5.066   -3.527  1.00 3.68  ? 17 TYR A N      1  
ATOM 1389  C CA     . TYR C 2 17 ? -14.690 4.217   -3.504  1.00 3.49  ? 17 TYR A CA     1  
ATOM 1390  C C      . TYR C 2 17 ? -14.718 3.234   -2.351  1.00 3.42  ? 17 TYR A C      1  
ATOM 1391  O O      . TYR C 2 17 ? -14.549 2.030   -2.537  1.00 3.16  ? 17 TYR A O      1  
ATOM 1392  C CB     . TYR C 2 17 ? -13.479 5.100   -3.339  1.00 3.71  ? 17 TYR A CB     1  
ATOM 1393  C CG     . TYR C 2 17 ? -12.229 4.311   -3.155  1.00 3.56  ? 17 TYR A CG     1  
ATOM 1394  C CD1    . TYR C 2 17 ? -11.595 3.780   -4.251  1.00 3.31  ? 17 TYR A CD1    1  
ATOM 1395  C CD2    . TYR C 2 17 ? -11.689 4.088   -1.895  1.00 3.69  ? 17 TYR A CD2    1  
ATOM 1396  C CE1    . TYR C 2 17 ? -10.453 3.057   -4.121  1.00 3.18  ? 17 TYR A CE1    1  
ATOM 1397  C CE2    . TYR C 2 17 ? -10.534 3.353   -1.751  1.00 3.55  ? 17 TYR A CE2    1  
ATOM 1398  C CZ     . TYR C 2 17 ? -9.914  2.840   -2.871  1.00 3.28  ? 17 TYR A CZ     1  
ATOM 1399  O OH     . TYR C 2 17 ? -8.758  2.111   -2.743  1.00 3.16  ? 17 TYR A OH     1  
ATOM 1400  H H      . TYR C 2 17 ? -15.749 6.036   -3.551  1.00 3.91  ? 17 TYR A H      1  
ATOM 1401  H HA     . TYR C 2 17 ? -14.606 3.672   -4.439  1.00 3.28  ? 17 TYR A HA     1  
ATOM 1402  H HB2    . TYR C 2 17 ? -13.366 5.717   -4.213  1.00 3.77  ? 17 TYR A HB2    1  
ATOM 1403  H HB3    . TYR C 2 17 ? -13.612 5.728   -2.473  1.00 3.95  ? 17 TYR A HB3    1  
ATOM 1404  H HD1    . TYR C 2 17 ? -12.013 3.945   -5.233  1.00 3.25  ? 17 TYR A HD1    1  
ATOM 1405  H HD2    . TYR C 2 17 ? -12.198 4.486   -1.017  1.00 3.91  ? 17 TYR A HD2    1  
ATOM 1406  H HE1    . TYR C 2 17 ? -9.994  2.649   -5.006  1.00 3.01  ? 17 TYR A HE1    1  
ATOM 1407  H HE2    . TYR C 2 17 ? -10.123 3.187   -0.771  1.00 3.68  ? 17 TYR A HE2    1  
ATOM 1408  H HH     . TYR C 2 17 ? -8.053  2.542   -3.236  1.00 3.43  ? 17 TYR A HH     1  
ATOM 1409  N N      . GLN C 2 18 ? -14.955 3.769   -1.169  1.00 3.70  ? 18 GLN A N      1  
ATOM 1410  C CA     . GLN C 2 18 ? -14.974 2.977   0.051   1.00 3.76  ? 18 GLN A CA     1  
ATOM 1411  C C      . GLN C 2 18 ? -16.058 1.895   -0.004  1.00 3.60  ? 18 GLN A C      1  
ATOM 1412  O O      . GLN C 2 18 ? -15.993 0.898   0.718   1.00 3.59  ? 18 GLN A O      1  
ATOM 1413  C CB     . GLN C 2 18 ? -15.163 3.883   1.272   1.00 4.16  ? 18 GLN A CB     1  
ATOM 1414  C CG     . GLN C 2 18 ? -14.501 5.256   1.159   1.00 4.57  ? 18 GLN A CG     1  
ATOM 1415  C CD     . GLN C 2 18 ? -12.985 5.183   1.133   1.00 5.01  ? 18 GLN A CD     1  
ATOM 1416  O OE1    . GLN C 2 18 ? -12.387 4.273   1.699   1.00 5.50  ? 18 GLN A OE1    1  
ATOM 1417  N NE2    . GLN C 2 18 ? -12.354 6.146   0.479   1.00 5.22  ? 18 GLN A NE2    1  
ATOM 1418  H H      . GLN C 2 18 ? -15.117 4.730   -1.117  1.00 3.91  ? 18 GLN A H      1  
ATOM 1419  H HA     . GLN C 2 18 ? -14.013 2.489   0.132   1.00 3.66  ? 18 GLN A HA     1  
ATOM 1420  H HB2    . GLN C 2 18 ? -16.216 4.031   1.437   1.00 4.34  ? 18 GLN A HB2    1  
ATOM 1421  H HB3    . GLN C 2 18 ? -14.739 3.385   2.127   1.00 4.27  ? 18 GLN A HB3    1  
ATOM 1422  H HG2    . GLN C 2 18 ? -14.838 5.736   0.255   1.00 4.81  ? 18 GLN A HG2    1  
ATOM 1423  H HG3    . GLN C 2 18 ? -14.800 5.852   2.010   1.00 4.76  ? 18 GLN A HG3    1  
ATOM 1424  H HE21   . GLN C 2 18 ? -12.889 6.853   0.047   1.00 5.10  ? 18 GLN A HE21   1  
ATOM 1425  H HE22   . GLN C 2 18 ? -11.375 6.118   0.450   1.00 5.71  ? 18 GLN A HE22   1  
ATOM 1426  N N      . THR C 2 19 ? -17.049 2.096   -0.866  1.00 3.52  ? 19 THR A N      1  
ATOM 1427  C CA     . THR C 2 19 ? -18.125 1.141   -1.039  1.00 3.39  ? 19 THR A CA     1  
ATOM 1428  C C      . THR C 2 19 ? -17.613 -0.118  -1.723  1.00 3.07  ? 19 THR A C      1  
ATOM 1429  O O      . THR C 2 19 ? -17.614 -1.198  -1.136  1.00 3.08  ? 19 THR A O      1  
ATOM 1430  C CB     . THR C 2 19 ? -19.249 1.764   -1.889  1.00 3.36  ? 19 THR A CB     1  
ATOM 1431  O OG1    . THR C 2 19 ? -19.484 3.101   -1.438  1.00 3.65  ? 19 THR A OG1    1  
ATOM 1432  C CG2    . THR C 2 19 ? -20.531 0.957   -1.807  1.00 3.31  ? 19 THR A CG2    1  
ATOM 1433  H H      . THR C 2 19 ? -17.062 2.914   -1.403  1.00 3.56  ? 19 THR A H      1  
ATOM 1434  H HA     . THR C 2 19 ? -18.523 0.887   -0.069  1.00 3.57  ? 19 THR A HA     1  
ATOM 1435  H HB     . THR C 2 19 ? -18.931 1.794   -2.925  1.00 3.20  ? 19 THR A HB     1  
ATOM 1436  H HG1    . THR C 2 19 ? -20.426 3.301   -1.477  1.00 3.86  ? 19 THR A HG1    1  
ATOM 1437  H HG21   . THR C 2 19 ? -20.793 0.802   -0.774  1.00 3.18  ? 19 THR A HG21   1  
ATOM 1438  H HG22   . THR C 2 19 ? -20.385 -0.001  -2.295  1.00 3.58  ? 19 THR A HG22   1  
ATOM 1439  H HG23   . THR C 2 19 ? -21.321 1.501   -2.305  1.00 3.59  ? 19 THR A HG23   1  
ATOM 1440  N N      . VAL C 2 20 ? -17.136 0.042   -2.948  1.00 2.85  ? 20 VAL A N      1  
ATOM 1441  C CA     . VAL C 2 20 ? -16.631 -1.076  -3.730  1.00 2.58  ? 20 VAL A CA     1  
ATOM 1442  C C      . VAL C 2 20 ? -15.325 -1.621  -3.161  1.00 2.57  ? 20 VAL A C      1  
ATOM 1443  O O      . VAL C 2 20 ? -15.032 -2.809  -3.294  1.00 2.46  ? 20 VAL A O      1  
ATOM 1444  C CB     . VAL C 2 20 ? -16.511 -0.715  -5.232  1.00 2.42  ? 20 VAL A CB     1  
ATOM 1445  C CG1    . VAL C 2 20 ? -16.919 0.720   -5.479  1.00 2.61  ? 20 VAL A CG1    1  
ATOM 1446  C CG2    . VAL C 2 20 ? -15.128 -0.939  -5.802  1.00 2.31  ? 20 VAL A CG2    1  
ATOM 1447  H H      . VAL C 2 20 ? -17.123 0.939   -3.340  1.00 2.91  ? 20 VAL A H      1  
ATOM 1448  H HA     . VAL C 2 20 ? -17.371 -1.858  -3.646  1.00 2.56  ? 20 VAL A HA     1  
ATOM 1449  H HB     . VAL C 2 20 ? -17.196 -1.355  -5.766  1.00 2.31  ? 20 VAL A HB     1  
ATOM 1450  H HG11   . VAL C 2 20 ? -17.122 0.858   -6.533  1.00 2.67  ? 20 VAL A HG11   1  
ATOM 1451  H HG12   . VAL C 2 20 ? -16.119 1.380   -5.177  1.00 3.01  ? 20 VAL A HG12   1  
ATOM 1452  H HG13   . VAL C 2 20 ? -17.808 0.946   -4.909  1.00 2.85  ? 20 VAL A HG13   1  
ATOM 1453  H HG21   . VAL C 2 20 ? -15.213 -1.091  -6.872  1.00 2.50  ? 20 VAL A HG21   1  
ATOM 1454  H HG22   . VAL C 2 20 ? -14.683 -1.810  -5.344  1.00 2.55  ? 20 VAL A HG22   1  
ATOM 1455  H HG23   . VAL C 2 20 ? -14.509 -0.065  -5.607  1.00 2.42  ? 20 VAL A HG23   1  
ATOM 1456  N N      . SER C 2 21 ? -14.547 -0.756  -2.532  1.00 2.73  ? 21 SER A N      1  
ATOM 1457  C CA     . SER C 2 21 ? -13.294 -1.172  -1.915  1.00 2.74  ? 21 SER A CA     1  
ATOM 1458  C C      . SER C 2 21 ? -13.574 -2.258  -0.878  1.00 2.85  ? 21 SER A C      1  
ATOM 1459  O O      . SER C 2 21 ? -12.896 -3.287  -0.833  1.00 2.78  ? 21 SER A O      1  
ATOM 1460  C CB     . SER C 2 21 ? -12.591 0.024   -1.261  1.00 2.97  ? 21 SER A CB     1  
ATOM 1461  O OG     . SER C 2 21 ? -11.322 -0.338  -0.742  1.00 3.19  ? 21 SER A OG     1  
ATOM 1462  H H      . SER C 2 21 ? -14.811 0.190   -2.501  1.00 2.86  ? 21 SER A H      1  
ATOM 1463  H HA     . SER C 2 21 ? -12.661 -1.581  -2.688  1.00 2.56  ? 21 SER A HA     1  
ATOM 1464  H HB2    . SER C 2 21 ? -12.454 0.803   -1.996  1.00 3.15  ? 21 SER A HB2    1  
ATOM 1465  H HB3    . SER C 2 21 ? -13.202 0.398   -0.453  1.00 3.14  ? 21 SER A HB3    1  
ATOM 1466  H HG     . SER C 2 21 ? -10.725 -0.550  -1.467  1.00 3.29  ? 21 SER A HG     1  
ATOM 1467  N N      . ARG C 2 22 ? -14.606 -2.034  -0.068  1.00 3.06  ? 22 ARG A N      1  
ATOM 1468  C CA     . ARG C 2 22 ? -14.994 -2.982  0.955   1.00 3.25  ? 22 ARG A CA     1  
ATOM 1469  C C      . ARG C 2 22 ? -15.615 -4.203  0.293   1.00 3.12  ? 22 ARG A C      1  
ATOM 1470  O O      . ARG C 2 22 ? -15.570 -5.306  0.827   1.00 3.25  ? 22 ARG A O      1  
ATOM 1471  C CB     . ARG C 2 22 ? -15.964 -2.322  1.952   1.00 3.54  ? 22 ARG A CB     1  
ATOM 1472  C CG     . ARG C 2 22 ? -17.292 -3.045  2.114   1.00 3.73  ? 22 ARG A CG     1  
ATOM 1473  C CD     . ARG C 2 22 ? -18.456 -2.196  1.632   1.00 3.83  ? 22 ARG A CD     1  
ATOM 1474  N NE     . ARG C 2 22 ? -18.760 -1.100  2.550   1.00 3.92  ? 22 ARG A NE     1  
ATOM 1475  C CZ     . ARG C 2 22 ? -19.996 -0.739  2.893   1.00 4.17  ? 22 ARG A CZ     1  
ATOM 1476  N NH1    . ARG C 2 22 ? -21.041 -1.352  2.354   1.00 4.31  ? 22 ARG A NH1    1  
ATOM 1477  N NH2    . ARG C 2 22 ? -20.189 0.245   3.759   1.00 4.44  ? 22 ARG A NH2    1  
ATOM 1478  H H      . ARG C 2 22 ? -15.146 -1.229  -0.192  1.00 3.12  ? 22 ARG A H      1  
ATOM 1479  H HA     . ARG C 2 22 ? -14.100 -3.287  1.480   1.00 3.32  ? 22 ARG A HA     1  
ATOM 1480  H HB2    . ARG C 2 22 ? -15.487 -2.277  2.919   1.00 3.74  ? 22 ARG A HB2    1  
ATOM 1481  H HB3    . ARG C 2 22 ? -16.168 -1.315  1.618   1.00 3.64  ? 22 ARG A HB3    1  
ATOM 1482  H HG2    . ARG C 2 22 ? -17.264 -3.956  1.538   1.00 3.93  ? 22 ARG A HG2    1  
ATOM 1483  H HG3    . ARG C 2 22 ? -17.437 -3.281  3.158   1.00 3.83  ? 22 ARG A HG3    1  
ATOM 1484  H HD2    . ARG C 2 22 ? -18.206 -1.783  0.665   1.00 3.85  ? 22 ARG A HD2    1  
ATOM 1485  H HD3    . ARG C 2 22 ? -19.328 -2.827  1.537   1.00 4.03  ? 22 ARG A HD3    1  
ATOM 1486  H HE     . ARG C 2 22 ? -17.997 -0.614  2.937   1.00 3.94  ? 22 ARG A HE     1  
ATOM 1487  H HH11   . ARG C 2 22 ? -20.907 -2.084  1.686   1.00 4.31  ? 22 ARG A HH11   1  
ATOM 1488  H HH12   . ARG C 2 22 ? -21.975 -1.095  2.621   1.00 4.55  ? 22 ARG A HH12   1  
ATOM 1489  H HH21   . ARG C 2 22 ? -19.404 0.728   4.160   1.00 4.53  ? 22 ARG A HH21   1  
ATOM 1490  H HH22   . ARG C 2 22 ? -21.122 0.515   4.017   1.00 4.68  ? 22 ARG A HH22   1  
ATOM 1491  N N      . VAL C 2 23 ? -16.178 -3.980  -0.891  1.00 2.91  ? 23 VAL A N      1  
ATOM 1492  C CA     . VAL C 2 23 ? -16.821 -5.026  -1.662  1.00 2.82  ? 23 VAL A CA     1  
ATOM 1493  C C      . VAL C 2 23 ? -15.791 -6.050  -2.113  1.00 2.72  ? 23 VAL A C      1  
ATOM 1494  O O      . VAL C 2 23 ? -15.953 -7.250  -1.905  1.00 2.86  ? 23 VAL A O      1  
ATOM 1495  C CB     . VAL C 2 23 ? -17.538 -4.437  -2.901  1.00 2.62  ? 23 VAL A CB     1  
ATOM 1496  C CG1    . VAL C 2 23 ? -17.945 -5.527  -3.869  1.00 2.56  ? 23 VAL A CG1    1  
ATOM 1497  C CG2    . VAL C 2 23 ? -18.750 -3.606  -2.499  1.00 2.76  ? 23 VAL A CG2    1  
ATOM 1498  H H      . VAL C 2 23 ? -16.126 -3.085  -1.273  1.00 2.85  ? 23 VAL A H      1  
ATOM 1499  H HA     . VAL C 2 23 ? -17.555 -5.510  -1.035  1.00 3.00  ? 23 VAL A HA     1  
ATOM 1500  H HB     . VAL C 2 23 ? -16.843 -3.785  -3.410  1.00 2.48  ? 23 VAL A HB     1  
ATOM 1501  H HG11   . VAL C 2 23 ? -18.192 -5.077  -4.822  1.00 2.68  ? 23 VAL A HG11   1  
ATOM 1502  H HG12   . VAL C 2 23 ? -18.805 -6.052  -3.482  1.00 2.67  ? 23 VAL A HG12   1  
ATOM 1503  H HG13   . VAL C 2 23 ? -17.126 -6.215  -3.998  1.00 2.88  ? 23 VAL A HG13   1  
ATOM 1504  H HG21   . VAL C 2 23 ? -18.439 -2.586  -2.306  1.00 3.00  ? 23 VAL A HG21   1  
ATOM 1505  H HG22   . VAL C 2 23 ? -19.193 -4.023  -1.607  1.00 2.86  ? 23 VAL A HG22   1  
ATOM 1506  H HG23   . VAL C 2 23 ? -19.476 -3.614  -3.300  1.00 3.04  ? 23 VAL A HG23   1  
ATOM 1507  N N      . VAL C 2 24 ? -14.716 -5.546  -2.701  1.00 2.54  ? 24 VAL A N      1  
ATOM 1508  C CA     . VAL C 2 24 ? -13.632 -6.380  -3.195  1.00 2.46  ? 24 VAL A CA     1  
ATOM 1509  C C      . VAL C 2 24 ? -12.931 -7.119  -2.051  1.00 2.68  ? 24 VAL A C      1  
ATOM 1510  O O      . VAL C 2 24 ? -12.254 -8.123  -2.270  1.00 2.72  ? 24 VAL A O      1  
ATOM 1511  C CB     . VAL C 2 24 ? -12.624 -5.520  -4.014  1.00 2.28  ? 24 VAL A CB     1  
ATOM 1512  C CG1    . VAL C 2 24 ? -11.215 -5.569  -3.439  1.00 2.42  ? 24 VAL A CG1    1  
ATOM 1513  C CG2    . VAL C 2 24 ? -12.620 -5.951  -5.477  1.00 2.15  ? 24 VAL A CG2    1  
ATOM 1514  H H      . VAL C 2 24 ? -14.652 -4.572  -2.815  1.00 2.49  ? 24 VAL A H      1  
ATOM 1515  H HA     . VAL C 2 24 ? -14.060 -7.110  -3.859  1.00 2.45  ? 24 VAL A HA     1  
ATOM 1516  H HB     . VAL C 2 24 ? -12.959 -4.495  -3.974  1.00 2.37  ? 24 VAL A HB     1  
ATOM 1517  H HG11   . VAL C 2 24 ? -10.576 -4.895  -3.991  1.00 2.60  ? 24 VAL A HG11   1  
ATOM 1518  H HG12   . VAL C 2 24 ? -10.830 -6.575  -3.516  1.00 2.68  ? 24 VAL A HG12   1  
ATOM 1519  H HG13   . VAL C 2 24 ? -11.241 -5.273  -2.400  1.00 2.72  ? 24 VAL A HG13   1  
ATOM 1520  H HG21   . VAL C 2 24 ? -13.625 -5.898  -5.870  1.00 2.07  ? 24 VAL A HG21   1  
ATOM 1521  H HG22   . VAL C 2 24 ? -12.257 -6.965  -5.553  1.00 2.57  ? 24 VAL A HG22   1  
ATOM 1522  H HG23   . VAL C 2 24 ? -11.977 -5.294  -6.048  1.00 2.30  ? 24 VAL A HG23   1  
ATOM 1523  N N      . ASN C 2 25 ? -13.130 -6.643  -0.824  1.00 2.86  ? 25 ASN A N      1  
ATOM 1524  C CA     . ASN C 2 25 ? -12.478 -7.258  0.331   1.00 3.11  ? 25 ASN A CA     1  
ATOM 1525  C C      . ASN C 2 25 ? -13.429 -8.093  1.189   1.00 3.40  ? 25 ASN A C      1  
ATOM 1526  O O      . ASN C 2 25 ? -12.972 -8.834  2.061   1.00 3.68  ? 25 ASN A O      1  
ATOM 1527  C CB     . ASN C 2 25 ? -11.822 -6.180  1.194   1.00 3.26  ? 25 ASN A CB     1  
ATOM 1528  C CG     . ASN C 2 25 ? -10.487 -5.732  0.638   1.00 3.13  ? 25 ASN A CG     1  
ATOM 1529  O OD1    . ASN C 2 25 ? -9.433  -6.198  1.067   1.00 3.32  ? 25 ASN A OD1    1  
ATOM 1530  N ND2    . ASN C 2 25 ? -10.522 -4.829  -0.330  1.00 2.90  ? 25 ASN A ND2    1  
ATOM 1531  H H      . ASN C 2 25 ? -13.722 -5.867  -0.697  1.00 2.86  ? 25 ASN A H      1  
ATOM 1532  H HA     . ASN C 2 25 ? -11.703 -7.908  -0.046  1.00 3.04  ? 25 ASN A HA     1  
ATOM 1533  H HB2    . ASN C 2 25 ? -12.476 -5.322  1.246   1.00 3.28  ? 25 ASN A HB2    1  
ATOM 1534  H HB3    . ASN C 2 25 ? -11.666 -6.569  2.189   1.00 3.51  ? 25 ASN A HB3    1  
ATOM 1535  H HD21   . ASN C 2 25 ? -11.401 -4.501  -0.632  1.00 2.85  ? 25 ASN A HD21   1  
ATOM 1536  H HD22   . ASN C 2 25 ? -9.673  -4.533  -0.715  1.00 2.85  ? 25 ASN A HD22   1  
ATOM 1537  N N      . GLN C 2 26 ? -14.739 -7.991  0.943   1.00 3.38  ? 26 GLN A N      1  
ATOM 1538  C CA     . GLN C 2 26 ? -15.733 -8.753  1.717   1.00 3.69  ? 26 GLN A CA     1  
ATOM 1539  C C      . GLN C 2 26 ? -17.167 -8.412  1.306   1.00 3.73  ? 26 GLN A C      1  
ATOM 1540  O O      . GLN C 2 26 ? -17.939 -9.299  0.948   1.00 4.00  ? 26 GLN A O      1  
ATOM 1541  C CB     . GLN C 2 26 ? -15.570 -8.527  3.234   1.00 4.14  ? 26 GLN A CB     1  
ATOM 1542  C CG     . GLN C 2 26 ? -15.392 -7.070  3.643   1.00 4.79  ? 26 GLN A CG     1  
ATOM 1543  C CD     . GLN C 2 26 ? -15.024 -6.917  5.106   1.00 5.58  ? 26 GLN A CD     1  
ATOM 1544  O OE1    . GLN C 2 26 ? -15.889 -6.743  5.963   1.00 6.08  ? 26 GLN A OE1    1  
ATOM 1545  N NE2    . GLN C 2 26 ? -13.736 -6.990  5.402   1.00 6.01  ? 26 GLN A NE2    1  
ATOM 1546  H H      . GLN C 2 26 ? -15.043 -7.406  0.215   1.00 3.18  ? 26 GLN A H      1  
ATOM 1547  H HA     . GLN C 2 26 ? -15.565 -9.800  1.509   1.00 3.74  ? 26 GLN A HA     1  
ATOM 1548  H HB2    . GLN C 2 26 ? -16.446 -8.910  3.736   1.00 4.26  ? 26 GLN A HB2    1  
ATOM 1549  H HB3    . GLN C 2 26 ? -14.706 -9.080  3.573   1.00 4.31  ? 26 GLN A HB3    1  
ATOM 1550  H HG2    . GLN C 2 26 ? -14.607 -6.634  3.043   1.00 4.93  ? 26 GLN A HG2    1  
ATOM 1551  H HG3    . GLN C 2 26 ? -16.317 -6.543  3.462   1.00 4.95  ? 26 GLN A HG3    1  
ATOM 1552  H HE21   . GLN C 2 26 ? -13.099 -7.138  4.669   1.00 5.84  ? 26 GLN A HE21   1  
ATOM 1553  H HE22   . GLN C 2 26 ? -13.471 -6.895  6.340   1.00 6.64  ? 26 GLN A HE22   1  
ATOM 1554  N N      . ALA C 2 27 ? -17.508 -7.124  1.368   1.00 3.79  ? 27 ALA A N      1  
ATOM 1555  C CA     . ALA C 2 27 ? -18.847 -6.640  1.029   1.00 3.98  ? 27 ALA A CA     1  
ATOM 1556  C C      . ALA C 2 27 ? -19.915 -7.287  1.910   1.00 4.29  ? 27 ALA A C      1  
ATOM 1557  O O      . ALA C 2 27 ? -20.915 -7.808  1.417   1.00 4.63  ? 27 ALA A O      1  
ATOM 1558  C CB     . ALA C 2 27 ? -19.148 -6.868  -0.445  1.00 3.84  ? 27 ALA A CB     1  
ATOM 1559  H H      . ALA C 2 27 ? -16.825 -6.472  1.636   1.00 3.91  ? 27 ALA A H      1  
ATOM 1560  H HA     . ALA C 2 27 ? -18.860 -5.574  1.207   1.00 4.15  ? 27 ALA A HA     1  
ATOM 1561  H HB1    . ALA C 2 27 ? -18.486 -6.253  -1.042  1.00 3.98  ? 27 ALA A HB1    1  
ATOM 1562  H HB2    . ALA C 2 27 ? -20.173 -6.597  -0.649  1.00 3.81  ? 27 ALA A HB2    1  
ATOM 1563  H HB3    . ALA C 2 27 ? -18.993 -7.908  -0.689  1.00 4.05  ? 27 ALA A HB3    1  
ATOM 1564  N N      . SER C 2 28 ? -19.699 -7.223  3.219   1.00 4.40  ? 28 SER A N      1  
ATOM 1565  C CA     . SER C 2 28 ? -20.619 -7.798  4.190   1.00 4.74  ? 28 SER A CA     1  
ATOM 1566  C C      . SER C 2 28 ? -21.975 -7.092  4.164   1.00 4.78  ? 28 SER A C      1  
ATOM 1567  O O      . SER C 2 28 ? -23.006 -7.702  3.882   1.00 5.09  ? 28 SER A O      1  
ATOM 1568  C CB     . SER C 2 28 ? -20.002 -7.694  5.584   1.00 5.07  ? 28 SER A CB     1  
ATOM 1569  O OG     . SER C 2 28 ? -19.336 -6.448  5.744   1.00 5.08  ? 28 SER A OG     1  
ATOM 1570  H H      . SER C 2 28 ? -18.893 -6.775  3.546   1.00 4.41  ? 28 SER A H      1  
ATOM 1571  H HA     . SER C 2 28 ? -20.759 -8.840  3.943   1.00 4.79  ? 28 SER A HA     1  
ATOM 1572  H HB2    . SER C 2 28 ? -20.780 -7.772  6.329   1.00 5.40  ? 28 SER A HB2    1  
ATOM 1573  H HB3    . SER C 2 28 ? -19.287 -8.492  5.722   1.00 5.21  ? 28 SER A HB3    1  
ATOM 1574  H HG     . SER C 2 28 ? -18.851 -6.449  6.588   1.00 5.20  ? 28 SER A HG     1  
ATOM 1575  N N      . HIS C 2 29 ? -21.964 -5.799  4.451   1.00 4.57  ? 29 HIS A N      1  
ATOM 1576  C CA     . HIS C 2 29 ? -23.183 -5.012  4.474   1.00 4.63  ? 29 HIS A CA     1  
ATOM 1577  C C      . HIS C 2 29 ? -23.304 -4.195  3.195   1.00 4.35  ? 29 HIS A C      1  
ATOM 1578  O O      . HIS C 2 29 ? -23.057 -2.989  3.190   1.00 4.43  ? 29 HIS A O      1  
ATOM 1579  C CB     . HIS C 2 29 ? -23.206 -4.086  5.695   1.00 4.90  ? 29 HIS A CB     1  
ATOM 1580  C CG     . HIS C 2 29 ? -23.064 -4.789  7.015   1.00 5.21  ? 29 HIS A CG     1  
ATOM 1581  N ND1    . HIS C 2 29 ? -23.826 -5.877  7.389   1.00 5.58  ? 29 HIS A ND1    1  
ATOM 1582  C CD2    . HIS C 2 29 ? -22.235 -4.542  8.059   1.00 5.44  ? 29 HIS A CD2    1  
ATOM 1583  C CE1    . HIS C 2 29 ? -23.472 -6.262  8.602   1.00 5.80  ? 29 HIS A CE1    1  
ATOM 1584  N NE2    . HIS C 2 29 ? -22.510 -5.469  9.031   1.00 5.73  ? 29 HIS A NE2    1  
ATOM 1585  H H      . HIS C 2 29 ? -21.114 -5.363  4.643   1.00 4.45  ? 29 HIS A H      1  
ATOM 1586  H HA     . HIS C 2 29 ? -24.018 -5.695  4.533   1.00 4.74  ? 29 HIS A HA     1  
ATOM 1587  H HB2    . HIS C 2 29 ? -22.395 -3.379  5.612   1.00 4.91  ? 29 HIS A HB2    1  
ATOM 1588  H HB3    . HIS C 2 29 ? -24.139 -3.549  5.704   1.00 4.92  ? 29 HIS A HB3    1  
ATOM 1589  H HD1    . HIS C 2 29 ? -24.528 -6.308  6.848   1.00 5.83  ? 29 HIS A HD1    1  
ATOM 1590  H HD2    . HIS C 2 29 ? -21.494 -3.757  8.114   1.00 5.59  ? 29 HIS A HD2    1  
ATOM 1591  H HE1    . HIS C 2 29 ? -23.898 -7.089  9.151   1.00 6.16  ? 29 HIS A HE1    1  
ATOM 1592  H HE2    . HIS C 2 29 ? -22.220 -5.400  9.977   1.00 6.03  ? 29 HIS A HE2    1  
ATOM 1593  N N      . VAL C 2 30 ? -23.656 -4.869  2.110   1.00 4.23  ? 30 VAL A N      1  
ATOM 1594  C CA     . VAL C 2 30 ? -23.813 -4.226  0.804   1.00 3.95  ? 30 VAL A CA     1  
ATOM 1595  C C      . VAL C 2 30 ? -25.035 -4.788  0.088   1.00 3.85  ? 30 VAL A C      1  
ATOM 1596  O O      . VAL C 2 30 ? -25.356 -5.969  0.231   1.00 4.00  ? 30 VAL A O      1  
ATOM 1597  C CB     . VAL C 2 30 ? -22.578 -4.427  -0.108  1.00 3.73  ? 30 VAL A CB     1  
ATOM 1598  C CG1    . VAL C 2 30 ? -22.633 -3.500  -1.312  1.00 3.75  ? 30 VAL A CG1    1  
ATOM 1599  C CG2    . VAL C 2 30 ? -21.283 -4.217  0.658   1.00 4.14  ? 30 VAL A CG2    1  
ATOM 1600  H H      . VAL C 2 30 ? -23.840 -5.830  2.195   1.00 4.47  ? 30 VAL A H      1  
ATOM 1601  H HA     . VAL C 2 30 ? -23.953 -3.166  0.965   1.00 3.98  ? 30 VAL A HA     1  
ATOM 1602  H HB     . VAL C 2 30 ? -22.597 -5.442  -0.471  1.00 3.72  ? 30 VAL A HB     1  
ATOM 1603  H HG11   . VAL C 2 30 ? -22.652 -2.474  -0.976  1.00 3.77  ? 30 VAL A HG11   1  
ATOM 1604  H HG12   . VAL C 2 30 ? -23.524 -3.708  -1.886  1.00 4.08  ? 30 VAL A HG12   1  
ATOM 1605  H HG13   . VAL C 2 30 ? -21.762 -3.660  -1.930  1.00 4.01  ? 30 VAL A HG13   1  
ATOM 1606  H HG21   . VAL C 2 30 ? -20.445 -4.366  -0.006  1.00 4.47  ? 30 VAL A HG21   1  
ATOM 1607  H HG22   . VAL C 2 30 ? -21.228 -4.925  1.472   1.00 4.43  ? 30 VAL A HG22   1  
ATOM 1608  H HG23   . VAL C 2 30 ? -21.257 -3.212  1.052   1.00 4.33  ? 30 VAL A HG23   1  
ATOM 1609  N N      . SER C 2 31 ? -25.695 -3.948  -0.694  1.00 3.66  ? 31 SER A N      1  
ATOM 1610  C CA     . SER C 2 31 ? -26.888 -4.353  -1.429  1.00 3.57  ? 31 SER A CA     1  
ATOM 1611  C C      . SER C 2 31 ? -26.539 -5.171  -2.673  1.00 3.30  ? 31 SER A C      1  
ATOM 1612  O O      . SER C 2 31 ? -25.364 -5.357  -3.002  1.00 3.15  ? 31 SER A O      1  
ATOM 1613  C CB     . SER C 2 31 ? -27.690 -3.117  -1.823  1.00 3.52  ? 31 SER A CB     1  
ATOM 1614  O OG     . SER C 2 31 ? -26.861 -1.970  -1.825  1.00 3.59  ? 31 SER A OG     1  
ATOM 1615  H H      . SER C 2 31 ? -25.373 -3.023  -0.779  1.00 3.60  ? 31 SER A H      1  
ATOM 1616  H HA     . SER C 2 31 ? -27.489 -4.962  -0.771  1.00 3.79  ? 31 SER A HA     1  
ATOM 1617  H HB2    . SER C 2 31 ? -28.100 -3.256  -2.813  1.00 3.57  ? 31 SER A HB2    1  
ATOM 1618  H HB3    . SER C 2 31 ? -28.492 -2.968  -1.116  1.00 3.68  ? 31 SER A HB3    1  
ATOM 1619  H HG     . SER C 2 31 ? -26.585 -1.769  -2.729  1.00 3.80  ? 31 SER A HG     1  
ATOM 1620  N N      . ALA C 2 32 ? -27.574 -5.641  -3.363  1.00 3.28  ? 32 ALA A N      1  
ATOM 1621  C CA     . ALA C 2 32 ? -27.409 -6.456  -4.561  1.00 3.13  ? 32 ALA A CA     1  
ATOM 1622  C C      . ALA C 2 32 ? -26.868 -5.654  -5.747  1.00 2.81  ? 32 ALA A C      1  
ATOM 1623  O O      . ALA C 2 32 ? -25.728 -5.863  -6.160  1.00 2.69  ? 32 ALA A O      1  
ATOM 1624  C CB     . ALA C 2 32 ? -28.732 -7.109  -4.926  1.00 3.24  ? 32 ALA A CB     1  
ATOM 1625  H H      . ALA C 2 32 ? -28.481 -5.442  -3.050  1.00 3.42  ? 32 ALA A H      1  
ATOM 1626  H HA     . ALA C 2 32 ? -26.705 -7.242  -4.327  1.00 3.22  ? 32 ALA A HA     1  
ATOM 1627  H HB1    . ALA C 2 32 ? -29.465 -6.343  -5.133  1.00 3.30  ? 32 ALA A HB1    1  
ATOM 1628  H HB2    . ALA C 2 32 ? -29.071 -7.720  -4.103  1.00 3.60  ? 32 ALA A HB2    1  
ATOM 1629  H HB3    . ALA C 2 32 ? -28.600 -7.727  -5.802  1.00 3.38  ? 32 ALA A HB3    1  
ATOM 1630  N N      . LYS C 2 33 ? -27.682 -4.730  -6.278  1.00 2.73  ? 33 LYS A N      1  
ATOM 1631  C CA     . LYS C 2 33 ? -27.290 -3.913  -7.439  1.00 2.52  ? 33 LYS A CA     1  
ATOM 1632  C C      . LYS C 2 33 ? -25.920 -3.282  -7.272  1.00 2.43  ? 33 LYS A C      1  
ATOM 1633  O O      . LYS C 2 33 ? -25.177 -3.147  -8.241  1.00 2.32  ? 33 LYS A O      1  
ATOM 1634  C CB     . LYS C 2 33 ? -28.330 -2.823  -7.744  1.00 2.53  ? 33 LYS A CB     1  
ATOM 1635  C CG     . LYS C 2 33 ? -28.931 -2.143  -6.521  1.00 2.89  ? 33 LYS A CG     1  
ATOM 1636  C CD     . LYS C 2 33 ? -30.176 -1.350  -6.900  1.00 3.24  ? 33 LYS A CD     1  
ATOM 1637  C CE     . LYS C 2 33 ? -30.882 -0.767  -5.683  1.00 4.00  ? 33 LYS A CE     1  
ATOM 1638  N NZ     . LYS C 2 33 ? -32.116 -0.024  -6.062  1.00 4.59  ? 33 LYS A NZ     1  
ATOM 1639  H H      . LYS C 2 33 ? -28.573 -4.606  -5.892  1.00 2.85  ? 33 LYS A H      1  
ATOM 1640  H HA     . LYS C 2 33 ? -27.236 -4.576  -8.290  1.00 2.48  ? 33 LYS A HA     1  
ATOM 1641  H HB2    . LYS C 2 33 ? -27.856 -2.058  -8.344  1.00 2.62  ? 33 LYS A HB2    1  
ATOM 1642  H HB3    . LYS C 2 33 ? -29.135 -3.264  -8.314  1.00 2.61  ? 33 LYS A HB3    1  
ATOM 1643  H HG2    . LYS C 2 33 ? -29.197 -2.895  -5.792  1.00 3.12  ? 33 LYS A HG2    1  
ATOM 1644  H HG3    . LYS C 2 33 ? -28.198 -1.468  -6.100  1.00 2.98  ? 33 LYS A HG3    1  
ATOM 1645  H HD2    . LYS C 2 33 ? -29.888 -0.542  -7.554  1.00 3.45  ? 33 LYS A HD2    1  
ATOM 1646  H HD3    . LYS C 2 33 ? -30.859 -2.007  -7.419  1.00 3.17  ? 33 LYS A HD3    1  
ATOM 1647  H HE2    . LYS C 2 33 ? -31.149 -1.573  -5.016  1.00 4.23  ? 33 LYS A HE2    1  
ATOM 1648  H HE3    . LYS C 2 33 ? -30.205 -0.092  -5.179  1.00 4.32  ? 33 LYS A HE3    1  
ATOM 1649  H HZ1    . LYS C 2 33 ? -32.628 0.291   -5.209  1.00 4.92  ? 33 LYS A HZ1    1  
ATOM 1650  H HZ2    . LYS C 2 33 ? -32.748 -0.636  -6.625  1.00 4.97  ? 33 LYS A HZ2    1  
ATOM 1651  H HZ3    . LYS C 2 33 ? -31.869 0.816   -6.631  1.00 4.68  ? 33 LYS A HZ3    1  
ATOM 1652  N N      . THR C 2 34 ? -25.580 -2.904  -6.053  1.00 2.54  ? 34 THR A N      1  
ATOM 1653  C CA     . THR C 2 34 ? -24.294 -2.305  -5.792  1.00 2.50  ? 34 THR A CA     1  
ATOM 1654  C C      . THR C 2 34 ? -23.165 -3.253  -6.148  1.00 2.40  ? 34 THR A C      1  
ATOM 1655  O O      . THR C 2 34 ? -22.222 -2.868  -6.831  1.00 2.28  ? 34 THR A O      1  
ATOM 1656  C CB     . THR C 2 34 ? -24.161 -1.909  -4.329  1.00 2.73  ? 34 THR A CB     1  
ATOM 1657  O OG1    . THR C 2 34 ? -25.357 -1.239  -3.910  1.00 2.86  ? 34 THR A OG1    1  
ATOM 1658  C CG2    . THR C 2 34 ? -22.951 -1.013  -4.159  1.00 2.75  ? 34 THR A CG2    1  
ATOM 1659  H H      . THR C 2 34 ? -26.208 -3.024  -5.315  1.00 2.68  ? 34 THR A H      1  
ATOM 1660  H HA     . THR C 2 34 ? -24.207 -1.414  -6.394  1.00 2.46  ? 34 THR A HA     1  
ATOM 1661  H HB     . THR C 2 34 ? -24.023 -2.801  -3.736  1.00 2.86  ? 34 THR A HB     1  
ATOM 1662  H HG1    . THR C 2 34 ? -25.125 -0.449  -3.401  1.00 3.04  ? 34 THR A HG1    1  
ATOM 1663  H HG21   . THR C 2 34 ? -22.194 -1.303  -4.884  1.00 3.02  ? 34 THR A HG21   1  
ATOM 1664  H HG22   . THR C 2 34 ? -22.558 -1.123  -3.160  1.00 2.96  ? 34 THR A HG22   1  
ATOM 1665  H HG23   . THR C 2 34 ? -23.237 0.013   -4.328  1.00 2.82  ? 34 THR A HG23   1  
ATOM 1666  N N      . ARG C 2 35 ? -23.288 -4.500  -5.725  1.00 2.51  ? 35 ARG A N      1  
ATOM 1667  C CA     . ARG C 2 35 ? -22.260 -5.485  -5.997  1.00 2.50  ? 35 ARG A CA     1  
ATOM 1668  C C      . ARG C 2 35 ? -22.187 -5.730  -7.494  1.00 2.38  ? 35 ARG A C      1  
ATOM 1669  O O      . ARG C 2 35 ? -21.115 -5.944  -8.052  1.00 2.33  ? 35 ARG A O      1  
ATOM 1670  C CB     . ARG C 2 35 ? -22.549 -6.800  -5.269  1.00 2.77  ? 35 ARG A CB     1  
ATOM 1671  C CG     . ARG C 2 35 ? -22.523 -6.685  -3.757  1.00 2.94  ? 35 ARG A CG     1  
ATOM 1672  C CD     . ARG C 2 35 ? -22.807 -8.025  -3.094  1.00 3.35  ? 35 ARG A CD     1  
ATOM 1673  N NE     . ARG C 2 35 ? -23.700 -7.892  -1.941  1.00 3.39  ? 35 ARG A NE     1  
ATOM 1674  C CZ     . ARG C 2 35 ? -23.978 -8.883  -1.087  1.00 3.73  ? 35 ARG A CZ     1  
ATOM 1675  N NH1    . ARG C 2 35 ? -23.511 -10.109 -1.305  1.00 4.16  ? 35 ARG A NH1    1  
ATOM 1676  N NH2    . ARG C 2 35 ? -24.748 -8.650  -0.030  1.00 3.92  ? 35 ARG A NH2    1  
ATOM 1677  H H      . ARG C 2 35 ? -24.109 -4.776  -5.263  1.00 2.65  ? 35 ARG A H      1  
ATOM 1678  H HA     . ARG C 2 35 ? -21.316 -5.079  -5.651  1.00 2.47  ? 35 ARG A HA     1  
ATOM 1679  H HB2    . ARG C 2 35 ? -23.527 -7.152  -5.563  1.00 2.87  ? 35 ARG A HB2    1  
ATOM 1680  H HB3    . ARG C 2 35 ? -21.811 -7.531  -5.566  1.00 2.85  ? 35 ARG A HB3    1  
ATOM 1681  H HG2    . ARG C 2 35 ? -21.546 -6.341  -3.451  1.00 2.97  ? 35 ARG A HG2    1  
ATOM 1682  H HG3    . ARG C 2 35 ? -23.272 -5.972  -3.446  1.00 2.97  ? 35 ARG A HG3    1  
ATOM 1683  H HD2    . ARG C 2 35 ? -23.264 -8.681  -3.819  1.00 3.63  ? 35 ARG A HD2    1  
ATOM 1684  H HD3    . ARG C 2 35 ? -21.870 -8.451  -2.765  1.00 3.66  ? 35 ARG A HD3    1  
ATOM 1685  H HE     . ARG C 2 35 ? -24.103 -7.008  -1.787  1.00 3.38  ? 35 ARG A HE     1  
ATOM 1686  H HH11   . ARG C 2 35 ? -22.949 -10.299 -2.112  1.00 4.30  ? 35 ARG A HH11   1  
ATOM 1687  H HH12   . ARG C 2 35 ? -23.722 -10.856 -0.660  1.00 4.53  ? 35 ARG A HH12   1  
ATOM 1688  H HH21   . ARG C 2 35 ? -25.123 -7.728  0.130   1.00 3.98  ? 35 ARG A HH21   1  
ATOM 1689  H HH22   . ARG C 2 35 ? -24.953 -9.387  0.616   1.00 4.20  ? 35 ARG A HH22   1  
ATOM 1690  N N      . GLU C 2 36 ? -23.347 -5.657  -8.133  1.00 2.39  ? 36 GLU A N      1  
ATOM 1691  C CA     . GLU C 2 36 ? -23.459 -5.882  -9.562  1.00 2.38  ? 36 GLU A CA     1  
ATOM 1692  C C      . GLU C 2 36 ? -22.713 -4.820  -10.347 1.00 2.27  ? 36 GLU A C      1  
ATOM 1693  O O      . GLU C 2 36 ? -22.018 -5.130  -11.308 1.00 2.33  ? 36 GLU A O      1  
ATOM 1694  C CB     . GLU C 2 36 ? -24.923 -5.876  -10.006 1.00 2.47  ? 36 GLU A CB     1  
ATOM 1695  C CG     . GLU C 2 36 ? -25.831 -6.801  -9.217  1.00 2.59  ? 36 GLU A CG     1  
ATOM 1696  C CD     . GLU C 2 36 ? -27.213 -6.895  -9.838  1.00 3.03  ? 36 GLU A CD     1  
ATOM 1697  O OE1    . GLU C 2 36 ? -27.312 -7.357  -10.999 1.00 3.21  ? 36 GLU A OE1    1  
ATOM 1698  O OE2    . GLU C 2 36 ? -28.198 -6.486  -9.188  1.00 3.55  ? 36 GLU A OE2    1  
ATOM 1699  H H      . GLU C 2 36 ? -24.149 -5.425  -7.626  1.00 2.45  ? 36 GLU A H      1  
ATOM 1700  H HA     . GLU C 2 36 ? -23.027 -6.844  -9.781  1.00 2.49  ? 36 GLU A HA     1  
ATOM 1701  H HB2    . GLU C 2 36 ? -25.306 -4.872  -9.910  1.00 2.46  ? 36 GLU A HB2    1  
ATOM 1702  H HB3    . GLU C 2 36 ? -24.968 -6.167  -11.045 1.00 2.72  ? 36 GLU A HB3    1  
ATOM 1703  H HG2    . GLU C 2 36 ? -25.390 -7.787  -9.193  1.00 2.88  ? 36 GLU A HG2    1  
ATOM 1704  H HG3    . GLU C 2 36 ? -25.925 -6.420  -8.206  1.00 2.57  ? 36 GLU A HG3    1  
ATOM 1705  N N      . LYS C 2 37 ? -22.842 -3.566  -9.932  1.00 2.21  ? 37 LYS A N      1  
ATOM 1706  C CA     . LYS C 2 37 ? -22.183 -2.489  -10.650 1.00 2.23  ? 37 LYS A CA     1  
ATOM 1707  C C      . LYS C 2 37 ? -20.699 -2.429  -10.330 1.00 2.19  ? 37 LYS A C      1  
ATOM 1708  O O      . LYS C 2 37 ? -19.909 -2.141  -11.217 1.00 2.26  ? 37 LYS A O      1  
ATOM 1709  C CB     . LYS C 2 37 ? -22.861 -1.129  -10.441 1.00 2.31  ? 37 LYS A CB     1  
ATOM 1710  C CG     . LYS C 2 37 ? -23.263 -0.815  -9.017  1.00 2.44  ? 37 LYS A CG     1  
ATOM 1711  C CD     . LYS C 2 37 ? -24.639 -0.170  -8.980  1.00 2.48  ? 37 LYS A CD     1  
ATOM 1712  C CE     . LYS C 2 37 ? -24.673 1.013   -8.037  1.00 2.57  ? 37 LYS A CE     1  
ATOM 1713  N NZ     . LYS C 2 37 ? -24.573 2.309   -8.765  1.00 2.84  ? 37 LYS A NZ     1  
ATOM 1714  H H      . LYS C 2 37 ? -23.374 -3.372  -9.130  1.00 2.23  ? 37 LYS A H      1  
ATOM 1715  H HA     . LYS C 2 37 ? -22.268 -2.737  -11.699 1.00 2.31  ? 37 LYS A HA     1  
ATOM 1716  H HB2    . LYS C 2 37 ? -22.185 -0.356  -10.771 1.00 2.53  ? 37 LYS A HB2    1  
ATOM 1717  H HB3    . LYS C 2 37 ? -23.750 -1.094  -11.055 1.00 2.66  ? 37 LYS A HB3    1  
ATOM 1718  H HG2    . LYS C 2 37 ? -23.286 -1.730  -8.444  1.00 2.86  ? 37 LYS A HG2    1  
ATOM 1719  H HG3    . LYS C 2 37 ? -22.543 -0.133  -8.589  1.00 2.66  ? 37 LYS A HG3    1  
ATOM 1720  H HD2    . LYS C 2 37 ? -24.894 0.168   -9.974  1.00 2.62  ? 37 LYS A HD2    1  
ATOM 1721  H HD3    . LYS C 2 37 ? -25.360 -0.903  -8.651  1.00 2.57  ? 37 LYS A HD3    1  
ATOM 1722  H HE2    . LYS C 2 37 ? -25.602 0.984   -7.482  1.00 2.71  ? 37 LYS A HE2    1  
ATOM 1723  H HE3    . LYS C 2 37 ? -23.837 0.929   -7.355  1.00 2.63  ? 37 LYS A HE3    1  
ATOM 1724  H HZ1    . LYS C 2 37 ? -24.435 3.090   -8.094  1.00 3.16  ? 37 LYS A HZ1    1  
ATOM 1725  H HZ2    . LYS C 2 37 ? -25.449 2.489   -9.309  1.00 3.15  ? 37 LYS A HZ2    1  
ATOM 1726  H HZ3    . LYS C 2 37 ? -23.768 2.288   -9.429  1.00 2.93  ? 37 LYS A HZ3    1  
ATOM 1727  N N      . VAL C 2 38 ? -20.304 -2.686  -9.081  1.00 2.13  ? 38 VAL A N      1  
ATOM 1728  C CA     . VAL C 2 38 ? -18.877 -2.679  -8.757  1.00 2.10  ? 38 VAL A CA     1  
ATOM 1729  C C      . VAL C 2 38 ? -18.193 -3.800  -9.545  1.00 2.10  ? 38 VAL A C      1  
ATOM 1730  O O      . VAL C 2 38 ? -17.165 -3.583  -10.185 1.00 2.14  ? 38 VAL A O      1  
ATOM 1731  C CB     . VAL C 2 38 ? -18.605 -2.828  -7.245  1.00 2.11  ? 38 VAL A CB     1  
ATOM 1732  C CG1    . VAL C 2 38 ? -19.517 -1.913  -6.451  1.00 2.26  ? 38 VAL A CG1    1  
ATOM 1733  C CG2    . VAL C 2 38 ? -18.747 -4.261  -6.785  1.00 2.12  ? 38 VAL A CG2    1  
ATOM 1734  H H      . VAL C 2 38 ? -20.971 -2.881  -8.374  1.00 2.16  ? 38 VAL A H      1  
ATOM 1735  H HA     . VAL C 2 38 ? -18.460 -1.726  -9.077  1.00 2.16  ? 38 VAL A HA     1  
ATOM 1736  H HB     . VAL C 2 38 ? -17.589 -2.523  -7.065  1.00 2.11  ? 38 VAL A HB     1  
ATOM 1737  H HG11   . VAL C 2 38 ? -20.544 -2.073  -6.765  1.00 2.68  ? 38 VAL A HG11   1  
ATOM 1738  H HG12   . VAL C 2 38 ? -19.241 -0.884  -6.629  1.00 2.30  ? 38 VAL A HG12   1  
ATOM 1739  H HG13   . VAL C 2 38 ? -19.425 -2.135  -5.398  1.00 2.54  ? 38 VAL A HG13   1  
ATOM 1740  H HG21   . VAL C 2 38 ? -19.778 -4.566  -6.875  1.00 2.57  ? 38 VAL A HG21   1  
ATOM 1741  H HG22   . VAL C 2 38 ? -18.430 -4.345  -5.757  1.00 2.23  ? 38 VAL A HG22   1  
ATOM 1742  H HG23   . VAL C 2 38 ? -18.127 -4.895  -7.412  1.00 2.26  ? 38 VAL A HG23   1  
ATOM 1743  N N      . GLU C 2 39 ? -18.801 -4.989  -9.504  1.00 2.16  ? 39 GLU A N      1  
ATOM 1744  C CA     . GLU C 2 39 ? -18.308 -6.150  -10.233 1.00 2.30  ? 39 GLU A CA     1  
ATOM 1745  C C      . GLU C 2 39 ? -18.297 -5.845  -11.718 1.00 2.42  ? 39 GLU A C      1  
ATOM 1746  O O      . GLU C 2 39 ? -17.344 -6.178  -12.418 1.00 2.56  ? 39 GLU A O      1  
ATOM 1747  C CB     . GLU C 2 39 ? -19.180 -7.382  -9.966  1.00 2.46  ? 39 GLU A CB     1  
ATOM 1748  C CG     . GLU C 2 39 ? -18.543 -8.402  -9.034  1.00 2.53  ? 39 GLU A CG     1  
ATOM 1749  C CD     . GLU C 2 39 ? -19.090 -9.805  -9.249  1.00 2.89  ? 39 GLU A CD     1  
ATOM 1750  O OE1    . GLU C 2 39 ? -18.570 -10.523 -10.134 1.00 3.12  ? 39 GLU A OE1    1  
ATOM 1751  O OE2    . GLU C 2 39 ? -20.046 -10.195 -8.546  1.00 3.27  ? 39 GLU A OE2    1  
ATOM 1752  H H      . GLU C 2 39 ? -19.586 -5.091  -8.927  1.00 2.17  ? 39 GLU A H      1  
ATOM 1753  H HA     . GLU C 2 39 ? -17.298 -6.349  -9.905  1.00 2.28  ? 39 GLU A HA     1  
ATOM 1754  H HB2    . GLU C 2 39 ? -20.112 -7.059  -9.526  1.00 2.44  ? 39 GLU A HB2    1  
ATOM 1755  H HB3    . GLU C 2 39 ? -19.389 -7.870  -10.907 1.00 2.62  ? 39 GLU A HB3    1  
ATOM 1756  H HG2    . GLU C 2 39 ? -17.477 -8.414  -9.211  1.00 2.47  ? 39 GLU A HG2    1  
ATOM 1757  H HG3    . GLU C 2 39 ? -18.733 -8.105  -8.009  1.00 2.57  ? 39 GLU A HG3    1  
ATOM 1758  N N      . ALA C 2 40 ? -19.364 -5.209  -12.195 1.00 2.42  ? 40 ALA A N      1  
ATOM 1759  C CA     . ALA C 2 40 ? -19.447 -4.836  -13.596 1.00 2.60  ? 40 ALA A CA     1  
ATOM 1760  C C      . ALA C 2 40 ? -18.323 -3.883  -13.925 1.00 2.65  ? 40 ALA A C      1  
ATOM 1761  O O      . ALA C 2 40 ? -17.499 -4.168  -14.780 1.00 2.86  ? 40 ALA A O      1  
ATOM 1762  C CB     . ALA C 2 40 ? -20.778 -4.181  -13.929 1.00 2.61  ? 40 ALA A CB     1  
ATOM 1763  H H      . ALA C 2 40 ? -20.114 -4.994  -11.590 1.00 2.32  ? 40 ALA A H      1  
ATOM 1764  H HA     . ALA C 2 40 ? -19.343 -5.730  -14.193 1.00 2.77  ? 40 ALA A HA     1  
ATOM 1765  H HB1    . ALA C 2 40 ? -20.636 -3.484  -14.749 1.00 2.90  ? 40 ALA A HB1    1  
ATOM 1766  H HB2    . ALA C 2 40 ? -21.145 -3.649  -13.064 1.00 2.54  ? 40 ALA A HB2    1  
ATOM 1767  H HB3    . ALA C 2 40 ? -21.491 -4.937  -14.219 1.00 2.88  ? 40 ALA A HB3    1  
ATOM 1768  N N      . ALA C 2 41 ? -18.264 -2.779  -13.191 1.00 2.52  ? 41 ALA A N      1  
ATOM 1769  C CA     . ALA C 2 41 ? -17.254 -1.765  -13.408 1.00 2.63  ? 41 ALA A CA     1  
ATOM 1770  C C      . ALA C 2 41 ? -15.842 -2.328  -13.476 1.00 2.66  ? 41 ALA A C      1  
ATOM 1771  O O      . ALA C 2 41 ? -15.118 -2.067  -14.432 1.00 2.89  ? 41 ALA A O      1  
ATOM 1772  C CB     . ALA C 2 41 ? -17.339 -0.748  -12.303 1.00 2.54  ? 41 ALA A CB     1  
ATOM 1773  H H      . ALA C 2 41 ? -18.948 -2.621  -12.484 1.00 2.40  ? 41 ALA A H      1  
ATOM 1774  H HA     . ALA C 2 41 ? -17.477 -1.265  -14.337 1.00 2.83  ? 41 ALA A HA     1  
ATOM 1775  H HB1    . ALA C 2 41 ? -16.504 -0.069  -12.376 1.00 2.75  ? 41 ALA A HB1    1  
ATOM 1776  H HB2    . ALA C 2 41 ? -17.312 -1.259  -11.353 1.00 2.83  ? 41 ALA A HB2    1  
ATOM 1777  H HB3    . ALA C 2 41 ? -18.262 -0.197  -12.391 1.00 2.57  ? 41 ALA A HB3    1  
ATOM 1778  N N      . MET C 2 42 ? -15.456 -3.117  -12.488 1.00 2.47  ? 42 MET A N      1  
ATOM 1779  C CA     . MET C 2 42 ? -14.122 -3.692  -12.478 1.00 2.49  ? 42 MET A CA     1  
ATOM 1780  C C      . MET C 2 42 ? -13.947 -4.644  -13.656 1.00 2.73  ? 42 MET A C      1  
ATOM 1781  O O      . MET C 2 42 ? -12.859 -4.777  -14.197 1.00 2.88  ? 42 MET A O      1  
ATOM 1782  C CB     . MET C 2 42 ? -13.803 -4.393  -11.155 1.00 2.29  ? 42 MET A CB     1  
ATOM 1783  C CG     . MET C 2 42 ? -14.792 -5.462  -10.761 1.00 2.26  ? 42 MET A CG     1  
ATOM 1784  S SD     . MET C 2 42 ? -14.539 -6.033  -9.077  1.00 2.15  ? 42 MET A SD     1  
ATOM 1785  C CE     . MET C 2 42 ? -14.827 -4.494  -8.216  1.00 2.02  ? 42 MET A CE     1  
ATOM 1786  H H      . MET C 2 42 ? -16.078 -3.316  -11.752 1.00 2.33  ? 42 MET A H      1  
ATOM 1787  H HA     . MET C 2 42 ? -13.431 -2.871  -12.595 1.00 2.55  ? 42 MET A HA     1  
ATOM 1788  H HB2    . MET C 2 42 ? -12.828 -4.852  -11.233 1.00 2.33  ? 42 MET A HB2    1  
ATOM 1789  H HB3    . MET C 2 42 ? -13.775 -3.653  -10.368 1.00 2.19  ? 42 MET A HB3    1  
ATOM 1790  H HG2    . MET C 2 42 ? -15.788 -5.048  -10.834 1.00 2.24  ? 42 MET A HG2    1  
ATOM 1791  H HG3    . MET C 2 42 ? -14.687 -6.292  -11.437 1.00 2.42  ? 42 MET A HG3    1  
ATOM 1792  H HE1    . MET C 2 42 ? -14.407 -4.549  -7.223  1.00 2.48  ? 42 MET A HE1    1  
ATOM 1793  H HE2    . MET C 2 42 ? -15.893 -4.314  -8.152  1.00 2.10  ? 42 MET A HE2    1  
ATOM 1794  H HE3    . MET C 2 42 ? -14.356 -3.688  -8.769  1.00 2.11  ? 42 MET A HE3    1  
ATOM 1795  N N      . ALA C 2 43 ? -15.032 -5.300  -14.054 1.00 2.80  ? 43 ALA A N      1  
ATOM 1796  C CA     . ALA C 2 43 ? -14.980 -6.263  -15.149 1.00 3.09  ? 43 ALA A CA     1  
ATOM 1797  C C      . ALA C 2 43 ? -14.808 -5.563  -16.488 1.00 3.36  ? 43 ALA A C      1  
ATOM 1798  O O      . ALA C 2 43 ? -13.991 -5.970  -17.316 1.00 3.60  ? 43 ALA A O      1  
ATOM 1799  C CB     . ALA C 2 43 ? -16.229 -7.133  -15.163 1.00 3.15  ? 43 ALA A CB     1  
ATOM 1800  H H      . ALA C 2 43 ? -15.908 -5.062  -13.663 1.00 2.69  ? 43 ALA A H      1  
ATOM 1801  H HA     . ALA C 2 43 ? -14.128 -6.906  -14.982 1.00 3.13  ? 43 ALA A HA     1  
ATOM 1802  H HB1    . ALA C 2 43 ? -16.339 -7.621  -14.205 1.00 3.31  ? 43 ALA A HB1    1  
ATOM 1803  H HB2    . ALA C 2 43 ? -16.139 -7.879  -15.939 1.00 3.18  ? 43 ALA A HB2    1  
ATOM 1804  H HB3    . ALA C 2 43 ? -17.095 -6.517  -15.354 1.00 3.47  ? 43 ALA A HB3    1  
ATOM 1805  N N      . GLU C 2 44 ? -15.583 -4.504  -16.686 1.00 3.34  ? 44 GLU A N      1  
ATOM 1806  C CA     . GLU C 2 44 ? -15.549 -3.741  -17.926 1.00 3.63  ? 44 GLU A CA     1  
ATOM 1807  C C      . GLU C 2 44 ? -14.236 -2.996  -18.064 1.00 3.73  ? 44 GLU A C      1  
ATOM 1808  O O      . GLU C 2 44 ? -13.624 -2.984  -19.131 1.00 4.02  ? 44 GLU A O      1  
ATOM 1809  C CB     . GLU C 2 44 ? -16.700 -2.741  -17.966 1.00 3.61  ? 44 GLU A CB     1  
ATOM 1810  C CG     . GLU C 2 44 ? -18.000 -3.278  -17.406 1.00 3.44  ? 44 GLU A CG     1  
ATOM 1811  C CD     . GLU C 2 44 ? -19.216 -2.906  -18.233 1.00 3.74  ? 44 GLU A CD     1  
ATOM 1812  O OE1    . GLU C 2 44 ? -19.427 -3.514  -19.301 1.00 4.09  ? 44 GLU A OE1    1  
ATOM 1813  O OE2    . GLU C 2 44 ? -19.973 -1.999  -17.815 1.00 3.86  ? 44 GLU A OE2    1  
ATOM 1814  H H      . GLU C 2 44 ? -16.203 -4.223  -15.970 1.00 3.15  ? 44 GLU A H      1  
ATOM 1815  H HA     . GLU C 2 44 ? -15.646 -4.432  -18.746 1.00 3.84  ? 44 GLU A HA     1  
ATOM 1816  H HB2    . GLU C 2 44 ? -16.420 -1.881  -17.377 1.00 3.48  ? 44 GLU A HB2    1  
ATOM 1817  H HB3    . GLU C 2 44 ? -16.867 -2.435  -18.987 1.00 3.88  ? 44 GLU A HB3    1  
ATOM 1818  H HG2    . GLU C 2 44 ? -17.933 -4.353  -17.344 1.00 3.33  ? 44 GLU A HG2    1  
ATOM 1819  H HG3    . GLU C 2 44 ? -18.120 -2.869  -16.409 1.00 3.33  ? 44 GLU A HG3    1  
ATOM 1820  N N      . LEU C 2 45 ? -13.804 -2.375  -16.977 1.00 3.50  ? 45 LEU A N      1  
ATOM 1821  C CA     . LEU C 2 45 ? -12.551 -1.631  -16.989 1.00 3.59  ? 45 LEU A CA     1  
ATOM 1822  C C      . LEU C 2 45 ? -11.364 -2.567  -16.830 1.00 3.56  ? 45 LEU A C      1  
ATOM 1823  O O      . LEU C 2 45 ? -10.219 -2.113  -16.821 1.00 3.63  ? 45 LEU A O      1  
ATOM 1824  C CB     . LEU C 2 45 ? -12.510 -0.596  -15.858 1.00 3.41  ? 45 LEU A CB     1  
ATOM 1825  C CG     . LEU C 2 45 ? -13.793 0.200   -15.627 1.00 3.38  ? 45 LEU A CG     1  
ATOM 1826  C CD1    . LEU C 2 45 ? -13.533 1.351   -14.666 1.00 3.36  ? 45 LEU A CD1    1  
ATOM 1827  C CD2    . LEU C 2 45 ? -14.366 0.697   -16.945 1.00 3.71  ? 45 LEU A CD2    1  
ATOM 1828  H H      . LEU C 2 45 ? -14.361 -2.386  -16.160 1.00 3.28  ? 45 LEU A H      1  
ATOM 1829  H HA     . LEU C 2 45 ? -12.473 -1.121  -17.935 1.00 3.85  ? 45 LEU A HA     1  
ATOM 1830  H HB2    . LEU C 2 45 ? -12.267 -1.112  -14.941 1.00 3.17  ? 45 LEU A HB2    1  
ATOM 1831  H HB3    . LEU C 2 45 ? -11.716 0.104   -16.074 1.00 3.56  ? 45 LEU A HB3    1  
ATOM 1832  H HG     . LEU C 2 45 ? -14.527 -0.449  -15.170 1.00 3.18  ? 45 LEU A HG     1  
ATOM 1833  H HD11   . LEU C 2 45 ? -14.430 1.943   -14.558 1.00 3.42  ? 45 LEU A HD11   1  
ATOM 1834  H HD12   . LEU C 2 45 ? -12.736 1.972   -15.048 1.00 3.45  ? 45 LEU A HD12   1  
ATOM 1835  H HD13   . LEU C 2 45 ? -13.248 0.954   -13.701 1.00 3.66  ? 45 LEU A HD13   1  
ATOM 1836  H HD21   . LEU C 2 45 ? -15.065 1.497   -16.756 1.00 3.75  ? 45 LEU A HD21   1  
ATOM 1837  H HD22   . LEU C 2 45 ? -14.880 -0.122  -17.437 1.00 4.07  ? 45 LEU A HD22   1  
ATOM 1838  H HD23   . LEU C 2 45 ? -13.566 1.052   -17.577 1.00 3.93  ? 45 LEU A HD23   1  
ATOM 1839  N N      . ASN C 2 46 ? -11.648 -3.868  -16.698 1.00 3.49  ? 46 ASN A N      1  
ATOM 1840  C CA     . ASN C 2 46 ? -10.612 -4.902  -16.516 1.00 3.50  ? 46 ASN A CA     1  
ATOM 1841  C C      . ASN C 2 46 ? -10.059 -4.836  -15.091 1.00 3.19  ? 46 ASN A C      1  
ATOM 1842  O O      . ASN C 2 46 ? -9.949  -5.856  -14.407 1.00 3.08  ? 46 ASN A O      1  
ATOM 1843  C CB     . ASN C 2 46 ? -9.489  -4.764  -17.562 1.00 3.80  ? 46 ASN A CB     1  
ATOM 1844  C CG     . ASN C 2 46 ? -8.163  -5.343  -17.099 1.00 3.84  ? 46 ASN A CG     1  
ATOM 1845  O OD1    . ASN C 2 46 ? -7.334  -4.641  -16.528 1.00 4.18  ? 46 ASN A OD1    1  
ATOM 1846  N ND2    . ASN C 2 46 ? -7.946  -6.622  -17.356 1.00 3.81  ? 46 ASN A ND2    1  
ATOM 1847  H H      . ASN C 2 46 ? -12.596 -4.142  -16.697 1.00 3.46  ? 46 ASN A H      1  
ATOM 1848  H HA     . ASN C 2 46 ? -11.092 -5.863  -16.646 1.00 3.55  ? 46 ASN A HA     1  
ATOM 1849  H HB2    . ASN C 2 46 ? -9.785  -5.278  -18.464 1.00 4.05  ? 46 ASN A HB2    1  
ATOM 1850  H HB3    . ASN C 2 46 ? -9.344  -3.716  -17.783 1.00 3.81  ? 46 ASN A HB3    1  
ATOM 1851  H HD21   . ASN C 2 46 ? -8.643  -7.126  -17.827 1.00 3.95  ? 46 ASN A HD21   1  
ATOM 1852  H HD22   . ASN C 2 46 ? -7.098  -7.011  -17.061 1.00 3.85  ? 46 ASN A HD22   1  
ATOM 1853  N N      . TYR C 2 47 ? -9.728  -3.617  -14.669 1.00 3.10  ? 47 TYR A N      1  
ATOM 1854  C CA     . TYR C 2 47 ? -9.235  -3.326  -13.330 1.00 2.83  ? 47 TYR A CA     1  
ATOM 1855  C C      . TYR C 2 47 ? -7.941  -4.073  -12.983 1.00 2.81  ? 47 TYR A C      1  
ATOM 1856  O O      . TYR C 2 47 ? -7.951  -5.229  -12.551 1.00 2.91  ? 47 TYR A O      1  
ATOM 1857  C CB     . TYR C 2 47 ? -10.338 -3.598  -12.292 1.00 2.58  ? 47 TYR A CB     1  
ATOM 1858  C CG     . TYR C 2 47 ? -9.931  -3.296  -10.866 1.00 2.35  ? 47 TYR A CG     1  
ATOM 1859  C CD1    . TYR C 2 47 ? -8.852  -2.462  -10.602 1.00 2.39  ? 47 TYR A CD1    1  
ATOM 1860  C CD2    . TYR C 2 47 ? -10.598 -3.870  -9.787  1.00 2.15  ? 47 TYR A CD2    1  
ATOM 1861  C CE1    . TYR C 2 47 ? -8.448  -2.204  -9.314  1.00 2.25  ? 47 TYR A CE1    1  
ATOM 1862  C CE2    . TYR C 2 47 ? -10.190 -3.623  -8.492  1.00 2.03  ? 47 TYR A CE2    1  
ATOM 1863  C CZ     . TYR C 2 47 ? -9.114  -2.789  -8.262  1.00 2.08  ? 47 TYR A CZ     1  
ATOM 1864  O OH     . TYR C 2 47 ? -8.690  -2.555  -6.976  1.00 2.05  ? 47 TYR A OH     1  
ATOM 1865  H H      . TYR C 2 47 ? -9.812  -2.874  -15.306 1.00 3.27  ? 47 TYR A H      1  
ATOM 1866  H HA     . TYR C 2 47 ? -9.014  -2.269  -13.303 1.00 2.91  ? 47 TYR A HA     1  
ATOM 1867  H HB2    . TYR C 2 47 ? -11.198 -2.988  -12.524 1.00 2.65  ? 47 TYR A HB2    1  
ATOM 1868  H HB3    . TYR C 2 47 ? -10.619 -4.638  -12.345 1.00 2.56  ? 47 TYR A HB3    1  
ATOM 1869  H HD1    . TYR C 2 47 ? -8.333  -2.001  -11.432 1.00 2.59  ? 47 TYR A HD1    1  
ATOM 1870  H HD2    . TYR C 2 47 ? -11.454 -4.515  -9.969  1.00 2.15  ? 47 TYR A HD2    1  
ATOM 1871  H HE1    . TYR C 2 47 ? -7.610  -1.549  -9.136  1.00 2.33  ? 47 TYR A HE1    1  
ATOM 1872  H HE2    . TYR C 2 47 ? -10.720 -4.074  -7.668  1.00 1.97  ? 47 TYR A HE2    1  
ATOM 1873  H HH     . TYR C 2 47 ? -8.522  -1.619  -6.857  1.00 2.55  ? 47 TYR A HH     1  
ATOM 1874  N N      . ILE C 2 48 ? -6.828  -3.375  -13.166 1.00 2.82  ? 48 ILE A N      1  
ATOM 1875  C CA     . ILE C 2 48 ? -5.517  -3.891  -12.838 1.00 2.85  ? 48 ILE A CA     1  
ATOM 1876  C C      . ILE C 2 48 ? -4.804  -2.843  -11.974 1.00 2.59  ? 48 ILE A C      1  
ATOM 1877  O O      . ILE C 2 48 ? -4.474  -1.753  -12.443 1.00 2.65  ? 48 ILE A O      1  
ATOM 1878  C CB     . ILE C 2 48 ? -4.706  -4.255  -14.114 1.00 3.25  ? 48 ILE A CB     1  
ATOM 1879  C CG1    . ILE C 2 48 ? -3.210  -4.420  -13.802 1.00 3.41  ? 48 ILE A CG1    1  
ATOM 1880  C CG2    . ILE C 2 48 ? -4.935  -3.228  -15.219 1.00 3.45  ? 48 ILE A CG2    1  
ATOM 1881  C CD1    . ILE C 2 48 ? -2.379  -3.197  -14.122 1.00 3.70  ? 48 ILE A CD1    1  
ATOM 1882  H H      . ILE C 2 48 ? -6.888  -2.475  -13.544 1.00 2.90  ? 48 ILE A H      1  
ATOM 1883  H HA     . ILE C 2 48 ? -5.652  -4.788  -12.251 1.00 2.96  ? 48 ILE A HA     1  
ATOM 1884  H HB     . ILE C 2 48 ? -5.085  -5.200  -14.476 1.00 3.72  ? 48 ILE A HB     1  
ATOM 1885  H HG12   . ILE C 2 48 ? -3.091  -4.632  -12.750 1.00 3.88  ? 48 ILE A HG12   1  
ATOM 1886  H HG13   . ILE C 2 48 ? -2.819  -5.247  -14.376 1.00 3.47  ? 48 ILE A HG13   1  
ATOM 1887  H HG21   . ILE C 2 48 ? -4.814  -2.233  -14.819 1.00 3.52  ? 48 ILE A HG21   1  
ATOM 1888  H HG22   . ILE C 2 48 ? -5.936  -3.342  -15.613 1.00 3.61  ? 48 ILE A HG22   1  
ATOM 1889  H HG23   . ILE C 2 48 ? -4.219  -3.388  -16.012 1.00 3.89  ? 48 ILE A HG23   1  
ATOM 1890  H HD11   . ILE C 2 48 ? -2.183  -3.163  -15.183 1.00 3.98  ? 48 ILE A HD11   1  
ATOM 1891  H HD12   . ILE C 2 48 ? -1.446  -3.240  -13.580 1.00 3.99  ? 48 ILE A HD12   1  
ATOM 1892  H HD13   . ILE C 2 48 ? -2.931  -2.313  -13.830 1.00 3.96  ? 48 ILE A HD13   1  
ATOM 1893  N N      . PRO C 2 49 ? -4.619  -3.147  -10.679 1.00 2.70  ? 49 PRO A N      1  
ATOM 1894  C CA     . PRO C 2 49 ? -3.993  -2.228  -9.714  1.00 2.77  ? 49 PRO A CA     1  
ATOM 1895  C C      . PRO C 2 49 ? -2.546  -1.859  -10.044 1.00 2.92  ? 49 PRO A C      1  
ATOM 1896  O O      . PRO C 2 49 ? -2.264  -0.714  -10.412 1.00 3.54  ? 49 PRO A O      1  
ATOM 1897  C CB     . PRO C 2 49 ? -4.053  -2.998  -8.387  1.00 3.28  ? 49 PRO A CB     1  
ATOM 1898  C CG     . PRO C 2 49 ? -5.090  -4.048  -8.589  1.00 3.60  ? 49 PRO A CG     1  
ATOM 1899  C CD     . PRO C 2 49 ? -5.026  -4.411  -10.043 1.00 3.19  ? 49 PRO A CD     1  
ATOM 1900  H HA     . PRO C 2 49 ? -4.570  -1.320  -9.619  1.00 2.82  ? 49 PRO A HA     1  
ATOM 1901  H HB2    . PRO C 2 49 ? -3.086  -3.433  -8.178  1.00 3.40  ? 49 PRO A HB2    1  
ATOM 1902  H HB3    . PRO C 2 49 ? -4.327  -2.322  -7.590  1.00 3.61  ? 49 PRO A HB3    1  
ATOM 1903  H HG2    . PRO C 2 49 ? -4.866  -4.909  -7.977  1.00 3.91  ? 49 PRO A HG2    1  
ATOM 1904  H HG3    . PRO C 2 49 ? -6.065  -3.654  -8.344  1.00 4.10  ? 49 PRO A HG3    1  
ATOM 1905  H HD2    . PRO C 2 49 ? -4.288  -5.183  -10.209 1.00 3.38  ? 49 PRO A HD2    1  
ATOM 1906  H HD3    . PRO C 2 49 ? -5.995  -4.727  -10.399 1.00 3.35  ? 49 PRO A HD3    1  
ATOM 1907  N N      . ASN C 2 50 ? -1.639  -2.831  -9.894  1.00 2.91  ? 50 ASN A N      1  
ATOM 1908  C CA     . ASN C 2 50 ? -0.205  -2.623  -10.140 1.00 3.44  ? 50 ASN A CA     1  
ATOM 1909  C C      . ASN C 2 50 ? 0.353   -1.596  -9.157  1.00 3.91  ? 50 ASN A C      1  
ATOM 1910  O O      . ASN C 2 50 ? 1.172   -0.751  -9.514  1.00 4.67  ? 50 ASN A O      1  
ATOM 1911  C CB     . ASN C 2 50 ? 0.058   -2.170  -11.583 1.00 3.95  ? 50 ASN A CB     1  
ATOM 1912  C CG     . ASN C 2 50 ? 1.141   -2.989  -12.265 1.00 4.50  ? 50 ASN A CG     1  
ATOM 1913  O OD1    . ASN C 2 50 ? 2.331   -2.665  -12.200 1.00 4.64  ? 50 ASN A OD1    1  
ATOM 1914  N ND2    . ASN C 2 50 ? 0.732   -4.056  -12.934 1.00 5.14  ? 50 ASN A ND2    1  
ATOM 1915  H H      . ASN C 2 50 ? -1.945  -3.717  -9.613  1.00 2.93  ? 50 ASN A H      1  
ATOM 1916  H HA     . ASN C 2 50 ? 0.295   -3.566  -9.972  1.00 3.69  ? 50 ASN A HA     1  
ATOM 1917  H HB2    . ASN C 2 50 ? -0.853  -2.266  -12.155 1.00 4.09  ? 50 ASN A HB2    1  
ATOM 1918  H HB3    . ASN C 2 50 ? 0.365   -1.134  -11.577 1.00 4.21  ? 50 ASN A HB3    1  
ATOM 1919  H HD21   . ASN C 2 50 ? -0.227  -4.253  -12.950 1.00 5.31  ? 50 ASN A HD21   1  
ATOM 1920  H HD22   . ASN C 2 50 ? 1.407   -4.603  -13.399 1.00 5.58  ? 50 ASN A HD22   1  
ATOM 1921  N N      . ARG C 2 51 ? -0.088  -1.692  -7.905  1.00 3.91  ? 51 ARG A N      1  
ATOM 1922  C CA     . ARG C 2 51 ? 0.344   -0.768  -6.859  1.00 4.75  ? 51 ARG A CA     1  
ATOM 1923  C C      . ARG C 2 51 ? 1.619   -1.256  -6.177  1.00 4.81  ? 51 ARG A C      1  
ATOM 1924  O O      . ARG C 2 51 ? 2.017   -0.732  -5.135  1.00 5.41  ? 51 ARG A O      1  
ATOM 1925  C CB     . ARG C 2 51 ? -0.766  -0.598  -5.820  1.00 5.37  ? 51 ARG A CB     1  
ATOM 1926  C CG     . ARG C 2 51 ? -1.031  0.850   -5.441  1.00 6.42  ? 51 ARG A CG     1  
ATOM 1927  C CD     . ARG C 2 51 ? -0.724  1.119   -3.974  1.00 7.01  ? 51 ARG A CD     1  
ATOM 1928  N NE     . ARG C 2 51 ? 0.712   1.260   -3.725  1.00 7.58  ? 51 ARG A NE     1  
ATOM 1929  C CZ     . ARG C 2 51 ? 1.262   2.299   -3.094  1.00 8.32  ? 51 ARG A CZ     1  
ATOM 1930  N NH1    . ARG C 2 51 ? 0.502   3.317   -2.692  1.00 8.61  ? 51 ARG A NH1    1  
ATOM 1931  N NH2    . ARG C 2 51 ? 2.575   2.327   -2.881  1.00 9.00  ? 51 ARG A NH2    1  
ATOM 1932  H H      . ARG C 2 51 ? -0.723  -2.401  -7.679  1.00 3.65  ? 51 ARG A H      1  
ATOM 1933  H HA     . ARG C 2 51 ? 0.541   0.188   -7.321  1.00 5.24  ? 51 ARG A HA     1  
ATOM 1934  H HB2    . ARG C 2 51 ? -1.680  -1.016  -6.215  1.00 5.34  ? 51 ARG A HB2    1  
ATOM 1935  H HB3    . ARG C 2 51 ? -0.491  -1.137  -4.925  1.00 5.40  ? 51 ARG A HB3    1  
ATOM 1936  H HG2    . ARG C 2 51 ? -0.410  1.490   -6.049  1.00 6.80  ? 51 ARG A HG2    1  
ATOM 1937  H HG3    . ARG C 2 51 ? -2.072  1.075   -5.627  1.00 6.67  ? 51 ARG A HG3    1  
ATOM 1938  H HD2    . ARG C 2 51 ? -1.220  2.031   -3.678  1.00 7.11  ? 51 ARG A HD2    1  
ATOM 1939  H HD3    . ARG C 2 51 ? -1.102  0.296   -3.385  1.00 7.21  ? 51 ARG A HD3    1  
ATOM 1940  H HE     . ARG C 2 51 ? 1.297   0.528   -4.041  1.00 7.59  ? 51 ARG A HE     1  
ATOM 1941  H HH11   . ARG C 2 51 ? -0.489  3.306   -2.865  1.00 8.29  ? 51 ARG A HH11   1  
ATOM 1942  H HH12   . ARG C 2 51 ? 0.911   4.100   -2.216  1.00 9.30  ? 51 ARG A HH12   1  
ATOM 1943  H HH21   . ARG C 2 51 ? 3.151   1.569   -3.195  1.00 9.00  ? 51 ARG A HH21   1  
ATOM 1944  H HH22   . ARG C 2 51 ? 2.995   3.102   -2.405  1.00 9.64  ? 51 ARG A HH22   1  
ATOM 1945  N N      . CYS C 2 52 ? 2.252   -2.259  -6.760  1.00 4.54  ? 52 CYS A N      1  
ATOM 1946  C CA     . CYS C 2 52 ? 3.477   -2.808  -6.204  1.00 5.01  ? 52 CYS A CA     1  
ATOM 1947  C C      . CYS C 2 52 ? 4.656   -2.500  -7.106  1.00 5.61  ? 52 CYS A C      1  
ATOM 1948  O O      . CYS C 2 52 ? 5.264   -1.436  -6.992  1.00 5.87  ? 52 CYS A O      1  
ATOM 1949  C CB     . CYS C 2 52 ? 3.343   -4.318  -5.980  1.00 5.05  ? 52 CYS A CB     1  
ATOM 1950  S SG     . CYS C 2 52 ? 1.982   -4.793  -4.861  1.00 4.97  ? 52 CYS A SG     1  
ATOM 1951  H H      . CYS C 2 52 ? 1.895   -2.630  -7.592  1.00 4.29  ? 52 CYS A H      1  
ATOM 1952  H HA     . CYS C 2 52 ? 3.656   -2.330  -5.255  1.00 5.33  ? 52 CYS A HA     1  
ATOM 1953  H HB2    . CYS C 2 52 ? 3.168   -4.800  -6.930  1.00 5.12  ? 52 CYS A HB2    1  
ATOM 1954  H HB3    . CYS C 2 52 ? 4.263   -4.693  -5.556  1.00 5.54  ? 52 CYS A HB3    1  
ATOM 1955  N N      . ALA C 2 53 ? 4.952   -3.406  -8.027  1.00 6.17  ? 53 ALA A N      1  
ATOM 1956  C CA     . ALA C 2 53 ? 6.077   -3.228  -8.923  1.00 7.07  ? 53 ALA A CA     1  
ATOM 1957  C C      . ALA C 2 53 ? 6.098   -4.321  -9.980  1.00 7.73  ? 53 ALA A C      1  
ATOM 1958  O O      . ALA C 2 53 ? 6.907   -5.246  -9.922  1.00 7.95  ? 53 ALA A O      1  
ATOM 1959  C CB     . ALA C 2 53 ? 7.369   -3.219  -8.121  1.00 7.69  ? 53 ALA A CB     1  
ATOM 1960  H H      . ALA C 2 53 ? 4.393   -4.206  -8.118  1.00 6.16  ? 53 ALA A H      1  
ATOM 1961  H HA     . ALA C 2 53 ? 5.972   -2.269  -9.408  1.00 7.09  ? 53 ALA A HA     1  
ATOM 1962  H HB1    . ALA C 2 53 ? 7.169   -2.800  -7.140  1.00 7.99  ? 53 ALA A HB1    1  
ATOM 1963  H HB2    . ALA C 2 53 ? 8.106   -2.616  -8.629  1.00 7.63  ? 53 ALA A HB2    1  
ATOM 1964  H HB3    . ALA C 2 53 ? 7.735   -4.228  -8.014  1.00 8.15  ? 53 ALA A HB3    1  
ATOM 1965  N N      . GLN C 2 54 ? 5.173   -4.231  -10.921 1.00 8.29  ? 54 GLN A N      1  
ATOM 1966  C CA     . GLN C 2 54 ? 5.085   -5.203  -11.996 1.00 9.16  ? 54 GLN A CA     1  
ATOM 1967  C C      . GLN C 2 54 ? 5.578   -4.589  -13.302 1.00 10.13 ? 54 GLN A C      1  
ATOM 1968  O O      . GLN C 2 54 ? 6.622   -4.977  -13.825 1.00 10.55 ? 54 GLN A O      1  
ATOM 1969  C CB     . GLN C 2 54 ? 3.649   -5.710  -12.150 1.00 9.43  ? 54 GLN A CB     1  
ATOM 1970  C CG     . GLN C 2 54 ? 3.236   -6.726  -11.094 1.00 9.25  ? 54 GLN A CG     1  
ATOM 1971  C CD     . GLN C 2 54 ? 2.489   -6.110  -9.921  1.00 9.60  ? 54 GLN A CD     1  
ATOM 1972  O OE1    . GLN C 2 54 ? 2.733   -4.967  -9.530  1.00 9.58  ? 54 GLN A OE1    1  
ATOM 1973  N NE2    . GLN C 2 54 ? 1.565   -6.868  -9.352  1.00 10.15 ? 54 GLN A NE2    1  
ATOM 1974  H H      . GLN C 2 54 ? 4.528   -3.493  -10.889 1.00 8.28  ? 54 GLN A H      1  
ATOM 1975  H HA     . GLN C 2 54 ? 5.726   -6.035  -11.741 1.00 9.14  ? 54 GLN A HA     1  
ATOM 1976  H HB2    . GLN C 2 54 ? 2.975   -4.868  -12.089 1.00 9.49  ? 54 GLN A HB2    1  
ATOM 1977  H HB3    . GLN C 2 54 ? 3.545   -6.171  -13.121 1.00 9.99  ? 54 GLN A HB3    1  
ATOM 1978  H HG2    . GLN C 2 54 ? 2.596   -7.463  -11.555 1.00 9.25  ? 54 GLN A HG2    1  
ATOM 1979  H HG3    . GLN C 2 54 ? 4.125   -7.212  -10.718 1.00 9.14  ? 54 GLN A HG3    1  
ATOM 1980  H HE21   . GLN C 2 54 ? 1.418   -7.767  -9.715  1.00 10.27 ? 54 GLN A HE21   1  
ATOM 1981  H HE22   . GLN C 2 54 ? 1.069   -6.502  -8.591  1.00 10.53 ? 54 GLN A HE22   1  
ATOM 1982  N N      . GLN C 2 55 ? 4.829   -3.624  -13.822 1.00 10.65 ? 55 GLN A N      1  
ATOM 1983  C CA     . GLN C 2 55 ? 5.211   -2.952  -15.060 1.00 11.73 ? 55 GLN A CA     1  
ATOM 1984  C C      . GLN C 2 55 ? 5.063   -1.439  -14.927 1.00 12.00 ? 55 GLN A C      1  
ATOM 1985  O O      . GLN C 2 55 ? 5.415   -0.687  -15.836 1.00 12.99 ? 55 GLN A O      1  
ATOM 1986  C CB     . GLN C 2 55 ? 4.377   -3.465  -16.242 1.00 12.32 ? 55 GLN A CB     1  
ATOM 1987  C CG     . GLN C 2 55 ? 2.875   -3.387  -16.023 1.00 12.31 ? 55 GLN A CG     1  
ATOM 1988  C CD     . GLN C 2 55 ? 2.225   -4.756  -15.971 1.00 12.67 ? 55 GLN A CD     1  
ATOM 1989  O OE1    . GLN C 2 55 ? 2.134   -5.370  -14.911 1.00 12.67 ? 55 GLN A OE1    1  
ATOM 1990  N NE2    . GLN C 2 55 ? 1.770   -5.243  -17.115 1.00 13.16 ? 55 GLN A NE2    1  
ATOM 1991  H H      . GLN C 2 55 ? 3.995   -3.368  -13.372 1.00 10.41 ? 55 GLN A H      1  
ATOM 1992  H HA     . GLN C 2 55 ? 6.251   -3.179  -15.245 1.00 12.12 ? 55 GLN A HA     1  
ATOM 1993  H HB2    . GLN C 2 55 ? 4.620   -2.881  -17.117 1.00 12.65 ? 55 GLN A HB2    1  
ATOM 1994  H HB3    . GLN C 2 55 ? 4.638   -4.497  -16.428 1.00 12.66 ? 55 GLN A HB3    1  
ATOM 1995  H HG2    . GLN C 2 55 ? 2.685   -2.880  -15.088 1.00 12.13 ? 55 GLN A HG2    1  
ATOM 1996  H HG3    . GLN C 2 55 ? 2.434   -2.825  -16.833 1.00 12.42 ? 55 GLN A HG3    1  
ATOM 1997  H HE21   . GLN C 2 55 ? 1.876   -4.702  -17.924 1.00 13.26 ? 55 GLN A HE21   1  
ATOM 1998  H HE22   . GLN C 2 55 ? 1.341   -6.131  -17.105 1.00 13.52 ? 55 GLN A HE22   1  
ATOM 1999  N N      . LEU C 2 56 ? 4.549   -0.998  -13.786 1.00 11.27 ? 56 LEU A N      1  
ATOM 2000  C CA     . LEU C 2 56 ? 4.352   0.422   -13.535 1.00 11.66 ? 56 LEU A CA     1  
ATOM 2001  C C      . LEU C 2 56 ? 5.589   1.027   -12.874 1.00 12.14 ? 56 LEU A C      1  
ATOM 2002  O O      . LEU C 2 56 ? 5.721   1.021   -11.647 1.00 12.14 ? 56 LEU A O      1  
ATOM 2003  C CB     . LEU C 2 56 ? 3.119   0.636   -12.652 1.00 11.55 ? 56 LEU A CB     1  
ATOM 2004  C CG     . LEU C 2 56 ? 2.660   2.088   -12.508 1.00 11.61 ? 56 LEU A CG     1  
ATOM 2005  C CD1    . LEU C 2 56 ? 2.242   2.655   -13.856 1.00 11.79 ? 56 LEU A CD1    1  
ATOM 2006  C CD2    . LEU C 2 56 ? 1.517   2.183   -11.510 1.00 11.84 ? 56 LEU A CD2    1  
ATOM 2007  H H      . LEU C 2 56 ? 4.301   -1.642  -13.093 1.00 10.54 ? 56 LEU A H      1  
ATOM 2008  H HA     . LEU C 2 56 ? 4.193   0.908   -14.486 1.00 11.92 ? 56 LEU A HA     1  
ATOM 2009  H HB2    . LEU C 2 56 ? 2.303   0.063   -13.068 1.00 11.37 ? 56 LEU A HB2    1  
ATOM 2010  H HB3    . LEU C 2 56 ? 3.339   0.253   -11.667 1.00 11.82 ? 56 LEU A HB3    1  
ATOM 2011  H HG     . LEU C 2 56 ? 3.481   2.683   -12.135 1.00 11.61 ? 56 LEU A HG     1  
ATOM 2012  H HD11   . LEU C 2 56 ? 1.924   3.680   -13.732 1.00 11.93 ? 56 LEU A HD11   1  
ATOM 2013  H HD12   . LEU C 2 56 ? 1.426   2.071   -14.254 1.00 12.02 ? 56 LEU A HD12   1  
ATOM 2014  H HD13   . LEU C 2 56 ? 3.079   2.617   -14.537 1.00 11.75 ? 56 LEU A HD13   1  
ATOM 2015  H HD21   . LEU C 2 56 ? 0.687   1.585   -11.855 1.00 11.95 ? 56 LEU A HD21   1  
ATOM 2016  H HD22   . LEU C 2 56 ? 1.204   3.213   -11.418 1.00 12.01 ? 56 LEU A HD22   1  
ATOM 2017  H HD23   . LEU C 2 56 ? 1.847   1.820   -10.548 1.00 11.93 ? 56 LEU A HD23   1  
ATOM 2018  N N      . ALA C 2 57 ? 6.499   1.535   -13.695 1.00 12.72 ? 57 ALA A N      1  
ATOM 2019  C CA     . ALA C 2 57 ? 7.726   2.140   -13.196 1.00 13.38 ? 57 ALA A CA     1  
ATOM 2020  C C      . ALA C 2 57 ? 7.494   3.593   -12.793 1.00 13.99 ? 57 ALA A C      1  
ATOM 2021  O O      . ALA C 2 57 ? 7.388   3.906   -11.603 1.00 14.14 ? 57 ALA A O      1  
ATOM 2022  C CB     . ALA C 2 57 ? 8.828   2.040   -14.241 1.00 13.95 ? 57 ALA A CB     1  
ATOM 2023  H H      . ALA C 2 57 ? 6.341   1.503   -14.662 1.00 12.82 ? 57 ALA A H      1  
ATOM 2024  H HA     . ALA C 2 57 ? 8.039   1.583   -12.325 1.00 13.20 ? 57 ALA A HA     1  
ATOM 2025  H HB1    . ALA C 2 57 ? 8.971   1.006   -14.516 1.00 14.13 ? 57 ALA A HB1    1  
ATOM 2026  H HB2    . ALA C 2 57 ? 9.747   2.435   -13.834 1.00 14.02 ? 57 ALA A HB2    1  
ATOM 2027  H HB3    . ALA C 2 57 ? 8.548   2.610   -15.115 1.00 14.26 ? 57 ALA A HB3    1  
ATOM 2028  N N      . GLY C 2 58 ? 7.400   4.472   -13.785 1.00 14.49 ? 58 GLY A N      1  
ATOM 2029  C CA     . GLY C 2 58 ? 7.179   5.881   -13.518 1.00 15.23 ? 58 GLY A CA     1  
ATOM 2030  C C      . GLY C 2 58 ? 5.825   6.140   -12.893 1.00 15.72 ? 58 GLY A C      1  
ATOM 2031  O O      . GLY C 2 58 ? 4.795   5.772   -13.456 1.00 16.04 ? 58 GLY A O      1  
ATOM 2032  H H      . GLY C 2 58 ? 7.479   4.161   -14.715 1.00 14.44 ? 58 GLY A H      1  
ATOM 2033  H HA2    . GLY C 2 58 ? 7.948   6.235   -12.848 1.00 15.36 ? 58 GLY A HA2    1  
ATOM 2034  H HA3    . GLY C 2 58 ? 7.246   6.428   -14.447 1.00 15.45 ? 58 GLY A HA3    1  
ATOM 2035  N N      . LYS C 2 59 ? 5.827   6.763   -11.723 1.00 15.93 ? 59 LYS A N      1  
ATOM 2036  C CA     . LYS C 2 59 ? 4.589   7.059   -11.017 1.00 16.57 ? 59 LYS A CA     1  
ATOM 2037  C C      . LYS C 2 59 ? 4.544   8.524   -10.589 1.00 17.24 ? 59 LYS A C      1  
ATOM 2038  O O      . LYS C 2 59 ? 3.727   9.297   -11.086 1.00 17.61 ? 59 LYS A O      1  
ATOM 2039  C CB     . LYS C 2 59 ? 4.434   6.133   -9.805  1.00 16.45 ? 59 LYS A CB     1  
ATOM 2040  C CG     . LYS C 2 59 ? 4.161   4.684   -10.186 1.00 16.73 ? 59 LYS A CG     1  
ATOM 2041  C CD     . LYS C 2 59 ? 4.051   3.780   -8.967  1.00 17.03 ? 59 LYS A CD     1  
ATOM 2042  C CE     . LYS C 2 59 ? 5.418   3.363   -8.445  1.00 17.57 ? 59 LYS A CE     1  
ATOM 2043  N NZ     . LYS C 2 59 ? 6.219   2.642   -9.475  1.00 17.80 ? 59 LYS A NZ     1  
ATOM 2044  H H      . LYS C 2 59 ? 6.680   7.037   -11.329 1.00 15.76 ? 59 LYS A H      1  
ATOM 2045  H HA     . LYS C 2 59 ? 3.773   6.877   -11.701 1.00 16.82 ? 59 LYS A HA     1  
ATOM 2046  H HB2    . LYS C 2 59 ? 5.343   6.166   -9.222  1.00 16.25 ? 59 LYS A HB2    1  
ATOM 2047  H HB3    . LYS C 2 59 ? 3.613   6.485   -9.198  1.00 16.52 ? 59 LYS A HB3    1  
ATOM 2048  H HG2    . LYS C 2 59 ? 3.233   4.637   -10.737 1.00 16.83 ? 59 LYS A HG2    1  
ATOM 2049  H HG3    . LYS C 2 59 ? 4.968   4.331   -10.812 1.00 16.76 ? 59 LYS A HG3    1  
ATOM 2050  H HD2    . LYS C 2 59 ? 3.527   4.309   -8.185  1.00 16.96 ? 59 LYS A HD2    1  
ATOM 2051  H HD3    . LYS C 2 59 ? 3.494   2.894   -9.238  1.00 17.06 ? 59 LYS A HD3    1  
ATOM 2052  H HE2    . LYS C 2 59 ? 5.957   4.247   -8.140  1.00 17.89 ? 59 LYS A HE2    1  
ATOM 2053  H HE3    . LYS C 2 59 ? 5.281   2.715   -7.591  1.00 17.63 ? 59 LYS A HE3    1  
ATOM 2054  H HZ1    . LYS C 2 59 ? 6.460   3.285   -10.260 1.00 17.98 ? 59 LYS A HZ1    1  
ATOM 2055  H HZ2    . LYS C 2 59 ? 5.680   1.838   -9.858  1.00 17.82 ? 59 LYS A HZ2    1  
ATOM 2056  H HZ3    . LYS C 2 59 ? 7.102   2.283   -9.056  1.00 17.91 ? 59 LYS A HZ3    1  
ATOM 2057  N N      . GLN C 2 60 ? 5.434   8.909   -9.683  1.00 17.53 ? 60 GLN A N      1  
ATOM 2058  C CA     . GLN C 2 60 ? 5.481   10.283  -9.201  1.00 18.30 ? 60 GLN A CA     1  
ATOM 2059  C C      . GLN C 2 60 ? 6.876   10.867  -9.396  1.00 18.80 ? 60 GLN A C      1  
ATOM 2060  O O      . GLN C 2 60 ? 7.870   10.276  -8.979  1.00 18.98 ? 60 GLN A O      1  
ATOM 2061  C CB     . GLN C 2 60 ? 5.076   10.343  -7.723  1.00 18.40 ? 60 GLN A CB     1  
ATOM 2062  C CG     . GLN C 2 60 ? 5.094   11.746  -7.126  1.00 18.96 ? 60 GLN A CG     1  
ATOM 2063  C CD     . GLN C 2 60 ? 4.266   12.744  -7.918  1.00 19.28 ? 60 GLN A CD     1  
ATOM 2064  O OE1    . GLN C 2 60 ? 3.291   12.384  -8.576  1.00 19.33 ? 60 GLN A OE1    1  
ATOM 2065  N NE2    . GLN C 2 60 ? 4.655   14.008  -7.863  1.00 19.61 ? 60 GLN A NE2    1  
ATOM 2066  H H      . GLN C 2 60 ? 6.076   8.259   -9.332  1.00 17.29 ? 60 GLN A H      1  
ATOM 2067  H HA     . GLN C 2 60 ? 4.778   10.862  -9.782  1.00 18.59 ? 60 GLN A HA     1  
ATOM 2068  H HB2    . GLN C 2 60 ? 4.076   9.948   -7.622  1.00 17.92 ? 60 GLN A HB2    1  
ATOM 2069  H HB3    . GLN C 2 60 ? 5.755   9.726   -7.153  1.00 18.67 ? 60 GLN A HB3    1  
ATOM 2070  H HG2    . GLN C 2 60 ? 4.703   11.699  -6.121  1.00 19.26 ? 60 GLN A HG2    1  
ATOM 2071  H HG3    . GLN C 2 60 ? 6.116   12.094  -7.095  1.00 18.98 ? 60 GLN A HG3    1  
ATOM 2072  H HE21   . GLN C 2 60 ? 5.444   14.226  -7.325  1.00 19.63 ? 60 GLN A HE21   1  
ATOM 2073  H HE22   . GLN C 2 60 ? 4.131   14.681  -8.358  1.00 19.89 ? 60 GLN A HE22   1  
ATOM 2074  N N      . SER C 2 61 ? 6.941   12.021  -10.043 1.00 19.13 ? 61 SER A N      1  
ATOM 2075  C CA     . SER C 2 61 ? 8.209   12.683  -10.299 1.00 19.73 ? 61 SER A CA     1  
ATOM 2076  C C      . SER C 2 61 ? 8.420   13.846  -9.334  1.00 20.17 ? 61 SER A C      1  
ATOM 2077  O O      . SER C 2 61 ? 7.868   14.932  -9.522  1.00 20.57 ? 61 SER A O      1  
ATOM 2078  C CB     . SER C 2 61 ? 8.248   13.184  -11.742 1.00 20.14 ? 61 SER A CB     1  
ATOM 2079  O OG     . SER C 2 61 ? 7.543   12.302  -12.604 1.00 19.84 ? 61 SER A OG     1  
ATOM 2080  H H      . SER C 2 61 ? 6.114   12.438  -10.362 1.00 19.06 ? 61 SER A H      1  
ATOM 2081  H HA     . SER C 2 61 ? 8.998   11.960  -10.155 1.00 19.70 ? 61 SER A HA     1  
ATOM 2082  H HB2    . SER C 2 61 ? 7.792   14.161  -11.796 1.00 20.52 ? 61 SER A HB2    1  
ATOM 2083  H HB3    . SER C 2 61 ? 9.275   13.246  -12.073 1.00 20.42 ? 61 SER A HB3    1  
ATOM 2084  H HG     . SER C 2 61 ? 8.155   11.944  -13.266 1.00 19.90 ? 61 SER A HG     1  
ATOM 2085  N N      . LEU C 2 62 ? 9.202   13.609  -8.292  1.00 20.21 ? 62 LEU A N      1  
ATOM 2086  C CA     . LEU C 2 62 ? 9.494   14.641  -7.303  1.00 20.74 ? 62 LEU A CA     1  
ATOM 2087  C C      . LEU C 2 62 ? 10.924  15.140  -7.474  1.00 20.91 ? 62 LEU A C      1  
ATOM 2088  O O      . LEU C 2 62 ? 11.598  14.775  -8.438  1.00 20.68 ? 62 LEU A O      1  
ATOM 2089  C CB     . LEU C 2 62 ? 9.287   14.105  -5.884  1.00 21.23 ? 62 LEU A CB     1  
ATOM 2090  C CG     . LEU C 2 62 ? 7.837   13.785  -5.512  1.00 21.58 ? 62 LEU A CG     1  
ATOM 2091  C CD1    . LEU C 2 62 ? 7.779   13.042  -4.186  1.00 21.89 ? 62 LEU A CD1    1  
ATOM 2092  C CD2    . LEU C 2 62 ? 7.010   15.060  -5.445  1.00 21.76 ? 62 LEU A CD2    1  
ATOM 2093  H H      . LEU C 2 62 ? 9.603   12.720  -8.187  1.00 19.96 ? 62 LEU A H      1  
ATOM 2094  H HA     . LEU C 2 62 ? 8.815   15.464  -7.473  1.00 20.79 ? 62 LEU A HA     1  
ATOM 2095  H HB2    . LEU C 2 62 ? 9.872   13.204  -5.774  1.00 21.20 ? 62 LEU A HB2    1  
ATOM 2096  H HB3    . LEU C 2 62 ? 9.659   14.841  -5.187  1.00 21.50 ? 62 LEU A HB3    1  
ATOM 2097  H HG     . LEU C 2 62 ? 7.410   13.147  -6.272  1.00 21.60 ? 62 LEU A HG     1  
ATOM 2098  H HD11   . LEU C 2 62 ? 6.750   12.826  -3.941  1.00 21.79 ? 62 LEU A HD11   1  
ATOM 2099  H HD12   . LEU C 2 62 ? 8.213   13.656  -3.411  1.00 22.18 ? 62 LEU A HD12   1  
ATOM 2100  H HD13   . LEU C 2 62 ? 8.332   12.118  -4.266  1.00 22.04 ? 62 LEU A HD13   1  
ATOM 2101  H HD21   . LEU C 2 62 ? 7.030   15.553  -6.406  1.00 21.91 ? 62 LEU A HD21   1  
ATOM 2102  H HD22   . LEU C 2 62 ? 7.423   15.718  -4.695  1.00 21.83 ? 62 LEU A HD22   1  
ATOM 2103  H HD23   . LEU C 2 62 ? 5.991   14.815  -5.187  1.00 21.79 ? 62 LEU A HD23   1  
ATOM 2104  N N      . MET D 2 1  ? -4.072  -13.844 6.018   1.00 7.49  ? 1  MET B N      1  
ATOM 2105  C CA     . MET D 2 1  ? -2.831  -14.505 6.403   1.00 7.49  ? 1  MET B CA     1  
ATOM 2106  C C      . MET D 2 1  ? -1.621  -13.671 5.987   1.00 6.82  ? 1  MET B C      1  
ATOM 2107  O O      . MET D 2 1  ? -1.156  -13.746 4.847   1.00 7.04  ? 1  MET B O      1  
ATOM 2108  C CB     . MET D 2 1  ? -2.756  -15.902 5.777   1.00 8.28  ? 1  MET B CB     1  
ATOM 2109  C CG     . MET D 2 1  ? -1.513  -16.687 6.173   1.00 8.90  ? 1  MET B CG     1  
ATOM 2110  S SD     . MET D 2 1  ? -1.482  -18.350 5.470   1.00 9.76  ? 1  MET B SD     1  
ATOM 2111  C CE     . MET D 2 1  ? -2.814  -19.127 6.384   1.00 10.35 ? 1  MET B CE     1  
ATOM 2112  H H1     . MET D 2 1  ? -4.785  -13.747 6.683   1.00 7.72  ? 1  MET B H1     1  
ATOM 2113  H HA     . MET D 2 1  ? -2.830  -14.603 7.479   1.00 7.71  ? 1  MET B HA     1  
ATOM 2114  H HB2    . MET D 2 1  ? -3.624  -16.467 6.082   1.00 8.55  ? 1  MET B HB2    1  
ATOM 2115  H HB3    . MET D 2 1  ? -2.764  -15.802 4.701   1.00 8.42  ? 1  MET B HB3    1  
ATOM 2116  H HG2    . MET D 2 1  ? -0.641  -16.152 5.828   1.00 9.10  ? 1  MET B HG2    1  
ATOM 2117  H HG3    . MET D 2 1  ? -1.483  -16.766 7.250   1.00 8.90  ? 1  MET B HG3    1  
ATOM 2118  H HE1    . MET D 2 1  ? -3.738  -18.602 6.190   1.00 10.47 ? 1  MET B HE1    1  
ATOM 2119  H HE2    . MET D 2 1  ? -2.595  -19.091 7.441   1.00 10.35 ? 1  MET B HE2    1  
ATOM 2120  H HE3    . MET D 2 1  ? -2.912  -20.157 6.072   1.00 10.83 ? 1  MET B HE3    1  
ATOM 2121  N N      . LYS D 2 2  ? -1.121  -12.865 6.913   1.00 6.25  ? 2  LYS B N      1  
ATOM 2122  C CA     . LYS D 2 2  ? 0.037   -12.022 6.647   1.00 5.74  ? 2  LYS B CA     1  
ATOM 2123  C C      . LYS D 2 2  ? 1.184   -12.392 7.587   1.00 4.89  ? 2  LYS B C      1  
ATOM 2124  O O      . LYS D 2 2  ? 1.342   -11.799 8.655   1.00 4.98  ? 2  LYS B O      1  
ATOM 2125  C CB     . LYS D 2 2  ? -0.333  -10.543 6.809   1.00 6.32  ? 2  LYS B CB     1  
ATOM 2126  C CG     . LYS D 2 2  ? 0.729   -9.578  6.300   1.00 6.84  ? 2  LYS B CG     1  
ATOM 2127  C CD     . LYS D 2 2  ? 0.754   -9.513  4.780   1.00 7.40  ? 2  LYS B CD     1  
ATOM 2128  C CE     . LYS D 2 2  ? 1.674   -8.404  4.292   1.00 7.79  ? 2  LYS B CE     1  
ATOM 2129  N NZ     . LYS D 2 2  ? 1.657   -8.266  2.810   1.00 8.33  ? 2  LYS B NZ     1  
ATOM 2130  H H      . LYS D 2 2  ? -1.540  -12.836 7.800   1.00 6.35  ? 2  LYS B H      1  
ATOM 2131  H HA     . LYS D 2 2  ? 0.349   -12.198 5.629   1.00 5.83  ? 2  LYS B HA     1  
ATOM 2132  H HB2    . LYS D 2 2  ? -1.248  -10.353 6.268   1.00 6.66  ? 2  LYS B HB2    1  
ATOM 2133  H HB3    . LYS D 2 2  ? -0.499  -10.340 7.857   1.00 6.35  ? 2  LYS B HB3    1  
ATOM 2134  H HG2    . LYS D 2 2  ? 0.520   -8.593  6.687   1.00 6.92  ? 2  LYS B HG2    1  
ATOM 2135  H HG3    . LYS D 2 2  ? 1.696   -9.907  6.653   1.00 7.09  ? 2  LYS B HG3    1  
ATOM 2136  H HD2    . LYS D 2 2  ? 1.108   -10.458 4.393   1.00 7.57  ? 2  LYS B HD2    1  
ATOM 2137  H HD3    . LYS D 2 2  ? -0.246  -9.326  4.419   1.00 7.68  ? 2  LYS B HD3    1  
ATOM 2138  H HE2    . LYS D 2 2  ? 1.354   -7.471  4.733   1.00 7.81  ? 2  LYS B HE2    1  
ATOM 2139  H HE3    . LYS D 2 2  ? 2.682   -8.624  4.613   1.00 7.98  ? 2  LYS B HE3    1  
ATOM 2140  H HZ1    . LYS D 2 2  ? 0.683   -8.129  2.471   1.00 8.70  ? 2  LYS B HZ1    1  
ATOM 2141  H HZ2    . LYS D 2 2  ? 2.052   -9.121  2.363   1.00 8.54  ? 2  LYS B HZ2    1  
ATOM 2142  H HZ3    . LYS D 2 2  ? 2.231   -7.445  2.521   1.00 8.40  ? 2  LYS B HZ3    1  
ATOM 2143  N N      . PRO D 2 3  ? 1.981   -13.404 7.207   1.00 4.30  ? 3  PRO B N      1  
ATOM 2144  C CA     . PRO D 2 3  ? 3.114   -13.874 8.007   1.00 3.77  ? 3  PRO B CA     1  
ATOM 2145  C C      . PRO D 2 3  ? 4.294   -12.925 7.980   1.00 3.57  ? 3  PRO B C      1  
ATOM 2146  O O      . PRO D 2 3  ? 4.804   -12.533 9.027   1.00 3.91  ? 3  PRO B O      1  
ATOM 2147  C CB     . PRO D 2 3  ? 3.495   -15.218 7.361   1.00 3.70  ? 3  PRO B CB     1  
ATOM 2148  C CG     . PRO D 2 3  ? 2.411   -15.517 6.377   1.00 4.09  ? 3  PRO B CG     1  
ATOM 2149  C CD     . PRO D 2 3  ? 1.834   -14.192 5.980   1.00 4.49  ? 3  PRO B CD     1  
ATOM 2150  H HA     . PRO D 2 3  ? 2.836   -14.036 9.030   1.00 3.93  ? 3  PRO B HA     1  
ATOM 2151  H HB2    . PRO D 2 3  ? 4.453   -15.123 6.872   1.00 3.78  ? 3  PRO B HB2    1  
ATOM 2152  H HB3    . PRO D 2 3  ? 3.552   -15.980 8.124   1.00 3.71  ? 3  PRO B HB3    1  
ATOM 2153  H HG2    . PRO D 2 3  ? 2.826   -16.018 5.515   1.00 4.37  ? 3  PRO B HG2    1  
ATOM 2154  H HG3    . PRO D 2 3  ? 1.654   -16.132 6.840   1.00 4.15  ? 3  PRO B HG3    1  
ATOM 2155  H HD2    . PRO D 2 3  ? 2.399   -13.758 5.168   1.00 4.75  ? 3  PRO B HD2    1  
ATOM 2156  H HD3    . PRO D 2 3  ? 0.793   -14.295 5.709   1.00 4.88  ? 3  PRO B HD3    1  
ATOM 2157  N N      . VAL D 2 4  ? 4.731   -12.553 6.790   1.00 3.16  ? 4  VAL B N      1  
ATOM 2158  C CA     . VAL D 2 4  ? 5.869   -11.668 6.669   1.00 2.98  ? 4  VAL B CA     1  
ATOM 2159  C C      . VAL D 2 4  ? 5.628   -10.550 5.680   1.00 2.72  ? 4  VAL B C      1  
ATOM 2160  O O      . VAL D 2 4  ? 4.953   -10.703 4.660   1.00 2.56  ? 4  VAL B O      1  
ATOM 2161  C CB     . VAL D 2 4  ? 7.142   -12.413 6.223   1.00 2.87  ? 4  VAL B CB     1  
ATOM 2162  C CG1    . VAL D 2 4  ? 8.348   -11.503 6.304   1.00 2.71  ? 4  VAL B CG1    1  
ATOM 2163  C CG2    . VAL D 2 4  ? 7.379   -13.642 7.064   1.00 3.14  ? 4  VAL B CG2    1  
ATOM 2164  H H      . VAL D 2 4  ? 4.274   -12.866 5.984   1.00 3.11  ? 4  VAL B H      1  
ATOM 2165  H HA     . VAL D 2 4  ? 6.069   -11.235 7.645   1.00 3.16  ? 4  VAL B HA     1  
ATOM 2166  H HB     . VAL D 2 4  ? 7.015   -12.714 5.198   1.00 2.76  ? 4  VAL B HB     1  
ATOM 2167  H HG11   . VAL D 2 4  ? 9.219   -12.023 5.940   1.00 2.95  ? 4  VAL B HG11   1  
ATOM 2168  H HG12   . VAL D 2 4  ? 8.502   -11.212 7.335   1.00 2.74  ? 4  VAL B HG12   1  
ATOM 2169  H HG13   . VAL D 2 4  ? 8.173   -10.619 5.702   1.00 2.90  ? 4  VAL B HG13   1  
ATOM 2170  H HG21   . VAL D 2 4  ? 7.358   -13.362 8.106   1.00 3.44  ? 4  VAL B HG21   1  
ATOM 2171  H HG22   . VAL D 2 4  ? 8.346   -14.057 6.820   1.00 3.30  ? 4  VAL B HG22   1  
ATOM 2172  H HG23   . VAL D 2 4  ? 6.608   -14.369 6.867   1.00 3.34  ? 4  VAL B HG23   1  
ATOM 2173  N N      . THR D 2 5  ? 6.187   -9.435  6.036   1.00 2.76  ? 5  THR B N      1  
ATOM 2174  C CA     . THR D 2 5  ? 6.190   -8.240  5.243   1.00 2.63  ? 5  THR B CA     1  
ATOM 2175  C C      . THR D 2 5  ? 7.645   -7.984  4.933   1.00 2.52  ? 5  THR B C      1  
ATOM 2176  O O      . THR D 2 5  ? 8.504   -8.457  5.673   1.00 2.57  ? 5  THR B O      1  
ATOM 2177  C CB     . THR D 2 5  ? 5.587   -7.057  6.020   1.00 2.87  ? 5  THR B CB     1  
ATOM 2178  O OG1    . THR D 2 5  ? 4.895   -7.537  7.180   1.00 3.17  ? 5  THR B OG1    1  
ATOM 2179  C CG2    . THR D 2 5  ? 4.620   -6.285  5.152   1.00 2.93  ? 5  THR B CG2    1  
ATOM 2180  H H      . THR D 2 5  ? 6.641   -9.414  6.908   1.00 2.93  ? 5  THR B H      1  
ATOM 2181  H HA     . THR D 2 5  ? 5.642   -8.403  4.324   1.00 2.49  ? 5  THR B HA     1  
ATOM 2182  H HB     . THR D 2 5  ? 6.385   -6.397  6.327   1.00 2.97  ? 5  THR B HB     1  
ATOM 2183  H HG1    . THR D 2 5  ? 5.522   -8.013  7.759   1.00 3.17  ? 5  THR B HG1    1  
ATOM 2184  H HG21   . THR D 2 5  ? 3.822   -6.942  4.840   1.00 3.24  ? 5  THR B HG21   1  
ATOM 2185  H HG22   . THR D 2 5  ? 5.139   -5.909  4.285   1.00 3.19  ? 5  THR B HG22   1  
ATOM 2186  H HG23   . THR D 2 5  ? 4.211   -5.461  5.716   1.00 2.94  ? 5  THR B HG23   1  
ATOM 2187  N N      . LEU D 2 6  ? 7.966   -7.283  3.866   1.00 2.40  ? 6  LEU B N      1  
ATOM 2188  C CA     . LEU D 2 6  ? 9.376   -7.061  3.572   1.00 2.35  ? 6  LEU B CA     1  
ATOM 2189  C C      . LEU D 2 6  ? 10.056  -6.313  4.725   1.00 2.56  ? 6  LEU B C      1  
ATOM 2190  O O      . LEU D 2 6  ? 11.273  -6.363  4.888   1.00 2.56  ? 6  LEU B O      1  
ATOM 2191  C CB     . LEU D 2 6  ? 9.542   -6.357  2.243   1.00 2.33  ? 6  LEU B CB     1  
ATOM 2192  C CG     . LEU D 2 6  ? 10.300  -7.147  1.194   1.00 2.21  ? 6  LEU B CG     1  
ATOM 2193  C CD1    . LEU D 2 6  ? 10.573  -6.289  -0.028  1.00 2.35  ? 6  LEU B CD1    1  
ATOM 2194  C CD2    . LEU D 2 6  ? 11.597  -7.700  1.763   1.00 2.15  ? 6  LEU B CD2    1  
ATOM 2195  H H      . LEU D 2 6  ? 7.265   -6.906  3.279   1.00 2.38  ? 6  LEU B H      1  
ATOM 2196  H HA     . LEU D 2 6  ? 9.836   -8.030  3.500   1.00 2.25  ? 6  LEU B HA     1  
ATOM 2197  H HB2    . LEU D 2 6  ? 8.553   -6.141  1.859   1.00 2.34  ? 6  LEU B HB2    1  
ATOM 2198  H HB3    . LEU D 2 6  ? 10.063  -5.428  2.407   1.00 2.47  ? 6  LEU B HB3    1  
ATOM 2199  H HG     . LEU D 2 6  ? 9.687   -7.978  0.891   1.00 2.13  ? 6  LEU B HG     1  
ATOM 2200  H HD11   . LEU D 2 6  ? 11.110  -5.400  0.272   1.00 2.50  ? 6  LEU B HD11   1  
ATOM 2201  H HD12   . LEU D 2 6  ? 9.636   -6.007  -0.486  1.00 2.75  ? 6  LEU B HD12   1  
ATOM 2202  H HD13   . LEU D 2 6  ? 11.168  -6.847  -0.736  1.00 2.54  ? 6  LEU B HD13   1  
ATOM 2203  H HD21   . LEU D 2 6  ? 12.201  -6.886  2.141   1.00 2.43  ? 6  LEU B HD21   1  
ATOM 2204  H HD22   . LEU D 2 6  ? 12.140  -8.218  0.985   1.00 2.57  ? 6  LEU B HD22   1  
ATOM 2205  H HD23   . LEU D 2 6  ? 11.374  -8.387  2.567   1.00 2.08  ? 6  LEU B HD23   1  
ATOM 2206  N N      . TYR D 2 7  ? 9.236   -5.648  5.532   1.00 2.79  ? 7  TYR B N      1  
ATOM 2207  C CA     . TYR D 2 7  ? 9.700   -4.918  6.716   1.00 3.08  ? 7  TYR B CA     1  
ATOM 2208  C C      . TYR D 2 7  ? 10.312  -5.889  7.721   1.00 3.12  ? 7  TYR B C      1  
ATOM 2209  O O      . TYR D 2 7  ? 11.304  -5.596  8.382   1.00 3.25  ? 7  TYR B O      1  
ATOM 2210  C CB     . TYR D 2 7  ? 8.521   -4.228  7.406   1.00 3.33  ? 7  TYR B CB     1  
ATOM 2211  C CG     . TYR D 2 7  ? 8.371   -2.754  7.133   1.00 3.53  ? 7  TYR B CG     1  
ATOM 2212  C CD1    . TYR D 2 7  ? 9.448   -1.958  6.757   1.00 3.59  ? 7  TYR B CD1    1  
ATOM 2213  C CD2    . TYR D 2 7  ? 7.132   -2.153  7.284   1.00 3.70  ? 7  TYR B CD2    1  
ATOM 2214  C CE1    . TYR D 2 7  ? 9.285   -0.606  6.540   1.00 3.84  ? 7  TYR B CE1    1  
ATOM 2215  C CE2    . TYR D 2 7  ? 6.962   -0.806  7.064   1.00 3.93  ? 7  TYR B CE2    1  
ATOM 2216  C CZ     . TYR D 2 7  ? 8.042   -0.036  6.694   1.00 4.03  ? 7  TYR B CZ     1  
ATOM 2217  O OH     . TYR D 2 7  ? 7.876   1.308   6.477   1.00 4.28  ? 7  TYR B OH     1  
ATOM 2218  H H      . TYR D 2 7  ? 8.283   -5.660  5.325   1.00 2.78  ? 7  TYR B H      1  
ATOM 2219  H HA     . TYR D 2 7  ? 10.431  -4.185  6.416   1.00 3.13  ? 7  TYR B HA     1  
ATOM 2220  H HB2    . TYR D 2 7  ? 7.606   -4.703  7.091   1.00 3.22  ? 7  TYR B HB2    1  
ATOM 2221  H HB3    . TYR D 2 7  ? 8.628   -4.353  8.474   1.00 3.51  ? 7  TYR B HB3    1  
ATOM 2222  H HD1    . TYR D 2 7  ? 10.422  -2.408  6.626   1.00 3.48  ? 7  TYR B HD1    1  
ATOM 2223  H HD2    . TYR D 2 7  ? 6.288   -2.762  7.574   1.00 3.69  ? 7  TYR B HD2    1  
ATOM 2224  H HE1    . TYR D 2 7  ? 10.130  -0.002  6.247   1.00 3.93  ? 7  TYR B HE1    1  
ATOM 2225  H HE2    . TYR D 2 7  ? 5.988   -0.360  7.186   1.00 4.07  ? 7  TYR B HE2    1  
ATOM 2226  H HH     . TYR D 2 7  ? 7.103   1.614   6.958   1.00 4.42  ? 7  TYR B HH     1  
ATOM 2227  N N      . ASP D 2 8  ? 9.691   -7.054  7.792   1.00 3.03  ? 8  ASP B N      1  
ATOM 2228  C CA     . ASP D 2 8  ? 10.067  -8.124  8.706   1.00 3.14  ? 8  ASP B CA     1  
ATOM 2229  C C      . ASP D 2 8  ? 11.435  -8.657  8.360   1.00 2.96  ? 8  ASP B C      1  
ATOM 2230  O O      . ASP D 2 8  ? 12.282  -8.855  9.231   1.00 3.10  ? 8  ASP B O      1  
ATOM 2231  C CB     . ASP D 2 8  ? 9.014   -9.231  8.633   1.00 3.13  ? 8  ASP B CB     1  
ATOM 2232  C CG     . ASP D 2 8  ? 7.720   -8.836  9.309   1.00 3.41  ? 8  ASP B CG     1  
ATOM 2233  O OD1    . ASP D 2 8  ? 7.720   -8.643  10.541  1.00 3.77  ? 8  ASP B OD1    1  
ATOM 2234  O OD2    . ASP D 2 8  ? 6.700   -8.705  8.599   1.00 3.29  ? 8  ASP B OD2    1  
ATOM 2235  H H      . ASP D 2 8  ? 8.965   -7.221  7.169   1.00 2.92  ? 8  ASP B H      1  
ATOM 2236  H HA     . ASP D 2 8  ? 10.089  -7.734  9.704   1.00 3.38  ? 8  ASP B HA     1  
ATOM 2237  H HB2    . ASP D 2 8  ? 8.800   -9.434  7.595   1.00 2.91  ? 8  ASP B HB2    1  
ATOM 2238  H HB3    . ASP D 2 8  ? 9.384   -10.130 9.099   1.00 3.19  ? 8  ASP B HB3    1  
ATOM 2239  N N      . VAL D 2 9  ? 11.651  -8.867  7.074   1.00 2.68  ? 9  VAL B N      1  
ATOM 2240  C CA     . VAL D 2 9  ? 12.915  -9.364  6.589   1.00 2.52  ? 9  VAL B CA     1  
ATOM 2241  C C      . VAL D 2 9  ? 13.969  -8.303  6.812   1.00 2.58  ? 9  VAL B C      1  
ATOM 2242  O O      . VAL D 2 9  ? 15.091  -8.583  7.214   1.00 2.60  ? 9  VAL B O      1  
ATOM 2243  C CB     . VAL D 2 9  ? 12.828  -9.705  5.095   1.00 2.28  ? 9  VAL B CB     1  
ATOM 2244  C CG1    . VAL D 2 9  ? 14.178  -10.117 4.557   1.00 2.17  ? 9  VAL B CG1    1  
ATOM 2245  C CG2    . VAL D 2 9  ? 11.807  -10.801 4.849   1.00 2.28  ? 9  VAL B CG2    1  
ATOM 2246  H H      . VAL D 2 9  ? 10.962  -8.618  6.426   1.00 2.61  ? 9  VAL B H      1  
ATOM 2247  H HA     . VAL D 2 9  ? 13.175  -10.256 7.145   1.00 2.58  ? 9  VAL B HA     1  
ATOM 2248  H HB     . VAL D 2 9  ? 12.508  -8.818  4.568   1.00 2.26  ? 9  VAL B HB     1  
ATOM 2249  H HG11   . VAL D 2 9  ? 14.812  -9.248  4.475   1.00 2.23  ? 9  VAL B HG11   1  
ATOM 2250  H HG12   . VAL D 2 9  ? 14.051  -10.571 3.586   1.00 2.42  ? 9  VAL B HG12   1  
ATOM 2251  H HG13   . VAL D 2 9  ? 14.626  -10.831 5.237   1.00 2.44  ? 9  VAL B HG13   1  
ATOM 2252  H HG21   . VAL D 2 9  ? 11.583  -11.301 5.781   1.00 2.69  ? 9  VAL B HG21   1  
ATOM 2253  H HG22   . VAL D 2 9  ? 12.214  -11.518 4.143   1.00 2.42  ? 9  VAL B HG22   1  
ATOM 2254  H HG23   . VAL D 2 9  ? 10.905  -10.366 4.446   1.00 2.37  ? 9  VAL B HG23   1  
ATOM 2255  N N      . ALA D 2 10 ? 13.559  -7.075  6.564   1.00 2.67  ? 10 ALA B N      1  
ATOM 2256  C CA     . ALA D 2 10 ? 14.426  -5.916  6.717   1.00 2.84  ? 10 ALA B CA     1  
ATOM 2257  C C      . ALA D 2 10 ? 14.926  -5.784  8.149   1.00 3.09  ? 10 ALA B C      1  
ATOM 2258  O O      . ALA D 2 10 ? 16.122  -5.612  8.388   1.00 3.13  ? 10 ALA B O      1  
ATOM 2259  C CB     . ALA D 2 10 ? 13.667  -4.674  6.293   1.00 2.99  ? 10 ALA B CB     1  
ATOM 2260  H H      . ALA D 2 10 ? 12.623  -6.942  6.269   1.00 2.66  ? 10 ALA B H      1  
ATOM 2261  H HA     . ALA D 2 10 ? 15.277  -6.038  6.064   1.00 2.72  ? 10 ALA B HA     1  
ATOM 2262  H HB1    . ALA D 2 10 ? 14.000  -4.363  5.313   1.00 3.15  ? 10 ALA B HB1    1  
ATOM 2263  H HB2    . ALA D 2 10 ? 13.842  -3.879  7.005   1.00 3.33  ? 10 ALA B HB2    1  
ATOM 2264  H HB3    . ALA D 2 10 ? 12.608  -4.908  6.257   1.00 3.08  ? 10 ALA B HB3    1  
ATOM 2265  N N      . GLU D 2 11 ? 14.013  -5.909  9.093   1.00 3.27  ? 11 GLU B N      1  
ATOM 2266  C CA     . GLU D 2 11 ? 14.349  -5.799  10.507  1.00 3.56  ? 11 GLU B CA     1  
ATOM 2267  C C      . GLU D 2 11 ? 15.248  -6.954  10.909  1.00 3.49  ? 11 GLU B C      1  
ATOM 2268  O O      . GLU D 2 11 ? 16.290  -6.765  11.537  1.00 3.61  ? 11 GLU B O      1  
ATOM 2269  C CB     . GLU D 2 11 ? 13.088  -5.790  11.378  1.00 3.79  ? 11 GLU B CB     1  
ATOM 2270  C CG     . GLU D 2 11 ? 12.326  -4.474  11.354  1.00 4.20  ? 11 GLU B CG     1  
ATOM 2271  C CD     . GLU D 2 11 ? 13.099  -3.328  11.979  1.00 4.71  ? 11 GLU B CD     1  
ATOM 2272  O OE1    . GLU D 2 11 ? 13.893  -3.572  12.912  1.00 4.85  ? 11 GLU B OE1    1  
ATOM 2273  O OE2    . GLU D 2 11 ? 12.909  -2.173  11.541  1.00 5.21  ? 11 GLU B OE2    1  
ATOM 2274  H H      . GLU D 2 11 ? 13.088  -6.113  8.833   1.00 3.22  ? 11 GLU B H      1  
ATOM 2275  H HA     . GLU D 2 11 ? 14.887  -4.872  10.649  1.00 3.71  ? 11 GLU B HA     1  
ATOM 2276  H HB2    . GLU D 2 11 ? 12.425  -6.569  11.035  1.00 3.82  ? 11 GLU B HB2    1  
ATOM 2277  H HB3    . GLU D 2 11 ? 13.372  -5.996  12.399  1.00 3.89  ? 11 GLU B HB3    1  
ATOM 2278  H HG2    . GLU D 2 11 ? 12.106  -4.219  10.328  1.00 4.39  ? 11 GLU B HG2    1  
ATOM 2279  H HG3    . GLU D 2 11 ? 11.400  -4.601  11.897  1.00 4.27  ? 11 GLU B HG3    1  
ATOM 2280  N N      . TYR D 2 12 ? 14.820  -8.153  10.541  1.00 3.31  ? 12 TYR B N      1  
ATOM 2281  C CA     . TYR D 2 12 ? 15.557  -9.371  10.837  1.00 3.27  ? 12 TYR B CA     1  
ATOM 2282  C C      . TYR D 2 12 ? 16.955  -9.340  10.213  1.00 3.07  ? 12 TYR B C      1  
ATOM 2283  O O      . TYR D 2 12 ? 17.889  -9.946  10.739  1.00 3.12  ? 12 TYR B O      1  
ATOM 2284  C CB     . TYR D 2 12 ? 14.774  -10.573 10.312  1.00 3.15  ? 12 TYR B CB     1  
ATOM 2285  C CG     . TYR D 2 12 ? 15.353  -11.914 10.687  1.00 3.21  ? 12 TYR B CG     1  
ATOM 2286  C CD1    . TYR D 2 12 ? 15.498  -12.292 12.013  1.00 3.52  ? 12 TYR B CD1    1  
ATOM 2287  C CD2    . TYR D 2 12 ? 15.737  -12.808 9.706   1.00 3.01  ? 12 TYR B CD2    1  
ATOM 2288  C CE1    . TYR D 2 12 ? 16.012  -13.530 12.345  1.00 3.62  ? 12 TYR B CE1    1  
ATOM 2289  C CE2    . TYR D 2 12 ? 16.251  -14.041 10.021  1.00 3.12  ? 12 TYR B CE2    1  
ATOM 2290  C CZ     . TYR D 2 12 ? 16.388  -14.404 11.347  1.00 3.42  ? 12 TYR B CZ     1  
ATOM 2291  O OH     . TYR D 2 12 ? 16.896  -15.640 11.678  1.00 3.57  ? 12 TYR B OH     1  
ATOM 2292  H H      . TYR D 2 12 ? 13.973  -8.223  10.042  1.00 3.23  ? 12 TYR B H      1  
ATOM 2293  H HA     . TYR D 2 12 ? 15.651  -9.453  11.908  1.00 3.51  ? 12 TYR B HA     1  
ATOM 2294  H HB2    . TYR D 2 12 ? 13.767  -10.531 10.694  1.00 3.30  ? 12 TYR B HB2    1  
ATOM 2295  H HB3    . TYR D 2 12 ? 14.742  -10.522 9.232   1.00 2.92  ? 12 TYR B HB3    1  
ATOM 2296  H HD1    . TYR D 2 12 ? 15.203  -11.606 12.791  1.00 3.72  ? 12 TYR B HD1    1  
ATOM 2297  H HD2    . TYR D 2 12 ? 15.637  -12.521 8.660   1.00 2.79  ? 12 TYR B HD2    1  
ATOM 2298  H HE1    . TYR D 2 12 ? 16.118  -13.810 13.382  1.00 3.88  ? 12 TYR B HE1    1  
ATOM 2299  H HE2    . TYR D 2 12 ? 16.536  -14.721 9.223   1.00 3.02  ? 12 TYR B HE2    1  
ATOM 2300  H HH     . TYR D 2 12 ? 17.476  -15.949 10.974  1.00 3.54  ? 12 TYR B HH     1  
ATOM 2301  N N      . ALA D 2 13 ? 17.101  -8.614  9.107   1.00 2.88  ? 13 ALA B N      1  
ATOM 2302  C CA     . ALA D 2 13 ? 18.385  -8.524  8.434   1.00 2.72  ? 13 ALA B CA     1  
ATOM 2303  C C      . ALA D 2 13 ? 19.199  -7.400  9.054   1.00 2.94  ? 13 ALA B C      1  
ATOM 2304  O O      . ALA D 2 13 ? 20.436  -7.404  9.015   1.00 2.90  ? 13 ALA B O      1  
ATOM 2305  C CB     . ALA D 2 13 ? 18.190  -8.275  6.955   1.00 2.52  ? 13 ALA B CB     1  
ATOM 2306  H H      . ALA D 2 13 ? 16.325  -8.107  8.747   1.00 2.87  ? 13 ALA B H      1  
ATOM 2307  H HA     . ALA D 2 13 ? 18.904  -9.473  8.553   1.00 2.64  ? 13 ALA B HA     1  
ATOM 2308  H HB1    . ALA D 2 13 ? 17.674  -7.336  6.824   1.00 2.64  ? 13 ALA B HB1    1  
ATOM 2309  H HB2    . ALA D 2 13 ? 17.601  -9.079  6.530   1.00 2.61  ? 13 ALA B HB2    1  
ATOM 2310  H HB3    . ALA D 2 13 ? 19.151  -8.231  6.465   1.00 2.81  ? 13 ALA B HB3    1  
ATOM 2311  N N      . GLY D 2 14 ? 18.486  -6.432  9.612   1.00 3.18  ? 14 GLY B N      1  
ATOM 2312  C CA     . GLY D 2 14 ? 19.114  -5.305  10.265  1.00 3.46  ? 14 GLY B CA     1  
ATOM 2313  C C      . GLY D 2 14 ? 19.388  -4.198  9.292   1.00 3.50  ? 14 GLY B C      1  
ATOM 2314  O O      . GLY D 2 14 ? 20.376  -3.476  9.402   1.00 3.66  ? 14 GLY B O      1  
ATOM 2315  H H      . GLY D 2 14 ? 17.514  -6.452  9.517   1.00 3.18  ? 14 GLY B H      1  
ATOM 2316  H HA2    . GLY D 2 14 ? 18.467  -4.947  11.044  1.00 3.68  ? 14 GLY B HA2    1  
ATOM 2317  H HA3    . GLY D 2 14 ? 20.046  -5.633  10.688  1.00 3.48  ? 14 GLY B HA3    1  
ATOM 2318  N N      . VAL D 2 15 ? 18.503  -4.084  8.327   1.00 3.38  ? 15 VAL B N      1  
ATOM 2319  C CA     . VAL D 2 15 ? 18.639  -3.113  7.260   1.00 3.45  ? 15 VAL B CA     1  
ATOM 2320  C C      . VAL D 2 15 ? 17.306  -2.468  6.899   1.00 3.53  ? 15 VAL B C      1  
ATOM 2321  O O      . VAL D 2 15 ? 16.252  -3.053  7.142   1.00 3.41  ? 15 VAL B O      1  
ATOM 2322  C CB     . VAL D 2 15 ? 19.262  -3.767  6.026   1.00 3.19  ? 15 VAL B CB     1  
ATOM 2323  C CG1    . VAL D 2 15 ? 20.732  -4.036  6.264   1.00 3.17  ? 15 VAL B CG1    1  
ATOM 2324  C CG2    . VAL D 2 15 ? 18.551  -5.059  5.715   1.00 2.87  ? 15 VAL B CG2    1  
ATOM 2325  H H      . VAL D 2 15 ? 17.704  -4.677  8.335   1.00 3.27  ? 15 VAL B H      1  
ATOM 2326  H HA     . VAL D 2 15 ? 19.310  -2.346  7.603   1.00 3.67  ? 15 VAL B HA     1  
ATOM 2327  H HB     . VAL D 2 15 ? 19.158  -3.102  5.182   1.00 3.28  ? 15 VAL B HB     1  
ATOM 2328  H HG11   . VAL D 2 15 ? 21.237  -3.107  6.483   1.00 3.03  ? 15 VAL B HG11   1  
ATOM 2329  H HG12   . VAL D 2 15 ? 21.165  -4.485  5.382   1.00 3.56  ? 15 VAL B HG12   1  
ATOM 2330  H HG13   . VAL D 2 15 ? 20.831  -4.710  7.103   1.00 3.36  ? 15 VAL B HG13   1  
ATOM 2331  H HG21   . VAL D 2 15 ? 18.508  -5.664  6.610   1.00 3.03  ? 15 VAL B HG21   1  
ATOM 2332  H HG22   . VAL D 2 15 ? 19.088  -5.587  4.942   1.00 3.14  ? 15 VAL B HG22   1  
ATOM 2333  H HG23   . VAL D 2 15 ? 17.548  -4.839  5.379   1.00 2.77  ? 15 VAL B HG23   1  
ATOM 2334  N N      . SER D 2 16 ? 17.356  -1.231  6.413   1.00 3.79  ? 16 SER B N      1  
ATOM 2335  C CA     . SER D 2 16 ? 16.150  -0.522  6.003   1.00 3.90  ? 16 SER B CA     1  
ATOM 2336  C C      . SER D 2 16 ? 15.338  -1.393  5.059   1.00 3.60  ? 16 SER B C      1  
ATOM 2337  O O      . SER D 2 16 ? 15.866  -2.293  4.393   1.00 3.35  ? 16 SER B O      1  
ATOM 2338  C CB     . SER D 2 16 ? 16.521  0.801   5.320   1.00 4.20  ? 16 SER B CB     1  
ATOM 2339  O OG     . SER D 2 16 ? 17.681  1.369   5.907   1.00 4.38  ? 16 SER B OG     1  
ATOM 2340  H H      . SER D 2 16 ? 18.231  -0.803  6.274   1.00 3.90  ? 16 SER B H      1  
ATOM 2341  H HA     . SER D 2 16 ? 15.546  -0.317  6.870   1.00 4.02  ? 16 SER B HA     1  
ATOM 2342  H HB2    . SER D 2 16 ? 16.717  0.624   4.272   1.00 4.25  ? 16 SER B HB2    1  
ATOM 2343  H HB3    . SER D 2 16 ? 15.703  1.501   5.421   1.00 4.41  ? 16 SER B HB3    1  
ATOM 2344  H HG     . SER D 2 16 ? 18.392  1.377   5.252   1.00 4.40  ? 16 SER B HG     1  
ATOM 2345  N N      . TYR D 2 17 ? 14.054  -1.112  4.993   1.00 3.62  ? 17 TYR B N      1  
ATOM 2346  C CA     . TYR D 2 17 ? 13.165  -1.858  4.140   1.00 3.38  ? 17 TYR B CA     1  
ATOM 2347  C C      . TYR D 2 17 ? 13.662  -1.800  2.737   1.00 3.32  ? 17 TYR B C      1  
ATOM 2348  O O      . TYR D 2 17 ? 14.014  -2.802  2.169   1.00 3.10  ? 17 TYR B O      1  
ATOM 2349  C CB     . TYR D 2 17 ? 11.822  -1.198  4.243   1.00 3.51  ? 17 TYR B CB     1  
ATOM 2350  C CG     . TYR D 2 17 ? 10.783  -1.798  3.364   1.00 3.30  ? 17 TYR B CG     1  
ATOM 2351  C CD1    . TYR D 2 17 ? 10.231  -2.997  3.725   1.00 3.03  ? 17 TYR B CD1    1  
ATOM 2352  C CD2    . TYR D 2 17 ? 10.339  -1.177  2.205   1.00 3.42  ? 17 TYR B CD2    1  
ATOM 2353  C CE1    . TYR D 2 17 ? 9.263   -3.568  2.990   1.00 2.87  ? 17 TYR B CE1    1  
ATOM 2354  C CE2    . TYR D 2 17 ? 9.351   -1.766  1.438   1.00 3.26  ? 17 TYR B CE2    1  
ATOM 2355  C CZ     . TYR D 2 17 ? 8.820   -2.970  1.844   1.00 2.94  ? 17 TYR B CZ     1  
ATOM 2356  O OH     . TYR D 2 17 ? 7.834   -3.582  1.115   1.00 2.85  ? 17 TYR B OH     1  
ATOM 2357  H H      . TYR D 2 17 ? 13.698  -0.395  5.540   1.00 3.82  ? 17 TYR B H      1  
ATOM 2358  H HA     . TYR D 2 17 ? 13.095  -2.886  4.459   1.00 3.19  ? 17 TYR B HA     1  
ATOM 2359  H HB2    . TYR D 2 17 ? 11.467  -1.286  5.257   1.00 3.59  ? 17 TYR B HB2    1  
ATOM 2360  H HB3    . TYR D 2 17 ? 11.924  -0.163  3.994   1.00 3.73  ? 17 TYR B HB3    1  
ATOM 2361  H HD1    . TYR D 2 17 ? 10.582  -3.488  4.623   1.00 2.98  ? 17 TYR B HD1    1  
ATOM 2362  H HD2    . TYR D 2 17 ? 10.781  -0.236  1.899   1.00 3.67  ? 17 TYR B HD2    1  
ATOM 2363  H HE1    . TYR D 2 17 ? 8.868   -4.515  3.302   1.00 2.70  ? 17 TYR B HE1    1  
ATOM 2364  H HE2    . TYR D 2 17 ? 9.010   -1.290  0.534   1.00 3.39  ? 17 TYR B HE2    1  
ATOM 2365  H HH     . TYR D 2 17 ? 7.010   -3.556  1.613   1.00 3.14  ? 17 TYR B HH     1  
ATOM 2366  N N      . GLN D 2 18 ? 13.795  -0.599  2.202   1.00 3.58  ? 18 GLN B N      1  
ATOM 2367  C CA     . GLN D 2 18 ? 14.300  -0.450  0.857   1.00 3.64  ? 18 GLN B CA     1  
ATOM 2368  C C      . GLN D 2 18 ? 15.816  -0.740  0.784   1.00 3.63  ? 18 GLN B C      1  
ATOM 2369  O O      . GLN D 2 18 ? 16.456  -0.403  -0.206  1.00 3.77  ? 18 GLN B O      1  
ATOM 2370  C CB     . GLN D 2 18 ? 13.892  0.901   0.261   1.00 3.96  ? 18 GLN B CB     1  
ATOM 2371  C CG     . GLN D 2 18 ? 12.399  1.180   0.507   1.00 4.35  ? 18 GLN B CG     1  
ATOM 2372  C CD     . GLN D 2 18 ? 12.168  2.113   1.675   1.00 4.69  ? 18 GLN B CD     1  
ATOM 2373  O OE1    . GLN D 2 18 ? 11.904  1.671   2.782   1.00 5.01  ? 18 GLN B OE1    1  
ATOM 2374  N NE2    . GLN D 2 18 ? 12.299  3.397   1.438   1.00 5.04  ? 18 GLN B NE2    1  
ATOM 2375  H H      . GLN D 2 18 ? 13.538  0.173   2.713   1.00 3.77  ? 18 GLN B H      1  
ATOM 2376  H HA     . GLN D 2 18 ? 13.803  -1.224  0.271   1.00 3.47  ? 18 GLN B HA     1  
ATOM 2377  H HB2    . GLN D 2 18 ? 14.481  1.700   0.680   1.00 4.06  ? 18 GLN B HB2    1  
ATOM 2378  H HB3    . GLN D 2 18 ? 14.046  0.870   -0.824  1.00 4.11  ? 18 GLN B HB3    1  
ATOM 2379  H HG2    . GLN D 2 18 ? 11.954  1.609   -0.385  1.00 4.60  ? 18 GLN B HG2    1  
ATOM 2380  H HG3    . GLN D 2 18 ? 11.914  0.250   0.713   1.00 4.54  ? 18 GLN B HG3    1  
ATOM 2381  H HE21   . GLN D 2 18 ? 12.540  3.697   0.528   1.00 5.02  ? 18 GLN B HE21   1  
ATOM 2382  H HE22   . GLN D 2 18 ? 12.149  4.006   2.183   1.00 5.51  ? 18 GLN B HE22   1  
ATOM 2383  N N      . THR D 2 19 ? 16.415  -1.234  1.894   1.00 3.52  ? 19 THR B N      1  
ATOM 2384  C CA     . THR D 2 19 ? 17.775  -1.712  1.837   1.00 3.47  ? 19 THR B CA     1  
ATOM 2385  C C      . THR D 2 19 ? 17.621  -3.010  1.067   1.00 3.18  ? 19 THR B C      1  
ATOM 2386  O O      . THR D 2 19 ? 18.106  -3.182  -0.054  1.00 3.24  ? 19 THR B O      1  
ATOM 2387  C CB     . THR D 2 19 ? 18.438  -2.045  3.210   1.00 3.43  ? 19 THR B CB     1  
ATOM 2388  O OG1    . THR D 2 19 ? 18.696  -0.875  4.012   1.00 3.78  ? 19 THR B OG1    1  
ATOM 2389  C CG2    . THR D 2 19 ? 19.740  -2.739  2.924   1.00 3.34  ? 19 THR B CG2    1  
ATOM 2390  H H      . THR D 2 19 ? 15.942  -1.257  2.738   1.00 3.48  ? 19 THR B H      1  
ATOM 2391  H HA     . THR D 2 19 ? 18.395  -1.024  1.291   1.00 3.69  ? 19 THR B HA     1  
ATOM 2392  H HB     . THR D 2 19 ? 17.809  -2.735  3.768   1.00 3.24  ? 19 THR B HB     1  
ATOM 2393  H HG1    . THR D 2 19 ? 19.599  -0.900  4.352   1.00 4.01  ? 19 THR B HG1    1  
ATOM 2394  H HG21   . THR D 2 19 ? 19.529  -3.658  2.396   1.00 3.59  ? 19 THR B HG21   1  
ATOM 2395  H HG22   . THR D 2 19 ? 20.249  -2.961  3.848   1.00 3.30  ? 19 THR B HG22   1  
ATOM 2396  H HG23   . THR D 2 19 ? 20.360  -2.104  2.302   1.00 3.50  ? 19 THR B HG23   1  
ATOM 2397  N N      . VAL D 2 20 ? 16.865  -3.903  1.697   1.00 2.93  ? 20 VAL B N      1  
ATOM 2398  C CA     . VAL D 2 20 ? 16.532  -5.214  1.159   1.00 2.66  ? 20 VAL B CA     1  
ATOM 2399  C C      . VAL D 2 20 ? 15.481  -5.171  0.044   1.00 2.69  ? 20 VAL B C      1  
ATOM 2400  O O      . VAL D 2 20 ? 15.528  -5.985  -0.877  1.00 2.62  ? 20 VAL B O      1  
ATOM 2401  C CB     . VAL D 2 20 ? 16.086  -6.179  2.281   1.00 2.44  ? 20 VAL B CB     1  
ATOM 2402  C CG1    . VAL D 2 20 ? 16.127  -5.499  3.629   1.00 2.57  ? 20 VAL B CG1    1  
ATOM 2403  C CG2    . VAL D 2 20 ? 14.712  -6.764  2.055   1.00 2.33  ? 20 VAL B CG2    1  
ATOM 2404  H H      . VAL D 2 20 ? 16.521  -3.673  2.573   1.00 2.96  ? 20 VAL B H      1  
ATOM 2405  H HA     . VAL D 2 20 ? 17.441  -5.611  0.729   1.00 2.66  ? 20 VAL B HA     1  
ATOM 2406  H HB     . VAL D 2 20 ? 16.794  -6.995  2.291   1.00 2.32  ? 20 VAL B HB     1  
ATOM 2407  H HG11   . VAL D 2 20 ? 15.341  -4.768  3.690   1.00 2.83  ? 20 VAL B HG11   1  
ATOM 2408  H HG12   . VAL D 2 20 ? 17.084  -5.012  3.754   1.00 2.88  ? 20 VAL B HG12   1  
ATOM 2409  H HG13   . VAL D 2 20 ? 15.997  -6.237  4.407   1.00 2.66  ? 20 VAL B HG13   1  
ATOM 2410  H HG21   . VAL D 2 20 ? 13.954  -6.056  2.390   1.00 2.42  ? 20 VAL B HG21   1  
ATOM 2411  H HG22   . VAL D 2 20 ? 14.633  -7.683  2.617   1.00 2.66  ? 20 VAL B HG22   1  
ATOM 2412  H HG23   . VAL D 2 20 ? 14.579  -6.962  1.005   1.00 2.45  ? 20 VAL B HG23   1  
ATOM 2413  N N      . SER D 2 21 ? 14.504  -4.270  0.142   1.00 2.83  ? 21 SER B N      1  
ATOM 2414  C CA     . SER D 2 21 ? 13.456  -4.166  -0.880  1.00 2.87  ? 21 SER B CA     1  
ATOM 2415  C C      . SER D 2 21 ? 14.062  -3.841  -2.224  1.00 3.09  ? 21 SER B C      1  
ATOM 2416  O O      . SER D 2 21 ? 13.596  -4.309  -3.263  1.00 3.10  ? 21 SER B O      1  
ATOM 2417  C CB     . SER D 2 21 ? 12.416  -3.115  -0.495  1.00 3.04  ? 21 SER B CB     1  
ATOM 2418  O OG     . SER D 2 21 ? 11.723  -3.505  0.673   1.00 3.23  ? 21 SER B OG     1  
ATOM 2419  H H      . SER D 2 21 ? 14.466  -3.685  0.932   1.00 2.92  ? 21 SER B H      1  
ATOM 2420  H HA     . SER D 2 21 ? 12.971  -5.129  -0.950  1.00 2.67  ? 21 SER B HA     1  
ATOM 2421  H HB2    . SER D 2 21 ? 12.908  -2.171  -0.305  1.00 3.19  ? 21 SER B HB2    1  
ATOM 2422  H HB3    . SER D 2 21 ? 11.703  -2.999  -1.296  1.00 3.31  ? 21 SER B HB3    1  
ATOM 2423  H HG     . SER D 2 21 ? 10.833  -3.165  0.649   1.00 3.29  ? 21 SER B HG     1  
ATOM 2424  N N      . ARG D 2 22 ? 15.118  -3.046  -2.195  1.00 3.32  ? 22 ARG B N      1  
ATOM 2425  C CA     . ARG D 2 22 ? 15.830  -2.682  -3.396  1.00 3.59  ? 22 ARG B CA     1  
ATOM 2426  C C      . ARG D 2 22 ? 16.506  -3.941  -3.915  1.00 3.45  ? 22 ARG B C      1  
ATOM 2427  O O      . ARG D 2 22 ? 16.620  -4.160  -5.118  1.00 3.63  ? 22 ARG B O      1  
ATOM 2428  C CB     . ARG D 2 22 ? 16.838  -1.580  -3.059  1.00 3.86  ? 22 ARG B CB     1  
ATOM 2429  C CG     . ARG D 2 22 ? 18.150  -1.657  -3.810  1.00 4.07  ? 22 ARG B CG     1  
ATOM 2430  C CD     . ARG D 2 22 ? 19.277  -1.039  -2.996  1.00 4.20  ? 22 ARG B CD     1  
ATOM 2431  N NE     . ARG D 2 22 ? 18.945  0.305   -2.506  1.00 4.64  ? 22 ARG B NE     1  
ATOM 2432  C CZ     . ARG D 2 22 ? 19.841  1.278   -2.309  1.00 4.85  ? 22 ARG B CZ     1  
ATOM 2433  N NH1    . ARG D 2 22 ? 21.130  1.070   -2.560  1.00 4.70  ? 22 ARG B NH1    1  
ATOM 2434  N NH2    . ARG D 2 22 ? 19.447  2.467   -1.863  1.00 5.40  ? 22 ARG B NH2    1  
ATOM 2435  H H      . ARG D 2 22 ? 15.439  -2.709  -1.336  1.00 3.32  ? 22 ARG B H      1  
ATOM 2436  H HA     . ARG D 2 22 ? 15.118  -2.327  -4.122  1.00 3.73  ? 22 ARG B HA     1  
ATOM 2437  H HB2    . ARG D 2 22 ? 16.386  -0.628  -3.272  1.00 4.20  ? 22 ARG B HB2    1  
ATOM 2438  H HB3    . ARG D 2 22 ? 17.056  -1.634  -1.999  1.00 3.75  ? 22 ARG B HB3    1  
ATOM 2439  H HG2    . ARG D 2 22 ? 18.380  -2.695  -3.999  1.00 3.96  ? 22 ARG B HG2    1  
ATOM 2440  H HG3    . ARG D 2 22 ? 18.052  -1.128  -4.745  1.00 4.42  ? 22 ARG B HG3    1  
ATOM 2441  H HD2    . ARG D 2 22 ? 19.474  -1.683  -2.153  1.00 3.97  ? 22 ARG B HD2    1  
ATOM 2442  H HD3    . ARG D 2 22 ? 20.158  -0.983  -3.616  1.00 4.38  ? 22 ARG B HD3    1  
ATOM 2443  H HE     . ARG D 2 22 ? 18.000  0.485   -2.303  1.00 4.91  ? 22 ARG B HE     1  
ATOM 2444  H HH11   . ARG D 2 22 ? 21.445  0.176   -2.898  1.00 4.47  ? 22 ARG B HH11   1  
ATOM 2445  H HH12   . ARG D 2 22 ? 21.800  1.801   -2.404  1.00 4.95  ? 22 ARG B HH12   1  
ATOM 2446  H HH21   . ARG D 2 22 ? 18.480  2.637   -1.669  1.00 5.70  ? 22 ARG B HH21   1  
ATOM 2447  H HH22   . ARG D 2 22 ? 20.119  3.198   -1.716  1.00 5.62  ? 22 ARG B HH22   1  
ATOM 2448  N N      . VAL D 2 23 ? 16.905  -4.776  -2.958  1.00 3.17  ? 23 VAL B N      1  
ATOM 2449  C CA     . VAL D 2 23 ? 17.539  -6.051  -3.212  1.00 3.05  ? 23 VAL B CA     1  
ATOM 2450  C C      . VAL D 2 23 ? 16.546  -6.982  -3.902  1.00 3.00  ? 23 VAL B C      1  
ATOM 2451  O O      . VAL D 2 23 ? 16.836  -7.574  -4.941  1.00 3.18  ? 23 VAL B O      1  
ATOM 2452  C CB     . VAL D 2 23 ? 18.011  -6.683  -1.879  1.00 2.77  ? 23 VAL B CB     1  
ATOM 2453  C CG1    . VAL D 2 23 ? 18.400  -8.134  -2.051  1.00 2.66  ? 23 VAL B CG1    1  
ATOM 2454  C CG2    . VAL D 2 23 ? 19.152  -5.884  -1.261  1.00 2.87  ? 23 VAL B CG2    1  
ATOM 2455  H H      . VAL D 2 23 ? 16.743  -4.525  -2.031  1.00 3.07  ? 23 VAL B H      1  
ATOM 2456  H HA     . VAL D 2 23 ? 18.394  -5.890  -3.838  1.00 3.24  ? 23 VAL B HA     1  
ATOM 2457  H HB     . VAL D 2 23 ? 17.180  -6.651  -1.190  1.00 2.62  ? 23 VAL B HB     1  
ATOM 2458  H HG11   . VAL D 2 23 ? 17.690  -8.618  -2.705  1.00 2.82  ? 23 VAL B HG11   1  
ATOM 2459  H HG12   . VAL D 2 23 ? 18.383  -8.615  -1.081  1.00 3.01  ? 23 VAL B HG12   1  
ATOM 2460  H HG13   . VAL D 2 23 ? 19.390  -8.199  -2.475  1.00 2.64  ? 23 VAL B HG13   1  
ATOM 2461  H HG21   . VAL D 2 23 ? 18.741  -5.133  -0.585  1.00 2.87  ? 23 VAL B HG21   1  
ATOM 2462  H HG22   . VAL D 2 23 ? 19.717  -5.398  -2.044  1.00 3.44  ? 23 VAL B HG22   1  
ATOM 2463  H HG23   . VAL D 2 23 ? 19.797  -6.549  -0.710  1.00 2.86  ? 23 VAL B HG23   1  
ATOM 2464  N N      . VAL D 2 24 ? 15.361  -7.068  -3.313  1.00 2.81  ? 24 VAL B N      1  
ATOM 2465  C CA     . VAL D 2 24 ? 14.276  -7.896  -3.822  1.00 2.77  ? 24 VAL B CA     1  
ATOM 2466  C C      . VAL D 2 24 ? 13.761  -7.393  -5.173  1.00 3.04  ? 24 VAL B C      1  
ATOM 2467  O O      . VAL D 2 24 ? 13.176  -8.155  -5.950  1.00 3.12  ? 24 VAL B O      1  
ATOM 2468  C CB     . VAL D 2 24 ? 13.115  -7.977  -2.781  1.00 2.53  ? 24 VAL B CB     1  
ATOM 2469  C CG1    . VAL D 2 24 ? 11.744  -7.860  -3.433  1.00 2.54  ? 24 VAL B CG1    1  
ATOM 2470  C CG2    . VAL D 2 24 ? 13.203  -9.274  -1.981  1.00 2.32  ? 24 VAL B CG2    1  
ATOM 2471  H H      . VAL D 2 24 ? 15.213  -6.553  -2.490  1.00 2.73  ? 24 VAL B H      1  
ATOM 2472  H HA     . VAL D 2 24 ? 14.661  -8.883  -3.960  1.00 2.77  ? 24 VAL B HA     1  
ATOM 2473  H HB     . VAL D 2 24 ? 13.227  -7.154  -2.090  1.00 2.58  ? 24 VAL B HB     1  
ATOM 2474  H HG11   . VAL D 2 24 ? 10.983  -7.817  -2.667  1.00 2.74  ? 24 VAL B HG11   1  
ATOM 2475  H HG12   . VAL D 2 24 ? 11.572  -8.719  -4.064  1.00 2.81  ? 24 VAL B HG12   1  
ATOM 2476  H HG13   . VAL D 2 24 ? 11.706  -6.961  -4.030  1.00 2.62  ? 24 VAL B HG13   1  
ATOM 2477  H HG21   . VAL D 2 24 ? 14.139  -9.307  -1.445  1.00 2.58  ? 24 VAL B HG21   1  
ATOM 2478  H HG22   . VAL D 2 24 ? 13.145  -10.117 -2.653  1.00 2.41  ? 24 VAL B HG22   1  
ATOM 2479  H HG23   . VAL D 2 24 ? 12.383  -9.323  -1.275  1.00 2.48  ? 24 VAL B HG23   1  
ATOM 2480  N N      . ASN D 2 25 ? 14.026  -6.131  -5.491  1.00 3.23  ? 25 ASN B N      1  
ATOM 2481  C CA     . ASN D 2 25 ? 13.506  -5.568  -6.734  1.00 3.51  ? 25 ASN B CA     1  
ATOM 2482  C C      . ASN D 2 25 ? 14.534  -5.587  -7.867  1.00 3.82  ? 25 ASN B C      1  
ATOM 2483  O O      . ASN D 2 25 ? 14.170  -5.355  -9.020  1.00 4.07  ? 25 ASN B O      1  
ATOM 2484  C CB     . ASN D 2 25 ? 12.980  -4.146  -6.494  1.00 3.62  ? 25 ASN B CB     1  
ATOM 2485  C CG     . ASN D 2 25 ? 11.529  -4.117  -6.009  1.00 3.46  ? 25 ASN B CG     1  
ATOM 2486  O OD1    . ASN D 2 25 ? 10.602  -3.921  -6.794  1.00 3.65  ? 25 ASN B OD1    1  
ATOM 2487  N ND2    . ASN D 2 25 ? 11.314  -4.341  -4.714  1.00 3.15  ? 25 ASN B ND2    1  
ATOM 2488  H H      . ASN D 2 25 ? 14.608  -5.583  -4.904  1.00 3.22  ? 25 ASN B H      1  
ATOM 2489  H HA     . ASN D 2 25 ? 12.672  -6.187  -7.035  1.00 3.45  ? 25 ASN B HA     1  
ATOM 2490  H HB2    . ASN D 2 25 ? 13.596  -3.665  -5.749  1.00 3.58  ? 25 ASN B HB2    1  
ATOM 2491  H HB3    . ASN D 2 25 ? 13.041  -3.589  -7.417  1.00 3.90  ? 25 ASN B HB3    1  
ATOM 2492  H HD21   . ASN D 2 25 ? 12.098  -4.529  -4.139  1.00 3.05  ? 25 ASN B HD21   1  
ATOM 2493  H HD22   . ASN D 2 25 ? 10.388  -4.283  -4.378  1.00 3.06  ? 25 ASN B HD22   1  
ATOM 2494  N N      . GLN D 2 26 ? 15.801  -5.895  -7.537  1.00 3.82  ? 26 GLN B N      1  
ATOM 2495  C CA     . GLN D 2 26 ? 16.900  -5.968  -8.527  1.00 4.12  ? 26 GLN B CA     1  
ATOM 2496  C C      . GLN D 2 26 ? 18.270  -5.936  -7.843  1.00 4.18  ? 26 GLN B C      1  
ATOM 2497  O O      . GLN D 2 26 ? 19.166  -6.705  -8.187  1.00 4.60  ? 26 GLN B O      1  
ATOM 2498  C CB     . GLN D 2 26 ? 16.835  -4.829  -9.565  1.00 4.50  ? 26 GLN B CB     1  
ATOM 2499  C CG     . GLN D 2 26 ? 16.888  -3.424  -8.975  1.00 4.96  ? 26 GLN B CG     1  
ATOM 2500  C CD     . GLN D 2 26 ? 16.715  -2.343  -10.025 1.00 5.50  ? 26 GLN B CD     1  
ATOM 2501  O OE1    . GLN D 2 26 ? 17.309  -1.271  -9.929  1.00 6.03  ? 26 GLN B OE1    1  
ATOM 2502  N NE2    . GLN D 2 26 ? 15.892  -2.613  -11.027 1.00 5.69  ? 26 GLN B NE2    1  
ATOM 2503  H H      . GLN D 2 26 ? 16.002  -6.099  -6.598  1.00 3.64  ? 26 GLN B H      1  
ATOM 2504  H HA     . GLN D 2 26 ? 16.803  -6.912  -9.045  1.00 4.11  ? 26 GLN B HA     1  
ATOM 2505  H HB2    . GLN D 2 26 ? 17.667  -4.935  -10.245 1.00 4.72  ? 26 GLN B HB2    1  
ATOM 2506  H HB3    . GLN D 2 26 ? 15.916  -4.924  -10.124 1.00 4.61  ? 26 GLN B HB3    1  
ATOM 2507  H HG2    . GLN D 2 26 ? 16.100  -3.324  -8.245  1.00 4.99  ? 26 GLN B HG2    1  
ATOM 2508  H HG3    . GLN D 2 26 ? 17.845  -3.286  -8.492  1.00 5.30  ? 26 GLN B HG3    1  
ATOM 2509  H HE21   . GLN D 2 26 ? 15.442  -3.486  -11.038 1.00 5.47  ? 26 GLN B HE21   1  
ATOM 2510  H HE22   . GLN D 2 26 ? 15.769  -1.931  -11.720 1.00 6.22  ? 26 GLN B HE22   1  
ATOM 2511  N N      . ALA D 2 27 ? 18.405  -5.032  -6.877  1.00 4.01  ? 27 ALA B N      1  
ATOM 2512  C CA     . ALA D 2 27 ? 19.641  -4.827  -6.122  1.00 4.07  ? 27 ALA B CA     1  
ATOM 2513  C C      . ALA D 2 27 ? 20.851  -4.612  -7.028  1.00 4.43  ? 27 ALA B C      1  
ATOM 2514  O O      . ALA D 2 27 ? 21.920  -5.179  -6.799  1.00 4.48  ? 27 ALA B O      1  
ATOM 2515  C CB     . ALA D 2 27 ? 19.912  -5.970  -5.166  1.00 3.82  ? 27 ALA B CB     1  
ATOM 2516  H H      . ALA D 2 27 ? 17.624  -4.483  -6.646  1.00 3.99  ? 27 ALA B H      1  
ATOM 2517  H HA     . ALA D 2 27 ? 19.491  -3.938  -5.527  1.00 4.11  ? 27 ALA B HA     1  
ATOM 2518  H HB1    . ALA D 2 27 ? 18.981  -6.450  -4.906  1.00 4.16  ? 27 ALA B HB1    1  
ATOM 2519  H HB2    . ALA D 2 27 ? 20.373  -5.574  -4.269  1.00 3.82  ? 27 ALA B HB2    1  
ATOM 2520  H HB3    . ALA D 2 27 ? 20.574  -6.684  -5.631  1.00 3.73  ? 27 ALA B HB3    1  
ATOM 2521  N N      . SER D 2 28 ? 20.687  -3.781  -8.044  1.00 4.78  ? 28 SER B N      1  
ATOM 2522  C CA     . SER D 2 28 ? 21.770  -3.491  -8.973  1.00 5.16  ? 28 SER B CA     1  
ATOM 2523  C C      . SER D 2 28 ? 22.760  -2.506  -8.354  1.00 5.18  ? 28 SER B C      1  
ATOM 2524  O O      . SER D 2 28 ? 23.846  -2.270  -8.883  1.00 5.42  ? 28 SER B O      1  
ATOM 2525  C CB     . SER D 2 28 ? 21.186  -2.910  -10.258 1.00 5.61  ? 28 SER B CB     1  
ATOM 2526  O OG     . SER D 2 28 ? 20.219  -1.916  -9.956  1.00 5.69  ? 28 SER B OG     1  
ATOM 2527  H H      . SER D 2 28 ? 19.815  -3.357  -8.184  1.00 4.85  ? 28 SER B H      1  
ATOM 2528  H HA     . SER D 2 28 ? 22.280  -4.415  -9.198  1.00 5.15  ? 28 SER B HA     1  
ATOM 2529  H HB2    . SER D 2 28 ? 21.977  -2.464  -10.844 1.00 5.81  ? 28 SER B HB2    1  
ATOM 2530  H HB3    . SER D 2 28 ? 20.713  -3.697  -10.827 1.00 5.82  ? 28 SER B HB3    1  
ATOM 2531  H HG     . SER D 2 28 ? 19.527  -1.925  -10.628 1.00 5.90  ? 28 SER B HG     1  
ATOM 2532  N N      . HIS D 2 29 ? 22.364  -1.924  -7.229  1.00 4.98  ? 29 HIS B N      1  
ATOM 2533  C CA     . HIS D 2 29 ? 23.178  -0.954  -6.528  1.00 5.03  ? 29 HIS B CA     1  
ATOM 2534  C C      . HIS D 2 29 ? 23.168  -1.253  -5.027  1.00 4.65  ? 29 HIS B C      1  
ATOM 2535  O O      . HIS D 2 29 ? 22.368  -0.684  -4.285  1.00 4.62  ? 29 HIS B O      1  
ATOM 2536  C CB     . HIS D 2 29 ? 22.628  0.449   -6.808  1.00 5.41  ? 29 HIS B CB     1  
ATOM 2537  C CG     . HIS D 2 29 ? 22.791  0.891   -8.233  1.00 5.82  ? 29 HIS B CG     1  
ATOM 2538  N ND1    . HIS D 2 29 ? 24.003  1.237   -8.789  1.00 6.02  ? 29 HIS B ND1    1  
ATOM 2539  C CD2    . HIS D 2 29 ? 21.879  1.024   -9.218  1.00 6.27  ? 29 HIS B CD2    1  
ATOM 2540  C CE1    . HIS D 2 29 ? 23.828  1.561   -10.057 1.00 6.38  ? 29 HIS B CE1    1  
ATOM 2541  N NE2    . HIS D 2 29 ? 22.546  1.439   -10.346 1.00 6.53  ? 29 HIS B NE2    1  
ATOM 2542  H H      . HIS D 2 29 ? 21.493  -2.155  -6.859  1.00 4.82  ? 29 HIS B H      1  
ATOM 2543  H HA     . HIS D 2 29 ? 24.189  -1.025  -6.900  1.00 5.12  ? 29 HIS B HA     1  
ATOM 2544  H HB2    . HIS D 2 29 ? 21.574  0.464   -6.578  1.00 5.40  ? 29 HIS B HB2    1  
ATOM 2545  H HB3    . HIS D 2 29 ? 23.130  1.154   -6.183  1.00 5.43  ? 29 HIS B HB3    1  
ATOM 2546  H HD1    . HIS D 2 29 ? 24.867  1.247   -8.319  1.00 6.06  ? 29 HIS B HD1    1  
ATOM 2547  H HD2    . HIS D 2 29 ? 20.821  0.846   -9.126  1.00 6.55  ? 29 HIS B HD2    1  
ATOM 2548  H HE1    . HIS D 2 29 ? 24.603  1.872   -10.742 1.00 6.66  ? 29 HIS B HE1    1  
ATOM 2549  H HE2    . HIS D 2 29 ? 22.178  1.419   -11.265 1.00 6.89  ? 29 HIS B HE2    1  
ATOM 2550  N N      . VAL D 2 30 ? 24.056  -2.151  -4.592  1.00 4.43  ? 30 VAL B N      1  
ATOM 2551  C CA     . VAL D 2 30 ? 24.142  -2.569  -3.193  1.00 4.08  ? 30 VAL B CA     1  
ATOM 2552  C C      . VAL D 2 30 ? 25.509  -3.164  -2.891  1.00 4.00  ? 30 VAL B C      1  
ATOM 2553  O O      . VAL D 2 30 ? 26.417  -3.118  -3.721  1.00 4.18  ? 30 VAL B O      1  
ATOM 2554  C CB     . VAL D 2 30 ? 23.126  -3.676  -2.857  1.00 3.71  ? 30 VAL B CB     1  
ATOM 2555  C CG1    . VAL D 2 30 ? 21.718  -3.145  -2.690  1.00 3.82  ? 30 VAL B CG1    1  
ATOM 2556  C CG2    . VAL D 2 30 ? 23.179  -4.771  -3.904  1.00 3.92  ? 30 VAL B CG2    1  
ATOM 2557  H H      . VAL D 2 30 ? 24.698  -2.530  -5.223  1.00 4.57  ? 30 VAL B H      1  
ATOM 2558  H HA     . VAL D 2 30 ? 23.960  -1.717  -2.556  1.00 4.15  ? 30 VAL B HA     1  
ATOM 2559  H HB     . VAL D 2 30 ? 23.426  -4.108  -1.928  1.00 3.58  ? 30 VAL B HB     1  
ATOM 2560  H HG11   . VAL D 2 30 ? 21.405  -2.662  -3.604  1.00 4.13  ? 30 VAL B HG11   1  
ATOM 2561  H HG12   . VAL D 2 30 ? 21.697  -2.431  -1.880  1.00 4.03  ? 30 VAL B HG12   1  
ATOM 2562  H HG13   . VAL D 2 30 ? 21.049  -3.962  -2.468  1.00 3.93  ? 30 VAL B HG13   1  
ATOM 2563  H HG21   . VAL D 2 30 ? 22.488  -5.557  -3.639  1.00 4.08  ? 30 VAL B HG21   1  
ATOM 2564  H HG22   . VAL D 2 30 ? 24.184  -5.171  -3.948  1.00 4.16  ? 30 VAL B HG22   1  
ATOM 2565  H HG23   . VAL D 2 30 ? 22.911  -4.362  -4.867  1.00 4.16  ? 30 VAL B HG23   1  
ATOM 2566  N N      . SER D 2 31 ? 25.638  -3.738  -1.700  1.00 3.77  ? 31 SER B N      1  
ATOM 2567  C CA     . SER D 2 31 ? 26.863  -4.395  -1.298  1.00 3.67  ? 31 SER B CA     1  
ATOM 2568  C C      . SER D 2 31 ? 26.624  -5.901  -1.163  1.00 3.36  ? 31 SER B C      1  
ATOM 2569  O O      . SER D 2 31 ? 25.487  -6.370  -1.271  1.00 3.20  ? 31 SER B O      1  
ATOM 2570  C CB     . SER D 2 31 ? 27.377  -3.815  0.019   1.00 3.65  ? 31 SER B CB     1  
ATOM 2571  O OG     . SER D 2 31 ? 26.318  -3.657  0.950   1.00 3.96  ? 31 SER B OG     1  
ATOM 2572  H H      . SER D 2 31 ? 24.892  -3.700  -1.066  1.00 3.68  ? 31 SER B H      1  
ATOM 2573  H HA     . SER D 2 31 ? 27.592  -4.228  -2.074  1.00 3.89  ? 31 SER B HA     1  
ATOM 2574  H HB2    . SER D 2 31 ? 28.113  -4.486  0.440   1.00 3.48  ? 31 SER B HB2    1  
ATOM 2575  H HB3    . SER D 2 31 ? 27.828  -2.852  -0.164  1.00 3.79  ? 31 SER B HB3    1  
ATOM 2576  H HG     . SER D 2 31 ? 26.128  -2.716  1.060   1.00 4.12  ? 31 SER B HG     1  
ATOM 2577  N N      . ALA D 2 32 ? 27.694  -6.647  -0.917  1.00 3.31  ? 32 ALA B N      1  
ATOM 2578  C CA     . ALA D 2 32 ? 27.615  -8.098  -0.781  1.00 3.09  ? 32 ALA B CA     1  
ATOM 2579  C C      . ALA D 2 32 ? 26.868  -8.524  0.484   1.00 2.76  ? 32 ALA B C      1  
ATOM 2580  O O      . ALA D 2 32 ? 25.796  -9.125  0.404   1.00 2.62  ? 32 ALA B O      1  
ATOM 2581  C CB     . ALA D 2 32 ? 29.016  -8.688  -0.780  1.00 3.17  ? 32 ALA B CB     1  
ATOM 2582  H H      . ALA D 2 32 ? 28.567  -6.210  -0.834  1.00 3.46  ? 32 ALA B H      1  
ATOM 2583  H HA     . ALA D 2 32 ? 27.092  -8.485  -1.642  1.00 3.16  ? 32 ALA B HA     1  
ATOM 2584  H HB1    . ALA D 2 32 ? 29.493  -8.483  -1.727  1.00 3.12  ? 32 ALA B HB1    1  
ATOM 2585  H HB2    . ALA D 2 32 ? 28.958  -9.755  -0.628  1.00 3.30  ? 32 ALA B HB2    1  
ATOM 2586  H HB3    . ALA D 2 32 ? 29.591  -8.239  0.017   1.00 3.55  ? 32 ALA B HB3    1  
ATOM 2587  N N      . LYS D 2 33 ? 27.437  -8.183  1.642   1.00 2.69  ? 33 LYS B N      1  
ATOM 2588  C CA     . LYS D 2 33 ? 26.870  -8.542  2.952   1.00 2.46  ? 33 LYS B CA     1  
ATOM 2589  C C      . LYS D 2 33 ? 25.392  -8.205  3.072   1.00 2.42  ? 33 LYS B C      1  
ATOM 2590  O O      . LYS D 2 33 ? 24.639  -8.933  3.717   1.00 2.27  ? 33 LYS B O      1  
ATOM 2591  C CB     . LYS D 2 33 ? 27.642  -7.838  4.073   1.00 2.57  ? 33 LYS B CB     1  
ATOM 2592  C CG     . LYS D 2 33 ? 27.753  -6.329  3.891   1.00 2.90  ? 33 LYS B CG     1  
ATOM 2593  C CD     . LYS D 2 33 ? 29.174  -5.840  4.115   1.00 3.43  ? 33 LYS B CD     1  
ATOM 2594  C CE     . LYS D 2 33 ? 29.658  -6.143  5.525   1.00 4.18  ? 33 LYS B CE     1  
ATOM 2595  N NZ     . LYS D 2 33 ? 31.076  -5.747  5.720   1.00 4.90  ? 33 LYS B NZ     1  
ATOM 2596  H H      . LYS D 2 33 ? 28.275  -7.677  1.618   1.00 2.84  ? 33 LYS B H      1  
ATOM 2597  H HA     . LYS D 2 33 ? 26.980  -9.608  3.075   1.00 2.31  ? 33 LYS B HA     1  
ATOM 2598  H HB2    . LYS D 2 33 ? 27.136  -8.025  5.012   1.00 2.68  ? 33 LYS B HB2    1  
ATOM 2599  H HB3    . LYS D 2 33 ? 28.639  -8.248  4.123   1.00 2.83  ? 33 LYS B HB3    1  
ATOM 2600  H HG2    . LYS D 2 33 ? 27.450  -6.074  2.887   1.00 3.07  ? 33 LYS B HG2    1  
ATOM 2601  H HG3    . LYS D 2 33 ? 27.098  -5.843  4.600   1.00 3.00  ? 33 LYS B HG3    1  
ATOM 2602  H HD2    . LYS D 2 33 ? 29.828  -6.330  3.409   1.00 3.60  ? 33 LYS B HD2    1  
ATOM 2603  H HD3    . LYS D 2 33 ? 29.205  -4.772  3.956   1.00 3.60  ? 33 LYS B HD3    1  
ATOM 2604  H HE2    . LYS D 2 33 ? 29.042  -5.601  6.227   1.00 4.35  ? 33 LYS B HE2    1  
ATOM 2605  H HE3    . LYS D 2 33 ? 29.560  -7.204  5.704   1.00 4.47  ? 33 LYS B HE3    1  
ATOM 2606  H HZ1    . LYS D 2 33 ? 31.388  -5.992  6.686   1.00 5.05  ? 33 LYS B HZ1    1  
ATOM 2607  H HZ2    . LYS D 2 33 ? 31.185  -4.718  5.584   1.00 5.15  ? 33 LYS B HZ2    1  
ATOM 2608  H HZ3    . LYS D 2 33 ? 31.686  -6.241  5.033   1.00 5.39  ? 33 LYS B HZ3    1  
ATOM 2609  N N      . THR D 2 34 ? 24.978  -7.111  2.462   1.00 2.61  ? 34 THR B N      1  
ATOM 2610  C CA     . THR D 2 34 ? 23.599  -6.701  2.525   1.00 2.61  ? 34 THR B CA     1  
ATOM 2611  C C      . THR D 2 34 ? 22.670  -7.740  1.907   1.00 2.42  ? 34 THR B C      1  
ATOM 2612  O O      . THR D 2 34 ? 21.715  -8.176  2.546   1.00 2.28  ? 34 THR B O      1  
ATOM 2613  C CB     . THR D 2 34 ? 23.395  -5.358  1.822   1.00 2.90  ? 34 THR B CB     1  
ATOM 2614  O OG1    . THR D 2 34 ? 24.164  -4.345  2.484   1.00 3.13  ? 34 THR B OG1    1  
ATOM 2615  C CG2    . THR D 2 34 ? 21.928  -4.988  1.830   1.00 2.93  ? 34 THR B CG2    1  
ATOM 2616  H H      . THR D 2 34 ? 25.613  -6.567  1.960   1.00 2.78  ? 34 THR B H      1  
ATOM 2617  H HA     . THR D 2 34 ? 23.338  -6.576  3.566   1.00 2.59  ? 34 THR B HA     1  
ATOM 2618  H HB     . THR D 2 34 ? 23.727  -5.445  0.797   1.00 2.95  ? 34 THR B HB     1  
ATOM 2619  H HG1    . THR D 2 34 ? 24.847  -4.016  1.885   1.00 3.30  ? 34 THR B HG1    1  
ATOM 2620  H HG21   . THR D 2 34 ? 21.727  -4.343  2.672   1.00 3.01  ? 34 THR B HG21   1  
ATOM 2621  H HG22   . THR D 2 34 ? 21.337  -5.893  1.920   1.00 3.20  ? 34 THR B HG22   1  
ATOM 2622  H HG23   . THR D 2 34 ? 21.679  -4.479  0.913   1.00 3.08  ? 34 THR B HG23   1  
ATOM 2623  N N      . ARG D 2 35 ? 22.981  -8.173  0.691   1.00 2.50  ? 35 ARG B N      1  
ATOM 2624  C CA     . ARG D 2 35 ? 22.141  -9.136  -0.005  1.00 2.44  ? 35 ARG B CA     1  
ATOM 2625  C C      . ARG D 2 35 ? 22.066  -10.442 0.767   1.00 2.25  ? 35 ARG B C      1  
ATOM 2626  O O      . ARG D 2 35 ? 21.009  -11.043 0.886   1.00 2.20  ? 35 ARG B O      1  
ATOM 2627  C CB     . ARG D 2 35 ? 22.673  -9.390  -1.417  1.00 2.67  ? 35 ARG B CB     1  
ATOM 2628  C CG     . ARG D 2 35 ? 22.512  -8.200  -2.346  1.00 2.98  ? 35 ARG B CG     1  
ATOM 2629  C CD     . ARG D 2 35 ? 22.928  -8.536  -3.771  1.00 3.19  ? 35 ARG B CD     1  
ATOM 2630  N NE     . ARG D 2 35 ? 24.353  -8.858  -3.873  1.00 3.34  ? 35 ARG B NE     1  
ATOM 2631  C CZ     . ARG D 2 35 ? 25.222  -8.172  -4.620  1.00 3.60  ? 35 ARG B CZ     1  
ATOM 2632  N NH1    . ARG D 2 35 ? 24.822  -7.125  -5.332  1.00 3.81  ? 35 ARG B NH1    1  
ATOM 2633  N NH2    . ARG D 2 35 ? 26.497  -8.537  -4.668  1.00 3.91  ? 35 ARG B NH2    1  
ATOM 2634  H H      . ARG D 2 35 ? 23.815  -7.872  0.270   1.00 2.64  ? 35 ARG B H      1  
ATOM 2635  H HA     . ARG D 2 35 ? 21.148  -8.718  -0.076  1.00 2.44  ? 35 ARG B HA     1  
ATOM 2636  H HB2    . ARG D 2 35 ? 23.724  -9.632  -1.355  1.00 2.73  ? 35 ARG B HB2    1  
ATOM 2637  H HB3    . ARG D 2 35 ? 22.144  -10.228 -1.845  1.00 2.69  ? 35 ARG B HB3    1  
ATOM 2638  H HG2    . ARG D 2 35 ? 21.476  -7.896  -2.347  1.00 2.98  ? 35 ARG B HG2    1  
ATOM 2639  H HG3    . ARG D 2 35 ? 23.127  -7.388  -1.983  1.00 3.22  ? 35 ARG B HG3    1  
ATOM 2640  H HD2    . ARG D 2 35 ? 22.353  -9.385  -4.108  1.00 3.26  ? 35 ARG B HD2    1  
ATOM 2641  H HD3    . ARG D 2 35 ? 22.715  -7.686  -4.403  1.00 3.46  ? 35 ARG B HD3    1  
ATOM 2642  H HE     . ARG D 2 35 ? 24.675  -9.634  -3.362  1.00 3.45  ? 35 ARG B HE     1  
ATOM 2643  H HH11   . ARG D 2 35 ? 23.863  -6.838  -5.318  1.00 3.83  ? 35 ARG B HH11   1  
ATOM 2644  H HH12   . ARG D 2 35 ? 25.488  -6.612  -5.891  1.00 4.13  ? 35 ARG B HH12   1  
ATOM 2645  H HH21   . ARG D 2 35 ? 26.821  -9.331  -4.148  1.00 4.06  ? 35 ARG B HH21   1  
ATOM 2646  H HH22   . ARG D 2 35 ? 27.146  -8.015  -5.236  1.00 4.15  ? 35 ARG B HH22   1  
ATOM 2647  N N      . GLU D 2 36 ? 23.193  -10.845 1.316   1.00 2.21  ? 36 GLU B N      1  
ATOM 2648  C CA     . GLU D 2 36 ? 23.287  -12.085 2.071   1.00 2.13  ? 36 GLU B CA     1  
ATOM 2649  C C      . GLU D 2 36 ? 22.501  -11.999 3.376   1.00 2.03  ? 36 GLU B C      1  
ATOM 2650  O O      . GLU D 2 36 ? 21.947  -12.991 3.845   1.00 2.06  ? 36 GLU B O      1  
ATOM 2651  C CB     . GLU D 2 36 ? 24.753  -12.411 2.330   1.00 2.14  ? 36 GLU B CB     1  
ATOM 2652  C CG     . GLU D 2 36 ? 25.609  -12.248 1.085   1.00 2.40  ? 36 GLU B CG     1  
ATOM 2653  C CD     . GLU D 2 36 ? 27.025  -12.745 1.272   1.00 2.61  ? 36 GLU B CD     1  
ATOM 2654  O OE1    . GLU D 2 36 ? 27.203  -13.877 1.772   1.00 2.82  ? 36 GLU B OE1    1  
ATOM 2655  O OE2    . GLU D 2 36 ? 27.969  -12.012 0.914   1.00 2.94  ? 36 GLU B OE2    1  
ATOM 2656  H H      . GLU D 2 36 ? 23.984  -10.280 1.235   1.00 2.27  ? 36 GLU B H      1  
ATOM 2657  H HA     . GLU D 2 36 ? 22.859  -12.869 1.465   1.00 2.22  ? 36 GLU B HA     1  
ATOM 2658  H HB2    . GLU D 2 36 ? 25.131  -11.752 3.098   1.00 2.10  ? 36 GLU B HB2    1  
ATOM 2659  H HB3    . GLU D 2 36 ? 24.833  -13.433 2.668   1.00 2.20  ? 36 GLU B HB3    1  
ATOM 2660  H HG2    . GLU D 2 36 ? 25.154  -12.802 0.278   1.00 2.78  ? 36 GLU B HG2    1  
ATOM 2661  H HG3    . GLU D 2 36 ? 25.640  -11.195 0.824   1.00 2.47  ? 36 GLU B HG3    1  
ATOM 2662  N N      . LYS D 2 37 ? 22.452  -10.805 3.952   1.00 2.03  ? 37 LYS B N      1  
ATOM 2663  C CA     . LYS D 2 37 ? 21.729  -10.583 5.197   1.00 2.06  ? 37 LYS B CA     1  
ATOM 2664  C C      . LYS D 2 37 ? 20.229  -10.597 4.948   1.00 2.07  ? 37 LYS B C      1  
ATOM 2665  O O      . LYS D 2 37 ? 19.472  -11.210 5.699   1.00 2.14  ? 37 LYS B O      1  
ATOM 2666  C CB     . LYS D 2 37 ? 22.146  -9.257  5.833   1.00 2.19  ? 37 LYS B CB     1  
ATOM 2667  C CG     . LYS D 2 37 ? 22.913  -9.424  7.135   1.00 2.53  ? 37 LYS B CG     1  
ATOM 2668  C CD     . LYS D 2 37 ? 24.044  -8.416  7.251   1.00 2.52  ? 37 LYS B CD     1  
ATOM 2669  C CE     . LYS D 2 37 ? 23.525  -6.990  7.359   1.00 2.77  ? 37 LYS B CE     1  
ATOM 2670  N NZ     . LYS D 2 37 ? 22.976  -6.695  8.712   1.00 3.10  ? 37 LYS B NZ     1  
ATOM 2671  H H      . LYS D 2 37 ? 22.917  -10.055 3.529   1.00 2.08  ? 37 LYS B H      1  
ATOM 2672  H HA     . LYS D 2 37 ? 21.977  -11.390 5.871   1.00 2.08  ? 37 LYS B HA     1  
ATOM 2673  H HB2    . LYS D 2 37 ? 22.772  -8.718  5.137   1.00 2.31  ? 37 LYS B HB2    1  
ATOM 2674  H HB3    . LYS D 2 37 ? 21.260  -8.673  6.034   1.00 2.24  ? 37 LYS B HB3    1  
ATOM 2675  H HG2    . LYS D 2 37 ? 22.233  -9.284  7.962   1.00 2.82  ? 37 LYS B HG2    1  
ATOM 2676  H HG3    . LYS D 2 37 ? 23.326  -10.422 7.172   1.00 2.81  ? 37 LYS B HG3    1  
ATOM 2677  H HD2    . LYS D 2 37 ? 24.625  -8.642  8.133   1.00 2.54  ? 37 LYS B HD2    1  
ATOM 2678  H HD3    . LYS D 2 37 ? 24.672  -8.495  6.376   1.00 2.53  ? 37 LYS B HD3    1  
ATOM 2679  H HE2    . LYS D 2 37 ? 24.338  -6.310  7.151   1.00 3.03  ? 37 LYS B HE2    1  
ATOM 2680  H HE3    . LYS D 2 37 ? 22.741  -6.850  6.625   1.00 2.68  ? 37 LYS B HE3    1  
ATOM 2681  H HZ1    . LYS D 2 37 ? 22.803  -5.677  8.816   1.00 3.51  ? 37 LYS B HZ1    1  
ATOM 2682  H HZ2    . LYS D 2 37 ? 23.649  -6.997  9.454   1.00 3.04  ? 37 LYS B HZ2    1  
ATOM 2683  H HZ3    . LYS D 2 37 ? 22.075  -7.204  8.854   1.00 3.45  ? 37 LYS B HZ3    1  
ATOM 2684  N N      . VAL D 2 38 ? 19.804  -9.924  3.887   1.00 2.07  ? 38 VAL B N      1  
ATOM 2685  C CA     . VAL D 2 38 ? 18.390  -9.880  3.537   1.00 2.08  ? 38 VAL B CA     1  
ATOM 2686  C C      . VAL D 2 38 ? 17.944  -11.269 3.089   1.00 2.04  ? 38 VAL B C      1  
ATOM 2687  O O      . VAL D 2 38 ? 16.876  -11.744 3.472   1.00 2.07  ? 38 VAL B O      1  
ATOM 2688  C CB     . VAL D 2 38 ? 18.112  -8.826  2.452   1.00 2.17  ? 38 VAL B CB     1  
ATOM 2689  C CG1    . VAL D 2 38 ? 18.870  -7.545  2.766   1.00 2.33  ? 38 VAL B CG1    1  
ATOM 2690  C CG2    . VAL D 2 38 ? 18.458  -9.329  1.071   1.00 2.21  ? 38 VAL B CG2    1  
ATOM 2691  H H      . VAL D 2 38 ? 20.462  -9.454  3.317   1.00 2.10  ? 38 VAL B H      1  
ATOM 2692  H HA     . VAL D 2 38 ? 17.822  -9.601  4.418   1.00 2.14  ? 38 VAL B HA     1  
ATOM 2693  H HB     . VAL D 2 38 ? 17.061  -8.608  2.471   1.00 2.18  ? 38 VAL B HB     1  
ATOM 2694  H HG11   . VAL D 2 38 ? 19.919  -7.773  2.907   1.00 2.65  ? 38 VAL B HG11   1  
ATOM 2695  H HG12   . VAL D 2 38 ? 18.474  -7.102  3.669   1.00 2.45  ? 38 VAL B HG12   1  
ATOM 2696  H HG13   . VAL D 2 38 ? 18.760  -6.850  1.947   1.00 2.60  ? 38 VAL B HG13   1  
ATOM 2697  H HG21   . VAL D 2 38 ? 18.165  -8.595  0.336   1.00 2.56  ? 38 VAL B HG21   1  
ATOM 2698  H HG22   . VAL D 2 38 ? 17.931  -10.257 0.890   1.00 2.55  ? 38 VAL B HG22   1  
ATOM 2699  H HG23   . VAL D 2 38 ? 19.522  -9.500  1.010   1.00 2.23  ? 38 VAL B HG23   1  
ATOM 2700  N N      . GLU D 2 39 ? 18.793  -11.909 2.286   1.00 2.06  ? 39 GLU B N      1  
ATOM 2701  C CA     . GLU D 2 39 ? 18.555  -13.264 1.802   1.00 2.17  ? 39 GLU B CA     1  
ATOM 2702  C C      . GLU D 2 39 ? 18.386  -14.202 2.982   1.00 2.25  ? 39 GLU B C      1  
ATOM 2703  O O      . GLU D 2 39 ? 17.489  -15.043 2.991   1.00 2.39  ? 39 GLU B O      1  
ATOM 2704  C CB     . GLU D 2 39 ? 19.714  -13.749 0.926   1.00 2.31  ? 39 GLU B CB     1  
ATOM 2705  C CG     . GLU D 2 39 ? 19.425  -13.695 -0.565  1.00 2.51  ? 39 GLU B CG     1  
ATOM 2706  C CD     . GLU D 2 39 ? 20.410  -14.522 -1.377  1.00 2.75  ? 39 GLU B CD     1  
ATOM 2707  O OE1    . GLU D 2 39 ? 20.412  -15.764 -1.221  1.00 2.96  ? 39 GLU B OE1    1  
ATOM 2708  O OE2    . GLU D 2 39 ? 21.191  -13.939 -2.165  1.00 3.00  ? 39 GLU B OE2    1  
ATOM 2709  H H      . GLU D 2 39 ? 19.584  -11.426 1.972   1.00 2.08  ? 39 GLU B H      1  
ATOM 2710  H HA     . GLU D 2 39 ? 17.644  -13.259 1.221   1.00 2.19  ? 39 GLU B HA     1  
ATOM 2711  H HB2    . GLU D 2 39 ? 20.579  -13.134 1.124   1.00 2.25  ? 39 GLU B HB2    1  
ATOM 2712  H HB3    . GLU D 2 39 ? 19.944  -14.771 1.189   1.00 2.43  ? 39 GLU B HB3    1  
ATOM 2713  H HG2    . GLU D 2 39 ? 18.428  -14.075 -0.737  1.00 2.57  ? 39 GLU B HG2    1  
ATOM 2714  H HG3    . GLU D 2 39 ? 19.481  -12.666 -0.894  1.00 2.58  ? 39 GLU B HG3    1  
ATOM 2715  N N      . ALA D 2 40 ? 19.254  -14.055 3.982   1.00 2.22  ? 40 ALA B N      1  
ATOM 2716  C CA     . ALA D 2 40 ? 19.160  -14.883 5.173   1.00 2.38  ? 40 ALA B CA     1  
ATOM 2717  C C      . ALA D 2 40 ? 17.852  -14.602 5.877   1.00 2.45  ? 40 ALA B C      1  
ATOM 2718  O O      . ALA D 2 40 ? 17.079  -15.513 6.159   1.00 2.65  ? 40 ALA B O      1  
ATOM 2719  C CB     . ALA D 2 40 ? 20.312  -14.626 6.130   1.00 2.37  ? 40 ALA B CB     1  
ATOM 2720  H H      . ALA D 2 40 ? 19.973  -13.378 3.911   1.00 2.13  ? 40 ALA B H      1  
ATOM 2721  H HA     . ALA D 2 40 ? 19.187  -15.920 4.870   1.00 2.53  ? 40 ALA B HA     1  
ATOM 2722  H HB1    . ALA D 2 40 ? 20.667  -13.615 6.004   1.00 2.47  ? 40 ALA B HB1    1  
ATOM 2723  H HB2    . ALA D 2 40 ? 21.114  -15.321 5.927   1.00 2.67  ? 40 ALA B HB2    1  
ATOM 2724  H HB3    . ALA D 2 40 ? 19.961  -14.761 7.148   1.00 2.55  ? 40 ALA B HB3    1  
ATOM 2725  N N      . ALA D 2 41 ? 17.600  -13.324 6.130   1.00 2.34  ? 41 ALA B N      1  
ATOM 2726  C CA     . ALA D 2 41 ? 16.393  -12.906 6.811   1.00 2.45  ? 41 ALA B CA     1  
ATOM 2727  C C      . ALA D 2 41 ? 15.120  -13.446 6.170   1.00 2.47  ? 41 ALA B C      1  
ATOM 2728  O O      . ALA D 2 41 ? 14.293  -14.055 6.847   1.00 2.68  ? 41 ALA B O      1  
ATOM 2729  C CB     . ALA D 2 41 ? 16.342  -11.403 6.851   1.00 2.39  ? 41 ALA B CB     1  
ATOM 2730  H H      . ALA D 2 41 ? 18.265  -12.633 5.869   1.00 2.23  ? 41 ALA B H      1  
ATOM 2731  H HA     . ALA D 2 41 ? 16.447  -13.263 7.827   1.00 2.64  ? 41 ALA B HA     1  
ATOM 2732  H HB1    . ALA D 2 41 ? 16.394  -11.023 5.843   1.00 2.56  ? 41 ALA B HB1    1  
ATOM 2733  H HB2    . ALA D 2 41 ? 17.176  -11.030 7.425   1.00 2.62  ? 41 ALA B HB2    1  
ATOM 2734  H HB3    . ALA D 2 41 ? 15.416  -11.090 7.308   1.00 2.58  ? 41 ALA B HB3    1  
ATOM 2735  N N      . MET D 2 42 ? 14.971  -13.245 4.870   1.00 2.31  ? 42 MET B N      1  
ATOM 2736  C CA     . MET D 2 42 ? 13.789  -13.717 4.166   1.00 2.35  ? 42 MET B CA     1  
ATOM 2737  C C      . MET D 2 42 ? 13.722  -15.239 4.196   1.00 2.59  ? 42 MET B C      1  
ATOM 2738  O O      . MET D 2 42 ? 12.643  -15.813 4.227   1.00 2.74  ? 42 MET B O      1  
ATOM 2739  C CB     . MET D 2 42 ? 13.728  -13.196 2.729   1.00 2.21  ? 42 MET B CB     1  
ATOM 2740  C CG     . MET D 2 42 ? 14.932  -13.544 1.892   1.00 2.23  ? 42 MET B CG     1  
ATOM 2741  S SD     . MET D 2 42 ? 14.967  -12.630 0.342   1.00 2.21  ? 42 MET B SD     1  
ATOM 2742  C CE     . MET D 2 42 ? 14.916  -10.963 0.985   1.00 2.06  ? 42 MET B CE     1  
ATOM 2743  H H      . MET D 2 42 ? 15.671  -12.765 4.371   1.00 2.20  ? 42 MET B H      1  
ATOM 2744  H HA     . MET D 2 42 ? 12.931  -13.328 4.694   1.00 2.39  ? 42 MET B HA     1  
ATOM 2745  H HB2    . MET D 2 42 ? 12.854  -13.608 2.247   1.00 2.28  ? 42 MET B HB2    1  
ATOM 2746  H HB3    . MET D 2 42 ? 13.634  -12.120 2.754   1.00 2.11  ? 42 MET B HB3    1  
ATOM 2747  H HG2    . MET D 2 42 ? 15.819  -13.298 2.456   1.00 2.18  ? 42 MET B HG2    1  
ATOM 2748  H HG3    . MET D 2 42 ? 14.911  -14.600 1.681   1.00 2.38  ? 42 MET B HG3    1  
ATOM 2749  H HE1    . MET D 2 42 ? 14.592  -10.284 0.210   1.00 2.35  ? 42 MET B HE1    1  
ATOM 2750  H HE2    . MET D 2 42 ? 15.903  -10.680 1.326   1.00 2.16  ? 42 MET B HE2    1  
ATOM 2751  H HE3    . MET D 2 42 ? 14.222  -10.925 1.817   1.00 2.35  ? 42 MET B HE3    1  
ATOM 2752  N N      . ALA D 2 43 ? 14.884  -15.886 4.204   1.00 2.65  ? 43 ALA B N      1  
ATOM 2753  C CA     . ALA D 2 43 ? 14.938  -17.344 4.191   1.00 2.94  ? 43 ALA B CA     1  
ATOM 2754  C C      . ALA D 2 43 ? 14.460  -17.925 5.514   1.00 3.17  ? 43 ALA B C      1  
ATOM 2755  O O      . ALA D 2 43 ? 13.719  -18.909 5.543   1.00 3.43  ? 43 ALA B O      1  
ATOM 2756  C CB     . ALA D 2 43 ? 16.347  -17.829 3.882   1.00 2.97  ? 43 ALA B CB     1  
ATOM 2757  H H      . ALA D 2 43 ? 15.724  -15.372 4.295   1.00 2.53  ? 43 ALA B H      1  
ATOM 2758  H HA     . ALA D 2 43 ? 14.285  -17.692 3.404   1.00 3.01  ? 43 ALA B HA     1  
ATOM 2759  H HB1    . ALA D 2 43 ? 16.673  -17.411 2.941   1.00 3.11  ? 43 ALA B HB1    1  
ATOM 2760  H HB2    . ALA D 2 43 ? 16.350  -18.907 3.817   1.00 3.03  ? 43 ALA B HB2    1  
ATOM 2761  H HB3    . ALA D 2 43 ? 17.017  -17.513 4.668   1.00 3.28  ? 43 ALA B HB3    1  
ATOM 2762  N N      . GLU D 2 44 ? 14.888  -17.308 6.605   1.00 3.13  ? 44 GLU B N      1  
ATOM 2763  C CA     . GLU D 2 44 ? 14.517  -17.762 7.939   1.00 3.41  ? 44 GLU B CA     1  
ATOM 2764  C C      . GLU D 2 44 ? 13.052  -17.505 8.212   1.00 3.51  ? 44 GLU B C      1  
ATOM 2765  O O      . GLU D 2 44 ? 12.336  -18.361 8.732   1.00 3.81  ? 44 GLU B O      1  
ATOM 2766  C CB     . GLU D 2 44 ? 15.341  -17.027 8.977   1.00 3.38  ? 44 GLU B CB     1  
ATOM 2767  C CG     . GLU D 2 44 ? 16.824  -17.076 8.712   1.00 3.23  ? 44 GLU B CG     1  
ATOM 2768  C CD     . GLU D 2 44 ? 17.417  -18.456 8.968   1.00 3.42  ? 44 GLU B CD     1  
ATOM 2769  O OE1    . GLU D 2 44 ? 16.936  -19.153 9.894   1.00 3.67  ? 44 GLU B OE1    1  
ATOM 2770  O OE2    . GLU D 2 44 ? 18.355  -18.851 8.247   1.00 3.57  ? 44 GLU B OE2    1  
ATOM 2771  H H      . GLU D 2 44 ? 15.477  -16.519 6.513   1.00 2.94  ? 44 GLU B H      1  
ATOM 2772  H HA     . GLU D 2 44 ? 14.712  -18.819 8.006   1.00 3.62  ? 44 GLU B HA     1  
ATOM 2773  H HB2    . GLU D 2 44 ? 15.036  -15.991 8.984   1.00 3.25  ? 44 GLU B HB2    1  
ATOM 2774  H HB3    . GLU D 2 44 ? 15.152  -17.460 9.947   1.00 3.64  ? 44 GLU B HB3    1  
ATOM 2775  H HG2    . GLU D 2 44 ? 16.991  -16.800 7.674   1.00 3.07  ? 44 GLU B HG2    1  
ATOM 2776  H HG3    . GLU D 2 44 ? 17.305  -16.353 9.356   1.00 3.20  ? 44 GLU B HG3    1  
ATOM 2777  N N      . LEU D 2 45 ? 12.613  -16.314 7.855   1.00 3.28  ? 45 LEU B N      1  
ATOM 2778  C CA     . LEU D 2 45 ? 11.227  -15.926 8.065   1.00 3.36  ? 45 LEU B CA     1  
ATOM 2779  C C      . LEU D 2 45 ? 10.333  -16.501 6.974   1.00 3.35  ? 45 LEU B C      1  
ATOM 2780  O O      . LEU D 2 45 ? 9.125   -16.256 6.965   1.00 3.40  ? 45 LEU B O      1  
ATOM 2781  C CB     . LEU D 2 45 ? 11.096  -14.399 8.087   1.00 3.17  ? 45 LEU B CB     1  
ATOM 2782  C CG     . LEU D 2 45 ? 12.180  -13.649 8.870   1.00 3.15  ? 45 LEU B CG     1  
ATOM 2783  C CD1    . LEU D 2 45 ? 11.789  -12.189 9.045   1.00 3.11  ? 45 LEU B CD1    1  
ATOM 2784  C CD2    . LEU D 2 45 ? 12.439  -14.310 10.217  1.00 3.47  ? 45 LEU B CD2    1  
ATOM 2785  H H      . LEU D 2 45 ? 13.251  -15.663 7.472   1.00 3.07  ? 45 LEU B H      1  
ATOM 2786  H HA     . LEU D 2 45 ? 10.912  -16.319 9.019   1.00 3.61  ? 45 LEU B HA     1  
ATOM 2787  H HB2    . LEU D 2 45 ? 11.113  -14.046 7.067   1.00 2.94  ? 45 LEU B HB2    1  
ATOM 2788  H HB3    . LEU D 2 45 ? 10.138  -14.150 8.518   1.00 3.30  ? 45 LEU B HB3    1  
ATOM 2789  H HG     . LEU D 2 45 ? 13.104  -13.677 8.305   1.00 2.97  ? 45 LEU B HG     1  
ATOM 2790  H HD11   . LEU D 2 45 ? 11.712  -11.719 8.074   1.00 3.15  ? 45 LEU B HD11   1  
ATOM 2791  H HD12   . LEU D 2 45 ? 12.541  -11.681 9.631   1.00 3.48  ? 45 LEU B HD12   1  
ATOM 2792  H HD13   . LEU D 2 45 ? 10.837  -12.126 9.550   1.00 3.16  ? 45 LEU B HD13   1  
ATOM 2793  H HD21   . LEU D 2 45 ? 11.498  -14.569 10.679  1.00 3.59  ? 45 LEU B HD21   1  
ATOM 2794  H HD22   . LEU D 2 45 ? 12.980  -13.628 10.854  1.00 3.86  ? 45 LEU B HD22   1  
ATOM 2795  H HD23   . LEU D 2 45 ? 13.028  -15.207 10.065  1.00 3.59  ? 45 LEU B HD23   1  
ATOM 2796  N N      . ASN D 2 46 ? 10.944  -17.255 6.055   1.00 3.31  ? 46 ASN B N      1  
ATOM 2797  C CA     . ASN D 2 46 ? 10.242  -17.887 4.928   1.00 3.36  ? 46 ASN B CA     1  
ATOM 2798  C C      . ASN D 2 46 ? 9.892   -16.837 3.877   1.00 3.04  ? 46 ASN B C      1  
ATOM 2799  O O      . ASN D 2 46 ? 10.208  -17.003 2.702   1.00 3.00  ? 46 ASN B O      1  
ATOM 2800  C CB     . ASN D 2 46 ? 8.984   -18.633 5.399   1.00 3.70  ? 46 ASN B CB     1  
ATOM 2801  C CG     . ASN D 2 46 ? 8.271   -19.374 4.280   1.00 3.87  ? 46 ASN B CG     1  
ATOM 2802  O OD1    . ASN D 2 46 ? 8.534   -20.551 4.028   1.00 4.39  ? 46 ASN B OD1    1  
ATOM 2803  N ND2    . ASN D 2 46 ? 7.351   -18.697 3.607   1.00 3.66  ? 46 ASN B ND2    1  
ATOM 2804  H H      . ASN D 2 46 ? 11.917  -17.375 6.126   1.00 3.28  ? 46 ASN B H      1  
ATOM 2805  H HA     . ASN D 2 46 ? 10.923  -18.599 4.483   1.00 3.43  ? 46 ASN B HA     1  
ATOM 2806  H HB2    . ASN D 2 46 ? 9.265   -19.352 6.154   1.00 3.92  ? 46 ASN B HB2    1  
ATOM 2807  H HB3    . ASN D 2 46 ? 8.300   -17.920 5.830   1.00 3.68  ? 46 ASN B HB3    1  
ATOM 2808  H HD21   . ASN D 2 46 ? 7.182   -17.768 3.862   1.00 3.54  ? 46 ASN B HD21   1  
ATOM 2809  H HD22   . ASN D 2 46 ? 6.881   -19.156 2.881   1.00 3.80  ? 46 ASN B HD22   1  
ATOM 2810  N N      . TYR D 2 47 ? 9.247   -15.761 4.334   1.00 2.97  ? 47 TYR B N      1  
ATOM 2811  C CA     . TYR D 2 47 ? 8.857   -14.628 3.495   1.00 2.69  ? 47 TYR B CA     1  
ATOM 2812  C C      . TYR D 2 47 ? 8.090   -15.053 2.236   1.00 2.74  ? 47 TYR B C      1  
ATOM 2813  O O      . TYR D 2 47 ? 8.670   -15.439 1.220   1.00 2.93  ? 47 TYR B O      1  
ATOM 2814  C CB     . TYR D 2 47 ? 10.094  -13.789 3.140   1.00 2.42  ? 47 TYR B CB     1  
ATOM 2815  C CG     . TYR D 2 47 ? 9.780   -12.563 2.317   1.00 2.23  ? 47 TYR B CG     1  
ATOM 2816  C CD1    . TYR D 2 47 ? 8.570   -11.899 2.469   1.00 2.21  ? 47 TYR B CD1    1  
ATOM 2817  C CD2    . TYR D 2 47 ? 10.679  -12.086 1.370   1.00 2.14  ? 47 TYR B CD2    1  
ATOM 2818  C CE1    . TYR D 2 47 ? 8.255   -10.806 1.693   1.00 2.09  ? 47 TYR B CE1    1  
ATOM 2819  C CE2    . TYR D 2 47 ? 10.375  -10.987 0.599   1.00 2.07  ? 47 TYR B CE2    1  
ATOM 2820  C CZ     . TYR D 2 47 ? 9.159   -10.356 0.757   1.00 2.05  ? 47 TYR B CZ     1  
ATOM 2821  O OH     . TYR D 2 47 ? 8.843   -9.281  -0.039  1.00 2.04  ? 47 TYR B OH     1  
ATOM 2822  H H      . TYR D 2 47 ? 9.027   -15.730 5.291   1.00 3.22  ? 47 TYR B H      1  
ATOM 2823  H HA     . TYR D 2 47 ? 8.197   -14.012 4.088   1.00 2.72  ? 47 TYR B HA     1  
ATOM 2824  H HB2    . TYR D 2 47 ? 10.571  -13.462 4.052   1.00 2.42  ? 47 TYR B HB2    1  
ATOM 2825  H HB3    . TYR D 2 47 ? 10.785  -14.400 2.578   1.00 2.44  ? 47 TYR B HB3    1  
ATOM 2826  H HD1    . TYR D 2 47 ? 7.864   -12.259 3.203   1.00 2.34  ? 47 TYR B HD1    1  
ATOM 2827  H HD2    . TYR D 2 47 ? 11.641  -12.572 1.257   1.00 2.18  ? 47 TYR B HD2    1  
ATOM 2828  H HE1    . TYR D 2 47 ? 7.313   -10.299 1.836   1.00 2.09  ? 47 TYR B HE1    1  
ATOM 2829  H HE2    . TYR D 2 47 ? 11.085  -10.634 -0.132  1.00 2.09  ? 47 TYR B HE2    1  
ATOM 2830  H HH     . TYR D 2 47 ? 9.323   -9.354  -0.867  1.00 2.43  ? 47 TYR B HH     1  
ATOM 2831  N N      . ILE D 2 48 ? 6.770   -14.954 2.315   1.00 2.73  ? 48 ILE B N      1  
ATOM 2832  C CA     . ILE D 2 48 ? 5.905   -15.311 1.198   1.00 2.82  ? 48 ILE B CA     1  
ATOM 2833  C C      . ILE D 2 48 ? 5.955   -14.226 0.118   1.00 2.64  ? 48 ILE B C      1  
ATOM 2834  O O      . ILE D 2 48 ? 6.241   -13.064 0.414   1.00 2.54  ? 48 ILE B O      1  
ATOM 2835  C CB     . ILE D 2 48 ? 4.436   -15.536 1.652   1.00 3.08  ? 48 ILE B CB     1  
ATOM 2836  C CG1    . ILE D 2 48 ? 3.706   -14.202 1.897   1.00 3.43  ? 48 ILE B CG1    1  
ATOM 2837  C CG2    . ILE D 2 48 ? 4.394   -16.406 2.902   1.00 3.18  ? 48 ILE B CG2    1  
ATOM 2838  C CD1    . ILE D 2 48 ? 4.138   -13.471 3.152   1.00 3.97  ? 48 ILE B CD1    1  
ATOM 2839  H H      . ILE D 2 48 ? 6.368   -14.621 3.140   1.00 2.78  ? 48 ILE B H      1  
ATOM 2840  H HA     . ILE D 2 48 ? 6.274   -16.234 0.778   1.00 3.02  ? 48 ILE B HA     1  
ATOM 2841  H HB     . ILE D 2 48 ? 3.927   -16.071 0.864   1.00 3.47  ? 48 ILE B HB     1  
ATOM 2842  H HG12   . ILE D 2 48 ? 3.886   -13.546 1.059   1.00 3.86  ? 48 ILE B HG12   1  
ATOM 2843  H HG13   . ILE D 2 48 ? 2.645   -14.393 1.973   1.00 3.46  ? 48 ILE B HG13   1  
ATOM 2844  H HG21   . ILE D 2 48 ? 3.367   -16.627 3.152   1.00 3.66  ? 48 ILE B HG21   1  
ATOM 2845  H HG22   . ILE D 2 48 ? 4.857   -15.878 3.724   1.00 3.18  ? 48 ILE B HG22   1  
ATOM 2846  H HG23   . ILE D 2 48 ? 4.927   -17.327 2.719   1.00 3.35  ? 48 ILE B HG23   1  
ATOM 2847  H HD11   . ILE D 2 48 ? 3.976   -14.105 4.011   1.00 4.28  ? 48 ILE B HD11   1  
ATOM 2848  H HD12   . ILE D 2 48 ? 3.561   -12.565 3.258   1.00 4.27  ? 48 ILE B HD12   1  
ATOM 2849  H HD13   . ILE D 2 48 ? 5.187   -13.224 3.080   1.00 4.29  ? 48 ILE B HD13   1  
ATOM 2850  N N      . PRO D 2 49 ? 5.680   -14.589 -1.148  1.00 2.84  ? 49 PRO B N      1  
ATOM 2851  C CA     . PRO D 2 49 ? 5.700   -13.641 -2.273  1.00 2.94  ? 49 PRO B CA     1  
ATOM 2852  C C      . PRO D 2 49 ? 4.511   -12.673 -2.266  1.00 2.85  ? 49 PRO B C      1  
ATOM 2853  O O      . PRO D 2 49 ? 3.784   -12.555 -3.253  1.00 3.26  ? 49 PRO B O      1  
ATOM 2854  C CB     . PRO D 2 49 ? 5.641   -14.555 -3.499  1.00 3.45  ? 49 PRO B CB     1  
ATOM 2855  C CG     . PRO D 2 49 ? 4.939   -15.779 -3.024  1.00 3.66  ? 49 PRO B CG     1  
ATOM 2856  C CD     . PRO D 2 49 ? 5.344   -15.957 -1.587  1.00 3.26  ? 49 PRO B CD     1  
ATOM 2857  H HA     . PRO D 2 49 ? 6.618   -13.074 -2.291  1.00 3.03  ? 49 PRO B HA     1  
ATOM 2858  H HB2    . PRO D 2 49 ? 5.091   -14.065 -4.290  1.00 3.56  ? 49 PRO B HB2    1  
ATOM 2859  H HB3    . PRO D 2 49 ? 6.642   -14.779 -3.834  1.00 3.77  ? 49 PRO B HB3    1  
ATOM 2860  H HG2    . PRO D 2 49 ? 3.871   -15.642 -3.099  1.00 3.82  ? 49 PRO B HG2    1  
ATOM 2861  H HG3    . PRO D 2 49 ? 5.251   -16.631 -3.610  1.00 4.15  ? 49 PRO B HG3    1  
ATOM 2862  H HD2    . PRO D 2 49 ? 4.521   -16.355 -1.011  1.00 3.34  ? 49 PRO B HD2    1  
ATOM 2863  H HD3    . PRO D 2 49 ? 6.204   -16.606 -1.515  1.00 3.40  ? 49 PRO B HD3    1  
ATOM 2864  N N      . ASN D 2 50 ? 4.326   -11.978 -1.153  1.00 2.80  ? 50 ASN B N      1  
ATOM 2865  C CA     . ASN D 2 50 ? 3.239   -11.018 -1.017  1.00 3.03  ? 50 ASN B CA     1  
ATOM 2866  C C      . ASN D 2 50 ? 3.605   -9.949  0.005   1.00 3.35  ? 50 ASN B C      1  
ATOM 2867  O O      . ASN D 2 50 ? 3.086   -9.931  1.125   1.00 4.09  ? 50 ASN B O      1  
ATOM 2868  C CB     . ASN D 2 50 ? 1.938   -11.716 -0.603  1.00 3.59  ? 50 ASN B CB     1  
ATOM 2869  C CG     . ASN D 2 50 ? 0.742   -10.778 -0.637  1.00 4.23  ? 50 ASN B CG     1  
ATOM 2870  O OD1    . ASN D 2 50 ? 0.632   -9.921  -1.513  1.00 4.21  ? 50 ASN B OD1    1  
ATOM 2871  N ND2    . ASN D 2 50 ? -0.159  -10.931 0.322   1.00 5.11  ? 50 ASN B ND2    1  
ATOM 2872  H H      . ASN D 2 50 ? 4.943   -12.116 -0.397  1.00 2.94  ? 50 ASN B H      1  
ATOM 2873  H HA     . ASN D 2 50 ? 3.095   -10.545 -1.977  1.00 3.22  ? 50 ASN B HA     1  
ATOM 2874  H HB2    . ASN D 2 50 ? 1.747   -12.537 -1.278  1.00 3.78  ? 50 ASN B HB2    1  
ATOM 2875  H HB3    . ASN D 2 50 ? 2.046   -12.098 0.401   1.00 3.85  ? 50 ASN B HB3    1  
ATOM 2876  H HD21   . ASN D 2 50 ? -0.010  -11.632 0.992   1.00 5.34  ? 50 ASN B HD21   1  
ATOM 2877  H HD22   . ASN D 2 50 ? -0.943  -10.335 0.323   1.00 5.63  ? 50 ASN B HD22   1  
ATOM 2878  N N      . ARG D 2 51 ? 4.515   -9.063  -0.379  1.00 3.35  ? 51 ARG B N      1  
ATOM 2879  C CA     . ARG D 2 51 ? 4.948   -7.991  0.505   1.00 4.19  ? 51 ARG B CA     1  
ATOM 2880  C C      . ARG D 2 51 ? 3.858   -6.934  0.610   1.00 4.47  ? 51 ARG B C      1  
ATOM 2881  O O      . ARG D 2 51 ? 3.540   -6.456  1.698   1.00 5.22  ? 51 ARG B O      1  
ATOM 2882  C CB     . ARG D 2 51 ? 6.265   -7.372  0.014   1.00 4.85  ? 51 ARG B CB     1  
ATOM 2883  C CG     . ARG D 2 51 ? 6.218   -6.827  -1.408  1.00 5.60  ? 51 ARG B CG     1  
ATOM 2884  C CD     . ARG D 2 51 ? 7.608   -6.751  -2.019  1.00 6.31  ? 51 ARG B CD     1  
ATOM 2885  N NE     . ARG D 2 51 ? 7.676   -5.807  -3.138  1.00 6.87  ? 51 ARG B NE     1  
ATOM 2886  C CZ     . ARG D 2 51 ? 8.154   -6.110  -4.347  1.00 7.58  ? 51 ARG B CZ     1  
ATOM 2887  N NH1    . ARG D 2 51 ? 8.540   -7.352  -4.625  1.00 7.81  ? 51 ARG B NH1    1  
ATOM 2888  N NH2    . ARG D 2 51 ? 8.236   -5.168  -5.280  1.00 8.32  ? 51 ARG B NH2    1  
ATOM 2889  H H      . ARG D 2 51 ? 4.899   -9.131  -1.276  1.00 3.15  ? 51 ARG B H      1  
ATOM 2890  H HA     . ARG D 2 51 ? 5.106   -8.419  1.484   1.00 4.57  ? 51 ARG B HA     1  
ATOM 2891  H HB2    . ARG D 2 51 ? 6.532   -6.561  0.674   1.00 4.80  ? 51 ARG B HB2    1  
ATOM 2892  H HB3    . ARG D 2 51 ? 7.038   -8.126  0.059   1.00 5.25  ? 51 ARG B HB3    1  
ATOM 2893  H HG2    . ARG D 2 51 ? 5.604   -7.477  -2.013  1.00 5.78  ? 51 ARG B HG2    1  
ATOM 2894  H HG3    . ARG D 2 51 ? 5.787   -5.836  -1.389  1.00 5.84  ? 51 ARG B HG3    1  
ATOM 2895  H HD2    . ARG D 2 51 ? 8.305   -6.438  -1.256  1.00 6.51  ? 51 ARG B HD2    1  
ATOM 2896  H HD3    . ARG D 2 51 ? 7.884   -7.734  -2.374  1.00 6.56  ? 51 ARG B HD3    1  
ATOM 2897  H HE     . ARG D 2 51 ? 7.371   -4.888  -2.967  1.00 6.93  ? 51 ARG B HE     1  
ATOM 2898  H HH11   . ARG D 2 51 ? 8.475   -8.067  -3.927  1.00 7.47  ? 51 ARG B HH11   1  
ATOM 2899  H HH12   . ARG D 2 51 ? 8.899   -7.577  -5.534  1.00 8.49  ? 51 ARG B HH12   1  
ATOM 2900  H HH21   . ARG D 2 51 ? 7.938   -4.227  -5.076  1.00 8.37  ? 51 ARG B HH21   1  
ATOM 2901  H HH22   . ARG D 2 51 ? 8.605   -5.381  -6.190  1.00 8.97  ? 51 ARG B HH22   1  
ATOM 2902  N N      . CYS D 2 52 ? 3.260   -6.611  -0.523  1.00 4.27  ? 52 CYS B N      1  
ATOM 2903  C CA     . CYS D 2 52 ? 2.202   -5.622  -0.579  1.00 4.94  ? 52 CYS B CA     1  
ATOM 2904  C C      . CYS D 2 52 ? 0.846   -6.298  -0.525  1.00 5.55  ? 52 CYS B C      1  
ATOM 2905  O O      . CYS D 2 52 ? 0.399   -6.714  0.549   1.00 6.12  ? 52 CYS B O      1  
ATOM 2906  C CB     . CYS D 2 52 ? 2.350   -4.771  -1.843  1.00 5.05  ? 52 CYS B CB     1  
ATOM 2907  S SG     . CYS D 2 52 ? 2.917   -5.706  -3.306  1.00 5.08  ? 52 CYS B SG     1  
ATOM 2908  H H      . CYS D 2 52 ? 3.533   -7.057  -1.350  1.00 3.94  ? 52 CYS B H      1  
ATOM 2909  H HA     . CYS D 2 52 ? 2.287   -4.985  0.284   1.00 5.36  ? 52 CYS B HA     1  
ATOM 2910  H HB2    . CYS D 2 52 ? 1.396   -4.330  -2.085  1.00 5.09  ? 52 CYS B HB2    1  
ATOM 2911  H HB3    . CYS D 2 52 ? 3.069   -3.988  -1.656  1.00 5.59  ? 52 CYS B HB3    1  
ATOM 2912  N N      . ALA D 2 53 ? 0.217   -6.450  -1.677  1.00 5.80  ? 53 ALA B N      1  
ATOM 2913  C CA     . ALA D 2 53 ? -1.092  -7.056  -1.745  1.00 6.71  ? 53 ALA B CA     1  
ATOM 2914  C C      . ALA D 2 53 ? -1.396  -7.515  -3.165  1.00 7.17  ? 53 ALA B C      1  
ATOM 2915  O O      . ALA D 2 53 ? -2.038  -6.808  -3.938  1.00 7.21  ? 53 ALA B O      1  
ATOM 2916  C CB     . ALA D 2 53 ? -2.124  -6.060  -1.247  1.00 7.44  ? 53 ALA B CB     1  
ATOM 2917  H H      . ALA D 2 53 ? 0.645   -6.147  -2.506  1.00 5.59  ? 53 ALA B H      1  
ATOM 2918  H HA     . ALA D 2 53 ? -1.102  -7.912  -1.087  1.00 6.85  ? 53 ALA B HA     1  
ATOM 2919  H HB1    . ALA D 2 53 ? -2.959  -6.587  -0.814  1.00 7.46  ? 53 ALA B HB1    1  
ATOM 2920  H HB2    . ALA D 2 53 ? -2.465  -5.452  -2.072  1.00 7.68  ? 53 ALA B HB2    1  
ATOM 2921  H HB3    . ALA D 2 53 ? -1.663  -5.426  -0.497  1.00 7.92  ? 53 ALA B HB3    1  
ATOM 2922  N N      . GLN D 2 54 ? -0.890  -8.691  -3.508  1.00 7.80  ? 54 GLN B N      1  
ATOM 2923  C CA     . GLN D 2 54 ? -1.097  -9.257  -4.832  1.00 8.54  ? 54 GLN B CA     1  
ATOM 2924  C C      . GLN D 2 54 ? -2.380  -10.080 -4.871  1.00 9.32  ? 54 GLN B C      1  
ATOM 2925  O O      . GLN D 2 54 ? -3.260  -9.840  -5.694  1.00 9.60  ? 54 GLN B O      1  
ATOM 2926  C CB     . GLN D 2 54 ? 0.100   -10.127 -5.224  1.00 9.06  ? 54 GLN B CB     1  
ATOM 2927  C CG     . GLN D 2 54 ? -0.061  -10.817 -6.568  1.00 9.39  ? 54 GLN B CG     1  
ATOM 2928  C CD     . GLN D 2 54 ? 1.100   -11.733 -6.896  1.00 9.99  ? 54 GLN B CD     1  
ATOM 2929  O OE1    . GLN D 2 54 ? 1.100   -12.910 -6.536  1.00 10.19 ? 54 GLN B OE1    1  
ATOM 2930  N NE2    . GLN D 2 54 ? 2.097   -11.199 -7.582  1.00 10.52 ? 54 GLN B NE2    1  
ATOM 2931  H H      . GLN D 2 54 ? -0.356  -9.190  -2.850  1.00 7.92  ? 54 GLN B H      1  
ATOM 2932  H HA     . GLN D 2 54 ? -1.184  -8.441  -5.534  1.00 8.43  ? 54 GLN B HA     1  
ATOM 2933  H HB2    . GLN D 2 54 ? 0.983   -9.506  -5.267  1.00 9.19  ? 54 GLN B HB2    1  
ATOM 2934  H HB3    . GLN D 2 54 ? 0.241   -10.886 -4.469  1.00 9.38  ? 54 GLN B HB3    1  
ATOM 2935  H HG2    . GLN D 2 54 ? -0.967  -11.404 -6.551  1.00 9.55  ? 54 GLN B HG2    1  
ATOM 2936  H HG3    . GLN D 2 54 ? -0.135  -10.064 -7.339  1.00 9.30  ? 54 GLN B HG3    1  
ATOM 2937  H HE21   . GLN D 2 54 ? 2.033   -10.256 -7.832  1.00 10.50 ? 54 GLN B HE21   1  
ATOM 2938  H HE22   . GLN D 2 54 ? 2.859   -11.774 -7.823  1.00 11.04 ? 54 GLN B HE22   1  
ATOM 2939  N N      . GLN D 2 55 ? -2.474  -11.055 -3.977  1.00 9.86  ? 55 GLN B N      1  
ATOM 2940  C CA     . GLN D 2 55 ? -3.647  -11.917 -3.904  1.00 10.79 ? 55 GLN B CA     1  
ATOM 2941  C C      . GLN D 2 55 ? -4.093  -12.081 -2.455  1.00 11.03 ? 55 GLN B C      1  
ATOM 2942  O O      . GLN D 2 55 ? -4.817  -13.013 -2.114  1.00 11.89 ? 55 GLN B O      1  
ATOM 2943  C CB     . GLN D 2 55 ? -3.353  -13.285 -4.536  1.00 11.59 ? 55 GLN B CB     1  
ATOM 2944  C CG     . GLN D 2 55 ? -1.909  -13.744 -4.380  1.00 11.64 ? 55 GLN B CG     1  
ATOM 2945  C CD     . GLN D 2 55 ? -1.633  -15.061 -5.083  1.00 12.17 ? 55 GLN B CD     1  
ATOM 2946  O OE1    . GLN D 2 55 ? -2.498  -15.932 -5.165  1.00 12.46 ? 55 GLN B OE1    1  
ATOM 2947  N NE2    . GLN D 2 55 ? -0.428  -15.208 -5.612  1.00 12.48 ? 55 GLN B NE2    1  
ATOM 2948  H H      . GLN D 2 55 ? -1.735  -11.202 -3.353  1.00 9.74  ? 55 GLN B H      1  
ATOM 2949  H HA     . GLN D 2 55 ? -4.441  -11.439 -4.457  1.00 10.96 ? 55 GLN B HA     1  
ATOM 2950  H HB2    . GLN D 2 55 ? -3.992  -14.024 -4.077  1.00 12.06 ? 55 GLN B HB2    1  
ATOM 2951  H HB3    . GLN D 2 55 ? -3.579  -13.235 -5.591  1.00 11.87 ? 55 GLN B HB3    1  
ATOM 2952  H HG2    . GLN D 2 55 ? -1.259  -12.989 -4.796  1.00 11.18 ? 55 GLN B HG2    1  
ATOM 2953  H HG3    . GLN D 2 55 ? -1.695  -13.862 -3.328  1.00 11.94 ? 55 GLN B HG3    1  
ATOM 2954  H HE21   . GLN D 2 55 ? 0.212   -14.467 -5.527  1.00 12.35 ? 55 GLN B HE21   1  
ATOM 2955  H HE22   . GLN D 2 55 ? -0.221  -16.053 -6.062  1.00 12.93 ? 55 GLN B HE22   1  
ATOM 2956  N N      . LEU D 2 56 ? -3.658  -11.152 -1.613  1.00 10.42 ? 56 LEU B N      1  
ATOM 2957  C CA     . LEU D 2 56 ? -3.996  -11.167 -0.196  1.00 10.83 ? 56 LEU B CA     1  
ATOM 2958  C C      . LEU D 2 56 ? -3.715  -9.795  0.405   1.00 10.86 ? 56 LEU B C      1  
ATOM 2959  O O      . LEU D 2 56 ? -2.590  -9.294  0.319   1.00 10.80 ? 56 LEU B O      1  
ATOM 2960  C CB     . LEU D 2 56 ? -3.187  -12.252 0.536   1.00 10.96 ? 56 LEU B CB     1  
ATOM 2961  C CG     . LEU D 2 56 ? -3.793  -12.775 1.848   1.00 11.51 ? 56 LEU B CG     1  
ATOM 2962  C CD1    . LEU D 2 56 ? -3.501  -11.826 3.001   1.00 11.92 ? 56 LEU B CD1    1  
ATOM 2963  C CD2    . LEU D 2 56 ? -5.293  -12.991 1.701   1.00 11.84 ? 56 LEU B CD2    1  
ATOM 2964  H H      . LEU D 2 56 ? -3.102  -10.423 -1.958  1.00 9.81  ? 56 LEU B H      1  
ATOM 2965  H HA     . LEU D 2 56 ? -5.050  -11.383 -0.104  1.00 11.28 ? 56 LEU B HA     1  
ATOM 2966  H HB2    . LEU D 2 56 ? -3.067  -13.090 -0.135  1.00 10.74 ? 56 LEU B HB2    1  
ATOM 2967  H HB3    . LEU D 2 56 ? -2.209  -11.850 0.755   1.00 11.09 ? 56 LEU B HB3    1  
ATOM 2968  H HG     . LEU D 2 56 ? -3.342  -13.728 2.084   1.00 11.60 ? 56 LEU B HG     1  
ATOM 2969  H HD11   . LEU D 2 56 ? -2.433  -11.731 3.128   1.00 11.94 ? 56 LEU B HD11   1  
ATOM 2970  H HD12   . LEU D 2 56 ? -3.938  -12.217 3.908   1.00 12.29 ? 56 LEU B HD12   1  
ATOM 2971  H HD13   . LEU D 2 56 ? -3.926  -10.856 2.785   1.00 12.01 ? 56 LEU B HD13   1  
ATOM 2972  H HD21   . LEU D 2 56 ? -5.477  -13.714 0.920   1.00 11.99 ? 56 LEU B HD21   1  
ATOM 2973  H HD22   . LEU D 2 56 ? -5.768  -12.056 1.444   1.00 11.87 ? 56 LEU B HD22   1  
ATOM 2974  H HD23   . LEU D 2 56 ? -5.697  -13.357 2.633   1.00 12.11 ? 56 LEU B HD23   1  
ATOM 2975  N N      . ALA D 2 57 ? -4.735  -9.193  1.000   1.00 11.17 ? 57 ALA B N      1  
ATOM 2976  C CA     . ALA D 2 57 ? -4.605  -7.875  1.605   1.00 11.50 ? 57 ALA B CA     1  
ATOM 2977  C C      . ALA D 2 57 ? -5.145  -7.876  3.031   1.00 12.12 ? 57 ALA B C      1  
ATOM 2978  O O      . ALA D 2 57 ? -5.526  -8.922  3.557   1.00 12.46 ? 57 ALA B O      1  
ATOM 2979  C CB     . ALA D 2 57 ? -5.332  -6.839  0.760   1.00 11.76 ? 57 ALA B CB     1  
ATOM 2980  H H      . ALA D 2 57 ? -5.599  -9.652  1.048   1.00 11.34 ? 57 ALA B H      1  
ATOM 2981  H HA     . ALA D 2 57 ? -3.556  -7.619  1.626   1.00 11.33 ? 57 ALA B HA     1  
ATOM 2982  H HB1    . ALA D 2 57 ? -5.195  -5.860  1.195   1.00 11.79 ? 57 ALA B HB1    1  
ATOM 2983  H HB2    . ALA D 2 57 ? -6.385  -7.074  0.728   1.00 11.97 ? 57 ALA B HB2    1  
ATOM 2984  H HB3    . ALA D 2 57 ? -4.931  -6.846  -0.243  1.00 11.89 ? 57 ALA B HB3    1  
ATOM 2985  N N      . GLY D 2 58 ? -5.177  -6.700  3.647   1.00 12.46 ? 58 GLY B N      1  
ATOM 2986  C CA     . GLY D 2 58 ? -5.668  -6.582  5.006   1.00 13.22 ? 58 GLY B CA     1  
ATOM 2987  C C      . GLY D 2 58 ? -4.607  -6.053  5.951   1.00 13.88 ? 58 GLY B C      1  
ATOM 2988  O O      . GLY D 2 58 ? -3.447  -6.466  5.882   1.00 14.22 ? 58 GLY B O      1  
ATOM 2989  H H      . GLY D 2 58 ? -4.867  -5.903  3.174   1.00 12.30 ? 58 GLY B H      1  
ATOM 2990  H HA2    . GLY D 2 58 ? -6.513  -5.909  5.017   1.00 13.42 ? 58 GLY B HA2    1  
ATOM 2991  H HA3    . GLY D 2 58 ? -5.988  -7.554  5.349   1.00 13.31 ? 58 GLY B HA3    1  
ATOM 2992  N N      . LYS D 2 59 ? -4.993  -5.126  6.821   1.00 14.21 ? 59 LYS B N      1  
ATOM 2993  C CA     . LYS D 2 59 ? -4.069  -4.543  7.786   1.00 15.00 ? 59 LYS B CA     1  
ATOM 2994  C C      . LYS D 2 59 ? -4.831  -3.876  8.926   1.00 15.80 ? 59 LYS B C      1  
ATOM 2995  O O      . LYS D 2 59 ? -5.894  -3.299  8.714   1.00 16.22 ? 59 LYS B O      1  
ATOM 2996  C CB     . LYS D 2 59 ? -3.145  -3.520  7.108   1.00 15.15 ? 59 LYS B CB     1  
ATOM 2997  C CG     . LYS D 2 59 ? -3.882  -2.457  6.301   1.00 15.48 ? 59 LYS B CG     1  
ATOM 2998  C CD     . LYS D 2 59 ? -2.947  -1.349  5.835   1.00 15.83 ? 59 LYS B CD     1  
ATOM 2999  C CE     . LYS D 2 59 ? -1.820  -1.887  4.966   1.00 16.33 ? 59 LYS B CE     1  
ATOM 3000  N NZ     . LYS D 2 59 ? -1.006  -0.795  4.365   1.00 16.63 ? 59 LYS B NZ     1  
ATOM 3001  H H      . LYS D 2 59 ? -5.927  -4.824  6.816   1.00 14.03 ? 59 LYS B H      1  
ATOM 3002  H HA     . LYS D 2 59 ? -3.468  -5.343  8.192   1.00 15.08 ? 59 LYS B HA     1  
ATOM 3003  H HB2    . LYS D 2 59 ? -2.562  -3.021  7.868   1.00 14.97 ? 59 LYS B HB2    1  
ATOM 3004  H HB3    . LYS D 2 59 ? -2.475  -4.045  6.442   1.00 15.35 ? 59 LYS B HB3    1  
ATOM 3005  H HG2    . LYS D 2 59 ? -4.328  -2.923  5.435   1.00 15.45 ? 59 LYS B HG2    1  
ATOM 3006  H HG3    . LYS D 2 59 ? -4.657  -2.026  6.918   1.00 15.64 ? 59 LYS B HG3    1  
ATOM 3007  H HD2    . LYS D 2 59 ? -3.514  -0.630  5.264   1.00 15.98 ? 59 LYS B HD2    1  
ATOM 3008  H HD3    . LYS D 2 59 ? -2.520  -0.865  6.702   1.00 15.74 ? 59 LYS B HD3    1  
ATOM 3009  H HE2    . LYS D 2 59 ? -1.179  -2.507  5.575   1.00 16.47 ? 59 LYS B HE2    1  
ATOM 3010  H HE3    . LYS D 2 59 ? -2.248  -2.484  4.174   1.00 16.48 ? 59 LYS B HE3    1  
ATOM 3011  H HZ1    . LYS D 2 59 ? -0.003  -1.078  4.317   1.00 16.60 ? 59 LYS B HZ1    1  
ATOM 3012  H HZ2    . LYS D 2 59 ? -1.084  0.071   4.939   1.00 16.96 ? 59 LYS B HZ2    1  
ATOM 3013  H HZ3    . LYS D 2 59 ? -1.342  -0.588  3.404   1.00 16.69 ? 59 LYS B HZ3    1  
ATOM 3014  N N      . GLN D 2 60 ? -4.290  -3.976  10.132  1.00 16.14 ? 60 GLN B N      1  
ATOM 3015  C CA     . GLN D 2 60 ? -4.902  -3.370  11.306  1.00 17.03 ? 60 GLN B CA     1  
ATOM 3016  C C      . GLN D 2 60 ? -3.827  -3.055  12.336  1.00 17.70 ? 60 GLN B C      1  
ATOM 3017  O O      . GLN D 2 60 ? -2.717  -3.581  12.257  1.00 17.98 ? 60 GLN B O      1  
ATOM 3018  C CB     . GLN D 2 60 ? -5.974  -4.287  11.913  1.00 17.18 ? 60 GLN B CB     1  
ATOM 3019  C CG     . GLN D 2 60 ? -5.433  -5.586  12.493  1.00 17.43 ? 60 GLN B CG     1  
ATOM 3020  C CD     . GLN D 2 60 ? -6.496  -6.382  13.228  1.00 17.84 ? 60 GLN B CD     1  
ATOM 3021  O OE1    . GLN D 2 60 ? -7.208  -7.188  12.631  1.00 17.85 ? 60 GLN B OE1    1  
ATOM 3022  N NE2    . GLN D 2 60 ? -6.607  -6.167  14.531  1.00 18.33 ? 60 GLN B NE2    1  
ATOM 3023  H H      . GLN D 2 60 ? -3.448  -4.466  10.239  1.00 15.87 ? 60 GLN B H      1  
ATOM 3024  H HA     . GLN D 2 60 ? -5.365  -2.445  10.994  1.00 17.24 ? 60 GLN B HA     1  
ATOM 3025  H HB2    . GLN D 2 60 ? -6.479  -3.752  12.704  1.00 17.19 ? 60 GLN B HB2    1  
ATOM 3026  H HB3    . GLN D 2 60 ? -6.693  -4.534  11.146  1.00 17.25 ? 60 GLN B HB3    1  
ATOM 3027  H HG2    . GLN D 2 60 ? -5.045  -6.191  11.687  1.00 17.37 ? 60 GLN B HG2    1  
ATOM 3028  H HG3    . GLN D 2 60 ? -4.636  -5.353  13.183  1.00 17.52 ? 60 GLN B HG3    1  
ATOM 3029  H HE21   . GLN D 2 60 ? -6.005  -5.516  14.947  1.00 18.39 ? 60 GLN B HE21   1  
ATOM 3030  H HE22   . GLN D 2 60 ? -7.290  -6.672  15.028  1.00 18.68 ? 60 GLN B HE22   1  
ATOM 3031  N N      . SER D 2 61 ? -4.153  -2.198  13.288  1.00 18.07 ? 61 SER B N      1  
ATOM 3032  C CA     . SER D 2 61 ? -3.210  -1.812  14.325  1.00 18.84 ? 61 SER B CA     1  
ATOM 3033  C C      . SER D 2 61 ? -3.953  -1.559  15.629  1.00 19.39 ? 61 SER B C      1  
ATOM 3034  O O      . SER D 2 61 ? -5.170  -1.741  15.693  1.00 19.62 ? 61 SER B O      1  
ATOM 3035  C CB     . SER D 2 61 ? -2.442  -0.556  13.898  1.00 19.03 ? 61 SER B CB     1  
ATOM 3036  O OG     . SER D 2 61 ? -1.279  -0.362  14.687  1.00 18.82 ? 61 SER B OG     1  
ATOM 3037  H H      . SER D 2 61 ? -5.055  -1.817  13.303  1.00 17.90 ? 61 SER B H      1  
ATOM 3038  H HA     . SER D 2 61 ? -2.514  -2.625  14.466  1.00 19.02 ? 61 SER B HA     1  
ATOM 3039  H HB2    . SER D 2 61 ? -2.145  -0.654  12.864  1.00 18.96 ? 61 SER B HB2    1  
ATOM 3040  H HB3    . SER D 2 61 ? -3.083  0.307   14.006  1.00 19.52 ? 61 SER B HB3    1  
ATOM 3041  H HG     . SER D 2 61 ? -0.792  0.404   14.356  1.00 18.88 ? 61 SER B HG     1  
ATOM 3042  N N      . LEU D 2 62 ? -3.210  -1.137  16.651  1.00 19.70 ? 62 LEU B N      1  
ATOM 3043  C CA     . LEU D 2 62 ? -3.769  -0.846  17.968  1.00 20.35 ? 62 LEU B CA     1  
ATOM 3044  C C      . LEU D 2 62 ? -4.509  -2.057  18.524  1.00 20.63 ? 62 LEU B C      1  
ATOM 3045  O O      . LEU D 2 62 ? -5.737  -1.974  18.720  1.00 20.95 ? 62 LEU B O      1  
ATOM 3046  C CB     . LEU D 2 62 ? -4.701  0.370   17.900  1.00 20.72 ? 62 LEU B CB     1  
ATOM 3047  C CG     . LEU D 2 62 ? -4.037  1.670   17.442  1.00 20.77 ? 62 LEU B CG     1  
ATOM 3048  C CD1    . LEU D 2 62 ? -5.089  2.713   17.099  1.00 21.17 ? 62 LEU B CD1    1  
ATOM 3049  C CD2    . LEU D 2 62 ? -3.095  2.195   18.516  1.00 21.11 ? 62 LEU B CD2    1  
ATOM 3050  O OXT    . LEU D 2 62 ? -3.857  -3.098  18.753  1.00 20.62 ? 62 LEU B OXT    1  
ATOM 3051  H H      . LEU D 2 62 ? -2.247  -1.015  16.510  1.00 19.56 ? 62 LEU B H      1  
ATOM 3052  H HA     . LEU D 2 62 ? -2.945  -0.615  18.628  1.00 20.50 ? 62 LEU B HA     1  
ATOM 3053  H HB2    . LEU D 2 62 ? -5.506  0.141   17.217  1.00 20.72 ? 62 LEU B HB2    1  
ATOM 3054  H HB3    . LEU D 2 62 ? -5.119  0.532   18.881  1.00 21.11 ? 62 LEU B HB3    1  
ATOM 3055  H HG     . LEU D 2 62 ? -3.457  1.477   16.551  1.00 20.38 ? 62 LEU B HG     1  
ATOM 3056  H HD11   . LEU D 2 62 ? -5.716  2.344   16.301  1.00 21.11 ? 62 LEU B HD11   1  
ATOM 3057  H HD12   . LEU D 2 62 ? -4.602  3.624   16.782  1.00 21.41 ? 62 LEU B HD12   1  
ATOM 3058  H HD13   . LEU D 2 62 ? -5.695  2.913   17.970  1.00 21.41 ? 62 LEU B HD13   1  
ATOM 3059  H HD21   . LEU D 2 62 ? -2.330  1.460   18.713  1.00 21.30 ? 62 LEU B HD21   1  
ATOM 3060  H HD22   . LEU D 2 62 ? -3.653  2.387   19.421  1.00 21.08 ? 62 LEU B HD22   1  
ATOM 3061  H HD23   . LEU D 2 62 ? -2.635  3.111   18.175  1.00 21.32 ? 62 LEU B HD23   1  
ATOM 3062  O "O5'"  . DC  A 1 1  ? -28.724 -4.841  9.052   1.00 6.37  ? 1  DC  C "O5'"  2  
ATOM 3063  C "C5'"  . DC  A 1 1  ? -29.751 -5.338  8.189   1.00 6.29  ? 1  DC  C "C5'"  2  
ATOM 3064  C "C4'"  . DC  A 1 1  ? -29.743 -4.613  6.862   1.00 5.91  ? 1  DC  C "C4'"  2  
ATOM 3065  O "O4'"  . DC  A 1 1  ? -29.920 -3.197  7.113   1.00 5.98  ? 1  DC  C "O4'"  2  
ATOM 3066  C "C3'"  . DC  A 1 1  ? -28.428 -4.713  6.095   1.00 5.57  ? 1  DC  C "C3'"  2  
ATOM 3067  O "O3'"  . DC  A 1 1  ? -28.644 -4.528  4.696   1.00 5.22  ? 1  DC  C "O3'"  2  
ATOM 3068  C "C2'"  . DC  A 1 1  ? -27.621 -3.563  6.659   1.00 5.63  ? 1  DC  C "C2'"  2  
ATOM 3069  C "C1'"  . DC  A 1 1  ? -28.689 -2.507  6.908   1.00 5.81  ? 1  DC  C "C1'"  2  
ATOM 3070  N N1     . DC  A 1 1  ? -28.432 -1.643  8.072   1.00 6.13  ? 1  DC  C N1     2  
ATOM 3071  C C2     . DC  A 1 1  ? -28.720 -0.277  7.977   1.00 6.18  ? 1  DC  C C2     2  
ATOM 3072  O O2     . DC  A 1 1  ? -29.215 0.161   6.928   1.00 5.95  ? 1  DC  C O2     2  
ATOM 3073  N N3     . DC  A 1 1  ? -28.451 0.533   9.027   1.00 6.48  ? 1  DC  C N3     2  
ATOM 3074  C C4     . DC  A 1 1  ? -27.921 0.023   10.140  1.00 6.72  ? 1  DC  C C4     2  
ATOM 3075  N N4     . DC  A 1 1  ? -27.666 0.860   11.149  1.00 7.02  ? 1  DC  C N4     2  
ATOM 3076  C C5     . DC  A 1 1  ? -27.629 -1.367  10.272  1.00 6.67  ? 1  DC  C C5     2  
ATOM 3077  C C6     . DC  A 1 1  ? -27.901 -2.156  9.224   1.00 6.38  ? 1  DC  C C6     2  
ATOM 3078  H "H5'"  . DC  A 1 1  ? -30.722 -5.198  8.664   1.00 6.54  ? 1  DC  C "H5'"  2  
ATOM 3079  H "H5''" . DC  A 1 1  ? -29.593 -6.401  8.011   1.00 6.26  ? 1  DC  C "H5''" 2  
ATOM 3080  H "H4'"  . DC  A 1 1  ? -30.521 -5.047  6.233   1.00 5.83  ? 1  DC  C "H4'"  2  
ATOM 3081  H "H3'"  . DC  A 1 1  ? -27.944 -5.676  6.261   1.00 5.59  ? 1  DC  C "H3'"  2  
ATOM 3082  H "H2'"  . DC  A 1 1  ? -27.106 -3.854  7.575   1.00 5.83  ? 1  DC  C "H2'"  2  
ATOM 3083  H "H2''" . DC  A 1 1  ? -26.864 -3.229  5.953   1.00 5.38  ? 1  DC  C "H2''" 2  
ATOM 3084  H "H1'"  . DC  A 1 1  ? -28.810 -1.870  6.028   1.00 5.61  ? 1  DC  C "H1'"  2  
ATOM 3085  H H41    . DC  A 1 1  ? -27.871 1.845   11.059  1.00 7.08  ? 1  DC  C H41    2  
ATOM 3086  H H42    . DC  A 1 1  ? -27.264 0.506   12.005  1.00 7.21  ? 1  DC  C H42    2  
ATOM 3087  H H5     . DC  A 1 1  ? -27.196 -1.770  11.187  1.00 6.88  ? 1  DC  C H5     2  
ATOM 3088  H H6     . DC  A 1 1  ? -27.693 -3.224  9.294   1.00 6.37  ? 1  DC  C H6     2  
ATOM 3089  H "HO5'" . DC  A 1 1  ? -29.161 -4.285  9.702   1.00 6.58  ? 1  DC  C "HO5'" 2  
ATOM 3090  P P      . DG  A 1 2  ? -27.396 -4.572  3.682   1.00 4.83  ? 2  DG  C P      2  
ATOM 3091  O OP1    . DG  A 1 2  ? -27.848 -5.254  2.444   1.00 4.58  ? 2  DG  C OP1    2  
ATOM 3092  O OP2    . DG  A 1 2  ? -26.185 -5.060  4.389   1.00 4.91  ? 2  DG  C OP2    2  
ATOM 3093  O "O5'"  . DG  A 1 2  ? -27.167 -3.034  3.340   1.00 4.73  ? 2  DG  C "O5'"  2  
ATOM 3094  C "C5'"  . DG  A 1 2  ? -28.165 -2.306  2.634   1.00 4.67  ? 2  DG  C "C5'"  2  
ATOM 3095  C "C4'"  . DG  A 1 2  ? -27.589 -1.044  2.041   1.00 4.53  ? 2  DG  C "C4'"  2  
ATOM 3096  O "O4'"  . DG  A 1 2  ? -27.452 -0.050  3.088   1.00 4.84  ? 2  DG  C "O4'"  2  
ATOM 3097  C "C3'"  . DG  A 1 2  ? -26.177 -1.220  1.486   1.00 4.27  ? 2  DG  C "C3'"  2  
ATOM 3098  O "O3'"  . DG  A 1 2  ? -25.947 -0.259  0.458   1.00 4.08  ? 2  DG  C "O3'"  2  
ATOM 3099  C "C2'"  . DG  A 1 2  ? -25.301 -0.970  2.698   1.00 4.50  ? 2  DG  C "C2'"  2  
ATOM 3100  C "C1'"  . DG  A 1 2  ? -26.077 0.113   3.429   1.00 4.82  ? 2  DG  C "C1'"  2  
ATOM 3101  N N9     . DG  A 1 2  ? -25.929 0.107   4.881   1.00 5.17  ? 2  DG  C N9     2  
ATOM 3102  C C8     . DG  A 1 2  ? -25.732 -0.977  5.699   1.00 5.30  ? 2  DG  C C8     2  
ATOM 3103  N N7     . DG  A 1 2  ? -25.565 -0.654  6.954   1.00 5.63  ? 2  DG  C N7     2  
ATOM 3104  C C5     . DG  A 1 2  ? -25.672 0.732   6.967   1.00 5.74  ? 2  DG  C C5     2  
ATOM 3105  C C6     . DG  A 1 2  ? -25.572 1.657   8.046   1.00 6.09  ? 2  DG  C C6     2  
ATOM 3106  O O6     . DG  A 1 2  ? -25.352 1.431   9.246   1.00 6.37  ? 2  DG  C O6     2  
ATOM 3107  N N1     . DG  A 1 2  ? -25.748 2.968   7.611   1.00 6.12  ? 2  DG  C N1     2  
ATOM 3108  C C2     . DG  A 1 2  ? -25.989 3.343   6.312   1.00 5.85  ? 2  DG  C C2     2  
ATOM 3109  N N2     . DG  A 1 2  ? -26.141 4.657   6.092   1.00 5.98  ? 2  DG  C N2     2  
ATOM 3110  N N3     . DG  A 1 2  ? -26.079 2.494   5.302   1.00 5.51  ? 2  DG  C N3     2  
ATOM 3111  C C4     . DG  A 1 2  ? -25.911 1.214   5.698   1.00 5.47  ? 2  DG  C C4     2  
ATOM 3112  H "H5'"  . DG  A 1 2  ? -28.972 -2.041  3.317   1.00 4.93  ? 2  DG  C "H5'"  2  
ATOM 3113  H "H5''" . DG  A 1 2  ? -28.568 -2.925  1.833   1.00 4.50  ? 2  DG  C "H5''" 2  
ATOM 3114  H "H4'"  . DG  A 1 2  ? -28.229 -0.730  1.214   1.00 4.41  ? 2  DG  C "H4'"  2  
ATOM 3115  H "H3'"  . DG  A 1 2  ? -26.037 -2.220  1.081   1.00 4.11  ? 2  DG  C "H3'"  2  
ATOM 3116  H "H2'"  . DG  A 1 2  ? -25.186 -1.872  3.297   1.00 4.59  ? 2  DG  C "H2'"  2  
ATOM 3117  H "H2''" . DG  A 1 2  ? -24.305 -0.638  2.409   1.00 4.38  ? 2  DG  C "H2''" 2  
ATOM 3118  H "H1'"  . DG  A 1 2  ? -25.773 1.098   3.066   1.00 4.80  ? 2  DG  C "H1'"  2  
ATOM 3119  H H8     . DG  A 1 2  ? -25.704 -1.993  5.339   1.00 5.15  ? 2  DG  C H8     2  
ATOM 3120  H H1     . DG  A 1 2  ? -25.690 3.699   8.307   1.00 6.38  ? 2  DG  C H1     2  
ATOM 3121  H H21    . DG  A 1 2  ? -26.072 5.321   6.852   1.00 6.25  ? 2  DG  C H21    2  
ATOM 3122  H H22    . DG  A 1 2  ? -26.322 4.991   5.156   1.00 5.81  ? 2  DG  C H22    2  
ATOM 3123  P P      . DA  A 1 3  ? -24.488 -0.119  -0.195  1.00 3.85  ? 3  DA  C P      2  
ATOM 3124  O OP1    . DA  A 1 3  ? -24.653 -0.133  -1.666  1.00 3.56  ? 3  DA  C OP1    2  
ATOM 3125  O OP2    . DA  A 1 3  ? -23.556 -1.080  0.446   1.00 3.83  ? 3  DA  C OP2    2  
ATOM 3126  O "O5'"  . DA  A 1 3  ? -24.101 1.362   0.237   1.00 4.07  ? 3  DA  C "O5'"  2  
ATOM 3127  C "C5'"  . DA  A 1 3  ? -25.079 2.390   0.097   1.00 4.23  ? 3  DA  C "C5'"  2  
ATOM 3128  C "C4'"  . DA  A 1 3  ? -24.480 3.754   0.338   1.00 4.45  ? 3  DA  C "C4'"  2  
ATOM 3129  O "O4'"  . DA  A 1 3  ? -24.350 3.967   1.766   1.00 4.78  ? 3  DA  C "O4'"  2  
ATOM 3130  C "C3'"  . DA  A 1 3  ? -23.069 3.921   -0.211  1.00 4.31  ? 3  DA  C "C3'"  2  
ATOM 3131  O "O3'"  . DA  A 1 3  ? -22.846 5.297   -0.500  1.00 4.50  ? 3  DA  C "O3'"  2  
ATOM 3132  C "C2'"  . DA  A 1 3  ? -22.202 3.416   0.926   1.00 4.40  ? 3  DA  C "C2'"  2  
ATOM 3133  C "C1'"  . DA  A 1 3  ? -22.981 3.880   2.149   1.00 4.77  ? 3  DA  C "C1'"  2  
ATOM 3134  N N9     . DA  A 1 3  ? -22.867 3.018   3.328   1.00 4.90  ? 3  DA  C N9     2  
ATOM 3135  C C8     . DA  A 1 3  ? -22.901 1.649   3.410   1.00 4.75  ? 3  DA  C C8     2  
ATOM 3136  N N7     . DA  A 1 3  ? -22.708 1.186   4.625   1.00 4.98  ? 3  DA  C N7     2  
ATOM 3137  C C5     . DA  A 1 3  ? -22.548 2.330   5.396   1.00 5.29  ? 3  DA  C C5     2  
ATOM 3138  C C6     . DA  A 1 3  ? -22.306 2.524   6.772   1.00 5.64  ? 3  DA  C C6     2  
ATOM 3139  N N6     . DA  A 1 3  ? -22.159 1.527   7.649   1.00 5.74  ? 3  DA  C N6     2  
ATOM 3140  N N1     . DA  A 1 3  ? -22.209 3.795   7.220   1.00 5.90  ? 3  DA  C N1     2  
ATOM 3141  C C2     . DA  A 1 3  ? -22.340 4.796   6.338   1.00 5.83  ? 3  DA  C C2     2  
ATOM 3142  N N3     . DA  A 1 3  ? -22.559 4.741   5.027   1.00 5.53  ? 3  DA  C N3     2  
ATOM 3143  C C4     . DA  A 1 3  ? -22.656 3.464   4.613   1.00 5.25  ? 3  DA  C C4     2  
ATOM 3144  H "H5'"  . DA  A 1 3  ? -25.884 2.225   0.814   1.00 4.41  ? 3  DA  C "H5'"  2  
ATOM 3145  H "H5''" . DA  A 1 3  ? -25.493 2.361   -0.911  1.00 4.05  ? 3  DA  C "H5''" 2  
ATOM 3146  H "H4'"  . DA  A 1 3  ? -25.110 4.495   -0.159  1.00 4.51  ? 3  DA  C "H4'"  2  
ATOM 3147  H "H3'"  . DA  A 1 3  ? -22.929 3.335   -1.120  1.00 4.03  ? 3  DA  C "H3'"  2  
ATOM 3148  H "H2'"  . DA  A 1 3  ? -22.092 2.333   0.892   1.00 4.22  ? 3  DA  C "H2'"  2  
ATOM 3149  H "H2''" . DA  A 1 3  ? -21.204 3.849   0.889   1.00 4.42  ? 3  DA  C "H2''" 2  
ATOM 3150  H "H1'"  . DA  A 1 3  ? -22.665 4.885   2.436   1.00 4.98  ? 3  DA  C "H1'"  2  
ATOM 3151  H H8     . DA  A 1 3  ? -23.069 1.010   2.555   1.00 4.48  ? 3  DA  C H8     2  
ATOM 3152  H H61    . DA  A 1 3  ? -21.977 1.728   8.623   1.00 6.00  ? 3  DA  C H61    2  
ATOM 3153  H H62    . DA  A 1 3  ? -22.223 0.571   7.334   1.00 5.58  ? 3  DA  C H62    2  
ATOM 3154  H H2     . DA  A 1 3  ? -22.256 5.800   6.756   1.00 6.08  ? 3  DA  C H2     2  
ATOM 3155  P P      . DT  A 1 4  ? -21.404 5.789   -0.995  1.00 4.47  ? 4  DT  C P      2  
ATOM 3156  O OP1    . DT  A 1 4  ? -21.608 6.606   -2.219  1.00 4.48  ? 4  DT  C OP1    2  
ATOM 3157  O OP2    . DT  A 1 4  ? -20.479 4.627   -1.033  1.00 4.20  ? 4  DT  C OP2    2  
ATOM 3158  O "O5'"  . DT  A 1 4  ? -20.988 6.757   0.197   1.00 4.86  ? 4  DT  C "O5'"  2  
ATOM 3159  C "C5'"  . DT  A 1 4  ? -21.967 7.648   0.727   1.00 5.17  ? 4  DT  C "C5'"  2  
ATOM 3160  C "C4'"  . DT  A 1 4  ? -21.355 8.632   1.694   1.00 5.54  ? 4  DT  C "C4'"  2  
ATOM 3161  O "O4'"  . DT  A 1 4  ? -21.153 7.978   2.971   1.00 5.63  ? 4  DT  C "O4'"  2  
ATOM 3162  C "C3'"  . DT  A 1 4  ? -19.971 9.117   1.279   1.00 5.55  ? 4  DT  C "C3'"  2  
ATOM 3163  O "O3'"  . DT  A 1 4  ? -19.738 10.406  1.846   1.00 5.94  ? 4  DT  C "O3'"  2  
ATOM 3164  C "C2'"  . DT  A 1 4  ? -19.051 8.064   1.872   1.00 5.40  ? 4  DT  C "C2'"  2  
ATOM 3165  C "C1'"  . DT  A 1 4  ? -19.769 7.721   3.173   1.00 5.57  ? 4  DT  C "C1'"  2  
ATOM 3166  N N1     . DT  A 1 4  ? -19.598 6.338   3.668   1.00 5.39  ? 4  DT  C N1     2  
ATOM 3167  C C2     . DT  A 1 4  ? -19.389 6.182   5.022   1.00 5.63  ? 4  DT  C C2     2  
ATOM 3168  O O2     . DT  A 1 4  ? -19.396 7.113   5.811   1.00 5.97  ? 4  DT  C O2     2  
ATOM 3169  N N3     . DT  A 1 4  ? -19.168 4.892   5.427   1.00 5.48  ? 4  DT  C N3     2  
ATOM 3170  C C4     . DT  A 1 4  ? -19.147 3.766   4.636   1.00 5.12  ? 4  DT  C C4     2  
ATOM 3171  O O4     . DT  A 1 4  ? -18.876 2.675   5.136   1.00 5.06  ? 4  DT  C O4     2  
ATOM 3172  C C5     . DT  A 1 4  ? -19.400 3.995   3.226   1.00 4.86  ? 4  DT  C C5     2  
ATOM 3173  C C7     . DT  A 1 4  ? -19.362 2.830   2.288   1.00 4.47  ? 4  DT  C C7     2  
ATOM 3174  C C6     . DT  A 1 4  ? -19.618 5.253   2.814   1.00 5.01  ? 4  DT  C C6     2  
ATOM 3175  H "H5'"  . DT  A 1 4  ? -22.736 7.073   1.247   1.00 5.16  ? 4  DT  C "H5'"  2  
ATOM 3176  H "H5''" . DT  A 1 4  ? -22.433 8.201   -0.088  1.00 5.16  ? 4  DT  C "H5''" 2  
ATOM 3177  H "H4'"  . DT  A 1 4  ? -22.004 9.508   1.747   1.00 5.75  ? 4  DT  C "H4'"  2  
ATOM 3178  H "H3'"  . DT  A 1 4  ? -19.880 9.176   0.194   1.00 5.40  ? 4  DT  C "H3'"  2  
ATOM 3179  H "H2'"  . DT  A 1 4  ? -18.961 7.202   1.211   1.00 5.09  ? 4  DT  C "H2'"  2  
ATOM 3180  H "H2''" . DT  A 1 4  ? -18.049 8.456   2.033   1.00 5.50  ? 4  DT  C "H2''" 2  
ATOM 3181  H "H1'"  . DT  A 1 4  ? -19.437 8.398   3.966   1.00 5.86  ? 4  DT  C "H1'"  2  
ATOM 3182  H H3     . DT  A 1 4  ? -18.988 4.764   6.416   1.00 5.68  ? 4  DT  C H3     2  
ATOM 3183  H H71    . DT  A 1 4  ? -19.298 3.190   1.262   1.00 4.37  ? 4  DT  C H71    2  
ATOM 3184  H H72    . DT  A 1 4  ? -18.493 2.212   2.509   1.00 4.43  ? 4  DT  C H72    2  
ATOM 3185  H H73    . DT  A 1 4  ? -20.268 2.236   2.408   1.00 4.51  ? 4  DT  C H73    2  
ATOM 3186  H H6     . DT  A 1 4  ? -19.826 5.426   1.758   1.00 4.84  ? 4  DT  C H6     2  
ATOM 3187  P P      . DA  A 1 5  ? -18.330 11.139  1.627   1.00 6.08  ? 5  DA  C P      2  
ATOM 3188  O OP1    . DA  A 1 5  ? -18.616 12.523  1.173   1.00 6.36  ? 5  DA  C OP1    2  
ATOM 3189  O OP2    . DA  A 1 5  ? -17.437 10.270  0.818   1.00 5.74  ? 5  DA  C OP2    2  
ATOM 3190  O "O5'"  . DA  A 1 5  ? -17.768 11.207  3.113   1.00 6.32  ? 5  DA  C "O5'"  2  
ATOM 3191  C "C5'"  . DA  A 1 5  ? -18.549 11.822  4.138   1.00 6.63  ? 5  DA  C "C5'"  2  
ATOM 3192  C "C4'"  . DA  A 1 5  ? -17.713 12.072  5.368   1.00 6.88  ? 5  DA  C "C4'"  2  
ATOM 3193  O "O4'"  . DA  A 1 5  ? -17.570 10.829  6.099   1.00 6.71  ? 5  DA  C "O4'"  2  
ATOM 3194  C "C3'"  . DA  A 1 5  ? -16.288 12.508  5.049   1.00 6.92  ? 5  DA  C "C3'"  2  
ATOM 3195  O "O3'"  . DA  A 1 5  ? -15.752 13.268  6.130   1.00 7.27  ? 5  DA  C "O3'"  2  
ATOM 3196  C "C2'"  . DA  A 1 5  ? -15.557 11.189  4.898   1.00 6.57  ? 5  DA  C "C2'"  2  
ATOM 3197  C "C1'"  . DA  A 1 5  ? -16.249 10.321  5.943   1.00 6.54  ? 5  DA  C "C1'"  2  
ATOM 3198  N N9     . DA  A 1 5  ? -16.327 8.895   5.617   1.00 6.17  ? 5  DA  C N9     2  
ATOM 3199  C C8     . DA  A 1 5  ? -16.727 8.318   4.441   1.00 5.84  ? 5  DA  C C8     2  
ATOM 3200  N N7     . DA  A 1 5  ? -16.650 7.008   4.444   1.00 5.55  ? 5  DA  C N7     2  
ATOM 3201  C C5     . DA  A 1 5  ? -16.174 6.702   5.710   1.00 5.72  ? 5  DA  C C5     2  
ATOM 3202  C C6     . DA  A 1 5  ? -15.868 5.477   6.341   1.00 5.59  ? 5  DA  C C6     2  
ATOM 3203  N N6     . DA  A 1 5  ? -15.995 4.288   5.750   1.00 5.26  ? 5  DA  C N6     2  
ATOM 3204  N N1     . DA  A 1 5  ? -15.418 5.519   7.612   1.00 5.86  ? 5  DA  C N1     2  
ATOM 3205  C C2     . DA  A 1 5  ? -15.280 6.714   8.202   1.00 6.20  ? 5  DA  C C2     2  
ATOM 3206  N N3     . DA  A 1 5  ? -15.528 7.932   7.714   1.00 6.34  ? 5  DA  C N3     2  
ATOM 3207  C C4     . DA  A 1 5  ? -15.978 7.855   6.449   1.00 6.09  ? 5  DA  C C4     2  
ATOM 3208  H "H5'"  . DA  A 1 5  ? -19.383 11.170  4.400   1.00 6.53  ? 5  DA  C "H5'"  2  
ATOM 3209  H "H5''" . DA  A 1 5  ? -18.942 12.772  3.776   1.00 6.81  ? 5  DA  C "H5''" 2  
ATOM 3210  H "H4'"  . DA  A 1 5  ? -18.180 12.873  5.945   1.00 7.17  ? 5  DA  C "H4'"  2  
ATOM 3211  H "H3'"  . DA  A 1 5  ? -16.252 13.104  4.137   1.00 6.93  ? 5  DA  C "H3'"  2  
ATOM 3212  H "H2'"  . DA  A 1 5  ? -15.670 10.789  3.889   1.00 6.32  ? 5  DA  C "H2'"  2  
ATOM 3213  H "H2''" . DA  A 1 5  ? -14.491 11.302  5.084   1.00 6.61  ? 5  DA  C "H2''" 2  
ATOM 3214  H "H1'"  . DA  A 1 5  ? -15.747 10.420  6.909   1.00 6.72  ? 5  DA  C "H1'"  2  
ATOM 3215  H H8     . DA  A 1 5  ? -17.069 8.888   3.592   1.00 5.83  ? 5  DA  C H8     2  
ATOM 3216  H H61    . DA  A 1 5  ? -15.738 3.443   6.241   1.00 5.21  ? 5  DA  C H61    2  
ATOM 3217  H H62    . DA  A 1 5  ? -16.326 4.247   4.800   1.00 5.07  ? 5  DA  C H62    2  
ATOM 3218  H H2     . DA  A 1 5  ? -14.917 6.686   9.232   1.00 6.41  ? 5  DA  C H2     2  
ATOM 3219  P P      . DA  A 1 6  ? -14.240 13.796  6.056   1.00 7.38  ? 6  DA  C P      2  
ATOM 3220  O OP1    . DA  A 1 6  ? -14.227 15.187  6.578   1.00 7.80  ? 6  DA  C OP1    2  
ATOM 3221  O OP2    . DA  A 1 6  ? -13.682 13.511  4.710   1.00 7.10  ? 6  DA  C OP2    2  
ATOM 3222  O "O5'"  . DA  A 1 6  ? -13.517 12.857  7.118   1.00 7.35  ? 6  DA  C "O5'"  2  
ATOM 3223  C "C5'"  . DA  A 1 6  ? -14.075 12.714  8.421   1.00 7.57  ? 6  DA  C "C5'"  2  
ATOM 3224  C "C4'"  . DA  A 1 6  ? -13.096 12.050  9.358   1.00 7.58  ? 6  DA  C "C4'"  2  
ATOM 3225  O "O4'"  . DA  A 1 6  ? -13.109 10.619  9.118   1.00 7.22  ? 6  DA  C "O4'"  2  
ATOM 3226  C "C3'"  . DA  A 1 6  ? -11.651 12.476  9.115   1.00 7.61  ? 6  DA  C "C3'"  2  
ATOM 3227  O "O3'"  . DA  A 1 6  ? -10.900 12.324  10.313  1.00 7.79  ? 6  DA  C "O3'"  2  
ATOM 3228  C "C2'"  . DA  A 1 6  ? -11.186 11.505  8.044   1.00 7.18  ? 6  DA  C "C2'"  2  
ATOM 3229  C "C1'"  . DA  A 1 6  ? -11.916 10.231  8.443   1.00 6.98  ? 6  DA  C "C1'"  2  
ATOM 3230  N N9     . DA  A 1 6  ? -12.252 9.325   7.343   1.00 6.57  ? 6  DA  C N9     2  
ATOM 3231  C C8     . DA  A 1 6  ? -12.718 9.620   6.086   1.00 6.41  ? 6  DA  C C8     2  
ATOM 3232  N N7     . DA  A 1 6  ? -12.855 8.569   5.311   1.00 6.03  ? 6  DA  C N7     2  
ATOM 3233  C C5     . DA  A 1 6  ? -12.461 7.507   6.116   1.00 5.94  ? 6  DA  C C5     2  
ATOM 3234  C C6     . DA  A 1 6  ? -12.366 6.119   5.883   1.00 5.61  ? 6  DA  C C6     2  
ATOM 3235  N N6     . DA  A 1 6  ? -12.654 5.540   4.713   1.00 5.26  ? 6  DA  C N6     2  
ATOM 3236  N N1     . DA  A 1 6  ? -11.951 5.337   6.904   1.00 5.66  ? 6  DA  C N1     2  
ATOM 3237  C C2     . DA  A 1 6  ? -11.641 5.919   8.071   1.00 6.01  ? 6  DA  C C2     2  
ATOM 3238  N N3     . DA  A 1 6  ? -11.678 7.207   8.405   1.00 6.33  ? 6  DA  C N3     2  
ATOM 3239  C C4     . DA  A 1 6  ? -12.103 7.957   7.374   1.00 6.28  ? 6  DA  C C4     2  
ATOM 3240  H "H5'"  . DA  A 1 6  ? -14.979 12.109  8.365   1.00 7.43  ? 6  DA  C "H5'"  2  
ATOM 3241  H "H5''" . DA  A 1 6  ? -14.332 13.697  8.816   1.00 7.87  ? 6  DA  C "H5''" 2  
ATOM 3242  H "H4'"  . DA  A 1 6  ? -13.352 12.331  10.381  1.00 7.85  ? 6  DA  C "H4'"  2  
ATOM 3243  H "H3'"  . DA  A 1 6  ? -11.595 13.512  8.782   1.00 7.79  ? 6  DA  C "H3'"  2  
ATOM 3244  H "H2'"  . DA  A 1 6  ? -11.468 11.848  7.048   1.00 7.08  ? 6  DA  C "H2'"  2  
ATOM 3245  H "H2''" . DA  A 1 6  ? -10.105 11.386  8.056   1.00 7.14  ? 6  DA  C "H2''" 2  
ATOM 3246  H "H1'"  . DA  A 1 6  ? -11.315 9.669   9.162   1.00 6.99  ? 6  DA  C "H1'"  2  
ATOM 3247  H H8     . DA  A 1 6  ? -12.942 10.625  5.763   1.00 6.58  ? 6  DA  C H8     2  
ATOM 3248  H H61    . DA  A 1 6  ? -12.548 4.542   4.600   1.00 5.04  ? 6  DA  C H61    2  
ATOM 3249  H H62    . DA  A 1 6  ? -12.958 6.111   3.938   1.00 5.24  ? 6  DA  C H62    2  
ATOM 3250  H H2     . DA  A 1 6  ? -11.313 5.241   8.859   1.00 6.05  ? 6  DA  C H2     2  
ATOM 3251  P P      . DG  A 1 7  ? -9.319  12.595  10.308  1.00 7.83  ? 7  DG  C P      2  
ATOM 3252  O OP1    . DG  A 1 7  ? -9.010  13.461  11.474  1.00 8.24  ? 7  DG  C OP1    2  
ATOM 3253  O OP2    . DG  A 1 7  ? -8.880  13.008  8.949   1.00 7.69  ? 7  DG  C OP2    2  
ATOM 3254  O "O5'"  . DG  A 1 7  ? -8.764  11.137  10.609  1.00 7.54  ? 7  DG  C "O5'"  2  
ATOM 3255  C "C5'"  . DG  A 1 7  ? -9.368  10.365  11.643  1.00 7.59  ? 7  DG  C "C5'"  2  
ATOM 3256  C "C4'"  . DG  A 1 7  ? -8.528  9.157   11.983  1.00 7.39  ? 7  DG  C "C4'"  2  
ATOM 3257  O "O4'"  . DG  A 1 7  ? -8.779  8.115   11.007  1.00 6.98  ? 7  DG  C "O4'"  2  
ATOM 3258  C "C3'"  . DG  A 1 7  ? -7.032  9.442   11.880  1.00 7.39  ? 7  DG  C "C3'"  2  
ATOM 3259  O "O3'"  . DG  A 1 7  ? -6.320  8.555   12.735  1.00 7.37  ? 7  DG  C "O3'"  2  
ATOM 3260  C "C2'"  . DG  A 1 7  ? -6.733  9.162   10.419  1.00 7.03  ? 7  DG  C "C2'"  2  
ATOM 3261  C "C1'"  . DG  A 1 7  ? -7.663  7.989   10.137  1.00 6.75  ? 7  DG  C "C1'"  2  
ATOM 3262  N N9     . DG  A 1 7  ? -8.128  7.852   8.757   1.00 6.45  ? 7  DG  C N9     2  
ATOM 3263  C C8     . DG  A 1 7  ? -8.562  8.833   7.901   1.00 6.51  ? 7  DG  C C8     2  
ATOM 3264  N N7     . DG  A 1 7  ? -8.833  8.388   6.702   1.00 6.19  ? 7  DG  C N7     2  
ATOM 3265  C C5     . DG  A 1 7  ? -8.581  7.024   6.776   1.00 5.90  ? 7  DG  C C5     2  
ATOM 3266  C C6     . DG  A 1 7  ? -8.687  6.001   5.783   1.00 5.49  ? 7  DG  C C6     2  
ATOM 3267  O O6     . DG  A 1 7  ? -9.027  6.100   4.594   1.00 5.31  ? 7  DG  C O6     2  
ATOM 3268  N N1     . DG  A 1 7  ? -8.339  4.753   6.295   1.00 5.33  ? 7  DG  C N1     2  
ATOM 3269  C C2     . DG  A 1 7  ? -7.942  4.514   7.588   1.00 5.53  ? 7  DG  C C2     2  
ATOM 3270  N N2     . DG  A 1 7  ? -7.666  3.239   7.897   1.00 5.35  ? 7  DG  C N2     2  
ATOM 3271  N N3     . DG  A 1 7  ? -7.831  5.453   8.513   1.00 5.90  ? 7  DG  C N3     2  
ATOM 3272  C C4     . DG  A 1 7  ? -8.163  6.674   8.043   1.00 6.06  ? 7  DG  C C4     2  
ATOM 3273  H "H5'"  . DG  A 1 7  ? -10.353 10.030  11.318  1.00 7.47  ? 7  DG  C "H5'"  2  
ATOM 3274  H "H5''" . DG  A 1 7  ? -9.481  10.979  12.537  1.00 7.91  ? 7  DG  C "H5''" 2  
ATOM 3275  H "H4'"  . DG  A 1 7  ? -8.739  8.866   13.014  1.00 7.56  ? 7  DG  C "H4'"  2  
ATOM 3276  H "H3'"  . DG  A 1 7  ? -6.806  10.472  12.156  1.00 7.66  ? 7  DG  C "H3'"  2  
ATOM 3277  H "H2'"  . DG  A 1 7  ? -6.958  10.027  9.796   1.00 7.11  ? 7  DG  C "H2'"  2  
ATOM 3278  H "H2''" . DG  A 1 7  ? -5.684  8.915   10.267  1.00 6.93  ? 7  DG  C "H2''" 2  
ATOM 3279  H "H1'"  . DG  A 1 7  ? -7.162  7.055   10.406  1.00 6.60  ? 7  DG  C "H1'"  2  
ATOM 3280  H H8     . DG  A 1 7  ? -8.667  9.870   8.189   1.00 6.80  ? 7  DG  C H8     2  
ATOM 3281  H H1     . DG  A 1 7  ? -8.380  3.964   5.663   1.00 5.05  ? 7  DG  C H1     2  
ATOM 3282  H H21    . DG  A 1 7  ? -7.743  2.507   7.203   1.00 5.08  ? 7  DG  C H21    2  
ATOM 3283  H H22    . DG  A 1 7  ? -7.372  3.006   8.835   1.00 5.51  ? 7  DG  C H22    2  
ATOM 3284  P P      . DA  A 1 8  ? -4.717  8.567   12.745  1.00 7.34  ? 8  DA  C P      2  
ATOM 3285  O OP1    . DA  A 1 8  ? -4.281  8.594   14.165  1.00 7.64  ? 8  DA  C OP1    2  
ATOM 3286  O OP2    . DA  A 1 8  ? -4.208  9.595   11.800  1.00 7.36  ? 8  DA  C OP2    2  
ATOM 3287  O "O5'"  . DA  A 1 8  ? -4.399  7.122   12.161  1.00 6.91  ? 8  DA  C "O5'"  2  
ATOM 3288  C "C5'"  . DA  A 1 8  ? -5.081  5.991   12.696  1.00 6.83  ? 8  DA  C "C5'"  2  
ATOM 3289  C "C4'"  . DA  A 1 8  ? -4.426  4.705   12.256  1.00 6.47  ? 8  DA  C "C4'"  2  
ATOM 3290  O "O4'"  . DA  A 1 8  ? -4.861  4.389   10.910  1.00 6.13  ? 8  DA  C "O4'"  2  
ATOM 3291  C "C3'"  . DA  A 1 8  ? -2.908  4.811   12.166  1.00 6.42  ? 8  DA  C "C3'"  2  
ATOM 3292  O "O3'"  . DA  A 1 8  ? -2.329  3.522   12.349  1.00 6.21  ? 8  DA  C "O3'"  2  
ATOM 3293  C "C2'"  . DA  A 1 8  ? -2.688  5.330   10.758  1.00 6.21  ? 8  DA  C "C2'"  2  
ATOM 3294  C "C1'"  . DA  A 1 8  ? -3.802  4.631   9.990   1.00 5.94  ? 8  DA  C "C1'"  2  
ATOM 3295  N N9     . DA  A 1 8  ? -4.329  5.353   8.830   1.00 5.85  ? 8  DA  C N9     2  
ATOM 3296  C C8     . DA  A 1 8  ? -4.710  6.666   8.714   1.00 6.11  ? 8  DA  C C8     2  
ATOM 3297  N N7     . DA  A 1 8  ? -5.091  7.001   7.501   1.00 5.96  ? 8  DA  C N7     2  
ATOM 3298  C C5     . DA  A 1 8  ? -4.961  5.826   6.773   1.00 5.57  ? 8  DA  C C5     2  
ATOM 3299  C C6     . DA  A 1 8  ? -5.201  5.512   5.417   1.00 5.26  ? 8  DA  C C6     2  
ATOM 3300  N N6     . DA  A 1 8  ? -5.629  6.396   4.510   1.00 5.31  ? 8  DA  C N6     2  
ATOM 3301  N N1     . DA  A 1 8  ? -4.978  4.240   5.017   1.00 4.91  ? 8  DA  C N1     2  
ATOM 3302  C C2     . DA  A 1 8  ? -4.537  3.354   5.920   1.00 4.88  ? 8  DA  C C2     2  
ATOM 3303  N N3     . DA  A 1 8  ? -4.267  3.531   7.212   1.00 5.16  ? 8  DA  C N3     2  
ATOM 3304  C C4     . DA  A 1 8  ? -4.505  4.801   7.580   1.00 5.50  ? 8  DA  C C4     2  
ATOM 3305  H "H5'"  . DA  A 1 8  ? -6.117  5.996   12.352  1.00 6.79  ? 8  DA  C "H5'"  2  
ATOM 3306  H "H5''" . DA  A 1 8  ? -5.070  6.040   13.784  1.00 7.09  ? 8  DA  C "H5''" 2  
ATOM 3307  H "H4'"  . DA  A 1 8  ? -4.658  3.932   12.990  1.00 6.52  ? 8  DA  C "H4'"  2  
ATOM 3308  H "H3'"  . DA  A 1 8  ? -2.514  5.492   12.921  1.00 6.70  ? 8  DA  C "H3'"  2  
ATOM 3309  H "H2'"  . DA  A 1 8  ? -2.777  6.415   10.717  1.00 6.42  ? 8  DA  C "H2'"  2  
ATOM 3310  H "H2''" . DA  A 1 8  ? -1.699  5.067   10.387  1.00 6.05  ? 8  DA  C "H2''" 2  
ATOM 3311  H "H1'"  . DA  A 1 8  ? -3.455  3.654   9.643   1.00 5.67  ? 8  DA  C "H1'"  2  
ATOM 3312  H H8     . DA  A 1 8  ? -4.699  7.360   9.541   1.00 6.42  ? 8  DA  C H8     2  
ATOM 3313  H H61    . DA  A 1 8  ? -5.772  6.114   3.552   1.00 5.10  ? 8  DA  C H61    2  
ATOM 3314  H H62    . DA  A 1 8  ? -5.796  7.353   4.788   1.00 5.58  ? 8  DA  C H62    2  
ATOM 3315  H H2     . DA  A 1 8  ? -4.377  2.344   5.543   1.00 4.61  ? 8  DA  C H2     2  
ATOM 3316  P P      . DT  A 1 9  ? -0.741  3.335   12.230  1.00 6.09  ? 9  DT  C P      2  
ATOM 3317  O OP1    . DT  A 1 9  ? -0.301  2.552   13.414  1.00 6.21  ? 9  DT  C OP1    2  
ATOM 3318  O OP2    . DT  A 1 9  ? -0.099  4.639   11.928  1.00 6.24  ? 9  DT  C OP2    2  
ATOM 3319  O "O5'"  . DT  A 1 9  ? -0.635  2.403   10.944  1.00 5.64  ? 9  DT  C "O5'"  2  
ATOM 3320  C "C5'"  . DT  A 1 9  ? -1.490  1.268   10.837  1.00 5.46  ? 9  DT  C "C5'"  2  
ATOM 3321  C "C4'"  . DT  A 1 9  ? -1.019  0.341   9.744   1.00 5.04  ? 9  DT  C "C4'"  2  
ATOM 3322  O "O4'"  . DT  A 1 9  ? -1.449  0.867   8.465   1.00 4.86  ? 9  DT  C "O4'"  2  
ATOM 3323  C "C3'"  . DT  A 1 9  ? 0.498   0.242   9.641   1.00 4.94  ? 9  DT  C "C3'"  2  
ATOM 3324  O "O3'"  . DT  A 1 9  ? 0.848   -1.030  9.092   1.00 4.61  ? 9  DT  C "O3'"  2  
ATOM 3325  C "C2'"  . DT  A 1 9  ? 0.847   1.401   8.722   1.00 4.92  ? 9  DT  C "C2'"  2  
ATOM 3326  C "C1'"  . DT  A 1 9  ? -0.338  1.410   7.762   1.00 4.77  ? 9  DT  C "C1'"  2  
ATOM 3327  N N1     . DT  A 1 9  ? -0.724  2.730   7.210   1.00 4.93  ? 9  DT  C N1     2  
ATOM 3328  C C2     . DT  A 1 9  ? -1.060  2.768   5.874   1.00 4.69  ? 9  DT  C C2     2  
ATOM 3329  O O2     . DT  A 1 9  ? -1.077  1.777   5.165   1.00 4.36  ? 9  DT  C O2     2  
ATOM 3330  N N3     . DT  A 1 9  ? -1.376  4.010   5.395   1.00 4.89  ? 9  DT  C N3     2  
ATOM 3331  C C4     . DT  A 1 9  ? -1.392  5.194   6.096   1.00 5.28  ? 9  DT  C C4     2  
ATOM 3332  O O4     . DT  A 1 9  ? -1.672  6.242   5.515   1.00 5.43  ? 9  DT  C O4     2  
ATOM 3333  C C5     . DT  A 1 9  ? -1.039  5.088   7.498   1.00 5.49  ? 9  DT  C C5     2  
ATOM 3334  C C7     . DT  A 1 9  ? -0.990  6.334   8.325   1.00 5.91  ? 9  DT  C C7     2  
ATOM 3335  C C6     . DT  A 1 9  ? -0.730  3.873   7.987   1.00 5.31  ? 9  DT  C C6     2  
ATOM 3336  H "H5'"  . DT  A 1 9  ? -2.504  1.598   10.611  1.00 5.51  ? 9  DT  C "H5'"  2  
ATOM 3337  H "H5''" . DT  A 1 9  ? -1.497  0.727   11.783  1.00 5.60  ? 9  DT  C "H5''" 2  
ATOM 3338  H "H4'"  . DT  A 1 9  ? -1.396  -0.660  9.959   1.00 4.97  ? 9  DT  C "H4'"  2  
ATOM 3339  H "H3'"  . DT  A 1 9  ? 0.964   0.350   10.621  1.00 5.16  ? 9  DT  C "H3'"  2  
ATOM 3340  H "H2'"  . DT  A 1 9  ? 0.935   2.333   9.279   1.00 5.21  ? 9  DT  C "H2'"  2  
ATOM 3341  H "H2''" . DT  A 1 9  ? 1.795   1.234   8.215   1.00 4.76  ? 9  DT  C "H2''" 2  
ATOM 3342  H "H1'"  . DT  A 1 9  ? -0.139  0.744   6.920   1.00 4.47  ? 9  DT  C "H1'"  2  
ATOM 3343  H H3     . DT  A 1 9  ? -1.618  4.060   4.416   1.00 4.75  ? 9  DT  C H3     2  
ATOM 3344  H H71    . DT  A 1 9  ? -0.529  7.135   7.749   1.00 5.99  ? 9  DT  C H71    2  
ATOM 3345  H H72    . DT  A 1 9  ? -0.403  6.150   9.227   1.00 6.04  ? 9  DT  C H72    2  
ATOM 3346  H H73    . DT  A 1 9  ? -2.003  6.625   8.604   1.00 6.06  ? 9  DT  C H73    2  
ATOM 3347  H H6     . DT  A 1 9  ? -0.477  3.788   9.043   1.00 5.49  ? 9  DT  C H6     2  
ATOM 3348  P P      . DA  A 1 10 ? 2.390   -1.403  8.842   1.00 4.43  ? 10 DA  C P      2  
ATOM 3349  O OP1    . DA  A 1 10 ? 2.637   -2.725  9.472   1.00 4.39  ? 10 DA  C OP1    2  
ATOM 3350  O OP2    . DA  A 1 10 ? 3.246   -0.246  9.203   1.00 4.66  ? 10 DA  C OP2    2  
ATOM 3351  O "O5'"  . DA  A 1 10 ? 2.429   -1.596  7.265   1.00 4.06  ? 10 DA  C "O5'"  2  
ATOM 3352  C "C5'"  . DA  A 1 10 ? 1.493   -2.471  6.641   1.00 3.83  ? 10 DA  C "C5'"  2  
ATOM 3353  C "C4'"  . DA  A 1 10 ? 1.790   -2.621  5.168   1.00 3.50  ? 10 DA  C "C4'"  2  
ATOM 3354  O "O4'"  . DA  A 1 10 ? 1.350   -1.421  4.483   1.00 3.59  ? 10 DA  C "O4'"  2  
ATOM 3355  C "C3'"  . DA  A 1 10 ? 3.275   -2.737  4.838   1.00 3.38  ? 10 DA  C "C3'"  2  
ATOM 3356  O "O3'"  . DA  A 1 10 ? 3.449   -3.448  3.611   1.00 3.05  ? 10 DA  C "O3'"  2  
ATOM 3357  C "C2'"  . DA  A 1 10 ? 3.705   -1.288  4.714   1.00 3.59  ? 10 DA  C "C2'"  2  
ATOM 3358  C "C1'"  . DA  A 1 10 ? 2.475   -0.636  4.098   1.00 3.64  ? 10 DA  C "C1'"  2  
ATOM 3359  N N9     . DA  A 1 10 ? 2.256   0.753   4.508   1.00 3.99  ? 10 DA  C N9     2  
ATOM 3360  C C8     . DA  A 1 10 ? 2.369   1.296   5.763   1.00 4.31  ? 10 DA  C C8     2  
ATOM 3361  N N7     . DA  A 1 10 ? 2.156   2.591   5.800   1.00 4.59  ? 10 DA  C N7     2  
ATOM 3362  C C5     . DA  A 1 10 ? 1.878   2.921   4.482   1.00 4.47  ? 10 DA  C C5     2  
ATOM 3363  C C6     . DA  A 1 10 ? 1.572   4.145   3.853   1.00 4.68  ? 10 DA  C C6     2  
ATOM 3364  N N6     . DA  A 1 10 ? 1.510   5.317   4.493   1.00 5.05  ? 10 DA  C N6     2  
ATOM 3365  N N1     . DA  A 1 10 ? 1.340   4.127   2.522   1.00 4.52  ? 10 DA  C N1     2  
ATOM 3366  C C2     . DA  A 1 10 ? 1.417   2.956   1.874   1.00 4.16  ? 10 DA  C C2     2  
ATOM 3367  N N3     . DA  A 1 10 ? 1.703   1.746   2.351   1.00 3.92  ? 10 DA  C N3     2  
ATOM 3368  C C4     . DA  A 1 10 ? 1.924   1.796   3.677   1.00 4.10  ? 10 DA  C C4     2  
ATOM 3369  H "H5'"  . DA  A 1 10 ? 0.486   -2.070  6.760   1.00 3.96  ? 10 DA  C "H5'"  2  
ATOM 3370  H "H5''" . DA  A 1 10 ? 1.539   -3.453  7.113   1.00 3.81  ? 10 DA  C "H5''" 2  
ATOM 3371  H "H4'"  . DA  A 1 10 ? 1.306   -3.530  4.812   1.00 3.33  ? 10 DA  C "H4'"  2  
ATOM 3372  H "H3'"  . DA  A 1 10 ? 3.815   -3.254  5.631   1.00 3.43  ? 10 DA  C "H3'"  2  
ATOM 3373  H "H2'"  . DA  A 1 10 ? 3.954   -0.864  5.686   1.00 3.83  ? 10 DA  C "H2'"  2  
ATOM 3374  H "H2''" . DA  A 1 10 ? 4.583   -1.184  4.078   1.00 3.50  ? 10 DA  C "H2''" 2  
ATOM 3375  H "H1'"  . DA  A 1 10 ? 2.536   -0.664  3.008   1.00 3.48  ? 10 DA  C "H1'"  2  
ATOM 3376  H H8     . DA  A 1 10 ? 2.616   0.713   6.637   1.00 4.34  ? 10 DA  C H8     2  
ATOM 3377  H H61    . DA  A 1 10 ? 1.297   6.167   3.991   1.00 5.20  ? 10 DA  C H61    2  
ATOM 3378  H H62    . DA  A 1 10 ? 1.686   5.353   5.486   1.00 5.19  ? 10 DA  C H62    2  
ATOM 3379  H H2     . DA  A 1 10 ? 1.219   3.001   0.804   1.00 4.07  ? 10 DA  C H2     2  
ATOM 3380  P P      . DT  A 1 11 ? 4.917   -3.617  2.982   1.00 2.90  ? 11 DT  C P      2  
ATOM 3381  O OP1    . DT  A 1 11 ? 5.110   -5.024  2.527   1.00 2.64  ? 11 DT  C OP1    2  
ATOM 3382  O OP2    . DT  A 1 11 ? 5.923   -3.002  3.880   1.00 3.10  ? 11 DT  C OP2    2  
ATOM 3383  O "O5'"  . DT  A 1 11 ? 4.799   -2.689  1.695   1.00 2.91  ? 11 DT  C "O5'"  2  
ATOM 3384  C "C5'"  . DT  A 1 11 ? 3.699   -2.850  0.801   1.00 2.80  ? 11 DT  C "C5'"  2  
ATOM 3385  C "C4'"  . DT  A 1 11 ? 3.976   -2.148  -0.506  1.00 2.86  ? 11 DT  C "C4'"  2  
ATOM 3386  O "O4'"  . DT  A 1 11 ? 3.687   -0.732  -0.349  1.00 3.15  ? 11 DT  C "O4'"  2  
ATOM 3387  C "C3'"  . DT  A 1 11 ? 5.450   -2.218  -0.880  1.00 2.87  ? 11 DT  C "C3'"  2  
ATOM 3388  O "O3'"  . DT  A 1 11 ? 5.629   -2.129  -2.285  1.00 2.91  ? 11 DT  C "O3'"  2  
ATOM 3389  C "C2'"  . DT  A 1 11 ? 6.034   -1.008  -0.175  1.00 3.15  ? 11 DT  C "C2'"  2  
ATOM 3390  C "C1'"  . DT  A 1 11 ? 4.905   0.004   -0.298  1.00 3.35  ? 11 DT  C "C1'"  2  
ATOM 3391  N N1     . DT  A 1 11 ? 4.835   1.008   0.792   1.00 3.63  ? 11 DT  C N1     2  
ATOM 3392  C C2     . DT  A 1 11 ? 4.479   2.300   0.452   1.00 3.92  ? 11 DT  C C2     2  
ATOM 3393  O O2     . DT  A 1 11 ? 4.121   2.626   -0.668  1.00 3.95  ? 11 DT  C O2     2  
ATOM 3394  N N3     . DT  A 1 11 ? 4.553   3.203   1.480   1.00 4.21  ? 11 DT  C N3     2  
ATOM 3395  C C4     . DT  A 1 11 ? 4.913   2.952   2.784   1.00 4.26  ? 11 DT  C C4     2  
ATOM 3396  O O4     . DT  A 1 11 ? 5.002   3.882   3.580   1.00 4.57  ? 11 DT  C O4     2  
ATOM 3397  C C5     . DT  A 1 11 ? 5.226   1.572   3.084   1.00 3.96  ? 11 DT  C C5     2  
ATOM 3398  C C7     . DT  A 1 11 ? 5.667   1.220   4.467   1.00 4.05  ? 11 DT  C C7     2  
ATOM 3399  C C6     . DT  A 1 11 ? 5.163   0.672   2.089   1.00 3.65  ? 11 DT  C C6     2  
ATOM 3400  H "H5'"  . DT  A 1 11 ? 2.800   -2.424  1.250   1.00 2.92  ? 11 DT  C "H5'"  2  
ATOM 3401  H "H5''" . DT  A 1 11 ? 3.533   -3.910  0.610   1.00 2.62  ? 11 DT  C "H5''" 2  
ATOM 3402  H "H4'"  . DT  A 1 11 ? 3.405   -2.641  -1.297  1.00 2.74  ? 11 DT  C "H4'"  2  
ATOM 3403  H "H3'"  . DT  A 1 11 ? 5.894   -3.147  -0.525  1.00 2.71  ? 11 DT  C "H3'"  2  
ATOM 3404  H "H2'"  . DT  A 1 11 ? 6.274   -1.232  0.862   1.00 3.15  ? 11 DT  C "H2'"  2  
ATOM 3405  H "H2''" . DT  A 1 11 ? 6.949   -0.667  -0.655  1.00 3.24  ? 11 DT  C "H2''" 2  
ATOM 3406  H "H1'"  . DT  A 1 11 ? 4.990   0.545   -1.244  1.00 3.46  ? 11 DT  C "H1'"  2  
ATOM 3407  H H3     . DT  A 1 11 ? 4.346   4.168   1.257   1.00 4.44  ? 11 DT  C H3     2  
ATOM 3408  H H71    . DT  A 1 11 ? 6.367   1.973   4.828   1.00 4.18  ? 11 DT  C H71    2  
ATOM 3409  H H72    . DT  A 1 11 ? 4.801   1.184   5.129   1.00 4.22  ? 11 DT  C H72    2  
ATOM 3410  H H73    . DT  A 1 11 ? 6.156   0.246   4.457   1.00 4.16  ? 11 DT  C H73    2  
ATOM 3411  H H6     . DT  A 1 11 ? 5.372   -0.372  2.320   1.00 3.44  ? 11 DT  C H6     2  
ATOM 3412  P P      . DC  A 1 12 ? 7.113   -2.008  -2.881  1.00 3.03  ? 12 DC  C P      2  
ATOM 3413  O OP1    . DC  A 1 12 ? 7.210   -2.836  -4.113  1.00 2.99  ? 12 DC  C OP1    2  
ATOM 3414  O OP2    . DC  A 1 12 ? 8.109   -2.191  -1.795  1.00 2.97  ? 12 DC  C OP2    2  
ATOM 3415  O "O5'"  . DC  A 1 12 ? 7.099   -0.475  -3.297  1.00 3.38  ? 12 DC  C "O5'"  2  
ATOM 3416  C "C5'"  . DC  A 1 12 ? 5.942   0.046   -3.945  1.00 3.47  ? 12 DC  C "C5'"  2  
ATOM 3417  C "C4'"  . DC  A 1 12 ? 6.258   1.348   -4.634  1.00 3.83  ? 12 DC  C "C4'"  2  
ATOM 3418  O "O4'"  . DC  A 1 12 ? 6.181   2.426   -3.666  1.00 4.03  ? 12 DC  C "O4'"  2  
ATOM 3419  C "C3'"  . DC  A 1 12 ? 7.688   1.378   -5.155  1.00 3.98  ? 12 DC  C "C3'"  2  
ATOM 3420  O "O3'"  . DC  A 1 12 ? 7.772   2.257   -6.266  1.00 4.31  ? 12 DC  C "O3'"  2  
ATOM 3421  C "C2'"  . DC  A 1 12 ? 8.472   1.892   -3.961  1.00 4.06  ? 12 DC  C "C2'"  2  
ATOM 3422  C "C1'"  . DC  A 1 12 ? 7.490   2.884   -3.349  1.00 4.21  ? 12 DC  C "C1'"  2  
ATOM 3423  N N1     . DC  A 1 12 ? 7.598   3.099   -1.891  1.00 4.22  ? 12 DC  C N1     2  
ATOM 3424  C C2     . DC  A 1 12 ? 7.524   4.417   -1.406  1.00 4.57  ? 12 DC  C C2     2  
ATOM 3425  O O2     . DC  A 1 12 ? 7.296   5.338   -2.205  1.00 4.81  ? 12 DC  C O2     2  
ATOM 3426  N N3     . DC  A 1 12 ? 7.701   4.654   -0.086  1.00 4.65  ? 12 DC  C N3     2  
ATOM 3427  C C4     . DC  A 1 12 ? 7.936   3.638   0.746   1.00 4.41  ? 12 DC  C C4     2  
ATOM 3428  N N4     . DC  A 1 12 ? 8.145   3.929   2.036   1.00 4.56  ? 12 DC  C N4     2  
ATOM 3429  C C5     . DC  A 1 12 ? 7.979   2.282   0.292   1.00 4.05  ? 12 DC  C C5     2  
ATOM 3430  C C6     . DC  A 1 12 ? 7.801   2.060   -1.024  1.00 3.96  ? 12 DC  C C6     2  
ATOM 3431  H "H5'"  . DC  A 1 12 ? 5.158   0.214   -3.209  1.00 3.42  ? 12 DC  C "H5'"  2  
ATOM 3432  H "H5''" . DC  A 1 12 ? 5.585   -0.670  -4.685  1.00 3.35  ? 12 DC  C "H5''" 2  
ATOM 3433  H "H4'"  . DC  A 1 12 ? 5.589   1.462   -5.490  1.00 3.88  ? 12 DC  C "H4'"  2  
ATOM 3434  H "H3'"  . DC  A 1 12 ? 8.016   0.384   -5.458  1.00 3.82  ? 12 DC  C "H3'"  2  
ATOM 3435  H "H2'"  . DC  A 1 12 ? 8.724   1.084   -3.274  1.00 3.84  ? 12 DC  C "H2'"  2  
ATOM 3436  H "H2''" . DC  A 1 12 ? 9.403   2.366   -4.267  1.00 4.26  ? 12 DC  C "H2''" 2  
ATOM 3437  H "H1'"  . DC  A 1 12 ? 7.604   3.858   -3.833  1.00 4.48  ? 12 DC  C "H1'"  2  
ATOM 3438  H H41    . DC  A 1 12 ? 8.133   4.890   2.351   1.00 4.84  ? 12 DC  C H41    2  
ATOM 3439  H H42    . DC  A 1 12 ? 8.334   3.192   2.701   1.00 4.42  ? 12 DC  C H42    2  
ATOM 3440  H H5     . DC  A 1 12 ? 8.150   1.458   0.984   1.00 3.87  ? 12 DC  C H5     2  
ATOM 3441  H H6     . DC  A 1 12 ? 7.818   1.039   -1.402  1.00 3.70  ? 12 DC  C H6     2  
ATOM 3442  P P      . DT  A 1 13 ? 9.196   2.571   -6.925  1.00 4.57  ? 13 DT  C P      2  
ATOM 3443  O OP1    . DT  A 1 13 ? 9.052   2.452   -8.399  1.00 4.73  ? 13 DT  C OP1    2  
ATOM 3444  O OP2    . DT  A 1 13 ? 10.267  1.814   -6.227  1.00 4.41  ? 13 DT  C OP2    2  
ATOM 3445  O "O5'"  . DT  A 1 13 ? 9.336   4.107   -6.551  1.00 4.91  ? 13 DT  C "O5'"  2  
ATOM 3446  C "C5'"  . DT  A 1 13 ? 8.202   4.958   -6.697  1.00 5.05  ? 13 DT  C "C5'"  2  
ATOM 3447  C "C4'"  . DT  A 1 13 ? 8.628   6.404   -6.707  1.00 5.46  ? 13 DT  C "C4'"  2  
ATOM 3448  O "O4'"  . DT  A 1 13 ? 8.802   6.847   -5.338  1.00 5.48  ? 13 DT  C "O4'"  2  
ATOM 3449  C "C3'"  . DT  A 1 13 ? 9.983   6.595   -7.369  1.00 5.68  ? 13 DT  C "C3'"  2  
ATOM 3450  O "O3'"  . DT  A 1 13 ? 10.084  7.903   -7.914  1.00 6.08  ? 13 DT  C "O3'"  2  
ATOM 3451  C "C2'"  . DT  A 1 13 ? 10.951  6.378   -6.220  1.00 5.58  ? 13 DT  C "C2'"  2  
ATOM 3452  C "C1'"  . DT  A 1 13 ? 10.185  6.983   -5.046  1.00 5.59  ? 13 DT  C "C1'"  2  
ATOM 3453  N N1     . DT  A 1 13 ? 10.453  6.387   -3.713  1.00 5.36  ? 13 DT  C N1     2  
ATOM 3454  C C2     . DT  A 1 13 ? 10.568  7.258   -2.648  1.00 5.56  ? 13 DT  C C2     2  
ATOM 3455  O O2     . DT  A 1 13 ? 10.422  8.464   -2.755  1.00 5.88  ? 13 DT  C O2     2  
ATOM 3456  N N3     . DT  A 1 13 ? 10.861  6.667   -1.448  1.00 5.38  ? 13 DT  C N3     2  
ATOM 3457  C C4     . DT  A 1 13 ? 11.044  5.322   -1.206  1.00 5.02  ? 13 DT  C C4     2  
ATOM 3458  O O4     . DT  A 1 13 ? 11.347  4.943   -0.074  1.00 4.93  ? 13 DT  C O4     2  
ATOM 3459  C C5     . DT  A 1 13 ? 10.894  4.460   -2.360  1.00 4.81  ? 13 DT  C C5     2  
ATOM 3460  C C7     . DT  A 1 13 ? 11.106  2.987   -2.192  1.00 4.43  ? 13 DT  C C7     2  
ATOM 3461  C C6     . DT  A 1 13 ? 10.603  5.024   -3.545  1.00 5.00  ? 13 DT  C C6     2  
ATOM 3462  H "H5'"  . DT  A 1 13 ? 7.513   4.795   -5.870  1.00 4.88  ? 13 DT  C "H5'"  2  
ATOM 3463  H "H5''" . DT  A 1 13 ? 7.693   4.732   -7.634  1.00 5.06  ? 13 DT  C "H5''" 2  
ATOM 3464  H "H4'"  . DT  A 1 13 ? 7.895   6.980   -7.276  1.00 5.61  ? 13 DT  C "H4'"  2  
ATOM 3465  H "H3'"  . DT  A 1 13 ? 10.132  5.864   -8.164  1.00 5.59  ? 13 DT  C "H3'"  2  
ATOM 3466  H "H2'"  . DT  A 1 13 ? 11.161  5.318   -6.075  1.00 5.30  ? 13 DT  C "H2'"  2  
ATOM 3467  H "H2''" . DT  A 1 13 ? 11.901  6.878   -6.400  1.00 5.80  ? 13 DT  C "H2''" 2  
ATOM 3468  H "H1'"  . DT  A 1 13 ? 10.394  8.054   -4.979  1.00 5.89  ? 13 DT  C "H1'"  2  
ATOM 3469  H H3     . DT  A 1 13 ? 10.960  7.287   -0.654  1.00 5.55  ? 13 DT  C H3     2  
ATOM 3470  H H71    . DT  A 1 13 ? 10.203  2.533   -1.790  1.00 4.39  ? 13 DT  C H71    2  
ATOM 3471  H H72    . DT  A 1 13 ? 11.340  2.541   -3.158  1.00 4.34  ? 13 DT  C H72    2  
ATOM 3472  H H73    . DT  A 1 13 ? 11.935  2.816   -1.505  1.00 4.63  ? 13 DT  C H73    2  
ATOM 3473  H H6     . DT  A 1 13 ? 10.474  4.375   -4.411  1.00 4.87  ? 13 DT  C H6     2  
ATOM 3474  P P      . DT  A 1 14 ? 11.442  8.365   -8.623  1.00 6.39  ? 14 DT  C P      2  
ATOM 3475  O OP1    . DT  A 1 14 ? 11.089  8.995   -9.921  1.00 6.68  ? 14 DT  C OP1    2  
ATOM 3476  O OP2    . DT  A 1 14 ? 12.438  7.264   -8.587  1.00 6.17  ? 14 DT  C OP2    2  
ATOM 3477  O "O5'"  . DT  A 1 14 ? 11.920  9.507   -7.629  1.00 6.61  ? 14 DT  C "O5'"  2  
ATOM 3478  C "C5'"  . DT  A 1 14 ? 10.982  10.484  -7.192  1.00 6.76  ? 14 DT  C "C5'"  2  
ATOM 3479  C "C4'"  . DT  A 1 14 ? 11.680  11.601  -6.462  1.00 7.05  ? 14 DT  C "C4'"  2  
ATOM 3480  O "O4'"  . DT  A 1 14 ? 11.958  11.172  -5.105  1.00 6.86  ? 14 DT  C "O4'"  2  
ATOM 3481  C "C3'"  . DT  A 1 14 ? 13.040  11.928  -7.063  1.00 7.28  ? 14 DT  C "C3'"  2  
ATOM 3482  O "O3'"  . DT  A 1 14 ? 13.369  13.283  -6.785  1.00 7.65  ? 14 DT  C "O3'"  2  
ATOM 3483  C "C2'"  . DT  A 1 14 ? 13.967  10.961  -6.349  1.00 7.02  ? 14 DT  C "C2'"  2  
ATOM 3484  C "C1'"  . DT  A 1 14 ? 13.348  10.909  -4.956  1.00 6.87  ? 14 DT  C "C1'"  2  
ATOM 3485  N N1     . DT  A 1 14 ? 13.523  9.640   -4.211  1.00 6.48  ? 14 DT  C N1     2  
ATOM 3486  C C2     . DT  A 1 14 ? 13.733  9.741   -2.850  1.00 6.46  ? 14 DT  C C2     2  
ATOM 3487  O O2     . DT  A 1 14 ? 13.728  10.805  -2.251  1.00 6.74  ? 14 DT  C O2     2  
ATOM 3488  N N3     . DT  A 1 14 ? 13.949  8.549   -2.213  1.00 6.11  ? 14 DT  C N3     2  
ATOM 3489  C C4     . DT  A 1 14 ? 13.971  7.294   -2.780  1.00 5.79  ? 14 DT  C C4     2  
ATOM 3490  O O4     . DT  A 1 14 ? 14.218  6.313   -2.081  1.00 5.50  ? 14 DT  C O4     2  
ATOM 3491  C C5     . DT  A 1 14 ? 13.724  7.255   -4.205  1.00 5.84  ? 14 DT  C C5     2  
ATOM 3492  C C7     . DT  A 1 14 ? 13.780  5.935   -4.910  1.00 5.54  ? 14 DT  C C7     2  
ATOM 3493  C C6     . DT  A 1 14 ? 13.505  8.415   -4.847  1.00 6.19  ? 14 DT  C C6     2  
ATOM 3494  H "H5'"  . DT  A 1 14 ? 10.257  10.020  -6.524  1.00 6.53  ? 14 DT  C "H5'"  2  
ATOM 3495  H "H5''" . DT  A 1 14 ? 10.456  10.897  -8.054  1.00 6.91  ? 14 DT  C "H5''" 2  
ATOM 3496  H "H4'"  . DT  A 1 14 ? 11.063  12.500  -6.529  1.00 7.27  ? 14 DT  C "H4'"  2  
ATOM 3497  H "H3'"  . DT  A 1 14 ? 13.042  11.771  -8.141  1.00 7.34  ? 14 DT  C "H3'"  2  
ATOM 3498  H "H2'"  . DT  A 1 14 ? 13.971  9.987   -6.836  1.00 6.80  ? 14 DT  C "H2'"  2  
ATOM 3499  H "H2''" . DT  A 1 14 ? 14.993  11.326  -6.341  1.00 7.19  ? 14 DT  C "H2''" 2  
ATOM 3500  H "H1'"  . DT  A 1 14 ? 13.757  11.714  -4.339  1.00 7.08  ? 14 DT  C "H1'"  2  
ATOM 3501  H H3     . DT  A 1 14 ? 14.124  8.606   -1.218  1.00 6.11  ? 14 DT  C H3     2  
ATOM 3502  H H71    . DT  A 1 14 ? 13.824  6.098   -5.987  1.00 5.65  ? 14 DT  C H71    2  
ATOM 3503  H H72    . DT  A 1 14 ? 14.667  5.389   -4.588  1.00 5.56  ? 14 DT  C H72    2  
ATOM 3504  H H73    . DT  A 1 14 ? 12.890  5.355   -4.666  1.00 5.33  ? 14 DT  C H73    2  
ATOM 3505  H H6     . DT  A 1 14 ? 13.301  8.388   -5.917  1.00 6.25  ? 14 DT  C H6     2  
ATOM 3506  P P      . DA  A 1 15 ? 14.792  13.869  -7.236  1.00 7.95  ? 15 DA  C P      2  
ATOM 3507  O OP1    . DA  A 1 15 ? 14.535  15.160  -7.923  1.00 8.35  ? 15 DA  C OP1    2  
ATOM 3508  O OP2    . DA  A 1 15 ? 15.582  12.814  -7.918  1.00 7.77  ? 15 DA  C OP2    2  
ATOM 3509  O "O5'"  . DA  A 1 15 ? 15.451  14.175  -5.823  1.00 7.97  ? 15 DA  C "O5'"  2  
ATOM 3510  C "C5'"  . DA  A 1 15 ? 14.704  14.897  -4.850  1.00 8.07  ? 15 DA  C "C5'"  2  
ATOM 3511  C "C4'"  . DA  A 1 15 ? 15.566  15.258  -3.667  1.00 8.17  ? 15 DA  C "C4'"  2  
ATOM 3512  O "O4'"  . DA  A 1 15 ? 15.693  14.101  -2.803  1.00 7.81  ? 15 DA  C "O4'"  2  
ATOM 3513  C "C3'"  . DA  A 1 15 ? 16.995  15.615  -4.057  1.00 8.38  ? 15 DA  C "C3'"  2  
ATOM 3514  O "O3'"  . DA  A 1 15 ? 17.546  16.482  -3.076  1.00 8.63  ? 15 DA  C "O3'"  2  
ATOM 3515  C "C2'"  . DA  A 1 15 ? 17.692  14.267  -4.070  1.00 8.04  ? 15 DA  C "C2'"  2  
ATOM 3516  C "C1'"  . DA  A 1 15 ? 17.001  13.549  -2.918  1.00 7.73  ? 15 DA  C "C1'"  2  
ATOM 3517  N N9     . DA  A 1 15 ? 16.898  12.094  -3.052  1.00 7.31  ? 15 DA  C N9     2  
ATOM 3518  C C8     . DA  A 1 15 ? 16.557  11.351  -4.152  1.00 7.14  ? 15 DA  C C8     2  
ATOM 3519  N N7     . DA  A 1 15 ? 16.602  10.055  -3.950  1.00 6.76  ? 15 DA  C N7     2  
ATOM 3520  C C5     . DA  A 1 15 ? 16.996  9.936   -2.624  1.00 6.68  ? 15 DA  C C5     2  
ATOM 3521  C C6     . DA  A 1 15 ? 17.236  8.818   -1.799  1.00 6.35  ? 15 DA  C C6     2  
ATOM 3522  N N6     . DA  A 1 15 ? 17.116  7.553   -2.210  1.00 6.00  ? 15 DA  C N6     2  
ATOM 3523  N N1     . DA  A 1 15 ? 17.611  9.048   -0.521  1.00 6.40  ? 15 DA  C N1     2  
ATOM 3524  C C2     . DA  A 1 15 ? 17.740  10.317  -0.111  1.00 6.76  ? 15 DA  C C2     2  
ATOM 3525  N N3     . DA  A 1 15 ? 17.550  11.447  -0.791  1.00 7.09  ? 15 DA  C N3     2  
ATOM 3526  C C4     . DA  A 1 15 ? 17.174  11.184  -2.057  1.00 7.03  ? 15 DA  C C4     2  
ATOM 3527  H "H5'"  . DA  A 1 15 ? 13.869  14.285  -4.506  1.00 7.82  ? 15 DA  C "H5'"  2  
ATOM 3528  H "H5''" . DA  A 1 15 ? 14.312  15.812  -5.296  1.00 8.33  ? 15 DA  C "H5''" 2  
ATOM 3529  H "H4'"  . DA  A 1 15 ? 15.131  16.132  -3.177  1.00 8.38  ? 15 DA  C "H4'"  2  
ATOM 3530  H "H3'"  . DA  A 1 15 ? 17.028  16.104  -5.031  1.00 8.58  ? 15 DA  C "H3'"  2  
ATOM 3531  H "H2'"  . DA  A 1 15 ? 17.549  13.755  -5.021  1.00 7.94  ? 15 DA  C "H2'"  2  
ATOM 3532  H "H2''" . DA  A 1 15 ? 18.764  14.368  -3.909  1.00 8.13  ? 15 DA  C "H2''" 2  
ATOM 3533  H "H1'"  . DA  A 1 15 ? 17.521  13.762  -1.981  1.00 7.79  ? 15 DA  C "H1'"  2  
ATOM 3534  H H8     . DA  A 1 15 ? 16.282  11.792  -5.098  1.00 7.30  ? 15 DA  C H8     2  
ATOM 3535  H H61    . DA  A 1 15 ? 17.310  6.793   -1.573  1.00 5.78  ? 15 DA  C H61    2  
ATOM 3536  H H62    . DA  A 1 15 ? 16.842  7.357   -3.162  1.00 5.98  ? 15 DA  C H62    2  
ATOM 3537  H H2     . DA  A 1 15 ? 18.045  10.443  0.929   1.00 6.81  ? 15 DA  C H2     2  
ATOM 3538  P P      . DT  A 1 16 ? 19.084  16.922  -3.172  1.00 8.87  ? 16 DT  C P      2  
ATOM 3539  O OP1    . DT  A 1 16 ? 19.147  18.391  -2.970  1.00 9.30  ? 16 DT  C OP1    2  
ATOM 3540  O OP2    . DT  A 1 16 ? 19.719  16.314  -4.369  1.00 8.79  ? 16 DT  C OP2    2  
ATOM 3541  O "O5'"  . DT  A 1 16 ? 19.668  16.216  -1.871  1.00 8.65  ? 16 DT  C "O5'"  2  
ATOM 3542  C "C5'"  . DT  A 1 16 ? 18.915  16.263  -0.662  1.00 8.59  ? 16 DT  C "C5'"  2  
ATOM 3543  C "C4'"  . DT  A 1 16 ? 19.762  15.842  0.512   1.00 8.49  ? 16 DT  C "C4'"  2  
ATOM 3544  O "O4'"  . DT  A 1 16 ? 19.819  14.394  0.554   1.00 8.07  ? 16 DT  C "O4'"  2  
ATOM 3545  C "C3'"  . DT  A 1 16 ? 21.210  16.296  0.376   1.00 8.71  ? 16 DT  C "C3'"  2  
ATOM 3546  O "O3'"  . DT  A 1 16 ? 21.805  16.431  1.662   1.00 8.76  ? 16 DT  C "O3'"  2  
ATOM 3547  C "C2'"  . DT  A 1 16 ? 21.843  15.164  -0.411  1.00 8.42  ? 16 DT  C "C2'"  2  
ATOM 3548  C "C1'"  . DT  A 1 16 ? 21.102  13.948  0.139   1.00 8.01  ? 16 DT  C "C1'"  2  
ATOM 3549  N N1     . DT  A 1 16 ? 20.944  12.808  -0.794  1.00 7.70  ? 16 DT  C N1     2  
ATOM 3550  C C2     . DT  A 1 16 ? 21.080  11.537  -0.267  1.00 7.32  ? 16 DT  C C2     2  
ATOM 3551  O O2     . DT  A 1 16 ? 21.242  11.321  0.922   1.00 7.25  ? 16 DT  C O2     2  
ATOM 3552  N N3     . DT  A 1 16 ? 21.016  10.523  -1.186  1.00 7.06  ? 16 DT  C N3     2  
ATOM 3553  C C4     . DT  A 1 16 ? 20.820  10.643  -2.543  1.00 7.14  ? 16 DT  C C4     2  
ATOM 3554  O O4     . DT  A 1 16 ? 20.864  9.641   -3.255  1.00 6.91  ? 16 DT  C O4     2  
ATOM 3555  C C5     . DT  A 1 16 ? 20.644  11.999  -3.026  1.00 7.54  ? 16 DT  C C5     2  
ATOM 3556  C C7     . DT  A 1 16 ? 20.435  12.223  -4.492  1.00 7.68  ? 16 DT  C C7     2  
ATOM 3557  C C6     . DT  A 1 16 ? 20.706  13.004  -2.140  1.00 7.79  ? 16 DT  C C6     2  
ATOM 3558  H "H5'"  . DT  A 1 16 ? 18.058  15.592  -0.741  1.00 8.35  ? 16 DT  C "H5'"  2  
ATOM 3559  H "H5''" . DT  A 1 16 ? 18.556  17.278  -0.495  1.00 8.87  ? 16 DT  C "H5''" 2  
ATOM 3560  H "H4'"  . DT  A 1 16 ? 19.355  16.300  1.416   1.00 8.60  ? 16 DT  C "H4'"  2  
ATOM 3561  H "H3'"  . DT  A 1 16 ? 21.274  17.248  -0.153  1.00 9.00  ? 16 DT  C "H3'"  2  
ATOM 3562  H "H2'"  . DT  A 1 16 ? 21.691  15.292  -1.481  1.00 8.48  ? 16 DT  C "H2'"  2  
ATOM 3563  H "H2''" . DT  A 1 16 ? 22.918  15.113  -0.238  1.00 8.46  ? 16 DT  C "H2''" 2  
ATOM 3564  H "H1'"  . DT  A 1 16 ? 21.613  13.577  1.032   1.00 7.92  ? 16 DT  C "H1'"  2  
ATOM 3565  H H3     . DT  A 1 16 ? 21.142  9.586   -0.824  1.00 6.79  ? 16 DT  C H3     2  
ATOM 3566  H H71    . DT  A 1 16 ? 20.662  13.260  -4.738  1.00 7.73  ? 16 DT  C H71    2  
ATOM 3567  H H72    . DT  A 1 16 ? 21.093  11.563  -5.059  1.00 7.96  ? 16 DT  C H72    2  
ATOM 3568  H H73    . DT  A 1 16 ? 19.398  12.008  -4.749  1.00 7.57  ? 16 DT  C H73    2  
ATOM 3569  H H6     . DT  A 1 16 ? 20.554  14.023  -2.498  1.00 8.09  ? 16 DT  C H6     2  
ATOM 3570  P P      . DC  A 1 17 ? 23.342  16.869  1.783   1.00 8.97  ? 17 DC  C P      2  
ATOM 3571  O OP1    . DC  A 1 17 ? 23.425  17.950  2.795   1.00 9.29  ? 17 DC  C OP1    2  
ATOM 3572  O OP2    . DC  A 1 17 ? 23.900  17.090  0.424   1.00 9.08  ? 17 DC  C OP2    2  
ATOM 3573  O "O5'"  . DC  A 1 17 ? 23.999  15.556  2.393   1.00 8.62  ? 17 DC  C "O5'"  2  
ATOM 3574  C "C5'"  . DC  A 1 17 ? 23.403  14.933  3.526   1.00 8.41  ? 17 DC  C "C5'"  2  
ATOM 3575  C "C4'"  . DC  A 1 17 ? 24.326  13.890  4.106   1.00 8.15  ? 17 DC  C "C4'"  2  
ATOM 3576  O "O4'"  . DC  A 1 17 ? 24.248  12.694  3.296   1.00 7.79  ? 17 DC  C "O4'"  2  
ATOM 3577  C "C3'"  . DC  A 1 17 ? 25.791  14.306  4.065   1.00 8.34  ? 17 DC  C "C3'"  2  
ATOM 3578  O "O3'"  . DC  A 1 17 ? 26.522  13.642  5.096   1.00 8.19  ? 17 DC  C "O3'"  2  
ATOM 3579  C "C2'"  . DC  A 1 17 ? 26.231  13.844  2.687   1.00 8.23  ? 17 DC  C "C2'"  2  
ATOM 3580  C "C1'"  . DC  A 1 17 ? 25.431  12.555  2.518   1.00 7.81  ? 17 DC  C "C1'"  2  
ATOM 3581  N N1     . DC  A 1 17 ? 25.053  12.203  1.135   1.00 7.71  ? 17 DC  C N1     2  
ATOM 3582  C C2     . DC  A 1 17 ? 25.084  10.851  0.762   1.00 7.34  ? 17 DC  C C2     2  
ATOM 3583  O O2     . DC  A 1 17 ? 25.370  9.997   1.616   1.00 7.09  ? 17 DC  C O2     2  
ATOM 3584  N N3     . DC  A 1 17 ? 24.802  10.509  -0.515  1.00 7.27  ? 17 DC  C N3     2  
ATOM 3585  C C4     . DC  A 1 17 ? 24.493  11.450  -1.405  1.00 7.56  ? 17 DC  C C4     2  
ATOM 3586  N N4     . DC  A 1 17 ? 24.255  11.063  -2.662  1.00 7.51  ? 17 DC  C N4     2  
ATOM 3587  C C5     . DC  A 1 17 ? 24.424  12.833  -1.050  1.00 7.93  ? 17 DC  C C5     2  
ATOM 3588  C C6     . DC  A 1 17 ? 24.705  13.160  0.221   1.00 7.99  ? 17 DC  C C6     2  
ATOM 3589  H "H5'"  . DC  A 1 17 ? 22.468  14.456  3.230   1.00 8.22  ? 17 DC  C "H5'"  2  
ATOM 3590  H "H5''" . DC  A 1 17 ? 23.191  15.684  4.287   1.00 8.63  ? 17 DC  C "H5''" 2  
ATOM 3591  H "H4'"  . DC  A 1 17 ? 24.058  13.735  5.154   1.00 8.11  ? 17 DC  C "H4'"  2  
ATOM 3592  H "H3'"  . DC  A 1 17 ? 25.898  15.386  4.185   1.00 8.66  ? 17 DC  C "H3'"  2  
ATOM 3593  H "H2'"  . DC  A 1 17 ? 25.989  14.585  1.926   1.00 8.44  ? 17 DC  C "H2'"  2  
ATOM 3594  H "H2''" . DC  A 1 17 ? 27.306  13.676  2.648   1.00 8.23  ? 17 DC  C "H2''" 2  
ATOM 3595  H "H1'"  . DC  A 1 17 ? 25.989  11.715  2.935   1.00 7.59  ? 17 DC  C "H1'"  2  
ATOM 3596  H H41    . DC  A 1 17 ? 24.323  10.085  -2.910  1.00 7.27  ? 17 DC  C H41    2  
ATOM 3597  H H42    . DC  A 1 17 ? 24.023  11.743  -3.371  1.00 7.74  ? 17 DC  C H42    2  
ATOM 3598  H H5     . DC  A 1 17 ? 24.154  13.593  -1.784  1.00 8.17  ? 17 DC  C H5     2  
ATOM 3599  H H6     . DC  A 1 17 ? 24.649  14.204  0.529   1.00 8.28  ? 17 DC  C H6     2  
ATOM 3600  P P      . DG  A 1 18 ? 28.089  13.937  5.281   1.00 8.34  ? 18 DG  C P      2  
ATOM 3601  O OP1    . DG  A 1 18 ? 28.320  14.214  6.720   1.00 8.46  ? 18 DG  C OP1    2  
ATOM 3602  O OP2    . DG  A 1 18 ? 28.526  14.928  4.263   1.00 8.65  ? 18 DG  C OP2    2  
ATOM 3603  O "O5'"  . DG  A 1 18 ? 28.755  12.533  4.933   1.00 7.96  ? 18 DG  C "O5'"  2  
ATOM 3604  C "C5'"  . DG  A 1 18 ? 28.396  11.368  5.674   1.00 7.61  ? 18 DG  C "C5'"  2  
ATOM 3605  C "C4'"  . DG  A 1 18 ? 29.372  10.247  5.402   1.00 7.32  ? 18 DG  C "C4'"  2  
ATOM 3606  O "O4'"  . DG  A 1 18 ? 29.080  9.684   4.103   1.00 7.15  ? 18 DG  C "O4'"  2  
ATOM 3607  C "C3'"  . DG  A 1 18 ? 30.828  10.696  5.324   1.00 7.52  ? 18 DG  C "C3'"  2  
ATOM 3608  O "O3'"  . DG  A 1 18 ? 31.713  9.619   5.647   1.00 7.25  ? 18 DG  C "O3'"  2  
ATOM 3609  C "C2'"  . DG  A 1 18 ? 30.971  11.096  3.867   1.00 7.65  ? 18 DG  C "C2'"  2  
ATOM 3610  C "C1'"  . DG  A 1 18 ? 30.074  10.079  3.167   1.00 7.32  ? 18 DG  C "C1'"  2  
ATOM 3611  N N9     . DG  A 1 18 ? 29.405  10.549  1.956   1.00 7.45  ? 18 DG  C N9     2  
ATOM 3612  C C8     . DG  A 1 18 ? 28.927  11.810  1.686   1.00 7.80  ? 18 DG  C C8     2  
ATOM 3613  N N7     . DG  A 1 18 ? 28.409  11.920  0.491   1.00 7.85  ? 18 DG  C N7     2  
ATOM 3614  C C5     . DG  A 1 18 ? 28.547  10.651  -0.058  1.00 7.52  ? 18 DG  C C5     2  
ATOM 3615  C C6     . DG  A 1 18 ? 28.171  10.150  -1.337  1.00 7.43  ? 18 DG  C C6     2  
ATOM 3616  O O6     . DG  A 1 18 ? 27.623  10.749  -2.273  1.00 7.63  ? 18 DG  C O6     2  
ATOM 3617  N N1     . DG  A 1 18 ? 28.498  8.804   -1.474  1.00 7.08  ? 18 DG  C N1     2  
ATOM 3618  C C2     . DG  A 1 18 ? 29.106  8.038   -0.510  1.00 6.84  ? 18 DG  C C2     2  
ATOM 3619  N N2     . DG  A 1 18 ? 29.342  6.758   -0.823  1.00 6.52  ? 18 DG  C N2     2  
ATOM 3620  N N3     . DG  A 1 18 ? 29.461  8.491   0.680   1.00 6.92  ? 18 DG  C N3     2  
ATOM 3621  C C4     . DG  A 1 18 ? 29.154  9.794   0.837   1.00 7.27  ? 18 DG  C C4     2  
ATOM 3622  H "H5'"  . DG  A 1 18 ? 27.395  11.046  5.385   1.00 7.47  ? 18 DG  C "H5'"  2  
ATOM 3623  H "H5''" . DG  A 1 18 ? 28.402  11.595  6.740   1.00 7.70  ? 18 DG  C "H5''" 2  
ATOM 3624  H "H4'"  . DG  A 1 18 ? 29.298  9.527   6.218   1.00 7.13  ? 18 DG  C "H4'"  2  
ATOM 3625  H "H3'"  . DG  A 1 18 ? 31.017  11.533  5.997   1.00 7.77  ? 18 DG  C "H3'"  2  
ATOM 3626  H "HO3'" . DG  A 1 18 ? 31.232  9.035   6.241   1.00 7.26  ? 18 DG  C "HO3'" 2  
ATOM 3627  H "H2'"  . DG  A 1 18 ? 30.639  12.123  3.703   1.00 7.93  ? 18 DG  C "H2'"  2  
ATOM 3628  H "H2''" . DG  A 1 18 ? 32.006  11.029  3.536   1.00 7.69  ? 18 DG  C "H2''" 2  
ATOM 3629  H "H1'"  . DG  A 1 18 ? 30.647  9.187   2.909   1.00 7.10  ? 18 DG  C "H1'"  2  
ATOM 3630  H H8     . DG  A 1 18 ? 28.978  12.628  2.390   1.00 8.03  ? 18 DG  C H8     2  
ATOM 3631  H H1     . DG  A 1 18 ? 28.271  8.358   -2.352  1.00 7.02  ? 18 DG  C H1     2  
ATOM 3632  H H21    . DG  A 1 18 ? 29.080  6.388   -1.728  1.00 6.48  ? 18 DG  C H21    2  
ATOM 3633  H H22    . DG  A 1 18 ? 29.786  6.151   -0.150  1.00 6.34  ? 18 DG  C H22    2  
ATOM 3634  O "O5'"  . DC  B 1 1  ? 28.045  4.030   -8.370  1.00 6.69  ? 1  DC  D "O5'"  2  
ATOM 3635  C "C5'"  . DC  B 1 1  ? 29.289  3.340   -8.235  1.00 6.58  ? 1  DC  D "C5'"  2  
ATOM 3636  C "C4'"  . DC  B 1 1  ? 29.410  2.688   -6.878  1.00 6.22  ? 1  DC  D "C4'"  2  
ATOM 3637  O "O4'"  . DC  B 1 1  ? 29.572  3.727   -5.883  1.00 6.31  ? 1  DC  D "O4'"  2  
ATOM 3638  C "C3'"  . DC  B 1 1  ? 28.175  1.910   -6.434  1.00 5.89  ? 1  DC  D "C3'"  2  
ATOM 3639  O "O3'"  . DC  B 1 1  ? 28.525  0.904   -5.484  1.00 5.54  ? 1  DC  D "O3'"  2  
ATOM 3640  C "C2'"  . DC  B 1 1  ? 27.323  2.979   -5.779  1.00 5.98  ? 1  DC  D "C2'"  2  
ATOM 3641  C "C1'"  . DC  B 1 1  ? 28.371  3.876   -5.130  1.00 6.16  ? 1  DC  D "C1'"  2  
ATOM 3642  N N1     . DC  B 1 1  ? 28.016  5.305   -5.099  1.00 6.49  ? 1  DC  D N1     2  
ATOM 3643  C C2     . DC  B 1 1  ? 28.286  6.037   -3.940  1.00 6.55  ? 1  DC  D C2     2  
ATOM 3644  O O2     . DC  B 1 1  ? 28.834  5.467   -2.985  1.00 6.34  ? 1  DC  D O2     2  
ATOM 3645  N N3     . DC  B 1 1  ? 27.943  7.345   -3.886  1.00 6.87  ? 1  DC  D N3     2  
ATOM 3646  C C4     . DC  B 1 1  ? 27.354  7.922   -4.935  1.00 7.09  ? 1  DC  D C4     2  
ATOM 3647  N N4     . DC  B 1 1  ? 27.028  9.214   -4.833  1.00 7.40  ? 1  DC  D N4     2  
ATOM 3648  C C5     . DC  B 1 1  ? 27.074  7.204   -6.134  1.00 7.03  ? 1  DC  D C5     2  
ATOM 3649  C C6     . DC  B 1 1  ? 27.421  5.910   -6.172  1.00 6.74  ? 1  DC  D C6     2  
ATOM 3650  H "H5'"  . DC  B 1 1  ? 30.112  4.045   -8.364  1.00 6.83  ? 1  DC  D "H5'"  2  
ATOM 3651  H "H5''" . DC  B 1 1  ? 29.363  2.571   -9.004  1.00 6.54  ? 1  DC  D "H5''" 2  
ATOM 3652  H "H4'"  . DC  B 1 1  ? 30.242  1.982   -6.911  1.00 6.13  ? 1  DC  D "H4'"  2  
ATOM 3653  H "H3'"  . DC  B 1 1  ? 27.672  1.448   -7.284  1.00 5.89  ? 1  DC  D "H3'"  2  
ATOM 3654  H "H2'"  . DC  B 1 1  ? 26.721  3.513   -6.513  1.00 6.17  ? 1  DC  D "H2'"  2  
ATOM 3655  H "H2''" . DC  B 1 1  ? 26.644  2.549   -5.046  1.00 5.73  ? 1  DC  D "H2''" 2  
ATOM 3656  H "H1'"  . DC  B 1 1  ? 28.577  3.552   -4.110  1.00 5.97  ? 1  DC  D "H1'"  2  
ATOM 3657  H H41    . DC  B 1 1  ? 27.227  9.723   -3.984  1.00 7.47  ? 1  DC  D H41    2  
ATOM 3658  H H42    . DC  B 1 1  ? 26.582  9.684   -5.608  1.00 7.58  ? 1  DC  D H42    2  
ATOM 3659  H H5     . DC  B 1 1  ? 26.593  7.685   -6.984  1.00 7.23  ? 1  DC  D H5     2  
ATOM 3660  H H6     . DC  B 1 1  ? 27.224  5.331   -7.076  1.00 6.71  ? 1  DC  D H6     2  
ATOM 3661  H "HO5'" . DC  B 1 1  ? 28.129  4.606   -9.135  1.00 6.83  ? 1  DC  D "HO5'" 2  
ATOM 3662  P P      . DG  B 1 2  ? 27.385  -0.052  -4.878  1.00 5.16  ? 2  DG  D P      2  
ATOM 3663  O OP1    . DG  B 1 2  ? 28.046  -1.331  -4.518  1.00 4.91  ? 2  DG  D OP1    2  
ATOM 3664  O OP2    . DG  B 1 2  ? 26.219  -0.066  -5.798  1.00 5.20  ? 2  DG  D OP2    2  
ATOM 3665  O "O5'"  . DG  B 1 2  ? 26.967  0.695   -3.533  1.00 5.09  ? 2  DG  D "O5'"  2  
ATOM 3666  C "C5'"  . DG  B 1 2  ? 27.817  0.623   -2.394  1.00 5.02  ? 2  DG  D "C5'"  2  
ATOM 3667  C "C4'"  . DG  B 1 2  ? 27.035  0.791   -1.113  1.00 4.86  ? 2  DG  D "C4'"  2  
ATOM 3668  O "O4'"  . DG  B 1 2  ? 26.792  2.203   -0.883  1.00 5.18  ? 2  DG  D "O4'"  2  
ATOM 3669  C "C3'"  . DG  B 1 2  ? 25.641  0.164   -1.153  1.00 4.60  ? 2  DG  D "C3'"  2  
ATOM 3670  O "O3'"  . DG  B 1 2  ? 25.249  -0.202  0.172   1.00 4.38  ? 2  DG  D "O3'"  2  
ATOM 3671  C "C2'"  . DG  B 1 2  ? 24.785  1.271   -1.738  1.00 4.85  ? 2  DG  D "C2'"  2  
ATOM 3672  C "C1'"  . DG  B 1 2  ? 25.427  2.512   -1.136  1.00 5.17  ? 2  DG  D "C1'"  2  
ATOM 3673  N N9     . DG  B 1 2  ? 25.341  3.723   -1.950  1.00 5.54  ? 2  DG  D N9     2  
ATOM 3674  C C8     . DG  B 1 2  ? 25.198  3.812   -3.313  1.00 5.68  ? 2  DG  D C8     2  
ATOM 3675  N N7     . DG  B 1 2  ? 25.066  5.041   -3.738  1.00 6.03  ? 2  DG  D N7     2  
ATOM 3676  C C5     . DG  B 1 2  ? 25.140  5.811   -2.585  1.00 6.13  ? 2  DG  D C5     2  
ATOM 3677  C C6     . DG  B 1 2  ? 25.055  7.223   -2.408  1.00 6.49  ? 2  DG  D C6     2  
ATOM 3678  O O6     . DG  B 1 2  ? 24.877  8.101   -3.264  1.00 6.78  ? 2  DG  D O6     2  
ATOM 3679  N N1     . DG  B 1 2  ? 25.190  7.579   -1.070  1.00 6.50  ? 2  DG  D N1     2  
ATOM 3680  C C2     . DG  B 1 2  ? 25.382  6.698   -0.034  1.00 6.22  ? 2  DG  D C2     2  
ATOM 3681  N N2     . DG  B 1 2  ? 25.499  7.236   1.189   1.00 6.33  ? 2  DG  D N2     2  
ATOM 3682  N N3     . DG  B 1 2  ? 25.455  5.386   -0.183  1.00 5.87  ? 2  DG  D N3     2  
ATOM 3683  C C4     . DG  B 1 2  ? 25.329  5.014   -1.474  1.00 5.84  ? 2  DG  D C4     2  
ATOM 3684  H "H5'"  . DG  B 1 2  ? 28.571  1.408   -2.454  1.00 5.28  ? 2  DG  D "H5'"  2  
ATOM 3685  H "H5''" . DG  B 1 2  ? 28.319  -0.345  -2.375  1.00 4.84  ? 2  DG  D "H5''" 2  
ATOM 3686  H "H4'"  . DG  B 1 2  ? 27.585  0.303   -0.309  1.00 4.72  ? 2  DG  D "H4'"  2  
ATOM 3687  H "H3'"  . DG  B 1 2  ? 25.636  -0.722  -1.782  1.00 4.44  ? 2  DG  D "H3'"  2  
ATOM 3688  H "H2'"  . DG  B 1 2  ? 24.826  1.271   -2.826  1.00 4.96  ? 2  DG  D "H2'"  2  
ATOM 3689  H "H2''" . DG  B 1 2  ? 23.741  1.166   -1.448  1.00 4.72  ? 2  DG  D "H2''" 2  
ATOM 3690  H "H1'"  . DG  B 1 2  ? 24.968  2.730   -0.168  1.00 5.14  ? 2  DG  D "H1'"  2  
ATOM 3691  H H8     . DG  B 1 2  ? 25.185  2.953   -3.965  1.00 5.54  ? 2  DG  D H8     2  
ATOM 3692  H H1     . DG  B 1 2  ? 25.141  8.564   -0.845  1.00 6.76  ? 2  DG  D H1     2  
ATOM 3693  H H21    . DG  B 1 2  ? 25.444  8.237   1.324   1.00 6.61  ? 2  DG  D H21    2  
ATOM 3694  H H22    . DG  B 1 2  ? 25.644  6.634   1.986   1.00 6.15  ? 2  DG  D H22    2  
ATOM 3695  P P      . DA  B 1 3  ? 23.768  -0.759  0.457   1.00 4.12  ? 3  DA  D P      2  
ATOM 3696  O OP1    . DA  B 1 3  ? 23.921  -2.062  1.155   1.00 3.78  ? 3  DA  D OP1    2  
ATOM 3697  O OP2    . DA  B 1 3  ? 22.944  -0.682  -0.773  1.00 4.16  ? 3  DA  D OP2    2  
ATOM 3698  O "O5'"  . DA  B 1 3  ? 23.223  0.317   1.498   1.00 4.32  ? 3  DA  D "O5'"  2  
ATOM 3699  C "C5'"  . DA  B 1 3  ? 24.035  0.641   2.620   1.00 4.41  ? 3  DA  D "C5'"  2  
ATOM 3700  C "C4'"  . DA  B 1 3  ? 23.324  1.559   3.587   1.00 4.62  ? 3  DA  D "C4'"  2  
ATOM 3701  O "O4'"  . DA  B 1 3  ? 23.358  2.914   3.064   1.00 4.98  ? 3  DA  D "O4'"  2  
ATOM 3702  C "C3'"  . DA  B 1 3  ? 21.841  1.259   3.780   1.00 4.48  ? 3  DA  D "C3'"  2  
ATOM 3703  O "O3'"  . DA  B 1 3  ? 21.461  1.672   5.093   1.00 4.62  ? 3  DA  D "O3'"  2  
ATOM 3704  C "C2'"  . DA  B 1 3  ? 21.187  2.054   2.665   1.00 4.65  ? 3  DA  D "C2'"  2  
ATOM 3705  C "C1'"  . DA  B 1 3  ? 22.067  3.290   2.585   1.00 5.03  ? 3  DA  D "C1'"  2  
ATOM 3706  N N9     . DA  B 1 3  ? 22.179  3.873   1.246   1.00 5.21  ? 3  DA  D N9     2  
ATOM 3707  C C8     . DA  B 1 3  ? 22.398  3.241   0.047   1.00 5.09  ? 3  DA  D C8     2  
ATOM 3708  N N7     . DA  B 1 3  ? 22.341  4.042   -0.992  1.00 5.35  ? 3  DA  D N7     2  
ATOM 3709  C C5     . DA  B 1 3  ? 22.088  5.291   -0.438  1.00 5.64  ? 3  DA  D C5     2  
ATOM 3710  C C6     . DA  B 1 3  ? 21.904  6.569   -1.012  1.00 6.00  ? 3  DA  D C6     2  
ATOM 3711  N N6     . DA  B 1 3  ? 21.916  6.803   -2.328  1.00 6.14  ? 3  DA  D N6     2  
ATOM 3712  N N1     . DA  B 1 3  ? 21.689  7.609   -0.178  1.00 6.24  ? 3  DA  D N1     2  
ATOM 3713  C C2     . DA  B 1 3  ? 21.646  7.374   1.140   1.00 6.14  ? 3  DA  D C2     2  
ATOM 3714  N N3     . DA  B 1 3  ? 21.786  6.219   1.797   1.00 5.82  ? 3  DA  D N3     2  
ATOM 3715  C C4     . DA  B 1 3  ? 22.010  5.206   0.940   1.00 5.57  ? 3  DA  D C4     2  
ATOM 3716  H "H5'"  . DA  B 1 3  ? 24.946  1.132   2.274   1.00 4.60  ? 3  DA  D "H5'"  2  
ATOM 3717  H "H5''" . DA  B 1 3  ? 24.309  -0.275  3.144   1.00 4.18  ? 3  DA  D "H5''" 2  
ATOM 3718  H "H4'"  . DA  B 1 3  ? 23.802  1.457   4.562   1.00 4.63  ? 3  DA  D "H4'"  2  
ATOM 3719  H "H3'"  . DA  B 1 3  ? 21.644  0.192   3.674   1.00 4.20  ? 3  DA  D "H3'"  2  
ATOM 3720  H "H2'"  . DA  B 1 3  ? 21.177  1.495   1.728   1.00 4.51  ? 3  DA  D "H2'"  2  
ATOM 3721  H "H2''" . DA  B 1 3  ? 20.159  2.314   2.904   1.00 4.69  ? 3  DA  D "H2''" 2  
ATOM 3722  H "H1'"  . DA  B 1 3  ? 21.688  4.062   3.259   1.00 5.23  ? 3  DA  D "H1'"  2  
ATOM 3723  H H8     . DA  B 1 3  ? 22.598  2.183   -0.034  1.00 4.83  ? 3  DA  D H8     2  
ATOM 3724  H H61    . DA  B 1 3  ? 21.753  7.736   -2.680  1.00 6.41  ? 3  DA  D H61    2  
ATOM 3725  H H62    . DA  B 1 3  ? 22.063  6.040   -2.973  1.00 6.00  ? 3  DA  D H62    2  
ATOM 3726  H H2     . DA  B 1 3  ? 21.477  8.251   1.766   1.00 6.37  ? 3  DA  D H2     2  
ATOM 3727  P P      . DT  B 1 4  ? 19.919  1.660   5.536   1.00 4.60  ? 4  DT  D P      2  
ATOM 3728  O OP1    . DT  B 1 4  ? 19.775  0.852   6.777   1.00 4.51  ? 4  DT  D OP1    2  
ATOM 3729  O OP2    . DT  B 1 4  ? 19.060  1.357   4.365   1.00 4.43  ? 4  DT  D OP2    2  
ATOM 3730  O "O5'"  . DT  B 1 4  ? 19.720  3.202   5.879   1.00 5.01  ? 4  DT  D "O5'"  2  
ATOM 3731  C "C5'"  . DT  B 1 4  ? 20.845  3.963   6.327   1.00 5.28  ? 4  DT  D "C5'"  2  
ATOM 3732  C "C4'"  . DT  B 1 4  ? 20.455  5.392   6.617   1.00 5.67  ? 4  DT  D "C4'"  2  
ATOM 3733  O "O4'"  . DT  B 1 4  ? 20.335  6.110   5.366   1.00 5.79  ? 4  DT  D "O4'"  2  
ATOM 3734  C "C3'"  . DT  B 1 4  ? 19.088  5.512   7.276   1.00 5.71  ? 4  DT  D "C3'"  2  
ATOM 3735  O "O3'"  . DT  B 1 4  ? 19.023  6.716   8.036   1.00 6.10  ? 4  DT  D "O3'"  2  
ATOM 3736  C "C2'"  . DT  B 1 4  ? 18.144  5.558   6.089   1.00 5.60  ? 4  DT  D "C2'"  2  
ATOM 3737  C "C1'"  . DT  B 1 4  ? 18.964  6.346   5.071   1.00 5.78  ? 4  DT  D "C1'"  2  
ATOM 3738  N N1     . DT  B 1 4  ? 18.719  6.023   3.647   1.00 5.61  ? 4  DT  D N1     2  
ATOM 3739  C C2     . DT  B 1 4  ? 18.544  7.086   2.785   1.00 5.88  ? 4  DT  D C2     2  
ATOM 3740  O O2     . DT  B 1 4  ? 18.619  8.253   3.139   1.00 6.22  ? 4  DT  D O2     2  
ATOM 3741  N N3     . DT  B 1 4  ? 18.275  6.738   1.489   1.00 5.75  ? 4  DT  D N3     2  
ATOM 3742  C C4     . DT  B 1 4  ? 18.172  5.464   0.974   1.00 5.39  ? 4  DT  D C4     2  
ATOM 3743  O O4     . DT  B 1 4  ? 17.886  5.305   -0.212  1.00 5.35  ? 4  DT  D O4     2  
ATOM 3744  C C5     . DT  B 1 4  ? 18.386  4.394   1.926   1.00 5.11  ? 4  DT  D C5     2  
ATOM 3745  C C7     . DT  B 1 4  ? 18.276  2.977   1.454   1.00 4.72  ? 4  DT  D C7     2  
ATOM 3746  C C6     . DT  B 1 4  ? 18.651  4.718   3.202   1.00 5.23  ? 4  DT  D C6     2  
ATOM 3747  H "H5'"  . DT  B 1 4  ? 21.617  3.957   5.558   1.00 5.26  ? 4  DT  D "H5'"  2  
ATOM 3748  H "H5''" . DT  B 1 4  ? 21.249  3.516   7.236   1.00 5.24  ? 4  DT  D "H5''" 2  
ATOM 3749  H "H4'"  . DT  B 1 4  ? 21.189  5.817   7.306   1.00 5.86  ? 4  DT  D "H4'"  2  
ATOM 3750  H "H3'"  . DT  B 1 4  ? 18.886  4.661   7.929   1.00 5.55  ? 4  DT  D "H3'"  2  
ATOM 3751  H "H2'"  . DT  B 1 4  ? 17.903  4.555   5.739   1.00 5.30  ? 4  DT  D "H2'"  2  
ATOM 3752  H "H2''" . DT  B 1 4  ? 17.207  6.043   6.351   1.00 5.72  ? 4  DT  D "H2''" 2  
ATOM 3753  H "H1'"  . DT  B 1 4  ? 18.791  7.417   5.204   1.00 6.07  ? 4  DT  D "H1'"  2  
ATOM 3754  H H3     . DT  B 1 4  ? 18.126  7.506   0.847   1.00 5.96  ? 4  DT  D H3     2  
ATOM 3755  H H71    . DT  B 1 4  ? 19.205  2.684   0.966   1.00 4.61  ? 4  DT  D H71    2  
ATOM 3756  H H72    . DT  B 1 4  ? 17.451  2.891   0.747   1.00 4.84  ? 4  DT  D H72    2  
ATOM 3757  H H73    . DT  B 1 4  ? 18.092  2.323   2.307   1.00 4.66  ? 4  DT  D H73    2  
ATOM 3758  H H6     . DT  B 1 4  ? 18.821  3.916   3.919   1.00 5.05  ? 4  DT  D H6     2  
ATOM 3759  P P      . DA  B 1 5  ? 17.678  7.090   8.822   1.00 6.25  ? 5  DA  D P      2  
ATOM 3760  O OP1    . DA  B 1 5  ? 18.066  7.568   10.174  1.00 6.53  ? 5  DA  D OP1    2  
ATOM 3761  O OP2    . DA  B 1 5  ? 16.711  5.971   8.688   1.00 5.93  ? 5  DA  D OP2    2  
ATOM 3762  O "O5'"  . DA  B 1 5  ? 17.134  8.330   7.986   1.00 6.49  ? 5  DA  D "O5'"  2  
ATOM 3763  C "C5'"  . DA  B 1 5  ? 17.925  9.508   7.861   1.00 6.83  ? 5  DA  D "C5'"  2  
ATOM 3764  C "C4'"  . DA  B 1 5  ? 17.079  10.667  7.391   1.00 7.10  ? 5  DA  D "C4'"  2  
ATOM 3765  O "O4'"  . DA  B 1 5  ? 16.857  10.541  5.966   1.00 6.94  ? 5  DA  D "O4'"  2  
ATOM 3766  C "C3'"  . DA  B 1 5  ? 15.683  10.680  8.008   1.00 7.11  ? 5  DA  D "C3'"  2  
ATOM 3767  O "O3'"  . DA  B 1 5  ? 15.172  12.011  8.016   1.00 7.47  ? 5  DA  D "O3'"  2  
ATOM 3768  C "C2'"  . DA  B 1 5  ? 14.889  9.795   7.064   1.00 6.76  ? 5  DA  D "C2'"  2  
ATOM 3769  C "C1'"  . DA  B 1 5  ? 15.515  10.139  5.716   1.00 6.76  ? 5  DA  D "C1'"  2  
ATOM 3770  N N9     . DA  B 1 5  ? 15.524  9.061   4.724   1.00 6.39  ? 5  DA  D N9     2  
ATOM 3771  C C8     . DA  B 1 5  ? 15.793  7.729   4.903   1.00 6.03  ? 5  DA  D C8     2  
ATOM 3772  N N7     . DA  B 1 5  ? 15.700  7.017   3.806   1.00 5.75  ? 5  DA  D N7     2  
ATOM 3773  C C5     . DA  B 1 5  ? 15.343  7.944   2.838   1.00 5.96  ? 5  DA  D C5     2  
ATOM 3774  C C6     . DA  B 1 5  ? 15.083  7.820   1.461   1.00 5.87  ? 5  DA  D C6     2  
ATOM 3775  N N6     . DA  B 1 5  ? 15.155  6.660   0.799   1.00 5.52  ? 5  DA  D N6     2  
ATOM 3776  N N1     . DA  B 1 5  ? 14.747  8.938   0.781   1.00 6.17  ? 5  DA  D N1     2  
ATOM 3777  C C2     . DA  B 1 5  ? 14.681  10.101  1.450   1.00 6.52  ? 5  DA  D C2     2  
ATOM 3778  N N3     . DA  B 1 5  ? 14.903  10.342  2.743   1.00 6.64  ? 5  DA  D N3     2  
ATOM 3779  C C4     . DA  B 1 5  ? 15.233  9.207   3.388   1.00 6.35  ? 5  DA  D C4     2  
ATOM 3780  H "H5'"  . DA  B 1 5  ? 18.724  9.337   7.138   1.00 6.75  ? 5  DA  D "H5'"  2  
ATOM 3781  H "H5''" . DA  B 1 5  ? 18.367  9.757   8.826   1.00 7.01  ? 5  DA  D "H5''" 2  
ATOM 3782  H "H4'"  . DA  B 1 5  ? 17.574  11.595  7.682   1.00 7.40  ? 5  DA  D "H4'"  2  
ATOM 3783  H "H3'"  . DA  B 1 5  ? 15.696  10.289  9.026   1.00 7.11  ? 5  DA  D "H3'"  2  
ATOM 3784  H "H2'"  . DA  B 1 5  ? 15.006  8.741   7.317   1.00 6.49  ? 5  DA  D "H2'"  2  
ATOM 3785  H "H2''" . DA  B 1 5  ? 13.827  10.026  7.106   1.00 6.80  ? 5  DA  D "H2''" 2  
ATOM 3786  H "H1'"  . DA  B 1 5  ? 14.999  10.993  5.273   1.00 6.96  ? 5  DA  D "H1'"  2  
ATOM 3787  H H8     . DA  B 1 5  ? 16.047  7.304   5.861   1.00 5.99  ? 5  DA  D H8     2  
ATOM 3788  H H61    . DA  B 1 5  ? 14.918  6.628   -0.183  1.00 5.50  ? 5  DA  D H61    2  
ATOM 3789  H H62    . DA  B 1 5  ? 15.409  5.810   1.291   1.00 5.30  ? 5  DA  D H62    2  
ATOM 3790  H H2     . DA  B 1 5  ? 14.408  10.972  0.853   1.00 6.75  ? 5  DA  D H2     2  
ATOM 3791  P P      . DA  B 1 6  ? 13.691  12.297  8.558   1.00 7.56  ? 6  DA  D P      2  
ATOM 3792  O OP1    . DA  B 1 6  ? 13.770  13.464  9.472   1.00 7.97  ? 6  DA  D OP1    2  
ATOM 3793  O OP2    . DA  B 1 6  ? 13.076  11.031  9.034   1.00 7.26  ? 6  DA  D OP2    2  
ATOM 3794  O "O5'"  . DA  B 1 6  ? 12.944  12.759  7.231   1.00 7.53  ? 6  DA  D "O5'"  2  
ATOM 3795  C "C5'"  . DA  B 1 6  ? 13.520  13.778  6.419   1.00 7.75  ? 6  DA  D "C5'"  2  
ATOM 3796  C "C4'"  . DA  B 1 6  ? 12.556  14.219  5.343   1.00 7.77  ? 6  DA  D "C4'"  2  
ATOM 3797  O "O4'"  . DA  B 1 6  ? 12.568  13.240  4.272   1.00 7.43  ? 6  DA  D "O4'"  2  
ATOM 3798  C "C3'"  . DA  B 1 6  ? 11.107  14.260  5.818   1.00 7.77  ? 6  DA  D "C3'"  2  
ATOM 3799  O "O3'"  . DA  B 1 6  ? 10.370  15.188  5.031   1.00 7.95  ? 6  DA  D "O3'"  2  
ATOM 3800  C "C2'"  . DA  B 1 6  ? 10.629  12.840  5.578   1.00 7.34  ? 6  DA  D "C2'"  2  
ATOM 3801  C "C1'"  . DA  B 1 6  ? 11.368  12.476  4.298   1.00 7.17  ? 6  DA  D "C1'"  2  
ATOM 3802  N N9     . DA  B 1 6  ? 11.688  11.056  4.139   1.00 6.78  ? 6  DA  D N9     2  
ATOM 3803  C C8     . DA  B 1 6  ? 12.150  10.164  5.073   1.00 6.60  ? 6  DA  D C8     2  
ATOM 3804  N N7     . DA  B 1 6  ? 12.275  8.939   4.618   1.00 6.23  ? 6  DA  D N7     2  
ATOM 3805  C C5     . DA  B 1 6  ? 11.879  9.033   3.291   1.00 6.16  ? 6  DA  D C5     2  
ATOM 3806  C C6     . DA  B 1 6  ? 11.774  8.077   2.257   1.00 5.84  ? 6  DA  D C6     2  
ATOM 3807  N N6     . DA  B 1 6  ? 12.057  6.780   2.412   1.00 5.50  ? 6  DA  D N6     2  
ATOM 3808  N N1     . DA  B 1 6  ? 11.355  8.505   1.045   1.00 5.91  ? 6  DA  D N1     2  
ATOM 3809  C C2     . DA  B 1 6  ? 11.055  9.803   0.893   1.00 6.26  ? 6  DA  D C2     2  
ATOM 3810  N N3     . DA  B 1 6  ? 11.104  10.790  1.787   1.00 6.57  ? 6  DA  D N3     2  
ATOM 3811  C C4     . DA  B 1 6  ? 11.529  10.334  2.978   1.00 6.50  ? 6  DA  D C4     2  
ATOM 3812  H "H5'"  . DA  B 1 6  ? 14.428  13.400  5.950   1.00 7.64  ? 6  DA  D "H5'"  2  
ATOM 3813  H "H5''" . DA  B 1 6  ? 13.773  14.638  7.040   1.00 8.05  ? 6  DA  D "H5''" 2  
ATOM 3814  H "H4'"  . DA  B 1 6  ? 12.828  15.228  5.027   1.00 8.04  ? 6  DA  D "H4'"  2  
ATOM 3815  H "H3'"  . DA  B 1 6  ? 11.042  14.543  6.868   1.00 7.93  ? 6  DA  D "H3'"  2  
ATOM 3816  H "H2'"  . DA  B 1 6  ? 10.893  12.187  6.408   1.00 7.24  ? 6  DA  D "H2'"  2  
ATOM 3817  H "H2''" . DA  B 1 6  ? 9.547   12.798  5.460   1.00 7.29  ? 6  DA  D "H2''" 2  
ATOM 3818  H "H1'"  . DA  B 1 6  ? 10.778  12.782  3.430   1.00 7.19  ? 6  DA  D "H1'"  2  
ATOM 3819  H H8     . DA  B 1 6  ? 12.382  10.444  6.089   1.00 6.77  ? 6  DA  D H8     2  
ATOM 3820  H H61    . DA  B 1 6  ? 11.952  6.136   1.643   1.00 5.29  ? 6  DA  D H61    2  
ATOM 3821  H H62    . DA  B 1 6  ? 12.364  6.442   3.314   1.00 5.46  ? 6  DA  D H62    2  
ATOM 3822  H H2     . DA  B 1 6  ? 10.723  10.092  -0.104  1.00 6.31  ? 6  DA  D H2     2  
ATOM 3823  P P      . DG  B 1 7  ? 8.787   15.333  5.242   1.00 7.95  ? 7  DG  D P      2  
ATOM 3824  O OP1    . DG  B 1 7  ? 8.469   16.787  5.256   1.00 8.35  ? 7  DG  D OP1    2  
ATOM 3825  O OP2    . DG  B 1 7  ? 8.339   14.472  6.367   1.00 7.79  ? 7  DG  D OP2    2  
ATOM 3826  O "O5'"  . DG  B 1 7  ? 8.246   14.724  3.877   1.00 7.66  ? 7  DG  D "O5'"  2  
ATOM 3827  C "C5'"  . DG  B 1 7  ? 8.829   15.151  2.650   1.00 7.74  ? 7  DG  D "C5'"  2  
ATOM 3828  C "C4'"  . DG  B 1 7  ? 7.951   14.790  1.477   1.00 7.55  ? 7  DG  D "C4'"  2  
ATOM 3829  O "O4'"  . DG  B 1 7  ? 8.182   13.404  1.118   1.00 7.14  ? 7  DG  D "O4'"  2  
ATOM 3830  C "C3'"  . DG  B 1 7  ? 6.466   14.868  1.815   1.00 7.53  ? 7  DG  D "C3'"  2  
ATOM 3831  O "O3'"  . DG  B 1 7  ? 5.721   15.121  0.631   1.00 7.52  ? 7  DG  D "O3'"  2  
ATOM 3832  C "C2'"  . DG  B 1 7  ? 6.173   13.489  2.378   1.00 7.15  ? 7  DG  D "C2'"  2  
ATOM 3833  C "C1'"  . DG  B 1 7  ? 7.072   12.610  1.517   1.00 6.89  ? 7  DG  D "C1'"  2  
ATOM 3834  N N9     . DG  B 1 7  ? 7.552   11.374  2.137   1.00 6.59  ? 7  DG  D N9     2  
ATOM 3835  C C8     . DG  B 1 7  ? 7.993   11.184  3.423   1.00 6.62  ? 7  DG  D C8     2  
ATOM 3836  N N7     . DG  B 1 7  ? 8.278   9.934   3.690   1.00 6.30  ? 7  DG  D N7     2  
ATOM 3837  C C5     . DG  B 1 7  ? 8.023   9.262   2.499   1.00 6.03  ? 7  DG  D C5     2  
ATOM 3838  C C6     . DG  B 1 7  ? 8.140   7.874   2.169   1.00 5.63  ? 7  DG  D C6     2  
ATOM 3839  O O6     . DG  B 1 7  ? 8.490   6.929   2.891   1.00 5.43  ? 7  DG  D O6     2  
ATOM 3840  N N1     . DG  B 1 7  ? 7.788   7.632   0.846   1.00 5.49  ? 7  DG  D N1     2  
ATOM 3841  C C2     . DG  B 1 7  ? 7.377   8.590   -0.049  1.00 5.71  ? 7  DG  D C2     2  
ATOM 3842  N N2     . DG  B 1 7  ? 7.097   8.161   -1.288  1.00 5.56  ? 7  DG  D N2     2  
ATOM 3843  N N3     . DG  B 1 7  ? 7.255   9.875   0.245   1.00 6.08  ? 7  DG  D N3     2  
ATOM 3844  C C4     . DG  B 1 7  ? 7.592   10.139  1.527   1.00 6.21  ? 7  DG  D C4     2  
ATOM 3845  H "H5'"  . DG  B 1 7  ? 9.801   14.673  2.525   1.00 7.63  ? 7  DG  D "H5'"  2  
ATOM 3846  H "H5''" . DG  B 1 7  ? 8.967   16.232  2.668   1.00 8.06  ? 7  DG  D "H5''" 2  
ATOM 3847  H "H4'"  . DG  B 1 7  ? 8.142   15.499  0.668   1.00 7.73  ? 7  DG  D "H4'"  2  
ATOM 3848  H "H3'"  . DG  B 1 7  ? 6.268   15.656  2.542   1.00 7.78  ? 7  DG  D "H3'"  2  
ATOM 3849  H "H2'"  . DG  B 1 7  ? 6.428   13.429  3.436   1.00 7.21  ? 7  DG  D "H2'"  2  
ATOM 3850  H "H2''" . DG  B 1 7  ? 5.119   13.232  2.281   1.00 7.04  ? 7  DG  D "H2''" 2  
ATOM 3851  H "H1'"  . DG  B 1 7  ? 6.542   12.333  0.602   1.00 6.75  ? 7  DG  D "H1'"  2  
ATOM 3852  H H8     . DG  B 1 7  ? 8.096   11.982  4.141   1.00 6.90  ? 7  DG  D H8     2  
ATOM 3853  H H1     . DG  B 1 7  ? 7.835   6.675   0.520   1.00 5.22  ? 7  DG  D H1     2  
ATOM 3854  H H21    . DG  B 1 7  ? 7.184   7.186   -1.534  1.00 5.29  ? 7  DG  D H21    2  
ATOM 3855  H H22    . DG  B 1 7  ? 6.795   8.825   -1.989  1.00 5.73  ? 7  DG  D H22    2  
ATOM 3856  P P      . DA  B 1 8  ? 4.118   15.141  0.683   1.00 7.47  ? 8  DA  D P      2  
ATOM 3857  O OP1    . DA  B 1 8  ? 3.668   16.367  -0.026  1.00 7.77  ? 8  DA  D OP1    2  
ATOM 3858  O OP2    . DA  B 1 8  ? 3.645   14.875  2.066   1.00 7.45  ? 8  DA  D OP2    2  
ATOM 3859  O "O5'"  . DA  B 1 8  ? 3.773   13.886  -0.230  1.00 7.06  ? 8  DA  D "O5'"  2  
ATOM 3860  C "C5'"  . DA  B 1 8  ? 4.422   13.748  -1.492  1.00 7.01  ? 8  DA  D "C5'"  2  
ATOM 3861  C "C4'"  . DA  B 1 8  ? 3.723   12.721  -2.347  1.00 6.67  ? 8  DA  D "C4'"  2  
ATOM 3862  O "O4'"  . DA  B 1 8  ? 4.153   11.396  -1.941  1.00 6.32  ? 8  DA  D "O4'"  2  
ATOM 3863  C "C3'"  . DA  B 1 8  ? 2.210   12.718  -2.160  1.00 6.62  ? 8  DA  D "C3'"  2  
ATOM 3864  O "O3'"  . DA  B 1 8  ? 1.588   12.230  -3.342  1.00 6.44  ? 8  DA  D "O3'"  2  
ATOM 3865  C "C2'"  . DA  B 1 8  ? 2.017   11.778  -0.985  1.00 6.37  ? 8  DA  D "C2'"  2  
ATOM 3866  C "C1'"  . DA  B 1 8  ? 3.110   10.744  -1.228  1.00 6.11  ? 8  DA  D "C1'"  2  
ATOM 3867  N N9     . DA  B 1 8  ? 3.668   10.116  -0.027  1.00 5.99  ? 8  DA  D N9     2  
ATOM 3868  C C8     . DA  B 1 8  ? 4.084   10.695  1.146   1.00 6.22  ? 8  DA  D C8     2  
ATOM 3869  N N7     . DA  B 1 8  ? 4.487   9.829   2.048   1.00 6.04  ? 8  DA  D N7     2  
ATOM 3870  C C5     . DA  B 1 8  ? 4.336   8.598   1.423   1.00 5.66  ? 8  DA  D C5     2  
ATOM 3871  C C6     . DA  B 1 8  ? 4.585   7.276   1.850   1.00 5.33  ? 8  DA  D C6     2  
ATOM 3872  N N6     . DA  B 1 8  ? 5.044   6.964   3.066   1.00 5.34  ? 8  DA  D N6     2  
ATOM 3873  N N1     . DA  B 1 8  ? 4.336   6.273   0.976   1.00 4.99  ? 8  DA  D N1     2  
ATOM 3874  C C2     . DA  B 1 8  ? 3.862   6.587   -0.238  1.00 5.01  ? 8  DA  D C2     2  
ATOM 3875  N N3     . DA  B 1 8  ? 3.581   7.787   -0.750  1.00 5.31  ? 8  DA  D N3     2  
ATOM 3876  C C4     . DA  B 1 8  ? 3.844   8.760   0.140   1.00 5.62  ? 8  DA  D C4     2  
ATOM 3877  H "H5'"  . DA  B 1 8  ? 5.455   13.437  -1.337  1.00 6.96  ? 8  DA  D "H5'"  2  
ATOM 3878  H "H5''" . DA  B 1 8  ? 4.416   14.706  -2.011  1.00 7.28  ? 8  DA  D "H5''" 2  
ATOM 3879  H "H4'"  . DA  B 1 8  ? 3.924   12.951  -3.395  1.00 6.75  ? 8  DA  D "H4'"  2  
ATOM 3880  H "H3'"  . DA  B 1 8  ? 1.839   13.722  -1.945  1.00 6.90  ? 8  DA  D "H3'"  2  
ATOM 3881  H "H2'"  . DA  B 1 8  ? 2.143   12.297  -0.036  1.00 6.56  ? 8  DA  D "H2'"  2  
ATOM 3882  H "H2''" . DA  B 1 8  ? 1.022   11.336  -0.988  1.00 6.22  ? 8  DA  D "H2''" 2  
ATOM 3883  H "H1'"  . DA  B 1 8  ? 2.732   9.948   -1.875  1.00 5.86  ? 8  DA  D "H1'"  2  
ATOM 3884  H H8     . DA  B 1 8  ? 4.080   11.761  1.311   1.00 6.53  ? 8  DA  D H8     2  
ATOM 3885  H H61    . DA  B 1 8  ? 5.195   6.000   3.328   1.00 5.11  ? 8  DA  D H61    2  
ATOM 3886  H H62    . DA  B 1 8  ? 5.229   7.701   3.732   1.00 5.60  ? 8  DA  D H62    2  
ATOM 3887  H H2     . DA  B 1 8  ? 3.684   5.742   -0.902  1.00 4.75  ? 8  DA  D H2     2  
ATOM 3888  P P      . DT  B 1 9  ? -0.003  12.031  -3.386  1.00 6.32  ? 9  DT  D P      2  
ATOM 3889  O OP1    . DT  B 1 9  ? -0.498  12.649  -4.641  1.00 6.48  ? 9  DT  D OP1    2  
ATOM 3890  O OP2    . DT  B 1 9  ? -0.609  12.420  -2.085  1.00 6.44  ? 9  DT  D OP2    2  
ATOM 3891  O "O5'"  . DT  B 1 9  ? -0.100  10.454  -3.539  1.00 5.87  ? 9  DT  D "O5'"  2  
ATOM 3892  C "C5'"  . DT  B 1 9  ? 0.769   9.792   -4.453  1.00 5.72  ? 9  DT  D "C5'"  2  
ATOM 3893  C "C4'"  . DT  B 1 9  ? 0.326   8.370   -4.680  1.00 5.31  ? 9  DT  D "C4'"  2  
ATOM 3894  O "O4'"  . DT  B 1 9  ? 0.778   7.554   -3.571  1.00 5.09  ? 9  DT  D "O4'"  2  
ATOM 3895  C "C3'"  . DT  B 1 9  ? -1.189  8.212   -4.695  1.00 5.19  ? 9  DT  D "C3'"  2  
ATOM 3896  O "O3'"  . DT  B 1 9  ? -1.530  7.083   -5.499  1.00 4.88  ? 9  DT  D "O3'"  2  
ATOM 3897  C "C2'"  . DT  B 1 9  ? -1.521  8.016   -3.227  1.00 5.13  ? 9  DT  D "C2'"  2  
ATOM 3898  C "C1'"  . DT  B 1 9  ? -0.320  7.212   -2.737  1.00 4.96  ? 9  DT  D "C1'"  2  
ATOM 3899  N N1     . DT  B 1 9  ? 0.072   7.415   -1.322  1.00 5.08  ? 9  DT  D N1     2  
ATOM 3900  C C2     . DT  B 1 9  ? 0.429   6.289   -0.609  1.00 4.82  ? 9  DT  D C2     2  
ATOM 3901  O O2     . DT  B 1 9  ? 0.469   5.172   -1.103  1.00 4.49  ? 9  DT  D O2     2  
ATOM 3902  N N3     . DT  B 1 9  ? 0.738   6.516   0.706   1.00 4.97  ? 9  DT  D N3     2  
ATOM 3903  C C4     . DT  B 1 9  ? 0.736   7.724   1.365   1.00 5.34  ? 9  DT  D C4     2  
ATOM 3904  O O4     . DT  B 1 9  ? 1.011   7.763   2.564   1.00 5.47  ? 9  DT  D O4     2  
ATOM 3905  C C5     . DT  B 1 9  ? 0.369   8.869   0.558   1.00 5.58  ? 9  DT  D C5     2  
ATOM 3906  C C7     . DT  B 1 9  ? 0.308   10.216  1.207   1.00 6.00  ? 9  DT  D C7     2  
ATOM 3907  C C6     . DT  B 1 9  ? 0.063   8.665   -0.735  1.00 5.44  ? 9  DT  D C6     2  
ATOM 3908  H "H5'"  . DT  B 1 9  ? 1.783   9.789   -4.054  1.00 5.76  ? 9  DT  D "H5'"  2  
ATOM 3909  H "H5''" . DT  B 1 9  ? 0.764   10.320  -5.407  1.00 5.89  ? 9  DT  D "H5''" 2  
ATOM 3910  H "H4'"  . DT  B 1 9  ? 0.699   8.043   -5.652  1.00 5.26  ? 9  DT  D "H4'"  2  
ATOM 3911  H "H3'"  . DT  B 1 9  ? -1.669  9.101   -5.103  1.00 5.42  ? 9  DT  D "H3'"  2  
ATOM 3912  H "H2'"  . DT  B 1 9  ? -1.613  8.973   -2.714  1.00 5.40  ? 9  DT  D "H2'"  2  
ATOM 3913  H "H2''" . DT  B 1 9  ? -2.462  7.488   -3.100  1.00 4.95  ? 9  DT  D "H2''" 2  
ATOM 3914  H "H1'"  . DT  B 1 9  ? -0.507  6.144   -2.880  1.00 4.66  ? 9  DT  D "H1'"  2  
ATOM 3915  H H3     . DT  B 1 9  ? 0.986   5.709   1.260   1.00 4.81  ? 9  DT  D H3     2  
ATOM 3916  H H71    . DT  B 1 9  ? 1.315   10.622  1.300   1.00 6.19  ? 9  DT  D H71    2  
ATOM 3917  H H72    . DT  B 1 9  ? -0.139  10.125  2.197   1.00 6.06  ? 9  DT  D H72    2  
ATOM 3918  H H73    . DT  B 1 9  ? -0.298  10.887  0.598   1.00 6.21  ? 9  DT  D H73    2  
ATOM 3919  H H6     . DT  B 1 9  ? -0.200  9.527   -1.348  1.00 5.65  ? 9  DT  D H6     2  
ATOM 3920  P P      . DA  B 1 10 ? -3.064  6.640   -5.649  1.00 4.69  ? 10 DA  D P      2  
ATOM 3921  O OP1    . DA  B 1 10 ? -3.348  6.496   -7.100  1.00 4.69  ? 10 DA  D OP1    2  
ATOM 3922  O OP2    . DA  B 1 10 ? -3.930  7.511   -4.814  1.00 4.90  ? 10 DA  D OP2    2  
ATOM 3923  O "O5'"  . DA  B 1 10 ? -3.034  5.189   -5.003  1.00 4.29  ? 10 DA  D "O5'"  2  
ATOM 3924  C "C5'"  . DA  B 1 10 ? -2.011  4.276   -5.388  1.00 4.08  ? 10 DA  D "C5'"  2  
ATOM 3925  C "C4'"  . DA  B 1 10 ? -2.216  2.929   -4.740  1.00 3.70  ? 10 DA  D "C4'"  2  
ATOM 3926  O "O4'"  . DA  B 1 10 ? -1.789  3.007   -3.356  1.00 3.74  ? 10 DA  D "O4'"  2  
ATOM 3927  C "C3'"  . DA  B 1 10 ? -3.673  2.490   -4.676  1.00 3.55  ? 10 DA  D "C3'"  2  
ATOM 3928  O "O3'"  . DA  B 1 10 ? -3.742  1.067   -4.635  1.00 3.19  ? 10 DA  D "O3'"  2  
ATOM 3929  C "C2'"  . DA  B 1 10 ? -4.159  3.113   -3.382  1.00 3.73  ? 10 DA  D "C2'"  2  
ATOM 3930  C "C1'"  . DA  B 1 10 ? -2.926  3.012   -2.495  1.00 3.75  ? 10 DA  D "C1'"  2  
ATOM 3931  N N9     . DA  B 1 10 ? -2.778  4.095   -1.520  1.00 4.09  ? 10 DA  D N9     2  
ATOM 3932  C C8     . DA  B 1 10 ? -2.950  5.442   -1.711  1.00 4.43  ? 10 DA  D C8     2  
ATOM 3933  N N7     . DA  B 1 10 ? -2.782  6.157   -0.622  1.00 4.69  ? 10 DA  D N7     2  
ATOM 3934  C C5     . DA  B 1 10 ? -2.476  5.217   0.350   1.00 4.53  ? 10 DA  D C5     2  
ATOM 3935  C C6     . DA  B 1 10 ? -2.194  5.330   1.728   1.00 4.70  ? 10 DA  D C6     2  
ATOM 3936  N N6     . DA  B 1 10 ? -2.182  6.490   2.393   1.00 5.07  ? 10 DA  D N6     2  
ATOM 3937  N N1     . DA  B 1 10 ? -1.922  4.195   2.407   1.00 4.50  ? 10 DA  D N1     2  
ATOM 3938  C C2     . DA  B 1 10 ? -1.945  3.030   1.747   1.00 4.14  ? 10 DA  D C2     2  
ATOM 3939  N N3     . DA  B 1 10 ? -2.201  2.795   0.461   1.00 3.93  ? 10 DA  D N3     2  
ATOM 3940  C C4     . DA  B 1 10 ? -2.461  3.942   -0.190  1.00 4.15  ? 10 DA  D C4     2  
ATOM 3941  H "H5'"  . DA  B 1 10 ? -1.039  4.670   -5.087  1.00 4.21  ? 10 DA  D "H5'"  2  
ATOM 3942  H "H5''" . DA  B 1 10 ? -2.022  4.152   -6.472  1.00 4.08  ? 10 DA  D "H5''" 2  
ATOM 3943  H "H4'"  . DA  B 1 10 ? -1.676  2.182   -5.324  1.00 3.54  ? 10 DA  D "H4'"  2  
ATOM 3944  H "H3'"  . DA  B 1 10 ? -4.233  2.854   -5.537  1.00 3.64  ? 10 DA  D "H3'"  2  
ATOM 3945  H "H2'"  . DA  B 1 10 ? -4.474  4.146   -3.534  1.00 3.99  ? 10 DA  D "H2'"  2  
ATOM 3946  H "H2''" . DA  B 1 10 ? -5.008  2.568   -2.972  1.00 3.59  ? 10 DA  D "H2''" 2  
ATOM 3947  H "H1'"  . DA  B 1 10 ? -2.926  2.064   -1.950  1.00 3.54  ? 10 DA  D "H1'"  2  
ATOM 3948  H H8     . DA  B 1 10 ? -3.206  5.872   -2.668  1.00 4.49  ? 10 DA  D H8     2  
ATOM 3949  H H61    . DA  B 1 10 ? -1.981  6.508   3.384   1.00 5.20  ? 10 DA  D H61    2  
ATOM 3950  H H62    . DA  B 1 10 ? -2.387  7.351   1.907   1.00 5.24  ? 10 DA  D H62    2  
ATOM 3951  H H2     . DA  B 1 10 ? -1.720  2.148   2.347   1.00 4.01  ? 10 DA  D H2     2  
ATOM 3952  P P      . DT  B 1 11 ? -5.161  0.340   -4.477  1.00 3.00  ? 11 DT  D P      2  
ATOM 3953  O OP1    . DT  B 1 11 ? -5.104  -0.893  -5.303  1.00 2.75  ? 11 DT  D OP1    2  
ATOM 3954  O OP2    . DT  B 1 11 ? -6.261  1.318   -4.704  1.00 3.23  ? 11 DT  D OP2    2  
ATOM 3955  O "O5'"  . DT  B 1 11 ? -5.114  -0.083  -2.945  1.00 2.93  ? 11 DT  D "O5'"  2  
ATOM 3956  C "C5'"  . DT  B 1 11 ? -4.001  -0.841  -2.471  1.00 2.81  ? 11 DT  D "C5'"  2  
ATOM 3957  C "C4'"  . DT  B 1 11 ? -4.315  -1.508  -1.153  1.00 2.79  ? 11 DT  D "C4'"  2  
ATOM 3958  O "O4'"  . DT  B 1 11 ? -4.120  -0.554  -0.076  1.00 3.09  ? 11 DT  D "O4'"  2  
ATOM 3959  C "C3'"  . DT  B 1 11 ? -5.777  -1.928  -1.048  1.00 2.74  ? 11 DT  D "C3'"  2  
ATOM 3960  O "O3'"  . DT  B 1 11 ? -5.904  -3.013  -0.139  1.00 2.71  ? 11 DT  D "O3'"  2  
ATOM 3961  C "C2'"  . DT  B 1 11 ? -6.452  -0.681  -0.504  1.00 3.05  ? 11 DT  D "C2'"  2  
ATOM 3962  C "C1'"  . DT  B 1 11 ? -5.381  -0.145  0.438   1.00 3.26  ? 11 DT  D "C1'"  2  
ATOM 3963  N N1     . DT  B 1 11 ? -5.377  1.320   0.662   1.00 3.59  ? 11 DT  D N1     2  
ATOM 3964  C C2     . DT  B 1 11 ? -5.092  1.750   1.942   1.00 3.86  ? 11 DT  D C2     2  
ATOM 3965  O O2     . DT  B 1 11 ? -4.777  0.994   2.846   1.00 3.85  ? 11 DT  D O2     2  
ATOM 3966  N N3     . DT  B 1 11 ? -5.191  3.101   2.130   1.00 4.18  ? 11 DT  D N3     2  
ATOM 3967  C C4     . DT  B 1 11 ? -5.527  4.049   1.191   1.00 4.27  ? 11 DT  D C4     2  
ATOM 3968  O O4     . DT  B 1 11 ? -5.639  5.228   1.529   1.00 4.60  ? 11 DT  D O4     2  
ATOM 3969  C C5     . DT  B 1 11 ? -5.779  3.536   -0.141  1.00 3.99  ? 11 DT  D C5     2  
ATOM 3970  C C7     . DT  B 1 11 ? -6.207  4.491   -1.211  1.00 4.12  ? 11 DT  D C7     2  
ATOM 3971  C C6     . DT  B 1 11 ? -5.683  2.212   -0.344  1.00 3.66  ? 11 DT  D C6     2  
ATOM 3972  H "H5'"  . DT  B 1 11 ? -3.144  -0.181  -2.337  1.00 2.96  ? 11 DT  D "H5'"  2  
ATOM 3973  H "H5''" . DT  B 1 11 ? -3.746  -1.607  -3.201  1.00 2.62  ? 11 DT  D "H5''" 2  
ATOM 3974  H "H4'"  . DT  B 1 11 ? -3.705  -2.411  -1.067  1.00 2.64  ? 11 DT  D "H4'"  2  
ATOM 3975  H "H3'"  . DT  B 1 11 ? -6.175  -2.220  -2.019  1.00 2.59  ? 11 DT  D "H3'"  2  
ATOM 3976  H "H2'"  . DT  B 1 11 ? -6.690  0.019   -1.301  1.00 3.09  ? 11 DT  D "H2'"  2  
ATOM 3977  H "H2''" . DT  B 1 11 ? -7.381  -0.923  0.010   1.00 3.10  ? 11 DT  D "H2''" 2  
ATOM 3978  H "H1'"  . DT  B 1 11 ? -5.487  -0.622  1.414   1.00 3.32  ? 11 DT  D "H1'"  2  
ATOM 3979  H H3     . DT  B 1 11 ? -5.015  3.436   3.068   1.00 4.40  ? 11 DT  D H3     2  
ATOM 3980  H H71    . DT  B 1 11 ? -5.428  5.237   -1.366  1.00 4.30  ? 11 DT  D H71    2  
ATOM 3981  H H72    . DT  B 1 11 ? -7.129  4.986   -0.907  1.00 4.20  ? 11 DT  D H72    2  
ATOM 3982  H H73    . DT  B 1 11 ? -6.377  3.945   -2.138  1.00 4.27  ? 11 DT  D H73    2  
ATOM 3983  H H6     . DT  B 1 11 ? -5.847  1.827   -1.349  1.00 3.46  ? 11 DT  D H6     2  
ATOM 3984  P P      . DC  B 1 12 ? -7.361  -3.545  0.267   1.00 2.77  ? 12 DC  D P      2  
ATOM 3985  O OP1    . DC  B 1 12 ? -7.322  -5.030  0.244   1.00 2.66  ? 12 DC  D OP1    2  
ATOM 3986  O OP2    . DC  B 1 12 ? -8.402  -2.826  -0.511  1.00 2.76  ? 12 DC  D OP2    2  
ATOM 3987  O "O5'"  . DC  B 1 12 ? -7.430  -3.066  1.781   1.00 3.11  ? 12 DC  D "O5'"  2  
ATOM 3988  C "C5'"  . DC  B 1 12 ? -6.324  -3.330  2.638   1.00 3.21  ? 12 DC  D "C5'"  2  
ATOM 3989  C "C4'"  . DC  B 1 12 ? -6.721  -3.210  4.088   1.00 3.55  ? 12 DC  D "C4'"  2  
ATOM 3990  O "O4'"  . DC  B 1 12 ? -6.685  -1.811  4.475   1.00 3.79  ? 12 DC  D "O4'"  2  
ATOM 3991  C "C3'"  . DC  B 1 12 ? -8.159  -3.651  4.335   1.00 3.65  ? 12 DC  D "C3'"  2  
ATOM 3992  O "O3'"  . DC  B 1 12 ? -8.289  -4.102  5.678   1.00 3.94  ? 12 DC  D "O3'"  2  
ATOM 3993  C "C2'"  . DC  B 1 12 ? -8.953  -2.383  4.079   1.00 3.74  ? 12 DC  D "C2'"  2  
ATOM 3994  C "C1'"  . DC  B 1 12 ? -8.010  -1.314  4.618   1.00 3.94  ? 12 DC  D "C1'"  2  
ATOM 3995  N N1     . DC  B 1 12 ? -8.105  0.022   3.993   1.00 4.00  ? 12 DC  D N1     2  
ATOM 3996  C C2     . DC  B 1 12 ? -8.061  1.148   4.833   1.00 4.36  ? 12 DC  D C2     2  
ATOM 3997  O O2     . DC  B 1 12 ? -7.869  0.985   6.047   1.00 4.58  ? 12 DC  D O2     2  
ATOM 3998  N N3     . DC  B 1 12 ? -8.227  2.381   4.302   1.00 4.47  ? 12 DC  D N3     2  
ATOM 3999  C C4     . DC  B 1 12 ? -8.422  2.519   2.991   1.00 4.25  ? 12 DC  D C4     2  
ATOM 4000  N N4     . DC  B 1 12 ? -8.623  3.757   2.523   1.00 4.43  ? 12 DC  D N4     2  
ATOM 4001  C C5     . DC  B 1 12 ? -8.434  1.397   2.103   1.00 3.88  ? 12 DC  D C5     2  
ATOM 4002  C C6     . DC  B 1 12 ? -8.265  0.177   2.644   1.00 3.76  ? 12 DC  D C6     2  
ATOM 4003  H "H5'"  . DC  B 1 12 ? -5.525  -2.617  2.429   1.00 3.21  ? 12 DC  D "H5'"  2  
ATOM 4004  H "H5''" . DC  B 1 12 ? -5.955  -4.339  2.456   1.00 3.06  ? 12 DC  D "H5''" 2  
ATOM 4005  H "H4'"  . DC  B 1 12 ? -6.070  -3.854  4.682   1.00 3.59  ? 12 DC  D "H4'"  2  
ATOM 4006  H "H3'"  . DC  B 1 12 ? -8.445  -4.456  3.657   1.00 3.45  ? 12 DC  D "H3'"  2  
ATOM 4007  H "H2'"  . DC  B 1 12 ? -9.160  -2.253  3.016   1.00 3.53  ? 12 DC  D "H2'"  2  
ATOM 4008  H "H2''" . DC  B 1 12 ? -9.909  -2.395  4.602   1.00 3.92  ? 12 DC  D "H2''" 2  
ATOM 4009  H "H1'"  . DC  B 1 12 ? -8.180  -1.186  5.690   1.00 4.21  ? 12 DC  D "H1'"  2  
ATOM 4010  H H41    . DC  B 1 12 ? -8.628  4.546   3.155   1.00 4.71  ? 12 DC  D H41    2  
ATOM 4011  H H42    . DC  B 1 12 ? -8.785  3.905   1.537   1.00 4.31  ? 12 DC  D H42    2  
ATOM 4012  H H5     . DC  B 1 12 ? -8.576  1.526   1.031   1.00 3.72  ? 12 DC  D H5     2  
ATOM 4013  H H6     . DC  B 1 12 ? -8.255  -0.699  1.995   1.00 3.49  ? 12 DC  D H6     2  
ATOM 4014  P P      . DT  B 1 13 ? -9.732  -4.505  6.249   1.00 4.16  ? 13 DT  D P      2  
ATOM 4015  O OP1    . DT  B 1 13 ? -9.601  -5.821  6.925   1.00 4.28  ? 13 DT  D OP1    2  
ATOM 4016  O OP2    . DT  B 1 13 ? -10.770 -4.316  5.203   1.00 3.98  ? 13 DT  D OP2    2  
ATOM 4017  O "O5'"  . DT  B 1 13 ? -9.921  -3.388  7.362   1.00 4.51  ? 13 DT  D "O5'"  2  
ATOM 4018  C "C5'"  . DT  B 1 13 ? -8.825  -3.076  8.218   1.00 4.67  ? 13 DT  D "C5'"  2  
ATOM 4019  C "C4'"  . DT  B 1 13 ? -9.291  -2.314  9.431   1.00 5.07  ? 13 DT  D "C4'"  2  
ATOM 4020  O "O4'"  . DT  B 1 13 ? -9.450  -0.917  9.076   1.00 5.12  ? 13 DT  D "O4'"  2  
ATOM 4021  C "C3'"  . DT  B 1 13 ? -10.663 -2.759  9.919   1.00 5.26  ? 13 DT  D "C3'"  2  
ATOM 4022  O "O3'"  . DT  B 1 13 ? -10.785 -2.506  11.314  1.00 5.65  ? 13 DT  D "O3'"  2  
ATOM 4023  C "C2'"  . DT  B 1 13 ? -11.606 -1.902  9.095   1.00 5.17  ? 13 DT  D "C2'"  2  
ATOM 4024  C "C1'"  . DT  B 1 13 ? -10.833 -0.592  8.989   1.00 5.21  ? 13 DT  D "C1'"  2  
ATOM 4025  N N1     . DT  B 1 13 ? -11.066 0.200   7.757   1.00 5.01  ? 13 DT  D N1     2  
ATOM 4026  C C2     . DT  B 1 13 ? -11.165 1.570   7.899   1.00 5.23  ? 13 DT  D C2     2  
ATOM 4027  O O2     . DT  B 1 13 ? -11.018 2.141   8.966   1.00 5.56  ? 13 DT  D O2     2  
ATOM 4028  N N3     . DT  B 1 13 ? -11.446 2.250   6.744   1.00 5.08  ? 13 DT  D N3     2  
ATOM 4029  C C4     . DT  B 1 13 ? -11.628 1.717   5.487   1.00 4.72  ? 13 DT  D C4     2  
ATOM 4030  O O4     . DT  B 1 13 ? -11.943 2.453   4.552   1.00 4.65  ? 13 DT  D O4     2  
ATOM 4031  C C5     . DT  B 1 13 ? -11.483 0.277   5.400   1.00 4.48  ? 13 DT  D C5     2  
ATOM 4032  C C7     . DT  B 1 13 ? -11.687 -0.389  4.075   1.00 4.11  ? 13 DT  D C7     2  
ATOM 4033  C C6     . DT  B 1 13 ? -11.206 -0.405  6.523   1.00 4.65  ? 13 DT  D C6     2  
ATOM 4034  H "H5'"  . DT  B 1 13 ? -8.101  -2.469  7.674   1.00 4.54  ? 13 DT  D "H5'"  2  
ATOM 4035  H "H5''" . DT  B 1 13 ? -8.342  -3.999  8.542   1.00 4.67  ? 13 DT  D "H5''" 2  
ATOM 4036  H "H4'"  . DT  B 1 13 ? -8.581  -2.489  10.243  1.00 5.22  ? 13 DT  D "H4'"  2  
ATOM 4037  H "H3'"  . DT  B 1 13 ? -10.817 -3.822  9.734   1.00 5.16  ? 13 DT  D "H3'"  2  
ATOM 4038  H "H2'"  . DT  B 1 13 ? -11.800 -2.349  8.121   1.00 4.90  ? 13 DT  D "H2'"  2  
ATOM 4039  H "H2''" . DT  B 1 13 ? -12.566 -1.773  9.593   1.00 5.37  ? 13 DT  D "H2''" 2  
ATOM 4040  H "H1'"  . DT  B 1 13 ? -11.063 0.047   9.843   1.00 5.51  ? 13 DT  D "H1'"  2  
ATOM 4041  H H3     . DT  B 1 13 ? -11.534 3.255   6.828   1.00 5.26  ? 13 DT  D H3     2  
ATOM 4042  H H71    . DT  B 1 13 ? -12.503 0.101   3.544   1.00 4.06  ? 13 DT  D H71    2  
ATOM 4043  H H72    . DT  B 1 13 ? -10.774 -0.313  3.486   1.00 4.04  ? 13 DT  D H72    2  
ATOM 4044  H H73    . DT  B 1 13 ? -11.933 -1.440  4.229   1.00 4.12  ? 13 DT  D H73    2  
ATOM 4045  H H6     . DT  B 1 13 ? -11.080 -1.486  6.457   1.00 4.51  ? 13 DT  D H6     2  
ATOM 4046  P P      . DT  B 1 14 ? -12.170 -2.811  12.062  1.00 5.93  ? 14 DT  D P      2  
ATOM 4047  O OP1    . DT  B 1 14 ? -11.868 -3.601  13.284  1.00 6.20  ? 14 DT  D OP1    2  
ATOM 4048  O OP2    . DT  B 1 14 ? -13.165 -3.321  11.086  1.00 5.72  ? 14 DT  D OP2    2  
ATOM 4049  O "O5'"  . DT  B 1 14 ? -12.598 -1.346  12.502  1.00 6.17  ? 14 DT  D "O5'"  2  
ATOM 4050  C "C5'"  . DT  B 1 14 ? -11.632 -0.492  13.111  1.00 6.33  ? 14 DT  D "C5'"  2  
ATOM 4051  C "C4'"  . DT  B 1 14 ? -12.294 0.737   13.680  1.00 6.64  ? 14 DT  D "C4'"  2  
ATOM 4052  O "O4'"  . DT  B 1 14 ? -12.552 1.671   12.602  1.00 6.46  ? 14 DT  D "O4'"  2  
ATOM 4053  C "C3'"  . DT  B 1 14 ? -13.659 0.436   14.284  1.00 6.86  ? 14 DT  D "C3'"  2  
ATOM 4054  O "O3'"  . DT  B 1 14 ? -13.968 1.396   15.288  1.00 7.24  ? 14 DT  D "O3'"  2  
ATOM 4055  C "C2'"  . DT  B 1 14 ? -14.589 0.560   13.091  1.00 6.61  ? 14 DT  D "C2'"  2  
ATOM 4056  C "C1'"  . DT  B 1 14 ? -13.943 1.698   12.309  1.00 6.47  ? 14 DT  D "C1'"  2  
ATOM 4057  N N1     . DT  B 1 14 ? -14.133 1.662   10.841  1.00 6.10  ? 14 DT  D N1     2  
ATOM 4058  C C2     . DT  B 1 14 ? -14.341 2.869   10.205  1.00 6.09  ? 14 DT  D C2     2  
ATOM 4059  O O2     . DT  B 1 14 ? -14.308 3.944   10.782  1.00 6.38  ? 14 DT  D O2     2  
ATOM 4060  N N3     . DT  B 1 14 ? -14.592 2.774   8.863   1.00 5.76  ? 14 DT  D N3     2  
ATOM 4061  C C4     . DT  B 1 14 ? -14.645 1.626   8.104   1.00 5.43  ? 14 DT  D C4     2  
ATOM 4062  O O4     . DT  B 1 14 ? -14.945 1.694   6.913   1.00 5.16  ? 14 DT  D O4     2  
ATOM 4063  C C5     . DT  B 1 14 ? -14.388 0.397   8.825   1.00 5.46  ? 14 DT  D C5     2  
ATOM 4064  C C7     . DT  B 1 14 ? -14.468 -0.902  8.086   1.00 5.15  ? 14 DT  D C7     2  
ATOM 4065  C C6     . DT  B 1 14 ? -14.137 0.471   10.142  1.00 5.79  ? 14 DT  D C6     2  
ATOM 4066  H "H5'"  . DT  B 1 14 ? -10.895 -0.188  12.367  1.00 6.11  ? 14 DT  D "H5'"  2  
ATOM 4067  H "H5''" . DT  B 1 14 ? -11.127 -1.028  13.914  1.00 6.47  ? 14 DT  D "H5''" 2  
ATOM 4068  H "H4'"  . DT  B 1 14 ? -11.660 1.136   14.476  1.00 6.85  ? 14 DT  D "H4'"  2  
ATOM 4069  H "H3'"  . DT  B 1 14 ? -13.685 -0.563  14.720  1.00 6.90  ? 14 DT  D "H3'"  2  
ATOM 4070  H "H2'"  . DT  B 1 14 ? -14.622 -0.368  12.520  1.00 6.38  ? 14 DT  D "H2'"  2  
ATOM 4071  H "H2''" . DT  B 1 14 ? -15.606 0.784   13.404  1.00 6.78  ? 14 DT  D "H2''" 2  
ATOM 4072  H "H1'"  . DT  B 1 14 ? -14.324 2.658   12.670  1.00 6.70  ? 14 DT  D "H1'"  2  
ATOM 4073  H H3     . DT  B 1 14 ? -14.771 3.651   8.387   1.00 5.78  ? 14 DT  D H3     2  
ATOM 4074  H H71    . DT  B 1 14 ? -13.573 -1.031  7.477   1.00 4.98  ? 14 DT  D H71    2  
ATOM 4075  H H72    . DT  B 1 14 ? -15.347 -0.901  7.443   1.00 5.03  ? 14 DT  D H72    2  
ATOM 4076  H H73    . DT  B 1 14 ? -14.542 -1.724  8.799   1.00 5.27  ? 14 DT  D H73    2  
ATOM 4077  H H6     . DT  B 1 14 ? -13.920 -0.450  10.682  1.00 5.83  ? 14 DT  D H6     2  
ATOM 4078  P P      . DA  B 1 15 ? -15.387 1.346   16.032  1.00 7.52  ? 15 DA  D P      2  
ATOM 4079  O OP1    . DA  B 1 15 ? -15.132 1.446   17.491  1.00 7.92  ? 15 DA  D OP1    2  
ATOM 4080  O OP2    . DA  B 1 15 ? -16.191 0.214   15.503  1.00 7.34  ? 15 DA  D OP2    2  
ATOM 4081  O "O5'"  . DA  B 1 15 ? -16.042 2.708   15.542  1.00 7.56  ? 15 DA  D "O5'"  2  
ATOM 4082  C "C5'"  . DA  B 1 15 ? -15.294 3.916   15.638  1.00 7.67  ? 15 DA  D "C5'"  2  
ATOM 4083  C "C4'"  . DA  B 1 15 ? -16.160 5.114   15.334  1.00 7.79  ? 15 DA  D "C4'"  2  
ATOM 4084  O "O4'"  . DA  B 1 15 ? -16.305 5.237   13.896  1.00 7.44  ? 15 DA  D "O4'"  2  
ATOM 4085  C "C3'"  . DA  B 1 15 ? -17.583 4.973   15.863  1.00 7.99  ? 15 DA  D "C3'"  2  
ATOM 4086  O "O3'"  . DA  B 1 15 ? -18.139 6.262   16.097  1.00 8.25  ? 15 DA  D "O3'"  2  
ATOM 4087  C "C2'"  . DA  B 1 15 ? -18.293 4.253   14.731  1.00 7.65  ? 15 DA  D "C2'"  2  
ATOM 4088  C "C1'"  . DA  B 1 15 ? -17.618 4.848   13.504  1.00 7.36  ? 15 DA  D "C1'"  2  
ATOM 4089  N N9     . DA  B 1 15 ? -17.530 3.958   12.342  1.00 6.95  ? 15 DA  D N9     2  
ATOM 4090  C C8     . DA  B 1 15 ? -17.185 2.632   12.299  1.00 6.75  ? 15 DA  D C8     2  
ATOM 4091  N N7     . DA  B 1 15 ? -17.258 2.104   11.100  1.00 6.39  ? 15 DA  D N7     2  
ATOM 4092  C C5     . DA  B 1 15 ? -17.671 3.157   10.295  1.00 6.33  ? 15 DA  D C5     2  
ATOM 4093  C C6     . DA  B 1 15 ? -17.946 3.248   8.915   1.00 6.01  ? 15 DA  D C6     2  
ATOM 4094  N N6     . DA  B 1 15 ? -17.854 2.220   8.068   1.00 5.66  ? 15 DA  D N6     2  
ATOM 4095  N N1     . DA  B 1 15 ? -18.330 4.449   8.427   1.00 6.08  ? 15 DA  D N1     2  
ATOM 4096  C C2     . DA  B 1 15 ? -18.439 5.480   9.278   1.00 6.44  ? 15 DA  D C2     2  
ATOM 4097  N N3     . DA  B 1 15 ? -18.218 5.515   10.593  1.00 6.76  ? 15 DA  D N3     2  
ATOM 4098  C C4     . DA  B 1 15 ? -17.832 4.309   11.044  1.00 6.68  ? 15 DA  D C4     2  
ATOM 4099  H "H5'"  . DA  B 1 15 ? -14.466 3.887   14.930  1.00 7.43  ? 15 DA  D "H5'"  2  
ATOM 4100  H "H5''" . DA  B 1 15 ? -14.891 4.016   16.647  1.00 7.93  ? 15 DA  D "H5''" 2  
ATOM 4101  H "H4'"  . DA  B 1 15 ? -15.717 5.989   15.812  1.00 8.00  ? 15 DA  D "H4'"  2  
ATOM 4102  H "H3'"  . DA  B 1 15 ? -17.603 4.399   16.789  1.00 8.18  ? 15 DA  D "H3'"  2  
ATOM 4103  H "H2'"  . DA  B 1 15 ? -18.154 3.173   14.798  1.00 7.54  ? 15 DA  D "H2'"  2  
ATOM 4104  H "H2''" . DA  B 1 15 ? -19.365 4.445   14.747  1.00 7.74  ? 15 DA  D "H2''" 2  
ATOM 4105  H "H1'"  . DA  B 1 15 ? -18.141 5.754   13.193  1.00 7.43  ? 15 DA  D "H1'"  2  
ATOM 4106  H H8     . DA  B 1 15 ? -16.888 2.073   13.173  1.00 6.91  ? 15 DA  D H8     2  
ATOM 4107  H H61    . DA  B 1 15 ? -18.077 2.345   7.092   1.00 5.45  ? 15 DA  D H61    2  
ATOM 4108  H H62    . DA  B 1 15 ? -17.574 1.313   8.416   1.00 5.63  ? 15 DA  D H62    2  
ATOM 4109  H H2     . DA  B 1 15 ? -18.749 6.425   8.831   1.00 6.50  ? 15 DA  D H2     2  
ATOM 4110  P P      . DT  B 1 16 ? -19.669 6.401   16.558  1.00 8.48  ? 16 DT  D P      2  
ATOM 4111  O OP1    . DT  B 1 16 ? -19.711 7.331   17.716  1.00 8.91  ? 16 DT  D OP1    2  
ATOM 4112  O OP2    . DT  B 1 16 ? -20.288 5.056   16.672  1.00 8.39  ? 16 DT  D OP2    2  
ATOM 4113  O "O5'"  . DT  B 1 16 ? -20.295 7.147   15.302  1.00 8.28  ? 16 DT  D "O5'"  2  
ATOM 4114  C "C5'"  . DT  B 1 16 ? -19.584 8.232   14.714  1.00 8.25  ? 16 DT  D "C5'"  2  
ATOM 4115  C "C4'"  . DT  B 1 16 ? -20.444 8.958   13.708  1.00 8.16  ? 16 DT  D "C4'"  2  
ATOM 4116  O "O4'"  . DT  B 1 16 ? -20.458 8.202   12.471  1.00 7.74  ? 16 DT  D "O4'"  2  
ATOM 4117  C "C3'"  . DT  B 1 16 ? -21.904 9.045   14.137  1.00 8.35  ? 16 DT  D "C3'"  2  
ATOM 4118  O "O3'"  . DT  B 1 16 ? -22.518 10.178  13.529  1.00 8.42  ? 16 DT  D "O3'"  2  
ATOM 4119  C "C2'"  . DT  B 1 16 ? -22.489 7.747   13.611  1.00 8.06  ? 16 DT  D "C2'"  2  
ATOM 4120  C "C1'"  . DT  B 1 16 ? -21.720 7.567   12.307  1.00 7.67  ? 16 DT  D "C1'"  2  
ATOM 4121  N N1     . DT  B 1 16 ? -21.507 6.168   11.868  1.00 7.34  ? 16 DT  D N1     2  
ATOM 4122  C C2     . DT  B 1 16 ? -21.665 5.910   10.521  1.00 6.98  ? 16 DT  D C2     2  
ATOM 4123  O O2     . DT  B 1 16 ? -21.903 6.780   9.700   1.00 6.92  ? 16 DT  D O2     2  
ATOM 4124  N N3     . DT  B 1 16 ? -21.535 4.594   10.168  1.00 6.70  ? 16 DT  D N3     2  
ATOM 4125  C C4     . DT  B 1 16 ? -21.258 3.533   11.001  1.00 6.77  ? 16 DT  D C4     2  
ATOM 4126  O O4     . DT  B 1 16 ? -21.228 2.392   10.542  1.00 6.52  ? 16 DT  D O4     2  
ATOM 4127  C C5     . DT  B 1 16 ? -21.073 3.874   12.397  1.00 7.16  ? 16 DT  D C5     2  
ATOM 4128  C C7     . DT  B 1 16 ? -20.804 2.776   13.378  1.00 7.28  ? 16 DT  D C7     2  
ATOM 4129  C C6     . DT  B 1 16 ? -21.196 5.162   12.760  1.00 7.42  ? 16 DT  D C6     2  
ATOM 4130  H "H5'"  . DT  B 1 16 ? -18.694 7.853   14.211  1.00 8.01  ? 16 DT  D "H5'"  2  
ATOM 4131  H "H5''" . DT  B 1 16 ? -19.280 8.933   15.491  1.00 8.53  ? 16 DT  D "H5''" 2  
ATOM 4132  H "H4'"  . DT  B 1 16 ? -20.070 9.978   13.604  1.00 8.28  ? 16 DT  D "H4'"  2  
ATOM 4133  H "H3'"  . DT  B 1 16 ? -21.994 9.125   15.220  1.00 8.64  ? 16 DT  D "H3'"  2  
ATOM 4134  H "H2'"  . DT  B 1 16 ? -22.321 6.927   14.306  1.00 8.11  ? 16 DT  D "H2'"  2  
ATOM 4135  H "H2''" . DT  B 1 16 ? -23.564 7.829   13.453  1.00 8.10  ? 16 DT  D "H2''" 2  
ATOM 4136  H "H1'"  . DT  B 1 16 ? -22.234 8.091   11.499  1.00 7.58  ? 16 DT  D "H1'"  2  
ATOM 4137  H H3     . DT  B 1 16 ? -21.674 4.380   9.189   1.00 6.44  ? 16 DT  D H3     2  
ATOM 4138  H H71    . DT  B 1 16 ? -19.758 2.477   13.310  1.00 7.19  ? 16 DT  D H71    2  
ATOM 4139  H H72    . DT  B 1 16 ? -21.441 1.922   13.151  1.00 7.26  ? 16 DT  D H72    2  
ATOM 4140  H H73    . DT  B 1 16 ? -21.017 3.128   14.387  1.00 7.56  ? 16 DT  D H73    2  
ATOM 4141  H H6     . DT  B 1 16 ? -21.038 5.425   13.806  1.00 7.71  ? 16 DT  D H6     2  
ATOM 4142  P P      . DC  B 1 17 ? -24.077 10.467  13.771  1.00 8.61  ? 17 DC  D P      2  
ATOM 4143  O OP1    . DC  B 1 17 ? -24.215 11.898  14.140  1.00 8.94  ? 17 DC  D OP1    2  
ATOM 4144  O OP2    . DC  B 1 17 ? -24.644 9.421   14.662  1.00 8.70  ? 17 DC  D OP2    2  
ATOM 4145  O "O5'"  . DC  B 1 17 ? -24.671 10.267  12.310  1.00 8.25  ? 17 DC  D "O5'"  2  
ATOM 4146  C "C5'"  . DC  B 1 17 ? -24.027 10.885  11.196  1.00 8.07  ? 17 DC  D "C5'"  2  
ATOM 4147  C "C4'"  . DC  B 1 17 ? -24.893 10.794  9.963   1.00 7.81  ? 17 DC  D "C4'"  2  
ATOM 4148  O "O4'"  . DC  B 1 17 ? -24.780 9.462   9.409   1.00 7.44  ? 17 DC  D "O4'"  2  
ATOM 4149  C "C3'"  . DC  B 1 17 ? -26.377 10.982  10.252  1.00 7.97  ? 17 DC  D "C3'"  2  
ATOM 4150  O "O3'"  . DC  B 1 17 ? -27.048 11.469  9.089   1.00 7.82  ? 17 DC  D "O3'"  2  
ATOM 4151  C "C2'"  . DC  B 1 17 ? -26.829 9.575   10.598  1.00 7.83  ? 17 DC  D "C2'"  2  
ATOM 4152  C "C1'"  . DC  B 1 17 ? -25.972 8.729   9.663   1.00 7.43  ? 17 DC  D "C1'"  2  
ATOM 4153  N N1     . DC  B 1 17 ? -25.605 7.386   10.156  1.00 7.33  ? 17 DC  D N1     2  
ATOM 4154  C C2     . DC  B 1 17 ? -25.655 6.312   9.258   1.00 6.96  ? 17 DC  D C2     2  
ATOM 4155  O O2     . DC  B 1 17 ? -25.961 6.527   8.075   1.00 6.72  ? 17 DC  D O2     2  
ATOM 4156  N N3     . DC  B 1 17 ? -25.367 5.066   9.697   1.00 6.88  ? 17 DC  D N3     2  
ATOM 4157  C C4     . DC  B 1 17 ? -25.037 4.869   10.975  1.00 7.16  ? 17 DC  D C4     2  
ATOM 4158  N N4     . DC  B 1 17 ? -24.785 3.616   11.364  1.00 7.10  ? 17 DC  D N4     2  
ATOM 4159  C C5     . DC  B 1 17 ? -24.957 5.947   11.908  1.00 7.53  ? 17 DC  D C5     2  
ATOM 4160  C C6     . DC  B 1 17 ? -25.244 7.178   11.458  1.00 7.60  ? 17 DC  D C6     2  
ATOM 4161  H "H5'"  . DC  B 1 17 ? -23.079 10.385  11.002  1.00 7.89  ? 17 DC  D "H5'"  2  
ATOM 4162  H "H5''" . DC  B 1 17 ? -23.838 11.934  11.422  1.00 8.30  ? 17 DC  D "H5''" 2  
ATOM 4163  H "H4'"  . DC  B 1 17 ? -24.592 11.586  9.274   1.00 7.79  ? 17 DC  D "H4'"  2  
ATOM 4164  H "H3'"  . DC  B 1 17 ? -26.533 11.677  11.077  1.00 8.28  ? 17 DC  D "H3'"  2  
ATOM 4165  H "H2'"  . DC  B 1 17 ? -26.643 9.347   11.648  1.00 8.04  ? 17 DC  D "H2'"  2  
ATOM 4166  H "H2''" . DC  B 1 17 ? -27.896 9.445   10.421  1.00 7.82  ? 17 DC  D "H2''" 2  
ATOM 4167  H "H1'"  . DC  B 1 17 ? -26.480 8.604   8.704   1.00 7.21  ? 17 DC  D "H1'"  2  
ATOM 4168  H H41    . DC  B 1 17 ? -24.853 2.856   10.702  1.00 6.86  ? 17 DC  D H41    2  
ATOM 4169  H H42    . DC  B 1 17 ? -24.536 3.424   12.324  1.00 7.32  ? 17 DC  D H42    2  
ATOM 4170  H H5     . DC  B 1 17 ? -24.676 5.776   12.948  1.00 7.75  ? 17 DC  D H5     2  
ATOM 4171  H H6     . DC  B 1 17 ? -25.185 8.024   12.142  1.00 7.88  ? 17 DC  D H6     2  
ATOM 4172  P P      . DG  B 1 18 ? -28.619 11.792  9.147   1.00 7.95  ? 18 DG  D P      2  
ATOM 4173  O OP1    . DG  B 1 18 ? -28.811 13.136  8.549   1.00 8.08  ? 18 DG  D OP1    2  
ATOM 4174  O OP2    . DG  B 1 18 ? -29.118 11.523  10.521  1.00 8.23  ? 18 DG  D OP2    2  
ATOM 4175  O "O5'"  . DG  B 1 18 ? -29.243 10.711  8.161   1.00 7.55  ? 18 DG  D "O5'"  2  
ATOM 4176  C "C5'"  . DG  B 1 18 ? -28.826 10.653  6.797   1.00 7.23  ? 18 DG  D "C5'"  2  
ATOM 4177  C "C4'"  . DG  B 1 18 ? -29.771 9.798   5.988   1.00 6.93  ? 18 DG  D "C4'"  2  
ATOM 4178  O "O4'"  . DG  B 1 18 ? -29.505 8.407   6.283   1.00 6.75  ? 18 DG  D "O4'"  2  
ATOM 4179  C "C3'"  . DG  B 1 18 ? -31.244 10.002  6.330   1.00 7.08  ? 18 DG  D "C3'"  2  
ATOM 4180  O "O3'"  . DG  B 1 18 ? -32.089 9.653   5.229   1.00 6.80  ? 18 DG  D "O3'"  2  
ATOM 4181  C "C2'"  . DG  B 1 18 ? -31.451 9.036   7.483   1.00 7.19  ? 18 DG  D "C2'"  2  
ATOM 4182  C "C1'"  . DG  B 1 18 ? -30.543 7.874   7.095   1.00 6.89  ? 18 DG  D "C1'"  2  
ATOM 4183  N N9     . DG  B 1 18 ? -29.930 7.151   8.208   1.00 7.02  ? 18 DG  D N9     2  
ATOM 4184  C C8     . DG  B 1 18 ? -29.527 7.656   9.419   1.00 7.37  ? 18 DG  D C8     2  
ATOM 4185  N N7     . DG  B 1 18 ? -29.047 6.744   10.222  1.00 7.43  ? 18 DG  D N7     2  
ATOM 4186  C C5     . DG  B 1 18 ? -29.133 5.566   9.492   1.00 7.10  ? 18 DG  D C5     2  
ATOM 4187  C C6     . DG  B 1 18 ? -28.764 4.235   9.838   1.00 7.02  ? 18 DG  D C6     2  
ATOM 4188  O O6     . DG  B 1 18 ? -28.275 3.817   10.896  1.00 7.23  ? 18 DG  D O6     2  
ATOM 4189  N N1     . DG  B 1 18 ? -29.023 3.346   8.797   1.00 6.68  ? 18 DG  D N1     2  
ATOM 4190  C C2     . DG  B 1 18 ? -29.564 3.691   7.581   1.00 6.43  ? 18 DG  D C2     2  
ATOM 4191  N N2     . DG  B 1 18 ? -29.740 2.695   6.702   1.00 6.12  ? 18 DG  D N2     2  
ATOM 4192  N N3     . DG  B 1 18 ? -29.911 4.923   7.249   1.00 6.50  ? 18 DG  D N3     2  
ATOM 4193  C C4     . DG  B 1 18 ? -29.669 5.801   8.245   1.00 6.84  ? 18 DG  D C4     2  
ATOM 4194  H "H5'"  . DG  B 1 18 ? -27.824 10.228  6.741   1.00 7.12  ? 18 DG  D "H5'"  2  
ATOM 4195  H "H5''" . DG  B 1 18 ? -28.809 11.659  6.379   1.00 7.33  ? 18 DG  D "H5''" 2  
ATOM 4196  H "H4'"  . DG  B 1 18 ? -29.645 10.055  4.935   1.00 6.74  ? 18 DG  D "H4'"  2  
ATOM 4197  H "H3'"  . DG  B 1 18 ? -31.440 11.034  6.622   1.00 7.33  ? 18 DG  D "H3'"  2  
ATOM 4198  H "HO3'" . DG  B 1 18 ? -32.844 10.247  5.262   1.00 6.78  ? 18 DG  D "HO3'" 2  
ATOM 4199  H "H2'"  . DG  B 1 18 ? -31.163 9.488   8.433   1.00 7.48  ? 18 DG  D "H2'"  2  
ATOM 4200  H "H2''" . DG  B 1 18 ? -32.496 8.737   7.566   1.00 7.20  ? 18 DG  D "H2''" 2  
ATOM 4201  H "H1'"  . DG  B 1 18 ? -31.092 7.153   6.486   1.00 6.65  ? 18 DG  D "H1'"  2  
ATOM 4202  H H8     . DG  B 1 18 ? -29.602 8.701   9.684   1.00 7.59  ? 18 DG  D H8     2  
ATOM 4203  H H1     . DG  B 1 18 ? -28.796 2.373   8.949   1.00 6.62  ? 18 DG  D H1     2  
ATOM 4204  H H21    . DG  B 1 18 ? -29.483 1.744   6.932   1.00 6.08  ? 18 DG  D H21    2  
ATOM 4205  H H22    . DG  B 1 18 ? -30.134 2.897   5.794   1.00 5.93  ? 18 DG  D H22    2  
ATOM 4206  N N      . MET C 2 1  ? 1.275   4.923   -19.629 1.00 6.61  ? 1  MET A N      2  
ATOM 4207  C CA     . MET C 2 1  ? -0.160  4.561   -19.625 1.00 6.29  ? 1  MET A CA     2  
ATOM 4208  C C      . MET C 2 1  ? -0.543  3.893   -18.310 1.00 5.80  ? 1  MET A C      2  
ATOM 4209  O O      . MET C 2 1  ? 0.051   2.890   -17.915 1.00 5.96  ? 1  MET A O      2  
ATOM 4210  C CB     . MET C 2 1  ? -0.475  3.630   -20.801 1.00 6.58  ? 1  MET A CB     2  
ATOM 4211  C CG     . MET C 2 1  ? -1.952  3.288   -20.936 1.00 6.98  ? 1  MET A CG     2  
ATOM 4212  S SD     . MET C 2 1  ? -2.318  2.371   -22.447 1.00 7.35  ? 1  MET A SD     2  
ATOM 4213  C CE     . MET C 2 1  ? -4.064  2.031   -22.219 1.00 8.11  ? 1  MET A CE     2  
ATOM 4214  H H1     . MET C 2 1  ? 1.497   5.487   -20.478 1.00 6.85  ? 1  MET A H1     2  
ATOM 4215  H H2     . MET C 2 1  ? 1.865   4.065   -19.633 1.00 6.72  ? 1  MET A H2     2  
ATOM 4216  H H3     . MET C 2 1  ? 1.506   5.488   -18.782 1.00 6.83  ? 1  MET A H3     2  
ATOM 4217  H HA     . MET C 2 1  ? -0.737  5.468   -19.731 1.00 6.54  ? 1  MET A HA     2  
ATOM 4218  H HB2    . MET C 2 1  ? -0.152  4.103   -21.717 1.00 6.87  ? 1  MET A HB2    2  
ATOM 4219  H HB3    . MET C 2 1  ? 0.075   2.708   -20.671 1.00 6.62  ? 1  MET A HB3    2  
ATOM 4220  H HG2    . MET C 2 1  ? -2.247  2.688   -20.087 1.00 7.25  ? 1  MET A HG2    2  
ATOM 4221  H HG3    . MET C 2 1  ? -2.520  4.207   -20.941 1.00 7.18  ? 1  MET A HG3    2  
ATOM 4222  H HE1    . MET C 2 1  ? -4.605  2.962   -22.139 1.00 8.46  ? 1  MET A HE1    2  
ATOM 4223  H HE2    . MET C 2 1  ? -4.204  1.454   -21.316 1.00 8.28  ? 1  MET A HE2    2  
ATOM 4224  H HE3    . MET C 2 1  ? -4.435  1.470   -23.065 1.00 8.36  ? 1  MET A HE3    2  
ATOM 4225  N N      . LYS C 2 2  ? -1.527  4.468   -17.631 1.00 5.48  ? 2  LYS A N      2  
ATOM 4226  C CA     . LYS C 2 2  ? -2.003  3.936   -16.361 1.00 5.17  ? 2  LYS A CA     2  
ATOM 4227  C C      . LYS C 2 2  ? -3.096  2.896   -16.590 1.00 4.60  ? 2  LYS A C      2  
ATOM 4228  O O      . LYS C 2 2  ? -3.923  3.049   -17.489 1.00 4.73  ? 2  LYS A O      2  
ATOM 4229  C CB     . LYS C 2 2  ? -2.546  5.067   -15.483 1.00 5.62  ? 2  LYS A CB     2  
ATOM 4230  C CG     . LYS C 2 2  ? -1.488  6.056   -15.023 1.00 5.98  ? 2  LYS A CG     2  
ATOM 4231  C CD     . LYS C 2 2  ? -2.110  7.202   -14.242 1.00 6.39  ? 2  LYS A CD     2  
ATOM 4232  C CE     . LYS C 2 2  ? -1.050  8.087   -13.604 1.00 6.72  ? 2  LYS A CE     2  
ATOM 4233  N NZ     . LYS C 2 2  ? -1.655  9.217   -12.850 1.00 7.29  ? 2  LYS A NZ     2  
ATOM 4234  H H      . LYS C 2 2  ? -1.946  5.281   -17.995 1.00 5.65  ? 2  LYS A H      2  
ATOM 4235  H HA     . LYS C 2 2  ? -1.170  3.466   -15.859 1.00 5.28  ? 2  LYS A HA     2  
ATOM 4236  H HB2    . LYS C 2 2  ? -3.294  5.610   -16.040 1.00 5.96  ? 2  LYS A HB2    2  
ATOM 4237  H HB3    . LYS C 2 2  ? -3.007  4.634   -14.607 1.00 5.72  ? 2  LYS A HB3    2  
ATOM 4238  H HG2    . LYS C 2 2  ? -0.778  5.542   -14.391 1.00 6.17  ? 2  LYS A HG2    2  
ATOM 4239  H HG3    . LYS C 2 2  ? -0.980  6.454   -15.890 1.00 6.16  ? 2  LYS A HG3    2  
ATOM 4240  H HD2    . LYS C 2 2  ? -2.705  7.799   -14.914 1.00 6.78  ? 2  LYS A HD2    2  
ATOM 4241  H HD3    . LYS C 2 2  ? -2.739  6.793   -13.465 1.00 6.45  ? 2  LYS A HD3    2  
ATOM 4242  H HE2    . LYS C 2 2  ? -0.459  7.489   -12.927 1.00 6.67  ? 2  LYS A HE2    2  
ATOM 4243  H HE3    . LYS C 2 2  ? -0.414  8.482   -14.383 1.00 6.92  ? 2  LYS A HE3    2  
ATOM 4244  H HZ1    . LYS C 2 2  ? -2.130  9.875   -13.506 1.00 7.55  ? 2  LYS A HZ1    2  
ATOM 4245  H HZ2    . LYS C 2 2  ? -0.918  9.739   -12.329 1.00 7.51  ? 2  LYS A HZ2    2  
ATOM 4246  H HZ3    . LYS C 2 2  ? -2.358  8.857   -12.168 1.00 7.50  ? 2  LYS A HZ3    2  
ATOM 4247  N N      . PRO C 2 3  ? -3.102  1.817   -15.791 1.00 4.22  ? 3  PRO A N      2  
ATOM 4248  C CA     . PRO C 2 3  ? -4.101  0.762   -15.898 1.00 3.97  ? 3  PRO A CA     2  
ATOM 4249  C C      . PRO C 2 3  ? -5.355  1.070   -15.078 1.00 3.83  ? 3  PRO A C      2  
ATOM 4250  O O      . PRO C 2 3  ? -6.122  1.966   -15.432 1.00 4.13  ? 3  PRO A O      2  
ATOM 4251  C CB     . PRO C 2 3  ? -3.343  -0.455  -15.366 1.00 4.05  ? 3  PRO A CB     2  
ATOM 4252  C CG     . PRO C 2 3  ? -2.411  0.098   -14.336 1.00 4.26  ? 3  PRO A CG     2  
ATOM 4253  C CD     . PRO C 2 3  ? -2.119  1.530   -14.729 1.00 4.37  ? 3  PRO A CD     2  
ATOM 4254  H HA     . PRO C 2 3  ? -4.390  0.590   -16.923 1.00 4.12  ? 3  PRO A HA     2  
ATOM 4255  H HB2    . PRO C 2 3  ? -4.037  -1.164  -14.942 1.00 4.23  ? 3  PRO A HB2    2  
ATOM 4256  H HB3    . PRO C 2 3  ? -2.798  -0.922  -16.175 1.00 4.13  ? 3  PRO A HB3    2  
ATOM 4257  H HG2    . PRO C 2 3  ? -2.882  0.067   -13.365 1.00 4.56  ? 3  PRO A HG2    2  
ATOM 4258  H HG3    . PRO C 2 3  ? -1.497  -0.478  -14.325 1.00 4.30  ? 3  PRO A HG3    2  
ATOM 4259  H HD2    . PRO C 2 3  ? -2.266  2.187   -13.884 1.00 4.55  ? 3  PRO A HD2    2  
ATOM 4260  H HD3    . PRO C 2 3  ? -1.111  1.618   -15.105 1.00 4.58  ? 3  PRO A HD3    2  
ATOM 4261  N N      . VAL C 2 4  ? -5.562  0.343   -13.985 1.00 3.45  ? 4  VAL A N      2  
ATOM 4262  C CA     . VAL C 2 4  ? -6.729  0.551   -13.145 1.00 3.31  ? 4  VAL A CA     2  
ATOM 4263  C C      . VAL C 2 4  ? -6.361  0.470   -11.680 1.00 3.06  ? 4  VAL A C      2  
ATOM 4264  O O      . VAL C 2 4  ? -5.477  -0.284  -11.274 1.00 2.85  ? 4  VAL A O      2  
ATOM 4265  C CB     . VAL C 2 4  ? -7.839  -0.497  -13.392 1.00 3.15  ? 4  VAL A CB     2  
ATOM 4266  C CG1    . VAL C 2 4  ? -9.083  -0.171  -12.586 1.00 3.02  ? 4  VAL A CG1    2  
ATOM 4267  C CG2    . VAL C 2 4  ? -8.206  -0.588  -14.852 1.00 3.43  ? 4  VAL A CG2    2  
ATOM 4268  H H      . VAL C 2 4  ? -4.906  -0.330  -13.721 1.00 3.34  ? 4  VAL A H      2  
ATOM 4269  H HA     . VAL C 2 4  ? -7.138  1.534   -13.356 1.00 3.54  ? 4  VAL A HA     2  
ATOM 4270  H HB     . VAL C 2 4  ? -7.474  -1.453  -13.069 1.00 2.96  ? 4  VAL A HB     2  
ATOM 4271  H HG11   . VAL C 2 4  ? -8.807  0.023   -11.557 1.00 3.17  ? 4  VAL A HG11   2  
ATOM 4272  H HG12   . VAL C 2 4  ? -9.767  -1.004  -12.625 1.00 3.22  ? 4  VAL A HG12   2  
ATOM 4273  H HG13   . VAL C 2 4  ? -9.559  0.708   -13.000 1.00 3.08  ? 4  VAL A HG13   2  
ATOM 4274  H HG21   . VAL C 2 4  ? -9.046  -1.258  -14.964 1.00 3.42  ? 4  VAL A HG21   2  
ATOM 4275  H HG22   . VAL C 2 4  ? -7.363  -0.960  -15.413 1.00 3.82  ? 4  VAL A HG22   2  
ATOM 4276  H HG23   . VAL C 2 4  ? -8.475  0.394   -15.208 1.00 3.65  ? 4  VAL A HG23   2  
ATOM 4277  N N      . THR C 2 5  ? -7.055  1.263   -10.919 1.00 3.14  ? 5  THR A N      2  
ATOM 4278  C CA     . THR C 2 5  ? -6.929  1.295   -9.480  1.00 3.01  ? 5  THR A CA     2  
ATOM 4279  C C      . THR C 2 5  ? -8.300  0.996   -8.945  1.00 2.85  ? 5  THR A C      2  
ATOM 4280  O O      . THR C 2 5  ? -9.274  1.070   -9.696  1.00 2.89  ? 5  THR A O      2  
ATOM 4281  C CB     . THR C 2 5  ? -6.453  2.660   -8.950  1.00 3.29  ? 5  THR A CB     2  
ATOM 4282  O OG1    . THR C 2 5  ? -7.288  3.710   -9.455  1.00 3.55  ? 5  THR A OG1    2  
ATOM 4283  C CG2    . THR C 2 5  ? -5.005  2.916   -9.335  1.00 3.52  ? 5  THR A CG2    2  
ATOM 4284  H H      . THR C 2 5  ? -7.710  1.855   -11.353 1.00 3.33  ? 5  THR A H      2  
ATOM 4285  H HA     . THR C 2 5  ? -6.247  0.520   -9.157  1.00 2.86  ? 5  THR A HA     2  
ATOM 4286  H HB     . THR C 2 5  ? -6.522  2.650   -7.872  1.00 3.25  ? 5  THR A HB     2  
ATOM 4287  H HG1    . THR C 2 5  ? -7.346  3.646   -10.426 1.00 3.59  ? 5  THR A HG1    2  
ATOM 4288  H HG21   . THR C 2 5  ? -4.909  2.890   -10.410 1.00 3.69  ? 5  THR A HG21   2  
ATOM 4289  H HG22   . THR C 2 5  ? -4.382  2.151   -8.897  1.00 3.76  ? 5  THR A HG22   2  
ATOM 4290  H HG23   . THR C 2 5  ? -4.701  3.884   -8.967  1.00 3.70  ? 5  THR A HG23   2  
ATOM 4291  N N      . LEU C 2 6  ? -8.414  0.639   -7.687  1.00 2.72  ? 6  LEU A N      2  
ATOM 4292  C CA     . LEU C 2 6  ? -9.731  0.352   -7.156  1.00 2.62  ? 6  LEU A CA     2  
ATOM 4293  C C      . LEU C 2 6  ? -10.638 1.578   -7.277  1.00 2.85  ? 6  LEU A C      2  
ATOM 4294  O O      . LEU C 2 6  ? -11.862 1.467   -7.290  1.00 2.79  ? 6  LEU A O      2  
ATOM 4295  C CB     . LEU C 2 6  ? -9.639  -0.154  -5.735  1.00 2.55  ? 6  LEU A CB     2  
ATOM 4296  C CG     . LEU C 2 6  ? -10.022 -1.613  -5.574  1.00 2.31  ? 6  LEU A CG     2  
ATOM 4297  C CD1    . LEU C 2 6  ? -10.025 -2.007  -4.109  1.00 2.37  ? 6  LEU A CD1    2  
ATOM 4298  C CD2    . LEU C 2 6  ? -11.375 -1.876  -6.214  1.00 2.25  ? 6  LEU A CD2    2  
ATOM 4299  H H      . LEU C 2 6  ? -7.612  0.559   -7.113  1.00 2.71  ? 6  LEU A H      2  
ATOM 4300  H HA     . LEU C 2 6  ? -10.147 -0.427  -7.767  1.00 2.47  ? 6  LEU A HA     2  
ATOM 4301  H HB2    . LEU C 2 6  ? -8.616  -0.028  -5.403  1.00 2.61  ? 6  LEU A HB2    2  
ATOM 4302  H HB3    . LEU C 2 6  ? -10.292 0.437   -5.114  1.00 2.69  ? 6  LEU A HB3    2  
ATOM 4303  H HG     . LEU C 2 6  ? -9.288  -2.217  -6.083  1.00 2.21  ? 6  LEU A HG     2  
ATOM 4304  H HD11   . LEU C 2 6  ? -9.024  -1.923  -3.710  1.00 2.76  ? 6  LEU A HD11   2  
ATOM 4305  H HD12   . LEU C 2 6  ? -10.367 -3.027  -4.011  1.00 2.47  ? 6  LEU A HD12   2  
ATOM 4306  H HD13   . LEU C 2 6  ? -10.687 -1.350  -3.563  1.00 2.50  ? 6  LEU A HD13   2  
ATOM 4307  H HD21   . LEU C 2 6  ? -12.152 -1.773  -5.471  1.00 2.34  ? 6  LEU A HD21   2  
ATOM 4308  H HD22   . LEU C 2 6  ? -11.395 -2.877  -6.622  1.00 2.39  ? 6  LEU A HD22   2  
ATOM 4309  H HD23   . LEU C 2 6  ? -11.546 -1.159  -7.012  1.00 2.51  ? 6  LEU A HD23   2  
ATOM 4310  N N      . TYR C 2 7  ? -10.007 2.741   -7.392  1.00 3.13  ? 7  TYR A N      2  
ATOM 4311  C CA     . TYR C 2 7  ? -10.712 4.014   -7.552  1.00 3.41  ? 7  TYR A CA     2  
ATOM 4312  C C      . TYR C 2 7  ? -11.472 4.045   -8.874  1.00 3.42  ? 7  TYR A C      2  
ATOM 4313  O O      . TYR C 2 7  ? -12.593 4.538   -8.964  1.00 3.50  ? 7  TYR A O      2  
ATOM 4314  C CB     . TYR C 2 7  ? -9.724  5.182   -7.564  1.00 3.74  ? 7  TYR A CB     2  
ATOM 4315  C CG     . TYR C 2 7  ? -9.169  5.571   -6.221  1.00 3.86  ? 7  TYR A CG     2  
ATOM 4316  C CD1    . TYR C 2 7  ? -10.011 6.049   -5.228  1.00 3.98  ? 7  TYR A CD1    2  
ATOM 4317  C CD2    . TYR C 2 7  ? -7.819  5.425   -5.930  1.00 3.89  ? 7  TYR A CD2    2  
ATOM 4318  C CE1    . TYR C 2 7  ? -9.525  6.381   -3.983  1.00 4.16  ? 7  TYR A CE1    2  
ATOM 4319  C CE2    . TYR C 2 7  ? -7.326  5.749   -4.682  1.00 4.04  ? 7  TYR A CE2    2  
ATOM 4320  C CZ     . TYR C 2 7  ? -8.106  6.349   -3.780  1.00 4.20  ? 7  TYR A CZ     2  
ATOM 4321  O OH     . TYR C 2 7  ? -7.703  6.550   -2.468  1.00 4.39  ? 7  TYR A OH     2  
ATOM 4322  H H      . TYR C 2 7  ? -9.028  2.735   -7.397  1.00 3.16  ? 7  TYR A H      2  
ATOM 4323  H HA     . TYR C 2 7  ? -11.401 4.130   -6.730  1.00 3.41  ? 7  TYR A HA     2  
ATOM 4324  H HB2    . TYR C 2 7  ? -8.887  4.921   -8.193  1.00 3.72  ? 7  TYR A HB2    2  
ATOM 4325  H HB3    . TYR C 2 7  ? -10.217 6.048   -7.981  1.00 3.94  ? 7  TYR A HB3    2  
ATOM 4326  H HD1    . TYR C 2 7  ? -11.061 6.167   -5.444  1.00 3.96  ? 7  TYR A HD1    2  
ATOM 4327  H HD2    . TYR C 2 7  ? -7.149  5.061   -6.702  1.00 3.82  ? 7  TYR A HD2    2  
ATOM 4328  H HE1    . TYR C 2 7  ? -10.196 6.756   -3.226  1.00 4.30  ? 7  TYR A HE1    2  
ATOM 4329  H HE2    . TYR C 2 7  ? -6.274  5.632   -4.470  1.00 4.07  ? 7  TYR A HE2    2  
ATOM 4330  H HH     . TYR C 2 7  ? -8.411  6.460   -1.822  1.00 4.61  ? 7  TYR A HH     2  
ATOM 4331  N N      . ASP C 2 8  ? -10.831 3.483   -9.887  1.00 3.37  ? 8  ASP A N      2  
ATOM 4332  C CA     . ASP C 2 8  ? -11.344 3.447   -11.251 1.00 3.45  ? 8  ASP A CA     2  
ATOM 4333  C C      . ASP C 2 8  ? -12.604 2.625   -11.317 1.00 3.21  ? 8  ASP A C      2  
ATOM 4334  O O      . ASP C 2 8  ? -13.598 3.038   -11.913 1.00 3.31  ? 8  ASP A O      2  
ATOM 4335  C CB     . ASP C 2 8  ? -10.280 2.870   -12.191 1.00 3.49  ? 8  ASP A CB     2  
ATOM 4336  C CG     . ASP C 2 8  ? -9.162  3.847   -12.487 1.00 3.79  ? 8  ASP A CG     2  
ATOM 4337  O OD1    . ASP C 2 8  ? -9.393  4.822   -13.235 1.00 4.13  ? 8  ASP A OD1    2  
ATOM 4338  O OD2    . ASP C 2 8  ? -8.041  3.636   -11.976 1.00 3.72  ? 8  ASP A OD2    2  
ATOM 4339  H H      . ASP C 2 8  ? -9.995  3.029   -9.698  1.00 3.28  ? 8  ASP A H      2  
ATOM 4340  H HA     . ASP C 2 8  ? -11.570 4.448   -11.558 1.00 3.70  ? 8  ASP A HA     2  
ATOM 4341  H HB2    . ASP C 2 8  ? -9.846  1.999   -11.727 1.00 3.28  ? 8  ASP A HB2    2  
ATOM 4342  H HB3    . ASP C 2 8  ? -10.736 2.581   -13.125 1.00 3.52  ? 8  ASP A HB3    2  
ATOM 4343  N N      . VAL C 2 9  ? -12.564 1.470   -10.679 1.00 2.91  ? 9  VAL A N      2  
ATOM 4344  C CA     . VAL C 2 9  ? -13.697 0.586   -10.662 1.00 2.70  ? 9  VAL A CA     2  
ATOM 4345  C C      . VAL C 2 9  ? -14.805 1.219   -9.856  1.00 2.72  ? 9  VAL A C      2  
ATOM 4346  O O      . VAL C 2 9  ? -15.969 1.185   -10.228 1.00 2.70  ? 9  VAL A O      2  
ATOM 4347  C CB     . VAL C 2 9  ? -13.319 -0.767  -10.051 1.00 2.43  ? 9  VAL A CB     2  
ATOM 4348  C CG1    . VAL C 2 9  ? -14.535 -1.651  -9.917  1.00 2.28  ? 9  VAL A CG1    2  
ATOM 4349  C CG2    . VAL C 2 9  ? -12.250 -1.450  -10.885 1.00 2.45  ? 9  VAL A CG2    2  
ATOM 4350  H H      . VAL C 2 9  ? -11.775 1.238   -10.143 1.00 2.85  ? 9  VAL A H      2  
ATOM 4351  H HA     . VAL C 2 9  ? -14.033 0.437   -11.680 1.00 2.77  ? 9  VAL A HA     2  
ATOM 4352  H HB     . VAL C 2 9  ? -12.919 -0.589  -9.064  1.00 2.40  ? 9  VAL A HB     2  
ATOM 4353  H HG11   . VAL C 2 9  ? -15.193 -1.245  -9.165  1.00 2.36  ? 9  VAL A HG11   2  
ATOM 4354  H HG12   . VAL C 2 9  ? -14.226 -2.647  -9.632  1.00 2.36  ? 9  VAL A HG12   2  
ATOM 4355  H HG13   . VAL C 2 9  ? -15.051 -1.689  -10.868 1.00 2.64  ? 9  VAL A HG13   2  
ATOM 4356  H HG21   . VAL C 2 9  ? -12.452 -2.516  -10.927 1.00 2.71  ? 9  VAL A HG21   2  
ATOM 4357  H HG22   . VAL C 2 9  ? -11.285 -1.283  -10.433 1.00 2.80  ? 9  VAL A HG22   2  
ATOM 4358  H HG23   . VAL C 2 9  ? -12.255 -1.043  -11.885 1.00 2.48  ? 9  VAL A HG23   2  
ATOM 4359  N N      . ALA C 2 10 ? -14.404 1.815   -8.755  1.00 2.80  ? 10 ALA A N      2  
ATOM 4360  C CA     . ALA C 2 10 ? -15.324 2.479   -7.844  1.00 2.91  ? 10 ALA A CA     2  
ATOM 4361  C C      . ALA C 2 10 ? -16.117 3.568   -8.546  1.00 3.14  ? 10 ALA A C      2  
ATOM 4362  O O      . ALA C 2 10 ? -17.348 3.599   -8.483  1.00 3.12  ? 10 ALA A O      2  
ATOM 4363  C CB     . ALA C 2 10 ? -14.528 3.053   -6.687  1.00 3.09  ? 10 ALA A CB     2  
ATOM 4364  H H      . ALA C 2 10 ? -13.434 1.814   -8.546  1.00 2.83  ? 10 ALA A H      2  
ATOM 4365  H HA     . ALA C 2 10 ? -16.018 1.748   -7.458  1.00 2.75  ? 10 ALA A HA     2  
ATOM 4366  H HB1    . ALA C 2 10 ? -14.666 2.435   -5.813  1.00 3.39  ? 10 ALA A HB1    2  
ATOM 4367  H HB2    . ALA C 2 10 ? -14.861 4.059   -6.479  1.00 3.18  ? 10 ALA A HB2    2  
ATOM 4368  H HB3    . ALA C 2 10 ? -13.476 3.068   -6.957  1.00 3.24  ? 10 ALA A HB3    2  
ATOM 4369  N N      . GLU C 2 11 ? -15.412 4.414   -9.266  1.00 3.37  ? 11 GLU A N      2  
ATOM 4370  C CA     . GLU C 2 11 ? -16.044 5.516   -9.969  1.00 3.64  ? 11 GLU A CA     2  
ATOM 4371  C C      . GLU C 2 11 ? -16.923 4.977   -11.086 1.00 3.52  ? 11 GLU A C      2  
ATOM 4372  O O      . GLU C 2 11 ? -18.076 5.388   -11.234 1.00 3.57  ? 11 GLU A O      2  
ATOM 4373  C CB     . GLU C 2 11 ? -15.002 6.514   -10.485 1.00 3.95  ? 11 GLU A CB     2  
ATOM 4374  C CG     . GLU C 2 11 ? -14.336 7.296   -9.357  1.00 4.31  ? 11 GLU A CG     2  
ATOM 4375  C CD     . GLU C 2 11 ? -13.564 8.514   -9.829  1.00 4.89  ? 11 GLU A CD     2  
ATOM 4376  O OE1    . GLU C 2 11 ? -14.016 9.171   -10.791 1.00 5.24  ? 11 GLU A OE1    2  
ATOM 4377  O OE2    . GLU C 2 11 ? -12.489 8.809   -9.263  1.00 5.23  ? 11 GLU A OE2    2  
ATOM 4378  H H      . GLU C 2 11 ? -14.442 4.266   -9.360  1.00 3.37  ? 11 GLU A H      2  
ATOM 4379  H HA     . GLU C 2 11 ? -16.684 6.018   -9.256  1.00 3.74  ? 11 GLU A HA     2  
ATOM 4380  H HB2    . GLU C 2 11 ? -14.237 5.977   -11.027 1.00 3.90  ? 11 GLU A HB2    2  
ATOM 4381  H HB3    . GLU C 2 11 ? -15.482 7.216   -11.149 1.00 4.15  ? 11 GLU A HB3    2  
ATOM 4382  H HG2    . GLU C 2 11 ? -15.101 7.626   -8.670  1.00 4.29  ? 11 GLU A HG2    2  
ATOM 4383  H HG3    . GLU C 2 11 ? -13.655 6.637   -8.839  1.00 4.50  ? 11 GLU A HG3    2  
ATOM 4384  N N      . TYR C 2 12 ? -16.367 4.062   -11.867 1.00 3.40  ? 12 TYR A N      2  
ATOM 4385  C CA     . TYR C 2 12 ? -17.084 3.439   -12.969 1.00 3.35  ? 12 TYR A CA     2  
ATOM 4386  C C      . TYR C 2 12 ? -18.312 2.669   -12.474 1.00 3.08  ? 12 TYR A C      2  
ATOM 4387  O O      . TYR C 2 12 ? -19.313 2.563   -13.183 1.00 3.11  ? 12 TYR A O      2  
ATOM 4388  C CB     . TYR C 2 12 ? -16.152 2.483   -13.711 1.00 3.31  ? 12 TYR A CB     2  
ATOM 4389  C CG     . TYR C 2 12 ? -16.763 1.858   -14.942 1.00 3.39  ? 12 TYR A CG     2  
ATOM 4390  C CD1    . TYR C 2 12 ? -17.172 2.656   -15.994 1.00 3.70  ? 12 TYR A CD1    2  
ATOM 4391  C CD2    . TYR C 2 12 ? -16.934 0.486   -15.052 1.00 3.19  ? 12 TYR A CD2    2  
ATOM 4392  C CE1    . TYR C 2 12 ? -17.737 2.116   -17.126 1.00 3.82  ? 12 TYR A CE1    2  
ATOM 4393  C CE2    . TYR C 2 12 ? -17.499 -0.071  -16.184 1.00 3.34  ? 12 TYR A CE2    2  
ATOM 4394  C CZ     . TYR C 2 12 ? -17.870 0.669   -17.196 1.00 3.64  ? 12 TYR A CZ     2  
ATOM 4395  O OH     . TYR C 2 12 ? -18.465 0.194   -18.349 1.00 3.82  ? 12 TYR A OH     2  
ATOM 4396  H H      . TYR C 2 12 ? -15.436 3.790   -11.692 1.00 3.37  ? 12 TYR A H      2  
ATOM 4397  H HA     . TYR C 2 12 ? -17.404 4.217   -13.645 1.00 3.57  ? 12 TYR A HA     2  
ATOM 4398  H HB2    . TYR C 2 12 ? -15.262 3.011   -14.010 1.00 3.49  ? 12 TYR A HB2    2  
ATOM 4399  H HB3    . TYR C 2 12 ? -15.876 1.681   -13.043 1.00 3.08  ? 12 TYR A HB3    2  
ATOM 4400  H HD1    . TYR C 2 12 ? -17.036 3.734   -15.922 1.00 3.88  ? 12 TYR A HD1    2  
ATOM 4401  H HD2    . TYR C 2 12 ? -16.618 -0.151  -14.239 1.00 2.97  ? 12 TYR A HD2    2  
ATOM 4402  H HE1    . TYR C 2 12 ? -18.052 2.769   -17.929 1.00 4.08  ? 12 TYR A HE1    2  
ATOM 4403  H HE2    . TYR C 2 12 ? -17.623 -1.141  -16.255 1.00 3.25  ? 12 TYR A HE2    2  
ATOM 4404  H HH     . TYR C 2 12 ? -18.248 0.737   -19.128 1.00 4.13  ? 12 TYR A HH     2  
ATOM 4405  N N      . ALA C 2 13 ? -18.243 2.145   -11.250 1.00 2.87  ? 13 ALA A N      2  
ATOM 4406  C CA     . ALA C 2 13 ? -19.352 1.373   -10.700 1.00 2.66  ? 13 ALA A CA     2  
ATOM 4407  C C      . ALA C 2 13 ? -20.407 2.311   -10.144 1.00 2.78  ? 13 ALA A C      2  
ATOM 4408  O O      . ALA C 2 13 ? -21.595 1.986   -10.074 1.00 2.70  ? 13 ALA A O      2  
ATOM 4409  C CB     . ALA C 2 13 ? -18.857 0.464   -9.602  1.00 2.47  ? 13 ALA A CB     2  
ATOM 4410  H H      . ALA C 2 13 ? -17.437 2.305   -10.692 1.00 2.89  ? 13 ALA A H      2  
ATOM 4411  H HA     . ALA C 2 13 ? -19.773 0.754   -11.490 1.00 2.61  ? 13 ALA A HA     2  
ATOM 4412  H HB1    . ALA C 2 13 ? -18.134 -0.231  -10.009 1.00 2.73  ? 13 ALA A HB1    2  
ATOM 4413  H HB2    . ALA C 2 13 ? -19.692 -0.079  -9.180  1.00 2.66  ? 13 ALA A HB2    2  
ATOM 4414  H HB3    . ALA C 2 13 ? -18.391 1.061   -8.832  1.00 2.52  ? 13 ALA A HB3    2  
ATOM 4415  N N      . GLY C 2 14 ? -19.945 3.481   -9.738  1.00 3.02  ? 14 GLY A N      2  
ATOM 4416  C CA     . GLY C 2 14 ? -20.822 4.490   -9.204  1.00 3.22  ? 14 GLY A CA     2  
ATOM 4417  C C      . GLY C 2 14 ? -20.977 4.327   -7.723  1.00 3.21  ? 14 GLY A C      2  
ATOM 4418  O O      . GLY C 2 14 ? -22.047 4.559   -7.155  1.00 3.28  ? 14 GLY A O      2  
ATOM 4419  H H      . GLY C 2 14 ? -18.976 3.628   -9.729  1.00 3.08  ? 14 GLY A H      2  
ATOM 4420  H HA2    . GLY C 2 14 ? -20.411 5.461   -9.417  1.00 3.45  ? 14 GLY A HA2    2  
ATOM 4421  H HA3    . GLY C 2 14 ? -21.785 4.393   -9.670  1.00 3.18  ? 14 GLY A HA3    2  
ATOM 4422  N N      . VAL C 2 15 ? -19.895 3.886   -7.113  1.00 3.16  ? 15 VAL A N      2  
ATOM 4423  C CA     . VAL C 2 15 ? -19.841 3.638   -5.688  1.00 3.22  ? 15 VAL A CA     2  
ATOM 4424  C C      . VAL C 2 15 ? -18.520 4.112   -5.124  1.00 3.39  ? 15 VAL A C      2  
ATOM 4425  O O      . VAL C 2 15 ? -17.507 4.081   -5.816  1.00 3.33  ? 15 VAL A O      2  
ATOM 4426  C CB     . VAL C 2 15 ? -20.019 2.153   -5.385  1.00 2.96  ? 15 VAL A CB     2  
ATOM 4427  C CG1    . VAL C 2 15 ? -21.461 1.754   -5.545  1.00 2.89  ? 15 VAL A CG1    2  
ATOM 4428  C CG2    . VAL C 2 15 ? -19.155 1.351   -6.316  1.00 2.72  ? 15 VAL A CG2    2  
ATOM 4429  H H      . VAL C 2 15 ? -19.074 3.729   -7.654  1.00 3.12  ? 15 VAL A H      2  
ATOM 4430  H HA     . VAL C 2 15 ? -20.646 4.185   -5.217  1.00 3.38  ? 15 VAL A HA     2  
ATOM 4431  H HB     . VAL C 2 15 ? -19.709 1.959   -4.370  1.00 3.04  ? 15 VAL A HB     2  
ATOM 4432  H HG11   . VAL C 2 15 ? -21.749 1.884   -6.582  1.00 2.96  ? 15 VAL A HG11   2  
ATOM 4433  H HG12   . VAL C 2 15 ? -22.077 2.373   -4.913  1.00 3.04  ? 15 VAL A HG12   2  
ATOM 4434  H HG13   . VAL C 2 15 ? -21.576 0.719   -5.264  1.00 3.14  ? 15 VAL A HG13   2  
ATOM 4435  H HG21   . VAL C 2 15 ? -19.369 1.640   -7.338  1.00 2.95  ? 15 VAL A HG21   2  
ATOM 4436  H HG22   . VAL C 2 15 ? -19.358 0.300   -6.183  1.00 2.86  ? 15 VAL A HG22   2  
ATOM 4437  H HG23   . VAL C 2 15 ? -18.118 1.556   -6.095  1.00 2.74  ? 15 VAL A HG23   2  
ATOM 4438  N N      . SER C 2 16 ? -18.533 4.584   -3.897  1.00 3.63  ? 16 SER A N      2  
ATOM 4439  C CA     . SER C 2 16 ? -17.316 5.065   -3.270  1.00 3.82  ? 16 SER A CA     2  
ATOM 4440  C C      . SER C 2 16 ? -16.232 3.996   -3.302  1.00 3.58  ? 16 SER A C      2  
ATOM 4441  O O      . SER C 2 16 ? -16.509 2.793   -3.291  1.00 3.34  ? 16 SER A O      2  
ATOM 4442  C CB     . SER C 2 16 ? -17.577 5.521   -1.839  1.00 4.13  ? 16 SER A CB     2  
ATOM 4443  O OG     . SER C 2 16 ? -18.614 6.485   -1.797  1.00 4.34  ? 16 SER A OG     2  
ATOM 4444  H H      . SER C 2 16 ? -19.361 4.559   -3.386  1.00 3.69  ? 16 SER A H      2  
ATOM 4445  H HA     . SER C 2 16 ? -16.969 5.912   -3.844  1.00 3.95  ? 16 SER A HA     2  
ATOM 4446  H HB2    . SER C 2 16 ? -17.860 4.671   -1.240  1.00 4.23  ? 16 SER A HB2    2  
ATOM 4447  H HB3    . SER C 2 16 ? -16.676 5.960   -1.434  1.00 4.25  ? 16 SER A HB3    2  
ATOM 4448  H HG     . SER C 2 16 ? -18.677 6.850   -0.911  1.00 4.52  ? 16 SER A HG     2  
ATOM 4449  N N      . TYR C 2 17 ? -15.009 4.463   -3.333  1.00 3.68  ? 17 TYR A N      2  
ATOM 4450  C CA     . TYR C 2 17 ? -13.830 3.612   -3.386  1.00 3.49  ? 17 TYR A CA     2  
ATOM 4451  C C      . TYR C 2 17 ? -13.837 2.566   -2.286  1.00 3.42  ? 17 TYR A C      2  
ATOM 4452  O O      . TYR C 2 17 ? -13.703 1.367   -2.537  1.00 3.16  ? 17 TYR A O      2  
ATOM 4453  C CB     . TYR C 2 17 ? -12.619 4.510   -3.217  1.00 3.71  ? 17 TYR A CB     2  
ATOM 4454  C CG     . TYR C 2 17 ? -11.351 3.751   -3.045  1.00 3.56  ? 17 TYR A CG     2  
ATOM 4455  C CD1    . TYR C 2 17 ? -10.808 3.014   -4.086  1.00 3.31  ? 17 TYR A CD1    2  
ATOM 4456  C CD2    . TYR C 2 17 ? -10.696 3.777   -1.840  1.00 3.69  ? 17 TYR A CD2    2  
ATOM 4457  C CE1    . TYR C 2 17 ? -9.637  2.318   -3.913  1.00 3.18  ? 17 TYR A CE1    2  
ATOM 4458  C CE2    . TYR C 2 17 ? -9.535  3.092   -1.656  1.00 3.55  ? 17 TYR A CE2    2  
ATOM 4459  C CZ     . TYR C 2 17 ? -9.007  2.330   -2.762  1.00 3.28  ? 17 TYR A CZ     2  
ATOM 4460  O OH     . TYR C 2 17 ? -7.828  1.667   -2.510  1.00 3.16  ? 17 TYR A OH     2  
ATOM 4461  H H      . TYR C 2 17 ? -14.887 5.434   -3.300  1.00 3.91  ? 17 TYR A H      2  
ATOM 4462  H HA     . TYR C 2 17 ? -13.774 3.119   -4.349  1.00 3.28  ? 17 TYR A HA     2  
ATOM 4463  H HB2    . TYR C 2 17 ? -12.519 5.135   -4.088  1.00 3.77  ? 17 TYR A HB2    2  
ATOM 4464  H HB3    . TYR C 2 17 ? -12.755 5.132   -2.347  1.00 3.95  ? 17 TYR A HB3    2  
ATOM 4465  H HD1    . TYR C 2 17 ? -11.315 2.993   -5.041  1.00 3.25  ? 17 TYR A HD1    2  
ATOM 4466  H HD2    . TYR C 2 17 ? -11.111 4.353   -1.027  1.00 3.91  ? 17 TYR A HD2    2  
ATOM 4467  H HE1    . TYR C 2 17 ? -9.224  1.751   -4.731  1.00 3.01  ? 17 TYR A HE1    2  
ATOM 4468  H HE2    . TYR C 2 17 ? -9.050  3.140   -0.696  1.00 3.68  ? 17 TYR A HE2    2  
ATOM 4469  H HH     . TYR C 2 17 ? -7.779  1.355   -1.600  1.00 3.43  ? 17 TYR A HH     2  
ATOM 4470  N N      . GLN C 2 18 ? -14.032 3.042   -1.077  1.00 3.70  ? 18 GLN A N      2  
ATOM 4471  C CA     . GLN C 2 18 ? -14.052 2.198   0.109   1.00 3.76  ? 18 GLN A CA     2  
ATOM 4472  C C      . GLN C 2 18 ? -15.175 1.160   0.059   1.00 3.60  ? 18 GLN A C      2  
ATOM 4473  O O      . GLN C 2 18 ? -15.082 0.111   0.699   1.00 3.59  ? 18 GLN A O      2  
ATOM 4474  C CB     . GLN C 2 18 ? -14.186 3.073   1.356   1.00 4.16  ? 18 GLN A CB     2  
ATOM 4475  C CG     . GLN C 2 18 ? -14.624 4.496   1.048   1.00 4.57  ? 18 GLN A CG     2  
ATOM 4476  C CD     . GLN C 2 18 ? -15.216 5.196   2.242   1.00 5.01  ? 18 GLN A CD     2  
ATOM 4477  O OE1    . GLN C 2 18 ? -15.848 4.568   3.086   1.00 5.50  ? 18 GLN A OE1    2  
ATOM 4478  N NE2    . GLN C 2 18 ? -15.020 6.501   2.318   1.00 5.22  ? 18 GLN A NE2    2  
ATOM 4479  H H      . GLN C 2 18 ? -14.152 4.009   -0.979  1.00 3.91  ? 18 GLN A H      2  
ATOM 4480  H HA     . GLN C 2 18 ? -13.107 1.677   0.155   1.00 3.66  ? 18 GLN A HA     2  
ATOM 4481  H HB2    . GLN C 2 18 ? -14.910 2.630   2.023   1.00 4.34  ? 18 GLN A HB2    2  
ATOM 4482  H HB3    . GLN C 2 18 ? -13.226 3.117   1.853   1.00 4.27  ? 18 GLN A HB3    2  
ATOM 4483  H HG2    . GLN C 2 18 ? -13.765 5.059   0.712   1.00 4.81  ? 18 GLN A HG2    2  
ATOM 4484  H HG3    . GLN C 2 18 ? -15.366 4.469   0.264   1.00 4.76  ? 18 GLN A HG3    2  
ATOM 4485  H HE21   . GLN C 2 18 ? -14.509 6.938   1.601   1.00 5.10  ? 18 GLN A HE21   2  
ATOM 4486  H HE22   . GLN C 2 18 ? -15.395 6.982   3.088   1.00 5.71  ? 18 GLN A HE22   2  
ATOM 4487  N N      . THR C 2 19 ? -16.223 1.450   -0.704  1.00 3.52  ? 19 THR A N      2  
ATOM 4488  C CA     . THR C 2 19 ? -17.353 0.549   -0.845  1.00 3.39  ? 19 THR A CA     2  
ATOM 4489  C C      . THR C 2 19 ? -16.947 -0.718  -1.584  1.00 3.07  ? 19 THR A C      2  
ATOM 4490  O O      . THR C 2 19 ? -17.001 -1.816  -1.030  1.00 3.08  ? 19 THR A O      2  
ATOM 4491  C CB     . THR C 2 19 ? -18.498 1.257   -1.604  1.00 3.36  ? 19 THR A CB     2  
ATOM 4492  O OG1    . THR C 2 19 ? -18.664 2.578   -1.075  1.00 3.65  ? 19 THR A OG1    2  
ATOM 4493  C CG2    . THR C 2 19 ? -19.803 0.495   -1.488  1.00 3.31  ? 19 THR A CG2    2  
ATOM 4494  H H      . THR C 2 19 ? -16.240 2.297   -1.195  1.00 3.56  ? 19 THR A H      2  
ATOM 4495  H HA     . THR C 2 19 ? -17.702 0.284   0.139   1.00 3.57  ? 19 THR A HA     2  
ATOM 4496  H HB     . THR C 2 19 ? -18.236 1.327   -2.655  1.00 3.20  ? 19 THR A HB     2  
ATOM 4497  H HG1    . THR C 2 19 ? -19.579 2.858   -1.182  1.00 3.86  ? 19 THR A HG1    2  
ATOM 4498  H HG21   . THR C 2 19 ? -20.590 1.075   -1.949  1.00 3.18  ? 19 THR A HG21   2  
ATOM 4499  H HG22   . THR C 2 19 ? -20.035 0.332   -0.446  1.00 3.58  ? 19 THR A HG22   2  
ATOM 4500  H HG23   . THR C 2 19 ? -19.713 -0.457  -1.995  1.00 3.59  ? 19 THR A HG23   2  
ATOM 4501  N N      . VAL C 2 20 ? -16.496 -0.552  -2.817  1.00 2.85  ? 20 VAL A N      2  
ATOM 4502  C CA     . VAL C 2 20 ? -16.098 -1.675  -3.650  1.00 2.58  ? 20 VAL A CA     2  
ATOM 4503  C C      . VAL C 2 20 ? -14.840 -2.358  -3.126  1.00 2.57  ? 20 VAL A C      2  
ATOM 4504  O O      . VAL C 2 20 ? -14.643 -3.553  -3.346  1.00 2.46  ? 20 VAL A O      2  
ATOM 4505  C CB     . VAL C 2 20 ? -15.968 -1.269  -5.138  1.00 2.42  ? 20 VAL A CB     2  
ATOM 4506  C CG1    . VAL C 2 20 ? -16.374 0.172   -5.341  1.00 2.61  ? 20 VAL A CG1    2  
ATOM 4507  C CG2    . VAL C 2 20 ? -14.583 -1.478  -5.712  1.00 2.31  ? 20 VAL A CG2    2  
ATOM 4508  H H      . VAL C 2 20 ? -16.433 0.354   -3.182  1.00 2.91  ? 20 VAL A H      2  
ATOM 4509  H HA     . VAL C 2 20 ? -16.903 -2.393  -3.586  1.00 2.56  ? 20 VAL A HA     2  
ATOM 4510  H HB     . VAL C 2 20 ? -16.654 -1.893  -5.692  1.00 2.31  ? 20 VAL A HB     2  
ATOM 4511  H HG11   . VAL C 2 20 ? -16.485 0.368   -6.398  1.00 2.67  ? 20 VAL A HG11   2  
ATOM 4512  H HG12   . VAL C 2 20 ? -15.615 0.824   -4.932  1.00 3.01  ? 20 VAL A HG12   2  
ATOM 4513  H HG13   . VAL C 2 20 ? -17.313 0.356   -4.840  1.00 2.85  ? 20 VAL A HG13   2  
ATOM 4514  H HG21   . VAL C 2 20 ? -14.668 -1.588  -6.788  1.00 2.50  ? 20 VAL A HG21   2  
ATOM 4515  H HG22   . VAL C 2 20 ? -14.145 -2.369  -5.289  1.00 2.55  ? 20 VAL A HG22   2  
ATOM 4516  H HG23   . VAL C 2 20 ? -13.960 -0.617  -5.484  1.00 2.42  ? 20 VAL A HG23   2  
ATOM 4517  N N      . SER C 2 21 ? -13.989 -1.603  -2.448  1.00 2.73  ? 21 SER A N      2  
ATOM 4518  C CA     . SER C 2 21 ? -12.775 -2.173  -1.863  1.00 2.74  ? 21 SER A CA     2  
ATOM 4519  C C      . SER C 2 21 ? -13.144 -3.334  -0.940  1.00 2.85  ? 21 SER A C      2  
ATOM 4520  O O      . SER C 2 21 ? -12.519 -4.397  -0.968  1.00 2.78  ? 21 SER A O      2  
ATOM 4521  C CB     . SER C 2 21 ? -11.988 -1.112  -1.088  1.00 2.97  ? 21 SER A CB     2  
ATOM 4522  O OG     . SER C 2 21 ? -11.578 -0.050  -1.933  1.00 3.19  ? 21 SER A OG     2  
ATOM 4523  H H      . SER C 2 21 ? -14.172 -0.645  -2.353  1.00 2.86  ? 21 SER A H      2  
ATOM 4524  H HA     . SER C 2 21 ? -12.168 -2.552  -2.671  1.00 2.56  ? 21 SER A HA     2  
ATOM 4525  H HB2    . SER C 2 21 ? -12.610 -0.708  -0.302  1.00 3.15  ? 21 SER A HB2    2  
ATOM 4526  H HB3    . SER C 2 21 ? -11.110 -1.567  -0.650  1.00 3.14  ? 21 SER A HB3    2  
ATOM 4527  H HG     . SER C 2 21 ? -12.356 0.401   -2.284  1.00 3.29  ? 21 SER A HG     2  
ATOM 4528  N N      . ARG C 2 22 ? -14.182 -3.121  -0.136  1.00 3.06  ? 22 ARG A N      2  
ATOM 4529  C CA     . ARG C 2 22 ? -14.670 -4.138  0.785   1.00 3.25  ? 22 ARG A CA     2  
ATOM 4530  C C      . ARG C 2 22 ? -15.335 -5.252  0.009   1.00 3.12  ? 22 ARG A C      2  
ATOM 4531  O O      . ARG C 2 22 ? -15.326 -6.404  0.419   1.00 3.25  ? 22 ARG A O      2  
ATOM 4532  C CB     . ARG C 2 22 ? -15.670 -3.533  1.770   1.00 3.54  ? 22 ARG A CB     2  
ATOM 4533  C CG     . ARG C 2 22 ? -15.070 -2.501  2.701   1.00 3.73  ? 22 ARG A CG     2  
ATOM 4534  C CD     . ARG C 2 22 ? -16.153 -1.777  3.479   1.00 3.83  ? 22 ARG A CD     2  
ATOM 4535  N NE     . ARG C 2 22 ? -15.904 -0.340  3.549   1.00 3.92  ? 22 ARG A NE     2  
ATOM 4536  C CZ     . ARG C 2 22 ? -16.753 0.538   4.075   1.00 4.17  ? 22 ARG A CZ     2  
ATOM 4537  N NH1    . ARG C 2 22 ? -17.909 0.127   4.583   1.00 4.31  ? 22 ARG A NH1    2  
ATOM 4538  N NH2    . ARG C 2 22 ? -16.451 1.830   4.087   1.00 4.44  ? 22 ARG A NH2    2  
ATOM 4539  H H      . ARG C 2 22 ? -14.655 -2.265  -0.191  1.00 3.12  ? 22 ARG A H      2  
ATOM 4540  H HA     . ARG C 2 22 ? -13.829 -4.547  1.324   1.00 3.32  ? 22 ARG A HA     2  
ATOM 4541  H HB2    . ARG C 2 22 ? -16.463 -3.057  1.209   1.00 3.74  ? 22 ARG A HB2    2  
ATOM 4542  H HB3    . ARG C 2 22 ? -16.091 -4.327  2.368   1.00 3.64  ? 22 ARG A HB3    2  
ATOM 4543  H HG2    . ARG C 2 22 ? -14.408 -2.996  3.396   1.00 3.93  ? 22 ARG A HG2    2  
ATOM 4544  H HG3    . ARG C 2 22 ? -14.514 -1.782  2.119   1.00 3.83  ? 22 ARG A HG3    2  
ATOM 4545  H HD2    . ARG C 2 22 ? -17.104 -1.947  2.991   1.00 3.85  ? 22 ARG A HD2    2  
ATOM 4546  H HD3    . ARG C 2 22 ? -16.189 -2.179  4.482   1.00 4.03  ? 22 ARG A HD3    2  
ATOM 4547  H HE     . ARG C 2 22 ? -15.057 -0.015  3.171   1.00 3.94  ? 22 ARG A HE     2  
ATOM 4548  H HH11   . ARG C 2 22 ? -18.145 -0.845  4.575   1.00 4.31  ? 22 ARG A HH11   2  
ATOM 4549  H HH12   . ARG C 2 22 ? -18.554 0.792   4.970   1.00 4.55  ? 22 ARG A HH12   2  
ATOM 4550  H HH21   . ARG C 2 22 ? -15.584 2.152   3.703   1.00 4.53  ? 22 ARG A HH21   2  
ATOM 4551  H HH22   . ARG C 2 22 ? -17.095 2.493   4.478   1.00 4.68  ? 22 ARG A HH22   2  
ATOM 4552  N N      . VAL C 2 23 ? -15.888 -4.887  -1.131  1.00 2.91  ? 23 VAL A N      2  
ATOM 4553  C CA     . VAL C 2 23 ? -16.578 -5.822  -1.988  1.00 2.82  ? 23 VAL A CA     2  
ATOM 4554  C C      . VAL C 2 23 ? -15.598 -6.850  -2.533  1.00 2.72  ? 23 VAL A C      2  
ATOM 4555  O O      . VAL C 2 23 ? -15.881 -8.047  -2.546  1.00 2.86  ? 23 VAL A O      2  
ATOM 4556  C CB     . VAL C 2 23 ? -17.266 -5.088  -3.149  1.00 2.62  ? 23 VAL A CB     2  
ATOM 4557  C CG1    . VAL C 2 23 ? -17.883 -6.076  -4.099  1.00 2.56  ? 23 VAL A CG1    2  
ATOM 4558  C CG2    . VAL C 2 23 ? -18.315 -4.112  -2.633  1.00 2.76  ? 23 VAL A CG2    2  
ATOM 4559  H H      . VAL C 2 23 ? -15.796 -3.960  -1.425  1.00 2.85  ? 23 VAL A H      2  
ATOM 4560  H HA     . VAL C 2 23 ? -17.332 -6.323  -1.402  1.00 3.00  ? 23 VAL A HA     2  
ATOM 4561  H HB     . VAL C 2 23 ? -16.517 -4.525  -3.686  1.00 2.48  ? 23 VAL A HB     2  
ATOM 4562  H HG11   . VAL C 2 23 ? -18.709 -6.571  -3.618  1.00 2.68  ? 23 VAL A HG11   2  
ATOM 4563  H HG12   . VAL C 2 23 ? -17.140 -6.803  -4.389  1.00 2.67  ? 23 VAL A HG12   2  
ATOM 4564  H HG13   . VAL C 2 23 ? -18.232 -5.547  -4.974  1.00 2.88  ? 23 VAL A HG13   2  
ATOM 4565  H HG21   . VAL C 2 23 ? -18.883 -4.576  -1.841  1.00 3.00  ? 23 VAL A HG21   2  
ATOM 4566  H HG22   . VAL C 2 23 ? -18.980 -3.840  -3.441  1.00 2.86  ? 23 VAL A HG22   2  
ATOM 4567  H HG23   . VAL C 2 23 ? -17.827 -3.221  -2.256  1.00 3.04  ? 23 VAL A HG23   2  
ATOM 4568  N N      . VAL C 2 24 ? -14.437 -6.370  -2.968  1.00 2.54  ? 24 VAL A N      2  
ATOM 4569  C CA     . VAL C 2 24 ? -13.391 -7.242  -3.487  1.00 2.46  ? 24 VAL A CA     2  
ATOM 4570  C C      . VAL C 2 24 ? -12.894 -8.173  -2.379  1.00 2.68  ? 24 VAL A C      2  
ATOM 4571  O O      . VAL C 2 24 ? -12.352 -9.248  -2.637  1.00 2.72  ? 24 VAL A O      2  
ATOM 4572  C CB     . VAL C 2 24 ? -12.209 -6.416  -4.068  1.00 2.28  ? 24 VAL A CB     2  
ATOM 4573  C CG1    . VAL C 2 24 ? -11.012 -7.303  -4.373  1.00 2.42  ? 24 VAL A CG1    2  
ATOM 4574  C CG2    . VAL C 2 24 ? -12.641 -5.667  -5.323  1.00 2.15  ? 24 VAL A CG2    2  
ATOM 4575  H H      . VAL C 2 24 ? -14.284 -5.399  -2.948  1.00 2.49  ? 24 VAL A H      2  
ATOM 4576  H HA     . VAL C 2 24 ? -13.812 -7.836  -4.278  1.00 2.45  ? 24 VAL A HA     2  
ATOM 4577  H HB     . VAL C 2 24 ? -11.908 -5.689  -3.328  1.00 2.37  ? 24 VAL A HB     2  
ATOM 4578  H HG11   . VAL C 2 24 ? -11.260 -7.977  -5.179  1.00 2.60  ? 24 VAL A HG11   2  
ATOM 4579  H HG12   . VAL C 2 24 ? -10.757 -7.875  -3.492  1.00 2.68  ? 24 VAL A HG12   2  
ATOM 4580  H HG13   . VAL C 2 24 ? -10.171 -6.689  -4.659  1.00 2.72  ? 24 VAL A HG13   2  
ATOM 4581  H HG21   . VAL C 2 24 ? -11.774 -5.229  -5.803  1.00 2.07  ? 24 VAL A HG21   2  
ATOM 4582  H HG22   . VAL C 2 24 ? -13.335 -4.885  -5.055  1.00 2.57  ? 24 VAL A HG22   2  
ATOM 4583  H HG23   . VAL C 2 24 ? -13.117 -6.354  -6.007  1.00 2.30  ? 24 VAL A HG23   2  
ATOM 4584  N N      . ASN C 2 25 ? -13.135 -7.771  -1.138  1.00 2.86  ? 25 ASN A N      2  
ATOM 4585  C CA     . ASN C 2 25 ? -12.713 -8.557  0.013   1.00 3.11  ? 25 ASN A CA     2  
ATOM 4586  C C      . ASN C 2 25 ? -13.890 -9.325  0.607   1.00 3.40  ? 25 ASN A C      2  
ATOM 4587  O O      . ASN C 2 25 ? -13.766 -9.946  1.663   1.00 3.68  ? 25 ASN A O      2  
ATOM 4588  C CB     . ASN C 2 25 ? -12.064 -7.655  1.060   1.00 3.26  ? 25 ASN A CB     2  
ATOM 4589  C CG     . ASN C 2 25 ? -10.637 -7.294  0.686   1.00 3.13  ? 25 ASN A CG     2  
ATOM 4590  O OD1    . ASN C 2 25 ? -9.684  -7.917  1.152   1.00 3.32  ? 25 ASN A OD1    2  
ATOM 4591  N ND2    . ASN C 2 25 ? -10.482 -6.301  -0.180  1.00 2.90  ? 25 ASN A ND2    2  
ATOM 4592  H H      . ASN C 2 25 ? -13.620 -6.925  -0.993  1.00 2.86  ? 25 ASN A H      2  
ATOM 4593  H HA     . ASN C 2 25 ? -11.979 -9.272  -0.333  1.00 3.04  ? 25 ASN A HA     2  
ATOM 4594  H HB2    . ASN C 2 25 ? -12.637 -6.744  1.150   1.00 3.28  ? 25 ASN A HB2    2  
ATOM 4595  H HB3    . ASN C 2 25 ? -12.050 -8.165  2.012   1.00 3.51  ? 25 ASN A HB3    2  
ATOM 4596  H HD21   . ASN C 2 25 ? -11.288 -5.857  -0.531  1.00 2.85  ? 25 ASN A HD21   2  
ATOM 4597  H HD22   . ASN C 2 25 ? -9.570  -6.050  -0.435  1.00 2.85  ? 25 ASN A HD22   2  
ATOM 4598  N N      . GLN C 2 26 ? -15.039 -9.220  -0.073  1.00 3.38  ? 26 GLN A N      2  
ATOM 4599  C CA     . GLN C 2 26 ? -16.288 -9.913  0.288   1.00 3.69  ? 26 GLN A CA     2  
ATOM 4600  C C      . GLN C 2 26 ? -17.089 -9.100  1.292   1.00 3.73  ? 26 GLN A C      2  
ATOM 4601  O O      . GLN C 2 26 ? -18.315 -9.010  1.188   1.00 4.00  ? 26 GLN A O      2  
ATOM 4602  C CB     . GLN C 2 26 ? -16.040 -11.335 0.812   1.00 4.14  ? 26 GLN A CB     2  
ATOM 4603  C CG     . GLN C 2 26 ? -15.581 -12.307 -0.266  1.00 4.79  ? 26 GLN A CG     2  
ATOM 4604  C CD     . GLN C 2 26 ? -15.212 -13.668 0.292   1.00 5.58  ? 26 GLN A CD     2  
ATOM 4605  O OE1    . GLN C 2 26 ? -16.053 -14.560 0.396   1.00 6.08  ? 26 GLN A OE1    2  
ATOM 4606  N NE2    . GLN C 2 26 ? -13.949 -13.836 0.652   1.00 6.01  ? 26 GLN A NE2    2  
ATOM 4607  H H      . GLN C 2 26 ? -15.064 -8.593  -0.829  1.00 3.18  ? 26 GLN A H      2  
ATOM 4608  H HA     . GLN C 2 26 ? -16.875 -9.985  -0.617  1.00 3.74  ? 26 GLN A HA     2  
ATOM 4609  H HB2    . GLN C 2 26 ? -15.281 -11.297 1.580   1.00 4.26  ? 26 GLN A HB2    2  
ATOM 4610  H HB3    . GLN C 2 26 ? -16.957 -11.713 1.241   1.00 4.31  ? 26 GLN A HB3    2  
ATOM 4611  H HG2    . GLN C 2 26 ? -16.380 -12.435 -0.981  1.00 4.93  ? 26 GLN A HG2    2  
ATOM 4612  H HG3    . GLN C 2 26 ? -14.718 -11.889 -0.762  1.00 4.95  ? 26 GLN A HG3    2  
ATOM 4613  H HE21   . GLN C 2 26 ? -13.332 -13.082 0.541   1.00 5.84  ? 26 GLN A HE21   2  
ATOM 4614  H HE22   . GLN C 2 26 ? -13.682 -14.706 1.014   1.00 6.64  ? 26 GLN A HE22   2  
ATOM 4615  N N      . ALA C 2 27 ? -16.385 -8.516  2.254   1.00 3.79  ? 27 ALA A N      2  
ATOM 4616  C CA     . ALA C 2 27 ? -16.998 -7.674  3.271   1.00 3.98  ? 27 ALA A CA     2  
ATOM 4617  C C      . ALA C 2 27 ? -17.977 -8.455  4.152   1.00 4.29  ? 27 ALA A C      2  
ATOM 4618  O O      . ALA C 2 27 ? -17.591 -9.435  4.790   1.00 4.63  ? 27 ALA A O      2  
ATOM 4619  C CB     . ALA C 2 27 ? -17.673 -6.480  2.606   1.00 3.84  ? 27 ALA A CB     2  
ATOM 4620  H H      . ALA C 2 27 ? -15.417 -8.668  2.285   1.00 3.91  ? 27 ALA A H      2  
ATOM 4621  H HA     . ALA C 2 27 ? -16.205 -7.294  3.897   1.00 4.15  ? 27 ALA A HA     2  
ATOM 4622  H HB1    . ALA C 2 27 ? -17.548 -5.603  3.223   1.00 3.98  ? 27 ALA A HB1    2  
ATOM 4623  H HB2    . ALA C 2 27 ? -18.725 -6.687  2.478   1.00 3.81  ? 27 ALA A HB2    2  
ATOM 4624  H HB3    . ALA C 2 27 ? -17.215 -6.311  1.637   1.00 4.05  ? 27 ALA A HB3    2  
ATOM 4625  N N      . SER C 2 28 ? -19.236 -8.028  4.182   1.00 4.40  ? 28 SER A N      2  
ATOM 4626  C CA     . SER C 2 28 ? -20.243 -8.688  5.006   1.00 4.74  ? 28 SER A CA     2  
ATOM 4627  C C      . SER C 2 28 ? -21.652 -8.245  4.623   1.00 4.78  ? 28 SER A C      2  
ATOM 4628  O O      . SER C 2 28 ? -22.540 -9.068  4.398   1.00 5.09  ? 28 SER A O      2  
ATOM 4629  C CB     . SER C 2 28 ? -19.989 -8.373  6.486   1.00 5.07  ? 28 SER A CB     2  
ATOM 4630  O OG     . SER C 2 28 ? -19.886 -6.968  6.703   1.00 5.08  ? 28 SER A OG     2  
ATOM 4631  H H      . SER C 2 28 ? -19.497 -7.266  3.627   1.00 4.41  ? 28 SER A H      2  
ATOM 4632  H HA     . SER C 2 28 ? -20.154 -9.753  4.853   1.00 4.79  ? 28 SER A HA     2  
ATOM 4633  H HB2    . SER C 2 28 ? -20.806 -8.757  7.078   1.00 5.40  ? 28 SER A HB2    2  
ATOM 4634  H HB3    . SER C 2 28 ? -19.067 -8.842  6.800   1.00 5.21  ? 28 SER A HB3    2  
ATOM 4635  H HG     . SER C 2 28 ? -19.271 -6.801  7.430   1.00 5.20  ? 28 SER A HG     2  
ATOM 4636  N N      . HIS C 2 29 ? -21.846 -6.934  4.545   1.00 4.57  ? 29 HIS A N      2  
ATOM 4637  C CA     . HIS C 2 29 ? -23.134 -6.365  4.219   1.00 4.63  ? 29 HIS A CA     2  
ATOM 4638  C C      . HIS C 2 29 ? -23.170 -5.966  2.748   1.00 4.35  ? 29 HIS A C      2  
ATOM 4639  O O      . HIS C 2 29 ? -22.775 -6.740  1.878   1.00 4.43  ? 29 HIS A O      2  
ATOM 4640  C CB     . HIS C 2 29 ? -23.389 -5.137  5.105   1.00 4.90  ? 29 HIS A CB     2  
ATOM 4641  C CG     . HIS C 2 29 ? -23.524 -5.437  6.571   1.00 5.21  ? 29 HIS A CG     2  
ATOM 4642  N ND1    . HIS C 2 29 ? -22.472 -5.858  7.360   1.00 5.58  ? 29 HIS A ND1    2  
ATOM 4643  C CD2    . HIS C 2 29 ? -24.592 -5.339  7.398   1.00 5.44  ? 29 HIS A CD2    2  
ATOM 4644  C CE1    . HIS C 2 29 ? -22.889 -6.003  8.603   1.00 5.80  ? 29 HIS A CE1    2  
ATOM 4645  N NE2    . HIS C 2 29 ? -24.169 -5.694  8.655   1.00 5.73  ? 29 HIS A NE2    2  
ATOM 4646  H H      . HIS C 2 29 ? -21.095 -6.330  4.697   1.00 4.45  ? 29 HIS A H      2  
ATOM 4647  H HA     . HIS C 2 29 ? -23.894 -7.107  4.408   1.00 4.74  ? 29 HIS A HA     2  
ATOM 4648  H HB2    . HIS C 2 29 ? -22.567 -4.448  4.988   1.00 4.91  ? 29 HIS A HB2    2  
ATOM 4649  H HB3    . HIS C 2 29 ? -24.299 -4.656  4.780   1.00 4.92  ? 29 HIS A HB3    2  
ATOM 4650  H HD1    . HIS C 2 29 ? -21.553 -6.040  7.052   1.00 5.83  ? 29 HIS A HD1    2  
ATOM 4651  H HD2    . HIS C 2 29 ? -25.593 -5.039  7.120   1.00 5.59  ? 29 HIS A HD2    2  
ATOM 4652  H HE1    . HIS C 2 29 ? -22.282 -6.321  9.440   1.00 6.16  ? 29 HIS A HE1    2  
ATOM 4653  H HE2    . HIS C 2 29 ? -24.762 -5.874  9.428   1.00 6.03  ? 29 HIS A HE2    2  
ATOM 4654  N N      . VAL C 2 30 ? -23.625 -4.741  2.502   1.00 4.23  ? 30 VAL A N      2  
ATOM 4655  C CA     . VAL C 2 30 ? -23.726 -4.167  1.153   1.00 3.95  ? 30 VAL A CA     2  
ATOM 4656  C C      . VAL C 2 30 ? -24.895 -4.783  0.376   1.00 3.85  ? 30 VAL A C      2  
ATOM 4657  O O      . VAL C 2 30 ? -25.271 -5.935  0.591   1.00 4.00  ? 30 VAL A O      2  
ATOM 4658  C CB     . VAL C 2 30 ? -22.407 -4.324  0.354   1.00 3.73  ? 30 VAL A CB     2  
ATOM 4659  C CG1    . VAL C 2 30 ? -22.475 -3.601  -0.985  1.00 3.75  ? 30 VAL A CG1    2  
ATOM 4660  C CG2    . VAL C 2 30 ? -21.215 -3.819  1.163   1.00 4.14  ? 30 VAL A CG2    2  
ATOM 4661  H H      . VAL C 2 30 ? -23.921 -4.206  3.258   1.00 4.47  ? 30 VAL A H      2  
ATOM 4662  H HA     . VAL C 2 30 ? -23.918 -3.109  1.270   1.00 3.98  ? 30 VAL A HA     2  
ATOM 4663  H HB     . VAL C 2 30 ? -22.265 -5.370  0.163   1.00 3.72  ? 30 VAL A HB     2  
ATOM 4664  H HG11   . VAL C 2 30 ? -22.649 -2.549  -0.817  1.00 3.77  ? 30 VAL A HG11   2  
ATOM 4665  H HG12   . VAL C 2 30 ? -23.284 -4.011  -1.573  1.00 4.08  ? 30 VAL A HG12   2  
ATOM 4666  H HG13   . VAL C 2 30 ? -21.542 -3.734  -1.512  1.00 4.01  ? 30 VAL A HG13   2  
ATOM 4667  H HG21   . VAL C 2 30 ? -21.354 -2.772  1.394   1.00 4.47  ? 30 VAL A HG21   2  
ATOM 4668  H HG22   . VAL C 2 30 ? -20.309 -3.941  0.587   1.00 4.43  ? 30 VAL A HG22   2  
ATOM 4669  H HG23   . VAL C 2 30 ? -21.138 -4.382  2.081   1.00 4.33  ? 30 VAL A HG23   2  
ATOM 4670  N N      . SER C 2 31 ? -25.467 -4.002  -0.530  1.00 3.66  ? 31 SER A N      2  
ATOM 4671  C CA     . SER C 2 31 ? -26.610 -4.446  -1.319  1.00 3.57  ? 31 SER A CA     2  
ATOM 4672  C C      . SER C 2 31 ? -26.190 -5.295  -2.521  1.00 3.30  ? 31 SER A C      2  
ATOM 4673  O O      . SER C 2 31 ? -24.997 -5.477  -2.790  1.00 3.15  ? 31 SER A O      2  
ATOM 4674  C CB     . SER C 2 31 ? -27.411 -3.232  -1.785  1.00 3.52  ? 31 SER A CB     2  
ATOM 4675  O OG     . SER C 2 31 ? -26.642 -2.048  -1.666  1.00 3.59  ? 31 SER A OG     2  
ATOM 4676  H H      . SER C 2 31 ? -25.099 -3.106  -0.682  1.00 3.60  ? 31 SER A H      2  
ATOM 4677  H HA     . SER C 2 31 ? -27.236 -5.047  -0.677  1.00 3.79  ? 31 SER A HA     2  
ATOM 4678  H HB2    . SER C 2 31 ? -27.693 -3.367  -2.821  1.00 3.57  ? 31 SER A HB2    2  
ATOM 4679  H HB3    . SER C 2 31 ? -28.300 -3.136  -1.180  1.00 3.68  ? 31 SER A HB3    2  
ATOM 4680  H HG     . SER C 2 31 ? -26.979 -1.518  -0.932  1.00 3.80  ? 31 SER A HG     2  
ATOM 4681  N N      . ALA C 2 32 ? -27.186 -5.815  -3.234  1.00 3.28  ? 32 ALA A N      2  
ATOM 4682  C CA     . ALA C 2 32 ? -26.959 -6.659  -4.400  1.00 3.13  ? 32 ALA A CA     2  
ATOM 4683  C C      . ALA C 2 32 ? -26.416 -5.875  -5.595  1.00 2.81  ? 32 ALA A C      2  
ATOM 4684  O O      . ALA C 2 32 ? -25.285 -6.101  -6.019  1.00 2.69  ? 32 ALA A O      2  
ATOM 4685  C CB     . ALA C 2 32 ? -28.248 -7.366  -4.781  1.00 3.24  ? 32 ALA A CB     2  
ATOM 4686  H H      . ALA C 2 32 ? -28.112 -5.629  -2.961  1.00 3.42  ? 32 ALA A H      2  
ATOM 4687  H HA     . ALA C 2 32 ? -26.238 -7.414  -4.125  1.00 3.22  ? 32 ALA A HA     2  
ATOM 4688  H HB1    . ALA C 2 32 ? -28.080 -7.979  -5.654  1.00 3.30  ? 32 ALA A HB1    2  
ATOM 4689  H HB2    . ALA C 2 32 ? -29.009 -6.629  -4.998  1.00 3.60  ? 32 ALA A HB2    2  
ATOM 4690  H HB3    . ALA C 2 32 ? -28.574 -7.988  -3.961  1.00 3.38  ? 32 ALA A HB3    2  
ATOM 4691  N N      . LYS C 2 33 ? -27.224 -4.944  -6.116  1.00 2.73  ? 33 LYS A N      2  
ATOM 4692  C CA     . LYS C 2 33 ? -26.848 -4.138  -7.287  1.00 2.52  ? 33 LYS A CA     2  
ATOM 4693  C C      . LYS C 2 33 ? -25.472 -3.503  -7.149  1.00 2.43  ? 33 LYS A C      2  
ATOM 4694  O O      . LYS C 2 33 ? -24.754 -3.352  -8.133  1.00 2.32  ? 33 LYS A O      2  
ATOM 4695  C CB     . LYS C 2 33 ? -27.891 -3.046  -7.559  1.00 2.53  ? 33 LYS A CB     2  
ATOM 4696  C CG     . LYS C 2 33 ? -28.367 -2.310  -6.317  1.00 2.89  ? 33 LYS A CG     2  
ATOM 4697  C CD     . LYS C 2 33 ? -29.558 -1.420  -6.630  1.00 3.24  ? 33 LYS A CD     2  
ATOM 4698  C CE     . LYS C 2 33 ? -30.087 -0.724  -5.387  1.00 4.00  ? 33 LYS A CE     2  
ATOM 4699  N NZ     . LYS C 2 33 ? -31.252 0.150   -5.690  1.00 4.59  ? 33 LYS A NZ     2  
ATOM 4700  H H      . LYS C 2 33 ? -28.104 -4.803  -5.710  1.00 2.85  ? 33 LYS A H      2  
ATOM 4701  H HA     . LYS C 2 33 ? -26.821 -4.800  -8.139  1.00 2.48  ? 33 LYS A HA     2  
ATOM 4702  H HB2    . LYS C 2 33 ? -27.457 -2.317  -8.230  1.00 2.62  ? 33 LYS A HB2    2  
ATOM 4703  H HB3    . LYS C 2 33 ? -28.748 -3.496  -8.036  1.00 2.61  ? 33 LYS A HB3    2  
ATOM 4704  H HG2    . LYS C 2 33 ? -28.655 -3.033  -5.566  1.00 3.12  ? 33 LYS A HG2    2  
ATOM 4705  H HG3    . LYS C 2 33 ? -27.560 -1.698  -5.940  1.00 2.98  ? 33 LYS A HG3    2  
ATOM 4706  H HD2    . LYS C 2 33 ? -29.256 -0.673  -7.349  1.00 3.45  ? 33 LYS A HD2    2  
ATOM 4707  H HD3    . LYS C 2 33 ? -30.345 -2.029  -7.051  1.00 3.17  ? 33 LYS A HD3    2  
ATOM 4708  H HE2    . LYS C 2 33 ? -30.388 -1.472  -4.670  1.00 4.23  ? 33 LYS A HE2    2  
ATOM 4709  H HE3    . LYS C 2 33 ? -29.296 -0.119  -4.964  1.00 4.32  ? 33 LYS A HE3    2  
ATOM 4710  H HZ1    . LYS C 2 33 ? -31.729 0.434   -4.805  1.00 4.92  ? 33 LYS A HZ1    2  
ATOM 4711  H HZ2    . LYS C 2 33 ? -31.938 -0.357  -6.295  1.00 4.97  ? 33 LYS A HZ2    2  
ATOM 4712  H HZ3    . LYS C 2 33 ? -30.941 1.009   -6.192  1.00 4.68  ? 33 LYS A HZ3    2  
ATOM 4713  N N      . THR C 2 34 ? -25.104 -3.126  -5.940  1.00 2.54  ? 34 THR A N      2  
ATOM 4714  C CA     . THR C 2 34 ? -23.815 -2.523  -5.706  1.00 2.50  ? 34 THR A CA     2  
ATOM 4715  C C      . THR C 2 34 ? -22.691 -3.505  -5.999  1.00 2.40  ? 34 THR A C      2  
ATOM 4716  O O      . THR C 2 34 ? -21.716 -3.154  -6.656  1.00 2.28  ? 34 THR A O      2  
ATOM 4717  C CB     . THR C 2 34 ? -23.710 -2.021  -4.271  1.00 2.73  ? 34 THR A CB     2  
ATOM 4718  O OG1    . THR C 2 34 ? -24.831 -1.171  -4.004  1.00 2.86  ? 34 THR A OG1    2  
ATOM 4719  C CG2    . THR C 2 34 ? -22.412 -1.266  -4.074  1.00 2.75  ? 34 THR A CG2    2  
ATOM 4720  H H      . THR C 2 34 ? -25.714 -3.249  -5.187  1.00 2.68  ? 34 THR A H      2  
ATOM 4721  H HA     . THR C 2 34 ? -23.715 -1.678  -6.369  1.00 2.46  ? 34 THR A HA     2  
ATOM 4722  H HB     . THR C 2 34 ? -23.733 -2.868  -3.600  1.00 2.86  ? 34 THR A HB     2  
ATOM 4723  H HG1    . THR C 2 34 ? -24.868 -0.972  -3.060  1.00 3.04  ? 34 THR A HG1    2  
ATOM 4724  H HG21   . THR C 2 34 ? -21.658 -1.676  -4.736  1.00 3.02  ? 34 THR A HG21   2  
ATOM 4725  H HG22   . THR C 2 34 ? -22.088 -1.369  -3.049  1.00 2.96  ? 34 THR A HG22   2  
ATOM 4726  H HG23   . THR C 2 34 ? -22.563 -0.223  -4.303  1.00 2.82  ? 34 THR A HG23   2  
ATOM 4727  N N      . ARG C 2 35 ? -22.846 -4.740  -5.542  1.00 2.51  ? 35 ARG A N      2  
ATOM 4728  C CA     . ARG C 2 35 ? -21.843 -5.755  -5.771  1.00 2.50  ? 35 ARG A CA     2  
ATOM 4729  C C      . ARG C 2 35 ? -21.714 -6.006  -7.270  1.00 2.38  ? 35 ARG A C      2  
ATOM 4730  O O      . ARG C 2 35 ? -20.621 -6.192  -7.796  1.00 2.33  ? 35 ARG A O      2  
ATOM 4731  C CB     . ARG C 2 35 ? -22.234 -7.049  -5.057  1.00 2.77  ? 35 ARG A CB     2  
ATOM 4732  C CG     . ARG C 2 35 ? -21.311 -7.418  -3.914  1.00 2.94  ? 35 ARG A CG     2  
ATOM 4733  C CD     . ARG C 2 35 ? -21.622 -6.632  -2.649  1.00 3.35  ? 35 ARG A CD     2  
ATOM 4734  N NE     . ARG C 2 35 ? -22.767 -7.179  -1.919  1.00 3.39  ? 35 ARG A NE     2  
ATOM 4735  C CZ     . ARG C 2 35 ? -22.684 -8.181  -1.035  1.00 3.73  ? 35 ARG A CZ     2  
ATOM 4736  N NH1    . ARG C 2 35 ? -21.512 -8.754  -0.779  1.00 4.16  ? 35 ARG A NH1    2  
ATOM 4737  N NH2    . ARG C 2 35 ? -23.768 -8.606  -0.398  1.00 3.92  ? 35 ARG A NH2    2  
ATOM 4738  H H      . ARG C 2 35 ? -23.667 -4.985  -5.066  1.00 2.65  ? 35 ARG A H      2  
ATOM 4739  H HA     . ARG C 2 35 ? -20.901 -5.393  -5.380  1.00 2.47  ? 35 ARG A HA     2  
ATOM 4740  H HB2    . ARG C 2 35 ? -23.234 -6.940  -4.661  1.00 2.87  ? 35 ARG A HB2    2  
ATOM 4741  H HB3    . ARG C 2 35 ? -22.226 -7.858  -5.772  1.00 2.85  ? 35 ARG A HB3    2  
ATOM 4742  H HG2    . ARG C 2 35 ? -21.419 -8.469  -3.706  1.00 2.97  ? 35 ARG A HG2    2  
ATOM 4743  H HG3    . ARG C 2 35 ? -20.298 -7.210  -4.214  1.00 2.97  ? 35 ARG A HG3    2  
ATOM 4744  H HD2    . ARG C 2 35 ? -20.754 -6.655  -2.006  1.00 3.63  ? 35 ARG A HD2    2  
ATOM 4745  H HD3    . ARG C 2 35 ? -21.836 -5.608  -2.922  1.00 3.66  ? 35 ARG A HD3    2  
ATOM 4746  H HE     . ARG C 2 35 ? -23.648 -6.768  -2.090  1.00 3.38  ? 35 ARG A HE     2  
ATOM 4747  H HH11   . ARG C 2 35 ? -20.684 -8.441  -1.243  1.00 4.30  ? 35 ARG A HH11   2  
ATOM 4748  H HH12   . ARG C 2 35 ? -21.454 -9.500  -0.110  1.00 4.53  ? 35 ARG A HH12   2  
ATOM 4749  H HH21   . ARG C 2 35 ? -24.657 -8.175  -0.569  1.00 3.98  ? 35 ARG A HH21   2  
ATOM 4750  H HH22   . ARG C 2 35 ? -23.701 -9.365  0.262   1.00 4.20  ? 35 ARG A HH22   2  
ATOM 4751  N N      . GLU C 2 36 ? -22.859 -5.980  -7.938  1.00 2.39  ? 36 GLU A N      2  
ATOM 4752  C CA     . GLU C 2 36 ? -22.933 -6.199  -9.375  1.00 2.38  ? 36 GLU A CA     2  
ATOM 4753  C C      . GLU C 2 36 ? -22.295 -5.039  -10.125 1.00 2.27  ? 36 GLU A C      2  
ATOM 4754  O O      . GLU C 2 36 ? -21.681 -5.225  -11.169 1.00 2.33  ? 36 GLU A O      2  
ATOM 4755  C CB     . GLU C 2 36 ? -24.390 -6.363  -9.819  1.00 2.47  ? 36 GLU A CB     2  
ATOM 4756  C CG     . GLU C 2 36 ? -25.208 -7.293  -8.935  1.00 2.59  ? 36 GLU A CG     2  
ATOM 4757  C CD     . GLU C 2 36 ? -26.626 -7.485  -9.445  1.00 3.03  ? 36 GLU A CD     2  
ATOM 4758  O OE1    . GLU C 2 36 ? -27.151 -6.569  -10.113 1.00 3.21  ? 36 GLU A OE1    2  
ATOM 4759  O OE2    . GLU C 2 36 ? -27.220 -8.558  -9.187  1.00 3.55  ? 36 GLU A OE2    2  
ATOM 4760  H H      . GLU C 2 36 ? -23.679 -5.776  -7.451  1.00 2.45  ? 36 GLU A H      2  
ATOM 4761  H HA     . GLU C 2 36 ? -22.390 -7.104  -9.602  1.00 2.49  ? 36 GLU A HA     2  
ATOM 4762  H HB2    . GLU C 2 36 ? -24.864 -5.393  -9.816  1.00 2.46  ? 36 GLU A HB2    2  
ATOM 4763  H HB3    . GLU C 2 36 ? -24.404 -6.755  -10.827 1.00 2.72  ? 36 GLU A HB3    2  
ATOM 4764  H HG2    . GLU C 2 36 ? -24.720 -8.256  -8.901  1.00 2.88  ? 36 GLU A HG2    2  
ATOM 4765  H HG3    . GLU C 2 36 ? -25.249 -6.874  -7.938  1.00 2.57  ? 36 GLU A HG3    2  
ATOM 4766  N N      . LYS C 2 37 ? -22.437 -3.843  -9.569  1.00 2.21  ? 37 LYS A N      2  
ATOM 4767  C CA     . LYS C 2 37 ? -21.898 -2.638  -10.180 1.00 2.23  ? 37 LYS A CA     2  
ATOM 4768  C C      . LYS C 2 37 ? -20.383 -2.624  -10.096 1.00 2.19  ? 37 LYS A C      2  
ATOM 4769  O O      . LYS C 2 37 ? -19.709 -2.338  -11.080 1.00 2.26  ? 37 LYS A O      2  
ATOM 4770  C CB     . LYS C 2 37 ? -22.472 -1.393  -9.502  1.00 2.31  ? 37 LYS A CB     2  
ATOM 4771  C CG     . LYS C 2 37 ? -23.595 -0.733  -10.286 1.00 2.44  ? 37 LYS A CG     2  
ATOM 4772  C CD     . LYS C 2 37 ? -24.734 -0.297  -9.376  1.00 2.48  ? 37 LYS A CD     2  
ATOM 4773  C CE     . LYS C 2 37 ? -24.253 0.624   -8.263  1.00 2.57  ? 37 LYS A CE     2  
ATOM 4774  N NZ     . LYS C 2 37 ? -24.007 2.011   -8.750  1.00 2.84  ? 37 LYS A NZ     2  
ATOM 4775  H H      . LYS C 2 37 ? -22.917 -3.772  -8.718  1.00 2.23  ? 37 LYS A H      2  
ATOM 4776  H HA     . LYS C 2 37 ? -22.189 -2.636  -11.220 1.00 2.31  ? 37 LYS A HA     2  
ATOM 4777  H HB2    . LYS C 2 37 ? -22.854 -1.671  -8.530  1.00 2.53  ? 37 LYS A HB2    2  
ATOM 4778  H HB3    . LYS C 2 37 ? -21.678 -0.671  -9.374  1.00 2.66  ? 37 LYS A HB3    2  
ATOM 4779  H HG2    . LYS C 2 37 ? -23.204 0.136   -10.795 1.00 2.86  ? 37 LYS A HG2    2  
ATOM 4780  H HG3    . LYS C 2 37 ? -23.976 -1.437  -11.012 1.00 2.66  ? 37 LYS A HG3    2  
ATOM 4781  H HD2    . LYS C 2 37 ? -25.472 0.227   -9.965  1.00 2.62  ? 37 LYS A HD2    2  
ATOM 4782  H HD3    . LYS C 2 37 ? -25.182 -1.175  -8.933  1.00 2.57  ? 37 LYS A HD3    2  
ATOM 4783  H HE2    . LYS C 2 37 ? -25.005 0.649   -7.488  1.00 2.71  ? 37 LYS A HE2    2  
ATOM 4784  H HE3    . LYS C 2 37 ? -23.331 0.227   -7.859  1.00 2.63  ? 37 LYS A HE3    2  
ATOM 4785  H HZ1    . LYS C 2 37 ? -23.587 2.586   -7.993  1.00 3.16  ? 37 LYS A HZ1    2  
ATOM 4786  H HZ2    . LYS C 2 37 ? -24.907 2.457   -9.043  1.00 3.15  ? 37 LYS A HZ2    2  
ATOM 4787  H HZ3    . LYS C 2 37 ? -23.354 1.997   -9.564  1.00 2.93  ? 37 LYS A HZ3    2  
ATOM 4788  N N      . VAL C 2 38 ? -19.852 -2.937  -8.920  1.00 2.13  ? 38 VAL A N      2  
ATOM 4789  C CA     . VAL C 2 38 ? -18.405 -2.964  -8.732  1.00 2.10  ? 38 VAL A CA     2  
ATOM 4790  C C      . VAL C 2 38 ? -17.801 -4.079  -9.585  1.00 2.10  ? 38 VAL A C      2  
ATOM 4791  O O      . VAL C 2 38 ? -16.795 -3.881  -10.263 1.00 2.14  ? 38 VAL A O      2  
ATOM 4792  C CB     . VAL C 2 38 ? -18.024 -3.144  -7.253  1.00 2.11  ? 38 VAL A CB     2  
ATOM 4793  C CG1    . VAL C 2 38 ? -18.922 -2.298  -6.365  1.00 2.26  ? 38 VAL A CG1    2  
ATOM 4794  C CG2    . VAL C 2 38 ? -18.073 -4.590  -6.836  1.00 2.12  ? 38 VAL A CG2    2  
ATOM 4795  H H      . VAL C 2 38 ? -20.449 -3.168  -8.165  1.00 2.16  ? 38 VAL A H      2  
ATOM 4796  H HA     . VAL C 2 38 ? -17.996 -2.013  -9.062  1.00 2.16  ? 38 VAL A HA     2  
ATOM 4797  H HB     . VAL C 2 38 ? -17.014 -2.800  -7.134  1.00 2.11  ? 38 VAL A HB     2  
ATOM 4798  H HG11   . VAL C 2 38 ? -18.713 -1.252  -6.534  1.00 2.68  ? 38 VAL A HG11   2  
ATOM 4799  H HG12   . VAL C 2 38 ? -18.739 -2.540  -5.330  1.00 2.30  ? 38 VAL A HG12   2  
ATOM 4800  H HG13   . VAL C 2 38 ? -19.960 -2.501  -6.607  1.00 2.54  ? 38 VAL A HG13   2  
ATOM 4801  H HG21   . VAL C 2 38 ? -19.093 -4.939  -6.863  1.00 2.57  ? 38 VAL A HG21   2  
ATOM 4802  H HG22   . VAL C 2 38 ? -17.682 -4.690  -5.835  1.00 2.23  ? 38 VAL A HG22   2  
ATOM 4803  H HG23   . VAL C 2 38 ? -17.472 -5.178  -7.519  1.00 2.26  ? 38 VAL A HG23   2  
ATOM 4804  N N      . GLU C 2 39 ? -18.442 -5.248  -9.548  1.00 2.16  ? 39 GLU A N      2  
ATOM 4805  C CA     . GLU C 2 39 ? -18.007 -6.398  -10.325 1.00 2.30  ? 39 GLU A CA     2  
ATOM 4806  C C      . GLU C 2 39 ? -18.070 -6.061  -11.797 1.00 2.42  ? 39 GLU A C      2  
ATOM 4807  O O      . GLU C 2 39 ? -17.173 -6.415  -12.557 1.00 2.56  ? 39 GLU A O      2  
ATOM 4808  C CB     . GLU C 2 39 ? -18.861 -7.631  -10.024 1.00 2.46  ? 39 GLU A CB     2  
ATOM 4809  C CG     . GLU C 2 39 ? -18.114 -8.702  -9.241  1.00 2.53  ? 39 GLU A CG     2  
ATOM 4810  C CD     . GLU C 2 39 ? -17.802 -9.940  -10.071 1.00 2.89  ? 39 GLU A CD     2  
ATOM 4811  O OE1    . GLU C 2 39 ? -18.427 -10.112 -11.146 1.00 3.12  ? 39 GLU A OE1    2  
ATOM 4812  O OE2    . GLU C 2 39 ? -16.937 -10.745 -9.661  1.00 3.27  ? 39 GLU A OE2    2  
ATOM 4813  H H      . GLU C 2 39 ? -19.206 -5.341  -8.945  1.00 2.17  ? 39 GLU A H      2  
ATOM 4814  H HA     . GLU C 2 39 ? -16.980 -6.607  -10.061 1.00 2.28  ? 39 GLU A HA     2  
ATOM 4815  H HB2    . GLU C 2 39 ? -19.722 -7.328  -9.446  1.00 2.44  ? 39 GLU A HB2    2  
ATOM 4816  H HB3    . GLU C 2 39 ? -19.195 -8.063  -10.954 1.00 2.62  ? 39 GLU A HB3    2  
ATOM 4817  H HG2    . GLU C 2 39 ? -17.183 -8.281  -8.891  1.00 2.47  ? 39 GLU A HG2    2  
ATOM 4818  H HG3    . GLU C 2 39 ? -18.715 -8.995  -8.392  1.00 2.57  ? 39 GLU A HG3    2  
ATOM 4819  N N      . ALA C 2 40 ? -19.133 -5.368  -12.201 1.00 2.42  ? 40 ALA A N      2  
ATOM 4820  C CA     . ALA C 2 40 ? -19.260 -4.951  -13.582 1.00 2.60  ? 40 ALA A CA     2  
ATOM 4821  C C      . ALA C 2 40 ? -18.108 -4.036  -13.911 1.00 2.65  ? 40 ALA A C      2  
ATOM 4822  O O      . ALA C 2 40 ? -17.323 -4.317  -14.805 1.00 2.86  ? 40 ALA A O      2  
ATOM 4823  C CB     . ALA C 2 40 ? -20.569 -4.225  -13.840 1.00 2.61  ? 40 ALA A CB     2  
ATOM 4824  H H      . ALA C 2 40 ? -19.845 -5.144  -11.555 1.00 2.32  ? 40 ALA A H      2  
ATOM 4825  H HA     . ALA C 2 40 ? -19.215 -5.828  -14.213 1.00 2.77  ? 40 ALA A HA     2  
ATOM 4826  H HB1    . ALA C 2 40 ? -21.317 -4.931  -14.172 1.00 2.90  ? 40 ALA A HB1    2  
ATOM 4827  H HB2    . ALA C 2 40 ? -20.413 -3.473  -14.607 1.00 2.54  ? 40 ALA A HB2    2  
ATOM 4828  H HB3    . ALA C 2 40 ? -20.900 -3.746  -12.931 1.00 2.88  ? 40 ALA A HB3    2  
ATOM 4829  N N      . ALA C 2 41 ? -17.977 -2.970  -13.131 1.00 2.52  ? 41 ALA A N      2  
ATOM 4830  C CA     . ALA C 2 41 ? -16.928 -1.995  -13.335 1.00 2.63  ? 41 ALA A CA     2  
ATOM 4831  C C      . ALA C 2 41 ? -15.543 -2.618  -13.454 1.00 2.66  ? 41 ALA A C      2  
ATOM 4832  O O      . ALA C 2 41 ? -14.823 -2.350  -14.411 1.00 2.89  ? 41 ALA A O      2  
ATOM 4833  C CB     . ALA C 2 41 ? -16.944 -1.014  -12.197 1.00 2.54  ? 41 ALA A CB     2  
ATOM 4834  H H      . ALA C 2 41 ? -18.631 -2.818  -12.394 1.00 2.40  ? 41 ALA A H      2  
ATOM 4835  H HA     . ALA C 2 41 ? -17.147 -1.456  -14.243 1.00 2.83  ? 41 ALA A HA     2  
ATOM 4836  H HB1    . ALA C 2 41 ? -17.869 -0.460  -12.212 1.00 2.75  ? 41 ALA A HB1    2  
ATOM 4837  H HB2    . ALA C 2 41 ? -16.112 -0.332  -12.300 1.00 2.83  ? 41 ALA A HB2    2  
ATOM 4838  H HB3    . ALA C 2 41 ? -16.861 -1.553  -11.268 1.00 2.57  ? 41 ALA A HB3    2  
ATOM 4839  N N      . MET C 2 42 ? -15.177 -3.461  -12.502 1.00 2.47  ? 42 MET A N      2  
ATOM 4840  C CA     . MET C 2 42 ? -13.870 -4.097  -12.531 1.00 2.49  ? 42 MET A CA     2  
ATOM 4841  C C      . MET C 2 42 ? -13.753 -5.018  -13.739 1.00 2.73  ? 42 MET A C      2  
ATOM 4842  O O      . MET C 2 42 ? -12.679 -5.177  -14.297 1.00 2.88  ? 42 MET A O      2  
ATOM 4843  C CB     . MET C 2 42 ? -13.564 -4.854  -11.236 1.00 2.29  ? 42 MET A CB     2  
ATOM 4844  C CG     . MET C 2 42 ? -14.539 -5.960  -10.914 1.00 2.26  ? 42 MET A CG     2  
ATOM 4845  S SD     . MET C 2 42 ? -14.312 -6.599  -9.250  1.00 2.15  ? 42 MET A SD     2  
ATOM 4846  C CE     . MET C 2 42 ? -14.466 -5.071  -8.335  1.00 2.02  ? 42 MET A CE     2  
ATOM 4847  H H      . MET C 2 42 ? -15.798 -3.661  -11.765 1.00 2.33  ? 42 MET A H      2  
ATOM 4848  H HA     . MET C 2 42 ? -13.139 -3.306  -12.634 1.00 2.55  ? 42 MET A HA     2  
ATOM 4849  H HB2    . MET C 2 42 ? -12.578 -5.289  -11.313 1.00 2.33  ? 42 MET A HB2    2  
ATOM 4850  H HB3    . MET C 2 42 ? -13.567 -4.152  -10.414 1.00 2.19  ? 42 MET A HB3    2  
ATOM 4851  H HG2    . MET C 2 42 ? -15.539 -5.565  -10.998 1.00 2.24  ? 42 MET A HG2    2  
ATOM 4852  H HG3    . MET C 2 42 ? -14.399 -6.759  -11.622 1.00 2.42  ? 42 MET A HG3    2  
ATOM 4853  H HE1    . MET C 2 42 ? -15.513 -4.817  -8.234  1.00 2.48  ? 42 MET A HE1    2  
ATOM 4854  H HE2    . MET C 2 42 ? -13.955 -4.282  -8.876  1.00 2.10  ? 42 MET A HE2    2  
ATOM 4855  H HE3    . MET C 2 42 ? -14.024 -5.186  -7.358  1.00 2.11  ? 42 MET A HE3    2  
ATOM 4856  N N      . ALA C 2 43 ? -14.869 -5.618  -14.139 1.00 2.80  ? 43 ALA A N      2  
ATOM 4857  C CA     . ALA C 2 43 ? -14.867 -6.546  -15.264 1.00 3.09  ? 43 ALA A CA     2  
ATOM 4858  C C      . ALA C 2 43 ? -14.672 -5.812  -16.580 1.00 3.36  ? 43 ALA A C      2  
ATOM 4859  O O      . ALA C 2 43 ? -13.896 -6.239  -17.435 1.00 3.60  ? 43 ALA A O      2  
ATOM 4860  C CB     . ALA C 2 43 ? -16.154 -7.358  -15.298 1.00 3.15  ? 43 ALA A CB     2  
ATOM 4861  H H      . ALA C 2 43 ? -15.729 -5.365  -13.721 1.00 2.69  ? 43 ALA A H      2  
ATOM 4862  H HA     . ALA C 2 43 ? -14.044 -7.233  -15.123 1.00 3.13  ? 43 ALA A HA     2  
ATOM 4863  H HB1    . ALA C 2 43 ? -16.993 -6.697  -15.461 1.00 3.31  ? 43 ALA A HB1    2  
ATOM 4864  H HB2    . ALA C 2 43 ? -16.281 -7.872  -14.357 1.00 3.18  ? 43 ALA A HB2    2  
ATOM 4865  H HB3    . ALA C 2 43 ? -16.103 -8.081  -16.100 1.00 3.47  ? 43 ALA A HB3    2  
ATOM 4866  N N      . GLU C 2 44 ? -15.377 -4.699  -16.730 1.00 3.34  ? 44 GLU A N      2  
ATOM 4867  C CA     . GLU C 2 44 ? -15.304 -3.902  -17.944 1.00 3.63  ? 44 GLU A CA     2  
ATOM 4868  C C      . GLU C 2 44 ? -13.948 -3.232  -18.071 1.00 3.73  ? 44 GLU A C      2  
ATOM 4869  O O      . GLU C 2 44 ? -13.340 -3.229  -19.140 1.00 4.02  ? 44 GLU A O      2  
ATOM 4870  C CB     . GLU C 2 44 ? -16.400 -2.844  -17.936 1.00 3.61  ? 44 GLU A CB     2  
ATOM 4871  C CG     . GLU C 2 44 ? -17.730 -3.354  -17.421 1.00 3.44  ? 44 GLU A CG     2  
ATOM 4872  C CD     . GLU C 2 44 ? -18.887 -3.115  -18.377 1.00 3.74  ? 44 GLU A CD     2  
ATOM 4873  O OE1    . GLU C 2 44 ? -18.935 -3.789  -19.430 1.00 4.09  ? 44 GLU A OE1    2  
ATOM 4874  O OE2    . GLU C 2 44 ? -19.737 -2.247  -18.086 1.00 3.86  ? 44 GLU A OE2    2  
ATOM 4875  H H      . GLU C 2 44 ? -15.966 -4.403  -15.995 1.00 3.15  ? 44 GLU A H      2  
ATOM 4876  H HA     . GLU C 2 44 ? -15.449 -4.559  -18.786 1.00 3.84  ? 44 GLU A HA     2  
ATOM 4877  H HB2    . GLU C 2 44 ? -16.086 -2.035  -17.292 1.00 3.48  ? 44 GLU A HB2    2  
ATOM 4878  H HB3    . GLU C 2 44 ? -16.540 -2.468  -18.937 1.00 3.88  ? 44 GLU A HB3    2  
ATOM 4879  H HG2    . GLU C 2 44 ? -17.643 -4.415  -17.238 1.00 3.33  ? 44 GLU A HG2    2  
ATOM 4880  H HG3    . GLU C 2 44 ? -17.939 -2.850  -16.487 1.00 3.33  ? 44 GLU A HG3    2  
ATOM 4881  N N      . LEU C 2 45 ? -13.475 -2.668  -16.969 1.00 3.50  ? 45 LEU A N      2  
ATOM 4882  C CA     . LEU C 2 45 ? -12.176 -2.002  -16.961 1.00 3.59  ? 45 LEU A CA     2  
ATOM 4883  C C      . LEU C 2 45 ? -11.045 -3.013  -16.820 1.00 3.56  ? 45 LEU A C      2  
ATOM 4884  O O      . LEU C 2 45 ? -9.873  -2.632  -16.765 1.00 3.63  ? 45 LEU A O      2  
ATOM 4885  C CB     . LEU C 2 45 ? -12.080 -0.990  -15.812 1.00 3.41  ? 45 LEU A CB     2  
ATOM 4886  C CG     . LEU C 2 45 ? -13.331 -0.150  -15.548 1.00 3.38  ? 45 LEU A CG     2  
ATOM 4887  C CD1    . LEU C 2 45 ? -13.018 0.962   -14.557 1.00 3.36  ? 45 LEU A CD1    2  
ATOM 4888  C CD2    . LEU C 2 45 ? -13.894 0.411   -16.846 1.00 3.71  ? 45 LEU A CD2    2  
ATOM 4889  H H      . LEU C 2 45 ? -14.031 -2.669  -16.151 1.00 3.28  ? 45 LEU A H      2  
ATOM 4890  H HA     . LEU C 2 45 ? -12.064 -1.479  -17.898 1.00 3.85  ? 45 LEU A HA     2  
ATOM 4891  H HB2    . LEU C 2 45 ? -11.845 -1.532  -14.909 1.00 3.17  ? 45 LEU A HB2    2  
ATOM 4892  H HB3    . LEU C 2 45 ? -11.263 -0.316  -16.026 1.00 3.56  ? 45 LEU A HB3    2  
ATOM 4893  H HG     . LEU C 2 45 ? -14.088 -0.782  -15.104 1.00 3.18  ? 45 LEU A HG     2  
ATOM 4894  H HD11   . LEU C 2 45 ? -12.742 0.526   -13.607 1.00 3.42  ? 45 LEU A HD11   2  
ATOM 4895  H HD12   . LEU C 2 45 ? -13.890 1.584   -14.426 1.00 3.45  ? 45 LEU A HD12   2  
ATOM 4896  H HD13   . LEU C 2 45 ? -12.201 1.561   -14.930 1.00 3.66  ? 45 LEU A HD13   2  
ATOM 4897  H HD21   . LEU C 2 45 ? -14.438 -0.374  -17.364 1.00 3.75  ? 45 LEU A HD21   2  
ATOM 4898  H HD22   . LEU C 2 45 ? -13.086 0.759   -17.470 1.00 4.07  ? 45 LEU A HD22   2  
ATOM 4899  H HD23   . LEU C 2 45 ? -14.564 1.228   -16.627 1.00 3.93  ? 45 LEU A HD23   2  
ATOM 4900  N N      . ASN C 2 46 ? -11.413 -4.295  -16.739 1.00 3.49  ? 46 ASN A N      2  
ATOM 4901  C CA     . ASN C 2 46 ? -10.461 -5.408  -16.581 1.00 3.50  ? 46 ASN A CA     2  
ATOM 4902  C C      . ASN C 2 46 ? -9.900  -5.427  -15.157 1.00 3.19  ? 46 ASN A C      2  
ATOM 4903  O O      . ASN C 2 46 ? -9.834  -6.479  -14.523 1.00 3.08  ? 46 ASN A O      2  
ATOM 4904  C CB     . ASN C 2 46 ? -9.321  -5.330  -17.608 1.00 3.80  ? 46 ASN A CB     2  
ATOM 4905  C CG     . ASN C 2 46 ? -8.340  -6.490  -17.499 1.00 3.84  ? 46 ASN A CG     2  
ATOM 4906  O OD1    . ASN C 2 46 ? -8.475  -7.504  -18.184 1.00 4.18  ? 46 ASN A OD1    2  
ATOM 4907  N ND2    . ASN C 2 46 ? -7.339  -6.348  -16.642 1.00 3.81  ? 46 ASN A ND2    2  
ATOM 4908  H H      . ASN C 2 46 ? -12.374 -4.505  -16.781 1.00 3.46  ? 46 ASN A H      2  
ATOM 4909  H HA     . ASN C 2 46 ? -11.010 -6.326  -16.740 1.00 3.55  ? 46 ASN A HA     2  
ATOM 4910  H HB2    . ASN C 2 46 ? -9.742  -5.335  -18.602 1.00 4.05  ? 46 ASN A HB2    2  
ATOM 4911  H HB3    . ASN C 2 46 ? -8.780  -4.408  -17.458 1.00 3.81  ? 46 ASN A HB3    2  
ATOM 4912  H HD21   . ASN C 2 46 ? -7.285  -5.516  -16.130 1.00 3.95  ? 46 ASN A HD21   2  
ATOM 4913  H HD22   . ASN C 2 46 ? -6.702  -7.084  -16.551 1.00 3.85  ? 46 ASN A HD22   2  
ATOM 4914  N N      . TYR C 2 47 ? -9.508  -4.246  -14.677 1.00 3.10  ? 47 TYR A N      2  
ATOM 4915  C CA     . TYR C 2 47 ? -8.975  -4.057  -13.332 1.00 2.83  ? 47 TYR A CA     2  
ATOM 4916  C C      . TYR C 2 47 ? -7.795  -4.987  -13.044 1.00 2.81  ? 47 TYR A C      2  
ATOM 4917  O O      . TYR C 2 47 ? -7.949  -6.082  -12.501 1.00 2.91  ? 47 TYR A O      2  
ATOM 4918  C CB     . TYR C 2 47 ? -10.089 -4.225  -12.287 1.00 2.58  ? 47 TYR A CB     2  
ATOM 4919  C CG     . TYR C 2 47 ? -9.638  -4.000  -10.858 1.00 2.35  ? 47 TYR A CG     2  
ATOM 4920  C CD1    . TYR C 2 47 ? -8.483  -3.277  -10.583 1.00 2.39  ? 47 TYR A CD1    2  
ATOM 4921  C CD2    . TYR C 2 47 ? -10.353 -4.530  -9.786  1.00 2.15  ? 47 TYR A CD2    2  
ATOM 4922  C CE1    . TYR C 2 47 ? -8.050  -3.087  -9.290  1.00 2.25  ? 47 TYR A CE1    2  
ATOM 4923  C CE2    . TYR C 2 47 ? -9.918  -4.350  -8.491  1.00 2.03  ? 47 TYR A CE2    2  
ATOM 4924  C CZ     . TYR C 2 47 ? -8.768  -3.628  -8.247  1.00 2.08  ? 47 TYR A CZ     2  
ATOM 4925  O OH     . TYR C 2 47 ? -8.320  -3.460  -6.960  1.00 2.05  ? 47 TYR A OH     2  
ATOM 4926  H H      . TYR C 2 47 ? -9.584  -3.462  -15.264 1.00 3.27  ? 47 TYR A H      2  
ATOM 4927  H HA     . TYR C 2 47 ? -8.613  -3.041  -13.273 1.00 2.91  ? 47 TYR A HA     2  
ATOM 4928  H HB2    . TYR C 2 47 ? -10.875 -3.518  -12.498 1.00 2.65  ? 47 TYR A HB2    2  
ATOM 4929  H HB3    . TYR C 2 47 ? -10.486 -5.225  -12.357 1.00 2.56  ? 47 TYR A HB3    2  
ATOM 4930  H HD1    . TYR C 2 47 ? -7.924  -2.852  -11.404 1.00 2.59  ? 47 TYR A HD1    2  
ATOM 4931  H HD2    . TYR C 2 47 ? -11.263 -5.087  -9.974  1.00 2.15  ? 47 TYR A HD2    2  
ATOM 4932  H HE1    . TYR C 2 47 ? -7.155  -2.517  -9.100  1.00 2.33  ? 47 TYR A HE1    2  
ATOM 4933  H HE2    . TYR C 2 47 ? -10.487 -4.767  -7.674  1.00 1.97  ? 47 TYR A HE2    2  
ATOM 4934  H HH     . TYR C 2 47 ? -8.434  -4.281  -6.472  1.00 2.55  ? 47 TYR A HH     2  
ATOM 4935  N N      . ILE C 2 48 ? -6.610  -4.525  -13.409 1.00 2.82  ? 48 ILE A N      2  
ATOM 4936  C CA     . ILE C 2 48 ? -5.394  -5.275  -13.183 1.00 2.85  ? 48 ILE A CA     2  
ATOM 4937  C C      . ILE C 2 48 ? -4.565  -4.558  -12.115 1.00 2.59  ? 48 ILE A C      2  
ATOM 4938  O O      . ILE C 2 48 ? -4.100  -3.435  -12.321 1.00 2.65  ? 48 ILE A O      2  
ATOM 4939  C CB     . ILE C 2 48 ? -4.604  -5.465  -14.506 1.00 3.25  ? 48 ILE A CB     2  
ATOM 4940  C CG1    . ILE C 2 48 ? -3.154  -5.904  -14.239 1.00 3.41  ? 48 ILE A CG1    2  
ATOM 4941  C CG2    . ILE C 2 48 ? -4.654  -4.195  -15.354 1.00 3.45  ? 48 ILE A CG2    2  
ATOM 4942  C CD1    . ILE C 2 48 ? -2.150  -4.776  -14.298 1.00 3.70  ? 48 ILE A CD1    2  
ATOM 4943  H H      . ILE C 2 48 ? -6.548  -3.645  -13.828 1.00 2.90  ? 48 ILE A H      2  
ATOM 4944  H HA     . ILE C 2 48 ? -5.669  -6.250  -12.808 1.00 2.96  ? 48 ILE A HA     2  
ATOM 4945  H HB     . ILE C 2 48 ? -5.100  -6.243  -15.068 1.00 3.72  ? 48 ILE A HB     2  
ATOM 4946  H HG12   . ILE C 2 48 ? -3.097  -6.345  -13.254 1.00 3.88  ? 48 ILE A HG12   2  
ATOM 4947  H HG13   . ILE C 2 48 ? -2.869  -6.643  -14.974 1.00 3.47  ? 48 ILE A HG13   2  
ATOM 4948  H HG21   . ILE C 2 48 ? -4.095  -4.349  -16.267 1.00 3.52  ? 48 ILE A HG21   2  
ATOM 4949  H HG22   . ILE C 2 48 ? -4.219  -3.375  -14.801 1.00 3.61  ? 48 ILE A HG22   2  
ATOM 4950  H HG23   . ILE C 2 48 ? -5.680  -3.964  -15.596 1.00 3.89  ? 48 ILE A HG23   2  
ATOM 4951  H HD11   . ILE C 2 48 ? -1.918  -4.554  -15.329 1.00 3.98  ? 48 ILE A HD11   2  
ATOM 4952  H HD12   . ILE C 2 48 ? -1.251  -5.062  -13.775 1.00 3.99  ? 48 ILE A HD12   2  
ATOM 4953  H HD13   . ILE C 2 48 ? -2.580  -3.899  -13.831 1.00 3.96  ? 48 ILE A HD13   2  
ATOM 4954  N N      . PRO C 2 49 ? -4.420  -5.180  -10.937 1.00 2.70  ? 49 PRO A N      2  
ATOM 4955  C CA     . PRO C 2 49 ? -3.674  -4.600  -9.822  1.00 2.77  ? 49 PRO A CA     2  
ATOM 4956  C C      . PRO C 2 49 ? -2.159  -4.757  -9.958  1.00 2.92  ? 49 PRO A C      2  
ATOM 4957  O O      . PRO C 2 49 ? -1.600  -5.818  -9.685  1.00 3.54  ? 49 PRO A O      2  
ATOM 4958  C CB     . PRO C 2 49 ? -4.194  -5.383  -8.616  1.00 3.28  ? 49 PRO A CB     2  
ATOM 4959  C CG     . PRO C 2 49 ? -4.587  -6.717  -9.160  1.00 3.60  ? 49 PRO A CG     2  
ATOM 4960  C CD     . PRO C 2 49 ? -4.985  -6.501  -10.599 1.00 3.19  ? 49 PRO A CD     2  
ATOM 4961  H HA     . PRO C 2 49 ? -3.912  -3.554  -9.697  1.00 2.82  ? 49 PRO A HA     2  
ATOM 4962  H HB2    . PRO C 2 49 ? -3.411  -5.473  -7.878  1.00 3.40  ? 49 PRO A HB2    2  
ATOM 4963  H HB3    . PRO C 2 49 ? -5.041  -4.868  -8.189  1.00 3.61  ? 49 PRO A HB3    2  
ATOM 4964  H HG2    . PRO C 2 49 ? -3.748  -7.394  -9.103  1.00 3.91  ? 49 PRO A HG2    2  
ATOM 4965  H HG3    . PRO C 2 49 ? -5.422  -7.107  -8.597  1.00 4.10  ? 49 PRO A HG3    2  
ATOM 4966  H HD2    . PRO C 2 49 ? -4.559  -7.271  -11.225 1.00 3.38  ? 49 PRO A HD2    2  
ATOM 4967  H HD3    . PRO C 2 49 ? -6.062  -6.492  -10.692 1.00 3.35  ? 49 PRO A HD3    2  
ATOM 4968  N N      . ASN C 2 50 ? -1.503  -3.687  -10.384 1.00 2.91  ? 50 ASN A N      2  
ATOM 4969  C CA     . ASN C 2 50 ? -0.055  -3.691  -10.543 1.00 3.44  ? 50 ASN A CA     2  
ATOM 4970  C C      . ASN C 2 50 ? 0.547   -2.486  -9.827  1.00 3.91  ? 50 ASN A C      2  
ATOM 4971  O O      . ASN C 2 50 ? 0.884   -1.479  -10.448 1.00 4.67  ? 50 ASN A O      2  
ATOM 4972  C CB     . ASN C 2 50 ? 0.327   -3.677  -12.025 1.00 3.95  ? 50 ASN A CB     2  
ATOM 4973  C CG     . ASN C 2 50 ? 1.792   -4.002  -12.254 1.00 4.50  ? 50 ASN A CG     2  
ATOM 4974  O OD1    . ASN C 2 50 ? 2.181   -5.168  -12.286 1.00 4.64  ? 50 ASN A OD1    2  
ATOM 4975  N ND2    . ASN C 2 50 ? 2.612   -2.976  -12.423 1.00 5.14  ? 50 ASN A ND2    2  
ATOM 4976  H H      . ASN C 2 50 ? -2.006  -2.876  -10.606 1.00 2.93  ? 50 ASN A H      2  
ATOM 4977  H HA     . ASN C 2 50 ? 0.326   -4.593  -10.087 1.00 3.69  ? 50 ASN A HA     2  
ATOM 4978  H HB2    . ASN C 2 50 ? -0.269  -4.406  -12.550 1.00 4.09  ? 50 ASN A HB2    2  
ATOM 4979  H HB3    . ASN C 2 50 ? 0.128   -2.696  -12.431 1.00 4.21  ? 50 ASN A HB3    2  
ATOM 4980  H HD21   . ASN C 2 50 ? 2.235   -2.072  -12.386 1.00 5.31  ? 50 ASN A HD21   2  
ATOM 4981  H HD22   . ASN C 2 50 ? 3.562   -3.168  -12.594 1.00 5.58  ? 50 ASN A HD22   2  
ATOM 4982  N N      . ARG C 2 51 ? 0.665   -2.595  -8.513  1.00 3.91  ? 51 ARG A N      2  
ATOM 4983  C CA     . ARG C 2 51 ? 1.209   -1.515  -7.697  1.00 4.75  ? 51 ARG A CA     2  
ATOM 4984  C C      . ARG C 2 51 ? 2.675   -1.787  -7.361  1.00 4.81  ? 51 ARG A C      2  
ATOM 4985  O O      . ARG C 2 51 ? 3.094   -1.669  -6.210  1.00 5.41  ? 51 ARG A O      2  
ATOM 4986  C CB     . ARG C 2 51 ? 0.384   -1.370  -6.411  1.00 5.37  ? 51 ARG A CB     2  
ATOM 4987  C CG     . ARG C 2 51 ? 0.574   -0.039  -5.697  1.00 6.42  ? 51 ARG A CG     2  
ATOM 4988  C CD     . ARG C 2 51 ? -0.041  -0.065  -4.305  1.00 7.01  ? 51 ARG A CD     2  
ATOM 4989  N NE     . ARG C 2 51 ? 0.260   1.152   -3.546  1.00 7.58  ? 51 ARG A NE     2  
ATOM 4990  C CZ     . ARG C 2 51 ? 1.276   1.262   -2.689  1.00 8.32  ? 51 ARG A CZ     2  
ATOM 4991  N NH1    . ARG C 2 51 ? 2.081   0.226   -2.471  1.00 8.61  ? 51 ARG A NH1    2  
ATOM 4992  N NH2    . ARG C 2 51 ? 1.484   2.407   -2.045  1.00 9.00  ? 51 ARG A NH2    2  
ATOM 4993  H H      . ARG C 2 51 ? 0.392   -3.431  -8.079  1.00 3.65  ? 51 ARG A H      2  
ATOM 4994  H HA     . ARG C 2 51 ? 1.143   -0.600  -8.266  1.00 5.24  ? 51 ARG A HA     2  
ATOM 4995  H HB2    . ARG C 2 51 ? -0.662  -1.473  -6.658  1.00 5.34  ? 51 ARG A HB2    2  
ATOM 4996  H HB3    . ARG C 2 51 ? 0.662   -2.162  -5.730  1.00 5.40  ? 51 ARG A HB3    2  
ATOM 4997  H HG2    . ARG C 2 51 ? 1.631   0.164   -5.609  1.00 6.80  ? 51 ARG A HG2    2  
ATOM 4998  H HG3    . ARG C 2 51 ? 0.101   0.741   -6.277  1.00 6.67  ? 51 ARG A HG3    2  
ATOM 4999  H HD2    . ARG C 2 51 ? -1.113  -0.159  -4.401  1.00 7.11  ? 51 ARG A HD2    2  
ATOM 5000  H HD3    . ARG C 2 51 ? 0.349   -0.918  -3.770  1.00 7.21  ? 51 ARG A HD3    2  
ATOM 5001  H HE     . ARG C 2 51 ? -0.333  1.926   -3.684  1.00 7.59  ? 51 ARG A HE     2  
ATOM 5002  H HH11   . ARG C 2 51 ? 1.928   -0.639  -2.953  1.00 8.29  ? 51 ARG A HH11   2  
ATOM 5003  H HH12   . ARG C 2 51 ? 2.837   0.300   -1.818  1.00 9.30  ? 51 ARG A HH12   2  
ATOM 5004  H HH21   . ARG C 2 51 ? 0.874   3.191   -2.199  1.00 9.00  ? 51 ARG A HH21   2  
ATOM 5005  H HH22   . ARG C 2 51 ? 2.256   2.498   -1.412  1.00 9.64  ? 51 ARG A HH22   2  
ATOM 5006  N N      . CYS C 2 52 ? 3.453   -2.139  -8.378  1.00 4.54  ? 52 CYS A N      2  
ATOM 5007  C CA     . CYS C 2 52 ? 4.860   -2.434  -8.194  1.00 5.01  ? 52 CYS A CA     2  
ATOM 5008  C C      . CYS C 2 52 ? 5.639   -2.050  -9.428  1.00 5.61  ? 52 CYS A C      2  
ATOM 5009  O O      . CYS C 2 52 ? 5.541   -2.676  -10.481 1.00 5.87  ? 52 CYS A O      2  
ATOM 5010  C CB     . CYS C 2 52 ? 5.089   -3.912  -7.872  1.00 5.05  ? 52 CYS A CB     2  
ATOM 5011  S SG     . CYS C 2 52 ? 3.569   -4.859  -7.516  1.00 4.97  ? 52 CYS A SG     2  
ATOM 5012  H H      . CYS C 2 52 ? 3.081   -2.172  -9.278  1.00 4.29  ? 52 CYS A H      2  
ATOM 5013  H HA     . CYS C 2 52 ? 5.219   -1.830  -7.372  1.00 5.33  ? 52 CYS A HA     2  
ATOM 5014  H HB2    . CYS C 2 52 ? 5.576   -4.382  -8.713  1.00 5.12  ? 52 CYS A HB2    2  
ATOM 5015  H HB3    . CYS C 2 52 ? 5.732   -3.978  -7.010  1.00 5.54  ? 52 CYS A HB3    2  
ATOM 5016  N N      . ALA C 2 53 ? 6.404   -1.004  -9.265  1.00 6.17  ? 53 ALA A N      2  
ATOM 5017  C CA     . ALA C 2 53 ? 7.227   -0.459  -10.326 1.00 7.07  ? 53 ALA A CA     2  
ATOM 5018  C C      . ALA C 2 53 ? 8.699   -0.738  -10.063 1.00 7.73  ? 53 ALA A C      2  
ATOM 5019  O O      . ALA C 2 53 ? 9.053   -1.321  -9.041  1.00 7.95  ? 53 ALA A O      2  
ATOM 5020  C CB     . ALA C 2 53 ? 6.969   1.030   -10.428 1.00 7.69  ? 53 ALA A CB     2  
ATOM 5021  H H      . ALA C 2 53 ? 6.419   -0.580  -8.388  1.00 6.16  ? 53 ALA A H      2  
ATOM 5022  H HA     . ALA C 2 53 ? 6.941   -0.921  -11.258 1.00 7.09  ? 53 ALA A HA     2  
ATOM 5023  H HB1    . ALA C 2 53 ? 7.891   1.544   -10.653 1.00 7.99  ? 53 ALA A HB1    2  
ATOM 5024  H HB2    . ALA C 2 53 ? 6.576   1.381   -9.484  1.00 7.63  ? 53 ALA A HB2    2  
ATOM 5025  H HB3    . ALA C 2 53 ? 6.249   1.218   -11.210 1.00 8.15  ? 53 ALA A HB3    2  
ATOM 5026  N N      . GLN C 2 54 ? 9.549   -0.338  -10.997 1.00 8.29  ? 54 GLN A N      2  
ATOM 5027  C CA     . GLN C 2 54 ? 10.985  -0.545  -10.867 1.00 9.16  ? 54 GLN A CA     2  
ATOM 5028  C C      . GLN C 2 54 ? 11.700  0.789   -10.700 1.00 10.13 ? 54 GLN A C      2  
ATOM 5029  O O      . GLN C 2 54 ? 12.742  0.878   -10.051 1.00 10.55 ? 54 GLN A O      2  
ATOM 5030  C CB     . GLN C 2 54 ? 11.538  -1.264  -12.101 1.00 9.43  ? 54 GLN A CB     2  
ATOM 5031  C CG     . GLN C 2 54 ? 10.663  -2.394  -12.616 1.00 9.25  ? 54 GLN A CG     2  
ATOM 5032  C CD     . GLN C 2 54 ? 9.724   -1.941  -13.715 1.00 9.60  ? 54 GLN A CD     2  
ATOM 5033  O OE1    . GLN C 2 54 ? 8.577   -1.572  -13.459 1.00 9.58  ? 54 GLN A OE1    2  
ATOM 5034  N NE2    . GLN C 2 54 ? 10.203  -1.955  -14.946 1.00 10.15 ? 54 GLN A NE2    2  
ATOM 5035  H H      . GLN C 2 54 ? 9.200   0.097   -11.801 1.00 8.28  ? 54 GLN A H      2  
ATOM 5036  H HA     . GLN C 2 54 ? 11.160  -1.153  -9.992  1.00 9.14  ? 54 GLN A HA     2  
ATOM 5037  H HB2    . GLN C 2 54 ? 11.650  -0.542  -12.894 1.00 9.49  ? 54 GLN A HB2    2  
ATOM 5038  H HB3    . GLN C 2 54 ? 12.508  -1.671  -11.858 1.00 9.99  ? 54 GLN A HB3    2  
ATOM 5039  H HG2    . GLN C 2 54 ? 11.297  -3.176  -13.006 1.00 9.25  ? 54 GLN A HG2    2  
ATOM 5040  H HG3    . GLN C 2 54 ? 10.075  -2.782  -11.797 1.00 9.14  ? 54 GLN A HG3    2  
ATOM 5041  H HE21   . GLN C 2 54 ? 11.135  -2.260  -15.080 1.00 10.27 ? 54 GLN A HE21   2  
ATOM 5042  H HE22   . GLN C 2 54 ? 9.628   -1.645  -15.674 1.00 10.53 ? 54 GLN A HE22   2  
ATOM 5043  N N      . GLN C 2 55 ? 11.133  1.820   -11.310 1.00 10.65 ? 55 GLN A N      2  
ATOM 5044  C CA     . GLN C 2 55 ? 11.702  3.161   -11.253 1.00 11.73 ? 55 GLN A CA     2  
ATOM 5045  C C      . GLN C 2 55 ? 10.594  4.196   -11.112 1.00 12.00 ? 55 GLN A C      2  
ATOM 5046  O O      . GLN C 2 55 ? 10.658  5.074   -10.258 1.00 12.99 ? 55 GLN A O      2  
ATOM 5047  C CB     . GLN C 2 55 ? 12.539  3.445   -12.513 1.00 12.32 ? 55 GLN A CB     2  
ATOM 5048  C CG     . GLN C 2 55 ? 12.267  2.500   -13.679 1.00 12.31 ? 55 GLN A CG     2  
ATOM 5049  C CD     . GLN C 2 55 ? 10.948  2.776   -14.379 1.00 12.67 ? 55 GLN A CD     2  
ATOM 5050  O OE1    . GLN C 2 55 ? 9.900   2.260   -13.983 1.00 12.67 ? 55 GLN A OE1    2  
ATOM 5051  N NE2    . GLN C 2 55 ? 10.988  3.591   -15.420 1.00 13.16 ? 55 GLN A NE2    2  
ATOM 5052  H H      . GLN C 2 55 ? 10.305  1.679   -11.807 1.00 10.41 ? 55 GLN A H      2  
ATOM 5053  H HA     . GLN C 2 55 ? 12.341  3.214   -10.385 1.00 12.12 ? 55 GLN A HA     2  
ATOM 5054  H HB2    . GLN C 2 55 ? 12.333  4.453   -12.843 1.00 12.65 ? 55 GLN A HB2    2  
ATOM 5055  H HB3    . GLN C 2 55 ? 13.586  3.371   -12.255 1.00 12.66 ? 55 GLN A HB3    2  
ATOM 5056  H HG2    . GLN C 2 55 ? 13.064  2.601   -14.401 1.00 12.13 ? 55 GLN A HG2    2  
ATOM 5057  H HG3    . GLN C 2 55 ? 12.251  1.486   -13.305 1.00 12.42 ? 55 GLN A HG3    2  
ATOM 5058  H HE21   . GLN C 2 55 ? 11.864  3.970   -15.679 1.00 13.26 ? 55 GLN A HE21   2  
ATOM 5059  H HE22   . GLN C 2 55 ? 10.155  3.779   -15.897 1.00 13.52 ? 55 GLN A HE22   2  
ATOM 5060  N N      . LEU C 2 56 ? 9.587   4.071   -11.966 1.00 11.27 ? 56 LEU A N      2  
ATOM 5061  C CA     . LEU C 2 56 ? 8.437   4.962   -11.979 1.00 11.66 ? 56 LEU A CA     2  
ATOM 5062  C C      . LEU C 2 56 ? 7.483   4.519   -13.081 1.00 12.14 ? 56 LEU A C      2  
ATOM 5063  O O      . LEU C 2 56 ? 6.487   3.847   -12.824 1.00 12.14 ? 56 LEU A O      2  
ATOM 5064  C CB     . LEU C 2 56 ? 8.868   6.418   -12.210 1.00 11.55 ? 56 LEU A CB     2  
ATOM 5065  C CG     . LEU C 2 56 ? 7.782   7.468   -11.964 1.00 11.61 ? 56 LEU A CG     2  
ATOM 5066  C CD1    . LEU C 2 56 ? 7.398   7.506   -10.492 1.00 11.79 ? 56 LEU A CD1    2  
ATOM 5067  C CD2    . LEU C 2 56 ? 8.251   8.837   -12.431 1.00 11.84 ? 56 LEU A CD2    2  
ATOM 5068  H H      . LEU C 2 56 ? 9.618   3.345   -12.627 1.00 10.54 ? 56 LEU A H      2  
ATOM 5069  H HA     . LEU C 2 56 ? 7.939   4.881   -11.024 1.00 11.92 ? 56 LEU A HA     2  
ATOM 5070  H HB2    . LEU C 2 56 ? 9.700   6.631   -11.554 1.00 11.37 ? 56 LEU A HB2    2  
ATOM 5071  H HB3    . LEU C 2 56 ? 9.203   6.513   -13.231 1.00 11.82 ? 56 LEU A HB3    2  
ATOM 5072  H HG     . LEU C 2 56 ? 6.900   7.203   -12.531 1.00 11.61 ? 56 LEU A HG     2  
ATOM 5073  H HD11   . LEU C 2 56 ? 6.628   8.248   -10.340 1.00 11.93 ? 56 LEU A HD11   2  
ATOM 5074  H HD12   . LEU C 2 56 ? 8.265   7.761   -9.901  1.00 12.02 ? 56 LEU A HD12   2  
ATOM 5075  H HD13   . LEU C 2 56 ? 7.029   6.537   -10.191 1.00 11.75 ? 56 LEU A HD13   2  
ATOM 5076  H HD21   . LEU C 2 56 ? 7.474   9.564   -12.253 1.00 11.95 ? 56 LEU A HD21   2  
ATOM 5077  H HD22   . LEU C 2 56 ? 8.473   8.799   -13.487 1.00 12.01 ? 56 LEU A HD22   2  
ATOM 5078  H HD23   . LEU C 2 56 ? 9.140   9.118   -11.886 1.00 11.93 ? 56 LEU A HD23   2  
ATOM 5079  N N      . ALA C 2 57 ? 7.823   4.876   -14.314 1.00 12.72 ? 57 ALA A N      2  
ATOM 5080  C CA     . ALA C 2 57 ? 7.021   4.522   -15.476 1.00 13.38 ? 57 ALA A CA     2  
ATOM 5081  C C      . ALA C 2 57 ? 7.846   4.696   -16.743 1.00 13.99 ? 57 ALA A C      2  
ATOM 5082  O O      . ALA C 2 57 ? 8.453   5.746   -16.952 1.00 14.14 ? 57 ALA A O      2  
ATOM 5083  C CB     . ALA C 2 57 ? 5.762   5.377   -15.542 1.00 13.95 ? 57 ALA A CB     2  
ATOM 5084  H H      . ALA C 2 57 ? 8.641   5.399   -14.449 1.00 12.82 ? 57 ALA A H      2  
ATOM 5085  H HA     . ALA C 2 57 ? 6.729   3.487   -15.383 1.00 13.20 ? 57 ALA A HA     2  
ATOM 5086  H HB1    . ALA C 2 57 ? 5.190   5.246   -14.637 1.00 14.13 ? 57 ALA A HB1    2  
ATOM 5087  H HB2    . ALA C 2 57 ? 5.166   5.074   -16.391 1.00 14.02 ? 57 ALA A HB2    2  
ATOM 5088  H HB3    . ALA C 2 57 ? 6.037   6.416   -15.647 1.00 14.26 ? 57 ALA A HB3    2  
ATOM 5089  N N      . GLY C 2 58 ? 7.891   3.661   -17.571 1.00 14.49 ? 58 GLY A N      2  
ATOM 5090  C CA     . GLY C 2 58 ? 8.647   3.740   -18.805 1.00 15.23 ? 58 GLY A CA     2  
ATOM 5091  C C      . GLY C 2 58 ? 9.691   2.648   -18.916 1.00 15.72 ? 58 GLY A C      2  
ATOM 5092  O O      . GLY C 2 58 ? 10.868  2.933   -19.135 1.00 16.04 ? 58 GLY A O      2  
ATOM 5093  H H      . GLY C 2 58 ? 7.409   2.834   -17.341 1.00 14.44 ? 58 GLY A H      2  
ATOM 5094  H HA2    . GLY C 2 58 ? 7.964   3.656   -19.638 1.00 15.36 ? 58 GLY A HA2    2  
ATOM 5095  H HA3    . GLY C 2 58 ? 9.139   4.700   -18.852 1.00 15.45 ? 58 GLY A HA3    2  
ATOM 5096  N N      . LYS C 2 59 ? 9.252   1.402   -18.754 1.00 15.93 ? 59 LYS A N      2  
ATOM 5097  C CA     . LYS C 2 59 ? 10.133  0.237   -18.842 1.00 16.57 ? 59 LYS A CA     2  
ATOM 5098  C C      . LYS C 2 59 ? 11.170  0.247   -17.718 1.00 17.24 ? 59 LYS A C      2  
ATOM 5099  O O      . LYS C 2 59 ? 10.852  0.594   -16.583 1.00 17.61 ? 59 LYS A O      2  
ATOM 5100  C CB     . LYS C 2 59 ? 10.812  0.174   -20.220 1.00 16.45 ? 59 LYS A CB     2  
ATOM 5101  C CG     . LYS C 2 59 ? 9.843   -0.130  -21.354 1.00 16.73 ? 59 LYS A CG     2  
ATOM 5102  C CD     . LYS C 2 59 ? 10.510  -0.017  -22.718 1.00 17.03 ? 59 LYS A CD     2  
ATOM 5103  C CE     . LYS C 2 59 ? 10.925  1.415   -23.022 1.00 17.57 ? 59 LYS A CE     2  
ATOM 5104  N NZ     . LYS C 2 59 ? 10.811  1.729   -24.471 1.00 17.80 ? 59 LYS A NZ     2  
ATOM 5105  H H      . LYS C 2 59 ? 8.303   1.258   -18.546 1.00 15.76 ? 59 LYS A H      2  
ATOM 5106  H HA     . LYS C 2 59 ? 9.515   -0.641  -18.723 1.00 16.82 ? 59 LYS A HA     2  
ATOM 5107  H HB2    . LYS C 2 59 ? 11.282  1.124   -20.420 1.00 16.25 ? 59 LYS A HB2    2  
ATOM 5108  H HB3    . LYS C 2 59 ? 11.567  -0.598  -20.203 1.00 16.52 ? 59 LYS A HB3    2  
ATOM 5109  H HG2    . LYS C 2 59 ? 9.469   -1.135  -21.234 1.00 16.83 ? 59 LYS A HG2    2  
ATOM 5110  H HG3    . LYS C 2 59 ? 9.021   0.569   -21.307 1.00 16.76 ? 59 LYS A HG3    2  
ATOM 5111  H HD2    . LYS C 2 59 ? 11.388  -0.645  -22.731 1.00 16.96 ? 59 LYS A HD2    2  
ATOM 5112  H HD3    . LYS C 2 59 ? 9.815   -0.350  -23.475 1.00 17.06 ? 59 LYS A HD3    2  
ATOM 5113  H HE2    . LYS C 2 59 ? 10.288  2.087   -22.466 1.00 17.89 ? 59 LYS A HE2    2  
ATOM 5114  H HE3    . LYS C 2 59 ? 11.950  1.552   -22.712 1.00 17.63 ? 59 LYS A HE3    2  
ATOM 5115  H HZ1    . LYS C 2 59 ? 11.303  2.625   -24.684 1.00 17.98 ? 59 LYS A HZ1    2  
ATOM 5116  H HZ2    . LYS C 2 59 ? 9.807   1.829   -24.740 1.00 17.82 ? 59 LYS A HZ2    2  
ATOM 5117  H HZ3    . LYS C 2 59 ? 11.236  0.968   -25.045 1.00 17.91 ? 59 LYS A HZ3    2  
ATOM 5118  N N      . GLN C 2 60 ? 12.397  -0.144  -18.035 1.00 17.53 ? 60 GLN A N      2  
ATOM 5119  C CA     . GLN C 2 60 ? 13.471  -0.185  -17.048 1.00 18.30 ? 60 GLN A CA     2  
ATOM 5120  C C      . GLN C 2 60 ? 14.340  1.070   -17.145 1.00 18.80 ? 60 GLN A C      2  
ATOM 5121  O O      . GLN C 2 60 ? 15.401  1.158   -16.526 1.00 18.98 ? 60 GLN A O      2  
ATOM 5122  C CB     . GLN C 2 60 ? 14.327  -1.437  -17.268 1.00 18.40 ? 60 GLN A CB     2  
ATOM 5123  C CG     . GLN C 2 60 ? 14.969  -1.987  -15.999 1.00 18.96 ? 60 GLN A CG     2  
ATOM 5124  C CD     . GLN C 2 60 ? 14.031  -2.875  -15.200 1.00 19.28 ? 60 GLN A CD     2  
ATOM 5125  O OE1    . GLN C 2 60 ? 12.818  -2.665  -15.181 1.00 19.33 ? 60 GLN A OE1    2  
ATOM 5126  N NE2    . GLN C 2 60 ? 14.588  -3.879  -14.541 1.00 19.61 ? 60 GLN A NE2    2  
ATOM 5127  H H      . GLN C 2 60 ? 12.586  -0.419  -18.954 1.00 17.29 ? 60 GLN A H      2  
ATOM 5128  H HA     . GLN C 2 60 ? 13.024  -0.228  -16.066 1.00 18.59 ? 60 GLN A HA     2  
ATOM 5129  H HB2    . GLN C 2 60 ? 13.706  -2.212  -17.693 1.00 17.92 ? 60 GLN A HB2    2  
ATOM 5130  H HB3    . GLN C 2 60 ? 15.116  -1.199  -17.967 1.00 18.67 ? 60 GLN A HB3    2  
ATOM 5131  H HG2    . GLN C 2 60 ? 15.837  -2.566  -16.275 1.00 19.26 ? 60 GLN A HG2    2  
ATOM 5132  H HG3    . GLN C 2 60 ? 15.273  -1.157  -15.379 1.00 18.98 ? 60 GLN A HG3    2  
ATOM 5133  H HE21   . GLN C 2 60 ? 15.563  -3.995  -14.605 1.00 19.63 ? 60 GLN A HE21   2  
ATOM 5134  H HE22   . GLN C 2 60 ? 14.006  -4.469  -14.014 1.00 19.89 ? 60 GLN A HE22   2  
ATOM 5135  N N      . SER C 2 61 ? 13.878  2.041   -17.921 1.00 19.13 ? 61 SER A N      2  
ATOM 5136  C CA     . SER C 2 61 ? 14.609  3.285   -18.118 1.00 19.73 ? 61 SER A CA     2  
ATOM 5137  C C      . SER C 2 61 ? 14.528  4.176   -16.879 1.00 20.17 ? 61 SER A C      2  
ATOM 5138  O O      . SER C 2 61 ? 13.477  4.287   -16.248 1.00 20.57 ? 61 SER A O      2  
ATOM 5139  C CB     . SER C 2 61 ? 14.048  4.019   -19.335 1.00 20.14 ? 61 SER A CB     2  
ATOM 5140  O OG     . SER C 2 61 ? 13.318  3.130   -20.168 1.00 19.84 ? 61 SER A OG     2  
ATOM 5141  H H      . SER C 2 61 ? 13.018  1.920   -18.371 1.00 19.06 ? 61 SER A H      2  
ATOM 5142  H HA     . SER C 2 61 ? 15.643  3.038   -18.304 1.00 19.70 ? 61 SER A HA     2  
ATOM 5143  H HB2    . SER C 2 61 ? 13.388  4.809   -19.006 1.00 20.52 ? 61 SER A HB2    2  
ATOM 5144  H HB3    . SER C 2 61 ? 14.861  4.444   -19.905 1.00 20.42 ? 61 SER A HB3    2  
ATOM 5145  H HG     . SER C 2 61 ? 12.381  3.167   -19.927 1.00 19.90 ? 61 SER A HG     2  
ATOM 5146  N N      . LEU C 2 62 ? 15.645  4.807   -16.534 1.00 20.21 ? 62 LEU A N      2  
ATOM 5147  C CA     . LEU C 2 62 ? 15.699  5.689   -15.374 1.00 20.74 ? 62 LEU A CA     2  
ATOM 5148  C C      . LEU C 2 62 ? 15.083  7.048   -15.696 1.00 20.91 ? 62 LEU A C      2  
ATOM 5149  O O      . LEU C 2 62 ? 15.044  7.460   -16.859 1.00 20.68 ? 62 LEU A O      2  
ATOM 5150  C CB     . LEU C 2 62 ? 17.147  5.864   -14.904 1.00 21.23 ? 62 LEU A CB     2  
ATOM 5151  C CG     . LEU C 2 62 ? 18.108  6.442   -15.947 1.00 21.58 ? 62 LEU A CG     2  
ATOM 5152  C CD1    . LEU C 2 62 ? 18.624  7.801   -15.506 1.00 21.89 ? 62 LEU A CD1    2  
ATOM 5153  C CD2    . LEU C 2 62 ? 19.265  5.484   -16.192 1.00 21.76 ? 62 LEU A CD2    2  
ATOM 5154  H H      . LEU C 2 62 ? 16.450  4.682   -17.076 1.00 19.96 ? 62 LEU A H      2  
ATOM 5155  H HA     . LEU C 2 62 ? 15.126  5.228   -14.582 1.00 20.79 ? 62 LEU A HA     2  
ATOM 5156  H HB2    . LEU C 2 62 ? 17.147  6.519   -14.044 1.00 21.20 ? 62 LEU A HB2    2  
ATOM 5157  H HB3    . LEU C 2 62 ? 17.522  4.899   -14.599 1.00 21.50 ? 62 LEU A HB3    2  
ATOM 5158  H HG     . LEU C 2 62 ? 17.579  6.572   -16.880 1.00 21.60 ? 62 LEU A HG     2  
ATOM 5159  H HD11   . LEU C 2 62 ? 17.793  8.479   -15.380 1.00 21.79 ? 62 LEU A HD11   2  
ATOM 5160  H HD12   . LEU C 2 62 ? 19.297  8.194   -16.255 1.00 22.18 ? 62 LEU A HD12   2  
ATOM 5161  H HD13   . LEU C 2 62 ? 19.151  7.701   -14.568 1.00 22.04 ? 62 LEU A HD13   2  
ATOM 5162  H HD21   . LEU C 2 62 ? 18.882  4.542   -16.558 1.00 21.91 ? 62 LEU A HD21   2  
ATOM 5163  H HD22   . LEU C 2 62 ? 19.799  5.322   -15.267 1.00 21.83 ? 62 LEU A HD22   2  
ATOM 5164  H HD23   . LEU C 2 62 ? 19.935  5.909   -16.924 1.00 21.79 ? 62 LEU A HD23   2  
ATOM 5165  N N      . MET D 2 1  ? -2.215  -16.152 9.376   1.00 7.49  ? 1  MET B N      2  
ATOM 5166  C CA     . MET D 2 1  ? -3.125  -15.011 9.379   1.00 7.49  ? 1  MET B CA     2  
ATOM 5167  C C      . MET D 2 1  ? -2.499  -13.825 8.653   1.00 6.82  ? 1  MET B C      2  
ATOM 5168  O O      . MET D 2 1  ? -3.187  -12.871 8.281   1.00 7.04  ? 1  MET B O      2  
ATOM 5169  C CB     . MET D 2 1  ? -3.492  -14.627 10.818  1.00 8.28  ? 1  MET B CB     2  
ATOM 5170  C CG     . MET D 2 1  ? -2.291  -14.287 11.689  1.00 8.90  ? 1  MET B CG     2  
ATOM 5171  S SD     . MET D 2 1  ? -2.720  -14.129 13.436  1.00 9.76  ? 1  MET B SD     2  
ATOM 5172  C CE     . MET D 2 1  ? -3.243  -15.801 13.812  1.00 10.35 ? 1  MET B CE     2  
ATOM 5173  H H1     . MET D 2 1  ? -2.543  -17.026 9.072   1.00 7.72  ? 1  MET B H1     2  
ATOM 5174  H HA     . MET D 2 1  ? -4.024  -15.304 8.855   1.00 7.71  ? 1  MET B HA     2  
ATOM 5175  H HB2    . MET D 2 1  ? -4.145  -13.768 10.793  1.00 8.55  ? 1  MET B HB2    2  
ATOM 5176  H HB3    . MET D 2 1  ? -4.017  -15.453 11.275  1.00 8.42  ? 1  MET B HB3    2  
ATOM 5177  H HG2    . MET D 2 1  ? -1.554  -15.068 11.584  1.00 9.10  ? 1  MET B HG2    2  
ATOM 5178  H HG3    . MET D 2 1  ? -1.872  -13.350 11.351  1.00 8.90  ? 1  MET B HG3    2  
ATOM 5179  H HE1    . MET D 2 1  ? -2.425  -16.484 13.634  1.00 10.47 ? 1  MET B HE1    2  
ATOM 5180  H HE2    . MET D 2 1  ? -4.077  -16.069 13.179  1.00 10.35 ? 1  MET B HE2    2  
ATOM 5181  H HE3    . MET D 2 1  ? -3.544  -15.861 14.848  1.00 10.83 ? 1  MET B HE3    2  
ATOM 5182  N N      . LYS D 2 2  ? -1.192  -13.903 8.447   1.00 6.25  ? 2  LYS B N      2  
ATOM 5183  C CA     . LYS D 2 2  ? -0.451  -12.852 7.764   1.00 5.74  ? 2  LYS B CA     2  
ATOM 5184  C C      . LYS D 2 2  ? 0.874   -13.393 7.243   1.00 4.89  ? 2  LYS B C      2  
ATOM 5185  O O      . LYS D 2 2  ? 1.723   -13.817 8.026   1.00 4.98  ? 2  LYS B O      2  
ATOM 5186  C CB     . LYS D 2 2  ? -0.178  -11.673 8.707   1.00 6.32  ? 2  LYS B CB     2  
ATOM 5187  C CG     . LYS D 2 2  ? 0.538   -10.508 8.030   1.00 6.84  ? 2  LYS B CG     2  
ATOM 5188  C CD     . LYS D 2 2  ? 1.258   -9.621  9.037   1.00 7.40  ? 2  LYS B CD     2  
ATOM 5189  C CE     . LYS D 2 2  ? 2.632   -10.174 9.401   1.00 7.79  ? 2  LYS B CE     2  
ATOM 5190  N NZ     . LYS D 2 2  ? 3.583   -10.119 8.254   1.00 8.33  ? 2  LYS B NZ     2  
ATOM 5191  H H      . LYS D 2 2  ? -0.709  -14.699 8.762   1.00 6.35  ? 2  LYS B H      2  
ATOM 5192  H HA     . LYS D 2 2  ? -1.045  -12.510 6.930   1.00 5.83  ? 2  LYS B HA     2  
ATOM 5193  H HB2    . LYS D 2 2  ? -1.119  -11.312 9.096   1.00 6.66  ? 2  LYS B HB2    2  
ATOM 5194  H HB3    . LYS D 2 2  ? 0.435   -12.016 9.527   1.00 6.35  ? 2  LYS B HB3    2  
ATOM 5195  H HG2    . LYS D 2 2  ? 1.261   -10.902 7.332   1.00 6.92  ? 2  LYS B HG2    2  
ATOM 5196  H HG3    . LYS D 2 2  ? -0.192  -9.914  7.498   1.00 7.09  ? 2  LYS B HG3    2  
ATOM 5197  H HD2    . LYS D 2 2  ? 1.383   -8.637  8.607   1.00 7.57  ? 2  LYS B HD2    2  
ATOM 5198  H HD3    . LYS D 2 2  ? 0.660   -9.550  9.933   1.00 7.68  ? 2  LYS B HD3    2  
ATOM 5199  H HE2    . LYS D 2 2  ? 3.034   -9.592  10.216  1.00 7.81  ? 2  LYS B HE2    2  
ATOM 5200  H HE3    . LYS D 2 2  ? 2.519   -11.202 9.715   1.00 7.98  ? 2  LYS B HE3    2  
ATOM 5201  H HZ1    . LYS D 2 2  ? 4.562   -10.267 8.586   1.00 8.70  ? 2  LYS B HZ1    2  
ATOM 5202  H HZ2    . LYS D 2 2  ? 3.529   -9.193  7.785   1.00 8.54  ? 2  LYS B HZ2    2  
ATOM 5203  H HZ3    . LYS D 2 2  ? 3.352   -10.859 7.558   1.00 8.40  ? 2  LYS B HZ3    2  
ATOM 5204  N N      . PRO D 2 3  ? 1.066   -13.408 5.917   1.00 4.30  ? 3  PRO B N      2  
ATOM 5205  C CA     . PRO D 2 3  ? 2.311   -13.873 5.315   1.00 3.77  ? 3  PRO B CA     2  
ATOM 5206  C C      . PRO D 2 3  ? 3.428   -12.866 5.528   1.00 3.57  ? 3  PRO B C      2  
ATOM 5207  O O      . PRO D 2 3  ? 3.228   -11.825 6.162   1.00 3.91  ? 3  PRO B O      2  
ATOM 5208  C CB     . PRO D 2 3  ? 1.986   -14.004 3.817   1.00 3.70  ? 3  PRO B CB     2  
ATOM 5209  C CG     . PRO D 2 3  ? 0.512   -13.789 3.697   1.00 4.09  ? 3  PRO B CG     2  
ATOM 5210  C CD     . PRO D 2 3  ? 0.096   -12.987 4.899   1.00 4.49  ? 3  PRO B CD     2  
ATOM 5211  H HA     . PRO D 2 3  ? 2.615   -14.831 5.709   1.00 3.93  ? 3  PRO B HA     2  
ATOM 5212  H HB2    . PRO D 2 3  ? 2.536   -13.257 3.265   1.00 3.78  ? 3  PRO B HB2    2  
ATOM 5213  H HB3    . PRO D 2 3  ? 2.267   -14.987 3.473   1.00 3.71  ? 3  PRO B HB3    2  
ATOM 5214  H HG2    . PRO D 2 3  ? 0.297   -13.243 2.788   1.00 4.37  ? 3  PRO B HG2    2  
ATOM 5215  H HG3    . PRO D 2 3  ? 0.004   -14.743 3.686   1.00 4.15  ? 3  PRO B HG3    2  
ATOM 5216  H HD2    . PRO D 2 3  ? 0.179   -11.929 4.698   1.00 4.75  ? 3  PRO B HD2    2  
ATOM 5217  H HD3    . PRO D 2 3  ? -0.910  -13.241 5.196   1.00 4.88  ? 3  PRO B HD3    2  
ATOM 5218  N N      . VAL D 2 4  ? 4.600   -13.170 5.006   1.00 3.16  ? 4  VAL B N      2  
ATOM 5219  C CA     . VAL D 2 4  ? 5.736   -12.282 5.145   1.00 2.98  ? 4  VAL B CA     2  
ATOM 5220  C C      . VAL D 2 4  ? 5.552   -11.032 4.322   1.00 2.72  ? 4  VAL B C      2  
ATOM 5221  O O      . VAL D 2 4  ? 5.078   -11.057 3.189   1.00 2.56  ? 4  VAL B O      2  
ATOM 5222  C CB     . VAL D 2 4  ? 7.054   -12.933 4.702   1.00 2.87  ? 4  VAL B CB     2  
ATOM 5223  C CG1    . VAL D 2 4  ? 8.224   -11.980 4.888   1.00 2.71  ? 4  VAL B CG1    2  
ATOM 5224  C CG2    . VAL D 2 4  ? 7.302   -14.211 5.463   1.00 3.14  ? 4  VAL B CG2    2  
ATOM 5225  H H      . VAL D 2 4  ? 4.702   -14.006 4.508   1.00 3.11  ? 4  VAL B H      2  
ATOM 5226  H HA     . VAL D 2 4  ? 5.835   -12.007 6.191   1.00 3.16  ? 4  VAL B HA     2  
ATOM 5227  H HB     . VAL D 2 4  ? 6.974   -13.161 3.660   1.00 2.76  ? 4  VAL B HB     2  
ATOM 5228  H HG11   . VAL D 2 4  ? 9.114   -12.414 4.460   1.00 2.95  ? 4  VAL B HG11   2  
ATOM 5229  H HG12   . VAL D 2 4  ? 8.380   -11.803 5.944   1.00 2.74  ? 4  VAL B HG12   2  
ATOM 5230  H HG13   . VAL D 2 4  ? 8.006   -11.040 4.395   1.00 2.90  ? 4  VAL B HG13   2  
ATOM 5231  H HG21   . VAL D 2 4  ? 8.293   -14.574 5.233   1.00 3.44  ? 4  VAL B HG21   2  
ATOM 5232  H HG22   . VAL D 2 4  ? 6.568   -14.948 5.178   1.00 3.30  ? 4  VAL B HG22   2  
ATOM 5233  H HG23   . VAL D 2 4  ? 7.226   -14.010 6.520   1.00 3.34  ? 4  VAL B HG23   2  
ATOM 5234  N N      . THR D 2 5  ? 5.929   -9.958  4.930   1.00 2.76  ? 5  THR B N      2  
ATOM 5235  C CA     . THR D 2 5  ? 5.916   -8.656  4.318   1.00 2.63  ? 5  THR B CA     2  
ATOM 5236  C C      . THR D 2 5  ? 7.368   -8.329  4.080   1.00 2.52  ? 5  THR B C      2  
ATOM 5237  O O      . THR D 2 5  ? 8.220   -8.861  4.788   1.00 2.57  ? 5  THR B O      2  
ATOM 5238  C CB     . THR D 2 5  ? 5.258   -7.605  5.237   1.00 2.87  ? 5  THR B CB     2  
ATOM 5239  O OG1    . THR D 2 5  ? 4.767   -8.228  6.435   1.00 3.17  ? 5  THR B OG1    2  
ATOM 5240  C CG2    . THR D 2 5  ? 4.106   -6.917  4.534   1.00 2.93  ? 5  THR B CG2    2  
ATOM 5241  H H      . THR D 2 5  ? 6.270   -10.054 5.845   1.00 2.93  ? 5  THR B H      2  
ATOM 5242  H HA     . THR D 2 5  ? 5.396   -8.702  3.369   1.00 2.49  ? 5  THR B HA     2  
ATOM 5243  H HB     . THR D 2 5  ? 5.998   -6.862  5.501   1.00 2.97  ? 5  THR B HB     2  
ATOM 5244  H HG1    . THR D 2 5  ? 5.477   -8.752  6.844   1.00 3.17  ? 5  THR B HG1    2  
ATOM 5245  H HG21   . THR D 2 5  ? 3.751   -6.099  5.144   1.00 3.24  ? 5  THR B HG21   2  
ATOM 5246  H HG22   . THR D 2 5  ? 3.307   -7.627  4.380   1.00 3.19  ? 5  THR B HG22   2  
ATOM 5247  H HG23   . THR D 2 5  ? 4.442   -6.539  3.580   1.00 2.94  ? 5  THR B HG23   2  
ATOM 5248  N N      . LEU D 2 6  ? 7.697   -7.504  3.105   1.00 2.40  ? 6  LEU B N      2  
ATOM 5249  C CA     . LEU D 2 6  ? 9.109   -7.214  2.874   1.00 2.35  ? 6  LEU B CA     2  
ATOM 5250  C C      . LEU D 2 6  ? 9.742   -6.602  4.128   1.00 2.56  ? 6  LEU B C      2  
ATOM 5251  O O      . LEU D 2 6  ? 10.956  -6.642  4.318   1.00 2.56  ? 6  LEU B O      2  
ATOM 5252  C CB     . LEU D 2 6  ? 9.288   -6.331  1.655   1.00 2.33  ? 6  LEU B CB     2  
ATOM 5253  C CG     . LEU D 2 6  ? 10.059  -6.965  0.514   1.00 2.21  ? 6  LEU B CG     2  
ATOM 5254  C CD1    . LEU D 2 6  ? 10.219  -5.980  -0.632  1.00 2.35  ? 6  LEU B CD1    2  
ATOM 5255  C CD2    . LEU D 2 6  ? 11.413  -7.454  0.998   1.00 2.15  ? 6  LEU B CD2    2  
ATOM 5256  H H      . LEU D 2 6  ? 6.997   -7.084  2.545   1.00 2.38  ? 6  LEU B H      2  
ATOM 5257  H HA     . LEU D 2 6  ? 9.596   -8.158  2.686   1.00 2.25  ? 6  LEU B HA     2  
ATOM 5258  H HB2    . LEU D 2 6  ? 8.305   -6.056  1.297   1.00 2.34  ? 6  LEU B HB2    2  
ATOM 5259  H HB3    . LEU D 2 6  ? 9.813   -5.439  1.956   1.00 2.47  ? 6  LEU B HB3    2  
ATOM 5260  H HG     . LEU D 2 6  ? 9.503   -7.814  0.155   1.00 2.13  ? 6  LEU B HG     2  
ATOM 5261  H HD11   . LEU D 2 6  ? 10.721  -5.092  -0.273  1.00 2.50  ? 6  LEU B HD11   2  
ATOM 5262  H HD12   . LEU D 2 6  ? 9.246   -5.711  -1.016  1.00 2.75  ? 6  LEU B HD12   2  
ATOM 5263  H HD13   . LEU D 2 6  ? 10.807  -6.431  -1.418  1.00 2.54  ? 6  LEU B HD13   2  
ATOM 5264  H HD21   . LEU D 2 6  ? 11.873  -8.064  0.233   1.00 2.43  ? 6  LEU B HD21   2  
ATOM 5265  H HD22   . LEU D 2 6  ? 11.282  -8.040  1.899   1.00 2.57  ? 6  LEU B HD22   2  
ATOM 5266  H HD23   . LEU D 2 6  ? 12.047  -6.605  1.212   1.00 2.08  ? 6  LEU B HD23   2  
ATOM 5267  N N      . TYR D 2 7  ? 8.881   -6.050  4.977   1.00 2.79  ? 7  TYR B N      2  
ATOM 5268  C CA     . TYR D 2 7  ? 9.283   -5.468  6.260   1.00 3.08  ? 7  TYR B CA     2  
ATOM 5269  C C      . TYR D 2 7  ? 9.868   -6.557  7.160   1.00 3.12  ? 7  TYR B C      2  
ATOM 5270  O O      . TYR D 2 7  ? 10.827  -6.343  7.892   1.00 3.25  ? 7  TYR B O      2  
ATOM 5271  C CB     . TYR D 2 7  ? 8.060   -4.876  6.966   1.00 3.33  ? 7  TYR B CB     2  
ATOM 5272  C CG     . TYR D 2 7  ? 7.895   -3.376  6.874   1.00 3.53  ? 7  TYR B CG     2  
ATOM 5273  C CD1    . TYR D 2 7  ? 9.008   -2.582  6.650   1.00 3.59  ? 7  TYR B CD1    2  
ATOM 5274  C CD2    . TYR D 2 7  ? 6.653   -2.754  6.973   1.00 3.70  ? 7  TYR B CD2    2  
ATOM 5275  C CE1    . TYR D 2 7  ? 8.898   -1.216  6.523   1.00 3.84  ? 7  TYR B CE1    2  
ATOM 5276  C CE2    . TYR D 2 7  ? 6.537   -1.382  6.853   1.00 3.93  ? 7  TYR B CE2    2  
ATOM 5277  C CZ     . TYR D 2 7  ? 7.527   -0.624  6.785   1.00 4.03  ? 7  TYR B CZ     2  
ATOM 5278  O OH     . TYR D 2 7  ? 7.546   0.744   6.493   1.00 4.28  ? 7  TYR B OH     2  
ATOM 5279  H H      . TYR D 2 7  ? 7.938   -6.038  4.729   1.00 2.78  ? 7  TYR B H      2  
ATOM 5280  H HA     . TYR D 2 7  ? 10.018  -4.697  6.086   1.00 3.13  ? 7  TYR B HA     2  
ATOM 5281  H HB2    . TYR D 2 7  ? 7.169   -5.315  6.545   1.00 3.22  ? 7  TYR B HB2    2  
ATOM 5282  H HB3    . TYR D 2 7  ? 8.109   -5.134  8.015   1.00 3.51  ? 7  TYR B HB3    2  
ATOM 5283  H HD1    . TYR D 2 7  ? 9.979   -3.052  6.577   1.00 3.48  ? 7  TYR B HD1    2  
ATOM 5284  H HD2    . TYR D 2 7  ? 5.769   -3.349  7.164   1.00 3.69  ? 7  TYR B HD2    2  
ATOM 5285  H HE1    . TYR D 2 7  ? 9.779   -0.620  6.349   1.00 3.93  ? 7  TYR B HE1    2  
ATOM 5286  H HE2    . TYR D 2 7  ? 5.568   -0.915  6.935   1.00 4.07  ? 7  TYR B HE2    2  
ATOM 5287  H HH     . TYR D 2 7  ? 8.041   1.032   5.719   1.00 4.42  ? 7  TYR B HH     2  
ATOM 5288  N N      . ASP D 2 8  ? 9.275   -7.740  7.047   1.00 3.03  ? 8  ASP B N      2  
ATOM 5289  C CA     . ASP D 2 8  ? 9.644   -8.912  7.835   1.00 3.14  ? 8  ASP B CA     2  
ATOM 5290  C C      . ASP D 2 8  ? 11.043  -9.362  7.474   1.00 2.96  ? 8  ASP B C      2  
ATOM 5291  O O      . ASP D 2 8  ? 11.857  -9.660  8.346   1.00 3.10  ? 8  ASP B O      2  
ATOM 5292  C CB     . ASP D 2 8  ? 8.635   -10.045 7.589   1.00 3.13  ? 8  ASP B CB     2  
ATOM 5293  C CG     . ASP D 2 8  ? 7.312   -9.830  8.300   1.00 3.41  ? 8  ASP B CG     2  
ATOM 5294  O OD1    . ASP D 2 8  ? 7.335   -9.570  9.524   1.00 3.77  ? 8  ASP B OD1    2  
ATOM 5295  O OD2    . ASP D 2 8  ? 6.252   -9.910  7.650   1.00 3.29  ? 8  ASP B OD2    2  
ATOM 5296  H H      . ASP D 2 8  ? 8.590   -7.841  6.367   1.00 2.92  ? 8  ASP B H      2  
ATOM 5297  H HA     . ASP D 2 8  ? 9.623   -8.650  8.873   1.00 3.38  ? 8  ASP B HA     2  
ATOM 5298  H HB2    . ASP D 2 8  ? 8.436   -10.101 6.530   1.00 2.91  ? 8  ASP B HB2    2  
ATOM 5299  H HB3    . ASP D 2 8  ? 9.049   -10.984 7.918   1.00 3.19  ? 8  ASP B HB3    2  
ATOM 5300  N N      . VAL D 2 9  ? 11.322  -9.387  6.179   1.00 2.68  ? 9  VAL B N      2  
ATOM 5301  C CA     . VAL D 2 9  ? 12.619  -9.792  5.686   1.00 2.52  ? 9  VAL B CA     2  
ATOM 5302  C C      . VAL D 2 9  ? 13.645  -8.761  6.095   1.00 2.58  ? 9  VAL B C      2  
ATOM 5303  O O      . VAL D 2 9  ? 14.754  -9.079  6.509   1.00 2.60  ? 9  VAL B O      2  
ATOM 5304  C CB     . VAL D 2 9  ? 12.607  -9.930  4.158   1.00 2.28  ? 9  VAL B CB     2  
ATOM 5305  C CG1    . VAL D 2 9  ? 13.993  -10.221 3.635   1.00 2.17  ? 9  VAL B CG1    2  
ATOM 5306  C CG2    . VAL D 2 9  ? 11.644  -11.017 3.726   1.00 2.28  ? 9  VAL B CG2    2  
ATOM 5307  H H      . VAL D 2 9  ? 10.656  -9.061  5.541   1.00 2.61  ? 9  VAL B H      2  
ATOM 5308  H HA     . VAL D 2 9  ? 12.872  -10.748 6.125   1.00 2.58  ? 9  VAL B HA     2  
ATOM 5309  H HB     . VAL D 2 9  ? 12.273  -8.992  3.737   1.00 2.26  ? 9  VAL B HB     2  
ATOM 5310  H HG11   . VAL D 2 9  ? 13.925  -10.566 2.613   1.00 2.23  ? 9  VAL B HG11   2  
ATOM 5311  H HG12   . VAL D 2 9  ? 14.448  -10.988 4.249   1.00 2.42  ? 9  VAL B HG12   2  
ATOM 5312  H HG13   . VAL D 2 9  ? 14.589  -9.322  3.676   1.00 2.44  ? 9  VAL B HG13   2  
ATOM 5313  H HG21   . VAL D 2 9  ? 11.429  -11.662 4.567   1.00 2.69  ? 9  VAL B HG21   2  
ATOM 5314  H HG22   . VAL D 2 9  ? 12.097  -11.599 2.930   1.00 2.42  ? 9  VAL B HG22   2  
ATOM 5315  H HG23   . VAL D 2 9  ? 10.730  -10.566 3.374   1.00 2.37  ? 9  VAL B HG23   2  
ATOM 5316  N N      . ALA D 2 10 ? 13.232  -7.518  5.983   1.00 2.67  ? 10 ALA B N      2  
ATOM 5317  C CA     . ALA D 2 10 ? 14.070  -6.381  6.324   1.00 2.84  ? 10 ALA B CA     2  
ATOM 5318  C C      . ALA D 2 10 ? 14.478  -6.413  7.786   1.00 3.09  ? 10 ALA B C      2  
ATOM 5319  O O      . ALA D 2 10 ? 15.656  -6.274  8.117   1.00 3.13  ? 10 ALA B O      2  
ATOM 5320  C CB     . ALA D 2 10 ? 13.313  -5.113  6.000   1.00 2.99  ? 10 ALA B CB     2  
ATOM 5321  H H      . ALA D 2 10 ? 12.306  -7.359  5.661   1.00 2.66  ? 10 ALA B H      2  
ATOM 5322  H HA     . ALA D 2 10 ? 14.963  -6.415  5.719   1.00 2.72  ? 10 ALA B HA     2  
ATOM 5323  H HB1    . ALA D 2 10 ? 12.250  -5.335  5.986   1.00 3.15  ? 10 ALA B HB1    2  
ATOM 5324  H HB2    . ALA D 2 10 ? 13.619  -4.750  5.031   1.00 3.33  ? 10 ALA B HB2    2  
ATOM 5325  H HB3    . ALA D 2 10 ? 13.517  -4.366  6.750   1.00 3.08  ? 10 ALA B HB3    2  
ATOM 5326  N N      . GLU D 2 11 ? 13.506  -6.642  8.645   1.00 3.27  ? 11 GLU B N      2  
ATOM 5327  C CA     . GLU D 2 11 ? 13.744  -6.697  10.076  1.00 3.56  ? 11 GLU B CA     2  
ATOM 5328  C C      . GLU D 2 11 ? 14.637  -7.877  10.388  1.00 3.49  ? 11 GLU B C      2  
ATOM 5329  O O      . GLU D 2 11 ? 15.621  -7.759  11.115  1.00 3.61  ? 11 GLU B O      2  
ATOM 5330  C CB     . GLU D 2 11 ? 12.428  -6.796  10.854  1.00 3.79  ? 11 GLU B CB     2  
ATOM 5331  C CG     . GLU D 2 11 ? 11.654  -5.488  10.896  1.00 4.20  ? 11 GLU B CG     2  
ATOM 5332  C CD     . GLU D 2 11 ? 10.566  -5.482  11.951  1.00 4.71  ? 11 GLU B CD     2  
ATOM 5333  O OE1    . GLU D 2 11 ? 10.697  -6.222  12.947  1.00 4.85  ? 11 GLU B OE1    2  
ATOM 5334  O OE2    . GLU D 2 11 ? 9.568   -4.748  11.785  1.00 5.21  ? 11 GLU B OE2    2  
ATOM 5335  H H      . GLU D 2 11 ? 12.603  -6.815  8.301   1.00 3.22  ? 11 GLU B H      2  
ATOM 5336  H HA     . GLU D 2 11 ? 14.259  -5.789  10.358  1.00 3.71  ? 11 GLU B HA     2  
ATOM 5337  H HB2    . GLU D 2 11 ? 11.803  -7.546  10.391  1.00 3.82  ? 11 GLU B HB2    2  
ATOM 5338  H HB3    . GLU D 2 11 ? 12.643  -7.094  11.869  1.00 3.89  ? 11 GLU B HB3    2  
ATOM 5339  H HG2    . GLU D 2 11 ? 12.343  -4.686  11.108  1.00 4.39  ? 11 GLU B HG2    2  
ATOM 5340  H HG3    . GLU D 2 11 ? 11.200  -5.324  9.929   1.00 4.27  ? 11 GLU B HG3    2  
ATOM 5341  N N      . TYR D 2 12 ? 14.269  -9.021  9.835   1.00 3.31  ? 12 TYR B N      2  
ATOM 5342  C CA     . TYR D 2 12 ? 15.016  -10.251 10.020  1.00 3.27  ? 12 TYR B CA     2  
ATOM 5343  C C      . TYR D 2 12 ? 16.449  -10.128 9.487   1.00 3.07  ? 12 TYR B C      2  
ATOM 5344  O O      . TYR D 2 12 ? 17.358  -10.801 9.977   1.00 3.12  ? 12 TYR B O      2  
ATOM 5345  C CB     . TYR D 2 12 ? 14.281  -11.381 9.309   1.00 3.15  ? 12 TYR B CB     2  
ATOM 5346  C CG     . TYR D 2 12 ? 14.860  -12.748 9.552   1.00 3.21  ? 12 TYR B CG     2  
ATOM 5347  C CD1    . TYR D 2 12 ? 14.904  -13.300 10.823  1.00 3.52  ? 12 TYR B CD1    2  
ATOM 5348  C CD2    . TYR D 2 12 ? 15.351  -13.489 8.497   1.00 3.01  ? 12 TYR B CD2    2  
ATOM 5349  C CE1    . TYR D 2 12 ? 15.427  -14.561 11.028  1.00 3.62  ? 12 TYR B CE1    2  
ATOM 5350  C CE2    . TYR D 2 12 ? 15.873  -14.743 8.688   1.00 3.12  ? 12 TYR B CE2    2  
ATOM 5351  C CZ     . TYR D 2 12 ? 15.910  -15.280 9.957   1.00 3.42  ? 12 TYR B CZ     2  
ATOM 5352  O OH     . TYR D 2 12 ? 16.432  -16.536 10.163  1.00 3.57  ? 12 TYR B OH     2  
ATOM 5353  H H      . TYR D 2 12 ? 13.460  -9.039  9.274   1.00 3.23  ? 12 TYR B H      2  
ATOM 5354  H HA     . TYR D 2 12 ? 15.050  -10.464 11.077  1.00 3.51  ? 12 TYR B HA     2  
ATOM 5355  H HB2    . TYR D 2 12 ? 13.256  -11.396 9.637   1.00 3.30  ? 12 TYR B HB2    2  
ATOM 5356  H HB3    . TYR D 2 12 ? 14.306  -11.199 8.242   1.00 2.92  ? 12 TYR B HB3    2  
ATOM 5357  H HD1    . TYR D 2 12 ? 14.523  -12.732 11.657  1.00 3.72  ? 12 TYR B HD1    2  
ATOM 5358  H HD2    . TYR D 2 12 ? 15.327  -13.062 7.495   1.00 2.79  ? 12 TYR B HD2    2  
ATOM 5359  H HE1    . TYR D 2 12 ? 15.455  -14.978 12.025  1.00 3.88  ? 12 TYR B HE1    2  
ATOM 5360  H HE2    . TYR D 2 12 ? 16.241  -15.299 7.835   1.00 3.02  ? 12 TYR B HE2    2  
ATOM 5361  H HH     . TYR D 2 12 ? 17.270  -16.621 9.686   1.00 3.54  ? 12 TYR B HH     2  
ATOM 5362  N N      . ALA D 2 13 ? 16.657  -9.262  8.494   1.00 2.88  ? 13 ALA B N      2  
ATOM 5363  C CA     . ALA D 2 13 ? 17.985  -9.075  7.921   1.00 2.72  ? 13 ALA B CA     2  
ATOM 5364  C C      . ALA D 2 13 ? 18.741  -8.036  8.731   1.00 2.94  ? 13 ALA B C      2  
ATOM 5365  O O      . ALA D 2 13 ? 19.978  -8.010  8.756   1.00 2.90  ? 13 ALA B O      2  
ATOM 5366  C CB     . ALA D 2 13 ? 17.882  -8.638  6.476   1.00 2.52  ? 13 ALA B CB     2  
ATOM 5367  H H      . ALA D 2 13 ? 15.901  -8.716  8.151   1.00 2.87  ? 13 ALA B H      2  
ATOM 5368  H HA     . ALA D 2 13 ? 18.512  -10.026 7.951   1.00 2.64  ? 13 ALA B HA     2  
ATOM 5369  H HB1    . ALA D 2 13 ? 17.338  -9.384  5.911   1.00 2.64  ? 13 ALA B HB1    2  
ATOM 5370  H HB2    . ALA D 2 13 ? 18.876  -8.523  6.063   1.00 2.61  ? 13 ALA B HB2    2  
ATOM 5371  H HB3    . ALA D 2 13 ? 17.363  -7.693  6.428   1.00 2.81  ? 13 ALA B HB3    2  
ATOM 5372  N N      . GLY D 2 14 ? 17.979  -7.164  9.375   1.00 3.18  ? 14 GLY B N      2  
ATOM 5373  C CA     . GLY D 2 14 ? 18.554  -6.130  10.207  1.00 3.46  ? 14 GLY B CA     2  
ATOM 5374  C C      . GLY D 2 14 ? 18.872  -4.900  9.417   1.00 3.50  ? 14 GLY B C      2  
ATOM 5375  O O      . GLY D 2 14 ? 19.803  -4.157  9.729   1.00 3.66  ? 14 GLY B O      2  
ATOM 5376  H H      . GLY D 2 14 ? 17.009  -7.195  9.245   1.00 3.18  ? 14 GLY B H      2  
ATOM 5377  H HA2    . GLY D 2 14 ? 17.860  -5.879  10.978  1.00 3.68  ? 14 GLY B HA2    2  
ATOM 5378  H HA3    . GLY D 2 14 ? 19.462  -6.511  10.635  1.00 3.48  ? 14 GLY B HA3    2  
ATOM 5379  N N      . VAL D 2 15 ? 18.075  -4.683  8.401   1.00 3.38  ? 15 VAL B N      2  
ATOM 5380  C CA     . VAL D 2 15 ? 18.270  -3.580  7.474   1.00 3.45  ? 15 VAL B CA     2  
ATOM 5381  C C      . VAL D 2 15 ? 16.940  -2.959  7.106   1.00 3.53  ? 15 VAL B C      2  
ATOM 5382  O O      . VAL D 2 15 ? 15.916  -3.624  7.185   1.00 3.41  ? 15 VAL B O      2  
ATOM 5383  C CB     . VAL D 2 15 ? 18.996  -4.058  6.209   1.00 3.19  ? 15 VAL B CB     2  
ATOM 5384  C CG1    . VAL D 2 15 ? 20.440  -4.368  6.532   1.00 3.17  ? 15 VAL B CG1    2  
ATOM 5385  C CG2    . VAL D 2 15 ? 18.310  -5.284  5.654   1.00 2.87  ? 15 VAL B CG2    2  
ATOM 5386  H H      . VAL D 2 15 ? 17.277  -5.265  8.289   1.00 3.27  ? 15 VAL B H      2  
ATOM 5387  H HA     . VAL D 2 15 ? 18.886  -2.830  7.964   1.00 3.67  ? 15 VAL B HA     2  
ATOM 5388  H HB     . VAL D 2 15 ? 18.957  -3.274  5.463   1.00 3.28  ? 15 VAL B HB     2  
ATOM 5389  H HG11   . VAL D 2 15 ? 20.949  -4.675  5.637   1.00 3.03  ? 15 VAL B HG11   2  
ATOM 5390  H HG12   . VAL D 2 15 ? 20.473  -5.165  7.267   1.00 3.56  ? 15 VAL B HG12   2  
ATOM 5391  H HG13   . VAL D 2 15 ? 20.911  -3.486  6.939   1.00 3.36  ? 15 VAL B HG13   2  
ATOM 5392  H HG21   . VAL D 2 15 ? 17.361  -4.997  5.226   1.00 3.03  ? 15 VAL B HG21   2  
ATOM 5393  H HG22   . VAL D 2 15 ? 18.141  -5.990  6.462   1.00 3.14  ? 15 VAL B HG22   2  
ATOM 5394  H HG23   . VAL D 2 15 ? 18.934  -5.732  4.896   1.00 2.77  ? 15 VAL B HG23   2  
ATOM 5395  N N      . SER D 2 16 ? 16.943  -1.679  6.785   1.00 3.79  ? 16 SER B N      2  
ATOM 5396  C CA     . SER D 2 16 ? 15.711  -0.986  6.422   1.00 3.90  ? 16 SER B CA     2  
ATOM 5397  C C      . SER D 2 16 ? 14.961  -1.754  5.356   1.00 3.60  ? 16 SER B C      2  
ATOM 5398  O O      . SER D 2 16 ? 15.538  -2.536  4.602   1.00 3.35  ? 16 SER B O      2  
ATOM 5399  C CB     . SER D 2 16 ? 16.028  0.399   5.896   1.00 4.20  ? 16 SER B CB     2  
ATOM 5400  O OG     . SER D 2 16 ? 17.004  1.037   6.701   1.00 4.38  ? 16 SER B OG     2  
ATOM 5401  H H      . SER D 2 16 ? 17.800  -1.193  6.739   1.00 3.90  ? 16 SER B H      2  
ATOM 5402  H HA     . SER D 2 16 ? 15.065  -0.908  7.288   1.00 4.02  ? 16 SER B HA     2  
ATOM 5403  H HB2    . SER D 2 16 ? 16.404  0.313   4.889   1.00 4.25  ? 16 SER B HB2    2  
ATOM 5404  H HB3    . SER D 2 16 ? 15.129  0.995   5.903   1.00 4.41  ? 16 SER B HB3    2  
ATOM 5405  H HG     . SER D 2 16 ? 17.127  1.945   6.401   1.00 4.40  ? 16 SER B HG     2  
ATOM 5406  N N      . TYR D 2 17 ? 13.661  -1.518  5.295   1.00 3.62  ? 17 TYR B N      2  
ATOM 5407  C CA     . TYR D 2 17 ? 12.793  -2.177  4.334   1.00 3.38  ? 17 TYR B CA     2  
ATOM 5408  C C      . TYR D 2 17 ? 13.372  -2.025  2.955   1.00 3.32  ? 17 TYR B C      2  
ATOM 5409  O O      . TYR D 2 17 ? 13.701  -3.012  2.306   1.00 3.10  ? 17 TYR B O      2  
ATOM 5410  C CB     . TYR D 2 17 ? 11.460  -1.456  4.423   1.00 3.51  ? 17 TYR B CB     2  
ATOM 5411  C CG     . TYR D 2 17 ? 10.426  -1.936  3.484   1.00 3.30  ? 17 TYR B CG     2  
ATOM 5412  C CD1    . TYR D 2 17 ? 9.957   -3.215  3.590   1.00 3.03  ? 17 TYR B CD1    2  
ATOM 5413  C CD2    . TYR D 2 17 ? 9.872   -1.095  2.534   1.00 3.42  ? 17 TYR B CD2    2  
ATOM 5414  C CE1    . TYR D 2 17 ? 8.965   -3.668  2.792   1.00 2.87  ? 17 TYR B CE1    2  
ATOM 5415  C CE2    . TYR D 2 17 ? 8.869   -1.549  1.700   1.00 3.26  ? 17 TYR B CE2    2  
ATOM 5416  C CZ     . TYR D 2 17 ? 8.413   -2.850  1.846   1.00 2.94  ? 17 TYR B CZ     2  
ATOM 5417  O OH     . TYR D 2 17 ? 7.412   -3.333  1.049   1.00 2.85  ? 17 TYR B OH     2  
ATOM 5418  H H      . TYR D 2 17 ? 13.271  -0.851  5.912   1.00 3.82  ? 17 TYR B H      2  
ATOM 5419  H HA     . TYR D 2 17 ? 12.663  -3.229  4.564   1.00 3.19  ? 17 TYR B HA     2  
ATOM 5420  H HB2    . TYR D 2 17 ? 11.055  -1.551  5.421   1.00 3.59  ? 17 TYR B HB2    2  
ATOM 5421  H HB3    . TYR D 2 17 ? 11.627  -0.421  4.217   1.00 3.73  ? 17 TYR B HB3    2  
ATOM 5422  H HD1    . TYR D 2 17 ? 10.403  -3.869  4.318   1.00 2.98  ? 17 TYR B HD1    2  
ATOM 5423  H HD2    . TYR D 2 17 ? 10.244  -0.089  2.430   1.00 3.67  ? 17 TYR B HD2    2  
ATOM 5424  H HE1    . TYR D 2 17 ? 8.624   -4.684  2.909   1.00 2.70  ? 17 TYR B HE1    2  
ATOM 5425  H HE2    . TYR D 2 17 ? 8.445   -0.891  0.969   1.00 3.39  ? 17 TYR B HE2    2  
ATOM 5426  H HH     . TYR D 2 17 ? 6.558   -3.034  1.369   1.00 3.14  ? 17 TYR B HH     2  
ATOM 5427  N N      . GLN D 2 18 ? 13.557  -0.770  2.519   1.00 3.58  ? 18 GLN B N      2  
ATOM 5428  C CA     . GLN D 2 18 ? 14.117  -0.503  1.211   1.00 3.64  ? 18 GLN B CA     2  
ATOM 5429  C C      . GLN D 2 18 ? 15.618  -0.765  1.151   1.00 3.63  ? 18 GLN B C      2  
ATOM 5430  O O      . GLN D 2 18 ? 16.312  -0.382  0.198   1.00 3.77  ? 18 GLN B O      2  
ATOM 5431  C CB     . GLN D 2 18 ? 13.732  0.861   0.711   1.00 3.96  ? 18 GLN B CB     2  
ATOM 5432  C CG     . GLN D 2 18 ? 13.759  1.901   1.799   1.00 4.35  ? 18 GLN B CG     2  
ATOM 5433  C CD     . GLN D 2 18 ? 14.319  3.245   1.368   1.00 4.69  ? 18 GLN B CD     2  
ATOM 5434  O OE1    . GLN D 2 18 ? 14.633  4.074   2.215   1.00 5.01  ? 18 GLN B OE1    2  
ATOM 5435  N NE2    . GLN D 2 18 ? 14.543  3.427   0.067   1.00 5.04  ? 18 GLN B NE2    2  
ATOM 5436  H H      . GLN D 2 18 ? 13.288  -0.007  3.083   1.00 3.77  ? 18 GLN B H      2  
ATOM 5437  H HA     . GLN D 2 18 ? 13.644  -1.247  0.546   1.00 3.47  ? 18 GLN B HA     2  
ATOM 5438  H HB2    . GLN D 2 18 ? 14.386  1.133   -0.101  1.00 4.06  ? 18 GLN B HB2    2  
ATOM 5439  H HB3    . GLN D 2 18 ? 12.721  0.774   0.349   1.00 4.11  ? 18 GLN B HB3    2  
ATOM 5440  H HG2    . GLN D 2 18 ? 12.761  2.053   2.132   1.00 4.60  ? 18 GLN B HG2    2  
ATOM 5441  H HG3    . GLN D 2 18 ? 14.342  1.527   2.626   1.00 4.54  ? 18 GLN B HG3    2  
ATOM 5442  H HE21   . GLN D 2 18 ? 14.345  2.688   -0.550  1.00 5.02  ? 18 GLN B HE21   2  
ATOM 5443  H HE22   . GLN D 2 18 ? 14.842  4.300   -0.235  1.00 5.51  ? 18 GLN B HE22   2  
ATOM 5444  N N      . THR D 2 19 ? 16.152  -1.354  2.208   1.00 3.52  ? 19 THR B N      2  
ATOM 5445  C CA     . THR D 2 19 ? 17.525  -1.742  2.124   1.00 3.47  ? 19 THR B CA     2  
ATOM 5446  C C      . THR D 2 19 ? 17.465  -2.968  1.218   1.00 3.18  ? 19 THR B C      2  
ATOM 5447  O O      . THR D 2 19 ? 18.101  -3.047  0.154   1.00 3.24  ? 19 THR B O      2  
ATOM 5448  C CB     . THR D 2 19 ? 18.222  -2.118  3.476   1.00 3.43  ? 19 THR B CB     2  
ATOM 5449  O OG1    . THR D 2 19 ? 18.332  -1.013  4.407   1.00 3.78  ? 19 THR B OG1    2  
ATOM 5450  C CG2    . THR D 2 19 ? 19.613  -2.672  3.223   1.00 3.34  ? 19 THR B CG2    2  
ATOM 5451  H H      . THR D 2 19 ? 15.598  -1.606  2.978   1.00 3.48  ? 19 THR B H      2  
ATOM 5452  H HA     . THR D 2 19 ? 18.049  -0.944  1.619   1.00 3.69  ? 19 THR B HA     2  
ATOM 5453  H HB     . THR D 2 19 ? 17.645  -2.914  3.935   1.00 3.24  ? 19 THR B HB     2  
ATOM 5454  H HG1    . THR D 2 19 ? 18.073  -0.187  3.995   1.00 4.01  ? 19 THR B HG1    2  
ATOM 5455  H HG21   . THR D 2 19 ? 19.537  -3.564  2.616   1.00 3.59  ? 19 THR B HG21   2  
ATOM 5456  H HG22   . THR D 2 19 ? 20.064  -2.923  4.165   1.00 3.30  ? 19 THR B HG22   2  
ATOM 5457  H HG23   . THR D 2 19 ? 20.209  -1.943  2.713   1.00 3.50  ? 19 THR B HG23   2  
ATOM 5458  N N      . VAL D 2 20 ? 16.659  -3.917  1.711   1.00 2.93  ? 20 VAL B N      2  
ATOM 5459  C CA     . VAL D 2 20 ? 16.328  -5.165  1.040   1.00 2.66  ? 20 VAL B CA     2  
ATOM 5460  C C      . VAL D 2 20 ? 15.264  -5.001  -0.050  1.00 2.69  ? 20 VAL B C      2  
ATOM 5461  O O      . VAL D 2 20 ? 15.296  -5.706  -1.055  1.00 2.62  ? 20 VAL B O      2  
ATOM 5462  C CB     . VAL D 2 20 ? 15.917  -6.284  2.040   1.00 2.44  ? 20 VAL B CB     2  
ATOM 5463  C CG1    . VAL D 2 20 ? 16.015  -5.832  3.492   1.00 2.57  ? 20 VAL B CG1    2  
ATOM 5464  C CG2    . VAL D 2 20 ? 14.532  -6.824  1.795   1.00 2.33  ? 20 VAL B CG2    2  
ATOM 5465  H H      . VAL D 2 20 ? 16.250  -3.750  2.576   1.00 2.96  ? 20 VAL B H      2  
ATOM 5466  H HA     . VAL D 2 20 ? 17.223  -5.483  0.540   1.00 2.66  ? 20 VAL B HA     2  
ATOM 5467  H HB     . VAL D 2 20 ? 16.605  -7.101  1.890   1.00 2.32  ? 20 VAL B HB     2  
ATOM 5468  H HG11   . VAL D 2 20 ? 15.259  -5.087  3.699   1.00 2.83  ? 20 VAL B HG11   2  
ATOM 5469  H HG12   . VAL D 2 20 ? 16.996  -5.417  3.683   1.00 2.88  ? 20 VAL B HG12   2  
ATOM 5470  H HG13   . VAL D 2 20 ? 15.861  -6.685  4.133   1.00 2.66  ? 20 VAL B HG13   2  
ATOM 5471  H HG21   . VAL D 2 20 ? 14.474  -7.806  2.238   1.00 2.42  ? 20 VAL B HG21   2  
ATOM 5472  H HG22   . VAL D 2 20 ? 14.356  -6.884  0.734   1.00 2.66  ? 20 VAL B HG22   2  
ATOM 5473  H HG23   . VAL D 2 20 ? 13.793  -6.170  2.252   1.00 2.45  ? 20 VAL B HG23   2  
ATOM 5474  N N      . SER D 2 21 ? 14.302  -4.119  0.122   1.00 2.83  ? 21 SER B N      2  
ATOM 5475  C CA     . SER D 2 21 ? 13.292  -3.947  -0.913  1.00 2.87  ? 21 SER B CA     2  
ATOM 5476  C C      . SER D 2 21 ? 13.953  -3.405  -2.166  1.00 3.09  ? 21 SER B C      2  
ATOM 5477  O O      . SER D 2 21 ? 13.505  -3.655  -3.275  1.00 3.10  ? 21 SER B O      2  
ATOM 5478  C CB     . SER D 2 21 ? 12.180  -3.021  -0.465  1.00 3.04  ? 21 SER B CB     2  
ATOM 5479  O OG     . SER D 2 21 ? 11.612  -3.459  0.759   1.00 3.23  ? 21 SER B OG     2  
ATOM 5480  H H      . SER D 2 21 ? 14.261  -3.590  0.944   1.00 2.92  ? 21 SER B H      2  
ATOM 5481  H HA     . SER D 2 21 ? 12.879  -4.925  -1.136  1.00 2.67  ? 21 SER B HA     2  
ATOM 5482  H HB2    . SER D 2 21 ? 12.586  -2.032  -0.340  1.00 3.19  ? 21 SER B HB2    2  
ATOM 5483  H HB3    . SER D 2 21 ? 11.412  -3.005  -1.224  1.00 3.31  ? 21 SER B HB3    2  
ATOM 5484  H HG     . SER D 2 21 ? 12.272  -3.945  1.265   1.00 3.29  ? 21 SER B HG     2  
ATOM 5485  N N      . ARG D 2 22 ? 15.030  -2.664  -1.980  1.00 3.32  ? 22 ARG B N      2  
ATOM 5486  C CA     . ARG D 2 22 ? 15.782  -2.157  -3.101  1.00 3.59  ? 22 ARG B CA     2  
ATOM 5487  C C      . ARG D 2 22 ? 16.358  -3.354  -3.823  1.00 3.45  ? 22 ARG B C      2  
ATOM 5488  O O      . ARG D 2 22 ? 16.422  -3.400  -5.043  1.00 3.63  ? 22 ARG B O      2  
ATOM 5489  C CB     . ARG D 2 22 ? 16.905  -1.257  -2.592  1.00 3.86  ? 22 ARG B CB     2  
ATOM 5490  C CG     . ARG D 2 22 ? 17.053  0.072   -3.319  1.00 4.07  ? 22 ARG B CG     2  
ATOM 5491  C CD     . ARG D 2 22 ? 18.219  0.874   -2.755  1.00 4.20  ? 22 ARG B CD     2  
ATOM 5492  N NE     . ARG D 2 22 ? 18.410  2.131   -3.482  1.00 4.64  ? 22 ARG B NE     2  
ATOM 5493  C CZ     . ARG D 2 22 ? 19.587  2.739   -3.642  1.00 4.85  ? 22 ARG B CZ     2  
ATOM 5494  N NH1    . ARG D 2 22 ? 20.688  2.206   -3.121  1.00 4.70  ? 22 ARG B NH1    2  
ATOM 5495  N NH2    . ARG D 2 22 ? 19.656  3.876   -4.337  1.00 5.40  ? 22 ARG B NH2    2  
ATOM 5496  H H      . ARG D 2 22 ? 15.326  -2.455  -1.070  1.00 3.32  ? 22 ARG B H      2  
ATOM 5497  H HA     . ARG D 2 22 ? 15.123  -1.622  -3.759  1.00 3.73  ? 22 ARG B HA     2  
ATOM 5498  H HB2    . ARG D 2 22 ? 16.721  -1.046  -1.549  1.00 4.20  ? 22 ARG B HB2    2  
ATOM 5499  H HB3    . ARG D 2 22 ? 17.839  -1.796  -2.680  1.00 3.75  ? 22 ARG B HB3    2  
ATOM 5500  H HG2    . ARG D 2 22 ? 17.226  -0.109  -4.373  1.00 3.96  ? 22 ARG B HG2    2  
ATOM 5501  H HG3    . ARG D 2 22 ? 16.144  0.643   -3.195  1.00 4.42  ? 22 ARG B HG3    2  
ATOM 5502  H HD2    . ARG D 2 22 ? 18.019  1.088   -1.709  1.00 3.97  ? 22 ARG B HD2    2  
ATOM 5503  H HD3    . ARG D 2 22 ? 19.118  0.280   -2.829  1.00 4.38  ? 22 ARG B HD3    2  
ATOM 5504  H HE     . ARG D 2 22 ? 17.613  2.541   -3.878  1.00 4.91  ? 22 ARG B HE     2  
ATOM 5505  H HH11   . ARG D 2 22 ? 20.635  1.347   -2.606  1.00 4.47  ? 22 ARG B HH11   2  
ATOM 5506  H HH12   . ARG D 2 22 ? 21.573  2.658   -3.232  1.00 4.95  ? 22 ARG B HH12   2  
ATOM 5507  H HH21   . ARG D 2 22 ? 18.820  4.283   -4.735  1.00 5.70  ? 22 ARG B HH21   2  
ATOM 5508  H HH22   . ARG D 2 22 ? 20.538  4.333   -4.484  1.00 5.62  ? 22 ARG B HH22   2  
ATOM 5509  N N      . VAL D 2 23 ? 16.723  -4.335  -3.019  1.00 3.17  ? 23 VAL B N      2  
ATOM 5510  C CA     . VAL D 2 23 ? 17.270  -5.584  -3.484  1.00 3.05  ? 23 VAL B CA     2  
ATOM 5511  C C      . VAL D 2 23 ? 16.226  -6.308  -4.339  1.00 3.00  ? 23 VAL B C      2  
ATOM 5512  O O      . VAL D 2 23 ? 16.486  -6.680  -5.484  1.00 3.18  ? 23 VAL B O      2  
ATOM 5513  C CB     . VAL D 2 23 ? 17.647  -6.428  -2.247  1.00 2.77  ? 23 VAL B CB     2  
ATOM 5514  C CG1    . VAL D 2 23 ? 18.115  -7.813  -2.609  1.00 2.66  ? 23 VAL B CG1    2  
ATOM 5515  C CG2    . VAL D 2 23 ? 18.688  -5.708  -1.395  1.00 2.87  ? 23 VAL B CG2    2  
ATOM 5516  H H      . VAL D 2 23 ? 16.598  -4.215  -2.062  1.00 3.07  ? 23 VAL B H      2  
ATOM 5517  H HA     . VAL D 2 23 ? 18.158  -5.391  -4.057  1.00 3.24  ? 23 VAL B HA     2  
ATOM 5518  H HB     . VAL D 2 23 ? 16.757  -6.531  -1.647  1.00 2.62  ? 23 VAL B HB     2  
ATOM 5519  H HG11   . VAL D 2 23 ? 17.455  -8.230  -3.351  1.00 2.82  ? 23 VAL B HG11   2  
ATOM 5520  H HG12   . VAL D 2 23 ? 18.093  -8.426  -1.715  1.00 3.01  ? 23 VAL B HG12   2  
ATOM 5521  H HG13   . VAL D 2 23 ? 19.118  -7.764  -2.994  1.00 2.64  ? 23 VAL B HG13   2  
ATOM 5522  H HG21   . VAL D 2 23 ? 19.146  -6.408  -0.712  1.00 2.87  ? 23 VAL B HG21   2  
ATOM 5523  H HG22   . VAL D 2 23 ? 18.203  -4.921  -0.823  1.00 3.44  ? 23 VAL B HG22   2  
ATOM 5524  H HG23   . VAL D 2 23 ? 19.444  -5.276  -2.036  1.00 2.86  ? 23 VAL B HG23   2  
ATOM 5525  N N      . VAL D 2 24 ? 15.033  -6.472  -3.766  1.00 2.81  ? 24 VAL B N      2  
ATOM 5526  C CA     . VAL D 2 24 ? 13.903  -7.120  -4.436  1.00 2.77  ? 24 VAL B CA     2  
ATOM 5527  C C      . VAL D 2 24 ? 13.357  -6.267  -5.597  1.00 3.04  ? 24 VAL B C      2  
ATOM 5528  O O      . VAL D 2 24 ? 12.712  -6.782  -6.508  1.00 3.12  ? 24 VAL B O      2  
ATOM 5529  C CB     . VAL D 2 24 ? 12.771  -7.447  -3.421  1.00 2.53  ? 24 VAL B CB     2  
ATOM 5530  C CG1    . VAL D 2 24 ? 11.597  -8.140  -4.102  1.00 2.54  ? 24 VAL B CG1    2  
ATOM 5531  C CG2    . VAL D 2 24 ? 13.304  -8.318  -2.288  1.00 2.32  ? 24 VAL B CG2    2  
ATOM 5532  H H      . VAL D 2 24 ? 14.909  -6.147  -2.847  1.00 2.73  ? 24 VAL B H      2  
ATOM 5533  H HA     . VAL D 2 24 ? 14.259  -8.058  -4.842  1.00 2.77  ? 24 VAL B HA     2  
ATOM 5534  H HB     . VAL D 2 24 ? 12.415  -6.521  -2.995  1.00 2.58  ? 24 VAL B HB     2  
ATOM 5535  H HG11   . VAL D 2 24 ? 10.801  -8.293  -3.387  1.00 2.74  ? 24 VAL B HG11   2  
ATOM 5536  H HG12   . VAL D 2 24 ? 11.920  -9.093  -4.491  1.00 2.81  ? 24 VAL B HG12   2  
ATOM 5537  H HG13   . VAL D 2 24 ? 11.237  -7.523  -4.914  1.00 2.62  ? 24 VAL B HG13   2  
ATOM 5538  H HG21   . VAL D 2 24 ? 13.902  -7.716  -1.621  1.00 2.58  ? 24 VAL B HG21   2  
ATOM 5539  H HG22   . VAL D 2 24 ? 13.912  -9.110  -2.700  1.00 2.41  ? 24 VAL B HG22   2  
ATOM 5540  H HG23   . VAL D 2 24 ? 12.477  -8.752  -1.741  1.00 2.48  ? 24 VAL B HG23   2  
ATOM 5541  N N      . ASN D 2 25 ? 13.650  -4.966  -5.581  1.00 3.23  ? 25 ASN B N      2  
ATOM 5542  C CA     . ASN D 2 25 ? 13.153  -4.060  -6.621  1.00 3.51  ? 25 ASN B CA     2  
ATOM 5543  C C      . ASN D 2 25 ? 14.191  -3.883  -7.718  1.00 3.82  ? 25 ASN B C      2  
ATOM 5544  O O      . ASN D 2 25 ? 14.048  -3.012  -8.577  1.00 4.07  ? 25 ASN B O      2  
ATOM 5545  C CB     . ASN D 2 25 ? 12.784  -2.689  -6.034  1.00 3.62  ? 25 ASN B CB     2  
ATOM 5546  C CG     . ASN D 2 25 ? 11.306  -2.550  -5.674  1.00 3.46  ? 25 ASN B CG     2  
ATOM 5547  O OD1    . ASN D 2 25 ? 10.713  -1.494  -5.876  1.00 3.65  ? 25 ASN B OD1    2  
ATOM 5548  N ND2    . ASN D 2 25 ? 10.704  -3.598  -5.123  1.00 3.15  ? 25 ASN B ND2    2  
ATOM 5549  H H      . ASN D 2 25 ? 14.237  -4.606  -4.869  1.00 3.22  ? 25 ASN B H      2  
ATOM 5550  H HA     . ASN D 2 25 ? 12.269  -4.506  -7.051  1.00 3.45  ? 25 ASN B HA     2  
ATOM 5551  H HB2    . ASN D 2 25 ? 13.365  -2.525  -5.137  1.00 3.58  ? 25 ASN B HB2    2  
ATOM 5552  H HB3    . ASN D 2 25 ? 13.030  -1.925  -6.756  1.00 3.90  ? 25 ASN B HB3    2  
ATOM 5553  H HD21   . ASN D 2 25 ? 11.230  -4.411  -4.976  1.00 3.05  ? 25 ASN B HD21   2  
ATOM 5554  H HD22   . ASN D 2 25 ? 9.755   -3.509  -4.874  1.00 3.06  ? 25 ASN B HD22   2  
ATOM 5555  N N      . GLN D 2 26 ? 15.251  -4.695  -7.636  1.00 3.82  ? 26 GLN B N      2  
ATOM 5556  C CA     . GLN D 2 26 ? 16.355  -4.704  -8.603  1.00 4.12  ? 26 GLN B CA     2  
ATOM 5557  C C      . GLN D 2 26 ? 17.380  -3.689  -8.163  1.00 4.18  ? 26 GLN B C      2  
ATOM 5558  O O      . GLN D 2 26 ? 17.508  -2.599  -8.723  1.00 4.60  ? 26 GLN B O      2  
ATOM 5559  C CB     . GLN D 2 26 ? 15.895  -4.449  -10.046 1.00 4.50  ? 26 GLN B CB     2  
ATOM 5560  C CG     . GLN D 2 26 ? 15.108  -5.599  -10.651 1.00 4.96  ? 26 GLN B CG     2  
ATOM 5561  C CD     . GLN D 2 26 ? 13.922  -5.129  -11.473 1.00 5.50  ? 26 GLN B CD     2  
ATOM 5562  O OE1    . GLN D 2 26 ? 13.558  -5.745  -12.475 1.00 6.03  ? 26 GLN B OE1    2  
ATOM 5563  N NE2    . GLN D 2 26 ? 13.301  -4.040  -11.049 1.00 5.69  ? 26 GLN B NE2    2  
ATOM 5564  H H      . GLN D 2 26 ? 15.330  -5.267  -6.839  1.00 3.64  ? 26 GLN B H      2  
ATOM 5565  H HA     . GLN D 2 26 ? 16.812  -5.684  -8.552  1.00 4.11  ? 26 GLN B HA     2  
ATOM 5566  H HB2    . GLN D 2 26 ? 15.272  -3.566  -10.062 1.00 4.72  ? 26 GLN B HB2    2  
ATOM 5567  H HB3    . GLN D 2 26 ? 16.766  -4.273  -10.662 1.00 4.61  ? 26 GLN B HB3    2  
ATOM 5568  H HG2    . GLN D 2 26 ? 15.763  -6.172  -11.289 1.00 4.99  ? 26 GLN B HG2    2  
ATOM 5569  H HG3    . GLN D 2 26 ? 14.744  -6.229  -9.852  1.00 5.30  ? 26 GLN B HG3    2  
ATOM 5570  H HE21   . GLN D 2 26 ? 13.637  -3.600  -10.231 1.00 5.47  ? 26 GLN B HE21   2  
ATOM 5571  H HE22   . GLN D 2 26 ? 12.535  -3.715  -11.562 1.00 6.22  ? 26 GLN B HE22   2  
ATOM 5572  N N      . ALA D 2 27 ? 18.091  -4.075  -7.125  1.00 4.01  ? 27 ALA B N      2  
ATOM 5573  C CA     . ALA D 2 27 ? 19.095  -3.242  -6.511  1.00 4.07  ? 27 ALA B CA     2  
ATOM 5574  C C      . ALA D 2 27 ? 20.319  -3.058  -7.396  1.00 4.43  ? 27 ALA B C      2  
ATOM 5575  O O      . ALA D 2 27 ? 21.154  -3.954  -7.508  1.00 4.48  ? 27 ALA B O      2  
ATOM 5576  C CB     . ALA D 2 27 ? 19.492  -3.854  -5.189  1.00 3.82  ? 27 ALA B CB     2  
ATOM 5577  H H      . ALA D 2 27 ? 17.926  -4.964  -6.749  1.00 3.99  ? 27 ALA B H      2  
ATOM 5578  H HA     . ALA D 2 27 ? 18.643  -2.283  -6.309  1.00 4.11  ? 27 ALA B HA     2  
ATOM 5579  H HB1    . ALA D 2 27 ? 20.305  -4.546  -5.341  1.00 4.16  ? 27 ALA B HB1    2  
ATOM 5580  H HB2    . ALA D 2 27 ? 18.639  -4.386  -4.782  1.00 3.82  ? 27 ALA B HB2    2  
ATOM 5581  H HB3    . ALA D 2 27 ? 19.794  -3.077  -4.505  1.00 3.73  ? 27 ALA B HB3    2  
ATOM 5582  N N      . SER D 2 28 ? 20.419  -1.901  -8.025  1.00 4.78  ? 28 SER B N      2  
ATOM 5583  C CA     . SER D 2 28 ? 21.551  -1.603  -8.884  1.00 5.16  ? 28 SER B CA     2  
ATOM 5584  C C      . SER D 2 28 ? 22.712  -1.037  -8.067  1.00 5.18  ? 28 SER B C      2  
ATOM 5585  O O      . SER D 2 28 ? 23.845  -0.967  -8.542  1.00 5.42  ? 28 SER B O      2  
ATOM 5586  C CB     . SER D 2 28 ? 21.130  -0.616  -9.974  1.00 5.61  ? 28 SER B CB     2  
ATOM 5587  O OG     . SER D 2 28 ? 20.036  0.183   -9.543  1.00 5.69  ? 28 SER B OG     2  
ATOM 5588  H H      . SER D 2 28 ? 19.702  -1.237  -7.933  1.00 4.85  ? 28 SER B H      2  
ATOM 5589  H HA     . SER D 2 28 ? 21.867  -2.525  -9.348  1.00 5.15  ? 28 SER B HA     2  
ATOM 5590  H HB2    . SER D 2 28 ? 21.962  0.031   -10.211 1.00 5.81  ? 28 SER B HB2    2  
ATOM 5591  H HB3    . SER D 2 28 ? 20.836  -1.164  -10.857 1.00 5.82  ? 28 SER B HB3    2  
ATOM 5592  H HG     . SER D 2 28 ? 19.545  0.495   -10.321 1.00 5.90  ? 28 SER B HG     2  
ATOM 5593  N N      . HIS D 2 29 ? 22.423  -0.624  -6.835  1.00 4.98  ? 29 HIS B N      2  
ATOM 5594  C CA     . HIS D 2 29 ? 23.435  -0.066  -5.963  1.00 5.03  ? 29 HIS B CA     2  
ATOM 5595  C C      . HIS D 2 29 ? 23.294  -0.601  -4.542  1.00 4.65  ? 29 HIS B C      2  
ATOM 5596  O O      . HIS D 2 29 ? 22.561  -0.040  -3.727  1.00 4.62  ? 29 HIS B O      2  
ATOM 5597  C CB     . HIS D 2 29 ? 23.348  1.459   -5.967  1.00 5.41  ? 29 HIS B CB     2  
ATOM 5598  C CG     . HIS D 2 29 ? 23.935  2.081   -7.194  1.00 5.82  ? 29 HIS B CG     2  
ATOM 5599  N ND1    . HIS D 2 29 ? 25.162  1.721   -7.704  1.00 6.02  ? 29 HIS B ND1    2  
ATOM 5600  C CD2    . HIS D 2 29 ? 23.450  3.031   -8.026  1.00 6.27  ? 29 HIS B CD2    2  
ATOM 5601  C CE1    . HIS D 2 29 ? 25.409  2.421   -8.793  1.00 6.38  ? 29 HIS B CE1    2  
ATOM 5602  N NE2    . HIS D 2 29 ? 24.388  3.225   -9.013  1.00 6.53  ? 29 HIS B NE2    2  
ATOM 5603  H H      . HIS D 2 29 ? 21.509  -0.689  -6.511  1.00 4.82  ? 29 HIS B H      2  
ATOM 5604  H HA     . HIS D 2 29 ? 24.399  -0.360  -6.348  1.00 5.12  ? 29 HIS B HA     2  
ATOM 5605  H HB2    . HIS D 2 29 ? 22.310  1.752   -5.908  1.00 5.40  ? 29 HIS B HB2    2  
ATOM 5606  H HB3    . HIS D 2 29 ? 23.872  1.840   -5.110  1.00 5.43  ? 29 HIS B HB3    2  
ATOM 5607  H HD1    . HIS D 2 29 ? 25.764  1.043   -7.324  1.00 6.06  ? 29 HIS B HD1    2  
ATOM 5608  H HD2    . HIS D 2 29 ? 22.497  3.530   -7.937  1.00 6.55  ? 29 HIS B HD2    2  
ATOM 5609  H HE1    . HIS D 2 29 ? 26.297  2.350   -9.403  1.00 6.66  ? 29 HIS B HE1    2  
ATOM 5610  H HE2    . HIS D 2 29 ? 24.402  3.986   -9.646  1.00 6.89  ? 29 HIS B HE2    2  
ATOM 5611  N N      . VAL D 2 30 ? 23.995  -1.695  -4.267  1.00 4.43  ? 30 VAL B N      2  
ATOM 5612  C CA     . VAL D 2 30 ? 23.979  -2.338  -2.958  1.00 4.08  ? 30 VAL B CA     2  
ATOM 5613  C C      . VAL D 2 30 ? 25.316  -3.010  -2.685  1.00 4.00  ? 30 VAL B C      2  
ATOM 5614  O O      . VAL D 2 30 ? 26.200  -3.000  -3.535  1.00 4.18  ? 30 VAL B O      2  
ATOM 5615  C CB     . VAL D 2 30 ? 22.901  -3.423  -2.857  1.00 3.71  ? 30 VAL B CB     2  
ATOM 5616  C CG1    . VAL D 2 30 ? 21.513  -2.821  -2.704  1.00 3.82  ? 30 VAL B CG1    2  
ATOM 5617  C CG2    . VAL D 2 30 ? 22.981  -4.354  -4.055  1.00 3.92  ? 30 VAL B CG2    2  
ATOM 5618  H H      . VAL D 2 30 ? 24.553  -2.084  -4.967  1.00 4.57  ? 30 VAL B H      2  
ATOM 5619  H HA     . VAL D 2 30 ? 23.792  -1.586  -2.206  1.00 4.15  ? 30 VAL B HA     2  
ATOM 5620  H HB     . VAL D 2 30 ? 23.111  -4.001  -1.981  1.00 3.58  ? 30 VAL B HB     2  
ATOM 5621  H HG11   . VAL D 2 30 ? 20.781  -3.613  -2.652  1.00 4.13  ? 30 VAL B HG11   2  
ATOM 5622  H HG12   . VAL D 2 30 ? 21.300  -2.189  -3.554  1.00 4.03  ? 30 VAL B HG12   2  
ATOM 5623  H HG13   . VAL D 2 30 ? 21.474  -2.234  -1.799  1.00 3.93  ? 30 VAL B HG13   2  
ATOM 5624  H HG21   . VAL D 2 30 ? 22.255  -5.148  -3.947  1.00 4.08  ? 30 VAL B HG21   2  
ATOM 5625  H HG22   . VAL D 2 30 ? 23.976  -4.778  -4.107  1.00 4.16  ? 30 VAL B HG22   2  
ATOM 5626  H HG23   . VAL D 2 30 ? 22.778  -3.799  -4.959  1.00 4.16  ? 30 VAL B HG23   2  
ATOM 5627  N N      . SER D 2 31 ? 25.456  -3.602  -1.505  1.00 3.77  ? 31 SER B N      2  
ATOM 5628  C CA     . SER D 2 31 ? 26.685  -4.292  -1.155  1.00 3.67  ? 31 SER B CA     2  
ATOM 5629  C C      . SER D 2 31 ? 26.443  -5.792  -0.983  1.00 3.36  ? 31 SER B C      2  
ATOM 5630  O O      . SER D 2 31 ? 25.299  -6.233  -0.837  1.00 3.20  ? 31 SER B O      2  
ATOM 5631  C CB     . SER D 2 31 ? 27.291  -3.708  0.124   1.00 3.65  ? 31 SER B CB     2  
ATOM 5632  O OG     . SER D 2 31 ? 27.419  -2.299  0.036   1.00 3.96  ? 31 SER B OG     2  
ATOM 5633  H H      . SER D 2 31 ? 24.721  -3.570  -0.856  1.00 3.68  ? 31 SER B H      2  
ATOM 5634  H HA     . SER D 2 31 ? 27.373  -4.148  -1.971  1.00 3.89  ? 31 SER B HA     2  
ATOM 5635  H HB2    . SER D 2 31 ? 26.653  -3.948  0.963   1.00 3.48  ? 31 SER B HB2    2  
ATOM 5636  H HB3    . SER D 2 31 ? 28.270  -4.140  0.282   1.00 3.79  ? 31 SER B HB3    2  
ATOM 5637  H HG     . SER D 2 31 ? 27.277  -2.022  -0.877  1.00 4.12  ? 31 SER B HG     2  
ATOM 5638  N N      . ALA D 2 32 ? 27.531  -6.554  -1.004  1.00 3.31  ? 32 ALA B N      2  
ATOM 5639  C CA     . ALA D 2 32 ? 27.489  -8.009  -0.866  1.00 3.09  ? 32 ALA B CA     2  
ATOM 5640  C C      . ALA D 2 32 ? 26.771  -8.460  0.404   1.00 2.76  ? 32 ALA B C      2  
ATOM 5641  O O      . ALA D 2 32 ? 25.683  -9.028  0.326   1.00 2.62  ? 32 ALA B O      2  
ATOM 5642  C CB     . ALA D 2 32 ? 28.905  -8.562  -0.891  1.00 3.17  ? 32 ALA B CB     2  
ATOM 5643  H H      . ALA D 2 32 ? 28.409  -6.121  -1.136  1.00 3.46  ? 32 ALA B H      2  
ATOM 5644  H HA     . ALA D 2 32 ? 26.964  -8.406  -1.721  1.00 3.16  ? 32 ALA B HA     2  
ATOM 5645  H HB1    . ALA D 2 32 ? 29.350  -8.367  -1.854  1.00 3.12  ? 32 ALA B HB1    2  
ATOM 5646  H HB2    . ALA D 2 32 ? 28.878  -9.627  -0.714  1.00 3.30  ? 32 ALA B HB2    2  
ATOM 5647  H HB3    . ALA D 2 32 ? 29.489  -8.082  -0.121  1.00 3.55  ? 32 ALA B HB3    2  
ATOM 5648  N N      . LYS D 2 33 ? 27.381  -8.191  1.567   1.00 2.69  ? 33 LYS B N      2  
ATOM 5649  C CA     . LYS D 2 33 ? 26.817  -8.588  2.871   1.00 2.46  ? 33 LYS B CA     2  
ATOM 5650  C C      . LYS D 2 33 ? 25.343  -8.248  2.988   1.00 2.42  ? 33 LYS B C      2  
ATOM 5651  O O      . LYS D 2 33 ? 24.567  -9.023  3.541   1.00 2.27  ? 33 LYS B O      2  
ATOM 5652  C CB     . LYS D 2 33 ? 27.589  -7.931  4.022   1.00 2.57  ? 33 LYS B CB     2  
ATOM 5653  C CG     . LYS D 2 33 ? 27.677  -6.416  3.918   1.00 2.90  ? 33 LYS B CG     2  
ATOM 5654  C CD     . LYS D 2 33 ? 28.962  -5.883  4.530   1.00 3.43  ? 33 LYS B CD     2  
ATOM 5655  C CE     . LYS D 2 33 ? 29.120  -4.396  4.263   1.00 4.18  ? 33 LYS B CE     2  
ATOM 5656  N NZ     . LYS D 2 33 ? 30.417  -3.870  4.760   1.00 4.90  ? 33 LYS B NZ     2  
ATOM 5657  H H      . LYS D 2 33 ? 28.239  -7.721  1.549   1.00 2.84  ? 33 LYS B H      2  
ATOM 5658  H HA     . LYS D 2 33 ? 26.918  -9.660  2.956   1.00 2.31  ? 33 LYS B HA     2  
ATOM 5659  H HB2    . LYS D 2 33 ? 27.091  -8.172  4.954   1.00 2.68  ? 33 LYS B HB2    2  
ATOM 5660  H HB3    . LYS D 2 33 ? 28.592  -8.330  4.045   1.00 2.83  ? 33 LYS B HB3    2  
ATOM 5661  H HG2    . LYS D 2 33 ? 27.641  -6.134  2.877   1.00 3.07  ? 33 LYS B HG2    2  
ATOM 5662  H HG3    . LYS D 2 33 ? 26.834  -5.983  4.441   1.00 3.00  ? 33 LYS B HG3    2  
ATOM 5663  H HD2    . LYS D 2 33 ? 28.938  -6.049  5.597   1.00 3.60  ? 33 LYS B HD2    2  
ATOM 5664  H HD3    . LYS D 2 33 ? 29.800  -6.410  4.098   1.00 3.60  ? 33 LYS B HD3    2  
ATOM 5665  H HE2    . LYS D 2 33 ? 29.060  -4.228  3.198   1.00 4.35  ? 33 LYS B HE2    2  
ATOM 5666  H HE3    . LYS D 2 33 ? 28.315  -3.869  4.753   1.00 4.47  ? 33 LYS B HE3    2  
ATOM 5667  H HZ1    . LYS D 2 33 ? 30.507  -4.034  5.785   1.00 5.05  ? 33 LYS B HZ1    2  
ATOM 5668  H HZ2    . LYS D 2 33 ? 30.478  -2.845  4.577   1.00 5.15  ? 33 LYS B HZ2    2  
ATOM 5669  H HZ3    . LYS D 2 33 ? 31.210  -4.344  4.271   1.00 5.39  ? 33 LYS B HZ3    2  
ATOM 5670  N N      . THR D 2 34 ? 24.958  -7.096  2.472   1.00 2.61  ? 34 THR B N      2  
ATOM 5671  C CA     . THR D 2 34 ? 23.581  -6.684  2.522   1.00 2.61  ? 34 THR B CA     2  
ATOM 5672  C C      . THR D 2 34 ? 22.693  -7.689  1.810   1.00 2.42  ? 34 THR B C      2  
ATOM 5673  O O      . THR D 2 34 ? 21.716  -8.169  2.377   1.00 2.28  ? 34 THR B O      2  
ATOM 5674  C CB     . THR D 2 34 ? 23.390  -5.314  1.877   1.00 2.90  ? 34 THR B CB     2  
ATOM 5675  O OG1    . THR D 2 34 ? 24.397  -4.409  2.347   1.00 3.13  ? 34 THR B OG1    2  
ATOM 5676  C CG2    . THR D 2 34 ? 22.007  -4.795  2.207   1.00 2.93  ? 34 THR B CG2    2  
ATOM 5677  H H      . THR D 2 34 ? 25.615  -6.507  2.052   1.00 2.78  ? 34 THR B H      2  
ATOM 5678  H HA     . THR D 2 34 ? 23.285  -6.619  3.559   1.00 2.59  ? 34 THR B HA     2  
ATOM 5679  H HB     . THR D 2 34 ? 23.475  -5.419  0.805   1.00 2.95  ? 34 THR B HB     2  
ATOM 5680  H HG1    . THR D 2 34 ? 24.143  -3.503  2.127   1.00 3.30  ? 34 THR B HG1    2  
ATOM 5681  H HG21   . THR D 2 34 ? 21.694  -4.092  1.450   1.00 3.01  ? 34 THR B HG21   2  
ATOM 5682  H HG22   . THR D 2 34 ? 22.030  -4.305  3.169   1.00 3.20  ? 34 THR B HG22   2  
ATOM 5683  H HG23   . THR D 2 34 ? 21.314  -5.629  2.241   1.00 3.08  ? 34 THR B HG23   2  
ATOM 5684  N N      . ARG D 2 35 ? 23.067  -8.043  0.587   1.00 2.50  ? 35 ARG B N      2  
ATOM 5685  C CA     . ARG D 2 35 ? 22.284  -8.977  -0.198  1.00 2.44  ? 35 ARG B CA     2  
ATOM 5686  C C      . ARG D 2 35 ? 22.268  -10.336 0.474   1.00 2.25  ? 35 ARG B C      2  
ATOM 5687  O O      . ARG D 2 35 ? 21.258  -11.022 0.468   1.00 2.20  ? 35 ARG B O      2  
ATOM 5688  C CB     . ARG D 2 35 ? 22.836  -9.108  -1.619  1.00 2.67  ? 35 ARG B CB     2  
ATOM 5689  C CG     . ARG D 2 35 ? 22.862  -7.798  -2.386  1.00 2.98  ? 35 ARG B CG     2  
ATOM 5690  C CD     . ARG D 2 35 ? 23.049  -8.027  -3.877  1.00 3.19  ? 35 ARG B CD     2  
ATOM 5691  N NE     . ARG D 2 35 ? 24.232  -8.839  -4.176  1.00 3.34  ? 35 ARG B NE     2  
ATOM 5692  C CZ     . ARG D 2 35 ? 25.215  -8.455  -4.996  1.00 3.60  ? 35 ARG B CZ     2  
ATOM 5693  N NH1    . ARG D 2 35 ? 25.190  -7.246  -5.552  1.00 3.81  ? 35 ARG B NH1    2  
ATOM 5694  N NH2    . ARG D 2 35 ? 26.223  -9.284  -5.256  1.00 3.91  ? 35 ARG B NH2    2  
ATOM 5695  H H      . ARG D 2 35 ? 23.914  -7.700  0.224   1.00 2.64  ? 35 ARG B H      2  
ATOM 5696  H HA     . ARG D 2 35 ? 21.272  -8.598  -0.244  1.00 2.44  ? 35 ARG B HA     2  
ATOM 5697  H HB2    . ARG D 2 35 ? 23.846  -9.490  -1.568  1.00 2.73  ? 35 ARG B HB2    2  
ATOM 5698  H HB3    . ARG D 2 35 ? 22.224  -9.808  -2.167  1.00 2.69  ? 35 ARG B HB3    2  
ATOM 5699  H HG2    . ARG D 2 35 ? 21.927  -7.282  -2.226  1.00 2.98  ? 35 ARG B HG2    2  
ATOM 5700  H HG3    . ARG D 2 35 ? 23.677  -7.193  -2.017  1.00 3.22  ? 35 ARG B HG3    2  
ATOM 5701  H HD2    . ARG D 2 35 ? 22.175  -8.532  -4.261  1.00 3.26  ? 35 ARG B HD2    2  
ATOM 5702  H HD3    . ARG D 2 35 ? 23.150  -7.068  -4.364  1.00 3.46  ? 35 ARG B HD3    2  
ATOM 5703  H HE     . ARG D 2 35 ? 24.283  -9.727  -3.757  1.00 3.45  ? 35 ARG B HE     2  
ATOM 5704  H HH11   . ARG D 2 35 ? 24.438  -6.618  -5.356  1.00 3.83  ? 35 ARG B HH11   2  
ATOM 5705  H HH12   . ARG D 2 35 ? 25.930  -6.955  -6.179  1.00 4.13  ? 35 ARG B HH12   2  
ATOM 5706  H HH21   . ARG D 2 35 ? 26.247  -10.194 -4.839  1.00 4.06  ? 35 ARG B HH21   2  
ATOM 5707  H HH22   . ARG D 2 35 ? 26.969  -9.002  -5.880  1.00 4.15  ? 35 ARG B HH22   2  
ATOM 5708  N N      . GLU D 2 36 ? 23.379  -10.686 1.100   1.00 2.21  ? 36 GLU B N      2  
ATOM 5709  C CA     . GLU D 2 36 ? 23.509  -11.968 1.776   1.00 2.13  ? 36 GLU B CA     2  
ATOM 5710  C C      . GLU D 2 36 ? 22.549  -12.046 2.953   1.00 2.03  ? 36 GLU B C      2  
ATOM 5711  O O      . GLU D 2 36 ? 21.979  -13.096 3.235   1.00 2.06  ? 36 GLU B O      2  
ATOM 5712  C CB     . GLU D 2 36 ? 24.947  -12.178 2.263   1.00 2.14  ? 36 GLU B CB     2  
ATOM 5713  C CG     . GLU D 2 36 ? 26.005  -11.904 1.202   1.00 2.40  ? 36 GLU B CG     2  
ATOM 5714  C CD     . GLU D 2 36 ? 27.422  -11.984 1.745   1.00 2.61  ? 36 GLU B CD     2  
ATOM 5715  O OE1    . GLU D 2 36 ? 27.593  -12.298 2.942   1.00 2.82  ? 36 GLU B OE1    2  
ATOM 5716  O OE2    . GLU D 2 36 ? 28.379  -11.733 0.978   1.00 2.94  ? 36 GLU B OE2    2  
ATOM 5717  H H      . GLU D 2 36 ? 24.127  -10.056 1.124   1.00 2.27  ? 36 GLU B H      2  
ATOM 5718  H HA     . GLU D 2 36 ? 23.254  -12.740 1.071   1.00 2.22  ? 36 GLU B HA     2  
ATOM 5719  H HB2    . GLU D 2 36 ? 25.129  -11.521 3.099   1.00 2.10  ? 36 GLU B HB2    2  
ATOM 5720  H HB3    . GLU D 2 36 ? 25.055  -13.201 2.593   1.00 2.20  ? 36 GLU B HB3    2  
ATOM 5721  H HG2    . GLU D 2 36 ? 25.898  -12.631 0.411   1.00 2.78  ? 36 GLU B HG2    2  
ATOM 5722  H HG3    . GLU D 2 36 ? 25.841  -10.910 0.801   1.00 2.47  ? 36 GLU B HG3    2  
ATOM 5723  N N      . LYS D 2 37 ? 22.362  -10.921 3.623   1.00 2.03  ? 37 LYS B N      2  
ATOM 5724  C CA     . LYS D 2 37 ? 21.477  -10.860 4.773   1.00 2.06  ? 37 LYS B CA     2  
ATOM 5725  C C      . LYS D 2 37 ? 20.023  -10.793 4.338   1.00 2.07  ? 37 LYS B C      2  
ATOM 5726  O O      . LYS D 2 37 ? 19.178  -11.480 4.905   1.00 2.14  ? 37 LYS B O      2  
ATOM 5727  C CB     . LYS D 2 37 ? 21.821  -9.662  5.648   1.00 2.19  ? 37 LYS B CB     2  
ATOM 5728  C CG     . LYS D 2 37 ? 22.999  -9.920  6.572   1.00 2.53  ? 37 LYS B CG     2  
ATOM 5729  C CD     . LYS D 2 37 ? 23.977  -8.760  6.564   1.00 2.52  ? 37 LYS B CD     2  
ATOM 5730  C CE     . LYS D 2 37 ? 23.343  -7.488  7.091   1.00 2.77  ? 37 LYS B CE     2  
ATOM 5731  N NZ     . LYS D 2 37 ? 22.871  -7.649  8.493   1.00 3.10  ? 37 LYS B NZ     2  
ATOM 5732  H H      . LYS D 2 37 ? 22.832  -10.111 3.331   1.00 2.08  ? 37 LYS B H      2  
ATOM 5733  H HA     . LYS D 2 37 ? 21.622  -11.762 5.345   1.00 2.08  ? 37 LYS B HA     2  
ATOM 5734  H HB2    . LYS D 2 37 ? 22.062  -8.821  5.016   1.00 2.31  ? 37 LYS B HB2    2  
ATOM 5735  H HB3    . LYS D 2 37 ? 20.964  -9.413  6.256   1.00 2.24  ? 37 LYS B HB3    2  
ATOM 5736  H HG2    . LYS D 2 37 ? 22.632  -10.061 7.576   1.00 2.82  ? 37 LYS B HG2    2  
ATOM 5737  H HG3    . LYS D 2 37 ? 23.511  -10.814 6.244   1.00 2.81  ? 37 LYS B HG3    2  
ATOM 5738  H HD2    . LYS D 2 37 ? 24.823  -9.013  7.186   1.00 2.54  ? 37 LYS B HD2    2  
ATOM 5739  H HD3    . LYS D 2 37 ? 24.312  -8.593  5.550   1.00 2.53  ? 37 LYS B HD3    2  
ATOM 5740  H HE2    . LYS D 2 37 ? 24.078  -6.697  7.050   1.00 3.03  ? 37 LYS B HE2    2  
ATOM 5741  H HE3    . LYS D 2 37 ? 22.499  -7.230  6.461   1.00 2.68  ? 37 LYS B HE3    2  
ATOM 5742  H HZ1    . LYS D 2 37 ? 23.007  -6.763  9.025   1.00 3.51  ? 37 LYS B HZ1    2  
ATOM 5743  H HZ2    . LYS D 2 37 ? 23.407  -8.409  8.969   1.00 3.04  ? 37 LYS B HZ2    2  
ATOM 5744  H HZ3    . LYS D 2 37 ? 21.858  -7.896  8.507   1.00 3.45  ? 37 LYS B HZ3    2  
ATOM 5745  N N      . VAL D 2 38 ? 19.731  -9.975  3.335   1.00 2.07  ? 38 VAL B N      2  
ATOM 5746  C CA     . VAL D 2 38 ? 18.365  -9.853  2.850   1.00 2.08  ? 38 VAL B CA     2  
ATOM 5747  C C      . VAL D 2 38 ? 17.927  -11.168 2.204   1.00 2.04  ? 38 VAL B C      2  
ATOM 5748  O O      . VAL D 2 38 ? 16.826  -11.652 2.462   1.00 2.07  ? 38 VAL B O      2  
ATOM 5749  C CB     . VAL D 2 38 ? 18.212  -8.678  1.870   1.00 2.17  ? 38 VAL B CB     2  
ATOM 5750  C CG1    . VAL D 2 38 ? 18.896  -7.438  2.424   1.00 2.33  ? 38 VAL B CG1    2  
ATOM 5751  C CG2    . VAL D 2 38 ? 18.755  -9.018  0.505   1.00 2.21  ? 38 VAL B CG2    2  
ATOM 5752  H H      . VAL D 2 38 ? 20.451  -9.449  2.905   1.00 2.10  ? 38 VAL B H      2  
ATOM 5753  H HA     . VAL D 2 38 ? 17.720  -9.659  3.700   1.00 2.14  ? 38 VAL B HA     2  
ATOM 5754  H HB     . VAL D 2 38 ? 17.163  -8.469  1.768   1.00 2.18  ? 38 VAL B HB     2  
ATOM 5755  H HG11   . VAL D 2 38 ? 18.883  -6.656  1.679   1.00 2.65  ? 38 VAL B HG11   2  
ATOM 5756  H HG12   . VAL D 2 38 ? 19.920  -7.678  2.680   1.00 2.45  ? 38 VAL B HG12   2  
ATOM 5757  H HG13   . VAL D 2 38 ? 18.373  -7.102  3.308   1.00 2.60  ? 38 VAL B HG13   2  
ATOM 5758  H HG21   . VAL D 2 38 ? 18.282  -9.929  0.155   1.00 2.56  ? 38 VAL B HG21   2  
ATOM 5759  H HG22   . VAL D 2 38 ? 19.821  -9.166  0.574   1.00 2.55  ? 38 VAL B HG22   2  
ATOM 5760  H HG23   . VAL D 2 38 ? 18.542  -8.212  -0.180  1.00 2.23  ? 38 VAL B HG23   2  
ATOM 5761  N N      . GLU D 2 39 ? 18.806  -11.737 1.377   1.00 2.06  ? 39 GLU B N      2  
ATOM 5762  C CA     . GLU D 2 39 ? 18.553  -13.013 0.721   1.00 2.17  ? 39 GLU B CA     2  
ATOM 5763  C C      . GLU D 2 39 ? 18.337  -14.077 1.776   1.00 2.25  ? 39 GLU B C      2  
ATOM 5764  O O      . GLU D 2 39 ? 17.436  -14.902 1.658   1.00 2.39  ? 39 GLU B O      2  
ATOM 5765  C CB     . GLU D 2 39 ? 19.715  -13.415 -0.194  1.00 2.31  ? 39 GLU B CB     2  
ATOM 5766  C CG     . GLU D 2 39 ? 19.536  -12.980 -1.642  1.00 2.51  ? 39 GLU B CG     2  
ATOM 5767  C CD     . GLU D 2 39 ? 20.754  -13.277 -2.506  1.00 2.75  ? 39 GLU B CD     2  
ATOM 5768  O OE1    . GLU D 2 39 ? 20.991  -14.465 -2.825  1.00 2.96  ? 39 GLU B OE1    2  
ATOM 5769  O OE2    . GLU D 2 39 ? 21.484  -12.326 -2.865  1.00 3.00  ? 39 GLU B OE2    2  
ATOM 5770  H H      . GLU D 2 39 ? 19.636  -11.258 1.177   1.00 2.08  ? 39 GLU B H      2  
ATOM 5771  H HA     . GLU D 2 39 ? 17.651  -12.915 0.133   1.00 2.19  ? 39 GLU B HA     2  
ATOM 5772  H HB2    . GLU D 2 39 ? 20.624  -12.966 0.181   1.00 2.25  ? 39 GLU B HB2    2  
ATOM 5773  H HB3    . GLU D 2 39 ? 19.820  -14.489 -0.175  1.00 2.43  ? 39 GLU B HB3    2  
ATOM 5774  H HG2    . GLU D 2 39 ? 18.686  -13.503 -2.053  1.00 2.57  ? 39 GLU B HG2    2  
ATOM 5775  H HG3    . GLU D 2 39 ? 19.347  -11.917 -1.663  1.00 2.58  ? 39 GLU B HG3    2  
ATOM 5776  N N      . ALA D 2 40 ? 19.168  -14.054 2.816   1.00 2.22  ? 40 ALA B N      2  
ATOM 5777  C CA     . ALA D 2 40 ? 19.024  -15.005 3.902   1.00 2.38  ? 40 ALA B CA     2  
ATOM 5778  C C      . ALA D 2 40 ? 17.678  -14.807 4.559   1.00 2.45  ? 40 ALA B C      2  
ATOM 5779  O O      . ALA D 2 40 ? 16.886  -15.736 4.659   1.00 2.65  ? 40 ALA B O      2  
ATOM 5780  C CB     . ALA D 2 40 ? 20.117  -14.848 4.942   1.00 2.37  ? 40 ALA B CB     2  
ATOM 5781  H H      . ALA D 2 40 ? 19.893  -13.381 2.848   1.00 2.13  ? 40 ALA B H      2  
ATOM 5782  H HA     . ALA D 2 40 ? 19.077  -16.003 3.490   1.00 2.53  ? 40 ALA B HA     2  
ATOM 5783  H HB1    . ALA D 2 40 ? 19.717  -15.100 5.919   1.00 2.47  ? 40 ALA B HB1    2  
ATOM 5784  H HB2    . ALA D 2 40 ? 20.464  -13.824 4.947   1.00 2.67  ? 40 ALA B HB2    2  
ATOM 5785  H HB3    . ALA D 2 40 ? 20.939  -15.506 4.705   1.00 2.55  ? 40 ALA B HB3    2  
ATOM 5786  N N      . ALA D 2 41 ? 17.415  -13.575 4.976   1.00 2.34  ? 41 ALA B N      2  
ATOM 5787  C CA     . ALA D 2 41 ? 16.172  -13.240 5.635   1.00 2.45  ? 41 ALA B CA     2  
ATOM 5788  C C      . ALA D 2 41 ? 14.944  -13.700 4.862   1.00 2.47  ? 41 ALA B C      2  
ATOM 5789  O O      . ALA D 2 41 ? 14.081  -14.377 5.417   1.00 2.68  ? 41 ALA B O      2  
ATOM 5790  C CB     . ALA D 2 41 ? 16.110  -11.752 5.849   1.00 2.39  ? 41 ALA B CB     2  
ATOM 5791  H H      . ALA D 2 41 ? 18.097  -12.863 4.857   1.00 2.23  ? 41 ALA B H      2  
ATOM 5792  H HA     . ALA D 2 41 ? 16.171  -13.715 6.602   1.00 2.64  ? 41 ALA B HA     2  
ATOM 5793  H HB1    . ALA D 2 41 ? 16.938  -11.441 6.465   1.00 2.56  ? 41 ALA B HB1    2  
ATOM 5794  H HB2    . ALA D 2 41 ? 15.179  -11.500 6.334   1.00 2.62  ? 41 ALA B HB2    2  
ATOM 5795  H HB3    . ALA D 2 41 ? 16.167  -11.259 4.891   1.00 2.58  ? 41 ALA B HB3    2  
ATOM 5796  N N      . MET D 2 42 ? 14.870  -13.355 3.587   1.00 2.31  ? 42 MET B N      2  
ATOM 5797  C CA     . MET D 2 42 ? 13.735  -13.753 2.774   1.00 2.35  ? 42 MET B CA     2  
ATOM 5798  C C      . MET D 2 42 ? 13.703  -15.267 2.618   1.00 2.59  ? 42 MET B C      2  
ATOM 5799  O O      . MET D 2 42 ? 12.642  -15.859 2.555   1.00 2.74  ? 42 MET B O      2  
ATOM 5800  C CB     . MET D 2 42 ? 13.734  -13.067 1.405   1.00 2.21  ? 42 MET B CB     2  
ATOM 5801  C CG     . MET D 2 42 ? 15.002  -13.261 0.613   1.00 2.23  ? 42 MET B CG     2  
ATOM 5802  S SD     . MET D 2 42 ? 15.075  -12.183 -0.822  1.00 2.21  ? 42 MET B SD     2  
ATOM 5803  C CE     . MET D 2 42 ? 15.017  -10.604 0.012   1.00 2.06  ? 42 MET B CE     2  
ATOM 5804  H H      . MET D 2 42 ? 15.593  -12.821 3.185   1.00 2.20  ? 42 MET B H      2  
ATOM 5805  H HA     . MET D 2 42 ? 12.846  -13.443 3.302   1.00 2.39  ? 42 MET B HA     2  
ATOM 5806  H HB2    . MET D 2 42 ? 12.912  -13.459 0.823   1.00 2.28  ? 42 MET B HB2    2  
ATOM 5807  H HB3    . MET D 2 42 ? 13.581  -12.006 1.548   1.00 2.11  ? 42 MET B HB3    2  
ATOM 5808  H HG2    . MET D 2 42 ? 15.839  -13.031 1.256   1.00 2.18  ? 42 MET B HG2    2  
ATOM 5809  H HG3    . MET D 2 42 ? 15.053  -14.286 0.291   1.00 2.38  ? 42 MET B HG3    2  
ATOM 5810  H HE1    . MET D 2 42 ? 14.707  -9.839  -0.682  1.00 2.35  ? 42 MET B HE1    2  
ATOM 5811  H HE2    . MET D 2 42 ? 15.998  -10.369 0.401   1.00 2.16  ? 42 MET B HE2    2  
ATOM 5812  H HE3    . MET D 2 42 ? 14.307  -10.664 0.830   1.00 2.35  ? 42 MET B HE3    2  
ATOM 5813  N N      . ALA D 2 43 ? 14.878  -15.888 2.586   1.00 2.65  ? 43 ALA B N      2  
ATOM 5814  C CA     . ALA D 2 43 ? 14.969  -17.334 2.396   1.00 2.94  ? 43 ALA B CA     2  
ATOM 5815  C C      . ALA D 2 43 ? 14.480  -18.091 3.623   1.00 3.17  ? 43 ALA B C      2  
ATOM 5816  O O      . ALA D 2 43 ? 13.761  -19.088 3.508   1.00 3.43  ? 43 ALA B O      2  
ATOM 5817  C CB     . ALA D 2 43 ? 16.396  -17.745 2.059   1.00 2.97  ? 43 ALA B CB     2  
ATOM 5818  H H      . ALA D 2 43 ? 15.701  -15.371 2.766   1.00 2.53  ? 43 ALA B H      2  
ATOM 5819  H HA     . ALA D 2 43 ? 14.342  -17.597 1.557   1.00 3.01  ? 43 ALA B HA     2  
ATOM 5820  H HB1    . ALA D 2 43 ? 17.041  -17.517 2.895   1.00 3.11  ? 43 ALA B HB1    2  
ATOM 5821  H HB2    . ALA D 2 43 ? 16.729  -17.201 1.188   1.00 3.03  ? 43 ALA B HB2    2  
ATOM 5822  H HB3    . ALA D 2 43 ? 16.428  -18.804 1.857   1.00 3.28  ? 43 ALA B HB3    2  
ATOM 5823  N N      . GLU D 2 44 ? 14.869  -17.609 4.794   1.00 3.13  ? 44 GLU B N      2  
ATOM 5824  C CA     . GLU D 2 44 ? 14.482  -18.242 6.047   1.00 3.41  ? 44 GLU B CA     2  
ATOM 5825  C C      . GLU D 2 44 ? 12.995  -18.072 6.290   1.00 3.51  ? 44 GLU B C      2  
ATOM 5826  O O      . GLU D 2 44 ? 12.300  -19.013 6.675   1.00 3.81  ? 44 GLU B O      2  
ATOM 5827  C CB     . GLU D 2 44 ? 15.244  -17.619 7.205   1.00 3.38  ? 44 GLU B CB     2  
ATOM 5828  C CG     . GLU D 2 44 ? 16.730  -17.467 6.957   1.00 3.23  ? 44 GLU B CG     2  
ATOM 5829  C CD     . GLU D 2 44 ? 17.497  -18.769 7.075   1.00 3.42  ? 44 GLU B CD     2  
ATOM 5830  O OE1    . GLU D 2 44 ? 17.231  -19.690 6.270   1.00 3.57  ? 44 GLU B OE1    2  
ATOM 5831  O OE2    . GLU D 2 44 ? 18.351  -18.883 7.974   1.00 3.67  ? 44 GLU B OE2    2  
ATOM 5832  H H      . GLU D 2 44 ? 15.436  -16.801 4.820   1.00 2.94  ? 44 GLU B H      2  
ATOM 5833  H HA     . GLU D 2 44 ? 14.716  -19.292 5.984   1.00 3.62  ? 44 GLU B HA     2  
ATOM 5834  H HB2    . GLU D 2 44 ? 14.838  -16.635 7.384   1.00 3.25  ? 44 GLU B HB2    2  
ATOM 5835  H HB3    . GLU D 2 44 ? 15.106  -18.227 8.085   1.00 3.64  ? 44 GLU B HB3    2  
ATOM 5836  H HG2    . GLU D 2 44 ? 16.869  -17.067 5.960   1.00 3.07  ? 44 GLU B HG2    2  
ATOM 5837  H HG3    . GLU D 2 44 ? 17.121  -16.764 7.678   1.00 3.20  ? 44 GLU B HG3    2  
ATOM 5838  N N      . LEU D 2 45 ? 12.516  -16.860 6.058   1.00 3.28  ? 45 LEU B N      2  
ATOM 5839  C CA     . LEU D 2 45 ? 11.101  -16.554 6.242   1.00 3.36  ? 45 LEU B CA     2  
ATOM 5840  C C      . LEU D 2 45 ? 10.297  -17.009 5.030   1.00 3.35  ? 45 LEU B C      2  
ATOM 5841  O O      . LEU D 2 45 ? 9.080   -16.811 4.974   1.00 3.40  ? 45 LEU B O      2  
ATOM 5842  C CB     . LEU D 2 45 ? 10.891  -15.051 6.456   1.00 3.17  ? 45 LEU B CB     2  
ATOM 5843  C CG     . LEU D 2 45 ? 11.901  -14.352 7.372   1.00 3.15  ? 45 LEU B CG     2  
ATOM 5844  C CD1    . LEU D 2 45 ? 11.423  -12.946 7.705   1.00 3.11  ? 45 LEU B CD1    2  
ATOM 5845  C CD2    . LEU D 2 45 ? 12.142  -15.160 8.639   1.00 3.47  ? 45 LEU B CD2    2  
ATOM 5846  H H      . LEU D 2 45 ? 13.140  -16.142 5.787   1.00 3.07  ? 45 LEU B H      2  
ATOM 5847  H HA     . LEU D 2 45 ? 10.755  -17.086 7.113   1.00 3.61  ? 45 LEU B HA     2  
ATOM 5848  H HB2    . LEU D 2 45 ? 10.925  -14.567 5.490   1.00 2.94  ? 45 LEU B HB2    2  
ATOM 5849  H HB3    . LEU D 2 45 ? 9.905   -14.906 6.872   1.00 3.30  ? 45 LEU B HB3    2  
ATOM 5850  H HG     . LEU D 2 45 ? 12.845  -14.264 6.849   1.00 2.97  ? 45 LEU B HG     2  
ATOM 5851  H HD11   . LEU D 2 45 ? 12.108  -12.487 8.401   1.00 3.15  ? 45 LEU B HD11   2  
ATOM 5852  H HD12   . LEU D 2 45 ? 10.439  -12.992 8.148   1.00 3.48  ? 45 LEU B HD12   2  
ATOM 5853  H HD13   . LEU D 2 45 ? 11.382  -12.357 6.800   1.00 3.16  ? 45 LEU B HD13   2  
ATOM 5854  H HD21   . LEU D 2 45 ? 11.199  -15.494 9.041   1.00 3.59  ? 45 LEU B HD21   2  
ATOM 5855  H HD22   . LEU D 2 45 ? 12.650  -14.544 9.367   1.00 3.86  ? 45 LEU B HD22   2  
ATOM 5856  H HD23   . LEU D 2 45 ? 12.760  -16.018 8.400   1.00 3.59  ? 45 LEU B HD23   2  
ATOM 5857  N N      . ASN D 2 46 ? 10.999  -17.604 4.064   1.00 3.31  ? 46 ASN B N      2  
ATOM 5858  C CA     . ASN D 2 46 ? 10.410  -18.100 2.816   1.00 3.36  ? 46 ASN B CA     2  
ATOM 5859  C C      . ASN D 2 46 ? 10.099  -16.929 1.890   1.00 3.04  ? 46 ASN B C      2  
ATOM 5860  O O      . ASN D 2 46 ? 10.588  -16.884 0.767   1.00 3.00  ? 46 ASN B O      2  
ATOM 5861  C CB     . ASN D 2 46 ? 9.160   -18.942 3.076   1.00 3.70  ? 46 ASN B CB     2  
ATOM 5862  C CG     . ASN D 2 46 ? 8.719   -19.732 1.856   1.00 3.87  ? 46 ASN B CG     2  
ATOM 5863  O OD1    . ASN D 2 46 ? 9.068   -20.902 1.706   1.00 4.39  ? 46 ASN B OD1    2  
ATOM 5864  N ND2    . ASN D 2 46 ? 7.950   -19.103 0.978   1.00 3.66  ? 46 ASN B ND2    2  
ATOM 5865  H H      . ASN D 2 46 ? 11.965  -17.694 4.187   1.00 3.28  ? 46 ASN B H      2  
ATOM 5866  H HA     . ASN D 2 46 ? 11.155  -18.722 2.335   1.00 3.43  ? 46 ASN B HA     2  
ATOM 5867  H HB2    . ASN D 2 46 ? 9.364   -19.638 3.877   1.00 3.92  ? 46 ASN B HB2    2  
ATOM 5868  H HB3    . ASN D 2 46 ? 8.360   -18.287 3.373   1.00 3.68  ? 46 ASN B HB3    2  
ATOM 5869  H HD21   . ASN D 2 46 ? 7.710   -18.171 1.156   1.00 3.54  ? 46 ASN B HD21   2  
ATOM 5870  H HD22   . ASN D 2 46 ? 7.664   -19.595 0.182   1.00 3.80  ? 46 ASN B HD22   2  
ATOM 5871  N N      . TYR D 2 47 ? 9.285   -15.992 2.393   1.00 2.97  ? 47 TYR B N      2  
ATOM 5872  C CA     . TYR D 2 47 ? 8.906   -14.772 1.680   1.00 2.69  ? 47 TYR B CA     2  
ATOM 5873  C C      . TYR D 2 47 ? 8.336   -15.044 0.283   1.00 2.74  ? 47 TYR B C      2  
ATOM 5874  O O      . TYR D 2 47 ? 9.051   -15.404 -0.651  1.00 2.93  ? 47 TYR B O      2  
ATOM 5875  C CB     . TYR D 2 47 ? 10.100  -13.806 1.613   1.00 2.42  ? 47 TYR B CB     2  
ATOM 5876  C CG     . TYR D 2 47 ? 9.768   -12.491 0.948   1.00 2.23  ? 47 TYR B CG     2  
ATOM 5877  C CD1    . TYR D 2 47 ? 8.540   -11.871 1.150   1.00 2.21  ? 47 TYR B CD1    2  
ATOM 5878  C CD2    . TYR D 2 47 ? 10.708  -11.848 0.150   1.00 2.14  ? 47 TYR B CD2    2  
ATOM 5879  C CE1    . TYR D 2 47 ? 8.268   -10.644 0.584   1.00 2.09  ? 47 TYR B CE1    2  
ATOM 5880  C CE2    . TYR D 2 47 ? 10.436  -10.630 -0.433  1.00 2.07  ? 47 TYR B CE2    2  
ATOM 5881  C CZ     . TYR D 2 47 ? 9.103   -10.124 -0.339  1.00 2.05  ? 47 TYR B CZ     2  
ATOM 5882  O OH     . TYR D 2 47 ? 8.958   -8.793  -0.751  1.00 2.04  ? 47 TYR B OH     2  
ATOM 5883  H H      . TYR D 2 47 ? 8.921   -16.132 3.292   1.00 3.22  ? 47 TYR B H      2  
ATOM 5884  H HA     . TYR D 2 47 ? 8.130   -14.298 2.264   1.00 2.72  ? 47 TYR B HA     2  
ATOM 5885  H HB2    . TYR D 2 47 ? 10.441  -13.594 2.616   1.00 2.42  ? 47 TYR B HB2    2  
ATOM 5886  H HB3    . TYR D 2 47 ? 10.899  -14.270 1.057   1.00 2.44  ? 47 TYR B HB3    2  
ATOM 5887  H HD1    . TYR D 2 47 ? 7.788   -12.364 1.756   1.00 2.34  ? 47 TYR B HD1    2  
ATOM 5888  H HD2    . TYR D 2 47 ? 11.661  -12.327 -0.024  1.00 2.18  ? 47 TYR B HD2    2  
ATOM 5889  H HE1    . TYR D 2 47 ? 7.307   -10.179 0.749   1.00 2.09  ? 47 TYR B HE1    2  
ATOM 5890  H HE2    . TYR D 2 47 ? 11.175  -10.152 -1.061  1.00 2.09  ? 47 TYR B HE2    2  
ATOM 5891  H HH     . TYR D 2 47 ? 8.659   -8.201  -0.056  1.00 2.43  ? 47 TYR B HH     2  
ATOM 5892  N N      . ILE D 2 48 ? 7.029   -14.850 0.161   1.00 2.73  ? 48 ILE B N      2  
ATOM 5893  C CA     . ILE D 2 48 ? 6.333   -15.052 -1.110  1.00 2.82  ? 48 ILE B CA     2  
ATOM 5894  C C      . ILE D 2 48 ? 6.928   -14.159 -2.206  1.00 2.64  ? 48 ILE B C      2  
ATOM 5895  O O      . ILE D 2 48 ? 7.453   -13.080 -1.922  1.00 2.54  ? 48 ILE B O      2  
ATOM 5896  C CB     . ILE D 2 48 ? 4.805   -14.785 -0.992  1.00 3.08  ? 48 ILE B CB     2  
ATOM 5897  C CG1    . ILE D 2 48 ? 4.496   -13.279 -0.924  1.00 3.43  ? 48 ILE B CG1    2  
ATOM 5898  C CG2    . ILE D 2 48 ? 4.223   -15.507 0.218   1.00 3.18  ? 48 ILE B CG2    2  
ATOM 5899  C CD1    . ILE D 2 48 ? 4.820   -12.630 0.406   1.00 3.97  ? 48 ILE B CD1    2  
ATOM 5900  H H      . ILE D 2 48 ? 6.521   -14.560 0.944   1.00 2.78  ? 48 ILE B H      2  
ATOM 5901  H HA     . ILE D 2 48 ? 6.471   -16.085 -1.394  1.00 3.02  ? 48 ILE B HA     2  
ATOM 5902  H HB     . ILE D 2 48 ? 4.333   -15.194 -1.872  1.00 3.47  ? 48 ILE B HB     2  
ATOM 5903  H HG12   . ILE D 2 48 ? 5.068   -12.768 -1.684  1.00 3.86  ? 48 ILE B HG12   2  
ATOM 5904  H HG13   . ILE D 2 48 ? 3.443   -13.128 -1.116  1.00 3.46  ? 48 ILE B HG13   2  
ATOM 5905  H HG21   . ILE D 2 48 ? 4.268   -16.573 0.058   1.00 3.66  ? 48 ILE B HG21   2  
ATOM 5906  H HG22   . ILE D 2 48 ? 3.194   -15.205 0.359   1.00 3.18  ? 48 ILE B HG22   2  
ATOM 5907  H HG23   . ILE D 2 48 ? 4.794   -15.252 1.099   1.00 3.35  ? 48 ILE B HG23   2  
ATOM 5908  H HD11   . ILE D 2 48 ? 4.617   -11.571 0.352   1.00 4.28  ? 48 ILE B HD11   2  
ATOM 5909  H HD12   . ILE D 2 48 ? 5.865   -12.785 0.635   1.00 4.27  ? 48 ILE B HD12   2  
ATOM 5910  H HD13   . ILE D 2 48 ? 4.214   -13.075 1.181   1.00 4.29  ? 48 ILE B HD13   2  
ATOM 5911  N N      . PRO D 2 49 ? 6.872   -14.611 -3.471  1.00 2.84  ? 49 PRO B N      2  
ATOM 5912  C CA     . PRO D 2 49 ? 7.410   -13.854 -4.608  1.00 2.94  ? 49 PRO B CA     2  
ATOM 5913  C C      . PRO D 2 49 ? 6.734   -12.495 -4.781  1.00 2.85  ? 49 PRO B C      2  
ATOM 5914  O O      . PRO D 2 49 ? 5.521   -12.365 -4.613  1.00 3.26  ? 49 PRO B O      2  
ATOM 5915  C CB     . PRO D 2 49 ? 7.124   -14.753 -5.818  1.00 3.45  ? 49 PRO B CB     2  
ATOM 5916  C CG     . PRO D 2 49 ? 6.062   -15.696 -5.366  1.00 3.66  ? 49 PRO B CG     2  
ATOM 5917  C CD     . PRO D 2 49 ? 6.283   -15.892 -3.894  1.00 3.26  ? 49 PRO B CD     2  
ATOM 5918  H HA     . PRO D 2 49 ? 8.475   -13.709 -4.511  1.00 3.03  ? 49 PRO B HA     2  
ATOM 5919  H HB2    . PRO D 2 49 ? 6.788   -14.147 -6.647  1.00 3.56  ? 49 PRO B HB2    2  
ATOM 5920  H HB3    . PRO D 2 49 ? 8.025   -15.280 -6.097  1.00 3.77  ? 49 PRO B HB3    2  
ATOM 5921  H HG2    . PRO D 2 49 ? 5.089   -15.265 -5.544  1.00 3.82  ? 49 PRO B HG2    2  
ATOM 5922  H HG3    . PRO D 2 49 ? 6.159   -16.635 -5.887  1.00 4.15  ? 49 PRO B HG3    2  
ATOM 5923  H HD2    . PRO D 2 49 ? 5.345   -16.071 -3.391  1.00 3.34  ? 49 PRO B HD2    2  
ATOM 5924  H HD3    . PRO D 2 49 ? 6.969   -16.707 -3.719  1.00 3.40  ? 49 PRO B HD3    2  
ATOM 5925  N N      . ASN D 2 50 ? 7.529   -11.493 -5.128  1.00 2.80  ? 50 ASN B N      2  
ATOM 5926  C CA     . ASN D 2 50 ? 7.030   -10.140 -5.323  1.00 3.03  ? 50 ASN B CA     2  
ATOM 5927  C C      . ASN D 2 50 ? 7.855   -9.428  -6.392  1.00 3.35  ? 50 ASN B C      2  
ATOM 5928  O O      . ASN D 2 50 ? 8.912   -8.865  -6.107  1.00 4.09  ? 50 ASN B O      2  
ATOM 5929  C CB     . ASN D 2 50 ? 7.071   -9.356  -4.003  1.00 3.59  ? 50 ASN B CB     2  
ATOM 5930  C CG     . ASN D 2 50 ? 6.590   -7.921  -4.149  1.00 4.23  ? 50 ASN B CG     2  
ATOM 5931  O OD1    . ASN D 2 50 ? 5.817   -7.597  -5.049  1.00 4.21  ? 50 ASN B OD1    2  
ATOM 5932  N ND2    . ASN D 2 50 ? 7.036   -7.053  -3.251  1.00 5.11  ? 50 ASN B ND2    2  
ATOM 5933  H H      . ASN D 2 50 ? 8.489   -11.672 -5.272  1.00 2.94  ? 50 ASN B H      2  
ATOM 5934  H HA     . ASN D 2 50 ? 6.007   -10.208 -5.662  1.00 3.22  ? 50 ASN B HA     2  
ATOM 5935  H HB2    . ASN D 2 50 ? 6.441   -9.853  -3.280  1.00 3.78  ? 50 ASN B HB2    2  
ATOM 5936  H HB3    . ASN D 2 50 ? 8.086   -9.339  -3.635  1.00 3.85  ? 50 ASN B HB3    2  
ATOM 5937  H HD21   . ASN D 2 50 ? 7.641   -7.378  -2.552  1.00 5.34  ? 50 ASN B HD21   2  
ATOM 5938  H HD22   . ASN D 2 50 ? 6.742   -6.122  -3.324  1.00 5.63  ? 50 ASN B HD22   2  
ATOM 5939  N N      . ARG D 2 51 ? 7.373   -9.480  -7.626  1.00 3.35  ? 51 ARG B N      2  
ATOM 5940  C CA     . ARG D 2 51 ? 8.053   -8.851  -8.750  1.00 4.19  ? 51 ARG B CA     2  
ATOM 5941  C C      . ARG D 2 51 ? 7.059   -8.584  -9.876  1.00 4.47  ? 51 ARG B C      2  
ATOM 5942  O O      . ARG D 2 51 ? 6.949   -9.367  -10.819 1.00 5.22  ? 51 ARG B O      2  
ATOM 5943  C CB     . ARG D 2 51 ? 9.190   -9.747  -9.253  1.00 4.85  ? 51 ARG B CB     2  
ATOM 5944  C CG     . ARG D 2 51 ? 10.082  -9.086  -10.291 1.00 5.60  ? 51 ARG B CG     2  
ATOM 5945  C CD     . ARG D 2 51 ? 10.699  -10.114 -11.227 1.00 6.31  ? 51 ARG B CD     2  
ATOM 5946  N NE     . ARG D 2 51 ? 9.693   -10.742 -12.088 1.00 6.87  ? 51 ARG B NE     2  
ATOM 5947  C CZ     . ARG D 2 51 ? 9.638   -12.050 -12.345 1.00 7.58  ? 51 ARG B CZ     2  
ATOM 5948  N NH1    . ARG D 2 51 ? 10.528  -12.878 -11.803 1.00 7.81  ? 51 ARG B NH1    2  
ATOM 5949  N NH2    . ARG D 2 51 ? 8.693   -12.522 -13.150 1.00 8.32  ? 51 ARG B NH2    2  
ATOM 5950  H H      . ARG D 2 51 ? 6.529   -9.953  -7.785  1.00 3.15  ? 51 ARG B H      2  
ATOM 5951  H HA     . ARG D 2 51 ? 8.463   -7.912  -8.410  1.00 4.57  ? 51 ARG B HA     2  
ATOM 5952  H HB2    . ARG D 2 51 ? 9.805   -10.032 -8.412  1.00 4.80  ? 51 ARG B HB2    2  
ATOM 5953  H HB3    . ARG D 2 51 ? 8.763   -10.637 -9.691  1.00 5.25  ? 51 ARG B HB3    2  
ATOM 5954  H HG2    . ARG D 2 51 ? 9.491   -8.394  -10.873 1.00 5.78  ? 51 ARG B HG2    2  
ATOM 5955  H HG3    . ARG D 2 51 ? 10.873  -8.551  -9.786  1.00 5.84  ? 51 ARG B HG3    2  
ATOM 5956  H HD2    . ARG D 2 51 ? 11.435  -9.624  -11.847 1.00 6.51  ? 51 ARG B HD2    2  
ATOM 5957  H HD3    . ARG D 2 51 ? 11.179  -10.879 -10.634 1.00 6.56  ? 51 ARG B HD3    2  
ATOM 5958  H HE     . ARG D 2 51 ? 9.022   -10.151 -12.499 1.00 6.93  ? 51 ARG B HE     2  
ATOM 5959  H HH11   . ARG D 2 51 ? 11.245  -12.523 -11.201 1.00 7.47  ? 51 ARG B HH11   2  
ATOM 5960  H HH12   . ARG D 2 51 ? 10.484  -13.867 -11.991 1.00 8.49  ? 51 ARG B HH12   2  
ATOM 5961  H HH21   . ARG D 2 51 ? 8.025   -11.894 -13.567 1.00 8.37  ? 51 ARG B HH21   2  
ATOM 5962  H HH22   . ARG D 2 51 ? 8.635   -13.506 -13.346 1.00 8.97  ? 51 ARG B HH22   2  
ATOM 5963  N N      . CYS D 2 52 ? 6.324   -7.491  -9.758  1.00 4.27  ? 52 CYS B N      2  
ATOM 5964  C CA     . CYS D 2 52 ? 5.330   -7.131  -10.762 1.00 4.94  ? 52 CYS B CA     2  
ATOM 5965  C C      . CYS D 2 52 ? 5.970   -6.426  -11.942 1.00 5.55  ? 52 CYS B C      2  
ATOM 5966  O O      . CYS D 2 52 ? 5.973   -6.966  -13.053 1.00 6.12  ? 52 CYS B O      2  
ATOM 5967  C CB     . CYS D 2 52 ? 4.239   -6.260  -10.135 1.00 5.05  ? 52 CYS B CB     2  
ATOM 5968  S SG     . CYS D 2 52 ? 3.890   -6.664  -8.391  1.00 5.08  ? 52 CYS B SG     2  
ATOM 5969  H H      . CYS D 2 52 ? 6.438   -6.919  -8.972  1.00 3.94  ? 52 CYS B H      2  
ATOM 5970  H HA     . CYS D 2 52 ? 4.894   -8.039  -11.127 1.00 5.36  ? 52 CYS B HA     2  
ATOM 5971  H HB2    . CYS D 2 52 ? 4.545   -5.226  -10.179 1.00 5.09  ? 52 CYS B HB2    2  
ATOM 5972  H HB3    . CYS D 2 52 ? 3.324   -6.386  -10.694 1.00 5.59  ? 52 CYS B HB3    2  
ATOM 5973  N N      . ALA D 2 53 ? 6.508   -5.231  -11.704 1.00 5.80  ? 53 ALA B N      2  
ATOM 5974  C CA     . ALA D 2 53 ? 7.162   -4.471  -12.758 1.00 6.71  ? 53 ALA B CA     2  
ATOM 5975  C C      . ALA D 2 53 ? 6.152   -4.074  -13.835 1.00 7.17  ? 53 ALA B C      2  
ATOM 5976  O O      . ALA D 2 53 ? 4.955   -4.002  -13.568 1.00 7.21  ? 53 ALA B O      2  
ATOM 5977  C CB     . ALA D 2 53 ? 8.286   -5.308  -13.342 1.00 7.44  ? 53 ALA B CB     2  
ATOM 5978  H H      . ALA D 2 53 ? 6.446   -4.846  -10.808 1.00 5.59  ? 53 ALA B H      2  
ATOM 5979  H HA     . ALA D 2 53 ? 7.589   -3.579  -12.322 1.00 6.85  ? 53 ALA B HA     2  
ATOM 5980  H HB1    . ALA D 2 53 ? 8.009   -6.357  -13.267 1.00 7.46  ? 53 ALA B HB1    2  
ATOM 5981  H HB2    . ALA D 2 53 ? 9.195   -5.133  -12.788 1.00 7.68  ? 53 ALA B HB2    2  
ATOM 5982  H HB3    . ALA D 2 53 ? 8.435   -5.047  -14.379 1.00 7.92  ? 53 ALA B HB3    2  
ATOM 5983  N N      . GLN D 2 54 ? 6.632   -3.798  -15.040 1.00 7.80  ? 54 GLN B N      2  
ATOM 5984  C CA     . GLN D 2 54 ? 5.746   -3.433  -16.141 1.00 8.54  ? 54 GLN B CA     2  
ATOM 5985  C C      . GLN D 2 54 ? 6.098   -4.223  -17.394 1.00 9.32  ? 54 GLN B C      2  
ATOM 5986  O O      . GLN D 2 54 ? 5.603   -3.940  -18.483 1.00 9.60  ? 54 GLN B O      2  
ATOM 5987  C CB     . GLN D 2 54 ? 5.807   -1.927  -16.422 1.00 9.06  ? 54 GLN B CB     2  
ATOM 5988  C CG     . GLN D 2 54 ? 7.212   -1.367  -16.561 1.00 9.39  ? 54 GLN B CG     2  
ATOM 5989  C CD     . GLN D 2 54 ? 7.268   0.122   -16.275 1.00 9.99  ? 54 GLN B CD     2  
ATOM 5990  O OE1    . GLN D 2 54 ? 7.055   0.950   -17.160 1.00 10.19 ? 54 GLN B OE1    2  
ATOM 5991  N NE2    . GLN D 2 54 ? 7.566   0.471   -15.035 1.00 10.52 ? 54 GLN B NE2    2  
ATOM 5992  H H      . GLN D 2 54 ? 7.599   -3.824  -15.189 1.00 7.92  ? 54 GLN B H      2  
ATOM 5993  H HA     . GLN D 2 54 ? 4.740   -3.691  -15.846 1.00 8.43  ? 54 GLN B HA     2  
ATOM 5994  H HB2    . GLN D 2 54 ? 5.280   -1.730  -17.342 1.00 9.19  ? 54 GLN B HB2    2  
ATOM 5995  H HB3    . GLN D 2 54 ? 5.313   -1.403  -15.617 1.00 9.38  ? 54 GLN B HB3    2  
ATOM 5996  H HG2    . GLN D 2 54 ? 7.862   -1.878  -15.866 1.00 9.55  ? 54 GLN B HG2    2  
ATOM 5997  H HG3    . GLN D 2 54 ? 7.556   -1.539  -17.570 1.00 9.30  ? 54 GLN B HG3    2  
ATOM 5998  H HE21   . GLN D 2 54 ? 7.733   -0.245  -14.379 1.00 10.50 ? 54 GLN B HE21   2  
ATOM 5999  H HE22   . GLN D 2 54 ? 7.616   1.425   -14.820 1.00 11.04 ? 54 GLN B HE22   2  
ATOM 6000  N N      . GLN D 2 55 ? 6.959   -5.219  -17.227 1.00 9.86  ? 55 GLN B N      2  
ATOM 6001  C CA     . GLN D 2 55 ? 7.392   -6.061  -18.336 1.00 10.79 ? 55 GLN B CA     2  
ATOM 6002  C C      . GLN D 2 55 ? 7.989   -7.367  -17.821 1.00 11.03 ? 55 GLN B C      2  
ATOM 6003  O O      . GLN D 2 55 ? 8.721   -8.053  -18.535 1.00 11.89 ? 55 GLN B O      2  
ATOM 6004  C CB     . GLN D 2 55 ? 8.419   -5.322  -19.202 1.00 11.59 ? 55 GLN B CB     2  
ATOM 6005  C CG     . GLN D 2 55 ? 9.336   -4.400  -18.413 1.00 11.64 ? 55 GLN B CG     2  
ATOM 6006  C CD     . GLN D 2 55 ? 10.563  -3.975  -19.199 1.00 12.17 ? 55 GLN B CD     2  
ATOM 6007  O OE1    . GLN D 2 55 ? 11.057  -2.861  -19.041 1.00 12.46 ? 55 GLN B OE1    2  
ATOM 6008  N NE2    . GLN D 2 55 ? 11.068  -4.861  -20.045 1.00 12.48 ? 55 GLN B NE2    2  
ATOM 6009  H H      . GLN D 2 55 ? 7.314   -5.394  -16.332 1.00 9.74  ? 55 GLN B H      2  
ATOM 6010  H HA     . GLN D 2 55 ? 6.524   -6.290  -18.937 1.00 10.96 ? 55 GLN B HA     2  
ATOM 6011  H HB2    . GLN D 2 55 ? 9.032   -6.051  -19.713 1.00 12.06 ? 55 GLN B HB2    2  
ATOM 6012  H HB3    . GLN D 2 55 ? 7.893   -4.730  -19.936 1.00 11.87 ? 55 GLN B HB3    2  
ATOM 6013  H HG2    . GLN D 2 55 ? 8.779   -3.513  -18.135 1.00 11.18 ? 55 GLN B HG2    2  
ATOM 6014  H HG3    . GLN D 2 55 ? 9.660   -4.914  -17.519 1.00 11.94 ? 55 GLN B HG3    2  
ATOM 6015  H HE21   . GLN D 2 55 ? 10.629  -5.734  -20.119 1.00 12.35 ? 55 GLN B HE21   2  
ATOM 6016  H HE22   . GLN D 2 55 ? 11.859  -4.608  -20.561 1.00 12.93 ? 55 GLN B HE22   2  
ATOM 6017  N N      . LEU D 2 56 ? 7.669   -7.707  -16.578 1.00 10.42 ? 56 LEU B N      2  
ATOM 6018  C CA     . LEU D 2 56 ? 8.182   -8.925  -15.963 1.00 10.83 ? 56 LEU B CA     2  
ATOM 6019  C C      . LEU D 2 56 ? 7.059   -9.676  -15.259 1.00 10.86 ? 56 LEU B C      2  
ATOM 6020  O O      . LEU D 2 56 ? 7.286   -10.375 -14.267 1.00 10.80 ? 56 LEU B O      2  
ATOM 6021  C CB     . LEU D 2 56 ? 9.299   -8.599  -14.964 1.00 10.96 ? 56 LEU B CB     2  
ATOM 6022  C CG     . LEU D 2 56 ? 10.657  -8.252  -15.584 1.00 11.51 ? 56 LEU B CG     2  
ATOM 6023  C CD1    . LEU D 2 56 ? 10.823  -6.746  -15.718 1.00 11.92 ? 56 LEU B CD1    2  
ATOM 6024  C CD2    . LEU D 2 56 ? 11.787  -8.840  -14.749 1.00 11.84 ? 56 LEU B CD2    2  
ATOM 6025  H H      . LEU D 2 56 ? 7.058   -7.137  -16.067 1.00 9.81  ? 56 LEU B H      2  
ATOM 6026  H HA     . LEU D 2 56 ? 8.582   -9.550  -16.747 1.00 11.28 ? 56 LEU B HA     2  
ATOM 6027  H HB2    . LEU D 2 56 ? 8.979   -7.761  -14.362 1.00 10.74 ? 56 LEU B HB2    2  
ATOM 6028  H HB3    . LEU D 2 56 ? 9.433   -9.453  -14.315 1.00 11.09 ? 56 LEU B HB3    2  
ATOM 6029  H HG     . LEU D 2 56 ? 10.712  -8.684  -16.572 1.00 11.60 ? 56 LEU B HG     2  
ATOM 6030  H HD11   . LEU D 2 56 ? 10.756  -6.286  -14.744 1.00 11.94 ? 56 LEU B HD11   2  
ATOM 6031  H HD12   . LEU D 2 56 ? 10.042  -6.355  -16.355 1.00 12.29 ? 56 LEU B HD12   2  
ATOM 6032  H HD13   . LEU D 2 56 ? 11.786  -6.527  -16.155 1.00 12.01 ? 56 LEU B HD13   2  
ATOM 6033  H HD21   . LEU D 2 56 ? 11.683  -9.914  -14.710 1.00 11.99 ? 56 LEU B HD21   2  
ATOM 6034  H HD22   . LEU D 2 56 ? 11.742  -8.436  -13.749 1.00 11.87 ? 56 LEU B HD22   2  
ATOM 6035  H HD23   . LEU D 2 56 ? 12.735  -8.587  -15.200 1.00 12.11 ? 56 LEU B HD23   2  
ATOM 6036  N N      . ALA D 2 57 ? 5.849   -9.531  -15.785 1.00 11.17 ? 57 ALA B N      2  
ATOM 6037  C CA     . ALA D 2 57 ? 4.680   -10.188 -15.218 1.00 11.50 ? 57 ALA B CA     2  
ATOM 6038  C C      . ALA D 2 57 ? 4.742   -11.691 -15.458 1.00 12.12 ? 57 ALA B C      2  
ATOM 6039  O O      . ALA D 2 57 ? 4.722   -12.150 -16.602 1.00 12.46 ? 57 ALA B O      2  
ATOM 6040  C CB     . ALA D 2 57 ? 3.406   -9.603  -15.807 1.00 11.76 ? 57 ALA B CB     2  
ATOM 6041  H H      . ALA D 2 57 ? 5.743   -8.977  -16.585 1.00 11.34 ? 57 ALA B H      2  
ATOM 6042  H HA     . ALA D 2 57 ? 4.677   -10.001 -14.153 1.00 11.33 ? 57 ALA B HA     2  
ATOM 6043  H HB1    . ALA D 2 57 ? 2.549   -10.067 -15.344 1.00 11.79 ? 57 ALA B HB1    2  
ATOM 6044  H HB2    . ALA D 2 57 ? 3.384   -9.790  -16.872 1.00 11.97 ? 57 ALA B HB2    2  
ATOM 6045  H HB3    . ALA D 2 57 ? 3.381   -8.539  -15.629 1.00 11.89 ? 57 ALA B HB3    2  
ATOM 6046  N N      . GLY D 2 58 ? 4.829   -12.451 -14.374 1.00 12.46 ? 58 GLY B N      2  
ATOM 6047  C CA     . GLY D 2 58 ? 4.905   -13.894 -14.482 1.00 13.22 ? 58 GLY B CA     2  
ATOM 6048  C C      . GLY D 2 58 ? 6.301   -14.353 -14.847 1.00 13.88 ? 58 GLY B C      2  
ATOM 6049  O O      . GLY D 2 58 ? 7.091   -14.727 -13.978 1.00 14.22 ? 58 GLY B O      2  
ATOM 6050  H H      . GLY D 2 58 ? 4.849   -12.028 -13.492 1.00 12.30 ? 58 GLY B H      2  
ATOM 6051  H HA2    . GLY D 2 58 ? 4.625   -14.334 -13.536 1.00 13.42 ? 58 GLY B HA2    2  
ATOM 6052  H HA3    . GLY D 2 58 ? 4.217   -14.227 -15.243 1.00 13.31 ? 58 GLY B HA3    2  
ATOM 6053  N N      . LYS D 2 59 ? 6.614   -14.302 -16.132 1.00 14.21 ? 59 LYS B N      2  
ATOM 6054  C CA     . LYS D 2 59 ? 7.925   -14.704 -16.616 1.00 15.00 ? 59 LYS B CA     2  
ATOM 6055  C C      . LYS D 2 59 ? 8.508   -13.613 -17.507 1.00 15.80 ? 59 LYS B C      2  
ATOM 6056  O O      . LYS D 2 59 ? 9.386   -12.860 -17.087 1.00 16.22 ? 59 LYS B O      2  
ATOM 6057  C CB     . LYS D 2 59 ? 7.843   -16.032 -17.379 1.00 15.15 ? 59 LYS B CB     2  
ATOM 6058  C CG     . LYS D 2 59 ? 7.358   -17.197 -16.528 1.00 15.48 ? 59 LYS B CG     2  
ATOM 6059  C CD     . LYS D 2 59 ? 7.379   -18.504 -17.303 1.00 15.83 ? 59 LYS B CD     2  
ATOM 6060  C CE     . LYS D 2 59 ? 6.643   -19.606 -16.557 1.00 16.33 ? 59 LYS B CE     2  
ATOM 6061  N NZ     . LYS D 2 59 ? 5.169   -19.409 -16.581 1.00 16.63 ? 59 LYS B NZ     2  
ATOM 6062  H H      . LYS D 2 59 ? 5.948   -13.970 -16.772 1.00 14.03 ? 59 LYS B H      2  
ATOM 6063  H HA     . LYS D 2 59 ? 8.569   -14.830 -15.758 1.00 15.08 ? 59 LYS B HA     2  
ATOM 6064  H HB2    . LYS D 2 59 ? 7.164   -15.915 -18.211 1.00 14.97 ? 59 LYS B HB2    2  
ATOM 6065  H HB3    . LYS D 2 59 ? 8.824   -16.276 -17.760 1.00 15.35 ? 59 LYS B HB3    2  
ATOM 6066  H HG2    . LYS D 2 59 ? 8.001   -17.291 -15.666 1.00 15.45 ? 59 LYS B HG2    2  
ATOM 6067  H HG3    . LYS D 2 59 ? 6.347   -16.995 -16.205 1.00 15.64 ? 59 LYS B HG3    2  
ATOM 6068  H HD2    . LYS D 2 59 ? 6.905   -18.352 -18.260 1.00 15.98 ? 59 LYS B HD2    2  
ATOM 6069  H HD3    . LYS D 2 59 ? 8.406   -18.806 -17.452 1.00 15.74 ? 59 LYS B HD3    2  
ATOM 6070  H HE2    . LYS D 2 59 ? 6.876   -20.555 -17.018 1.00 16.47 ? 59 LYS B HE2    2  
ATOM 6071  H HE3    . LYS D 2 59 ? 6.978   -19.616 -15.530 1.00 16.48 ? 59 LYS B HE3    2  
ATOM 6072  H HZ1    . LYS D 2 59 ? 4.791   -19.367 -15.611 1.00 16.60 ? 59 LYS B HZ1    2  
ATOM 6073  H HZ2    . LYS D 2 59 ? 4.706   -20.199 -17.081 1.00 16.96 ? 59 LYS B HZ2    2  
ATOM 6074  H HZ3    . LYS D 2 59 ? 4.932   -18.518 -17.072 1.00 16.69 ? 59 LYS B HZ3    2  
ATOM 6075  N N      . GLN D 2 60 ? 7.999   -13.517 -18.730 1.00 16.14 ? 60 GLN B N      2  
ATOM 6076  C CA     . GLN D 2 60 ? 8.469   -12.515 -19.679 1.00 17.03 ? 60 GLN B CA     2  
ATOM 6077  C C      . GLN D 2 60 ? 7.297   -11.937 -20.464 1.00 17.70 ? 60 GLN B C      2  
ATOM 6078  O O      . GLN D 2 60 ? 6.274   -12.600 -20.643 1.00 17.98 ? 60 GLN B O      2  
ATOM 6079  C CB     . GLN D 2 60 ? 9.503   -13.119 -20.636 1.00 17.18 ? 60 GLN B CB     2  
ATOM 6080  C CG     . GLN D 2 60 ? 10.848  -13.392 -19.979 1.00 17.43 ? 60 GLN B CG     2  
ATOM 6081  C CD     . GLN D 2 60 ? 11.826  -14.096 -20.898 1.00 17.84 ? 60 GLN B CD     2  
ATOM 6082  O OE1    . GLN D 2 60 ? 11.862  -15.324 -20.962 1.00 17.85 ? 60 GLN B OE1    2  
ATOM 6083  N NE2    . GLN D 2 60 ? 12.636  -13.322 -21.604 1.00 18.33 ? 60 GLN B NE2    2  
ATOM 6084  H H      . GLN D 2 60 ? 7.283   -14.132 -19.001 1.00 15.87 ? 60 GLN B H      2  
ATOM 6085  H HA     . GLN D 2 60 ? 8.934   -11.719 -19.116 1.00 17.24 ? 60 GLN B HA     2  
ATOM 6086  H HB2    . GLN D 2 60 ? 9.119   -14.051 -21.023 1.00 17.19 ? 60 GLN B HB2    2  
ATOM 6087  H HB3    . GLN D 2 60 ? 9.660   -12.436 -21.458 1.00 17.25 ? 60 GLN B HB3    2  
ATOM 6088  H HG2    . GLN D 2 60 ? 11.280  -12.451 -19.674 1.00 17.37 ? 60 GLN B HG2    2  
ATOM 6089  H HG3    . GLN D 2 60 ? 10.687  -14.011 -19.108 1.00 17.52 ? 60 GLN B HG3    2  
ATOM 6090  H HE21   . GLN D 2 60 ? 12.559  -12.353 -21.499 1.00 18.39 ? 60 GLN B HE21   2  
ATOM 6091  H HE22   . GLN D 2 60 ? 13.293  -13.757 -22.198 1.00 18.68 ? 60 GLN B HE22   2  
ATOM 6092  N N      . SER D 2 61 ? 7.442   -10.701 -20.915 1.00 18.07 ? 61 SER B N      2  
ATOM 6093  C CA     . SER D 2 61 ? 6.396   -10.034 -21.674 1.00 18.84 ? 61 SER B CA     2  
ATOM 6094  C C      . SER D 2 61 ? 6.939   -9.541  -23.015 1.00 19.39 ? 61 SER B C      2  
ATOM 6095  O O      . SER D 2 61 ? 8.132   -9.261  -23.141 1.00 19.62 ? 61 SER B O      2  
ATOM 6096  C CB     . SER D 2 61 ? 5.838   -8.863  -20.861 1.00 19.03 ? 61 SER B CB     2  
ATOM 6097  O OG     . SER D 2 61 ? 5.646   -9.238  -19.505 1.00 18.82 ? 61 SER B OG     2  
ATOM 6098  H H      . SER D 2 61 ? 8.277   -10.219 -20.736 1.00 17.90 ? 61 SER B H      2  
ATOM 6099  H HA     . SER D 2 61 ? 5.606   -10.747 -21.855 1.00 19.02 ? 61 SER B HA     2  
ATOM 6100  H HB2    . SER D 2 61 ? 6.532   -8.035  -20.899 1.00 18.96 ? 61 SER B HB2    2  
ATOM 6101  H HB3    . SER D 2 61 ? 4.888   -8.557  -21.276 1.00 19.52 ? 61 SER B HB3    2  
ATOM 6102  H HG     . SER D 2 61 ? 5.686   -10.198 -19.433 1.00 18.88 ? 61 SER B HG     2  
ATOM 6103  N N      . LEU D 2 62 ? 6.065   -9.449  -24.012 1.00 19.70 ? 62 LEU B N      2  
ATOM 6104  C CA     . LEU D 2 62 ? 6.457   -8.996  -25.340 1.00 20.35 ? 62 LEU B CA     2  
ATOM 6105  C C      . LEU D 2 62 ? 5.527   -7.889  -25.816 1.00 20.63 ? 62 LEU B C      2  
ATOM 6106  O O      . LEU D 2 62 ? 4.302   -8.005  -25.587 1.00 20.95 ? 62 LEU B O      2  
ATOM 6107  C CB     . LEU D 2 62 ? 6.431   -10.161 -26.336 1.00 20.72 ? 62 LEU B CB     2  
ATOM 6108  C CG     . LEU D 2 62 ? 7.503   -11.233 -26.121 1.00 20.77 ? 62 LEU B CG     2  
ATOM 6109  C CD1    . LEU D 2 62 ? 7.254   -12.424 -27.032 1.00 21.17 ? 62 LEU B CD1    2  
ATOM 6110  C CD2    . LEU D 2 62 ? 8.889   -10.656 -26.367 1.00 21.11 ? 62 LEU B CD2    2  
ATOM 6111  O OXT    . LEU D 2 62 ? 6.015   -6.914  -26.423 1.00 20.62 ? 62 LEU B OXT    2  
ATOM 6112  H H      . LEU D 2 62 ? 5.128   -9.680  -23.848 1.00 19.56 ? 62 LEU B H      2  
ATOM 6113  H HA     . LEU D 2 62 ? 7.462   -8.608  -25.277 1.00 20.50 ? 62 LEU B HA     2  
ATOM 6114  H HB2    . LEU D 2 62 ? 5.462   -10.636 -26.275 1.00 20.72 ? 62 LEU B HB2    2  
ATOM 6115  H HB3    . LEU D 2 62 ? 6.551   -9.759  -27.330 1.00 21.11 ? 62 LEU B HB3    2  
ATOM 6116  H HG     . LEU D 2 62 ? 7.459   -11.578 -25.098 1.00 20.38 ? 62 LEU B HG     2  
ATOM 6117  H HD11   . LEU D 2 62 ? 8.017   -13.170 -26.866 1.00 21.11 ? 62 LEU B HD11   2  
ATOM 6118  H HD12   . LEU D 2 62 ? 7.284   -12.103 -28.062 1.00 21.41 ? 62 LEU B HD12   2  
ATOM 6119  H HD13   . LEU D 2 62 ? 6.284   -12.847 -26.814 1.00 21.41 ? 62 LEU B HD13   2  
ATOM 6120  H HD21   . LEU D 2 62 ? 8.953   -10.291 -27.381 1.00 21.30 ? 62 LEU B HD21   2  
ATOM 6121  H HD22   . LEU D 2 62 ? 9.632   -11.426 -26.214 1.00 21.08 ? 62 LEU B HD22   2  
ATOM 6122  H HD23   . LEU D 2 62 ? 9.069   -9.843  -25.679 1.00 21.32 ? 62 LEU B HD23   2  
ATOM 6123  O "O5'"  . DC  A 1 1  ? -28.234 -5.114  8.735   1.00 6.37  ? 1  DC  C "O5'"  3  
ATOM 6124  C "C5'"  . DC  A 1 1  ? -29.464 -5.392  8.056   1.00 6.29  ? 1  DC  C "C5'"  3  
ATOM 6125  C "C4'"  . DC  A 1 1  ? -29.551 -4.631  6.754   1.00 5.91  ? 1  DC  C "C4'"  3  
ATOM 6126  O "O4'"  . DC  A 1 1  ? -29.774 -3.232  7.059   1.00 5.98  ? 1  DC  C "O4'"  3  
ATOM 6127  C "C3'"  . DC  A 1 1  ? -28.273 -4.652  5.920   1.00 5.57  ? 1  DC  C "C3'"  3  
ATOM 6128  O "O3'"  . DC  A 1 1  ? -28.564 -4.433  4.536   1.00 5.22  ? 1  DC  C "O3'"  3  
ATOM 6129  C "C2'"  . DC  A 1 1  ? -27.488 -3.486  6.482   1.00 5.63  ? 1  DC  C "C2'"  3  
ATOM 6130  C "C1'"  . DC  A 1 1  ? -28.585 -2.484  6.819   1.00 5.81  ? 1  DC  C "C1'"  3  
ATOM 6131  N N1     . DC  A 1 1  ? -28.305 -1.657  8.005   1.00 6.13  ? 1  DC  C N1     3  
ATOM 6132  C C2     . DC  A 1 1  ? -28.565 -0.284  7.948   1.00 6.18  ? 1  DC  C C2     3  
ATOM 6133  O O2     . DC  A 1 1  ? -29.052 0.192   6.911   1.00 5.95  ? 1  DC  C O2     3  
ATOM 6134  N N3     . DC  A 1 1  ? -28.279 0.490   9.019   1.00 6.48  ? 1  DC  C N3     3  
ATOM 6135  C C4     . DC  A 1 1  ? -27.757 -0.060  10.119  1.00 6.72  ? 1  DC  C C4     3  
ATOM 6136  N N4     . DC  A 1 1  ? -27.483 0.742   11.150  1.00 7.02  ? 1  DC  C N4     3  
ATOM 6137  C C5     . DC  A 1 1  ? -27.490 -1.459  10.209  1.00 6.67  ? 1  DC  C C5     3  
ATOM 6138  C C6     . DC  A 1 1  ? -27.780 -2.213  9.139   1.00 6.38  ? 1  DC  C C6     3  
ATOM 6139  H "H5'"  . DC  A 1 1  ? -30.303 -5.106  8.690   1.00 6.54  ? 1  DC  C "H5'"  3  
ATOM 6140  H "H5''" . DC  A 1 1  ? -29.529 -6.460  7.845   1.00 6.26  ? 1  DC  C "H5''" 3  
ATOM 6141  H "H4'"  . DC  A 1 1  ? -30.341 -5.077  6.149   1.00 5.83  ? 1  DC  C "H4'"  3  
ATOM 6142  H "H3'"  . DC  A 1 1  ? -27.744 -5.596  6.033   1.00 5.59  ? 1  DC  C "H3'"  3  
ATOM 6143  H "H2'"  . DC  A 1 1  ? -26.914 -3.781  7.359   1.00 5.83  ? 1  DC  C "H2'"  3  
ATOM 6144  H "H2''" . DC  A 1 1  ? -26.786 -3.094  5.750   1.00 5.38  ? 1  DC  C "H2''" 3  
ATOM 6145  H "H1'"  . DC  A 1 1  ? -28.774 -1.819  5.973   1.00 5.61  ? 1  DC  C "H1'"  3  
ATOM 6146  H H41    . DC  A 1 1  ? -27.670 1.734   11.089  1.00 7.08  ? 1  DC  C H41    3  
ATOM 6147  H H42    . DC  A 1 1  ? -27.088 0.356   11.996  1.00 7.21  ? 1  DC  C H42    3  
ATOM 6148  H H5     . DC  A 1 1  ? -27.064 -1.897  11.111  1.00 6.88  ? 1  DC  C H5     3  
ATOM 6149  H H6     . DC  A 1 1  ? -27.594 -3.285  9.177   1.00 6.37  ? 1  DC  C H6     3  
ATOM 6150  H "HO5'" . DC  A 1 1  ? -28.211 -5.678  9.514   1.00 6.58  ? 1  DC  C "HO5'" 3  
ATOM 6151  P P      . DG  A 1 2  ? -27.365 -4.417  3.466   1.00 4.83  ? 2  DG  C P      3  
ATOM 6152  O OP1    . DG  A 1 2  ? -27.899 -4.959  2.191   1.00 4.58  ? 2  DG  C OP1    3  
ATOM 6153  O OP2    . DG  A 1 2  ? -26.153 -5.026  4.068   1.00 4.91  ? 2  DG  C OP2    3  
ATOM 6154  O "O5'"  . DG  A 1 2  ? -27.093 -2.861  3.259   1.00 4.73  ? 2  DG  C "O5'"  3  
ATOM 6155  C "C5'"  . DG  A 1 2  ? -28.055 -2.059  2.586   1.00 4.67  ? 2  DG  C "C5'"  3  
ATOM 6156  C "C4'"  . DG  A 1 2  ? -27.420 -0.818  2.005   1.00 4.53  ? 2  DG  C "C4'"  3  
ATOM 6157  O "O4'"  . DG  A 1 2  ? -27.240 0.160   3.060   1.00 4.84  ? 2  DG  C "O4'"  3  
ATOM 6158  C "C3'"  . DG  A 1 2  ? -26.019 -1.041  1.443   1.00 4.27  ? 2  DG  C "C3'"  3  
ATOM 6159  O "O3'"  . DG  A 1 2  ? -25.768 -0.085  0.413   1.00 4.08  ? 2  DG  C "O3'"  3  
ATOM 6160  C "C2'"  . DG  A 1 2  ? -25.129 -0.841  2.655   1.00 4.50  ? 2  DG  C "C2'"  3  
ATOM 6161  C "C1'"  . DG  A 1 2  ? -25.862 0.260   3.406   1.00 4.82  ? 2  DG  C "C1'"  3  
ATOM 6162  N N9     . DG  A 1 2  ? -25.722 0.219   4.860   1.00 5.17  ? 2  DG  C N9     3  
ATOM 6163  C C8     . DG  A 1 2  ? -25.531 -0.885  5.653   1.00 5.30  ? 2  DG  C C8     3  
ATOM 6164  N N7     . DG  A 1 2  ? -25.371 -0.594  6.915   1.00 5.63  ? 2  DG  C N7     3  
ATOM 6165  C C5     . DG  A 1 2  ? -25.474 0.791   6.962   1.00 5.74  ? 2  DG  C C5     3  
ATOM 6166  C C6     . DG  A 1 2  ? -25.376 1.691   8.064   1.00 6.09  ? 2  DG  C C6     3  
ATOM 6167  O O6     . DG  A 1 2  ? -25.163 1.432   9.257   1.00 6.37  ? 2  DG  C O6     3  
ATOM 6168  N N1     . DG  A 1 2  ? -25.548 3.011   7.664   1.00 6.12  ? 2  DG  C N1     3  
ATOM 6169  C C2     . DG  A 1 2  ? -25.782 3.419   6.372   1.00 5.85  ? 2  DG  C C2     3  
ATOM 6170  N N2     . DG  A 1 2  ? -25.933 4.740   6.186   1.00 5.98  ? 2  DG  C N2     3  
ATOM 6171  N N3     . DG  A 1 2  ? -25.869 2.596   5.340   1.00 5.51  ? 2  DG  C N3     3  
ATOM 6172  C C4     . DG  A 1 2  ? -25.706 1.306   5.704   1.00 5.47  ? 2  DG  C C4     3  
ATOM 6173  H "H5'"  . DG  A 1 2  ? -28.834 -1.761  3.289   1.00 4.93  ? 2  DG  C "H5'"  3  
ATOM 6174  H "H5''" . DG  A 1 2  ? -28.510 -2.634  1.780   1.00 4.50  ? 2  DG  C "H5''" 3  
ATOM 6175  H "H4'"  . DG  A 1 2  ? -28.047 -0.468  1.183   1.00 4.41  ? 2  DG  C "H4'"  3  
ATOM 6176  H "H3'"  . DG  A 1 2  ? -25.919 -2.043  1.030   1.00 4.11  ? 2  DG  C "H3'"  3  
ATOM 6177  H "H2'"  . DG  A 1 2  ? -25.046 -1.756  3.241   1.00 4.59  ? 2  DG  C "H2'"  3  
ATOM 6178  H "H2''" . DG  A 1 2  ? -24.122 -0.542  2.369   1.00 4.38  ? 2  DG  C "H2''" 3  
ATOM 6179  H "H1'"  . DG  A 1 2  ? -25.516 1.238   3.064   1.00 4.80  ? 2  DG  C "H1'"  3  
ATOM 6180  H H8     . DG  A 1 2  ? -25.507 -1.893  5.268   1.00 5.15  ? 2  DG  C H8     3  
ATOM 6181  H H1     . DG  A 1 2  ? -25.495 3.724   8.377   1.00 6.38  ? 2  DG  C H1     3  
ATOM 6182  H H21    . DG  A 1 2  ? -25.872 5.384   6.963   1.00 6.25  ? 2  DG  C H21    3  
ATOM 6183  H H22    . DG  A 1 2  ? -26.109 5.096   5.258   1.00 5.81  ? 2  DG  C H22    3  
ATOM 6184  P P      . DA  A 1 3  ? -24.318 0.010   -0.269  1.00 3.85  ? 3  DA  C P      3  
ATOM 6185  O OP1    . DA  A 1 3  ? -24.509 -0.075  -1.740  1.00 3.56  ? 3  DA  C OP1    3  
ATOM 6186  O OP2    . DA  A 1 3  ? -23.387 -0.932  0.401   1.00 3.83  ? 3  DA  C OP2    3  
ATOM 6187  O "O5'"  . DA  A 1 3  ? -23.900 1.500   0.107   1.00 4.07  ? 3  DA  C "O5'"  3  
ATOM 6188  C "C5'"  . DA  A 1 3  ? -24.877 2.531   -0.013  1.00 4.23  ? 3  DA  C "C5'"  3  
ATOM 6189  C "C4'"  . DA  A 1 3  ? -24.290 3.894   0.264   1.00 4.45  ? 3  DA  C "C4'"  3  
ATOM 6190  O "O4'"  . DA  A 1 3  ? -24.154 4.069   1.698   1.00 4.78  ? 3  DA  C "O4'"  3  
ATOM 6191  C "C3'"  . DA  A 1 3  ? -22.882 4.098   -0.284  1.00 4.31  ? 3  DA  C "C3'"  3  
ATOM 6192  O "O3'"  . DA  A 1 3  ? -22.682 5.489   -0.519  1.00 4.50  ? 3  DA  C "O3'"  3  
ATOM 6193  C "C2'"  . DA  A 1 3  ? -22.002 3.569   0.834   1.00 4.40  ? 3  DA  C "C2'"  3  
ATOM 6194  C "C1'"  . DA  A 1 3  ? -22.784 3.986   2.074   1.00 4.77  ? 3  DA  C "C1'"  3  
ATOM 6195  N N9     . DA  A 1 3  ? -22.654 3.098   3.234   1.00 4.90  ? 3  DA  C N9     3  
ATOM 6196  C C8     . DA  A 1 3  ? -22.670 1.727   3.283   1.00 4.75  ? 3  DA  C C8     3  
ATOM 6197  N N7     . DA  A 1 3  ? -22.466 1.238   4.486   1.00 4.98  ? 3  DA  C N7     3  
ATOM 6198  C C5     . DA  A 1 3  ? -22.322 2.366   5.284   1.00 5.29  ? 3  DA  C C5     3  
ATOM 6199  C C6     . DA  A 1 3  ? -22.079 2.529   6.667   1.00 5.64  ? 3  DA  C C6     3  
ATOM 6200  N N6     . DA  A 1 3  ? -21.920 1.515   7.520   1.00 5.74  ? 3  DA  C N6     3  
ATOM 6201  N N1     . DA  A 1 3  ? -21.998 3.792   7.146   1.00 5.90  ? 3  DA  C N1     3  
ATOM 6202  C C2     . DA  A 1 3  ? -22.144 4.812   6.289   1.00 5.83  ? 3  DA  C C2     3  
ATOM 6203  N N3     . DA  A 1 3  ? -22.367 4.784   4.973   1.00 5.53  ? 3  DA  C N3     3  
ATOM 6204  C C4     . DA  A 1 3  ? -22.448 3.518   4.529   1.00 5.25  ? 3  DA  C C4     3  
ATOM 6205  H "H5'"  . DA  A 1 3  ? -25.688 2.344   0.694   1.00 4.41  ? 3  DA  C "H5'"  3  
ATOM 6206  H "H5''" . DA  A 1 3  ? -25.287 2.525   -1.023  1.00 4.05  ? 3  DA  C "H5''" 3  
ATOM 6207  H "H4'"  . DA  A 1 3  ? -24.930 4.641   -0.207  1.00 4.51  ? 3  DA  C "H4'"  3  
ATOM 6208  H "H3'"  . DA  A 1 3  ? -22.736 3.550   -1.213  1.00 4.03  ? 3  DA  C "H3'"  3  
ATOM 6209  H "H2'"  . DA  A 1 3  ? -21.880 2.488   0.767   1.00 4.22  ? 3  DA  C "H2'"  3  
ATOM 6210  H "H2''" . DA  A 1 3  ? -21.009 4.015   0.804   1.00 4.42  ? 3  DA  C "H2''" 3  
ATOM 6211  H "H1'"  . DA  A 1 3  ? -22.477 4.987   2.386   1.00 4.98  ? 3  DA  C "H1'"  3  
ATOM 6212  H H8     . DA  A 1 3  ? -22.835 1.108   2.413   1.00 4.48  ? 3  DA  C H8     3  
ATOM 6213  H H61    . DA  A 1 3  ? -21.739 1.697   8.498   1.00 6.00  ? 3  DA  C H61    3  
ATOM 6214  H H62    . DA  A 1 3  ? -21.971 0.563   7.186   1.00 5.58  ? 3  DA  C H62    3  
ATOM 6215  H H2     . DA  A 1 3  ? -22.073 5.807   6.729   1.00 6.08  ? 3  DA  C H2     3  
ATOM 6216  P P      . DT  A 1 4  ? -21.252 6.029   -1.001  1.00 4.47  ? 4  DT  C P      3  
ATOM 6217  O OP1    . DT  A 1 4  ? -21.490 6.935   -2.153  1.00 4.48  ? 4  DT  C OP1    3  
ATOM 6218  O OP2    . DT  A 1 4  ? -20.321 4.880   -1.153  1.00 4.20  ? 4  DT  C OP2    3  
ATOM 6219  O "O5'"  . DT  A 1 4  ? -20.836 6.914   0.256   1.00 4.86  ? 4  DT  C "O5'"  3  
ATOM 6220  C "C5'"  . DT  A 1 4  ? -21.831 7.738   0.869   1.00 5.17  ? 4  DT  C "C5'"  3  
ATOM 6221  C "C4'"  . DT  A 1 4  ? -21.229 8.679   1.886   1.00 5.54  ? 4  DT  C "C4'"  3  
ATOM 6222  O "O4'"  . DT  A 1 4  ? -20.998 7.961   3.121   1.00 5.63  ? 4  DT  C "O4'"  3  
ATOM 6223  C "C3'"  . DT  A 1 4  ? -19.861 9.219   1.485   1.00 5.55  ? 4  DT  C "C3'"  3  
ATOM 6224  O "O3'"  . DT  A 1 4  ? -19.651 10.478  2.124   1.00 5.94  ? 4  DT  C "O3'"  3  
ATOM 6225  C "C2'"  . DT  A 1 4  ? -18.911 8.156   2.007   1.00 5.40  ? 4  DT  C "C2'"  3  
ATOM 6226  C "C1'"  . DT  A 1 4  ? -19.607 7.727   3.295   1.00 5.57  ? 4  DT  C "C1'"  3  
ATOM 6227  N N1     . DT  A 1 4  ? -19.401 6.326   3.722   1.00 5.39  ? 4  DT  C N1     3  
ATOM 6228  C C2     . DT  A 1 4  ? -19.155 6.117   5.064   1.00 5.63  ? 4  DT  C C2     3  
ATOM 6229  O O2     . DT  A 1 4  ? -19.155 7.014   5.889   1.00 5.97  ? 4  DT  C O2     3  
ATOM 6230  N N3     . DT  A 1 4  ? -18.910 4.814   5.411   1.00 5.48  ? 4  DT  C N3     3  
ATOM 6231  C C4     . DT  A 1 4  ? -18.893 3.720   4.571   1.00 5.12  ? 4  DT  C C4     3  
ATOM 6232  O O4     . DT  A 1 4  ? -18.615 2.609   5.022   1.00 5.06  ? 4  DT  C O4     3  
ATOM 6233  C C5     . DT  A 1 4  ? -19.182 4.005   3.178   1.00 4.86  ? 4  DT  C C5     3  
ATOM 6234  C C7     . DT  A 1 4  ? -19.146 2.883   2.190   1.00 4.47  ? 4  DT  C C7     3  
ATOM 6235  C C6     . DT  A 1 4  ? -19.427 5.279   2.824   1.00 5.01  ? 4  DT  C C6     3  
ATOM 6236  H "H5'"  . DT  A 1 4  ? -22.566 7.105   1.366   1.00 5.16  ? 4  DT  C "H5'"  3  
ATOM 6237  H "H5''" . DT  A 1 4  ? -22.335 8.325   0.102   1.00 5.16  ? 4  DT  C "H5''" 3  
ATOM 6238  H "H4'"  . DT  A 1 4  ? -21.896 9.536   1.993   1.00 5.75  ? 4  DT  C "H4'"  3  
ATOM 6239  H "H3'"  . DT  A 1 4  ? -19.784 9.344   0.404   1.00 5.40  ? 4  DT  C "H3'"  3  
ATOM 6240  H "H2'"  . DT  A 1 4  ? -18.811 7.333   1.299   1.00 5.09  ? 4  DT  C "H2'"  3  
ATOM 6241  H "H2''" . DT  A 1 4  ? -17.916 8.561   2.177   1.00 5.50  ? 4  DT  C "H2''" 3  
ATOM 6242  H "H1'"  . DT  A 1 4  ? -19.282 8.371   4.118   1.00 5.86  ? 4  DT  C "H1'"  3  
ATOM 6243  H H3     . DT  A 1 4  ? -18.704 4.646   6.388   1.00 5.68  ? 4  DT  C H3     3  
ATOM 6244  H H71    . DT  A 1 4  ? -18.317 2.215   2.427   1.00 4.37  ? 4  DT  C H71    3  
ATOM 6245  H H72    . DT  A 1 4  ? -20.083 2.328   2.234   1.00 4.43  ? 4  DT  C H72    3  
ATOM 6246  H H73    . DT  A 1 4  ? -19.010 3.286   1.185   1.00 4.51  ? 4  DT  C H73    3  
ATOM 6247  H H6     . DT  A 1 4  ? -19.661 5.493   1.782   1.00 4.84  ? 4  DT  C H6     3  
ATOM 6248  P P      . DA  A 1 5  ? -18.269 11.264  1.912   1.00 6.08  ? 5  DA  C P      3  
ATOM 6249  O OP1    . DA  A 1 5  ? -18.612 12.663  1.553   1.00 6.36  ? 5  DA  C OP1    3  
ATOM 6250  O OP2    . DA  A 1 5  ? -17.379 10.473  1.026   1.00 5.74  ? 5  DA  C OP2    3  
ATOM 6251  O "O5'"  . DA  A 1 5  ? -17.655 11.260  3.382   1.00 6.32  ? 5  DA  C "O5'"  3  
ATOM 6252  C "C5'"  . DA  A 1 5  ? -18.401 11.817  4.463   1.00 6.63  ? 5  DA  C "C5'"  3  
ATOM 6253  C "C4'"  . DA  A 1 5  ? -17.523 12.001  5.679   1.00 6.88  ? 5  DA  C "C4'"  3  
ATOM 6254  O "O4'"  . DA  A 1 5  ? -17.343 10.717  6.326   1.00 6.71  ? 5  DA  C "O4'"  3  
ATOM 6255  C "C3'"  . DA  A 1 5  ? -16.113 12.475  5.344   1.00 6.92  ? 5  DA  C "C3'"  3  
ATOM 6256  O "O3'"  . DA  A 1 5  ? -15.554 13.167  6.457   1.00 7.27  ? 5  DA  C "O3'"  3  
ATOM 6257  C "C2'"  . DA  A 1 5  ? -15.374 11.175  5.083   1.00 6.57  ? 5  DA  C "C2'"  3  
ATOM 6258  C "C1'"  . DA  A 1 5  ? -16.024 10.236  6.093   1.00 6.54  ? 5  DA  C "C1'"  3  
ATOM 6259  N N9     . DA  A 1 5  ? -16.094 8.835   5.675   1.00 6.17  ? 5  DA  C N9     3  
ATOM 6260  C C8     . DA  A 1 5  ? -16.471 8.333   4.459   1.00 5.84  ? 5  DA  C C8     3  
ATOM 6261  N N7     . DA  A 1 5  ? -16.388 7.026   4.377   1.00 5.55  ? 5  DA  C N7     3  
ATOM 6262  C C5     . DA  A 1 5  ? -15.927 6.641   5.627   1.00 5.72  ? 5  DA  C C5     3  
ATOM 6263  C C6     . DA  A 1 5  ? -15.620 5.381   6.179   1.00 5.59  ? 5  DA  C C6     3  
ATOM 6264  N N6     . DA  A 1 5  ? -15.717 4.231   5.504   1.00 5.26  ? 5  DA  C N6     3  
ATOM 6265  N N1     . DA  A 1 5  ? -15.195 5.341   7.460   1.00 5.86  ? 5  DA  C N1     3  
ATOM 6266  C C2     . DA  A 1 5  ? -15.079 6.496   8.130   1.00 6.20  ? 5  DA  C C2     3  
ATOM 6267  N N3     . DA  A 1 5  ? -15.327 7.740   7.719   1.00 6.34  ? 5  DA  C N3     3  
ATOM 6268  C C4     . DA  A 1 5  ? -15.753 7.743   6.443   1.00 6.09  ? 5  DA  C C4     3  
ATOM 6269  H "H5'"  . DA  A 1 5  ? -19.227 11.153  4.718   1.00 6.53  ? 5  DA  C "H5'"  3  
ATOM 6270  H "H5''" . DA  A 1 5  ? -18.803 12.786  4.167   1.00 6.81  ? 5  DA  C "H5''" 3  
ATOM 6271  H "H4'"  . DA  A 1 5  ? -17.979 12.758  6.319   1.00 7.17  ? 5  DA  C "H4'"  3  
ATOM 6272  H "H3'"  . DA  A 1 5  ? -16.112 13.129  4.472   1.00 6.93  ? 5  DA  C "H3'"  3  
ATOM 6273  H "H2'"  . DA  A 1 5  ? -15.516 10.840  4.057   1.00 6.32  ? 5  DA  C "H2'"  3  
ATOM 6274  H "H2''" . DA  A 1 5  ? -14.305 11.289  5.246   1.00 6.61  ? 5  DA  C "H2''" 3  
ATOM 6275  H "H1'"  . DA  A 1 5  ? -15.491 10.277  7.045   1.00 6.72  ? 5  DA  C "H1'"  3  
ATOM 6276  H H8     . DA  A 1 5  ? -16.803 8.956   3.641   1.00 5.83  ? 5  DA  C H8     3  
ATOM 6277  H H61    . DA  A 1 5  ? -15.465 3.358   5.946   1.00 5.21  ? 5  DA  C H61    3  
ATOM 6278  H H62    . DA  A 1 5  ? -16.025 4.243   4.543   1.00 5.07  ? 5  DA  C H62    3  
ATOM 6279  H H2     . DA  A 1 5  ? -14.733 6.405   9.162   1.00 6.41  ? 5  DA  C H2     3  
ATOM 6280  P P      . DA  A 1 6  ? -14.050 13.719  6.378   1.00 7.38  ? 6  DA  C P      3  
ATOM 6281  O OP1    . DA  A 1 6  ? -14.059 15.118  6.876   1.00 7.80  ? 6  DA  C OP1    3  
ATOM 6282  O OP2    . DA  A 1 6  ? -13.475 13.419  5.041   1.00 7.10  ? 6  DA  C OP2    3  
ATOM 6283  O "O5'"  . DA  A 1 6  ? -13.316 12.812  7.462   1.00 7.35  ? 6  DA  C "O5'"  3  
ATOM 6284  C "C5'"  . DA  A 1 6  ? -13.889 12.666  8.757   1.00 7.57  ? 6  DA  C "C5'"  3  
ATOM 6285  C "C4'"  . DA  A 1 6  ? -12.931 11.972  9.696   1.00 7.58  ? 6  DA  C "C4'"  3  
ATOM 6286  O "O4'"  . DA  A 1 6  ? -12.954 10.547  9.428   1.00 7.22  ? 6  DA  C "O4'"  3  
ATOM 6287  C "C3'"  . DA  A 1 6  ? -11.479 12.387  9.481   1.00 7.61  ? 6  DA  C "C3'"  3  
ATOM 6288  O "O3'"  . DA  A 1 6  ? -10.741 12.200  10.684  1.00 7.79  ? 6  DA  C "O3'"  3  
ATOM 6289  C "C2'"  . DA  A 1 6  ? -11.009 11.433  8.399   1.00 7.18  ? 6  DA  C "C2'"  3  
ATOM 6290  C "C1'"  . DA  A 1 6  ? -11.757 10.158  8.762   1.00 6.98  ? 6  DA  C "C1'"  3  
ATOM 6291  N N9     . DA  A 1 6  ? -12.087 9.278   7.640   1.00 6.57  ? 6  DA  C N9     3  
ATOM 6292  C C8     . DA  A 1 6  ? -12.572 9.598   6.398   1.00 6.41  ? 6  DA  C C8     3  
ATOM 6293  N N7     . DA  A 1 6  ? -12.698 8.564   5.597   1.00 6.03  ? 6  DA  C N7     3  
ATOM 6294  C C5     . DA  A 1 6  ? -12.278 7.489   6.370   1.00 5.94  ? 6  DA  C C5     3  
ATOM 6295  C C6     . DA  A 1 6  ? -12.163 6.108   6.100   1.00 5.61  ? 6  DA  C C6     3  
ATOM 6296  N N6     . DA  A 1 6  ? -12.458 5.552   4.922   1.00 5.26  ? 6  DA  C N6     3  
ATOM 6297  N N1     . DA  A 1 6  ? -11.720 5.307   7.096   1.00 5.66  ? 6  DA  C N1     3  
ATOM 6298  C C2     . DA  A 1 6  ? -11.408 5.866   8.274   1.00 6.01  ? 6  DA  C C2     3  
ATOM 6299  N N3     . DA  A 1 6  ? -11.465 7.144   8.643   1.00 6.33  ? 6  DA  C N3     3  
ATOM 6300  C C4     . DA  A 1 6  ? -11.914 7.913   7.634   1.00 6.28  ? 6  DA  C C4     3  
ATOM 6301  H "H5'"  . DA  A 1 6  ? -14.804 12.075  8.686   1.00 7.43  ? 6  DA  C "H5'"  3  
ATOM 6302  H "H5''" . DA  A 1 6  ? -14.132 13.649  9.162   1.00 7.87  ? 6  DA  C "H5''" 3  
ATOM 6303  H "H4'"  . DA  A 1 6  ? -13.199 12.236  10.721  1.00 7.85  ? 6  DA  C "H4'"  3  
ATOM 6304  H "H3'"  . DA  A 1 6  ? -11.406 13.429  9.169   1.00 7.79  ? 6  DA  C "H3'"  3  
ATOM 6305  H "H2'"  . DA  A 1 6  ? -11.273 11.798  7.406   1.00 7.08  ? 6  DA  C "H2'"  3  
ATOM 6306  H "H2''" . DA  A 1 6  ? -9.928  11.303  8.423   1.00 7.14  ? 6  DA  C "H2''" 3  
ATOM 6307  H "H1'"  . DA  A 1 6  ? -11.171 9.577   9.479   1.00 6.99  ? 6  DA  C "H1'"  3  
ATOM 6308  H H8     . DA  A 1 6  ? -12.819 10.605  6.103   1.00 6.58  ? 6  DA  C H8     3  
ATOM 6309  H H61    . DA  A 1 6  ? -12.341 4.560   4.779   1.00 5.04  ? 6  DA  C H61    3  
ATOM 6310  H H62    . DA  A 1 6  ? -12.784 6.134   4.162   1.00 5.24  ? 6  DA  C H62    3  
ATOM 6311  H H2     . DA  A 1 6  ? -11.058 5.174   9.040   1.00 6.05  ? 6  DA  C H2     3  
ATOM 6312  P P      . DG  A 1 7  ? -9.159  12.466  10.700  1.00 7.83  ? 7  DG  C P      3  
ATOM 6313  O OP1    . DG  A 1 7  ? -8.867  13.287  11.902  1.00 8.24  ? 7  DG  C OP1    3  
ATOM 6314  O OP2    . DG  A 1 7  ? -8.714  12.933  9.364   1.00 7.69  ? 7  DG  C OP2    3  
ATOM 6315  O "O5'"  . DG  A 1 7  ? -8.602  10.996  10.947  1.00 7.54  ? 7  DG  C "O5'"  3  
ATOM 6316  C "C5'"  . DG  A 1 7  ? -9.179  10.197  11.977  1.00 7.59  ? 7  DG  C "C5'"  3  
ATOM 6317  C "C4'"  . DG  A 1 7  ? -8.311  8.999   12.281  1.00 7.39  ? 7  DG  C "C4'"  3  
ATOM 6318  O "O4'"  . DG  A 1 7  ? -8.556  7.973   11.287  1.00 6.98  ? 7  DG  C "O4'"  3  
ATOM 6319  C "C3'"  . DG  A 1 7  ? -6.823  9.312   12.167  1.00 7.39  ? 7  DG  C "C3'"  3  
ATOM 6320  O "O3'"  . DG  A 1 7  ? -6.081  8.420   12.993  1.00 7.37  ? 7  DG  C "O3'"  3  
ATOM 6321  C "C2'"  . DG  A 1 7  ? -6.536  9.067   10.696  1.00 7.03  ? 7  DG  C "C2'"  3  
ATOM 6322  C "C1'"  . DG  A 1 7  ? -7.449  7.886   10.399  1.00 6.75  ? 7  DG  C "C1'"  3  
ATOM 6323  N N9     . DG  A 1 7  ? -7.932  7.777   9.024   1.00 6.45  ? 7  DG  C N9     3  
ATOM 6324  C C8     . DG  A 1 7  ? -8.390  8.775   8.200   1.00 6.51  ? 7  DG  C C8     3  
ATOM 6325  N N7     . DG  A 1 7  ? -8.674  8.359   6.993   1.00 6.19  ? 7  DG  C N7     3  
ATOM 6326  C C5     . DG  A 1 7  ? -8.402  6.997   7.027   1.00 5.90  ? 7  DG  C C5     3  
ATOM 6327  C C6     . DG  A 1 7  ? -8.510  5.998   6.009   1.00 5.49  ? 7  DG  C C6     3  
ATOM 6328  O O6     . DG  A 1 7  ? -8.867  6.125   4.829   1.00 5.31  ? 7  DG  C O6     3  
ATOM 6329  N N1     . DG  A 1 7  ? -8.138  4.743   6.483   1.00 5.33  ? 7  DG  C N1     3  
ATOM 6330  C C2     . DG  A 1 7  ? -7.716  4.475   7.761   1.00 5.53  ? 7  DG  C C2     3  
ATOM 6331  N N2     . DG  A 1 7  ? -7.415  3.198   8.033   1.00 5.35  ? 7  DG  C N2     3  
ATOM 6332  N N3     . DG  A 1 7  ? -7.602  5.390   8.711   1.00 5.90  ? 7  DG  C N3     3  
ATOM 6333  C C4     . DG  A 1 7  ? -7.960  6.618   8.278   1.00 6.06  ? 7  DG  C C4     3  
ATOM 6334  H "H5'"  . DG  A 1 7  ? -10.163 9.852   11.661  1.00 7.47  ? 7  DG  C "H5'"  3  
ATOM 6335  H "H5''" . DG  A 1 7  ? -9.288  10.793  12.882  1.00 7.91  ? 7  DG  C "H5''" 3  
ATOM 6336  H "H4'"  . DG  A 1 7  ? -8.505  8.684   13.308  1.00 7.56  ? 7  DG  C "H4'"  3  
ATOM 6337  H "H3'"  . DG  A 1 7  ? -6.610  10.340  12.461  1.00 7.66  ? 7  DG  C "H3'"  3  
ATOM 6338  H "H2'"  . DG  A 1 7  ? -6.782  9.941   10.093  1.00 7.11  ? 7  DG  C "H2'"  3  
ATOM 6339  H "H2''" . DG  A 1 7  ? -5.485  8.838   10.526  1.00 6.93  ? 7  DG  C "H2''" 3  
ATOM 6340  H "H1'"  . DG  A 1 7  ? -6.930  6.954   10.639  1.00 6.60  ? 7  DG  C "H1'"  3  
ATOM 6341  H H8     . DG  A 1 7  ? -8.505  9.802   8.516   1.00 6.80  ? 7  DG  C H8     3  
ATOM 6342  H H1     . DG  A 1 7  ? -8.180  3.971   5.829   1.00 5.05  ? 7  DG  C H1     3  
ATOM 6343  H H21    . DG  A 1 7  ? -7.497  2.482   7.323   1.00 5.08  ? 7  DG  C H21    3  
ATOM 6344  H H22    . DG  A 1 7  ? -7.103  2.946   8.961   1.00 5.51  ? 7  DG  C H22    3  
ATOM 6345  P P      . DA  A 1 8  ? -4.478  8.459   12.974  1.00 7.34  ? 8  DA  C P      3  
ATOM 6346  O OP1    . DA  A 1 8  ? -4.010  8.471   14.384  1.00 7.64  ? 8  DA  C OP1    3  
ATOM 6347  O OP2    . DA  A 1 8  ? -4.006  9.509   12.036  1.00 7.36  ? 8  DA  C OP2    3  
ATOM 6348  O "O5'"  . DA  A 1 8  ? -4.145  7.032   12.356  1.00 6.91  ? 8  DA  C "O5'"  3  
ATOM 6349  C "C5'"  . DA  A 1 8  ? -4.799  5.879   12.882  1.00 6.83  ? 8  DA  C "C5'"  3  
ATOM 6350  C "C4'"  . DA  A 1 8  ? -4.121  4.616   12.413  1.00 6.47  ? 8  DA  C "C4'"  3  
ATOM 6351  O "O4'"  . DA  A 1 8  ? -4.571  4.308   11.068  1.00 6.13  ? 8  DA  C "O4'"  3  
ATOM 6352  C "C3'"  . DA  A 1 8  ? -2.608  4.757   12.298  1.00 6.42  ? 8  DA  C "C3'"  3  
ATOM 6353  O "O3'"  . DA  A 1 8  ? -1.994  3.484   12.459  1.00 6.21  ? 8  DA  C "O3'"  3  
ATOM 6354  C "C2'"  . DA  A 1 8  ? -2.425  5.300   10.892  1.00 6.21  ? 8  DA  C "C2'"  3  
ATOM 6355  C "C1'"  . DA  A 1 8  ? -3.535  4.584   10.133  1.00 5.94  ? 8  DA  C "C1'"  3  
ATOM 6356  N N9     . DA  A 1 8  ? -4.094  5.308   8.990   1.00 5.85  ? 8  DA  C N9     3  
ATOM 6357  C C8     . DA  A 1 8  ? -4.499  6.618   8.894   1.00 6.11  ? 8  DA  C C8     3  
ATOM 6358  N N7     . DA  A 1 8  ? -4.903  6.959   7.691   1.00 5.96  ? 8  DA  C N7     3  
ATOM 6359  C C5     . DA  A 1 8  ? -4.766  5.793   6.950   1.00 5.57  ? 8  DA  C C5     3  
ATOM 6360  C C6     . DA  A 1 8  ? -5.022  5.491   5.592   1.00 5.26  ? 8  DA  C C6     3  
ATOM 6361  N N6     . DA  A 1 8  ? -5.474  6.380   4.703   1.00 5.31  ? 8  DA  C N6     3  
ATOM 6362  N N1     . DA  A 1 8  ? -4.787  4.226   5.175   1.00 4.91  ? 8  DA  C N1     3  
ATOM 6363  C C2     . DA  A 1 8  ? -4.321  3.337   6.063   1.00 4.88  ? 8  DA  C C2     3  
ATOM 6364  N N3     . DA  A 1 8  ? -4.033  3.503   7.353   1.00 5.16  ? 8  DA  C N3     3  
ATOM 6365  C C4     . DA  A 1 8  ? -4.283  4.767   7.738   1.00 5.50  ? 8  DA  C C4     3  
ATOM 6366  H "H5'"  . DA  A 1 8  ? -5.837  5.869   12.551  1.00 6.79  ? 8  DA  C "H5'"  3  
ATOM 6367  H "H5''" . DA  A 1 8  ? -4.772  5.912   13.970  1.00 7.09  ? 8  DA  C "H5''" 3  
ATOM 6368  H "H4'"  . DA  A 1 8  ? -4.322  3.826   13.139  1.00 6.52  ? 8  DA  C "H4'"  3  
ATOM 6369  H "H3'"  . DA  A 1 8  ? -2.220  5.442   13.052  1.00 6.70  ? 8  DA  C "H3'"  3  
ATOM 6370  H "H2'"  . DA  A 1 8  ? -2.540  6.383   10.867  1.00 6.42  ? 8  DA  C "H2'"  3  
ATOM 6371  H "H2''" . DA  A 1 8  ? -1.437  5.063   10.500  1.00 6.05  ? 8  DA  C "H2''" 3  
ATOM 6372  H "H1'"  . DA  A 1 8  ? -3.171  3.620   9.770   1.00 5.67  ? 8  DA  C "H1'"  3  
ATOM 6373  H H8     . DA  A 1 8  ? -4.486  7.301   9.730   1.00 6.42  ? 8  DA  C H8     3  
ATOM 6374  H H61    . DA  A 1 8  ? -5.627  6.114   3.742   1.00 5.10  ? 8  DA  C H61    3  
ATOM 6375  H H62    . DA  A 1 8  ? -5.649  7.332   4.994   1.00 5.58  ? 8  DA  C H62    3  
ATOM 6376  H H2     . DA  A 1 8  ? -4.153  2.333   5.672   1.00 4.61  ? 8  DA  C H2     3  
ATOM 6377  P P      . DT  A 1 9  ? -0.407  3.332   12.293  1.00 6.09  ? 9  DT  C P      3  
ATOM 6378  O OP1    . DT  A 1 9  ? 0.100   2.569   13.461  1.00 6.21  ? 9  DT  C OP1    3  
ATOM 6379  O OP2    . DT  A 1 9  ? 0.189   4.652   11.962  1.00 6.24  ? 9  DT  C OP2    3  
ATOM 6380  O "O5'"  . DT  A 1 9  ? -0.324  2.400   11.009  1.00 5.64  ? 9  DT  C "O5'"  3  
ATOM 6381  C "C5'"  . DT  A 1 9  ? -1.184  1.267   10.913  1.00 5.46  ? 9  DT  C "C5'"  3  
ATOM 6382  C "C4'"  . DT  A 1 9  ? -0.739  0.349   9.803   1.00 5.04  ? 9  DT  C "C4'"  3  
ATOM 6383  O "O4'"  . DT  A 1 9  ? -1.191  0.892   8.539   1.00 4.86  ? 9  DT  C "O4'"  3  
ATOM 6384  C "C3'"  . DT  A 1 9  ? 0.776   0.250   9.675   1.00 4.94  ? 9  DT  C "C3'"  3  
ATOM 6385  O "O3'"  . DT  A 1 9  ? 1.118   -1.015  9.106   1.00 4.61  ? 9  DT  C "O3'"  3  
ATOM 6386  C "C2'"  . DT  A 1 9  ? 1.112   1.416   8.763   1.00 4.92  ? 9  DT  C "C2'"  3  
ATOM 6387  C "C1'"  . DT  A 1 9  ? -0.088  1.437   7.822   1.00 4.77  ? 9  DT  C "C1'"  3  
ATOM 6388  N N1     . DT  A 1 9  ? -0.477  2.766   7.293   1.00 4.93  ? 9  DT  C N1     3  
ATOM 6389  C C2     . DT  A 1 9  ? -0.846  2.822   5.966   1.00 4.69  ? 9  DT  C C2     3  
ATOM 6390  O O2     . DT  A 1 9  ? -0.900  1.838   5.248   1.00 4.36  ? 9  DT  C O2     3  
ATOM 6391  N N3     . DT  A 1 9  ? -1.152  4.076   5.508   1.00 4.89  ? 9  DT  C N3     3  
ATOM 6392  C C4     . DT  A 1 9  ? -1.135  5.251   6.223   1.00 5.28  ? 9  DT  C C4     3  
ATOM 6393  O O4     . DT  A 1 9  ? -1.406  6.312   5.660   1.00 5.43  ? 9  DT  C O4     3  
ATOM 6394  C C5     . DT  A 1 9  ? -0.754  5.123   7.614   1.00 5.49  ? 9  DT  C C5     3  
ATOM 6395  C C7     . DT  A 1 9  ? -0.673  6.359   8.456   1.00 5.91  ? 9  DT  C C7     3  
ATOM 6396  C C6     . DT  A 1 9  ? -0.451  3.899   8.082   1.00 5.31  ? 9  DT  C C6     3  
ATOM 6397  H "H5'"  . DT  A 1 9  ? -2.202  1.598   10.713  1.00 5.51  ? 9  DT  C "H5'"  3  
ATOM 6398  H "H5''" . DT  A 1 9  ? -1.168  0.718   11.855  1.00 5.60  ? 9  DT  C "H5''" 3  
ATOM 6399  H "H4'"  . DT  A 1 9  ? -1.115  -0.654  10.014  1.00 4.97  ? 9  DT  C "H4'"  3  
ATOM 6400  H "H3'"  . DT  A 1 9  ? 1.257   0.346   10.648  1.00 5.16  ? 9  DT  C "H3'"  3  
ATOM 6401  H "H2'"  . DT  A 1 9  ? 1.209   2.342   9.329   1.00 5.21  ? 9  DT  C "H2'"  3  
ATOM 6402  H "H2''" . DT  A 1 9  ? 2.053   1.255   8.243   1.00 4.76  ? 9  DT  C "H2''" 3  
ATOM 6403  H "H1'"  . DT  A 1 9  ? 0.096   0.779   6.970   1.00 4.47  ? 9  DT  C "H1'"  3  
ATOM 6404  H H3     . DT  A 1 9  ? -1.408  4.149   4.533   1.00 4.75  ? 9  DT  C H3     3  
ATOM 6405  H H71    . DT  A 1 9  ? -0.222  7.164   7.877   1.00 5.99  ? 9  DT  C H71    3  
ATOM 6406  H H72    . DT  A 1 9  ? -0.062  6.159   9.337   1.00 6.04  ? 9  DT  C H72    3  
ATOM 6407  H H73    . DT  A 1 9  ? -1.674  6.651   8.769   1.00 6.06  ? 9  DT  C H73    3  
ATOM 6408  H H6     . DT  A 1 9  ? -0.178  3.798   9.131   1.00 5.49  ? 9  DT  C H6     3  
ATOM 6409  P P      . DA  A 1 10 ? 2.653   -1.379  8.818   1.00 4.43  ? 10 DA  C P      3  
ATOM 6410  O OP1    . DA  A 1 10 ? 2.927   -2.704  9.429   1.00 4.39  ? 10 DA  C OP1    3  
ATOM 6411  O OP2    . DA  A 1 10 ? 3.514   -0.219  9.163   1.00 4.66  ? 10 DA  C OP2    3  
ATOM 6412  O "O5'"  . DA  A 1 10 ? 2.654   -1.552  7.236   1.00 4.06  ? 10 DA  C "O5'"  3  
ATOM 6413  C "C5'"  . DA  A 1 10 ? 1.682   -2.398  6.624   1.00 3.83  ? 10 DA  C "C5'"  3  
ATOM 6414  C "C4'"  . DA  A 1 10 ? 1.920   -2.510  5.139   1.00 3.50  ? 10 DA  C "C4'"  3  
ATOM 6415  O "O4'"  . DA  A 1 10 ? 1.473   -1.287  4.501   1.00 3.59  ? 10 DA  C "O4'"  3  
ATOM 6416  C "C3'"  . DA  A 1 10 ? 3.392   -2.635  4.757   1.00 3.38  ? 10 DA  C "C3'"  3  
ATOM 6417  O "O3'"  . DA  A 1 10 ? 3.519   -3.316  3.511   1.00 3.05  ? 10 DA  C "O3'"  3  
ATOM 6418  C "C2'"  . DA  A 1 10 ? 3.836   -1.189  4.653   1.00 3.59  ? 10 DA  C "C2'"  3  
ATOM 6419  C "C1'"  . DA  A 1 10 ? 2.597   -0.510  4.093   1.00 3.64  ? 10 DA  C "C1'"  3  
ATOM 6420  N N9     . DA  A 1 10 ? 2.410   0.873   4.538   1.00 3.99  ? 10 DA  C N9     3  
ATOM 6421  C C8     . DA  A 1 10 ? 2.560   1.385   5.801   1.00 4.31  ? 10 DA  C C8     3  
ATOM 6422  N N7     . DA  A 1 10 ? 2.373   2.683   5.872   1.00 4.59  ? 10 DA  C N7     3  
ATOM 6423  C C5     . DA  A 1 10 ? 2.075   3.049   4.566   1.00 4.47  ? 10 DA  C C5     3  
ATOM 6424  C C6     . DA  A 1 10 ? 1.780   4.293   3.971   1.00 4.68  ? 10 DA  C C6     3  
ATOM 6425  N N6     . DA  A 1 10 ? 1.756   5.452   4.637   1.00 5.05  ? 10 DA  C N6     3  
ATOM 6426  N N1     . DA  A 1 10 ? 1.519   4.307   2.646   1.00 4.52  ? 10 DA  C N1     3  
ATOM 6427  C C2     . DA  A 1 10 ? 1.561   3.150   1.971   1.00 4.16  ? 10 DA  C C2     3  
ATOM 6428  N N3     . DA  A 1 10 ? 1.832   1.925   2.416   1.00 3.92  ? 10 DA  C N3     3  
ATOM 6429  C C4     . DA  A 1 10 ? 2.082   1.942   3.737   1.00 4.10  ? 10 DA  C C4     3  
ATOM 6430  H "H5'"  . DA  A 1 10 ? 0.686   -1.989  6.793   1.00 3.96  ? 10 DA  C "H5'"  3  
ATOM 6431  H "H5''" . DA  A 1 10 ? 1.736   -3.393  7.068   1.00 3.81  ? 10 DA  C "H5''" 3  
ATOM 6432  H "H4'"  . DA  A 1 10 ? 1.414   -3.406  4.777   1.00 3.33  ? 10 DA  C "H4'"  3  
ATOM 6433  H "H3'"  . DA  A 1 10 ? 3.950   -3.176  5.522   1.00 3.43  ? 10 DA  C "H3'"  3  
ATOM 6434  H "H2'"  . DA  A 1 10 ? 4.120   -0.791  5.627   1.00 3.83  ? 10 DA  C "H2'"  3  
ATOM 6435  H "H2''" . DA  A 1 10 ? 4.696   -1.083  3.993   1.00 3.50  ? 10 DA  C "H2''" 3  
ATOM 6436  H "H1'"  . DA  A 1 10 ? 2.619   -0.515  3.001   1.00 3.48  ? 10 DA  C "H1'"  3  
ATOM 6437  H H8     . DA  A 1 10 ? 2.814   0.778   6.655   1.00 4.34  ? 10 DA  C H8     3  
ATOM 6438  H H61    . DA  A 1 10 ? 1.552   6.314   4.152   1.00 5.20  ? 10 DA  C H61    3  
ATOM 6439  H H62    . DA  A 1 10 ? 1.955   5.469   5.627   1.00 5.19  ? 10 DA  C H62    3  
ATOM 6440  H H2     . DA  A 1 10 ? 1.340   3.222   0.906   1.00 4.07  ? 10 DA  C H2     3  
ATOM 6441  P P      . DT  A 1 11 ? 4.969   -3.508  2.856   1.00 2.90  ? 11 DT  C P      3  
ATOM 6442  O OP1    . DT  A 1 11 ? 5.107   -4.907  2.361   1.00 2.64  ? 11 DT  C OP1    3  
ATOM 6443  O OP2    . DT  A 1 11 ? 5.995   -2.962  3.782   1.00 3.10  ? 11 DT  C OP2    3  
ATOM 6444  O "O5'"  . DT  A 1 11 ? 4.877   -2.539  1.599   1.00 2.91  ? 11 DT  C "O5'"  3  
ATOM 6445  C "C5'"  . DT  A 1 11 ? 3.792   -2.674  0.682   1.00 2.80  ? 11 DT  C "C5'"  3  
ATOM 6446  C "C4'"  . DT  A 1 11 ? 4.088   -1.947  -0.606  1.00 2.86  ? 11 DT  C "C4'"  3  
ATOM 6447  O "O4'"  . DT  A 1 11 ? 3.821   -0.530  -0.415  1.00 3.15  ? 11 DT  C "O4'"  3  
ATOM 6448  C "C3'"  . DT  A 1 11 ? 5.565   -2.025  -0.977  1.00 2.87  ? 11 DT  C "C3'"  3  
ATOM 6449  O "O3'"  . DT  A 1 11 ? 5.755   -1.899  -2.381  1.00 2.91  ? 11 DT  C "O3'"  3  
ATOM 6450  C "C2'"  . DT  A 1 11 ? 6.163   -0.839  -0.240  1.00 3.15  ? 11 DT  C "C2'"  3  
ATOM 6451  C "C1'"  . DT  A 1 11 ? 5.049   0.188   -0.340  1.00 3.35  ? 11 DT  C "C1'"  3  
ATOM 6452  N N1     . DT  A 1 11 ? 4.996   1.165   0.775   1.00 3.63  ? 11 DT  C N1     3  
ATOM 6453  C C2     . DT  A 1 11 ? 4.681   2.474   0.466   1.00 3.92  ? 11 DT  C C2     3  
ATOM 6454  O O2     . DT  A 1 11 ? 4.362   2.841   -0.653  1.00 3.95  ? 11 DT  C O2     3  
ATOM 6455  N N3     . DT  A 1 11 ? 4.755   3.349   1.516   1.00 4.21  ? 11 DT  C N3     3  
ATOM 6456  C C4     . DT  A 1 11 ? 5.090   3.055   2.819   1.00 4.26  ? 11 DT  C C4     3  
ATOM 6457  O O4     . DT  A 1 11 ? 5.185   3.966   3.641   1.00 4.57  ? 11 DT  C O4     3  
ATOM 6458  C C5     . DT  A 1 11 ? 5.372   1.662   3.087   1.00 3.96  ? 11 DT  C C5     3  
ATOM 6459  C C7     . DT  A 1 11 ? 5.815   1.268   4.460   1.00 4.05  ? 11 DT  C C7     3  
ATOM 6460  C C6     . DT  A 1 11 ? 5.299   0.790   2.068   1.00 3.65  ? 11 DT  C C6     3  
ATOM 6461  H "H5'"  . DT  A 1 11 ? 2.886   -2.260  1.124   1.00 2.92  ? 11 DT  C "H5'"  3  
ATOM 6462  H "H5''" . DT  A 1 11 ? 3.628   -3.729  0.463   1.00 2.62  ? 11 DT  C "H5''" 3  
ATOM 6463  H "H4'"  . DT  A 1 11 ? 3.516   -2.409  -1.412  1.00 2.74  ? 11 DT  C "H4'"  3  
ATOM 6464  H "H3'"  . DT  A 1 11 ? 5.996   -2.967  -0.645  1.00 2.71  ? 11 DT  C "H3'"  3  
ATOM 6465  H "H2'"  . DT  A 1 11 ? 6.398   -1.094  0.791   1.00 3.15  ? 11 DT  C "H2'"  3  
ATOM 6466  H "H2''" . DT  A 1 11 ? 7.083   -0.498  -0.712  1.00 3.24  ? 11 DT  C "H2''" 3  
ATOM 6467  H "H1'"  . DT  A 1 11 ? 5.144   0.752   -1.270  1.00 3.46  ? 11 DT  C "H1'"  3  
ATOM 6468  H H3     . DT  A 1 11 ? 4.558   4.319   1.310   1.00 4.44  ? 11 DT  C H3     3  
ATOM 6469  H H71    . DT  A 1 11 ? 6.257   0.273   4.429   1.00 4.18  ? 11 DT  C H71    3  
ATOM 6470  H H72    . DT  A 1 11 ? 6.554   1.982   4.821   1.00 4.22  ? 11 DT  C H72    3  
ATOM 6471  H H73    . DT  A 1 11 ? 4.957   1.264   5.132   1.00 4.16  ? 11 DT  C H73    3  
ATOM 6472  H H6     . DT  A 1 11 ? 5.485   -0.264  2.274   1.00 3.44  ? 11 DT  C H6     3  
ATOM 6473  P P      . DC  A 1 12 ? 7.243   -1.775  -2.967  1.00 3.03  ? 12 DC  C P      3  
ATOM 6474  O OP1    . DC  A 1 12 ? 7.345   -2.572  -4.220  1.00 2.99  ? 12 DC  C OP1    3  
ATOM 6475  O OP2    . DC  A 1 12 ? 8.241   -1.984  -1.888  1.00 2.97  ? 12 DC  C OP2    3  
ATOM 6476  O "O5'"  . DC  A 1 12 ? 7.244   -0.237  -3.357  1.00 3.38  ? 12 DC  C "O5'"  3  
ATOM 6477  C "C5'"  . DC  A 1 12 ? 6.095   0.307   -4.003  1.00 3.47  ? 12 DC  C "C5'"  3  
ATOM 6478  C "C4'"  . DC  A 1 12 ? 6.426   1.622   -4.661  1.00 3.83  ? 12 DC  C "C4'"  3  
ATOM 6479  O "O4'"  . DC  A 1 12 ? 6.357   2.677   -3.667  1.00 4.03  ? 12 DC  C "O4'"  3  
ATOM 6480  C "C3'"  . DC  A 1 12 ? 7.858   1.648   -5.175  1.00 3.98  ? 12 DC  C "C3'"  3  
ATOM 6481  O "O3'"  . DC  A 1 12 ? 7.960   2.549   -6.264  1.00 4.31  ? 12 DC  C "O3'"  3  
ATOM 6482  C "C2'"  . DC  A 1 12 ? 8.643   2.124   -3.965  1.00 4.06  ? 12 DC  C "C2'"  3  
ATOM 6483  C "C1'"  . DC  A 1 12 ? 7.668   3.115   -3.337  1.00 4.21  ? 12 DC  C "C1'"  3  
ATOM 6484  N N1     . DC  A 1 12 ? 7.773   3.301   -1.875  1.00 4.22  ? 12 DC  C N1     3  
ATOM 6485  C C2     . DC  A 1 12 ? 7.715   4.611   -1.369  1.00 4.57  ? 12 DC  C C2     3  
ATOM 6486  O O2     . DC  A 1 12 ? 7.505   5.550   -2.152  1.00 4.81  ? 12 DC  C O2     3  
ATOM 6487  N N3     . DC  A 1 12 ? 7.889   4.822   -0.044  1.00 4.65  ? 12 DC  C N3     3  
ATOM 6488  C C4     . DC  A 1 12 ? 8.106   3.789   0.771   1.00 4.41  ? 12 DC  C C4     3  
ATOM 6489  N N4     . DC  A 1 12 ? 8.314   4.055   2.066   1.00 4.56  ? 12 DC  C N4     3  
ATOM 6490  C C5     . DC  A 1 12 ? 8.132   2.440   0.293   1.00 4.05  ? 12 DC  C C5     3  
ATOM 6491  C C6     . DC  A 1 12 ? 7.958   2.245   -1.026  1.00 3.96  ? 12 DC  C C6     3  
ATOM 6492  H "H5'"  . DC  A 1 12 ? 5.306   0.464   -3.270  1.00 3.42  ? 12 DC  C "H5'"  3  
ATOM 6493  H "H5''" . DC  A 1 12 ? 5.741   -0.390  -4.763  1.00 3.35  ? 12 DC  C "H5''" 3  
ATOM 6494  H "H4'"  . DC  A 1 12 ? 5.761   1.762   -5.517  1.00 3.88  ? 12 DC  C "H4'"  3  
ATOM 6495  H "H3'"  . DC  A 1 12 ? 8.176   0.655   -5.498  1.00 3.82  ? 12 DC  C "H3'"  3  
ATOM 6496  H "H2'"  . DC  A 1 12 ? 8.881   1.298   -3.294  1.00 3.84  ? 12 DC  C "H2'"  3  
ATOM 6497  H "H2''" . DC  A 1 12 ? 9.582   2.592   -4.255  1.00 4.26  ? 12 DC  C "H2''" 3  
ATOM 6498  H "H1'"  . DC  A 1 12 ? 7.795   4.095   -3.803  1.00 4.48  ? 12 DC  C "H1'"  3  
ATOM 6499  H H41    . DC  A 1 12 ? 8.309   5.010   2.395   1.00 4.84  ? 12 DC  C H41    3  
ATOM 6500  H H42    . DC  A 1 12 ? 8.491   3.304   2.717   1.00 4.42  ? 12 DC  C H42    3  
ATOM 6501  H H5     . DC  A 1 12 ? 8.291   1.603   0.973   1.00 3.87  ? 12 DC  C H5     3  
ATOM 6502  H H6     . DC  A 1 12 ? 7.959   1.229   -1.420  1.00 3.70  ? 12 DC  C H6     3  
ATOM 6503  P P      . DT  A 1 13 ? 9.390   2.858   -6.909  1.00 4.57  ? 13 DT  C P      3  
ATOM 6504  O OP1    . DT  A 1 13 ? 9.260   2.755   -8.385  1.00 4.73  ? 13 DT  C OP1    3  
ATOM 6505  O OP2    . DT  A 1 13 ? 10.447  2.084   -6.208  1.00 4.41  ? 13 DT  C OP2    3  
ATOM 6506  O "O5'"  . DT  A 1 13 ? 9.538   4.392   -6.522  1.00 4.91  ? 13 DT  C "O5'"  3  
ATOM 6507  C "C5'"  . DT  A 1 13 ? 8.408   5.247   -6.659  1.00 5.05  ? 13 DT  C "C5'"  3  
ATOM 6508  C "C4'"  . DT  A 1 13 ? 8.833   6.693   -6.636  1.00 5.46  ? 13 DT  C "C4'"  3  
ATOM 6509  O "O4'"  . DT  A 1 13 ? 9.006   7.106   -5.258  1.00 5.48  ? 13 DT  C "O4'"  3  
ATOM 6510  C "C3'"  . DT  A 1 13 ? 10.189  6.902   -7.294  1.00 5.68  ? 13 DT  C "C3'"  3  
ATOM 6511  O "O3'"  . DT  A 1 13 ? 10.282  8.226   -7.803  1.00 6.08  ? 13 DT  C "O3'"  3  
ATOM 6512  C "C2'"  . DT  A 1 13 ? 11.157  6.660   -6.149  1.00 5.58  ? 13 DT  C "C2'"  3  
ATOM 6513  C "C1'"  . DT  A 1 13 ? 10.390  7.234   -4.960  1.00 5.59  ? 13 DT  C "C1'"  3  
ATOM 6514  N N1     . DT  A 1 13 ? 10.656  6.606   -3.644  1.00 5.36  ? 13 DT  C N1     3  
ATOM 6515  C C2     . DT  A 1 13 ? 10.778  7.448   -2.557  1.00 5.56  ? 13 DT  C C2     3  
ATOM 6516  O O2     . DT  A 1 13 ? 10.637  8.657   -2.631  1.00 5.88  ? 13 DT  C O2     3  
ATOM 6517  N N3     . DT  A 1 13 ? 11.070  6.825   -1.372  1.00 5.38  ? 13 DT  C N3     3  
ATOM 6518  C C4     . DT  A 1 13 ? 11.248  5.475   -1.163  1.00 5.02  ? 13 DT  C C4     3  
ATOM 6519  O O4     . DT  A 1 13 ? 11.557  5.067   -0.044  1.00 4.93  ? 13 DT  C O4     3  
ATOM 6520  C C5     . DT  A 1 13 ? 11.090  4.643   -2.339  1.00 4.81  ? 13 DT  C C5     3  
ATOM 6521  C C7     . DT  A 1 13 ? 11.298  3.165   -2.210  1.00 4.43  ? 13 DT  C C7     3  
ATOM 6522  C C6     . DT  A 1 13 ? 10.798  5.238   -3.509  1.00 5.00  ? 13 DT  C C6     3  
ATOM 6523  H "H5'"  . DT  A 1 13 ? 7.711   5.068   -5.839  1.00 4.88  ? 13 DT  C "H5'"  3  
ATOM 6524  H "H5''" . DT  A 1 13 ? 7.904   5.040   -7.603  1.00 5.06  ? 13 DT  C "H5''" 3  
ATOM 6525  H "H4'"  . DT  A 1 13 ? 8.100   7.280   -7.192  1.00 5.61  ? 13 DT  C "H4'"  3  
ATOM 6526  H "H3'"  . DT  A 1 13 ? 10.341  6.195   -8.109  1.00 5.59  ? 13 DT  C "H3'"  3  
ATOM 6527  H "H2'"  . DT  A 1 13 ? 11.369  5.598   -6.028  1.00 5.30  ? 13 DT  C "H2'"  3  
ATOM 6528  H "H2''" . DT  A 1 13 ? 12.104  7.169   -6.315  1.00 5.80  ? 13 DT  C "H2''" 3  
ATOM 6529  H "H1'"  . DT  A 1 13 ? 10.597  8.304   -4.866  1.00 5.89  ? 13 DT  C "H1'"  3  
ATOM 6530  H H3     . DT  A 1 13 ? 11.174  7.423   -0.563  1.00 5.55  ? 13 DT  C H3     3  
ATOM 6531  H H71    . DT  A 1 13 ? 11.530  2.745   -3.188  1.00 4.39  ? 13 DT  C H71    3  
ATOM 6532  H H72    . DT  A 1 13 ? 12.126  2.974   -1.528  1.00 4.34  ? 13 DT  C H72    3  
ATOM 6533  H H73    . DT  A 1 13 ? 10.392  2.703   -1.821  1.00 4.63  ? 13 DT  C H73    3  
ATOM 6534  H H6     . DT  A 1 13 ? 10.663  4.611   -4.390  1.00 4.87  ? 13 DT  C H6     3  
ATOM 6535  P P      . DT  A 1 14 ? 11.638  8.712   -8.503  1.00 6.39  ? 14 DT  C P      3  
ATOM 6536  O OP1    . DT  A 1 14 ? 11.270  9.374   -9.779  1.00 6.68  ? 14 DT  C OP1    3  
ATOM 6537  O OP2    . DT  A 1 14 ? 12.627  7.605   -8.506  1.00 6.17  ? 14 DT  C OP2    3  
ATOM 6538  O "O5'"  . DT  A 1 14 ? 12.119  9.824   -7.478  1.00 6.61  ? 14 DT  C "O5'"  3  
ATOM 6539  C "C5'"  . DT  A 1 14 ? 11.189  10.806  -7.033  1.00 6.76  ? 14 DT  C "C5'"  3  
ATOM 6540  C "C4'"  . DT  A 1 14 ? 11.901  11.907  -6.287  1.00 7.05  ? 14 DT  C "C4'"  3  
ATOM 6541  O "O4'"  . DT  A 1 14 ? 12.170  11.459  -4.935  1.00 6.86  ? 14 DT  C "O4'"  3  
ATOM 6542  C "C3'"  . DT  A 1 14 ? 13.267  12.221  -6.884  1.00 7.28  ? 14 DT  C "C3'"  3  
ATOM 6543  O "O3'"  . DT  A 1 14 ? 13.615  13.569  -6.597  1.00 7.65  ? 14 DT  C "O3'"  3  
ATOM 6544  C "C2'"  . DT  A 1 14 ? 14.179  11.234  -6.177  1.00 7.02  ? 14 DT  C "C2'"  3  
ATOM 6545  C "C1'"  . DT  A 1 14 ? 13.556  11.177  -4.785  1.00 6.87  ? 14 DT  C "C1'"  3  
ATOM 6546  N N1     . DT  A 1 14 ? 13.712  9.897   -4.052  1.00 6.48  ? 14 DT  C N1     3  
ATOM 6547  C C2     . DT  A 1 14 ? 13.921  9.976   -2.689  1.00 6.46  ? 14 DT  C C2     3  
ATOM 6548  O O2     . DT  A 1 14 ? 13.939  11.032  -2.077  1.00 6.74  ? 14 DT  C O2     3  
ATOM 6549  N N3     . DT  A 1 14 ? 14.111  8.773   -2.064  1.00 6.11  ? 14 DT  C N3     3  
ATOM 6550  C C4     . DT  A 1 14 ? 14.110  7.524   -2.645  1.00 5.79  ? 14 DT  C C4     3  
ATOM 6551  O O4     . DT  A 1 14 ? 14.325  6.530   -1.955  1.00 5.50  ? 14 DT  C O4     3  
ATOM 6552  C C5     . DT  A 1 14 ? 13.872  7.507   -4.074  1.00 5.84  ? 14 DT  C C5     3  
ATOM 6553  C C7     . DT  A 1 14 ? 13.922  6.197   -4.797  1.00 5.54  ? 14 DT  C C7     3  
ATOM 6554  C C6     . DT  A 1 14 ? 13.676  8.679   -4.703  1.00 6.19  ? 14 DT  C C6     3  
ATOM 6555  H "H5'"  . DT  A 1 14 ? 10.460  10.343  -6.368  1.00 6.53  ? 14 DT  C "H5'"  3  
ATOM 6556  H "H5''" . DT  A 1 14 ? 10.669  11.234  -7.889  1.00 6.91  ? 14 DT  C "H5''" 3  
ATOM 6557  H "H4'"  . DT  A 1 14 ? 11.298  12.815  -6.347  1.00 7.27  ? 14 DT  C "H4'"  3  
ATOM 6558  H "H3'"  . DT  A 1 14 ? 13.268  12.071  -7.964  1.00 7.34  ? 14 DT  C "H3'"  3  
ATOM 6559  H "H2'"  . DT  A 1 14 ? 14.171  10.264  -6.673  1.00 6.80  ? 14 DT  C "H2'"  3  
ATOM 6560  H "H2''" . DT  A 1 14 ? 15.209  11.584  -6.165  1.00 7.19  ? 14 DT  C "H2''" 3  
ATOM 6561  H "H1'"  . DT  A 1 14 ? 13.975  11.970  -4.159  1.00 7.08  ? 14 DT  C "H1'"  3  
ATOM 6562  H H3     . DT  A 1 14 ? 14.283  8.811   -1.066  1.00 6.11  ? 14 DT  C H3     3  
ATOM 6563  H H71    . DT  A 1 14 ? 13.936  6.375   -5.873  1.00 5.65  ? 14 DT  C H71    3  
ATOM 6564  H H72    . DT  A 1 14 ? 14.825  5.659   -4.508  1.00 5.56  ? 14 DT  C H72    3  
ATOM 6565  H H73    . DT  A 1 14 ? 13.047  5.603   -4.538  1.00 5.33  ? 14 DT  C H73    3  
ATOM 6566  H H6     . DT  A 1 14 ? 13.476  8.666   -5.773  1.00 6.25  ? 14 DT  C H6     3  
ATOM 6567  P P      . DA  A 1 15 ? 15.047  14.136  -7.036  1.00 7.95  ? 15 DA  C P      3  
ATOM 6568  O OP1    . DA  A 1 15 ? 14.822  15.431  -7.726  1.00 8.35  ? 15 DA  C OP1    3  
ATOM 6569  O OP2    . DA  A 1 15 ? 15.823  13.066  -7.713  1.00 7.77  ? 15 DA  C OP2    3  
ATOM 6570  O "O5'"  . DA  A 1 15 ? 15.702  14.429  -5.618  1.00 7.97  ? 15 DA  C "O5'"  3  
ATOM 6571  C "C5'"  . DA  A 1 15 ? 14.958  15.166  -4.652  1.00 8.07  ? 15 DA  C "C5'"  3  
ATOM 6572  C "C4'"  . DA  A 1 15 ? 15.816  15.508  -3.459  1.00 8.17  ? 15 DA  C "C4'"  3  
ATOM 6573  O "O4'"  . DA  A 1 15 ? 15.907  14.346  -2.594  1.00 7.81  ? 15 DA  C "O4'"  3  
ATOM 6574  C "C3'"  . DA  A 1 15 ? 17.258  15.832  -3.832  1.00 8.38  ? 15 DA  C "C3'"  3  
ATOM 6575  O "O3'"  . DA  A 1 15 ? 17.819  16.691  -2.849  1.00 8.63  ? 15 DA  C "O3'"  3  
ATOM 6576  C "C2'"  . DA  A 1 15 ? 17.923  14.468  -3.836  1.00 8.04  ? 15 DA  C "C2'"  3  
ATOM 6577  C "C1'"  . DA  A 1 15 ? 17.203  13.763  -2.695  1.00 7.73  ? 15 DA  C "C1'"  3  
ATOM 6578  N N9     . DA  A 1 15 ? 17.071  12.311  -2.837  1.00 7.31  ? 15 DA  C N9     3  
ATOM 6579  C C8     . DA  A 1 15 ? 16.707  11.589  -3.945  1.00 7.14  ? 15 DA  C C8     3  
ATOM 6580  N N7     . DA  A 1 15 ? 16.732  10.289  -3.762  1.00 6.76  ? 15 DA  C N7     3  
ATOM 6581  C C5     . DA  A 1 15 ? 17.133  10.145  -2.440  1.00 6.68  ? 15 DA  C C5     3  
ATOM 6582  C C6     . DA  A 1 15 ? 17.361  9.009   -1.634  1.00 6.35  ? 15 DA  C C6     3  
ATOM 6583  N N6     . DA  A 1 15 ? 17.222  7.752   -2.065  1.00 6.00  ? 15 DA  C N6     3  
ATOM 6584  N N1     . DA  A 1 15 ? 17.748  9.213   -0.355  1.00 6.40  ? 15 DA  C N1     3  
ATOM 6585  C C2     . DA  A 1 15 ? 17.900  10.474  0.074   1.00 6.76  ? 15 DA  C C2     3  
ATOM 6586  N N3     . DA  A 1 15 ? 17.725  11.618  -0.588  1.00 7.09  ? 15 DA  C N3     3  
ATOM 6587  C C4     . DA  A 1 15 ? 17.335  11.382  -1.855  1.00 7.03  ? 15 DA  C C4     3  
ATOM 6588  H "H5'"  . DA  A 1 15 ? 14.107  14.574  -4.319  1.00 7.82  ? 15 DA  C "H5'"  3  
ATOM 6589  H "H5''" . DA  A 1 15 ? 14.594  16.089  -5.101  1.00 8.33  ? 15 DA  C "H5''" 3  
ATOM 6590  H "H4'"  . DA  A 1 15 ? 15.396  16.391  -2.974  1.00 8.38  ? 15 DA  C "H4'"  3  
ATOM 6591  H "H3'"  . DA  A 1 15 ? 17.313  16.317  -4.807  1.00 8.58  ? 15 DA  C "H3'"  3  
ATOM 6592  H "H2'"  . DA  A 1 15 ? 17.780  13.960  -4.790  1.00 7.94  ? 15 DA  C "H2'"  3  
ATOM 6593  H "H2''" . DA  A 1 15 ? 18.996  14.545  -3.663  1.00 8.13  ? 15 DA  C "H2''" 3  
ATOM 6594  H "H1'"  . DA  A 1 15 ? 17.717  13.962  -1.750  1.00 7.79  ? 15 DA  C "H1'"  3  
ATOM 6595  H H8     . DA  A 1 15 ? 16.431  12.049  -4.881  1.00 7.30  ? 15 DA  C H8     3  
ATOM 6596  H H61    . DA  A 1 15 ? 17.406  6.977   -1.444  1.00 5.78  ? 15 DA  C H61    3  
ATOM 6597  H H62    . DA  A 1 15 ? 16.940  7.583   -3.019  1.00 5.98  ? 15 DA  C H62    3  
ATOM 6598  H H2     . DA  A 1 15 ? 18.213  10.578  1.114   1.00 6.81  ? 15 DA  C H2     3  
ATOM 6599  P P      . DT  A 1 16 ? 19.366  17.099  -2.933  1.00 8.87  ? 16 DT  C P      3  
ATOM 6600  O OP1    . DT  A 1 16 ? 19.465  18.566  -2.721  1.00 9.30  ? 16 DT  C OP1    3  
ATOM 6601  O OP2    . DT  A 1 16 ? 19.992  16.487  -4.132  1.00 8.79  ? 16 DT  C OP2    3  
ATOM 6602  O "O5'"  . DT  A 1 16 ? 19.927  16.373  -1.636  1.00 8.65  ? 16 DT  C "O5'"  3  
ATOM 6603  C "C5'"  . DT  A 1 16 ? 19.151  16.395  -0.439  1.00 8.59  ? 16 DT  C "C5'"  3  
ATOM 6604  C "C4'"  . DT  A 1 16 ? 19.978  15.950  0.740   1.00 8.49  ? 16 DT  C "C4'"  3  
ATOM 6605  O "O4'"  . DT  A 1 16 ? 20.038  14.504  0.751   1.00 8.07  ? 16 DT  C "O4'"  3  
ATOM 6606  C "C3'"  . DT  A 1 16 ? 21.426  16.412  0.641   1.00 8.71  ? 16 DT  C "C3'"  3  
ATOM 6607  O "O3'"  . DT  A 1 16 ? 22.000  16.517  1.938   1.00 8.76  ? 16 DT  C "O3'"  3  
ATOM 6608  C "C2'"  . DT  A 1 16 ? 22.077  15.301  -0.161  1.00 8.42  ? 16 DT  C "C2'"  3  
ATOM 6609  C "C1'"  . DT  A 1 16 ? 21.331  14.071  0.349   1.00 8.01  ? 16 DT  C "C1'"  3  
ATOM 6610  N N1     . DT  A 1 16 ? 21.190  12.950  -0.610  1.00 7.70  ? 16 DT  C N1     3  
ATOM 6611  C C2     . DT  A 1 16 ? 21.310  11.671  -0.102  1.00 7.32  ? 16 DT  C C2     3  
ATOM 6612  O O2     . DT  A 1 16 ? 21.454  11.434  1.086   1.00 7.25  ? 16 DT  C O2     3  
ATOM 6613  N N3     . DT  A 1 16 ? 21.255  10.674  -1.039  1.00 7.06  ? 16 DT  C N3     3  
ATOM 6614  C C4     . DT  A 1 16 ? 21.082  10.816  -2.398  1.00 7.14  ? 16 DT  C C4     3  
ATOM 6615  O O4     . DT  A 1 16 ? 21.119  9.826   -3.125  1.00 6.91  ? 16 DT  C O4     3  
ATOM 6616  C C5     . DT  A 1 16 ? 20.927  12.181  -2.861  1.00 7.54  ? 16 DT  C C5     3  
ATOM 6617  C C7     . DT  A 1 16 ? 20.751  12.430  -4.326  1.00 7.68  ? 16 DT  C C7     3  
ATOM 6618  C C6     . DT  A 1 16 ? 20.980  13.173  -1.956  1.00 7.79  ? 16 DT  C C6     3  
ATOM 6619  H "H5'"  . DT  A 1 16 ? 18.296  15.727  -0.546  1.00 8.35  ? 16 DT  C "H5'"  3  
ATOM 6620  H "H5''" . DT  A 1 16 ? 18.788  17.407  -0.258  1.00 8.87  ? 16 DT  C "H5''" 3  
ATOM 6621  H "H4'"  . DT  A 1 16 ? 19.553  16.387  1.647   1.00 8.60  ? 16 DT  C "H4'"  3  
ATOM 6622  H "H3'"  . DT  A 1 16 ? 21.497  17.376  0.135   1.00 9.00  ? 16 DT  C "H3'"  3  
ATOM 6623  H "H2'"  . DT  A 1 16 ? 21.940  15.452  -1.231  1.00 8.48  ? 16 DT  C "H2'"  3  
ATOM 6624  H "H2''" . DT  A 1 16 ? 23.149  15.250  0.026   1.00 8.46  ? 16 DT  C "H2''" 3  
ATOM 6625  H "H1'"  . DT  A 1 16 ? 21.825  13.683  1.242   1.00 7.92  ? 16 DT  C "H1'"  3  
ATOM 6626  H H3     . DT  A 1 16 ? 21.366  9.730   -0.689  1.00 6.79  ? 16 DT  C H3     3  
ATOM 6627  H H71    . DT  A 1 16 ? 21.461  11.823  -4.887  1.00 7.73  ? 16 DT  C H71    3  
ATOM 6628  H H72    . DT  A 1 16 ? 19.735  12.164  -4.620  1.00 7.96  ? 16 DT  C H72    3  
ATOM 6629  H H73    . DT  A 1 16 ? 20.926  13.484  -4.541  1.00 7.57  ? 16 DT  C H73    3  
ATOM 6630  H H6     . DT  A 1 16 ? 20.846  14.197  -2.299  1.00 8.09  ? 16 DT  C H6     3  
ATOM 6631  P P      . DC  A 1 17 ? 23.537  16.941  2.096   1.00 8.97  ? 17 DC  C P      3  
ATOM 6632  O OP1    . DC  A 1 17 ? 23.612  17.986  3.146   1.00 9.29  ? 17 DC  C OP1    3  
ATOM 6633  O OP2    . DC  A 1 17 ? 24.115  17.207  0.752   1.00 9.08  ? 17 DC  C OP2    3  
ATOM 6634  O "O5'"  . DC  A 1 17 ? 24.181  15.605  2.666   1.00 8.62  ? 17 DC  C "O5'"  3  
ATOM 6635  C "C5'"  . DC  A 1 17 ? 23.566  14.940  3.767   1.00 8.41  ? 17 DC  C "C5'"  3  
ATOM 6636  C "C4'"  . DC  A 1 17 ? 24.472  13.866  4.317   1.00 8.15  ? 17 DC  C "C4'"  3  
ATOM 6637  O "O4'"  . DC  A 1 17 ? 24.390  12.701  3.458   1.00 7.79  ? 17 DC  C "O4'"  3  
ATOM 6638  C "C3'"  . DC  A 1 17 ? 25.944  14.264  4.309   1.00 8.34  ? 17 DC  C "C3'"  3  
ATOM 6639  O "O3'"  . DC  A 1 17 ? 26.654  13.547  5.319   1.00 8.19  ? 17 DC  C "O3'"  3  
ATOM 6640  C "C2'"  . DC  A 1 17 ? 26.393  13.851  2.919   1.00 8.23  ? 17 DC  C "C2'"  3  
ATOM 6641  C "C1'"  . DC  A 1 17 ? 25.580  12.580  2.690   1.00 7.81  ? 17 DC  C "C1'"  3  
ATOM 6642  N N1     . DC  A 1 17 ? 25.213  12.286  1.290   1.00 7.71  ? 17 DC  C N1     3  
ATOM 6643  C C2     . DC  A 1 17 ? 25.242  10.950  0.862   1.00 7.34  ? 17 DC  C C2     3  
ATOM 6644  O O2     . DC  A 1 17 ? 25.528  10.063  1.681   1.00 7.09  ? 17 DC  C O2     3  
ATOM 6645  N N3     . DC  A 1 17 ? 24.961  10.660  -0.427  1.00 7.27  ? 17 DC  C N3     3  
ATOM 6646  C C4     . DC  A 1 17 ? 24.655  11.639  -1.279  1.00 7.56  ? 17 DC  C C4     3  
ATOM 6647  N N4     . DC  A 1 17 ? 24.412  11.302  -2.550  1.00 7.51  ? 17 DC  C N4     3  
ATOM 6648  C C5     . DC  A 1 17 ? 24.590  13.005  -0.869  1.00 7.93  ? 17 DC  C C5     3  
ATOM 6649  C C6     . DC  A 1 17 ? 24.871  13.281  0.415   1.00 7.99  ? 17 DC  C C6     3  
ATOM 6650  H "H5'"  . DC  A 1 17 ? 22.630  14.485  3.442   1.00 8.22  ? 17 DC  C "H5'"  3  
ATOM 6651  H "H5''" . DC  A 1 17 ? 23.354  15.664  4.555   1.00 8.63  ? 17 DC  C "H5''" 3  
ATOM 6652  H "H4'"  . DC  A 1 17 ? 24.189  13.673  5.353   1.00 8.11  ? 17 DC  C "H4'"  3  
ATOM 6653  H "H3'"  . DC  A 1 17 ? 26.062  15.335  4.475   1.00 8.66  ? 17 DC  C "H3'"  3  
ATOM 6654  H "H2'"  . DC  A 1 17 ? 26.170  14.624  2.184   1.00 8.44  ? 17 DC  C "H2'"  3  
ATOM 6655  H "H2''" . DC  A 1 17 ? 27.467  13.669  2.887   1.00 8.23  ? 17 DC  C "H2''" 3  
ATOM 6656  H "H1'"  . DC  A 1 17 ? 26.122  11.717  3.079   1.00 7.59  ? 17 DC  C "H1'"  3  
ATOM 6657  H H41    . DC  A 1 17 ? 24.471  10.334  -2.838  1.00 7.27  ? 17 DC  C H41    3  
ATOM 6658  H H42    . DC  A 1 17 ? 24.181  12.013  -3.229  1.00 7.74  ? 17 DC  C H42    3  
ATOM 6659  H H5     . DC  A 1 17 ? 24.326  13.796  -1.572  1.00 8.17  ? 17 DC  C H5     3  
ATOM 6660  H H6     . DC  A 1 17 ? 24.821  14.311  0.763   1.00 8.28  ? 17 DC  C H6     3  
ATOM 6661  P P      . DG  A 1 18 ? 28.219  13.825  5.541   1.00 8.34  ? 18 DG  C P      3  
ATOM 6662  O OP1    . DG  A 1 18 ? 28.432  14.019  6.998   1.00 8.46  ? 18 DG  C OP1    3  
ATOM 6663  O OP2    . DG  A 1 18 ? 28.664  14.874  4.589   1.00 8.65  ? 18 DG  C OP2    3  
ATOM 6664  O "O5'"  . DG  A 1 18 ? 28.890  12.445  5.117   1.00 7.96  ? 18 DG  C "O5'"  3  
ATOM 6665  C "C5'"  . DG  A 1 18 ? 28.559  11.242  5.807   1.00 7.61  ? 18 DG  C "C5'"  3  
ATOM 6666  C "C4'"  . DG  A 1 18 ? 29.564  10.160  5.495   1.00 7.32  ? 18 DG  C "C4'"  3  
ATOM 6667  O "O4'"  . DG  A 1 18 ? 29.297  9.649   4.169   1.00 7.15  ? 18 DG  C "O4'"  3  
ATOM 6668  C "C3'"  . DG  A 1 18 ? 31.008  10.652  5.448   1.00 7.52  ? 18 DG  C "C3'"  3  
ATOM 6669  O "O3'"  . DG  A 1 18 ? 31.924  9.590   5.727   1.00 7.25  ? 18 DG  C "O3'"  3  
ATOM 6670  C "C2'"  . DG  A 1 18 ? 31.150  11.120  4.011   1.00 7.65  ? 18 DG  C "C2'"  3  
ATOM 6671  C "C1'"  . DG  A 1 18 ? 30.285  10.111  3.259   1.00 7.32  ? 18 DG  C "C1'"  3  
ATOM 6672  N N9     . DG  A 1 18 ? 29.614  10.614  2.064   1.00 7.45  ? 18 DG  C N9     3  
ATOM 6673  C C8     . DG  A 1 18 ? 29.154  11.885  1.823   1.00 7.80  ? 18 DG  C C8     3  
ATOM 6674  N N7     . DG  A 1 18 ? 28.630  12.027  0.633   1.00 7.85  ? 18 DG  C N7     3  
ATOM 6675  C C5     . DG  A 1 18 ? 28.747  10.768  0.057   1.00 7.52  ? 18 DG  C C5     3  
ATOM 6676  C C6     . DG  A 1 18 ? 28.356  10.300  -1.229  1.00 7.43  ? 18 DG  C C6     3  
ATOM 6677  O O6     . DG  A 1 18 ? 27.813  10.926  -2.150  1.00 7.63  ? 18 DG  C O6     3  
ATOM 6678  N N1     . DG  A 1 18 ? 28.661  8.951   -1.396  1.00 7.08  ? 18 DG  C N1     3  
ATOM 6679  C C2     . DG  A 1 18 ? 29.262  8.156   -0.451  1.00 6.84  ? 18 DG  C C2     3  
ATOM 6680  N N2     . DG  A 1 18 ? 29.475  6.877   -0.792  1.00 6.52  ? 18 DG  C N2     3  
ATOM 6681  N N3     . DG  A 1 18 ? 29.629  8.579   0.745   1.00 6.92  ? 18 DG  C N3     3  
ATOM 6682  C C4     . DG  A 1 18 ? 29.344  9.884   0.930   1.00 7.27  ? 18 DG  C C4     3  
ATOM 6683  H "H5'"  . DG  A 1 18 ? 27.567  10.907  5.500   1.00 7.47  ? 18 DG  C "H5'"  3  
ATOM 6684  H "H5''" . DG  A 1 18 ? 28.554  11.426  6.882   1.00 7.70  ? 18 DG  C "H5''" 3  
ATOM 6685  H "H4'"  . DG  A 1 18 ? 29.505  9.403   6.278   1.00 7.13  ? 18 DG  C "H4'"  3  
ATOM 6686  H "H3'"  . DG  A 1 18 ? 31.169  11.464  6.158   1.00 7.77  ? 18 DG  C "H3'"  3  
ATOM 6687  H "HO3'" . DG  A 1 18 ? 31.510  9.030   6.388   1.00 7.26  ? 18 DG  C "HO3'" 3  
ATOM 6688  H "H2'"  . DG  A 1 18 ? 30.790  12.143  3.888   1.00 7.93  ? 18 DG  C "H2'"  3  
ATOM 6689  H "H2''" . DG  A 1 18 ? 32.189  11.097  3.686   1.00 7.69  ? 18 DG  C "H2''" 3  
ATOM 6690  H "H1'"  . DG  A 1 18 ? 30.886  9.246   2.970   1.00 7.10  ? 18 DG  C "H1'"  3  
ATOM 6691  H H8     . DG  A 1 18 ? 29.221  12.688  2.542   1.00 8.03  ? 18 DG  C H8     3  
ATOM 6692  H H1     . DG  A 1 18 ? 28.422  8.528   -2.283  1.00 7.02  ? 18 DG  C H1     3  
ATOM 6693  H H21    . DG  A 1 18 ? 29.203  6.532   -1.703  1.00 6.48  ? 18 DG  C H21    3  
ATOM 6694  H H22    . DG  A 1 18 ? 29.914  6.251   -0.132  1.00 6.34  ? 18 DG  C H22    3  
ATOM 6695  O "O5'"  . DC  B 1 1  ? 28.184  4.553   -8.326  1.00 6.69  ? 1  DC  D "O5'"  3  
ATOM 6696  C "C5'"  . DC  B 1 1  ? 29.262  3.615   -8.324  1.00 6.58  ? 1  DC  D "C5'"  3  
ATOM 6697  C "C4'"  . DC  B 1 1  ? 29.390  2.921   -6.987  1.00 6.22  ? 1  DC  D "C4'"  3  
ATOM 6698  O "O4'"  . DC  B 1 1  ? 29.598  3.928   -5.966  1.00 6.31  ? 1  DC  D "O4'"  3  
ATOM 6699  C "C3'"  . DC  B 1 1  ? 28.145  2.163   -6.536  1.00 5.89  ? 1  DC  D "C3'"  3  
ATOM 6700  O "O3'"  . DC  B 1 1  ? 28.495  1.126   -5.619  1.00 5.54  ? 1  DC  D "O3'"  3  
ATOM 6701  C "C2'"  . DC  B 1 1  ? 27.334  3.234   -5.835  1.00 5.98  ? 1  DC  D "C2'"  3  
ATOM 6702  C "C1'"  . DC  B 1 1  ? 28.416  4.087   -5.186  1.00 6.16  ? 1  DC  D "C1'"  3  
ATOM 6703  N N1     . DC  B 1 1  ? 28.098  5.523   -5.106  1.00 6.49  ? 1  DC  D N1     3  
ATOM 6704  C C2     . DC  B 1 1  ? 28.394  6.214   -3.926  1.00 6.55  ? 1  DC  D C2     3  
ATOM 6705  O O2     . DC  B 1 1  ? 28.938  5.604   -2.993  1.00 6.34  ? 1  DC  D O2     3  
ATOM 6706  N N3     . DC  B 1 1  ? 28.077  7.526   -3.831  1.00 6.87  ? 1  DC  D N3     3  
ATOM 6707  C C4     . DC  B 1 1  ? 27.493  8.147   -4.857  1.00 7.09  ? 1  DC  D C4     3  
ATOM 6708  N N4     . DC  B 1 1  ? 27.192  9.440   -4.716  1.00 7.40  ? 1  DC  D N4     3  
ATOM 6709  C C5     . DC  B 1 1  ? 27.187  7.471   -6.075  1.00 7.03  ? 1  DC  D C5     3  
ATOM 6710  C C6     . DC  B 1 1  ? 27.507  6.171   -6.155  1.00 6.74  ? 1  DC  D C6     3  
ATOM 6711  H "H5'"  . DC  B 1 1  ? 30.194  4.135   -8.544  1.00 6.83  ? 1  DC  D "H5'"  3  
ATOM 6712  H "H5''" . DC  B 1 1  ? 29.088  2.863   -9.093  1.00 6.54  ? 1  DC  D "H5''" 3  
ATOM 6713  H "H4'"  . DC  B 1 1  ? 30.203  2.198   -7.056  1.00 6.13  ? 1  DC  D "H4'"  3  
ATOM 6714  H "H3'"  . DC  B 1 1  ? 27.614  1.733   -7.385  1.00 5.89  ? 1  DC  D "H3'"  3  
ATOM 6715  H "H2'"  . DC  B 1 1  ? 26.729  3.800   -6.541  1.00 6.17  ? 1  DC  D "H2'"  3  
ATOM 6716  H "H2''" . DC  B 1 1  ? 26.661  2.799   -5.100  1.00 5.73  ? 1  DC  D "H2''" 3  
ATOM 6717  H "H1'"  . DC  B 1 1  ? 28.635  3.728   -4.177  1.00 5.97  ? 1  DC  D "H1'"  3  
ATOM 6718  H H41    . DC  B 1 1  ? 27.405  9.923   -3.855  1.00 7.47  ? 1  DC  D H41    3  
ATOM 6719  H H42    . DC  B 1 1  ? 26.748  9.939   -5.474  1.00 7.58  ? 1  DC  D H42    3  
ATOM 6720  H H5     . DC  B 1 1  ? 26.709  7.986   -6.906  1.00 7.23  ? 1  DC  D H5     3  
ATOM 6721  H H6     . DC  B 1 1  ? 27.292  5.626   -7.074  1.00 6.71  ? 1  DC  D H6     3  
ATOM 6722  H "HO5'" . DC  B 1 1  ? 27.381  4.050   -8.174  1.00 6.83  ? 1  DC  D "HO5'" 3  
ATOM 6723  P P      . DG  B 1 2  ? 27.350  0.176   -5.010  1.00 5.16  ? 2  DG  D P      3  
ATOM 6724  O OP1    . DG  B 1 2  ? 28.002  -1.119  -4.695  1.00 4.91  ? 2  DG  D OP1    3  
ATOM 6725  O OP2    . DG  B 1 2  ? 26.163  0.202   -5.902  1.00 5.20  ? 2  DG  D OP2    3  
ATOM 6726  O "O5'"  . DG  B 1 2  ? 26.978  0.894   -3.634  1.00 5.09  ? 2  DG  D "O5'"  3  
ATOM 6727  C "C5'"  . DG  B 1 2  ? 27.837  0.748   -2.508  1.00 5.02  ? 2  DG  D "C5'"  3  
ATOM 6728  C "C4'"  . DG  B 1 2  ? 27.071  0.885   -1.214  1.00 4.86  ? 2  DG  D "C4'"  3  
ATOM 6729  O "O4'"  . DG  B 1 2  ? 26.869  2.292   -0.927  1.00 5.18  ? 2  DG  D "O4'"  3  
ATOM 6730  C "C3'"  . DG  B 1 2  ? 25.663  0.295   -1.259  1.00 4.60  ? 2  DG  D "C3'"  3  
ATOM 6731  O "O3'"  . DG  B 1 2  ? 25.270  -0.116  0.051   1.00 4.38  ? 2  DG  D "O3'"  3  
ATOM 6732  C "C2'"  . DG  B 1 2  ? 24.830  1.445   -1.793  1.00 4.85  ? 2  DG  D "C2'"  3  
ATOM 6733  C "C1'"  . DG  B 1 2  ? 25.508  2.646   -1.154  1.00 5.17  ? 2  DG  D "C1'"  3  
ATOM 6734  N N9     . DG  B 1 2  ? 25.445  3.885   -1.927  1.00 5.54  ? 2  DG  D N9     3  
ATOM 6735  C C8     . DG  B 1 2  ? 25.296  4.016   -3.286  1.00 5.68  ? 2  DG  D C8     3  
ATOM 6736  N N7     . DG  B 1 2  ? 25.186  5.257   -3.675  1.00 6.03  ? 2  DG  D N7     3  
ATOM 6737  C C5     . DG  B 1 2  ? 25.281  5.995   -2.503  1.00 6.13  ? 2  DG  D C5     3  
ATOM 6738  C C6     . DG  B 1 2  ? 25.221  7.402   -2.287  1.00 6.49  ? 2  DG  D C6     3  
ATOM 6739  O O6     . DG  B 1 2  ? 25.054  8.308   -3.117  1.00 6.78  ? 2  DG  D O6     3  
ATOM 6740  N N1     . DG  B 1 2  ? 25.371  7.720   -0.940  1.00 6.50  ? 2  DG  D N1     3  
ATOM 6741  C C2     . DG  B 1 2  ? 25.554  6.807   0.070   1.00 6.22  ? 2  DG  D C2     3  
ATOM 6742  N N2     . DG  B 1 2  ? 25.690  7.312   1.304   1.00 6.33  ? 2  DG  D N2     3  
ATOM 6743  N N3     . DG  B 1 2  ? 25.603  5.497   -0.115  1.00 5.87  ? 2  DG  D N3     3  
ATOM 6744  C C4     . DG  B 1 2  ? 25.462  5.164   -1.416  1.00 5.84  ? 2  DG  D C4     3  
ATOM 6745  H "H5'"  . DG  B 1 2  ? 28.613  1.514   -2.543  1.00 5.28  ? 2  DG  D "H5'"  3  
ATOM 6746  H "H5''" . DG  B 1 2  ? 28.309  -0.233  -2.536  1.00 4.84  ? 2  DG  D "H5''" 3  
ATOM 6747  H "H4'"  . DG  B 1 2  ? 27.620  0.353   -0.434  1.00 4.72  ? 2  DG  D "H4'"  3  
ATOM 6748  H "H3'"  . DG  B 1 2  ? 25.628  -0.566  -1.927  1.00 4.44  ? 2  DG  D "H3'"  3  
ATOM 6749  H "H2'"  . DG  B 1 2  ? 24.858  1.485   -2.881  1.00 4.96  ? 2  DG  D "H2'"  3  
ATOM 6750  H "H2''" . DG  B 1 2  ? 23.786  1.355   -1.495  1.00 4.72  ? 2  DG  D "H2''" 3  
ATOM 6751  H "H1'"  . DG  B 1 2  ? 25.066  2.845   -0.175  1.00 5.14  ? 2  DG  D "H1'"  3  
ATOM 6752  H H8     . DG  B 1 2  ? 25.264  3.175   -3.963  1.00 5.54  ? 2  DG  D H8     3  
ATOM 6753  H H1     . DG  B 1 2  ? 25.338  8.698   -0.687  1.00 6.76  ? 2  DG  D H1     3  
ATOM 6754  H H21    . DG  B 1 2  ? 25.654  8.311   1.459   1.00 6.61  ? 2  DG  D H21    3  
ATOM 6755  H H22    . DG  B 1 2  ? 25.831  6.692   2.090   1.00 6.15  ? 2  DG  D H22    3  
ATOM 6756  P P      . DA  B 1 3  ? 23.774  -0.645  0.324   1.00 4.12  ? 3  DA  D P      3  
ATOM 6757  O OP1    . DA  B 1 3  ? 23.897  -1.973  0.976   1.00 3.78  ? 3  DA  D OP1    3  
ATOM 6758  O OP2    . DA  B 1 3  ? 22.953  -0.508  -0.906  1.00 4.16  ? 3  DA  D OP2    3  
ATOM 6759  O "O5'"  . DA  B 1 3  ? 23.262  0.404   1.407   1.00 4.32  ? 3  DA  D "O5'"  3  
ATOM 6760  C "C5'"  . DA  B 1 3  ? 24.082  0.653   2.544   1.00 4.41  ? 3  DA  D "C5'"  3  
ATOM 6761  C "C4'"  . DA  B 1 3  ? 23.403  1.559   3.544   1.00 4.62  ? 3  DA  D "C4'"  3  
ATOM 6762  O "O4'"  . DA  B 1 3  ? 23.478  2.929   3.065   1.00 4.98  ? 3  DA  D "O4'"  3  
ATOM 6763  C "C3'"  . DA  B 1 3  ? 21.911  1.303   3.741   1.00 4.48  ? 3  DA  D "C3'"  3  
ATOM 6764  O "O3'"  . DA  B 1 3  ? 21.547  1.686   5.068   1.00 4.62  ? 3  DA  D "O3'"  3  
ATOM 6765  C "C2'"  . DA  B 1 3  ? 21.278  2.153   2.655   1.00 4.65  ? 3  DA  D "C2'"  3  
ATOM 6766  C "C1'"  . DA  B 1 3  ? 22.199  3.361   2.604   1.00 5.03  ? 3  DA  D "C1'"  3  
ATOM 6767  N N9     . DA  B 1 3  ? 22.327  3.975   1.278   1.00 5.21  ? 3  DA  D N9     3  
ATOM 6768  C C8     . DA  B 1 3  ? 22.556  3.370   0.070   1.00 5.09  ? 3  DA  D C8     3  
ATOM 6769  N N7     . DA  B 1 3  ? 22.511  4.193   -0.954  1.00 5.35  ? 3  DA  D N7     3  
ATOM 6770  C C5     . DA  B 1 3  ? 22.258  5.431   -0.375  1.00 5.64  ? 3  DA  D C5     3  
ATOM 6771  C C6     . DA  B 1 3  ? 22.085  6.722   -0.923  1.00 6.00  ? 3  DA  D C6     3  
ATOM 6772  N N6     . DA  B 1 3  ? 22.111  6.987   -2.233  1.00 6.14  ? 3  DA  D N6     3  
ATOM 6773  N N1     . DA  B 1 3  ? 21.866  7.745   -0.067  1.00 6.24  ? 3  DA  D N1     3  
ATOM 6774  C C2     . DA  B 1 3  ? 21.807  7.479   1.245   1.00 6.14  ? 3  DA  D C2     3  
ATOM 6775  N N3     . DA  B 1 3  ? 21.937  6.310   1.876   1.00 5.82  ? 3  DA  D N3     3  
ATOM 6776  C C4     . DA  B 1 3  ? 22.166  5.316   1.001   1.00 5.57  ? 3  DA  D C4     3  
ATOM 6777  H "H5'"  . DA  B 1 3  ? 25.012  1.120   2.219   1.00 4.60  ? 3  DA  D "H5'"  3  
ATOM 6778  H "H5''" . DA  B 1 3  ? 24.317  -0.292  3.032   1.00 4.18  ? 3  DA  D "H5''" 3  
ATOM 6779  H "H4'"  . DA  B 1 3  ? 23.884  1.413   4.512   1.00 4.63  ? 3  DA  D "H4'"  3  
ATOM 6780  H "H3'"  . DA  B 1 3  ? 21.676  0.247   3.606   1.00 4.20  ? 3  DA  D "H3'"  3  
ATOM 6781  H "H2'"  . DA  B 1 3  ? 21.239  1.623   1.704   1.00 4.51  ? 3  DA  D "H2'"  3  
ATOM 6782  H "H2''" . DA  B 1 3  ? 20.262  2.442   2.914   1.00 4.69  ? 3  DA  D "H2''" 3  
ATOM 6783  H "H1'"  . DA  B 1 3  ? 21.851  4.129   3.299   1.00 5.23  ? 3  DA  D "H1'"  3  
ATOM 6784  H H8     . DA  B 1 3  ? 22.756  2.314   -0.033  1.00 4.83  ? 3  DA  D H8     3  
ATOM 6785  H H61    . DA  B 1 3  ? 21.957  7.931   -2.562  1.00 6.41  ? 3  DA  D H61    3  
ATOM 6786  H H62    . DA  B 1 3  ? 22.261  6.245   -2.901  1.00 6.00  ? 3  DA  D H62    3  
ATOM 6787  H H2     . DA  B 1 3  ? 21.635  8.344   1.889   1.00 6.37  ? 3  DA  D H2     3  
ATOM 6788  P P      . DT  B 1 4  ? 20.005  1.692   5.522   1.00 4.60  ? 4  DT  D P      3  
ATOM 6789  O OP1    . DT  B 1 4  ? 19.857  0.862   6.750   1.00 4.51  ? 4  DT  D OP1    3  
ATOM 6790  O OP2    . DT  B 1 4  ? 19.144  1.406   4.349   1.00 4.43  ? 4  DT  D OP2    3  
ATOM 6791  O "O5'"  . DT  B 1 4  ? 19.838  3.229   5.896   1.00 5.01  ? 4  DT  D "O5'"  3  
ATOM 6792  C "C5'"  . DT  B 1 4  ? 20.972  3.945   6.395   1.00 5.28  ? 4  DT  D "C5'"  3  
ATOM 6793  C "C4'"  . DT  B 1 4  ? 20.617  5.374   6.720   1.00 5.67  ? 4  DT  D "C4'"  3  
ATOM 6794  O "O4'"  . DT  B 1 4  ? 20.515  6.125   5.485   1.00 5.79  ? 4  DT  D "O4'"  3  
ATOM 6795  C "C3'"  . DT  B 1 4  ? 19.256  5.515   7.384   1.00 5.71  ? 4  DT  D "C3'"  3  
ATOM 6796  O "O3'"  . DT  B 1 4  ? 19.221  6.699   8.175   1.00 6.10  ? 4  DT  D "O3'"  3  
ATOM 6797  C "C2'"  . DT  B 1 4  ? 18.313  5.615   6.200   1.00 5.60  ? 4  DT  D "C2'"  3  
ATOM 6798  C "C1'"  . DT  B 1 4  ? 19.149  6.402   5.195   1.00 5.78  ? 4  DT  D "C1'"  3  
ATOM 6799  N N1     . DT  B 1 4  ? 18.888  6.103   3.767   1.00 5.61  ? 4  DT  D N1     3  
ATOM 6800  C C2     . DT  B 1 4  ? 18.697  7.179   2.920   1.00 5.88  ? 4  DT  D C2     3  
ATOM 6801  O O2     . DT  B 1 4  ? 18.775  8.339   3.287   1.00 6.22  ? 4  DT  D O2     3  
ATOM 6802  N N3     . DT  B 1 4  ? 18.411  6.846   1.624   1.00 5.75  ? 4  DT  D N3     3  
ATOM 6803  C C4     . DT  B 1 4  ? 18.305  5.577   1.092   1.00 5.39  ? 4  DT  D C4     3  
ATOM 6804  O O4     . DT  B 1 4  ? 18.021  5.432   -0.096  1.00 5.35  ? 4  DT  D O4     3  
ATOM 6805  C C5     . DT  B 1 4  ? 18.533  4.496   2.028   1.00 5.11  ? 4  DT  D C5     3  
ATOM 6806  C C7     . DT  B 1 4  ? 18.398  3.085   1.547   1.00 4.72  ? 4  DT  D C7     3  
ATOM 6807  C C6     . DT  B 1 4  ? 18.817  4.805   3.306   1.00 5.23  ? 4  DT  D C6     3  
ATOM 6808  H "H5'"  . DT  B 1 4  ? 21.765  3.937   5.645   1.00 5.26  ? 4  DT  D "H5'"  3  
ATOM 6809  H "H5''" . DT  B 1 4  ? 21.339  3.459   7.299   1.00 5.24  ? 4  DT  D "H5''" 3  
ATOM 6810  H "H4'"  . DT  B 1 4  ? 21.362  5.765   7.416   1.00 5.86  ? 4  DT  D "H4'"  3  
ATOM 6811  H "H3'"  . DT  B 1 4  ? 19.032  4.654   8.014   1.00 5.55  ? 4  DT  D "H3'"  3  
ATOM 6812  H "H2'"  . DT  B 1 4  ? 18.042  4.626   5.827   1.00 5.30  ? 4  DT  D "H2'"  3  
ATOM 6813  H "H2''" . DT  B 1 4  ? 17.392  6.121   6.472   1.00 5.72  ? 4  DT  D "H2''" 3  
ATOM 6814  H "H1'"  . DT  B 1 4  ? 19.001  7.474   5.345   1.00 6.07  ? 4  DT  D "H1'"  3  
ATOM 6815  H H3     . DT  B 1 4  ? 18.242  7.621   0.992   1.00 5.96  ? 4  DT  D H3     3  
ATOM 6816  H H71    . DT  B 1 4  ? 19.322  2.777   1.060   1.00 4.61  ? 4  DT  D H71    3  
ATOM 6817  H H72    . DT  B 1 4  ? 17.574  3.020   0.835   1.00 4.84  ? 4  DT  D H72    3  
ATOM 6818  H H73    . DT  B 1 4  ? 18.196  2.429   2.394   1.00 4.66  ? 4  DT  D H73    3  
ATOM 6819  H H6     . DT  B 1 4  ? 19.002  3.993   4.008   1.00 5.05  ? 4  DT  D H6     3  
ATOM 6820  P P      . DA  B 1 5  ? 17.888  7.083   8.976   1.00 6.25  ? 5  DA  D P      3  
ATOM 6821  O OP1    . DA  B 1 5  ? 18.292  7.553   10.325  1.00 6.53  ? 5  DA  D OP1    3  
ATOM 6822  O OP2    . DA  B 1 5  ? 16.901  5.979   8.848   1.00 5.93  ? 5  DA  D OP2    3  
ATOM 6823  O "O5'"  . DA  B 1 5  ? 17.350  8.331   8.148   1.00 6.49  ? 5  DA  D "O5'"  3  
ATOM 6824  C "C5'"  . DA  B 1 5  ? 18.166  9.488   7.992   1.00 6.83  ? 5  DA  D "C5'"  3  
ATOM 6825  C "C4'"  . DA  B 1 5  ? 17.339  10.653  7.509   1.00 7.10  ? 5  DA  D "C4'"  3  
ATOM 6826  O "O4'"  . DA  B 1 5  ? 17.092  10.495  6.089   1.00 6.94  ? 5  DA  D "O4'"  3  
ATOM 6827  C "C3'"  . DA  B 1 5  ? 15.956  10.693  8.149   1.00 7.11  ? 5  DA  D "C3'"  3  
ATOM 6828  O "O3'"  . DA  B 1 5  ? 15.457  12.027  8.150   1.00 7.47  ? 5  DA  D "O3'"  3  
ATOM 6829  C "C2'"  . DA  B 1 5  ? 15.133  9.805   7.235   1.00 6.76  ? 5  DA  D "C2'"  3  
ATOM 6830  C "C1'"  . DA  B 1 5  ? 15.737  10.114  5.871   1.00 6.76  ? 5  DA  D "C1'"  3  
ATOM 6831  N N9     . DA  B 1 5  ? 15.701  9.012   4.907   1.00 6.39  ? 5  DA  D N9     3  
ATOM 6832  C C8     . DA  B 1 5  ? 15.896  7.675   5.133   1.00 6.03  ? 5  DA  D C8     3  
ATOM 6833  N N7     . DA  B 1 5  ? 15.767  6.930   4.061   1.00 5.75  ? 5  DA  D N7     3  
ATOM 6834  C C5     . DA  B 1 5  ? 15.465  7.841   3.057   1.00 5.96  ? 5  DA  D C5     3  
ATOM 6835  C C6     . DA  B 1 5  ? 15.201  7.685   1.682   1.00 5.87  ? 5  DA  D C6     3  
ATOM 6836  N N6     . DA  B 1 5  ? 15.189  6.504   1.057   1.00 5.52  ? 5  DA  D N6     3  
ATOM 6837  N N1     . DA  B 1 5  ? 14.939  8.798   0.960   1.00 6.17  ? 5  DA  D N1     3  
ATOM 6838  C C2     . DA  B 1 5  ? 14.941  9.982   1.591   1.00 6.52  ? 5  DA  D C2     3  
ATOM 6839  N N3     . DA  B 1 5  ? 15.168  10.254  2.875   1.00 6.64  ? 5  DA  D N3     3  
ATOM 6840  C C4     . DA  B 1 5  ? 15.430  9.129   3.562   1.00 6.35  ? 5  DA  D C4     3  
ATOM 6841  H "H5'"  . DA  B 1 5  ? 18.953  9.285   7.266   1.00 6.75  ? 5  DA  D "H5'"  3  
ATOM 6842  H "H5''" . DA  B 1 5  ? 18.621  9.746   8.949   1.00 7.01  ? 5  DA  D "H5''" 3  
ATOM 6843  H "H4'"  . DA  B 1 5  ? 17.852  11.578  7.773   1.00 7.40  ? 5  DA  D "H4'"  3  
ATOM 6844  H "H3'"  . DA  B 1 5  ? 15.982  10.317  9.171   1.00 7.11  ? 5  DA  D "H3'"  3  
ATOM 6845  H "H2'"  . DA  B 1 5  ? 15.241  8.755   7.505   1.00 6.49  ? 5  DA  D "H2'"  3  
ATOM 6846  H "H2''" . DA  B 1 5  ? 14.074  10.048  7.294   1.00 6.80  ? 5  DA  D "H2''" 3  
ATOM 6847  H "H1'"  . DA  B 1 5  ? 15.231  10.972  5.420   1.00 6.96  ? 5  DA  D "H1'"  3  
ATOM 6848  H H8     . DA  B 1 5  ? 16.121  7.273   6.109   1.00 5.99  ? 5  DA  D H8     3  
ATOM 6849  H H61    . DA  B 1 5  ? 14.980  6.452   0.071   1.00 5.50  ? 5  DA  D H61    3  
ATOM 6850  H H62    . DA  B 1 5  ? 15.376  5.661   1.581   1.00 5.30  ? 5  DA  D H62    3  
ATOM 6851  H H2     . DA  B 1 5  ? 14.720  10.844  0.963   1.00 6.75  ? 5  DA  D H2     3  
ATOM 6852  P P      . DA  B 1 6  ? 13.991  12.327  8.722   1.00 7.56  ? 6  DA  D P      3  
ATOM 6853  O OP1    . DA  B 1 6  ? 14.105  13.492  9.637   1.00 7.97  ? 6  DA  D OP1    3  
ATOM 6854  O OP2    . DA  B 1 6  ? 13.375  11.067  9.212   1.00 7.26  ? 6  DA  D OP2    3  
ATOM 6855  O "O5'"  . DA  B 1 6  ? 13.225  12.792  7.409   1.00 7.53  ? 6  DA  D "O5'"  3  
ATOM 6856  C "C5'"  . DA  B 1 6  ? 13.802  13.797  6.582   1.00 7.75  ? 6  DA  D "C5'"  3  
ATOM 6857  C "C4'"  . DA  B 1 6  ? 12.838  14.227  5.502   1.00 7.77  ? 6  DA  D "C4'"  3  
ATOM 6858  O "O4'"  . DA  B 1 6  ? 12.847  13.240  4.439   1.00 7.43  ? 6  DA  D "O4'"  3  
ATOM 6859  C "C3'"  . DA  B 1 6  ? 11.393  14.267  5.988   1.00 7.77  ? 6  DA  D "C3'"  3  
ATOM 6860  O "O3'"  . DA  B 1 6  ? 10.650  15.191  5.203   1.00 7.95  ? 6  DA  D "O3'"  3  
ATOM 6861  C "C2'"  . DA  B 1 6  ? 10.915  12.844  5.758   1.00 7.34  ? 6  DA  D "C2'"  3  
ATOM 6862  C "C1'"  . DA  B 1 6  ? 11.644  12.479  4.474   1.00 7.17  ? 6  DA  D "C1'"  3  
ATOM 6863  N N9     . DA  B 1 6  ? 11.956  11.057  4.305   1.00 6.78  ? 6  DA  D N9     3  
ATOM 6864  C C8     . DA  B 1 6  ? 12.408  10.151  5.230   1.00 6.60  ? 6  DA  D C8     3  
ATOM 6865  N N7     . DA  B 1 6  ? 12.517  8.928   4.760   1.00 6.23  ? 6  DA  D N7     3  
ATOM 6866  C C5     . DA  B 1 6  ? 12.119  9.041   3.435   1.00 6.16  ? 6  DA  D C5     3  
ATOM 6867  C C6     . DA  B 1 6  ? 12.003  8.096   2.391   1.00 5.84  ? 6  DA  D C6     3  
ATOM 6868  N N6     . DA  B 1 6  ? 12.265  6.794   2.530   1.00 5.50  ? 6  DA  D N6     3  
ATOM 6869  N N1     . DA  B 1 6  ? 11.588  8.545   1.184   1.00 5.91  ? 6  DA  D N1     3  
ATOM 6870  C C2     . DA  B 1 6  ? 11.306  9.846   1.047   1.00 6.26  ? 6  DA  D C2     3  
ATOM 6871  N N3     . DA  B 1 6  ? 11.367  10.823  1.951   1.00 6.57  ? 6  DA  D N3     3  
ATOM 6872  C C4     . DA  B 1 6  ? 11.789  10.350  3.136   1.00 6.50  ? 6  DA  D C4     3  
ATOM 6873  H "H5'"  . DA  B 1 6  ? 14.706  13.407  6.114   1.00 7.64  ? 6  DA  D "H5'"  3  
ATOM 6874  H "H5''" . DA  B 1 6  ? 14.064  14.663  7.189   1.00 8.05  ? 6  DA  D "H5''" 3  
ATOM 6875  H "H4'"  . DA  B 1 6  ? 13.106  15.234  5.179   1.00 8.04  ? 6  DA  D "H4'"  3  
ATOM 6876  H "H3'"  . DA  B 1 6  ? 11.335  14.555  7.037   1.00 7.93  ? 6  DA  D "H3'"  3  
ATOM 6877  H "H2'"  . DA  B 1 6  ? 11.190  12.194  6.588   1.00 7.24  ? 6  DA  D "H2'"  3  
ATOM 6878  H "H2''" . DA  B 1 6  ? 9.833   12.798  5.648   1.00 7.29  ? 6  DA  D "H2''" 3  
ATOM 6879  H "H1'"  . DA  B 1 6  ? 11.050  12.790  3.612   1.00 7.19  ? 6  DA  D "H1'"  3  
ATOM 6880  H H8     . DA  B 1 6  ? 12.644  10.416  6.247   1.00 6.77  ? 6  DA  D H8     3  
ATOM 6881  H H61    . DA  B 1 6  ? 12.143  6.160   1.753   1.00 5.29  ? 6  DA  D H61    3  
ATOM 6882  H H62    . DA  B 1 6  ? 12.567  6.440   3.427   1.00 5.46  ? 6  DA  D H62    3  
ATOM 6883  H H2     . DA  B 1 6  ? 10.978  10.152  0.052   1.00 6.31  ? 6  DA  D H2     3  
ATOM 6884  P P      . DG  B 1 7  ? 9.070   15.341  5.429   1.00 7.95  ? 7  DG  D P      3  
ATOM 6885  O OP1    . DG  B 1 7  ? 8.769   16.793  5.507   1.00 8.35  ? 7  DG  D OP1    3  
ATOM 6886  O OP2    . DG  B 1 7  ? 8.624   14.438  6.520   1.00 7.79  ? 7  DG  D OP2    3  
ATOM 6887  O "O5'"  . DG  B 1 7  ? 8.517   14.789  4.043   1.00 7.66  ? 7  DG  D "O5'"  3  
ATOM 6888  C "C5'"  . DG  B 1 7  ? 9.115   15.238  2.830   1.00 7.74  ? 7  DG  D "C5'"  3  
ATOM 6889  C "C4'"  . DG  B 1 7  ? 8.243   14.904  1.645   1.00 7.55  ? 7  DG  D "C4'"  3  
ATOM 6890  O "O4'"  . DG  B 1 7  ? 8.456   13.518  1.277   1.00 7.14  ? 7  DG  D "O4'"  3  
ATOM 6891  C "C3'"  . DG  B 1 7  ? 6.757   15.004  1.973   1.00 7.53  ? 7  DG  D "C3'"  3  
ATOM 6892  O "O3'"  . DG  B 1 7  ? 6.026   15.279  0.783   1.00 7.52  ? 7  DG  D "O3'"  3  
ATOM 6893  C "C2'"  . DG  B 1 7  ? 6.437   13.625  2.518   1.00 7.15  ? 7  DG  D "C2'"  3  
ATOM 6894  C "C1'"  . DG  B 1 7  ? 7.330   12.739  1.657   1.00 6.89  ? 7  DG  D "C1'"  3  
ATOM 6895  N N9     . DG  B 1 7  ? 7.785   11.492  2.270   1.00 6.59  ? 7  DG  D N9     3  
ATOM 6896  C C8     . DG  B 1 7  ? 8.207   11.283  3.561   1.00 6.62  ? 7  DG  D C8     3  
ATOM 6897  N N7     . DG  B 1 7  ? 8.476   10.029  3.817   1.00 6.30  ? 7  DG  D N7     3  
ATOM 6898  C C5     . DG  B 1 7  ? 8.233   9.373   2.618   1.00 6.03  ? 7  DG  D C5     3  
ATOM 6899  C C6     . DG  B 1 7  ? 8.342   7.988   2.273   1.00 5.63  ? 7  DG  D C6     3  
ATOM 6900  O O6     . DG  B 1 7  ? 8.678   7.032   2.988   1.00 5.43  ? 7  DG  D O6     3  
ATOM 6901  N N1     . DG  B 1 7  ? 8.005   7.764   0.942   1.00 5.49  ? 7  DG  D N1     3  
ATOM 6902  C C2     . DG  B 1 7  ? 7.615   8.736   0.052   1.00 5.71  ? 7  DG  D C2     3  
ATOM 6903  N N2     . DG  B 1 7  ? 7.345   8.324   -1.195  1.00 5.56  ? 7  DG  D N2     3  
ATOM 6904  N N3     . DG  B 1 7  ? 7.500   10.018  0.359   1.00 6.08  ? 7  DG  D N3     3  
ATOM 6905  C C4     . DG  B 1 7  ? 7.822   10.263  1.648   1.00 6.21  ? 7  DG  D C4     3  
ATOM 6906  H "H5'"  . DG  B 1 7  ? 10.085  14.758  2.703   1.00 7.63  ? 7  DG  D "H5'"  3  
ATOM 6907  H "H5''" . DG  B 1 7  ? 9.258   16.318  2.873   1.00 8.06  ? 7  DG  D "H5''" 3  
ATOM 6908  H "H4'"  . DG  B 1 7  ? 8.455   15.618  0.846   1.00 7.73  ? 7  DG  D "H4'"  3  
ATOM 6909  H "H3'"  . DG  B 1 7  ? 6.565   15.789  2.704   1.00 7.78  ? 7  DG  D "H3'"  3  
ATOM 6910  H "H2'"  . DG  B 1 7  ? 6.680   13.551  3.577   1.00 7.21  ? 7  DG  D "H2'"  3  
ATOM 6911  H "H2''" . DG  B 1 7  ? 5.379   13.386  2.407   1.00 7.04  ? 7  DG  D "H2''" 3  
ATOM 6912  H "H1'"  . DG  B 1 7  ? 6.805   12.478  0.735   1.00 6.75  ? 7  DG  D "H1'"  3  
ATOM 6913  H H8     . DG  B 1 7  ? 8.304   12.073  4.290   1.00 6.90  ? 7  DG  D H8     3  
ATOM 6914  H H1     . DG  B 1 7  ? 8.051   6.811   0.607   1.00 5.22  ? 7  DG  D H1     3  
ATOM 6915  H H21    . DG  B 1 7  ? 7.428   7.349   -1.449  1.00 5.29  ? 7  DG  D H21    3  
ATOM 6916  H H22    . DG  B 1 7  ? 7.058   8.998   -1.892  1.00 5.73  ? 7  DG  D H22    3  
ATOM 6917  P P      . DA  B 1 8  ? 4.427   15.331  0.823   1.00 7.47  ? 8  DA  D P      3  
ATOM 6918  O OP1    . DA  B 1 8  ? 4.000   16.560  0.104   1.00 7.77  ? 8  DA  D OP1    3  
ATOM 6919  O OP2    . DA  B 1 8  ? 3.942   15.083  2.205   1.00 7.45  ? 8  DA  D OP2    3  
ATOM 6920  O "O5'"  . DA  B 1 8  ? 4.064   14.076  -0.082  1.00 7.06  ? 8  DA  D "O5'"  3  
ATOM 6921  C "C5'"  . DA  B 1 8  ? 4.714   13.918  -1.340  1.00 7.01  ? 8  DA  D "C5'"  3  
ATOM 6922  C "C4'"  . DA  B 1 8  ? 4.002   12.893  -2.187  1.00 6.67  ? 8  DA  D "C4'"  3  
ATOM 6923  O "O4'"  . DA  B 1 8  ? 4.418   11.567  -1.773  1.00 6.32  ? 8  DA  D "O4'"  3  
ATOM 6924  C "C3'"  . DA  B 1 8  ? 2.492   12.914  -1.991  1.00 6.62  ? 8  DA  D "C3'"  3  
ATOM 6925  O "O3'"  . DA  B 1 8  ? 1.851   12.433  -3.166  1.00 6.44  ? 8  DA  D "O3'"  3  
ATOM 6926  C "C2'"  . DA  B 1 8  ? 2.292   11.983  -0.810  1.00 6.37  ? 8  DA  D "C2'"  3  
ATOM 6927  C "C1'"  . DA  B 1 8  ? 3.365   10.932  -1.055  1.00 6.11  ? 8  DA  D "C1'"  3  
ATOM 6928  N N9     . DA  B 1 8  ? 3.917   10.291  0.142   1.00 5.99  ? 8  DA  D N9     3  
ATOM 6929  C C8     . DA  B 1 8  ? 4.327   10.853  1.327   1.00 6.22  ? 8  DA  D C8     3  
ATOM 6930  N N7     . DA  B 1 8  ? 4.720   9.974   2.220   1.00 6.04  ? 8  DA  D N7     3  
ATOM 6931  C C5     . DA  B 1 8  ? 4.566   8.751   1.578   1.00 5.66  ? 8  DA  D C5     3  
ATOM 6932  C C6     . DA  B 1 8  ? 4.806   7.421   1.989   1.00 5.33  ? 8  DA  D C6     3  
ATOM 6933  N N6     . DA  B 1 8  ? 5.251   7.089   3.203   1.00 5.34  ? 8  DA  D N6     3  
ATOM 6934  N N1     . DA  B 1 8  ? 4.557   6.432   1.099   1.00 4.99  ? 8  DA  D N1     3  
ATOM 6935  C C2     . DA  B 1 8  ? 4.095   6.767   -0.114  1.00 5.01  ? 8  DA  D C2     3  
ATOM 6936  N N3     . DA  B 1 8  ? 3.824   7.973   -0.611  1.00 5.31  ? 8  DA  D N3     3  
ATOM 6937  C C4     . DA  B 1 8  ? 4.085   8.933   0.295   1.00 5.62  ? 8  DA  D C4     3  
ATOM 6938  H "H5'"  . DA  B 1 8  ? 5.742   13.593  -1.179  1.00 6.96  ? 8  DA  D "H5'"  3  
ATOM 6939  H "H5''" . DA  B 1 8  ? 4.722   14.871  -1.868  1.00 7.28  ? 8  DA  D "H5''" 3  
ATOM 6940  H "H4'"  . DA  B 1 8  ? 4.201   13.116  -3.237  1.00 6.75  ? 8  DA  D "H4'"  3  
ATOM 6941  H "H3'"  . DA  B 1 8  ? 2.137   13.924  -1.778  1.00 6.90  ? 8  DA  D "H3'"  3  
ATOM 6942  H "H2'"  . DA  B 1 8  ? 2.432   12.506  0.137   1.00 6.56  ? 8  DA  D "H2'"  3  
ATOM 6943  H "H2''" . DA  B 1 8  ? 1.289   11.555  -0.802  1.00 6.22  ? 8  DA  D "H2''" 3  
ATOM 6944  H "H1'"  . DA  B 1 8  ? 2.973   10.144  -1.701  1.00 5.86  ? 8  DA  D "H1'"  3  
ATOM 6945  H H8     . DA  B 1 8  ? 4.327   11.918  1.506   1.00 6.53  ? 8  DA  D H8     3  
ATOM 6946  H H61    . DA  B 1 8  ? 5.391   6.119   3.450   1.00 5.11  ? 8  DA  D H61    3  
ATOM 6947  H H62    . DA  B 1 8  ? 5.434   7.813   3.882   1.00 5.60  ? 8  DA  D H62    3  
ATOM 6948  H H2     . DA  B 1 8  ? 3.917   5.932   -0.792  1.00 4.75  ? 8  DA  D H2     3  
ATOM 6949  P P      . DT  B 1 9  ? 0.260   12.251  -3.193  1.00 6.32  ? 9  DT  D P      3  
ATOM 6950  O OP1    . DT  B 1 9  ? -0.245  12.890  -4.434  1.00 6.48  ? 9  DT  D OP1    3  
ATOM 6951  O OP2    . DT  B 1 9  ? -0.317  12.642  -1.879  1.00 6.44  ? 9  DT  D OP2    3  
ATOM 6952  O "O5'"  . DT  B 1 9  ? 0.143   10.676  -3.354  1.00 5.87  ? 9  DT  D "O5'"  3  
ATOM 6953  C "C5'"  . DT  B 1 9  ? 1.013   10.010  -4.267  1.00 5.72  ? 9  DT  D "C5'"  3  
ATOM 6954  C "C4'"  . DT  B 1 9  ? 0.556   8.594   -4.507  1.00 5.31  ? 9  DT  D "C4'"  3  
ATOM 6955  O "O4'"  . DT  B 1 9  ? 0.995   7.765   -3.403  1.00 5.09  ? 9  DT  D "O4'"  3  
ATOM 6956  C "C3'"  . DT  B 1 9  ? -0.961  8.450   -4.534  1.00 5.19  ? 9  DT  D "C3'"  3  
ATOM 6957  O "O3'"  . DT  B 1 9  ? -1.309  7.329   -5.343  1.00 4.88  ? 9  DT  D "O3'"  3  
ATOM 6958  C "C2'"  . DT  B 1 9  ? -1.304  8.249   -3.069  1.00 5.13  ? 9  DT  D "C2'"  3  
ATOM 6959  C "C1'"  . DT  B 1 9  ? -0.113  7.429   -2.577  1.00 4.96  ? 9  DT  D "C1'"  3  
ATOM 6960  N N1     . DT  B 1 9  ? 0.274   7.619   -1.159  1.00 5.08  ? 9  DT  D N1     3  
ATOM 6961  C C2     . DT  B 1 9  ? 0.614   6.485   -0.453  1.00 4.82  ? 9  DT  D C2     3  
ATOM 6962  O O2     . DT  B 1 9  ? 0.633   5.371   -0.950  1.00 4.49  ? 9  DT  D O2     3  
ATOM 6963  N N3     . DT  B 1 9  ? 0.929   6.697   0.863   1.00 4.97  ? 9  DT  D N3     3  
ATOM 6964  C C4     . DT  B 1 9  ? 0.945   7.901   1.532   1.00 5.34  ? 9  DT  D C4     3  
ATOM 6965  O O4     . DT  B 1 9  ? 1.221   7.927   2.730   1.00 5.47  ? 9  DT  D O4     3  
ATOM 6966  C C5     . DT  B 1 9  ? 0.592   9.056   0.732   1.00 5.58  ? 9  DT  D C5     3  
ATOM 6967  C C7     . DT  B 1 9  ? 0.554   10.401  1.387   1.00 6.00  ? 9  DT  D C7     3  
ATOM 6968  C C6     . DT  B 1 9  ? 0.282   8.865   -0.563  1.00 5.44  ? 9  DT  D C6     3  
ATOM 6969  H "H5'"  . DT  B 1 9  ? 2.024   9.993   -3.861  1.00 5.76  ? 9  DT  D "H5'"  3  
ATOM 6970  H "H5''" . DT  B 1 9  ? 1.021   10.545  -5.218  1.00 5.89  ? 9  DT  D "H5''" 3  
ATOM 6971  H "H4'"  . DT  B 1 9  ? 0.933   8.270   -5.479  1.00 5.26  ? 9  DT  D "H4'"  3  
ATOM 6972  H "H3'"  . DT  B 1 9  ? -1.430  9.345   -4.940  1.00 5.42  ? 9  DT  D "H3'"  3  
ATOM 6973  H "H2'"  . DT  B 1 9  ? -1.391  9.203   -2.550  1.00 5.40  ? 9  DT  D "H2'"  3  
ATOM 6974  H "H2''" . DT  B 1 9  ? -2.252  7.728   -2.952  1.00 4.95  ? 9  DT  D "H2''" 3  
ATOM 6975  H "H1'"  . DT  B 1 9  ? -0.309  6.363   -2.726  1.00 4.66  ? 9  DT  D "H1'"  3  
ATOM 6976  H H3     . DT  B 1 9  ? 1.172   5.879   1.403   1.00 4.81  ? 9  DT  D H3     3  
ATOM 6977  H H71    . DT  B 1 9  ? 0.078   10.317  2.364   1.00 6.19  ? 9  DT  D H71    3  
ATOM 6978  H H72    . DT  B 1 9  ? -0.014  11.094  0.765   1.00 6.06  ? 9  DT  D H72    3  
ATOM 6979  H H73    . DT  B 1 9  ? 1.571   10.774  1.511   1.00 6.21  ? 9  DT  D H73    3  
ATOM 6980  H H6     . DT  B 1 9  ? 0.029   9.735   -1.170  1.00 5.65  ? 9  DT  D H6     3  
ATOM 6981  P P      . DA  B 1 10 ? -2.848  6.919   -5.526  1.00 4.69  ? 10 DA  D P      3  
ATOM 6982  O OP1    . DA  B 1 10 ? -3.101  6.770   -6.981  1.00 4.69  ? 10 DA  D OP1    3  
ATOM 6983  O OP2    . DA  B 1 10 ? -3.709  7.825   -4.720  1.00 4.90  ? 10 DA  D OP2    3  
ATOM 6984  O "O5'"  . DA  B 1 10 ? -2.880  5.474   -4.864  1.00 4.29  ? 10 DA  D "O5'"  3  
ATOM 6985  C "C5'"  . DA  B 1 10 ? -1.924  4.497   -5.268  1.00 4.08  ? 10 DA  D "C5'"  3  
ATOM 6986  C "C4'"  . DA  B 1 10 ? -2.215  3.163   -4.626  1.00 3.70  ? 10 DA  D "C4'"  3  
ATOM 6987  O "O4'"  . DA  B 1 10 ? -1.779  3.207   -3.243  1.00 3.74  ? 10 DA  D "O4'"  3  
ATOM 6988  C "C3'"  . DA  B 1 10 ? -3.702  2.832   -4.557  1.00 3.55  ? 10 DA  D "C3'"  3  
ATOM 6989  O "O3'"  . DA  B 1 10 ? -3.884  1.420   -4.523  1.00 3.19  ? 10 DA  D "O3'"  3  
ATOM 6990  C "C2'"  . DA  B 1 10 ? -4.134  3.481   -3.256  1.00 3.73  ? 10 DA  D "C2'"  3  
ATOM 6991  C "C1'"  . DA  B 1 10 ? -2.908  3.282   -2.377  1.00 3.75  ? 10 DA  D "C1'"  3  
ATOM 6992  N N9     . DA  B 1 10 ? -2.685  4.338   -1.388  1.00 4.09  ? 10 DA  D N9     3  
ATOM 6993  C C8     . DA  B 1 10 ? -2.801  5.694   -1.551  1.00 4.43  ? 10 DA  D C8     3  
ATOM 6994  N N7     . DA  B 1 10 ? -2.583  6.381   -0.454  1.00 4.69  ? 10 DA  D N7     3  
ATOM 6995  C C5     . DA  B 1 10 ? -2.298  5.410   0.496   1.00 4.53  ? 10 DA  D C5     3  
ATOM 6996  C C6     . DA  B 1 10 ? -1.985  5.486   1.869   1.00 4.70  ? 10 DA  D C6     3  
ATOM 6997  N N6     . DA  B 1 10 ? -1.919  6.630   2.554   1.00 5.07  ? 10 DA  D N6     3  
ATOM 6998  N N1     . DA  B 1 10 ? -1.747  4.328   2.522   1.00 4.50  ? 10 DA  D N1     3  
ATOM 6999  C C2     . DA  B 1 10 ? -1.830  3.179   1.839   1.00 4.14  ? 10 DA  D C2     3  
ATOM 7000  N N3     . DA  B 1 10 ? -2.122  2.978   0.556   1.00 3.93  ? 10 DA  D N3     3  
ATOM 7001  C C4     . DA  B 1 10 ? -2.347  4.147   -0.068  1.00 4.15  ? 10 DA  D C4     3  
ATOM 7002  H "H5'"  . DA  B 1 10 ? -0.925  4.822   -4.975  1.00 4.21  ? 10 DA  D "H5'"  3  
ATOM 7003  H "H5''" . DA  B 1 10 ? -1.955  4.384   -6.352  1.00 4.08  ? 10 DA  D "H5''" 3  
ATOM 7004  H "H4'"  . DA  B 1 10 ? -1.732  2.383   -5.217  1.00 3.54  ? 10 DA  D "H4'"  3  
ATOM 7005  H "H3'"  . DA  B 1 10 ? -4.236  3.243   -5.413  1.00 3.64  ? 10 DA  D "H3'"  3  
ATOM 7006  H "H2'"  . DA  B 1 10 ? -4.371  4.535   -3.399  1.00 3.99  ? 10 DA  D "H2'"  3  
ATOM 7007  H "H2''" . DA  B 1 10 ? -5.016  2.998   -2.842  1.00 3.59  ? 10 DA  D "H2''" 3  
ATOM 7008  H "H1'"  . DA  B 1 10 ? -2.973  2.329   -1.846  1.00 3.54  ? 10 DA  D "H1'"  3  
ATOM 7009  H H8     . DA  B 1 10 ? -3.055  6.153   -2.494  1.00 4.49  ? 10 DA  D H8     3  
ATOM 7010  H H61    . DA  B 1 10 ? -1.699  6.625   3.542   1.00 5.20  ? 10 DA  D H61    3  
ATOM 7011  H H62    . DA  B 1 10 ? -2.100  7.507   2.086   1.00 5.24  ? 10 DA  D H62    3  
ATOM 7012  H H2     . DA  B 1 10 ? -1.626  2.277   2.418   1.00 4.01  ? 10 DA  D H2     3  
ATOM 7013  P P      . DT  B 1 11 ? -5.354  0.810   -4.332  1.00 3.00  ? 11 DT  D P      3  
ATOM 7014  O OP1    . DT  B 1 11 ? -5.555  -0.280  -5.323  1.00 2.75  ? 11 DT  D OP1    3  
ATOM 7015  O OP2    . DT  B 1 11 ? -6.344  1.916   -4.258  1.00 3.23  ? 11 DT  D OP2    3  
ATOM 7016  O "O5'"  . DT  B 1 11 ? -5.222  0.169   -2.883  1.00 2.93  ? 11 DT  D "O5'"  3  
ATOM 7017  C "C5'"  . DT  B 1 11 ? -4.067  -0.607  -2.566  1.00 2.81  ? 11 DT  D "C5'"  3  
ATOM 7018  C "C4'"  . DT  B 1 11 ? -4.260  -1.348  -1.265  1.00 2.79  ? 11 DT  D "C4'"  3  
ATOM 7019  O "O4'"  . DT  B 1 11 ? -3.993  -0.442  -0.161  1.00 3.09  ? 11 DT  D "O4'"  3  
ATOM 7020  C "C3'"  . DT  B 1 11 ? -5.703  -1.794  -1.070  1.00 2.74  ? 11 DT  D "C3'"  3  
ATOM 7021  O "O3'"  . DT  B 1 11 ? -5.761  -2.932  -0.224  1.00 2.71  ? 11 DT  D "O3'"  3  
ATOM 7022  C "C2'"  . DT  B 1 11 ? -6.346  -0.590  -0.408  1.00 3.05  ? 11 DT  D "C2'"  3  
ATOM 7023  C "C1'"  . DT  B 1 11 ? -5.215  -0.080  0.473   1.00 3.26  ? 11 DT  D "C1'"  3  
ATOM 7024  N N1     . DT  B 1 11 ? -5.225  1.375   0.750   1.00 3.59  ? 11 DT  D N1     3  
ATOM 7025  C C2     . DT  B 1 11 ? -4.919  1.771   2.039   1.00 3.86  ? 11 DT  D C2     3  
ATOM 7026  O O2     . DT  B 1 11 ? -4.574  0.991   2.913   1.00 3.85  ? 11 DT  D O2     3  
ATOM 7027  N N3     . DT  B 1 11 ? -5.032  3.116   2.269   1.00 4.18  ? 11 DT  D N3     3  
ATOM 7028  C C4     . DT  B 1 11 ? -5.397  4.087   1.364   1.00 4.27  ? 11 DT  D C4     3  
ATOM 7029  O O4     . DT  B 1 11 ? -5.518  5.253   1.739   1.00 4.60  ? 11 DT  D O4     3  
ATOM 7030  C C5     . DT  B 1 11 ? -5.670  3.612   0.024   1.00 3.99  ? 11 DT  D C5     3  
ATOM 7031  C C7     . DT  B 1 11 ? -6.120  4.595   -1.012  1.00 4.12  ? 11 DT  D C7     3  
ATOM 7032  C C6     . DT  B 1 11 ? -5.563  2.295   -0.221  1.00 3.66  ? 11 DT  D C6     3  
ATOM 7033  H "H5'"  . DT  B 1 11 ? -3.202  0.049   -2.476  1.00 2.96  ? 11 DT  D "H5'"  3  
ATOM 7034  H "H5''" . DT  B 1 11 ? -3.883  -1.331  -3.360  1.00 2.62  ? 11 DT  D "H5''" 3  
ATOM 7035  H "H4'"  . DT  B 1 11 ? -3.633  -2.241  -1.274  1.00 2.64  ? 11 DT  D "H4'"  3  
ATOM 7036  H "H3'"  . DT  B 1 11 ? -6.173  -2.033  -2.024  1.00 2.59  ? 11 DT  D "H3'"  3  
ATOM 7037  H "H2'"  . DT  B 1 11 ? -6.656  0.145   -1.146  1.00 3.09  ? 11 DT  D "H2'"  3  
ATOM 7038  H "H2''" . DT  B 1 11 ? -7.230  -0.872  0.163   1.00 3.10  ? 11 DT  D "H2''" 3  
ATOM 7039  H "H1'"  . DT  B 1 11 ? -5.238  -0.599  1.433   1.00 3.32  ? 11 DT  D "H1'"  3  
ATOM 7040  H H3     . DT  B 1 11 ? -4.845  3.436   3.210   1.00 4.40  ? 11 DT  D H3     3  
ATOM 7041  H H71    . DT  B 1 11 ? -5.253  5.108   -1.428  1.00 4.30  ? 11 DT  D H71    3  
ATOM 7042  H H72    . DT  B 1 11 ? -6.787  5.324   -0.553  1.00 4.20  ? 11 DT  D H72    3  
ATOM 7043  H H73    . DT  B 1 11 ? -6.646  4.070   -1.807  1.00 4.27  ? 11 DT  D H73    3  
ATOM 7044  H H6     . DT  B 1 11 ? -5.746  1.938   -1.235  1.00 3.46  ? 11 DT  D H6     3  
ATOM 7045  P P      . DC  B 1 12 ? -7.185  -3.490  0.251   1.00 2.77  ? 12 DC  D P      3  
ATOM 7046  O OP1    . DC  B 1 12 ? -7.112  -4.972  0.264   1.00 2.66  ? 12 DC  D OP1    3  
ATOM 7047  O OP2    . DC  B 1 12 ? -8.271  -2.813  -0.501  1.00 2.76  ? 12 DC  D OP2    3  
ATOM 7048  O "O5'"  . DC  B 1 12 ? -7.195  -2.971  1.754   1.00 3.11  ? 12 DC  D "O5'"  3  
ATOM 7049  C "C5'"  . DC  B 1 12 ? -6.064  -3.230  2.581   1.00 3.21  ? 12 DC  D "C5'"  3  
ATOM 7050  C "C4'"  . DC  B 1 12 ? -6.438  -3.151  4.038   1.00 3.55  ? 12 DC  D "C4'"  3  
ATOM 7051  O "O4'"  . DC  B 1 12 ? -6.408  -1.760  4.457   1.00 3.79  ? 12 DC  D "O4'"  3  
ATOM 7052  C "C3'"  . DC  B 1 12 ? -7.869  -3.612  4.284   1.00 3.65  ? 12 DC  D "C3'"  3  
ATOM 7053  O "O3'"  . DC  B 1 12 ? -7.992  -4.105  5.611   1.00 3.94  ? 12 DC  D "O3'"  3  
ATOM 7054  C "C2'"  . DC  B 1 12 ? -8.676  -2.345  4.070   1.00 3.74  ? 12 DC  D "C2'"  3  
ATOM 7055  C "C1'"  . DC  B 1 12 ? -7.738  -1.284  4.633   1.00 3.94  ? 12 DC  D "C1'"  3  
ATOM 7056  N N1     . DC  B 1 12 ? -7.860  0.070   4.052   1.00 4.00  ? 12 DC  D N1     3  
ATOM 7057  C C2     . DC  B 1 12 ? -7.779  1.171   4.920   1.00 4.36  ? 12 DC  D C2     3  
ATOM 7058  O O2     . DC  B 1 12 ? -7.520  0.976   6.116   1.00 4.58  ? 12 DC  D O2     3  
ATOM 7059  N N3     . DC  B 1 12 ? -7.983  2.418   4.434   1.00 4.47  ? 12 DC  D N3     3  
ATOM 7060  C C4     . DC  B 1 12 ? -8.247  2.592   3.138   1.00 4.25  ? 12 DC  D C4     3  
ATOM 7061  N N4     . DC  B 1 12 ? -8.486  3.839   2.716   1.00 4.43  ? 12 DC  D N4     3  
ATOM 7062  C C5     . DC  B 1 12 ? -8.290  1.496   2.220   1.00 3.88  ? 12 DC  D C5     3  
ATOM 7063  C C6     . DC  B 1 12 ? -8.087  0.262   2.717   1.00 3.76  ? 12 DC  D C6     3  
ATOM 7064  H "H5'"  . DC  B 1 12 ? -5.286  -2.499  2.370   1.00 3.21  ? 12 DC  D "H5'"  3  
ATOM 7065  H "H5''" . DC  B 1 12 ? -5.680  -4.228  2.368   1.00 3.06  ? 12 DC  D "H5''" 3  
ATOM 7066  H "H4'"  . DC  B 1 12 ? -5.774  -3.805  4.606   1.00 3.59  ? 12 DC  D "H4'"  3  
ATOM 7067  H "H3'"  . DC  B 1 12 ? -8.152  -4.398  3.582   1.00 3.45  ? 12 DC  D "H3'"  3  
ATOM 7068  H "H2'"  . DC  B 1 12 ? -8.895  -2.187  3.014   1.00 3.53  ? 12 DC  D "H2'"  3  
ATOM 7069  H "H2''" . DC  B 1 12 ? -9.626  -2.381  4.600   1.00 3.92  ? 12 DC  D "H2''" 3  
ATOM 7070  H "H1'"  . DC  B 1 12 ? -7.897  -1.193  5.710   1.00 4.21  ? 12 DC  D "H1'"  3  
ATOM 7071  H H41    . DC  B 1 12 ? -8.478  4.610   3.370   1.00 4.71  ? 12 DC  D H41    3  
ATOM 7072  H H42    . DC  B 1 12 ? -8.698  4.015   1.744   1.00 4.31  ? 12 DC  D H42    3  
ATOM 7073  H H5     . DC  B 1 12 ? -8.483  1.653   1.159   1.00 3.72  ? 12 DC  D H5     3  
ATOM 7074  H H6     . DC  B 1 12 ? -8.101  -0.594  2.042   1.00 3.49  ? 12 DC  D H6     3  
ATOM 7075  P P      . DT  B 1 13 ? -9.432  -4.534  6.169   1.00 4.16  ? 13 DT  D P      3  
ATOM 7076  O OP1    . DT  B 1 13 ? -9.293  -5.862  6.817   1.00 4.28  ? 13 DT  D OP1    3  
ATOM 7077  O OP2    . DT  B 1 13 ? -10.473 -4.326  5.131   1.00 3.98  ? 13 DT  D OP2    3  
ATOM 7078  O "O5'"  . DT  B 1 13 ? -9.620  -3.442  7.308   1.00 4.51  ? 13 DT  D "O5'"  3  
ATOM 7079  C "C5'"  . DT  B 1 13 ? -8.512  -3.127  8.144   1.00 4.67  ? 13 DT  D "C5'"  3  
ATOM 7080  C "C4'"  . DT  B 1 13 ? -8.964  -2.382  9.374   1.00 5.07  ? 13 DT  D "C4'"  3  
ATOM 7081  O "O4'"  . DT  B 1 13 ? -9.143  -0.984  9.034   1.00 5.12  ? 13 DT  D "O4'"  3  
ATOM 7082  C "C3'"  . DT  B 1 13 ? -10.327 -2.851  9.865   1.00 5.26  ? 13 DT  D "C3'"  3  
ATOM 7083  O "O3'"  . DT  B 1 13 ? -10.440 -2.619  11.263  1.00 5.65  ? 13 DT  D "O3'"  3  
ATOM 7084  C "C2'"  . DT  B 1 13 ? -11.288 -1.992  9.063   1.00 5.17  ? 13 DT  D "C2'"  3  
ATOM 7085  C "C1'"  . DT  B 1 13 ? -10.529 -0.672  8.973   1.00 5.21  ? 13 DT  D "C1'"  3  
ATOM 7086  N N1     . DT  B 1 13 ? -10.788 0.148   7.765   1.00 5.01  ? 13 DT  D N1     3  
ATOM 7087  C C2     . DT  B 1 13 ? -10.896 1.512   7.948   1.00 5.23  ? 13 DT  D C2     3  
ATOM 7088  O O2     . DT  B 1 13 ? -10.738 2.054   9.029   1.00 5.56  ? 13 DT  D O2     3  
ATOM 7089  N N3     . DT  B 1 13 ? -11.198 2.224   6.815   1.00 5.08  ? 13 DT  D N3     3  
ATOM 7090  C C4     . DT  B 1 13 ? -11.392 1.724   5.547   1.00 4.72  ? 13 DT  D C4     3  
ATOM 7091  O O4     . DT  B 1 13 ? -11.709 2.486   4.635   1.00 4.65  ? 13 DT  D O4     3  
ATOM 7092  C C5     . DT  B 1 13 ? -11.240 0.288   5.417   1.00 4.48  ? 13 DT  D C5     3  
ATOM 7093  C C7     . DT  B 1 13 ? -11.466 -0.343  4.079   1.00 4.11  ? 13 DT  D C7     3  
ATOM 7094  C C6     . DT  B 1 13 ? -10.943 -0.424  6.518   1.00 4.65  ? 13 DT  D C6     3  
ATOM 7095  H "H5'"  . DT  B 1 13 ? -7.804  -2.507  7.594   1.00 4.54  ? 13 DT  D "H5'"  3  
ATOM 7096  H "H5''" . DT  B 1 13 ? -8.013  -4.046  8.453   1.00 4.67  ? 13 DT  D "H5''" 3  
ATOM 7097  H "H4'"  . DT  B 1 13 ? -8.244  -2.558  10.174  1.00 5.22  ? 13 DT  D "H4'"  3  
ATOM 7098  H "H3'"  . DT  B 1 13 ? -10.470 -3.913  9.666   1.00 5.16  ? 13 DT  D "H3'"  3  
ATOM 7099  H "H2'"  . DT  B 1 13 ? -11.482 -2.426  8.083   1.00 4.90  ? 13 DT  D "H2'"  3  
ATOM 7100  H "H2''" . DT  B 1 13 ? -12.246 -1.887  9.571   1.00 5.37  ? 13 DT  D "H2''" 3  
ATOM 7101  H "H1'"  . DT  B 1 13 ? -10.753 -0.055  9.847   1.00 5.51  ? 13 DT  D "H1'"  3  
ATOM 7102  H H3     . DT  B 1 13 ? -11.297 3.224   6.926   1.00 5.26  ? 13 DT  D H3     3  
ATOM 7103  H H71    . DT  B 1 13 ? -11.652 -1.410  4.206   1.00 4.06  ? 13 DT  D H71    3  
ATOM 7104  H H72    . DT  B 1 13 ? -12.328 0.120   3.599   1.00 4.04  ? 13 DT  D H72    3  
ATOM 7105  H H73    . DT  B 1 13 ? -10.584 -0.200  3.456   1.00 4.12  ? 13 DT  D H73    3  
ATOM 7106  H H6     . DT  B 1 13 ? -10.812 -1.502  6.420   1.00 4.51  ? 13 DT  D H6     3  
ATOM 7107  P P      . DT  B 1 14 ? -11.811 -2.957  12.017  1.00 5.93  ? 14 DT  D P      3  
ATOM 7108  O OP1    . DT  B 1 14 ? -11.481 -3.737  13.236  1.00 6.20  ? 14 DT  D OP1    3  
ATOM 7109  O OP2    . DT  B 1 14 ? -12.800 -3.492  11.046  1.00 5.72  ? 14 DT  D OP2    3  
ATOM 7110  O "O5'"  . DT  B 1 14 ? -12.269 -1.503  12.461  1.00 6.17  ? 14 DT  D "O5'"  3  
ATOM 7111  C "C5'"  . DT  B 1 14 ? -11.322 -0.636  13.080  1.00 6.33  ? 14 DT  D "C5'"  3  
ATOM 7112  C "C4'"  . DT  B 1 14 ? -12.010 0.569   13.666  1.00 6.64  ? 14 DT  D "C4'"  3  
ATOM 7113  O "O4'"  . DT  B 1 14 ? -12.280 1.518   12.603  1.00 6.46  ? 14 DT  D "O4'"  3  
ATOM 7114  C "C3'"  . DT  B 1 14 ? -13.373 0.228   14.253  1.00 6.86  ? 14 DT  D "C3'"  3  
ATOM 7115  O "O3'"  . DT  B 1 14 ? -13.702 1.162   15.275  1.00 7.24  ? 14 DT  D "O3'"  3  
ATOM 7116  C "C2'"  . DT  B 1 14 ? -14.298 0.358   13.057  1.00 6.61  ? 14 DT  D "C2'"  3  
ATOM 7117  C "C1'"  . DT  B 1 14 ? -13.671 1.525   12.304  1.00 6.47  ? 14 DT  D "C1'"  3  
ATOM 7118  N N1     . DT  B 1 14 ? -13.852 1.521   10.833  1.00 6.10  ? 14 DT  D N1     3  
ATOM 7119  C C2     . DT  B 1 14 ? -14.074 2.741   10.226  1.00 6.09  ? 14 DT  D C2     3  
ATOM 7120  O O2     . DT  B 1 14 ? -14.056 3.801   10.832  1.00 6.38  ? 14 DT  D O2     3  
ATOM 7121  N N3     . DT  B 1 14 ? -14.316 2.678   8.879   1.00 5.76  ? 14 DT  D N3     3  
ATOM 7122  C C4     . DT  B 1 14 ? -14.350 1.549   8.092   1.00 5.43  ? 14 DT  D C4     3  
ATOM 7123  O O4     . DT  B 1 14 ? -14.644 1.643   6.901   1.00 5.16  ? 14 DT  D O4     3  
ATOM 7124  C C5     . DT  B 1 14 ? -14.080 0.304   8.782   1.00 5.46  ? 14 DT  D C5     3  
ATOM 7125  C C7     . DT  B 1 14 ? -14.141 -0.977  8.011   1.00 5.15  ? 14 DT  D C7     3  
ATOM 7126  C C6     . DT  B 1 14 ? -13.838 0.349   10.103  1.00 5.79  ? 14 DT  D C6     3  
ATOM 7127  H "H5'"  . DT  B 1 14 ? -10.593 -0.306  12.339  1.00 6.11  ? 14 DT  D "H5'"  3  
ATOM 7128  H "H5''" . DT  B 1 14 ? -10.803 -1.171  13.874  1.00 6.47  ? 14 DT  D "H5''" 3  
ATOM 7129  H "H4'"  . DT  B 1 14 ? -11.390 0.966   14.473  1.00 6.85  ? 14 DT  D "H4'"  3  
ATOM 7130  H "H3'"  . DT  B 1 14 ? -13.382 -0.779  14.669  1.00 6.90  ? 14 DT  D "H3'"  3  
ATOM 7131  H "H2'"  . DT  B 1 14 ? -14.309 -0.558  12.466  1.00 6.38  ? 14 DT  D "H2'"  3  
ATOM 7132  H "H2''" . DT  B 1 14 ? -15.322 0.556   13.365  1.00 6.78  ? 14 DT  D "H2''" 3  
ATOM 7133  H "H1'"  . DT  B 1 14 ? -14.070 2.468   12.683  1.00 6.70  ? 14 DT  D "H1'"  3  
ATOM 7134  H H3     . DT  B 1 14 ? -14.505 3.561   8.418   1.00 5.78  ? 14 DT  D H3     3  
ATOM 7135  H H71    . DT  B 1 14 ? -13.253 -1.069  7.388   1.00 4.98  ? 14 DT  D H71    3  
ATOM 7136  H H72    . DT  B 1 14 ? -15.029 -0.978  7.379   1.00 5.03  ? 14 DT  D H72    3  
ATOM 7137  H H73    . DT  B 1 14 ? -14.188 -1.817  8.703   1.00 5.27  ? 14 DT  D H73    3  
ATOM 7138  H H6     . DT  B 1 14 ? -13.613 -0.584  10.622  1.00 5.83  ? 14 DT  D H6     3  
ATOM 7139  P P      . DA  B 1 15 ? -15.132 1.086   15.995  1.00 7.52  ? 15 DA  D P      3  
ATOM 7140  O OP1    . DA  B 1 15 ? -14.903 1.153   17.459  1.00 7.92  ? 15 DA  D OP1    3  
ATOM 7141  O OP2    . DA  B 1 15 ? -15.926 -0.035  15.426  1.00 7.34  ? 15 DA  D OP2    3  
ATOM 7142  O "O5'"  . DA  B 1 15 ? -15.775 2.461   15.526  1.00 7.56  ? 15 DA  D "O5'"  3  
ATOM 7143  C "C5'"  . DA  B 1 15 ? -15.002 3.654   15.615  1.00 7.67  ? 15 DA  D "C5'"  3  
ATOM 7144  C "C4'"  . DA  B 1 15 ? -15.848 4.868   15.319  1.00 7.79  ? 15 DA  D "C4'"  3  
ATOM 7145  O "O4'"  . DA  B 1 15 ? -15.995 5.001   13.882  1.00 7.44  ? 15 DA  D "O4'"  3  
ATOM 7146  C "C3'"  . DA  B 1 15 ? -17.271 4.741   15.851  1.00 7.99  ? 15 DA  D "C3'"  3  
ATOM 7147  O "O3'"  . DA  B 1 15 ? -17.807 6.035   16.094  1.00 8.25  ? 15 DA  D "O3'"  3  
ATOM 7148  C "C2'"  . DA  B 1 15 ? -17.995 4.038   14.716  1.00 7.65  ? 15 DA  D "C2'"  3  
ATOM 7149  C "C1'"  . DA  B 1 15 ? -17.314 4.637   13.491  1.00 7.36  ? 15 DA  D "C1'"  3  
ATOM 7150  N N9     . DA  B 1 15 ? -17.246 3.765   12.315  1.00 6.95  ? 15 DA  D N9     3  
ATOM 7151  C C8     . DA  B 1 15 ? -16.906 2.438   12.240  1.00 6.75  ? 15 DA  D C8     3  
ATOM 7152  N N7     . DA  B 1 15 ? -16.992 1.938   11.030  1.00 6.39  ? 15 DA  D N7     3  
ATOM 7153  C C5     . DA  B 1 15 ? -17.411 3.010   10.252  1.00 6.33  ? 15 DA  D C5     3  
ATOM 7154  C C6     . DA  B 1 15 ? -17.696 3.135   8.876   1.00 6.01  ? 15 DA  D C6     3  
ATOM 7155  N N6     . DA  B 1 15 ? -17.614 2.126   8.003   1.00 5.66  ? 15 DA  D N6     3  
ATOM 7156  N N1     . DA  B 1 15 ? -18.083 4.347   8.420   1.00 6.08  ? 15 DA  D N1     3  
ATOM 7157  C C2     . DA  B 1 15 ? -18.181 5.358   9.298   1.00 6.44  ? 15 DA  D C2     3  
ATOM 7158  N N3     . DA  B 1 15 ? -17.947 5.361   10.610  1.00 6.76  ? 15 DA  D N3     3  
ATOM 7159  C C4     . DA  B 1 15 ? -17.561 4.144   11.030  1.00 6.68  ? 15 DA  D C4     3  
ATOM 7160  H "H5'"  . DA  B 1 15 ? -14.182 3.610   14.897  1.00 7.43  ? 15 DA  D "H5'"  3  
ATOM 7161  H "H5''" . DA  B 1 15 ? -14.589 3.746   16.618  1.00 7.93  ? 15 DA  D "H5''" 3  
ATOM 7162  H "H4'"  . DA  B 1 15 ? -15.392 5.733   15.801  1.00 8.00  ? 15 DA  D "H4'"  3  
ATOM 7163  H "H3'"  . DA  B 1 15 ? -17.296 4.160   16.773  1.00 8.18  ? 15 DA  D "H3'"  3  
ATOM 7164  H "H2'"  . DA  B 1 15 ? -17.866 2.957   14.774  1.00 7.54  ? 15 DA  D "H2'"  3  
ATOM 7165  H "H2''" . DA  B 1 15 ? -19.063 4.242   14.739  1.00 7.74  ? 15 DA  D "H2''" 3  
ATOM 7166  H "H1'"  . DA  B 1 15 ? -17.824 5.556   13.197  1.00 7.43  ? 15 DA  D "H1'"  3  
ATOM 7167  H H8     . DA  B 1 15 ? -16.601 1.860   13.099  1.00 6.91  ? 15 DA  D H8     3  
ATOM 7168  H H61    . DA  B 1 15 ? -17.839 2.277   7.030   1.00 5.45  ? 15 DA  D H61    3  
ATOM 7169  H H62    . DA  B 1 15 ? -17.332 1.212   8.324   1.00 5.63  ? 15 DA  D H62    3  
ATOM 7170  H H2     . DA  B 1 15 ? -18.495 6.313   8.876   1.00 6.50  ? 15 DA  D H2     3  
ATOM 7171  P P      . DT  B 1 16 ? -19.328 6.190   16.572  1.00 8.48  ? 16 DT  D P      3  
ATOM 7172  O OP1    . DT  B 1 16 ? -19.342 7.125   17.726  1.00 8.91  ? 16 DT  D OP1    3  
ATOM 7173  O OP2    . DT  B 1 16 ? -19.957 4.851   16.702  1.00 8.39  ? 16 DT  D OP2    3  
ATOM 7174  O "O5'"  . DT  B 1 16 ? -19.961 6.933   15.318  1.00 8.28  ? 16 DT  D "O5'"  3  
ATOM 7175  C "C5'"  . DT  B 1 16 ? -19.251 8.016   14.724  1.00 8.25  ? 16 DT  D "C5'"  3  
ATOM 7176  C "C4'"  . DT  B 1 16 ? -20.135 8.777   13.766  1.00 8.16  ? 16 DT  D "C4'"  3  
ATOM 7177  O "O4'"  . DT  B 1 16 ? -20.194 8.057   12.509  1.00 7.74  ? 16 DT  D "O4'"  3  
ATOM 7178  C "C3'"  . DT  B 1 16 ? -21.579 8.865   14.243  1.00 8.35  ? 16 DT  D "C3'"  3  
ATOM 7179  O "O3'"  . DT  B 1 16 ? -22.200 10.022  13.694  1.00 8.42  ? 16 DT  D "O3'"  3  
ATOM 7180  C "C2'"  . DT  B 1 16 ? -22.191 7.586   13.700  1.00 8.06  ? 16 DT  D "C2'"  3  
ATOM 7181  C "C1'"  . DT  B 1 16 ? -21.465 7.434   12.366  1.00 7.67  ? 16 DT  D "C1'"  3  
ATOM 7182  N N1     . DT  B 1 16 ? -21.274 6.047   11.881  1.00 7.34  ? 16 DT  D N1     3  
ATOM 7183  C C2     . DT  B 1 16 ? -21.456 5.825   10.528  1.00 6.98  ? 16 DT  D C2     3  
ATOM 7184  O O2     . DT  B 1 16 ? -21.705 6.716   9.733   1.00 6.92  ? 16 DT  D O2     3  
ATOM 7185  N N3     . DT  B 1 16 ? -21.334 4.519   10.137  1.00 6.70  ? 16 DT  D N3     3  
ATOM 7186  C C4     . DT  B 1 16 ? -21.047 3.434   10.936  1.00 6.77  ? 16 DT  D C4     3  
ATOM 7187  O O4     . DT  B 1 16 ? -21.019 2.307   10.445  1.00 6.52  ? 16 DT  D O4     3  
ATOM 7188  C C5     . DT  B 1 16 ? -20.841 3.737   12.340  1.00 7.16  ? 16 DT  D C5     3  
ATOM 7189  C C7     . DT  B 1 16 ? -20.555 2.613   13.286  1.00 7.28  ? 16 DT  D C7     3  
ATOM 7190  C C6     . DT  B 1 16 ? -20.956 5.014   12.741  1.00 7.42  ? 16 DT  D C6     3  
ATOM 7191  H "H5'"  . DT  B 1 16 ? -18.387 7.632   14.181  1.00 8.01  ? 16 DT  D "H5'"  3  
ATOM 7192  H "H5''" . DT  B 1 16 ? -18.905 8.697   15.502  1.00 8.53  ? 16 DT  D "H5''" 3  
ATOM 7193  H "H4'"  . DT  B 1 16 ? -19.754 9.796   13.678  1.00 8.28  ? 16 DT  D "H4'"  3  
ATOM 7194  H "H3'"  . DT  B 1 16 ? -21.631 8.910   15.332  1.00 8.64  ? 16 DT  D "H3'"  3  
ATOM 7195  H "H2'"  . DT  B 1 16 ? -22.010 6.744   14.367  1.00 8.11  ? 16 DT  D "H2'"  3  
ATOM 7196  H "H2''" . DT  B 1 16 ? -23.270 7.681   13.578  1.00 8.10  ? 16 DT  D "H2''" 3  
ATOM 7197  H "H1'"  . DT  B 1 16 ? -22.001 7.986   11.589  1.00 7.58  ? 16 DT  D "H1'"  3  
ATOM 7198  H H3     . DT  B 1 16 ? -21.485 4.331   9.155   1.00 6.44  ? 16 DT  D H3     3  
ATOM 7199  H H71    . DT  B 1 16 ? -19.509 2.321   13.197  1.00 7.19  ? 16 DT  D H71    3  
ATOM 7200  H H72    . DT  B 1 16 ? -21.191 1.762   13.042  1.00 7.26  ? 16 DT  D H72    3  
ATOM 7201  H H73    . DT  B 1 16 ? -20.756 2.936   14.307  1.00 7.56  ? 16 DT  D H73    3  
ATOM 7202  H H6     . DT  B 1 16 ? -20.784 5.247   13.792  1.00 7.71  ? 16 DT  D H6     3  
ATOM 7203  P P      . DC  B 1 17 ? -23.742 10.325  14.008  1.00 8.61  ? 17 DC  D P      3  
ATOM 7204  O OP1    . DC  B 1 17 ? -23.846 11.746  14.426  1.00 8.94  ? 17 DC  D OP1    3  
ATOM 7205  O OP2    . DC  B 1 17 ? -24.288 9.258   14.886  1.00 8.70  ? 17 DC  D OP2    3  
ATOM 7206  O "O5'"  . DC  B 1 17 ? -24.395 10.178  12.566  1.00 8.25  ? 17 DC  D "O5'"  3  
ATOM 7207  C "C5'"  . DC  B 1 17 ? -23.791 10.833  11.453  1.00 8.07  ? 17 DC  D "C5'"  3  
ATOM 7208  C "C4'"  . DC  B 1 17 ? -24.690 10.775  10.243  1.00 7.81  ? 17 DC  D "C4'"  3  
ATOM 7209  O "O4'"  . DC  B 1 17 ? -24.587 9.458   9.647   1.00 7.44  ? 17 DC  D "O4'"  3  
ATOM 7210  C "C3'"  . DC  B 1 17 ? -26.168 10.944  10.579  1.00 7.97  ? 17 DC  D "C3'"  3  
ATOM 7211  O "O3'"  . DC  B 1 17 ? -26.864 11.471  9.449   1.00 7.82  ? 17 DC  D "O3'"  3  
ATOM 7212  C "C2'"  . DC  B 1 17 ? -26.604 9.524   10.895  1.00 7.83  ? 17 DC  D "C2'"  3  
ATOM 7213  C "C1'"  . DC  B 1 17 ? -25.769 8.710   9.911   1.00 7.43  ? 17 DC  D "C1'"  3  
ATOM 7214  N N1     . DC  B 1 17 ? -25.386 7.357   10.359  1.00 7.33  ? 17 DC  D N1     3  
ATOM 7215  C C2     . DC  B 1 17 ? -25.431 6.310   9.425   1.00 6.96  ? 17 DC  D C2     3  
ATOM 7216  O O2     . DC  B 1 17 ? -25.738 6.565   8.250   1.00 6.72  ? 17 DC  D O2     3  
ATOM 7217  N N3     . DC  B 1 17 ? -25.137 5.053   9.823   1.00 6.88  ? 17 DC  D N3     3  
ATOM 7218  C C4     . DC  B 1 17 ? -24.806 4.816   11.092  1.00 7.16  ? 17 DC  D C4     3  
ATOM 7219  N N4     . DC  B 1 17 ? -24.554 3.550   11.442  1.00 7.10  ? 17 DC  D N4     3  
ATOM 7220  C C5     . DC  B 1 17 ? -24.725 5.862   12.060  1.00 7.53  ? 17 DC  D C5     3  
ATOM 7221  C C6     . DC  B 1 17 ? -25.018 7.108   11.652  1.00 7.60  ? 17 DC  D C6     3  
ATOM 7222  H "H5'"  . DC  B 1 17 ? -22.843 10.347  11.216  1.00 7.89  ? 17 DC  D "H5'"  3  
ATOM 7223  H "H5''" . DC  B 1 17 ? -23.600 11.877  11.703  1.00 8.30  ? 17 DC  D "H5''" 3  
ATOM 7224  H "H4'"  . DC  B 1 17 ? -24.413 11.587  9.569   1.00 7.79  ? 17 DC  D "H4'"  3  
ATOM 7225  H "H3'"  . DC  B 1 17 ? -26.303 11.612  11.430  1.00 8.28  ? 17 DC  D "H3'"  3  
ATOM 7226  H "H2'"  . DC  B 1 17 ? -26.389 9.267   11.932  1.00 8.04  ? 17 DC  D "H2'"  3  
ATOM 7227  H "H2''" . DC  B 1 17 ? -27.674 9.393   10.740  1.00 7.82  ? 17 DC  D "H2''" 3  
ATOM 7228  H "H1'"  . DC  B 1 17 ? -26.302 8.611   8.965   1.00 7.21  ? 17 DC  D "H1'"  3  
ATOM 7229  H H41    . DC  B 1 17 ? -24.628 2.811   10.756  1.00 6.86  ? 17 DC  D H41    3  
ATOM 7230  H H42    . DC  B 1 17 ? -24.305 3.326   12.394  1.00 7.32  ? 17 DC  D H42    3  
ATOM 7231  H H5     . DC  B 1 17 ? -24.440 5.658   13.093  1.00 7.75  ? 17 DC  D H5     3  
ATOM 7232  H H6     . DC  B 1 17 ? -24.956 7.932   12.363  1.00 7.88  ? 17 DC  D H6     3  
ATOM 7233  P P      . DG  B 1 18 ? -28.444 11.750  9.541   1.00 7.95  ? 18 DG  D P      3  
ATOM 7234  O OP1    . DG  B 1 18 ? -28.688 13.124  9.033   1.00 8.08  ? 18 DG  D OP1    3  
ATOM 7235  O OP2    . DG  B 1 18 ? -28.933 11.371  10.891  1.00 8.23  ? 18 DG  D OP2    3  
ATOM 7236  O "O5'"  . DG  B 1 18 ? -29.040 10.722  8.482   1.00 7.55  ? 18 DG  D "O5'"  3  
ATOM 7237  C "C5'"  . DG  B 1 18 ? -28.575 10.733  7.134   1.00 7.23  ? 18 DG  D "C5'"  3  
ATOM 7238  C "C4'"  . DG  B 1 18 ? -29.477 9.900   6.255   1.00 6.93  ? 18 DG  D "C4'"  3  
ATOM 7239  O "O4'"  . DG  B 1 18 ? -29.193 8.502   6.494   1.00 6.75  ? 18 DG  D "O4'"  3  
ATOM 7240  C "C3'"  . DG  B 1 18 ? -30.962 10.064  6.555   1.00 7.08  ? 18 DG  D "C3'"  3  
ATOM 7241  O "O3'"  . DG  B 1 18 ? -31.742 9.760   5.396   1.00 6.80  ? 18 DG  D "O3'"  3  
ATOM 7242  C "C2'"  . DG  B 1 18 ? -31.189 9.042   7.656   1.00 7.19  ? 18 DG  D "C2'"  3  
ATOM 7243  C "C1'"  . DG  B 1 18 ? -30.245 7.913   7.246   1.00 6.89  ? 18 DG  D "C1'"  3  
ATOM 7244  N N9     . DG  B 1 18 ? -29.652 7.155   8.346   1.00 7.02  ? 18 DG  D N9     3  
ATOM 7245  C C8     . DG  B 1 18 ? -29.241 7.625   9.569   1.00 7.37  ? 18 DG  D C8     3  
ATOM 7246  N N7     . DG  B 1 18 ? -28.776 6.687   10.351  1.00 7.43  ? 18 DG  D N7     3  
ATOM 7247  C C5     . DG  B 1 18 ? -28.881 5.527   9.594   1.00 7.10  ? 18 DG  D C5     3  
ATOM 7248  C C6     . DG  B 1 18 ? -28.535 4.182   9.908   1.00 7.02  ? 18 DG  D C6     3  
ATOM 7249  O O6     . DG  B 1 18 ? -28.050 3.731   10.957  1.00 7.23  ? 18 DG  D O6     3  
ATOM 7250  N N1     . DG  B 1 18 ? -28.809 3.322   8.849   1.00 6.68  ? 18 DG  D N1     3  
ATOM 7251  C C2     . DG  B 1 18 ? -29.346 3.704   7.643   1.00 6.43  ? 18 DG  D C2     3  
ATOM 7252  N N2     . DG  B 1 18 ? -29.538 2.732   6.740   1.00 6.12  ? 18 DG  D N2     3  
ATOM 7253  N N3     . DG  B 1 18 ? -29.672 4.949   7.338   1.00 6.50  ? 18 DG  D N3     3  
ATOM 7254  C C4     . DG  B 1 18 ? -29.416 5.799   8.351   1.00 6.84  ? 18 DG  D C4     3  
ATOM 7255  H "H5'"  . DG  B 1 18 ? -27.563 10.325  7.094   1.00 7.12  ? 18 DG  D "H5'"  3  
ATOM 7256  H "H5''" . DG  B 1 18 ? -28.559 11.757  6.761   1.00 7.33  ? 18 DG  D "H5''" 3  
ATOM 7257  H "H4'"  . DG  B 1 18 ? -29.320 10.209  5.221   1.00 6.74  ? 18 DG  D "H4'"  3  
ATOM 7258  H "H3'"  . DG  B 1 18 ? -31.189 11.076  6.888   1.00 7.33  ? 18 DG  D "H3'"  3  
ATOM 7259  H "HO3'" . DG  B 1 18 ? -31.344 8.988   4.989   1.00 6.78  ? 18 DG  D "HO3'" 3  
ATOM 7260  H "H2'"  . DG  B 1 18 ? -30.943 9.451   8.634   1.00 7.48  ? 18 DG  D "H2'"  3  
ATOM 7261  H "H2''" . DG  B 1 18 ? -32.228 8.717   7.687   1.00 7.20  ? 18 DG  D "H2''" 3  
ATOM 7262  H "H1'"  . DG  B 1 18 ? -30.760 7.209   6.587   1.00 6.65  ? 18 DG  D "H1'"  3  
ATOM 7263  H H8     . DG  B 1 18 ? -29.298 8.664   9.856   1.00 7.59  ? 18 DG  D H8     3  
ATOM 7264  H H1     . DG  B 1 18 ? -28.597 2.341   8.977   1.00 6.62  ? 18 DG  D H1     3  
ATOM 7265  H H21    . DG  B 1 18 ? -29.297 1.772   6.949   1.00 6.08  ? 18 DG  D H21    3  
ATOM 7266  H H22    . DG  B 1 18 ? -29.930 2.959   5.837   1.00 5.93  ? 18 DG  D H22    3  
ATOM 7267  N N      . MET C 2 1  ? -4.223  -4.395  -20.633 1.00 6.61  ? 1  MET A N      3  
ATOM 7268  C CA     . MET C 2 1  ? -4.364  -2.925  -20.735 1.00 6.29  ? 1  MET A CA     3  
ATOM 7269  C C      . MET C 2 1  ? -3.860  -2.252  -19.464 1.00 5.80  ? 1  MET A C      3  
ATOM 7270  O O      . MET C 2 1  ? -3.105  -2.856  -18.703 1.00 5.96  ? 1  MET A O      3  
ATOM 7271  C CB     . MET C 2 1  ? -5.828  -2.550  -20.990 1.00 6.58  ? 1  MET A CB     3  
ATOM 7272  C CG     . MET C 2 1  ? -6.036  -1.798  -22.293 1.00 6.98  ? 1  MET A CG     3  
ATOM 7273  S SD     . MET C 2 1  ? -5.075  -0.274  -22.366 1.00 7.35  ? 1  MET A SD     3  
ATOM 7274  C CE     . MET C 2 1  ? -4.867  -0.092  -24.137 1.00 8.11  ? 1  MET A CE     3  
ATOM 7275  H H1     . MET C 2 1  ? -4.455  -4.843  -21.546 1.00 6.85  ? 1  MET A H1     3  
ATOM 7276  H H2     . MET C 2 1  ? -4.868  -4.769  -19.903 1.00 6.72  ? 1  MET A H2     3  
ATOM 7277  H H3     . MET C 2 1  ? -3.247  -4.648  -20.373 1.00 6.83  ? 1  MET A H3     3  
ATOM 7278  H HA     . MET C 2 1  ? -3.763  -2.586  -21.567 1.00 6.54  ? 1  MET A HA     3  
ATOM 7279  H HB2    . MET C 2 1  ? -6.420  -3.454  -21.020 1.00 6.87  ? 1  MET A HB2    3  
ATOM 7280  H HB3    . MET C 2 1  ? -6.176  -1.928  -20.178 1.00 6.62  ? 1  MET A HB3    3  
ATOM 7281  H HG2    . MET C 2 1  ? -5.738  -2.435  -23.113 1.00 7.25  ? 1  MET A HG2    3  
ATOM 7282  H HG3    . MET C 2 1  ? -7.084  -1.554  -22.390 1.00 7.18  ? 1  MET A HG3    3  
ATOM 7283  H HE1    . MET C 2 1  ? -5.838  -0.020  -24.607 1.00 8.46  ? 1  MET A HE1    3  
ATOM 7284  H HE2    . MET C 2 1  ? -4.340  -0.949  -24.528 1.00 8.28  ? 1  MET A HE2    3  
ATOM 7285  H HE3    . MET C 2 1  ? -4.301  0.805   -24.343 1.00 8.36  ? 1  MET A HE3    3  
ATOM 7286  N N      . LYS C 2 2  ? -4.271  -1.001  -19.249 1.00 5.48  ? 2  LYS A N      3  
ATOM 7287  C CA     . LYS C 2 2  ? -3.867  -0.237  -18.071 1.00 5.17  ? 2  LYS A CA     3  
ATOM 7288  C C      . LYS C 2 2  ? -4.224  -0.983  -16.787 1.00 4.60  ? 2  LYS A C      3  
ATOM 7289  O O      . LYS C 2 2  ? -5.373  -1.389  -16.603 1.00 4.73  ? 2  LYS A O      3  
ATOM 7290  C CB     . LYS C 2 2  ? -4.548  1.144   -18.083 1.00 5.62  ? 2  LYS A CB     3  
ATOM 7291  C CG     . LYS C 2 2  ? -4.147  2.059   -16.927 1.00 5.98  ? 2  LYS A CG     3  
ATOM 7292  C CD     . LYS C 2 2  ? -5.156  2.012   -15.783 1.00 6.39  ? 2  LYS A CD     3  
ATOM 7293  C CE     . LYS C 2 2  ? -4.770  2.956   -14.652 1.00 6.72  ? 2  LYS A CE     3  
ATOM 7294  N NZ     . LYS C 2 2  ? -5.433  2.596   -13.367 1.00 7.29  ? 2  LYS A NZ     3  
ATOM 7295  H H      . LYS C 2 2  ? -4.864  -0.579  -19.907 1.00 5.65  ? 2  LYS A H      3  
ATOM 7296  H HA     . LYS C 2 2  ? -2.797  -0.102  -18.111 1.00 5.28  ? 2  LYS A HA     3  
ATOM 7297  H HB2    . LYS C 2 2  ? -4.297  1.644   -19.008 1.00 5.96  ? 2  LYS A HB2    3  
ATOM 7298  H HB3    . LYS C 2 2  ? -5.618  1.001   -18.044 1.00 5.72  ? 2  LYS A HB3    3  
ATOM 7299  H HG2    . LYS C 2 2  ? -3.183  1.747   -16.553 1.00 6.17  ? 2  LYS A HG2    3  
ATOM 7300  H HG3    . LYS C 2 2  ? -4.079  3.073   -17.293 1.00 6.16  ? 2  LYS A HG3    3  
ATOM 7301  H HD2    . LYS C 2 2  ? -6.126  2.296   -16.161 1.00 6.78  ? 2  LYS A HD2    3  
ATOM 7302  H HD3    . LYS C 2 2  ? -5.200  1.003   -15.398 1.00 6.45  ? 2  LYS A HD3    3  
ATOM 7303  H HE2    . LYS C 2 2  ? -3.700  2.916   -14.516 1.00 6.67  ? 2  LYS A HE2    3  
ATOM 7304  H HE3    . LYS C 2 2  ? -5.059  3.961   -14.927 1.00 6.92  ? 2  LYS A HE3    3  
ATOM 7305  H HZ1    . LYS C 2 2  ? -5.117  3.233   -12.610 1.00 7.55  ? 2  LYS A HZ1    3  
ATOM 7306  H HZ2    . LYS C 2 2  ? -5.193  1.618   -13.103 1.00 7.51  ? 2  LYS A HZ2    3  
ATOM 7307  H HZ3    . LYS C 2 2  ? -6.476  2.674   -13.460 1.00 7.50  ? 2  LYS A HZ3    3  
ATOM 7308  N N      . PRO C 2 3  ? -3.237  -1.196  -15.900 1.00 4.22  ? 3  PRO A N      3  
ATOM 7309  C CA     . PRO C 2 3  ? -3.454  -1.875  -14.621 1.00 3.97  ? 3  PRO A CA     3  
ATOM 7310  C C      . PRO C 2 3  ? -4.514  -1.164  -13.788 1.00 3.83  ? 3  PRO A C      3  
ATOM 7311  O O      . PRO C 2 3  ? -4.317  -0.032  -13.336 1.00 4.13  ? 3  PRO A O      3  
ATOM 7312  C CB     . PRO C 2 3  ? -2.087  -1.808  -13.935 1.00 4.05  ? 3  PRO A CB     3  
ATOM 7313  C CG     . PRO C 2 3  ? -1.119  -1.658  -15.054 1.00 4.26  ? 3  PRO A CG     3  
ATOM 7314  C CD     . PRO C 2 3  ? -1.823  -0.821  -16.085 1.00 4.37  ? 3  PRO A CD     3  
ATOM 7315  H HA     . PRO C 2 3  ? -3.743  -2.907  -14.764 1.00 4.12  ? 3  PRO A HA     3  
ATOM 7316  H HB2    . PRO C 2 3  ? -2.056  -0.960  -13.267 1.00 4.23  ? 3  PRO A HB2    3  
ATOM 7317  H HB3    . PRO C 2 3  ? -1.912  -2.718  -13.382 1.00 4.13  ? 3  PRO A HB3    3  
ATOM 7318  H HG2    . PRO C 2 3  ? -0.226  -1.156  -14.707 1.00 4.56  ? 3  PRO A HG2    3  
ATOM 7319  H HG3    . PRO C 2 3  ? -0.875  -2.628  -15.461 1.00 4.30  ? 3  PRO A HG3    3  
ATOM 7320  H HD2    . PRO C 2 3  ? -1.671  0.230   -15.889 1.00 4.55  ? 3  PRO A HD2    3  
ATOM 7321  H HD3    . PRO C 2 3  ? -1.482  -1.076  -17.078 1.00 4.58  ? 3  PRO A HD3    3  
ATOM 7322  N N      . VAL C 2 4  ? -5.645  -1.820  -13.624 1.00 3.45  ? 4  VAL A N      3  
ATOM 7323  C CA     . VAL C 2 4  ? -6.751  -1.268  -12.864 1.00 3.31  ? 4  VAL A CA     3  
ATOM 7324  C C      . VAL C 2 4  ? -6.469  -1.297  -11.381 1.00 3.06  ? 4  VAL A C      3  
ATOM 7325  O O      . VAL C 2 4  ? -5.844  -2.214  -10.853 1.00 2.85  ? 4  VAL A O      3  
ATOM 7326  C CB     . VAL C 2 4  ? -8.050  -2.049  -13.118 1.00 3.15  ? 4  VAL A CB     3  
ATOM 7327  C CG1    . VAL C 2 4  ? -9.223  -1.454  -12.353 1.00 3.02  ? 4  VAL A CG1    3  
ATOM 7328  C CG2    . VAL C 2 4  ? -8.353  -2.083  -14.594 1.00 3.43  ? 4  VAL A CG2    3  
ATOM 7329  H H      . VAL C 2 4  ? -5.740  -2.707  -14.022 1.00 3.34  ? 4  VAL A H      3  
ATOM 7330  H HA     . VAL C 2 4  ? -6.914  -0.241  -13.177 1.00 3.54  ? 4  VAL A HA     3  
ATOM 7331  H HB     . VAL C 2 4  ? -7.904  -3.053  -12.773 1.00 2.96  ? 4  VAL A HB     3  
ATOM 7332  H HG11   . VAL C 2 4  ? -9.607  -0.599  -12.890 1.00 3.17  ? 4  VAL A HG11   3  
ATOM 7333  H HG12   . VAL C 2 4  ? -8.894  -1.141  -11.369 1.00 3.22  ? 4  VAL A HG12   3  
ATOM 7334  H HG13   . VAL C 2 4  ? -10.002 -2.196  -12.253 1.00 3.08  ? 4  VAL A HG13   3  
ATOM 7335  H HG21   . VAL C 2 4  ? -8.424  -1.071  -14.963 1.00 3.42  ? 4  VAL A HG21   3  
ATOM 7336  H HG22   . VAL C 2 4  ? -9.290  -2.595  -14.755 1.00 3.82  ? 4  VAL A HG22   3  
ATOM 7337  H HG23   . VAL C 2 4  ? -7.562  -2.602  -15.112 1.00 3.65  ? 4  VAL A HG23   3  
ATOM 7338  N N      . THR C 2 5  ? -6.945  -0.271  -10.743 1.00 3.14  ? 5  THR A N      3  
ATOM 7339  C CA     . THR C 2 5  ? -6.850  -0.115  -9.317  1.00 3.01  ? 5  THR A CA     3  
ATOM 7340  C C      . THR C 2 5  ? -8.268  -0.169  -8.802  1.00 2.85  ? 5  THR A C      3  
ATOM 7341  O O      . THR C 2 5  ? -9.203  0.028   -9.577  1.00 2.89  ? 5  THR A O      3  
ATOM 7342  C CB     . THR C 2 5  ? -6.171  1.214   -8.935  1.00 3.29  ? 5  THR A CB     3  
ATOM 7343  O OG1    . THR C 2 5  ? -5.828  1.949   -10.117 1.00 3.55  ? 5  THR A OG1    3  
ATOM 7344  C CG2    . THR C 2 5  ? -4.914  0.959   -8.122  1.00 3.52  ? 5  THR A CG2    3  
ATOM 7345  H H      . THR C 2 5  ? -7.414  0.408   -11.261 1.00 3.33  ? 5  THR A H      3  
ATOM 7346  H HA     . THR C 2 5  ? -6.292  -0.942  -8.898  1.00 2.86  ? 5  THR A HA     3  
ATOM 7347  H HB     . THR C 2 5  ? -6.857  1.799   -8.338  1.00 3.25  ? 5  THR A HB     3  
ATOM 7348  H HG1    . THR C 2 5  ? -6.635  2.358   -10.485 1.00 3.59  ? 5  THR A HG1    3  
ATOM 7349  H HG21   . THR C 2 5  ? -5.173  0.443   -7.211  1.00 3.69  ? 5  THR A HG21   3  
ATOM 7350  H HG22   . THR C 2 5  ? -4.444  1.901   -7.883  1.00 3.76  ? 5  THR A HG22   3  
ATOM 7351  H HG23   . THR C 2 5  ? -4.234  0.352   -8.701  1.00 3.70  ? 5  THR A HG23   3  
ATOM 7352  N N      . LEU C 2 6  ? -8.461  -0.450  -7.536  1.00 2.72  ? 6  LEU A N      3  
ATOM 7353  C CA     . LEU C 2 6  ? -9.815  -0.539  -7.018  1.00 2.62  ? 6  LEU A CA     3  
ATOM 7354  C C      . LEU C 2 6  ? -10.599 0.761   -7.230  1.00 2.85  ? 6  LEU A C      3  
ATOM 7355  O O      . LEU C 2 6  ? -11.826 0.753   -7.299  1.00 2.79  ? 6  LEU A O      3  
ATOM 7356  C CB     . LEU C 2 6  ? -9.793  -0.944  -5.559  1.00 2.55  ? 6  LEU A CB     3  
ATOM 7357  C CG     . LEU C 2 6  ? -10.286 -2.353  -5.296  1.00 2.31  ? 6  LEU A CG     3  
ATOM 7358  C CD1    . LEU C 2 6  ? -10.440 -2.591  -3.805  1.00 2.37  ? 6  LEU A CD1    3  
ATOM 7359  C CD2    . LEU C 2 6  ? -11.598 -2.596  -6.027  1.00 2.25  ? 6  LEU A CD2    3  
ATOM 7360  H H      . LEU C 2 6  ? -7.689  -0.622  -6.944  1.00 2.71  ? 6  LEU A H      3  
ATOM 7361  H HA     . LEU C 2 6  ? -10.308 -1.316  -7.573  1.00 2.47  ? 6  LEU A HA     3  
ATOM 7362  H HB2    . LEU C 2 6  ? -8.773  -0.865  -5.207  1.00 2.61  ? 6  LEU A HB2    3  
ATOM 7363  H HB3    . LEU C 2 6  ? -10.415 -0.262  -5.003  1.00 2.69  ? 6  LEU A HB3    3  
ATOM 7364  H HG     . LEU C 2 6  ? -9.556  -3.048  -5.677  1.00 2.21  ? 6  LEU A HG     3  
ATOM 7365  H HD11   . LEU C 2 6  ? -11.084 -1.832  -3.384  1.00 2.76  ? 6  LEU A HD11   3  
ATOM 7366  H HD12   . LEU C 2 6  ? -9.470  -2.545  -3.331  1.00 2.47  ? 6  LEU A HD12   3  
ATOM 7367  H HD13   . LEU C 2 6  ? -10.876 -3.567  -3.638  1.00 2.50  ? 6  LEU A HD13   3  
ATOM 7368  H HD21   . LEU C 2 6  ? -12.402 -2.663  -5.311  1.00 2.34  ? 6  LEU A HD21   3  
ATOM 7369  H HD22   . LEU C 2 6  ? -11.534 -3.517  -6.587  1.00 2.39  ? 6  LEU A HD22   3  
ATOM 7370  H HD23   . LEU C 2 6  ? -11.791 -1.773  -6.707  1.00 2.51  ? 6  LEU A HD23   3  
ATOM 7371  N N      . TYR C 2 7  ? -9.871  1.864   -7.353  1.00 3.13  ? 7  TYR A N      3  
ATOM 7372  C CA     . TYR C 2 7  ? -10.475 3.183   -7.591  1.00 3.41  ? 7  TYR A CA     3  
ATOM 7373  C C      . TYR C 2 7  ? -11.169 3.216   -8.952  1.00 3.42  ? 7  TYR A C      3  
ATOM 7374  O O      . TYR C 2 7  ? -12.230 3.815   -9.126  1.00 3.50  ? 7  TYR A O      3  
ATOM 7375  C CB     . TYR C 2 7  ? -9.401  4.277   -7.574  1.00 3.74  ? 7  TYR A CB     3  
ATOM 7376  C CG     . TYR C 2 7  ? -9.050  4.819   -6.209  1.00 3.86  ? 7  TYR A CG     3  
ATOM 7377  C CD1    . TYR C 2 7  ? -9.998  5.455   -5.413  1.00 3.98  ? 7  TYR A CD1    3  
ATOM 7378  C CD2    . TYR C 2 7  ? -7.752  4.717   -5.729  1.00 3.89  ? 7  TYR A CD2    3  
ATOM 7379  C CE1    . TYR C 2 7  ? -9.656  5.968   -4.178  1.00 4.16  ? 7  TYR A CE1    3  
ATOM 7380  C CE2    . TYR C 2 7  ? -7.405  5.232   -4.498  1.00 4.04  ? 7  TYR A CE2    3  
ATOM 7381  C CZ     . TYR C 2 7  ? -8.360  5.857   -3.726  1.00 4.20  ? 7  TYR A CZ     3  
ATOM 7382  O OH     . TYR C 2 7  ? -8.017  6.375   -2.502  1.00 4.39  ? 7  TYR A OH     3  
ATOM 7383  H H      . TYR C 2 7  ? -8.899  1.782   -7.312  1.00 3.16  ? 7  TYR A H      3  
ATOM 7384  H HA     . TYR C 2 7  ? -11.198 3.376   -6.812  1.00 3.41  ? 7  TYR A HA     3  
ATOM 7385  H HB2    . TYR C 2 7  ? -8.495  3.881   -8.003  1.00 3.72  ? 7  TYR A HB2    3  
ATOM 7386  H HB3    . TYR C 2 7  ? -9.742  5.105   -8.180  1.00 3.94  ? 7  TYR A HB3    3  
ATOM 7387  H HD1    . TYR C 2 7  ? -11.018 5.535   -5.764  1.00 3.96  ? 7  TYR A HD1    3  
ATOM 7388  H HD2    . TYR C 2 7  ? -7.006  4.226   -6.335  1.00 3.82  ? 7  TYR A HD2    3  
ATOM 7389  H HE1    . TYR C 2 7  ? -10.404 6.458   -3.572  1.00 4.30  ? 7  TYR A HE1    3  
ATOM 7390  H HE2    . TYR C 2 7  ? -6.390  5.142   -4.145  1.00 4.07  ? 7  TYR A HE2    3  
ATOM 7391  H HH     . TYR C 2 7  ? -7.222  6.910   -2.593  1.00 4.61  ? 7  TYR A HH     3  
ATOM 7392  N N      . ASP C 2 8  ? -10.540 2.535   -9.893  1.00 3.37  ? 8  ASP A N      3  
ATOM 7393  C CA     . ASP C 2 8  ? -10.982 2.450   -11.279 1.00 3.45  ? 8  ASP A CA     3  
ATOM 7394  C C      . ASP C 2 8  ? -12.299 1.717   -11.358 1.00 3.21  ? 8  ASP A C      3  
ATOM 7395  O O      . ASP C 2 8  ? -13.235 2.159   -12.021 1.00 3.31  ? 8  ASP A O      3  
ATOM 7396  C CB     . ASP C 2 8  ? -9.919  1.715   -12.113 1.00 3.49  ? 8  ASP A CB     3  
ATOM 7397  C CG     . ASP C 2 8  ? -8.587  2.438   -12.176 1.00 3.79  ? 8  ASP A CG     3  
ATOM 7398  O OD1    . ASP C 2 8  ? -8.017  2.728   -11.107 1.00 3.72  ? 8  ASP A OD1    3  
ATOM 7399  O OD2    . ASP C 2 8  ? -8.082  2.678   -13.292 1.00 4.13  ? 8  ASP A OD2    3  
ATOM 7400  H H      . ASP C 2 8  ? -9.760  2.024   -9.636  1.00 3.28  ? 8  ASP A H      3  
ATOM 7401  H HA     . ASP C 2 8  ? -11.110 3.442   -11.665 1.00 3.70  ? 8  ASP A HA     3  
ATOM 7402  H HB2    . ASP C 2 8  ? -9.747  0.750   -11.665 1.00 3.28  ? 8  ASP A HB2    3  
ATOM 7403  H HB3    . ASP C 2 8  ? -10.274 1.571   -13.121 1.00 3.52  ? 8  ASP A HB3    3  
ATOM 7404  N N      . VAL C 2 9  ? -12.369 0.600   -10.651 1.00 2.91  ? 9  VAL A N      3  
ATOM 7405  C CA     . VAL C 2 9  ? -13.559 -0.211  -10.638 1.00 2.70  ? 9  VAL A CA     3  
ATOM 7406  C C      . VAL C 2 9  ? -14.666 0.535   -9.935  1.00 2.72  ? 9  VAL A C      3  
ATOM 7407  O O      . VAL C 2 9  ? -15.809 0.532   -10.361 1.00 2.70  ? 9  VAL A O      3  
ATOM 7408  C CB     . VAL C 2 9  ? -13.302 -1.544  -9.924  1.00 2.43  ? 9  VAL A CB     3  
ATOM 7409  C CG1    . VAL C 2 9  ? -14.564 -2.363  -9.853  1.00 2.28  ? 9  VAL A CG1    3  
ATOM 7410  C CG2    . VAL C 2 9  ? -12.205 -2.322  -10.622 1.00 2.45  ? 9  VAL A CG2    3  
ATOM 7411  H H      . VAL C 2 9  ? -11.624 0.352   -10.061 1.00 2.85  ? 9  VAL A H      3  
ATOM 7412  H HA     . VAL C 2 9  ? -13.855 -0.410  -11.662 1.00 2.77  ? 9  VAL A HA     3  
ATOM 7413  H HB     . VAL C 2 9  ? -12.978 -1.326  -8.916  1.00 2.40  ? 9  VAL A HB     3  
ATOM 7414  H HG11   . VAL C 2 9  ? -15.035 -2.367  -10.829 1.00 2.36  ? 9  VAL A HG11   3  
ATOM 7415  H HG12   . VAL C 2 9  ? -15.234 -1.929  -9.128  1.00 2.36  ? 9  VAL A HG12   3  
ATOM 7416  H HG13   . VAL C 2 9  ? -14.319 -3.373  -9.567  1.00 2.64  ? 9  VAL A HG13   3  
ATOM 7417  H HG21   . VAL C 2 9  ? -11.251 -2.051  -10.201 1.00 2.71  ? 9  VAL A HG21   3  
ATOM 7418  H HG22   . VAL C 2 9  ? -12.213 -2.087  -11.678 1.00 2.80  ? 9  VAL A HG22   3  
ATOM 7419  H HG23   . VAL C 2 9  ? -12.376 -3.384  -10.487 1.00 2.48  ? 9  VAL A HG23   3  
ATOM 7420  N N      . ALA C 2 10 ? -14.286 1.188   -8.859  1.00 2.80  ? 10 ALA A N      3  
ATOM 7421  C CA     . ALA C 2 10 ? -15.216 1.956   -8.048  1.00 2.91  ? 10 ALA A CA     3  
ATOM 7422  C C      . ALA C 2 10 ? -15.901 3.045   -8.861  1.00 3.14  ? 10 ALA A C      3  
ATOM 7423  O O      . ALA C 2 10 ? -17.125 3.181   -8.832  1.00 3.12  ? 10 ALA A O      3  
ATOM 7424  C CB     . ALA C 2 10 ? -14.460 2.547   -6.878  1.00 3.09  ? 10 ALA A CB     3  
ATOM 7425  H H      . ALA C 2 10 ? -13.328 1.157   -8.601  1.00 2.83  ? 10 ALA A H      3  
ATOM 7426  H HA     . ALA C 2 10 ? -15.972 1.288   -7.664  1.00 2.75  ? 10 ALA A HA     3  
ATOM 7427  H HB1    . ALA C 2 10 ? -13.396 2.452   -7.065  1.00 3.39  ? 10 ALA A HB1    3  
ATOM 7428  H HB2    . ALA C 2 10 ? -14.720 2.014   -5.974  1.00 3.18  ? 10 ALA A HB2    3  
ATOM 7429  H HB3    . ALA C 2 10 ? -14.716 3.591   -6.769  1.00 3.24  ? 10 ALA A HB3    3  
ATOM 7430  N N      . GLU C 2 11 ? -15.112 3.779   -9.623  1.00 3.37  ? 11 GLU A N      3  
ATOM 7431  C CA     . GLU C 2 11 ? -15.643 4.865   -10.438 1.00 3.64  ? 11 GLU A CA     3  
ATOM 7432  C C      . GLU C 2 11 ? -16.517 4.290   -11.538 1.00 3.52  ? 11 GLU A C      3  
ATOM 7433  O O      . GLU C 2 11 ? -17.646 4.731   -11.759 1.00 3.57  ? 11 GLU A O      3  
ATOM 7434  C CB     . GLU C 2 11 ? -14.504 5.699   -11.039 1.00 3.95  ? 11 GLU A CB     3  
ATOM 7435  C CG     . GLU C 2 11 ? -14.621 7.193   -10.771 1.00 4.31  ? 11 GLU A CG     3  
ATOM 7436  C CD     . GLU C 2 11 ? -15.600 7.892   -11.697 1.00 4.89  ? 11 GLU A CD     3  
ATOM 7437  O OE1    . GLU C 2 11 ? -15.271 8.085   -12.884 1.00 5.24  ? 11 GLU A OE1    3  
ATOM 7438  O OE2    . GLU C 2 11 ? -16.717 8.238   -11.247 1.00 5.23  ? 11 GLU A OE2    3  
ATOM 7439  H H      . GLU C 2 11 ? -14.150 3.561   -9.668  1.00 3.37  ? 11 GLU A H      3  
ATOM 7440  H HA     . GLU C 2 11 ? -16.254 5.488   -9.800  1.00 3.74  ? 11 GLU A HA     3  
ATOM 7441  H HB2    . GLU C 2 11 ? -13.568 5.354   -10.626 1.00 3.90  ? 11 GLU A HB2    3  
ATOM 7442  H HB3    . GLU C 2 11 ? -14.492 5.546   -12.108 1.00 4.15  ? 11 GLU A HB3    3  
ATOM 7443  H HG2    . GLU C 2 11 ? -14.951 7.338   -9.754  1.00 4.29  ? 11 GLU A HG2    3  
ATOM 7444  H HG3    . GLU C 2 11 ? -13.647 7.643   -10.898 1.00 4.50  ? 11 GLU A HG3    3  
ATOM 7445  N N      . TYR C 2 12 ? -15.967 3.299   -12.220 1.00 3.40  ? 12 TYR A N      3  
ATOM 7446  C CA     . TYR C 2 12 ? -16.648 2.622   -13.308 1.00 3.35  ? 12 TYR A CA     3  
ATOM 7447  C C      . TYR C 2 12 ? -17.928 1.930   -12.830 1.00 3.08  ? 12 TYR A C      3  
ATOM 7448  O O      . TYR C 2 12 ? -18.872 1.761   -13.601 1.00 3.11  ? 12 TYR A O      3  
ATOM 7449  C CB     . TYR C 2 12 ? -15.694 1.605   -13.922 1.00 3.31  ? 12 TYR A CB     3  
ATOM 7450  C CG     . TYR C 2 12 ? -16.192 0.964   -15.189 1.00 3.39  ? 12 TYR A CG     3  
ATOM 7451  C CD1    . TYR C 2 12 ? -16.320 1.688   -16.366 1.00 3.70  ? 12 TYR A CD1    3  
ATOM 7452  C CD2    . TYR C 2 12 ? -16.513 -0.377  -15.203 1.00 3.19  ? 12 TYR A CD2    3  
ATOM 7453  C CE1    . TYR C 2 12 ? -16.762 1.083   -17.525 1.00 3.82  ? 12 TYR A CE1    3  
ATOM 7454  C CE2    . TYR C 2 12 ? -16.952 -0.997  -16.353 1.00 3.34  ? 12 TYR A CE2    3  
ATOM 7455  C CZ     . TYR C 2 12 ? -17.076 -0.260  -17.519 1.00 3.64  ? 12 TYR A CZ     3  
ATOM 7456  O OH     . TYR C 2 12 ? -17.502 -0.864  -18.679 1.00 3.82  ? 12 TYR A OH     3  
ATOM 7457  H H      . TYR C 2 12 ? -15.058 3.005   -11.978 1.00 3.37  ? 12 TYR A H      3  
ATOM 7458  H HA     . TYR C 2 12 ? -16.904 3.359   -14.053 1.00 3.57  ? 12 TYR A HA     3  
ATOM 7459  H HB2    . TYR C 2 12 ? -14.757 2.089   -14.144 1.00 3.49  ? 12 TYR A HB2    3  
ATOM 7460  H HB3    . TYR C 2 12 ? -15.520 0.815   -13.205 1.00 3.08  ? 12 TYR A HB3    3  
ATOM 7461  H HD1    . TYR C 2 12 ? -16.071 2.739   -16.366 1.00 3.88  ? 12 TYR A HD1    3  
ATOM 7462  H HD2    . TYR C 2 12 ? -16.415 -0.950  -14.278 1.00 2.97  ? 12 TYR A HD2    3  
ATOM 7463  H HE1    . TYR C 2 12 ? -16.857 1.661   -18.433 1.00 4.08  ? 12 TYR A HE1    3  
ATOM 7464  H HE2    . TYR C 2 12 ? -17.197 -2.055  -16.334 1.00 3.25  ? 12 TYR A HE2    3  
ATOM 7465  H HH     . TYR C 2 12 ? -18.173 -1.541  -18.469 1.00 4.13  ? 12 TYR A HH     3  
ATOM 7466  N N      . ALA C 2 13 ? -17.967 1.538   -11.557 1.00 2.87  ? 13 ALA A N      3  
ATOM 7467  C CA     . ALA C 2 13 ? -19.139 0.860   -11.016 1.00 2.66  ? 13 ALA A CA     3  
ATOM 7468  C C      . ALA C 2 13 ? -20.164 1.889   -10.577 1.00 2.78  ? 13 ALA A C      3  
ATOM 7469  O O      . ALA C 2 13 ? -21.368 1.636   -10.565 1.00 2.70  ? 13 ALA A O      3  
ATOM 7470  C CB     . ALA C 2 13 ? -18.748 0.001   -9.836  1.00 2.47  ? 13 ALA A CB     3  
ATOM 7471  H H      . ALA C 2 13 ? -17.199 1.730   -10.958 1.00 2.89  ? 13 ALA A H      3  
ATOM 7472  H HA     . ALA C 2 13 ? -19.554 0.214   -11.787 1.00 2.61  ? 13 ALA A HA     3  
ATOM 7473  H HB1    . ALA C 2 13 ? -18.318 0.629   -9.071  1.00 2.73  ? 13 ALA A HB1    3  
ATOM 7474  H HB2    . ALA C 2 13 ? -18.025 -0.737  -10.153 1.00 2.66  ? 13 ALA A HB2    3  
ATOM 7475  H HB3    . ALA C 2 13 ? -19.625 -0.494  -9.446  1.00 2.52  ? 13 ALA A HB3    3  
ATOM 7476  N N      . GLY C 2 14 ? -19.659 3.059   -10.217 1.00 3.02  ? 14 GLY A N      3  
ATOM 7477  C CA     . GLY C 2 14 ? -20.504 4.148   -9.792  1.00 3.22  ? 14 GLY A CA     3  
ATOM 7478  C C      . GLY C 2 14 ? -20.750 4.092   -8.313  1.00 3.21  ? 14 GLY A C      3  
ATOM 7479  O O      . GLY C 2 14 ? -21.830 4.427   -7.824  1.00 3.28  ? 14 GLY A O      3  
ATOM 7480  H H      . GLY C 2 14 ? -18.687 3.157   -10.171 1.00 3.08  ? 14 GLY A H      3  
ATOM 7481  H HA2    . GLY C 2 14 ? -20.028 5.079   -10.040 1.00 3.45  ? 14 GLY A HA2    3  
ATOM 7482  H HA3    . GLY C 2 14 ? -21.446 4.075   -10.306 1.00 3.18  ? 14 GLY A HA3    3  
ATOM 7483  N N      . VAL C 2 15 ? -19.730 3.644   -7.608  1.00 3.16  ? 15 VAL A N      3  
ATOM 7484  C CA     . VAL C 2 15 ? -19.783 3.482   -6.165  1.00 3.22  ? 15 VAL A CA     3  
ATOM 7485  C C      . VAL C 2 15 ? -18.476 3.926   -5.544  1.00 3.39  ? 15 VAL A C      3  
ATOM 7486  O O      . VAL C 2 15 ? -17.429 3.808   -6.172  1.00 3.33  ? 15 VAL A O      3  
ATOM 7487  C CB     . VAL C 2 15 ? -20.061 2.026   -5.795  1.00 2.96  ? 15 VAL A CB     3  
ATOM 7488  C CG1    . VAL C 2 15 ? -21.513 1.694   -6.025  1.00 2.89  ? 15 VAL A CG1    3  
ATOM 7489  C CG2    . VAL C 2 15 ? -19.191 1.127   -6.627  1.00 2.72  ? 15 VAL A CG2    3  
ATOM 7490  H H      . VAL C 2 15 ? -18.879 3.431   -8.083  1.00 3.12  ? 15 VAL A H      3  
ATOM 7491  H HA     . VAL C 2 15 ? -20.587 4.096   -5.784  1.00 3.38  ? 15 VAL A HA     3  
ATOM 7492  H HB     . VAL C 2 15 ? -19.825 1.873   -4.752  1.00 3.04  ? 15 VAL A HB     3  
ATOM 7493  H HG11   . VAL C 2 15 ? -21.702 0.682   -5.700  1.00 2.96  ? 15 VAL A HG11   3  
ATOM 7494  H HG12   . VAL C 2 15 ? -21.729 1.785   -7.084  1.00 3.04  ? 15 VAL A HG12   3  
ATOM 7495  H HG13   . VAL C 2 15 ? -22.132 2.378   -5.466  1.00 3.14  ? 15 VAL A HG13   3  
ATOM 7496  H HG21   . VAL C 2 15 ? -18.156 1.351   -6.419  1.00 2.95  ? 15 VAL A HG21   3  
ATOM 7497  H HG22   . VAL C 2 15 ? -19.398 1.305   -7.676  1.00 2.86  ? 15 VAL A HG22   3  
ATOM 7498  H HG23   . VAL C 2 15 ? -19.396 0.098   -6.384  1.00 2.74  ? 15 VAL A HG23   3  
ATOM 7499  N N      . SER C 2 16 ? -18.527 4.476   -4.341  1.00 3.63  ? 16 SER A N      3  
ATOM 7500  C CA     . SER C 2 16 ? -17.308 4.928   -3.698  1.00 3.82  ? 16 SER A CA     3  
ATOM 7501  C C      . SER C 2 16 ? -16.302 3.793   -3.596  1.00 3.58  ? 16 SER A C      3  
ATOM 7502  O O      . SER C 2 16 ? -16.664 2.620   -3.487  1.00 3.34  ? 16 SER A O      3  
ATOM 7503  C CB     . SER C 2 16 ? -17.588 5.514   -2.322  1.00 4.13  ? 16 SER A CB     3  
ATOM 7504  O OG     . SER C 2 16 ? -18.590 6.513   -2.397  1.00 4.34  ? 16 SER A OG     3  
ATOM 7505  H H      . SER C 2 16 ? -19.376 4.503   -3.850  1.00 3.69  ? 16 SER A H      3  
ATOM 7506  H HA     . SER C 2 16 ? -16.877 5.698   -4.321  1.00 3.95  ? 16 SER A HA     3  
ATOM 7507  H HB2    . SER C 2 16 ? -17.916 4.731   -1.661  1.00 4.23  ? 16 SER A HB2    3  
ATOM 7508  H HB3    . SER C 2 16 ? -16.685 5.958   -1.933  1.00 4.25  ? 16 SER A HB3    3  
ATOM 7509  H HG     . SER C 2 16 ? -18.749 6.740   -3.316  1.00 4.52  ? 16 SER A HG     3  
ATOM 7510  N N      . TYR C 2 17 ? -15.050 4.169   -3.644  1.00 3.68  ? 17 TYR A N      3  
ATOM 7511  C CA     . TYR C 2 17 ? -13.936 3.238   -3.564  1.00 3.49  ? 17 TYR A CA     3  
ATOM 7512  C C      . TYR C 2 17 ? -14.074 2.282   -2.392  1.00 3.42  ? 17 TYR A C      3  
ATOM 7513  O O      . TYR C 2 17 ? -13.990 1.066   -2.547  1.00 3.16  ? 17 TYR A O      3  
ATOM 7514  C CB     . TYR C 2 17 ? -12.667 4.048   -3.404  1.00 3.71  ? 17 TYR A CB     3  
ATOM 7515  C CG     . TYR C 2 17 ? -11.469 3.200   -3.151  1.00 3.56  ? 17 TYR A CG     3  
ATOM 7516  C CD1    . TYR C 2 17 ? -10.939 2.447   -4.171  1.00 3.31  ? 17 TYR A CD1    3  
ATOM 7517  C CD2    . TYR C 2 17 ? -10.871 3.150   -1.901  1.00 3.69  ? 17 TYR A CD2    3  
ATOM 7518  C CE1    . TYR C 2 17 ? -9.846  1.666   -3.970  1.00 3.18  ? 17 TYR A CE1    3  
ATOM 7519  C CE2    . TYR C 2 17 ? -9.766  2.362   -1.688  1.00 3.55  ? 17 TYR A CE2    3  
ATOM 7520  C CZ     . TYR C 2 17 ? -9.255  1.621   -2.731  1.00 3.28  ? 17 TYR A CZ     3  
ATOM 7521  O OH     . TYR C 2 17 ? -8.154  0.835   -2.538  1.00 3.16  ? 17 TYR A OH     3  
ATOM 7522  H H      . TYR C 2 17 ? -14.858 5.127   -3.746  1.00 3.91  ? 17 TYR A H      3  
ATOM 7523  H HA     . TYR C 2 17 ? -13.872 2.665   -4.482  1.00 3.28  ? 17 TYR A HA     3  
ATOM 7524  H HB2    . TYR C 2 17 ? -12.493 4.612   -4.301  1.00 3.77  ? 17 TYR A HB2    3  
ATOM 7525  H HB3    . TYR C 2 17 ? -12.777 4.727   -2.576  1.00 3.95  ? 17 TYR A HB3    3  
ATOM 7526  H HD1    . TYR C 2 17 ? -11.405 2.475   -5.144  1.00 3.25  ? 17 TYR A HD1    3  
ATOM 7527  H HD2    . TYR C 2 17 ? -11.287 3.732   -1.089  1.00 3.91  ? 17 TYR A HD2    3  
ATOM 7528  H HE1    . TYR C 2 17 ? -9.458  1.085   -4.790  1.00 3.01  ? 17 TYR A HE1    3  
ATOM 7529  H HE2    . TYR C 2 17 ? -9.308  2.330   -0.714  1.00 3.68  ? 17 TYR A HE2    3  
ATOM 7530  H HH     . TYR C 2 17 ? -7.431  1.159   -3.084  1.00 3.43  ? 17 TYR A HH     3  
ATOM 7531  N N      . GLN C 2 18 ? -14.313 2.854   -1.229  1.00 3.70  ? 18 GLN A N      3  
ATOM 7532  C CA     . GLN C 2 18 ? -14.457 2.088   0.004   1.00 3.76  ? 18 GLN A CA     3  
ATOM 7533  C C      . GLN C 2 18 ? -15.646 1.123   -0.058  1.00 3.60  ? 18 GLN A C      3  
ATOM 7534  O O      . GLN C 2 18 ? -15.670 0.118   0.653   1.00 3.59  ? 18 GLN A O      3  
ATOM 7535  C CB     . GLN C 2 18 ? -14.583 3.034   1.200   1.00 4.16  ? 18 GLN A CB     3  
ATOM 7536  C CG     . GLN C 2 18 ? -14.779 4.491   0.811   1.00 4.57  ? 18 GLN A CG     3  
ATOM 7537  C CD     . GLN C 2 18 ? -15.139 5.368   1.985   1.00 5.01  ? 18 GLN A CD     3  
ATOM 7538  O OE1    . GLN C 2 18 ? -14.270 5.846   2.708   1.00 5.50  ? 18 GLN A OE1    3  
ATOM 7539  N NE2    . GLN C 2 18 ? -16.427 5.597   2.173   1.00 5.22  ? 18 GLN A NE2    3  
ATOM 7540  H H      . GLN C 2 18 ? -14.376 3.830   -1.197  1.00 3.91  ? 18 GLN A H      3  
ATOM 7541  H HA     . GLN C 2 18 ? -13.556 1.504   0.124   1.00 3.66  ? 18 GLN A HA     3  
ATOM 7542  H HB2    . GLN C 2 18 ? -15.423 2.726   1.805   1.00 4.34  ? 18 GLN A HB2    3  
ATOM 7543  H HB3    . GLN C 2 18 ? -13.679 2.964   1.788   1.00 4.27  ? 18 GLN A HB3    3  
ATOM 7544  H HG2    . GLN C 2 18 ? -13.861 4.861   0.377   1.00 4.81  ? 18 GLN A HG2    3  
ATOM 7545  H HG3    . GLN C 2 18 ? -15.571 4.553   0.080   1.00 4.76  ? 18 GLN A HG3    3  
ATOM 7546  H HE21   . GLN C 2 18 ? -17.066 5.193   1.553   1.00 5.10  ? 18 GLN A HE21   3  
ATOM 7547  H HE22   . GLN C 2 18 ? -16.686 6.175   2.925   1.00 5.71  ? 18 GLN A HE22   3  
ATOM 7548  N N      . THR C 2 19 ? -16.619 1.423   -0.912  1.00 3.52  ? 19 THR A N      3  
ATOM 7549  C CA     . THR C 2 19 ? -17.785 0.575   -1.073  1.00 3.39  ? 19 THR A CA     3  
ATOM 7550  C C      . THR C 2 19 ? -17.382 -0.754  -1.693  1.00 3.07  ? 19 THR A C      3  
ATOM 7551  O O      . THR C 2 19 ? -17.522 -1.808  -1.073  1.00 3.08  ? 19 THR A O      3  
ATOM 7552  C CB     . THR C 2 19 ? -18.837 1.272   -1.963  1.00 3.36  ? 19 THR A CB     3  
ATOM 7553  O OG1    . THR C 2 19 ? -18.992 2.629   -1.529  1.00 3.65  ? 19 THR A OG1    3  
ATOM 7554  C CG2    . THR C 2 19 ? -20.173 0.559   -1.906  1.00 3.31  ? 19 THR A CG2    3  
ATOM 7555  H H      . THR C 2 19 ? -16.551 2.231   -1.458  1.00 3.56  ? 19 THR A H      3  
ATOM 7556  H HA     . THR C 2 19 ? -18.216 0.397   -0.100  1.00 3.57  ? 19 THR A HA     3  
ATOM 7557  H HB     . THR C 2 19 ? -18.491 1.268   -2.991  1.00 3.20  ? 19 THR A HB     3  
ATOM 7558  H HG1    . THR C 2 19 ? -19.926 2.864   -1.524  1.00 3.86  ? 19 THR A HG1    3  
ATOM 7559  H HG21   . THR C 2 19 ? -20.907 1.142   -2.442  1.00 3.18  ? 19 THR A HG21   3  
ATOM 7560  H HG22   . THR C 2 19 ? -20.477 0.447   -0.878  1.00 3.58  ? 19 THR A HG22   3  
ATOM 7561  H HG23   . THR C 2 19 ? -20.081 -0.417  -2.368  1.00 3.59  ? 19 THR A HG23   3  
ATOM 7562  N N      . VAL C 2 20 ? -16.846 -0.689  -2.904  1.00 2.85  ? 20 VAL A N      3  
ATOM 7563  C CA     . VAL C 2 20 ? -16.418 -1.875  -3.623  1.00 2.58  ? 20 VAL A CA     3  
ATOM 7564  C C      . VAL C 2 20 ? -15.197 -2.509  -2.968  1.00 2.57  ? 20 VAL A C      3  
ATOM 7565  O O      . VAL C 2 20 ? -14.992 -3.717  -3.062  1.00 2.46  ? 20 VAL A O      3  
ATOM 7566  C CB     . VAL C 2 20 ? -16.193 -1.587  -5.129  1.00 2.42  ? 20 VAL A CB     3  
ATOM 7567  C CG1    . VAL C 2 20 ? -16.489 -0.138  -5.454  1.00 2.61  ? 20 VAL A CG1    3  
ATOM 7568  C CG2    . VAL C 2 20 ? -14.801 -1.932  -5.611  1.00 2.31  ? 20 VAL A CG2    3  
ATOM 7569  H H      . VAL C 2 20 ? -16.738 0.188   -3.328  1.00 2.91  ? 20 VAL A H      3  
ATOM 7570  H HA     . VAL C 2 20 ? -17.232 -2.583  -3.546  1.00 2.56  ? 20 VAL A HA     3  
ATOM 7571  H HB     . VAL C 2 20 ? -16.893 -2.202  -5.674  1.00 2.31  ? 20 VAL A HB     3  
ATOM 7572  H HG11   . VAL C 2 20 ? -17.436 0.142   -5.017  1.00 2.67  ? 20 VAL A HG11   3  
ATOM 7573  H HG12   . VAL C 2 20 ? -16.537 -0.017  -6.527  1.00 3.01  ? 20 VAL A HG12   3  
ATOM 7574  H HG13   . VAL C 2 20 ? -15.707 0.490   -5.054  1.00 2.85  ? 20 VAL A HG13   3  
ATOM 7575  H HG21   . VAL C 2 20 ? -14.129 -1.104  -5.401  1.00 2.50  ? 20 VAL A HG21   3  
ATOM 7576  H HG22   . VAL C 2 20 ? -14.837 -2.111  -6.680  1.00 2.55  ? 20 VAL A HG22   3  
ATOM 7577  H HG23   . VAL C 2 20 ? -14.453 -2.819  -5.108  1.00 2.42  ? 20 VAL A HG23   3  
ATOM 7578  N N      . SER C 2 21 ? -14.383 -1.691  -2.318  1.00 2.73  ? 21 SER A N      3  
ATOM 7579  C CA     . SER C 2 21 ? -13.211 -2.193  -1.612  1.00 2.74  ? 21 SER A CA     3  
ATOM 7580  C C      . SER C 2 21 ? -13.651 -3.203  -0.555  1.00 2.85  ? 21 SER A C      3  
ATOM 7581  O O      . SER C 2 21 ? -13.041 -4.264  -0.393  1.00 2.78  ? 21 SER A O      3  
ATOM 7582  C CB     . SER C 2 21 ? -12.439 -1.036  -0.964  1.00 2.97  ? 21 SER A CB     3  
ATOM 7583  O OG     . SER C 2 21 ? -11.263 -1.490  -0.316  1.00 3.19  ? 21 SER A OG     3  
ATOM 7584  H H      . SER C 2 21 ? -14.563 -0.726  -2.336  1.00 2.86  ? 21 SER A H      3  
ATOM 7585  H HA     . SER C 2 21 ? -12.578 -2.690  -2.329  1.00 2.56  ? 21 SER A HA     3  
ATOM 7586  H HB2    . SER C 2 21 ? -12.158 -0.324  -1.726  1.00 3.15  ? 21 SER A HB2    3  
ATOM 7587  H HB3    . SER C 2 21 ? -13.071 -0.549  -0.237  1.00 3.14  ? 21 SER A HB3    3  
ATOM 7588  H HG     . SER C 2 21 ? -10.578 -1.660  -0.969  1.00 3.29  ? 21 SER A HG     3  
ATOM 7589  N N      . ARG C 2 22 ? -14.745 -2.880  0.133   1.00 3.06  ? 22 ARG A N      3  
ATOM 7590  C CA     . ARG C 2 22 ? -15.303 -3.743  1.152   1.00 3.25  ? 22 ARG A CA     3  
ATOM 7591  C C      . ARG C 2 22 ? -15.898 -4.970  0.481   1.00 3.12  ? 22 ARG A C      3  
ATOM 7592  O O      . ARG C 2 22 ? -15.905 -6.065  1.033   1.00 3.25  ? 22 ARG A O      3  
ATOM 7593  C CB     . ARG C 2 22 ? -16.374 -2.976  1.945   1.00 3.54  ? 22 ARG A CB     3  
ATOM 7594  C CG     . ARG C 2 22 ? -17.601 -3.802  2.297   1.00 3.73  ? 22 ARG A CG     3  
ATOM 7595  C CD     . ARG C 2 22 ? -18.888 -2.998  2.156   1.00 3.83  ? 22 ARG A CD     3  
ATOM 7596  N NE     . ARG C 2 22 ? -18.824 -1.723  2.877   1.00 3.92  ? 22 ARG A NE     3  
ATOM 7597  C CZ     . ARG C 2 22 ? -19.893 -1.034  3.292   1.00 4.17  ? 22 ARG A CZ     3  
ATOM 7598  N NH1    . ARG C 2 22 ? -21.120 -1.497  3.078   1.00 4.31  ? 22 ARG A NH1    3  
ATOM 7599  N NH2    . ARG C 2 22 ? -19.735 0.119   3.932   1.00 4.44  ? 22 ARG A NH2    3  
ATOM 7600  H H      . ARG C 2 22 ? -15.213 -2.049  -0.078  1.00 3.12  ? 22 ARG A H      3  
ATOM 7601  H HA     . ARG C 2 22 ? -14.507 -4.048  1.816   1.00 3.32  ? 22 ARG A HA     3  
ATOM 7602  H HB2    . ARG C 2 22 ? -15.935 -2.620  2.864   1.00 3.74  ? 22 ARG A HB2    3  
ATOM 7603  H HB3    . ARG C 2 22 ? -16.695 -2.127  1.360   1.00 3.64  ? 22 ARG A HB3    3  
ATOM 7604  H HG2    . ARG C 2 22 ? -17.647 -4.648  1.629   1.00 3.93  ? 22 ARG A HG2    3  
ATOM 7605  H HG3    . ARG C 2 22 ? -17.510 -4.147  3.315   1.00 3.83  ? 22 ARG A HG3    3  
ATOM 7606  H HD2    . ARG C 2 22 ? -19.058 -2.800  1.107   1.00 3.85  ? 22 ARG A HD2    3  
ATOM 7607  H HD3    . ARG C 2 22 ? -19.706 -3.583  2.546   1.00 4.03  ? 22 ARG A HD3    3  
ATOM 7608  H HE     . ARG C 2 22 ? -17.929 -1.358  3.057   1.00 3.94  ? 22 ARG A HE     3  
ATOM 7609  H HH11   . ARG C 2 22 ? -21.256 -2.374  2.605   1.00 4.31  ? 22 ARG A HH11   3  
ATOM 7610  H HH12   . ARG C 2 22 ? -21.917 -0.976  3.386   1.00 4.55  ? 22 ARG A HH12   3  
ATOM 7611  H HH21   . ARG C 2 22 ? -18.816 0.480   4.107   1.00 4.53  ? 22 ARG A HH21   3  
ATOM 7612  H HH22   . ARG C 2 22 ? -20.537 0.634   4.248   1.00 4.68  ? 22 ARG A HH22   3  
ATOM 7613  N N      . VAL C 2 23 ? -16.378 -4.751  -0.734  1.00 2.91  ? 23 VAL A N      3  
ATOM 7614  C CA     . VAL C 2 23 ? -16.998 -5.785  -1.534  1.00 2.82  ? 23 VAL A CA     3  
ATOM 7615  C C      . VAL C 2 23 ? -15.976 -6.840  -1.930  1.00 2.72  ? 23 VAL A C      3  
ATOM 7616  O O      . VAL C 2 23 ? -16.181 -8.033  -1.726  1.00 2.86  ? 23 VAL A O      3  
ATOM 7617  C CB     . VAL C 2 23 ? -17.629 -5.173  -2.804  1.00 2.62  ? 23 VAL A CB     3  
ATOM 7618  C CG1    . VAL C 2 23 ? -18.129 -6.246  -3.743  1.00 2.56  ? 23 VAL A CG1    3  
ATOM 7619  C CG2    . VAL C 2 23 ? -18.752 -4.210  -2.446  1.00 2.76  ? 23 VAL A CG2    3  
ATOM 7620  H H      . VAL C 2 23 ? -16.276 -3.863  -1.124  1.00 2.85  ? 23 VAL A H      3  
ATOM 7621  H HA     . VAL C 2 23 ? -17.780 -6.244  -0.950  1.00 3.00  ? 23 VAL A HA     3  
ATOM 7622  H HB     . VAL C 2 23 ? -16.863 -4.612  -3.319  1.00 2.48  ? 23 VAL A HB     3  
ATOM 7623  H HG11   . VAL C 2 23 ? -19.055 -6.652  -3.367  1.00 2.68  ? 23 VAL A HG11   3  
ATOM 7624  H HG12   . VAL C 2 23 ? -17.391 -7.029  -3.815  1.00 2.67  ? 23 VAL A HG12   3  
ATOM 7625  H HG13   . VAL C 2 23 ? -18.293 -5.811  -4.719  1.00 2.88  ? 23 VAL A HG13   3  
ATOM 7626  H HG21   . VAL C 2 23 ? -19.273 -4.569  -1.570  1.00 3.00  ? 23 VAL A HG21   3  
ATOM 7627  H HG22   . VAL C 2 23 ? -19.444 -4.142  -3.272  1.00 2.86  ? 23 VAL A HG22   3  
ATOM 7628  H HG23   . VAL C 2 23 ? -18.337 -3.229  -2.244  1.00 3.04  ? 23 VAL A HG23   3  
ATOM 7629  N N      . VAL C 2 24 ? -14.862 -6.370  -2.472  1.00 2.54  ? 24 VAL A N      3  
ATOM 7630  C CA     . VAL C 2 24 ? -13.780 -7.234  -2.912  1.00 2.46  ? 24 VAL A CA     3  
ATOM 7631  C C      . VAL C 2 24 ? -13.137 -7.973  -1.736  1.00 2.68  ? 24 VAL A C      3  
ATOM 7632  O O      . VAL C 2 24 ? -12.476 -8.993  -1.922  1.00 2.72  ? 24 VAL A O      3  
ATOM 7633  C CB     . VAL C 2 24 ? -12.726 -6.412  -3.710  1.00 2.28  ? 24 VAL A CB     3  
ATOM 7634  C CG1    . VAL C 2 24 ? -11.347 -6.446  -3.065  1.00 2.42  ? 24 VAL A CG1    3  
ATOM 7635  C CG2    . VAL C 2 24 ? -12.652 -6.899  -5.152  1.00 2.15  ? 24 VAL A CG2    3  
ATOM 7636  H H      . VAL C 2 24 ? -14.768 -5.397  -2.588  1.00 2.49  ? 24 VAL A H      3  
ATOM 7637  H HA     . VAL C 2 24 ? -14.199 -7.964  -3.578  1.00 2.45  ? 24 VAL A HA     3  
ATOM 7638  H HB     . VAL C 2 24 ? -13.055 -5.385  -3.724  1.00 2.37  ? 24 VAL A HB     3  
ATOM 7639  H HG11   . VAL C 2 24 ? -11.409 -6.036  -2.068  1.00 2.60  ? 24 VAL A HG11   3  
ATOM 7640  H HG12   . VAL C 2 24 ? -10.659 -5.859  -3.656  1.00 2.68  ? 24 VAL A HG12   3  
ATOM 7641  H HG13   . VAL C 2 24 ? -10.999 -7.467  -3.013  1.00 2.72  ? 24 VAL A HG13   3  
ATOM 7642  H HG21   . VAL C 2 24 ? -13.635 -6.856  -5.598  1.00 2.07  ? 24 VAL A HG21   3  
ATOM 7643  H HG22   . VAL C 2 24 ? -12.295 -7.917  -5.172  1.00 2.57  ? 24 VAL A HG22   3  
ATOM 7644  H HG23   . VAL C 2 24 ? -11.975 -6.268  -5.713  1.00 2.30  ? 24 VAL A HG23   3  
ATOM 7645  N N      . ASN C 2 25 ? -13.360 -7.473  -0.525  1.00 2.86  ? 25 ASN A N      3  
ATOM 7646  C CA     . ASN C 2 25 ? -12.764 -8.098  0.655   1.00 3.11  ? 25 ASN A CA     3  
ATOM 7647  C C      . ASN C 2 25 ? -13.766 -8.908  1.479   1.00 3.40  ? 25 ASN A C      3  
ATOM 7648  O O      . ASN C 2 25 ? -13.357 -9.676  2.352   1.00 3.68  ? 25 ASN A O      3  
ATOM 7649  C CB     . ASN C 2 25 ? -12.119 -7.030  1.541   1.00 3.26  ? 25 ASN A CB     3  
ATOM 7650  C CG     . ASN C 2 25 ? -10.717 -6.675  1.091   1.00 3.13  ? 25 ASN A CG     3  
ATOM 7651  O OD1    . ASN C 2 25 ? -9.732  -7.176  1.630   1.00 3.32  ? 25 ASN A OD1    3  
ATOM 7652  N ND2    . ASN C 2 25 ? -10.617 -5.816  0.087   1.00 2.90  ? 25 ASN A ND2    3  
ATOM 7653  H H      . ASN C 2 25 ? -13.929 -6.675  -0.426  1.00 2.86  ? 25 ASN A H      3  
ATOM 7654  H HA     . ASN C 2 25 ? -11.990 -8.764  0.309   1.00 3.04  ? 25 ASN A HA     3  
ATOM 7655  H HB2    . ASN C 2 25 ? -12.722 -6.135  1.514   1.00 3.28  ? 25 ASN A HB2    3  
ATOM 7656  H HB3    . ASN C 2 25 ? -12.070 -7.395  2.557   1.00 3.51  ? 25 ASN A HB3    3  
ATOM 7657  H HD21   . ASN C 2 25 ? -11.448 -5.460  -0.305  1.00 2.85  ? 25 ASN A HD21   3  
ATOM 7658  H HD22   . ASN C 2 25 ? -9.723  -5.569  -0.221  1.00 2.85  ? 25 ASN A HD22   3  
ATOM 7659  N N      . GLN C 2 26 ? -15.064 -8.768  1.192   1.00 3.38  ? 26 GLN A N      3  
ATOM 7660  C CA     . GLN C 2 26 ? -16.099 -9.504  1.937   1.00 3.69  ? 26 GLN A CA     3  
ATOM 7661  C C      . GLN C 2 26 ? -17.515 -9.163  1.467   1.00 3.73  ? 26 GLN A C      3  
ATOM 7662  O O      . GLN C 2 26 ? -18.263 -10.048 1.050   1.00 4.00  ? 26 GLN A O      3  
ATOM 7663  C CB     . GLN C 2 26 ? -15.992 -9.248  3.455   1.00 4.14  ? 26 GLN A CB     3  
ATOM 7664  C CG     . GLN C 2 26 ? -15.794 -7.785  3.842   1.00 4.79  ? 26 GLN A CG     3  
ATOM 7665  C CD     . GLN C 2 26 ? -16.867 -7.277  4.786   1.00 5.58  ? 26 GLN A CD     3  
ATOM 7666  O OE1    . GLN C 2 26 ? -17.917 -6.799  4.353   1.00 6.08  ? 26 GLN A OE1    3  
ATOM 7667  N NE2    . GLN C 2 26 ? -16.609 -7.370  6.080   1.00 6.01  ? 26 GLN A NE2    3  
ATOM 7668  H H      . GLN C 2 26 ? -15.332 -8.171  0.460   1.00 3.18  ? 26 GLN A H      3  
ATOM 7669  H HA     . GLN C 2 26 ? -15.930 -10.556 1.758   1.00 3.74  ? 26 GLN A HA     3  
ATOM 7670  H HB2    . GLN C 2 26 ? -16.898 -9.597  3.928   1.00 4.26  ? 26 GLN A HB2    3  
ATOM 7671  H HB3    . GLN C 2 26 ? -15.158 -9.814  3.843   1.00 4.31  ? 26 GLN A HB3    3  
ATOM 7672  H HG2    . GLN C 2 26 ? -14.834 -7.683  4.327   1.00 4.93  ? 26 GLN A HG2    3  
ATOM 7673  H HG3    . GLN C 2 26 ? -15.807 -7.184  2.946   1.00 4.95  ? 26 GLN A HG3    3  
ATOM 7674  H HE21   . GLN C 2 26 ? -15.752 -7.758  6.354   1.00 5.84  ? 26 GLN A HE21   3  
ATOM 7675  H HE22   . GLN C 2 26 ? -17.283 -7.045  6.711   1.00 6.64  ? 26 GLN A HE22   3  
ATOM 7676  N N      . ALA C 2 27 ? -17.873 -7.880  1.545   1.00 3.79  ? 27 ALA A N      3  
ATOM 7677  C CA     . ALA C 2 27 ? -19.202 -7.400  1.166   1.00 3.98  ? 27 ALA A CA     3  
ATOM 7678  C C      . ALA C 2 27 ? -20.295 -8.132  1.940   1.00 4.29  ? 27 ALA A C      3  
ATOM 7679  O O      . ALA C 2 27 ? -21.284 -8.594  1.367   1.00 4.63  ? 27 ALA A O      3  
ATOM 7680  C CB     . ALA C 2 27 ? -19.420 -7.522  -0.332  1.00 3.84  ? 27 ALA A CB     3  
ATOM 7681  H H      . ALA C 2 27 ? -17.210 -7.228  1.856   1.00 3.91  ? 27 ALA A H      3  
ATOM 7682  H HA     . ALA C 2 27 ? -19.251 -6.351  1.421   1.00 4.15  ? 27 ALA A HA     3  
ATOM 7683  H HB1    . ALA C 2 27 ? -20.443 -7.271  -0.568  1.00 3.98  ? 27 ALA A HB1    3  
ATOM 7684  H HB2    . ALA C 2 27 ? -19.211 -8.533  -0.648  1.00 3.81  ? 27 ALA A HB2    3  
ATOM 7685  H HB3    . ALA C 2 27 ? -18.756 -6.836  -0.844  1.00 4.05  ? 27 ALA A HB3    3  
ATOM 7686  N N      . SER C 2 28 ? -20.114 -8.217  3.252   1.00 4.40  ? 28 SER A N      3  
ATOM 7687  C CA     . SER C 2 28 ? -21.071 -8.886  4.122   1.00 4.74  ? 28 SER A CA     3  
ATOM 7688  C C      . SER C 2 28 ? -22.319 -8.018  4.310   1.00 4.78  ? 28 SER A C      3  
ATOM 7689  O O      . SER C 2 28 ? -23.375 -8.499  4.720   1.00 5.09  ? 28 SER A O      3  
ATOM 7690  C CB     . SER C 2 28 ? -20.417 -9.192  5.474   1.00 5.07  ? 28 SER A CB     3  
ATOM 7691  O OG     . SER C 2 28 ? -21.221 -10.050 6.263   1.00 5.08  ? 28 SER A OG     3  
ATOM 7692  H H      . SER C 2 28 ? -19.306 -7.820  3.647   1.00 4.41  ? 28 SER A H      3  
ATOM 7693  H HA     . SER C 2 28 ? -21.360 -9.813  3.650   1.00 4.79  ? 28 SER A HA     3  
ATOM 7694  H HB2    . SER C 2 28 ? -19.464 -9.671  5.307   1.00 5.40  ? 28 SER A HB2    3  
ATOM 7695  H HB3    . SER C 2 28 ? -20.263 -8.269  6.012   1.00 5.21  ? 28 SER A HB3    3  
ATOM 7696  H HG     . SER C 2 28 ? -20.911 -10.966 6.168   1.00 5.20  ? 28 SER A HG     3  
ATOM 7697  N N      . HIS C 2 29 ? -22.193 -6.740  3.984   1.00 4.57  ? 29 HIS A N      3  
ATOM 7698  C CA     . HIS C 2 29 ? -23.288 -5.798  4.106   1.00 4.63  ? 29 HIS A CA     3  
ATOM 7699  C C      . HIS C 2 29 ? -23.230 -4.812  2.950   1.00 4.35  ? 29 HIS A C      3  
ATOM 7700  O O      . HIS C 2 29 ? -22.441 -3.867  2.964   1.00 4.43  ? 29 HIS A O      3  
ATOM 7701  C CB     . HIS C 2 29 ? -23.231 -5.055  5.447   1.00 4.90  ? 29 HIS A CB     3  
ATOM 7702  C CG     . HIS C 2 29 ? -24.162 -5.608  6.488   1.00 5.21  ? 29 HIS A CG     3  
ATOM 7703  N ND1    . HIS C 2 29 ? -24.179 -5.173  7.798   1.00 5.58  ? 29 HIS A ND1    3  
ATOM 7704  C CD2    . HIS C 2 29 ? -25.121 -6.561  6.401   1.00 5.44  ? 29 HIS A CD2    3  
ATOM 7705  C CE1    . HIS C 2 29 ? -25.103 -5.839  8.468   1.00 5.80  ? 29 HIS A CE1    3  
ATOM 7706  N NE2    . HIS C 2 29 ? -25.686 -6.683  7.644   1.00 5.73  ? 29 HIS A NE2    3  
ATOM 7707  H H      . HIS C 2 29 ? -21.344 -6.425  3.620   1.00 4.45  ? 29 HIS A H      3  
ATOM 7708  H HA     . HIS C 2 29 ? -24.215 -6.353  4.046   1.00 4.74  ? 29 HIS A HA     3  
ATOM 7709  H HB2    . HIS C 2 29 ? -22.227 -5.113  5.840   1.00 4.91  ? 29 HIS A HB2    3  
ATOM 7710  H HB3    . HIS C 2 29 ? -23.490 -4.021  5.285   1.00 4.92  ? 29 HIS A HB3    3  
ATOM 7711  H HD1    . HIS C 2 29 ? -23.600 -4.481  8.180   1.00 5.83  ? 29 HIS A HD1    3  
ATOM 7712  H HD2    . HIS C 2 29 ? -25.390 -7.119  5.516   1.00 5.59  ? 29 HIS A HD2    3  
ATOM 7713  H HE1    . HIS C 2 29 ? -25.342 -5.710  9.513   1.00 6.16  ? 29 HIS A HE1    3  
ATOM 7714  H HE2    . HIS C 2 29 ? -26.370 -7.352  7.901   1.00 6.03  ? 29 HIS A HE2    3  
ATOM 7715  N N      . VAL C 2 30 ? -24.045 -5.061  1.939   1.00 4.23  ? 30 VAL A N      3  
ATOM 7716  C CA     . VAL C 2 30 ? -24.091 -4.217  0.750   1.00 3.95  ? 30 VAL A CA     3  
ATOM 7717  C C      . VAL C 2 30 ? -25.321 -4.557  -0.087  1.00 3.85  ? 30 VAL A C      3  
ATOM 7718  O O      . VAL C 2 30 ? -25.878 -5.648  0.033   1.00 4.00  ? 30 VAL A O      3  
ATOM 7719  C CB     . VAL C 2 30 ? -22.803 -4.379  -0.096  1.00 3.73  ? 30 VAL A CB     3  
ATOM 7720  C CG1    . VAL C 2 30 ? -22.595 -5.830  -0.492  1.00 3.75  ? 30 VAL A CG1    3  
ATOM 7721  C CG2    . VAL C 2 30 ? -22.808 -3.482  -1.326  1.00 4.14  ? 30 VAL A CG2    3  
ATOM 7722  H H      . VAL C 2 30 ? -24.642 -5.837  1.995   1.00 4.47  ? 30 VAL A H      3  
ATOM 7723  H HA     . VAL C 2 30 ? -24.162 -3.188  1.074   1.00 3.98  ? 30 VAL A HA     3  
ATOM 7724  H HB     . VAL C 2 30 ? -21.977 -4.080  0.522   1.00 3.72  ? 30 VAL A HB     3  
ATOM 7725  H HG11   . VAL C 2 30 ? -22.494 -6.435  0.397   1.00 3.77  ? 30 VAL A HG11   3  
ATOM 7726  H HG12   . VAL C 2 30 ? -21.698 -5.914  -1.090  1.00 4.08  ? 30 VAL A HG12   3  
ATOM 7727  H HG13   . VAL C 2 30 ? -23.443 -6.172  -1.067  1.00 4.01  ? 30 VAL A HG13   3  
ATOM 7728  H HG21   . VAL C 2 30 ? -22.874 -2.449  -1.019  1.00 4.47  ? 30 VAL A HG21   3  
ATOM 7729  H HG22   . VAL C 2 30 ? -23.655 -3.728  -1.948  1.00 4.43  ? 30 VAL A HG22   3  
ATOM 7730  H HG23   . VAL C 2 30 ? -21.894 -3.632  -1.885  1.00 4.33  ? 30 VAL A HG23   3  
ATOM 7731  N N      . SER C 2 31 ? -25.731 -3.620  -0.928  1.00 3.66  ? 31 SER A N      3  
ATOM 7732  C CA     . SER C 2 31 ? -26.902 -3.803  -1.778  1.00 3.57  ? 31 SER A CA     3  
ATOM 7733  C C      . SER C 2 31 ? -26.635 -4.787  -2.917  1.00 3.30  ? 31 SER A C      3  
ATOM 7734  O O      . SER C 2 31 ? -25.497 -5.207  -3.150  1.00 3.15  ? 31 SER A O      3  
ATOM 7735  C CB     . SER C 2 31 ? -27.350 -2.464  -2.357  1.00 3.52  ? 31 SER A CB     3  
ATOM 7736  O OG     . SER C 2 31 ? -27.431 -1.474  -1.350  1.00 3.59  ? 31 SER A OG     3  
ATOM 7737  H H      . SER C 2 31 ? -25.217 -2.783  -0.987  1.00 3.60  ? 31 SER A H      3  
ATOM 7738  H HA     . SER C 2 31 ? -27.696 -4.196  -1.161  1.00 3.79  ? 31 SER A HA     3  
ATOM 7739  H HB2    . SER C 2 31 ? -26.641 -2.143  -3.105  1.00 3.57  ? 31 SER A HB2    3  
ATOM 7740  H HB3    . SER C 2 31 ? -28.324 -2.582  -2.812  1.00 3.68  ? 31 SER A HB3    3  
ATOM 7741  H HG     . SER C 2 31 ? -27.519 -1.895  -0.488  1.00 3.80  ? 31 SER A HG     3  
ATOM 7742  N N      . ALA C 2 32 ? -27.704 -5.139  -3.623  1.00 3.28  ? 32 ALA A N      3  
ATOM 7743  C CA     . ALA C 2 32 ? -27.634 -6.069  -4.742  1.00 3.13  ? 32 ALA A CA     3  
ATOM 7744  C C      . ALA C 2 32 ? -26.917 -5.459  -5.945  1.00 2.81  ? 32 ALA A C      3  
ATOM 7745  O O      . ALA C 2 32 ? -25.802 -5.868  -6.278  1.00 2.69  ? 32 ALA A O      3  
ATOM 7746  C CB     . ALA C 2 32 ? -29.036 -6.506  -5.129  1.00 3.24  ? 32 ALA A CB     3  
ATOM 7747  H H      . ALA C 2 32 ? -28.576 -4.766  -3.377  1.00 3.42  ? 32 ALA A H      3  
ATOM 7748  H HA     . ALA C 2 32 ? -27.089 -6.943  -4.415  1.00 3.22  ? 32 ALA A HA     3  
ATOM 7749  H HB1    . ALA C 2 32 ? -29.476 -7.064  -4.317  1.00 3.30  ? 32 ALA A HB1    3  
ATOM 7750  H HB2    . ALA C 2 32 ? -28.990 -7.127  -6.012  1.00 3.60  ? 32 ALA A HB2    3  
ATOM 7751  H HB3    . ALA C 2 32 ? -29.639 -5.632  -5.333  1.00 3.38  ? 32 ALA A HB3    3  
ATOM 7752  N N      . LYS C 2 33 ? -27.548 -4.460  -6.573  1.00 2.73  ? 33 LYS A N      3  
ATOM 7753  C CA     . LYS C 2 33 ? -26.989 -3.801  -7.757  1.00 2.52  ? 33 LYS A CA     3  
ATOM 7754  C C      . LYS C 2 33 ? -25.563 -3.319  -7.530  1.00 2.43  ? 33 LYS A C      3  
ATOM 7755  O O      . LYS C 2 33 ? -24.763 -3.295  -8.458  1.00 2.32  ? 33 LYS A O      3  
ATOM 7756  C CB     . LYS C 2 33 ? -27.865 -2.620  -8.183  1.00 2.53  ? 33 LYS A CB     3  
ATOM 7757  C CG     . LYS C 2 33 ? -28.190 -1.652  -7.055  1.00 2.89  ? 33 LYS A CG     3  
ATOM 7758  C CD     . LYS C 2 33 ? -29.093 -0.535  -7.540  1.00 3.24  ? 33 LYS A CD     3  
ATOM 7759  C CE     . LYS C 2 33 ? -29.183 0.597   -6.528  1.00 4.00  ? 33 LYS A CE     3  
ATOM 7760  N NZ     . LYS C 2 33 ? -29.266 1.928   -7.186  1.00 4.59  ? 33 LYS A NZ     3  
ATOM 7761  H H      . LYS C 2 33 ? -28.422 -4.166  -6.242  1.00 2.85  ? 33 LYS A H      3  
ATOM 7762  H HA     . LYS C 2 33 ? -26.975 -4.524  -8.556  1.00 2.48  ? 33 LYS A HA     3  
ATOM 7763  H HB2    . LYS C 2 33 ? -27.349 -2.068  -8.957  1.00 2.62  ? 33 LYS A HB2    3  
ATOM 7764  H HB3    . LYS C 2 33 ? -28.793 -3.000  -8.581  1.00 2.61  ? 33 LYS A HB3    3  
ATOM 7765  H HG2    . LYS C 2 33 ? -28.690 -2.189  -6.263  1.00 3.12  ? 33 LYS A HG2    3  
ATOM 7766  H HG3    . LYS C 2 33 ? -27.271 -1.226  -6.682  1.00 2.98  ? 33 LYS A HG3    3  
ATOM 7767  H HD2    . LYS C 2 33 ? -28.702 -0.146  -8.469  1.00 3.45  ? 33 LYS A HD2    3  
ATOM 7768  H HD3    . LYS C 2 33 ? -30.081 -0.940  -7.705  1.00 3.17  ? 33 LYS A HD3    3  
ATOM 7769  H HE2    . LYS C 2 33 ? -30.065 0.451   -5.922  1.00 4.23  ? 33 LYS A HE2    3  
ATOM 7770  H HE3    . LYS C 2 33 ? -28.306 0.569   -5.899  1.00 4.32  ? 33 LYS A HE3    3  
ATOM 7771  H HZ1    . LYS C 2 33 ? -28.371 2.144   -7.679  1.00 4.92  ? 33 LYS A HZ1    3  
ATOM 7772  H HZ2    . LYS C 2 33 ? -29.439 2.671   -6.473  1.00 4.97  ? 33 LYS A HZ2    3  
ATOM 7773  H HZ3    . LYS C 2 33 ? -30.044 1.943   -7.884  1.00 4.68  ? 33 LYS A HZ3    3  
ATOM 7774  N N      . THR C 2 34 ? -25.250 -2.931  -6.305  1.00 2.54  ? 34 THR A N      3  
ATOM 7775  C CA     . THR C 2 34 ? -23.923 -2.461  -5.990  1.00 2.50  ? 34 THR A CA     3  
ATOM 7776  C C      . THR C 2 34 ? -22.877 -3.535  -6.247  1.00 2.40  ? 34 THR A C      3  
ATOM 7777  O O      . THR C 2 34 ? -21.873 -3.276  -6.903  1.00 2.28  ? 34 THR A O      3  
ATOM 7778  C CB     . THR C 2 34 ? -23.824 -2.013  -4.531  1.00 2.73  ? 34 THR A CB     3  
ATOM 7779  O OG1    . THR C 2 34 ? -24.941 -1.173  -4.204  1.00 2.86  ? 34 THR A OG1    3  
ATOM 7780  C CG2    . THR C 2 34 ? -22.520 -1.270  -4.316  1.00 2.75  ? 34 THR A CG2    3  
ATOM 7781  H H      . THR C 2 34 ? -25.923 -2.956  -5.600  1.00 2.68  ? 34 THR A H      3  
ATOM 7782  H HA     . THR C 2 34 ? -23.713 -1.609  -6.619  1.00 2.46  ? 34 THR A HA     3  
ATOM 7783  H HB     . THR C 2 34 ? -23.835 -2.886  -3.895  1.00 2.86  ? 34 THR A HB     3  
ATOM 7784  H HG1    . THR C 2 34 ? -24.726 -0.635  -3.430  1.00 3.04  ? 34 THR A HG1    3  
ATOM 7785  H HG21   . THR C 2 34 ? -21.762 -1.693  -4.967  1.00 3.02  ? 34 THR A HG21   3  
ATOM 7786  H HG22   . THR C 2 34 ? -22.212 -1.372  -3.287  1.00 2.96  ? 34 THR A HG22   3  
ATOM 7787  H HG23   . THR C 2 34 ? -22.658 -0.227  -4.552  1.00 2.82  ? 34 THR A HG23   3  
ATOM 7788  N N      . ARG C 2 35 ? -23.136 -4.748  -5.773  1.00 2.51  ? 35 ARG A N      3  
ATOM 7789  C CA     . ARG C 2 35 ? -22.190 -5.839  -5.951  1.00 2.50  ? 35 ARG A CA     3  
ATOM 7790  C C      . ARG C 2 35 ? -22.051 -6.157  -7.431  1.00 2.38  ? 35 ARG A C      3  
ATOM 7791  O O      . ARG C 2 35 ? -20.959 -6.427  -7.924  1.00 2.33  ? 35 ARG A O      3  
ATOM 7792  C CB     . ARG C 2 35 ? -22.650 -7.092  -5.201  1.00 2.77  ? 35 ARG A CB     3  
ATOM 7793  C CG     . ARG C 2 35 ? -22.178 -7.162  -3.760  1.00 2.94  ? 35 ARG A CG     3  
ATOM 7794  C CD     . ARG C 2 35 ? -22.568 -8.482  -3.111  1.00 3.35  ? 35 ARG A CD     3  
ATOM 7795  N NE     . ARG C 2 35 ? -23.957 -8.483  -2.641  1.00 3.39  ? 35 ARG A NE     3  
ATOM 7796  C CZ     . ARG C 2 35 ? -24.666 -9.591  -2.403  1.00 3.73  ? 35 ARG A CZ     3  
ATOM 7797  N NH1    . ARG C 2 35 ? -24.146 -10.788 -2.653  1.00 4.16  ? 35 ARG A NH1    3  
ATOM 7798  N NH2    . ARG C 2 35 ? -25.903 -9.498  -1.926  1.00 3.92  ? 35 ARG A NH2    3  
ATOM 7799  H H      . ARG C 2 35 ? -23.998 -4.927  -5.337  1.00 2.65  ? 35 ARG A H      3  
ATOM 7800  H HA     . ARG C 2 35 ? -21.235 -5.514  -5.560  1.00 2.47  ? 35 ARG A HA     3  
ATOM 7801  H HB2    . ARG C 2 35 ? -23.730 -7.121  -5.203  1.00 2.87  ? 35 ARG A HB2    3  
ATOM 7802  H HB3    . ARG C 2 35 ? -22.276 -7.962  -5.720  1.00 2.85  ? 35 ARG A HB3    3  
ATOM 7803  H HG2    . ARG C 2 35 ? -21.103 -7.065  -3.739  1.00 2.97  ? 35 ARG A HG2    3  
ATOM 7804  H HG3    . ARG C 2 35 ? -22.626 -6.351  -3.204  1.00 2.97  ? 35 ARG A HG3    3  
ATOM 7805  H HD2    . ARG C 2 35 ? -22.446 -9.273  -3.835  1.00 3.63  ? 35 ARG A HD2    3  
ATOM 7806  H HD3    . ARG C 2 35 ? -21.914 -8.662  -2.270  1.00 3.66  ? 35 ARG A HD3    3  
ATOM 7807  H HE     . ARG C 2 35 ? -24.374 -7.608  -2.478  1.00 3.38  ? 35 ARG A HE     3  
ATOM 7808  H HH11   . ARG C 2 35 ? -23.217 -10.870 -3.025  1.00 4.30  ? 35 ARG A HH11   3  
ATOM 7809  H HH12   . ARG C 2 35 ? -24.681 -11.619 -2.477  1.00 4.53  ? 35 ARG A HH12   3  
ATOM 7810  H HH21   . ARG C 2 35 ? -26.311 -8.602  -1.743  1.00 3.98  ? 35 ARG A HH21   3  
ATOM 7811  H HH22   . ARG C 2 35 ? -26.442 -10.335 -1.745  1.00 4.20  ? 35 ARG A HH22   3  
ATOM 7812  N N      . GLU C 2 36 ? -23.173 -6.090  -8.125  1.00 2.39  ? 36 GLU A N      3  
ATOM 7813  C CA     . GLU C 2 36 ? -23.225 -6.372  -9.548  1.00 2.38  ? 36 GLU A CA     3  
ATOM 7814  C C      . GLU C 2 36 ? -22.471 -5.312  -10.334 1.00 2.27  ? 36 GLU A C      3  
ATOM 7815  O O      . GLU C 2 36 ? -21.860 -5.601  -11.356 1.00 2.33  ? 36 GLU A O      3  
ATOM 7816  C CB     . GLU C 2 36 ? -24.677 -6.446  -10.021 1.00 2.47  ? 36 GLU A CB     3  
ATOM 7817  C CG     . GLU C 2 36 ? -25.554 -7.333  -9.150  1.00 2.59  ? 36 GLU A CG     3  
ATOM 7818  C CD     . GLU C 2 36 ? -26.932 -7.561  -9.746  1.00 3.03  ? 36 GLU A CD     3  
ATOM 7819  O OE1    . GLU C 2 36 ? -27.019 -7.907  -10.942 1.00 3.21  ? 36 GLU A OE1    3  
ATOM 7820  O OE2    . GLU C 2 36 ? -27.937 -7.385  -9.020  1.00 3.55  ? 36 GLU A OE2    3  
ATOM 7821  H H      . GLU C 2 36 ? -23.990 -5.814  -7.670  1.00 2.45  ? 36 GLU A H      3  
ATOM 7822  H HA     . GLU C 2 36 ? -22.751 -7.328  -9.712  1.00 2.49  ? 36 GLU A HA     3  
ATOM 7823  H HB2    . GLU C 2 36 ? -25.096 -5.450  -10.021 1.00 2.46  ? 36 GLU A HB2    3  
ATOM 7824  H HB3    . GLU C 2 36 ? -24.698 -6.834  -11.029 1.00 2.72  ? 36 GLU A HB3    3  
ATOM 7825  H HG2    . GLU C 2 36 ? -25.069 -8.289  -9.030  1.00 2.88  ? 36 GLU A HG2    3  
ATOM 7826  H HG3    . GLU C 2 36 ? -25.667 -6.861  -8.182  1.00 2.57  ? 36 GLU A HG3    3  
ATOM 7827  N N      . LYS C 2 37 ? -22.505 -4.084  -9.834  1.00 2.21  ? 37 LYS A N      3  
ATOM 7828  C CA     . LYS C 2 37 ? -21.836 -2.979  -10.492 1.00 2.23  ? 37 LYS A CA     3  
ATOM 7829  C C      . LYS C 2 37 ? -20.338 -3.048  -10.268 1.00 2.19  ? 37 LYS A C      3  
ATOM 7830  O O      . LYS C 2 37 ? -19.566 -2.853  -11.201 1.00 2.26  ? 37 LYS A O      3  
ATOM 7831  C CB     . LYS C 2 37 ? -22.396 -1.641  -10.008 1.00 2.31  ? 37 LYS A CB     3  
ATOM 7832  C CG     . LYS C 2 37 ? -23.528 -1.118  -10.879 1.00 2.44  ? 37 LYS A CG     3  
ATOM 7833  C CD     . LYS C 2 37 ? -24.653 -0.524  -10.047 1.00 2.48  ? 37 LYS A CD     3  
ATOM 7834  C CE     . LYS C 2 37 ? -24.236 0.777   -9.382  1.00 2.57  ? 37 LYS A CE     3  
ATOM 7835  N NZ     . LYS C 2 37 ? -24.036 1.870   -10.372 1.00 2.84  ? 37 LYS A NZ     3  
ATOM 7836  H H      . LYS C 2 37 ? -22.987 -3.923  -8.995  1.00 2.23  ? 37 LYS A H      3  
ATOM 7837  H HA     . LYS C 2 37 ? -22.027 -3.070  -11.551 1.00 2.31  ? 37 LYS A HA     3  
ATOM 7838  H HB2    . LYS C 2 37 ? -22.768 -1.762  -9.001  1.00 2.53  ? 37 LYS A HB2    3  
ATOM 7839  H HB3    . LYS C 2 37 ? -21.602 -0.908  -10.006 1.00 2.66  ? 37 LYS A HB3    3  
ATOM 7840  H HG2    . LYS C 2 37 ? -23.139 -0.355  -11.536 1.00 2.86  ? 37 LYS A HG2    3  
ATOM 7841  H HG3    . LYS C 2 37 ? -23.920 -1.934  -11.468 1.00 2.66  ? 37 LYS A HG3    3  
ATOM 7842  H HD2    . LYS C 2 37 ? -25.497 -0.331  -10.690 1.00 2.62  ? 37 LYS A HD2    3  
ATOM 7843  H HD3    . LYS C 2 37 ? -24.935 -1.234  -9.284  1.00 2.57  ? 37 LYS A HD3    3  
ATOM 7844  H HE2    . LYS C 2 37 ? -25.009 1.068   -8.685  1.00 2.71  ? 37 LYS A HE2    3  
ATOM 7845  H HE3    . LYS C 2 37 ? -23.308 0.612   -8.846  1.00 2.63  ? 37 LYS A HE3    3  
ATOM 7846  H HZ1    . LYS C 2 37 ? -24.657 1.731   -11.196 1.00 3.16  ? 37 LYS A HZ1    3  
ATOM 7847  H HZ2    . LYS C 2 37 ? -23.046 1.879   -10.698 1.00 3.15  ? 37 LYS A HZ2    3  
ATOM 7848  H HZ3    . LYS C 2 37 ? -24.255 2.793   -9.938  1.00 2.93  ? 37 LYS A HZ3    3  
ATOM 7849  N N      . VAL C 2 38 ? -19.922 -3.333  -9.036  1.00 2.13  ? 38 VAL A N      3  
ATOM 7850  C CA     . VAL C 2 38 ? -18.494 -3.440  -8.739  1.00 2.10  ? 38 VAL A CA     3  
ATOM 7851  C C      . VAL C 2 38 ? -17.904 -4.621  -9.510  1.00 2.10  ? 38 VAL A C      3  
ATOM 7852  O O      . VAL C 2 38 ? -16.862 -4.496  -10.150 1.00 2.14  ? 38 VAL A O      3  
ATOM 7853  C CB     . VAL C 2 38 ? -18.219 -3.581  -7.228  1.00 2.11  ? 38 VAL A CB     3  
ATOM 7854  C CG1    . VAL C 2 38 ? -19.065 -2.595  -6.441  1.00 2.26  ? 38 VAL A CG1    3  
ATOM 7855  C CG2    . VAL C 2 38 ? -18.455 -4.992  -6.740  1.00 2.12  ? 38 VAL A CG2    3  
ATOM 7856  H H      . VAL C 2 38 ? -20.586 -3.477  -8.316  1.00 2.16  ? 38 VAL A H      3  
ATOM 7857  H HA     . VAL C 2 38 ? -18.009 -2.529  -9.077  1.00 2.16  ? 38 VAL A HA     3  
ATOM 7858  H HB     . VAL C 2 38 ? -17.185 -3.343  -7.061  1.00 2.11  ? 38 VAL A HB     3  
ATOM 7859  H HG11   . VAL C 2 38 ? -18.736 -1.588  -6.653  1.00 2.68  ? 38 VAL A HG11   3  
ATOM 7860  H HG12   . VAL C 2 38 ? -18.962 -2.792  -5.384  1.00 2.30  ? 38 VAL A HG12   3  
ATOM 7861  H HG13   . VAL C 2 38 ? -20.103 -2.703  -6.730  1.00 2.54  ? 38 VAL A HG13   3  
ATOM 7862  H HG21   . VAL C 2 38 ? -18.141 -5.076  -5.712  1.00 2.57  ? 38 VAL A HG21   3  
ATOM 7863  H HG22   . VAL C 2 38 ? -17.879 -5.678  -7.354  1.00 2.23  ? 38 VAL A HG22   3  
ATOM 7864  H HG23   . VAL C 2 38 ? -19.504 -5.228  -6.821  1.00 2.26  ? 38 VAL A HG23   3  
ATOM 7865  N N      . GLU C 2 39 ? -18.596 -5.762  -9.453  1.00 2.16  ? 39 GLU A N      3  
ATOM 7866  C CA     . GLU C 2 39 ? -18.176 -6.962  -10.160 1.00 2.30  ? 39 GLU A CA     3  
ATOM 7867  C C      . GLU C 2 39 ? -18.155 -6.691  -11.650 1.00 2.42  ? 39 GLU A C      3  
ATOM 7868  O O      . GLU C 2 39 ? -17.238 -7.115  -12.346 1.00 2.56  ? 39 GLU A O      3  
ATOM 7869  C CB     . GLU C 2 39 ? -19.093 -8.149  -9.850  1.00 2.46  ? 39 GLU A CB     3  
ATOM 7870  C CG     . GLU C 2 39 ? -18.497 -9.133  -8.854  1.00 2.53  ? 39 GLU A CG     3  
ATOM 7871  C CD     . GLU C 2 39 ? -18.949 -10.564 -9.098  1.00 2.89  ? 39 GLU A CD     3  
ATOM 7872  O OE1    . GLU C 2 39 ? -20.004 -10.961 -8.559  1.00 3.27  ? 39 GLU A OE1    3  
ATOM 7873  O OE2    . GLU C 2 39 ? -18.249 -11.302 -9.831  1.00 3.12  ? 39 GLU A OE2    3  
ATOM 7874  H H      . GLU C 2 39 ? -19.392 -5.797  -8.884  1.00 2.17  ? 39 GLU A H      3  
ATOM 7875  H HA     . GLU C 2 39 ? -17.172 -7.199  -9.837  1.00 2.28  ? 39 GLU A HA     3  
ATOM 7876  H HB2    . GLU C 2 39 ? -20.022 -7.777  -9.444  1.00 2.44  ? 39 GLU A HB2    3  
ATOM 7877  H HB3    . GLU C 2 39 ? -19.298 -8.680  -10.768 1.00 2.62  ? 39 GLU A HB3    3  
ATOM 7878  H HG2    . GLU C 2 39 ? -17.420 -9.094  -8.929  1.00 2.47  ? 39 GLU A HG2    3  
ATOM 7879  H HG3    . GLU C 2 39 ? -18.795 -8.842  -7.855  1.00 2.57  ? 39 GLU A HG3    3  
ATOM 7880  N N      . ALA C 2 40 ? -19.165 -5.972  -12.140 1.00 2.42  ? 40 ALA A N      3  
ATOM 7881  C CA     . ALA C 2 40 ? -19.209 -5.621  -13.546 1.00 2.60  ? 40 ALA A CA     3  
ATOM 7882  C C      . ALA C 2 40 ? -18.000 -4.782  -13.871 1.00 2.65  ? 40 ALA A C      3  
ATOM 7883  O O      . ALA C 2 40 ? -17.190 -5.157  -14.702 1.00 2.86  ? 40 ALA A O      3  
ATOM 7884  C CB     . ALA C 2 40 ? -20.462 -4.841  -13.909 1.00 2.61  ? 40 ALA A CB     3  
ATOM 7885  H H      . ALA C 2 40 ? -19.895 -5.685  -11.542 1.00 2.32  ? 40 ALA A H      3  
ATOM 7886  H HA     . ALA C 2 40 ? -19.183 -6.529  -14.128 1.00 2.77  ? 40 ALA A HA     3  
ATOM 7887  H HB1    . ALA C 2 40 ? -21.214 -5.517  -14.285 1.00 2.90  ? 40 ALA A HB1    3  
ATOM 7888  H HB2    . ALA C 2 40 ? -20.214 -4.107  -14.671 1.00 2.54  ? 40 ALA A HB2    3  
ATOM 7889  H HB3    . ALA C 2 40 ? -20.836 -4.334  -13.031 1.00 2.88  ? 40 ALA A HB3    3  
ATOM 7890  N N      . ALA C 2 41 ? -17.858 -3.675  -13.156 1.00 2.52  ? 41 ALA A N      3  
ATOM 7891  C CA     . ALA C 2 41 ? -16.758 -2.762  -13.374 1.00 2.63  ? 41 ALA A CA     3  
ATOM 7892  C C      . ALA C 2 41 ? -15.403 -3.455  -13.398 1.00 2.66  ? 41 ALA A C      3  
ATOM 7893  O O      . ALA C 2 41 ? -14.642 -3.285  -14.345 1.00 2.89  ? 41 ALA A O      3  
ATOM 7894  C CB     . ALA C 2 41 ? -16.772 -1.715  -12.297 1.00 2.54  ? 41 ALA A CB     3  
ATOM 7895  H H      . ALA C 2 41 ? -18.534 -3.447  -12.458 1.00 2.40  ? 41 ALA A H      3  
ATOM 7896  H HA     . ALA C 2 41 ? -16.917 -2.269  -14.319 1.00 2.83  ? 41 ALA A HA     3  
ATOM 7897  H HB1    . ALA C 2 41 ? -17.633 -1.078  -12.425 1.00 2.75  ? 41 ALA A HB1    3  
ATOM 7898  H HB2    . ALA C 2 41 ? -15.870 -1.125  -12.358 1.00 2.83  ? 41 ALA A HB2    3  
ATOM 7899  H HB3    . ALA C 2 41 ? -16.824 -2.201  -11.335 1.00 2.57  ? 41 ALA A HB3    3  
ATOM 7900  N N      . MET C 2 42 ? -15.112 -4.256  -12.388 1.00 2.47  ? 42 MET A N      3  
ATOM 7901  C CA     . MET C 2 42 ? -13.835 -4.953  -12.335 1.00 2.49  ? 42 MET A CA     3  
ATOM 7902  C C      . MET C 2 42 ? -13.718 -5.937  -13.494 1.00 2.73  ? 42 MET A C      3  
ATOM 7903  O O      . MET C 2 42 ? -12.632 -6.169  -14.005 1.00 2.88  ? 42 MET A O      3  
ATOM 7904  C CB     . MET C 2 42 ? -13.611 -5.654  -10.993 1.00 2.29  ? 42 MET A CB     3  
ATOM 7905  C CG     . MET C 2 42 ? -14.678 -6.655  -10.619 1.00 2.26  ? 42 MET A CG     3  
ATOM 7906  S SD     . MET C 2 42 ? -14.514 -7.216  -8.920  1.00 2.15  ? 42 MET A SD     3  
ATOM 7907  C CE     . MET C 2 42 ? -14.642 -5.640  -8.088  1.00 2.02  ? 42 MET A CE     3  
ATOM 7908  H H      . MET C 2 42 ? -15.766 -4.382  -11.664 1.00 2.33  ? 42 MET A H      3  
ATOM 7909  H HA     . MET C 2 42 ? -13.067 -4.204  -12.448 1.00 2.55  ? 42 MET A HA     3  
ATOM 7910  H HB2    . MET C 2 42 ? -12.665 -6.172  -11.027 1.00 2.33  ? 42 MET A HB2    3  
ATOM 7911  H HB3    . MET C 2 42 ? -13.567 -4.905  -10.215 1.00 2.19  ? 42 MET A HB3    3  
ATOM 7912  H HG2    . MET C 2 42 ? -15.643 -6.185  -10.732 1.00 2.24  ? 42 MET A HG2    3  
ATOM 7913  H HG3    . MET C 2 42 ? -14.602 -7.502  -11.280 1.00 2.42  ? 42 MET A HG3    3  
ATOM 7914  H HE1    . MET C 2 42 ? -14.067 -4.903  -8.638  1.00 2.48  ? 42 MET A HE1    3  
ATOM 7915  H HE2    . MET C 2 42 ? -14.256 -5.727  -7.083  1.00 2.10  ? 42 MET A HE2    3  
ATOM 7916  H HE3    . MET C 2 42 ? -15.681 -5.335  -8.054  1.00 2.11  ? 42 MET A HE3    3  
ATOM 7917  N N      . ALA C 2 43 ? -14.848 -6.499  -13.908 1.00 2.80  ? 43 ALA A N      3  
ATOM 7918  C CA     . ALA C 2 43 ? -14.860 -7.483  -14.986 1.00 3.09  ? 43 ALA A CA     3  
ATOM 7919  C C      . ALA C 2 43 ? -14.595 -6.818  -16.327 1.00 3.36  ? 43 ALA A C      3  
ATOM 7920  O O      . ALA C 2 43 ? -13.772 -7.285  -17.113 1.00 3.60  ? 43 ALA A O      3  
ATOM 7921  C CB     . ALA C 2 43 ? -16.181 -8.236  -15.021 1.00 3.15  ? 43 ALA A CB     3  
ATOM 7922  H H      . ALA C 2 43 ? -15.707 -6.175  -13.545 1.00 2.69  ? 43 ALA A H      3  
ATOM 7923  H HA     . ALA C 2 43 ? -14.072 -8.196  -14.791 1.00 3.13  ? 43 ALA A HA     3  
ATOM 7924  H HB1    . ALA C 2 43 ? -16.145 -8.992  -15.791 1.00 3.31  ? 43 ALA A HB1    3  
ATOM 7925  H HB2    . ALA C 2 43 ? -16.985 -7.546  -15.232 1.00 3.18  ? 43 ALA A HB2    3  
ATOM 7926  H HB3    . ALA C 2 43 ? -16.353 -8.707  -14.063 1.00 3.47  ? 43 ALA A HB3    3  
ATOM 7927  N N      . GLU C 2 44 ? -15.294 -5.718  -16.571 1.00 3.34  ? 44 GLU A N      3  
ATOM 7928  C CA     . GLU C 2 44 ? -15.153 -4.981  -17.818 1.00 3.63  ? 44 GLU A CA     3  
ATOM 7929  C C      . GLU C 2 44 ? -13.769 -4.366  -17.907 1.00 3.73  ? 44 GLU A C      3  
ATOM 7930  O O      . GLU C 2 44 ? -13.146 -4.350  -18.968 1.00 4.02  ? 44 GLU A O      3  
ATOM 7931  C CB     . GLU C 2 44 ? -16.216 -3.890  -17.910 1.00 3.61  ? 44 GLU A CB     3  
ATOM 7932  C CG     . GLU C 2 44 ? -17.560 -4.297  -17.340 1.00 3.44  ? 44 GLU A CG     3  
ATOM 7933  C CD     . GLU C 2 44 ? -18.732 -4.043  -18.272 1.00 3.74  ? 44 GLU A CD     3  
ATOM 7934  O OE1    . GLU C 2 44 ? -19.106 -2.866  -18.454 1.00 3.86  ? 44 GLU A OE1    3  
ATOM 7935  O OE2    . GLU C 2 44 ? -19.301 -5.020  -18.801 1.00 4.09  ? 44 GLU A OE2    3  
ATOM 7936  H H      . GLU C 2 44 ? -15.922 -5.383  -15.885 1.00 3.15  ? 44 GLU A H      3  
ATOM 7937  H HA     . GLU C 2 44 ? -15.281 -5.676  -18.632 1.00 3.84  ? 44 GLU A HA     3  
ATOM 7938  H HB2    . GLU C 2 44 ? -15.868 -3.035  -17.351 1.00 3.48  ? 44 GLU A HB2    3  
ATOM 7939  H HB3    . GLU C 2 44 ? -16.349 -3.612  -18.943 1.00 3.88  ? 44 GLU A HB3    3  
ATOM 7940  H HG2    . GLU C 2 44 ? -17.527 -5.350  -17.103 1.00 3.33  ? 44 GLU A HG2    3  
ATOM 7941  H HG3    . GLU C 2 44 ? -17.715 -3.735  -16.428 1.00 3.33  ? 44 GLU A HG3    3  
ATOM 7942  N N      . LEU C 2 45 ? -13.290 -3.852  -16.780 1.00 3.50  ? 45 LEU A N      3  
ATOM 7943  C CA     . LEU C 2 45 ? -11.961 -3.250  -16.726 1.00 3.59  ? 45 LEU A CA     3  
ATOM 7944  C C      . LEU C 2 45 ? -10.889 -4.323  -16.574 1.00 3.56  ? 45 LEU A C      3  
ATOM 7945  O O      . LEU C 2 45 ? -9.699  -4.013  -16.520 1.00 3.63  ? 45 LEU A O      3  
ATOM 7946  C CB     . LEU C 2 45 ? -11.848 -2.263  -15.560 1.00 3.41  ? 45 LEU A CB     3  
ATOM 7947  C CG     . LEU C 2 45 ? -12.976 -1.235  -15.442 1.00 3.38  ? 45 LEU A CG     3  
ATOM 7948  C CD1    . LEU C 2 45 ? -12.550 -0.084  -14.544 1.00 3.36  ? 45 LEU A CD1    3  
ATOM 7949  C CD2    . LEU C 2 45 ? -13.403 -0.739  -16.814 1.00 3.71  ? 45 LEU A CD2    3  
ATOM 7950  H H      . LEU C 2 45 ? -13.862 -3.844  -15.974 1.00 3.28  ? 45 LEU A H      3  
ATOM 7951  H HA     . LEU C 2 45 ? -11.797 -2.721  -17.650 1.00 3.85  ? 45 LEU A HA     3  
ATOM 7952  H HB2    . LEU C 2 45 ? -11.815 -2.830  -14.642 1.00 3.17  ? 45 LEU A HB2    3  
ATOM 7953  H HB3    . LEU C 2 45 ? -10.917 -1.727  -15.663 1.00 3.56  ? 45 LEU A HB3    3  
ATOM 7954  H HG     . LEU C 2 45 ? -13.830 -1.711  -14.980 1.00 3.18  ? 45 LEU A HG     3  
ATOM 7955  H HD11   . LEU C 2 45 ? -12.403 -0.451  -13.536 1.00 3.42  ? 45 LEU A HD11   3  
ATOM 7956  H HD12   . LEU C 2 45 ? -13.318 0.675   -14.541 1.00 3.45  ? 45 LEU A HD12   3  
ATOM 7957  H HD13   . LEU C 2 45 ? -11.626 0.339   -14.909 1.00 3.66  ? 45 LEU A HD13   3  
ATOM 7958  H HD21   . LEU C 2 45 ? -13.925 0.200   -16.711 1.00 3.75  ? 45 LEU A HD21   3  
ATOM 7959  H HD22   . LEU C 2 45 ? -14.066 -1.472  -17.264 1.00 4.07  ? 45 LEU A HD22   3  
ATOM 7960  H HD23   . LEU C 2 45 ? -12.534 -0.609  -17.440 1.00 3.93  ? 45 LEU A HD23   3  
ATOM 7961  N N      . ASN C 2 46 ? -11.328 -5.581  -16.502 1.00 3.49  ? 46 ASN A N      3  
ATOM 7962  C CA     . ASN C 2 46 ? -10.440 -6.744  -16.354 1.00 3.50  ? 46 ASN A CA     3  
ATOM 7963  C C      . ASN C 2 46 ? -9.884  -6.836  -14.926 1.00 3.19  ? 46 ASN A C      3  
ATOM 7964  O O      . ASN C 2 46 ? -9.913  -7.905  -14.320 1.00 3.08  ? 46 ASN A O      3  
ATOM 7965  C CB     . ASN C 2 46 ? -9.301  -6.694  -17.379 1.00 3.80  ? 46 ASN A CB     3  
ATOM 7966  C CG     . ASN C 2 46 ? -8.511  -7.988  -17.462 1.00 3.84  ? 46 ASN A CG     3  
ATOM 7967  O OD1    . ASN C 2 46 ? -8.772  -8.833  -18.317 1.00 4.18  ? 46 ASN A OD1    3  
ATOM 7968  N ND2    . ASN C 2 46 ? -7.533  -8.148  -16.583 1.00 3.81  ? 46 ASN A ND2    3  
ATOM 7969  H H      . ASN C 2 46 ? -12.296 -5.738  -16.537 1.00 3.46  ? 46 ASN A H      3  
ATOM 7970  H HA     . ASN C 2 46 ? -11.035 -7.627  -16.542 1.00 3.55  ? 46 ASN A HA     3  
ATOM 7971  H HB2    . ASN C 2 46 ? -9.717  -6.488  -18.353 1.00 4.05  ? 46 ASN A HB2    3  
ATOM 7972  H HB3    . ASN C 2 46 ? -8.630  -5.896  -17.106 1.00 3.81  ? 46 ASN A HB3    3  
ATOM 7973  H HD21   . ASN C 2 46 ? -7.373  -7.435  -15.933 1.00 3.95  ? 46 ASN A HD21   3  
ATOM 7974  H HD22   . ASN C 2 46 ? -7.017  -8.980  -16.615 1.00 3.85  ? 46 ASN A HD22   3  
ATOM 7975  N N      . TYR C 2 47 ? -9.380  -5.707  -14.414 1.00 3.10  ? 47 TYR A N      3  
ATOM 7976  C CA     . TYR C 2 47 ? -8.827  -5.608  -13.056 1.00 2.83  ? 47 TYR A CA     3  
ATOM 7977  C C      . TYR C 2 47 ? -7.814  -6.726  -12.776 1.00 2.81  ? 47 TYR A C      3  
ATOM 7978  O O      . TYR C 2 47 ? -8.100  -7.695  -12.076 1.00 2.91  ? 47 TYR A O      3  
ATOM 7979  C CB     . TYR C 2 47 ? -9.965  -5.604  -12.025 1.00 2.58  ? 47 TYR A CB     3  
ATOM 7980  C CG     . TYR C 2 47 ? -9.556  -5.168  -10.631 1.00 2.35  ? 47 TYR A CG     3  
ATOM 7981  C CD1    . TYR C 2 47 ? -8.335  -4.528  -10.405 1.00 2.39  ? 47 TYR A CD1    3  
ATOM 7982  C CD2    . TYR C 2 47 ? -10.388 -5.386  -9.537  1.00 2.15  ? 47 TYR A CD2    3  
ATOM 7983  C CE1    . TYR C 2 47 ? -7.970  -4.122  -9.137  1.00 2.25  ? 47 TYR A CE1    3  
ATOM 7984  C CE2    . TYR C 2 47 ? -10.027 -4.978  -8.270  1.00 2.03  ? 47 TYR A CE2    3  
ATOM 7985  C CZ     . TYR C 2 47 ? -8.789  -4.387  -8.071  1.00 2.08  ? 47 TYR A CZ     3  
ATOM 7986  O OH     . TYR C 2 47 ? -8.468  -3.933  -6.812  1.00 2.05  ? 47 TYR A OH     3  
ATOM 7987  H H      . TYR C 2 47 ? -9.385  -4.902  -14.976 1.00 3.27  ? 47 TYR A H      3  
ATOM 7988  H HA     . TYR C 2 47 ? -8.306  -4.664  -12.994 1.00 2.91  ? 47 TYR A HA     3  
ATOM 7989  H HB2    . TYR C 2 47 ? -10.730 -4.927  -12.365 1.00 2.65  ? 47 TYR A HB2    3  
ATOM 7990  H HB3    . TYR C 2 47 ? -10.382 -6.596  -11.956 1.00 2.56  ? 47 TYR A HB3    3  
ATOM 7991  H HD1    . TYR C 2 47 ? -7.661  -4.359  -11.237 1.00 2.59  ? 47 TYR A HD1    3  
ATOM 7992  H HD2    . TYR C 2 47 ? -11.334 -5.883  -9.692  1.00 2.15  ? 47 TYR A HD2    3  
ATOM 7993  H HE1    . TYR C 2 47 ? -7.022  -3.628  -8.983  1.00 2.33  ? 47 TYR A HE1    3  
ATOM 7994  H HE2    . TYR C 2 47 ? -10.686 -5.162  -7.434  1.00 1.97  ? 47 TYR A HE2    3  
ATOM 7995  H HH     . TYR C 2 47 ? -8.304  -2.986  -6.822  1.00 2.55  ? 47 TYR A HH     3  
ATOM 7996  N N      . ILE C 2 48 ? -6.627  -6.563  -13.339 1.00 2.82  ? 48 ILE A N      3  
ATOM 7997  C CA     . ILE C 2 48 ? -5.553  -7.535  -13.190 1.00 2.85  ? 48 ILE A CA     3  
ATOM 7998  C C      . ILE C 2 48 ? -4.740  -7.303  -11.904 1.00 2.59  ? 48 ILE A C      3  
ATOM 7999  O O      . ILE C 2 48 ? -4.436  -6.163  -11.546 1.00 2.65  ? 48 ILE A O      3  
ATOM 8000  C CB     . ILE C 2 48 ? -4.623  -7.504  -14.439 1.00 3.25  ? 48 ILE A CB     3  
ATOM 8001  C CG1    . ILE C 2 48 ? -4.028  -8.886  -14.689 1.00 3.41  ? 48 ILE A CG1    3  
ATOM 8002  C CG2    . ILE C 2 48 ? -3.521  -6.455  -14.313 1.00 3.45  ? 48 ILE A CG2    3  
ATOM 8003  C CD1    . ILE C 2 48 ? -5.067  -9.906  -15.084 1.00 3.70  ? 48 ILE A CD1    3  
ATOM 8004  H H      . ILE C 2 48 ? -6.467  -5.766  -13.871 1.00 2.90  ? 48 ILE A H      3  
ATOM 8005  H HA     . ILE C 2 48 ? -6.005  -8.514  -13.138 1.00 2.96  ? 48 ILE A HA     3  
ATOM 8006  H HB     . ILE C 2 48 ? -5.230  -7.234  -15.290 1.00 3.72  ? 48 ILE A HB     3  
ATOM 8007  H HG12   . ILE C 2 48 ? -3.300  -8.821  -15.485 1.00 3.88  ? 48 ILE A HG12   3  
ATOM 8008  H HG13   . ILE C 2 48 ? -3.543  -9.234  -13.789 1.00 3.47  ? 48 ILE A HG13   3  
ATOM 8009  H HG21   . ILE C 2 48 ? -3.965  -5.478  -14.196 1.00 3.52  ? 48 ILE A HG21   3  
ATOM 8010  H HG22   . ILE C 2 48 ? -2.908  -6.468  -15.202 1.00 3.61  ? 48 ILE A HG22   3  
ATOM 8011  H HG23   . ILE C 2 48 ? -2.910  -6.679  -13.451 1.00 3.89  ? 48 ILE A HG23   3  
ATOM 8012  H HD11   . ILE C 2 48 ? -5.221  -9.867  -16.153 1.00 3.98  ? 48 ILE A HD11   3  
ATOM 8013  H HD12   . ILE C 2 48 ? -5.997  -9.675  -14.580 1.00 3.99  ? 48 ILE A HD12   3  
ATOM 8014  H HD13   . ILE C 2 48 ? -4.734  -10.892 -14.800 1.00 3.96  ? 48 ILE A HD13   3  
ATOM 8015  N N      . PRO C 2 49 ? -4.434  -8.387  -11.165 1.00 2.70  ? 49 PRO A N      3  
ATOM 8016  C CA     . PRO C 2 49 ? -3.640  -8.324  -9.942  1.00 2.77  ? 49 PRO A CA     3  
ATOM 8017  C C      . PRO C 2 49 ? -2.151  -8.573  -10.211 1.00 2.92  ? 49 PRO A C      3  
ATOM 8018  O O      . PRO C 2 49 ? -1.706  -8.512  -11.358 1.00 3.54  ? 49 PRO A O      3  
ATOM 8019  C CB     . PRO C 2 49 ? -4.237  -9.461  -9.118  1.00 3.28  ? 49 PRO A CB     3  
ATOM 8020  C CG     . PRO C 2 49 ? -4.655  -10.487 -10.124 1.00 3.60  ? 49 PRO A CG     3  
ATOM 8021  C CD     . PRO C 2 49 ? -4.882  -9.764  -11.434 1.00 3.19  ? 49 PRO A CD     3  
ATOM 8022  H HA     . PRO C 2 49 ? -3.769  -7.385  -9.426  1.00 2.82  ? 49 PRO A HA     3  
ATOM 8023  H HB2    . PRO C 2 49 ? -3.489  -9.850  -8.441  1.00 3.40  ? 49 PRO A HB2    3  
ATOM 8024  H HB3    . PRO C 2 49 ? -5.083  -9.095  -8.554  1.00 3.61  ? 49 PRO A HB3    3  
ATOM 8025  H HG2    . PRO C 2 49 ? -3.873  -11.223 -10.237 1.00 3.91  ? 49 PRO A HG2    3  
ATOM 8026  H HG3    . PRO C 2 49 ? -5.568  -10.963 -9.799  1.00 4.10  ? 49 PRO A HG3    3  
ATOM 8027  H HD2    . PRO C 2 49 ? -4.290  -10.214 -12.218 1.00 3.38  ? 49 PRO A HD2    3  
ATOM 8028  H HD3    . PRO C 2 49 ? -5.930  -9.783  -11.696 1.00 3.35  ? 49 PRO A HD3    3  
ATOM 8029  N N      . ASN C 2 50 ? -1.382  -8.866  -9.161  1.00 2.91  ? 50 ASN A N      3  
ATOM 8030  C CA     . ASN C 2 50 ? 0.051   -9.123  -9.319  1.00 3.44  ? 50 ASN A CA     3  
ATOM 8031  C C      . ASN C 2 50 ? 0.591   -10.031 -8.212  1.00 3.91  ? 50 ASN A C      3  
ATOM 8032  O O      . ASN C 2 50 ? 0.954   -11.177 -8.467  1.00 4.67  ? 50 ASN A O      3  
ATOM 8033  C CB     . ASN C 2 50 ? 0.847   -7.812  -9.344  1.00 3.95  ? 50 ASN A CB     3  
ATOM 8034  C CG     . ASN C 2 50 ? 2.302   -8.026  -9.734  1.00 4.50  ? 50 ASN A CG     3  
ATOM 8035  O OD1    . ASN C 2 50 ? 2.626   -8.929  -10.503 1.00 4.64  ? 50 ASN A OD1    3  
ATOM 8036  N ND2    . ASN C 2 50 ? 3.190   -7.194  -9.207  1.00 5.14  ? 50 ASN A ND2    3  
ATOM 8037  H H      . ASN C 2 50 ? -1.786  -8.924  -8.272  1.00 2.93  ? 50 ASN A H      3  
ATOM 8038  H HA     . ASN C 2 50 ? 0.185   -9.625  -10.266 1.00 3.69  ? 50 ASN A HA     3  
ATOM 8039  H HB2    . ASN C 2 50 ? 0.397   -7.139  -10.059 1.00 4.09  ? 50 ASN A HB2    3  
ATOM 8040  H HB3    . ASN C 2 50 ? 0.817   -7.360  -8.364  1.00 4.21  ? 50 ASN A HB3    3  
ATOM 8041  H HD21   . ASN C 2 50 ? 2.870   -6.492  -8.606  1.00 5.31  ? 50 ASN A HD21   3  
ATOM 8042  H HD22   . ASN C 2 50 ? 4.140   -7.319  -9.444  1.00 5.58  ? 50 ASN A HD22   3  
ATOM 8043  N N      . ARG C 2 51 ? 0.633   -9.520  -6.981  1.00 3.91  ? 51 ARG A N      3  
ATOM 8044  C CA     . ARG C 2 51 ? 1.145   -10.292 -5.854  1.00 4.75  ? 51 ARG A CA     3  
ATOM 8045  C C      . ARG C 2 51 ? 0.025   -11.069 -5.181  1.00 4.81  ? 51 ARG A C      3  
ATOM 8046  O O      . ARG C 2 51 ? -0.070  -12.278 -5.324  1.00 5.41  ? 51 ARG A O      3  
ATOM 8047  C CB     . ARG C 2 51 ? 1.839   -9.362  -4.836  1.00 5.37  ? 51 ARG A CB     3  
ATOM 8048  C CG     . ARG C 2 51 ? 2.069   -9.989  -3.459  1.00 6.42  ? 51 ARG A CG     3  
ATOM 8049  C CD     . ARG C 2 51 ? 2.856   -9.063  -2.539  1.00 7.01  ? 51 ARG A CD     3  
ATOM 8050  N NE     . ARG C 2 51 ? 2.459   -9.187  -1.129  1.00 7.58  ? 51 ARG A NE     3  
ATOM 8051  C CZ     . ARG C 2 51 ? 3.171   -9.839  -0.200  1.00 8.32  ? 51 ARG A CZ     3  
ATOM 8052  N NH1    . ARG C 2 51 ? 4.270   -10.503 -0.542  1.00 8.61  ? 51 ARG A NH1    3  
ATOM 8053  N NH2    . ARG C 2 51 ? 2.783   -9.832  1.074   1.00 9.00  ? 51 ARG A NH2    3  
ATOM 8054  H H      . ARG C 2 51 ? 0.301   -8.617  -6.827  1.00 3.65  ? 51 ARG A H      3  
ATOM 8055  H HA     . ARG C 2 51 ? 1.871   -10.994 -6.237  1.00 5.24  ? 51 ARG A HA     3  
ATOM 8056  H HB2    . ARG C 2 51 ? 2.798   -9.069  -5.235  1.00 5.34  ? 51 ARG A HB2    3  
ATOM 8057  H HB3    . ARG C 2 51 ? 1.232   -8.479  -4.707  1.00 5.40  ? 51 ARG A HB3    3  
ATOM 8058  H HG2    . ARG C 2 51 ? 1.112   -10.198 -3.006  1.00 6.80  ? 51 ARG A HG2    3  
ATOM 8059  H HG3    . ARG C 2 51 ? 2.619   -10.912 -3.582  1.00 6.67  ? 51 ARG A HG3    3  
ATOM 8060  H HD2    . ARG C 2 51 ? 3.905   -9.300  -2.626  1.00 7.11  ? 51 ARG A HD2    3  
ATOM 8061  H HD3    . ARG C 2 51 ? 2.695   -8.042  -2.857  1.00 7.21  ? 51 ARG A HD3    3  
ATOM 8062  H HE     . ARG C 2 51 ? 1.628   -8.734  -0.853  1.00 7.59  ? 51 ARG A HE     3  
ATOM 8063  H HH11   . ARG C 2 51 ? 4.570   -10.523 -1.497  1.00 8.29  ? 51 ARG A HH11   3  
ATOM 8064  H HH12   . ARG C 2 51 ? 4.803   -10.990 0.154   1.00 9.30  ? 51 ARG A HH12   3  
ATOM 8065  H HH21   . ARG C 2 51 ? 1.947   -9.338  1.350   1.00 9.00  ? 51 ARG A HH21   3  
ATOM 8066  H HH22   . ARG C 2 51 ? 3.326   -10.313 1.771   1.00 9.64  ? 51 ARG A HH22   3  
ATOM 8067  N N      . CYS C 2 52 ? -0.834  -10.342 -4.480  1.00 4.54  ? 52 CYS A N      3  
ATOM 8068  C CA     . CYS C 2 52 ? -1.948  -10.923 -3.741  1.00 5.01  ? 52 CYS A CA     3  
ATOM 8069  C C      . CYS C 2 52 ? -2.683  -9.813  -3.035  1.00 5.61  ? 52 CYS A C      3  
ATOM 8070  O O      . CYS C 2 52 ? -3.779  -9.420  -3.429  1.00 5.87  ? 52 CYS A O      3  
ATOM 8071  C CB     . CYS C 2 52 ? -1.439  -11.929 -2.698  1.00 5.05  ? 52 CYS A CB     3  
ATOM 8072  S SG     . CYS C 2 52 ? -1.483  -13.680 -3.209  1.00 4.97  ? 52 CYS A SG     3  
ATOM 8073  H H      . CYS C 2 52 ? -0.719  -9.372  -4.460  1.00 4.29  ? 52 CYS A H      3  
ATOM 8074  H HA     . CYS C 2 52 ? -2.621  -11.406 -4.422  1.00 5.33  ? 52 CYS A HA     3  
ATOM 8075  H HB2    . CYS C 2 52 ? -0.412  -11.689 -2.467  1.00 5.12  ? 52 CYS A HB2    3  
ATOM 8076  H HB3    . CYS C 2 52 ? -2.033  -11.832 -1.801  1.00 5.54  ? 52 CYS A HB3    3  
ATOM 8077  N N      . ALA C 2 53 ? -2.022  -9.278  -2.025  1.00 6.17  ? 53 ALA A N      3  
ATOM 8078  C CA     . ALA C 2 53 ? -2.561  -8.223  -1.206  1.00 7.07  ? 53 ALA A CA     3  
ATOM 8079  C C      . ALA C 2 53 ? -1.527  -7.865  -0.154  1.00 7.73  ? 53 ALA A C      3  
ATOM 8080  O O      . ALA C 2 53 ? -0.344  -8.176  -0.332  1.00 7.95  ? 53 ALA A O      3  
ATOM 8081  C CB     . ALA C 2 53 ? -3.860  -8.695  -0.574  1.00 7.69  ? 53 ALA A CB     3  
ATOM 8082  H H      . ALA C 2 53 ? -1.122  -9.609  -1.822  1.00 6.16  ? 53 ALA A H      3  
ATOM 8083  H HA     . ALA C 2 53 ? -2.761  -7.364  -1.829  1.00 7.09  ? 53 ALA A HA     3  
ATOM 8084  H HB1    . ALA C 2 53 ? -3.655  -9.137  0.387   1.00 7.99  ? 53 ALA A HB1    3  
ATOM 8085  H HB2    . ALA C 2 53 ? -4.309  -9.439  -1.227  1.00 7.63  ? 53 ALA A HB2    3  
ATOM 8086  H HB3    . ALA C 2 53 ? -4.533  -7.860  -0.459  1.00 8.15  ? 53 ALA A HB3    3  
ATOM 8087  N N      . GLN C 2 54 ? -1.951  -7.225  0.928   1.00 8.29  ? 54 GLN A N      3  
ATOM 8088  C CA     . GLN C 2 54 ? -1.028  -6.866  1.997   1.00 9.16  ? 54 GLN A CA     3  
ATOM 8089  C C      . GLN C 2 54 ? -0.471  -8.132  2.646   1.00 10.13 ? 54 GLN A C      3  
ATOM 8090  O O      . GLN C 2 54 ? 0.650   -8.550  2.353   1.00 10.55 ? 54 GLN A O      3  
ATOM 8091  C CB     . GLN C 2 54 ? -1.728  -5.987  3.040   1.00 9.43  ? 54 GLN A CB     3  
ATOM 8092  C CG     . GLN C 2 54 ? -0.828  -5.579  4.199   1.00 9.25  ? 54 GLN A CG     3  
ATOM 8093  C CD     . GLN C 2 54 ? -1.511  -4.632  5.165   1.00 9.60  ? 54 GLN A CD     3  
ATOM 8094  O OE1    . GLN C 2 54 ? -2.329  -3.797  4.766   1.00 9.58  ? 54 GLN A OE1    3  
ATOM 8095  N NE2    . GLN C 2 54 ? -1.193  -4.763  6.442   1.00 10.15 ? 54 GLN A NE2    3  
ATOM 8096  H H      . GLN C 2 54 ? -2.897  -6.985  1.006   1.00 8.28  ? 54 GLN A H      3  
ATOM 8097  H HA     . GLN C 2 54 ? -0.211  -6.311  1.558   1.00 9.14  ? 54 GLN A HA     3  
ATOM 8098  H HB2    . GLN C 2 54 ? -2.086  -5.090  2.558   1.00 9.49  ? 54 GLN A HB2    3  
ATOM 8099  H HB3    . GLN C 2 54 ? -2.571  -6.529  3.443   1.00 9.99  ? 54 GLN A HB3    3  
ATOM 8100  H HG2    . GLN C 2 54 ? -0.533  -6.465  4.738   1.00 9.25  ? 54 GLN A HG2    3  
ATOM 8101  H HG3    . GLN C 2 54 ? 0.050   -5.093  3.801   1.00 9.14  ? 54 GLN A HG3    3  
ATOM 8102  H HE21   . GLN C 2 54 ? -0.543  -5.461  6.693   1.00 10.27 ? 54 GLN A HE21   3  
ATOM 8103  H HE22   . GLN C 2 54 ? -1.617  -4.164  7.088   1.00 10.53 ? 54 GLN A HE22   3  
ATOM 8104  N N      . GLN C 2 55 ? -1.273  -8.757  3.495   1.00 10.65 ? 55 GLN A N      3  
ATOM 8105  C CA     . GLN C 2 55 ? -0.863  -9.977  4.175   1.00 11.73 ? 55 GLN A CA     3  
ATOM 8106  C C      . GLN C 2 55 ? -2.045  -10.932 4.306   1.00 12.00 ? 55 GLN A C      3  
ATOM 8107  O O      . GLN C 2 55 ? -2.099  -11.754 5.222   1.00 12.99 ? 55 GLN A O      3  
ATOM 8108  C CB     . GLN C 2 55 ? -0.290  -9.641  5.556   1.00 12.32 ? 55 GLN A CB     3  
ATOM 8109  C CG     . GLN C 2 55 ? -1.282  -8.946  6.476   1.00 12.31 ? 55 GLN A CG     3  
ATOM 8110  C CD     . GLN C 2 55 ? -0.617  -8.344  7.696   1.00 12.67 ? 55 GLN A CD     3  
ATOM 8111  O OE1    . GLN C 2 55 ? -0.288  -7.159  7.714   1.00 12.67 ? 55 GLN A OE1    3  
ATOM 8112  N NE2    . GLN C 2 55 ? -0.401  -9.160  8.715   1.00 13.16 ? 55 GLN A NE2    3  
ATOM 8113  H H      . GLN C 2 55 ? -2.156  -8.380  3.684   1.00 10.41 ? 55 GLN A H      3  
ATOM 8114  H HA     . GLN C 2 55 ? -0.096  -10.450 3.580   1.00 12.12 ? 55 GLN A HA     3  
ATOM 8115  H HB2    . GLN C 2 55 ? 0.029   -10.556 6.032   1.00 12.65 ? 55 GLN A HB2    3  
ATOM 8116  H HB3    . GLN C 2 55 ? 0.565   -8.994  5.430   1.00 12.66 ? 55 GLN A HB3    3  
ATOM 8117  H HG2    . GLN C 2 55 ? -1.773  -8.158  5.926   1.00 12.13 ? 55 GLN A HG2    3  
ATOM 8118  H HG3    . GLN C 2 55 ? -2.016  -9.667  6.804   1.00 12.42 ? 55 GLN A HG3    3  
ATOM 8119  H HE21   . GLN C 2 55 ? -0.680  -10.097 8.625   1.00 13.26 ? 55 GLN A HE21   3  
ATOM 8120  H HE22   . GLN C 2 55 ? 0.034   -8.796  9.514   1.00 13.52 ? 55 GLN A HE22   3  
ATOM 8121  N N      . LEU C 2 56 ? -2.986  -10.816 3.364   1.00 11.27 ? 56 LEU A N      3  
ATOM 8122  C CA     . LEU C 2 56 ? -4.197  -11.643 3.350   1.00 11.66 ? 56 LEU A CA     3  
ATOM 8123  C C      . LEU C 2 56 ? -5.039  -11.372 4.593   1.00 12.14 ? 56 LEU A C      3  
ATOM 8124  O O      . LEU C 2 56 ? -5.821  -12.213 5.032   1.00 12.14 ? 56 LEU A O      3  
ATOM 8125  C CB     . LEU C 2 56 ? -3.850  -13.135 3.247   1.00 11.55 ? 56 LEU A CB     3  
ATOM 8126  C CG     . LEU C 2 56 ? -3.177  -13.558 1.938   1.00 11.61 ? 56 LEU A CG     3  
ATOM 8127  C CD1    . LEU C 2 56 ? -2.870  -15.047 1.954   1.00 11.79 ? 56 LEU A CD1    3  
ATOM 8128  C CD2    . LEU C 2 56 ? -4.055  -13.209 0.746   1.00 11.84 ? 56 LEU A CD2    3  
ATOM 8129  H H      . LEU C 2 56 ? -2.858  -10.157 2.652   1.00 10.54 ? 56 LEU A H      3  
ATOM 8130  H HA     . LEU C 2 56 ? -4.772  -11.359 2.480   1.00 11.92 ? 56 LEU A HA     3  
ATOM 8131  H HB2    . LEU C 2 56 ? -3.189  -13.386 4.065   1.00 11.37 ? 56 LEU A HB2    3  
ATOM 8132  H HB3    . LEU C 2 56 ? -4.762  -13.703 3.356   1.00 11.82 ? 56 LEU A HB3    3  
ATOM 8133  H HG     . LEU C 2 56 ? -2.242  -13.027 1.833   1.00 11.61 ? 56 LEU A HG     3  
ATOM 8134  H HD11   . LEU C 2 56 ? -2.185  -15.265 2.759   1.00 11.93 ? 56 LEU A HD11   3  
ATOM 8135  H HD12   . LEU C 2 56 ? -2.425  -15.334 1.013   1.00 12.02 ? 56 LEU A HD12   3  
ATOM 8136  H HD13   . LEU C 2 56 ? -3.787  -15.602 2.102   1.00 11.75 ? 56 LEU A HD13   3  
ATOM 8137  H HD21   . LEU C 2 56 ? -4.994  -13.737 0.822   1.00 11.95 ? 56 LEU A HD21   3  
ATOM 8138  H HD22   . LEU C 2 56 ? -3.554  -13.496 -0.168  1.00 12.01 ? 56 LEU A HD22   3  
ATOM 8139  H HD23   . LEU C 2 56 ? -4.240  -12.145 0.735   1.00 11.93 ? 56 LEU A HD23   3  
ATOM 8140  N N      . ALA C 2 57 ? -4.866  -10.176 5.139   1.00 12.72 ? 57 ALA A N      3  
ATOM 8141  C CA     . ALA C 2 57 ? -5.580  -9.741  6.323   1.00 13.38 ? 57 ALA A CA     3  
ATOM 8142  C C      . ALA C 2 57 ? -5.571  -8.220  6.382   1.00 13.99 ? 57 ALA A C      3  
ATOM 8143  O O      . ALA C 2 57 ? -4.949  -7.571  5.536   1.00 14.14 ? 57 ALA A O      3  
ATOM 8144  C CB     . ALA C 2 57 ? -4.950  -10.330 7.579   1.00 13.95 ? 57 ALA A CB     3  
ATOM 8145  H H      . ALA C 2 57 ? -4.237  -9.556  4.722   1.00 12.82 ? 57 ALA A H      3  
ATOM 8146  H HA     . ALA C 2 57 ? -6.600  -10.088 6.253   1.00 13.20 ? 57 ALA A HA     3  
ATOM 8147  H HB1    . ALA C 2 57 ? -4.960  -11.408 7.513   1.00 14.13 ? 57 ALA A HB1    3  
ATOM 8148  H HB2    . ALA C 2 57 ? -5.513  -10.016 8.444   1.00 14.02 ? 57 ALA A HB2    3  
ATOM 8149  H HB3    . ALA C 2 57 ? -3.931  -9.983  7.665   1.00 14.26 ? 57 ALA A HB3    3  
ATOM 8150  N N      . GLY C 2 58 ? -6.246  -7.663  7.375   1.00 14.49 ? 58 GLY A N      3  
ATOM 8151  C CA     . GLY C 2 58 ? -6.300  -6.223  7.518   1.00 15.23 ? 58 GLY A CA     3  
ATOM 8152  C C      . GLY C 2 58 ? -5.064  -5.657  8.187   1.00 15.72 ? 58 GLY A C      3  
ATOM 8153  O O      . GLY C 2 58 ? -4.123  -6.392  8.496   1.00 16.04 ? 58 GLY A O      3  
ATOM 8154  H H      . GLY C 2 58 ? -6.710  -8.233  8.020   1.00 14.44 ? 58 GLY A H      3  
ATOM 8155  H HA2    . GLY C 2 58 ? -6.401  -5.779  6.538   1.00 15.36 ? 58 GLY A HA2    3  
ATOM 8156  H HA3    . GLY C 2 58 ? -7.167  -5.963  8.108   1.00 15.45 ? 58 GLY A HA3    3  
ATOM 8157  N N      . LYS C 2 59 ? -5.067  -4.354  8.418   1.00 15.93 ? 59 LYS A N      3  
ATOM 8158  C CA     . LYS C 2 59 ? -3.938  -3.692  9.052   1.00 16.57 ? 59 LYS A CA     3  
ATOM 8159  C C      . LYS C 2 59 ? -4.030  -3.803  10.568  1.00 17.24 ? 59 LYS A C      3  
ATOM 8160  O O      . LYS C 2 59 ? -4.645  -2.965  11.226  1.00 17.61 ? 59 LYS A O      3  
ATOM 8161  C CB     . LYS C 2 59 ? -3.875  -2.223  8.630   1.00 16.45 ? 59 LYS A CB     3  
ATOM 8162  C CG     . LYS C 2 59 ? -3.425  -2.031  7.195   1.00 16.73 ? 59 LYS A CG     3  
ATOM 8163  C CD     . LYS C 2 59 ? -3.621  -0.601  6.729   1.00 17.03 ? 59 LYS A CD     3  
ATOM 8164  C CE     . LYS C 2 59 ? -3.057  -0.394  5.332   1.00 17.57 ? 59 LYS A CE     3  
ATOM 8165  N NZ     . LYS C 2 59 ? -3.590  -1.388  4.361   1.00 17.80 ? 59 LYS A NZ     3  
ATOM 8166  H H      . LYS C 2 59 ? -5.850  -3.825  8.165   1.00 15.76 ? 59 LYS A H      3  
ATOM 8167  H HA     . LYS C 2 59 ? -3.037  -4.188  8.723   1.00 16.82 ? 59 LYS A HA     3  
ATOM 8168  H HB2    . LYS C 2 59 ? -4.857  -1.786  8.740   1.00 16.25 ? 59 LYS A HB2    3  
ATOM 8169  H HB3    . LYS C 2 59 ? -3.183  -1.703  9.276   1.00 16.52 ? 59 LYS A HB3    3  
ATOM 8170  H HG2    . LYS C 2 59 ? -2.378  -2.280  7.121   1.00 16.83 ? 59 LYS A HG2    3  
ATOM 8171  H HG3    . LYS C 2 59 ? -3.997  -2.690  6.558   1.00 16.76 ? 59 LYS A HG3    3  
ATOM 8172  H HD2    . LYS C 2 59 ? -4.677  -0.376  6.717   1.00 16.96 ? 59 LYS A HD2    3  
ATOM 8173  H HD3    . LYS C 2 59 ? -3.116  0.065   7.413   1.00 17.06 ? 59 LYS A HD3    3  
ATOM 8174  H HE2    . LYS C 2 59 ? -3.318  0.598   4.996   1.00 17.89 ? 59 LYS A HE2    3  
ATOM 8175  H HE3    . LYS C 2 59 ? -1.982  -0.487  5.375   1.00 17.63 ? 59 LYS A HE3    3  
ATOM 8176  H HZ1    . LYS C 2 59 ? -3.178  -2.330  4.549   1.00 17.98 ? 59 LYS A HZ1    3  
ATOM 8177  H HZ2    . LYS C 2 59 ? -3.350  -1.105  3.392   1.00 17.82 ? 59 LYS A HZ2    3  
ATOM 8178  H HZ3    . LYS C 2 59 ? -4.628  -1.455  4.446   1.00 17.91 ? 59 LYS A HZ3    3  
ATOM 8179  N N      . GLN C 2 60 ? -3.436  -4.856  11.109  1.00 17.53 ? 60 GLN A N      3  
ATOM 8180  C CA     . GLN C 2 60 ? -3.442  -5.078  12.545  1.00 18.30 ? 60 GLN A CA     3  
ATOM 8181  C C      . GLN C 2 60 ? -2.514  -4.088  13.241  1.00 18.80 ? 60 GLN A C      3  
ATOM 8182  O O      . GLN C 2 60 ? -1.291  -4.208  13.165  1.00 18.98 ? 60 GLN A O      3  
ATOM 8183  C CB     . GLN C 2 60 ? -3.012  -6.509  12.876  1.00 18.40 ? 60 GLN A CB     3  
ATOM 8184  C CG     . GLN C 2 60 ? -4.106  -7.355  13.516  1.00 18.96 ? 60 GLN A CG     3  
ATOM 8185  C CD     . GLN C 2 60 ? -4.795  -6.664  14.682  1.00 19.28 ? 60 GLN A CD     3  
ATOM 8186  O OE1    . GLN C 2 60 ? -4.234  -5.774  15.321  1.00 19.33 ? 60 GLN A OE1    3  
ATOM 8187  N NE2    . GLN C 2 60 ? -6.013  -7.084  14.981  1.00 19.61 ? 60 GLN A NE2    3  
ATOM 8188  H H      . GLN C 2 60 ? -2.984  -5.501  10.527  1.00 17.29 ? 60 GLN A H      3  
ATOM 8189  H HA     . GLN C 2 60 ? -4.449  -4.920  12.901  1.00 18.59 ? 60 GLN A HA     3  
ATOM 8190  H HB2    . GLN C 2 60 ? -2.699  -6.997  11.965  1.00 17.92 ? 60 GLN A HB2    3  
ATOM 8191  H HB3    . GLN C 2 60 ? -2.174  -6.471  13.556  1.00 18.67 ? 60 GLN A HB3    3  
ATOM 8192  H HG2    . GLN C 2 60 ? -4.849  -7.584  12.767  1.00 19.26 ? 60 GLN A HG2    3  
ATOM 8193  H HG3    . GLN C 2 60 ? -3.666  -8.275  13.874  1.00 18.98 ? 60 GLN A HG3    3  
ATOM 8194  H HE21   . GLN C 2 60 ? -6.400  -7.815  14.442  1.00 19.63 ? 60 GLN A HE21   3  
ATOM 8195  H HE22   . GLN C 2 60 ? -6.480  -6.655  15.726  1.00 19.89 ? 60 GLN A HE22   3  
ATOM 8196  N N      . SER C 2 61 ? -3.105  -3.108  13.908  1.00 19.13 ? 61 SER A N      3  
ATOM 8197  C CA     . SER C 2 61 ? -2.346  -2.099  14.627  1.00 19.73 ? 61 SER A CA     3  
ATOM 8198  C C      . SER C 2 61 ? -1.922  -2.619  16.000  1.00 20.17 ? 61 SER A C      3  
ATOM 8199  O O      . SER C 2 61 ? -1.240  -1.926  16.759  1.00 20.57 ? 61 SER A O      3  
ATOM 8200  C CB     . SER C 2 61 ? -3.193  -0.836  14.774  1.00 20.14 ? 61 SER A CB     3  
ATOM 8201  O OG     . SER C 2 61 ? -4.466  -1.014  14.170  1.00 19.84 ? 61 SER A OG     3  
ATOM 8202  H H      . SER C 2 61 ? -4.086  -3.050  13.905  1.00 19.06 ? 61 SER A H      3  
ATOM 8203  H HA     . SER C 2 61 ? -1.463  -1.868  14.049  1.00 19.70 ? 61 SER A HA     3  
ATOM 8204  H HB2    . SER C 2 61 ? -3.331  -0.615  15.823  1.00 20.52 ? 61 SER A HB2    3  
ATOM 8205  H HB3    . SER C 2 61 ? -2.692  -0.008  14.293  1.00 20.42 ? 61 SER A HB3    3  
ATOM 8206  H HG     . SER C 2 61 ? -4.440  -0.691  13.264  1.00 19.90 ? 61 SER A HG     3  
ATOM 8207  N N      . LEU C 2 62 ? -2.334  -3.841  16.309  1.00 20.21 ? 62 LEU A N      3  
ATOM 8208  C CA     . LEU C 2 62 ? -2.007  -4.468  17.581  1.00 20.74 ? 62 LEU A CA     3  
ATOM 8209  C C      . LEU C 2 62 ? -1.659  -5.937  17.370  1.00 20.91 ? 62 LEU A C      3  
ATOM 8210  O O      . LEU C 2 62 ? -1.327  -6.348  16.256  1.00 20.68 ? 62 LEU A O      3  
ATOM 8211  C CB     . LEU C 2 62 ? -3.184  -4.341  18.554  1.00 21.23 ? 62 LEU A CB     3  
ATOM 8212  C CG     . LEU C 2 62 ? -2.915  -4.851  19.972  1.00 21.58 ? 62 LEU A CG     3  
ATOM 8213  C CD1    . LEU C 2 62 ? -1.864  -3.994  20.661  1.00 21.89 ? 62 LEU A CD1    3  
ATOM 8214  C CD2    . LEU C 2 62 ? -4.203  -4.871  20.782  1.00 21.76 ? 62 LEU A CD2    3  
ATOM 8215  H H      . LEU C 2 62 ? -2.870  -4.344  15.657  1.00 19.96 ? 62 LEU A H      3  
ATOM 8216  H HA     . LEU C 2 62 ? -1.149  -3.958  17.994  1.00 20.79 ? 62 LEU A HA     3  
ATOM 8217  H HB2    . LEU C 2 62 ? -3.460  -3.298  18.615  1.00 21.20 ? 62 LEU A HB2    3  
ATOM 8218  H HB3    . LEU C 2 62 ? -4.018  -4.892  18.150  1.00 21.50 ? 62 LEU A HB3    3  
ATOM 8219  H HG     . LEU C 2 62 ? -2.539  -5.862  19.918  1.00 21.60 ? 62 LEU A HG     3  
ATOM 8220  H HD11   . LEU C 2 62 ? -2.211  -2.973  20.715  1.00 21.79 ? 62 LEU A HD11   3  
ATOM 8221  H HD12   . LEU C 2 62 ? -0.943  -4.032  20.097  1.00 22.18 ? 62 LEU A HD12   3  
ATOM 8222  H HD13   . LEU C 2 62 ? -1.691  -4.370  21.658  1.00 22.04 ? 62 LEU A HD13   3  
ATOM 8223  H HD21   . LEU C 2 62 ? -3.995  -5.221  21.781  1.00 21.91 ? 62 LEU A HD21   3  
ATOM 8224  H HD22   . LEU C 2 62 ? -4.915  -5.533  20.310  1.00 21.83 ? 62 LEU A HD22   3  
ATOM 8225  H HD23   . LEU C 2 62 ? -4.615  -3.874  20.828  1.00 21.79 ? 62 LEU A HD23   3  
ATOM 8226  N N      . MET D 2 1  ? -1.157  -12.212 7.933   1.00 7.49  ? 1  MET B N      3  
ATOM 8227  C CA     . MET D 2 1  ? -0.789  -13.196 8.946   1.00 7.49  ? 1  MET B CA     3  
ATOM 8228  C C      . MET D 2 1  ? -0.419  -14.527 8.301   1.00 6.82  ? 1  MET B C      3  
ATOM 8229  O O      . MET D 2 1  ? -0.286  -15.543 8.979   1.00 7.04  ? 1  MET B O      3  
ATOM 8230  C CB     . MET D 2 1  ? -1.932  -13.395 9.943   1.00 8.28  ? 1  MET B CB     3  
ATOM 8231  C CG     . MET D 2 1  ? -2.131  -12.217 10.882  1.00 8.90  ? 1  MET B CG     3  
ATOM 8232  S SD     . MET D 2 1  ? -3.431  -12.505 12.099  1.00 9.76  ? 1  MET B SD     3  
ATOM 8233  C CE     . MET D 2 1  ? -2.695  -13.810 13.083  1.00 10.35 ? 1  MET B CE     3  
ATOM 8234  H H1     . MET D 2 1  ? -1.973  -12.351 7.402   1.00 7.72  ? 1  MET B H1     3  
ATOM 8235  H HA     . MET D 2 1  ? 0.073   -12.817 9.474   1.00 7.71  ? 1  MET B HA     3  
ATOM 8236  H HB2    . MET D 2 1  ? -2.850  -13.550 9.395   1.00 8.55  ? 1  MET B HB2    3  
ATOM 8237  H HB3    . MET D 2 1  ? -1.725  -14.272 10.538  1.00 8.42  ? 1  MET B HB3    3  
ATOM 8238  H HG2    . MET D 2 1  ? -1.204  -12.031 11.405  1.00 9.10  ? 1  MET B HG2    3  
ATOM 8239  H HG3    . MET D 2 1  ? -2.391  -11.348 10.296  1.00 8.90  ? 1  MET B HG3    3  
ATOM 8240  H HE1    . MET D 2 1  ? -2.521  -14.676 12.463  1.00 10.47 ? 1  MET B HE1    3  
ATOM 8241  H HE2    . MET D 2 1  ? -3.366  -14.074 13.889  1.00 10.35 ? 1  MET B HE2    3  
ATOM 8242  H HE3    . MET D 2 1  ? -1.757  -13.466 13.495  1.00 10.83 ? 1  MET B HE3    3  
ATOM 8243  N N      . LYS D 2 2  ? -0.261  -14.510 6.985   1.00 6.25  ? 2  LYS B N      3  
ATOM 8244  C CA     . LYS D 2 2  ? 0.109   -15.709 6.243   1.00 5.74  ? 2  LYS B CA     3  
ATOM 8245  C C      . LYS D 2 2  ? 1.383   -15.463 5.424   1.00 4.89  ? 2  LYS B C      3  
ATOM 8246  O O      . LYS D 2 2  ? 2.382   -16.153 5.617   1.00 4.98  ? 2  LYS B O      3  
ATOM 8247  C CB     . LYS D 2 2  ? -1.037  -16.190 5.337   1.00 6.32  ? 2  LYS B CB     3  
ATOM 8248  C CG     . LYS D 2 2  ? -2.188  -16.856 6.078   1.00 6.84  ? 2  LYS B CG     3  
ATOM 8249  C CD     . LYS D 2 2  ? -3.197  -17.445 5.104   1.00 7.40  ? 2  LYS B CD     3  
ATOM 8250  C CE     . LYS D 2 2  ? -4.445  -17.962 5.810   1.00 7.79  ? 2  LYS B CE     3  
ATOM 8251  N NZ     . LYS D 2 2  ? -4.213  -19.265 6.493   1.00 8.33  ? 2  LYS B NZ     3  
ATOM 8252  H H      . LYS D 2 2  ? -0.378  -13.665 6.503   1.00 6.35  ? 2  LYS B H      3  
ATOM 8253  H HA     . LYS D 2 2  ? 0.321   -16.482 6.969   1.00 5.83  ? 2  LYS B HA     3  
ATOM 8254  H HB2    . LYS D 2 2  ? -1.431  -15.342 4.798   1.00 6.66  ? 2  LYS B HB2    3  
ATOM 8255  H HB3    . LYS D 2 2  ? -0.640  -16.901 4.625   1.00 6.35  ? 2  LYS B HB3    3  
ATOM 8256  H HG2    . LYS D 2 2  ? -1.796  -17.648 6.700   1.00 6.92  ? 2  LYS B HG2    3  
ATOM 8257  H HG3    . LYS D 2 2  ? -2.681  -16.119 6.695   1.00 7.09  ? 2  LYS B HG3    3  
ATOM 8258  H HD2    . LYS D 2 2  ? -3.490  -16.681 4.400   1.00 7.57  ? 2  LYS B HD2    3  
ATOM 8259  H HD3    . LYS D 2 2  ? -2.733  -18.263 4.572   1.00 7.68  ? 2  LYS B HD3    3  
ATOM 8260  H HE2    . LYS D 2 2  ? -4.751  -17.233 6.545   1.00 7.81  ? 2  LYS B HE2    3  
ATOM 8261  H HE3    . LYS D 2 2  ? -5.229  -18.084 5.079   1.00 7.98  ? 2  LYS B HE3    3  
ATOM 8262  H HZ1    . LYS D 2 2  ? -5.120  -19.662 6.824   1.00 8.70  ? 2  LYS B HZ1    3  
ATOM 8263  H HZ2    . LYS D 2 2  ? -3.588  -19.134 7.319   1.00 8.54  ? 2  LYS B HZ2    3  
ATOM 8264  H HZ3    . LYS D 2 2  ? -3.767  -19.947 5.840   1.00 8.40  ? 2  LYS B HZ3    3  
ATOM 8265  N N      . PRO D 2 3  ? 1.383   -14.487 4.488   1.00 4.30  ? 3  PRO B N      3  
ATOM 8266  C CA     . PRO D 2 3  ? 2.551   -14.181 3.683   1.00 3.77  ? 3  PRO B CA     3  
ATOM 8267  C C      . PRO D 2 3  ? 3.400   -13.065 4.287   1.00 3.57  ? 3  PRO B C      3  
ATOM 8268  O O      . PRO D 2 3  ? 2.875   -12.089 4.822   1.00 3.91  ? 3  PRO B O      3  
ATOM 8269  C CB     . PRO D 2 3  ? 1.945   -13.726 2.348   1.00 3.70  ? 3  PRO B CB     3  
ATOM 8270  C CG     . PRO D 2 3  ? 0.506   -13.398 2.629   1.00 4.09  ? 3  PRO B CG     3  
ATOM 8271  C CD     . PRO D 2 3  ? 0.269   -13.615 4.105   1.00 4.49  ? 3  PRO B CD     3  
ATOM 8272  H HA     . PRO D 2 3  ? 3.164   -15.055 3.524   1.00 3.93  ? 3  PRO B HA     3  
ATOM 8273  H HB2    . PRO D 2 3  ? 2.480   -12.860 1.991   1.00 3.78  ? 3  PRO B HB2    3  
ATOM 8274  H HB3    . PRO D 2 3  ? 2.030   -14.525 1.627   1.00 3.71  ? 3  PRO B HB3    3  
ATOM 8275  H HG2    . PRO D 2 3  ? 0.313   -12.369 2.373   1.00 4.37  ? 3  PRO B HG2    3  
ATOM 8276  H HG3    . PRO D 2 3  ? -0.133  -14.050 2.051   1.00 4.15  ? 3  PRO B HG3    3  
ATOM 8277  H HD2    . PRO D 2 3  ? 0.312   -12.678 4.637   1.00 4.75  ? 3  PRO B HD2    3  
ATOM 8278  H HD3    . PRO D 2 3  ? -0.678  -14.105 4.269   1.00 4.88  ? 3  PRO B HD3    3  
ATOM 8279  N N      . VAL D 2 4  ? 4.711   -13.231 4.194   1.00 3.16  ? 4  VAL B N      3  
ATOM 8280  C CA     . VAL D 2 4  ? 5.667   -12.257 4.706   1.00 2.98  ? 4  VAL B CA     3  
ATOM 8281  C C      . VAL D 2 4  ? 5.531   -10.917 4.010   1.00 2.72  ? 4  VAL B C      3  
ATOM 8282  O O      . VAL D 2 4  ? 5.165   -10.823 2.832   1.00 2.56  ? 4  VAL B O      3  
ATOM 8283  C CB     . VAL D 2 4  ? 7.111   -12.745 4.496   1.00 2.87  ? 4  VAL B CB     3  
ATOM 8284  C CG1    . VAL D 2 4  ? 8.123   -11.760 5.058   1.00 2.71  ? 4  VAL B CG1    3  
ATOM 8285  C CG2    . VAL D 2 4  ? 7.293   -14.101 5.123   1.00 3.14  ? 4  VAL B CG2    3  
ATOM 8286  H H      . VAL D 2 4  ? 5.052   -14.040 3.765   1.00 3.11  ? 4  VAL B H      3  
ATOM 8287  H HA     . VAL D 2 4  ? 5.520   -12.121 5.777   1.00 3.16  ? 4  VAL B HA     3  
ATOM 8288  H HB     . VAL D 2 4  ? 7.281   -12.831 3.440   1.00 2.76  ? 4  VAL B HB     3  
ATOM 8289  H HG11   . VAL D 2 4  ? 7.969   -11.647 6.123   1.00 2.95  ? 4  VAL B HG11   3  
ATOM 8290  H HG12   . VAL D 2 4  ? 7.996   -10.797 4.575   1.00 2.74  ? 4  VAL B HG12   3  
ATOM 8291  H HG13   . VAL D 2 4  ? 9.122   -12.123 4.874   1.00 2.90  ? 4  VAL B HG13   3  
ATOM 8292  H HG21   . VAL D 2 4  ? 7.221   -14.008 6.195   1.00 3.44  ? 4  VAL B HG21   3  
ATOM 8293  H HG22   . VAL D 2 4  ? 8.264   -14.493 4.857   1.00 3.30  ? 4  VAL B HG22   3  
ATOM 8294  H HG23   . VAL D 2 4  ? 6.524   -14.769 4.766   1.00 3.34  ? 4  VAL B HG23   3  
ATOM 8295  N N      . THR D 2 5  ? 5.816   -9.903  4.772   1.00 2.76  ? 5  THR B N      3  
ATOM 8296  C CA     . THR D 2 5  ? 5.829   -8.542  4.310   1.00 2.63  ? 5  THR B CA     3  
ATOM 8297  C C      . THR D 2 5  ? 7.287   -8.183  4.108   1.00 2.52  ? 5  THR B C      3  
ATOM 8298  O O      . THR D 2 5  ? 8.139   -8.709  4.816   1.00 2.57  ? 5  THR B O      3  
ATOM 8299  C CB     . THR D 2 5  ? 5.196   -7.610  5.361   1.00 2.87  ? 5  THR B CB     3  
ATOM 8300  O OG1    . THR D 2 5  ? 4.470   -8.386  6.324   1.00 3.17  ? 5  THR B OG1    3  
ATOM 8301  C CG2    . THR D 2 5  ? 4.254   -6.616  4.709   1.00 2.93  ? 5  THR B CG2    3  
ATOM 8302  H H      . THR D 2 5  ? 6.039   -10.085 5.708   1.00 2.93  ? 5  THR B H      3  
ATOM 8303  H HA     . THR D 2 5  ? 5.297   -8.464  3.372   1.00 2.49  ? 5  THR B HA     3  
ATOM 8304  H HB     . THR D 2 5  ? 5.982   -7.063  5.863   1.00 2.97  ? 5  THR B HB     3  
ATOM 8305  H HG1    . THR D 2 5  ? 5.058   -8.622  7.069   1.00 3.17  ? 5  THR B HG1    3  
ATOM 8306  H HG21   . THR D 2 5  ? 4.797   -6.027  3.987   1.00 3.24  ? 5  THR B HG21   3  
ATOM 8307  H HG22   . THR D 2 5  ? 3.838   -5.966  5.465   1.00 3.19  ? 5  THR B HG22   3  
ATOM 8308  H HG23   . THR D 2 5  ? 3.459   -7.151  4.214   1.00 2.94  ? 5  THR B HG23   3  
ATOM 8309  N N      . LEU D 2 6  ? 7.611   -7.336  3.148   1.00 2.40  ? 6  LEU B N      3  
ATOM 8310  C CA     . LEU D 2 6  ? 9.015   -6.987  2.951   1.00 2.35  ? 6  LEU B CA     3  
ATOM 8311  C C      . LEU D 2 6  ? 9.589   -6.369  4.226   1.00 2.56  ? 6  LEU B C      3  
ATOM 8312  O O      . LEU D 2 6  ? 10.793  -6.394  4.462   1.00 2.56  ? 6  LEU B O      3  
ATOM 8313  C CB     . LEU D 2 6  ? 9.189   -6.074  1.753   1.00 2.33  ? 6  LEU B CB     3  
ATOM 8314  C CG     . LEU D 2 6  ? 10.012  -6.654  0.618   1.00 2.21  ? 6  LEU B CG     3  
ATOM 8315  C CD1    . LEU D 2 6  ? 10.229  -5.614  -0.466  1.00 2.35  ? 6  LEU B CD1    3  
ATOM 8316  C CD2    . LEU D 2 6  ? 11.334  -7.169  1.140   1.00 2.15  ? 6  LEU B CD2    3  
ATOM 8317  H H      . LEU D 2 6  ? 6.913   -6.949  2.565   1.00 2.38  ? 6  LEU B H      3  
ATOM 8318  H HA     . LEU D 2 6  ? 9.547   -7.900  2.764   1.00 2.25  ? 6  LEU B HA     3  
ATOM 8319  H HB2    . LEU D 2 6  ? 8.207   -5.827  1.375   1.00 2.34  ? 6  LEU B HB2    3  
ATOM 8320  H HB3    . LEU D 2 6  ? 9.675   -5.170  2.084   1.00 2.47  ? 6  LEU B HB3    3  
ATOM 8321  H HG     . LEU D 2 6  ? 9.474   -7.482  0.190   1.00 2.13  ? 6  LEU B HG     3  
ATOM 8322  H HD11   . LEU D 2 6  ? 10.681  -4.733  -0.030  1.00 2.50  ? 6  LEU B HD11   3  
ATOM 8323  H HD12   . LEU D 2 6  ? 9.281   -5.350  -0.909  1.00 2.75  ? 6  LEU B HD12   3  
ATOM 8324  H HD13   . LEU D 2 6  ? 10.885  -6.014  -1.224  1.00 2.54  ? 6  LEU B HD13   3  
ATOM 8325  H HD21   . LEU D 2 6  ? 11.982  -6.332  1.362   1.00 2.43  ? 6  LEU B HD21   3  
ATOM 8326  H HD22   . LEU D 2 6  ? 11.801  -7.797  0.396   1.00 2.57  ? 6  LEU B HD22   3  
ATOM 8327  H HD23   . LEU D 2 6  ? 11.170  -7.740  2.042   1.00 2.08  ? 6  LEU B HD23   3  
ATOM 8328  N N      . TYR D 2 7  ? 8.692   -5.838  5.043   1.00 2.79  ? 7  TYR B N      3  
ATOM 8329  C CA     . TYR D 2 7  ? 9.042   -5.251  6.335   1.00 3.08  ? 7  TYR B CA     3  
ATOM 8330  C C      . TYR D 2 7  ? 9.616   -6.333  7.251   1.00 3.12  ? 7  TYR B C      3  
ATOM 8331  O O      . TYR D 2 7  ? 10.556  -6.110  8.007   1.00 3.25  ? 7  TYR B O      3  
ATOM 8332  C CB     . TYR D 2 7  ? 7.783   -4.668  6.988   1.00 3.33  ? 7  TYR B CB     3  
ATOM 8333  C CG     . TYR D 2 7  ? 7.675   -3.163  6.983   1.00 3.53  ? 7  TYR B CG     3  
ATOM 8334  C CD1    . TYR D 2 7  ? 8.781   -2.400  6.647   1.00 3.59  ? 7  TYR B CD1    3  
ATOM 8335  C CD2    . TYR D 2 7  ? 6.490   -2.501  7.295   1.00 3.70  ? 7  TYR B CD2    3  
ATOM 8336  C CE1    . TYR D 2 7  ? 8.719   -1.026  6.620   1.00 3.84  ? 7  TYR B CE1    3  
ATOM 8337  C CE2    . TYR D 2 7  ? 6.423   -1.124  7.271   1.00 3.93  ? 7  TYR B CE2    3  
ATOM 8338  C CZ     . TYR D 2 7  ? 7.411   -0.401  7.019   1.00 4.03  ? 7  TYR B CZ     3  
ATOM 8339  O OH     . TYR D 2 7  ? 7.476   0.980   6.902   1.00 4.28  ? 7  TYR B OH     3  
ATOM 8340  H H      . TYR D 2 7  ? 7.756   -5.847  4.767   1.00 2.78  ? 7  TYR B H      3  
ATOM 8341  H HA     . TYR D 2 7  ? 9.772   -4.477  6.182   1.00 3.13  ? 7  TYR B HA     3  
ATOM 8342  H HB2    . TYR D 2 7  ? 6.916   -5.043  6.467   1.00 3.22  ? 7  TYR B HB2    3  
ATOM 8343  H HB3    . TYR D 2 7  ? 7.740   -4.998  8.015   1.00 3.51  ? 7  TYR B HB3    3  
ATOM 8344  H HD1    . TYR D 2 7  ? 9.707   -2.901  6.405   1.00 3.48  ? 7  TYR B HD1    3  
ATOM 8345  H HD2    . TYR D 2 7  ? 5.616   -3.070  7.569   1.00 3.69  ? 7  TYR B HD2    3  
ATOM 8346  H HE1    . TYR D 2 7  ? 9.593   -0.455  6.356   1.00 3.93  ? 7  TYR B HE1    3  
ATOM 8347  H HE2    . TYR D 2 7  ? 5.498   -0.626  7.517   1.00 4.07  ? 7  TYR B HE2    3  
ATOM 8348  H HH     . TYR D 2 7  ? 8.126   1.312   6.279   1.00 4.42  ? 7  TYR B HH     3  
ATOM 8349  N N      . ASP D 2 8  ? 9.020   -7.507  7.130   1.00 3.03  ? 8  ASP B N      3  
ATOM 8350  C CA     . ASP D 2 8  ? 9.368   -8.690  7.908   1.00 3.14  ? 8  ASP B CA     3  
ATOM 8351  C C      . ASP D 2 8  ? 10.750  -9.170  7.526   1.00 2.96  ? 8  ASP B C      3  
ATOM 8352  O O      . ASP D 2 8  ? 11.561  -9.521  8.380   1.00 3.10  ? 8  ASP B O      3  
ATOM 8353  C CB     . ASP D 2 8  ? 8.296   -9.771  7.677   1.00 3.13  ? 8  ASP B CB     3  
ATOM 8354  C CG     . ASP D 2 8  ? 7.155   -9.654  8.663   1.00 3.41  ? 8  ASP B CG     3  
ATOM 8355  O OD1    . ASP D 2 8  ? 7.338   -10.024 9.845   1.00 3.77  ? 8  ASP B OD1    3  
ATOM 8356  O OD2    . ASP D 2 8  ? 6.075   -9.178  8.252   1.00 3.29  ? 8  ASP B OD2    3  
ATOM 8357  H H      . ASP D 2 8  ? 8.349   -7.601  6.439   1.00 2.92  ? 8  ASP B H      3  
ATOM 8358  H HA     . ASP D 2 8  ? 9.375   -8.425  8.947   1.00 3.38  ? 8  ASP B HA     3  
ATOM 8359  H HB2    . ASP D 2 8  ? 7.889   -9.645  6.685   1.00 2.91  ? 8  ASP B HB2    3  
ATOM 8360  H HB3    . ASP D 2 8  ? 8.717   -10.761 7.753   1.00 3.19  ? 8  ASP B HB3    3  
ATOM 8361  N N      . VAL D 2 9  ? 11.017  -9.152  6.231   1.00 2.68  ? 9  VAL B N      3  
ATOM 8362  C CA     . VAL D 2 9  ? 12.293  -9.573  5.711   1.00 2.52  ? 9  VAL B CA     3  
ATOM 8363  C C      . VAL D 2 9  ? 13.355  -8.579  6.122   1.00 2.58  ? 9  VAL B C      3  
ATOM 8364  O O      . VAL D 2 9  ? 14.436  -8.942  6.566   1.00 2.60  ? 9  VAL B O      3  
ATOM 8365  C CB     . VAL D 2 9  ? 12.258  -9.685  4.181   1.00 2.28  ? 9  VAL B CB     3  
ATOM 8366  C CG1    . VAL D 2 9  ? 13.634  -9.987  3.644   1.00 2.17  ? 9  VAL B CG1    3  
ATOM 8367  C CG2    . VAL D 2 9  ? 11.270  -10.750 3.750   1.00 2.28  ? 9  VAL B CG2    3  
ATOM 8368  H H      . VAL D 2 9  ? 10.355  -8.784  5.612   1.00 2.61  ? 9  VAL B H      3  
ATOM 8369  H HA     . VAL D 2 9  ? 12.532  -10.543 6.127   1.00 2.58  ? 9  VAL B HA     3  
ATOM 8370  H HB     . VAL D 2 9  ? 11.933  -8.737  3.776   1.00 2.26  ? 9  VAL B HB     3  
ATOM 8371  H HG11   . VAL D 2 9  ? 13.570  -10.196 2.589   1.00 2.23  ? 9  VAL B HG11   3  
ATOM 8372  H HG12   . VAL D 2 9  ? 14.031  -10.850 4.163   1.00 2.42  ? 9  VAL B HG12   3  
ATOM 8373  H HG13   . VAL D 2 9  ? 14.277  -9.137  3.808   1.00 2.44  ? 9  VAL B HG13   3  
ATOM 8374  H HG21   . VAL D 2 9  ? 11.501  -11.067 2.741   1.00 2.69  ? 9  VAL B HG21   3  
ATOM 8375  H HG22   . VAL D 2 9  ? 10.271  -10.343 3.784   1.00 2.42  ? 9  VAL B HG22   3  
ATOM 8376  H HG23   . VAL D 2 9  ? 11.339  -11.597 4.420   1.00 2.37  ? 9  VAL B HG23   3  
ATOM 8377  N N      . ALA D 2 10 ? 13.001  -7.318  5.983   1.00 2.67  ? 10 ALA B N      3  
ATOM 8378  C CA     . ALA D 2 10 ? 13.893  -6.214  6.314   1.00 2.84  ? 10 ALA B CA     3  
ATOM 8379  C C      . ALA D 2 10 ? 14.328  -6.275  7.766   1.00 3.09  ? 10 ALA B C      3  
ATOM 8380  O O      . ALA D 2 10 ? 15.514  -6.172  8.079   1.00 3.13  ? 10 ALA B O      3  
ATOM 8381  C CB     . ALA D 2 10 ? 13.180  -4.911  6.024   1.00 2.99  ? 10 ALA B CB     3  
ATOM 8382  H H      . ALA D 2 10 ? 12.085  -7.118  5.654   1.00 2.66  ? 10 ALA B H      3  
ATOM 8383  H HA     . ALA D 2 10 ? 14.769  -6.276  5.688   1.00 2.72  ? 10 ALA B HA     3  
ATOM 8384  H HB1    . ALA D 2 10 ? 12.131  -5.120  5.855   1.00 3.15  ? 10 ALA B HB1    3  
ATOM 8385  H HB2    . ALA D 2 10 ? 13.607  -4.452  5.147   1.00 3.33  ? 10 ALA B HB2    3  
ATOM 8386  H HB3    . ALA D 2 10 ? 13.285  -4.245  6.869   1.00 3.08  ? 10 ALA B HB3    3  
ATOM 8387  N N      . GLU D 2 11 ? 13.365  -6.487  8.637   1.00 3.27  ? 11 GLU B N      3  
ATOM 8388  C CA     . GLU D 2 11 ? 13.625  -6.567  10.062  1.00 3.56  ? 11 GLU B CA     3  
ATOM 8389  C C      . GLU D 2 11 ? 14.500  -7.777  10.352  1.00 3.49  ? 11 GLU B C      3  
ATOM 8390  O O      . GLU D 2 11 ? 15.499  -7.686  11.063  1.00 3.61  ? 11 GLU B O      3  
ATOM 8391  C CB     . GLU D 2 11 ? 12.311  -6.642  10.837  1.00 3.79  ? 11 GLU B CB     3  
ATOM 8392  C CG     . GLU D 2 11 ? 11.969  -5.361  11.585  1.00 4.20  ? 11 GLU B CG     3  
ATOM 8393  C CD     . GLU D 2 11 ? 12.895  -5.106  12.758  1.00 4.71  ? 11 GLU B CD     3  
ATOM 8394  O OE1    . GLU D 2 11 ? 12.690  -5.722  13.828  1.00 4.85  ? 11 GLU B OE1    3  
ATOM 8395  O OE2    . GLU D 2 11 ? 13.834  -4.294  12.618  1.00 5.21  ? 11 GLU B OE2    3  
ATOM 8396  H H      . GLU D 2 11 ? 12.451  -6.626  8.309   1.00 3.22  ? 11 GLU B H      3  
ATOM 8397  H HA     . GLU D 2 11 ? 14.162  -5.673  10.349  1.00 3.71  ? 11 GLU B HA     3  
ATOM 8398  H HB2    . GLU D 2 11 ? 11.512  -6.849  10.142  1.00 3.82  ? 11 GLU B HB2    3  
ATOM 8399  H HB3    . GLU D 2 11 ? 12.372  -7.448  11.553  1.00 3.89  ? 11 GLU B HB3    3  
ATOM 8400  H HG2    . GLU D 2 11 ? 12.041  -4.527  10.901  1.00 4.39  ? 11 GLU B HG2    3  
ATOM 8401  H HG3    . GLU D 2 11 ? 10.956  -5.435  11.954  1.00 4.27  ? 11 GLU B HG3    3  
ATOM 8402  N N      . TYR D 2 12 ? 14.097  -8.909  9.796   1.00 3.31  ? 12 TYR B N      3  
ATOM 8403  C CA     . TYR D 2 12 ? 14.822  -10.158 9.960   1.00 3.27  ? 12 TYR B CA     3  
ATOM 8404  C C      . TYR D 2 12 ? 16.237  -10.057 9.387   1.00 3.07  ? 12 TYR B C      3  
ATOM 8405  O O      . TYR D 2 12 ? 17.157  -10.724 9.862   1.00 3.12  ? 12 TYR B O      3  
ATOM 8406  C CB     . TYR D 2 12 ? 14.054  -11.277 9.265   1.00 3.15  ? 12 TYR B CB     3  
ATOM 8407  C CG     . TYR D 2 12 ? 14.641  -12.652 9.453   1.00 3.21  ? 12 TYR B CG     3  
ATOM 8408  C CD1    . TYR D 2 12 ? 14.773  -13.180 10.720  1.00 3.52  ? 12 TYR B CD1    3  
ATOM 8409  C CD2    . TYR D 2 12 ? 15.078  -13.409 8.375   1.00 3.01  ? 12 TYR B CD2    3  
ATOM 8410  C CE1    . TYR D 2 12 ? 15.319  -14.424 10.926  1.00 3.62  ? 12 TYR B CE1    3  
ATOM 8411  C CE2    . TYR D 2 12 ? 15.628  -14.662 8.565   1.00 3.12  ? 12 TYR B CE2    3  
ATOM 8412  C CZ     . TYR D 2 12 ? 15.697  -15.201 9.753   1.00 3.42  ? 12 TYR B CZ     3  
ATOM 8413  O OH     . TYR D 2 12 ? 16.299  -16.414 10.036  1.00 3.57  ? 12 TYR B OH     3  
ATOM 8414  H H      . TYR D 2 12 ? 13.280  -8.905  9.251   1.00 3.23  ? 12 TYR B H      3  
ATOM 8415  H HA     . TYR D 2 12 ? 14.885  -10.375 11.015  1.00 3.51  ? 12 TYR B HA     3  
ATOM 8416  H HB2    . TYR D 2 12 ? 13.044  -11.297 9.641   1.00 3.30  ? 12 TYR B HB2    3  
ATOM 8417  H HB3    . TYR D 2 12 ? 14.028  -11.076 8.204   1.00 2.92  ? 12 TYR B HB3    3  
ATOM 8418  H HD1    . TYR D 2 12 ? 14.424  -12.599 11.572  1.00 3.72  ? 12 TYR B HD1    3  
ATOM 8419  H HD2    . TYR D 2 12 ? 14.981  -13.008 7.378   1.00 2.79  ? 12 TYR B HD2    3  
ATOM 8420  H HE1    . TYR D 2 12 ? 15.414  -14.802 11.935  1.00 3.88  ? 12 TYR B HE1    3  
ATOM 8421  H HE2    . TYR D 2 12 ? 15.959  -15.239 7.716   1.00 3.02  ? 12 TYR B HE2    3  
ATOM 8422  H HH     . TYR D 2 12 ? 15.982  -16.787 10.875  1.00 3.54  ? 12 TYR B HH     3  
ATOM 8423  N N      . ALA D 2 13 ? 16.417  -9.212  8.372   1.00 2.88  ? 13 ALA B N      3  
ATOM 8424  C CA     . ALA D 2 13 ? 17.724  -9.048  7.755   1.00 2.72  ? 13 ALA B CA     3  
ATOM 8425  C C      . ALA D 2 13 ? 18.549  -8.060  8.570   1.00 2.94  ? 13 ALA B C      3  
ATOM 8426  O O      . ALA D 2 13 ? 19.784  -8.089  8.569   1.00 2.90  ? 13 ALA B O      3  
ATOM 8427  C CB     . ALA D 2 13 ? 17.573  -8.555  6.331   1.00 2.52  ? 13 ALA B CB     3  
ATOM 8428  H H      . ALA D 2 13 ? 15.654  -8.665  8.049   1.00 2.87  ? 13 ALA B H      3  
ATOM 8429  H HA     . ALA D 2 13 ? 18.218  -10.016 7.727   1.00 2.64  ? 13 ALA B HA     3  
ATOM 8430  H HB1    . ALA D 2 13 ? 16.981  -9.264  5.764   1.00 2.64  ? 13 ALA B HB1    3  
ATOM 8431  H HB2    . ALA D 2 13 ? 18.549  -8.456  5.879   1.00 2.61  ? 13 ALA B HB2    3  
ATOM 8432  H HB3    . ALA D 2 13 ? 17.079  -7.595  6.340   1.00 2.81  ? 13 ALA B HB3    3  
ATOM 8433  N N      . GLY D 2 14 ? 17.829  -7.179  9.261   1.00 3.18  ? 14 GLY B N      3  
ATOM 8434  C CA     . GLY D 2 14 ? 18.442  -6.180  10.109  1.00 3.46  ? 14 GLY B CA     3  
ATOM 8435  C C      . GLY D 2 14 ? 18.757  -4.926  9.337   1.00 3.50  ? 14 GLY B C      3  
ATOM 8436  O O      . GLY D 2 14 ? 19.725  -4.225  9.628   1.00 3.66  ? 14 GLY B O      3  
ATOM 8437  H H      . GLY D 2 14 ? 16.857  -7.175  9.144   1.00 3.18  ? 14 GLY B H      3  
ATOM 8438  H HA2    . GLY D 2 14 ? 17.773  -5.943  10.914  1.00 3.68  ? 14 GLY B HA2    3  
ATOM 8439  H HA3    . GLY D 2 14 ? 19.358  -6.584  10.508  1.00 3.48  ? 14 GLY B HA3    3  
ATOM 8440  N N      . VAL D 2 15 ? 17.922  -4.652  8.354   1.00 3.38  ? 15 VAL B N      3  
ATOM 8441  C CA     . VAL D 2 15 ? 18.115  -3.519  7.454   1.00 3.45  ? 15 VAL B CA     3  
ATOM 8442  C C      . VAL D 2 15 ? 16.799  -2.813  7.123   1.00 3.53  ? 15 VAL B C      3  
ATOM 8443  O O      . VAL D 2 15 ? 15.744  -3.430  7.206   1.00 3.41  ? 15 VAL B O      3  
ATOM 8444  C CB     . VAL D 2 15 ? 18.769  -4.001  6.166   1.00 3.19  ? 15 VAL B CB     3  
ATOM 8445  C CG1    . VAL D 2 15 ? 20.221  -4.345  6.414   1.00 3.17  ? 15 VAL B CG1    3  
ATOM 8446  C CG2    . VAL D 2 15 ? 18.029  -5.210  5.657   1.00 2.87  ? 15 VAL B CG2    3  
ATOM 8447  H H      . VAL D 2 15 ? 17.126  -5.234  8.232   1.00 3.27  ? 15 VAL B H      3  
ATOM 8448  H HA     . VAL D 2 15 ? 18.786  -2.823  7.935   1.00 3.67  ? 15 VAL B HA     3  
ATOM 8449  H HB     . VAL D 2 15 ? 18.713  -3.221  5.423   1.00 3.28  ? 15 VAL B HB     3  
ATOM 8450  H HG11   . VAL D 2 15 ? 20.274  -5.152  7.140   1.00 3.03  ? 15 VAL B HG11   3  
ATOM 8451  H HG12   . VAL D 2 15 ? 20.735  -3.479  6.798   1.00 3.56  ? 15 VAL B HG12   3  
ATOM 8452  H HG13   . VAL D 2 15 ? 20.676  -4.656  5.489   1.00 3.36  ? 15 VAL B HG13   3  
ATOM 8453  H HG21   . VAL D 2 15 ? 17.920  -5.925  6.465   1.00 3.03  ? 15 VAL B HG21   3  
ATOM 8454  H HG22   . VAL D 2 15 ? 18.582  -5.662  4.848   1.00 3.14  ? 15 VAL B HG22   3  
ATOM 8455  H HG23   . VAL D 2 15 ? 17.054  -4.906  5.314   1.00 2.77  ? 15 VAL B HG23   3  
ATOM 8456  N N      . SER D 2 16 ? 16.851  -1.510  6.812   1.00 3.79  ? 16 SER B N      3  
ATOM 8457  C CA     . SER D 2 16 ? 15.632  -0.765  6.461   1.00 3.90  ? 16 SER B CA     3  
ATOM 8458  C C      . SER D 2 16 ? 14.855  -1.512  5.374   1.00 3.60  ? 16 SER B C      3  
ATOM 8459  O O      . SER D 2 16 ? 15.401  -2.343  4.645   1.00 3.35  ? 16 SER B O      3  
ATOM 8460  C CB     . SER D 2 16 ? 15.972  0.653   5.994   1.00 4.20  ? 16 SER B CB     3  
ATOM 8461  O OG     . SER D 2 16 ? 17.097  1.170   6.687   1.00 4.38  ? 16 SER B OG     3  
ATOM 8462  H H      . SER D 2 16 ? 17.720  -1.065  6.735   1.00 3.90  ? 16 SER B H      3  
ATOM 8463  H HA     . SER D 2 16 ? 14.994  -0.711  7.324   1.00 4.02  ? 16 SER B HA     3  
ATOM 8464  H HB2    . SER D 2 16 ? 16.195  0.626   4.940   1.00 4.25  ? 16 SER B HB2    3  
ATOM 8465  H HB3    . SER D 2 16 ? 15.124  1.298   6.169   1.00 4.41  ? 16 SER B HB3    3  
ATOM 8466  H HG     . SER D 2 16 ? 17.433  0.502   7.286   1.00 4.40  ? 16 SER B HG     3  
ATOM 8467  N N      . TYR D 2 17 ? 13.593  -1.198  5.273   1.00 3.62  ? 17 TYR B N      3  
ATOM 8468  C CA     . TYR D 2 17 ? 12.707  -1.844  4.335   1.00 3.38  ? 17 TYR B CA     3  
ATOM 8469  C C      . TYR D 2 17 ? 13.231  -1.690  2.932   1.00 3.32  ? 17 TYR B C      3  
ATOM 8470  O O      . TYR D 2 17 ? 13.470  -2.674  2.242   1.00 3.10  ? 17 TYR B O      3  
ATOM 8471  C CB     . TYR D 2 17 ? 11.368  -1.174  4.487   1.00 3.51  ? 17 TYR B CB     3  
ATOM 8472  C CG     . TYR D 2 17 ? 10.360  -1.642  3.520   1.00 3.30  ? 17 TYR B CG     3  
ATOM 8473  C CD1    . TYR D 2 17 ? 9.805   -2.912  3.587   1.00 3.03  ? 17 TYR B CD1    3  
ATOM 8474  C CD2    . TYR D 2 17 ? 9.980   -0.810  2.508   1.00 3.42  ? 17 TYR B CD2    3  
ATOM 8475  C CE1    . TYR D 2 17 ? 8.880   -3.314  2.654   1.00 2.87  ? 17 TYR B CE1    3  
ATOM 8476  C CE2    . TYR D 2 17 ? 9.071   -1.196  1.587   1.00 3.26  ? 17 TYR B CE2    3  
ATOM 8477  C CZ     . TYR D 2 17 ? 8.451   -2.578  1.788   1.00 2.94  ? 17 TYR B CZ     3  
ATOM 8478  O OH     . TYR D 2 17 ? 7.595   -2.808  0.717   1.00 2.85  ? 17 TYR B OH     3  
ATOM 8479  H H      . TYR D 2 17 ? 13.243  -0.473  5.834   1.00 3.82  ? 17 TYR B H      3  
ATOM 8480  H HA     . TYR D 2 17 ? 12.612  -2.907  4.576   1.00 3.19  ? 17 TYR B HA     3  
ATOM 8481  H HB2    . TYR D 2 17 ? 10.985  -1.384  5.468   1.00 3.59  ? 17 TYR B HB2    3  
ATOM 8482  H HB3    . TYR D 2 17 ? 11.489  -0.117  4.370   1.00 3.73  ? 17 TYR B HB3    3  
ATOM 8483  H HD1    . TYR D 2 17 ? 10.089  -3.577  4.388   1.00 2.98  ? 17 TYR B HD1    3  
ATOM 8484  H HD2    . TYR D 2 17 ? 10.401  0.184   2.449   1.00 3.67  ? 17 TYR B HD2    3  
ATOM 8485  H HE1    . TYR D 2 17 ? 8.451   -4.304  2.706   1.00 2.70  ? 17 TYR B HE1    3  
ATOM 8486  H HE2    . TYR D 2 17 ? 8.793   -0.509  0.804   1.00 3.39  ? 17 TYR B HE2    3  
ATOM 8487  H HH     . TYR D 2 17 ? 8.026   -2.904  -0.134  1.00 3.14  ? 17 TYR B HH     3  
ATOM 8488  N N      . GLN D 2 18 ? 13.430  -0.440  2.530   1.00 3.58  ? 18 GLN B N      3  
ATOM 8489  C CA     . GLN D 2 18 ? 13.994  -0.155  1.199   1.00 3.64  ? 18 GLN B CA     3  
ATOM 8490  C C      . GLN D 2 18 ? 15.457  -0.418  1.182   1.00 3.63  ? 18 GLN B C      3  
ATOM 8491  O O      . GLN D 2 18 ? 16.176  0.058   0.292   1.00 3.77  ? 18 GLN B O      3  
ATOM 8492  C CB     . GLN D 2 18 ? 13.656  1.222   0.632   1.00 3.96  ? 18 GLN B CB     3  
ATOM 8493  C CG     . GLN D 2 18 ? 12.859  2.050   1.568   1.00 4.35  ? 18 GLN B CG     3  
ATOM 8494  C CD     . GLN D 2 18 ? 13.714  2.638   2.676   1.00 4.69  ? 18 GLN B CD     3  
ATOM 8495  O OE1    . GLN D 2 18 ? 13.227  2.819   3.771   1.00 5.01  ? 18 GLN B OE1    3  
ATOM 8496  N NE2    . GLN D 2 18 ? 15.013  2.856   2.421   1.00 5.04  ? 18 GLN B NE2    3  
ATOM 8497  H H      . GLN D 2 18 ? 13.214  0.313   3.152   1.00 3.77  ? 18 GLN B H      3  
ATOM 8498  H HA     . GLN D 2 18 ? 13.557  -0.895  0.526   1.00 3.47  ? 18 GLN B HA     3  
ATOM 8499  H HB2    . GLN D 2 18 ? 14.565  1.782   0.379   1.00 4.06  ? 18 GLN B HB2    3  
ATOM 8500  H HB3    . GLN D 2 18 ? 13.072  1.079   -0.262  1.00 4.11  ? 18 GLN B HB3    3  
ATOM 8501  H HG2    . GLN D 2 18 ? 12.393  2.844   1.011   1.00 4.60  ? 18 GLN B HG2    3  
ATOM 8502  H HG3    . GLN D 2 18 ? 12.090  1.424   2.000   1.00 4.54  ? 18 GLN B HG3    3  
ATOM 8503  H HE21   . GLN D 2 18 ? 15.378  2.624   1.535   1.00 5.02  ? 18 GLN B HE21   3  
ATOM 8504  H HE22   . GLN D 2 18 ? 15.552  3.232   3.141   1.00 5.51  ? 18 GLN B HE22   3  
ATOM 8505  N N      . THR D 2 19 ? 15.957  -1.021  2.226   1.00 3.52  ? 19 THR B N      3  
ATOM 8506  C CA     . THR D 2 19 ? 17.306  -1.413  2.152   1.00 3.47  ? 19 THR B CA     3  
ATOM 8507  C C      . THR D 2 19 ? 17.227  -2.594  1.214   1.00 3.18  ? 19 THR B C      3  
ATOM 8508  O O      . THR D 2 19 ? 17.840  -2.628  0.144   1.00 3.24  ? 19 THR B O      3  
ATOM 8509  C CB     . THR D 2 19 ? 17.937  -1.870  3.473   1.00 3.43  ? 19 THR B CB     3  
ATOM 8510  O OG1    . THR D 2 19 ? 17.968  -0.831  4.463   1.00 3.78  ? 19 THR B OG1    3  
ATOM 8511  C CG2    . THR D 2 19 ? 19.341  -2.401  3.222   1.00 3.34  ? 19 THR B CG2    3  
ATOM 8512  H H      . THR D 2 19 ? 15.403  -1.244  3.019   1.00 3.48  ? 19 THR B H      3  
ATOM 8513  H HA     . THR D 2 19 ? 17.862  -0.622  1.719   1.00 3.69  ? 19 THR B HA     3  
ATOM 8514  H HB     . THR D 2 19 ? 17.321  -2.684  3.853   1.00 3.24  ? 19 THR B HB     3  
ATOM 8515  H HG1    . THR D 2 19 ? 18.409  -0.049  4.123   1.00 4.01  ? 19 THR B HG1    3  
ATOM 8516  H HG21   . THR D 2 19 ? 19.265  -3.391  2.809   1.00 3.59  ? 19 THR B HG21   3  
ATOM 8517  H HG22   . THR D 2 19 ? 19.874  -2.435  4.154   1.00 3.30  ? 19 THR B HG22   3  
ATOM 8518  H HG23   . THR D 2 19 ? 19.863  -1.765  2.519   1.00 3.50  ? 19 THR B HG23   3  
ATOM 8519  N N      . VAL D 2 20 ? 16.408  -3.548  1.658   1.00 2.93  ? 20 VAL B N      3  
ATOM 8520  C CA     . VAL D 2 20 ? 16.107  -4.751  0.933   1.00 2.66  ? 20 VAL B CA     3  
ATOM 8521  C C      . VAL D 2 20 ? 15.073  -4.548  -0.204  1.00 2.69  ? 20 VAL B C      3  
ATOM 8522  O O      . VAL D 2 20 ? 15.133  -5.229  -1.217  1.00 2.62  ? 20 VAL B O      3  
ATOM 8523  C CB     . VAL D 2 20 ? 15.700  -5.909  1.887   1.00 2.44  ? 20 VAL B CB     3  
ATOM 8524  C CG1    . VAL D 2 20 ? 15.769  -5.489  3.336   1.00 2.57  ? 20 VAL B CG1    3  
ATOM 8525  C CG2    . VAL D 2 20 ? 14.320  -6.435  1.606   1.00 2.33  ? 20 VAL B CG2    3  
ATOM 8526  H H      . VAL D 2 20 ? 15.976  -3.412  2.513   1.00 2.96  ? 20 VAL B H      3  
ATOM 8527  H HA     . VAL D 2 20 ? 17.030  -5.042  0.460   1.00 2.66  ? 20 VAL B HA     3  
ATOM 8528  H HB     . VAL D 2 20 ? 16.396  -6.715  1.734   1.00 2.32  ? 20 VAL B HB     3  
ATOM 8529  H HG11   . VAL D 2 20 ? 15.243  -4.556  3.454   1.00 2.83  ? 20 VAL B HG11   3  
ATOM 8530  H HG12   . VAL D 2 20 ? 16.798  -5.366  3.620   1.00 2.88  ? 20 VAL B HG12   3  
ATOM 8531  H HG13   . VAL D 2 20 ? 15.307  -6.249  3.964   1.00 2.66  ? 20 VAL B HG13   3  
ATOM 8532  H HG21   . VAL D 2 20 ? 14.154  -6.457  0.543   1.00 2.42  ? 20 VAL B HG21   3  
ATOM 8533  H HG22   . VAL D 2 20 ? 13.584  -5.791  2.081   1.00 2.66  ? 20 VAL B HG22   3  
ATOM 8534  H HG23   . VAL D 2 20 ? 14.235  -7.443  2.011   1.00 2.45  ? 20 VAL B HG23   3  
ATOM 8535  N N      . SER D 2 21 ? 14.101  -3.637  -0.044  1.00 2.83  ? 21 SER B N      3  
ATOM 8536  C CA     . SER D 2 21 ? 13.096  -3.417  -1.109  1.00 2.87  ? 21 SER B CA     3  
ATOM 8537  C C      . SER D 2 21 ? 13.772  -2.894  -2.366  1.00 3.09  ? 21 SER B C      3  
ATOM 8538  O O      . SER D 2 21 ? 13.348  -3.190  -3.486  1.00 3.10  ? 21 SER B O      3  
ATOM 8539  C CB     . SER D 2 21 ? 11.971  -2.464  -0.669  1.00 3.04  ? 21 SER B CB     3  
ATOM 8540  O OG     . SER D 2 21 ? 11.996  -1.239  -1.385  1.00 3.23  ? 21 SER B OG     3  
ATOM 8541  H H      . SER D 2 21 ? 14.044  -3.131  0.800   1.00 2.92  ? 21 SER B H      3  
ATOM 8542  H HA     . SER D 2 21 ? 12.660  -4.383  -1.344  1.00 2.67  ? 21 SER B HA     3  
ATOM 8543  H HB2    . SER D 2 21 ? 11.016  -2.943  -0.842  1.00 3.19  ? 21 SER B HB2    3  
ATOM 8544  H HB3    . SER D 2 21 ? 12.080  -2.253  0.378   1.00 3.31  ? 21 SER B HB3    3  
ATOM 8545  H HG     . SER D 2 21 ? 11.648  -1.375  -2.277  1.00 3.29  ? 21 SER B HG     3  
ATOM 8546  N N      . ARG D 2 22 ? 14.835  -2.136  -2.169  1.00 3.32  ? 22 ARG B N      3  
ATOM 8547  C CA     . ARG D 2 22 ? 15.602  -1.610  -3.274  1.00 3.59  ? 22 ARG B CA     3  
ATOM 8548  C C      . ARG D 2 22 ? 16.282  -2.788  -3.948  1.00 3.45  ? 22 ARG B C      3  
ATOM 8549  O O      . ARG D 2 22 ? 16.437  -2.831  -5.168  1.00 3.63  ? 22 ARG B O      3  
ATOM 8550  C CB     . ARG D 2 22 ? 16.617  -0.583  -2.751  1.00 3.86  ? 22 ARG B CB     3  
ATOM 8551  C CG     . ARG D 2 22 ? 17.971  -0.624  -3.434  1.00 4.07  ? 22 ARG B CG     3  
ATOM 8552  C CD     . ARG D 2 22 ? 19.091  -0.196  -2.493  1.00 4.20  ? 22 ARG B CD     3  
ATOM 8553  N NE     . ARG D 2 22 ? 18.958  1.194   -2.051  1.00 4.64  ? 22 ARG B NE     3  
ATOM 8554  C CZ     . ARG D 2 22 ? 19.969  2.069   -2.013  1.00 4.85  ? 22 ARG B CZ     3  
ATOM 8555  N NH1    . ARG D 2 22 ? 21.191  1.708   -2.390  1.00 4.70  ? 22 ARG B NH1    3  
ATOM 8556  N NH2    . ARG D 2 22 ? 19.757  3.312   -1.592  1.00 5.40  ? 22 ARG B NH2    3  
ATOM 8557  H H      . ARG D 2 22 ? 15.121  -1.943  -1.254  1.00 3.32  ? 22 ARG B H      3  
ATOM 8558  H HA     . ARG D 2 22 ? 14.923  -1.142  -3.972  1.00 3.73  ? 22 ARG B HA     3  
ATOM 8559  H HB2    . ARG D 2 22 ? 16.207  0.403   -2.888  1.00 4.20  ? 22 ARG B HB2    3  
ATOM 8560  H HB3    . ARG D 2 22 ? 16.767  -0.753  -1.692  1.00 3.75  ? 22 ARG B HB3    3  
ATOM 8561  H HG2    . ARG D 2 22 ? 18.160  -1.632  -3.765  1.00 3.96  ? 22 ARG B HG2    3  
ATOM 8562  H HG3    . ARG D 2 22 ? 17.953  0.040   -4.284  1.00 4.42  ? 22 ARG B HG3    3  
ATOM 8563  H HD2    . ARG D 2 22 ? 19.077  -0.841  -1.626  1.00 3.97  ? 22 ARG B HD2    3  
ATOM 8564  H HD3    . ARG D 2 22 ? 20.032  -0.313  -3.009  1.00 4.38  ? 22 ARG B HD3    3  
ATOM 8565  H HE     . ARG D 2 22 ? 18.066  1.487   -1.765  1.00 4.91  ? 22 ARG B HE     3  
ATOM 8566  H HH11   . ARG D 2 22 ? 21.369  0.773   -2.710  1.00 4.47  ? 22 ARG B HH11   3  
ATOM 8567  H HH12   . ARG D 2 22 ? 21.946  2.369   -2.360  1.00 4.95  ? 22 ARG B HH12   3  
ATOM 8568  H HH21   . ARG D 2 22 ? 18.841  3.598   -1.306  1.00 5.70  ? 22 ARG B HH21   3  
ATOM 8569  H HH22   . ARG D 2 22 ? 20.516  3.968   -1.560  1.00 5.62  ? 22 ARG B HH22   3  
ATOM 8570  N N      . VAL D 2 23 ? 16.617  -3.765  -3.109  1.00 3.17  ? 23 VAL B N      3  
ATOM 8571  C CA     . VAL D 2 23 ? 17.252  -4.999  -3.518  1.00 3.05  ? 23 VAL B CA     3  
ATOM 8572  C C      . VAL D 2 23 ? 16.302  -5.813  -4.388  1.00 3.00  ? 23 VAL B C      3  
ATOM 8573  O O      . VAL D 2 23 ? 16.626  -6.196  -5.510  1.00 3.18  ? 23 VAL B O      3  
ATOM 8574  C CB     . VAL D 2 23 ? 17.622  -5.821  -2.264  1.00 2.77  ? 23 VAL B CB     3  
ATOM 8575  C CG1    . VAL D 2 23 ? 18.069  -7.229  -2.610  1.00 2.66  ? 23 VAL B CG1    3  
ATOM 8576  C CG2    . VAL D 2 23 ? 18.670  -5.096  -1.433  1.00 2.87  ? 23 VAL B CG2    3  
ATOM 8577  H H      . VAL D 2 23 ? 16.407  -3.655  -2.163  1.00 3.07  ? 23 VAL B H      3  
ATOM 8578  H HA     . VAL D 2 23 ? 18.148  -4.767  -4.058  1.00 3.24  ? 23 VAL B HA     3  
ATOM 8579  H HB     . VAL D 2 23 ? 16.731  -5.909  -1.660  1.00 2.62  ? 23 VAL B HB     3  
ATOM 8580  H HG11   . VAL D 2 23 ? 19.074  -7.204  -2.999  1.00 2.82  ? 23 VAL B HG11   3  
ATOM 8581  H HG12   . VAL D 2 23 ? 17.402  -7.642  -3.351  1.00 3.01  ? 23 VAL B HG12   3  
ATOM 8582  H HG13   . VAL D 2 23 ? 18.038  -7.840  -1.716  1.00 2.64  ? 23 VAL B HG13   3  
ATOM 8583  H HG21   . VAL D 2 23 ? 18.176  -4.412  -0.745  1.00 2.87  ? 23 VAL B HG21   3  
ATOM 8584  H HG22   . VAL D 2 23 ? 19.324  -4.540  -2.088  1.00 3.44  ? 23 VAL B HG22   3  
ATOM 8585  H HG23   . VAL D 2 23 ? 19.246  -5.815  -0.870  1.00 2.86  ? 23 VAL B HG23   3  
ATOM 8586  N N      . VAL D 2 24 ? 15.108  -6.022  -3.856  1.00 2.81  ? 24 VAL B N      3  
ATOM 8587  C CA     . VAL D 2 24 ? 14.059  -6.767  -4.532  1.00 2.77  ? 24 VAL B CA     3  
ATOM 8588  C C      . VAL D 2 24 ? 13.545  -6.040  -5.779  1.00 3.04  ? 24 VAL B C      3  
ATOM 8589  O O      . VAL D 2 24 ? 13.003  -6.663  -6.694  1.00 3.12  ? 24 VAL B O      3  
ATOM 8590  C CB     . VAL D 2 24 ? 12.880  -7.056  -3.566  1.00 2.53  ? 24 VAL B CB     3  
ATOM 8591  C CG1    . VAL D 2 24 ? 11.664  -7.583  -4.309  1.00 2.54  ? 24 VAL B CG1    3  
ATOM 8592  C CG2    . VAL D 2 24 ? 13.306  -8.044  -2.489  1.00 2.32  ? 24 VAL B CG2    3  
ATOM 8593  H H      . VAL D 2 24 ? 14.925  -5.661  -2.960  1.00 2.73  ? 24 VAL B H      3  
ATOM 8594  H HA     . VAL D 2 24 ? 14.473  -7.708  -4.838  1.00 2.77  ? 24 VAL B HA     3  
ATOM 8595  H HB     . VAL D 2 24 ? 12.604  -6.131  -3.082  1.00 2.58  ? 24 VAL B HB     3  
ATOM 8596  H HG11   . VAL D 2 24 ? 11.469  -6.948  -5.163  1.00 2.74  ? 24 VAL B HG11   3  
ATOM 8597  H HG12   . VAL D 2 24 ? 10.807  -7.576  -3.653  1.00 2.81  ? 24 VAL B HG12   3  
ATOM 8598  H HG13   . VAL D 2 24 ? 11.856  -8.590  -4.645  1.00 2.62  ? 24 VAL B HG13   3  
ATOM 8599  H HG21   . VAL D 2 24 ? 13.794  -8.891  -2.949  1.00 2.58  ? 24 VAL B HG21   3  
ATOM 8600  H HG22   . VAL D 2 24 ? 12.434  -8.388  -1.944  1.00 2.41  ? 24 VAL B HG22   3  
ATOM 8601  H HG23   . VAL D 2 24 ? 13.989  -7.562  -1.805  1.00 2.48  ? 24 VAL B HG23   3  
ATOM 8602  N N      . ASN D 2 25 ? 13.773  -4.736  -5.857  1.00 3.23  ? 25 ASN B N      3  
ATOM 8603  C CA     . ASN D 2 25 ? 13.236  -3.977  -6.979  1.00 3.51  ? 25 ASN B CA     3  
ATOM 8604  C C      . ASN D 2 25 ? 14.222  -3.872  -8.133  1.00 3.82  ? 25 ASN B C      3  
ATOM 8605  O O      . ASN D 2 25 ? 13.832  -3.481  -9.233  1.00 4.07  ? 25 ASN B O      3  
ATOM 8606  C CB     . ASN D 2 25 ? 12.781  -2.592  -6.513  1.00 3.62  ? 25 ASN B CB     3  
ATOM 8607  C CG     . ASN D 2 25 ? 11.307  -2.570  -6.133  1.00 3.46  ? 25 ASN B CG     3  
ATOM 8608  O OD1    . ASN D 2 25 ? 10.479  -2.008  -6.846  1.00 3.65  ? 25 ASN B OD1    3  
ATOM 8609  N ND2    . ASN D 2 25 ? 10.963  -3.204  -5.015  1.00 3.15  ? 25 ASN B ND2    3  
ATOM 8610  H H      . ASN D 2 25 ? 14.347  -4.289  -5.182  1.00 3.22  ? 25 ASN B H      3  
ATOM 8611  H HA     . ASN D 2 25 ? 12.368  -4.513  -7.335  1.00 3.45  ? 25 ASN B HA     3  
ATOM 8612  H HB2    . ASN D 2 25 ? 13.362  -2.299  -5.650  1.00 3.58  ? 25 ASN B HB2    3  
ATOM 8613  H HB3    . ASN D 2 25 ? 12.940  -1.879  -7.309  1.00 3.90  ? 25 ASN B HB3    3  
ATOM 8614  H HD21   . ASN D 2 25 ? 11.673  -3.654  -4.498  1.00 3.05  ? 25 ASN B HD21   3  
ATOM 8615  H HD22   . ASN D 2 25 ? 10.014  -3.196  -4.749  1.00 3.06  ? 25 ASN B HD22   3  
ATOM 8616  N N      . GLN D 2 26 ? 15.476  -4.263  -7.880  1.00 3.82  ? 26 GLN B N      3  
ATOM 8617  C CA     . GLN D 2 26 ? 16.549  -4.239  -8.896  1.00 4.12  ? 26 GLN B CA     3  
ATOM 8618  C C      . GLN D 2 26 ? 17.926  -4.306  -8.242  1.00 4.18  ? 26 GLN B C      3  
ATOM 8619  O O      . GLN D 2 26 ? 18.790  -5.073  -8.668  1.00 4.60  ? 26 GLN B O      3  
ATOM 8620  C CB     . GLN D 2 26 ? 16.480  -2.991  -9.803  1.00 4.50  ? 26 GLN B CB     3  
ATOM 8621  C CG     . GLN D 2 26 ? 16.545  -1.656  -9.070  1.00 4.96  ? 26 GLN B CG     3  
ATOM 8622  C CD     . GLN D 2 26 ? 16.057  -0.500  -9.924  1.00 5.50  ? 26 GLN B CD     3  
ATOM 8623  O OE1    . GLN D 2 26 ? 16.535  0.628   -9.804  1.00 6.03  ? 26 GLN B OE1    3  
ATOM 8624  N NE2    . GLN D 2 26 ? 15.091  -0.771  -10.789 1.00 5.69  ? 26 GLN B NE2    3  
ATOM 8625  H H      . GLN D 2 26 ? 15.685  -4.603  -6.979  1.00 3.64  ? 26 GLN B H      3  
ATOM 8626  H HA     . GLN D 2 26 ? 16.426  -5.119  -9.513  1.00 4.11  ? 26 GLN B HA     3  
ATOM 8627  H HB2    . GLN D 2 26 ? 17.301  -3.027  -10.502 1.00 4.72  ? 26 GLN B HB2    3  
ATOM 8628  H HB3    . GLN D 2 26 ? 15.553  -3.022  -10.358 1.00 4.61  ? 26 GLN B HB3    3  
ATOM 8629  H HG2    . GLN D 2 26 ? 15.930  -1.714  -8.184  1.00 4.99  ? 26 GLN B HG2    3  
ATOM 8630  H HG3    . GLN D 2 26 ? 17.570  -1.467  -8.785  1.00 5.30  ? 26 GLN B HG3    3  
ATOM 8631  H HE21   . GLN D 2 26 ? 14.749  -1.692  -10.829 1.00 5.47  ? 26 GLN B HE21   3  
ATOM 8632  H HE22   . GLN D 2 26 ? 14.760  -0.045  -11.357 1.00 6.22  ? 26 GLN B HE22   3  
ATOM 8633  N N      . ALA D 2 27 ? 18.106  -3.494  -7.204  1.00 4.01  ? 27 ALA B N      3  
ATOM 8634  C CA     . ALA D 2 27 ? 19.360  -3.397  -6.459  1.00 4.07  ? 27 ALA B CA     3  
ATOM 8635  C C      . ALA D 2 27 ? 20.572  -3.197  -7.371  1.00 4.43  ? 27 ALA B C      3  
ATOM 8636  O O      . ALA D 2 27 ? 21.631  -3.785  -7.147  1.00 4.48  ? 27 ALA B O      3  
ATOM 8637  C CB     . ALA D 2 27 ? 19.574  -4.613  -5.580  1.00 3.82  ? 27 ALA B CB     3  
ATOM 8638  H H      . ALA D 2 27 ? 17.351  -2.941  -6.912  1.00 3.99  ? 27 ALA B H      3  
ATOM 8639  H HA     . ALA D 2 27 ? 19.264  -2.541  -5.806  1.00 4.11  ? 27 ALA B HA     3  
ATOM 8640  H HB1    . ALA D 2 27 ? 20.147  -5.353  -6.119  1.00 4.16  ? 27 ALA B HB1    3  
ATOM 8641  H HB2    . ALA D 2 27 ? 18.618  -5.029  -5.300  1.00 3.82  ? 27 ALA B HB2    3  
ATOM 8642  H HB3    . ALA D 2 27 ? 20.111  -4.316  -4.689  1.00 3.73  ? 27 ALA B HB3    3  
ATOM 8643  N N      . SER D 2 28 ? 20.420  -2.359  -8.388  1.00 4.78  ? 28 SER B N      3  
ATOM 8644  C CA     . SER D 2 28 ? 21.502  -2.094  -9.331  1.00 5.16  ? 28 SER B CA     3  
ATOM 8645  C C      . SER D 2 28 ? 22.699  -1.434  -8.638  1.00 5.18  ? 28 SER B C      3  
ATOM 8646  O O      . SER D 2 28 ? 23.840  -1.587  -9.071  1.00 5.42  ? 28 SER B O      3  
ATOM 8647  C CB     . SER D 2 28 ? 20.989  -1.204  -10.462 1.00 5.61  ? 28 SER B CB     3  
ATOM 8648  O OG     . SER D 2 28 ? 19.653  -1.539  -10.803 1.00 5.69  ? 28 SER B OG     3  
ATOM 8649  H H      . SER D 2 28 ? 19.556  -1.920  -8.524  1.00 4.85  ? 28 SER B H      3  
ATOM 8650  H HA     . SER D 2 28 ? 21.819  -3.039  -9.744  1.00 5.15  ? 28 SER B HA     3  
ATOM 8651  H HB2    . SER D 2 28 ? 21.020  -0.172  -10.150 1.00 5.81  ? 28 SER B HB2    3  
ATOM 8652  H HB3    . SER D 2 28 ? 21.614  -1.337  -11.334 1.00 5.82  ? 28 SER B HB3    3  
ATOM 8653  H HG     . SER D 2 28 ? 19.630  -2.436  -11.177 1.00 5.90  ? 28 SER B HG     3  
ATOM 8654  N N      . HIS D 2 29 ? 22.434  -0.706  -7.561  1.00 4.98  ? 29 HIS B N      3  
ATOM 8655  C CA     . HIS D 2 29 ? 23.476  -0.029  -6.817  1.00 5.03  ? 29 HIS B CA     3  
ATOM 8656  C C      . HIS D 2 29 ? 23.354  -0.358  -5.329  1.00 4.65  ? 29 HIS B C      3  
ATOM 8657  O O      . HIS D 2 29 ? 22.708  0.366   -4.567  1.00 4.62  ? 29 HIS B O      3  
ATOM 8658  C CB     . HIS D 2 29 ? 23.404  1.484   -7.058  1.00 5.41  ? 29 HIS B CB     3  
ATOM 8659  C CG     . HIS D 2 29 ? 23.944  1.904   -8.397  1.00 5.82  ? 29 HIS B CG     3  
ATOM 8660  N ND1    . HIS D 2 29 ? 23.486  3.005   -9.092  1.00 6.02  ? 29 HIS B ND1    3  
ATOM 8661  C CD2    . HIS D 2 29 ? 24.899  1.345   -9.180  1.00 6.27  ? 29 HIS B CD2    3  
ATOM 8662  C CE1    . HIS D 2 29 ? 24.134  3.099   -10.240 1.00 6.38  ? 29 HIS B CE1    3  
ATOM 8663  N NE2    . HIS D 2 29 ? 24.996  2.103   -10.322 1.00 6.53  ? 29 HIS B NE2    3  
ATOM 8664  H H      . HIS D 2 29 ? 21.513  -0.634  -7.250  1.00 4.82  ? 29 HIS B H      3  
ATOM 8665  H HA     . HIS D 2 29 ? 24.428  -0.397  -7.175  1.00 5.12  ? 29 HIS B HA     3  
ATOM 8666  H HB2    . HIS D 2 29 ? 22.372  1.800   -7.004  1.00 5.40  ? 29 HIS B HB2    3  
ATOM 8667  H HB3    . HIS D 2 29 ? 23.968  1.988   -6.295  1.00 5.43  ? 29 HIS B HB3    3  
ATOM 8668  H HD1    . HIS D 2 29 ? 22.781  3.633   -8.791  1.00 6.06  ? 29 HIS B HD1    3  
ATOM 8669  H HD2    . HIS D 2 29 ? 25.481  0.463   -8.947  1.00 6.55  ? 29 HIS B HD2    3  
ATOM 8670  H HE1    . HIS D 2 29 ? 23.982  3.864   -10.986 1.00 6.66  ? 29 HIS B HE1    3  
ATOM 8671  H HE2    . HIS D 2 29 ? 25.403  1.791   -11.168 1.00 6.89  ? 29 HIS B HE2    3  
ATOM 8672  N N      . VAL D 2 30 ? 23.971  -1.471  -4.934  1.00 4.43  ? 30 VAL B N      3  
ATOM 8673  C CA     . VAL D 2 30 ? 23.944  -1.956  -3.561  1.00 4.08  ? 30 VAL B CA     3  
ATOM 8674  C C      . VAL D 2 30 ? 25.213  -2.724  -3.234  1.00 4.00  ? 30 VAL B C      3  
ATOM 8675  O O      . VAL D 2 30 ? 26.080  -2.899  -4.088  1.00 4.18  ? 30 VAL B O      3  
ATOM 8676  C CB     . VAL D 2 30 ? 22.787  -2.937  -3.319  1.00 3.71  ? 30 VAL B CB     3  
ATOM 8677  C CG1    . VAL D 2 30 ? 21.438  -2.265  -3.438  1.00 3.82  ? 30 VAL B CG1    3  
ATOM 8678  C CG2    . VAL D 2 30 ? 22.895  -4.123  -4.260  1.00 3.92  ? 30 VAL B CG2    3  
ATOM 8679  H H      . VAL D 2 30 ? 24.483  -1.977  -5.588  1.00 4.57  ? 30 VAL B H      3  
ATOM 8680  H HA     . VAL D 2 30 ? 23.839  -1.115  -2.892  1.00 4.15  ? 30 VAL B HA     3  
ATOM 8681  H HB     . VAL D 2 30 ? 22.887  -3.306  -2.321  1.00 3.58  ? 30 VAL B HB     3  
ATOM 8682  H HG11   . VAL D 2 30 ? 20.658  -3.008  -3.352  1.00 4.13  ? 30 VAL B HG11   3  
ATOM 8683  H HG12   . VAL D 2 30 ? 21.363  -1.771  -4.395  1.00 4.03  ? 30 VAL B HG12   3  
ATOM 8684  H HG13   . VAL D 2 30 ? 21.332  -1.540  -2.645  1.00 3.93  ? 30 VAL B HG13   3  
ATOM 8685  H HG21   . VAL D 2 30 ? 23.881  -4.561  -4.170  1.00 4.08  ? 30 VAL B HG21   3  
ATOM 8686  H HG22   . VAL D 2 30 ? 22.738  -3.792  -5.276  1.00 4.16  ? 30 VAL B HG22   3  
ATOM 8687  H HG23   . VAL D 2 30 ? 22.149  -4.858  -4.000  1.00 4.16  ? 30 VAL B HG23   3  
ATOM 8688  N N      . SER D 2 31 ? 25.290  -3.221  -2.005  1.00 3.77  ? 31 SER B N      3  
ATOM 8689  C CA     . SER D 2 31 ? 26.432  -4.002  -1.574  1.00 3.67  ? 31 SER B CA     3  
ATOM 8690  C C      . SER D 2 31 ? 26.107  -5.491  -1.639  1.00 3.36  ? 31 SER B C      3  
ATOM 8691  O O      . SER D 2 31 ? 24.942  -5.878  -1.753  1.00 3.20  ? 31 SER B O      3  
ATOM 8692  C CB     . SER D 2 31 ? 26.853  -3.621  -0.156  1.00 3.65  ? 31 SER B CB     3  
ATOM 8693  O OG     . SER D 2 31 ? 27.304  -2.278  -0.099  1.00 3.96  ? 31 SER B OG     3  
ATOM 8694  H H      . SER D 2 31 ? 24.559  -3.059  -1.377  1.00 3.68  ? 31 SER B H      3  
ATOM 8695  H HA     . SER D 2 31 ? 27.243  -3.797  -2.254  1.00 3.89  ? 31 SER B HA     3  
ATOM 8696  H HB2    . SER D 2 31 ? 26.011  -3.736  0.510   1.00 3.48  ? 31 SER B HB2    3  
ATOM 8697  H HB3    . SER D 2 31 ? 27.657  -4.275  0.161   1.00 3.79  ? 31 SER B HB3    3  
ATOM 8698  H HG     . SER D 2 31 ? 26.554  -1.687  0.036   1.00 4.12  ? 31 SER B HG     3  
ATOM 8699  N N      . ALA D 2 32 ? 27.142  -6.312  -1.565  1.00 3.31  ? 32 ALA B N      3  
ATOM 8700  C CA     . ALA D 2 32 ? 26.995  -7.759  -1.630  1.00 3.09  ? 32 ALA B CA     3  
ATOM 8701  C C      . ALA D 2 32 ? 26.340  -8.336  -0.376  1.00 2.76  ? 32 ALA B C      3  
ATOM 8702  O O      . ALA D 2 32 ? 25.276  -8.944  -0.463  1.00 2.62  ? 32 ALA B O      3  
ATOM 8703  C CB     . ALA D 2 32 ? 28.352  -8.388  -1.848  1.00 3.17  ? 32 ALA B CB     3  
ATOM 8704  H H      . ALA D 2 32 ? 28.040  -5.932  -1.465  1.00 3.46  ? 32 ALA B H      3  
ATOM 8705  H HA     . ALA D 2 32 ? 26.379  -7.992  -2.485  1.00 3.16  ? 32 ALA B HA     3  
ATOM 8706  H HB1    . ALA D 2 32 ? 28.278  -9.459  -1.730  1.00 3.12  ? 32 ALA B HB1    3  
ATOM 8707  H HB2    . ALA D 2 32 ? 29.047  -7.991  -1.120  1.00 3.30  ? 32 ALA B HB2    3  
ATOM 8708  H HB3    . ALA D 2 32 ? 28.702  -8.156  -2.842  1.00 3.55  ? 32 ALA B HB3    3  
ATOM 8709  N N      . LYS D 2 33 ? 26.986  -8.135  0.777   1.00 2.69  ? 33 LYS B N      3  
ATOM 8710  C CA     . LYS D 2 33 ? 26.492  -8.647  2.062   1.00 2.46  ? 33 LYS B CA     3  
ATOM 8711  C C      . LYS D 2 33 ? 25.020  -8.370  2.250   1.00 2.42  ? 33 LYS B C      3  
ATOM 8712  O O      . LYS D 2 33 ? 24.256  -9.264  2.597   1.00 2.27  ? 33 LYS B O      3  
ATOM 8713  C CB     . LYS D 2 33 ? 27.259  -8.013  3.218   1.00 2.57  ? 33 LYS B CB     3  
ATOM 8714  C CG     . LYS D 2 33 ? 27.300  -8.887  4.451   1.00 2.90  ? 33 LYS B CG     3  
ATOM 8715  C CD     . LYS D 2 33 ? 28.327  -9.999  4.303   1.00 3.43  ? 33 LYS B CD     3  
ATOM 8716  C CE     . LYS D 2 33 ? 27.703  -11.377 4.465   1.00 4.18  ? 33 LYS B CE     3  
ATOM 8717  N NZ     . LYS D 2 33 ? 28.464  -12.411 3.715   1.00 4.90  ? 33 LYS B NZ     3  
ATOM 8718  H H      . LYS D 2 33 ? 27.828  -7.636  0.764   1.00 2.84  ? 33 LYS B H      3  
ATOM 8719  H HA     . LYS D 2 33 ? 26.636  -9.715  2.083   1.00 2.31  ? 33 LYS B HA     3  
ATOM 8720  H HB2    . LYS D 2 33 ? 28.271  -7.811  2.905   1.00 2.68  ? 33 LYS B HB2    3  
ATOM 8721  H HB3    . LYS D 2 33 ? 26.775  -7.081  3.487   1.00 2.83  ? 33 LYS B HB3    3  
ATOM 8722  H HG2    . LYS D 2 33 ? 27.554  -8.278  5.302   1.00 3.07  ? 33 LYS B HG2    3  
ATOM 8723  H HG3    . LYS D 2 33 ? 26.322  -9.323  4.591   1.00 3.00  ? 33 LYS B HG3    3  
ATOM 8724  H HD2    . LYS D 2 33 ? 28.774  -9.933  3.323   1.00 3.60  ? 33 LYS B HD2    3  
ATOM 8725  H HD3    . LYS D 2 33 ? 29.091  -9.870  5.057   1.00 3.60  ? 33 LYS B HD3    3  
ATOM 8726  H HE2    . LYS D 2 33 ? 27.696  -11.635 5.512   1.00 4.35  ? 33 LYS B HE2    3  
ATOM 8727  H HE3    . LYS D 2 33 ? 26.689  -11.346 4.093   1.00 4.47  ? 33 LYS B HE3    3  
ATOM 8728  H HZ1    . LYS D 2 33 ? 28.154  -13.364 3.993   1.00 5.05  ? 33 LYS B HZ1    3  
ATOM 8729  H HZ2    . LYS D 2 33 ? 29.484  -12.320 3.913   1.00 5.15  ? 33 LYS B HZ2    3  
ATOM 8730  H HZ3    . LYS D 2 33 ? 28.308  -12.292 2.687   1.00 5.39  ? 33 LYS B HZ3    3  
ATOM 8731  N N      . THR D 2 34 ? 24.640  -7.130  2.032   1.00 2.61  ? 34 THR B N      3  
ATOM 8732  C CA     . THR D 2 34 ? 23.262  -6.719  2.163   1.00 2.61  ? 34 THR B CA     3  
ATOM 8733  C C      . THR D 2 34 ? 22.320  -7.644  1.405   1.00 2.42  ? 34 THR B C      3  
ATOM 8734  O O      . THR D 2 34 ? 21.331  -8.108  1.961   1.00 2.28  ? 34 THR B O      3  
ATOM 8735  C CB     . THR D 2 34 ? 23.061  -5.298  1.639   1.00 2.90  ? 34 THR B CB     3  
ATOM 8736  O OG1    . THR D 2 34 ? 24.105  -4.445  2.126   1.00 3.13  ? 34 THR B OG1    3  
ATOM 8737  C CG2    . THR D 2 34 ? 21.707  -4.780  2.076   1.00 2.93  ? 34 THR B CG2    3  
ATOM 8738  H H      . THR D 2 34 ? 25.314  -6.461  1.812   1.00 2.78  ? 34 THR B H      3  
ATOM 8739  H HA     . THR D 2 34 ? 23.004  -6.733  3.211   1.00 2.59  ? 34 THR B HA     3  
ATOM 8740  H HB     . THR D 2 34 ? 23.093  -5.318  0.558   1.00 2.95  ? 34 THR B HB     3  
ATOM 8741  H HG1    . THR D 2 34 ? 23.848  -3.522  2.010   1.00 3.30  ? 34 THR B HG1    3  
ATOM 8742  H HG21   . THR D 2 34 ? 21.782  -4.385  3.076   1.00 3.01  ? 34 THR B HG21   3  
ATOM 8743  H HG22   . THR D 2 34 ? 20.996  -5.599  2.064   1.00 3.20  ? 34 THR B HG22   3  
ATOM 8744  H HG23   . THR D 2 34 ? 21.381  -4.005  1.400   1.00 3.08  ? 34 THR B HG23   3  
ATOM 8745  N N      . ARG D 2 35 ? 22.663  -7.958  0.164   1.00 2.50  ? 35 ARG B N      3  
ATOM 8746  C CA     . ARG D 2 35 ? 21.811  -8.800  -0.656  1.00 2.44  ? 35 ARG B CA     3  
ATOM 8747  C C      . ARG D 2 35 ? 21.688  -10.185 -0.041  1.00 2.25  ? 35 ARG B C      3  
ATOM 8748  O O      . ARG D 2 35 ? 20.633  -10.810 -0.102  1.00 2.20  ? 35 ARG B O      3  
ATOM 8749  C CB     . ARG D 2 35 ? 22.360  -8.913  -2.083  1.00 2.67  ? 35 ARG B CB     3  
ATOM 8750  C CG     . ARG D 2 35 ? 22.451  -7.582  -2.806  1.00 2.98  ? 35 ARG B CG     3  
ATOM 8751  C CD     . ARG D 2 35 ? 22.832  -7.752  -4.272  1.00 3.19  ? 35 ARG B CD     3  
ATOM 8752  N NE     . ARG D 2 35 ? 24.133  -8.408  -4.455  1.00 3.34  ? 35 ARG B NE     3  
ATOM 8753  C CZ     . ARG D 2 35 ? 25.240  -7.778  -4.862  1.00 3.60  ? 35 ARG B CZ     3  
ATOM 8754  N NH1    . ARG D 2 35 ? 25.235  -6.458  -5.023  1.00 3.81  ? 35 ARG B NH1    3  
ATOM 8755  N NH2    . ARG D 2 35 ? 26.353  -8.465  -5.102  1.00 3.91  ? 35 ARG B NH2    3  
ATOM 8756  H H      . ARG D 2 35 ? 23.529  -7.660  -0.189  1.00 2.64  ? 35 ARG B H      3  
ATOM 8757  H HA     . ARG D 2 35 ? 20.832  -8.335  -0.684  1.00 2.44  ? 35 ARG B HA     3  
ATOM 8758  H HB2    . ARG D 2 35 ? 23.348  -9.343  -2.044  1.00 2.73  ? 35 ARG B HB2    3  
ATOM 8759  H HB3    . ARG D 2 35 ? 21.713  -9.564  -2.653  1.00 2.69  ? 35 ARG B HB3    3  
ATOM 8760  H HG2    . ARG D 2 35 ? 21.490  -7.092  -2.752  1.00 2.98  ? 35 ARG B HG2    3  
ATOM 8761  H HG3    . ARG D 2 35 ? 23.194  -6.970  -2.318  1.00 3.22  ? 35 ARG B HG3    3  
ATOM 8762  H HD2    . ARG D 2 35 ? 22.073  -8.347  -4.758  1.00 3.26  ? 35 ARG B HD2    3  
ATOM 8763  H HD3    . ARG D 2 35 ? 22.867  -6.776  -4.733  1.00 3.46  ? 35 ARG B HD3    3  
ATOM 8764  H HE     . ARG D 2 35 ? 24.169  -9.380  -4.302  1.00 3.45  ? 35 ARG B HE     3  
ATOM 8765  H HH11   . ARG D 2 35 ? 24.401  -5.934  -4.841  1.00 3.83  ? 35 ARG B HH11   3  
ATOM 8766  H HH12   . ARG D 2 35 ? 26.061  -5.982  -5.331  1.00 4.13  ? 35 ARG B HH12   3  
ATOM 8767  H HH21   . ARG D 2 35 ? 26.366  -9.463  -4.984  1.00 4.06  ? 35 ARG B HH21   3  
ATOM 8768  H HH22   . ARG D 2 35 ? 27.188  -7.994  -5.411  1.00 4.15  ? 35 ARG B HH22   3  
ATOM 8769  N N      . GLU D 2 36 ? 22.774  -10.640 0.565   1.00 2.21  ? 36 GLU B N      3  
ATOM 8770  C CA     . GLU D 2 36 ? 22.813  -11.950 1.193   1.00 2.13  ? 36 GLU B CA     3  
ATOM 8771  C C      . GLU D 2 36 ? 21.894  -11.996 2.403   1.00 2.03  ? 36 GLU B C      3  
ATOM 8772  O O      . GLU D 2 36 ? 21.158  -12.957 2.589   1.00 2.06  ? 36 GLU B O      3  
ATOM 8773  C CB     . GLU D 2 36 ? 24.240  -12.304 1.623   1.00 2.14  ? 36 GLU B CB     3  
ATOM 8774  C CG     . GLU D 2 36 ? 25.292  -12.074 0.550   1.00 2.40  ? 36 GLU B CG     3  
ATOM 8775  C CD     . GLU D 2 36 ? 26.683  -12.482 1.007   1.00 2.61  ? 36 GLU B CD     3  
ATOM 8776  O OE1    . GLU D 2 36 ? 26.959  -13.696 1.098   1.00 2.82  ? 36 GLU B OE1    3  
ATOM 8777  O OE2    . GLU D 2 36 ? 27.505  -11.590 1.296   1.00 2.94  ? 36 GLU B OE2    3  
ATOM 8778  H H      . GLU D 2 36 ? 23.562  -10.066 0.617   1.00 2.27  ? 36 GLU B H      3  
ATOM 8779  H HA     . GLU D 2 36 ? 22.473  -12.673 0.471   1.00 2.22  ? 36 GLU B HA     3  
ATOM 8780  H HB2    . GLU D 2 36 ? 24.501  -11.701 2.482   1.00 2.10  ? 36 GLU B HB2    3  
ATOM 8781  H HB3    . GLU D 2 36 ? 24.269  -13.345 1.907   1.00 2.20  ? 36 GLU B HB3    3  
ATOM 8782  H HG2    . GLU D 2 36 ? 25.030  -12.655 -0.323  1.00 2.78  ? 36 GLU B HG2    3  
ATOM 8783  H HG3    . GLU D 2 36 ? 25.301  -11.020 0.293   1.00 2.47  ? 36 GLU B HG3    3  
ATOM 8784  N N      . LYS D 2 37 ? 21.923  -10.942 3.212   1.00 2.03  ? 37 LYS B N      3  
ATOM 8785  C CA     . LYS D 2 37 ? 21.099  -10.883 4.413   1.00 2.06  ? 37 LYS B CA     3  
ATOM 8786  C C      . LYS D 2 37 ? 19.623  -10.727 4.076   1.00 2.07  ? 37 LYS B C      3  
ATOM 8787  O O      . LYS D 2 37 ? 18.775  -11.390 4.668   1.00 2.14  ? 37 LYS B O      3  
ATOM 8788  C CB     . LYS D 2 37 ? 21.549  -9.731  5.308   1.00 2.19  ? 37 LYS B CB     3  
ATOM 8789  C CG     . LYS D 2 37 ? 23.040  -9.474  5.237   1.00 2.53  ? 37 LYS B CG     3  
ATOM 8790  C CD     . LYS D 2 37 ? 23.579  -8.915  6.532   1.00 2.52  ? 37 LYS B CD     3  
ATOM 8791  C CE     . LYS D 2 37 ? 23.219  -7.448  6.715   1.00 2.77  ? 37 LYS B CE     3  
ATOM 8792  N NZ     . LYS D 2 37 ? 23.462  -6.992  8.113   1.00 3.10  ? 37 LYS B NZ     3  
ATOM 8793  H H      . LYS D 2 37 ? 22.531  -10.193 3.010   1.00 2.08  ? 37 LYS B H      3  
ATOM 8794  H HA     . LYS D 2 37 ? 21.233  -11.812 4.949   1.00 2.08  ? 37 LYS B HA     3  
ATOM 8795  H HB2    . LYS D 2 37 ? 21.033  -8.832  5.008   1.00 2.31  ? 37 LYS B HB2    3  
ATOM 8796  H HB3    . LYS D 2 37 ? 21.291  -9.961  6.332   1.00 2.24  ? 37 LYS B HB3    3  
ATOM 8797  H HG2    . LYS D 2 37 ? 23.545  -10.405 5.024   1.00 2.82  ? 37 LYS B HG2    3  
ATOM 8798  H HG3    . LYS D 2 37 ? 23.234  -8.769  4.443   1.00 2.81  ? 37 LYS B HG3    3  
ATOM 8799  H HD2    . LYS D 2 37 ? 23.169  -9.483  7.350   1.00 2.54  ? 37 LYS B HD2    3  
ATOM 8800  H HD3    . LYS D 2 37 ? 24.652  -9.015  6.522   1.00 2.53  ? 37 LYS B HD3    3  
ATOM 8801  H HE2    . LYS D 2 37 ? 23.827  -6.859  6.040   1.00 3.03  ? 37 LYS B HE2    3  
ATOM 8802  H HE3    . LYS D 2 37 ? 22.172  -7.309  6.473   1.00 2.68  ? 37 LYS B HE3    3  
ATOM 8803  H HZ1    . LYS D 2 37 ? 24.444  -6.641  8.213   1.00 3.51  ? 37 LYS B HZ1    3  
ATOM 8804  H HZ2    . LYS D 2 37 ? 23.324  -7.783  8.782   1.00 3.04  ? 37 LYS B HZ2    3  
ATOM 8805  H HZ3    . LYS D 2 37 ? 22.806  -6.226  8.363   1.00 3.45  ? 37 LYS B HZ3    3  
ATOM 8806  N N      . VAL D 2 38 ? 19.313  -9.858  3.121   1.00 2.07  ? 38 VAL B N      3  
ATOM 8807  C CA     . VAL D 2 38 ? 17.924  -9.634  2.738   1.00 2.08  ? 38 VAL B CA     3  
ATOM 8808  C C      . VAL D 2 38 ? 17.348  -10.881 2.065   1.00 2.04  ? 38 VAL B C      3  
ATOM 8809  O O      . VAL D 2 38 ? 16.249  -11.321 2.406   1.00 2.07  ? 38 VAL B O      3  
ATOM 8810  C CB     . VAL D 2 38 ? 17.776  -8.396  1.837   1.00 2.17  ? 38 VAL B CB     3  
ATOM 8811  C CG1    . VAL D 2 38 ? 18.619  -7.252  2.377   1.00 2.33  ? 38 VAL B CG1    3  
ATOM 8812  C CG2    . VAL D 2 38 ? 18.134  -8.699  0.403   1.00 2.21  ? 38 VAL B CG2    3  
ATOM 8813  H H      . VAL D 2 38 ? 20.035  -9.368  2.657   1.00 2.10  ? 38 VAL B H      3  
ATOM 8814  H HA     . VAL D 2 38 ? 17.353  -9.446  3.641   1.00 2.14  ? 38 VAL B HA     3  
ATOM 8815  H HB     . VAL D 2 38 ? 16.744  -8.096  1.864   1.00 2.18  ? 38 VAL B HB     3  
ATOM 8816  H HG11   . VAL D 2 38 ? 19.635  -7.599  2.537   1.00 2.65  ? 38 VAL B HG11   3  
ATOM 8817  H HG12   . VAL D 2 38 ? 18.204  -6.908  3.316   1.00 2.45  ? 38 VAL B HG12   3  
ATOM 8818  H HG13   . VAL D 2 38 ? 18.623  -6.439  1.667   1.00 2.60  ? 38 VAL B HG13   3  
ATOM 8819  H HG21   . VAL D 2 38 ? 17.893  -7.849  -0.215  1.00 2.56  ? 38 VAL B HG21   3  
ATOM 8820  H HG22   . VAL D 2 38 ? 17.566  -9.564  0.074   1.00 2.55  ? 38 VAL B HG22   3  
ATOM 8821  H HG23   . VAL D 2 38 ? 19.189  -8.913  0.337   1.00 2.23  ? 38 VAL B HG23   3  
ATOM 8822  N N      . GLU D 2 39 ? 18.093  -11.444 1.116   1.00 2.06  ? 39 GLU B N      3  
ATOM 8823  C CA     . GLU D 2 39 ? 17.665  -12.654 0.434   1.00 2.17  ? 39 GLU B CA     3  
ATOM 8824  C C      . GLU D 2 39 ? 17.565  -13.783 1.437   1.00 2.25  ? 39 GLU B C      3  
ATOM 8825  O O      . GLU D 2 39 ? 16.658  -14.605 1.356   1.00 2.39  ? 39 GLU B O      3  
ATOM 8826  C CB     . GLU D 2 39 ? 18.611  -13.028 -0.709  1.00 2.31  ? 39 GLU B CB     3  
ATOM 8827  C CG     . GLU D 2 39 ? 17.927  -13.053 -2.071  1.00 2.51  ? 39 GLU B CG     3  
ATOM 8828  C CD     . GLU D 2 39 ? 17.169  -14.348 -2.336  1.00 2.75  ? 39 GLU B CD     3  
ATOM 8829  O OE1    . GLU D 2 39 ? 17.638  -15.426 -1.894  1.00 2.96  ? 39 GLU B OE1    3  
ATOM 8830  O OE2    . GLU D 2 39 ? 16.093  -14.295 -2.973  1.00 3.00  ? 39 GLU B OE2    3  
ATOM 8831  H H      . GLU D 2 39 ? 18.929  -11.011 0.852   1.00 2.08  ? 39 GLU B H      3  
ATOM 8832  H HA     . GLU D 2 39 ? 16.681  -12.469 0.026   1.00 2.19  ? 39 GLU B HA     3  
ATOM 8833  H HB2    . GLU D 2 39 ? 19.416  -12.308 -0.745  1.00 2.25  ? 39 GLU B HB2    3  
ATOM 8834  H HB3    . GLU D 2 39 ? 19.021  -14.008 -0.518  1.00 2.43  ? 39 GLU B HB3    3  
ATOM 8835  H HG2    . GLU D 2 39 ? 17.229  -12.229 -2.117  1.00 2.57  ? 39 GLU B HG2    3  
ATOM 8836  H HG3    . GLU D 2 39 ? 18.678  -12.928 -2.837  1.00 2.58  ? 39 GLU B HG3    3  
ATOM 8837  N N      . ALA D 2 40 ? 18.497  -13.820 2.394   1.00 2.22  ? 40 ALA B N      3  
ATOM 8838  C CA     . ALA D 2 40 ? 18.438  -14.837 3.427   1.00 2.38  ? 40 ALA B CA     3  
ATOM 8839  C C      . ALA D 2 40 ? 17.137  -14.679 4.173   1.00 2.45  ? 40 ALA B C      3  
ATOM 8840  O O      . ALA D 2 40 ? 16.334  -15.597 4.233   1.00 2.65  ? 40 ALA B O      3  
ATOM 8841  C CB     . ALA D 2 40 ? 19.591  -14.731 4.412   1.00 2.37  ? 40 ALA B CB     3  
ATOM 8842  H H      . ALA D 2 40 ? 19.233  -13.157 2.396   1.00 2.13  ? 40 ALA B H      3  
ATOM 8843  H HA     . ALA D 2 40 ? 18.467  -15.810 2.956   1.00 2.53  ? 40 ALA B HA     3  
ATOM 8844  H HB1    . ALA D 2 40 ? 19.996  -13.731 4.387   1.00 2.47  ? 40 ALA B HB1    3  
ATOM 8845  H HB2    . ALA D 2 40 ? 20.360  -15.442 4.148   1.00 2.67  ? 40 ALA B HB2    3  
ATOM 8846  H HB3    . ALA D 2 40 ? 19.223  -14.946 5.412   1.00 2.55  ? 40 ALA B HB3    3  
ATOM 8847  N N      . ALA D 2 41 ? 16.917  -13.474 4.684   1.00 2.34  ? 41 ALA B N      3  
ATOM 8848  C CA     . ALA D 2 41 ? 15.723  -13.165 5.437   1.00 2.45  ? 41 ALA B CA     3  
ATOM 8849  C C      . ALA D 2 41 ? 14.442  -13.569 4.717   1.00 2.47  ? 41 ALA B C      3  
ATOM 8850  O O      . ALA D 2 41 ? 13.612  -14.279 5.277   1.00 2.68  ? 41 ALA B O      3  
ATOM 8851  C CB     . ALA D 2 41 ? 15.700  -11.687 5.728   1.00 2.39  ? 41 ALA B CB     3  
ATOM 8852  H H      . ALA D 2 41 ? 17.602  -12.762 4.568   1.00 2.23  ? 41 ALA B H      3  
ATOM 8853  H HA     . ALA D 2 41 ? 15.776  -13.690 6.378   1.00 2.64  ? 41 ALA B HA     3  
ATOM 8854  H HB1    . ALA D 2 41 ? 16.559  -11.424 6.323   1.00 2.56  ? 41 ALA B HB1    3  
ATOM 8855  H HB2    . ALA D 2 41 ? 14.796  -11.443 6.265   1.00 2.62  ? 41 ALA B HB2    3  
ATOM 8856  H HB3    . ALA D 2 41 ? 15.728  -11.148 4.795   1.00 2.58  ? 41 ALA B HB3    3  
ATOM 8857  N N      . MET D 2 42 ? 14.296  -13.148 3.471   1.00 2.31  ? 42 MET B N      3  
ATOM 8858  C CA     . MET D 2 42 ? 13.102  -13.477 2.704   1.00 2.35  ? 42 MET B CA     3  
ATOM 8859  C C      . MET D 2 42 ? 13.007  -14.981 2.479   1.00 2.59  ? 42 MET B C      3  
ATOM 8860  O O      . MET D 2 42 ? 11.917  -15.542 2.420   1.00 2.74  ? 42 MET B O      3  
ATOM 8861  C CB     . MET D 2 42 ? 13.052  -12.723 1.375   1.00 2.21  ? 42 MET B CB     3  
ATOM 8862  C CG     . MET D 2 42 ? 14.244  -12.950 0.481   1.00 2.23  ? 42 MET B CG     3  
ATOM 8863  S SD     . MET D 2 42 ? 14.237  -11.842 -0.931  1.00 2.21  ? 42 MET B SD     3  
ATOM 8864  C CE     . MET D 2 42 ? 14.272  -10.286 -0.054  1.00 2.06  ? 42 MET B CE     3  
ATOM 8865  H H      . MET D 2 42 ? 15.006  -12.604 3.059   1.00 2.20  ? 42 MET B H      3  
ATOM 8866  H HA     . MET D 2 42 ? 12.252  -13.164 3.291   1.00 2.39  ? 42 MET B HA     3  
ATOM 8867  H HB2    . MET D 2 42 ? 12.167  -13.033 0.836   1.00 2.28  ? 42 MET B HB2    3  
ATOM 8868  H HB3    . MET D 2 42 ? 12.976  -11.664 1.579   1.00 2.11  ? 42 MET B HB3    3  
ATOM 8869  H HG2    . MET D 2 42 ? 15.141  -12.766 1.056   1.00 2.18  ? 42 MET B HG2    3  
ATOM 8870  H HG3    . MET D 2 42 ? 14.228  -13.970 0.136   1.00 2.38  ? 42 MET B HG3    3  
ATOM 8871  H HE1    . MET D 2 42 ? 15.278  -10.095 0.297   1.00 2.35  ? 42 MET B HE1    3  
ATOM 8872  H HE2    . MET D 2 42 ? 13.601  -10.346 0.795   1.00 2.16  ? 42 MET B HE2    3  
ATOM 8873  H HE3    . MET D 2 42 ? 13.957  -9.491  -0.710  1.00 2.35  ? 42 MET B HE3    3  
ATOM 8874  N N      . ALA D 2 43 ? 14.158  -15.628 2.355   1.00 2.65  ? 43 ALA B N      3  
ATOM 8875  C CA     . ALA D 2 43 ? 14.200  -17.063 2.107   1.00 2.94  ? 43 ALA B CA     3  
ATOM 8876  C C      . ALA D 2 43 ? 13.781  -17.841 3.345   1.00 3.17  ? 43 ALA B C      3  
ATOM 8877  O O      . ALA D 2 43 ? 12.974  -18.765 3.267   1.00 3.43  ? 43 ALA B O      3  
ATOM 8878  C CB     . ALA D 2 43 ? 15.586  -17.493 1.655   1.00 2.97  ? 43 ALA B CB     3  
ATOM 8879  H H      . ALA D 2 43 ? 15.006  -15.141 2.511   1.00 2.53  ? 43 ALA B H      3  
ATOM 8880  H HA     . ALA D 2 43 ? 13.505  -17.281 1.309   1.00 3.01  ? 43 ALA B HA     3  
ATOM 8881  H HB1    . ALA D 2 43 ? 15.588  -18.554 1.453   1.00 3.11  ? 43 ALA B HB1    3  
ATOM 8882  H HB2    . ALA D 2 43 ? 16.303  -17.275 2.434   1.00 3.03  ? 43 ALA B HB2    3  
ATOM 8883  H HB3    . ALA D 2 43 ? 15.855  -16.955 0.759   1.00 3.28  ? 43 ALA B HB3    3  
ATOM 8884  N N      . GLU D 2 44 ? 14.324  -17.439 4.486   1.00 3.13  ? 44 GLU B N      3  
ATOM 8885  C CA     . GLU D 2 44 ? 14.037  -18.100 5.751   1.00 3.41  ? 44 GLU B CA     3  
ATOM 8886  C C      . GLU D 2 44 ? 12.590  -17.901 6.156   1.00 3.51  ? 44 GLU B C      3  
ATOM 8887  O O      . GLU D 2 44 ? 11.932  -18.828 6.625   1.00 3.81  ? 44 GLU B O      3  
ATOM 8888  C CB     . GLU D 2 44 ? 14.935  -17.549 6.849   1.00 3.38  ? 44 GLU B CB     3  
ATOM 8889  C CG     . GLU D 2 44 ? 16.372  -17.352 6.423   1.00 3.23  ? 44 GLU B CG     3  
ATOM 8890  C CD     . GLU D 2 44 ? 17.340  -18.279 7.130   1.00 3.42  ? 44 GLU B CD     3  
ATOM 8891  O OE1    . GLU D 2 44 ? 17.839  -17.913 8.216   1.00 3.67  ? 44 GLU B OE1    3  
ATOM 8892  O OE2    . GLU D 2 44 ? 17.593  -19.388 6.606   1.00 3.57  ? 44 GLU B OE2    3  
ATOM 8893  H H      . GLU D 2 44 ? 14.940  -16.667 4.480   1.00 2.94  ? 44 GLU B H      3  
ATOM 8894  H HA     . GLU D 2 44 ? 14.223  -19.153 5.630   1.00 3.62  ? 44 GLU B HA     3  
ATOM 8895  H HB2    . GLU D 2 44 ? 14.546  -16.588 7.150   1.00 3.25  ? 44 GLU B HB2    3  
ATOM 8896  H HB3    . GLU D 2 44 ? 14.915  -18.221 7.691   1.00 3.64  ? 44 GLU B HB3    3  
ATOM 8897  H HG2    . GLU D 2 44 ? 16.439  -17.518 5.358   1.00 3.07  ? 44 GLU B HG2    3  
ATOM 8898  H HG3    . GLU D 2 44 ? 16.648  -16.330 6.639   1.00 3.20  ? 44 GLU B HG3    3  
ATOM 8899  N N      . LEU D 2 45 ? 12.097  -16.687 5.970   1.00 3.28  ? 45 LEU B N      3  
ATOM 8900  C CA     . LEU D 2 45 ? 10.721  -16.384 6.335   1.00 3.36  ? 45 LEU B CA     3  
ATOM 8901  C C      . LEU D 2 45 ? 9.746   -16.882 5.277   1.00 3.35  ? 45 LEU B C      3  
ATOM 8902  O O      . LEU D 2 45 ? 8.535   -16.790 5.461   1.00 3.40  ? 45 LEU B O      3  
ATOM 8903  C CB     . LEU D 2 45 ? 10.529  -14.877 6.523   1.00 3.17  ? 45 LEU B CB     3  
ATOM 8904  C CG     . LEU D 2 45 ? 11.593  -14.167 7.359   1.00 3.15  ? 45 LEU B CG     3  
ATOM 8905  C CD1    . LEU D 2 45 ? 11.107  -12.785 7.771   1.00 3.11  ? 45 LEU B CD1    3  
ATOM 8906  C CD2    . LEU D 2 45 ? 11.974  -15.003 8.572   1.00 3.47  ? 45 LEU B CD2    3  
ATOM 8907  H H      . LEU D 2 45 ? 12.685  -15.972 5.627   1.00 3.07  ? 45 LEU B H      3  
ATOM 8908  H HA     . LEU D 2 45 ? 10.507  -16.879 7.267   1.00 3.61  ? 45 LEU B HA     3  
ATOM 8909  H HB2    . LEU D 2 45 ? 10.507  -14.418 5.546   1.00 2.94  ? 45 LEU B HB2    3  
ATOM 8910  H HB3    . LEU D 2 45 ? 9.571   -14.718 6.995   1.00 3.30  ? 45 LEU B HB3    3  
ATOM 8911  H HG     . LEU D 2 45 ? 12.483  -14.036 6.756   1.00 2.97  ? 45 LEU B HG     3  
ATOM 8912  H HD11   . LEU D 2 45 ? 11.034  -12.154 6.895   1.00 3.15  ? 45 LEU B HD11   3  
ATOM 8913  H HD12   . LEU D 2 45 ? 11.806  -12.347 8.469   1.00 3.48  ? 45 LEU B HD12   3  
ATOM 8914  H HD13   . LEU D 2 45 ? 10.137  -12.864 8.236   1.00 3.16  ? 45 LEU B HD13   3  
ATOM 8915  H HD21   . LEU D 2 45 ? 11.082  -15.389 9.039   1.00 3.59  ? 45 LEU B HD21   3  
ATOM 8916  H HD22   . LEU D 2 45 ? 12.517  -14.389 9.275   1.00 3.86  ? 45 LEU B HD22   3  
ATOM 8917  H HD23   . LEU D 2 45 ? 12.603  -15.827 8.252   1.00 3.59  ? 45 LEU B HD23   3  
ATOM 8918  N N      . ASN D 2 46 ? 10.279  -17.450 4.197   1.00 3.31  ? 46 ASN B N      3  
ATOM 8919  C CA     . ASN D 2 46 ? 9.447   -17.962 3.102   1.00 3.36  ? 46 ASN B CA     3  
ATOM 8920  C C      . ASN D 2 46 ? 8.582   -16.832 2.546   1.00 3.04  ? 46 ASN B C      3  
ATOM 8921  O O      . ASN D 2 46 ? 7.358   -16.795 2.709   1.00 3.00  ? 46 ASN B O      3  
ATOM 8922  C CB     . ASN D 2 46 ? 8.585   -19.144 3.570   1.00 3.70  ? 46 ASN B CB     3  
ATOM 8923  C CG     . ASN D 2 46 ? 7.799   -19.792 2.440   1.00 3.87  ? 46 ASN B CG     3  
ATOM 8924  O OD1    . ASN D 2 46 ? 8.320   -20.627 1.700   1.00 4.39  ? 46 ASN B OD1    3  
ATOM 8925  N ND2    . ASN D 2 46 ? 6.536   -19.421 2.305   1.00 3.66  ? 46 ASN B ND2    3  
ATOM 8926  H H      . ASN D 2 46 ? 11.265  -17.510 4.125   1.00 3.28  ? 46 ASN B H      3  
ATOM 8927  H HA     . ASN D 2 46 ? 10.112  -18.300 2.320   1.00 3.43  ? 46 ASN B HA     3  
ATOM 8928  H HB2    . ASN D 2 46 ? 9.225   -19.893 4.011   1.00 3.92  ? 46 ASN B HB2    3  
ATOM 8929  H HB3    . ASN D 2 46 ? 7.887   -18.793 4.316   1.00 3.68  ? 46 ASN B HB3    3  
ATOM 8930  H HD21   . ASN D 2 46 ? 6.182   -18.753 2.932   1.00 3.54  ? 46 ASN B HD21   3  
ATOM 8931  H HD22   . ASN D 2 46 ? 6.009   -19.826 1.590   1.00 3.80  ? 46 ASN B HD22   3  
ATOM 8932  N N      . TYR D 2 47 ? 9.256   -15.898 1.907   1.00 2.97  ? 47 TYR B N      3  
ATOM 8933  C CA     . TYR D 2 47 ? 8.636   -14.727 1.321   1.00 2.69  ? 47 TYR B CA     3  
ATOM 8934  C C      . TYR D 2 47 ? 7.956   -15.075 0.002   1.00 2.74  ? 47 TYR B C      3  
ATOM 8935  O O      . TYR D 2 47 ? 8.464   -14.784 -1.080  1.00 2.93  ? 47 TYR B O      3  
ATOM 8936  C CB     . TYR D 2 47 ? 9.712   -13.660 1.130   1.00 2.42  ? 47 TYR B CB     3  
ATOM 8937  C CG     . TYR D 2 47 ? 9.204   -12.273 0.821   1.00 2.23  ? 47 TYR B CG     3  
ATOM 8938  C CD1    . TYR D 2 47 ? 7.882   -11.935 1.084   1.00 2.21  ? 47 TYR B CD1    3  
ATOM 8939  C CD2    . TYR D 2 47 ? 10.033  -11.306 0.269   1.00 2.14  ? 47 TYR B CD2    3  
ATOM 8940  C CE1    . TYR D 2 47 ? 7.406   -10.673 0.813   1.00 2.09  ? 47 TYR B CE1    3  
ATOM 8941  C CE2    . TYR D 2 47 ? 9.560   -10.041 -0.009  1.00 2.07  ? 47 TYR B CE2    3  
ATOM 8942  C CZ     . TYR D 2 47 ? 8.291   -9.719  0.241   1.00 2.05  ? 47 TYR B CZ     3  
ATOM 8943  O OH     . TYR D 2 47 ? 7.788   -8.463  -0.004  1.00 2.04  ? 47 TYR B OH     3  
ATOM 8944  H H      . TYR D 2 47 ? 10.223  -15.999 1.825   1.00 3.22  ? 47 TYR B H      3  
ATOM 8945  H HA     . TYR D 2 47 ? 7.893   -14.358 2.013   1.00 2.72  ? 47 TYR B HA     3  
ATOM 8946  H HB2    . TYR D 2 47 ? 10.291  -13.597 2.035   1.00 2.42  ? 47 TYR B HB2    3  
ATOM 8947  H HB3    . TYR D 2 47 ? 10.359  -13.964 0.323   1.00 2.44  ? 47 TYR B HB3    3  
ATOM 8948  H HD1    . TYR D 2 47 ? 7.220   -12.681 1.509   1.00 2.34  ? 47 TYR B HD1    3  
ATOM 8949  H HD2    . TYR D 2 47 ? 11.062  -11.554 0.056   1.00 2.18  ? 47 TYR B HD2    3  
ATOM 8950  H HE1    . TYR D 2 47 ? 6.375   -10.433 1.020   1.00 2.09  ? 47 TYR B HE1    3  
ATOM 8951  H HE2    . TYR D 2 47 ? 10.215  -9.302  -0.445  1.00 2.09  ? 47 TYR B HE2    3  
ATOM 8952  H HH     . TYR D 2 47 ? 7.233   -8.166  0.724   1.00 2.43  ? 47 TYR B HH     3  
ATOM 8953  N N      . ILE D 2 48 ? 6.828   -15.752 0.124   1.00 2.73  ? 48 ILE B N      3  
ATOM 8954  C CA     . ILE D 2 48 ? 6.026   -16.161 -1.023  1.00 2.82  ? 48 ILE B CA     3  
ATOM 8955  C C      . ILE D 2 48 ? 5.548   -14.942 -1.833  1.00 2.64  ? 48 ILE B C      3  
ATOM 8956  O O      . ILE D 2 48 ? 5.107   -13.937 -1.268  1.00 2.54  ? 48 ILE B O      3  
ATOM 8957  C CB     . ILE D 2 48 ? 4.822   -17.037 -0.568  1.00 3.08  ? 48 ILE B CB     3  
ATOM 8958  C CG1    . ILE D 2 48 ? 4.423   -18.009 -1.676  1.00 3.43  ? 48 ILE B CG1    3  
ATOM 8959  C CG2    . ILE D 2 48 ? 3.627   -16.194 -0.141  1.00 3.18  ? 48 ILE B CG2    3  
ATOM 8960  C CD1    . ILE D 2 48 ? 5.454   -19.089 -1.915  1.00 3.97  ? 48 ILE B CD1    3  
ATOM 8961  H H      . ILE D 2 48 ? 6.544   -16.013 1.023   1.00 2.78  ? 48 ILE B H      3  
ATOM 8962  H HA     . ILE D 2 48 ? 6.656   -16.768 -1.659  1.00 3.02  ? 48 ILE B HA     3  
ATOM 8963  H HB     . ILE D 2 48 ? 5.139   -17.609 0.290   1.00 3.47  ? 48 ILE B HB     3  
ATOM 8964  H HG12   . ILE D 2 48 ? 3.492   -18.489 -1.411  1.00 3.86  ? 48 ILE B HG12   3  
ATOM 8965  H HG13   . ILE D 2 48 ? 4.293   -17.463 -2.598  1.00 3.46  ? 48 ILE B HG13   3  
ATOM 8966  H HG21   . ILE D 2 48 ? 3.901   -15.585 0.709   1.00 3.66  ? 48 ILE B HG21   3  
ATOM 8967  H HG22   . ILE D 2 48 ? 2.808   -16.844 0.133   1.00 3.18  ? 48 ILE B HG22   3  
ATOM 8968  H HG23   . ILE D 2 48 ? 3.324   -15.555 -0.957  1.00 3.35  ? 48 ILE B HG23   3  
ATOM 8969  H HD11   . ILE D 2 48 ? 5.494   -19.743 -1.056  1.00 4.28  ? 48 ILE B HD11   3  
ATOM 8970  H HD12   . ILE D 2 48 ? 6.420   -18.633 -2.064  1.00 4.27  ? 48 ILE B HD12   3  
ATOM 8971  H HD13   . ILE D 2 48 ? 5.184   -19.660 -2.791  1.00 4.29  ? 48 ILE B HD13   3  
ATOM 8972  N N      . PRO D 2 49 ? 5.676   -15.003 -3.172  1.00 2.84  ? 49 PRO B N      3  
ATOM 8973  C CA     . PRO D 2 49 ? 5.269   -13.908 -4.053  1.00 2.94  ? 49 PRO B CA     3  
ATOM 8974  C C      . PRO D 2 49 ? 3.776   -13.905 -4.412  1.00 2.85  ? 49 PRO B C      3  
ATOM 8975  O O      . PRO D 2 49 ? 3.135   -12.854 -4.386  1.00 3.26  ? 49 PRO B O      3  
ATOM 8976  C CB     . PRO D 2 49 ? 6.120   -14.147 -5.299  1.00 3.45  ? 49 PRO B CB     3  
ATOM 8977  C CG     . PRO D 2 49 ? 6.328   -15.625 -5.348  1.00 3.66  ? 49 PRO B CG     3  
ATOM 8978  C CD     . PRO D 2 49 ? 6.279   -16.120 -3.924  1.00 3.26  ? 49 PRO B CD     3  
ATOM 8979  H HA     . PRO D 2 49 ? 5.529   -12.949 -3.627  1.00 3.03  ? 49 PRO B HA     3  
ATOM 8980  H HB2    . PRO D 2 49 ? 5.590   -13.793 -6.172  1.00 3.56  ? 49 PRO B HB2    3  
ATOM 8981  H HB3    . PRO D 2 49 ? 7.058   -13.621 -5.204  1.00 3.77  ? 49 PRO B HB3    3  
ATOM 8982  H HG2    . PRO D 2 49 ? 5.541   -16.083 -5.928  1.00 3.82  ? 49 PRO B HG2    3  
ATOM 8983  H HG3    . PRO D 2 49 ? 7.290   -15.842 -5.787  1.00 4.15  ? 49 PRO B HG3    3  
ATOM 8984  H HD2    . PRO D 2 49 ? 5.663   -17.005 -3.854  1.00 3.34  ? 49 PRO B HD2    3  
ATOM 8985  H HD3    . PRO D 2 49 ? 7.277   -16.329 -3.565  1.00 3.40  ? 49 PRO B HD3    3  
ATOM 8986  N N      . ASN D 2 50 ? 3.223   -15.074 -4.732  1.00 2.80  ? 50 ASN B N      3  
ATOM 8987  C CA     . ASN D 2 50 ? 1.822   -15.175 -5.119  1.00 3.03  ? 50 ASN B CA     3  
ATOM 8988  C C      . ASN D 2 50 ? 1.291   -16.574 -4.846  1.00 3.35  ? 50 ASN B C      3  
ATOM 8989  O O      . ASN D 2 50 ? 1.649   -17.539 -5.523  1.00 4.09  ? 50 ASN B O      3  
ATOM 8990  C CB     . ASN D 2 50 ? 1.650   -14.833 -6.609  1.00 3.59  ? 50 ASN B CB     3  
ATOM 8991  C CG     . ASN D 2 50 ? 0.193   -14.801 -7.066  1.00 4.23  ? 50 ASN B CG     3  
ATOM 8992  O OD1    . ASN D 2 50 ? -0.654  -15.561 -6.590  1.00 4.21  ? 50 ASN B OD1    3  
ATOM 8993  N ND2    . ASN D 2 50 ? -0.110  -13.910 -7.999  1.00 5.11  ? 50 ASN B ND2    3  
ATOM 8994  H H      . ASN D 2 50 ? 3.756   -15.888 -4.683  1.00 2.94  ? 50 ASN B H      3  
ATOM 8995  H HA     . ASN D 2 50 ? 1.261   -14.466 -4.529  1.00 3.22  ? 50 ASN B HA     3  
ATOM 8996  H HB2    . ASN D 2 50 ? 2.083   -13.863 -6.798  1.00 3.78  ? 50 ASN B HB2    3  
ATOM 8997  H HB3    . ASN D 2 50 ? 2.174   -15.572 -7.199  1.00 3.85  ? 50 ASN B HB3    3  
ATOM 8998  H HD21   . ASN D 2 50 ? 0.606   -13.326 -8.337  1.00 5.34  ? 50 ASN B HD21   3  
ATOM 8999  H HD22   . ASN D 2 50 ? -1.036  -13.868 -8.314  1.00 5.63  ? 50 ASN B HD22   3  
ATOM 9000  N N      . ARG D 2 51 ? 0.456   -16.678 -3.832  1.00 3.35  ? 51 ARG B N      3  
ATOM 9001  C CA     . ARG D 2 51 ? -0.160  -17.948 -3.471  1.00 4.19  ? 51 ARG B CA     3  
ATOM 9002  C C      . ARG D 2 51 ? -1.679  -17.849 -3.604  1.00 4.47  ? 51 ARG B C      3  
ATOM 9003  O O      . ARG D 2 51 ? -2.413  -18.711 -3.125  1.00 5.22  ? 51 ARG B O      3  
ATOM 9004  C CB     . ARG D 2 51 ? 0.221   -18.352 -2.044  1.00 4.85  ? 51 ARG B CB     3  
ATOM 9005  C CG     . ARG D 2 51 ? 1.077   -19.610 -1.976  1.00 5.60  ? 51 ARG B CG     3  
ATOM 9006  C CD     . ARG D 2 51 ? 1.396   -19.992 -0.538  1.00 6.31  ? 51 ARG B CD     3  
ATOM 9007  N NE     . ARG D 2 51 ? 2.355   -21.097 -0.456  1.00 6.87  ? 51 ARG B NE     3  
ATOM 9008  C CZ     . ARG D 2 51 ? 2.920   -21.515 0.679   1.00 7.58  ? 51 ARG B CZ     3  
ATOM 9009  N NH1    . ARG D 2 51 ? 2.615   -20.936 1.834   1.00 7.81  ? 51 ARG B NH1    3  
ATOM 9010  N NH2    . ARG D 2 51 ? 3.790   -22.517 0.652   1.00 8.32  ? 51 ARG B NH2    3  
ATOM 9011  H H      . ARG D 2 51 ? 0.255   -15.879 -3.305  1.00 3.15  ? 51 ARG B H      3  
ATOM 9012  H HA     . ARG D 2 51 ? 0.201   -18.698 -4.161  1.00 4.57  ? 51 ARG B HA     3  
ATOM 9013  H HB2    . ARG D 2 51 ? 0.771   -17.543 -1.588  1.00 4.80  ? 51 ARG B HB2    3  
ATOM 9014  H HB3    . ARG D 2 51 ? -0.683  -18.527 -1.479  1.00 5.25  ? 51 ARG B HB3    3  
ATOM 9015  H HG2    . ARG D 2 51 ? 0.542   -20.424 -2.443  1.00 5.78  ? 51 ARG B HG2    3  
ATOM 9016  H HG3    . ARG D 2 51 ? 2.001   -19.434 -2.507  1.00 5.84  ? 51 ARG B HG3    3  
ATOM 9017  H HD2    . ARG D 2 51 ? 1.814   -19.131 -0.036  1.00 6.51  ? 51 ARG B HD2    3  
ATOM 9018  H HD3    . ARG D 2 51 ? 0.481   -20.285 -0.045  1.00 6.56  ? 51 ARG B HD3    3  
ATOM 9019  H HE     . ARG D 2 51 ? 2.593   -21.554 -1.299  1.00 6.93  ? 51 ARG B HE     3  
ATOM 9020  H HH11   . ARG D 2 51 ? 1.959   -20.182 1.862   1.00 7.47  ? 51 ARG B HH11   3  
ATOM 9021  H HH12   . ARG D 2 51 ? 3.038   -21.261 2.698   1.00 8.49  ? 51 ARG B HH12   3  
ATOM 9022  H HH21   . ARG D 2 51 ? 4.020   -22.959 -0.225  1.00 8.37  ? 51 ARG B HH21   3  
ATOM 9023  H HH22   . ARG D 2 51 ? 4.218   -22.841 1.499   1.00 8.97  ? 51 ARG B HH22   3  
ATOM 9024  N N      . CYS D 2 52 ? -2.134  -16.798 -4.276  1.00 4.27  ? 52 CYS B N      3  
ATOM 9025  C CA     . CYS D 2 52 ? -3.561  -16.564 -4.472  1.00 4.94  ? 52 CYS B CA     3  
ATOM 9026  C C      . CYS D 2 52 ? -4.045  -17.154 -5.779  1.00 5.55  ? 52 CYS B C      3  
ATOM 9027  O O      . CYS D 2 52 ? -5.198  -17.581 -5.883  1.00 6.12  ? 52 CYS B O      3  
ATOM 9028  C CB     . CYS D 2 52 ? -3.857  -15.069 -4.455  1.00 5.05  ? 52 CYS B CB     3  
ATOM 9029  S SG     . CYS D 2 52 ? -3.409  -14.235 -2.899  1.00 5.08  ? 52 CYS B SG     3  
ATOM 9030  H H      . CYS D 2 52 ? -1.493  -16.160 -4.656  1.00 3.94  ? 52 CYS B H      3  
ATOM 9031  H HA     . CYS D 2 52 ? -4.093  -17.042 -3.668  1.00 5.36  ? 52 CYS B HA     3  
ATOM 9032  H HB2    . CYS D 2 52 ? -3.303  -14.594 -5.251  1.00 5.09  ? 52 CYS B HB2    3  
ATOM 9033  H HB3    . CYS D 2 52 ? -4.908  -14.920 -4.624  1.00 5.59  ? 52 CYS B HB3    3  
ATOM 9034  N N      . ALA D 2 53 ? -3.162  -17.141 -6.774  1.00 5.80  ? 53 ALA B N      3  
ATOM 9035  C CA     . ALA D 2 53 ? -3.460  -17.685 -8.094  1.00 6.71  ? 53 ALA B CA     3  
ATOM 9036  C C      . ALA D 2 53 ? -4.384  -16.756 -8.868  1.00 7.17  ? 53 ALA B C      3  
ATOM 9037  O O      . ALA D 2 53 ? -4.619  -15.618 -8.459  1.00 7.21  ? 53 ALA B O      3  
ATOM 9038  C CB     . ALA D 2 53 ? -4.052  -19.081 -7.969  1.00 7.44  ? 53 ALA B CB     3  
ATOM 9039  H H      . ALA D 2 53 ? -2.289  -16.721 -6.619  1.00 5.59  ? 53 ALA B H      3  
ATOM 9040  H HA     . ALA D 2 53 ? -2.533  -17.765 -8.641  1.00 6.85  ? 53 ALA B HA     3  
ATOM 9041  H HB1    . ALA D 2 53 ? -4.511  -19.180 -6.992  1.00 7.46  ? 53 ALA B HB1    3  
ATOM 9042  H HB2    . ALA D 2 53 ? -3.268  -19.816 -8.076  1.00 7.68  ? 53 ALA B HB2    3  
ATOM 9043  H HB3    . ALA D 2 53 ? -4.796  -19.228 -8.736  1.00 7.92  ? 53 ALA B HB3    3  
ATOM 9044  N N      . GLN D 2 54 ? -4.893  -17.239 -9.988  1.00 7.80  ? 54 GLN B N      3  
ATOM 9045  C CA     . GLN D 2 54 ? -5.768  -16.442 -10.832 1.00 8.54  ? 54 GLN B CA     3  
ATOM 9046  C C      . GLN D 2 54 ? -7.221  -16.492 -10.352 1.00 9.32  ? 54 GLN B C      3  
ATOM 9047  O O      . GLN D 2 54 ? -7.628  -15.719 -9.487  1.00 9.60  ? 54 GLN B O      3  
ATOM 9048  C CB     . GLN D 2 54 ? -5.663  -16.925 -12.278 1.00 9.06  ? 54 GLN B CB     3  
ATOM 9049  C CG     . GLN D 2 54 ? -4.265  -16.807 -12.869 1.00 9.39  ? 54 GLN B CG     3  
ATOM 9050  C CD     . GLN D 2 54 ? -3.695  -15.403 -12.781 1.00 9.99  ? 54 GLN B CD     3  
ATOM 9051  O OE1    . GLN D 2 54 ? -4.427  -14.415 -12.822 1.00 10.19 ? 54 GLN B OE1    3  
ATOM 9052  N NE2    . GLN D 2 54 ? -2.380  -15.308 -12.671 1.00 10.52 ? 54 GLN B NE2    3  
ATOM 9053  H H      . GLN D 2 54 ? -4.669  -18.156 -10.261 1.00 7.92  ? 54 GLN B H      3  
ATOM 9054  H HA     . GLN D 2 54 ? -5.426  -15.418 -10.784 1.00 8.43  ? 54 GLN B HA     3  
ATOM 9055  H HB2    . GLN D 2 54 ? -5.952  -17.965 -12.309 1.00 9.19  ? 54 GLN B HB2    3  
ATOM 9056  H HB3    . GLN D 2 54 ? -6.342  -16.351 -12.888 1.00 9.38  ? 54 GLN B HB3    3  
ATOM 9057  H HG2    . GLN D 2 54 ? -3.607  -17.477 -12.335 1.00 9.55  ? 54 GLN B HG2    3  
ATOM 9058  H HG3    . GLN D 2 54 ? -4.304  -17.098 -13.908 1.00 9.30  ? 54 GLN B HG3    3  
ATOM 9059  H HE21   . GLN D 2 54 ? -1.851  -16.137 -12.655 1.00 10.50 ? 54 GLN B HE21   3  
ATOM 9060  H HE22   . GLN D 2 54 ? -1.983  -14.415 -12.608 1.00 11.04 ? 54 GLN B HE22   3  
ATOM 9061  N N      . GLN D 2 55 ? -7.997  -17.425 -10.899 1.00 9.86  ? 55 GLN B N      3  
ATOM 9062  C CA     . GLN D 2 55 ? -9.411  -17.556 -10.540 1.00 10.79 ? 55 GLN B CA     3  
ATOM 9063  C C      . GLN D 2 55 ? -9.584  -18.183 -9.167  1.00 11.03 ? 55 GLN B C      3  
ATOM 9064  O O      . GLN D 2 55 ? -10.639 -18.054 -8.546  1.00 11.89 ? 55 GLN B O      3  
ATOM 9065  C CB     . GLN D 2 55 ? -10.144 -18.414 -11.567 1.00 11.59 ? 55 GLN B CB     3  
ATOM 9066  C CG     . GLN D 2 55 ? -10.041 -17.890 -12.984 1.00 11.64 ? 55 GLN B CG     3  
ATOM 9067  C CD     . GLN D 2 55 ? -10.835 -16.613 -13.199 1.00 12.17 ? 55 GLN B CD     3  
ATOM 9068  O OE1    . GLN D 2 55 ? -11.845 -16.374 -12.538 1.00 12.46 ? 55 GLN B OE1    3  
ATOM 9069  N NE2    . GLN D 2 55 ? -10.385 -15.784 -14.130 1.00 12.48 ? 55 GLN B NE2    3  
ATOM 9070  H H      . GLN D 2 55 ? -7.614  -18.036 -11.559 1.00 9.74  ? 55 GLN B H      3  
ATOM 9071  H HA     . GLN D 2 55 ? -9.846  -16.569 -10.531 1.00 10.96 ? 55 GLN B HA     3  
ATOM 9072  H HB2    . GLN D 2 55 ? -9.733  -19.412 -11.547 1.00 12.06 ? 55 GLN B HB2    3  
ATOM 9073  H HB3    . GLN D 2 55 ? -11.190 -18.459 -11.300 1.00 11.87 ? 55 GLN B HB3    3  
ATOM 9074  H HG2    . GLN D 2 55 ? -9.003  -17.693 -13.198 1.00 11.18 ? 55 GLN B HG2    3  
ATOM 9075  H HG3    . GLN D 2 55 ? -10.410 -18.647 -13.656 1.00 11.94 ? 55 GLN B HG3    3  
ATOM 9076  H HE21   . GLN D 2 55 ? -9.577  -16.036 -14.621 1.00 12.35 ? 55 GLN B HE21   3  
ATOM 9077  H HE22   . GLN D 2 55 ? -10.886 -14.950 -14.292 1.00 12.93 ? 55 GLN B HE22   3  
ATOM 9078  N N      . LEU D 2 56 ? -8.542  -18.853 -8.696  1.00 10.42 ? 56 LEU B N      3  
ATOM 9079  C CA     . LEU D 2 56 ? -8.587  -19.526 -7.409  1.00 10.83 ? 56 LEU B CA     3  
ATOM 9080  C C      . LEU D 2 56 ? -8.827  -18.544 -6.261  1.00 10.86 ? 56 LEU B C      3  
ATOM 9081  O O      . LEU D 2 56 ? -9.382  -18.913 -5.224  1.00 10.80 ? 56 LEU B O      3  
ATOM 9082  C CB     . LEU D 2 56 ? -7.289  -20.303 -7.169  1.00 10.96 ? 56 LEU B CB     3  
ATOM 9083  C CG     . LEU D 2 56 ? -7.235  -21.101 -5.863  1.00 11.51 ? 56 LEU B CG     3  
ATOM 9084  C CD1    . LEU D 2 56 ? -8.178  -22.294 -5.923  1.00 11.92 ? 56 LEU B CD1    3  
ATOM 9085  C CD2    . LEU D 2 56 ? -5.813  -21.560 -5.576  1.00 11.84 ? 56 LEU B CD2    3  
ATOM 9086  H H      . LEU D 2 56 ? -7.724  -18.893 -9.229  1.00 9.81  ? 56 LEU B H      3  
ATOM 9087  H HA     . LEU D 2 56 ? -9.408  -20.223 -7.448  1.00 11.28 ? 56 LEU B HA     3  
ATOM 9088  H HB2    . LEU D 2 56 ? -7.150  -20.988 -7.992  1.00 10.74 ? 56 LEU B HB2    3  
ATOM 9089  H HB3    . LEU D 2 56 ? -6.471  -19.599 -7.167  1.00 11.09 ? 56 LEU B HB3    3  
ATOM 9090  H HG     . LEU D 2 56 ? -7.553  -20.467 -5.048  1.00 11.60 ? 56 LEU B HG     3  
ATOM 9091  H HD11   . LEU D 2 56 ? -7.883  -22.946 -6.732  1.00 11.94 ? 56 LEU B HD11   3  
ATOM 9092  H HD12   . LEU D 2 56 ? -9.187  -21.945 -6.092  1.00 12.29 ? 56 LEU B HD12   3  
ATOM 9093  H HD13   . LEU D 2 56 ? -8.135  -22.834 -4.990  1.00 12.01 ? 56 LEU B HD13   3  
ATOM 9094  H HD21   . LEU D 2 56 ? -5.168  -20.697 -5.490  1.00 11.99 ? 56 LEU B HD21   3  
ATOM 9095  H HD22   . LEU D 2 56 ? -5.467  -22.188 -6.385  1.00 11.87 ? 56 LEU B HD22   3  
ATOM 9096  H HD23   . LEU D 2 56 ? -5.794  -22.118 -4.653  1.00 12.11 ? 56 LEU B HD23   3  
ATOM 9097  N N      . ALA D 2 57 ? -8.422  -17.295 -6.458  1.00 11.17 ? 57 ALA B N      3  
ATOM 9098  C CA     . ALA D 2 57 ? -8.582  -16.263 -5.441  1.00 11.50 ? 57 ALA B CA     3  
ATOM 9099  C C      . ALA D 2 57 ? -10.051 -15.907 -5.224  1.00 12.12 ? 57 ALA B C      3  
ATOM 9100  O O      . ALA D 2 57 ? -10.435 -15.460 -4.144  1.00 12.46 ? 57 ALA B O      3  
ATOM 9101  C CB     . ALA D 2 57 ? -7.788  -15.022 -5.824  1.00 11.76 ? 57 ALA B CB     3  
ATOM 9102  H H      . ALA D 2 57 ? -8.001  -17.058 -7.312  1.00 11.34 ? 57 ALA B H      3  
ATOM 9103  H HA     . ALA D 2 57 ? -8.178  -16.645 -4.516  1.00 11.33 ? 57 ALA B HA     3  
ATOM 9104  H HB1    . ALA D 2 57 ? -6.753  -15.291 -5.973  1.00 11.79 ? 57 ALA B HB1    3  
ATOM 9105  H HB2    . ALA D 2 57 ? -7.859  -14.291 -5.032  1.00 11.97 ? 57 ALA B HB2    3  
ATOM 9106  H HB3    . ALA D 2 57 ? -8.188  -14.607 -6.737  1.00 11.89 ? 57 ALA B HB3    3  
ATOM 9107  N N      . GLY D 2 58 ? -10.873 -16.120 -6.244  1.00 12.46 ? 58 GLY B N      3  
ATOM 9108  C CA     . GLY D 2 58 ? -12.283 -15.801 -6.137  1.00 13.22 ? 58 GLY B CA     3  
ATOM 9109  C C      . GLY D 2 58 ? -13.145 -17.033 -5.952  1.00 13.88 ? 58 GLY B C      3  
ATOM 9110  O O      . GLY D 2 58 ? -13.178 -17.615 -4.862  1.00 14.22 ? 58 GLY B O      3  
ATOM 9111  H H      . GLY D 2 58 ? -10.522 -16.506 -7.073  1.00 12.30 ? 58 GLY B H      3  
ATOM 9112  H HA2    . GLY D 2 58 ? -12.428 -15.144 -5.292  1.00 13.42 ? 58 GLY B HA2    3  
ATOM 9113  H HA3    . GLY D 2 58 ? -12.595 -15.289 -7.034  1.00 13.31 ? 58 GLY B HA3    3  
ATOM 9114  N N      . LYS D 2 59 ? -13.822 -17.434 -7.031  1.00 14.21 ? 59 LYS B N      3  
ATOM 9115  C CA     . LYS D 2 59 ? -14.714 -18.601 -7.040  1.00 15.00 ? 59 LYS B CA     3  
ATOM 9116  C C      . LYS D 2 59 ? -15.990 -18.295 -6.265  1.00 15.80 ? 59 LYS B C      3  
ATOM 9117  O O      . LYS D 2 59 ? -16.124 -18.644 -5.092  1.00 16.22 ? 59 LYS B O      3  
ATOM 9118  C CB     . LYS D 2 59 ? -14.039 -19.855 -6.464  1.00 15.15 ? 59 LYS B CB     3  
ATOM 9119  C CG     . LYS D 2 59 ? -12.615 -20.080 -6.950  1.00 15.48 ? 59 LYS B CG     3  
ATOM 9120  C CD     . LYS D 2 59 ? -11.936 -21.222 -6.203  1.00 15.83 ? 59 LYS B CD     3  
ATOM 9121  C CE     . LYS D 2 59 ? -12.164 -21.140 -4.698  1.00 16.33 ? 59 LYS B CE     3  
ATOM 9122  N NZ     . LYS D 2 59 ? -11.680 -19.857 -4.112  1.00 16.63 ? 59 LYS B NZ     3  
ATOM 9123  H H      . LYS D 2 59 ? -13.733 -16.909 -7.858  1.00 14.03 ? 59 LYS B H      3  
ATOM 9124  H HA     . LYS D 2 59 ? -14.981 -18.791 -8.070  1.00 15.08 ? 59 LYS B HA     3  
ATOM 9125  H HB2    . LYS D 2 59 ? -14.017 -19.774 -5.388  1.00 14.97 ? 59 LYS B HB2    3  
ATOM 9126  H HB3    . LYS D 2 59 ? -14.628 -20.720 -6.736  1.00 15.35 ? 59 LYS B HB3    3  
ATOM 9127  H HG2    . LYS D 2 59 ? -12.636 -20.316 -8.003  1.00 15.45 ? 59 LYS B HG2    3  
ATOM 9128  H HG3    . LYS D 2 59 ? -12.047 -19.173 -6.795  1.00 15.64 ? 59 LYS B HG3    3  
ATOM 9129  H HD2    . LYS D 2 59 ? -12.332 -22.157 -6.564  1.00 15.98 ? 59 LYS B HD2    3  
ATOM 9130  H HD3    . LYS D 2 59 ? -10.874 -21.181 -6.400  1.00 15.74 ? 59 LYS B HD3    3  
ATOM 9131  H HE2    . LYS D 2 59 ? -13.223 -21.233 -4.504  1.00 16.47 ? 59 LYS B HE2    3  
ATOM 9132  H HE3    . LYS D 2 59 ? -11.642 -21.960 -4.226  1.00 16.48 ? 59 LYS B HE3    3  
ATOM 9133  H HZ1    . LYS D 2 59 ? -11.599 -19.948 -3.075  1.00 16.60 ? 59 LYS B HZ1    3  
ATOM 9134  H HZ2    . LYS D 2 59 ? -12.348 -19.085 -4.331  1.00 16.96 ? 59 LYS B HZ2    3  
ATOM 9135  H HZ3    . LYS D 2 59 ? -10.745 -19.610 -4.502  1.00 16.69 ? 59 LYS B HZ3    3  
ATOM 9136  N N      . GLN D 2 60 ? -16.923 -17.634 -6.929  1.00 16.14 ? 60 GLN B N      3  
ATOM 9137  C CA     . GLN D 2 60 ? -18.189 -17.272 -6.314  1.00 17.03 ? 60 GLN B CA     3  
ATOM 9138  C C      . GLN D 2 60 ? -19.215 -18.377 -6.529  1.00 17.70 ? 60 GLN B C      3  
ATOM 9139  O O      . GLN D 2 60 ? -19.675 -18.602 -7.647  1.00 17.98 ? 60 GLN B O      3  
ATOM 9140  C CB     . GLN D 2 60 ? -18.699 -15.951 -6.894  1.00 17.18 ? 60 GLN B CB     3  
ATOM 9141  C CG     . GLN D 2 60 ? -19.964 -15.435 -6.224  1.00 17.43 ? 60 GLN B CG     3  
ATOM 9142  C CD     . GLN D 2 60 ? -20.432 -14.114 -6.801  1.00 17.84 ? 60 GLN B CD     3  
ATOM 9143  O OE1    . GLN D 2 60 ? -21.631 -13.834 -6.851  1.00 17.85 ? 60 GLN B OE1    3  
ATOM 9144  N NE2    . GLN D 2 60 ? -19.492 -13.290 -7.241  1.00 18.33 ? 60 GLN B NE2    3  
ATOM 9145  H H      . GLN D 2 60 ? -16.764 -17.396 -7.871  1.00 15.87 ? 60 GLN B H      3  
ATOM 9146  H HA     . GLN D 2 60 ? -18.020 -17.151 -5.254  1.00 17.24 ? 60 GLN B HA     3  
ATOM 9147  H HB2    . GLN D 2 60 ? -17.929 -15.203 -6.785  1.00 17.19 ? 60 GLN B HB2    3  
ATOM 9148  H HB3    . GLN D 2 60 ? -18.907 -16.091 -7.944  1.00 17.25 ? 60 GLN B HB3    3  
ATOM 9149  H HG2    . GLN D 2 60 ? -20.748 -16.165 -6.352  1.00 17.37 ? 60 GLN B HG2    3  
ATOM 9150  H HG3    . GLN D 2 60 ? -19.767 -15.301 -5.169  1.00 17.52 ? 60 GLN B HG3    3  
ATOM 9151  H HE21   . GLN D 2 60 ? -18.558 -13.573 -7.170  1.00 18.39 ? 60 GLN B HE21   3  
ATOM 9152  H HE22   . GLN D 2 60 ? -19.770 -12.421 -7.627  1.00 18.68 ? 60 GLN B HE22   3  
ATOM 9153  N N      . SER D 2 61 ? -19.546 -19.082 -5.459  1.00 18.07 ? 61 SER B N      3  
ATOM 9154  C CA     . SER D 2 61 ? -20.518 -20.163 -5.534  1.00 18.84 ? 61 SER B CA     3  
ATOM 9155  C C      . SER D 2 61 ? -21.727 -19.882 -4.640  1.00 19.39 ? 61 SER B C      3  
ATOM 9156  O O      . SER D 2 61 ? -22.807 -20.432 -4.857  1.00 19.62 ? 61 SER B O      3  
ATOM 9157  C CB     . SER D 2 61 ? -19.860 -21.484 -5.130  1.00 19.03 ? 61 SER B CB     3  
ATOM 9158  O OG     . SER D 2 61 ? -18.563 -21.602 -5.694  1.00 18.82 ? 61 SER B OG     3  
ATOM 9159  H H      . SER D 2 61 ? -19.114 -18.887 -4.603  1.00 17.90 ? 61 SER B H      3  
ATOM 9160  H HA     . SER D 2 61 ? -20.852 -20.237 -6.557  1.00 19.02 ? 61 SER B HA     3  
ATOM 9161  H HB2    . SER D 2 61 ? -19.776 -21.527 -4.053  1.00 18.96 ? 61 SER B HB2    3  
ATOM 9162  H HB3    . SER D 2 61 ? -20.467 -22.307 -5.476  1.00 19.52 ? 61 SER B HB3    3  
ATOM 9163  H HG     . SER D 2 61 ? -18.596 -21.356 -6.631  1.00 18.88 ? 61 SER B HG     3  
ATOM 9164  N N      . LEU D 2 62 ? -21.543 -19.014 -3.648  1.00 19.70 ? 62 LEU B N      3  
ATOM 9165  C CA     . LEU D 2 62 ? -22.615 -18.674 -2.719  1.00 20.35 ? 62 LEU B CA     3  
ATOM 9166  C C      . LEU D 2 62 ? -22.612 -17.178 -2.423  1.00 20.63 ? 62 LEU B C      3  
ATOM 9167  O O      . LEU D 2 62 ? -23.702 -16.570 -2.422  1.00 20.95 ? 62 LEU B O      3  
ATOM 9168  C CB     . LEU D 2 62 ? -22.465 -19.460 -1.412  1.00 20.72 ? 62 LEU B CB     3  
ATOM 9169  C CG     . LEU D 2 62 ? -22.803 -20.951 -1.502  1.00 20.77 ? 62 LEU B CG     3  
ATOM 9170  C CD1    . LEU D 2 62 ? -22.407 -21.664 -0.218  1.00 21.17 ? 62 LEU B CD1    3  
ATOM 9171  C CD2    . LEU D 2 62 ? -24.286 -21.146 -1.782  1.00 21.11 ? 62 LEU B CD2    3  
ATOM 9172  O OXT    . LEU D 2 62 ? -21.517 -16.619 -2.195  1.00 20.62 ? 62 LEU B OXT    3  
ATOM 9173  H H      . LEU D 2 62 ? -20.673 -18.579 -3.545  1.00 19.56 ? 62 LEU B H      3  
ATOM 9174  H HA     . LEU D 2 62 ? -23.553 -18.936 -3.183  1.00 20.50 ? 62 LEU B HA     3  
ATOM 9175  H HB2    . LEU D 2 62 ? -21.442 -19.365 -1.076  1.00 20.72 ? 62 LEU B HB2    3  
ATOM 9176  H HB3    . LEU D 2 62 ? -23.110 -19.013 -0.671  1.00 21.11 ? 62 LEU B HB3    3  
ATOM 9177  H HG     . LEU D 2 62 ? -22.245 -21.392 -2.315  1.00 20.38 ? 62 LEU B HG     3  
ATOM 9178  H HD11   . LEU D 2 62 ? -21.345 -21.558 -0.060  1.00 21.11 ? 62 LEU B HD11   3  
ATOM 9179  H HD12   . LEU D 2 62 ? -22.655 -22.713 -0.298  1.00 21.41 ? 62 LEU B HD12   3  
ATOM 9180  H HD13   . LEU D 2 62 ? -22.941 -21.230 0.614   1.00 21.41 ? 62 LEU B HD13   3  
ATOM 9181  H HD21   . LEU D 2 62 ? -24.503 -22.202 -1.855  1.00 21.30 ? 62 LEU B HD21   3  
ATOM 9182  H HD22   . LEU D 2 62 ? -24.542 -20.662 -2.714  1.00 21.08 ? 62 LEU B HD22   3  
ATOM 9183  H HD23   . LEU D 2 62 ? -24.864 -20.714 -0.981  1.00 21.32 ? 62 LEU B HD23   3  
ATOM 9184  O "O5'"  . DC  A 1 1  ? -28.673 -4.552  8.958   1.00 6.37  ? 1  DC  C "O5'"  4  
ATOM 9185  C "C5'"  . DC  A 1 1  ? -29.733 -5.059  8.142   1.00 6.29  ? 1  DC  C "C5'"  4  
ATOM 9186  C "C4'"  . DC  A 1 1  ? -29.779 -4.358  6.803   1.00 5.91  ? 1  DC  C "C4'"  4  
ATOM 9187  O "O4'"  . DC  A 1 1  ? -29.950 -2.939  7.034   1.00 5.98  ? 1  DC  C "O4'"  4  
ATOM 9188  C "C3'"  . DC  A 1 1  ? -28.498 -4.469  5.980   1.00 5.57  ? 1  DC  C "C3'"  4  
ATOM 9189  O "O3'"  . DC  A 1 1  ? -28.777 -4.307  4.587   1.00 5.22  ? 1  DC  C "O3'"  4  
ATOM 9190  C "C2'"  . DC  A 1 1  ? -27.670 -3.308  6.490   1.00 5.63  ? 1  DC  C "C2'"  4  
ATOM 9191  C "C1'"  . DC  A 1 1  ? -28.729 -2.249  6.770   1.00 5.81  ? 1  DC  C "C1'"  4  
ATOM 9192  N N1     . DC  A 1 1  ? -28.426 -1.380  7.921   1.00 6.13  ? 1  DC  C N1     4  
ATOM 9193  C C2     . DC  A 1 1  ? -28.717 -0.013  7.831   1.00 6.18  ? 1  DC  C C2     4  
ATOM 9194  O O2     . DC  A 1 1  ? -29.245 0.424   6.797   1.00 5.95  ? 1  DC  C O2     4  
ATOM 9195  N N3     . DC  A 1 1  ? -28.416 0.798   8.873   1.00 6.48  ? 1  DC  C N3     4  
ATOM 9196  C C4     . DC  A 1 1  ? -27.851 0.289   9.970   1.00 6.72  ? 1  DC  C C4     4  
ATOM 9197  N N4     . DC  A 1 1  ? -27.565 1.127   10.971  1.00 7.02  ? 1  DC  C N4     4  
ATOM 9198  C C5     . DC  A 1 1  ? -27.551 -1.099  10.092  1.00 6.67  ? 1  DC  C C5     4  
ATOM 9199  C C6     . DC  A 1 1  ? -27.855 -1.889  9.054   1.00 6.38  ? 1  DC  C C6     4  
ATOM 9200  H "H5'"  . DC  A 1 1  ? -30.685 -4.909  8.651   1.00 6.54  ? 1  DC  C "H5'"  4  
ATOM 9201  H "H5''" . DC  A 1 1  ? -29.587 -6.125  7.975   1.00 6.26  ? 1  DC  C "H5''" 4  
ATOM 9202  H "H4'"  . DC  A 1 1  ? -30.581 -4.803  6.212   1.00 5.83  ? 1  DC  C "H4'"  4  
ATOM 9203  H "H3'"  . DC  A 1 1  ? -28.006 -5.428  6.141   1.00 5.59  ? 1  DC  C "H3'"  4  
ATOM 9204  H "H2'"  . DC  A 1 1  ? -27.113 -3.583  7.384   1.00 5.83  ? 1  DC  C "H2'"  4  
ATOM 9205  H "H2''" . DC  A 1 1  ? -26.950 -2.979  5.744   1.00 5.38  ? 1  DC  C "H2''" 4  
ATOM 9206  H "H1'"  . DC  A 1 1  ? -28.886 -1.618  5.893   1.00 5.61  ? 1  DC  C "H1'"  4  
ATOM 9207  H H41    . DC  A 1 1  ? -27.776 2.111   10.888  1.00 7.08  ? 1  DC  C H41    4  
ATOM 9208  H H42    . DC  A 1 1  ? -27.137 0.776   11.816  1.00 7.21  ? 1  DC  C H42    4  
ATOM 9209  H H5     . DC  A 1 1  ? -27.087 -1.502  10.993  1.00 6.88  ? 1  DC  C H5     4  
ATOM 9210  H H6     . DC  A 1 1  ? -27.642 -2.957  9.117   1.00 6.37  ? 1  DC  C H6     4  
ATOM 9211  H "HO5'" . DC  A 1 1  ? -28.252 -5.308  9.377   1.00 6.58  ? 1  DC  C "HO5'" 4  
ATOM 9212  P P      . DG  A 1 2  ? -27.576 -4.370  3.522   1.00 4.83  ? 2  DG  C P      4  
ATOM 9213  O OP1    . DG  A 1 2  ? -28.119 -4.986  2.283   1.00 4.58  ? 2  DG  C OP1    4  
ATOM 9214  O OP2    . DG  A 1 2  ? -26.376 -4.962  4.169   1.00 4.91  ? 2  DG  C OP2    4  
ATOM 9215  O "O5'"  . DG  A 1 2  ? -27.299 -2.831  3.216   1.00 4.73  ? 2  DG  C "O5'"  4  
ATOM 9216  C "C5'"  . DG  A 1 2  ? -28.320 -2.039  2.617   1.00 4.67  ? 2  DG  C "C5'"  4  
ATOM 9217  C "C4'"  . DG  A 1 2  ? -27.756 -0.762  2.036   1.00 4.53  ? 2  DG  C "C4'"  4  
ATOM 9218  O "O4'"  . DG  A 1 2  ? -27.545 0.196   3.102   1.00 4.84  ? 2  DG  C "O4'"  4  
ATOM 9219  C "C3'"  . DG  A 1 2  ? -26.382 -0.931  1.393   1.00 4.27  ? 2  DG  C "C3'"  4  
ATOM 9220  O "O3'"  . DG  A 1 2  ? -26.209 0.080   0.402   1.00 4.08  ? 2  DG  C "O3'"  4  
ATOM 9221  C "C2'"  . DG  A 1 2  ? -25.432 -0.737  2.560   1.00 4.50  ? 2  DG  C "C2'"  4  
ATOM 9222  C "C1'"  . DG  A 1 2  ? -26.154 0.330   3.371   1.00 4.82  ? 2  DG  C "C1'"  4  
ATOM 9223  N N9     . DG  A 1 2  ? -25.934 0.299   4.815   1.00 5.17  ? 2  DG  C N9     4  
ATOM 9224  C C8     . DG  A 1 2  ? -25.676 -0.791  5.607   1.00 5.30  ? 2  DG  C C8     4  
ATOM 9225  N N7     . DG  A 1 2  ? -25.465 -0.479  6.860   1.00 5.63  ? 2  DG  C N7     4  
ATOM 9226  C C5     . DG  A 1 2  ? -25.601 0.904   6.894   1.00 5.74  ? 2  DG  C C5     4  
ATOM 9227  C C6     . DG  A 1 2  ? -25.479 1.821   7.979   1.00 6.09  ? 2  DG  C C6     4  
ATOM 9228  O O6     . DG  A 1 2  ? -25.208 1.587   9.167   1.00 6.37  ? 2  DG  C O6     4  
ATOM 9229  N N1     . DG  A 1 2  ? -25.700 3.132   7.568   1.00 6.12  ? 2  DG  C N1     4  
ATOM 9230  C C2     . DG  A 1 2  ? -26.002 3.516   6.284   1.00 5.85  ? 2  DG  C C2     4  
ATOM 9231  N N2     . DG  A 1 2  ? -26.190 4.829   6.085   1.00 5.98  ? 2  DG  C N2     4  
ATOM 9232  N N3     . DG  A 1 2  ? -26.115 2.675   5.269   1.00 5.51  ? 2  DG  C N3     4  
ATOM 9233  C C4     . DG  A 1 2  ? -25.904 1.396   5.644   1.00 5.47  ? 2  DG  C C4     4  
ATOM 9234  H "H5'"  . DG  A 1 2  ? -29.068 -1.786  3.368   1.00 4.93  ? 2  DG  C "H5'"  4  
ATOM 9235  H "H5''" . DG  A 1 2  ? -28.799 -2.607  1.820   1.00 4.50  ? 2  DG  C "H5''" 4  
ATOM 9236  H "H4'"  . DG  A 1 2  ? -28.438 -0.411  1.259   1.00 4.41  ? 2  DG  C "H4'"  4  
ATOM 9237  H "H3'"  . DG  A 1 2  ? -26.277 -1.911  0.935   1.00 4.11  ? 2  DG  C "H3'"  4  
ATOM 9238  H "H2'"  . DG  A 1 2  ? -25.297 -1.662  3.120   1.00 4.59  ? 2  DG  C "H2'"  4  
ATOM 9239  H "H2''" . DG  A 1 2  ? -24.447 -0.413  2.223   1.00 4.38  ? 2  DG  C "H2''" 4  
ATOM 9240  H "H1'"  . DG  A 1 2  ? -25.860 1.320   3.015   1.00 4.80  ? 2  DG  C "H1'"  4  
ATOM 9241  H H8     . DG  A 1 2  ? -25.639 -1.803  5.234   1.00 5.15  ? 2  DG  C H8     4  
ATOM 9242  H H1     . DG  A 1 2  ? -25.632 3.857   8.267   1.00 6.38  ? 2  DG  C H1     4  
ATOM 9243  H H21    . DG  A 1 2  ? -26.106 5.487   6.848   1.00 6.25  ? 2  DG  C H21    4  
ATOM 9244  H H22    . DG  A 1 2  ? -26.416 5.167   5.160   1.00 5.81  ? 2  DG  C H22    4  
ATOM 9245  P P      . DA  A 1 3  ? -24.808 0.222   -0.367  1.00 3.85  ? 3  DA  C P      4  
ATOM 9246  O OP1    . DA  A 1 3  ? -25.136 0.323   -1.809  1.00 3.56  ? 3  DA  C OP1    4  
ATOM 9247  O OP2    . DA  A 1 3  ? -23.856 -0.817  0.102   1.00 3.83  ? 3  DA  C OP2    4  
ATOM 9248  O "O5'"  . DA  A 1 3  ? -24.326 1.659   0.119   1.00 4.07  ? 3  DA  C "O5'"  4  
ATOM 9249  C "C5'"  . DA  A 1 3  ? -25.233 2.751   0.017   1.00 4.23  ? 3  DA  C "C5'"  4  
ATOM 9250  C "C4'"  . DA  A 1 3  ? -24.539 4.071   0.248   1.00 4.45  ? 3  DA  C "C4'"  4  
ATOM 9251  O "O4'"  . DA  A 1 3  ? -24.362 4.272   1.673   1.00 4.78  ? 3  DA  C "O4'"  4  
ATOM 9252  C "C3'"  . DA  A 1 3  ? -23.131 4.149   -0.331  1.00 4.31  ? 3  DA  C "C3'"  4  
ATOM 9253  O "O3'"  . DA  A 1 3  ? -22.834 5.513   -0.620  1.00 4.50  ? 3  DA  C "O3'"  4  
ATOM 9254  C "C2'"  . DA  A 1 3  ? -22.272 3.584   0.787   1.00 4.40  ? 3  DA  C "C2'"  4  
ATOM 9255  C "C1'"  . DA  A 1 3  ? -22.994 4.094   2.026   1.00 4.77  ? 3  DA  C "C1'"  4  
ATOM 9256  N N9     . DA  A 1 3  ? -22.907 3.233   3.209   1.00 4.90  ? 3  DA  C N9     4  
ATOM 9257  C C8     . DA  A 1 3  ? -22.975 1.866   3.298   1.00 4.75  ? 3  DA  C C8     4  
ATOM 9258  N N7     . DA  A 1 3  ? -22.792 1.406   4.515   1.00 4.98  ? 3  DA  C N7     4  
ATOM 9259  C C5     . DA  A 1 3  ? -22.603 2.551   5.280   1.00 5.29  ? 3  DA  C C5     4  
ATOM 9260  C C6     . DA  A 1 3  ? -22.354 2.746   6.655   1.00 5.64  ? 3  DA  C C6     4  
ATOM 9261  N N6     . DA  A 1 3  ? -22.228 1.753   7.537   1.00 5.74  ? 3  DA  C N6     4  
ATOM 9262  N N1     . DA  A 1 3  ? -22.227 4.017   7.096   1.00 5.90  ? 3  DA  C N1     4  
ATOM 9263  C C2     . DA  A 1 3  ? -22.337 5.016   6.209   1.00 5.83  ? 3  DA  C C2     4  
ATOM 9264  N N3     . DA  A 1 3  ? -22.560 4.958   4.896   1.00 5.53  ? 3  DA  C N3     4  
ATOM 9265  C C4     . DA  A 1 3  ? -22.685 3.682   4.491   1.00 5.25  ? 3  DA  C C4     4  
ATOM 9266  H "H5'"  . DA  A 1 3  ? -26.025 2.634   0.757   1.00 4.41  ? 3  DA  C "H5'"  4  
ATOM 9267  H "H5''" . DA  A 1 3  ? -25.679 2.759   -0.978  1.00 4.05  ? 3  DA  C "H5''" 4  
ATOM 9268  H "H4'"  . DA  A 1 3  ? -25.129 4.854   -0.233  1.00 4.51  ? 3  DA  C "H4'"  4  
ATOM 9269  H "H3'"  . DA  A 1 3  ? -23.046 3.561   -1.246  1.00 4.03  ? 3  DA  C "H3'"  4  
ATOM 9270  H "H2'"  . DA  A 1 3  ? -22.236 2.495   0.748   1.00 4.22  ? 3  DA  C "H2'"  4  
ATOM 9271  H "H2''" . DA  A 1 3  ? -21.248 3.950   0.730   1.00 4.42  ? 3  DA  C "H2''" 4  
ATOM 9272  H "H1'"  . DA  A 1 3  ? -22.607 5.078   2.301   1.00 4.98  ? 3  DA  C "H1'"  4  
ATOM 9273  H H8     . DA  A 1 3  ? -23.161 1.226   2.447   1.00 4.48  ? 3  DA  C H8     4  
ATOM 9274  H H61    . DA  A 1 3  ? -22.036 1.953   8.509   1.00 6.00  ? 3  DA  C H61    4  
ATOM 9275  H H62    . DA  A 1 3  ? -22.312 0.795   7.226   1.00 5.58  ? 3  DA  C H62    4  
ATOM 9276  H H2     . DA  A 1 3  ? -22.231 6.021   6.620   1.00 6.08  ? 3  DA  C H2     4  
ATOM 9277  P P      . DT  A 1 4  ? -21.368 5.933   -1.112  1.00 4.47  ? 4  DT  C P      4  
ATOM 9278  O OP1    . DT  A 1 4  ? -21.526 6.760   -2.335  1.00 4.48  ? 4  DT  C OP1    4  
ATOM 9279  O OP2    . DT  A 1 4  ? -20.498 4.729   -1.147  1.00 4.20  ? 4  DT  C OP2    4  
ATOM 9280  O "O5'"  . DT  A 1 4  ? -20.919 6.882   0.085   1.00 4.86  ? 4  DT  C "O5'"  4  
ATOM 9281  C "C5'"  . DT  A 1 4  ? -21.879 7.782   0.638   1.00 5.17  ? 4  DT  C "C5'"  4  
ATOM 9282  C "C4'"  . DT  A 1 4  ? -21.237 8.767   1.586   1.00 5.54  ? 4  DT  C "C4'"  4  
ATOM 9283  O "O4'"  . DT  A 1 4  ? -21.009 8.119   2.860   1.00 5.63  ? 4  DT  C "O4'"  4  
ATOM 9284  C "C3'"  . DT  A 1 4  ? -19.860 9.243   1.137   1.00 5.55  ? 4  DT  C "C3'"  4  
ATOM 9285  O "O3'"  . DT  A 1 4  ? -19.611 10.533  1.693   1.00 5.94  ? 4  DT  C "O3'"  4  
ATOM 9286  C "C2'"  . DT  A 1 4  ? -18.933 8.187   1.713   1.00 5.40  ? 4  DT  C "C2'"  4  
ATOM 9287  C "C1'"  . DT  A 1 4  ? -19.623 7.854   3.032   1.00 5.57  ? 4  DT  C "C1'"  4  
ATOM 9288  N N1     . DT  A 1 4  ? -19.454 6.469   3.527   1.00 5.39  ? 4  DT  C N1     4  
ATOM 9289  C C2     . DT  A 1 4  ? -19.230 6.317   4.882   1.00 5.63  ? 4  DT  C C2     4  
ATOM 9290  O O2     . DT  A 1 4  ? -19.224 7.252   5.664   1.00 5.97  ? 4  DT  C O2     4  
ATOM 9291  N N3     . DT  A 1 4  ? -19.014 5.028   5.288   1.00 5.48  ? 4  DT  C N3     4  
ATOM 9292  C C4     . DT  A 1 4  ? -19.008 3.898   4.500   1.00 5.12  ? 4  DT  C C4     4  
ATOM 9293  O O4     . DT  A 1 4  ? -18.749 2.806   5.003   1.00 5.06  ? 4  DT  C O4     4  
ATOM 9294  C C5     . DT  A 1 4  ? -19.276 4.124   3.093   1.00 4.86  ? 4  DT  C C5     4  
ATOM 9295  C C7     . DT  A 1 4  ? -19.267 2.953   2.160   1.00 4.47  ? 4  DT  C C7     4  
ATOM 9296  C C6     . DT  A 1 4  ? -19.489 5.383   2.678   1.00 5.01  ? 4  DT  C C6     4  
ATOM 9297  H "H5'"  . DT  A 1 4  ? -22.636 7.215   1.179   1.00 5.16  ? 4  DT  C "H5'"  4  
ATOM 9298  H "H5''" . DT  A 1 4  ? -22.363 8.334   -0.167  1.00 5.16  ? 4  DT  C "H5''" 4  
ATOM 9299  H "H4'"  . DT  A 1 4  ? -21.878 9.647   1.648   1.00 5.75  ? 4  DT  C "H4'"  4  
ATOM 9300  H "H3'"  . DT  A 1 4  ? -19.793 9.297   0.050   1.00 5.40  ? 4  DT  C "H3'"  4  
ATOM 9301  H "H2'"  . DT  A 1 4  ? -18.863 7.321   1.054   1.00 5.09  ? 4  DT  C "H2'"  4  
ATOM 9302  H "H2''" . DT  A 1 4  ? -17.926 8.574   1.851   1.00 5.50  ? 4  DT  C "H2''" 4  
ATOM 9303  H "H1'"  . DT  A 1 4  ? -19.268 8.530   3.814   1.00 5.86  ? 4  DT  C "H1'"  4  
ATOM 9304  H H3     . DT  A 1 4  ? -18.824 4.897   6.273   1.00 5.68  ? 4  DT  C H3     4  
ATOM 9305  H H71    . DT  A 1 4  ? -18.441 2.290   2.418   1.00 4.37  ? 4  DT  C H71    4  
ATOM 9306  H H72    . DT  A 1 4  ? -20.209 2.411   2.246   1.00 4.43  ? 4  DT  C H72    4  
ATOM 9307  H H73    . DT  A 1 4  ? -19.143 3.305   1.136   1.00 4.51  ? 4  DT  C H73    4  
ATOM 9308  H H6     . DT  A 1 4  ? -19.706 5.553   1.623   1.00 4.84  ? 4  DT  C H6     4  
ATOM 9309  P P      . DA  A 1 5  ? -18.206 11.264  1.434   1.00 6.08  ? 5  DA  C P      4  
ATOM 9310  O OP1    . DA  A 1 5  ? -18.498 12.648  0.979   1.00 6.36  ? 5  DA  C OP1    4  
ATOM 9311  O OP2    . DA  A 1 5  ? -17.334 10.390  0.611   1.00 5.74  ? 5  DA  C OP2    4  
ATOM 9312  O "O5'"  . DA  A 1 5  ? -17.605 11.341  2.906   1.00 6.32  ? 5  DA  C "O5'"  4  
ATOM 9313  C "C5'"  . DA  A 1 5  ? -18.398 11.877  3.964   1.00 6.63  ? 5  DA  C "C5'"  4  
ATOM 9314  C "C4'"  . DA  A 1 5  ? -17.571 12.059  5.215   1.00 6.88  ? 5  DA  C "C4'"  4  
ATOM 9315  O "O4'"  . DA  A 1 5  ? -17.397 10.770  5.854   1.00 6.71  ? 5  DA  C "O4'"  4  
ATOM 9316  C "C3'"  . DA  A 1 5  ? -16.157 12.558  4.942   1.00 6.92  ? 5  DA  C "C3'"  4  
ATOM 9317  O "O3'"  . DA  A 1 5  ? -15.662 13.250  6.088   1.00 7.27  ? 5  DA  C "O3'"  4  
ATOM 9318  C "C2'"  . DA  A 1 5  ? -15.389 11.273  4.695   1.00 6.57  ? 5  DA  C "C2'"  4  
ATOM 9319  C "C1'"  . DA  A 1 5  ? -16.062 10.312  5.669   1.00 6.54  ? 5  DA  C "C1'"  4  
ATOM 9320  N N9     . DA  A 1 5  ? -16.097 8.909   5.248   1.00 6.17  ? 5  DA  C N9     4  
ATOM 9321  C C8     . DA  A 1 5  ? -16.389 8.388   4.012   1.00 5.84  ? 5  DA  C C8     4  
ATOM 9322  N N7     . DA  A 1 5  ? -16.296 7.081   3.954   1.00 5.55  ? 5  DA  C N7     4  
ATOM 9323  C C5     . DA  A 1 5  ? -15.919 6.714   5.240   1.00 5.72  ? 5  DA  C C5     4  
ATOM 9324  C C6     . DA  A 1 5  ? -15.649 5.464   5.832   1.00 5.59  ? 5  DA  C C6     4  
ATOM 9325  N N6     . DA  A 1 5  ? -15.709 4.301   5.177   1.00 5.26  ? 5  DA  C N6     4  
ATOM 9326  N N1     . DA  A 1 5  ? -15.304 5.448   7.140   1.00 5.86  ? 5  DA  C N1     4  
ATOM 9327  C C2     . DA  A 1 5  ? -15.234 6.614   7.797   1.00 6.20  ? 5  DA  C C2     4  
ATOM 9328  N N3     . DA  A 1 5  ? -15.459 7.849   7.349   1.00 6.34  ? 5  DA  C N3     4  
ATOM 9329  C C4     . DA  A 1 5  ? -15.802 7.830   6.049   1.00 6.09  ? 5  DA  C C4     4  
ATOM 9330  H "H5'"  . DA  A 1 5  ? -19.224 11.199  4.181   1.00 6.53  ? 5  DA  C "H5'"  4  
ATOM 9331  H "H5''" . DA  A 1 5  ? -18.802 12.844  3.663   1.00 6.81  ? 5  DA  C "H5''" 4  
ATOM 9332  H "H4'"  . DA  A 1 5  ? -18.064 12.801  5.847   1.00 7.17  ? 5  DA  C "H4'"  4  
ATOM 9333  H "H3'"  . DA  A 1 5  ? -16.133 13.222  4.079   1.00 6.93  ? 5  DA  C "H3'"  4  
ATOM 9334  H "H2'"  . DA  A 1 5  ? -15.485 10.948  3.661   1.00 6.32  ? 5  DA  C "H2'"  4  
ATOM 9335  H "H2''" . DA  A 1 5  ? -14.328 11.402  4.898   1.00 6.61  ? 5  DA  C "H2''" 4  
ATOM 9336  H "H1'"  . DA  A 1 5  ? -15.569 10.357  6.643   1.00 6.72  ? 5  DA  C "H1'"  4  
ATOM 9337  H H8     . DA  A 1 5  ? -16.666 8.999   3.167   1.00 5.83  ? 5  DA  C H8     4  
ATOM 9338  H H61    . DA  A 1 5  ? -15.497 3.435   5.652   1.00 5.21  ? 5  DA  C H61    4  
ATOM 9339  H H62    . DA  A 1 5  ? -15.961 4.293   4.198   1.00 5.07  ? 5  DA  C H62    4  
ATOM 9340  H H2     . DA  A 1 5  ? -14.951 6.543   8.847   1.00 6.41  ? 5  DA  C H2     4  
ATOM 9341  P P      . DA  A 1 6  ? -14.172 13.844  6.083   1.00 7.38  ? 6  DA  C P      4  
ATOM 9342  O OP1    . DA  A 1 6  ? -14.245 15.247  6.568   1.00 7.80  ? 6  DA  C OP1    4  
ATOM 9343  O OP2    . DA  A 1 6  ? -13.524 13.551  4.778   1.00 7.10  ? 6  DA  C OP2    4  
ATOM 9344  O "O5'"  . DA  A 1 6  ? -13.466 12.968  7.207   1.00 7.35  ? 6  DA  C "O5'"  4  
ATOM 9345  C "C5'"  . DA  A 1 6  ? -14.046 12.891  8.506   1.00 7.57  ? 6  DA  C "C5'"  4  
ATOM 9346  C "C4'"  . DA  A 1 6  ? -13.102 12.229  9.481   1.00 7.58  ? 6  DA  C "C4'"  4  
ATOM 9347  O "O4'"  . DA  A 1 6  ? -13.136 10.796  9.272   1.00 7.22  ? 6  DA  C "O4'"  4  
ATOM 9348  C "C3'"  . DA  A 1 6  ? -11.644 12.620  9.263   1.00 7.61  ? 6  DA  C "C3'"  4  
ATOM 9349  O "O3'"  . DA  A 1 6  ? -10.921 12.468  10.479  1.00 7.79  ? 6  DA  C "O3'"  4  
ATOM 9350  C "C2'"  . DA  A 1 6  ? -11.172 11.619  8.226   1.00 7.18  ? 6  DA  C "C2'"  4  
ATOM 9351  C "C1'"  . DA  A 1 6  ? -11.935 10.369  8.634   1.00 6.98  ? 6  DA  C "C1'"  4  
ATOM 9352  N N9     . DA  A 1 6  ? -12.261 9.453   7.541   1.00 6.57  ? 6  DA  C N9     4  
ATOM 9353  C C8     . DA  A 1 6  ? -12.752 9.730   6.292   1.00 6.41  ? 6  DA  C C8     4  
ATOM 9354  N N7     . DA  A 1 6  ? -12.875 8.674   5.524   1.00 6.03  ? 6  DA  C N7     4  
ATOM 9355  C C5     . DA  A 1 6  ? -12.444 7.626   6.328   1.00 5.94  ? 6  DA  C C5     4  
ATOM 9356  C C6     . DA  A 1 6  ? -12.322 6.241   6.101   1.00 5.61  ? 6  DA  C C6     4  
ATOM 9357  N N6     . DA  A 1 6  ? -12.623 5.650   4.944   1.00 5.26  ? 6  DA  C N6     4  
ATOM 9358  N N1     . DA  A 1 6  ? -11.868 5.473   7.116   1.00 5.66  ? 6  DA  C N1     4  
ATOM 9359  C C2     . DA  A 1 6  ? -11.554 6.067   8.274   1.00 6.01  ? 6  DA  C C2     4  
ATOM 9360  N N3     . DA  A 1 6  ? -11.617 7.356   8.605   1.00 6.33  ? 6  DA  C N3     4  
ATOM 9361  C C4     . DA  A 1 6  ? -12.076 8.090   7.576   1.00 6.28  ? 6  DA  C C4     4  
ATOM 9362  H "H5'"  . DA  A 1 6  ? -14.970 12.312  8.457   1.00 7.43  ? 6  DA  C "H5'"  4  
ATOM 9363  H "H5''" . DA  A 1 6  ? -14.277 13.894  8.862   1.00 7.87  ? 6  DA  C "H5''" 4  
ATOM 9364  H "H4'"  . DA  A 1 6  ? -13.378 12.537  10.491  1.00 7.85  ? 6  DA  C "H4'"  4  
ATOM 9365  H "H3'"  . DA  A 1 6  ? -11.556 13.648  8.914   1.00 7.79  ? 6  DA  C "H3'"  4  
ATOM 9366  H "H2'"  . DA  A 1 6  ? -11.421 11.945  7.217   1.00 7.08  ? 6  DA  C "H2'"  4  
ATOM 9367  H "H2''" . DA  A 1 6  ? -10.092 11.480  8.268   1.00 7.14  ? 6  DA  C "H2''" 4  
ATOM 9368  H "H1'"  . DA  A 1 6  ? -11.362 9.810   9.376   1.00 6.99  ? 6  DA  C "H1'"  4  
ATOM 9369  H H8     . DA  A 1 6  ? -13.008 10.729  5.970   1.00 6.58  ? 6  DA  C H8     4  
ATOM 9370  H H61    . DA  A 1 6  ? -12.515 4.653   4.832   1.00 5.04  ? 6  DA  C H61    4  
ATOM 9371  H H62    . DA  A 1 6  ? -12.958 6.216   4.176   1.00 5.24  ? 6  DA  C H62    4  
ATOM 9372  H H2     . DA  A 1 6  ? -11.196 5.400   9.059   1.00 6.05  ? 6  DA  C H2     4  
ATOM 9373  P P      . DG  A 1 7  ? -9.331  12.673  10.492  1.00 7.83  ? 7  DG  C P      4  
ATOM 9374  O OP1    . DG  A 1 7  ? -8.989  13.434  11.720  1.00 8.24  ? 7  DG  C OP1    4  
ATOM 9375  O OP2    . DG  A 1 7  ? -8.878  13.171  9.168   1.00 7.69  ? 7  DG  C OP2    4  
ATOM 9376  O "O5'"  . DG  A 1 7  ? -8.834  11.174  10.677  1.00 7.54  ? 7  DG  C "O5'"  4  
ATOM 9377  C "C5'"  . DG  A 1 7  ? -9.437  10.359  11.679  1.00 7.59  ? 7  DG  C "C5'"  4  
ATOM 9378  C "C4'"  . DG  A 1 7  ? -8.560  9.178   12.014  1.00 7.39  ? 7  DG  C "C4'"  4  
ATOM 9379  O "O4'"  . DG  A 1 7  ? -8.758  8.141   11.020  1.00 6.98  ? 7  DG  C "O4'"  4  
ATOM 9380  C "C3'"  . DG  A 1 7  ? -7.075  9.514   11.943  1.00 7.39  ? 7  DG  C "C3'"  4  
ATOM 9381  O "O3'"  . DG  A 1 7  ? -6.354  8.636   12.801  1.00 7.37  ? 7  DG  C "O3'"  4  
ATOM 9382  C "C2'"  . DG  A 1 7  ? -6.740  9.267   10.482  1.00 7.03  ? 7  DG  C "C2'"  4  
ATOM 9383  C "C1'"  . DG  A 1 7  ? -7.626  8.070   10.163  1.00 6.75  ? 7  DG  C "C1'"  4  
ATOM 9384  N N9     . DG  A 1 7  ? -8.075  7.947   8.778   1.00 6.45  ? 7  DG  C N9     4  
ATOM 9385  C C8     . DG  A 1 7  ? -8.495  8.941   7.928   1.00 6.51  ? 7  DG  C C8     4  
ATOM 9386  N N7     . DG  A 1 7  ? -8.759  8.509   6.723   1.00 6.19  ? 7  DG  C N7     4  
ATOM 9387  C C5     . DG  A 1 7  ? -8.514  7.142   6.784   1.00 5.90  ? 7  DG  C C5     4  
ATOM 9388  C C6     . DG  A 1 7  ? -8.621  6.130   5.781   1.00 5.49  ? 7  DG  C C6     4  
ATOM 9389  O O6     . DG  A 1 7  ? -8.956  6.244   4.593   1.00 5.31  ? 7  DG  C O6     4  
ATOM 9390  N N1     . DG  A 1 7  ? -8.282  4.876   6.282   1.00 5.33  ? 7  DG  C N1     4  
ATOM 9391  C C2     . DG  A 1 7  ? -7.892  4.621   7.573   1.00 5.53  ? 7  DG  C C2     4  
ATOM 9392  N N2     . DG  A 1 7  ? -7.613  3.341   7.865   1.00 5.35  ? 7  DG  C N2     4  
ATOM 9393  N N3     . DG  A 1 7  ? -7.783  5.549   8.512   1.00 5.90  ? 7  DG  C N3     4  
ATOM 9394  C C4     . DG  A 1 7  ? -8.108  6.776   8.051   1.00 6.06  ? 7  DG  C C4     4  
ATOM 9395  H "H5'"  . DG  A 1 7  ? -10.401 9.996   11.321  1.00 7.47  ? 7  DG  C "H5'"  4  
ATOM 9396  H "H5''" . DG  A 1 7  ? -9.596  10.950  12.582  1.00 7.91  ? 7  DG  C "H5''" 4  
ATOM 9397  H "H4'"  . DG  A 1 7  ? -8.777  8.864   13.037  1.00 7.56  ? 7  DG  C "H4'"  4  
ATOM 9398  H "H3'"  . DG  A 1 7  ? -6.887  10.546  12.239  1.00 7.66  ? 7  DG  C "H3'"  4  
ATOM 9399  H "H2'"  . DG  A 1 7  ? -6.982  10.135  9.869   1.00 7.11  ? 7  DG  C "H2'"  4  
ATOM 9400  H "H2''" . DG  A 1 7  ? -5.682  9.056   10.345  1.00 6.93  ? 7  DG  C "H2''" 4  
ATOM 9401  H "H1'"  . DG  A 1 7  ? -7.097  7.149   10.420  1.00 6.60  ? 7  DG  C "H1'"  4  
ATOM 9402  H H8     . DG  A 1 7  ? -8.595  9.974   8.224   1.00 6.80  ? 7  DG  C H8     4  
ATOM 9403  H H1     . DG  A 1 7  ? -8.324  4.094   5.642   1.00 5.05  ? 7  DG  C H1     4  
ATOM 9404  H H21    . DG  A 1 7  ? -7.686  2.623   7.155   1.00 5.08  ? 7  DG  C H21    4  
ATOM 9405  H H22    . DG  A 1 7  ? -7.321  3.072   8.794   1.00 5.51  ? 7  DG  C H22    4  
ATOM 9406  P P      . DA  A 1 8  ? -4.753  8.690   12.838  1.00 7.34  ? 8  DA  C P      4  
ATOM 9407  O OP1    . DA  A 1 8  ? -4.343  8.723   14.265  1.00 7.64  ? 8  DA  C OP1    4  
ATOM 9408  O OP2    . DA  A 1 8  ? -4.258  9.734   11.905  1.00 7.36  ? 8  DA  C OP2    4  
ATOM 9409  O "O5'"  . DA  A 1 8  ? -4.400  7.255   12.251  1.00 6.91  ? 8  DA  C "O5'"  4  
ATOM 9410  C "C5'"  . DA  A 1 8  ? -5.071  6.113   12.772  1.00 6.83  ? 8  DA  C "C5'"  4  
ATOM 9411  C "C4'"  . DA  A 1 8  ? -4.401  4.837   12.326  1.00 6.47  ? 8  DA  C "C4'"  4  
ATOM 9412  O "O4'"  . DA  A 1 8  ? -4.834  4.523   10.977  1.00 6.13  ? 8  DA  C "O4'"  4  
ATOM 9413  C "C3'"  . DA  A 1 8  ? -2.886  4.970   12.234  1.00 6.42  ? 8  DA  C "C3'"  4  
ATOM 9414  O "O3'"  . DA  A 1 8  ? -2.281  3.694   12.416  1.00 6.21  ? 8  DA  C "O3'"  4  
ATOM 9415  C "C2'"  . DA  A 1 8  ? -2.677  5.498   10.826  1.00 6.21  ? 8  DA  C "C2'"  4  
ATOM 9416  C "C1'"  . DA  A 1 8  ? -3.778  4.778   10.057  1.00 5.94  ? 8  DA  C "C1'"  4  
ATOM 9417  N N9     . DA  A 1 8  ? -4.312  5.483   8.888   1.00 5.85  ? 8  DA  C N9     4  
ATOM 9418  C C8     . DA  A 1 8  ? -4.703  6.791   8.753   1.00 6.11  ? 8  DA  C C8     4  
ATOM 9419  N N7     . DA  A 1 8  ? -5.087  7.106   7.537   1.00 5.96  ? 8  DA  C N7     4  
ATOM 9420  C C5     . DA  A 1 8  ? -4.946  5.921   6.824   1.00 5.57  ? 8  DA  C C5     4  
ATOM 9421  C C6     . DA  A 1 8  ? -5.182  5.587   5.470   1.00 5.26  ? 8  DA  C C6     4  
ATOM 9422  N N6     . DA  A 1 8  ? -5.615  6.456   4.552   1.00 5.31  ? 8  DA  C N6     4  
ATOM 9423  N N1     . DA  A 1 8  ? -4.949  4.310   5.088   1.00 4.91  ? 8  DA  C N1     4  
ATOM 9424  C C2     . DA  A 1 8  ? -4.501  3.440   6.004   1.00 4.88  ? 8  DA  C C2     4  
ATOM 9425  N N3     . DA  A 1 8  ? -4.235  3.637   7.295   1.00 5.16  ? 8  DA  C N3     4  
ATOM 9426  C C4     . DA  A 1 8  ? -4.481  4.912   7.647   1.00 5.50  ? 8  DA  C C4     4  
ATOM 9427  H "H5'"  . DA  A 1 8  ? -6.105  6.111   12.428  1.00 6.79  ? 8  DA  C "H5'"  4  
ATOM 9428  H "H5''" . DA  A 1 8  ? -5.062  6.152   13.862  1.00 7.09  ? 8  DA  C "H5''" 4  
ATOM 9429  H "H4'"  . DA  A 1 8  ? -4.619  4.056   13.057  1.00 6.52  ? 8  DA  C "H4'"  4  
ATOM 9430  H "H3'"  . DA  A 1 8  ? -2.506  5.658   12.989  1.00 6.70  ? 8  DA  C "H3'"  4  
ATOM 9431  H "H2'"  . DA  A 1 8  ? -2.785  6.582   10.788  1.00 6.42  ? 8  DA  C "H2'"  4  
ATOM 9432  H "H2''" . DA  A 1 8  ? -1.682  5.254   10.453  1.00 6.05  ? 8  DA  C "H2''" 4  
ATOM 9433  H "H1'"  . DA  A 1 8  ? -3.413  3.805   9.718   1.00 5.67  ? 8  DA  C "H1'"  4  
ATOM 9434  H H8     . DA  A 1 8  ? -4.694  7.497   9.570   1.00 6.42  ? 8  DA  C H8     4  
ATOM 9435  H H61    . DA  A 1 8  ? -5.755  6.160   3.597   1.00 5.10  ? 8  DA  C H61    4  
ATOM 9436  H H62    . DA  A 1 8  ? -5.790  7.415   4.814   1.00 5.58  ? 8  DA  C H62    4  
ATOM 9437  H H2     . DA  A 1 8  ? -4.332  2.427   5.643   1.00 4.61  ? 8  DA  C H2     4  
ATOM 9438  P P      . DT  A 1 9  ? -0.691  3.538   12.284  1.00 6.09  ? 9  DT  C P      4  
ATOM 9439  O OP1    . DT  A 1 9  ? -0.215  2.758   13.457  1.00 6.21  ? 9  DT  C OP1    4  
ATOM 9440  O OP2    . DT  A 1 9  ? -0.075  4.852   11.976  1.00 6.24  ? 9  DT  C OP2    4  
ATOM 9441  O "O5'"  . DT  A 1 9  ? -0.586  2.603   11.005  1.00 5.64  ? 9  DT  C "O5'"  4  
ATOM 9442  C "C5'"  . DT  A 1 9  ? -1.441  1.468   10.903  1.00 5.46  ? 9  DT  C "C5'"  4  
ATOM 9443  C "C4'"  . DT  A 1 9  ? -0.967  0.531   9.821   1.00 5.04  ? 9  DT  C "C4'"  4  
ATOM 9444  O "O4'"  . DT  A 1 9  ? -1.392  1.047   8.538   1.00 4.86  ? 9  DT  C "O4'"  4  
ATOM 9445  C "C3'"  . DT  A 1 9  ? 0.551   0.429   9.727   1.00 4.94  ? 9  DT  C "C3'"  4  
ATOM 9446  O "O3'"  . DT  A 1 9  ? 0.902   -0.851  9.195   1.00 4.61  ? 9  DT  C "O3'"  4  
ATOM 9447  C "C2'"  . DT  A 1 9  ? 0.905   1.578   8.800   1.00 4.92  ? 9  DT  C "C2'"  4  
ATOM 9448  C "C1'"  . DT  A 1 9  ? -0.278  1.584   7.834   1.00 4.77  ? 9  DT  C "C1'"  4  
ATOM 9449  N N1     . DT  A 1 9  ? -0.657  2.905   7.281   1.00 4.93  ? 9  DT  C N1     4  
ATOM 9450  C C2     . DT  A 1 9  ? -1.007  2.944   5.947   1.00 4.69  ? 9  DT  C C2     4  
ATOM 9451  O O2     . DT  A 1 9  ? -1.047  1.951   5.241   1.00 4.36  ? 9  DT  C O2     4  
ATOM 9452  N N3     . DT  A 1 9  ? -1.310  4.190   5.468   1.00 4.89  ? 9  DT  C N3     4  
ATOM 9453  C C4     . DT  A 1 9  ? -1.302  5.376   6.167   1.00 5.28  ? 9  DT  C C4     4  
ATOM 9454  O O4     . DT  A 1 9  ? -1.568  6.428   5.584   1.00 5.43  ? 9  DT  C O4     4  
ATOM 9455  C C5     . DT  A 1 9  ? -0.941  5.267   7.566   1.00 5.49  ? 9  DT  C C5     4  
ATOM 9456  C C7     . DT  A 1 9  ? -0.874  6.513   8.393   1.00 5.91  ? 9  DT  C C7     4  
ATOM 9457  C C6     . DT  A 1 9  ? -0.645  4.050   8.054   1.00 5.31  ? 9  DT  C C6     4  
ATOM 9458  H "H5'"  . DT  A 1 9  ? -2.454  1.797   10.670  1.00 5.51  ? 9  DT  C "H5'"  4  
ATOM 9459  H "H5''" . DT  A 1 9  ? -1.451  0.935   11.853  1.00 5.60  ? 9  DT  C "H5''" 4  
ATOM 9460  H "H4'"  . DT  A 1 9  ? -1.347  -0.467  10.042  1.00 4.97  ? 9  DT  C "H4'"  4  
ATOM 9461  H "H3'"  . DT  A 1 9  ? 1.011   0.546   10.709  1.00 5.16  ? 9  DT  C "H3'"  4  
ATOM 9462  H "H2'"  . DT  A 1 9  ? 0.991   2.515   9.352   1.00 5.21  ? 9  DT  C "H2'"  4  
ATOM 9463  H "H2''" . DT  A 1 9  ? 1.855   1.408   8.302   1.00 4.76  ? 9  DT  C "H2''" 4  
ATOM 9464  H "H1'"  . DT  A 1 9  ? -0.078  0.915   6.995   1.00 4.47  ? 9  DT  C "H1'"  4  
ATOM 9465  H H3     . DT  A 1 9  ? -1.558  4.241   4.490   1.00 4.75  ? 9  DT  C H3     4  
ATOM 9466  H H71    . DT  A 1 9  ? -0.394  7.305   7.819   1.00 5.99  ? 9  DT  C H71    4  
ATOM 9467  H H72    . DT  A 1 9  ? -0.296  6.319   9.296   1.00 6.04  ? 9  DT  C H72    4  
ATOM 9468  H H73    . DT  A 1 9  ? -1.882  6.823   8.667   1.00 6.06  ? 9  DT  C H73    4  
ATOM 9469  H H6     . DT  A 1 9  ? -0.388  3.962   9.109   1.00 5.49  ? 9  DT  C H6     4  
ATOM 9470  P P      . DA  A 1 10 ? 2.445   -1.227  8.954   1.00 4.43  ? 10 DA  C P      4  
ATOM 9471  O OP1    . DA  A 1 10 ? 2.701   -2.521  9.635   1.00 4.39  ? 10 DA  C OP1    4  
ATOM 9472  O OP2    . DA  A 1 10 ? 3.292   -0.048  9.270   1.00 4.66  ? 10 DA  C OP2    4  
ATOM 9473  O "O5'"  . DA  A 1 10 ? 2.489   -1.469  7.381   1.00 4.06  ? 10 DA  C "O5'"  4  
ATOM 9474  C "C5'"  . DA  A 1 10 ? 1.544   -2.350  6.779   1.00 3.83  ? 10 DA  C "C5'"  4  
ATOM 9475  C "C4'"  . DA  A 1 10 ? 1.821   -2.513  5.305   1.00 3.50  ? 10 DA  C "C4'"  4  
ATOM 9476  O "O4'"  . DA  A 1 10 ? 1.371   -1.322  4.613   1.00 3.59  ? 10 DA  C "O4'"  4  
ATOM 9477  C "C3'"  . DA  A 1 10 ? 3.297   -2.637  4.942   1.00 3.38  ? 10 DA  C "C3'"  4  
ATOM 9478  O "O3'"  . DA  A 1 10 ? 3.427   -3.361  3.718   1.00 3.05  ? 10 DA  C "O3'"  4  
ATOM 9479  C "C2'"  . DA  A 1 10 ? 3.730   -1.191  4.797   1.00 3.59  ? 10 DA  C "C2'"  4  
ATOM 9480  C "C1'"  . DA  A 1 10 ? 2.489   -0.539  4.203   1.00 3.64  ? 10 DA  C "C1'"  4  
ATOM 9481  N N9     . DA  A 1 10 ? 2.276   0.849   4.618   1.00 3.99  ? 10 DA  C N9     4  
ATOM 9482  C C8     . DA  A 1 10 ? 2.383   1.386   5.875   1.00 4.31  ? 10 DA  C C8     4  
ATOM 9483  N N7     . DA  A 1 10 ? 2.180   2.682   5.917   1.00 4.59  ? 10 DA  C N7     4  
ATOM 9484  C C5     . DA  A 1 10 ? 1.914   3.021   4.598   1.00 4.47  ? 10 DA  C C5     4  
ATOM 9485  C C6     . DA  A 1 10 ? 1.622   4.249   3.972   1.00 4.68  ? 10 DA  C C6     4  
ATOM 9486  N N6     . DA  A 1 10 ? 1.567   5.421   4.615   1.00 5.05  ? 10 DA  C N6     4  
ATOM 9487  N N1     . DA  A 1 10 ? 1.396   4.236   2.639   1.00 4.52  ? 10 DA  C N1     4  
ATOM 9488  C C2     . DA  A 1 10 ? 1.471   3.067   1.987   1.00 4.16  ? 10 DA  C C2     4  
ATOM 9489  N N3     . DA  A 1 10 ? 1.744   1.854   2.462   1.00 3.92  ? 10 DA  C N3     4  
ATOM 9490  C C4     . DA  A 1 10 ? 1.957   1.899   3.789   1.00 4.10  ? 10 DA  C C4     4  
ATOM 9491  H "H5'"  . DA  A 1 10 ? 0.540   -1.947  6.908   1.00 3.96  ? 10 DA  C "H5'"  4  
ATOM 9492  H "H5''" . DA  A 1 10 ? 1.597   -3.327  7.260   1.00 3.81  ? 10 DA  C "H5''" 4  
ATOM 9493  H "H4'"  . DA  A 1 10 ? 1.331   -3.427  4.966   1.00 3.33  ? 10 DA  C "H4'"  4  
ATOM 9494  H "H3'"  . DA  A 1 10 ? 3.855   -3.150  5.727   1.00 3.43  ? 10 DA  C "H3'"  4  
ATOM 9495  H "H2'"  . DA  A 1 10 ? 4.001   -0.759  5.761   1.00 3.83  ? 10 DA  C "H2'"  4  
ATOM 9496  H "H2''" . DA  A 1 10 ? 4.594   -1.098  4.141   1.00 3.50  ? 10 DA  C "H2''" 4  
ATOM 9497  H "H1'"  . DA  A 1 10 ? 2.528   -0.568  3.112   1.00 3.48  ? 10 DA  C "H1'"  4  
ATOM 9498  H H8     . DA  A 1 10 ? 2.618   0.796   6.749   1.00 4.34  ? 10 DA  C H8     4  
ATOM 9499  H H61    . DA  A 1 10 ? 1.359   6.274   4.115   1.00 5.20  ? 10 DA  C H61    4  
ATOM 9500  H H62    . DA  A 1 10 ? 1.741   5.453   5.610   1.00 5.19  ? 10 DA  C H62    4  
ATOM 9501  H H2     . DA  A 1 10 ? 1.274   3.116   0.916   1.00 4.07  ? 10 DA  C H2     4  
ATOM 9502  P P      . DT  A 1 11 ? 4.873   -3.555  3.056   1.00 2.90  ? 11 DT  C P      4  
ATOM 9503  O OP1    . DT  A 1 11 ? 5.013   -4.948  2.544   1.00 2.64  ? 11 DT  C OP1    4  
ATOM 9504  O OP2    . DT  A 1 11 ? 5.896   -3.018  3.984   1.00 3.10  ? 11 DT  C OP2    4  
ATOM 9505  O "O5'"  . DT  A 1 11 ? 4.771   -2.578  1.803   1.00 2.91  ? 11 DT  C "O5'"  4  
ATOM 9506  C "C5'"  . DT  A 1 11 ? 3.678   -2.707  0.890   1.00 2.80  ? 11 DT  C "C5'"  4  
ATOM 9507  C "C4'"  . DT  A 1 11 ? 3.980   -1.995  -0.406  1.00 2.86  ? 11 DT  C "C4'"  4  
ATOM 9508  O "O4'"  . DT  A 1 11 ? 3.725   -0.577  -0.230  1.00 3.15  ? 11 DT  C "O4'"  4  
ATOM 9509  C "C3'"  . DT  A 1 11 ? 5.456   -2.094  -0.773  1.00 2.87  ? 11 DT  C "C3'"  4  
ATOM 9510  O "O3'"  . DT  A 1 11 ? 5.663   -1.990  -2.175  1.00 2.91  ? 11 DT  C "O3'"  4  
ATOM 9511  C "C2'"  . DT  A 1 11 ? 6.064   -0.908  -0.045  1.00 3.15  ? 11 DT  C "C2'"  4  
ATOM 9512  C "C1'"  . DT  A 1 11 ? 4.956   0.131   -0.159  1.00 3.35  ? 11 DT  C "C1'"  4  
ATOM 9513  N N1     . DT  A 1 11 ? 4.899   1.120   0.942   1.00 3.63  ? 11 DT  C N1     4  
ATOM 9514  C C2     . DT  A 1 11 ? 4.595   2.425   0.608   1.00 3.92  ? 11 DT  C C2     4  
ATOM 9515  O O2     . DT  A 1 11 ? 4.293   2.774   -0.522  1.00 3.95  ? 11 DT  C O2     4  
ATOM 9516  N N3     . DT  A 1 11 ? 4.656   3.315   1.646   1.00 4.21  ? 11 DT  C N3     4  
ATOM 9517  C C4     . DT  A 1 11 ? 4.970   3.041   2.959   1.00 4.26  ? 11 DT  C C4     4  
ATOM 9518  O O4     . DT  A 1 11 ? 5.053   3.962   3.770   1.00 4.57  ? 11 DT  C O4     4  
ATOM 9519  C C5     . DT  A 1 11 ? 5.242   1.649   3.250   1.00 3.96  ? 11 DT  C C5     4  
ATOM 9520  C C7     . DT  A 1 11 ? 5.664   1.273   4.636   1.00 4.05  ? 11 DT  C C7     4  
ATOM 9521  C C6     . DT  A 1 11 ? 5.182   0.763   2.244   1.00 3.65  ? 11 DT  C C6     4  
ATOM 9522  H "H5'"  . DT  A 1 11 ? 2.779   -2.275  1.331   1.00 2.92  ? 11 DT  C "H5'"  4  
ATOM 9523  H "H5''" . DT  A 1 11 ? 3.499   -3.762  0.681   1.00 2.62  ? 11 DT  C "H5''" 4  
ATOM 9524  H "H4'"  . DT  A 1 11 ? 3.404   -2.462  -1.208  1.00 2.74  ? 11 DT  C "H4'"  4  
ATOM 9525  H "H3'"  . DT  A 1 11 ? 5.872   -3.037  -0.426  1.00 2.71  ? 11 DT  C "H3'"  4  
ATOM 9526  H "H2'"  . DT  A 1 11 ? 6.289   -1.156  0.992   1.00 3.15  ? 11 DT  C "H2'"  4  
ATOM 9527  H "H2''" . DT  A 1 11 ? 6.992   -0.586  -0.512  1.00 3.24  ? 11 DT  C "H2''" 4  
ATOM 9528  H "H1'"  . DT  A 1 11 ? 5.060   0.683   -1.097  1.00 3.46  ? 11 DT  C "H1'"  4  
ATOM 9529  H H3     . DT  A 1 11 ? 4.467   4.281   1.416   1.00 4.44  ? 11 DT  C H3     4  
ATOM 9530  H H71    . DT  A 1 11 ? 4.791   1.230   5.284   1.00 4.18  ? 11 DT  C H71    4  
ATOM 9531  H H72    . DT  A 1 11 ? 6.149   0.298   4.615   1.00 4.22  ? 11 DT  C H72    4  
ATOM 9532  H H73    . DT  A 1 11 ? 6.363   2.017   5.017   1.00 4.16  ? 11 DT  C H73    4  
ATOM 9533  H H6     . DT  A 1 11 ? 5.358   -0.290  2.466   1.00 3.44  ? 11 DT  C H6     4  
ATOM 9534  P P      . DC  A 1 12 ? 7.160   -1.895  -2.747  1.00 3.03  ? 12 DC  C P      4  
ATOM 9535  O OP1    . DC  A 1 12 ? 7.246   -2.714  -3.988  1.00 2.99  ? 12 DC  C OP1    4  
ATOM 9536  O OP2    . DC  A 1 12 ? 8.142   -2.117  -1.658  1.00 2.97  ? 12 DC  C OP2    4  
ATOM 9537  O "O5'"  . DC  A 1 12 ? 7.188   -0.361  -3.152  1.00 3.38  ? 12 DC  C "O5'"  4  
ATOM 9538  C "C5'"  . DC  A 1 12 ? 6.037   0.194   -3.781  1.00 3.47  ? 12 DC  C "C5'"  4  
ATOM 9539  C "C4'"  . DC  A 1 12 ? 6.369   1.503   -4.450  1.00 3.83  ? 12 DC  C "C4'"  4  
ATOM 9540  O "O4'"  . DC  A 1 12 ? 6.317   2.567   -3.465  1.00 4.03  ? 12 DC  C "O4'"  4  
ATOM 9541  C "C3'"  . DC  A 1 12 ? 7.797   1.522   -4.981  1.00 3.98  ? 12 DC  C "C3'"  4  
ATOM 9542  O "O3'"  . DC  A 1 12 ? 7.875   2.416   -6.080  1.00 4.31  ? 12 DC  C "O3'"  4  
ATOM 9543  C "C2'"  . DC  A 1 12 ? 8.598   2.003   -3.783  1.00 4.06  ? 12 DC  C "C2'"  4  
ATOM 9544  C "C1'"  . DC  A 1 12 ? 7.634   3.000   -3.149  1.00 4.21  ? 12 DC  C "C1'"  4  
ATOM 9545  N N1     . DC  A 1 12 ? 7.749   3.199   -1.688  1.00 4.22  ? 12 DC  C N1     4  
ATOM 9546  C C2     . DC  A 1 12 ? 7.695   4.515   -1.194  1.00 4.57  ? 12 DC  C C2     4  
ATOM 9547  O O2     . DC  A 1 12 ? 7.486   5.446   -1.985  1.00 4.81  ? 12 DC  C O2     4  
ATOM 9548  N N3     . DC  A 1 12 ? 7.870   4.737   0.129   1.00 4.65  ? 12 DC  C N3     4  
ATOM 9549  C C4     . DC  A 1 12 ? 8.085   3.712   0.954   1.00 4.41  ? 12 DC  C C4     4  
ATOM 9550  N N4     . DC  A 1 12 ? 8.289   3.990   2.247   1.00 4.56  ? 12 DC  C N4     4  
ATOM 9551  C C5     . DC  A 1 12 ? 8.110   2.358   0.488   1.00 4.05  ? 12 DC  C C5     4  
ATOM 9552  C C6     . DC  A 1 12 ? 7.934   2.151   -0.829  1.00 3.96  ? 12 DC  C C6     4  
ATOM 9553  H "H5'"  . DC  A 1 12 ? 5.262   0.364   -3.034  1.00 3.42  ? 12 DC  C "H5'"  4  
ATOM 9554  H "H5''" . DC  A 1 12 ? 5.662   -0.501  -4.530  1.00 3.35  ? 12 DC  C "H5''" 4  
ATOM 9555  H "H4'"  . DC  A 1 12 ? 5.697   1.642   -5.298  1.00 3.88  ? 12 DC  C "H4'"  4  
ATOM 9556  H "H3'"  . DC  A 1 12 ? 8.108   0.528   -5.304  1.00 3.82  ? 12 DC  C "H3'"  4  
ATOM 9557  H "H2'"  . DC  A 1 12 ? 8.842   1.180   -3.112  1.00 3.84  ? 12 DC  C "H2'"  4  
ATOM 9558  H "H2''" . DC  A 1 12 ? 9.535   2.466   -4.089  1.00 4.26  ? 12 DC  C "H2''" 4  
ATOM 9559  H "H1'"  . DC  A 1 12 ? 7.760   3.977   -3.623  1.00 4.48  ? 12 DC  C "H1'"  4  
ATOM 9560  H H41    . DC  A 1 12 ? 8.287   4.948   2.569   1.00 4.84  ? 12 DC  C H41    4  
ATOM 9561  H H42    . DC  A 1 12 ? 8.463   3.244   2.906   1.00 4.42  ? 12 DC  C H42    4  
ATOM 9562  H H5     . DC  A 1 12 ? 8.267   1.526   1.176   1.00 3.87  ? 12 DC  C H5     4  
ATOM 9563  H H6     . DC  A 1 12 ? 7.942   1.131   -1.216  1.00 3.70  ? 12 DC  C H6     4  
ATOM 9564  P P      . DT  A 1 13 ? 9.291   2.725   -6.756  1.00 4.57  ? 13 DT  C P      4  
ATOM 9565  O OP1    . DT  A 1 13 ? 9.126   2.598   -8.226  1.00 4.73  ? 13 DT  C OP1    4  
ATOM 9566  O OP2    . DT  A 1 13 ? 10.367  1.969   -6.066  1.00 4.41  ? 13 DT  C OP2    4  
ATOM 9567  O "O5'"  . DT  A 1 13 ? 9.438   4.266   -6.399  1.00 4.91  ? 13 DT  C "O5'"  4  
ATOM 9568  C "C5'"  . DT  A 1 13 ? 8.318   5.125   -6.583  1.00 5.05  ? 13 DT  C "C5'"  4  
ATOM 9569  C "C4'"  . DT  A 1 13 ? 8.757   6.565   -6.630  1.00 5.46  ? 13 DT  C "C4'"  4  
ATOM 9570  O "O4'"  . DT  A 1 13 ? 8.929   7.044   -5.274  1.00 5.48  ? 13 DT  C "O4'"  4  
ATOM 9571  C "C3'"  . DT  A 1 13 ? 10.117  6.737   -7.292  1.00 5.68  ? 13 DT  C "C3'"  4  
ATOM 9572  O "O3'"  . DT  A 1 13 ? 10.227  8.036   -7.854  1.00 6.08  ? 13 DT  C "O3'"  4  
ATOM 9573  C "C2'"  . DT  A 1 13 ? 11.080  6.542   -6.135  1.00 5.58  ? 13 DT  C "C2'"  4  
ATOM 9574  C "C1'"  . DT  A 1 13 ? 10.314  7.176   -4.976  1.00 5.59  ? 13 DT  C "C1'"  4  
ATOM 9575  N N1     . DT  A 1 13 ? 10.575  6.590   -3.638  1.00 5.36  ? 13 DT  C N1     4  
ATOM 9576  C C2     . DT  A 1 13 ? 10.672  7.460   -2.568  1.00 5.56  ? 13 DT  C C2     4  
ATOM 9577  O O2     . DT  A 1 13 ? 10.506  8.665   -2.667  1.00 5.88  ? 13 DT  C O2     4  
ATOM 9578  N N3     . DT  A 1 13 ? 10.972  6.868   -1.370  1.00 5.38  ? 13 DT  C N3     4  
ATOM 9579  C C4     . DT  A 1 13 ? 11.178  5.526   -1.134  1.00 5.02  ? 13 DT  C C4     4  
ATOM 9580  O O4     . DT  A 1 13 ? 11.505  5.149   -0.011  1.00 4.93  ? 13 DT  C O4     4  
ATOM 9581  C C5     . DT  A 1 13 ? 11.041  4.666   -2.292  1.00 4.81  ? 13 DT  C C5     4  
ATOM 9582  C C7     . DT  A 1 13 ? 11.288  3.197   -2.137  1.00 4.43  ? 13 DT  C C7     4  
ATOM 9583  C C6     . DT  A 1 13 ? 10.741  5.230   -3.473  1.00 5.00  ? 13 DT  C C6     4  
ATOM 9584  H "H5'"  . DT  A 1 13 ? 7.617   4.993   -5.759  1.00 4.88  ? 13 DT  C "H5'"  4  
ATOM 9585  H "H5''" . DT  A 1 13 ? 7.815   4.875   -7.518  1.00 5.06  ? 13 DT  C "H5''" 4  
ATOM 9586  H "H4'"  . DT  A 1 13 ? 8.031   7.131   -7.216  1.00 5.61  ? 13 DT  C "H4'"  4  
ATOM 9587  H "H3'"  . DT  A 1 13 ? 10.268  5.992   -8.075  1.00 5.59  ? 13 DT  C "H3'"  4  
ATOM 9588  H "H2'"  . DT  A 1 13 ? 11.289  5.487   -5.965  1.00 5.30  ? 13 DT  C "H2'"  4  
ATOM 9589  H "H2''" . DT  A 1 13 ? 12.030  7.041   -6.319  1.00 5.80  ? 13 DT  C "H2''" 4  
ATOM 9590  H "H1'"  . DT  A 1 13 ? 10.531  8.245   -4.923  1.00 5.89  ? 13 DT  C "H1'"  4  
ATOM 9591  H H3     . DT  A 1 13 ? 11.058  7.489   -0.575  1.00 5.55  ? 13 DT  C H3     4  
ATOM 9592  H H71    . DT  A 1 13 ? 12.246  3.040   -1.642  1.00 4.39  ? 13 DT  C H71    4  
ATOM 9593  H H72    . DT  A 1 13 ? 10.493  2.755   -1.536  1.00 4.34  ? 13 DT  C H72    4  
ATOM 9594  H H73    . DT  A 1 13 ? 11.306  2.724   -3.119  1.00 4.63  ? 13 DT  C H73    4  
ATOM 9595  H H6     . DT  A 1 13 ? 10.619  4.584   -4.342  1.00 4.87  ? 13 DT  C H6     4  
ATOM 9596  P P      . DT  A 1 14 ? 11.602  8.487   -8.538  1.00 6.39  ? 14 DT  C P      4  
ATOM 9597  O OP1    . DT  A 1 14 ? 11.274  9.110   -9.845  1.00 6.68  ? 14 DT  C OP1    4  
ATOM 9598  O OP2    . DT  A 1 14 ? 12.584  7.376   -8.480  1.00 6.17  ? 14 DT  C OP2    4  
ATOM 9599  O "O5'"  . DT  A 1 14 ? 12.062  9.629   -7.534  1.00 6.61  ? 14 DT  C "O5'"  4  
ATOM 9600  C "C5'"  . DT  A 1 14 ? 11.111  10.598  -7.102  1.00 6.76  ? 14 DT  C "C5'"  4  
ATOM 9601  C "C4'"  . DT  A 1 14 ? 11.793  11.716  -6.358  1.00 7.05  ? 14 DT  C "C4'"  4  
ATOM 9602  O "O4'"  . DT  A 1 14 ? 12.049  11.287  -4.996  1.00 6.86  ? 14 DT  C "O4'"  4  
ATOM 9603  C "C3'"  . DT  A 1 14 ? 13.162  12.044  -6.938  1.00 7.28  ? 14 DT  C "C3'"  4  
ATOM 9604  O "O3'"  . DT  A 1 14 ? 13.490  13.399  -6.659  1.00 7.65  ? 14 DT  C "O3'"  4  
ATOM 9605  C "C2'"  . DT  A 1 14 ? 14.079  11.079  -6.206  1.00 7.02  ? 14 DT  C "C2'"  4  
ATOM 9606  C "C1'"  . DT  A 1 14 ? 13.438  11.031  -4.821  1.00 6.87  ? 14 DT  C "C1'"  4  
ATOM 9607  N N1     . DT  A 1 14 ? 13.604  9.767   -4.064  1.00 6.48  ? 14 DT  C N1     4  
ATOM 9608  C C2     . DT  A 1 14 ? 13.799  9.876   -2.700  1.00 6.46  ? 14 DT  C C2     4  
ATOM 9609  O O2     . DT  A 1 14 ? 13.794  10.942  -2.106  1.00 6.74  ? 14 DT  C O2     4  
ATOM 9610  N N3     . DT  A 1 14 ? 14.003  8.688   -2.050  1.00 6.11  ? 14 DT  C N3     4  
ATOM 9611  C C4     . DT  A 1 14 ? 14.027  7.428   -2.608  1.00 5.79  ? 14 DT  C C4     4  
ATOM 9612  O O4     . DT  A 1 14 ? 14.248  6.449   -1.896  1.00 5.50  ? 14 DT  C O4     4  
ATOM 9613  C C5     . DT  A 1 14 ? 13.800  7.381   -4.039  1.00 5.84  ? 14 DT  C C5     4  
ATOM 9614  C C7     . DT  A 1 14 ? 13.862  6.057   -4.733  1.00 5.54  ? 14 DT  C C7     4  
ATOM 9615  C C6     . DT  A 1 14 ? 13.594  8.538   -4.691  1.00 6.19  ? 14 DT  C C6     4  
ATOM 9616  H "H5'"  . DT  A 1 14 ? 10.382  10.124  -6.446  1.00 6.53  ? 14 DT  C "H5'"  4  
ATOM 9617  H "H5''" . DT  A 1 14 ? 10.594  11.011  -7.969  1.00 6.91  ? 14 DT  C "H5''" 4  
ATOM 9618  H "H4'"  . DT  A 1 14 ? 11.175  12.614  -6.437  1.00 7.27  ? 14 DT  C "H4'"  4  
ATOM 9619  H "H3'"  . DT  A 1 14 ? 13.180  11.883  -8.015  1.00 7.34  ? 14 DT  C "H3'"  4  
ATOM 9620  H "H2'"  . DT  A 1 14 ? 14.090  10.103  -6.690  1.00 6.80  ? 14 DT  C "H2'"  4  
ATOM 9621  H "H2''" . DT  A 1 14 ? 15.104  11.444  -6.184  1.00 7.19  ? 14 DT  C "H2''" 4  
ATOM 9622  H "H1'"  . DT  A 1 14 ? 13.832  11.842  -4.204  1.00 7.08  ? 14 DT  C "H1'"  4  
ATOM 9623  H H3     . DT  A 1 14 ? 14.171  8.748   -1.054  1.00 6.11  ? 14 DT  C H3     4  
ATOM 9624  H H71    . DT  A 1 14 ? 13.925  6.212   -5.810  1.00 5.65  ? 14 DT  C H71    4  
ATOM 9625  H H72    . DT  A 1 14 ? 14.742  5.510   -4.394  1.00 5.56  ? 14 DT  C H72    4  
ATOM 9626  H H73    . DT  A 1 14 ? 12.966  5.482   -4.503  1.00 5.33  ? 14 DT  C H73    4  
ATOM 9627  H H6     . DT  A 1 14 ? 13.407  8.503   -5.763  1.00 6.25  ? 14 DT  C H6     4  
ATOM 9628  P P      . DA  A 1 15 ? 14.916  13.981  -7.102  1.00 7.95  ? 15 DA  C P      4  
ATOM 9629  O OP1    . DA  A 1 15 ? 14.678  15.282  -7.781  1.00 8.35  ? 15 DA  C OP1    4  
ATOM 9630  O OP2    . DA  A 1 15 ? 15.702  12.924  -7.786  1.00 7.77  ? 15 DA  C OP2    4  
ATOM 9631  O "O5'"  . DA  A 1 15 ? 15.572  14.273  -5.685  1.00 7.97  ? 15 DA  C "O5'"  4  
ATOM 9632  C "C5'"  . DA  A 1 15 ? 14.827  15.000  -4.713  1.00 8.07  ? 15 DA  C "C5'"  4  
ATOM 9633  C "C4'"  . DA  A 1 15 ? 15.688  15.358  -3.528  1.00 8.17  ? 15 DA  C "C4'"  4  
ATOM 9634  O "O4'"  . DA  A 1 15 ? 15.797  14.203  -2.654  1.00 7.81  ? 15 DA  C "O4'"  4  
ATOM 9635  C "C3'"  . DA  A 1 15 ? 17.124  15.692  -3.915  1.00 8.38  ? 15 DA  C "C3'"  4  
ATOM 9636  O "O3'"  . DA  A 1 15 ? 17.680  16.567  -2.943  1.00 8.63  ? 15 DA  C "O3'"  4  
ATOM 9637  C "C2'"  . DA  A 1 15 ? 17.802  14.334  -3.914  1.00 8.04  ? 15 DA  C "C2'"  4  
ATOM 9638  C "C1'"  . DA  A 1 15 ? 17.098  13.634  -2.758  1.00 7.73  ? 15 DA  C "C1'"  4  
ATOM 9639  N N9     . DA  A 1 15 ? 16.982  12.178  -2.876  1.00 7.31  ? 15 DA  C N9     4  
ATOM 9640  C C8     . DA  A 1 15 ? 16.633  11.429  -3.971  1.00 7.14  ? 15 DA  C C8     4  
ATOM 9641  N N7     . DA  A 1 15 ? 16.661  10.134  -3.757  1.00 6.76  ? 15 DA  C N7     4  
ATOM 9642  C C5     . DA  A 1 15 ? 17.052  10.022  -2.430  1.00 6.68  ? 15 DA  C C5     4  
ATOM 9643  C C6     . DA  A 1 15 ? 17.276  8.907   -1.595  1.00 6.35  ? 15 DA  C C6     4  
ATOM 9644  N N6     . DA  A 1 15 ? 17.142  7.641   -1.998  1.00 6.00  ? 15 DA  C N6     4  
ATOM 9645  N N1     . DA  A 1 15 ? 17.653  9.141   -0.318  1.00 6.40  ? 15 DA  C N1     4  
ATOM 9646  C C2     . DA  A 1 15 ? 17.796  10.411  0.083   1.00 6.76  ? 15 DA  C C2     4  
ATOM 9647  N N3     . DA  A 1 15 ? 17.620  11.540  -0.607  1.00 7.09  ? 15 DA  C N3     4  
ATOM 9648  C C4     . DA  A 1 15 ? 17.243  11.273  -1.871  1.00 7.03  ? 15 DA  C C4     4  
ATOM 9649  H "H5'"  . DA  A 1 15 ? 13.987  14.395  -4.372  1.00 7.82  ? 15 DA  C "H5'"  4  
ATOM 9650  H "H5''" . DA  A 1 15 ? 14.445  15.917  -5.161  1.00 8.33  ? 15 DA  C "H5''" 4  
ATOM 9651  H "H4'"  . DA  A 1 15 ? 15.263  16.240  -3.046  1.00 8.38  ? 15 DA  C "H4'"  4  
ATOM 9652  H "H3'"  . DA  A 1 15 ? 17.165  16.167  -4.895  1.00 8.58  ? 15 DA  C "H3'"  4  
ATOM 9653  H "H2'"  . DA  A 1 15 ? 17.656  13.816  -4.861  1.00 7.94  ? 15 DA  C "H2'"  4  
ATOM 9654  H "H2''" . DA  A 1 15 ? 18.875  14.424  -3.751  1.00 8.13  ? 15 DA  C "H2''" 4  
ATOM 9655  H "H1'"  . DA  A 1 15 ? 17.616  13.852  -1.822  1.00 7.79  ? 15 DA  C "H1'"  4  
ATOM 9656  H H8     . DA  A 1 15 ? 16.366  11.866  -4.921  1.00 7.30  ? 15 DA  C H8     4  
ATOM 9657  H H61    . DA  A 1 15 ? 17.320  6.881   -1.355  1.00 5.78  ? 15 DA  C H61    4  
ATOM 9658  H H62    . DA  A 1 15 ? 16.866  7.446   -2.949  1.00 5.98  ? 15 DA  C H62    4  
ATOM 9659  H H2     . DA  A 1 15 ? 18.101  10.540  1.122   1.00 6.81  ? 15 DA  C H2     4  
ATOM 9660  P P      . DT  A 1 16 ? 19.219  16.998  -3.041  1.00 8.87  ? 16 DT  C P      4  
ATOM 9661  O OP1    . DT  A 1 16 ? 19.278  18.472  -2.871  1.00 9.30  ? 16 DT  C OP1    4  
ATOM 9662  O OP2    . DT  A 1 16 ? 19.844  16.369  -4.232  1.00 8.79  ? 16 DT  C OP2    4  
ATOM 9663  O "O5'"  . DT  A 1 16 ? 19.796  16.314  -1.728  1.00 8.65  ? 16 DT  C "O5'"  4  
ATOM 9664  C "C5'"  . DT  A 1 16 ? 19.028  16.376  -0.527  1.00 8.59  ? 16 DT  C "C5'"  4  
ATOM 9665  C "C4'"  . DT  A 1 16 ? 19.856  15.958  0.663   1.00 8.49  ? 16 DT  C "C4'"  4  
ATOM 9666  O "O4'"  . DT  A 1 16 ? 19.910  14.512  0.712   1.00 8.07  ? 16 DT  C "O4'"  4  
ATOM 9667  C "C3'"  . DT  A 1 16 ? 21.307  16.409  0.556   1.00 8.71  ? 16 DT  C "C3'"  4  
ATOM 9668  O "O3'"  . DT  A 1 16 ? 21.873  16.542  1.855   1.00 8.76  ? 16 DT  C "O3'"  4  
ATOM 9669  C "C2'"  . DT  A 1 16 ? 21.956  15.274  -0.216  1.00 8.42  ? 16 DT  C "C2'"  4  
ATOM 9670  C "C1'"  . DT  A 1 16 ? 21.201  14.063  0.319   1.00 8.01  ? 16 DT  C "C1'"  4  
ATOM 9671  N N1     . DT  A 1 16 ? 21.057  12.925  -0.618  1.00 7.70  ? 16 DT  C N1     4  
ATOM 9672  C C2     . DT  A 1 16 ? 21.178  11.657  -0.085  1.00 7.32  ? 16 DT  C C2     4  
ATOM 9673  O O2     . DT  A 1 16 ? 21.315  11.445  1.109   1.00 7.25  ? 16 DT  C O2     4  
ATOM 9674  N N3     . DT  A 1 16 ? 21.128  10.641  -1.001  1.00 7.06  ? 16 DT  C N3     4  
ATOM 9675  C C4     . DT  A 1 16 ? 20.961  10.756  -2.363  1.00 7.14  ? 16 DT  C C4     4  
ATOM 9676  O O4     . DT  A 1 16 ? 21.017  9.752   -3.070  1.00 6.91  ? 16 DT  C O4     4  
ATOM 9677  C C5     . DT  A 1 16 ? 20.800  12.109  -2.855  1.00 7.54  ? 16 DT  C C5     4  
ATOM 9678  C C7     . DT  A 1 16 ? 20.622  12.327  -4.325  1.00 7.68  ? 16 DT  C C7     4  
ATOM 9679  C C6     . DT  A 1 16 ? 20.848  13.118  -1.970  1.00 7.79  ? 16 DT  C C6     4  
ATOM 9680  H "H5'"  . DT  A 1 16 ? 18.169  15.710  -0.612  1.00 8.35  ? 16 DT  C "H5'"  4  
ATOM 9681  H "H5''" . DT  A 1 16 ? 18.674  17.394  -0.373  1.00 8.87  ? 16 DT  C "H5''" 4  
ATOM 9682  H "H4'"  . DT  A 1 16 ? 19.433  16.419  1.557   1.00 8.60  ? 16 DT  C "H4'"  4  
ATOM 9683  H "H3'"  . DT  A 1 16 ? 21.388  17.360  0.028   1.00 9.00  ? 16 DT  C "H3'"  4  
ATOM 9684  H "H2'"  . DT  A 1 16 ? 21.829  15.401  -1.291  1.00 8.48  ? 16 DT  C "H2'"  4  
ATOM 9685  H "H2''" . DT  A 1 16 ? 23.026  15.216  -0.016  1.00 8.46  ? 16 DT  C "H2''" 4  
ATOM 9686  H "H1'"  . DT  A 1 16 ? 21.693  13.688  1.219   1.00 7.92  ? 16 DT  C "H1'"  4  
ATOM 9687  H H3     . DT  A 1 16 ? 21.245  9.707   -0.629  1.00 6.79  ? 16 DT  C H3     4  
ATOM 9688  H H71    . DT  A 1 16 ? 19.593  12.098  -4.604  1.00 7.73  ? 16 DT  C H71    4  
ATOM 9689  H H72    . DT  A 1 16 ? 20.841  13.366  -4.569  1.00 7.96  ? 16 DT  C H72    4  
ATOM 9690  H H73    . DT  A 1 16 ? 21.300  11.675  -4.874  1.00 7.57  ? 16 DT  C H73    4  
ATOM 9691  H H6     . DT  A 1 16 ? 20.709  14.137  -2.334  1.00 8.09  ? 16 DT  C H6     4  
ATOM 9692  P P      . DC  A 1 17 ? 23.413  16.958  2.012   1.00 8.97  ? 17 DC  C P      4  
ATOM 9693  O OP1    . DC  A 1 17 ? 23.490  18.019  3.048   1.00 9.29  ? 17 DC  C OP1    4  
ATOM 9694  O OP2    . DC  A 1 17 ? 24.001  17.197  0.669   1.00 9.08  ? 17 DC  C OP2    4  
ATOM 9695  O "O5'"  . DC  A 1 17 ? 24.040  15.626  2.615   1.00 8.62  ? 17 DC  C "O5'"  4  
ATOM 9696  C "C5'"  . DC  A 1 17 ? 23.404  14.988  3.720   1.00 8.41  ? 17 DC  C "C5'"  4  
ATOM 9697  C "C4'"  . DC  A 1 17 ? 24.301  13.928  4.308   1.00 8.15  ? 17 DC  C "C4'"  4  
ATOM 9698  O "O4'"  . DC  A 1 17 ? 24.239  12.746  3.474   1.00 7.79  ? 17 DC  C "O4'"  4  
ATOM 9699  C "C3'"  . DC  A 1 17 ? 25.771  14.331  4.320   1.00 8.34  ? 17 DC  C "C3'"  4  
ATOM 9700  O "O3'"  . DC  A 1 17 ? 26.459  13.641  5.362   1.00 8.19  ? 17 DC  C "O3'"  4  
ATOM 9701  C "C2'"  . DC  A 1 17 ? 26.249  13.890  2.947   1.00 8.23  ? 17 DC  C "C2'"  4  
ATOM 9702  C "C1'"  . DC  A 1 17 ? 25.444  12.612  2.730   1.00 7.81  ? 17 DC  C "C1'"  4  
ATOM 9703  N N1     . DC  A 1 17 ? 25.103  12.286  1.331   1.00 7.71  ? 17 DC  C N1     4  
ATOM 9704  C C2     . DC  A 1 17 ? 25.132  10.941  0.939   1.00 7.34  ? 17 DC  C C2     4  
ATOM 9705  O O2     . DC  A 1 17 ? 25.390  10.070  1.784   1.00 7.09  ? 17 DC  C O2     4  
ATOM 9706  N N3     . DC  A 1 17 ? 24.878  10.619  -0.349  1.00 7.27  ? 17 DC  C N3     4  
ATOM 9707  C C4     . DC  A 1 17 ? 24.599  11.578  -1.233  1.00 7.56  ? 17 DC  C C4     4  
ATOM 9708  N N4     . DC  A 1 17 ? 24.385  11.210  -2.501  1.00 7.51  ? 17 DC  C N4     4  
ATOM 9709  C C5     . DC  A 1 17 ? 24.534  12.955  -0.858  1.00 7.93  ? 17 DC  C C5     4  
ATOM 9710  C C6     . DC  A 1 17 ? 24.788  13.260  0.425   1.00 7.99  ? 17 DC  C C6     4  
ATOM 9711  H "H5'"  . DC  A 1 17 ? 22.476  14.523  3.387   1.00 8.22  ? 17 DC  C "H5'"  4  
ATOM 9712  H "H5''" . DC  A 1 17 ? 23.177  15.728  4.487   1.00 8.63  ? 17 DC  C "H5''" 4  
ATOM 9713  H "H4'"  . DC  A 1 17 ? 23.999  13.758  5.344   1.00 8.11  ? 17 DC  C "H4'"  4  
ATOM 9714  H "H3'"  . DC  A 1 17 ? 25.883  15.406  4.464   1.00 8.66  ? 17 DC  C "H3'"  4  
ATOM 9715  H "H2'"  . DC  A 1 17 ? 26.037  14.646  2.193   1.00 8.44  ? 17 DC  C "H2'"  4  
ATOM 9716  H "H2''" . DC  A 1 17 ? 27.324  13.713  2.940   1.00 8.23  ? 17 DC  C "H2''" 4  
ATOM 9717  H "H1'"  . DC  A 1 17 ? 25.983  11.760  3.149   1.00 7.59  ? 17 DC  C "H1'"  4  
ATOM 9718  H H41    . DC  A 1 17 ? 24.447  10.237  -2.765  1.00 7.27  ? 17 DC  C H41    4  
ATOM 9719  H H42    . DC  A 1 17 ? 24.177  11.906  -3.202  1.00 7.74  ? 17 DC  C H42    4  
ATOM 9720  H H5     . DC  A 1 17 ? 24.291  13.729  -1.587  1.00 8.17  ? 17 DC  C H5     4  
ATOM 9721  H H6     . DC  A 1 17 ? 24.737  14.300  0.746   1.00 8.28  ? 17 DC  C H6     4  
ATOM 9722  P P      . DG  A 1 18 ? 28.020  13.914  5.605   1.00 8.34  ? 18 DG  C P      4  
ATOM 9723  O OP1    . DG  A 1 18 ? 28.201  14.158  7.058   1.00 8.46  ? 18 DG  C OP1    4  
ATOM 9724  O OP2    . DG  A 1 18 ? 28.499  14.926  4.628   1.00 8.65  ? 18 DG  C OP2    4  
ATOM 9725  O "O5'"  . DG  A 1 18 ? 28.683  12.512  5.244   1.00 7.96  ? 18 DG  C "O5'"  4  
ATOM 9726  C "C5'"  . DG  A 1 18 ? 28.291  11.333  5.942   1.00 7.61  ? 18 DG  C "C5'"  4  
ATOM 9727  C "C4'"  . DG  A 1 18 ? 29.266  10.211  5.673   1.00 7.32  ? 18 DG  C "C4'"  4  
ATOM 9728  O "O4'"  . DG  A 1 18 ? 29.009  9.680   4.353   1.00 7.15  ? 18 DG  C "O4'"  4  
ATOM 9729  C "C3'"  . DG  A 1 18 ? 30.725  10.657  5.648   1.00 7.52  ? 18 DG  C "C3'"  4  
ATOM 9730  O "O3'"  . DG  A 1 18 ? 31.597  9.571   5.968   1.00 7.25  ? 18 DG  C "O3'"  4  
ATOM 9731  C "C2'"  . DG  A 1 18 ? 30.912  11.088  4.205   1.00 7.65  ? 18 DG  C "C2'"  4  
ATOM 9732  C "C1'"  . DG  A 1 18 ? 30.033  10.088  3.457   1.00 7.32  ? 18 DG  C "C1'"  4  
ATOM 9733  N N9     . DG  A 1 18 ? 29.402  10.577  2.233   1.00 7.45  ? 18 DG  C N9     4  
ATOM 9734  C C8     . DG  A 1 18 ? 28.951  11.846  1.959   1.00 7.80  ? 18 DG  C C8     4  
ATOM 9735  N N7     . DG  A 1 18 ? 28.464  11.970  0.753   1.00 7.85  ? 18 DG  C N7     4  
ATOM 9736  C C5     . DG  A 1 18 ? 28.595  10.702  0.198   1.00 7.52  ? 18 DG  C C5     4  
ATOM 9737  C C6     . DG  A 1 18 ? 28.243  10.215  -1.093  1.00 7.43  ? 18 DG  C C6     4  
ATOM 9738  O O6     . DG  A 1 18 ? 27.727  10.827  -2.039  1.00 7.63  ? 18 DG  C O6     4  
ATOM 9739  N N1     . DG  A 1 18 ? 28.552  8.864   -1.231  1.00 7.08  ? 18 DG  C N1     4  
ATOM 9740  C C2     . DG  A 1 18 ? 29.126  8.083   -0.256  1.00 6.84  ? 18 DG  C C2     4  
ATOM 9741  N N2     . DG  A 1 18 ? 29.347  6.801   -0.572  1.00 6.52  ? 18 DG  C N2     4  
ATOM 9742  N N3     . DG  A 1 18 ? 29.457  8.524   0.944   1.00 6.92  ? 18 DG  C N3     4  
ATOM 9743  C C4     . DG  A 1 18 ? 29.167  9.831   1.102   1.00 7.27  ? 18 DG  C C4     4  
ATOM 9744  H "H5'"  . DG  A 1 18 ? 27.297  11.027  5.612   1.00 7.47  ? 18 DG  C "H5'"  4  
ATOM 9745  H "H5''" . DG  A 1 18 ? 28.263  11.534  7.013   1.00 7.70  ? 18 DG  C "H5''" 4  
ATOM 9746  H "H4'"  . DG  A 1 18 ? 29.165  9.475   6.472   1.00 7.13  ? 18 DG  C "H4'"  4  
ATOM 9747  H "H3'"  . DG  A 1 18 ? 30.898  11.478  6.345   1.00 7.77  ? 18 DG  C "H3'"  4  
ATOM 9748  H "HO3'" . DG  A 1 18 ? 31.696  9.039   5.172   1.00 7.26  ? 18 DG  C "HO3'" 4  
ATOM 9749  H "H2'"  . DG  A 1 18 ? 30.587  12.118  4.053   1.00 7.93  ? 18 DG  C "H2'"  4  
ATOM 9750  H "H2''" . DG  A 1 18 ? 31.958  11.027  3.906   1.00 7.69  ? 18 DG  C "H2''" 4  
ATOM 9751  H "H1'"  . DG  A 1 18 ? 30.611  9.197   3.205   1.00 7.10  ? 18 DG  C "H1'"  4  
ATOM 9752  H H8     . DG  A 1 18 ? 28.998  12.658  2.668   1.00 8.03  ? 18 DG  C H8     4  
ATOM 9753  H H1     . DG  A 1 18 ? 28.339  8.426   -2.117  1.00 7.02  ? 18 DG  C H1     4  
ATOM 9754  H H21    . DG  A 1 18 ? 29.103  6.442   -1.486  1.00 6.48  ? 18 DG  C H21    4  
ATOM 9755  H H22    . DG  A 1 18 ? 29.767  6.183   0.108   1.00 6.34  ? 18 DG  C H22    4  
ATOM 9756  O "O5'"  . DC  B 1 1  ? 28.114  4.146   -8.162  1.00 6.69  ? 1  DC  D "O5'"  4  
ATOM 9757  C "C5'"  . DC  B 1 1  ? 29.340  3.419   -8.039  1.00 6.58  ? 1  DC  D "C5'"  4  
ATOM 9758  C "C4'"  . DC  B 1 1  ? 29.453  2.755   -6.686  1.00 6.22  ? 1  DC  D "C4'"  4  
ATOM 9759  O "O4'"  . DC  B 1 1  ? 29.637  3.785   -5.686  1.00 6.31  ? 1  DC  D "O4'"  4  
ATOM 9760  C "C3'"  . DC  B 1 1  ? 28.204  1.999   -6.241  1.00 5.89  ? 1  DC  D "C3'"  4  
ATOM 9761  O "O3'"  . DC  B 1 1  ? 28.536  0.979   -5.297  1.00 5.54  ? 1  DC  D "O3'"  4  
ATOM 9762  C "C2'"  . DC  B 1 1  ? 27.377  3.079   -5.576  1.00 5.98  ? 1  DC  D "C2'"  4  
ATOM 9763  C "C1'"  . DC  B 1 1  ? 28.441  3.953   -4.928  1.00 6.16  ? 1  DC  D "C1'"  4  
ATOM 9764  N N1     . DC  B 1 1  ? 28.106  5.387   -4.892  1.00 6.49  ? 1  DC  D N1     4  
ATOM 9765  C C2     . DC  B 1 1  ? 28.358  6.106   -3.721  1.00 6.55  ? 1  DC  D C2     4  
ATOM 9766  O O2     . DC  B 1 1  ? 28.875  5.522   -2.757  1.00 6.34  ? 1  DC  D O2     4  
ATOM 9767  N N3     . DC  B 1 1  ? 28.033  7.419   -3.666  1.00 6.87  ? 1  DC  D N3     4  
ATOM 9768  C C4     . DC  B 1 1  ? 27.479  8.013   -4.726  1.00 7.09  ? 1  DC  D C4     4  
ATOM 9769  N N4     . DC  B 1 1  ? 27.171  9.309   -4.624  1.00 7.40  ? 1  DC  D N4     4  
ATOM 9770  C C5     . DC  B 1 1  ? 27.216  7.306   -5.936  1.00 7.03  ? 1  DC  D C5     4  
ATOM 9771  C C6     . DC  B 1 1  ? 27.546  6.007   -5.976  1.00 6.74  ? 1  DC  D C6     4  
ATOM 9772  H "H5'"  . DC  B 1 1  ? 30.181  4.101   -8.168  1.00 6.83  ? 1  DC  D "H5'"  4  
ATOM 9773  H "H5''" . DC  B 1 1  ? 29.386  2.652   -8.812  1.00 6.54  ? 1  DC  D "H5''" 4  
ATOM 9774  H "H4'"  . DC  B 1 1  ? 30.271  2.035   -6.727  1.00 6.13  ? 1  DC  D "H4'"  4  
ATOM 9775  H "H3'"  . DC  B 1 1  ? 27.689  1.550   -7.090  1.00 5.89  ? 1  DC  D "H3'"  4  
ATOM 9776  H "H2'"  . DC  B 1 1  ? 26.779  3.626   -6.302  1.00 6.17  ? 1  DC  D "H2'"  4  
ATOM 9777  H "H2''" . DC  B 1 1  ? 26.694  2.657   -4.841  1.00 5.73  ? 1  DC  D "H2''" 4  
ATOM 9778  H "H1'"  . DC  B 1 1  ? 28.644  3.621   -3.908  1.00 5.97  ? 1  DC  D "H1'"  4  
ATOM 9779  H H41    . DC  B 1 1  ? 27.355  9.812   -3.769  1.00 7.47  ? 1  DC  D H41    4  
ATOM 9780  H H42    . DC  B 1 1  ? 26.750  9.789   -5.408  1.00 7.58  ? 1  DC  D H42    4  
ATOM 9781  H H5     . DC  B 1 1  ? 26.764  7.801   -6.794  1.00 7.23  ? 1  DC  D H5     4  
ATOM 9782  H H6     . DC  B 1 1  ? 27.361  5.438   -6.886  1.00 6.71  ? 1  DC  D H6     4  
ATOM 9783  H "HO5'" . DC  B 1 1  ? 28.354  5.047   -8.400  1.00 6.83  ? 1  DC  D "HO5'" 4  
ATOM 9784  P P      . DG  B 1 2  ? 27.376  0.044   -4.692  1.00 5.16  ? 2  DG  D P      4  
ATOM 9785  O OP1    . DG  B 1 2  ? 28.018  -1.243  -4.329  1.00 4.91  ? 2  DG  D OP1    4  
ATOM 9786  O OP2    . DG  B 1 2  ? 26.203  0.046   -5.605  1.00 5.20  ? 2  DG  D OP2    4  
ATOM 9787  O "O5'"  . DG  B 1 2  ? 26.974  0.793   -3.343  1.00 5.09  ? 2  DG  D "O5'"  4  
ATOM 9788  C "C5'"  . DG  B 1 2  ? 27.824  0.696   -2.204  1.00 5.02  ? 2  DG  D "C5'"  4  
ATOM 9789  C "C4'"  . DG  B 1 2  ? 27.043  0.859   -0.921  1.00 4.86  ? 2  DG  D "C4'"  4  
ATOM 9790  O "O4'"  . DG  B 1 2  ? 26.816  2.270   -0.679  1.00 5.18  ? 2  DG  D "O4'"  4  
ATOM 9791  C "C3'"  . DG  B 1 2  ? 25.646  0.245   -0.958  1.00 4.60  ? 2  DG  D "C3'"  4  
ATOM 9792  O "O3'"  . DG  B 1 2  ? 25.258  -0.117  0.369   1.00 4.38  ? 2  DG  D "O3'"  4  
ATOM 9793  C "C2'"  . DG  B 1 2  ? 24.797  1.363   -1.533  1.00 4.85  ? 2  DG  D "C2'"  4  
ATOM 9794  C "C1'"  . DG  B 1 2  ? 25.452  2.596   -0.929  1.00 5.17  ? 2  DG  D "C1'"  4  
ATOM 9795  N N9     . DG  B 1 2  ? 25.383  3.809   -1.738  1.00 5.54  ? 2  DG  D N9     4  
ATOM 9796  C C8     . DG  B 1 2  ? 25.258  3.904   -3.103  1.00 5.68  ? 2  DG  D C8     4  
ATOM 9797  N N7     . DG  B 1 2  ? 25.147  5.136   -3.524  1.00 6.03  ? 2  DG  D N7     4  
ATOM 9798  C C5     . DG  B 1 2  ? 25.217  5.902   -2.368  1.00 6.13  ? 2  DG  D C5     4  
ATOM 9799  C C6     . DG  B 1 2  ? 25.147  7.314   -2.188  1.00 6.49  ? 2  DG  D C6     4  
ATOM 9800  O O6     . DG  B 1 2  ? 24.993  8.198   -3.043  1.00 6.78  ? 2  DG  D O6     4  
ATOM 9801  N N1     . DG  B 1 2  ? 25.268  7.663   -0.847  1.00 6.50  ? 2  DG  D N1     4  
ATOM 9802  C C2     . DG  B 1 2  ? 25.433  6.776   0.190   1.00 6.22  ? 2  DG  D C2     4  
ATOM 9803  N N2     . DG  B 1 2  ? 25.536  7.309   1.417   1.00 6.33  ? 2  DG  D N2     4  
ATOM 9804  N N3     . DG  B 1 2  ? 25.493  5.464   0.036   1.00 5.87  ? 2  DG  D N3     4  
ATOM 9805  C C4     . DG  B 1 2  ? 25.379  5.100   -1.259  1.00 5.84  ? 2  DG  D C4     4  
ATOM 9806  H "H5'"  . DG  B 1 2  ? 28.587  1.474   -2.256  1.00 5.28  ? 2  DG  D "H5'"  4  
ATOM 9807  H "H5''" . DG  B 1 2  ? 28.313  -0.277  -2.197  1.00 4.84  ? 2  DG  D "H5''" 4  
ATOM 9808  H "H4'"  . DG  B 1 2  ? 27.595  0.362   -0.121  1.00 4.72  ? 2  DG  D "H4'"  4  
ATOM 9809  H "H3'"  . DG  B 1 2  ? 25.628  -0.641  -1.588  1.00 4.44  ? 2  DG  D "H3'"  4  
ATOM 9810  H "H2'"  . DG  B 1 2  ? 24.835  1.367   -2.622  1.00 4.96  ? 2  DG  D "H2'"  4  
ATOM 9811  H "H2''" . DG  B 1 2  ? 23.752  1.261   -1.242  1.00 4.72  ? 2  DG  D "H2''" 4  
ATOM 9812  H "H1'"  . DG  B 1 2  ? 24.998  2.817   0.041   1.00 5.14  ? 2  DG  D "H1'"  4  
ATOM 9813  H H8     . DG  B 1 2  ? 25.242  3.048   -3.759  1.00 5.54  ? 2  DG  D H8     4  
ATOM 9814  H H1     . DG  B 1 2  ? 25.229  8.648   -0.619  1.00 6.76  ? 2  DG  D H1     4  
ATOM 9815  H H21    . DG  B 1 2  ? 25.485  8.309   1.557   1.00 6.61  ? 2  DG  D H21    4  
ATOM 9816  H H22    . DG  B 1 2  ? 25.663  6.702   2.214   1.00 6.15  ? 2  DG  D H22    4  
ATOM 9817  P P      . DA  B 1 3  ? 23.777  -0.668  0.661   1.00 4.12  ? 3  DA  D P      4  
ATOM 9818  O OP1    . DA  B 1 3  ? 23.926  -1.966  1.372   1.00 3.78  ? 3  DA  D OP1    4  
ATOM 9819  O OP2    . DA  B 1 3  ? 22.954  -0.604  -0.574  1.00 4.16  ? 3  DA  D OP2    4  
ATOM 9820  O "O5'"  . DA  B 1 3  ? 23.235  0.420   1.689   1.00 4.32  ? 3  DA  D "O5'"  4  
ATOM 9821  C "C5'"  . DA  B 1 3  ? 24.036  0.733   2.824   1.00 4.41  ? 3  DA  D "C5'"  4  
ATOM 9822  C "C4'"  . DA  B 1 3  ? 23.325  1.657   3.783   1.00 4.62  ? 3  DA  D "C4'"  4  
ATOM 9823  O "O4'"  . DA  B 1 3  ? 23.375  3.015   3.262   1.00 4.98  ? 3  DA  D "O4'"  4  
ATOM 9824  C "C3'"  . DA  B 1 3  ? 21.839  1.369   3.958   1.00 4.48  ? 3  DA  D "C3'"  4  
ATOM 9825  O "O3'"  . DA  B 1 3  ? 21.465  1.760   5.276   1.00 4.62  ? 3  DA  D "O3'"  4  
ATOM 9826  C "C2'"  . DA  B 1 3  ? 21.203  2.173   2.836   1.00 4.65  ? 3  DA  D "C2'"  4  
ATOM 9827  C "C1'"  . DA  B 1 3  ? 22.092  3.405   2.773   1.00 5.03  ? 3  DA  D "C1'"  4  
ATOM 9828  N N9     . DA  B 1 3  ? 22.220  3.996   1.436   1.00 5.21  ? 3  DA  D N9     4  
ATOM 9829  C C8     . DA  B 1 3  ? 22.441  3.364   0.238   1.00 5.09  ? 3  DA  D C8     4  
ATOM 9830  N N7     . DA  B 1 3  ? 22.382  4.165   -0.801  1.00 5.35  ? 3  DA  D N7     4  
ATOM 9831  C C5     . DA  B 1 3  ? 22.132  5.414   -0.248  1.00 5.64  ? 3  DA  D C5     4  
ATOM 9832  C C6     . DA  B 1 3  ? 21.946  6.690   -0.824  1.00 6.00  ? 3  DA  D C6     4  
ATOM 9833  N N6     . DA  B 1 3  ? 21.943  6.922   -2.142  1.00 6.14  ? 3  DA  D N6     4  
ATOM 9834  N N1     . DA  B 1 3  ? 21.737  7.732   0.010   1.00 6.24  ? 3  DA  D N1     4  
ATOM 9835  C C2     . DA  B 1 3  ? 21.701  7.499   1.329   1.00 6.14  ? 3  DA  D C2     4  
ATOM 9836  N N3     . DA  B 1 3  ? 21.838  6.344   1.987   1.00 5.82  ? 3  DA  D N3     4  
ATOM 9837  C C4     . DA  B 1 3  ? 22.057  5.330   1.131   1.00 5.57  ? 3  DA  D C4     4  
ATOM 9838  H "H5'"  . DA  B 1 3  ? 24.959  1.211   2.491   1.00 4.60  ? 3  DA  D "H5'"  4  
ATOM 9839  H "H5''" . DA  B 1 3  ? 24.289  -0.185  3.351   1.00 4.18  ? 3  DA  D "H5''" 4  
ATOM 9840  H "H4'"  . DA  B 1 3  ? 23.790  1.551   4.764   1.00 4.63  ? 3  DA  D "H4'"  4  
ATOM 9841  H "H3'"  . DA  B 1 3  ? 21.637  0.304   3.839   1.00 4.20  ? 3  DA  D "H3'"  4  
ATOM 9842  H "H2'"  . DA  B 1 3  ? 21.200  1.617   1.900   1.00 4.51  ? 3  DA  D "H2'"  4  
ATOM 9843  H "H2''" . DA  B 1 3  ? 20.173  2.437   3.068   1.00 4.69  ? 3  DA  D "H2''" 4  
ATOM 9844  H "H1'"  . DA  B 1 3  ? 21.713  4.176   3.446   1.00 5.23  ? 3  DA  D "H1'"  4  
ATOM 9845  H H8     . DA  B 1 3  ? 22.648  2.307   0.158   1.00 4.83  ? 3  DA  D H8     4  
ATOM 9846  H H61    . DA  B 1 3  ? 21.765  7.855   -2.490  1.00 6.41  ? 3  DA  D H61    4  
ATOM 9847  H H62    . DA  B 1 3  ? 22.080  6.165   -2.794  1.00 6.00  ? 3  DA  D H62    4  
ATOM 9848  H H2     . DA  B 1 3  ? 21.536  8.378   1.953   1.00 6.37  ? 3  DA  D H2     4  
ATOM 9849  P P      . DT  B 1 4  ? 19.927  1.728   5.728   1.00 4.60  ? 4  DT  D P      4  
ATOM 9850  O OP1    . DT  B 1 4  ? 19.810  0.935   6.980   1.00 4.51  ? 4  DT  D OP1    4  
ATOM 9851  O OP2    . DT  B 1 4  ? 19.092  1.366   4.559   1.00 4.43  ? 4  DT  D OP2    4  
ATOM 9852  O "O5'"  . DT  B 1 4  ? 19.721  3.270   6.057   1.00 5.01  ? 4  DT  D "O5'"  4  
ATOM 9853  C "C5'"  . DT  B 1 4  ? 20.837  4.015   6.560   1.00 5.28  ? 4  DT  D "C5'"  4  
ATOM 9854  C "C4'"  . DT  B 1 4  ? 20.452  5.443   6.858   1.00 5.67  ? 4  DT  D "C4'"  4  
ATOM 9855  O "O4'"  . DT  B 1 4  ? 20.351  6.170   5.608   1.00 5.79  ? 4  DT  D "O4'"  4  
ATOM 9856  C "C3'"  . DT  B 1 4  ? 19.077  5.560   7.500   1.00 5.71  ? 4  DT  D "C3'"  4  
ATOM 9857  O "O3'"  . DT  B 1 4  ? 18.994  6.753   8.275   1.00 6.10  ? 4  DT  D "O3'"  4  
ATOM 9858  C "C2'"  . DT  B 1 4  ? 18.149  5.623   6.303   1.00 5.60  ? 4  DT  D "C2'"  4  
ATOM 9859  C "C1'"  . DT  B 1 4  ? 18.983  6.417   5.302   1.00 5.78  ? 4  DT  D "C1'"  4  
ATOM 9860  N N1     . DT  B 1 4  ? 18.747  6.108   3.872   1.00 5.61  ? 4  DT  D N1     4  
ATOM 9861  C C2     . DT  B 1 4  ? 18.572  7.177   3.014   1.00 5.88  ? 4  DT  D C2     4  
ATOM 9862  O O2     . DT  B 1 4  ? 18.637  8.341   3.374   1.00 6.22  ? 4  DT  D O2     4  
ATOM 9863  N N3     . DT  B 1 4  ? 18.316  6.834   1.714   1.00 5.75  ? 4  DT  D N3     4  
ATOM 9864  C C4     . DT  B 1 4  ? 18.231  5.562   1.191   1.00 5.39  ? 4  DT  D C4     4  
ATOM 9865  O O4     . DT  B 1 4  ? 17.989  5.409   -0.006  1.00 5.35  ? 4  DT  D O4     4  
ATOM 9866  C C5     . DT  B 1 4  ? 18.437  4.487   2.139   1.00 5.11  ? 4  DT  D C5     4  
ATOM 9867  C C7     . DT  B 1 4  ? 18.331  3.073   1.659   1.00 4.72  ? 4  DT  D C7     4  
ATOM 9868  C C6     . DT  B 1 4  ? 18.687  4.805   3.420   1.00 5.23  ? 4  DT  D C6     4  
ATOM 9869  H "H5'"  . DT  B 1 4  ? 21.640  4.009   5.824   1.00 5.26  ? 4  DT  D "H5'"  4  
ATOM 9870  H "H5''" . DT  B 1 4  ? 21.197  3.549   7.478   1.00 5.24  ? 4  DT  D "H5''" 4  
ATOM 9871  H "H4'"  . DT  B 1 4  ? 21.181  5.859   7.557   1.00 5.86  ? 4  DT  D "H4'"  4  
ATOM 9872  H "H3'"  . DT  B 1 4  ? 18.866  4.701   8.137   1.00 5.55  ? 4  DT  D "H3'"  4  
ATOM 9873  H "H2'"  . DT  B 1 4  ? 17.905  4.625   5.938   1.00 5.30  ? 4  DT  D "H2'"  4  
ATOM 9874  H "H2''" . DT  B 1 4  ? 17.213  6.115   6.555   1.00 5.72  ? 4  DT  D "H2''" 4  
ATOM 9875  H "H1'"  . DT  B 1 4  ? 18.813  7.488   5.442   1.00 6.07  ? 4  DT  D "H1'"  4  
ATOM 9876  H H3     . DT  B 1 4  ? 18.151  7.603   1.075   1.00 5.96  ? 4  DT  D H3     4  
ATOM 9877  H H71    . DT  B 1 4  ? 18.128  2.416   2.504   1.00 4.61  ? 4  DT  D H71    4  
ATOM 9878  H H72    . DT  B 1 4  ? 19.267  2.780   1.186   1.00 4.84  ? 4  DT  D H72    4  
ATOM 9879  H H73    . DT  B 1 4  ? 17.520  2.993   0.935   1.00 4.66  ? 4  DT  D H73    4  
ATOM 9880  H H6     . DT  B 1 4  ? 18.852  3.997   4.132   1.00 5.05  ? 4  DT  D H6     4  
ATOM 9881  P P      . DA  B 1 5  ? 17.633  7.103   9.049   1.00 6.25  ? 5  DA  D P      4  
ATOM 9882  O OP1    . DA  B 1 5  ? 17.991  7.562   10.416  1.00 6.53  ? 5  DA  D OP1    4  
ATOM 9883  O OP2    . DA  B 1 5  ? 16.673  5.985   8.876   1.00 5.93  ? 5  DA  D OP2    4  
ATOM 9884  O "O5'"  . DA  B 1 5  ? 17.096  8.357   8.230   1.00 6.49  ? 5  DA  D "O5'"  4  
ATOM 9885  C "C5'"  . DA  B 1 5  ? 17.912  9.517   8.088   1.00 6.83  ? 5  DA  D "C5'"  4  
ATOM 9886  C "C4'"  . DA  B 1 5  ? 17.092  10.688  7.603   1.00 7.10  ? 5  DA  D "C4'"  4  
ATOM 9887  O "O4'"  . DA  B 1 5  ? 16.881  10.554  6.176   1.00 6.94  ? 5  DA  D "O4'"  4  
ATOM 9888  C "C3'"  . DA  B 1 5  ? 15.692  10.734  8.206   1.00 7.11  ? 5  DA  D "C3'"  4  
ATOM 9889  O "O3'"  . DA  B 1 5  ? 15.205  12.073  8.208   1.00 7.47  ? 5  DA  D "O3'"  4  
ATOM 9890  C "C2'"  . DA  B 1 5  ? 14.890  9.860   7.261   1.00 6.76  ? 5  DA  D "C2'"  4  
ATOM 9891  C "C1'"  . DA  B 1 5  ? 15.532  10.174  5.914   1.00 6.76  ? 5  DA  D "C1'"  4  
ATOM 9892  N N9     . DA  B 1 5  ? 15.530  9.074   4.947   1.00 6.39  ? 5  DA  D N9     4  
ATOM 9893  C C8     . DA  B 1 5  ? 15.769  7.745   5.181   1.00 6.03  ? 5  DA  D C8     4  
ATOM 9894  N N7     . DA  B 1 5  ? 15.663  6.991   4.111   1.00 5.75  ? 5  DA  D N7     4  
ATOM 9895  C C5     . DA  B 1 5  ? 15.334  7.886   3.103   1.00 5.96  ? 5  DA  D C5     4  
ATOM 9896  C C6     . DA  B 1 5  ? 15.075  7.714   1.728   1.00 5.87  ? 5  DA  D C6     4  
ATOM 9897  N N6     . DA  B 1 5  ? 15.106  6.529   1.111   1.00 5.52  ? 5  DA  D N6     4  
ATOM 9898  N N1     . DA  B 1 5  ? 14.778  8.812   1.000   1.00 6.17  ? 5  DA  D N1     4  
ATOM 9899  C C2     . DA  B 1 5  ? 14.737  9.999   1.622   1.00 6.52  ? 5  DA  D C2     4  
ATOM 9900  N N3     . DA  B 1 5  ? 14.955  10.287  2.906   1.00 6.64  ? 5  DA  D N3     4  
ATOM 9901  C C4     . DA  B 1 5  ? 15.252  9.174   3.602   1.00 6.35  ? 5  DA  D C4     4  
ATOM 9902  H "H5'"  . DA  B 1 5  ? 18.705  9.317   7.368   1.00 6.75  ? 5  DA  D "H5'"  4  
ATOM 9903  H "H5''" . DA  B 1 5  ? 18.360  9.771   9.049   1.00 7.01  ? 5  DA  D "H5''" 4  
ATOM 9904  H "H4'"  . DA  B 1 5  ? 17.602  11.609  7.889   1.00 7.40  ? 5  DA  D "H4'"  4  
ATOM 9905  H "H3'"  . DA  B 1 5  ? 15.689  10.348  9.225   1.00 7.11  ? 5  DA  D "H3'"  4  
ATOM 9906  H "H2'"  . DA  B 1 5  ? 14.978  8.807   7.526   1.00 6.49  ? 5  DA  D "H2'"  4  
ATOM 9907  H "H2''" . DA  B 1 5  ? 13.832  10.115  7.290   1.00 6.80  ? 5  DA  D "H2''" 4  
ATOM 9908  H "H1'"  . DA  B 1 5  ? 15.039  11.031  5.452   1.00 6.96  ? 5  DA  D "H1'"  4  
ATOM 9909  H H8     . DA  B 1 5  ? 16.013  7.355   6.155   1.00 5.99  ? 5  DA  D H8     4  
ATOM 9910  H H61    . DA  B 1 5  ? 14.908  6.467   0.123   1.00 5.50  ? 5  DA  D H61    4  
ATOM 9911  H H62    . DA  B 1 5  ? 15.323  5.696   1.640   1.00 5.30  ? 5  DA  D H62    4  
ATOM 9912  H H2     . DA  B 1 5  ? 14.488  10.851  0.986   1.00 6.75  ? 5  DA  D H2     4  
ATOM 9913  P P      . DA  B 1 6  ? 13.726  12.381  8.747   1.00 7.56  ? 6  DA  D P      4  
ATOM 9914  O OP1    . DA  B 1 6  ? 13.816  13.546  9.663   1.00 7.97  ? 6  DA  D OP1    4  
ATOM 9915  O OP2    . DA  B 1 6  ? 13.097  11.120  9.220   1.00 7.26  ? 6  DA  D OP2    4  
ATOM 9916  O "O5'"  . DA  B 1 6  ? 12.994  12.849  7.414   1.00 7.53  ? 6  DA  D "O5'"  4  
ATOM 9917  C "C5'"  . DA  B 1 6  ? 13.590  13.862  6.609   1.00 7.75  ? 6  DA  D "C5'"  4  
ATOM 9918  C "C4'"  . DA  B 1 6  ? 12.641  14.317  5.528   1.00 7.77  ? 6  DA  D "C4'"  4  
ATOM 9919  O "O4'"  . DA  B 1 6  ? 12.657  13.350  4.447   1.00 7.43  ? 6  DA  D "O4'"  4  
ATOM 9920  C "C3'"  . DA  B 1 6  ? 11.189  14.364  5.989   1.00 7.77  ? 6  DA  D "C3'"  4  
ATOM 9921  O "O3'"  . DA  B 1 6  ? 10.469  15.309  5.208   1.00 7.95  ? 6  DA  D "O3'"  4  
ATOM 9922  C "C2'"  . DA  B 1 6  ? 10.702  12.951  5.729   1.00 7.34  ? 6  DA  D "C2'"  4  
ATOM 9923  C "C1'"  . DA  B 1 6  ? 11.450  12.594  4.452   1.00 7.17  ? 6  DA  D "C1'"  4  
ATOM 9924  N N9     . DA  B 1 6  ? 11.763  11.173  4.285   1.00 6.78  ? 6  DA  D N9     4  
ATOM 9925  C C8     . DA  B 1 6  ? 12.210  10.273  5.216   1.00 6.60  ? 6  DA  D C8     4  
ATOM 9926  N N7     . DA  B 1 6  ? 12.335  9.050   4.753   1.00 6.23  ? 6  DA  D N7     4  
ATOM 9927  C C5     . DA  B 1 6  ? 11.950  9.156   3.423   1.00 6.16  ? 6  DA  D C5     4  
ATOM 9928  C C6     . DA  B 1 6  ? 11.853  8.208   2.382   1.00 5.84  ? 6  DA  D C6     4  
ATOM 9929  N N6     . DA  B 1 6  ? 12.131  6.910   2.533   1.00 5.50  ? 6  DA  D N6     4  
ATOM 9930  N N1     . DA  B 1 6  ? 11.443  8.645   1.168   1.00 5.91  ? 6  DA  D N1     4  
ATOM 9931  C C2     . DA  B 1 6  ? 11.149  9.946   1.025   1.00 6.26  ? 6  DA  D C2     4  
ATOM 9932  N N3     . DA  B 1 6  ? 11.196  10.926  1.926   1.00 6.57  ? 6  DA  D N3     4  
ATOM 9933  C C4     . DA  B 1 6  ? 11.609  10.461  3.118   1.00 6.50  ? 6  DA  D C4     4  
ATOM 9934  H "H5'"  . DA  B 1 6  ? 14.495  13.471  6.145   1.00 7.64  ? 6  DA  D "H5'"  4  
ATOM 9935  H "H5''" . DA  B 1 6  ? 13.852  14.716  7.233   1.00 8.05  ? 6  DA  D "H5''" 4  
ATOM 9936  H "H4'"  . DA  B 1 6  ? 12.923  15.328  5.225   1.00 8.04  ? 6  DA  D "H4'"  4  
ATOM 9937  H "H3'"  . DA  B 1 6  ? 11.117  14.634  7.042   1.00 7.93  ? 6  DA  D "H3'"  4  
ATOM 9938  H "H2'"  . DA  B 1 6  ? 10.955  12.286  6.556   1.00 7.24  ? 6  DA  D "H2'"  4  
ATOM 9939  H "H2''" . DA  B 1 6  ? 9.621   12.917  5.599   1.00 7.29  ? 6  DA  D "H2''" 4  
ATOM 9940  H "H1'"  . DA  B 1 6  ? 10.872  12.912  3.582   1.00 7.19  ? 6  DA  D "H1'"  4  
ATOM 9941  H H8     . DA  B 1 6  ? 12.432  10.543  6.236   1.00 6.77  ? 6  DA  D H8     4  
ATOM 9942  H H61    . DA  B 1 6  ? 12.030  6.275   1.753   1.00 5.29  ? 6  DA  D H61    4  
ATOM 9943  H H62    . DA  B 1 6  ? 12.431  6.569   3.435   1.00 5.46  ? 6  DA  D H62    4  
ATOM 9944  H H2     . DA  B 1 6  ? 10.827  10.244  0.027   1.00 6.31  ? 6  DA  D H2     4  
ATOM 9945  P P      . DG  B 1 7  ? 8.884   15.452  5.393   1.00 7.95  ? 7  DG  D P      4  
ATOM 9946  O OP1    . DG  B 1 7  ? 8.559   16.903  5.393   1.00 8.35  ? 7  DG  D OP1    4  
ATOM 9947  O OP2    . DG  B 1 7  ? 8.420   14.596  6.515   1.00 7.79  ? 7  DG  D OP2    4  
ATOM 9948  O "O5'"  . DG  B 1 7  ? 8.373   14.832  4.022   1.00 7.66  ? 7  DG  D "O5'"  4  
ATOM 9949  C "C5'"  . DG  B 1 7  ? 9.003   15.230  2.807   1.00 7.74  ? 7  DG  D "C5'"  4  
ATOM 9950  C "C4'"  . DG  B 1 7  ? 8.157   14.867  1.613   1.00 7.55  ? 7  DG  D "C4'"  4  
ATOM 9951  O "O4'"  . DG  B 1 7  ? 8.377   13.474  1.280   1.00 7.14  ? 7  DG  D "O4'"  4  
ATOM 9952  C "C3'"  . DG  B 1 7  ? 6.665   14.974  1.906   1.00 7.53  ? 7  DG  D "C3'"  4  
ATOM 9953  O "O3'"  . DG  B 1 7  ? 5.961   15.222  0.696   1.00 7.52  ? 7  DG  D "O3'"  4  
ATOM 9954  C "C2'"  . DG  B 1 7  ? 6.333   13.607  2.477   1.00 7.15  ? 7  DG  D "C2'"  4  
ATOM 9955  C "C1'"  . DG  B 1 7  ? 7.244   12.701  1.656   1.00 6.89  ? 7  DG  D "C1'"  4  
ATOM 9956  N N9     . DG  B 1 7  ? 7.688   11.468  2.302   1.00 6.59  ? 7  DG  D N9     4  
ATOM 9957  C C8     . DG  B 1 7  ? 8.099   11.286  3.599   1.00 6.62  ? 7  DG  D C8     4  
ATOM 9958  N N7     . DG  B 1 7  ? 8.367   10.037  3.885   1.00 6.30  ? 7  DG  D N7     4  
ATOM 9959  C C5     . DG  B 1 7  ? 8.131   9.355   2.696   1.00 6.03  ? 7  DG  D C5     4  
ATOM 9960  C C6     . DG  B 1 7  ? 8.244   7.963   2.381   1.00 5.63  ? 7  DG  D C6     4  
ATOM 9961  O O6     . DG  B 1 7  ? 8.575   7.020   3.118   1.00 5.43  ? 7  DG  D O6     4  
ATOM 9962  N N1     . DG  B 1 7  ? 7.914   7.711   1.053   1.00 5.49  ? 7  DG  D N1     4  
ATOM 9963  C C2     . DG  B 1 7  ? 7.526   8.664   0.142   1.00 5.71  ? 7  DG  D C2     4  
ATOM 9964  N N2     . DG  B 1 7  ? 7.264   8.226   -1.099  1.00 5.56  ? 7  DG  D N2     4  
ATOM 9965  N N3     . DG  B 1 7  ? 7.411   9.953   0.420   1.00 6.08  ? 7  DG  D N3     4  
ATOM 9966  C C4     . DG  B 1 7  ? 7.727   10.225  1.707   1.00 6.21  ? 7  DG  D C4     4  
ATOM 9967  H "H5'"  . DG  B 1 7  ? 9.969   14.733  2.720   1.00 7.63  ? 7  DG  D "H5'"  4  
ATOM 9968  H "H5''" . DG  B 1 7  ? 9.160   16.309  2.815   1.00 8.06  ? 7  DG  D "H5''" 4  
ATOM 9969  H "H4'"  . DG  B 1 7  ? 8.384   15.562  0.802   1.00 7.73  ? 7  DG  D "H4'"  4  
ATOM 9970  H "H3'"  . DG  B 1 7  ? 6.458   15.775  2.616   1.00 7.78  ? 7  DG  D "H3'"  4  
ATOM 9971  H "H2'"  . DG  B 1 7  ? 6.556   13.557  3.543   1.00 7.21  ? 7  DG  D "H2'"  4  
ATOM 9972  H "H2''" . DG  B 1 7  ? 5.279   13.365  2.351   1.00 7.04  ? 7  DG  D "H2''" 4  
ATOM 9973  H "H1'"  . DG  B 1 7  ? 6.738   12.422  0.728   1.00 6.75  ? 7  DG  D "H1'"  4  
ATOM 9974  H H8     . DG  B 1 7  ? 8.192   12.091  4.311   1.00 6.90  ? 7  DG  D H8     4  
ATOM 9975  H H1     . DG  B 1 7  ? 7.959   6.751   0.735   1.00 5.22  ? 7  DG  D H1     4  
ATOM 9976  H H21    . DG  B 1 7  ? 7.346   7.246   -1.334  1.00 5.29  ? 7  DG  D H21    4  
ATOM 9977  H H22    . DG  B 1 7  ? 6.979   8.885   -1.810  1.00 5.73  ? 7  DG  D H22    4  
ATOM 9978  P P      . DA  B 1 8  ? 4.361   15.280  0.700   1.00 7.47  ? 8  DA  D P      4  
ATOM 9979  O OP1    . DA  B 1 8  ? 3.954   16.496  -0.051  1.00 7.77  ? 8  DA  D OP1    4  
ATOM 9980  O OP2    . DA  B 1 8  ? 3.850   15.063  2.078   1.00 7.45  ? 8  DA  D OP2    4  
ATOM 9981  O "O5'"  . DA  B 1 8  ? 4.009   14.009  -0.186  1.00 7.06  ? 8  DA  D "O5'"  4  
ATOM 9982  C "C5'"  . DA  B 1 8  ? 4.662   13.840  -1.440  1.00 7.01  ? 8  DA  D "C5'"  4  
ATOM 9983  C "C4'"  . DA  B 1 8  ? 3.953   12.808  -2.282  1.00 6.67  ? 8  DA  D "C4'"  4  
ATOM 9984  O "O4'"  . DA  B 1 8  ? 4.362   11.486  -1.847  1.00 6.32  ? 8  DA  D "O4'"  4  
ATOM 9985  C "C3'"  . DA  B 1 8  ? 2.441   12.836  -2.096  1.00 6.62  ? 8  DA  D "C3'"  4  
ATOM 9986  O "O3'"  . DA  B 1 8  ? 1.809   12.341  -3.268  1.00 6.44  ? 8  DA  D "O3'"  4  
ATOM 9987  C "C2'"  . DA  B 1 8  ? 2.230   11.919  -0.904  1.00 6.37  ? 8  DA  D "C2'"  4  
ATOM 9988  C "C1'"  . DA  B 1 8  ? 3.302   10.863  -1.128  1.00 6.11  ? 8  DA  D "C1'"  4  
ATOM 9989  N N9     . DA  B 1 8  ? 3.841   10.235  0.081   1.00 5.99  ? 8  DA  D N9     4  
ATOM 9990  C C8     . DA  B 1 8  ? 4.243   10.810  1.263   1.00 6.22  ? 8  DA  D C8     4  
ATOM 9991  N N7     . DA  B 1 8  ? 4.620   9.940   2.172   1.00 6.04  ? 8  DA  D N7     4  
ATOM 9992  C C5     . DA  B 1 8  ? 4.468   8.710   1.543   1.00 5.66  ? 8  DA  D C5     4  
ATOM 9993  C C6     . DA  B 1 8  ? 4.697   7.386   1.974   1.00 5.33  ? 8  DA  D C6     4  
ATOM 9994  N N6     . DA  B 1 8  ? 5.127   7.065   3.197   1.00 5.34  ? 8  DA  D N6     4  
ATOM 9995  N N1     . DA  B 1 8  ? 4.455   6.386   1.094   1.00 4.99  ? 8  DA  D N1     4  
ATOM 9996  C C2     . DA  B 1 8  ? 4.008   6.707   -0.128  1.00 5.01  ? 8  DA  D C2     4  
ATOM 9997  N N3     . DA  B 1 8  ? 3.749   7.909   -0.644  1.00 5.31  ? 8  DA  D N3     4  
ATOM 9998  C C4     . DA  B 1 8  ? 4.004   8.878   0.252   1.00 5.62  ? 8  DA  D C4     4  
ATOM 9999  H "H5'"  . DA  B 1 8  ? 5.691   13.518  -1.275  1.00 6.96  ? 8  DA  D "H5'"  4  
ATOM 10000 H "H5''" . DA  B 1 8  ? 4.671   14.788  -1.977  1.00 7.28  ? 8  DA  D "H5''" 4  
ATOM 10001 H "H4'"  . DA  B 1 8  ? 4.160   13.015  -3.333  1.00 6.75  ? 8  DA  D "H4'"  4  
ATOM 10002 H "H3'"  . DA  B 1 8  ? 2.089   13.848  -1.897  1.00 6.90  ? 8  DA  D "H3'"  4  
ATOM 10003 H "H2'"  . DA  B 1 8  ? 2.365   12.452  0.037   1.00 6.56  ? 8  DA  D "H2'"  4  
ATOM 10004 H "H2''" . DA  B 1 8  ? 1.227   11.494  -0.899  1.00 6.22  ? 8  DA  D "H2''" 4  
ATOM 10005 H "H1'"  . DA  B 1 8  ? 2.912   10.068  -1.768  1.00 5.86  ? 8  DA  D "H1'"  4  
ATOM 10006 H H8     . DA  B 1 8  ? 4.247   11.877  1.428   1.00 6.53  ? 8  DA  D H8     4  
ATOM 10007 H H61    . DA  B 1 8  ? 5.259   6.097   3.456   1.00 5.11  ? 8  DA  D H61    4  
ATOM 10008 H H62    . DA  B 1 8  ? 5.306   7.796   3.871   1.00 5.60  ? 8  DA  D H62    4  
ATOM 10009 H H2     . DA  B 1 8  ? 3.833   5.863   -0.798  1.00 4.75  ? 8  DA  D H2     4  
ATOM 10010 P P      . DT  B 1 9  ? 0.217   12.154  -3.302  1.00 6.32  ? 9  DT  D P      4  
ATOM 10011 O OP1    . DT  B 1 9  ? -0.287  12.769  -4.556  1.00 6.48  ? 9  DT  D OP1    4  
ATOM 10012 O OP2    . DT  B 1 9  ? -0.367  12.560  -1.997  1.00 6.44  ? 9  DT  D OP2    4  
ATOM 10013 O "O5'"  . DT  B 1 9  ? 0.114   10.575  -3.440  1.00 5.87  ? 9  DT  D "O5'"  4  
ATOM 10014 C "C5'"  . DT  B 1 9  ? 1.011   9.901   -4.319  1.00 5.72  ? 9  DT  D "C5'"  4  
ATOM 10015 C "C4'"  . DT  B 1 9  ? 0.574   8.476   -4.543  1.00 5.31  ? 9  DT  D "C4'"  4  
ATOM 10016 O "O4'"  . DT  B 1 9  ? 0.995   7.674   -3.413  1.00 5.09  ? 9  DT  D "O4'"  4  
ATOM 10017 C "C3'"  . DT  B 1 9  ? -0.941  8.322   -4.599  1.00 5.19  ? 9  DT  D "C3'"  4  
ATOM 10018 O "O3'"  . DT  B 1 9  ? -1.266  7.187   -5.397  1.00 4.88  ? 9  DT  D "O3'"  4  
ATOM 10019 C "C2'"  . DT  B 1 9  ? -1.313  8.143   -3.138  1.00 5.13  ? 9  DT  D "C2'"  4  
ATOM 10020 C "C1'"  . DT  B 1 9  ? -0.127  7.342   -2.606  1.00 4.96  ? 9  DT  D "C1'"  4  
ATOM 10021 N N1     . DT  B 1 9  ? 0.228   7.559   -1.183  1.00 5.08  ? 9  DT  D N1     4  
ATOM 10022 C C2     . DT  B 1 9  ? 0.556   6.438   -0.449  1.00 4.82  ? 9  DT  D C2     4  
ATOM 10023 O O2     . DT  B 1 9  ? 0.589   5.316   -0.926  1.00 4.49  ? 9  DT  D O2     4  
ATOM 10024 N N3     . DT  B 1 9  ? 0.843   6.675   0.869   1.00 4.97  ? 9  DT  D N3     4  
ATOM 10025 C C4     . DT  B 1 9  ? 0.841   7.892   1.515   1.00 5.34  ? 9  DT  D C4     4  
ATOM 10026 O O4     . DT  B 1 9  ? 1.092   7.940   2.719   1.00 5.47  ? 9  DT  D O4     4  
ATOM 10027 C C5     . DT  B 1 9  ? 0.504   9.031   0.687   1.00 5.58  ? 9  DT  D C5     4  
ATOM 10028 C C7     . DT  B 1 9  ? 0.455   10.389  1.314   1.00 6.00  ? 9  DT  D C7     4  
ATOM 10029 C C6     . DT  B 1 9  ? 0.221   8.816   -0.610  1.00 5.44  ? 9  DT  D C6     4  
ATOM 10030 H "H5'"  . DT  B 1 9  ? 2.013   9.902   -3.891  1.00 5.76  ? 9  DT  D "H5'"  4  
ATOM 10031 H "H5''" . DT  B 1 9  ? 1.036   10.417  -5.280  1.00 5.89  ? 9  DT  D "H5''" 4  
ATOM 10032 H "H4'"  . DT  B 1 9  ? 0.974   8.137   -5.500  1.00 5.26  ? 9  DT  D "H4'"  4  
ATOM 10033 H "H3'"  . DT  B 1 9  ? -1.407  9.207   -5.030  1.00 5.42  ? 9  DT  D "H3'"  4  
ATOM 10034 H "H2'"  . DT  B 1 9  ? -1.417  9.106   -2.638  1.00 5.40  ? 9  DT  D "H2'"  4  
ATOM 10035 H "H2''" . DT  B 1 9  ? -2.260  7.618   -3.031  1.00 4.95  ? 9  DT  D "H2''" 4  
ATOM 10036 H "H1'"  . DT  B 1 9  ? -0.310  6.272   -2.743  1.00 4.66  ? 9  DT  D "H1'"  4  
ATOM 10037 H H3     . DT  B 1 9  ? 1.075   5.866   1.426   1.00 4.81  ? 9  DT  D H3     4  
ATOM 10038 H H71    . DT  B 1 9  ? 1.467   10.775  1.427   1.00 6.19  ? 9  DT  D H71    4  
ATOM 10039 H H72    . DT  B 1 9  ? -0.019  10.320  2.294   1.00 6.06  ? 9  DT  D H72    4  
ATOM 10040 H H73    . DT  B 1 9  ? -0.123  11.063  0.681   1.00 6.21  ? 9  DT  D H73    4  
ATOM 10041 H H6     . DT  B 1 9  ? -0.021  9.672   -1.239  1.00 5.65  ? 9  DT  D H6     4  
ATOM 10042 P P      . DA  B 1 10 ? -2.798  6.770   -5.612  1.00 4.69  ? 10 DA  D P      4  
ATOM 10043 O OP1    . DA  B 1 10 ? -3.017  6.595   -7.071  1.00 4.69  ? 10 DA  D OP1    4  
ATOM 10044 O OP2    . DA  B 1 10 ? -3.680  7.686   -4.841  1.00 4.90  ? 10 DA  D OP2    4  
ATOM 10045 O "O5'"  . DA  B 1 10 ? -2.843  5.338   -4.925  1.00 4.29  ? 10 DA  D "O5'"  4  
ATOM 10046 C "C5'"  . DA  B 1 10 ? -1.883  4.353   -5.296  1.00 4.08  ? 10 DA  D "C5'"  4  
ATOM 10047 C "C4'"  . DA  B 1 10 ? -2.205  3.029   -4.647  1.00 3.70  ? 10 DA  D "C4'"  4  
ATOM 10048 O "O4'"  . DA  B 1 10 ? -1.806  3.086   -3.254  1.00 3.74  ? 10 DA  D "O4'"  4  
ATOM 10049 C "C3'"  . DA  B 1 10 ? -3.696  2.715   -4.617  1.00 3.55  ? 10 DA  D "C3'"  4  
ATOM 10050 O "O3'"  . DA  B 1 10 ? -3.901  1.306   -4.575  1.00 3.19  ? 10 DA  D "O3'"  4  
ATOM 10051 C "C2'"  . DA  B 1 10 ? -4.154  3.385   -3.335  1.00 3.73  ? 10 DA  D "C2'"  4  
ATOM 10052 C "C1'"  . DA  B 1 10 ? -2.956  3.183   -2.419  1.00 3.75  ? 10 DA  D "C1'"  4  
ATOM 10053 N N9     . DA  B 1 10 ? -2.748  4.254   -1.443  1.00 4.09  ? 10 DA  D N9     4  
ATOM 10054 C C8     . DA  B 1 10 ? -2.861  5.607   -1.632  1.00 4.43  ? 10 DA  D C8     4  
ATOM 10055 N N7     . DA  B 1 10 ? -2.657  6.314   -0.546  1.00 4.69  ? 10 DA  D N7     4  
ATOM 10056 C C5     . DA  B 1 10 ? -2.386  5.360   0.425   1.00 4.53  ? 10 DA  D C5     4  
ATOM 10057 C C6     . DA  B 1 10 ? -2.089  5.462   1.801   1.00 4.70  ? 10 DA  D C6     4  
ATOM 10058 N N6     . DA  B 1 10 ? -2.028  6.619   2.465   1.00 5.07  ? 10 DA  D N6     4  
ATOM 10059 N N1     . DA  B 1 10 ? -1.864  4.317   2.480   1.00 4.50  ? 10 DA  D N1     4  
ATOM 10060 C C2     . DA  B 1 10 ? -1.939  3.154   1.818   1.00 4.14  ? 10 DA  D C2     4  
ATOM 10061 N N3     . DA  B 1 10 ? -2.214  2.930   0.535   1.00 3.93  ? 10 DA  D N3     4  
ATOM 10062 C C4     . DA  B 1 10 ? -2.428  4.087   -0.115  1.00 4.15  ? 10 DA  D C4     4  
ATOM 10063 H "H5'"  . DA  B 1 10 ? -0.891  4.673   -4.978  1.00 4.21  ? 10 DA  D "H5'"  4  
ATOM 10064 H "H5''" . DA  B 1 10 ? -1.886  4.227   -6.378  1.00 4.08  ? 10 DA  D "H5''" 4  
ATOM 10065 H "H4'"  . DA  B 1 10 ? -1.714  2.238   -5.215  1.00 3.54  ? 10 DA  D "H4'"  4  
ATOM 10066 H "H3'"  . DA  B 1 10 ? -4.200  3.126   -5.491  1.00 3.64  ? 10 DA  D "H3'"  4  
ATOM 10067 H "H2'"  . DA  B 1 10 ? -4.377  4.438   -3.496  1.00 3.99  ? 10 DA  D "H2'"  4  
ATOM 10068 H "H2''" . DA  B 1 10 ? -5.053  2.915   -2.940  1.00 3.59  ? 10 DA  D "H2''" 4  
ATOM 10069 H "H1'"  . DA  B 1 10 ? -3.046  2.239   -1.875  1.00 3.54  ? 10 DA  D "H1'"  4  
ATOM 10070 H H8     . DA  B 1 10 ? -3.100  6.048   -2.588  1.00 4.49  ? 10 DA  D H8     4  
ATOM 10071 H H61    . DA  B 1 10 ? -1.820  6.631   3.454   1.00 5.20  ? 10 DA  D H61    4  
ATOM 10072 H H62    . DA  B 1 10 ? -2.199  7.487   1.978   1.00 5.24  ? 10 DA  D H62    4  
ATOM 10073 H H2     . DA  B 1 10 ? -1.746  2.263   2.416   1.00 4.01  ? 10 DA  D H2     4  
ATOM 10074 P P      . DT  B 1 11 ? -5.388  0.724   -4.438  1.00 3.00  ? 11 DT  D P      4  
ATOM 10075 O OP1    . DT  B 1 11 ? -5.567  -0.361  -5.439  1.00 2.75  ? 11 DT  D OP1    4  
ATOM 10076 O OP2    . DT  B 1 11 ? -6.346  1.860   -4.421  1.00 3.23  ? 11 DT  D OP2    4  
ATOM 10077 O "O5'"  . DT  B 1 11 ? -5.323  0.095   -2.977  1.00 2.93  ? 11 DT  D "O5'"  4  
ATOM 10078 C "C5'"  . DT  B 1 11 ? -4.177  -0.666  -2.596  1.00 2.81  ? 11 DT  D "C5'"  4  
ATOM 10079 C "C4'"  . DT  B 1 11 ? -4.392  -1.356  -1.270  1.00 2.79  ? 11 DT  D "C4'"  4  
ATOM 10080 O "O4'"  . DT  B 1 11 ? -4.139  -0.414  -0.194  1.00 3.09  ? 11 DT  D "O4'"  4  
ATOM 10081 C "C3'"  . DT  B 1 11 ? -5.842  -1.788  -1.081  1.00 2.74  ? 11 DT  D "C3'"  4  
ATOM 10082 O "O3'"  . DT  B 1 11 ? -5.915  -2.891  -0.186  1.00 2.71  ? 11 DT  D "O3'"  4  
ATOM 10083 C "C2'"  . DT  B 1 11 ? -6.490  -0.560  -0.473  1.00 3.05  ? 11 DT  D "C2'"  4  
ATOM 10084 C "C1'"  . DT  B 1 11 ? -5.369  -0.027  0.407   1.00 3.26  ? 11 DT  D "C1'"  4  
ATOM 10085 N N1     . DT  B 1 11 ? -5.371  1.435   0.653   1.00 3.59  ? 11 DT  D N1     4  
ATOM 10086 C C2     . DT  B 1 11 ? -5.086  1.853   1.941   1.00 3.86  ? 11 DT  D C2     4  
ATOM 10087 O O2     . DT  B 1 11 ? -4.766  1.088   2.835   1.00 3.85  ? 11 DT  D O2     4  
ATOM 10088 N N3     . DT  B 1 11 ? -5.191  3.202   2.145   1.00 4.18  ? 11 DT  D N3     4  
ATOM 10089 C C4     . DT  B 1 11 ? -5.533  4.160   1.217   1.00 4.27  ? 11 DT  D C4     4  
ATOM 10090 O O4     . DT  B 1 11 ? -5.656  5.332   1.569   1.00 4.60  ? 11 DT  D O4     4  
ATOM 10091 C C5     . DT  B 1 11 ? -5.786  3.660   -0.122  1.00 3.99  ? 11 DT  D C5     4  
ATOM 10092 C C7     . DT  B 1 11 ? -6.212  4.625   -1.182  1.00 4.12  ? 11 DT  D C7     4  
ATOM 10093 C C6     . DT  B 1 11 ? -5.684  2.338   -0.341  1.00 3.66  ? 11 DT  D C6     4  
ATOM 10094 H "H5'"  . DT  B 1 11 ? -3.314  -0.006  -2.515  1.00 2.96  ? 11 DT  D "H5'"  4  
ATOM 10095 H "H5''" . DT  B 1 11 ? -3.972  -1.421  -3.357  1.00 2.62  ? 11 DT  D "H5''" 4  
ATOM 10096 H "H4'"  . DT  B 1 11 ? -3.771  -2.254  -1.238  1.00 2.64  ? 11 DT  D "H4'"  4  
ATOM 10097 H "H3'"  . DT  B 1 11 ? -6.301  -2.064  -2.031  1.00 2.59  ? 11 DT  D "H3'"  4  
ATOM 10098 H "H2'"  . DT  B 1 11 ? -6.784  0.152   -1.239  1.00 3.09  ? 11 DT  D "H2'"  4  
ATOM 10099 H "H2''" . DT  B 1 11 ? -7.384  -0.817  0.095   1.00 3.10  ? 11 DT  D "H2''" 4  
ATOM 10100 H "H1'"  . DT  B 1 11 ? -5.405  -0.521  1.382   1.00 3.32  ? 11 DT  D "H1'"  4  
ATOM 10101 H H3     . DT  B 1 11 ? -5.013  3.527   3.088   1.00 4.40  ? 11 DT  D H3     4  
ATOM 10102 H H71    . DT  B 1 11 ? -5.345  5.177   -1.545  1.00 4.30  ? 11 DT  D H71    4  
ATOM 10103 H H72    . DT  B 1 11 ? -6.938  5.324   -0.766  1.00 4.20  ? 11 DT  D H72    4  
ATOM 10104 H H73    . DT  B 1 11 ? -6.668  4.080   -2.009  1.00 4.27  ? 11 DT  D H73    4  
ATOM 10105 H H6     . DT  B 1 11 ? -5.853  1.964   -1.349  1.00 3.46  ? 11 DT  D H6     4  
ATOM 10106 P P      . DC  B 1 12 ? -7.347  -3.438  0.278   1.00 2.77  ? 12 DC  D P      4  
ATOM 10107 O OP1    . DC  B 1 12 ? -7.272  -4.920  0.296   1.00 2.66  ? 12 DC  D OP1    4  
ATOM 10108 O OP2    . DC  B 1 12 ? -8.421  -2.764  -0.497  1.00 2.76  ? 12 DC  D OP2    4  
ATOM 10109 O "O5'"  . DC  B 1 12 ? -7.388  -2.911  1.778   1.00 3.11  ? 12 DC  D "O5'"  4  
ATOM 10110 C "C5'"  . DC  B 1 12 ? -6.272  -3.163  2.627   1.00 3.21  ? 12 DC  D "C5'"  4  
ATOM 10111 C "C4'"  . DC  B 1 12 ? -6.663  -3.047  4.078   1.00 3.55  ? 12 DC  D "C4'"  4  
ATOM 10112 O "O4'"  . DC  B 1 12 ? -6.632  -1.650  4.468   1.00 3.79  ? 12 DC  D "O4'"  4  
ATOM 10113 C "C3'"  . DC  B 1 12 ? -8.095  -3.497  4.335   1.00 3.65  ? 12 DC  D "C3'"  4  
ATOM 10114 O "O3'"  . DC  B 1 12 ? -8.211  -3.957  5.675   1.00 3.94  ? 12 DC  D "O3'"  4  
ATOM 10115 C "C2'"  . DC  B 1 12 ? -8.899  -2.235  4.086   1.00 3.74  ? 12 DC  D "C2'"  4  
ATOM 10116 C "C1'"  . DC  B 1 12 ? -7.959  -1.161  4.619   1.00 3.94  ? 12 DC  D "C1'"  4  
ATOM 10117 N N1     . DC  B 1 12 ? -8.065  0.173   3.991   1.00 4.00  ? 12 DC  D N1     4  
ATOM 10118 C C2     . DC  B 1 12 ? -8.021  1.302   4.825   1.00 4.36  ? 12 DC  D C2     4  
ATOM 10119 O O2     . DC  B 1 12 ? -7.823  1.145   6.040   1.00 4.58  ? 12 DC  D O2     4  
ATOM 10120 N N3     . DC  B 1 12 ? -8.194  2.530   4.289   1.00 4.47  ? 12 DC  D N3     4  
ATOM 10121 C C4     . DC  B 1 12 ? -8.399  2.663   2.978   1.00 4.25  ? 12 DC  D C4     4  
ATOM 10122 N N4     . DC  B 1 12 ? -8.605  3.900   2.507   1.00 4.43  ? 12 DC  D N4     4  
ATOM 10123 C C5     . DC  B 1 12 ? -8.412  1.538   2.097   1.00 3.88  ? 12 DC  D C5     4  
ATOM 10124 C C6     . DC  B 1 12 ? -8.237  0.321   2.642   1.00 3.76  ? 12 DC  D C6     4  
ATOM 10125 H "H5'"  . DC  B 1 12 ? -5.483  -2.441  2.412   1.00 3.21  ? 12 DC  D "H5'"  4  
ATOM 10126 H "H5''" . DC  B 1 12 ? -5.892  -4.166  2.441   1.00 3.06  ? 12 DC  D "H5''" 4  
ATOM 10127 H "H4'"  . DC  B 1 12 ? -6.003  -3.688  4.666   1.00 3.59  ? 12 DC  D "H4'"  4  
ATOM 10128 H "H3'"  . DC  B 1 12 ? -8.381  -4.301  3.655   1.00 3.45  ? 12 DC  D "H3'"  4  
ATOM 10129 H "H2'"  . DC  B 1 12 ? -9.116  -2.105  3.026   1.00 3.53  ? 12 DC  D "H2'"  4  
ATOM 10130 H "H2''" . DC  B 1 12 ? -9.850  -2.254  4.617   1.00 3.92  ? 12 DC  D "H2''" 4  
ATOM 10131 H "H1'"  . DC  B 1 12 ? -8.124  -1.031  5.692   1.00 4.21  ? 12 DC  D "H1'"  4  
ATOM 10132 H H41    . DC  B 1 12 ? -8.604  4.691   3.137   1.00 4.71  ? 12 DC  D H41    4  
ATOM 10133 H H42    . DC  B 1 12 ? -8.772  4.046   1.522   1.00 4.31  ? 12 DC  D H42    4  
ATOM 10134 H H5     . DC  B 1 12 ? -8.562  1.661   1.024   1.00 3.72  ? 12 DC  D H5     4  
ATOM 10135 H H6     . DC  B 1 12 ? -8.229  -0.557  1.998   1.00 3.49  ? 12 DC  D H6     4  
ATOM 10136 P P      . DT  B 1 13 ? -9.645  -4.372  6.258   1.00 4.16  ? 13 DT  D P      4  
ATOM 10137 O OP1    . DT  B 1 13 ? -9.509  -5.693  6.916   1.00 4.28  ? 13 DT  D OP1    4  
ATOM 10138 O OP2    . DT  B 1 13 ? -10.696 -4.167  5.226   1.00 3.98  ? 13 DT  D OP2    4  
ATOM 10139 O "O5'"  . DT  B 1 13 ? -9.821  -3.267  7.386   1.00 4.51  ? 13 DT  D "O5'"  4  
ATOM 10140 C "C5'"  . DT  B 1 13 ? -8.714  -2.969  8.232   1.00 4.67  ? 13 DT  D "C5'"  4  
ATOM 10141 C "C4'"  . DT  B 1 13 ? -9.162  -2.202  9.451   1.00 5.07  ? 13 DT  D "C4'"  4  
ATOM 10142 O "O4'"  . DT  B 1 13 ? -9.311  -0.805  9.097   1.00 5.12  ? 13 DT  D "O4'"  4  
ATOM 10143 C "C3'"  . DT  B 1 13 ? -10.535 -2.638  9.946   1.00 5.26  ? 13 DT  D "C3'"  4  
ATOM 10144 O "O3'"  . DT  B 1 13 ? -10.652 -2.371  11.336  1.00 5.65  ? 13 DT  D "O3'"  4  
ATOM 10145 C "C2'"  . DT  B 1 13 ? -11.477 -1.770  9.130   1.00 5.17  ? 13 DT  D "C2'"  4  
ATOM 10146 C "C1'"  . DT  B 1 13 ? -10.690 -0.468  9.025   1.00 5.21  ? 13 DT  D "C1'"  4  
ATOM 10147 N N1     . DT  B 1 13 ? -10.931 0.336   7.805   1.00 5.01  ? 13 DT  D N1     4  
ATOM 10148 C C2     . DT  B 1 13 ? -11.021 1.705   7.963   1.00 5.23  ? 13 DT  D C2     4  
ATOM 10149 O O2     . DT  B 1 13 ? -10.849 2.266   9.034   1.00 5.56  ? 13 DT  D O2     4  
ATOM 10150 N N3     . DT  B 1 13 ? -11.319 2.396   6.819   1.00 5.08  ? 13 DT  D N3     4  
ATOM 10151 C C4     . DT  B 1 13 ? -11.518 1.875   5.559   1.00 4.72  ? 13 DT  D C4     4  
ATOM 10152 O O4     . DT  B 1 13 ? -11.825 2.621   4.633   1.00 4.65  ? 13 DT  D O4     4  
ATOM 10153 C C5     . DT  B 1 13 ? -11.378 0.437   5.456   1.00 4.48  ? 13 DT  D C5     4  
ATOM 10154 C C7     . DT  B 1 13 ? -11.609 -0.218  4.130   1.00 4.11  ? 13 DT  D C7     4  
ATOM 10155 C C6     . DT  B 1 13 ? -11.088 -0.257  6.568   1.00 4.65  ? 13 DT  D C6     4  
ATOM 10156 H "H5'"  . DT  B 1 13 ? -7.989  -2.371  7.682   1.00 4.54  ? 13 DT  D "H5'"  4  
ATOM 10157 H "H5''" . DT  B 1 13 ? -8.239  -3.897  8.552   1.00 4.67  ? 13 DT  D "H5''" 4  
ATOM 10158 H "H4'"  . DT  B 1 13 ? -8.448  -2.384  10.256  1.00 5.22  ? 13 DT  D "H4'"  4  
ATOM 10159 H "H3'"  . DT  B 1 13 ? -10.700 -3.699  9.766   1.00 5.16  ? 13 DT  D "H3'"  4  
ATOM 10160 H "H2'"  . DT  B 1 13 ? -11.676 -2.213  8.154   1.00 4.90  ? 13 DT  D "H2'"  4  
ATOM 10161 H "H2''" . DT  B 1 13 ? -12.433 -1.638  9.633   1.00 5.37  ? 13 DT  D "H2''" 4  
ATOM 10162 H "H1'"  . DT  B 1 13 ? -10.908 0.165   9.889   1.00 5.51  ? 13 DT  D "H1'"  4  
ATOM 10163 H H3     . DT  B 1 13 ? -11.422 3.399   6.913   1.00 5.26  ? 13 DT  D H3     4  
ATOM 10164 H H71    . DT  B 1 13 ? -11.819 -1.277  4.278   1.00 4.06  ? 13 DT  D H71    4  
ATOM 10165 H H72    . DT  B 1 13 ? -12.457 0.255   3.634   1.00 4.04  ? 13 DT  D H72    4  
ATOM 10166 H H73    . DT  B 1 13 ? -10.720 -0.107  3.510   1.00 4.12  ? 13 DT  D H73    4  
ATOM 10167 H H6     . DT  B 1 13 ? -10.965 -1.337  6.490   1.00 4.51  ? 13 DT  D H6     4  
ATOM 10168 P P      . DT  B 1 14 ? -12.038 -2.655  12.086  1.00 5.93  ? 14 DT  D P      4  
ATOM 10169 O OP1    . DT  B 1 14 ? -11.735 -3.399  13.334  1.00 6.20  ? 14 DT  D OP1    4  
ATOM 10170 O OP2    . DT  B 1 14 ? -13.032 -3.200  11.125  1.00 5.72  ? 14 DT  D OP2    4  
ATOM 10171 O "O5'"  . DT  B 1 14 ? -12.468 -1.175  12.476  1.00 6.17  ? 14 DT  D "O5'"  4  
ATOM 10172 C "C5'"  . DT  B 1 14 ? -11.497 -0.295  13.034  1.00 6.33  ? 14 DT  D "C5'"  4  
ATOM 10173 C "C4'"  . DT  B 1 14 ? -12.153 0.952   13.571  1.00 6.64  ? 14 DT  D "C4'"  4  
ATOM 10174 O "O4'"  . DT  B 1 14 ? -12.424 1.853   12.468  1.00 6.46  ? 14 DT  D "O4'"  4  
ATOM 10175 C "C3'"  . DT  B 1 14 ? -13.512 0.670   14.198  1.00 6.86  ? 14 DT  D "C3'"  4  
ATOM 10176 O "O3'"  . DT  B 1 14 ? -13.804 1.663   15.175  1.00 7.24  ? 14 DT  D "O3'"  4  
ATOM 10177 C "C2'"  . DT  B 1 14 ? -14.456 0.757   13.012  1.00 6.61  ? 14 DT  D "C2'"  4  
ATOM 10178 C "C1'"  . DT  B 1 14 ? -13.819 1.871   12.188  1.00 6.47  ? 14 DT  D "C1'"  4  
ATOM 10179 N N1     . DT  B 1 14 ? -14.020 1.797   10.722  1.00 6.10  ? 14 DT  D N1     4  
ATOM 10180 C C2     . DT  B 1 14 ? -14.235 2.990   10.061  1.00 6.09  ? 14 DT  D C2     4  
ATOM 10181 O O2     . DT  B 1 14 ? -14.213 4.074   10.619  1.00 6.38  ? 14 DT  D O2     4  
ATOM 10182 N N3     . DT  B 1 14 ? -14.477 2.870   8.718   1.00 5.76  ? 14 DT  D N3     4  
ATOM 10183 C C4     . DT  B 1 14 ? -14.514 1.706   7.982   1.00 5.43  ? 14 DT  D C4     4  
ATOM 10184 O O4     . DT  B 1 14 ? -14.777 1.753   6.781   1.00 5.16  ? 14 DT  D O4     4  
ATOM 10185 C C5     . DT  B 1 14 ? -14.258 0.492   8.729   1.00 5.46  ? 14 DT  D C5     4  
ATOM 10186 C C7     . DT  B 1 14 ? -14.319 -0.823  8.015   1.00 5.15  ? 14 DT  D C7     4  
ATOM 10187 C C6     . DT  B 1 14 ? -14.018 0.593   10.049  1.00 5.79  ? 14 DT  D C6     4  
ATOM 10188 H "H5'"  . DT  B 1 14 ? -10.776 -0.015  12.266  1.00 6.11  ? 14 DT  D "H5'"  4  
ATOM 10189 H "H5''" . DT  B 1 14 ? -10.973 -0.799  13.847  1.00 6.47  ? 14 DT  D "H5''" 4  
ATOM 10190 H "H4'"  . DT  B 1 14 ? -11.512 1.375   14.346  1.00 6.85  ? 14 DT  D "H4'"  4  
ATOM 10191 H "H3'"  . DT  B 1 14 ? -13.534 -0.314  14.666  1.00 6.90  ? 14 DT  D "H3'"  4  
ATOM 10192 H "H2'"  . DT  B 1 14 ? -14.495 -0.187  12.470  1.00 6.38  ? 14 DT  D "H2'"  4  
ATOM 10193 H "H2''" . DT  B 1 14 ? -15.470 0.993   13.327  1.00 6.78  ? 14 DT  D "H2''" 4  
ATOM 10194 H "H1'"  . DT  B 1 14 ? -14.196 2.840   12.525  1.00 6.70  ? 14 DT  D "H1'"  4  
ATOM 10195 H H3     . DT  B 1 14 ? -14.668 3.729   8.218   1.00 5.78  ? 14 DT  D H3     4  
ATOM 10196 H H71    . DT  B 1 14 ? -13.418 -0.953  7.415   1.00 4.98  ? 14 DT  D H71    4  
ATOM 10197 H H72    . DT  B 1 14 ? -15.194 -0.842  7.365   1.00 5.03  ? 14 DT  D H72    4  
ATOM 10198 H H73    . DT  B 1 14 ? -14.389 -1.631  8.743   1.00 5.27  ? 14 DT  D H73    4  
ATOM 10199 H H6     . DT  B 1 14 ? -13.808 -0.318  10.609  1.00 5.83  ? 14 DT  D H6     4  
ATOM 10200 P P      . DA  B 1 15 ? -15.211 1.635   15.944  1.00 7.52  ? 15 DA  D P      4  
ATOM 10201 O OP1    . DA  B 1 15 ? -14.930 1.782   17.394  1.00 7.92  ? 15 DA  D OP1    4  
ATOM 10202 O OP2    . DA  B 1 15 ? -16.018 0.484   15.463  1.00 7.34  ? 15 DA  D OP2    4  
ATOM 10203 O "O5'"  . DA  B 1 15 ? -15.876 2.980   15.420  1.00 7.56  ? 15 DA  D "O5'"  4  
ATOM 10204 C "C5'"  . DA  B 1 15 ? -15.132 4.191   15.477  1.00 7.67  ? 15 DA  D "C5'"  4  
ATOM 10205 C "C4'"  . DA  B 1 15 ? -16.011 5.375   15.162  1.00 7.79  ? 15 DA  D "C4'"  4  
ATOM 10206 O "O4'"  . DA  B 1 15 ? -16.185 5.466   13.725  1.00 7.44  ? 15 DA  D "O4'"  4  
ATOM 10207 C "C3'"  . DA  B 1 15 ? -17.423 5.237   15.718  1.00 7.99  ? 15 DA  D "C3'"  4  
ATOM 10208 O "O3'"  . DA  B 1 15 ? -17.977 6.529   15.932  1.00 8.25  ? 15 DA  D "O3'"  4  
ATOM 10209 C "C2'"  . DA  B 1 15 ? -18.150 4.486   14.617  1.00 7.65  ? 15 DA  D "C2'"  4  
ATOM 10210 C "C1'"  . DA  B 1 15 ? -17.501 5.060   13.366  1.00 7.36  ? 15 DA  D "C1'"  4  
ATOM 10211 N N9     . DA  B 1 15 ? -17.428 4.151   12.220  1.00 6.95  ? 15 DA  D N9     4  
ATOM 10212 C C8     . DA  B 1 15 ? -17.100 2.819   12.193  1.00 6.75  ? 15 DA  D C8     4  
ATOM 10213 N N7     . DA  B 1 15 ? -17.180 2.277   10.998  1.00 6.39  ? 15 DA  D N7     4  
ATOM 10214 C C5     . DA  B 1 15 ? -17.581 3.326   10.183  1.00 6.33  ? 15 DA  D C5     4  
ATOM 10215 C C6     . DA  B 1 15 ? -17.853 3.406   8.801   1.00 6.01  ? 15 DA  D C6     4  
ATOM 10216 N N6     . DA  B 1 15 ? -17.773 2.367   7.965   1.00 5.66  ? 15 DA  D N6     4  
ATOM 10217 N N1     . DA  B 1 15 ? -18.225 4.606   8.301   1.00 6.08  ? 15 DA  D N1     4  
ATOM 10218 C C2     . DA  B 1 15 ? -18.319 5.647   9.140   1.00 6.44  ? 15 DA  D C2     4  
ATOM 10219 N N3     . DA  B 1 15 ? -18.100 5.694   10.454  1.00 6.76  ? 15 DA  D N3     4  
ATOM 10220 C C4     . DA  B 1 15 ? -17.728 4.488   10.919  1.00 6.68  ? 15 DA  D C4     4  
ATOM 10221 H "H5'"  . DA  B 1 15 ? -14.317 4.152   14.754  1.00 7.43  ? 15 DA  D "H5'"  4  
ATOM 10222 H "H5''" . DA  B 1 15 ? -14.714 4.316   16.475  1.00 7.93  ? 15 DA  D "H5''" 4  
ATOM 10223 H "H4'"  . DA  B 1 15 ? -15.567 6.265   15.611  1.00 8.00  ? 15 DA  D "H4'"  4  
ATOM 10224 H "H3'"  . DA  B 1 15 ? -17.423 4.684   16.658  1.00 8.18  ? 15 DA  D "H3'"  4  
ATOM 10225 H "H2'"  . DA  B 1 15 ? -18.001 3.410   14.706  1.00 7.54  ? 15 DA  D "H2'"  4  
ATOM 10226 H "H2''" . DA  B 1 15 ? -19.222 4.673   14.649  1.00 7.74  ? 15 DA  D "H2''" 4  
ATOM 10227 H "H1'"  . DA  B 1 15 ? -18.035 5.958   13.046  1.00 7.43  ? 15 DA  D "H1'"  4  
ATOM 10228 H H8     . DA  B 1 15 ? -16.809 2.266   13.073  1.00 6.91  ? 15 DA  D H8     4  
ATOM 10229 H H61    . DA  B 1 15 ? -17.990 2.485   6.985   1.00 5.45  ? 15 DA  D H61    4  
ATOM 10230 H H62    . DA  B 1 15 ? -17.504 1.461   8.320   1.00 5.63  ? 15 DA  D H62    4  
ATOM 10231 H H2     . DA  B 1 15 ? -18.620 6.589   8.683   1.00 6.50  ? 15 DA  D H2     4  
ATOM 10232 P P      . DT  B 1 16 ? -19.494 6.678   16.424  1.00 8.48  ? 16 DT  D P      4  
ATOM 10233 O OP1    . DT  B 1 16 ? -19.510 7.640   17.554  1.00 8.91  ? 16 DT  D OP1    4  
ATOM 10234 O OP2    . DT  B 1 16 ? -20.112 5.336   16.591  1.00 8.39  ? 16 DT  D OP2    4  
ATOM 10235 O "O5'"  . DT  B 1 16 ? -20.149 7.386   15.160  1.00 8.28  ? 16 DT  D "O5'"  4  
ATOM 10236 C "C5'"  . DT  B 1 16 ? -19.451 8.459   14.531  1.00 8.25  ? 16 DT  D "C5'"  4  
ATOM 10237 C "C4'"  . DT  B 1 16 ? -20.340 9.178   13.548  1.00 8.16  ? 16 DT  D "C4'"  4  
ATOM 10238 O "O4'"  . DT  B 1 16 ? -20.394 8.417   12.316  1.00 7.74  ? 16 DT  D "O4'"  4  
ATOM 10239 C "C3'"  . DT  B 1 16 ? -21.787 9.273   14.020  1.00 8.35  ? 16 DT  D "C3'"  4  
ATOM 10240 O "O3'"  . DT  B 1 16 ? -22.413 10.404  13.426  1.00 8.42  ? 16 DT  D "O3'"  4  
ATOM 10241 C "C2'"  . DT  B 1 16 ? -22.389 7.973   13.518  1.00 8.06  ? 16 DT  D "C2'"  4  
ATOM 10242 C "C1'"  . DT  B 1 16 ? -21.660 7.782   12.192  1.00 7.67  ? 16 DT  D "C1'"  4  
ATOM 10243 N N1     . DT  B 1 16 ? -21.463 6.381   11.752  1.00 7.34  ? 16 DT  D N1     4  
ATOM 10244 C C2     . DT  B 1 16 ? -21.639 6.123   10.407  1.00 6.98  ? 16 DT  D C2     4  
ATOM 10245 O O2     . DT  B 1 16 ? -21.877 6.994   9.587   1.00 6.92  ? 16 DT  D O2     4  
ATOM 10246 N N3     . DT  B 1 16 ? -21.526 4.805   10.053  1.00 6.70  ? 16 DT  D N3     4  
ATOM 10247 C C4     . DT  B 1 16 ? -21.251 3.742   10.885  1.00 6.77  ? 16 DT  D C4     4  
ATOM 10248 O O4     . DT  B 1 16 ? -21.247 2.599   10.429  1.00 6.52  ? 16 DT  D O4     4  
ATOM 10249 C C5     . DT  B 1 16 ? -21.043 4.085   12.278  1.00 7.16  ? 16 DT  D C5     4  
ATOM 10250 C C7     . DT  B 1 16 ? -20.765 2.987   13.258  1.00 7.28  ? 16 DT  D C7     4  
ATOM 10251 C C6     . DT  B 1 16 ? -21.150 5.374   12.641  1.00 7.42  ? 16 DT  D C6     4  
ATOM 10252 H "H5'"  . DT  B 1 16 ? -18.582 8.066   14.003  1.00 8.01  ? 16 DT  D "H5'"  4  
ATOM 10253 H "H5''" . DT  B 1 16 ? -19.113 9.166   15.287  1.00 8.53  ? 16 DT  D "H5''" 4  
ATOM 10254 H "H4'"  . DT  B 1 16 ? -19.967 10.197  13.426  1.00 8.28  ? 16 DT  D "H4'"  4  
ATOM 10255 H "H3'"  . DT  B 1 16 ? -21.842 9.357   15.105  1.00 8.64  ? 16 DT  D "H3'"  4  
ATOM 10256 H "H2'"  . DT  B 1 16 ? -22.203 7.154   14.214  1.00 8.11  ? 16 DT  D "H2'"  4  
ATOM 10257 H "H2''" . DT  B 1 16 ? -23.468 8.057   13.392  1.00 8.10  ? 16 DT  D "H2''" 4  
ATOM 10258 H "H1'"  . DT  B 1 16 ? -22.197 8.305   11.398  1.00 7.58  ? 16 DT  D "H1'"  4  
ATOM 10259 H H3     . DT  B 1 16 ? -21.678 4.590   9.076   1.00 6.44  ? 16 DT  D H3     4  
ATOM 10260 H H71    . DT  B 1 16 ? -19.723 2.680   13.172  1.00 7.19  ? 16 DT  D H71    4  
ATOM 10261 H H72    . DT  B 1 16 ? -21.412 2.136   13.043  1.00 7.26  ? 16 DT  D H72    4  
ATOM 10262 H H73    . DT  B 1 16 ? -20.957 3.343   14.269  1.00 7.56  ? 16 DT  D H73    4  
ATOM 10263 H H6     . DT  B 1 16 ? -20.976 5.636   13.685  1.00 7.71  ? 16 DT  D H6     4  
ATOM 10264 P P      . DC  B 1 17 ? -23.962 10.703  13.716  1.00 8.61  ? 17 DC  D P      4  
ATOM 10265 O OP1    . DC  B 1 17 ? -24.076 12.135  14.091  1.00 8.94  ? 17 DC  D OP1    4  
ATOM 10266 O OP2    . DC  B 1 17 ? -24.499 9.660   14.627  1.00 8.70  ? 17 DC  D OP2    4  
ATOM 10267 O "O5'"  . DC  B 1 17 ? -24.602 10.504  12.274  1.00 8.25  ? 17 DC  D "O5'"  4  
ATOM 10268 C "C5'"  . DC  B 1 17 ? -24.010 11.147  11.147  1.00 8.07  ? 17 DC  D "C5'"  4  
ATOM 10269 C "C4'"  . DC  B 1 17 ? -24.923 11.072  9.947   1.00 7.81  ? 17 DC  D "C4'"  4  
ATOM 10270 O "O4'"  . DC  B 1 17 ? -24.818 9.752   9.362   1.00 7.44  ? 17 DC  D "O4'"  4  
ATOM 10271 C "C3'"  . DC  B 1 17 ? -26.398 11.235  10.297  1.00 7.97  ? 17 DC  D "C3'"  4  
ATOM 10272 O "O3'"  . DC  B 1 17 ? -27.112 11.749  9.172   1.00 7.82  ? 17 DC  D "O3'"  4  
ATOM 10273 C "C2'"  . DC  B 1 17 ? -26.819 9.816   10.632  1.00 7.83  ? 17 DC  D "C2'"  4  
ATOM 10274 C "C1'"  . DC  B 1 17 ? -25.989 8.997   9.647   1.00 7.43  ? 17 DC  D "C1'"  4  
ATOM 10275 N N1     . DC  B 1 17 ? -25.586 7.652   10.100  1.00 7.33  ? 17 DC  D N1     4  
ATOM 10276 C C2     . DC  B 1 17 ? -25.646 6.594   9.181   1.00 6.96  ? 17 DC  D C2     4  
ATOM 10277 O O2     . DC  B 1 17 ? -25.992 6.829   8.013   1.00 6.72  ? 17 DC  D O2     4  
ATOM 10278 N N3     . DC  B 1 17 ? -25.325 5.345   9.585   1.00 6.88  ? 17 DC  D N3     4  
ATOM 10279 C C4     . DC  B 1 17 ? -24.953 5.127   10.846  1.00 7.16  ? 17 DC  D C4     4  
ATOM 10280 N N4     . DC  B 1 17 ? -24.669 3.869   11.202  1.00 7.10  ? 17 DC  D N4     4  
ATOM 10281 C C5     . DC  B 1 17 ? -24.861 6.187   11.801  1.00 7.53  ? 17 DC  D C5     4  
ATOM 10282 C C6     . DC  B 1 17 ? -25.182 7.423   11.386  1.00 7.60  ? 17 DC  D C6     4  
ATOM 10283 H "H5'"  . DC  B 1 17 ? -23.063 10.662  10.905  1.00 7.89  ? 17 DC  D "H5'"  4  
ATOM 10284 H "H5''" . DC  B 1 17 ? -23.821 12.195  11.384  1.00 8.30  ? 17 DC  D "H5''" 4  
ATOM 10285 H "H4'"  . DC  B 1 17 ? -24.658 11.881  9.265   1.00 7.79  ? 17 DC  D "H4'"  4  
ATOM 10286 H "H3'"  . DC  B 1 17 ? -26.528 11.909  11.145  1.00 8.28  ? 17 DC  D "H3'"  4  
ATOM 10287 H "H2'"  . DC  B 1 17 ? -26.593 9.569   11.668  1.00 8.04  ? 17 DC  D "H2'"  4  
ATOM 10288 H "H2''" . DC  B 1 17 ? -27.890 9.676   10.488  1.00 7.82  ? 17 DC  D "H2''" 4  
ATOM 10289 H "H1'"  . DC  B 1 17 ? -26.532 8.885   8.705   1.00 7.21  ? 17 DC  D "H1'"  4  
ATOM 10290 H H41    . DC  B 1 17 ? -24.748 3.120   10.528  1.00 6.86  ? 17 DC  D H41    4  
ATOM 10291 H H42    . DC  B 1 17 ? -24.389 3.662   12.151  1.00 7.32  ? 17 DC  D H42    4  
ATOM 10292 H H5     . DC  B 1 17 ? -24.546 5.998   12.827  1.00 7.75  ? 17 DC  D H5     4  
ATOM 10293 H H6     . DC  B 1 17 ? -25.114 8.255   12.087  1.00 7.88  ? 17 DC  D H6     4  
ATOM 10294 P P      . DG  B 1 18 ? -28.687 12.036  9.288   1.00 7.95  ? 18 DG  D P      4  
ATOM 10295 O OP1    . DG  B 1 18 ? -28.936 13.403  8.763   1.00 8.08  ? 18 DG  D OP1    4  
ATOM 10296 O OP2    . DG  B 1 18 ? -29.149 11.681  10.654  1.00 8.23  ? 18 DG  D OP2    4  
ATOM 10297 O "O5'"  . DG  B 1 18 ? -29.312 10.993  8.260   1.00 7.55  ? 18 DG  D "O5'"  4  
ATOM 10298 C "C5'"  . DG  B 1 18 ? -28.906 11.005  6.891   1.00 7.23  ? 18 DG  D "C5'"  4  
ATOM 10299 C "C4'"  . DG  B 1 18 ? -29.838 10.159  6.056   1.00 6.93  ? 18 DG  D "C4'"  4  
ATOM 10300 O "O4'"  . DG  B 1 18 ? -29.534 8.766   6.294   1.00 6.75  ? 18 DG  D "O4'"  4  
ATOM 10301 C "C3'"  . DG  B 1 18 ? -31.312 10.312  6.412   1.00 7.08  ? 18 DG  D "C3'"  4  
ATOM 10302 O "O3'"  . DG  B 1 18 ? -32.143 9.992   5.292   1.00 6.80  ? 18 DG  D "O3'"  4  
ATOM 10303 C "C2'"  . DG  B 1 18 ? -31.487 9.297   7.527   1.00 7.19  ? 18 DG  D "C2'"  4  
ATOM 10304 C "C1'"  . DG  B 1 18 ? -30.550 8.173   7.093   1.00 6.89  ? 18 DG  D "C1'"  4  
ATOM 10305 N N9     . DG  B 1 18 ? -29.908 7.436   8.178   1.00 7.02  ? 18 DG  D N9     4  
ATOM 10306 C C8     . DG  B 1 18 ? -29.465 7.927   9.382   1.00 7.37  ? 18 DG  D C8     4  
ATOM 10307 N N7     . DG  B 1 18 ? -28.959 7.006   10.159  1.00 7.43  ? 18 DG  D N7     4  
ATOM 10308 C C5     . DG  B 1 18 ? -29.072 5.835   9.420   1.00 7.10  ? 18 DG  D C5     4  
ATOM 10309 C C6     . DG  B 1 18 ? -28.695 4.501   9.741   1.00 7.02  ? 18 DG  D C6     4  
ATOM 10310 O O6     . DG  B 1 18 ? -28.170 4.073   10.777  1.00 7.23  ? 18 DG  D O6     4  
ATOM 10311 N N1     . DG  B 1 18 ? -28.989 3.622   8.701   1.00 6.68  ? 18 DG  D N1     4  
ATOM 10312 C C2     . DG  B 1 18 ? -29.571 3.980   7.507   1.00 6.43  ? 18 DG  D C2     4  
ATOM 10313 N N2     . DG  B 1 18 ? -29.774 2.991   6.624   1.00 6.12  ? 18 DG  D N2     4  
ATOM 10314 N N3     . DG  B 1 18 ? -29.925 5.215   7.199   1.00 6.50  ? 18 DG  D N3     4  
ATOM 10315 C C4     . DG  B 1 18 ? -29.650 6.085   8.194   1.00 6.84  ? 18 DG  D C4     4  
ATOM 10316 H "H5'"  . DG  B 1 18 ? -27.893 10.608  6.808   1.00 7.12  ? 18 DG  D "H5'"  4  
ATOM 10317 H "H5''" . DG  B 1 18 ? -28.919 12.027  6.516   1.00 7.33  ? 18 DG  D "H5''" 4  
ATOM 10318 H "H4'"  . DG  B 1 18 ? -29.724 10.460  5.013   1.00 6.74  ? 18 DG  D "H4'"  4  
ATOM 10319 H "H3'"  . DG  B 1 18 ? -31.532 11.326  6.747   1.00 7.33  ? 18 DG  D "H3'"  4  
ATOM 10320 H "HO3'" . DG  B 1 18 ? -31.688 9.308   4.794   1.00 6.78  ? 18 DG  D "HO3'" 4  
ATOM 10321 H "H2'"  . DG  B 1 18 ? -31.208 9.718   8.495   1.00 7.48  ? 18 DG  D "H2'"  4  
ATOM 10322 H "H2''" . DG  B 1 18 ? -32.522 8.964   7.602   1.00 7.20  ? 18 DG  D "H2''" 4  
ATOM 10323 H "H1'"  . DG  B 1 18 ? -31.084 7.458   6.465   1.00 6.65  ? 18 DG  D "H1'"  4  
ATOM 10324 H H8     . DG  B 1 18 ? -29.529 8.968   9.659   1.00 7.59  ? 18 DG  D H8     4  
ATOM 10325 H H1     . DG  B 1 18 ? -28.757 2.648   8.835   1.00 6.62  ? 18 DG  D H1     4  
ATOM 10326 H H21    . DG  B 1 18 ? -29.511 2.038   6.840   1.00 6.08  ? 18 DG  D H21    4  
ATOM 10327 H H22    . DG  B 1 18 ? -30.199 3.199   5.731   1.00 5.93  ? 18 DG  D H22    4  
ATOM 10328 N N      . MET C 2 1  ? -2.385  1.879   -22.789 1.00 6.61  ? 1  MET A N      4  
ATOM 10329 C CA     . MET C 2 1  ? -1.577  1.400   -21.639 1.00 6.29  ? 1  MET A CA     4  
ATOM 10330 C C      . MET C 2 1  ? -2.207  1.842   -20.319 1.00 5.80  ? 1  MET A C      4  
ATOM 10331 O O      . MET C 2 1  ? -3.273  2.457   -20.321 1.00 5.96  ? 1  MET A O      4  
ATOM 10332 C CB     . MET C 2 1  ? -0.133  1.915   -21.741 1.00 6.58  ? 1  MET A CB     4  
ATOM 10333 C CG     . MET C 2 1  ? 0.043   3.386   -21.379 1.00 6.98  ? 1  MET A CG     4  
ATOM 10334 S SD     . MET C 2 1  ? -0.685  4.503   -22.593 1.00 7.35  ? 1  MET A SD     4  
ATOM 10335 C CE     . MET C 2 1  ? -0.195  6.093   -21.926 1.00 8.11  ? 1  MET A CE     4  
ATOM 10336 H H1     . MET C 2 1  ? -1.766  2.099   -23.600 1.00 6.85  ? 1  MET A H1     4  
ATOM 10337 H H2     . MET C 2 1  ? -2.917  2.739   -22.525 1.00 6.72  ? 1  MET A H2     4  
ATOM 10338 H H3     . MET C 2 1  ? -3.063  1.144   -23.079 1.00 6.83  ? 1  MET A H3     4  
ATOM 10339 H HA     . MET C 2 1  ? -1.566  0.320   -21.667 1.00 6.54  ? 1  MET A HA     4  
ATOM 10340 H HB2    . MET C 2 1  ? 0.489   1.333   -21.078 1.00 6.87  ? 1  MET A HB2    4  
ATOM 10341 H HB3    . MET C 2 1  ? 0.213   1.776   -22.755 1.00 6.62  ? 1  MET A HB3    4  
ATOM 10342 H HG2    . MET C 2 1  ? -0.429  3.566   -20.423 1.00 7.25  ? 1  MET A HG2    4  
ATOM 10343 H HG3    . MET C 2 1  ? 1.098   3.600   -21.302 1.00 7.18  ? 1  MET A HG3    4  
ATOM 10344 H HE1    . MET C 2 1  ? 0.883   6.148   -21.878 1.00 8.46  ? 1  MET A HE1    4  
ATOM 10345 H HE2    . MET C 2 1  ? -0.604  6.210   -20.934 1.00 8.28  ? 1  MET A HE2    4  
ATOM 10346 H HE3    . MET C 2 1  ? -0.567  6.882   -22.564 1.00 8.36  ? 1  MET A HE3    4  
ATOM 10347 N N      . LYS C 2 2  ? -1.534  1.515   -19.204 1.00 5.48  ? 2  LYS A N      4  
ATOM 10348 C CA     . LYS C 2 2  ? -1.984  1.861   -17.846 1.00 5.17  ? 2  LYS A CA     4  
ATOM 10349 C C      . LYS C 2 2  ? -3.118  0.953   -17.375 1.00 4.60  ? 2  LYS A C      4  
ATOM 10350 O O      . LYS C 2 2  ? -4.136  0.811   -18.049 1.00 4.73  ? 2  LYS A O      4  
ATOM 10351 C CB     . LYS C 2 2  ? -2.405  3.335   -17.742 1.00 5.62  ? 2  LYS A CB     4  
ATOM 10352 C CG     . LYS C 2 2  ? -1.236  4.301   -17.636 1.00 5.98  ? 2  LYS A CG     4  
ATOM 10353 C CD     . LYS C 2 2  ? -0.444  4.081   -16.355 1.00 6.39  ? 2  LYS A CD     4  
ATOM 10354 C CE     . LYS C 2 2  ? -0.630  5.227   -15.371 1.00 6.72  ? 2  LYS A CE     4  
ATOM 10355 N NZ     . LYS C 2 2  ? -2.021  5.302   -14.844 1.00 7.29  ? 2  LYS A NZ     4  
ATOM 10356 H H      . LYS C 2 2  ? -0.702  1.005   -19.297 1.00 5.65  ? 2  LYS A H      4  
ATOM 10357 H HA     . LYS C 2 2  ? -1.141  1.706   -17.188 1.00 5.28  ? 2  LYS A HA     4  
ATOM 10358 H HB2    . LYS C 2 2  ? -2.980  3.595   -18.620 1.00 5.96  ? 2  LYS A HB2    4  
ATOM 10359 H HB3    . LYS C 2 2  ? -3.027  3.459   -16.868 1.00 5.72  ? 2  LYS A HB3    4  
ATOM 10360 H HG2    . LYS C 2 2  ? -0.582  4.153   -18.482 1.00 6.17  ? 2  LYS A HG2    4  
ATOM 10361 H HG3    . LYS C 2 2  ? -1.616  5.313   -17.647 1.00 6.16  ? 2  LYS A HG3    4  
ATOM 10362 H HD2    . LYS C 2 2  ? -0.778  3.166   -15.892 1.00 6.78  ? 2  LYS A HD2    4  
ATOM 10363 H HD3    . LYS C 2 2  ? 0.604   3.999   -16.605 1.00 6.45  ? 2  LYS A HD3    4  
ATOM 10364 H HE2    . LYS C 2 2  ? 0.048   5.084   -14.543 1.00 6.67  ? 2  LYS A HE2    4  
ATOM 10365 H HE3    . LYS C 2 2  ? -0.394  6.155   -15.871 1.00 6.92  ? 2  LYS A HE3    4  
ATOM 10366 H HZ1    . LYS C 2 2  ? -2.036  5.856   -13.957 1.00 7.55  ? 2  LYS A HZ1    4  
ATOM 10367 H HZ2    . LYS C 2 2  ? -2.387  4.351   -14.650 1.00 7.51  ? 2  LYS A HZ2    4  
ATOM 10368 H HZ3    . LYS C 2 2  ? -2.646  5.770   -15.539 1.00 7.50  ? 2  LYS A HZ3    4  
ATOM 10369 N N      . PRO C 2 3  ? -2.933  0.302   -16.214 1.00 4.22  ? 3  PRO A N      4  
ATOM 10370 C CA     . PRO C 2 3  ? -3.925  -0.598  -15.630 1.00 3.97  ? 3  PRO A CA     4  
ATOM 10371 C C      . PRO C 2 3  ? -5.013  0.132   -14.840 1.00 3.83  ? 3  PRO A C      4  
ATOM 10372 O O      . PRO C 2 3  ? -5.107  1.359   -14.869 1.00 4.13  ? 3  PRO A O      4  
ATOM 10373 C CB     . PRO C 2 3  ? -3.097  -1.492  -14.687 1.00 4.05  ? 3  PRO A CB     4  
ATOM 10374 C CG     . PRO C 2 3  ? -1.678  -1.035  -14.819 1.00 4.26  ? 3  PRO A CG     4  
ATOM 10375 C CD     . PRO C 2 3  ? -1.730  0.356   -15.384 1.00 4.37  ? 3  PRO A CD     4  
ATOM 10376 H HA     . PRO C 2 3  ? -4.391  -1.213  -16.387 1.00 4.12  ? 3  PRO A HA     4  
ATOM 10377 H HB2    . PRO C 2 3  ? -3.454  -1.370  -13.674 1.00 4.23  ? 3  PRO A HB2    4  
ATOM 10378 H HB3    . PRO C 2 3  ? -3.205  -2.525  -14.986 1.00 4.13  ? 3  PRO A HB3    4  
ATOM 10379 H HG2    . PRO C 2 3  ? -1.205  -1.027  -13.848 1.00 4.56  ? 3  PRO A HG2    4  
ATOM 10380 H HG3    . PRO C 2 3  ? -1.145  -1.692  -15.490 1.00 4.30  ? 3  PRO A HG3    4  
ATOM 10381 H HD2    . PRO C 2 3  ? -1.834  1.086   -14.594 1.00 4.55  ? 3  PRO A HD2    4  
ATOM 10382 H HD3    . PRO C 2 3  ? -0.855  0.559   -15.983 1.00 4.58  ? 3  PRO A HD3    4  
ATOM 10383 N N      . VAL C 2 4  ? -5.810  -0.649  -14.121 1.00 3.45  ? 4  VAL A N      4  
ATOM 10384 C CA     . VAL C 2 4  ? -6.917  -0.139  -13.320 1.00 3.31  ? 4  VAL A CA     4  
ATOM 10385 C C      . VAL C 2 4  ? -6.596  -0.189  -11.837 1.00 3.06  ? 4  VAL A C      4  
ATOM 10386 O O      . VAL C 2 4  ? -5.880  -1.073  -11.364 1.00 2.85  ? 4  VAL A O      4  
ATOM 10387 C CB     . VAL C 2 4  ? -8.180  -0.995  -13.545 1.00 3.15  ? 4  VAL A CB     4  
ATOM 10388 C CG1    . VAL C 2 4  ? -9.349  -0.529  -12.695 1.00 3.02  ? 4  VAL A CG1    4  
ATOM 10389 C CG2    . VAL C 2 4  ? -8.566  -0.991  -15.004 1.00 3.43  ? 4  VAL A CG2    4  
ATOM 10390 H H      . VAL C 2 4  ? -5.638  -1.610  -14.117 1.00 3.34  ? 4  VAL A H      4  
ATOM 10391 H HA     . VAL C 2 4  ? -7.141  0.881   -13.614 1.00 3.54  ? 4  VAL A HA     4  
ATOM 10392 H HB     . VAL C 2 4  ? -7.948  -2.000  -13.258 1.00 2.96  ? 4  VAL A HB     4  
ATOM 10393 H HG11   . VAL C 2 4  ? -10.114 -1.289  -12.686 1.00 3.17  ? 4  VAL A HG11   4  
ATOM 10394 H HG12   . VAL C 2 4  ? -9.753  0.384   -13.108 1.00 3.22  ? 4  VAL A HG12   4  
ATOM 10395 H HG13   . VAL C 2 4  ? -9.010  -0.346  -11.682 1.00 3.08  ? 4  VAL A HG13   4  
ATOM 10396 H HG21   . VAL C 2 4  ? -8.755  0.023   -15.316 1.00 3.42  ? 4  VAL A HG21   4  
ATOM 10397 H HG22   . VAL C 2 4  ? -9.458  -1.586  -15.136 1.00 3.82  ? 4  VAL A HG22   4  
ATOM 10398 H HG23   . VAL C 2 4  ? -7.763  -1.409  -15.589 1.00 3.65  ? 4  VAL A HG23   4  
ATOM 10399 N N      . THR C 2 5  ? -7.143  0.762   -11.129 1.00 3.14  ? 5  THR A N      4  
ATOM 10400 C CA     . THR C 2 5  ? -7.012  0.841   -9.687  1.00 3.01  ? 5  THR A CA     4  
ATOM 10401 C C      . THR C 2 5  ? -8.377  0.571   -9.115  1.00 2.85  ? 5  THR A C      4  
ATOM 10402 O O      . THR C 2 5  ? -9.369  0.652   -9.840  1.00 2.89  ? 5  THR A O      4  
ATOM 10403 C CB     . THR C 2 5  ? -6.516  2.216   -9.199  1.00 3.29  ? 5  THR A CB     4  
ATOM 10404 O OG1    . THR C 2 5  ? -7.356  3.262   -9.705  1.00 3.55  ? 5  THR A OG1    4  
ATOM 10405 C CG2    . THR C 2 5  ? -5.078  2.456   -9.618  1.00 3.52  ? 5  THR A CG2    4  
ATOM 10406 H H      . THR C 2 5  ? -7.684  1.435   -11.603 1.00 3.33  ? 5  THR A H      4  
ATOM 10407 H HA     . THR C 2 5  ? -6.332  0.071   -9.345  1.00 2.86  ? 5  THR A HA     4  
ATOM 10408 H HB     . THR C 2 5  ? -6.561  2.228   -8.119  1.00 3.25  ? 5  THR A HB     4  
ATOM 10409 H HG1    . THR C 2 5  ? -7.373  3.228   -10.682 1.00 3.59  ? 5  THR A HG1    4  
ATOM 10410 H HG21   . THR C 2 5  ? -4.754  3.420   -9.254  1.00 3.69  ? 5  THR A HG21   4  
ATOM 10411 H HG22   . THR C 2 5  ? -5.007  2.431   -10.694 1.00 3.76  ? 5  THR A HG22   4  
ATOM 10412 H HG23   . THR C 2 5  ? -4.452  1.682   -9.196  1.00 3.70  ? 5  THR A HG23   4  
ATOM 10413 N N      . LEU C 2 6  ? -8.466  0.230   -7.847  1.00 2.72  ? 6  LEU A N      4  
ATOM 10414 C CA     . LEU C 2 6  ? -9.780  -0.029  -7.281  1.00 2.62  ? 6  LEU A CA     4  
ATOM 10415 C C      . LEU C 2 6  ? -10.679 1.206   -7.396  1.00 2.85  ? 6  LEU A C      4  
ATOM 10416 O O      . LEU C 2 6  ? -11.903 1.100   -7.411  1.00 2.79  ? 6  LEU A O      4  
ATOM 10417 C CB     . LEU C 2 6  ? -9.667  -0.516  -5.853  1.00 2.55  ? 6  LEU A CB     4  
ATOM 10418 C CG     . LEU C 2 6  ? -10.086 -1.963  -5.662  1.00 2.31  ? 6  LEU A CG     4  
ATOM 10419 C CD1    . LEU C 2 6  ? -10.179 -2.301  -4.184  1.00 2.37  ? 6  LEU A CD1    4  
ATOM 10420 C CD2    . LEU C 2 6  ? -11.411 -2.229  -6.363  1.00 2.25  ? 6  LEU A CD2    4  
ATOM 10421 H H      . LEU C 2 6  ? -7.649  0.139   -7.294  1.00 2.71  ? 6  LEU A H      4  
ATOM 10422 H HA     . LEU C 2 6  ? -10.218 -0.812  -7.868  1.00 2.47  ? 6  LEU A HA     4  
ATOM 10423 H HB2    . LEU C 2 6  ? -8.635  -0.412  -5.545  1.00 2.61  ? 6  LEU A HB2    4  
ATOM 10424 H HB3    . LEU C 2 6  ? -10.292 0.099   -5.229  1.00 2.69  ? 6  LEU A HB3    4  
ATOM 10425 H HG     . LEU C 2 6  ? -9.338  -2.597  -6.107  1.00 2.21  ? 6  LEU A HG     4  
ATOM 10426 H HD11   . LEU C 2 6  ? -9.201  -2.226  -3.735  1.00 2.76  ? 6  LEU A HD11   4  
ATOM 10427 H HD12   . LEU C 2 6  ? -10.555 -3.306  -4.066  1.00 2.47  ? 6  LEU A HD12   4  
ATOM 10428 H HD13   . LEU C 2 6  ? -10.851 -1.606  -3.699  1.00 2.50  ? 6  LEU A HD13   4  
ATOM 10429 H HD21   . LEU C 2 6  ? -12.188 -2.378  -5.626  1.00 2.34  ? 6  LEU A HD21   4  
ATOM 10430 H HD22   . LEU C 2 6  ? -11.325 -3.112  -6.980  1.00 2.39  ? 6  LEU A HD22   4  
ATOM 10431 H HD23   . LEU C 2 6  ? -11.668 -1.379  -6.986  1.00 2.51  ? 6  LEU A HD23   4  
ATOM 10432 N N      . TYR C 2 7  ? -10.044 2.366   -7.504  1.00 3.13  ? 7  TYR A N      4  
ATOM 10433 C CA     . TYR C 2 7  ? -10.746 3.647   -7.657  1.00 3.41  ? 7  TYR A CA     4  
ATOM 10434 C C      . TYR C 2 7  ? -11.510 3.688   -8.978  1.00 3.42  ? 7  TYR A C      4  
ATOM 10435 O O      . TYR C 2 7  ? -12.627 4.193   -9.065  1.00 3.50  ? 7  TYR A O      4  
ATOM 10436 C CB     . TYR C 2 7  ? -9.747  4.806   -7.662  1.00 3.74  ? 7  TYR A CB     4  
ATOM 10437 C CG     . TYR C 2 7  ? -9.294  5.278   -6.306  1.00 3.86  ? 7  TYR A CG     4  
ATOM 10438 C CD1    . TYR C 2 7  ? -10.210 5.797   -5.401  1.00 3.98  ? 7  TYR A CD1    4  
ATOM 10439 C CD2    . TYR C 2 7  ? -7.966  5.170   -5.910  1.00 3.89  ? 7  TYR A CD2    4  
ATOM 10440 C CE1    . TYR C 2 7  ? -9.816  6.204   -4.144  1.00 4.16  ? 7  TYR A CE1    4  
ATOM 10441 C CE2    . TYR C 2 7  ? -7.566  5.568   -4.650  1.00 4.04  ? 7  TYR A CE2    4  
ATOM 10442 C CZ     . TYR C 2 7  ? -8.423  6.208   -3.838  1.00 4.20  ? 7  TYR A CZ     4  
ATOM 10443 O OH     . TYR C 2 7  ? -8.103  6.478   -2.512  1.00 4.39  ? 7  TYR A OH     4  
ATOM 10444 H H      . TYR C 2 7  ? -9.067  2.357   -7.507  1.00 3.16  ? 7  TYR A H      4  
ATOM 10445 H HA     . TYR C 2 7  ? -11.434 3.765   -6.835  1.00 3.41  ? 7  TYR A HA     4  
ATOM 10446 H HB2    . TYR C 2 7  ? -8.864  4.500   -8.203  1.00 3.72  ? 7  TYR A HB2    4  
ATOM 10447 H HB3    . TYR C 2 7  ? -10.194 5.647   -8.172  1.00 3.94  ? 7  TYR A HB3    4  
ATOM 10448 H HD1    . TYR C 2 7  ? -11.245 5.889   -5.696  1.00 3.96  ? 7  TYR A HD1    4  
ATOM 10449 H HD2    . TYR C 2 7  ? -7.239  4.772   -6.609  1.00 3.82  ? 7  TYR A HD2    4  
ATOM 10450 H HE1    . TYR C 2 7  ? -10.544 6.609   -3.458  1.00 4.30  ? 7  TYR A HE1    4  
ATOM 10451 H HE2    . TYR C 2 7  ? -6.531  5.479   -4.360  1.00 4.07  ? 7  TYR A HE2    4  
ATOM 10452 H HH     . TYR C 2 7  ? -8.860  6.440   -1.917  1.00 4.61  ? 7  TYR A HH     4  
ATOM 10453 N N      . ASP C 2 8  ? -10.872 3.128   -9.990  1.00 3.37  ? 8  ASP A N      4  
ATOM 10454 C CA     . ASP C 2 8  ? -11.380 3.091   -11.354 1.00 3.45  ? 8  ASP A CA     4  
ATOM 10455 C C      . ASP C 2 8  ? -12.632 2.247   -11.433 1.00 3.21  ? 8  ASP A C      4  
ATOM 10456 O O      . ASP C 2 8  ? -13.616 2.633   -12.063 1.00 3.31  ? 8  ASP A O      4  
ATOM 10457 C CB     . ASP C 2 8  ? -10.284 2.553   -12.283 1.00 3.49  ? 8  ASP A CB     4  
ATOM 10458 C CG     . ASP C 2 8  ? -9.180  3.560   -12.527 1.00 3.79  ? 8  ASP A CG     4  
ATOM 10459 O OD1    . ASP C 2 8  ? -9.492  4.666   -13.022 1.00 4.13  ? 8  ASP A OD1    4  
ATOM 10460 O OD2    . ASP C 2 8  ? -8.003  3.249   -12.237 1.00 3.72  ? 8  ASP A OD2    4  
ATOM 10461 H H      . ASP C 2 8  ? -10.036 2.674   -9.802  1.00 3.28  ? 8  ASP A H      4  
ATOM 10462 H HA     . ASP C 2 8  ? -11.624 4.095   -11.653 1.00 3.70  ? 8  ASP A HA     4  
ATOM 10463 H HB2    . ASP C 2 8  ? -9.843  1.683   -11.822 1.00 3.28  ? 8  ASP A HB2    4  
ATOM 10464 H HB3    . ASP C 2 8  ? -10.704 2.269   -13.235 1.00 3.52  ? 8  ASP A HB3    4  
ATOM 10465 N N      . VAL C 2 9  ? -12.597 1.098   -10.775 1.00 2.91  ? 9  VAL A N      4  
ATOM 10466 C CA     . VAL C 2 9  ? -13.732 0.206   -10.764 1.00 2.70  ? 9  VAL A CA     4  
ATOM 10467 C C      . VAL C 2 9  ? -14.854 0.850   -9.984  1.00 2.72  ? 9  VAL A C      4  
ATOM 10468 O O      . VAL C 2 9  ? -16.014 0.794   -10.364 1.00 2.70  ? 9  VAL A O      4  
ATOM 10469 C CB     . VAL C 2 9  ? -13.367 -1.140  -10.124 1.00 2.43  ? 9  VAL A CB     4  
ATOM 10470 C CG1    . VAL C 2 9  ? -14.585 -2.025  -10.005 1.00 2.28  ? 9  VAL A CG1    4  
ATOM 10471 C CG2    . VAL C 2 9  ? -12.287 -1.838  -10.920 1.00 2.45  ? 9  VAL A CG2    4  
ATOM 10472 H H      . VAL C 2 9  ? -11.814 0.876   -10.227 1.00 2.85  ? 9  VAL A H      4  
ATOM 10473 H HA     . VAL C 2 9  ? -14.054 0.040   -11.788 1.00 2.77  ? 9  VAL A HA     4  
ATOM 10474 H HB     . VAL C 2 9  ? -12.988 -0.947  -9.131  1.00 2.40  ? 9  VAL A HB     4  
ATOM 10475 H HG11   . VAL C 2 9  ? -15.230 -1.646  -9.228  1.00 2.36  ? 9  VAL A HG11   4  
ATOM 10476 H HG12   . VAL C 2 9  ? -14.273 -3.032  -9.762  1.00 2.36  ? 9  VAL A HG12   4  
ATOM 10477 H HG13   . VAL C 2 9  ? -15.115 -2.025  -10.949 1.00 2.64  ? 9  VAL A HG13   4  
ATOM 10478 H HG21   . VAL C 2 9  ? -11.326 -1.644  -10.467 1.00 2.71  ? 9  VAL A HG21   4  
ATOM 10479 H HG22   . VAL C 2 9  ? -12.289 -1.463  -11.934 1.00 2.80  ? 9  VAL A HG22   4  
ATOM 10480 H HG23   . VAL C 2 9  ? -12.479 -2.906  -10.929 1.00 2.48  ? 9  VAL A HG23   4  
ATOM 10481 N N      . ALA C 2 10 ? -14.465 1.477   -8.895  1.00 2.80  ? 10 ALA A N      4  
ATOM 10482 C CA     . ALA C 2 10 ? -15.398 2.157   -8.009  1.00 2.91  ? 10 ALA A CA     4  
ATOM 10483 C C      . ALA C 2 10 ? -16.179 3.230   -8.747  1.00 3.14  ? 10 ALA A C      4  
ATOM 10484 O O      . ALA C 2 10 ? -17.409 3.290   -8.667  1.00 3.12  ? 10 ALA A O      4  
ATOM 10485 C CB     . ALA C 2 10 ? -14.622 2.750   -6.851  1.00 3.09  ? 10 ALA A CB     4  
ATOM 10486 H H      . ALA C 2 10 ? -13.497 1.492   -8.679  1.00 2.83  ? 10 ALA A H      4  
ATOM 10487 H HA     . ALA C 2 10 ? -16.099 1.430   -7.616  1.00 2.75  ? 10 ALA A HA     4  
ATOM 10488 H HB1    . ALA C 2 10 ? -14.930 3.773   -6.693  1.00 3.39  ? 10 ALA A HB1    4  
ATOM 10489 H HB2    . ALA C 2 10 ? -13.562 2.723   -7.090  1.00 3.18  ? 10 ALA A HB2    4  
ATOM 10490 H HB3    . ALA C 2 10 ? -14.807 2.171   -5.959  1.00 3.24  ? 10 ALA A HB3    4  
ATOM 10491 N N      . GLU C 2 11 ? -15.468 4.040   -9.509  1.00 3.37  ? 11 GLU A N      4  
ATOM 10492 C CA     . GLU C 2 11 ? -16.092 5.119   -10.259 1.00 3.64  ? 11 GLU A CA     4  
ATOM 10493 C C      . GLU C 2 11 ? -16.990 4.540   -11.332 1.00 3.52  ? 11 GLU A C      4  
ATOM 10494 O O      . GLU C 2 11 ? -18.154 4.915   -11.463 1.00 3.57  ? 11 GLU A O      4  
ATOM 10495 C CB     . GLU C 2 11 ? -15.041 6.032   -10.896 1.00 3.95  ? 11 GLU A CB     4  
ATOM 10496 C CG     . GLU C 2 11 ? -14.857 7.358   -10.175 1.00 4.31  ? 11 GLU A CG     4  
ATOM 10497 C CD     . GLU C 2 11 ? -14.767 8.533   -11.130 1.00 4.89  ? 11 GLU A CD     4  
ATOM 10498 O OE1    . GLU C 2 11 ? -13.836 8.559   -11.964 1.00 5.24  ? 11 GLU A OE1    4  
ATOM 10499 O OE2    . GLU C 2 11 ? -15.627 9.438   -11.055 1.00 5.23  ? 11 GLU A OE2    4  
ATOM 10500 H H      . GLU C 2 11 ? -14.500 3.883   -9.597  1.00 3.37  ? 11 GLU A H      4  
ATOM 10501 H HA     . GLU C 2 11 ? -16.699 5.692   -9.570  1.00 3.74  ? 11 GLU A HA     4  
ATOM 10502 H HB2    . GLU C 2 11 ? -14.092 5.517   -10.901 1.00 3.90  ? 11 GLU A HB2    4  
ATOM 10503 H HB3    . GLU C 2 11 ? -15.332 6.240   -11.916 1.00 4.15  ? 11 GLU A HB3    4  
ATOM 10504 H HG2    . GLU C 2 11 ? -15.697 7.514   -9.515  1.00 4.29  ? 11 GLU A HG2    4  
ATOM 10505 H HG3    . GLU C 2 11 ? -13.947 7.314   -9.595  1.00 4.50  ? 11 GLU A HG3    4  
ATOM 10506 N N      . TYR C 2 12 ? -16.427 3.616   -12.092 1.00 3.40  ? 12 TYR A N      4  
ATOM 10507 C CA     . TYR C 2 12 ? -17.139 2.956   -13.168 1.00 3.35  ? 12 TYR A CA     4  
ATOM 10508 C C      . TYR C 2 12 ? -18.360 2.188   -12.650 1.00 3.08  ? 12 TYR A C      4  
ATOM 10509 O O      . TYR C 2 12 ? -19.340 2.015   -13.375 1.00 3.11  ? 12 TYR A O      4  
ATOM 10510 C CB     . TYR C 2 12 ? -16.190 2.003   -13.883 1.00 3.31  ? 12 TYR A CB     4  
ATOM 10511 C CG     . TYR C 2 12 ? -16.776 1.366   -15.113 1.00 3.39  ? 12 TYR A CG     4  
ATOM 10512 C CD1    . TYR C 2 12 ? -17.135 2.149   -16.189 1.00 3.70  ? 12 TYR A CD1    4  
ATOM 10513 C CD2    . TYR C 2 12 ? -16.976 -0.004  -15.199 1.00 3.19  ? 12 TYR A CD2    4  
ATOM 10514 C CE1    . TYR C 2 12 ? -17.676 1.603   -17.322 1.00 3.82  ? 12 TYR A CE1    4  
ATOM 10515 C CE2    . TYR C 2 12 ? -17.521 -0.570  -16.336 1.00 3.34  ? 12 TYR A CE2    4  
ATOM 10516 C CZ     . TYR C 2 12 ? -17.847 0.144   -17.360 1.00 3.64  ? 12 TYR A CZ     4  
ATOM 10517 O OH     . TYR C 2 12 ? -18.417 -0.319  -18.531 1.00 3.82  ? 12 TYR A OH     4  
ATOM 10518 H H      . TYR C 2 12 ? -15.492 3.365   -11.920 1.00 3.37  ? 12 TYR A H      4  
ATOM 10519 H HA     . TYR C 2 12 ? -17.468 3.711   -13.863 1.00 3.57  ? 12 TYR A HA     4  
ATOM 10520 H HB2    . TYR C 2 12 ? -15.301 2.537   -14.176 1.00 3.49  ? 12 TYR A HB2    4  
ATOM 10521 H HB3    . TYR C 2 12 ? -15.914 1.209   -13.205 1.00 3.08  ? 12 TYR A HB3    4  
ATOM 10522 H HD1    . TYR C 2 12 ? -16.976 3.226   -16.134 1.00 3.88  ? 12 TYR A HD1    4  
ATOM 10523 H HD2    . TYR C 2 12 ? -16.700 -0.630  -14.365 1.00 2.97  ? 12 TYR A HD2    4  
ATOM 10524 H HE1    . TYR C 2 12 ? -17.952 2.250   -18.144 1.00 4.08  ? 12 TYR A HE1    4  
ATOM 10525 H HE2    . TYR C 2 12 ? -17.671 -1.638  -16.390 1.00 3.25  ? 12 TYR A HE2    4  
ATOM 10526 H HH     . TYR C 2 12 ? -18.191 0.219   -19.299 1.00 4.13  ? 12 TYR A HH     4  
ATOM 10527 N N      . ALA C 2 13 ? -18.307 1.740   -11.400 1.00 2.87  ? 13 ALA A N      4  
ATOM 10528 C CA     . ALA C 2 13 ? -19.420 0.992   -10.827 1.00 2.66  ? 13 ALA A CA     4  
ATOM 10529 C C      . ALA C 2 13 ? -20.467 1.958   -10.305 1.00 2.78  ? 13 ALA A C      4  
ATOM 10530 O O      . ALA C 2 13 ? -21.656 1.647   -10.230 1.00 2.70  ? 13 ALA A O      4  
ATOM 10531 C CB     . ALA C 2 13 ? -18.942 0.113   -9.698  1.00 2.47  ? 13 ALA A CB     4  
ATOM 10532 H H      . ALA C 2 13 ? -17.511 1.934   -10.840 1.00 2.89  ? 13 ALA A H      4  
ATOM 10533 H HA     . ALA C 2 13 ? -19.846 0.354   -11.600 1.00 2.61  ? 13 ALA A HA     4  
ATOM 10534 H HB1    . ALA C 2 13 ? -18.297 -0.660  -10.093 1.00 2.73  ? 13 ALA A HB1    4  
ATOM 10535 H HB2    . ALA C 2 13 ? -19.797 -0.335  -9.207  1.00 2.66  ? 13 ALA A HB2    4  
ATOM 10536 H HB3    . ALA C 2 13 ? -18.395 0.715   -8.988  1.00 2.52  ? 13 ALA A HB3    4  
ATOM 10537 N N      . GLY C 2 14 ? -19.997 3.137   -9.933  1.00 3.02  ? 14 GLY A N      4  
ATOM 10538 C CA     . GLY C 2 14 ? -20.868 4.168   -9.431  1.00 3.22  ? 14 GLY A CA     4  
ATOM 10539 C C      . GLY C 2 14 ? -21.033 4.052   -7.947  1.00 3.21  ? 14 GLY A C      4  
ATOM 10540 O O      . GLY C 2 14 ? -22.092 4.346   -7.388  1.00 3.28  ? 14 GLY A O      4  
ATOM 10541 H H      . GLY C 2 14 ? -19.026 3.280   -9.937  1.00 3.08  ? 14 GLY A H      4  
ATOM 10542 H HA2    . GLY C 2 14 ? -20.448 5.129   -9.670  1.00 3.45  ? 14 GLY A HA2    4  
ATOM 10543 H HA3    . GLY C 2 14 ? -21.829 4.065   -9.900  1.00 3.18  ? 14 GLY A HA3    4  
ATOM 10544 N N      . VAL C 2 15 ? -19.964 3.613   -7.317  1.00 3.16  ? 15 VAL A N      4  
ATOM 10545 C CA     . VAL C 2 15 ? -19.932 3.399   -5.886  1.00 3.22  ? 15 VAL A CA     4  
ATOM 10546 C C      . VAL C 2 15 ? -18.624 3.896   -5.322  1.00 3.39  ? 15 VAL A C      4  
ATOM 10547 O O      . VAL C 2 15 ? -17.605 3.855   -6.003  1.00 3.33  ? 15 VAL A O      4  
ATOM 10548 C CB     . VAL C 2 15 ? -20.085 1.915   -5.551  1.00 2.96  ? 15 VAL A CB     4  
ATOM 10549 C CG1    . VAL C 2 15 ? -21.510 1.466   -5.749  1.00 2.89  ? 15 VAL A CG1    4  
ATOM 10550 C CG2    . VAL C 2 15 ? -19.160 1.114   -6.423  1.00 2.72  ? 15 VAL A CG2    4  
ATOM 10551 H H      . VAL C 2 15 ? -19.134 3.445   -7.845  1.00 3.12  ? 15 VAL A H      4  
ATOM 10552 H HA     . VAL C 2 15 ? -20.749 3.944   -5.439  1.00 3.38  ? 15 VAL A HA     4  
ATOM 10553 H HB     . VAL C 2 15 ? -19.809 1.757   -4.519  1.00 3.04  ? 15 VAL A HB     4  
ATOM 10554 H HG11   . VAL C 2 15 ? -22.167 2.084   -5.157  1.00 2.96  ? 15 VAL A HG11   4  
ATOM 10555 H HG12   . VAL C 2 15 ? -21.604 0.436   -5.440  1.00 3.04  ? 15 VAL A HG12   4  
ATOM 10556 H HG13   . VAL C 2 15 ? -21.765 1.562   -6.797  1.00 3.14  ? 15 VAL A HG13   4  
ATOM 10557 H HG21   . VAL C 2 15 ? -18.141 1.342   -6.154  1.00 2.95  ? 15 VAL A HG21   4  
ATOM 10558 H HG22   . VAL C 2 15 ? -19.329 1.381   -7.460  1.00 2.86  ? 15 VAL A HG22   4  
ATOM 10559 H HG23   . VAL C 2 15 ? -19.348 0.062   -6.282  1.00 2.74  ? 15 VAL A HG23   4  
ATOM 10560 N N      . SER C 2 16 ? -18.651 4.407   -4.110  1.00 3.63  ? 16 SER A N      4  
ATOM 10561 C CA     . SER C 2 16 ? -17.434 4.902   -3.504  1.00 3.82  ? 16 SER A CA     4  
ATOM 10562 C C      . SER C 2 16 ? -16.379 3.811   -3.479  1.00 3.58  ? 16 SER A C      4  
ATOM 10563 O O      . SER C 2 16 ? -16.684 2.619   -3.412  1.00 3.34  ? 16 SER A O      4  
ATOM 10564 C CB     . SER C 2 16 ? -17.682 5.439   -2.103  1.00 4.13  ? 16 SER A CB     4  
ATOM 10565 O OG     . SER C 2 16 ? -18.637 6.486   -2.131  1.00 4.34  ? 16 SER A OG     4  
ATOM 10566 H H      . SER C 2 16 ? -19.479 4.380   -3.592  1.00 3.69  ? 16 SER A H      4  
ATOM 10567 H HA     . SER C 2 16 ? -17.068 5.708   -4.124  1.00 3.95  ? 16 SER A HA     4  
ATOM 10568 H HB2    . SER C 2 16 ? -18.044 4.645   -1.477  1.00 4.23  ? 16 SER A HB2    4  
ATOM 10569 H HB3    . SER C 2 16 ? -16.757 5.823   -1.700  1.00 4.25  ? 16 SER A HB3    4  
ATOM 10570 H HG     . SER C 2 16 ? -18.869 6.686   -3.043  1.00 4.52  ? 16 SER A HG     4  
ATOM 10571 N N      . TYR C 2 17 ? -15.150 4.243   -3.540  1.00 3.68  ? 17 TYR A N      4  
ATOM 10572 C CA     . TYR C 2 17 ? -13.996 3.361   -3.544  1.00 3.49  ? 17 TYR A CA     4  
ATOM 10573 C C      . TYR C 2 17 ? -14.028 2.363   -2.400  1.00 3.42  ? 17 TYR A C      4  
ATOM 10574 O O      . TYR C 2 17 ? -13.918 1.155   -2.602  1.00 3.16  ? 17 TYR A O      4  
ATOM 10575 C CB     . TYR C 2 17 ? -12.759 4.222   -3.401  1.00 3.71  ? 17 TYR A CB     4  
ATOM 10576 C CG     . TYR C 2 17 ? -11.528 3.415   -3.182  1.00 3.56  ? 17 TYR A CG     4  
ATOM 10577 C CD1    . TYR C 2 17 ? -10.965 2.727   -4.230  1.00 3.31  ? 17 TYR A CD1    4  
ATOM 10578 C CD2    . TYR C 2 17 ? -10.933 3.331   -1.930  1.00 3.69  ? 17 TYR A CD2    4  
ATOM 10579 C CE1    . TYR C 2 17 ? -9.845  1.979   -4.058  1.00 3.18  ? 17 TYR A CE1    4  
ATOM 10580 C CE2    . TYR C 2 17 ? -9.800  2.576   -1.745  1.00 3.55  ? 17 TYR A CE2    4  
ATOM 10581 C CZ     . TYR C 2 17 ? -9.257  1.901   -2.816  1.00 3.28  ? 17 TYR A CZ     4  
ATOM 10582 O OH     . TYR C 2 17 ? -8.132  1.146   -2.644  1.00 3.16  ? 17 TYR A OH     4  
ATOM 10583 H H      . TYR C 2 17 ? -15.004 5.209   -3.574  1.00 3.91  ? 17 TYR A H      4  
ATOM 10584 H HA     . TYR C 2 17 ? -13.944 2.825   -4.485  1.00 3.28  ? 17 TYR A HA     4  
ATOM 10585 H HB2    . TYR C 2 17 ? -12.628 4.804   -4.294  1.00 3.77  ? 17 TYR A HB2    4  
ATOM 10586 H HB3    . TYR C 2 17 ? -12.879 4.884   -2.560  1.00 3.95  ? 17 TYR A HB3    4  
ATOM 10587 H HD1    . TYR C 2 17 ? -11.426 2.783   -5.205  1.00 3.25  ? 17 TYR A HD1    4  
ATOM 10588 H HD2    . TYR C 2 17 ? -11.377 3.858   -1.093  1.00 3.91  ? 17 TYR A HD2    4  
ATOM 10589 H HE1    . TYR C 2 17 ? -9.434  1.448   -4.902  1.00 3.01  ? 17 TYR A HE1    4  
ATOM 10590 H HE2    . TYR C 2 17 ? -9.345  2.517   -0.772  1.00 3.68  ? 17 TYR A HE2    4  
ATOM 10591 H HH     . TYR C 2 17 ? -7.436  1.476   -3.221  1.00 3.43  ? 17 TYR A HH     4  
ATOM 10592 N N      . GLN C 2 18 ? -14.242 2.893   -1.212  1.00 3.70  ? 18 GLN A N      4  
ATOM 10593 C CA     . GLN C 2 18 ? -14.241 2.102   0.014   1.00 3.76  ? 18 GLN A CA     4  
ATOM 10594 C C      . GLN C 2 18 ? -15.379 1.083   0.023   1.00 3.60  ? 18 GLN A C      4  
ATOM 10595 O O      . GLN C 2 18 ? -15.329 0.088   0.752   1.00 3.59  ? 18 GLN A O      4  
ATOM 10596 C CB     . GLN C 2 18 ? -14.296 3.021   1.239   1.00 4.16  ? 18 GLN A CB     4  
ATOM 10597 C CG     . GLN C 2 18 ? -13.978 4.484   0.932   1.00 4.57  ? 18 GLN A CG     4  
ATOM 10598 C CD     . GLN C 2 18 ? -13.067 5.123   1.956   1.00 5.01  ? 18 GLN A CD     4  
ATOM 10599 O OE1    . GLN C 2 18 ? -13.197 6.303   2.264   1.00 5.50  ? 18 GLN A OE1    4  
ATOM 10600 N NE2    . GLN C 2 18 ? -12.121 4.355   2.474   1.00 5.22  ? 18 GLN A NE2    4  
ATOM 10601 H H      . GLN C 2 18 ? -14.436 3.848   -1.166  1.00 3.91  ? 18 GLN A H      4  
ATOM 10602 H HA     . GLN C 2 18 ? -13.307 1.558   0.039   1.00 3.66  ? 18 GLN A HA     4  
ATOM 10603 H HB2    . GLN C 2 18 ? -15.281 2.971   1.674   1.00 4.34  ? 18 GLN A HB2    4  
ATOM 10604 H HB3    . GLN C 2 18 ? -13.572 2.672   1.960   1.00 4.27  ? 18 GLN A HB3    4  
ATOM 10605 H HG2    . GLN C 2 18 ? -13.488 4.539   -0.025  1.00 4.81  ? 18 GLN A HG2    4  
ATOM 10606 H HG3    . GLN C 2 18 ? -14.903 5.041   0.896   1.00 4.76  ? 18 GLN A HG3    4  
ATOM 10607 H HE21   . GLN C 2 18 ? -12.061 3.426   2.173   1.00 5.10  ? 18 GLN A HE21   4  
ATOM 10608 H HE22   . GLN C 2 18 ? -11.522 4.751   3.139   1.00 5.71  ? 18 GLN A HE22   4  
ATOM 10609 N N      . THR C 2 19 ? -16.393 1.333   -0.798  1.00 3.52  ? 19 THR A N      4  
ATOM 10610 C CA     . THR C 2 19 ? -17.529 0.435   -0.930  1.00 3.39  ? 19 THR A CA     4  
ATOM 10611 C C      . THR C 2 19 ? -17.102 -0.864  -1.618  1.00 3.07  ? 19 THR A C      4  
ATOM 10612 O O      . THR C 2 19 ? -17.172 -1.944  -1.029  1.00 3.08  ? 19 THR A O      4  
ATOM 10613 C CB     . THR C 2 19 ? -18.651 1.104   -1.760  1.00 3.36  ? 19 THR A CB     4  
ATOM 10614 O OG1    . THR C 2 19 ? -18.845 2.450   -1.311  1.00 3.65  ? 19 THR A OG1    4  
ATOM 10615 C CG2    . THR C 2 19 ? -19.959 0.345   -1.651  1.00 3.31  ? 19 THR A CG2    4  
ATOM 10616 H H      . THR C 2 19 ? -16.375 2.145   -1.340  1.00 3.56  ? 19 THR A H      4  
ATOM 10617 H HA     . THR C 2 19 ? -17.911 0.203   0.052   1.00 3.57  ? 19 THR A HA     4  
ATOM 10618 H HB     . THR C 2 19 ? -18.354 1.120   -2.804  1.00 3.20  ? 19 THR A HB     4  
ATOM 10619 H HG1    . THR C 2 19 ? -19.785 2.611   -1.171  1.00 3.86  ? 19 THR A HG1    4  
ATOM 10620 H HG21   . THR C 2 19 ? -20.202 0.198   -0.612  1.00 3.18  ? 19 THR A HG21   4  
ATOM 10621 H HG22   . THR C 2 19 ? -19.862 -0.617  -2.144  1.00 3.58  ? 19 THR A HG22   4  
ATOM 10622 H HG23   . THR C 2 19 ? -20.738 0.920   -2.130  1.00 3.59  ? 19 THR A HG23   4  
ATOM 10623 N N      . VAL C 2 20 ? -16.621 -0.741  -2.853  1.00 2.85  ? 20 VAL A N      4  
ATOM 10624 C CA     . VAL C 2 20 ? -16.203 -1.897  -3.634  1.00 2.58  ? 20 VAL A CA     4  
ATOM 10625 C C      . VAL C 2 20 ? -14.952 -2.557  -3.064  1.00 2.57  ? 20 VAL A C      4  
ATOM 10626 O O      . VAL C 2 20 ? -14.754 -3.761  -3.233  1.00 2.46  ? 20 VAL A O      4  
ATOM 10627 C CB     . VAL C 2 20 ? -16.045 -1.554  -5.139  1.00 2.42  ? 20 VAL A CB     4  
ATOM 10628 C CG1    . VAL C 2 20 ? -16.408 -0.109  -5.409  1.00 2.61  ? 20 VAL A CG1    4  
ATOM 10629 C CG2    . VAL C 2 20 ? -14.661 -1.829  -5.691  1.00 2.31  ? 20 VAL A CG2    4  
ATOM 10630 H H      . VAL C 2 20 ? -16.548 0.151   -3.251  1.00 2.91  ? 20 VAL A H      4  
ATOM 10631 H HA     . VAL C 2 20 ? -17.002 -2.618  -3.557  1.00 2.56  ? 20 VAL A HA     4  
ATOM 10632 H HB     . VAL C 2 20 ? -16.743 -2.180  -5.674  1.00 2.31  ? 20 VAL A HB     4  
ATOM 10633 H HG11   . VAL C 2 20 ? -17.360 0.113   -4.951  1.00 2.67  ? 20 VAL A HG11   4  
ATOM 10634 H HG12   . VAL C 2 20 ? -16.476 0.048   -6.478  1.00 3.01  ? 20 VAL A HG12   4  
ATOM 10635 H HG13   . VAL C 2 20 ? -15.648 0.537   -4.996  1.00 2.85  ? 20 VAL A HG13   4  
ATOM 10636 H HG21   . VAL C 2 20 ? -14.743 -1.995  -6.761  1.00 2.50  ? 20 VAL A HG21   4  
ATOM 10637 H HG22   . VAL C 2 20 ? -14.248 -2.707  -5.216  1.00 2.55  ? 20 VAL A HG22   4  
ATOM 10638 H HG23   . VAL C 2 20 ? -14.020 -0.971  -5.504  1.00 2.42  ? 20 VAL A HG23   4  
ATOM 10639 N N      . SER C 2 21 ? -14.108 -1.779  -2.405  1.00 2.73  ? 21 SER A N      4  
ATOM 10640 C CA     . SER C 2 21 ? -12.908 -2.328  -1.783  1.00 2.74  ? 21 SER A CA     4  
ATOM 10641 C C      . SER C 2 21 ? -13.285 -3.457  -0.821  1.00 2.85  ? 21 SER A C      4  
ATOM 10642 O O      . SER C 2 21 ? -12.676 -4.527  -0.829  1.00 2.78  ? 21 SER A O      4  
ATOM 10643 C CB     . SER C 2 21 ? -12.128 -1.239  -1.035  1.00 2.97  ? 21 SER A CB     4  
ATOM 10644 O OG     . SER C 2 21 ? -11.586 -0.289  -1.934  1.00 3.19  ? 21 SER A OG     4  
ATOM 10645 H H      . SER C 2 21 ? -14.281 -0.813  -2.361  1.00 2.86  ? 21 SER A H      4  
ATOM 10646 H HA     . SER C 2 21 ? -12.289 -2.737  -2.564  1.00 2.56  ? 21 SER A HA     4  
ATOM 10647 H HB2    . SER C 2 21 ? -12.793 -0.730  -0.352  1.00 3.15  ? 21 SER A HB2    4  
ATOM 10648 H HB3    . SER C 2 21 ? -11.321 -1.693  -0.481  1.00 3.14  ? 21 SER A HB3    4  
ATOM 10649 H HG     . SER C 2 21 ? -10.730 -0.598  -2.248  1.00 3.29  ? 21 SER A HG     4  
ATOM 10650 N N      . ARG C 2 22 ? -14.315 -3.214  -0.017  1.00 3.06  ? 22 ARG A N      4  
ATOM 10651 C CA     . ARG C 2 22 ? -14.798 -4.203  0.940   1.00 3.25  ? 22 ARG A CA     4  
ATOM 10652 C C      . ARG C 2 22 ? -15.468 -5.341  0.196   1.00 3.12  ? 22 ARG A C      4  
ATOM 10653 O O      . ARG C 2 22 ? -15.468 -6.482  0.644   1.00 3.25  ? 22 ARG A O      4  
ATOM 10654 C CB     . ARG C 2 22 ? -15.771 -3.538  1.933   1.00 3.54  ? 22 ARG A CB     4  
ATOM 10655 C CG     . ARG C 2 22 ? -17.130 -4.221  2.039   1.00 3.73  ? 22 ARG A CG     4  
ATOM 10656 C CD     . ARG C 2 22 ? -18.160 -3.327  2.712   1.00 3.83  ? 22 ARG A CD     4  
ATOM 10657 N NE     . ARG C 2 22 ? -18.084 -3.397  4.172   1.00 3.92  ? 22 ARG A NE     4  
ATOM 10658 C CZ     . ARG C 2 22 ? -19.088 -3.063  4.986   1.00 4.17  ? 22 ARG A CZ     4  
ATOM 10659 N NH1    . ARG C 2 22 ? -20.241 -2.631  4.482   1.00 4.31  ? 22 ARG A NH1    4  
ATOM 10660 N NH2    . ARG C 2 22 ? -18.937 -3.162  6.303   1.00 4.44  ? 22 ARG A NH2    4  
ATOM 10661 H H      . ARG C 2 22 ? -14.787 -2.360  -0.092  1.00 3.12  ? 22 ARG A H      4  
ATOM 10662 H HA     . ARG C 2 22 ? -13.950 -4.601  1.477   1.00 3.32  ? 22 ARG A HA     4  
ATOM 10663 H HB2    . ARG C 2 22 ? -15.319 -3.539  2.913   1.00 3.74  ? 22 ARG A HB2    4  
ATOM 10664 H HB3    . ARG C 2 22 ? -15.934 -2.514  1.625   1.00 3.64  ? 22 ARG A HB3    4  
ATOM 10665 H HG2    . ARG C 2 22 ? -17.477 -4.465  1.046   1.00 3.93  ? 22 ARG A HG2    4  
ATOM 10666 H HG3    . ARG C 2 22 ? -17.021 -5.127  2.616   1.00 3.83  ? 22 ARG A HG3    4  
ATOM 10667 H HD2    . ARG C 2 22 ? -17.989 -2.307  2.403   1.00 3.85  ? 22 ARG A HD2    4  
ATOM 10668 H HD3    . ARG C 2 22 ? -19.146 -3.637  2.397   1.00 4.03  ? 22 ARG A HD3    4  
ATOM 10669 H HE     . ARG C 2 22 ? -17.241 -3.712  4.563   1.00 3.94  ? 22 ARG A HE     4  
ATOM 10670 H HH11   . ARG C 2 22 ? -20.358 -2.554  3.491   1.00 4.31  ? 22 ARG A HH11   4  
ATOM 10671 H HH12   . ARG C 2 22 ? -21.003 -2.394  5.087   1.00 4.55  ? 22 ARG A HH12   4  
ATOM 10672 H HH21   . ARG C 2 22 ? -18.071 -3.489  6.687   1.00 4.53  ? 22 ARG A HH21   4  
ATOM 10673 H HH22   . ARG C 2 22 ? -19.688 -2.913  6.916   1.00 4.68  ? 22 ARG A HH22   4  
ATOM 10674 N N      . VAL C 2 23 ? -16.015 -5.013  -0.961  1.00 2.91  ? 23 VAL A N      4  
ATOM 10675 C CA     . VAL C 2 23 ? -16.700 -5.979  -1.787  1.00 2.82  ? 23 VAL A CA     4  
ATOM 10676 C C      . VAL C 2 23 ? -15.710 -7.011  -2.314  1.00 2.72  ? 23 VAL A C      4  
ATOM 10677 O O      . VAL C 2 23 ? -15.913 -8.217  -2.171  1.00 2.86  ? 23 VAL A O      4  
ATOM 10678 C CB     . VAL C 2 23 ? -17.401 -5.273  -2.964  1.00 2.62  ? 23 VAL A CB     4  
ATOM 10679 C CG1    . VAL C 2 23 ? -18.033 -6.277  -3.895  1.00 2.56  ? 23 VAL A CG1    4  
ATOM 10680 C CG2    . VAL C 2 23 ? -18.443 -4.283  -2.464  1.00 2.76  ? 23 VAL A CG2    4  
ATOM 10681 H H      . VAL C 2 23 ? -15.921 -4.096  -1.287  1.00 2.85  ? 23 VAL A H      4  
ATOM 10682 H HA     . VAL C 2 23 ? -17.447 -6.471  -1.186  1.00 3.00  ? 23 VAL A HA     4  
ATOM 10683 H HB     . VAL C 2 23 ? -16.656 -4.724  -3.519  1.00 2.48  ? 23 VAL A HB     4  
ATOM 10684 H HG11   . VAL C 2 23 ? -18.255 -5.787  -4.835  1.00 2.68  ? 23 VAL A HG11   4  
ATOM 10685 H HG12   . VAL C 2 23 ? -18.945 -6.651  -3.455  1.00 2.67  ? 23 VAL A HG12   4  
ATOM 10686 H HG13   . VAL C 2 23 ? -17.346 -7.088  -4.064  1.00 2.88  ? 23 VAL A HG13   4  
ATOM 10687 H HG21   . VAL C 2 23 ? -19.157 -4.084  -3.248  1.00 3.00  ? 23 VAL A HG21   4  
ATOM 10688 H HG22   . VAL C 2 23 ? -17.954 -3.357  -2.183  1.00 2.86  ? 23 VAL A HG22   4  
ATOM 10689 H HG23   . VAL C 2 23 ? -18.952 -4.696  -1.606  1.00 3.04  ? 23 VAL A HG23   4  
ATOM 10690 N N      . VAL C 2 24 ? -14.626 -6.510  -2.896  1.00 2.54  ? 24 VAL A N      4  
ATOM 10691 C CA     . VAL C 2 24 ? -13.573 -7.348  -3.448  1.00 2.46  ? 24 VAL A CA     4  
ATOM 10692 C C      . VAL C 2 24 ? -12.844 -8.132  -2.354  1.00 2.68  ? 24 VAL A C      4  
ATOM 10693 O O      . VAL C 2 24 ? -12.221 -9.161  -2.623  1.00 2.72  ? 24 VAL A O      4  
ATOM 10694 C CB     . VAL C 2 24 ? -12.577 -6.494  -4.288  1.00 2.28  ? 24 VAL A CB     4  
ATOM 10695 C CG1    . VAL C 2 24 ? -11.163 -6.518  -3.724  1.00 2.42  ? 24 VAL A CG1    4  
ATOM 10696 C CG2    . VAL C 2 24 ? -12.577 -6.953  -5.740  1.00 2.15  ? 24 VAL A CG2    4  
ATOM 10697 H H      . VAL C 2 24 ? -14.535 -5.533  -2.960  1.00 2.49  ? 24 VAL A H      4  
ATOM 10698 H HA     . VAL C 2 24 ? -14.038 -8.055  -4.112  1.00 2.45  ? 24 VAL A HA     4  
ATOM 10699 H HB     . VAL C 2 24 ? -12.923 -5.472  -4.266  1.00 2.37  ? 24 VAL A HB     4  
ATOM 10700 H HG11   . VAL C 2 24 ? -10.797 -7.535  -3.712  1.00 2.60  ? 24 VAL A HG11   4  
ATOM 10701 H HG12   . VAL C 2 24 ? -11.170 -6.126  -2.718  1.00 2.68  ? 24 VAL A HG12   4  
ATOM 10702 H HG13   . VAL C 2 24 ? -10.517 -5.912  -4.343  1.00 2.72  ? 24 VAL A HG13   4  
ATOM 10703 H HG21   . VAL C 2 24 ? -12.222 -7.973  -5.795  1.00 2.07  ? 24 VAL A HG21   4  
ATOM 10704 H HG22   . VAL C 2 24 ? -11.927 -6.314  -6.322  1.00 2.57  ? 24 VAL A HG22   4  
ATOM 10705 H HG23   . VAL C 2 24 ? -13.581 -6.900  -6.136  1.00 2.30  ? 24 VAL A HG23   4  
ATOM 10706 N N      . ASN C 2 25 ? -12.954 -7.661  -1.116  1.00 2.86  ? 25 ASN A N      4  
ATOM 10707 C CA     . ASN C 2 25 ? -12.270 -8.310  0.001   1.00 3.11  ? 25 ASN A CA     4  
ATOM 10708 C C      . ASN C 2 25 ? -13.211 -9.138  0.870   1.00 3.40  ? 25 ASN A C      4  
ATOM 10709 O O      . ASN C 2 25 ? -12.833 -9.517  1.979   1.00 3.68  ? 25 ASN A O      4  
ATOM 10710 C CB     . ASN C 2 25 ? -11.543 -7.270  0.853   1.00 3.26  ? 25 ASN A CB     4  
ATOM 10711 C CG     . ASN C 2 25 ? -10.226 -6.854  0.231   1.00 3.13  ? 25 ASN A CG     4  
ATOM 10712 O OD1    . ASN C 2 25 ? -9.171  -7.391  0.557   1.00 3.32  ? 25 ASN A OD1    4  
ATOM 10713 N ND2    . ASN C 2 25 ? -10.281 -5.905  -0.690  1.00 2.90  ? 25 ASN A ND2    4  
ATOM 10714 H H      . ASN C 2 25 ? -13.505 -6.862  -0.952  1.00 2.86  ? 25 ASN A H      4  
ATOM 10715 H HA     . ASN C 2 25 ? -11.532 -8.975  -0.421  1.00 3.04  ? 25 ASN A HA     4  
ATOM 10716 H HB2    . ASN C 2 25 ? -12.167 -6.394  0.955   1.00 3.28  ? 25 ASN A HB2    4  
ATOM 10717 H HB3    . ASN C 2 25 ? -11.345 -7.685  1.829   1.00 3.51  ? 25 ASN A HB3    4  
ATOM 10718 H HD21   . ASN C 2 25 ? -11.164 -5.529  -0.917  1.00 2.85  ? 25 ASN A HD21   4  
ATOM 10719 H HD22   . ASN C 2 25 ? -9.444  -5.617  -1.106  1.00 2.85  ? 25 ASN A HD22   4  
ATOM 10720 N N      . GLN C 2 26 ? -14.434 -9.370  0.363   1.00 3.38  ? 26 GLN A N      4  
ATOM 10721 C CA     . GLN C 2 26 ? -15.473 -10.186 1.023   1.00 3.69  ? 26 GLN A CA     4  
ATOM 10722 C C      . GLN C 2 26 ? -16.494 -9.278  1.664   1.00 3.73  ? 26 GLN A C      4  
ATOM 10723 O O      . GLN C 2 26 ? -16.480 -9.022  2.871   1.00 4.00  ? 26 GLN A O      4  
ATOM 10724 C CB     . GLN C 2 26 ? -14.931 -11.202 2.041   1.00 4.14  ? 26 GLN A CB     4  
ATOM 10725 C CG     . GLN C 2 26 ? -14.331 -12.449 1.405   1.00 4.79  ? 26 GLN A CG     4  
ATOM 10726 C CD     . GLN C 2 26 ? -15.377 -13.475 1.005   1.00 5.58  ? 26 GLN A CD     4  
ATOM 10727 O OE1    . GLN C 2 26 ? -16.519 -13.137 0.696   1.00 6.08  ? 26 GLN A OE1    4  
ATOM 10728 N NE2    . GLN C 2 26 ? -14.989 -14.741 1.010   1.00 6.01  ? 26 GLN A NE2    4  
ATOM 10729 H H      . GLN C 2 26 ? -14.683 -8.904  -0.470  1.00 3.18  ? 26 GLN A H      4  
ATOM 10730 H HA     . GLN C 2 26 ? -15.977 -10.732 0.235   1.00 3.74  ? 26 GLN A HA     4  
ATOM 10731 H HB2    . GLN C 2 26 ? -14.166 -10.725 2.637   1.00 4.26  ? 26 GLN A HB2    4  
ATOM 10732 H HB3    . GLN C 2 26 ? -15.738 -11.509 2.690   1.00 4.31  ? 26 GLN A HB3    4  
ATOM 10733 H HG2    . GLN C 2 26 ? -13.783 -12.156 0.521   1.00 4.93  ? 26 GLN A HG2    4  
ATOM 10734 H HG3    . GLN C 2 26 ? -13.653 -12.905 2.112   1.00 4.95  ? 26 GLN A HG3    4  
ATOM 10735 H HE21   . GLN C 2 26 ? -14.066 -14.942 1.267   1.00 5.84  ? 26 GLN A HE21   4  
ATOM 10736 H HE22   . GLN C 2 26 ? -15.641 -15.426 0.752   1.00 6.64  ? 26 GLN A HE22   4  
ATOM 10737 N N      . ALA C 2 27 ? -17.369 -8.785  0.814   1.00 3.79  ? 27 ALA A N      4  
ATOM 10738 C CA     . ALA C 2 27 ? -18.421 -7.880  1.207   1.00 3.98  ? 27 ALA A CA     4  
ATOM 10739 C C      . ALA C 2 27 ? -19.327 -8.485  2.275   1.00 4.29  ? 27 ALA A C      4  
ATOM 10740 O O      . ALA C 2 27 ? -19.725 -9.650  2.194   1.00 4.63  ? 27 ALA A O      4  
ATOM 10741 C CB     . ALA C 2 27 ? -19.195 -7.482  -0.028  1.00 3.84  ? 27 ALA A CB     4  
ATOM 10742 H H      . ALA C 2 27 ? -17.300 -9.043  -0.128  1.00 3.91  ? 27 ALA A H      4  
ATOM 10743 H HA     . ALA C 2 27 ? -17.958 -6.990  1.608   1.00 4.15  ? 27 ALA A HA     4  
ATOM 10744 H HB1    . ALA C 2 27 ? -18.501 -7.406  -0.860  1.00 3.98  ? 27 ALA A HB1    4  
ATOM 10745 H HB2    . ALA C 2 27 ? -19.673 -6.527  0.134   1.00 3.81  ? 27 ALA A HB2    4  
ATOM 10746 H HB3    . ALA C 2 27 ? -19.939 -8.231  -0.248  1.00 4.05  ? 27 ALA A HB3    4  
ATOM 10747 N N      . SER C 2 28 ? -19.653 -7.667  3.262   1.00 4.40  ? 28 SER A N      4  
ATOM 10748 C CA     . SER C 2 28 ? -20.477 -8.059  4.371   1.00 4.74  ? 28 SER A CA     4  
ATOM 10749 C C      . SER C 2 28 ? -21.268 -6.842  4.822   1.00 4.78  ? 28 SER A C      4  
ATOM 10750 O O      . SER C 2 28 ? -20.695 -5.801  5.148   1.00 5.09  ? 28 SER A O      4  
ATOM 10751 C CB     . SER C 2 28 ? -19.608 -8.598  5.509   1.00 5.07  ? 28 SER A CB     4  
ATOM 10752 O OG     . SER C 2 28 ? -18.337 -7.967  5.519   1.00 5.08  ? 28 SER A OG     4  
ATOM 10753 H H      . SER C 2 28 ? -19.354 -6.748  3.230   1.00 4.41  ? 28 SER A H      4  
ATOM 10754 H HA     . SER C 2 28 ? -21.159 -8.827  4.038   1.00 4.79  ? 28 SER A HA     4  
ATOM 10755 H HB2    . SER C 2 28 ? -20.098 -8.409  6.453   1.00 5.40  ? 28 SER A HB2    4  
ATOM 10756 H HB3    . SER C 2 28 ? -19.468 -9.662  5.381   1.00 5.21  ? 28 SER A HB3    4  
ATOM 10757 H HG     . SER C 2 28 ? -17.736 -8.448  4.936   1.00 5.20  ? 28 SER A HG     4  
ATOM 10758 N N      . HIS C 2 29 ? -22.576 -6.985  4.796   1.00 4.57  ? 29 HIS A N      4  
ATOM 10759 C CA     . HIS C 2 29 ? -23.507 -5.940  5.163   1.00 4.63  ? 29 HIS A CA     4  
ATOM 10760 C C      . HIS C 2 29 ? -23.470 -4.827  4.115   1.00 4.35  ? 29 HIS A C      4  
ATOM 10761 O O      . HIS C 2 29 ? -22.990 -3.720  4.366   1.00 4.43  ? 29 HIS A O      4  
ATOM 10762 C CB     . HIS C 2 29 ? -23.219 -5.394  6.558   1.00 4.90  ? 29 HIS A CB     4  
ATOM 10763 C CG     . HIS C 2 29 ? -23.052 -6.436  7.628   1.00 5.21  ? 29 HIS A CG     4  
ATOM 10764 N ND1    . HIS C 2 29 ? -24.053 -7.302  8.023   1.00 5.58  ? 29 HIS A ND1    4  
ATOM 10765 C CD2    . HIS C 2 29 ? -21.980 -6.733  8.397   1.00 5.44  ? 29 HIS A CD2    4  
ATOM 10766 C CE1    . HIS C 2 29 ? -23.597 -8.083  8.987   1.00 5.80  ? 29 HIS A CE1    4  
ATOM 10767 N NE2    . HIS C 2 29 ? -22.342 -7.760  9.234   1.00 5.73  ? 29 HIS A NE2    4  
ATOM 10768 H H      . HIS C 2 29 ? -22.934 -7.830  4.509   1.00 4.45  ? 29 HIS A H      4  
ATOM 10769 H HA     . HIS C 2 29 ? -24.495 -6.375  5.157   1.00 4.74  ? 29 HIS A HA     4  
ATOM 10770 H HB2    . HIS C 2 29 ? -22.317 -4.810  6.525   1.00 4.91  ? 29 HIS A HB2    4  
ATOM 10771 H HB3    . HIS C 2 29 ? -24.031 -4.770  6.837   1.00 4.92  ? 29 HIS A HB3    4  
ATOM 10772 H HD1    . HIS C 2 29 ? -24.968 -7.332  7.662   1.00 5.83  ? 29 HIS A HD1    4  
ATOM 10773 H HD2    . HIS C 2 29 ? -21.019 -6.244  8.361   1.00 5.59  ? 29 HIS A HD2    4  
ATOM 10774 H HE1    . HIS C 2 29 ? -24.160 -8.859  9.485   1.00 6.16  ? 29 HIS A HE1    4  
ATOM 10775 H HE2    . HIS C 2 29 ? -21.855 -8.012  10.057  1.00 6.03  ? 29 HIS A HE2    4  
ATOM 10776 N N      . VAL C 2 30 ? -23.971 -5.167  2.930   1.00 4.23  ? 30 VAL A N      4  
ATOM 10777 C CA     . VAL C 2 30 ? -24.031 -4.270  1.785   1.00 3.95  ? 30 VAL A CA     4  
ATOM 10778 C C      . VAL C 2 30 ? -25.139 -4.742  0.853   1.00 3.85  ? 30 VAL A C      4  
ATOM 10779 O O      . VAL C 2 30 ? -25.615 -5.870  0.989   1.00 4.00  ? 30 VAL A O      4  
ATOM 10780 C CB     . VAL C 2 30 ? -22.707 -4.237  0.993   1.00 3.73  ? 30 VAL A CB     4  
ATOM 10781 C CG1    . VAL C 2 30 ? -21.844 -3.058  1.416   1.00 3.75  ? 30 VAL A CG1    4  
ATOM 10782 C CG2    . VAL C 2 30 ? -21.945 -5.545  1.143   1.00 4.14  ? 30 VAL A CG2    4  
ATOM 10783 H H      . VAL C 2 30 ? -24.352 -6.059  2.825   1.00 4.47  ? 30 VAL A H      4  
ATOM 10784 H HA     . VAL C 2 30 ? -24.256 -3.272  2.139   1.00 3.98  ? 30 VAL A HA     4  
ATOM 10785 H HB     . VAL C 2 30 ? -22.953 -4.115  -0.048  1.00 3.72  ? 30 VAL A HB     4  
ATOM 10786 H HG11   . VAL C 2 30 ? -20.923 -3.065  0.853   1.00 3.77  ? 30 VAL A HG11   4  
ATOM 10787 H HG12   . VAL C 2 30 ? -21.622 -3.136  2.470   1.00 4.08  ? 30 VAL A HG12   4  
ATOM 10788 H HG13   . VAL C 2 30 ? -22.375 -2.137  1.227   1.00 4.01  ? 30 VAL A HG13   4  
ATOM 10789 H HG21   . VAL C 2 30 ? -22.546 -6.358  0.762   1.00 4.47  ? 30 VAL A HG21   4  
ATOM 10790 H HG22   . VAL C 2 30 ? -21.728 -5.718  2.187   1.00 4.43  ? 30 VAL A HG22   4  
ATOM 10791 H HG23   . VAL C 2 30 ? -21.020 -5.490  0.587   1.00 4.33  ? 30 VAL A HG23   4  
ATOM 10792 N N      . SER C 2 31 ? -25.535 -3.909  -0.097  1.00 3.66  ? 31 SER A N      4  
ATOM 10793 C CA     . SER C 2 31 ? -26.599 -4.276  -1.021  1.00 3.57  ? 31 SER A CA     4  
ATOM 10794 C C      . SER C 2 31 ? -26.086 -5.177  -2.137  1.00 3.30  ? 31 SER A C      4  
ATOM 10795 O O      . SER C 2 31 ? -24.880 -5.259  -2.392  1.00 3.15  ? 31 SER A O      4  
ATOM 10796 C CB     . SER C 2 31 ? -27.242 -3.032  -1.626  1.00 3.52  ? 31 SER A CB     4  
ATOM 10797 O OG     . SER C 2 31 ? -26.254 -2.097  -2.033  1.00 3.59  ? 31 SER A OG     4  
ATOM 10798 H H      . SER C 2 31 ? -25.105 -3.032  -0.183  1.00 3.60  ? 31 SER A H      4  
ATOM 10799 H HA     . SER C 2 31 ? -27.347 -4.815  -0.461  1.00 3.79  ? 31 SER A HA     4  
ATOM 10800 H HB2    . SER C 2 31 ? -27.825 -3.323  -2.492  1.00 3.57  ? 31 SER A HB2    4  
ATOM 10801 H HB3    . SER C 2 31 ? -27.886 -2.568  -0.895  1.00 3.68  ? 31 SER A HB3    4  
ATOM 10802 H HG     . SER C 2 31 ? -26.582 -1.201  -1.886  1.00 3.80  ? 31 SER A HG     4  
ATOM 10803 N N      . ALA C 2 32 ? -27.020 -5.837  -2.804  1.00 3.28  ? 32 ALA A N      4  
ATOM 10804 C CA     . ALA C 2 32 ? -26.705 -6.733  -3.900  1.00 3.13  ? 32 ALA A CA     4  
ATOM 10805 C C      . ALA C 2 32 ? -26.235 -5.953  -5.121  1.00 2.81  ? 32 ALA A C      4  
ATOM 10806 O O      . ALA C 2 32 ? -25.172 -6.240  -5.668  1.00 2.69  ? 32 ALA A O      4  
ATOM 10807 C CB     . ALA C 2 32 ? -27.928 -7.562  -4.243  1.00 3.24  ? 32 ALA A CB     4  
ATOM 10808 H H      . ALA C 2 32 ? -27.963 -5.712  -2.550  1.00 3.42  ? 32 ALA A H      4  
ATOM 10809 H HA     . ALA C 2 32 ? -25.917 -7.403  -3.580  1.00 3.22  ? 32 ALA A HA     4  
ATOM 10810 H HB1    . ALA C 2 32 ? -28.778 -6.904  -4.359  1.00 3.30  ? 32 ALA A HB1    4  
ATOM 10811 H HB2    . ALA C 2 32 ? -28.121 -8.264  -3.446  1.00 3.60  ? 32 ALA A HB2    4  
ATOM 10812 H HB3    . ALA C 2 32 ? -27.756 -8.096  -5.165  1.00 3.38  ? 32 ALA A HB3    4  
ATOM 10813 N N      . LYS C 2 33 ? -27.028 -4.950  -5.516  1.00 2.73  ? 33 LYS A N      4  
ATOM 10814 C CA     . LYS C 2 33 ? -26.728 -4.114  -6.684  1.00 2.52  ? 33 LYS A CA     4  
ATOM 10815 C C      . LYS C 2 33 ? -25.296 -3.613  -6.674  1.00 2.43  ? 33 LYS A C      4  
ATOM 10816 O O      . LYS C 2 33 ? -24.636 -3.615  -7.708  1.00 2.32  ? 33 LYS A O      4  
ATOM 10817 C CB     . LYS C 2 33 ? -27.697 -2.925  -6.772  1.00 2.53  ? 33 LYS A CB     4  
ATOM 10818 C CG     . LYS C 2 33 ? -27.875 -2.167  -5.464  1.00 2.89  ? 33 LYS A CG     4  
ATOM 10819 C CD     . LYS C 2 33 ? -29.191 -1.399  -5.430  1.00 3.24  ? 33 LYS A CD     4  
ATOM 10820 C CE     . LYS C 2 33 ? -29.203 -0.256  -6.434  1.00 4.00  ? 33 LYS A CE     4  
ATOM 10821 N NZ     . LYS C 2 33 ? -30.442 0.561   -6.337  1.00 4.59  ? 33 LYS A NZ     4  
ATOM 10822 H H      . LYS C 2 33 ? -27.847 -4.774  -5.008  1.00 2.85  ? 33 LYS A H      4  
ATOM 10823 H HA     . LYS C 2 33 ? -26.853 -4.725  -7.565  1.00 2.48  ? 33 LYS A HA     4  
ATOM 10824 H HB2    . LYS C 2 33 ? -27.321 -2.227  -7.511  1.00 2.62  ? 33 LYS A HB2    4  
ATOM 10825 H HB3    . LYS C 2 33 ? -28.664 -3.285  -7.090  1.00 2.61  ? 33 LYS A HB3    4  
ATOM 10826 H HG2    . LYS C 2 33 ? -27.861 -2.872  -4.646  1.00 3.12  ? 33 LYS A HG2    4  
ATOM 10827 H HG3    . LYS C 2 33 ? -27.059 -1.467  -5.353  1.00 2.98  ? 33 LYS A HG3    4  
ATOM 10828 H HD2    . LYS C 2 33 ? -29.997 -2.078  -5.666  1.00 3.45  ? 33 LYS A HD2    4  
ATOM 10829 H HD3    . LYS C 2 33 ? -29.335 -0.997  -4.438  1.00 3.17  ? 33 LYS A HD3    4  
ATOM 10830 H HE2    . LYS C 2 33 ? -28.350 0.378   -6.247  1.00 4.23  ? 33 LYS A HE2    4  
ATOM 10831 H HE3    . LYS C 2 33 ? -29.130 -0.669  -7.430  1.00 4.32  ? 33 LYS A HE3    4  
ATOM 10832 H HZ1    . LYS C 2 33 ? -31.232 0.079   -6.813  1.00 4.92  ? 33 LYS A HZ1    4  
ATOM 10833 H HZ2    . LYS C 2 33 ? -30.293 1.489   -6.793  1.00 4.97  ? 33 LYS A HZ2    4  
ATOM 10834 H HZ3    . LYS C 2 33 ? -30.695 0.716   -5.337  1.00 4.68  ? 33 LYS A HZ3    4  
ATOM 10835 N N      . THR C 2 34 ? -24.814 -3.196  -5.513  1.00 2.54  ? 34 THR A N      4  
ATOM 10836 C CA     . THR C 2 34 ? -23.462 -2.705  -5.399  1.00 2.50  ? 34 THR A CA     4  
ATOM 10837 C C      . THR C 2 34 ? -22.466 -3.754  -5.861  1.00 2.40  ? 34 THR A C      4  
ATOM 10838 O O      . THR C 2 34 ? -21.603 -3.473  -6.686  1.00 2.28  ? 34 THR A O      4  
ATOM 10839 C CB     . THR C 2 34 ? -23.137 -2.304  -3.960  1.00 2.73  ? 34 THR A CB     4  
ATOM 10840 O OG1    . THR C 2 34 ? -24.059 -1.304  -3.525  1.00 2.86  ? 34 THR A OG1    4  
ATOM 10841 C CG2    . THR C 2 34 ? -21.720 -1.775  -3.872  1.00 2.75  ? 34 THR A CG2    4  
ATOM 10842 H H      . THR C 2 34 ? -25.379 -3.221  -4.716  1.00 2.68  ? 34 THR A H      4  
ATOM 10843 H HA     . THR C 2 34 ? -23.368 -1.831  -6.025  1.00 2.46  ? 34 THR A HA     4  
ATOM 10844 H HB     . THR C 2 34 ? -23.225 -3.173  -3.324  1.00 2.86  ? 34 THR A HB     4  
ATOM 10845 H HG1    . THR C 2 34 ? -24.688 -1.692  -2.901  1.00 3.04  ? 34 THR A HG1    4  
ATOM 10846 H HG21   . THR C 2 34 ? -21.720 -0.715  -4.075  1.00 3.02  ? 34 THR A HG21   4  
ATOM 10847 H HG22   . THR C 2 34 ? -21.106 -2.282  -4.606  1.00 2.96  ? 34 THR A HG22   4  
ATOM 10848 H HG23   . THR C 2 34 ? -21.327 -1.956  -2.884  1.00 2.82  ? 34 THR A HG23   4  
ATOM 10849 N N      . ARG C 2 35 ? -22.628 -4.974  -5.375  1.00 2.51  ? 35 ARG A N      4  
ATOM 10850 C CA     . ARG C 2 35 ? -21.724 -6.048  -5.733  1.00 2.50  ? 35 ARG A CA     4  
ATOM 10851 C C      . ARG C 2 35 ? -21.798 -6.315  -7.231  1.00 2.38  ? 35 ARG A C      4  
ATOM 10852 O O      . ARG C 2 35 ? -20.799 -6.634  -7.868  1.00 2.33  ? 35 ARG A O      4  
ATOM 10853 C CB     . ARG C 2 35 ? -22.062 -7.319  -4.945  1.00 2.77  ? 35 ARG A CB     4  
ATOM 10854 C CG     . ARG C 2 35 ? -21.630 -7.263  -3.489  1.00 2.94  ? 35 ARG A CG     4  
ATOM 10855 C CD     . ARG C 2 35 ? -22.759 -7.647  -2.544  1.00 3.35  ? 35 ARG A CD     4  
ATOM 10856 N NE     . ARG C 2 35 ? -23.145 -9.056  -2.673  1.00 3.39  ? 35 ARG A NE     4  
ATOM 10857 C CZ     . ARG C 2 35 ? -23.741 -9.764  -1.704  1.00 3.73  ? 35 ARG A CZ     4  
ATOM 10858 N NH1    . ARG C 2 35 ? -24.081 -9.177  -0.558  1.00 4.16  ? 35 ARG A NH1    4  
ATOM 10859 N NH2    . ARG C 2 35 ? -24.008 -11.055 -1.886  1.00 3.92  ? 35 ARG A NH2    4  
ATOM 10860 H H      . ARG C 2 35 ? -23.402 -5.169  -4.802  1.00 2.65  ? 35 ARG A H      4  
ATOM 10861 H HA     . ARG C 2 35 ? -20.722 -5.725  -5.475  1.00 2.47  ? 35 ARG A HA     4  
ATOM 10862 H HB2    . ARG C 2 35 ? -23.131 -7.473  -4.976  1.00 2.87  ? 35 ARG A HB2    4  
ATOM 10863 H HB3    . ARG C 2 35 ? -21.572 -8.159  -5.413  1.00 2.85  ? 35 ARG A HB3    4  
ATOM 10864 H HG2    . ARG C 2 35 ? -20.807 -7.947  -3.344  1.00 2.97  ? 35 ARG A HG2    4  
ATOM 10865 H HG3    . ARG C 2 35 ? -21.308 -6.258  -3.260  1.00 2.97  ? 35 ARG A HG3    4  
ATOM 10866 H HD2    . ARG C 2 35 ? -22.434 -7.467  -1.530  1.00 3.63  ? 35 ARG A HD2    4  
ATOM 10867 H HD3    . ARG C 2 35 ? -23.617 -7.029  -2.761  1.00 3.66  ? 35 ARG A HD3    4  
ATOM 10868 H HE     . ARG C 2 35 ? -22.936 -9.499  -3.522  1.00 3.38  ? 35 ARG A HE     4  
ATOM 10869 H HH11   . ARG C 2 35 ? -23.898 -8.206  -0.416  1.00 4.30  ? 35 ARG A HH11   4  
ATOM 10870 H HH12   . ARG C 2 35 ? -24.526 -9.713  0.173   1.00 4.53  ? 35 ARG A HH12   4  
ATOM 10871 H HH21   . ARG C 2 35 ? -23.765 -11.506 -2.748  1.00 3.98  ? 35 ARG A HH21   4  
ATOM 10872 H HH22   . ARG C 2 35 ? -24.458 -11.589 -1.156  1.00 4.20  ? 35 ARG A HH22   4  
ATOM 10873 N N      . GLU C 2 36 ? -22.995 -6.151  -7.781  1.00 2.39  ? 36 GLU A N      4  
ATOM 10874 C CA     . GLU C 2 36 ? -23.238 -6.375  -9.198  1.00 2.38  ? 36 GLU A CA     4  
ATOM 10875 C C      . GLU C 2 36 ? -22.510 -5.344  -10.058 1.00 2.27  ? 36 GLU A C      4  
ATOM 10876 O O      . GLU C 2 36 ? -21.910 -5.688  -11.076 1.00 2.33  ? 36 GLU A O      4  
ATOM 10877 C CB     . GLU C 2 36 ? -24.744 -6.336  -9.503  1.00 2.47  ? 36 GLU A CB     4  
ATOM 10878 C CG     . GLU C 2 36 ? -25.589 -7.171  -8.550  1.00 2.59  ? 36 GLU A CG     4  
ATOM 10879 C CD     . GLU C 2 36 ? -27.066 -7.184  -8.918  1.00 3.03  ? 36 GLU A CD     4  
ATOM 10880 O OE1    . GLU C 2 36 ? -27.704 -6.106  -8.902  1.00 3.55  ? 36 GLU A OE1    4  
ATOM 10881 O OE2    . GLU C 2 36 ? -27.600 -8.276  -9.214  1.00 3.21  ? 36 GLU A OE2    4  
ATOM 10882 H H      . GLU C 2 36 ? -23.735 -5.853  -7.217  1.00 2.45  ? 36 GLU A H      4  
ATOM 10883 H HA     . GLU C 2 36 ? -22.858 -7.353  -9.443  1.00 2.49  ? 36 GLU A HA     4  
ATOM 10884 H HB2    . GLU C 2 36 ? -25.082 -5.312  -9.446  1.00 2.46  ? 36 GLU A HB2    4  
ATOM 10885 H HB3    . GLU C 2 36 ? -24.904 -6.702  -10.507 1.00 2.72  ? 36 GLU A HB3    4  
ATOM 10886 H HG2    . GLU C 2 36 ? -25.222 -8.186  -8.563  1.00 2.88  ? 36 GLU A HG2    4  
ATOM 10887 H HG3    . GLU C 2 36 ? -25.483 -6.764  -7.551  1.00 2.57  ? 36 GLU A HG3    4  
ATOM 10888 N N      . LYS C 2 37 ? -22.537 -4.081  -9.639  1.00 2.21  ? 37 LYS A N      4  
ATOM 10889 C CA     . LYS C 2 37 ? -21.892 -3.026  -10.415 1.00 2.23  ? 37 LYS A CA     4  
ATOM 10890 C C      . LYS C 2 37 ? -20.382 -3.025  -10.221 1.00 2.19  ? 37 LYS A C      4  
ATOM 10891 O O      . LYS C 2 37 ? -19.654 -2.762  -11.170 1.00 2.26  ? 37 LYS A O      4  
ATOM 10892 C CB     . LYS C 2 37 ? -22.489 -1.636  -10.143 1.00 2.31  ? 37 LYS A CB     4  
ATOM 10893 C CG     . LYS C 2 37 ? -22.762 -1.326  -8.685  1.00 2.44  ? 37 LYS A CG     4  
ATOM 10894 C CD     . LYS C 2 37 ? -24.171 -0.780  -8.502  1.00 2.48  ? 37 LYS A CD     4  
ATOM 10895 C CE     . LYS C 2 37 ? -24.171 0.702   -8.182  1.00 2.57  ? 37 LYS A CE     4  
ATOM 10896 N NZ     . LYS C 2 37 ? -24.215 1.547   -9.409  1.00 2.84  ? 37 LYS A NZ     4  
ATOM 10897 H H      . LYS C 2 37 ? -22.984 -3.863  -8.792  1.00 2.23  ? 37 LYS A H      4  
ATOM 10898 H HA     . LYS C 2 37 ? -22.078 -3.265  -11.454 1.00 2.31  ? 37 LYS A HA     4  
ATOM 10899 H HB2    . LYS C 2 37 ? -21.804 -0.892  -10.516 1.00 2.53  ? 37 LYS A HB2    4  
ATOM 10900 H HB3    . LYS C 2 37 ? -23.420 -1.552  -10.685 1.00 2.66  ? 37 LYS A HB3    4  
ATOM 10901 H HG2    . LYS C 2 37 ? -22.658 -2.231  -8.106  1.00 2.86  ? 37 LYS A HG2    4  
ATOM 10902 H HG3    . LYS C 2 37 ? -22.051 -0.590  -8.343  1.00 2.66  ? 37 LYS A HG3    4  
ATOM 10903 H HD2    . LYS C 2 37 ? -24.727 -0.937  -9.413  1.00 2.62  ? 37 LYS A HD2    4  
ATOM 10904 H HD3    . LYS C 2 37 ? -24.648 -1.312  -7.693  1.00 2.57  ? 37 LYS A HD3    4  
ATOM 10905 H HE2    . LYS C 2 37 ? -25.035 0.919   -7.569  1.00 2.71  ? 37 LYS A HE2    4  
ATOM 10906 H HE3    . LYS C 2 37 ? -23.268 0.933   -7.631  1.00 2.63  ? 37 LYS A HE3    4  
ATOM 10907 H HZ1    . LYS C 2 37 ? -23.269 1.591   -9.848  1.00 3.16  ? 37 LYS A HZ1    4  
ATOM 10908 H HZ2    . LYS C 2 37 ? -24.520 2.518   -9.170  1.00 3.15  ? 37 LYS A HZ2    4  
ATOM 10909 H HZ3    . LYS C 2 37 ? -24.887 1.146   -10.100 1.00 2.93  ? 37 LYS A HZ3    4  
ATOM 10910 N N      . VAL C 2 38 ? -19.901 -3.304  -9.009  1.00 2.13  ? 38 VAL A N      4  
ATOM 10911 C CA     . VAL C 2 38 ? -18.453 -3.347  -8.784  1.00 2.10  ? 38 VAL A CA     4  
ATOM 10912 C C      . VAL C 2 38 ? -17.863 -4.471  -9.636  1.00 2.10  ? 38 VAL A C      4  
ATOM 10913 O O      . VAL C 2 38 ? -16.848 -4.287  -10.306 1.00 2.14  ? 38 VAL A O      4  
ATOM 10914 C CB     . VAL C 2 38 ? -18.088 -3.547  -7.301  1.00 2.11  ? 38 VAL A CB     4  
ATOM 10915 C CG1    . VAL C 2 38 ? -18.886 -2.599  -6.428  1.00 2.26  ? 38 VAL A CG1    4  
ATOM 10916 C CG2    . VAL C 2 38 ? -18.284 -4.980  -6.865  1.00 2.12  ? 38 VAL A CG2    4  
ATOM 10917 H H      . VAL C 2 38 ? -20.521 -3.494  -8.264  1.00 2.16  ? 38 VAL A H      4  
ATOM 10918 H HA     . VAL C 2 38 ? -18.024 -2.400  -9.105  1.00 2.16  ? 38 VAL A HA     4  
ATOM 10919 H HB     . VAL C 2 38 ? -17.046 -3.309  -7.189  1.00 2.11  ? 38 VAL A HB     4  
ATOM 10920 H HG11   . VAL C 2 38 ? -18.573 -1.583  -6.616  1.00 2.68  ? 38 VAL A HG11   4  
ATOM 10921 H HG12   . VAL C 2 38 ? -18.723 -2.841  -5.388  1.00 2.30  ? 38 VAL A HG12   4  
ATOM 10922 H HG13   . VAL C 2 38 ? -19.940 -2.700  -6.662  1.00 2.54  ? 38 VAL A HG13   4  
ATOM 10923 H HG21   . VAL C 2 38 ? -17.916 -5.104  -5.858  1.00 2.57  ? 38 VAL A HG21   4  
ATOM 10924 H HG22   . VAL C 2 38 ? -17.737 -5.633  -7.537  1.00 2.23  ? 38 VAL A HG22   4  
ATOM 10925 H HG23   . VAL C 2 38 ? -19.335 -5.226  -6.901  1.00 2.26  ? 38 VAL A HG23   4  
ATOM 10926 N N      . GLU C 2 39 ? -18.534 -5.624  -9.611  1.00 2.16  ? 39 GLU A N      4  
ATOM 10927 C CA     . GLU C 2 39 ? -18.131 -6.781  -10.395 1.00 2.30  ? 39 GLU A CA     4  
ATOM 10928 C C      . GLU C 2 39 ? -18.185 -6.432  -11.867 1.00 2.42  ? 39 GLU A C      4  
ATOM 10929 O O      . GLU C 2 39 ? -17.281 -6.776  -12.623 1.00 2.56  ? 39 GLU A O      4  
ATOM 10930 C CB     . GLU C 2 39 ? -19.032 -7.985  -10.113 1.00 2.46  ? 39 GLU A CB     4  
ATOM 10931 C CG     . GLU C 2 39 ? -18.438 -8.972  -9.121  1.00 2.53  ? 39 GLU A CG     4  
ATOM 10932 C CD     . GLU C 2 39 ? -18.999 -10.377 -9.281  1.00 2.89  ? 39 GLU A CD     4  
ATOM 10933 O OE1    . GLU C 2 39 ? -20.026 -10.544 -9.980  1.00 3.27  ? 39 GLU A OE1    4  
ATOM 10934 O OE2    . GLU C 2 39 ? -18.412 -11.324 -8.714  1.00 3.12  ? 39 GLU A OE2    4  
ATOM 10935 H H      . GLU C 2 39 ? -19.304 -5.701  -9.013  1.00 2.17  ? 39 GLU A H      4  
ATOM 10936 H HA     . GLU C 2 39 ? -17.114 -7.026  -10.128 1.00 2.28  ? 39 GLU A HA     4  
ATOM 10937 H HB2    . GLU C 2 39 ? -19.973 -7.631  -9.716  1.00 2.44  ? 39 GLU A HB2    4  
ATOM 10938 H HB3    . GLU C 2 39 ? -19.217 -8.506  -11.040 1.00 2.62  ? 39 GLU A HB3    4  
ATOM 10939 H HG2    . GLU C 2 39 ? -17.369 -9.009  -9.271  1.00 2.47  ? 39 GLU A HG2    4  
ATOM 10940 H HG3    . GLU C 2 39 ? -18.649 -8.627  -8.117  1.00 2.57  ? 39 GLU A HG3    4  
ATOM 10941 N N      . ALA C 2 40 ? -19.250 -5.743  -12.271 1.00 2.42  ? 40 ALA A N      4  
ATOM 10942 C CA     . ALA C 2 40 ? -19.380 -5.326  -13.657 1.00 2.60  ? 40 ALA A CA     4  
ATOM 10943 C C      . ALA C 2 40 ? -18.224 -4.418  -14.009 1.00 2.65  ? 40 ALA A C      4  
ATOM 10944 O O      . ALA C 2 40 ? -17.478 -4.682  -14.944 1.00 2.86  ? 40 ALA A O      4  
ATOM 10945 C CB     . ALA C 2 40 ? -20.690 -4.595  -13.901 1.00 2.61  ? 40 ALA A CB     4  
ATOM 10946 H H      . ALA C 2 40 ? -19.962 -5.516  -11.622 1.00 2.32  ? 40 ALA A H      4  
ATOM 10947 H HA     . ALA C 2 40 ? -19.350 -6.206  -14.283 1.00 2.77  ? 40 ALA A HA     4  
ATOM 10948 H HB1    . ALA C 2 40 ? -21.005 -4.104  -12.993 1.00 2.90  ? 40 ALA A HB1    4  
ATOM 10949 H HB2    . ALA C 2 40 ? -21.446 -5.301  -14.214 1.00 2.54  ? 40 ALA A HB2    4  
ATOM 10950 H HB3    . ALA C 2 40 ? -20.539 -3.853  -14.679 1.00 2.88  ? 40 ALA A HB3    4  
ATOM 10951 N N      . ALA C 2 41 ? -18.064 -3.365  -13.219 1.00 2.52  ? 41 ALA A N      4  
ATOM 10952 C CA     . ALA C 2 41 ? -17.014 -2.396  -13.431 1.00 2.63  ? 41 ALA A CA     4  
ATOM 10953 C C      . ALA C 2 41 ? -15.633 -3.020  -13.562 1.00 2.66  ? 41 ALA A C      4  
ATOM 10954 O O      . ALA C 2 41 ? -14.923 -2.756  -14.529 1.00 2.89  ? 41 ALA A O      4  
ATOM 10955 C CB     . ALA C 2 41 ? -17.015 -1.417  -12.290 1.00 2.54  ? 41 ALA A CB     4  
ATOM 10956 H H      . ALA C 2 41 ? -18.702 -3.215  -12.471 1.00 2.40  ? 41 ALA A H      4  
ATOM 10957 H HA     . ALA C 2 41 ? -17.239 -1.854  -14.335 1.00 2.83  ? 41 ALA A HA     4  
ATOM 10958 H HB1    . ALA C 2 41 ? -17.934 -0.853  -12.299 1.00 2.75  ? 41 ALA A HB1    4  
ATOM 10959 H HB2    . ALA C 2 41 ? -16.177 -0.744  -12.395 1.00 2.83  ? 41 ALA A HB2    4  
ATOM 10960 H HB3    . ALA C 2 41 ? -16.933 -1.959  -11.362 1.00 2.57  ? 41 ALA A HB3    4  
ATOM 10961 N N      . MET C 2 42 ? -15.259 -3.857  -12.610 1.00 2.47  ? 42 MET A N      4  
ATOM 10962 C CA     . MET C 2 42 ? -13.952 -4.492  -12.649 1.00 2.49  ? 42 MET A CA     4  
ATOM 10963 C C      . MET C 2 42 ? -13.839 -5.407  -13.859 1.00 2.73  ? 42 MET A C      4  
ATOM 10964 O O      . MET C 2 42 ? -12.766 -5.563  -14.420 1.00 2.88  ? 42 MET A O      4  
ATOM 10965 C CB     . MET C 2 42 ? -13.637 -5.249  -11.356 1.00 2.29  ? 42 MET A CB     4  
ATOM 10966 C CG     . MET C 2 42 ? -14.636 -6.318  -10.995 1.00 2.26  ? 42 MET A CG     4  
ATOM 10967 S SD     . MET C 2 42 ? -14.359 -6.967  -9.343  1.00 2.15  ? 42 MET A SD     4  
ATOM 10968 C CE     . MET C 2 42 ? -14.529 -5.448  -8.416  1.00 2.02  ? 42 MET A CE     4  
ATOM 10969 H H      . MET C 2 42 ? -15.874 -4.053  -11.865 1.00 2.33  ? 42 MET A H      4  
ATOM 10970 H HA     . MET C 2 42 ? -13.227 -3.699  -12.752 1.00 2.55  ? 42 MET A HA     4  
ATOM 10971 H HB2    . MET C 2 42 ? -12.668 -5.716  -11.457 1.00 2.33  ? 42 MET A HB2    4  
ATOM 10972 H HB3    . MET C 2 42 ? -13.594 -4.538  -10.541 1.00 2.19  ? 42 MET A HB3    4  
ATOM 10973 H HG2    . MET C 2 42 ? -15.626 -5.885  -11.032 1.00 2.24  ? 42 MET A HG2    4  
ATOM 10974 H HG3    . MET C 2 42 ? -14.556 -7.119  -11.709 1.00 2.42  ? 42 MET A HG3    4  
ATOM 10975 H HE1    . MET C 2 42 ? -14.042 -4.645  -8.959  1.00 2.48  ? 42 MET A HE1    4  
ATOM 10976 H HE2    . MET C 2 42 ? -14.069 -5.560  -7.445  1.00 2.10  ? 42 MET A HE2    4  
ATOM 10977 H HE3    . MET C 2 42 ? -15.580 -5.215  -8.297  1.00 2.11  ? 42 MET A HE3    4  
ATOM 10978 N N      . ALA C 2 43 ? -14.959 -6.001  -14.260 1.00 2.80  ? 43 ALA A N      4  
ATOM 10979 C CA     . ALA C 2 43 ? -14.965 -6.923  -15.391 1.00 3.09  ? 43 ALA A CA     4  
ATOM 10980 C C      . ALA C 2 43 ? -14.750 -6.181  -16.703 1.00 3.36  ? 43 ALA A C      4  
ATOM 10981 O O      . ALA C 2 43 ? -13.955 -6.600  -17.544 1.00 3.60  ? 43 ALA A O      4  
ATOM 10982 C CB     . ALA C 2 43 ? -16.265 -7.711  -15.436 1.00 3.15  ? 43 ALA A CB     4  
ATOM 10983 H H      . ALA C 2 43 ? -15.814 -5.755  -13.833 1.00 2.69  ? 43 ALA A H      4  
ATOM 10984 H HA     . ALA C 2 43 ? -14.154 -7.623  -15.251 1.00 3.13  ? 43 ALA A HA     4  
ATOM 10985 H HB1    . ALA C 2 43 ? -16.405 -8.231  -14.501 1.00 3.31  ? 43 ALA A HB1    4  
ATOM 10986 H HB2    . ALA C 2 43 ? -16.224 -8.428  -16.244 1.00 3.18  ? 43 ALA A HB2    4  
ATOM 10987 H HB3    . ALA C 2 43 ? -17.091 -7.035  -15.599 1.00 3.47  ? 43 ALA A HB3    4  
ATOM 10988 N N      . GLU C 2 44 ? -15.452 -5.068  -16.858 1.00 3.34  ? 44 GLU A N      4  
ATOM 10989 C CA     . GLU C 2 44 ? -15.359 -4.262  -18.069 1.00 3.63  ? 44 GLU A CA     4  
ATOM 10990 C C      . GLU C 2 44 ? -13.993 -3.616  -18.175 1.00 3.73  ? 44 GLU A C      4  
ATOM 10991 O O      . GLU C 2 44 ? -13.381 -3.583  -19.245 1.00 4.02  ? 44 GLU A O      4  
ATOM 10992 C CB     . GLU C 2 44 ? -16.415 -3.172  -18.045 1.00 3.61  ? 44 GLU A CB     4  
ATOM 10993 C CG     . GLU C 2 44 ? -17.795 -3.665  -17.675 1.00 3.44  ? 44 GLU A CG     4  
ATOM 10994 C CD     . GLU C 2 44 ? -18.547 -4.275  -18.845 1.00 3.74  ? 44 GLU A CD     4  
ATOM 10995 O OE1    . GLU C 2 44 ? -17.937 -5.043  -19.624 1.00 4.09  ? 44 GLU A OE1    4  
ATOM 10996 O OE2    . GLU C 2 44 ? -19.751 -3.980  -18.990 1.00 3.86  ? 44 GLU A OE2    4  
ATOM 10997 H H      . GLU C 2 44 ? -16.057 -4.775  -16.135 1.00 3.15  ? 44 GLU A H      4  
ATOM 10998 H HA     . GLU C 2 44 ? -15.518 -4.902  -18.920 1.00 3.84  ? 44 GLU A HA     4  
ATOM 10999 H HB2    . GLU C 2 44 ? -16.123 -2.429  -17.317 1.00 3.48  ? 44 GLU A HB2    4  
ATOM 11000 H HB3    . GLU C 2 44 ? -16.468 -2.712  -19.020 1.00 3.88  ? 44 GLU A HB3    4  
ATOM 11001 H HG2    . GLU C 2 44 ? -17.689 -4.410  -16.894 1.00 3.33  ? 44 GLU A HG2    4  
ATOM 11002 H HG3    . GLU C 2 44 ? -18.359 -2.827  -17.293 1.00 3.33  ? 44 GLU A HG3    4  
ATOM 11003 N N      . LEU C 2 45 ? -13.521 -3.098  -17.054 1.00 3.50  ? 45 LEU A N      4  
ATOM 11004 C CA     . LEU C 2 45 ? -12.221 -2.447  -17.011 1.00 3.59  ? 45 LEU A CA     4  
ATOM 11005 C C      . LEU C 2 45 ? -11.106 -3.480  -16.912 1.00 3.56  ? 45 LEU A C      4  
ATOM 11006 O O      . LEU C 2 45 ? -9.929  -3.123  -16.835 1.00 3.63  ? 45 LEU A O      4  
ATOM 11007 C CB     . LEU C 2 45 ? -12.130 -1.486  -15.820 1.00 3.41  ? 45 LEU A CB     4  
ATOM 11008 C CG     . LEU C 2 45 ? -13.335 -0.565  -15.606 1.00 3.38  ? 45 LEU A CG     4  
ATOM 11009 C CD1    . LEU C 2 45 ? -12.981 0.552   -14.636 1.00 3.36  ? 45 LEU A CD1    4  
ATOM 11010 C CD2    . LEU C 2 45 ? -13.837 -0.006  -16.931 1.00 3.71  ? 45 LEU A CD2    4  
ATOM 11011 H H      . LEU C 2 45 ? -14.081 -3.125  -16.240 1.00 3.28  ? 45 LEU A H      4  
ATOM 11012 H HA     . LEU C 2 45 ? -12.098 -1.887  -17.924 1.00 3.85  ? 45 LEU A HA     4  
ATOM 11013 H HB2    . LEU C 2 45 ? -11.995 -2.074  -14.923 1.00 3.17  ? 45 LEU A HB2    4  
ATOM 11014 H HB3    . LEU C 2 45 ? -11.255 -0.866  -15.954 1.00 3.56  ? 45 LEU A HB3    4  
ATOM 11015 H HG     . LEU C 2 45 ? -14.140 -1.141  -15.165 1.00 3.18  ? 45 LEU A HG     4  
ATOM 11016 H HD11   . LEU C 2 45 ? -12.737 0.126   -13.672 1.00 3.42  ? 45 LEU A HD11   4  
ATOM 11017 H HD12   . LEU C 2 45 ? -13.823 1.219   -14.530 1.00 3.45  ? 45 LEU A HD12   4  
ATOM 11018 H HD13   . LEU C 2 45 ? -12.132 1.102   -15.011 1.00 3.66  ? 45 LEU A HD13   4  
ATOM 11019 H HD21   . LEU C 2 45 ? -14.410 -0.769  -17.445 1.00 3.75  ? 45 LEU A HD21   4  
ATOM 11020 H HD22   . LEU C 2 45 ? -12.995 0.285   -17.541 1.00 4.07  ? 45 LEU A HD22   4  
ATOM 11021 H HD23   . LEU C 2 45 ? -14.465 0.852   -16.745 1.00 3.93  ? 45 LEU A HD23   4  
ATOM 11022 N N      . ASN C 2 46 ? -11.497 -4.758  -16.897 1.00 3.49  ? 46 ASN A N      4  
ATOM 11023 C CA     . ASN C 2 46 ? -10.559 -5.886  -16.807 1.00 3.50  ? 46 ASN A CA     4  
ATOM 11024 C C      . ASN C 2 46 ? -10.026 -6.022  -15.382 1.00 3.19  ? 46 ASN A C      4  
ATOM 11025 O O      . ASN C 2 46 ? -10.087 -7.103  -14.801 1.00 3.08  ? 46 ASN A O      4  
ATOM 11026 C CB     . ASN C 2 46 ? -9.405  -5.739  -17.813 1.00 3.80  ? 46 ASN A CB     4  
ATOM 11027 C CG     . ASN C 2 46 ? -8.359  -6.833  -17.690 1.00 3.84  ? 46 ASN A CG     4  
ATOM 11028 O OD1    . ASN C 2 46 ? -8.483  -7.900  -18.289 1.00 4.18  ? 46 ASN A OD1    4  
ATOM 11029 N ND2    . ASN C 2 46 ? -7.307  -6.567  -16.929 1.00 3.81  ? 46 ASN A ND2    4  
ATOM 11030 H H      . ASN C 2 46 ? -12.461 -4.952  -16.926 1.00 3.46  ? 46 ASN A H      4  
ATOM 11031 H HA     . ASN C 2 46 ? -11.113 -6.783  -17.047 1.00 3.55  ? 46 ASN A HA     4  
ATOM 11032 H HB2    . ASN C 2 46 ? -9.805  -5.767  -18.815 1.00 4.05  ? 46 ASN A HB2    4  
ATOM 11033 H HB3    . ASN C 2 46 ? -8.922  -4.786  -17.655 1.00 3.81  ? 46 ASN A HB3    4  
ATOM 11034 H HD21   . ASN C 2 46 ? -7.261  -5.693  -16.495 1.00 3.95  ? 46 ASN A HD21   4  
ATOM 11035 H HD22   . ASN C 2 46 ? -6.623  -7.261  -16.833 1.00 3.85  ? 46 ASN A HD22   4  
ATOM 11036 N N      . TYR C 2 47 ? -9.520  -4.908  -14.843 1.00 3.10  ? 47 TYR A N      4  
ATOM 11037 C CA     . TYR C 2 47 ? -8.991  -4.832  -13.478 1.00 2.83  ? 47 TYR A CA     4  
ATOM 11038 C C      . TYR C 2 47 ? -8.108  -6.038  -13.129 1.00 2.81  ? 47 TYR A C      4  
ATOM 11039 O O      . TYR C 2 47 ? -8.586  -7.052  -12.610 1.00 2.91  ? 47 TYR A O      4  
ATOM 11040 C CB     . TYR C 2 47 ? -10.144 -4.679  -12.479 1.00 2.58  ? 47 TYR A CB     4  
ATOM 11041 C CG     . TYR C 2 47 ? -9.696  -4.436  -11.056 1.00 2.35  ? 47 TYR A CG     4  
ATOM 11042 C CD1    . TYR C 2 47 ? -8.544  -3.707  -10.790 1.00 2.39  ? 47 TYR A CD1    4  
ATOM 11043 C CD2    . TYR C 2 47 ? -10.410 -4.955  -9.981  1.00 2.15  ? 47 TYR A CD2    4  
ATOM 11044 C CE1    . TYR C 2 47 ? -8.115  -3.497  -9.497  1.00 2.25  ? 47 TYR A CE1    4  
ATOM 11045 C CE2    . TYR C 2 47 ? -9.981  -4.758  -8.686  1.00 2.03  ? 47 TYR A CE2    4  
ATOM 11046 C CZ     . TYR C 2 47 ? -8.833  -4.029  -8.448  1.00 2.08  ? 47 TYR A CZ     4  
ATOM 11047 O OH     . TYR C 2 47 ? -8.393  -3.848  -7.160  1.00 2.05  ? 47 TYR A OH     4  
ATOM 11048 H H      . TYR C 2 47 ? -9.514  -4.092  -15.393 1.00 3.27  ? 47 TYR A H      4  
ATOM 11049 H HA     . TYR C 2 47 ? -8.378  -3.945  -13.425 1.00 2.91  ? 47 TYR A HA     4  
ATOM 11050 H HB2    . TYR C 2 47 ? -10.758 -3.844  -12.778 1.00 2.65  ? 47 TYR A HB2    4  
ATOM 11051 H HB3    . TYR C 2 47 ? -10.742 -5.578  -12.491 1.00 2.56  ? 47 TYR A HB3    4  
ATOM 11052 H HD1    . TYR C 2 47 ? -7.984  -3.290  -11.619 1.00 2.59  ? 47 TYR A HD1    4  
ATOM 11053 H HD2    . TYR C 2 47 ? -11.319 -5.516  -10.167 1.00 2.15  ? 47 TYR A HD2    4  
ATOM 11054 H HE1    . TYR C 2 47 ? -7.222  -2.920  -9.308  1.00 2.33  ? 47 TYR A HE1    4  
ATOM 11055 H HE2    . TYR C 2 47 ? -10.549 -5.166  -7.864  1.00 1.97  ? 47 TYR A HE2    4  
ATOM 11056 H HH     . TYR C 2 47 ? -7.988  -2.981  -7.077  1.00 2.55  ? 47 TYR A HH     4  
ATOM 11057 N N      . ILE C 2 48 ? -6.810  -5.884  -13.394 1.00 2.82  ? 48 ILE A N      4  
ATOM 11058 C CA     . ILE C 2 48 ? -5.817  -6.934  -13.150 1.00 2.85  ? 48 ILE A CA     4  
ATOM 11059 C C      . ILE C 2 48 ? -5.992  -7.586  -11.773 1.00 2.59  ? 48 ILE A C      4  
ATOM 11060 O O      . ILE C 2 48 ? -6.287  -6.914  -10.780 1.00 2.65  ? 48 ILE A O      4  
ATOM 11061 C CB     . ILE C 2 48 ? -4.364  -6.403  -13.293 1.00 3.25  ? 48 ILE A CB     4  
ATOM 11062 C CG1    . ILE C 2 48 ? -3.969  -5.496  -12.116 1.00 3.41  ? 48 ILE A CG1    4  
ATOM 11063 C CG2    . ILE C 2 48 ? -4.192  -5.668  -14.618 1.00 3.45  ? 48 ILE A CG2    4  
ATOM 11064 C CD1    . ILE C 2 48 ? -4.583  -4.110  -12.153 1.00 3.70  ? 48 ILE A CD1    4  
ATOM 11065 H H      . ILE C 2 48 ? -6.508  -5.032  -13.760 1.00 2.90  ? 48 ILE A H      4  
ATOM 11066 H HA     . ILE C 2 48 ? -5.964  -7.694  -13.901 1.00 2.96  ? 48 ILE A HA     4  
ATOM 11067 H HB     . ILE C 2 48 ? -3.703  -7.258  -13.309 1.00 3.72  ? 48 ILE A HB     4  
ATOM 11068 H HG12   . ILE C 2 48 ? -4.280  -5.966  -11.195 1.00 3.88  ? 48 ILE A HG12   4  
ATOM 11069 H HG13   . ILE C 2 48 ? -2.896  -5.383  -12.107 1.00 3.47  ? 48 ILE A HG13   4  
ATOM 11070 H HG21   . ILE C 2 48 ? -3.205  -5.230  -14.662 1.00 3.52  ? 48 ILE A HG21   4  
ATOM 11071 H HG22   . ILE C 2 48 ? -4.935  -4.888  -14.696 1.00 3.61  ? 48 ILE A HG22   4  
ATOM 11072 H HG23   . ILE C 2 48 ? -4.315  -6.365  -15.435 1.00 3.89  ? 48 ILE A HG23   4  
ATOM 11073 H HD11   . ILE C 2 48 ? -4.282  -3.558  -11.274 1.00 3.98  ? 48 ILE A HD11   4  
ATOM 11074 H HD12   . ILE C 2 48 ? -5.660  -4.194  -12.174 1.00 3.99  ? 48 ILE A HD12   4  
ATOM 11075 H HD13   . ILE C 2 48 ? -4.247  -3.591  -13.037 1.00 3.96  ? 48 ILE A HD13   4  
ATOM 11076 N N      . PRO C 2 49 ? -5.808  -8.913  -11.701 1.00 2.70  ? 49 PRO A N      4  
ATOM 11077 C CA     . PRO C 2 49 ? -5.961  -9.672  -10.457 1.00 2.77  ? 49 PRO A CA     4  
ATOM 11078 C C      . PRO C 2 49 ? -4.751  -9.563  -9.537  1.00 2.92  ? 49 PRO A C      4  
ATOM 11079 O O      . PRO C 2 49 ? -4.387  -10.515 -8.853  1.00 3.54  ? 49 PRO A O      4  
ATOM 11080 C CB     . PRO C 2 49 ? -6.136  -11.105 -10.953 1.00 3.28  ? 49 PRO A CB     4  
ATOM 11081 C CG     . PRO C 2 49 ? -5.359  -11.161 -12.224 1.00 3.60  ? 49 PRO A CG     4  
ATOM 11082 C CD     . PRO C 2 49 ? -5.441  -9.784  -12.835 1.00 3.19  ? 49 PRO A CD     4  
ATOM 11083 H HA     . PRO C 2 49 ? -6.840  -9.364  -9.918  1.00 2.82  ? 49 PRO A HA     4  
ATOM 11084 H HB2    . PRO C 2 49 ? -5.747  -11.795 -10.219 1.00 3.40  ? 49 PRO A HB2    4  
ATOM 11085 H HB3    . PRO C 2 49 ? -7.184  -11.306 -11.124 1.00 3.61  ? 49 PRO A HB3    4  
ATOM 11086 H HG2    . PRO C 2 49 ? -4.331  -11.414 -12.012 1.00 3.91  ? 49 PRO A HG2    4  
ATOM 11087 H HG3    . PRO C 2 49 ? -5.796  -11.890 -12.890 1.00 4.10  ? 49 PRO A HG3    4  
ATOM 11088 H HD2    . PRO C 2 49 ? -4.485  -9.495  -13.244 1.00 3.38  ? 49 PRO A HD2    4  
ATOM 11089 H HD3    . PRO C 2 49 ? -6.201  -9.757  -13.601 1.00 3.35  ? 49 PRO A HD3    4  
ATOM 11090 N N      . ASN C 2 50 ? -4.156  -8.387  -9.503  1.00 2.91  ? 50 ASN A N      4  
ATOM 11091 C CA     . ASN C 2 50 ? -2.998  -8.135  -8.661  1.00 3.44  ? 50 ASN A CA     4  
ATOM 11092 C C      . ASN C 2 50 ? -3.465  -7.802  -7.249  1.00 3.91  ? 50 ASN A C      4  
ATOM 11093 O O      . ASN C 2 50 ? -3.183  -6.729  -6.717  1.00 4.67  ? 50 ASN A O      4  
ATOM 11094 C CB     . ASN C 2 50 ? -2.187  -6.977  -9.242  1.00 3.95  ? 50 ASN A CB     4  
ATOM 11095 C CG     . ASN C 2 50 ? -0.789  -6.872  -8.657  1.00 4.50  ? 50 ASN A CG     4  
ATOM 11096 O OD1    . ASN C 2 50 ? -0.286  -5.772  -8.420  1.00 4.64  ? 50 ASN A OD1    4  
ATOM 11097 N ND2    . ASN C 2 50 ? -0.145  -8.009  -8.437  1.00 5.14  ? 50 ASN A ND2    4  
ATOM 11098 H H      . ASN C 2 50 ? -4.515  -7.657  -10.050 1.00 2.93  ? 50 ASN A H      4  
ATOM 11099 H HA     . ASN C 2 50 ? -2.391  -9.026  -8.639  1.00 3.69  ? 50 ASN A HA     4  
ATOM 11100 H HB2    . ASN C 2 50 ? -2.101  -7.115  -10.310 1.00 4.09  ? 50 ASN A HB2    4  
ATOM 11101 H HB3    . ASN C 2 50 ? -2.712  -6.053  -9.048  1.00 4.21  ? 50 ASN A HB3    4  
ATOM 11102 H HD21   . ASN C 2 50 ? -0.597  -8.855  -8.661  1.00 5.31  ? 50 ASN A HD21   4  
ATOM 11103 H HD22   . ASN C 2 50 ? 0.762   -7.963  -8.069  1.00 5.58  ? 50 ASN A HD22   4  
ATOM 11104 N N      . ARG C 2 51 ? -4.182  -8.738  -6.644  1.00 3.91  ? 51 ARG A N      4  
ATOM 11105 C CA     . ARG C 2 51 ? -4.724  -8.539  -5.315  1.00 4.75  ? 51 ARG A CA     4  
ATOM 11106 C C      . ARG C 2 51 ? -4.529  -9.778  -4.442  1.00 4.81  ? 51 ARG A C      4  
ATOM 11107 O O      . ARG C 2 51 ? -5.372  -10.670 -4.400  1.00 5.41  ? 51 ARG A O      4  
ATOM 11108 C CB     . ARG C 2 51 ? -6.211  -8.163  -5.404  1.00 5.37  ? 51 ARG A CB     4  
ATOM 11109 C CG     . ARG C 2 51 ? -7.011  -9.021  -6.378  1.00 6.42  ? 51 ARG A CG     4  
ATOM 11110