data_1OXD
# 
_entry.id   1OXD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1OXD         
RCSB  RCSB018769   
WWPDB D_1000018769 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1EMB 
_pdbx_database_related.details        'GFP variant' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1OXD 
_pdbx_database_status.recvd_initial_deposition_date   2003-04-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hyun Bae, J.'  1  
'Rubini, M.'    2  
'Jung, G.'      3  
'Wiegand, G.'   4  
'Seifert, M.H.' 5  
'Azim, M.K.'    6  
'Kim, J.S.'     7  
'Zumbusch, A.'  8  
'Holak, T.A.'   9  
'Moroder, L.'   10 
'Huber, R.'     11 
'Budisa, N.'    12 
# 
_citation.id                        primary 
_citation.title                     
;Expansion of the Genetic Code Enables Design of a Novel "Gold" Class of Green Fluorescent Proteins
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            328 
_citation.page_first                1071 
_citation.page_last                 1081 
_citation.year                      2003 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12729742 
_citation.pdbx_database_id_DOI      '10.1016/S0022-2836(03)00364-4' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hyun Bae, J.'  1  
primary 'Rubini, M.'    2  
primary 'Jung, G.'      3  
primary 'Wiegand, G.'   4  
primary 'Seifert, M.H.' 5  
primary 'Azim, M.K.'    6  
primary 'Kim, J.S.'     7  
primary 'Zumbusch, A.'  8  
primary 'Holak, T.A.'   9  
primary 'Moroder, L.'   10 
primary 'Huber, R.'     11 
primary 'Budisa, N.'    12 
# 
_cell.entry_id           1OXD 
_cell.length_a           50.952 
_cell.length_b           62.768 
_cell.length_c           69.519 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1OXD 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'cyan fluorescent protein cfp' 25798.102 1   ? Q80R ? ? 
2 water   nat water                          18.015    166 ? ?    ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTL(CRF)VQCFSRYPDHM
KRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQK
NGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFSRYPDHMKR
HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNG
IKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGI
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   LYS n 
1 4   GLY n 
1 5   GLU n 
1 6   GLU n 
1 7   LEU n 
1 8   PHE n 
1 9   THR n 
1 10  GLY n 
1 11  VAL n 
1 12  VAL n 
1 13  PRO n 
1 14  ILE n 
1 15  LEU n 
1 16  VAL n 
1 17  GLU n 
1 18  LEU n 
1 19  ASP n 
1 20  GLY n 
1 21  ASP n 
1 22  VAL n 
1 23  ASN n 
1 24  GLY n 
1 25  HIS n 
1 26  LYS n 
1 27  PHE n 
1 28  SER n 
1 29  VAL n 
1 30  SER n 
1 31  GLY n 
1 32  GLU n 
1 33  GLY n 
1 34  GLU n 
1 35  GLY n 
1 36  ASP n 
1 37  ALA n 
1 38  THR n 
1 39  TYR n 
1 40  GLY n 
1 41  LYS n 
1 42  LEU n 
1 43  THR n 
1 44  LEU n 
1 45  LYS n 
1 46  PHE n 
1 47  ILE n 
1 48  CYS n 
1 49  THR n 
1 50  THR n 
1 51  GLY n 
1 52  LYS n 
1 53  LEU n 
1 54  PRO n 
1 55  VAL n 
1 56  PRO n 
1 57  TRP n 
1 58  PRO n 
1 59  THR n 
1 60  LEU n 
1 61  VAL n 
1 62  THR n 
1 63  THR n 
1 64  LEU n 
1 65  CRF n 
1 66  VAL n 
1 67  GLN n 
1 68  CYS n 
1 69  PHE n 
1 70  SER n 
1 71  ARG n 
1 72  TYR n 
1 73  PRO n 
1 74  ASP n 
1 75  HIS n 
1 76  MET n 
1 77  LYS n 
1 78  ARG n 
1 79  HIS n 
1 80  ASP n 
1 81  PHE n 
1 82  PHE n 
1 83  LYS n 
1 84  SER n 
1 85  ALA n 
1 86  MET n 
1 87  PRO n 
1 88  GLU n 
1 89  GLY n 
1 90  TYR n 
1 91  VAL n 
1 92  GLN n 
1 93  GLU n 
1 94  ARG n 
1 95  THR n 
1 96  ILE n 
1 97  PHE n 
1 98  PHE n 
1 99  LYS n 
1 100 ASP n 
1 101 ASP n 
1 102 GLY n 
1 103 ASN n 
1 104 TYR n 
1 105 LYS n 
1 106 THR n 
1 107 ARG n 
1 108 ALA n 
1 109 GLU n 
1 110 VAL n 
1 111 LYS n 
1 112 PHE n 
1 113 GLU n 
1 114 GLY n 
1 115 ASP n 
1 116 THR n 
1 117 LEU n 
1 118 VAL n 
1 119 ASN n 
1 120 ARG n 
1 121 ILE n 
1 122 GLU n 
1 123 LEU n 
1 124 LYS n 
1 125 GLY n 
1 126 ILE n 
1 127 ASP n 
1 128 PHE n 
1 129 LYS n 
1 130 GLU n 
1 131 ASP n 
1 132 GLY n 
1 133 ASN n 
1 134 ILE n 
1 135 LEU n 
1 136 GLY n 
1 137 HIS n 
1 138 LYS n 
1 139 LEU n 
1 140 GLU n 
1 141 TYR n 
1 142 ASN n 
1 143 TYR n 
1 144 ILE n 
1 145 SER n 
1 146 HIS n 
1 147 ASN n 
1 148 VAL n 
1 149 TYR n 
1 150 ILE n 
1 151 THR n 
1 152 ALA n 
1 153 ASP n 
1 154 LYS n 
1 155 GLN n 
1 156 LYS n 
1 157 ASN n 
1 158 GLY n 
1 159 ILE n 
1 160 LYS n 
1 161 ALA n 
1 162 ASN n 
1 163 PHE n 
1 164 LYS n 
1 165 ILE n 
1 166 ARG n 
1 167 HIS n 
1 168 ASN n 
1 169 ILE n 
1 170 GLU n 
1 171 ASP n 
1 172 GLY n 
1 173 SER n 
1 174 VAL n 
1 175 GLN n 
1 176 LEU n 
1 177 ALA n 
1 178 ASP n 
1 179 HIS n 
1 180 TYR n 
1 181 GLN n 
1 182 GLN n 
1 183 ASN n 
1 184 THR n 
1 185 PRO n 
1 186 ILE n 
1 187 GLY n 
1 188 ASP n 
1 189 GLY n 
1 190 PRO n 
1 191 VAL n 
1 192 LEU n 
1 193 LEU n 
1 194 PRO n 
1 195 ASP n 
1 196 ASN n 
1 197 HIS n 
1 198 TYR n 
1 199 LEU n 
1 200 SER n 
1 201 THR n 
1 202 GLN n 
1 203 SER n 
1 204 ALA n 
1 205 LEU n 
1 206 SER n 
1 207 LYS n 
1 208 ASP n 
1 209 PRO n 
1 210 ASN n 
1 211 GLU n 
1 212 LYS n 
1 213 ARG n 
1 214 ASP n 
1 215 HIS n 
1 216 MET n 
1 217 VAL n 
1 218 LEU n 
1 219 LEU n 
1 220 GLU n 
1 221 PHE n 
1 222 VAL n 
1 223 THR n 
1 224 ALA n 
1 225 ALA n 
1 226 GLY n 
1 227 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'cfp marker plasmid pWM1009' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     141850 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    GB 
_struct_ref.db_code                    AAG34040 
_struct_ref.pdbx_db_accession          11321072 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFSRYPDHMKQ
HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNG
IKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGI
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1OXD 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 227 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             11321072 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  229 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       229 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1OXD CRF A 65 ? GB 11321072 THR 65 CHROMOPHORE 66 1 
1 1OXD CRF A 65 ? GB 11321072 TRP 66 CHROMOPHORE 66 2 
1 1OXD CRF A 65 ? GB 11321072 GLY 67 CHROMOPHORE 66 3 
1 1OXD ARG A 78 ? GB 11321072 GLN 80 ENGINEERED  80 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CRF 'L-peptide linking' n 
'[(4Z)-2-[(1R,2R)-1-amino-2-hydroxypropyl]-4-(1H-indol-3-ylmethylidene)-5-oxo-4,5-dihydro-1H-imidazol-1-yl]acetic acid' ? 
'C17 H18 N4 O4'  342.349 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1OXD 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.15 
_exptl_crystal.density_percent_sol   42.92 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'PEG 1000, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2002-03-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.05 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MPG/DESY, HAMBURG BEAMLINE BW6' 
_diffrn_source.pdbx_synchrotron_site       'MPG/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   BW6 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.05 
# 
_reflns.entry_id                     1OXD 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             7.98 
_reflns.d_resolution_high            1.15 
_reflns.number_obs                   73514 
_reflns.number_all                   79530 
_reflns.percent_possible_obs         92.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        11.0 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.15 
_reflns_shell.d_res_low              1.22 
_reflns_shell.percent_possible_all   75.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1OXD 
_refine.ls_number_reflns_obs                     69062 
_refine.ls_number_reflns_all                     79530 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             7.98 
_refine.ls_d_res_high                            1.15 
_refine.ls_percent_reflns_obs                    86.6 
_refine.ls_R_factor_obs                          0.214 
_refine.ls_R_factor_all                          0.229 
_refine.ls_R_factor_R_work                       0.214 
_refine.ls_R_factor_R_free                       0.227 
_refine.ls_R_factor_R_free_error                 0.003 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.1 
_refine.ls_number_reflns_R_free                  6988 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               15.5 
_refine.aniso_B[1][1]                            -2.06 
_refine.aniso_B[2][2]                            -1.99 
_refine.aniso_B[3][3]                            4.05 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.613 
_refine.solvent_model_param_bsol                 68.4172 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1OXD 
_refine_analyze.Luzzati_coordinate_error_obs    0.15 
_refine_analyze.Luzzati_sigma_a_obs             0.13 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.16 
_refine_analyze.Luzzati_sigma_a_free            0.13 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1800 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             166 
_refine_hist.number_atoms_total               1966 
_refine_hist.d_res_high                       1.15 
_refine_hist.d_res_low                        7.98 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 26.4  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.85  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.15 
_refine_ls_shell.d_res_low                        1.22 
_refine_ls_shell.number_reflns_R_work             8936 
_refine_ls_shell.R_factor_R_work                  0.303 
_refine_ls_shell.percent_reflns_obs               75.6 
_refine_ls_shell.R_factor_R_free                  0.315 
_refine_ls_shell.R_factor_R_free_error            0.010 
_refine_ls_shell.percent_reflns_R_free            9.8 
_refine_ls_shell.number_reflns_R_free             972 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PRO_CFP.PAR     PRO_CFP.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1OXD 
_struct.title                     
;Expansion of the Genetic Code Enables Design of a Novel "Gold" Class of Green Fluorescent Proteins
;
_struct.pdbx_descriptor           'cyan fluorescent protein cfp' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1OXD 
_struct_keywords.pdbx_keywords   'LUMINESCENT PROTEIN' 
_struct_keywords.text            
'green fluorescent protein, chromophore, amino acid incorporation, tryptophan, genetic code, LUMINESCENT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 3   ? THR A 9   ? LYS A 3   THR A 9   5 ? 7 
HELX_P HELX_P2 2 ALA A 37  ? TYR A 39  ? ALA A 37  TYR A 39  5 ? 3 
HELX_P HELX_P3 3 PRO A 56  ? VAL A 61  ? PRO A 56  VAL A 61  5 ? 6 
HELX_P HELX_P4 4 VAL A 66  ? SER A 70  ? VAL A 68  SER A 72  5 ? 5 
HELX_P HELX_P5 5 PRO A 73  ? HIS A 79  ? PRO A 75  HIS A 81  5 ? 7 
HELX_P HELX_P6 6 ASP A 80  ? ALA A 85  ? ASP A 82  ALA A 87  1 ? 6 
HELX_P HELX_P7 7 LYS A 154 ? ASN A 157 ? LYS A 156 ASN A 159 5 ? 4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A LEU 64 C  ? ? ? 1_555 A CRF 65 N1 ? ? A LEU 64 A CRF 66 1_555 ? ? ? ? ? ? ? 1.480 ? 
covale2 covale ? ? A CRF 65 C3 ? ? ? 1_555 A VAL 66 N  ? ? A CRF 66 A VAL 68 1_555 ? ? ? ? ? ? ? 1.544 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          MET 
_struct_mon_prot_cis.label_seq_id           86 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           MET 
_struct_mon_prot_cis.auth_seq_id            88 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    87 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     89 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.55 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   12 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
A 9  10 ? anti-parallel 
A 10 11 ? anti-parallel 
A 11 12 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  VAL A 12  ? VAL A 22  ? VAL A 12  VAL A 22  
A 2  HIS A 25  ? ASP A 36  ? HIS A 25  ASP A 36  
A 3  LYS A 41  ? CYS A 48  ? LYS A 41  CYS A 48  
A 4  HIS A 215 ? ALA A 225 ? HIS A 217 ALA A 227 
A 5  HIS A 197 ? SER A 206 ? HIS A 199 SER A 208 
A 6  ASN A 147 ? ASP A 153 ? ASN A 149 ASP A 155 
A 7  GLY A 158 ? ASN A 168 ? GLY A 160 ASN A 170 
A 8  VAL A 174 ? PRO A 185 ? VAL A 176 PRO A 187 
A 9  TYR A 90  ? PHE A 98  ? TYR A 92  PHE A 100 
A 10 ASN A 103 ? GLU A 113 ? ASN A 105 GLU A 115 
A 11 THR A 116 ? ILE A 126 ? THR A 118 ILE A 128 
A 12 VAL A 12  ? VAL A 22  ? VAL A 12  VAL A 22  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N GLY A 20  ? N GLY A 20  O PHE A 27  ? O PHE A 27  
A 2  3  N SER A 30  ? N SER A 30  O ILE A 47  ? O ILE A 47  
A 3  4  N LEU A 44  ? N LEU A 44  O LEU A 218 ? O LEU A 220 
A 4  5  O THR A 223 ? O THR A 225 N SER A 200 ? N SER A 202 
A 5  6  O HIS A 197 ? O HIS A 199 N ILE A 150 ? N ILE A 152 
A 6  7  N ASP A 153 ? N ASP A 155 O GLY A 158 ? O GLY A 160 
A 7  8  N ALA A 161 ? N ALA A 163 O GLN A 181 ? O GLN A 183 
A 8  9  O GLN A 182 ? O GLN A 184 N GLU A 93  ? N GLU A 95  
A 9  10 N ILE A 96  ? N ILE A 98  O TYR A 104 ? O TYR A 106 
A 10 11 N LYS A 111 ? N LYS A 113 O VAL A 118 ? O VAL A 120 
A 11 12 O GLY A 125 ? O GLY A 127 N ASP A 21  ? N ASP A 21  
# 
_database_PDB_matrix.entry_id          1OXD 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1OXD 
_atom_sites.fract_transf_matrix[1][1]   0.019626 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015932 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014385 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1   ? 30.657 10.143 50.198 1.00 28.37 ? 1   MET A N   1 
ATOM   2    C CA  . MET A 1 1   ? 29.847 8.946  49.839 1.00 27.25 ? 1   MET A CA  1 
ATOM   3    C C   . MET A 1 1   ? 28.422 9.036  50.379 1.00 24.09 ? 1   MET A C   1 
ATOM   4    O O   . MET A 1 1   ? 27.864 8.056  50.877 1.00 18.84 ? 1   MET A O   1 
ATOM   5    C CB  . MET A 1 1   ? 30.526 7.682  50.366 1.00 48.07 ? 1   MET A CB  1 
ATOM   6    C CG  . MET A 1 1   ? 30.881 7.742  51.835 1.00 40.33 ? 1   MET A CG  1 
ATOM   7    S SD  . MET A 1 1   ? 31.592 6.197  52.411 1.00 42.93 ? 1   MET A SD  1 
ATOM   8    C CE  . MET A 1 1   ? 33.341 6.529  52.238 1.00 38.03 ? 1   MET A CE  1 
ATOM   9    N N   . SER A 1 2   ? 27.833 10.221 50.284 1.00 20.08 ? 2   SER A N   1 
ATOM   10   C CA  . SER A 1 2   ? 26.466 10.416 50.747 1.00 22.40 ? 2   SER A CA  1 
ATOM   11   C C   . SER A 1 2   ? 25.536 9.578  49.874 1.00 21.15 ? 2   SER A C   1 
ATOM   12   O O   . SER A 1 2   ? 25.901 9.185  48.758 1.00 14.35 ? 2   SER A O   1 
ATOM   13   C CB  . SER A 1 2   ? 26.072 11.890 50.635 1.00 15.57 ? 2   SER A CB  1 
ATOM   14   O OG  . SER A 1 2   ? 26.016 12.294 49.276 1.00 23.64 ? 2   SER A OG  1 
ATOM   15   N N   . LYS A 1 3   ? 24.340 9.294  50.378 1.00 16.03 ? 3   LYS A N   1 
ATOM   16   C CA  . LYS A 1 3   ? 23.381 8.522  49.601 1.00 19.55 ? 3   LYS A CA  1 
ATOM   17   C C   . LYS A 1 3   ? 23.051 9.308  48.341 1.00 17.80 ? 3   LYS A C   1 
ATOM   18   O O   . LYS A 1 3   ? 22.852 8.730  47.275 1.00 16.83 ? 3   LYS A O   1 
ATOM   19   C CB  . LYS A 1 3   ? 22.100 8.272  50.400 1.00 42.57 ? 3   LYS A CB  1 
ATOM   20   C CG  . LYS A 1 3   ? 22.270 7.333  51.582 1.00 31.96 ? 3   LYS A CG  1 
ATOM   21   C CD  . LYS A 1 3   ? 20.920 6.901  52.140 1.00 31.74 ? 3   LYS A CD  1 
ATOM   22   C CE  . LYS A 1 3   ? 20.120 6.111  51.111 1.00 30.94 ? 3   LYS A CE  1 
ATOM   23   N NZ  . LYS A 1 3   ? 20.863 4.910  50.630 1.00 30.53 ? 3   LYS A NZ  1 
ATOM   24   N N   . GLY A 1 4   ? 23.001 10.631 48.472 1.00 20.33 ? 4   GLY A N   1 
ATOM   25   C CA  . GLY A 1 4   ? 22.701 11.479 47.332 1.00 15.63 ? 4   GLY A CA  1 
ATOM   26   C C   . GLY A 1 4   ? 23.725 11.337 46.223 1.00 12.16 ? 4   GLY A C   1 
ATOM   27   O O   . GLY A 1 4   ? 23.373 11.351 45.038 1.00 12.84 ? 4   GLY A O   1 
ATOM   28   N N   . GLU A 1 5   ? 24.993 11.197 46.588 1.00 14.53 ? 5   GLU A N   1 
ATOM   29   C CA  . GLU A 1 5   ? 26.035 11.062 45.580 1.00 14.50 ? 5   GLU A CA  1 
ATOM   30   C C   . GLU A 1 5   ? 25.817 9.844  44.683 1.00 14.48 ? 5   GLU A C   1 
ATOM   31   O O   . GLU A 1 5   ? 26.173 9.855  43.498 1.00 13.88 ? 5   GLU A O   1 
ATOM   32   C CB  . GLU A 1 5   ? 27.423 11.001 46.229 1.00 16.24 ? 5   GLU A CB  1 
ATOM   33   C CG  . GLU A 1 5   ? 28.504 10.694 45.208 1.00 16.47 ? 5   GLU A CG  1 
ATOM   34   C CD  . GLU A 1 5   ? 29.870 11.242 45.563 1.00 17.78 ? 5   GLU A CD  1 
ATOM   35   O OE1 . GLU A 1 5   ? 30.810 10.995 44.780 1.00 18.99 ? 5   GLU A OE1 1 
ATOM   36   O OE2 . GLU A 1 5   ? 30.020 11.919 46.603 1.00 17.59 ? 5   GLU A OE2 1 
ATOM   37   N N   . GLU A 1 6   ? 25.211 8.799  45.231 1.00 15.84 ? 6   GLU A N   1 
ATOM   38   C CA  . GLU A 1 6   ? 24.952 7.595  44.449 1.00 16.39 ? 6   GLU A CA  1 
ATOM   39   C C   . GLU A 1 6   ? 24.068 7.866  43.231 1.00 15.29 ? 6   GLU A C   1 
ATOM   40   O O   . GLU A 1 6   ? 24.111 7.126  42.249 1.00 15.42 ? 6   GLU A O   1 
ATOM   41   C CB  . GLU A 1 6   ? 24.304 6.521  45.329 1.00 31.99 ? 6   GLU A CB  1 
ATOM   42   C CG  . GLU A 1 6   ? 25.223 5.968  46.409 1.00 30.16 ? 6   GLU A CG  1 
ATOM   43   C CD  . GLU A 1 6   ? 24.582 4.848  47.211 1.00 31.70 ? 6   GLU A CD  1 
ATOM   44   O OE1 . GLU A 1 6   ? 24.113 3.865  46.597 1.00 31.94 ? 6   GLU A OE1 1 
ATOM   45   O OE2 . GLU A 1 6   ? 24.552 4.947  48.457 1.00 31.52 ? 6   GLU A OE2 1 
ATOM   46   N N   . LEU A 1 7   ? 23.279 8.932  43.294 1.00 13.79 ? 7   LEU A N   1 
ATOM   47   C CA  . LEU A 1 7   ? 22.376 9.296  42.203 1.00 12.54 ? 7   LEU A CA  1 
ATOM   48   C C   . LEU A 1 7   ? 23.079 9.966  41.019 1.00 11.99 ? 7   LEU A C   1 
ATOM   49   O O   . LEU A 1 7   ? 22.454 10.226 39.982 1.00 14.05 ? 7   LEU A O   1 
ATOM   50   C CB  . LEU A 1 7   ? 21.280 10.233 42.731 1.00 16.93 ? 7   LEU A CB  1 
ATOM   51   C CG  . LEU A 1 7   ? 20.327 9.720  43.819 1.00 23.71 ? 7   LEU A CG  1 
ATOM   52   C CD1 . LEU A 1 7   ? 19.417 10.827 44.292 1.00 21.22 ? 7   LEU A CD1 1 
ATOM   53   C CD2 . LEU A 1 7   ? 19.493 8.579  43.265 1.00 19.36 ? 7   LEU A CD2 1 
ATOM   54   N N   . PHE A 1 8   ? 24.375 10.221 41.167 1.00 12.73 ? 8   PHE A N   1 
ATOM   55   C CA  . PHE A 1 8   ? 25.151 10.905 40.134 1.00 12.72 ? 8   PHE A CA  1 
ATOM   56   C C   . PHE A 1 8   ? 26.246 10.054 39.493 1.00 15.00 ? 8   PHE A C   1 
ATOM   57   O O   . PHE A 1 8   ? 27.090 10.580 38.771 1.00 16.07 ? 8   PHE A O   1 
ATOM   58   C CB  . PHE A 1 8   ? 25.798 12.157 40.743 1.00 13.37 ? 8   PHE A CB  1 
ATOM   59   C CG  . PHE A 1 8   ? 24.814 13.223 41.132 1.00 12.11 ? 8   PHE A CG  1 
ATOM   60   C CD1 . PHE A 1 8   ? 24.461 14.221 40.231 1.00 11.98 ? 8   PHE A CD1 1 
ATOM   61   C CD2 . PHE A 1 8   ? 24.214 13.214 42.394 1.00 11.04 ? 8   PHE A CD2 1 
ATOM   62   C CE1 . PHE A 1 8   ? 23.525 15.192 40.577 1.00 12.18 ? 8   PHE A CE1 1 
ATOM   63   C CE2 . PHE A 1 8   ? 23.275 14.182 42.746 1.00 12.24 ? 8   PHE A CE2 1 
ATOM   64   C CZ  . PHE A 1 8   ? 22.931 15.171 41.837 1.00 10.83 ? 8   PHE A CZ  1 
ATOM   65   N N   . THR A 1 9   ? 26.233 8.749  39.738 1.00 15.76 ? 9   THR A N   1 
ATOM   66   C CA  . THR A 1 9   ? 27.274 7.873  39.200 1.00 18.96 ? 9   THR A CA  1 
ATOM   67   C C   . THR A 1 9   ? 27.340 7.752  37.677 1.00 17.45 ? 9   THR A C   1 
ATOM   68   O O   . THR A 1 9   ? 28.382 7.382  37.131 1.00 18.92 ? 9   THR A O   1 
ATOM   69   C CB  . THR A 1 9   ? 27.165 6.457  39.800 1.00 22.81 ? 9   THR A CB  1 
ATOM   70   O OG1 . THR A 1 9   ? 25.848 5.945  39.577 1.00 23.37 ? 9   THR A OG1 1 
ATOM   71   C CG2 . THR A 1 9   ? 27.442 6.491  41.296 1.00 25.53 ? 9   THR A CG2 1 
ATOM   72   N N   . GLY A 1 10  ? 26.239 8.050  36.994 1.00 15.56 ? 10  GLY A N   1 
ATOM   73   C CA  . GLY A 1 10  ? 26.228 7.968  35.541 1.00 15.74 ? 10  GLY A CA  1 
ATOM   74   C C   . GLY A 1 10  ? 25.808 9.282  34.905 1.00 14.05 ? 10  GLY A C   1 
ATOM   75   O O   . GLY A 1 10  ? 25.926 10.338 35.530 1.00 14.96 ? 10  GLY A O   1 
ATOM   76   N N   . VAL A 1 11  ? 25.333 9.229  33.663 1.00 12.69 ? 11  VAL A N   1 
ATOM   77   C CA  . VAL A 1 11  ? 24.870 10.425 32.954 1.00 12.07 ? 11  VAL A CA  1 
ATOM   78   C C   . VAL A 1 11  ? 23.449 10.719 33.418 1.00 12.19 ? 11  VAL A C   1 
ATOM   79   O O   . VAL A 1 11  ? 22.583 9.848  33.383 1.00 14.22 ? 11  VAL A O   1 
ATOM   80   C CB  . VAL A 1 11  ? 24.877 10.207 31.429 1.00 14.63 ? 11  VAL A CB  1 
ATOM   81   C CG1 . VAL A 1 11  ? 24.288 11.421 30.719 1.00 17.56 ? 11  VAL A CG1 1 
ATOM   82   C CG2 . VAL A 1 11  ? 26.302 9.958  30.957 1.00 16.54 ? 11  VAL A CG2 1 
ATOM   83   N N   . VAL A 1 12  ? 23.216 11.952 33.840 1.00 11.13 ? 12  VAL A N   1 
ATOM   84   C CA  . VAL A 1 12  ? 21.927 12.354 34.373 1.00 10.63 ? 12  VAL A CA  1 
ATOM   85   C C   . VAL A 1 12  ? 21.268 13.440 33.544 1.00 10.32 ? 12  VAL A C   1 
ATOM   86   O O   . VAL A 1 12  ? 21.897 14.438 33.242 1.00 10.59 ? 12  VAL A O   1 
ATOM   87   C CB  . VAL A 1 12  ? 22.109 12.889 35.817 1.00 10.96 ? 12  VAL A CB  1 
ATOM   88   C CG1 . VAL A 1 12  ? 20.804 13.460 36.343 1.00 14.27 ? 12  VAL A CG1 1 
ATOM   89   C CG2 . VAL A 1 12  ? 22.606 11.782 36.723 1.00 13.46 ? 12  VAL A CG2 1 
ATOM   90   N N   . PRO A 1 13  ? 19.991 13.255 33.161 1.00 10.12 ? 13  PRO A N   1 
ATOM   91   C CA  . PRO A 1 13  ? 19.317 14.288 32.372 1.00 10.80 ? 13  PRO A CA  1 
ATOM   92   C C   . PRO A 1 13  ? 19.061 15.500 33.271 1.00 9.02  ? 13  PRO A C   1 
ATOM   93   O O   . PRO A 1 13  ? 18.761 15.351 34.472 1.00 10.40 ? 13  PRO A O   1 
ATOM   94   C CB  . PRO A 1 13  ? 18.008 13.618 31.945 1.00 13.16 ? 13  PRO A CB  1 
ATOM   95   C CG  . PRO A 1 13  ? 18.297 12.141 32.061 1.00 17.01 ? 13  PRO A CG  1 
ATOM   96   C CD  . PRO A 1 13  ? 19.149 12.055 33.296 1.00 11.60 ? 13  PRO A CD  1 
ATOM   97   N N   . ILE A 1 14  ? 19.171 16.685 32.690 1.00 8.85  ? 14  ILE A N   1 
ATOM   98   C CA  . ILE A 1 14  ? 18.962 17.932 33.411 1.00 9.69  ? 14  ILE A CA  1 
ATOM   99   C C   . ILE A 1 14  ? 17.867 18.764 32.753 1.00 8.84  ? 14  ILE A C   1 
ATOM   100  O O   . ILE A 1 14  ? 17.789 18.845 31.509 1.00 10.48 ? 14  ILE A O   1 
ATOM   101  C CB  . ILE A 1 14  ? 20.256 18.783 33.428 1.00 9.71  ? 14  ILE A CB  1 
ATOM   102  C CG1 . ILE A 1 14  ? 21.389 18.002 34.094 1.00 11.51 ? 14  ILE A CG1 1 
ATOM   103  C CG2 . ILE A 1 14  ? 20.003 20.104 34.129 1.00 12.46 ? 14  ILE A CG2 1 
ATOM   104  C CD1 . ILE A 1 14  ? 22.748 18.641 33.937 1.00 12.15 ? 14  ILE A CD1 1 
ATOM   105  N N   . LEU A 1 15  ? 17.025 19.375 33.578 1.00 9.32  ? 15  LEU A N   1 
ATOM   106  C CA  . LEU A 1 15  ? 15.969 20.255 33.087 1.00 9.96  ? 15  LEU A CA  1 
ATOM   107  C C   . LEU A 1 15  ? 16.030 21.537 33.904 1.00 8.91  ? 15  LEU A C   1 
ATOM   108  O O   . LEU A 1 15  ? 16.097 21.489 35.143 1.00 10.37 ? 15  LEU A O   1 
ATOM   109  C CB  . LEU A 1 15  ? 14.597 19.603 33.249 1.00 11.07 ? 15  LEU A CB  1 
ATOM   110  C CG  . LEU A 1 15  ? 13.408 20.423 32.749 1.00 10.74 ? 15  LEU A CG  1 
ATOM   111  C CD1 . LEU A 1 15  ? 13.451 20.519 31.228 1.00 14.32 ? 15  LEU A CD1 1 
ATOM   112  C CD2 . LEU A 1 15  ? 12.116 19.767 33.195 1.00 21.97 ? 15  LEU A CD2 1 
ATOM   113  N N   . VAL A 1 16  ? 16.018 22.678 33.226 1.00 9.49  ? 16  VAL A N   1 
ATOM   114  C CA  . VAL A 1 16  ? 16.078 23.965 33.898 1.00 9.84  ? 16  VAL A CA  1 
ATOM   115  C C   . VAL A 1 16  ? 14.897 24.819 33.451 1.00 8.93  ? 16  VAL A C   1 
ATOM   116  O O   . VAL A 1 16  ? 14.573 24.872 32.254 1.00 11.12 ? 16  VAL A O   1 
ATOM   117  C CB  . VAL A 1 16  ? 17.395 24.713 33.556 1.00 9.88  ? 16  VAL A CB  1 
ATOM   118  C CG1 . VAL A 1 16  ? 17.467 26.016 34.338 1.00 10.91 ? 16  VAL A CG1 1 
ATOM   119  C CG2 . VAL A 1 16  ? 18.602 23.845 33.872 1.00 11.02 ? 16  VAL A CG2 1 
ATOM   120  N N   . GLU A 1 17  ? 14.245 25.481 34.401 1.00 9.50  ? 17  GLU A N   1 
ATOM   121  C CA  . GLU A 1 17  ? 13.116 26.356 34.099 1.00 9.68  ? 17  GLU A CA  1 
ATOM   122  C C   . GLU A 1 17  ? 13.316 27.639 34.883 1.00 9.62  ? 17  GLU A C   1 
ATOM   123  O O   . GLU A 1 17  ? 13.487 27.602 36.108 1.00 11.19 ? 17  GLU A O   1 
ATOM   124  C CB  . GLU A 1 17  ? 11.788 25.717 34.518 1.00 11.89 ? 17  GLU A CB  1 
ATOM   125  C CG  . GLU A 1 17  ? 11.522 24.325 33.961 1.00 13.49 ? 17  GLU A CG  1 
ATOM   126  C CD  . GLU A 1 17  ? 11.345 24.271 32.452 1.00 14.37 ? 17  GLU A CD  1 
ATOM   127  O OE1 . GLU A 1 17  ? 11.094 25.314 31.812 1.00 16.13 ? 17  GLU A OE1 1 
ATOM   128  O OE2 . GLU A 1 17  ? 11.444 23.152 31.905 1.00 15.83 ? 17  GLU A OE2 1 
ATOM   129  N N   . LEU A 1 18  ? 13.289 28.773 34.193 1.00 9.47  ? 18  LEU A N   1 
ATOM   130  C CA  . LEU A 1 18  ? 13.486 30.049 34.847 1.00 10.55 ? 18  LEU A CA  1 
ATOM   131  C C   . LEU A 1 18  ? 12.453 31.075 34.424 1.00 10.03 ? 18  LEU A C   1 
ATOM   132  O O   . LEU A 1 18  ? 12.145 31.207 33.228 1.00 11.00 ? 18  LEU A O   1 
ATOM   133  C CB  . LEU A 1 18  ? 14.879 30.599 34.511 1.00 12.06 ? 18  LEU A CB  1 
ATOM   134  C CG  . LEU A 1 18  ? 15.200 32.009 35.023 1.00 11.81 ? 18  LEU A CG  1 
ATOM   135  C CD1 . LEU A 1 18  ? 16.699 32.148 35.232 1.00 15.26 ? 18  LEU A CD1 1 
ATOM   136  C CD2 . LEU A 1 18  ? 14.689 33.057 34.046 1.00 14.36 ? 18  LEU A CD2 1 
ATOM   137  N N   . ASP A 1 19  ? 11.898 31.777 35.409 1.00 10.20 ? 19  ASP A N   1 
ATOM   138  C CA  . ASP A 1 19  ? 10.992 32.880 35.139 1.00 11.23 ? 19  ASP A CA  1 
ATOM   139  C C   . ASP A 1 19  ? 11.735 34.101 35.666 1.00 10.78 ? 19  ASP A C   1 
ATOM   140  O O   . ASP A 1 19  ? 12.201 34.108 36.817 1.00 11.69 ? 19  ASP A O   1 
ATOM   141  C CB  . ASP A 1 19  ? 9.660  32.718 35.866 1.00 16.09 ? 19  ASP A CB  1 
ATOM   142  C CG  . ASP A 1 19  ? 8.765  31.684 35.214 1.00 18.51 ? 19  ASP A CG  1 
ATOM   143  O OD1 . ASP A 1 19  ? 8.898  31.450 33.991 1.00 19.16 ? 19  ASP A OD1 1 
ATOM   144  O OD2 . ASP A 1 19  ? 7.911  31.119 35.923 1.00 22.67 ? 19  ASP A OD2 1 
ATOM   145  N N   . GLY A 1 20  ? 11.861 35.119 34.822 1.00 10.67 ? 20  GLY A N   1 
ATOM   146  C CA  . GLY A 1 20  ? 12.582 36.309 35.215 1.00 11.30 ? 20  GLY A CA  1 
ATOM   147  C C   . GLY A 1 20  ? 11.848 37.603 34.961 1.00 10.86 ? 20  GLY A C   1 
ATOM   148  O O   . GLY A 1 20  ? 10.917 37.671 34.145 1.00 11.54 ? 20  GLY A O   1 
ATOM   149  N N   . ASP A 1 21  ? 12.278 38.636 35.672 1.00 10.75 ? 21  ASP A N   1 
ATOM   150  C CA  . ASP A 1 21  ? 11.698 39.962 35.552 1.00 11.85 ? 21  ASP A CA  1 
ATOM   151  C C   . ASP A 1 21  ? 12.828 40.914 35.897 1.00 10.60 ? 21  ASP A C   1 
ATOM   152  O O   . ASP A 1 21  ? 13.236 40.971 37.056 1.00 11.77 ? 21  ASP A O   1 
ATOM   153  C CB  . ASP A 1 21  ? 10.557 40.125 36.562 1.00 12.93 ? 21  ASP A CB  1 
ATOM   154  C CG  . ASP A 1 21  ? 9.937  41.516 36.539 1.00 14.72 ? 21  ASP A CG  1 
ATOM   155  O OD1 . ASP A 1 21  ? 10.655 42.493 36.251 1.00 14.09 ? 21  ASP A OD1 1 
ATOM   156  O OD2 . ASP A 1 21  ? 8.728  41.634 36.837 1.00 17.70 ? 21  ASP A OD2 1 
ATOM   157  N N   . VAL A 1 22  ? 13.345 41.641 34.910 1.00 10.86 ? 22  VAL A N   1 
ATOM   158  C CA  . VAL A 1 22  ? 14.436 42.581 35.141 1.00 10.55 ? 22  VAL A CA  1 
ATOM   159  C C   . VAL A 1 22  ? 13.920 43.955 34.733 1.00 9.91  ? 22  VAL A C   1 
ATOM   160  O O   . VAL A 1 22  ? 13.639 44.197 33.547 1.00 11.44 ? 22  VAL A O   1 
ATOM   161  C CB  . VAL A 1 22  ? 15.689 42.200 34.308 1.00 11.23 ? 22  VAL A CB  1 
ATOM   162  C CG1 . VAL A 1 22  ? 16.774 43.244 34.473 1.00 12.46 ? 22  VAL A CG1 1 
ATOM   163  C CG2 . VAL A 1 22  ? 16.212 40.839 34.765 1.00 12.19 ? 22  VAL A CG2 1 
ATOM   164  N N   . ASN A 1 23  ? 13.793 44.852 35.708 1.00 11.48 ? 23  ASN A N   1 
ATOM   165  C CA  . ASN A 1 23  ? 13.264 46.190 35.463 1.00 12.10 ? 23  ASN A CA  1 
ATOM   166  C C   . ASN A 1 23  ? 11.900 46.104 34.765 1.00 11.27 ? 23  ASN A C   1 
ATOM   167  O O   . ASN A 1 23  ? 11.565 46.949 33.940 1.00 12.78 ? 23  ASN A O   1 
ATOM   168  C CB  . ASN A 1 23  ? 14.230 47.022 34.605 1.00 13.20 ? 23  ASN A CB  1 
ATOM   169  C CG  . ASN A 1 23  ? 15.282 47.744 35.431 1.00 13.19 ? 23  ASN A CG  1 
ATOM   170  O OD1 . ASN A 1 23  ? 15.829 47.188 36.382 1.00 13.73 ? 23  ASN A OD1 1 
ATOM   171  N ND2 . ASN A 1 23  ? 15.584 48.985 35.055 1.00 14.15 ? 23  ASN A ND2 1 
ATOM   172  N N   . GLY A 1 24  ? 11.112 45.093 35.101 1.00 11.21 ? 24  GLY A N   1 
ATOM   173  C CA  . GLY A 1 24  ? 9.805  44.957 34.480 1.00 11.75 ? 24  GLY A CA  1 
ATOM   174  C C   . GLY A 1 24  ? 9.787  44.193 33.164 1.00 11.69 ? 24  GLY A C   1 
ATOM   175  O O   . GLY A 1 24  ? 8.715  43.888 32.641 1.00 13.00 ? 24  GLY A O   1 
ATOM   176  N N   . HIS A 1 25  ? 10.965 43.898 32.617 1.00 11.67 ? 25  HIS A N   1 
ATOM   177  C CA  . HIS A 1 25  ? 11.056 43.137 31.374 1.00 12.05 ? 25  HIS A CA  1 
ATOM   178  C C   . HIS A 1 25  ? 10.962 41.677 31.786 1.00 12.07 ? 25  HIS A C   1 
ATOM   179  O O   . HIS A 1 25  ? 11.904 41.131 32.362 1.00 12.29 ? 25  HIS A O   1 
ATOM   180  C CB  . HIS A 1 25  ? 12.397 43.381 30.674 1.00 14.05 ? 25  HIS A CB  1 
ATOM   181  C CG  . HIS A 1 25  ? 12.576 44.779 30.166 1.00 16.29 ? 25  HIS A CG  1 
ATOM   182  N ND1 . HIS A 1 25  ? 13.110 45.795 30.930 1.00 18.63 ? 25  HIS A ND1 1 
ATOM   183  C CD2 . HIS A 1 25  ? 12.296 45.325 28.959 1.00 18.07 ? 25  HIS A CD2 1 
ATOM   184  C CE1 . HIS A 1 25  ? 13.155 46.905 30.214 1.00 17.83 ? 25  HIS A CE1 1 
ATOM   185  N NE2 . HIS A 1 25  ? 12.667 46.646 29.015 1.00 22.99 ? 25  HIS A NE2 1 
ATOM   186  N N   . LYS A 1 26  ? 9.829  41.052 31.497 1.00 11.48 ? 26  LYS A N   1 
ATOM   187  C CA  . LYS A 1 26  ? 9.600  39.665 31.875 1.00 12.47 ? 26  LYS A CA  1 
ATOM   188  C C   . LYS A 1 26  ? 10.017 38.694 30.789 1.00 12.78 ? 26  LYS A C   1 
ATOM   189  O O   . LYS A 1 26  ? 9.893  38.985 29.592 1.00 14.17 ? 26  LYS A O   1 
ATOM   190  C CB  . LYS A 1 26  ? 8.120  39.461 32.206 1.00 15.05 ? 26  LYS A CB  1 
ATOM   191  C CG  . LYS A 1 26  ? 7.631  40.298 33.379 1.00 16.91 ? 26  LYS A CG  1 
ATOM   192  C CD  . LYS A 1 26  ? 6.130  40.130 33.589 1.00 21.16 ? 26  LYS A CD  1 
ATOM   193  C CE  . LYS A 1 26  ? 5.634  40.965 34.761 1.00 22.77 ? 26  LYS A CE  1 
ATOM   194  N NZ  . LYS A 1 26  ? 6.221  40.507 36.053 1.00 26.29 ? 26  LYS A NZ  1 
ATOM   195  N N   . PHE A 1 27  ? 10.499 37.530 31.200 1.00 11.17 ? 27  PHE A N   1 
ATOM   196  C CA  . PHE A 1 27  ? 10.930 36.527 30.245 1.00 11.77 ? 27  PHE A CA  1 
ATOM   197  C C   . PHE A 1 27  ? 11.022 35.177 30.927 1.00 10.84 ? 27  PHE A C   1 
ATOM   198  O O   . PHE A 1 27  ? 11.021 35.087 32.162 1.00 10.94 ? 27  PHE A O   1 
ATOM   199  C CB  . PHE A 1 27  ? 12.308 36.884 29.683 1.00 12.97 ? 27  PHE A CB  1 
ATOM   200  C CG  . PHE A 1 27  ? 13.383 36.984 30.730 1.00 11.60 ? 27  PHE A CG  1 
ATOM   201  C CD1 . PHE A 1 27  ? 13.530 38.137 31.491 1.00 13.35 ? 27  PHE A CD1 1 
ATOM   202  C CD2 . PHE A 1 27  ? 14.258 35.924 30.950 1.00 14.10 ? 27  PHE A CD2 1 
ATOM   203  C CE1 . PHE A 1 27  ? 14.531 38.237 32.453 1.00 15.76 ? 27  PHE A CE1 1 
ATOM   204  C CE2 . PHE A 1 27  ? 15.263 36.018 31.914 1.00 13.05 ? 27  PHE A CE2 1 
ATOM   205  C CZ  . PHE A 1 27  ? 15.397 37.175 32.661 1.00 14.07 ? 27  PHE A CZ  1 
ATOM   206  N N   . SER A 1 28  ? 11.082 34.125 30.124 1.00 11.46 ? 28  SER A N   1 
ATOM   207  C CA  . SER A 1 28  ? 11.226 32.780 30.649 1.00 11.04 ? 28  SER A CA  1 
ATOM   208  C C   . SER A 1 28  ? 12.279 32.057 29.834 1.00 10.93 ? 28  SER A C   1 
ATOM   209  O O   . SER A 1 28  ? 12.459 32.336 28.642 1.00 12.31 ? 28  SER A O   1 
ATOM   210  C CB  . SER A 1 28  ? 9.913  32.009 30.568 1.00 13.37 ? 28  SER A CB  1 
ATOM   211  O OG  . SER A 1 28  ? 8.943  32.585 31.419 1.00 15.67 ? 28  SER A OG  1 
ATOM   212  N N   . VAL A 1 29  ? 12.977 31.137 30.484 1.00 10.21 ? 29  VAL A N   1 
ATOM   213  C CA  . VAL A 1 29  ? 14.013 30.361 29.835 1.00 11.39 ? 29  VAL A CA  1 
ATOM   214  C C   . VAL A 1 29  ? 13.837 28.909 30.221 1.00 9.41  ? 29  VAL A C   1 
ATOM   215  O O   . VAL A 1 29  ? 13.516 28.605 31.377 1.00 11.30 ? 29  VAL A O   1 
ATOM   216  C CB  . VAL A 1 29  ? 15.423 30.814 30.292 1.00 10.81 ? 29  VAL A CB  1 
ATOM   217  C CG1 . VAL A 1 29  ? 16.487 29.852 29.766 1.00 12.15 ? 29  VAL A CG1 1 
ATOM   218  C CG2 . VAL A 1 29  ? 15.696 32.230 29.806 1.00 13.53 ? 29  VAL A CG2 1 
ATOM   219  N N   . SER A 1 30  ? 14.001 28.018 29.250 1.00 10.37 ? 30  SER A N   1 
ATOM   220  C CA  . SER A 1 30  ? 13.940 26.588 29.517 1.00 10.98 ? 30  SER A CA  1 
ATOM   221  C C   . SER A 1 30  ? 15.282 26.024 29.077 1.00 11.07 ? 30  SER A C   1 
ATOM   222  O O   . SER A 1 30  ? 15.892 26.532 28.135 1.00 14.58 ? 30  SER A O   1 
ATOM   223  C CB  . SER A 1 30  ? 12.820 25.915 28.719 1.00 11.33 ? 30  SER A CB  1 
ATOM   224  O OG  . SER A 1 30  ? 13.054 26.023 27.327 1.00 16.51 ? 30  SER A OG  1 
ATOM   225  N N   . GLY A 1 31  ? 15.754 24.992 29.759 1.00 9.89  ? 31  GLY A N   1 
ATOM   226  C CA  . GLY A 1 31  ? 17.019 24.406 29.387 1.00 10.55 ? 31  GLY A CA  1 
ATOM   227  C C   . GLY A 1 31  ? 16.984 22.912 29.548 1.00 10.06 ? 31  GLY A C   1 
ATOM   228  O O   . GLY A 1 31  ? 16.265 22.394 30.396 1.00 9.61  ? 31  GLY A O   1 
ATOM   229  N N   . GLU A 1 32  ? 17.763 22.218 28.732 1.00 10.10 ? 32  GLU A N   1 
ATOM   230  C CA  . GLU A 1 32  ? 17.842 20.769 28.796 1.00 10.93 ? 32  GLU A CA  1 
ATOM   231  C C   . GLU A 1 32  ? 19.260 20.338 28.506 1.00 11.21 ? 32  GLU A C   1 
ATOM   232  O O   . GLU A 1 32  ? 19.974 20.987 27.738 1.00 12.35 ? 32  GLU A O   1 
ATOM   233  C CB  . GLU A 1 32  ? 16.939 20.129 27.749 1.00 11.89 ? 32  GLU A CB  1 
ATOM   234  C CG  . GLU A 1 32  ? 15.461 20.359 27.962 1.00 14.93 ? 32  GLU A CG  1 
ATOM   235  C CD  . GLU A 1 32  ? 14.615 19.651 26.926 1.00 16.09 ? 32  GLU A CD  1 
ATOM   236  O OE1 . GLU A 1 32  ? 15.144 18.742 26.250 1.00 18.74 ? 32  GLU A OE1 1 
ATOM   237  O OE2 . GLU A 1 32  ? 13.423 19.997 26.796 1.00 15.47 ? 32  GLU A OE2 1 
ATOM   238  N N   . GLY A 1 33  ? 19.663 19.231 29.101 1.00 10.37 ? 33  GLY A N   1 
ATOM   239  C CA  . GLY A 1 33  ? 20.995 18.730 28.854 1.00 12.84 ? 33  GLY A CA  1 
ATOM   240  C C   . GLY A 1 33  ? 21.269 17.511 29.692 1.00 9.97  ? 33  GLY A C   1 
ATOM   241  O O   . GLY A 1 33  ? 20.351 16.820 30.130 1.00 10.59 ? 33  GLY A O   1 
ATOM   242  N N   . GLU A 1 34  ? 22.548 17.249 29.916 1.00 11.21 ? 34  GLU A N   1 
ATOM   243  C CA  . GLU A 1 34  ? 22.963 16.098 30.694 1.00 12.19 ? 34  GLU A CA  1 
ATOM   244  C C   . GLU A 1 34  ? 24.205 16.450 31.478 1.00 11.06 ? 34  GLU A C   1 
ATOM   245  O O   . GLU A 1 34  ? 24.988 17.306 31.071 1.00 10.66 ? 34  GLU A O   1 
ATOM   246  C CB  . GLU A 1 34  ? 23.276 14.923 29.771 1.00 16.65 ? 34  GLU A CB  1 
ATOM   247  C CG  . GLU A 1 34  ? 22.080 14.392 29.004 1.00 25.48 ? 34  GLU A CG  1 
ATOM   248  C CD  . GLU A 1 34  ? 22.466 13.324 28.004 1.00 28.26 ? 34  GLU A CD  1 
ATOM   249  O OE1 . GLU A 1 34  ? 21.556 12.668 27.455 1.00 29.87 ? 34  GLU A OE1 1 
ATOM   250  O OE2 . GLU A 1 34  ? 23.679 13.147 27.762 1.00 32.12 ? 34  GLU A OE2 1 
ATOM   251  N N   . GLY A 1 35  ? 24.364 15.782 32.615 1.00 10.68 ? 35  GLY A N   1 
ATOM   252  C CA  . GLY A 1 35  ? 25.520 15.993 33.464 1.00 11.25 ? 35  GLY A CA  1 
ATOM   253  C C   . GLY A 1 35  ? 26.146 14.656 33.814 1.00 11.46 ? 35  GLY A C   1 
ATOM   254  O O   . GLY A 1 35  ? 25.444 13.669 34.009 1.00 12.32 ? 35  GLY A O   1 
ATOM   255  N N   . ASP A 1 36  ? 27.472 14.627 33.882 1.00 10.40 ? 36  ASP A N   1 
ATOM   256  C CA  . ASP A 1 36  ? 28.214 13.411 34.212 1.00 10.75 ? 36  ASP A CA  1 
ATOM   257  C C   . ASP A 1 36  ? 29.189 13.874 35.299 1.00 11.15 ? 36  ASP A C   1 
ATOM   258  O O   . ASP A 1 36  ? 30.327 14.243 35.024 1.00 10.76 ? 36  ASP A O   1 
ATOM   259  C CB  . ASP A 1 36  ? 28.955 12.901 32.965 1.00 11.76 ? 36  ASP A CB  1 
ATOM   260  C CG  . ASP A 1 36  ? 29.351 11.436 33.066 1.00 14.37 ? 36  ASP A CG  1 
ATOM   261  O OD1 . ASP A 1 36  ? 29.286 10.866 34.175 1.00 16.05 ? 36  ASP A OD1 1 
ATOM   262  O OD2 . ASP A 1 36  ? 29.737 10.848 32.028 1.00 15.45 ? 36  ASP A OD2 1 
ATOM   263  N N   . ALA A 1 37  ? 28.712 13.870 36.541 1.00 10.90 ? 37  ALA A N   1 
ATOM   264  C CA  . ALA A 1 37  ? 29.492 14.353 37.678 1.00 10.64 ? 37  ALA A CA  1 
ATOM   265  C C   . ALA A 1 37  ? 30.835 13.691 37.894 1.00 10.59 ? 37  ALA A C   1 
ATOM   266  O O   . ALA A 1 37  ? 31.751 14.317 38.423 1.00 10.82 ? 37  ALA A O   1 
ATOM   267  C CB  . ALA A 1 37  ? 28.666 14.259 38.949 1.00 11.74 ? 37  ALA A CB  1 
ATOM   268  N N   . THR A 1 38  ? 30.959 12.429 37.502 1.00 11.01 ? 38  THR A N   1 
ATOM   269  C CA  . THR A 1 38  ? 32.225 11.729 37.662 1.00 11.69 ? 38  THR A CA  1 
ATOM   270  C C   . THR A 1 38  ? 33.334 12.517 36.968 1.00 10.37 ? 38  THR A C   1 
ATOM   271  O O   . THR A 1 38  ? 34.487 12.514 37.399 1.00 11.06 ? 38  THR A O   1 
ATOM   272  C CB  . THR A 1 38  ? 32.135 10.308 37.062 1.00 12.39 ? 38  THR A CB  1 
ATOM   273  O OG1 . THR A 1 38  ? 31.182 9.546  37.814 1.00 12.69 ? 38  THR A OG1 1 
ATOM   274  C CG2 . THR A 1 38  ? 33.485 9.608  37.111 1.00 13.48 ? 38  THR A CG2 1 
ATOM   275  N N   . TYR A 1 39  ? 32.969 13.211 35.895 1.00 10.99 ? 39  TYR A N   1 
ATOM   276  C CA  . TYR A 1 39  ? 33.913 14.000 35.110 1.00 11.90 ? 39  TYR A CA  1 
ATOM   277  C C   . TYR A 1 39  ? 33.638 15.493 35.240 1.00 12.47 ? 39  TYR A C   1 
ATOM   278  O O   . TYR A 1 39  ? 34.268 16.301 34.558 1.00 13.47 ? 39  TYR A O   1 
ATOM   279  C CB  . TYR A 1 39  ? 33.825 13.584 33.639 1.00 12.54 ? 39  TYR A CB  1 
ATOM   280  C CG  . TYR A 1 39  ? 33.965 12.094 33.467 1.00 12.36 ? 39  TYR A CG  1 
ATOM   281  C CD1 . TYR A 1 39  ? 35.225 11.495 33.435 1.00 11.95 ? 39  TYR A CD1 1 
ATOM   282  C CD2 . TYR A 1 39  ? 32.845 11.272 33.436 1.00 13.35 ? 39  TYR A CD2 1 
ATOM   283  C CE1 . TYR A 1 39  ? 35.362 10.116 33.387 1.00 13.68 ? 39  TYR A CE1 1 
ATOM   284  C CE2 . TYR A 1 39  ? 32.971 9.889  33.388 1.00 15.25 ? 39  TYR A CE2 1 
ATOM   285  C CZ  . TYR A 1 39  ? 34.235 9.319  33.367 1.00 14.14 ? 39  TYR A CZ  1 
ATOM   286  O OH  . TYR A 1 39  ? 34.373 7.951  33.346 1.00 15.04 ? 39  TYR A OH  1 
ATOM   287  N N   . GLY A 1 40  ? 32.697 15.848 36.115 1.00 12.37 ? 40  GLY A N   1 
ATOM   288  C CA  . GLY A 1 40  ? 32.328 17.241 36.328 1.00 13.23 ? 40  GLY A CA  1 
ATOM   289  C C   . GLY A 1 40  ? 31.874 17.901 35.042 1.00 11.55 ? 40  GLY A C   1 
ATOM   290  O O   . GLY A 1 40  ? 32.020 19.107 34.874 1.00 14.63 ? 40  GLY A O   1 
ATOM   291  N N   . LYS A 1 41  ? 31.269 17.111 34.162 1.00 11.32 ? 41  LYS A N   1 
ATOM   292  C CA  . LYS A 1 41  ? 30.861 17.582 32.842 1.00 10.42 ? 41  LYS A CA  1 
ATOM   293  C C   . LYS A 1 41  ? 29.379 17.860 32.649 1.00 11.34 ? 41  LYS A C   1 
ATOM   294  O O   . LYS A 1 41  ? 28.531 17.043 33.004 1.00 13.44 ? 41  LYS A O   1 
ATOM   295  C CB  . LYS A 1 41  ? 31.322 16.555 31.814 1.00 12.59 ? 41  LYS A CB  1 
ATOM   296  C CG  . LYS A 1 41  ? 31.141 16.959 30.372 1.00 13.33 ? 41  LYS A CG  1 
ATOM   297  C CD  . LYS A 1 41  ? 31.704 15.880 29.463 1.00 14.57 ? 41  LYS A CD  1 
ATOM   298  C CE  . LYS A 1 41  ? 31.729 16.329 28.020 1.00 16.60 ? 41  LYS A CE  1 
ATOM   299  N NZ  . LYS A 1 41  ? 32.396 15.313 27.164 1.00 19.54 ? 41  LYS A NZ  1 
ATOM   300  N N   . LEU A 1 42  ? 29.087 19.002 32.036 1.00 10.49 ? 42  LEU A N   1 
ATOM   301  C CA  . LEU A 1 42  ? 27.718 19.425 31.768 1.00 11.85 ? 42  LEU A CA  1 
ATOM   302  C C   . LEU A 1 42  ? 27.591 19.919 30.336 1.00 11.34 ? 42  LEU A C   1 
ATOM   303  O O   . LEU A 1 42  ? 28.454 20.654 29.850 1.00 12.44 ? 42  LEU A O   1 
ATOM   304  C CB  . LEU A 1 42  ? 27.324 20.582 32.690 1.00 17.33 ? 42  LEU A CB  1 
ATOM   305  C CG  . LEU A 1 42  ? 27.238 20.350 34.194 1.00 17.57 ? 42  LEU A CG  1 
ATOM   306  C CD1 . LEU A 1 42  ? 27.303 21.682 34.929 1.00 20.91 ? 42  LEU A CD1 1 
ATOM   307  C CD2 . LEU A 1 42  ? 25.950 19.619 34.509 1.00 21.80 ? 42  LEU A CD2 1 
ATOM   308  N N   . THR A 1 43  ? 26.512 19.520 29.667 1.00 11.71 ? 43  THR A N   1 
ATOM   309  C CA  . THR A 1 43  ? 26.225 19.965 28.305 1.00 12.89 ? 43  THR A CA  1 
ATOM   310  C C   . THR A 1 43  ? 24.759 20.386 28.330 1.00 11.89 ? 43  THR A C   1 
ATOM   311  O O   . THR A 1 43  ? 23.884 19.585 28.648 1.00 13.02 ? 43  THR A O   1 
ATOM   312  C CB  . THR A 1 43  ? 26.435 18.841 27.269 1.00 16.45 ? 43  THR A CB  1 
ATOM   313  O OG1 . THR A 1 43  ? 25.705 17.674 27.664 1.00 22.45 ? 43  THR A OG1 1 
ATOM   314  C CG2 . THR A 1 43  ? 27.910 18.495 27.162 1.00 18.99 ? 43  THR A CG2 1 
ATOM   315  N N   . LEU A 1 44  ? 24.492 21.645 28.011 1.00 11.13 ? 44  LEU A N   1 
ATOM   316  C CA  . LEU A 1 44  ? 23.129 22.145 28.051 1.00 11.67 ? 44  LEU A CA  1 
ATOM   317  C C   . LEU A 1 44  ? 22.804 23.126 26.945 1.00 11.32 ? 44  LEU A C   1 
ATOM   318  O O   . LEU A 1 44  ? 23.688 23.787 26.396 1.00 12.05 ? 44  LEU A O   1 
ATOM   319  C CB  . LEU A 1 44  ? 22.867 22.866 29.378 1.00 17.24 ? 44  LEU A CB  1 
ATOM   320  C CG  . LEU A 1 44  ? 23.120 22.227 30.748 1.00 21.28 ? 44  LEU A CG  1 
ATOM   321  C CD1 . LEU A 1 44  ? 22.337 20.935 30.863 1.00 23.59 ? 44  LEU A CD1 1 
ATOM   322  C CD2 . LEU A 1 44  ? 24.607 21.990 30.949 1.00 28.13 ? 44  LEU A CD2 1 
ATOM   323  N N   . LYS A 1 45  ? 21.519 23.224 26.637 1.00 10.84 ? 45  LYS A N   1 
ATOM   324  C CA  . LYS A 1 45  ? 21.049 24.184 25.661 1.00 10.77 ? 45  LYS A CA  1 
ATOM   325  C C   . LYS A 1 45  ? 19.869 24.893 26.296 1.00 10.84 ? 45  LYS A C   1 
ATOM   326  O O   . LYS A 1 45  ? 18.935 24.244 26.786 1.00 10.48 ? 45  LYS A O   1 
ATOM   327  C CB  . LYS A 1 45  ? 20.606 23.516 24.364 1.00 11.87 ? 45  LYS A CB  1 
ATOM   328  C CG  . LYS A 1 45  ? 20.062 24.516 23.348 1.00 12.59 ? 45  LYS A CG  1 
ATOM   329  C CD  . LYS A 1 45  ? 19.606 23.825 22.078 1.00 14.58 ? 45  LYS A CD  1 
ATOM   330  C CE  . LYS A 1 45  ? 18.951 24.802 21.125 1.00 13.91 ? 45  LYS A CE  1 
ATOM   331  N NZ  . LYS A 1 45  ? 18.412 24.098 19.923 1.00 15.81 ? 45  LYS A NZ  1 
ATOM   332  N N   . PHE A 1 46  ? 19.937 26.219 26.305 1.00 10.16 ? 46  PHE A N   1 
ATOM   333  C CA  . PHE A 1 46  ? 18.893 27.054 26.876 1.00 11.05 ? 46  PHE A CA  1 
ATOM   334  C C   . PHE A 1 46  ? 18.189 27.836 25.793 1.00 10.18 ? 46  PHE A C   1 
ATOM   335  O O   . PHE A 1 46  ? 18.825 28.297 24.841 1.00 11.16 ? 46  PHE A O   1 
ATOM   336  C CB  . PHE A 1 46  ? 19.493 28.039 27.873 1.00 10.86 ? 46  PHE A CB  1 
ATOM   337  C CG  . PHE A 1 46  ? 20.134 27.379 29.043 1.00 10.54 ? 46  PHE A CG  1 
ATOM   338  C CD1 . PHE A 1 46  ? 21.488 27.083 29.032 1.00 12.31 ? 46  PHE A CD1 1 
ATOM   339  C CD2 . PHE A 1 46  ? 19.374 27.019 30.150 1.00 10.67 ? 46  PHE A CD2 1 
ATOM   340  C CE1 . PHE A 1 46  ? 22.078 26.435 30.112 1.00 13.71 ? 46  PHE A CE1 1 
ATOM   341  C CE2 . PHE A 1 46  ? 19.953 26.370 31.232 1.00 11.79 ? 46  PHE A CE2 1 
ATOM   342  C CZ  . PHE A 1 46  ? 21.306 26.078 31.212 1.00 12.73 ? 46  PHE A CZ  1 
ATOM   343  N N   . ILE A 1 47  ? 16.891 28.034 25.975 1.00 9.57  ? 47  ILE A N   1 
ATOM   344  C CA  . ILE A 1 47  ? 16.064 28.749 25.017 1.00 11.61 ? 47  ILE A CA  1 
ATOM   345  C C   . ILE A 1 47  ? 15.218 29.798 25.727 1.00 11.01 ? 47  ILE A C   1 
ATOM   346  O O   . ILE A 1 47  ? 14.649 29.519 26.789 1.00 11.23 ? 47  ILE A O   1 
ATOM   347  C CB  . ILE A 1 47  ? 15.075 27.773 24.332 1.00 15.06 ? 47  ILE A CB  1 
ATOM   348  C CG1 . ILE A 1 47  ? 15.836 26.655 23.621 1.00 17.81 ? 47  ILE A CG1 1 
ATOM   349  C CG2 . ILE A 1 47  ? 14.165 28.531 23.372 1.00 17.30 ? 47  ILE A CG2 1 
ATOM   350  C CD1 . ILE A 1 47  ? 16.596 27.110 22.402 1.00 21.59 ? 47  ILE A CD1 1 
ATOM   351  N N   . CYS A 1 48  ? 15.142 31.003 25.170 1.00 11.53 ? 48  CYS A N   1 
ATOM   352  C CA  . CYS A 1 48  ? 14.260 32.008 25.753 1.00 12.41 ? 48  CYS A CA  1 
ATOM   353  C C   . CYS A 1 48  ? 12.910 31.685 25.105 1.00 12.62 ? 48  CYS A C   1 
ATOM   354  O O   . CYS A 1 48  ? 12.738 31.825 23.891 1.00 13.49 ? 48  CYS A O   1 
ATOM   355  C CB  . CYS A 1 48  ? 14.675 33.433 25.392 1.00 13.66 ? 48  CYS A CB  1 
ATOM   356  S SG  . CYS A 1 48  ? 13.519 34.647 26.090 1.00 13.84 ? 48  CYS A SG  1 
ATOM   357  N N   . THR A 1 49  ? 11.954 31.254 25.914 1.00 12.56 ? 49  THR A N   1 
ATOM   358  C CA  . THR A 1 49  ? 10.652 30.837 25.410 1.00 13.74 ? 49  THR A CA  1 
ATOM   359  C C   . THR A 1 49  ? 9.640  31.944 25.179 1.00 14.13 ? 49  THR A C   1 
ATOM   360  O O   . THR A 1 49  ? 8.582  31.706 24.595 1.00 16.25 ? 49  THR A O   1 
ATOM   361  C CB  . THR A 1 49  ? 10.023 29.825 26.368 1.00 14.13 ? 49  THR A CB  1 
ATOM   362  O OG1 . THR A 1 49  ? 9.872  30.436 27.652 1.00 16.14 ? 49  THR A OG1 1 
ATOM   363  C CG2 . THR A 1 49  ? 10.915 28.600 26.522 1.00 17.05 ? 49  THR A CG2 1 
ATOM   364  N N   . THR A 1 50  ? 9.960  33.149 25.628 1.00 13.98 ? 50  THR A N   1 
ATOM   365  C CA  . THR A 1 50  ? 9.045  34.271 25.502 1.00 15.54 ? 50  THR A CA  1 
ATOM   366  C C   . THR A 1 50  ? 9.380  35.245 24.377 1.00 15.24 ? 50  THR A C   1 
ATOM   367  O O   . THR A 1 50  ? 8.609  36.165 24.104 1.00 16.75 ? 50  THR A O   1 
ATOM   368  C CB  . THR A 1 50  ? 8.982  35.038 26.836 1.00 16.87 ? 50  THR A CB  1 
ATOM   369  O OG1 . THR A 1 50  ? 10.314 35.239 27.332 1.00 14.33 ? 50  THR A OG1 1 
ATOM   370  C CG2 . THR A 1 50  ? 8.181  34.252 27.862 1.00 16.66 ? 50  THR A CG2 1 
ATOM   371  N N   . GLY A 1 51  ? 10.517 35.035 23.718 1.00 15.70 ? 51  GLY A N   1 
ATOM   372  C CA  . GLY A 1 51  ? 10.931 35.918 22.641 1.00 15.63 ? 51  GLY A CA  1 
ATOM   373  C C   . GLY A 1 51  ? 12.412 36.222 22.774 1.00 14.86 ? 51  GLY A C   1 
ATOM   374  O O   . GLY A 1 51  ? 13.214 35.314 22.987 1.00 16.99 ? 51  GLY A O   1 
ATOM   375  N N   . LYS A 1 52  ? 12.785 37.490 22.656 1.00 15.29 ? 52  LYS A N   1 
ATOM   376  C CA  . LYS A 1 52  ? 14.182 37.874 22.785 1.00 14.70 ? 52  LYS A CA  1 
ATOM   377  C C   . LYS A 1 52  ? 14.522 38.047 24.259 1.00 12.85 ? 52  LYS A C   1 
ATOM   378  O O   . LYS A 1 52  ? 13.736 38.595 25.029 1.00 14.99 ? 52  LYS A O   1 
ATOM   379  C CB  . LYS A 1 52  ? 14.447 39.181 22.035 1.00 20.90 ? 52  LYS A CB  1 
ATOM   380  C CG  . LYS A 1 52  ? 14.241 39.067 20.536 1.00 28.90 ? 52  LYS A CG  1 
ATOM   381  C CD  . LYS A 1 52  ? 14.465 40.395 19.839 1.00 32.94 ? 52  LYS A CD  1 
ATOM   382  C CE  . LYS A 1 52  ? 14.184 40.273 18.351 1.00 34.80 ? 52  LYS A CE  1 
ATOM   383  N NZ  . LYS A 1 52  ? 12.806 39.771 18.099 1.00 36.14 ? 52  LYS A NZ  1 
ATOM   384  N N   . LEU A 1 53  ? 15.693 37.569 24.658 1.00 12.49 ? 53  LEU A N   1 
ATOM   385  C CA  . LEU A 1 53  ? 16.103 37.699 26.050 1.00 12.92 ? 53  LEU A CA  1 
ATOM   386  C C   . LEU A 1 53  ? 16.425 39.181 26.283 1.00 12.14 ? 53  LEU A C   1 
ATOM   387  O O   . LEU A 1 53  ? 17.177 39.776 25.517 1.00 13.49 ? 53  LEU A O   1 
ATOM   388  C CB  . LEU A 1 53  ? 17.338 36.835 26.295 1.00 12.81 ? 53  LEU A CB  1 
ATOM   389  C CG  . LEU A 1 53  ? 17.701 36.568 27.759 1.00 12.08 ? 53  LEU A CG  1 
ATOM   390  C CD1 . LEU A 1 53  ? 16.653 35.659 28.397 1.00 13.78 ? 53  LEU A CD1 1 
ATOM   391  C CD2 . LEU A 1 53  ? 19.079 35.923 27.828 1.00 13.30 ? 53  LEU A CD2 1 
ATOM   392  N N   . PRO A 1 54  ? 15.867 39.798 27.343 1.00 12.88 ? 54  PRO A N   1 
ATOM   393  C CA  . PRO A 1 54  ? 16.128 41.218 27.611 1.00 13.39 ? 54  PRO A CA  1 
ATOM   394  C C   . PRO A 1 54  ? 17.443 41.555 28.312 1.00 12.48 ? 54  PRO A C   1 
ATOM   395  O O   . PRO A 1 54  ? 17.730 42.722 28.571 1.00 13.10 ? 54  PRO A O   1 
ATOM   396  C CB  . PRO A 1 54  ? 14.908 41.641 28.419 1.00 14.26 ? 54  PRO A CB  1 
ATOM   397  C CG  . PRO A 1 54  ? 14.625 40.420 29.217 1.00 14.17 ? 54  PRO A CG  1 
ATOM   398  C CD  . PRO A 1 54  ? 14.801 39.288 28.223 1.00 13.72 ? 54  PRO A CD  1 
ATOM   399  N N   . VAL A 1 55  ? 18.228 40.530 28.629 1.00 11.62 ? 55  VAL A N   1 
ATOM   400  C CA  . VAL A 1 55  ? 19.534 40.709 29.260 1.00 11.81 ? 55  VAL A CA  1 
ATOM   401  C C   . VAL A 1 55  ? 20.500 39.821 28.483 1.00 11.84 ? 55  VAL A C   1 
ATOM   402  O O   . VAL A 1 55  ? 20.072 38.958 27.716 1.00 11.69 ? 55  VAL A O   1 
ATOM   403  C CB  . VAL A 1 55  ? 19.533 40.291 30.753 1.00 11.69 ? 55  VAL A CB  1 
ATOM   404  C CG1 . VAL A 1 55  ? 18.577 41.173 31.535 1.00 13.74 ? 55  VAL A CG1 1 
ATOM   405  C CG2 . VAL A 1 55  ? 19.160 38.822 30.893 1.00 13.19 ? 55  VAL A CG2 1 
ATOM   406  N N   . PRO A 1 56  ? 21.812 40.026 28.650 1.00 10.40 ? 56  PRO A N   1 
ATOM   407  C CA  . PRO A 1 56  ? 22.756 39.181 27.908 1.00 11.38 ? 56  PRO A CA  1 
ATOM   408  C C   . PRO A 1 56  ? 22.800 37.772 28.465 1.00 9.30  ? 56  PRO A C   1 
ATOM   409  O O   . PRO A 1 56  ? 22.786 37.587 29.688 1.00 9.92  ? 56  PRO A O   1 
ATOM   410  C CB  . PRO A 1 56  ? 24.098 39.884 28.106 1.00 11.95 ? 56  PRO A CB  1 
ATOM   411  C CG  . PRO A 1 56  ? 23.720 41.305 28.448 1.00 13.66 ? 56  PRO A CG  1 
ATOM   412  C CD  . PRO A 1 56  ? 22.509 41.135 29.318 1.00 11.51 ? 56  PRO A CD  1 
ATOM   413  N N   . TRP A 1 57  ? 22.876 36.785 27.585 1.00 10.77 ? 57  TRP A N   1 
ATOM   414  C CA  . TRP A 1 57  ? 22.959 35.406 28.029 1.00 9.91  ? 57  TRP A CA  1 
ATOM   415  C C   . TRP A 1 57  ? 24.069 35.161 29.057 1.00 10.32 ? 57  TRP A C   1 
ATOM   416  O O   . TRP A 1 57  ? 23.862 34.438 30.039 1.00 10.79 ? 57  TRP A O   1 
ATOM   417  C CB  . TRP A 1 57  ? 23.168 34.471 26.836 1.00 11.07 ? 57  TRP A CB  1 
ATOM   418  C CG  . TRP A 1 57  ? 21.901 34.142 26.110 1.00 10.50 ? 57  TRP A CG  1 
ATOM   419  C CD1 . TRP A 1 57  ? 21.517 34.594 24.879 1.00 10.45 ? 57  TRP A CD1 1 
ATOM   420  C CD2 . TRP A 1 57  ? 20.849 33.291 26.573 1.00 9.34  ? 57  TRP A CD2 1 
ATOM   421  N NE1 . TRP A 1 57  ? 20.288 34.072 24.546 1.00 10.94 ? 57  TRP A NE1 1 
ATOM   422  C CE2 . TRP A 1 57  ? 19.855 33.270 25.568 1.00 9.68  ? 57  TRP A CE2 1 
ATOM   423  C CE3 . TRP A 1 57  ? 20.648 32.544 27.743 1.00 10.78 ? 57  TRP A CE3 1 
ATOM   424  C CZ2 . TRP A 1 57  ? 18.681 32.532 25.692 1.00 11.02 ? 57  TRP A CZ2 1 
ATOM   425  C CZ3 . TRP A 1 57  ? 19.480 31.809 27.868 1.00 11.75 ? 57  TRP A CZ3 1 
ATOM   426  C CH2 . TRP A 1 57  ? 18.509 31.808 26.847 1.00 10.85 ? 57  TRP A CH2 1 
ATOM   427  N N   . PRO A 1 58  ? 25.259 35.751 28.862 1.00 9.84  ? 58  PRO A N   1 
ATOM   428  C CA  . PRO A 1 58  ? 26.306 35.491 29.857 1.00 10.76 ? 58  PRO A CA  1 
ATOM   429  C C   . PRO A 1 58  ? 25.940 35.843 31.288 1.00 10.10 ? 58  PRO A C   1 
ATOM   430  O O   . PRO A 1 58  ? 26.444 35.221 32.230 1.00 10.76 ? 58  PRO A O   1 
ATOM   431  C CB  . PRO A 1 58  ? 27.485 36.316 29.346 1.00 10.59 ? 58  PRO A CB  1 
ATOM   432  C CG  . PRO A 1 58  ? 27.291 36.295 27.868 1.00 11.71 ? 58  PRO A CG  1 
ATOM   433  C CD  . PRO A 1 58  ? 25.800 36.502 27.714 1.00 10.08 ? 58  PRO A CD  1 
ATOM   434  N N   . THR A 1 59  ? 25.067 36.827 31.462 1.00 9.34  ? 59  THR A N   1 
ATOM   435  C CA  . THR A 1 59  ? 24.689 37.222 32.814 1.00 9.77  ? 59  THR A CA  1 
ATOM   436  C C   . THR A 1 59  ? 23.800 36.223 33.528 1.00 10.16 ? 59  THR A C   1 
ATOM   437  O O   . THR A 1 59  ? 23.603 36.349 34.741 1.00 10.76 ? 59  THR A O   1 
ATOM   438  C CB  . THR A 1 59  ? 23.982 38.605 32.870 1.00 11.32 ? 59  THR A CB  1 
ATOM   439  O OG1 . THR A 1 59  ? 22.658 38.510 32.330 1.00 10.36 ? 59  THR A OG1 1 
ATOM   440  C CG2 . THR A 1 59  ? 24.781 39.643 32.102 1.00 11.37 ? 59  THR A CG2 1 
ATOM   441  N N   . LEU A 1 60  ? 23.295 35.225 32.803 1.00 9.70  ? 60  LEU A N   1 
ATOM   442  C CA  . LEU A 1 60  ? 22.419 34.215 33.386 1.00 10.43 ? 60  LEU A CA  1 
ATOM   443  C C   . LEU A 1 60  ? 23.098 32.872 33.599 1.00 10.13 ? 60  LEU A C   1 
ATOM   444  O O   . LEU A 1 60  ? 22.500 31.968 34.160 1.00 10.26 ? 60  LEU A O   1 
ATOM   445  C CB  . LEU A 1 60  ? 21.204 33.980 32.494 1.00 10.14 ? 60  LEU A CB  1 
ATOM   446  C CG  . LEU A 1 60  ? 20.263 35.156 32.237 1.00 11.57 ? 60  LEU A CG  1 
ATOM   447  C CD1 . LEU A 1 60  ? 19.083 34.665 31.423 1.00 12.42 ? 60  LEU A CD1 1 
ATOM   448  C CD2 . LEU A 1 60  ? 19.763 35.741 33.545 1.00 12.99 ? 60  LEU A CD2 1 
ATOM   449  N N   . VAL A 1 61  ? 24.337 32.735 33.151 1.00 10.17 ? 61  VAL A N   1 
ATOM   450  C CA  . VAL A 1 61  ? 25.043 31.472 33.281 1.00 10.35 ? 61  VAL A CA  1 
ATOM   451  C C   . VAL A 1 61  ? 25.096 30.939 34.712 1.00 9.51  ? 61  VAL A C   1 
ATOM   452  O O   . VAL A 1 61  ? 24.737 29.790 34.965 1.00 10.29 ? 61  VAL A O   1 
ATOM   453  C CB  . VAL A 1 61  ? 26.482 31.593 32.710 1.00 9.63  ? 61  VAL A CB  1 
ATOM   454  C CG1 . VAL A 1 61  ? 27.306 30.364 33.067 1.00 14.13 ? 61  VAL A CG1 1 
ATOM   455  C CG2 . VAL A 1 61  ? 26.416 31.761 31.193 1.00 11.69 ? 61  VAL A CG2 1 
ATOM   456  N N   . THR A 1 62  ? 25.535 31.763 35.660 1.00 9.30  ? 62  THR A N   1 
ATOM   457  C CA  . THR A 1 62  ? 25.616 31.277 37.036 1.00 9.69  ? 62  THR A CA  1 
ATOM   458  C C   . THR A 1 62  ? 24.252 30.904 37.612 1.00 10.02 ? 62  THR A C   1 
ATOM   459  O O   . THR A 1 62  ? 24.150 30.004 38.435 1.00 10.56 ? 62  THR A O   1 
ATOM   460  C CB  . THR A 1 62  ? 26.285 32.298 37.978 1.00 10.74 ? 62  THR A CB  1 
ATOM   461  O OG1 . THR A 1 62  ? 25.646 33.566 37.826 1.00 10.70 ? 62  THR A OG1 1 
ATOM   462  C CG2 . THR A 1 62  ? 27.766 32.433 37.666 1.00 12.10 ? 62  THR A CG2 1 
ATOM   463  N N   . THR A 1 63  ? 23.199 31.586 37.184 1.00 9.43  ? 63  THR A N   1 
ATOM   464  C CA  . THR A 1 63  ? 21.872 31.285 37.701 1.00 9.69  ? 63  THR A CA  1 
ATOM   465  C C   . THR A 1 63  ? 21.290 29.995 37.129 1.00 9.32  ? 63  THR A C   1 
ATOM   466  O O   . THR A 1 63  ? 20.768 29.153 37.868 1.00 9.94  ? 63  THR A O   1 
ATOM   467  C CB  . THR A 1 63  ? 20.906 32.437 37.389 1.00 10.42 ? 63  THR A CB  1 
ATOM   468  O OG1 . THR A 1 63  ? 21.362 33.619 38.052 1.00 9.58  ? 63  THR A OG1 1 
ATOM   469  C CG2 . THR A 1 63  ? 19.497 32.113 37.862 1.00 11.60 ? 63  THR A CG2 1 
ATOM   470  N N   . LEU A 1 64  ? 21.372 29.846 35.807 1.00 10.99 ? 64  LEU A N   1 
ATOM   471  C CA  . LEU A 1 64  ? 20.815 28.675 35.131 1.00 9.23  ? 64  LEU A CA  1 
ATOM   472  C C   . LEU A 1 64  ? 21.659 27.467 35.567 1.00 10.76 ? 64  LEU A C   1 
ATOM   473  O O   . LEU A 1 64  ? 20.998 26.315 35.558 1.00 11.02 ? 64  LEU A O   1 
ATOM   474  C CB  . LEU A 1 64  ? 20.985 28.837 33.626 1.00 10.10 ? 64  LEU A CB  1 
ATOM   475  C CG  . LEU A 1 64  ? 20.111 29.976 33.086 1.00 10.40 ? 64  LEU A CG  1 
ATOM   476  C CD1 . LEU A 1 64  ? 20.507 30.312 31.661 1.00 9.99  ? 64  LEU A CD1 1 
ATOM   477  C CD2 . LEU A 1 64  ? 18.646 29.567 33.158 1.00 11.98 ? 64  LEU A CD2 1 
HETATM 478  N N1  . CRF A 1 65  ? 23.137 27.511 35.618 1.00 10.57 ? 66  CRF A N1  1 
HETATM 479  C CA1 . CRF A 1 65  ? 24.052 26.411 35.942 1.00 12.30 ? 66  CRF A CA1 1 
HETATM 480  C CB1 . CRF A 1 65  ? 24.891 25.850 34.800 1.00 13.85 ? 66  CRF A CB1 1 
HETATM 481  C CG1 . CRF A 1 65  ? 24.064 25.327 33.598 1.00 15.04 ? 66  CRF A CG1 1 
HETATM 482  O OG1 . CRF A 1 65  ? 25.776 26.870 34.299 1.00 16.97 ? 66  CRF A OG1 1 
HETATM 483  C C1  . CRF A 1 65  ? 24.822 26.921 37.124 1.00 11.25 ? 66  CRF A C1  1 
HETATM 484  N N2  . CRF A 1 65  ? 25.997 27.386 37.053 1.00 11.42 ? 66  CRF A N2  1 
HETATM 485  N N3  . CRF A 1 65  ? 24.347 26.985 38.404 1.00 10.76 ? 66  CRF A N3  1 
HETATM 486  C C2  . CRF A 1 65  ? 25.368 27.522 39.158 1.00 10.91 ? 66  CRF A C2  1 
HETATM 487  O O2  . CRF A 1 65  ? 25.332 27.754 40.409 1.00 11.46 ? 66  CRF A O2  1 
HETATM 488  C CA2 . CRF A 1 65  ? 26.448 27.799 38.221 1.00 11.62 ? 66  CRF A CA2 1 
HETATM 489  C CA3 . CRF A 1 65  ? 22.981 26.574 38.836 1.00 12.28 ? 66  CRF A CA3 1 
HETATM 490  C C3  . CRF A 1 65  ? 22.818 25.207 39.386 1.00 24.68 ? 66  CRF A C3  1 
HETATM 491  O O3  . CRF A 1 65  ? 21.836 25.013 40.263 1.00 29.09 ? 66  CRF A O3  1 
HETATM 492  C CB2 . CRF A 1 65  ? 27.690 28.411 38.490 1.00 13.22 ? 66  CRF A CB2 1 
HETATM 493  C CG2 . CRF A 1 65  ? 28.702 28.714 37.544 1.00 12.74 ? 66  CRF A CG2 1 
HETATM 494  C CD1 . CRF A 1 65  ? 28.676 28.431 36.157 1.00 13.96 ? 66  CRF A CD1 1 
HETATM 495  C CD2 . CRF A 1 65  ? 29.919 29.374 37.764 1.00 13.48 ? 66  CRF A CD2 1 
HETATM 496  C CE2 . CRF A 1 65  ? 30.555 29.445 36.480 1.00 13.95 ? 66  CRF A CE2 1 
HETATM 497  N NE1 . CRF A 1 65  ? 29.784 28.872 35.565 1.00 16.93 ? 66  CRF A NE1 1 
HETATM 498  C CE3 . CRF A 1 65  ? 30.606 29.943 38.834 1.00 13.19 ? 66  CRF A CE3 1 
HETATM 499  C CZ2 . CRF A 1 65  ? 31.812 30.052 36.286 1.00 15.98 ? 66  CRF A CZ2 1 
HETATM 500  C CZ3 . CRF A 1 65  ? 31.889 30.566 38.653 1.00 15.73 ? 66  CRF A CZ3 1 
HETATM 501  C CH2 . CRF A 1 65  ? 32.487 30.619 37.386 1.00 15.42 ? 66  CRF A CH2 1 
ATOM   502  N N   . VAL A 1 66  ? 23.761 24.147 38.777 1.00 11.27 ? 68  VAL A N   1 
ATOM   503  C CA  . VAL A 1 66  ? 23.531 22.803 39.244 1.00 10.87 ? 68  VAL A CA  1 
ATOM   504  C C   . VAL A 1 66  ? 24.895 22.308 39.695 1.00 10.46 ? 68  VAL A C   1 
ATOM   505  O O   . VAL A 1 66  ? 25.501 21.423 39.096 1.00 10.51 ? 68  VAL A O   1 
ATOM   506  C CB  . VAL A 1 66  ? 22.920 21.964 38.105 1.00 10.70 ? 68  VAL A CB  1 
ATOM   507  C CG1 . VAL A 1 66  ? 21.459 22.373 37.929 1.00 11.62 ? 68  VAL A CG1 1 
ATOM   508  C CG2 . VAL A 1 66  ? 23.672 22.207 36.791 1.00 12.72 ? 68  VAL A CG2 1 
ATOM   509  N N   . GLN A 1 67  ? 25.364 22.909 40.785 1.00 10.64 ? 69  GLN A N   1 
ATOM   510  C CA  . GLN A 1 67  ? 26.679 22.617 41.330 1.00 11.21 ? 69  GLN A CA  1 
ATOM   511  C C   . GLN A 1 67  ? 26.812 21.212 41.873 1.00 10.14 ? 69  GLN A C   1 
ATOM   512  O O   . GLN A 1 67  ? 27.911 20.781 42.240 1.00 10.22 ? 69  GLN A O   1 
ATOM   513  C CB  . GLN A 1 67  ? 27.045 23.674 42.373 1.00 11.18 ? 69  GLN A CB  1 
ATOM   514  C CG  . GLN A 1 67  ? 27.220 25.046 41.727 1.00 12.51 ? 69  GLN A CG  1 
ATOM   515  C CD  . GLN A 1 67  ? 27.360 26.168 42.734 1.00 13.65 ? 69  GLN A CD  1 
ATOM   516  O OE1 . GLN A 1 67  ? 26.590 26.256 43.691 1.00 14.91 ? 69  GLN A OE1 1 
ATOM   517  N NE2 . GLN A 1 67  ? 28.329 27.046 42.510 1.00 16.27 ? 69  GLN A NE2 1 
ATOM   518  N N   . CYS A 1 68  ? 25.694 20.495 41.888 1.00 10.96 ? 70  CYS A N   1 
ATOM   519  C CA  . CYS A 1 68  ? 25.687 19.105 42.301 1.00 12.33 ? 70  CYS A CA  1 
ATOM   520  C C   . CYS A 1 68  ? 26.419 18.260 41.241 1.00 10.37 ? 70  CYS A C   1 
ATOM   521  O O   . CYS A 1 68  ? 26.703 17.091 41.475 1.00 11.68 ? 70  CYS A O   1 
ATOM   522  C CB  . CYS A 1 68  ? 24.244 18.608 42.479 1.00 22.92 ? 70  CYS A CB  1 
ATOM   523  S SG  . CYS A 1 68  ? 23.078 19.091 41.171 1.00 13.23 ? 70  CYS A SG  1 
ATOM   524  N N   . PHE A 1 69  ? 26.734 18.840 40.079 1.00 10.16 ? 71  PHE A N   1 
ATOM   525  C CA  . PHE A 1 69  ? 27.462 18.086 39.049 1.00 9.92  ? 71  PHE A CA  1 
ATOM   526  C C   . PHE A 1 69  ? 28.971 18.270 39.119 1.00 11.00 ? 71  PHE A C   1 
ATOM   527  O O   . PHE A 1 69  ? 29.713 17.753 38.281 1.00 11.50 ? 71  PHE A O   1 
ATOM   528  C CB  . PHE A 1 69  ? 26.943 18.420 37.647 1.00 10.72 ? 71  PHE A CB  1 
ATOM   529  C CG  . PHE A 1 69  ? 25.616 17.793 37.354 1.00 10.99 ? 71  PHE A CG  1 
ATOM   530  C CD1 . PHE A 1 69  ? 25.527 16.432 37.098 1.00 11.71 ? 71  PHE A CD1 1 
ATOM   531  C CD2 . PHE A 1 69  ? 24.447 18.540 37.424 1.00 10.63 ? 71  PHE A CD2 1 
ATOM   532  C CE1 . PHE A 1 69  ? 24.296 15.825 36.924 1.00 12.40 ? 71  PHE A CE1 1 
ATOM   533  C CE2 . PHE A 1 69  ? 23.212 17.940 37.253 1.00 11.16 ? 71  PHE A CE2 1 
ATOM   534  C CZ  . PHE A 1 69  ? 23.136 16.578 37.003 1.00 12.98 ? 71  PHE A CZ  1 
ATOM   535  N N   . SER A 1 70  ? 29.424 18.981 40.146 1.00 11.06 ? 72  SER A N   1 
ATOM   536  C CA  . SER A 1 70  ? 30.850 19.209 40.345 1.00 10.63 ? 72  SER A CA  1 
ATOM   537  C C   . SER A 1 70  ? 31.576 17.891 40.576 1.00 10.46 ? 72  SER A C   1 
ATOM   538  O O   . SER A 1 70  ? 31.041 16.972 41.208 1.00 11.61 ? 72  SER A O   1 
ATOM   539  C CB  . SER A 1 70  ? 31.090 20.075 41.586 1.00 12.87 ? 72  SER A CB  1 
ATOM   540  O OG  . SER A 1 70  ? 30.490 21.347 41.476 1.00 14.35 ? 72  SER A OG  1 
ATOM   541  N N   . ARG A 1 71  ? 32.803 17.799 40.078 1.00 10.85 ? 73  ARG A N   1 
ATOM   542  C CA  . ARG A 1 71  ? 33.594 16.612 40.337 1.00 11.05 ? 73  ARG A CA  1 
ATOM   543  C C   . ARG A 1 71  ? 34.363 16.862 41.629 1.00 10.52 ? 73  ARG A C   1 
ATOM   544  O O   . ARG A 1 71  ? 35.225 17.734 41.672 1.00 12.25 ? 73  ARG A O   1 
ATOM   545  C CB  . ARG A 1 71  ? 34.607 16.327 39.231 1.00 11.43 ? 73  ARG A CB  1 
ATOM   546  C CG  . ARG A 1 71  ? 35.495 15.128 39.576 1.00 12.03 ? 73  ARG A CG  1 
ATOM   547  C CD  . ARG A 1 71  ? 36.377 14.702 38.410 1.00 13.01 ? 73  ARG A CD  1 
ATOM   548  N NE  . ARG A 1 71  ? 37.510 15.594 38.153 1.00 13.41 ? 73  ARG A NE  1 
ATOM   549  C CZ  . ARG A 1 71  ? 38.659 15.572 38.822 1.00 14.01 ? 73  ARG A CZ  1 
ATOM   550  N NH1 . ARG A 1 71  ? 38.843 14.709 39.812 1.00 14.32 ? 73  ARG A NH1 1 
ATOM   551  N NH2 . ARG A 1 71  ? 39.645 16.390 38.470 1.00 15.78 ? 73  ARG A NH2 1 
ATOM   552  N N   . TYR A 1 72  ? 34.025 16.136 42.690 1.00 10.82 ? 74  TYR A N   1 
ATOM   553  C CA  . TYR A 1 72  ? 34.762 16.265 43.946 1.00 12.28 ? 74  TYR A CA  1 
ATOM   554  C C   . TYR A 1 72  ? 35.814 15.165 44.005 1.00 11.71 ? 74  TYR A C   1 
ATOM   555  O O   . TYR A 1 72  ? 35.508 13.998 43.771 1.00 13.86 ? 74  TYR A O   1 
ATOM   556  C CB  . TYR A 1 72  ? 33.846 16.127 45.173 1.00 12.65 ? 74  TYR A CB  1 
ATOM   557  C CG  . TYR A 1 72  ? 33.238 17.431 45.629 1.00 12.29 ? 74  TYR A CG  1 
ATOM   558  C CD1 . TYR A 1 72  ? 32.236 18.051 44.884 1.00 12.06 ? 74  TYR A CD1 1 
ATOM   559  C CD2 . TYR A 1 72  ? 33.693 18.068 46.786 1.00 12.54 ? 74  TYR A CD2 1 
ATOM   560  C CE1 . TYR A 1 72  ? 31.702 19.273 45.270 1.00 11.66 ? 74  TYR A CE1 1 
ATOM   561  C CE2 . TYR A 1 72  ? 33.167 19.294 47.186 1.00 12.02 ? 74  TYR A CE2 1 
ATOM   562  C CZ  . TYR A 1 72  ? 32.172 19.891 46.422 1.00 11.70 ? 74  TYR A CZ  1 
ATOM   563  O OH  . TYR A 1 72  ? 31.640 21.102 46.791 1.00 11.89 ? 74  TYR A OH  1 
ATOM   564  N N   . PRO A 1 73  ? 37.075 15.529 44.266 1.00 13.18 ? 75  PRO A N   1 
ATOM   565  C CA  . PRO A 1 73  ? 38.132 14.521 44.357 1.00 13.38 ? 75  PRO A CA  1 
ATOM   566  C C   . PRO A 1 73  ? 37.762 13.555 45.481 1.00 12.69 ? 75  PRO A C   1 
ATOM   567  O O   . PRO A 1 73  ? 37.060 13.928 46.429 1.00 13.88 ? 75  PRO A O   1 
ATOM   568  C CB  . PRO A 1 73  ? 39.359 15.352 44.713 1.00 14.70 ? 75  PRO A CB  1 
ATOM   569  C CG  . PRO A 1 73  ? 39.119 16.621 43.962 1.00 15.55 ? 75  PRO A CG  1 
ATOM   570  C CD  . PRO A 1 73  ? 37.646 16.887 44.233 1.00 14.32 ? 75  PRO A CD  1 
ATOM   571  N N   . ASP A 1 74  ? 38.237 12.319 45.382 1.00 13.47 ? 76  ASP A N   1 
ATOM   572  C CA  . ASP A 1 74  ? 37.962 11.316 46.403 1.00 12.95 ? 76  ASP A CA  1 
ATOM   573  C C   . ASP A 1 74  ? 38.261 11.827 47.813 1.00 13.54 ? 76  ASP A C   1 
ATOM   574  O O   . ASP A 1 74  ? 37.477 11.606 48.736 1.00 15.69 ? 76  ASP A O   1 
ATOM   575  C CB  . ASP A 1 74  ? 38.808 10.070 46.145 1.00 15.67 ? 76  ASP A CB  1 
ATOM   576  C CG  . ASP A 1 74  ? 38.539 8.975  47.151 1.00 15.74 ? 76  ASP A CG  1 
ATOM   577  O OD1 . ASP A 1 74  ? 37.506 8.290  47.019 1.00 17.42 ? 76  ASP A OD1 1 
ATOM   578  O OD2 . ASP A 1 74  ? 39.356 8.810  48.081 1.00 17.82 ? 76  ASP A OD2 1 
ATOM   579  N N   . HIS A 1 75  ? 39.388 12.512 47.977 1.00 13.70 ? 77  HIS A N   1 
ATOM   580  C CA  . HIS A 1 75  ? 39.760 12.994 49.301 1.00 15.09 ? 77  HIS A CA  1 
ATOM   581  C C   . HIS A 1 75  ? 38.911 14.151 49.812 1.00 15.18 ? 77  HIS A C   1 
ATOM   582  O O   . HIS A 1 75  ? 39.071 14.580 50.954 1.00 16.82 ? 77  HIS A O   1 
ATOM   583  C CB  . HIS A 1 75  ? 41.247 13.379 49.339 1.00 19.42 ? 77  HIS A CB  1 
ATOM   584  C CG  . HIS A 1 75  ? 41.568 14.667 48.647 1.00 23.46 ? 77  HIS A CG  1 
ATOM   585  N ND1 . HIS A 1 75  ? 41.552 14.803 47.275 1.00 25.72 ? 77  HIS A ND1 1 
ATOM   586  C CD2 . HIS A 1 75  ? 41.922 15.877 49.140 1.00 25.21 ? 77  HIS A CD2 1 
ATOM   587  C CE1 . HIS A 1 75  ? 41.883 16.041 46.954 1.00 26.35 ? 77  HIS A CE1 1 
ATOM   588  N NE2 . HIS A 1 75  ? 42.113 16.713 48.067 1.00 27.05 ? 77  HIS A NE2 1 
ATOM   589  N N   . MET A 1 76  ? 37.999 14.648 48.981 1.00 15.08 ? 78  MET A N   1 
ATOM   590  C CA  . MET A 1 76  ? 37.131 15.759 49.375 1.00 14.74 ? 78  MET A CA  1 
ATOM   591  C C   . MET A 1 76  ? 35.655 15.400 49.344 1.00 14.01 ? 78  MET A C   1 
ATOM   592  O O   . MET A 1 76  ? 34.810 16.274 49.519 1.00 14.01 ? 78  MET A O   1 
ATOM   593  C CB  . MET A 1 76  ? 37.336 16.958 48.442 1.00 14.98 ? 78  MET A CB  1 
ATOM   594  C CG  . MET A 1 76  ? 38.684 17.635 48.551 1.00 17.42 ? 78  MET A CG  1 
ATOM   595  S SD  . MET A 1 76  ? 38.837 18.977 47.347 1.00 17.47 ? 78  MET A SD  1 
ATOM   596  C CE  . MET A 1 76  ? 37.543 20.091 47.921 1.00 18.20 ? 78  MET A CE  1 
ATOM   597  N N   . LYS A 1 77  ? 35.325 14.132 49.147 1.00 13.91 ? 79  LYS A N   1 
ATOM   598  C CA  . LYS A 1 77  ? 33.918 13.788 49.042 1.00 15.43 ? 79  LYS A CA  1 
ATOM   599  C C   . LYS A 1 77  ? 33.054 14.021 50.273 1.00 15.00 ? 79  LYS A C   1 
ATOM   600  O O   . LYS A 1 77  ? 31.837 14.108 50.156 1.00 16.11 ? 79  LYS A O   1 
ATOM   601  C CB  . LYS A 1 77  ? 33.768 12.367 48.490 1.00 19.03 ? 79  LYS A CB  1 
ATOM   602  C CG  . LYS A 1 77  ? 34.048 12.324 46.976 1.00 17.43 ? 79  LYS A CG  1 
ATOM   603  C CD  . LYS A 1 77  ? 33.940 10.934 46.387 1.00 19.47 ? 79  LYS A CD  1 
ATOM   604  C CE  . LYS A 1 77  ? 34.279 10.949 44.910 1.00 18.88 ? 79  LYS A CE  1 
ATOM   605  N NZ  . LYS A 1 77  ? 33.387 11.846 44.135 1.00 20.59 ? 79  LYS A NZ  1 
ATOM   606  N N   . ARG A 1 78  ? 33.671 14.159 51.444 1.00 14.21 ? 80  ARG A N   1 
ATOM   607  C CA  . ARG A 1 78  ? 32.906 14.434 52.658 1.00 14.52 ? 80  ARG A CA  1 
ATOM   608  C C   . ARG A 1 78  ? 32.509 15.914 52.686 1.00 15.08 ? 80  ARG A C   1 
ATOM   609  O O   . ARG A 1 78  ? 31.801 16.355 53.589 1.00 15.44 ? 80  ARG A O   1 
ATOM   610  C CB  . ARG A 1 78  ? 33.775 14.140 53.887 1.00 20.45 ? 80  ARG A CB  1 
ATOM   611  C CG  . ARG A 1 78  ? 34.311 12.729 53.980 1.00 30.31 ? 80  ARG A CG  1 
ATOM   612  C CD  . ARG A 1 78  ? 35.119 12.592 55.256 1.00 35.00 ? 80  ARG A CD  1 
ATOM   613  N NE  . ARG A 1 78  ? 35.662 11.254 55.458 1.00 38.00 ? 80  ARG A NE  1 
ATOM   614  C CZ  . ARG A 1 78  ? 36.259 10.869 56.580 1.00 41.49 ? 80  ARG A CZ  1 
ATOM   615  N NH1 . ARG A 1 78  ? 36.381 11.723 57.587 1.00 40.27 ? 80  ARG A NH1 1 
ATOM   616  N NH2 . ARG A 1 78  ? 36.731 9.635  56.698 1.00 43.21 ? 80  ARG A NH2 1 
ATOM   617  N N   . HIS A 1 79  ? 32.954 16.674 51.686 1.00 14.86 ? 81  HIS A N   1 
ATOM   618  C CA  . HIS A 1 79  ? 32.665 18.106 51.620 1.00 14.28 ? 81  HIS A CA  1 
ATOM   619  C C   . HIS A 1 79  ? 31.689 18.503 50.516 1.00 12.56 ? 81  HIS A C   1 
ATOM   620  O O   . HIS A 1 79  ? 31.502 19.691 50.248 1.00 13.59 ? 81  HIS A O   1 
ATOM   621  C CB  . HIS A 1 79  ? 33.969 18.880 51.435 1.00 16.19 ? 81  HIS A CB  1 
ATOM   622  C CG  . HIS A 1 79  ? 34.972 18.618 52.512 1.00 15.06 ? 81  HIS A CG  1 
ATOM   623  N ND1 . HIS A 1 79  ? 34.801 19.052 53.809 1.00 17.50 ? 81  HIS A ND1 1 
ATOM   624  C CD2 . HIS A 1 79  ? 36.130 17.919 52.498 1.00 17.67 ? 81  HIS A CD2 1 
ATOM   625  C CE1 . HIS A 1 79  ? 35.811 18.630 54.548 1.00 17.10 ? 81  HIS A CE1 1 
ATOM   626  N NE2 . HIS A 1 79  ? 36.631 17.940 53.777 1.00 19.64 ? 81  HIS A NE2 1 
ATOM   627  N N   . ASP A 1 80  ? 31.066 17.512 49.888 1.00 12.09 ? 82  ASP A N   1 
ATOM   628  C CA  . ASP A 1 80  ? 30.119 17.768 48.808 1.00 12.03 ? 82  ASP A CA  1 
ATOM   629  C C   . ASP A 1 80  ? 28.697 17.911 49.346 1.00 10.97 ? 82  ASP A C   1 
ATOM   630  O O   . ASP A 1 80  ? 27.933 16.952 49.413 1.00 11.38 ? 82  ASP A O   1 
ATOM   631  C CB  . ASP A 1 80  ? 30.199 16.638 47.779 1.00 11.94 ? 82  ASP A CB  1 
ATOM   632  C CG  . ASP A 1 80  ? 29.354 16.898 46.538 1.00 11.25 ? 82  ASP A CG  1 
ATOM   633  O OD1 . ASP A 1 80  ? 28.550 17.854 46.514 1.00 11.34 ? 82  ASP A OD1 1 
ATOM   634  O OD2 . ASP A 1 80  ? 29.504 16.112 45.579 1.00 11.59 ? 82  ASP A OD2 1 
ATOM   635  N N   . PHE A 1 81  ? 28.356 19.133 49.731 1.00 11.17 ? 83  PHE A N   1 
ATOM   636  C CA  . PHE A 1 81  ? 27.034 19.434 50.256 1.00 11.33 ? 83  PHE A CA  1 
ATOM   637  C C   . PHE A 1 81  ? 25.945 19.187 49.215 1.00 9.70  ? 83  PHE A C   1 
ATOM   638  O O   . PHE A 1 81  ? 24.901 18.607 49.498 1.00 9.91  ? 83  PHE A O   1 
ATOM   639  C CB  . PHE A 1 81  ? 26.966 20.911 50.668 1.00 11.87 ? 83  PHE A CB  1 
ATOM   640  C CG  . PHE A 1 81  ? 25.564 21.424 50.848 1.00 10.98 ? 83  PHE A CG  1 
ATOM   641  C CD1 . PHE A 1 81  ? 24.879 21.215 52.046 1.00 12.08 ? 83  PHE A CD1 1 
ATOM   642  C CD2 . PHE A 1 81  ? 24.906 22.070 49.802 1.00 11.42 ? 83  PHE A CD2 1 
ATOM   643  C CE1 . PHE A 1 81  ? 23.561 21.637 52.197 1.00 12.31 ? 83  PHE A CE1 1 
ATOM   644  C CE2 . PHE A 1 81  ? 23.590 22.493 49.942 1.00 12.77 ? 83  PHE A CE2 1 
ATOM   645  C CZ  . PHE A 1 81  ? 22.914 22.277 51.142 1.00 14.18 ? 83  PHE A CZ  1 
ATOM   646  N N   . PHE A 1 82  ? 26.203 19.659 47.997 1.00 10.78 ? 84  PHE A N   1 
ATOM   647  C CA  . PHE A 1 82  ? 25.224 19.599 46.917 1.00 9.82  ? 84  PHE A CA  1 
ATOM   648  C C   . PHE A 1 82  ? 24.602 18.242 46.662 1.00 9.23  ? 84  PHE A C   1 
ATOM   649  O O   . PHE A 1 82  ? 23.387 18.114 46.637 1.00 10.70 ? 84  PHE A O   1 
ATOM   650  C CB  . PHE A 1 82  ? 25.842 20.148 45.633 1.00 10.70 ? 84  PHE A CB  1 
ATOM   651  C CG  . PHE A 1 82  ? 26.503 21.484 45.810 1.00 11.01 ? 84  PHE A CG  1 
ATOM   652  C CD1 . PHE A 1 82  ? 25.756 22.652 45.838 1.00 10.89 ? 84  PHE A CD1 1 
ATOM   653  C CD2 . PHE A 1 82  ? 27.883 21.567 45.950 1.00 12.05 ? 84  PHE A CD2 1 
ATOM   654  C CE1 . PHE A 1 82  ? 26.381 23.885 45.996 1.00 13.11 ? 84  PHE A CE1 1 
ATOM   655  C CE2 . PHE A 1 82  ? 28.515 22.792 46.112 1.00 11.98 ? 84  PHE A CE2 1 
ATOM   656  C CZ  . PHE A 1 82  ? 27.764 23.954 46.132 1.00 12.60 ? 84  PHE A CZ  1 
ATOM   657  N N   . LYS A 1 83  ? 25.429 17.226 46.465 1.00 10.50 ? 85  LYS A N   1 
ATOM   658  C CA  . LYS A 1 83  ? 24.882 15.905 46.211 1.00 11.06 ? 85  LYS A CA  1 
ATOM   659  C C   . LYS A 1 83  ? 24.257 15.315 47.475 1.00 10.56 ? 85  LYS A C   1 
ATOM   660  O O   . LYS A 1 83  ? 23.286 14.575 47.397 1.00 11.40 ? 85  LYS A O   1 
ATOM   661  C CB  . LYS A 1 83  ? 25.970 14.956 45.699 1.00 10.54 ? 85  LYS A CB  1 
ATOM   662  C CG  . LYS A 1 83  ? 26.549 15.333 44.342 1.00 10.50 ? 85  LYS A CG  1 
ATOM   663  C CD  . LYS A 1 83  ? 27.546 14.289 43.885 1.00 11.21 ? 85  LYS A CD  1 
ATOM   664  C CE  . LYS A 1 83  ? 28.288 14.721 42.622 1.00 11.65 ? 85  LYS A CE  1 
ATOM   665  N NZ  . LYS A 1 83  ? 28.979 16.033 42.817 1.00 11.72 ? 85  LYS A NZ  1 
ATOM   666  N N   . SER A 1 84  ? 24.806 15.647 48.644 1.00 11.40 ? 86  SER A N   1 
ATOM   667  C CA  . SER A 1 84  ? 24.286 15.089 49.894 1.00 10.87 ? 86  SER A CA  1 
ATOM   668  C C   . SER A 1 84  ? 22.849 15.500 50.180 1.00 10.96 ? 86  SER A C   1 
ATOM   669  O O   . SER A 1 84  ? 22.122 14.786 50.878 1.00 12.90 ? 86  SER A O   1 
ATOM   670  C CB  . SER A 1 84  ? 25.178 15.462 51.086 1.00 12.74 ? 86  SER A CB  1 
ATOM   671  O OG  . SER A 1 84  ? 24.939 16.775 51.555 1.00 11.90 ? 86  SER A OG  1 
ATOM   672  N N   . ALA A 1 85  ? 22.436 16.637 49.636 1.00 11.88 ? 87  ALA A N   1 
ATOM   673  C CA  . ALA A 1 85  ? 21.083 17.137 49.830 1.00 13.03 ? 87  ALA A CA  1 
ATOM   674  C C   . ALA A 1 85  ? 20.068 16.439 48.922 1.00 11.81 ? 87  ALA A C   1 
ATOM   675  O O   . ALA A 1 85  ? 18.866 16.624 49.074 1.00 12.84 ? 87  ALA A O   1 
ATOM   676  C CB  . ALA A 1 85  ? 21.054 18.633 49.580 1.00 14.04 ? 87  ALA A CB  1 
ATOM   677  N N   . MET A 1 86  ? 20.556 15.648 47.972 1.00 12.00 ? 88  MET A N   1 
ATOM   678  C CA  . MET A 1 86  ? 19.687 14.937 47.037 1.00 12.37 ? 88  MET A CA  1 
ATOM   679  C C   . MET A 1 86  ? 19.173 13.642 47.663 1.00 14.21 ? 88  MET A C   1 
ATOM   680  O O   . MET A 1 86  ? 19.846 13.056 48.506 1.00 14.06 ? 88  MET A O   1 
ATOM   681  C CB  . MET A 1 86  ? 20.400 14.609 45.730 1.00 17.81 ? 88  MET A CB  1 
ATOM   682  C CG  . MET A 1 86  ? 20.829 15.816 44.922 1.00 24.42 ? 88  MET A CG  1 
ATOM   683  S SD  . MET A 1 86  ? 19.450 16.902 44.525 1.00 12.70 ? 88  MET A SD  1 
ATOM   684  C CE  . MET A 1 86  ? 20.280 18.473 44.498 1.00 31.28 ? 88  MET A CE  1 
ATOM   685  N N   . PRO A 1 87  ? 18.016 13.135 47.210 1.00 12.75 ? 89  PRO A N   1 
ATOM   686  C CA  . PRO A 1 87  ? 17.140 13.651 46.155 1.00 12.83 ? 89  PRO A CA  1 
ATOM   687  C C   . PRO A 1 87  ? 16.189 14.778 46.530 1.00 11.74 ? 89  PRO A C   1 
ATOM   688  O O   . PRO A 1 87  ? 15.634 15.422 45.637 1.00 13.08 ? 89  PRO A O   1 
ATOM   689  C CB  . PRO A 1 87  ? 16.378 12.408 45.720 1.00 14.73 ? 89  PRO A CB  1 
ATOM   690  C CG  . PRO A 1 87  ? 16.160 11.721 47.034 1.00 15.53 ? 89  PRO A CG  1 
ATOM   691  C CD  . PRO A 1 87  ? 17.513 11.840 47.710 1.00 13.96 ? 89  PRO A CD  1 
ATOM   692  N N   . GLU A 1 88  ? 15.988 15.008 47.828 1.00 12.74 ? 90  GLU A N   1 
ATOM   693  C CA  . GLU A 1 88  ? 15.071 16.051 48.289 1.00 11.99 ? 90  GLU A CA  1 
ATOM   694  C C   . GLU A 1 88  ? 15.452 17.402 47.717 1.00 11.70 ? 90  GLU A C   1 
ATOM   695  O O   . GLU A 1 88  ? 14.582 18.219 47.401 1.00 13.24 ? 90  GLU A O   1 
ATOM   696  C CB  . GLU A 1 88  ? 15.056 16.116 49.817 1.00 14.06 ? 90  GLU A CB  1 
ATOM   697  C CG  . GLU A 1 88  ? 14.697 14.811 50.526 1.00 20.93 ? 90  GLU A CG  1 
ATOM   698  C CD  . GLU A 1 88  ? 15.716 13.703 50.294 1.00 24.33 ? 90  GLU A CD  1 
ATOM   699  O OE1 . GLU A 1 88  ? 16.936 13.980 50.334 1.00 18.99 ? 90  GLU A OE1 1 
ATOM   700  O OE2 . GLU A 1 88  ? 15.295 12.547 50.080 1.00 29.91 ? 90  GLU A OE2 1 
ATOM   701  N N   . GLY A 1 89  ? 16.753 17.651 47.641 1.00 10.88 ? 91  GLY A N   1 
ATOM   702  C CA  . GLY A 1 89  ? 17.234 18.873 47.031 1.00 11.36 ? 91  GLY A CA  1 
ATOM   703  C C   . GLY A 1 89  ? 17.633 20.003 47.944 1.00 10.25 ? 91  GLY A C   1 
ATOM   704  O O   . GLY A 1 89  ? 17.662 19.875 49.184 1.00 10.54 ? 91  GLY A O   1 
ATOM   705  N N   . TYR A 1 90  ? 17.960 21.127 47.321 1.00 9.77  ? 92  TYR A N   1 
ATOM   706  C CA  . TYR A 1 90  ? 18.340 22.299 48.072 1.00 10.12 ? 92  TYR A CA  1 
ATOM   707  C C   . TYR A 1 90  ? 17.815 23.553 47.405 1.00 9.39  ? 92  TYR A C   1 
ATOM   708  O O   . TYR A 1 90  ? 17.478 23.566 46.202 1.00 10.70 ? 92  TYR A O   1 
ATOM   709  C CB  . TYR A 1 90  ? 19.870 22.388 48.230 1.00 10.51 ? 92  TYR A CB  1 
ATOM   710  C CG  . TYR A 1 90  ? 20.661 22.363 46.934 1.00 10.56 ? 92  TYR A CG  1 
ATOM   711  C CD1 . TYR A 1 90  ? 20.748 23.484 46.107 1.00 10.94 ? 92  TYR A CD1 1 
ATOM   712  C CD2 . TYR A 1 90  ? 21.338 21.212 46.546 1.00 13.01 ? 92  TYR A CD2 1 
ATOM   713  C CE1 . TYR A 1 90  ? 21.499 23.450 44.925 1.00 11.52 ? 92  TYR A CE1 1 
ATOM   714  C CE2 . TYR A 1 90  ? 22.082 21.166 45.377 1.00 12.92 ? 92  TYR A CE2 1 
ATOM   715  C CZ  . TYR A 1 90  ? 22.163 22.283 44.573 1.00 12.70 ? 92  TYR A CZ  1 
ATOM   716  O OH  . TYR A 1 90  ? 22.931 22.217 43.430 1.00 12.78 ? 92  TYR A OH  1 
ATOM   717  N N   . VAL A 1 91  ? 17.720 24.600 48.210 1.00 10.00 ? 93  VAL A N   1 
ATOM   718  C CA  . VAL A 1 91  ? 17.306 25.900 47.735 1.00 10.51 ? 93  VAL A CA  1 
ATOM   719  C C   . VAL A 1 91  ? 18.614 26.660 47.550 1.00 10.73 ? 93  VAL A C   1 
ATOM   720  O O   . VAL A 1 91  ? 19.490 26.616 48.420 1.00 12.37 ? 93  VAL A O   1 
ATOM   721  C CB  . VAL A 1 91  ? 16.459 26.647 48.786 1.00 11.49 ? 93  VAL A CB  1 
ATOM   722  C CG1 . VAL A 1 91  ? 16.163 28.060 48.300 1.00 13.92 ? 93  VAL A CG1 1 
ATOM   723  C CG2 . VAL A 1 91  ? 15.166 25.900 49.036 1.00 14.53 ? 93  VAL A CG2 1 
ATOM   724  N N   . GLN A 1 92  ? 18.764 27.314 46.402 1.00 10.24 ? 94  GLN A N   1 
ATOM   725  C CA  . GLN A 1 92  ? 19.954 28.104 46.125 1.00 10.24 ? 94  GLN A CA  1 
ATOM   726  C C   . GLN A 1 92  ? 19.486 29.525 45.900 1.00 11.00 ? 94  GLN A C   1 
ATOM   727  O O   . GLN A 1 92  ? 18.675 29.784 45.011 1.00 10.48 ? 94  GLN A O   1 
ATOM   728  C CB  . GLN A 1 92  ? 20.686 27.595 44.877 1.00 10.47 ? 94  GLN A CB  1 
ATOM   729  C CG  . GLN A 1 92  ? 21.898 28.438 44.497 1.00 11.19 ? 94  GLN A CG  1 
ATOM   730  C CD  . GLN A 1 92  ? 22.855 27.703 43.591 1.00 10.83 ? 94  GLN A CD  1 
ATOM   731  O OE1 . GLN A 1 92  ? 23.401 26.673 43.969 1.00 11.51 ? 94  GLN A OE1 1 
ATOM   732  N NE2 . GLN A 1 92  ? 23.067 28.232 42.385 1.00 10.92 ? 94  GLN A NE2 1 
ATOM   733  N N   . GLU A 1 93  ? 19.992 30.441 46.713 1.00 10.03 ? 95  GLU A N   1 
ATOM   734  C CA  . GLU A 1 93  ? 19.622 31.839 46.606 1.00 10.77 ? 95  GLU A CA  1 
ATOM   735  C C   . GLU A 1 93  ? 20.850 32.680 46.346 1.00 9.14  ? 95  GLU A C   1 
ATOM   736  O O   . GLU A 1 93  ? 21.921 32.397 46.880 1.00 11.05 ? 95  GLU A O   1 
ATOM   737  C CB  . GLU A 1 93  ? 18.988 32.332 47.908 1.00 11.57 ? 95  GLU A CB  1 
ATOM   738  C CG  . GLU A 1 93  ? 17.714 31.628 48.303 1.00 17.56 ? 95  GLU A CG  1 
ATOM   739  C CD  . GLU A 1 93  ? 17.215 32.085 49.659 1.00 22.56 ? 95  GLU A CD  1 
ATOM   740  O OE1 . GLU A 1 93  ? 16.709 33.222 49.757 1.00 26.80 ? 95  GLU A OE1 1 
ATOM   741  O OE2 . GLU A 1 93  ? 17.344 31.310 50.629 1.00 24.96 ? 95  GLU A OE2 1 
ATOM   742  N N   . ARG A 1 94  ? 20.700 33.711 45.526 1.00 9.68  ? 96  ARG A N   1 
ATOM   743  C CA  . ARG A 1 94  ? 21.809 34.607 45.270 1.00 9.72  ? 96  ARG A CA  1 
ATOM   744  C C   . ARG A 1 94  ? 21.358 36.042 45.122 1.00 9.96  ? 96  ARG A C   1 
ATOM   745  O O   . ARG A 1 94  ? 20.194 36.333 44.839 1.00 10.16 ? 96  ARG A O   1 
ATOM   746  C CB  . ARG A 1 94  ? 22.545 34.277 43.959 1.00 10.20 ? 96  ARG A CB  1 
ATOM   747  C CG  . ARG A 1 94  ? 23.301 32.970 43.892 1.00 10.12 ? 96  ARG A CG  1 
ATOM   748  C CD  . ARG A 1 94  ? 24.536 33.127 43.012 1.00 10.56 ? 96  ARG A CD  1 
ATOM   749  N NE  . ARG A 1 94  ? 25.320 31.901 42.860 1.00 11.13 ? 96  ARG A NE  1 
ATOM   750  C CZ  . ARG A 1 94  ? 25.137 30.999 41.898 1.00 9.75  ? 96  ARG A CZ  1 
ATOM   751  N NH1 . ARG A 1 94  ? 24.183 31.169 40.992 1.00 11.74 ? 96  ARG A NH1 1 
ATOM   752  N NH2 . ARG A 1 94  ? 25.932 29.945 41.821 1.00 10.51 ? 96  ARG A NH2 1 
ATOM   753  N N   . THR A 1 95  ? 22.308 36.931 45.377 1.00 9.89  ? 97  THR A N   1 
ATOM   754  C CA  . THR A 1 95  ? 22.136 38.340 45.087 1.00 11.06 ? 97  THR A CA  1 
ATOM   755  C C   . THR A 1 95  ? 23.390 38.599 44.248 1.00 9.83  ? 97  THR A C   1 
ATOM   756  O O   . THR A 1 95  ? 24.503 38.262 44.662 1.00 10.80 ? 97  THR A O   1 
ATOM   757  C CB  . THR A 1 95  ? 22.142 39.254 46.313 1.00 11.66 ? 97  THR A CB  1 
ATOM   758  O OG1 . THR A 1 95  ? 21.039 38.918 47.156 1.00 12.42 ? 97  THR A OG1 1 
ATOM   759  C CG2 . THR A 1 95  ? 21.973 40.707 45.872 1.00 13.35 ? 97  THR A CG2 1 
ATOM   760  N N   . ILE A 1 96  ? 23.191 39.141 43.052 1.00 10.38 ? 98  ILE A N   1 
ATOM   761  C CA  . ILE A 1 96  ? 24.287 39.441 42.139 1.00 9.56  ? 98  ILE A CA  1 
ATOM   762  C C   . ILE A 1 96  ? 24.285 40.948 41.889 1.00 10.15 ? 98  ILE A C   1 
ATOM   763  O O   . ILE A 1 96  ? 23.335 41.493 41.332 1.00 10.24 ? 98  ILE A O   1 
ATOM   764  C CB  . ILE A 1 96  ? 24.120 38.690 40.800 1.00 10.36 ? 98  ILE A CB  1 
ATOM   765  C CG1 . ILE A 1 96  ? 24.027 37.183 41.062 1.00 11.30 ? 98  ILE A CG1 1 
ATOM   766  C CG2 . ILE A 1 96  ? 25.300 39.010 39.879 1.00 11.90 ? 98  ILE A CG2 1 
ATOM   767  C CD1 . ILE A 1 96  ? 23.615 36.364 39.849 1.00 11.45 ? 98  ILE A CD1 1 
ATOM   768  N N   . PHE A 1 97  ? 25.342 41.620 42.334 1.00 10.45 ? 99  PHE A N   1 
ATOM   769  C CA  . PHE A 1 97  ? 25.469 43.060 42.161 1.00 10.07 ? 99  PHE A CA  1 
ATOM   770  C C   . PHE A 1 97  ? 26.301 43.396 40.930 1.00 9.99  ? 99  PHE A C   1 
ATOM   771  O O   . PHE A 1 97  ? 27.489 43.091 40.890 1.00 10.69 ? 99  PHE A O   1 
ATOM   772  C CB  . PHE A 1 97  ? 26.144 43.690 43.384 1.00 11.49 ? 99  PHE A CB  1 
ATOM   773  C CG  . PHE A 1 97  ? 25.352 43.572 44.650 1.00 11.91 ? 99  PHE A CG  1 
ATOM   774  C CD1 . PHE A 1 97  ? 25.581 42.528 45.539 1.00 12.69 ? 99  PHE A CD1 1 
ATOM   775  C CD2 . PHE A 1 97  ? 24.386 44.519 44.964 1.00 14.22 ? 99  PHE A CD2 1 
ATOM   776  C CE1 . PHE A 1 97  ? 24.860 42.432 46.730 1.00 14.57 ? 99  PHE A CE1 1 
ATOM   777  C CE2 . PHE A 1 97  ? 23.659 44.432 46.150 1.00 14.71 ? 99  PHE A CE2 1 
ATOM   778  C CZ  . PHE A 1 97  ? 23.897 43.389 47.034 1.00 16.02 ? 99  PHE A CZ  1 
ATOM   779  N N   . PHE A 1 98  ? 25.687 44.014 39.923 1.00 10.50 ? 100 PHE A N   1 
ATOM   780  C CA  . PHE A 1 98  ? 26.440 44.413 38.740 1.00 9.79  ? 100 PHE A CA  1 
ATOM   781  C C   . PHE A 1 98  ? 26.979 45.795 39.059 1.00 10.12 ? 100 PHE A C   1 
ATOM   782  O O   . PHE A 1 98  ? 26.222 46.720 39.315 1.00 10.78 ? 100 PHE A O   1 
ATOM   783  C CB  . PHE A 1 98  ? 25.549 44.435 37.498 1.00 10.77 ? 100 PHE A CB  1 
ATOM   784  C CG  . PHE A 1 98  ? 25.113 43.069 37.060 1.00 10.30 ? 100 PHE A CG  1 
ATOM   785  C CD1 . PHE A 1 98  ? 23.949 42.499 37.568 1.00 11.03 ? 100 PHE A CD1 1 
ATOM   786  C CD2 . PHE A 1 98  ? 25.891 42.327 36.177 1.00 11.38 ? 100 PHE A CD2 1 
ATOM   787  C CE1 . PHE A 1 98  ? 23.568 41.213 37.205 1.00 11.52 ? 100 PHE A CE1 1 
ATOM   788  C CE2 . PHE A 1 98  ? 25.518 41.044 35.810 1.00 11.24 ? 100 PHE A CE2 1 
ATOM   789  C CZ  . PHE A 1 98  ? 24.358 40.484 36.322 1.00 10.83 ? 100 PHE A CZ  1 
ATOM   790  N N   . LYS A 1 99  ? 28.298 45.918 39.061 1.00 9.74  ? 101 LYS A N   1 
ATOM   791  C CA  . LYS A 1 99  ? 28.951 47.169 39.404 1.00 11.05 ? 101 LYS A CA  1 
ATOM   792  C C   . LYS A 1 99  ? 28.441 48.310 38.542 1.00 10.67 ? 101 LYS A C   1 
ATOM   793  O O   . LYS A 1 99  ? 28.384 48.203 37.310 1.00 11.33 ? 101 LYS A O   1 
ATOM   794  C CB  . LYS A 1 99  ? 30.462 47.007 39.261 1.00 12.44 ? 101 LYS A CB  1 
ATOM   795  C CG  . LYS A 1 99  ? 31.284 48.173 39.767 1.00 14.59 ? 101 LYS A CG  1 
ATOM   796  C CD  . LYS A 1 99  ? 32.753 47.786 39.759 1.00 17.74 ? 101 LYS A CD  1 
ATOM   797  C CE  . LYS A 1 99  ? 33.654 48.954 40.107 1.00 19.72 ? 101 LYS A CE  1 
ATOM   798  N NZ  . LYS A 1 99  ? 33.343 49.522 41.446 1.00 20.31 ? 101 LYS A NZ  1 
ATOM   799  N N   . ASP A 1 100 ? 28.061 49.396 39.211 1.00 12.57 ? 102 ASP A N   1 
ATOM   800  C CA  . ASP A 1 100 ? 27.528 50.590 38.563 1.00 13.04 ? 102 ASP A CA  1 
ATOM   801  C C   . ASP A 1 100 ? 26.260 50.320 37.760 1.00 12.24 ? 102 ASP A C   1 
ATOM   802  O O   . ASP A 1 100 ? 25.948 51.029 36.801 1.00 14.16 ? 102 ASP A O   1 
ATOM   803  C CB  . ASP A 1 100 ? 28.602 51.238 37.685 1.00 15.19 ? 102 ASP A CB  1 
ATOM   804  C CG  . ASP A 1 100 ? 29.792 51.715 38.498 1.00 18.00 ? 102 ASP A CG  1 
ATOM   805  O OD1 . ASP A 1 100 ? 29.575 52.490 39.452 1.00 20.47 ? 102 ASP A OD1 1 
ATOM   806  O OD2 . ASP A 1 100 ? 30.937 51.318 38.198 1.00 17.08 ? 102 ASP A OD2 1 
ATOM   807  N N   . ASP A 1 101 ? 25.527 49.289 38.163 1.00 11.86 ? 103 ASP A N   1 
ATOM   808  C CA  . ASP A 1 101 ? 24.274 48.948 37.502 1.00 11.62 ? 103 ASP A CA  1 
ATOM   809  C C   . ASP A 1 101 ? 23.342 48.288 38.529 1.00 10.96 ? 103 ASP A C   1 
ATOM   810  O O   . ASP A 1 101 ? 23.509 48.475 39.742 1.00 11.40 ? 103 ASP A O   1 
ATOM   811  C CB  . ASP A 1 101 ? 24.520 48.036 36.291 1.00 13.16 ? 103 ASP A CB  1 
ATOM   812  C CG  . ASP A 1 101 ? 23.521 48.283 35.163 1.00 12.20 ? 103 ASP A CG  1 
ATOM   813  O OD1 . ASP A 1 101 ? 22.377 48.665 35.468 1.00 14.55 ? 103 ASP A OD1 1 
ATOM   814  O OD2 . ASP A 1 101 ? 23.865 48.084 33.973 1.00 15.70 ? 103 ASP A OD2 1 
ATOM   815  N N   . GLY A 1 102 ? 22.372 47.515 38.056 1.00 11.48 ? 104 GLY A N   1 
ATOM   816  C CA  . GLY A 1 102 ? 21.415 46.891 38.952 1.00 10.66 ? 104 GLY A CA  1 
ATOM   817  C C   . GLY A 1 102 ? 21.869 45.606 39.606 1.00 9.96  ? 104 GLY A C   1 
ATOM   818  O O   . GLY A 1 102 ? 23.051 45.267 39.612 1.00 11.17 ? 104 GLY A O   1 
ATOM   819  N N   . ASN A 1 103 ? 20.912 44.884 40.169 1.00 10.73 ? 105 ASN A N   1 
ATOM   820  C CA  . ASN A 1 103 ? 21.225 43.624 40.813 1.00 9.68  ? 105 ASN A CA  1 
ATOM   821  C C   . ASN A 1 103 ? 20.155 42.590 40.524 1.00 10.28 ? 105 ASN A C   1 
ATOM   822  O O   . ASN A 1 103 ? 18.999 42.929 40.260 1.00 10.71 ? 105 ASN A O   1 
ATOM   823  C CB  . ASN A 1 103 ? 21.371 43.814 42.333 1.00 11.60 ? 105 ASN A CB  1 
ATOM   824  C CG  . ASN A 1 103 ? 20.094 44.281 42.988 1.00 16.31 ? 105 ASN A CG  1 
ATOM   825  O OD1 . ASN A 1 103 ? 19.211 43.479 43.288 1.00 16.61 ? 105 ASN A OD1 1 
ATOM   826  N ND2 . ASN A 1 103 ? 19.980 45.591 43.197 1.00 17.71 ? 105 ASN A ND2 1 
ATOM   827  N N   . TYR A 1 104 ? 20.577 41.331 40.509 1.00 9.91  ? 106 TYR A N   1 
ATOM   828  C CA  . TYR A 1 104 ? 19.650 40.227 40.353 1.00 9.73  ? 106 TYR A CA  1 
ATOM   829  C C   . TYR A 1 104 ? 19.515 39.555 41.714 1.00 9.95  ? 106 TYR A C   1 
ATOM   830  O O   . TYR A 1 104 ? 20.492 39.457 42.468 1.00 10.76 ? 106 TYR A O   1 
ATOM   831  C CB  . TYR A 1 104 ? 20.173 39.105 39.450 1.00 10.12 ? 106 TYR A CB  1 
ATOM   832  C CG  . TYR A 1 104 ? 20.353 39.367 37.980 1.00 9.75  ? 106 TYR A CG  1 
ATOM   833  C CD1 . TYR A 1 104 ? 19.734 40.442 37.339 1.00 9.21  ? 106 TYR A CD1 1 
ATOM   834  C CD2 . TYR A 1 104 ? 21.128 38.499 37.207 1.00 9.56  ? 106 TYR A CD2 1 
ATOM   835  C CE1 . TYR A 1 104 ? 19.889 40.641 35.960 1.00 10.11 ? 106 TYR A CE1 1 
ATOM   836  C CE2 . TYR A 1 104 ? 21.279 38.692 35.830 1.00 10.06 ? 106 TYR A CE2 1 
ATOM   837  C CZ  . TYR A 1 104 ? 20.659 39.764 35.220 1.00 10.27 ? 106 TYR A CZ  1 
ATOM   838  O OH  . TYR A 1 104 ? 20.806 39.979 33.868 1.00 11.08 ? 106 TYR A OH  1 
ATOM   839  N N   . LYS A 1 105 ? 18.311 39.087 42.015 1.00 10.10 ? 107 LYS A N   1 
ATOM   840  C CA  . LYS A 1 105 ? 18.080 38.292 43.208 1.00 9.58  ? 107 LYS A CA  1 
ATOM   841  C C   . LYS A 1 105 ? 17.437 37.040 42.638 1.00 9.79  ? 107 LYS A C   1 
ATOM   842  O O   . LYS A 1 105 ? 16.491 37.117 41.853 1.00 10.55 ? 107 LYS A O   1 
ATOM   843  C CB  . LYS A 1 105 ? 17.180 39.007 44.213 1.00 10.87 ? 107 LYS A CB  1 
ATOM   844  C CG  . LYS A 1 105 ? 17.996 39.976 45.064 1.00 14.66 ? 107 LYS A CG  1 
ATOM   845  C CD  . LYS A 1 105 ? 17.196 40.676 46.147 1.00 16.40 ? 107 LYS A CD  1 
ATOM   846  C CE  . LYS A 1 105 ? 18.115 41.505 47.057 1.00 17.60 ? 107 LYS A CE  1 
ATOM   847  N NZ  . LYS A 1 105 ? 18.971 40.669 47.959 1.00 17.42 ? 107 LYS A NZ  1 
ATOM   848  N N   . THR A 1 106 ? 17.981 35.891 43.001 1.00 9.52  ? 108 THR A N   1 
ATOM   849  C CA  . THR A 1 106 ? 17.479 34.646 42.471 1.00 9.47  ? 108 THR A CA  1 
ATOM   850  C C   . THR A 1 106 ? 17.190 33.645 43.572 1.00 9.24  ? 108 THR A C   1 
ATOM   851  O O   . THR A 1 106 ? 17.857 33.625 44.619 1.00 10.67 ? 108 THR A O   1 
ATOM   852  C CB  . THR A 1 106 ? 18.513 33.994 41.497 1.00 11.24 ? 108 THR A CB  1 
ATOM   853  O OG1 . THR A 1 106 ? 19.693 33.622 42.222 1.00 10.74 ? 108 THR A OG1 1 
ATOM   854  C CG2 . THR A 1 106 ? 18.913 34.962 40.391 1.00 10.83 ? 108 THR A CG2 1 
ATOM   855  N N   . ARG A 1 107 ? 16.174 32.825 43.349 1.00 9.20  ? 109 ARG A N   1 
ATOM   856  C CA  . ARG A 1 107 ? 15.826 31.759 44.279 1.00 9.51  ? 109 ARG A CA  1 
ATOM   857  C C   . ARG A 1 107 ? 15.514 30.552 43.413 1.00 10.62 ? 109 ARG A C   1 
ATOM   858  O O   . ARG A 1 107 ? 14.657 30.613 42.524 1.00 11.52 ? 109 ARG A O   1 
ATOM   859  C CB  . ARG A 1 107 ? 14.608 32.112 45.133 1.00 11.21 ? 109 ARG A CB  1 
ATOM   860  C CG  . ARG A 1 107 ? 14.293 31.021 46.152 1.00 13.19 ? 109 ARG A CG  1 
ATOM   861  C CD  . ARG A 1 107 ? 13.125 31.386 47.046 1.00 14.04 ? 109 ARG A CD  1 
ATOM   862  N NE  . ARG A 1 107 ? 12.955 30.430 48.140 1.00 15.75 ? 109 ARG A NE  1 
ATOM   863  C CZ  . ARG A 1 107 ? 12.451 29.209 48.002 1.00 18.86 ? 109 ARG A CZ  1 
ATOM   864  N NH1 . ARG A 1 107 ? 12.053 28.778 46.813 1.00 18.00 ? 109 ARG A NH1 1 
ATOM   865  N NH2 . ARG A 1 107 ? 12.356 28.412 49.059 1.00 21.42 ? 109 ARG A NH2 1 
ATOM   866  N N   . ALA A 1 108 ? 16.213 29.458 43.665 1.00 9.60  ? 110 ALA A N   1 
ATOM   867  C CA  . ALA A 1 108 ? 16.019 28.253 42.885 1.00 10.12 ? 110 ALA A CA  1 
ATOM   868  C C   . ALA A 1 108 ? 15.898 27.049 43.786 1.00 8.96  ? 110 ALA A C   1 
ATOM   869  O O   . ALA A 1 108 ? 16.410 27.045 44.917 1.00 10.78 ? 110 ALA A O   1 
ATOM   870  C CB  . ALA A 1 108 ? 17.207 28.050 41.951 1.00 11.80 ? 110 ALA A CB  1 
ATOM   871  N N   . GLU A 1 109 ? 15.208 26.036 43.285 1.00 9.91  ? 111 GLU A N   1 
ATOM   872  C CA  . GLU A 1 109 ? 15.087 24.775 43.989 1.00 11.19 ? 111 GLU A CA  1 
ATOM   873  C C   . GLU A 1 109 ? 15.636 23.743 43.017 1.00 9.98  ? 111 GLU A C   1 
ATOM   874  O O   . GLU A 1 109 ? 15.180 23.644 41.857 1.00 10.93 ? 111 GLU A O   1 
ATOM   875  C CB  . GLU A 1 109 ? 13.638 24.473 44.360 1.00 12.22 ? 111 GLU A CB  1 
ATOM   876  C CG  . GLU A 1 109 ? 13.104 25.446 45.395 1.00 16.85 ? 111 GLU A CG  1 
ATOM   877  C CD  . GLU A 1 109 ? 11.802 25.001 46.014 1.00 22.54 ? 111 GLU A CD  1 
ATOM   878  O OE1 . GLU A 1 109 ? 11.185 24.044 45.500 1.00 25.37 ? 111 GLU A OE1 1 
ATOM   879  O OE2 . GLU A 1 109 ? 11.395 25.623 47.017 1.00 23.69 ? 111 GLU A OE2 1 
ATOM   880  N N   . VAL A 1 110 ? 16.649 23.021 43.474 1.00 9.59  ? 112 VAL A N   1 
ATOM   881  C CA  . VAL A 1 110 ? 17.322 21.998 42.690 1.00 10.48 ? 112 VAL A CA  1 
ATOM   882  C C   . VAL A 1 110 ? 17.014 20.664 43.347 1.00 9.40  ? 112 VAL A C   1 
ATOM   883  O O   . VAL A 1 110 ? 17.338 20.453 44.529 1.00 10.90 ? 112 VAL A O   1 
ATOM   884  C CB  . VAL A 1 110 ? 18.844 22.242 42.693 1.00 10.67 ? 112 VAL A CB  1 
ATOM   885  C CG1 . VAL A 1 110 ? 19.540 21.258 41.765 1.00 12.36 ? 112 VAL A CG1 1 
ATOM   886  C CG2 . VAL A 1 110 ? 19.135 23.678 42.262 1.00 11.13 ? 112 VAL A CG2 1 
ATOM   887  N N   . LYS A 1 111 ? 16.377 19.766 42.611 1.00 10.10 ? 113 LYS A N   1 
ATOM   888  C CA  . LYS A 1 111 ? 16.030 18.475 43.177 1.00 10.08 ? 113 LYS A CA  1 
ATOM   889  C C   . LYS A 1 111 ? 15.751 17.493 42.060 1.00 9.46  ? 113 LYS A C   1 
ATOM   890  O O   . LYS A 1 111 ? 15.612 17.879 40.893 1.00 10.35 ? 113 LYS A O   1 
ATOM   891  C CB  . LYS A 1 111 ? 14.778 18.609 44.045 1.00 12.68 ? 113 LYS A CB  1 
ATOM   892  C CG  . LYS A 1 111 ? 13.537 18.975 43.247 1.00 13.41 ? 113 LYS A CG  1 
ATOM   893  C CD  . LYS A 1 111 ? 12.308 19.129 44.131 1.00 18.08 ? 113 LYS A CD  1 
ATOM   894  C CE  . LYS A 1 111 ? 12.453 20.306 45.075 1.00 22.49 ? 113 LYS A CE  1 
ATOM   895  N NZ  . LYS A 1 111 ? 11.256 20.460 45.952 1.00 26.86 ? 113 LYS A NZ  1 
ATOM   896  N N   . PHE A 1 112 ? 15.672 16.217 42.405 1.00 10.90 ? 114 PHE A N   1 
ATOM   897  C CA  . PHE A 1 112 ? 15.369 15.205 41.408 1.00 10.48 ? 114 PHE A CA  1 
ATOM   898  C C   . PHE A 1 112 ? 13.871 15.034 41.250 1.00 10.58 ? 114 PHE A C   1 
ATOM   899  O O   . PHE A 1 112 ? 13.120 15.113 42.220 1.00 12.48 ? 114 PHE A O   1 
ATOM   900  C CB  . PHE A 1 112 ? 15.953 13.850 41.819 1.00 11.53 ? 114 PHE A CB  1 
ATOM   901  C CG  . PHE A 1 112 ? 17.359 13.627 41.357 1.00 10.23 ? 114 PHE A CG  1 
ATOM   902  C CD1 . PHE A 1 112 ? 17.628 13.256 40.040 1.00 11.54 ? 114 PHE A CD1 1 
ATOM   903  C CD2 . PHE A 1 112 ? 18.417 13.793 42.234 1.00 12.46 ? 114 PHE A CD2 1 
ATOM   904  C CE1 . PHE A 1 112 ? 18.936 13.054 39.611 1.00 13.50 ? 114 PHE A CE1 1 
ATOM   905  C CE2 . PHE A 1 112 ? 19.731 13.594 41.815 1.00 12.56 ? 114 PHE A CE2 1 
ATOM   906  C CZ  . PHE A 1 112 ? 19.990 13.223 40.503 1.00 12.58 ? 114 PHE A CZ  1 
ATOM   907  N N   . GLU A 1 113 ? 13.451 14.842 40.007 1.00 10.66 ? 115 GLU A N   1 
ATOM   908  C CA  . GLU A 1 113 ? 12.065 14.522 39.694 1.00 10.86 ? 115 GLU A CA  1 
ATOM   909  C C   . GLU A 1 113 ? 12.310 13.238 38.909 1.00 11.93 ? 115 GLU A C   1 
ATOM   910  O O   . GLU A 1 113 ? 12.559 13.259 37.697 1.00 11.81 ? 115 GLU A O   1 
ATOM   911  C CB  . GLU A 1 113 ? 11.408 15.590 38.824 1.00 12.09 ? 115 GLU A CB  1 
ATOM   912  C CG  . GLU A 1 113 ? 11.202 16.936 39.522 1.00 13.54 ? 115 GLU A CG  1 
ATOM   913  C CD  . GLU A 1 113 ? 10.337 16.869 40.786 1.00 12.40 ? 115 GLU A CD  1 
ATOM   914  O OE1 . GLU A 1 113 ? 9.568  15.903 40.961 1.00 13.88 ? 115 GLU A OE1 1 
ATOM   915  O OE2 . GLU A 1 113 ? 10.423 17.814 41.605 1.00 15.09 ? 115 GLU A OE2 1 
ATOM   916  N N   . GLY A 1 114 ? 12.301 12.113 39.614 1.00 11.53 ? 116 GLY A N   1 
ATOM   917  C CA  . GLY A 1 114 ? 12.591 10.859 38.949 1.00 12.60 ? 116 GLY A CA  1 
ATOM   918  C C   . GLY A 1 114 ? 14.076 10.847 38.607 1.00 12.19 ? 116 GLY A C   1 
ATOM   919  O O   . GLY A 1 114 ? 14.915 11.193 39.442 1.00 13.57 ? 116 GLY A O   1 
ATOM   920  N N   . ASP A 1 115 ? 14.413 10.468 37.381 1.00 11.34 ? 117 ASP A N   1 
ATOM   921  C CA  . ASP A 1 115 ? 15.806 10.421 36.953 1.00 11.92 ? 117 ASP A CA  1 
ATOM   922  C C   . ASP A 1 115 ? 16.346 11.780 36.536 1.00 11.86 ? 117 ASP A C   1 
ATOM   923  O O   . ASP A 1 115 ? 17.547 11.928 36.329 1.00 12.68 ? 117 ASP A O   1 
ATOM   924  C CB  . ASP A 1 115 ? 15.988 9.469  35.766 1.00 17.80 ? 117 ASP A CB  1 
ATOM   925  C CG  . ASP A 1 115 ? 15.692 8.026  36.111 1.00 23.23 ? 117 ASP A CG  1 
ATOM   926  O OD1 . ASP A 1 115 ? 16.043 7.588  37.224 1.00 23.33 ? 117 ASP A OD1 1 
ATOM   927  O OD2 . ASP A 1 115 ? 15.123 7.324  35.249 1.00 26.15 ? 117 ASP A OD2 1 
ATOM   928  N N   . THR A 1 116 ? 15.468 12.765 36.417 1.00 11.51 ? 118 THR A N   1 
ATOM   929  C CA  . THR A 1 116 ? 15.879 14.085 35.974 1.00 11.63 ? 118 THR A CA  1 
ATOM   930  C C   . THR A 1 116 ? 16.216 15.061 37.088 1.00 10.14 ? 118 THR A C   1 
ATOM   931  O O   . THR A 1 116 ? 15.443 15.228 38.034 1.00 11.56 ? 118 THR A O   1 
ATOM   932  C CB  . THR A 1 116 ? 14.778 14.711 35.096 1.00 10.94 ? 118 THR A CB  1 
ATOM   933  O OG1 . THR A 1 116 ? 14.512 13.848 33.981 1.00 13.73 ? 118 THR A OG1 1 
ATOM   934  C CG2 . THR A 1 116 ? 15.210 16.064 34.567 1.00 12.41 ? 118 THR A CG2 1 
ATOM   935  N N   . LEU A 1 117 ? 17.382 15.690 36.980 1.00 9.96  ? 119 LEU A N   1 
ATOM   936  C CA  . LEU A 1 117 ? 17.795 16.698 37.949 1.00 9.47  ? 119 LEU A CA  1 
ATOM   937  C C   . LEU A 1 117 ? 17.179 18.000 37.427 1.00 9.96  ? 119 LEU A C   1 
ATOM   938  O O   . LEU A 1 117 ? 17.469 18.431 36.303 1.00 10.05 ? 119 LEU A O   1 
ATOM   939  C CB  . LEU A 1 117 ? 19.319 16.783 37.997 1.00 10.01 ? 119 LEU A CB  1 
ATOM   940  C CG  . LEU A 1 117 ? 19.947 17.646 39.097 1.00 10.40 ? 119 LEU A CG  1 
ATOM   941  C CD1 . LEU A 1 117 ? 19.830 19.114 38.714 1.00 11.62 ? 119 LEU A CD1 1 
ATOM   942  C CD2 . LEU A 1 117 ? 19.305 17.349 40.463 1.00 10.19 ? 119 LEU A CD2 1 
ATOM   943  N N   . VAL A 1 118 ? 16.325 18.611 38.247 1.00 10.03 ? 120 VAL A N   1 
ATOM   944  C CA  . VAL A 1 118 ? 15.599 19.817 37.870 1.00 10.83 ? 120 VAL A CA  1 
ATOM   945  C C   . VAL A 1 118 ? 16.023 21.052 38.647 1.00 9.12  ? 120 VAL A C   1 
ATOM   946  O O   . VAL A 1 118 ? 16.160 21.000 39.880 1.00 10.70 ? 120 VAL A O   1 
ATOM   947  C CB  . VAL A 1 118 ? 14.080 19.596 38.088 1.00 10.41 ? 120 VAL A CB  1 
ATOM   948  C CG1 . VAL A 1 118 ? 13.293 20.830 37.674 1.00 12.23 ? 120 VAL A CG1 1 
ATOM   949  C CG2 . VAL A 1 118 ? 13.615 18.386 37.297 1.00 11.53 ? 120 VAL A CG2 1 
ATOM   950  N N   . ASN A 1 119 ? 16.224 22.153 37.928 1.00 9.94  ? 121 ASN A N   1 
ATOM   951  C CA  . ASN A 1 119 ? 16.590 23.431 38.533 1.00 10.04 ? 121 ASN A CA  1 
ATOM   952  C C   . ASN A 1 119 ? 15.491 24.414 38.154 1.00 8.92  ? 121 ASN A C   1 
ATOM   953  O O   . ASN A 1 119 ? 15.406 24.821 36.991 1.00 10.29 ? 121 ASN A O   1 
ATOM   954  C CB  . ASN A 1 119 ? 17.943 23.914 37.986 1.00 9.74  ? 121 ASN A CB  1 
ATOM   955  C CG  . ASN A 1 119 ? 18.391 25.233 38.593 1.00 9.61  ? 121 ASN A CG  1 
ATOM   956  O OD1 . ASN A 1 119 ? 17.924 25.632 39.663 1.00 10.76 ? 121 ASN A OD1 1 
ATOM   957  N ND2 . ASN A 1 119 ? 19.320 25.911 37.920 1.00 10.26 ? 121 ASN A ND2 1 
ATOM   958  N N   . ARG A 1 120 ? 14.642 24.783 39.117 1.00 9.85  ? 122 ARG A N   1 
ATOM   959  C CA  . ARG A 1 120 ? 13.553 25.740 38.888 1.00 10.87 ? 122 ARG A CA  1 
ATOM   960  C C   . ARG A 1 120 ? 13.954 27.044 39.555 1.00 9.35  ? 122 ARG A C   1 
ATOM   961  O O   . ARG A 1 120 ? 14.245 27.065 40.759 1.00 11.07 ? 122 ARG A O   1 
ATOM   962  C CB  . ARG A 1 120 ? 12.244 25.224 39.477 1.00 10.72 ? 122 ARG A CB  1 
ATOM   963  C CG  . ARG A 1 120 ? 11.629 24.083 38.680 1.00 12.01 ? 122 ARG A CG  1 
ATOM   964  C CD  . ARG A 1 120 ? 10.269 23.712 39.227 1.00 14.96 ? 122 ARG A CD  1 
ATOM   965  N NE  . ARG A 1 120 ? 9.336  24.830 39.122 1.00 17.50 ? 122 ARG A NE  1 
ATOM   966  C CZ  . ARG A 1 120 ? 8.157  24.890 39.734 1.00 25.78 ? 122 ARG A CZ  1 
ATOM   967  N NH1 . ARG A 1 120 ? 7.752  23.892 40.506 1.00 26.45 ? 122 ARG A NH1 1 
ATOM   968  N NH2 . ARG A 1 120 ? 7.384  25.955 39.577 1.00 28.02 ? 122 ARG A NH2 1 
ATOM   969  N N   . ILE A 1 121 ? 13.923 28.132 38.792 1.00 10.16 ? 123 ILE A N   1 
ATOM   970  C CA  . ILE A 1 121 ? 14.396 29.420 39.269 1.00 10.92 ? 123 ILE A CA  1 
ATOM   971  C C   . ILE A 1 121 ? 13.467 30.606 39.055 1.00 9.57  ? 123 ILE A C   1 
ATOM   972  O O   . ILE A 1 121 ? 12.787 30.699 38.028 1.00 10.57 ? 123 ILE A O   1 
ATOM   973  C CB  . ILE A 1 121 ? 15.701 29.809 38.510 1.00 11.92 ? 123 ILE A CB  1 
ATOM   974  C CG1 . ILE A 1 121 ? 16.661 28.627 38.431 1.00 12.60 ? 123 ILE A CG1 1 
ATOM   975  C CG2 . ILE A 1 121 ? 16.366 31.005 39.173 1.00 13.47 ? 123 ILE A CG2 1 
ATOM   976  C CD1 . ILE A 1 121 ? 17.371 28.528 37.091 1.00 13.54 ? 123 ILE A CD1 1 
ATOM   977  N N   . GLU A 1 122 ? 13.470 31.522 40.019 1.00 9.91  ? 124 GLU A N   1 
ATOM   978  C CA  . GLU A 1 122 ? 12.752 32.779 39.880 1.00 10.07 ? 124 GLU A CA  1 
ATOM   979  C C   . GLU A 1 122 ? 13.869 33.817 39.994 1.00 9.78  ? 124 GLU A C   1 
ATOM   980  O O   . GLU A 1 122 ? 14.689 33.751 40.924 1.00 10.92 ? 124 GLU A O   1 
ATOM   981  C CB  . GLU A 1 122 ? 11.734 32.984 40.998 1.00 12.93 ? 124 GLU A CB  1 
ATOM   982  C CG  . GLU A 1 122 ? 10.564 32.026 40.935 1.00 20.01 ? 124 GLU A CG  1 
ATOM   983  C CD  . GLU A 1 122 ? 9.533  32.294 42.011 1.00 28.41 ? 124 GLU A CD  1 
ATOM   984  O OE1 . GLU A 1 122 ? 8.915  33.379 41.981 1.00 31.99 ? 124 GLU A OE1 1 
ATOM   985  O OE2 . GLU A 1 122 ? 9.342  31.423 42.887 1.00 32.59 ? 124 GLU A OE2 1 
ATOM   986  N N   . LEU A 1 123 ? 13.921 34.748 39.042 1.00 10.32 ? 125 LEU A N   1 
ATOM   987  C CA  . LEU A 1 123 ? 14.934 35.798 39.020 1.00 10.60 ? 125 LEU A CA  1 
ATOM   988  C C   . LEU A 1 123 ? 14.253 37.151 38.963 1.00 10.16 ? 125 LEU A C   1 
ATOM   989  O O   . LEU A 1 123 ? 13.337 37.363 38.164 1.00 11.74 ? 125 LEU A O   1 
ATOM   990  C CB  . LEU A 1 123 ? 15.856 35.630 37.800 1.00 10.32 ? 125 LEU A CB  1 
ATOM   991  C CG  . LEU A 1 123 ? 16.972 36.666 37.592 1.00 11.81 ? 125 LEU A CG  1 
ATOM   992  C CD1 . LEU A 1 123 ? 18.118 36.027 36.816 1.00 13.87 ? 125 LEU A CD1 1 
ATOM   993  C CD2 . LEU A 1 123 ? 16.444 37.890 36.846 1.00 11.98 ? 125 LEU A CD2 1 
ATOM   994  N N   . LYS A 1 124 ? 14.707 38.060 39.820 1.00 9.97  ? 126 LYS A N   1 
ATOM   995  C CA  . LYS A 1 124 ? 14.167 39.405 39.882 1.00 10.56 ? 126 LYS A CA  1 
ATOM   996  C C   . LYS A 1 124 ? 15.327 40.384 39.807 1.00 10.49 ? 126 LYS A C   1 
ATOM   997  O O   . LYS A 1 124 ? 16.239 40.335 40.639 1.00 11.64 ? 126 LYS A O   1 
ATOM   998  C CB  . LYS A 1 124 ? 13.430 39.607 41.207 1.00 12.73 ? 126 LYS A CB  1 
ATOM   999  C CG  . LYS A 1 124 ? 12.733 40.944 41.358 1.00 17.60 ? 126 LYS A CG  1 
ATOM   1000 C CD  . LYS A 1 124 ? 11.564 41.068 40.397 1.00 20.95 ? 126 LYS A CD  1 
ATOM   1001 C CE  . LYS A 1 124 ? 10.663 42.230 40.792 1.00 25.07 ? 126 LYS A CE  1 
ATOM   1002 N NZ  . LYS A 1 124 ? 10.064 42.010 42.141 1.00 27.08 ? 126 LYS A NZ  1 
ATOM   1003 N N   . GLY A 1 125 ? 15.300 41.268 38.816 1.00 10.38 ? 127 GLY A N   1 
ATOM   1004 C CA  . GLY A 1 125 ? 16.360 42.246 38.680 1.00 10.53 ? 127 GLY A CA  1 
ATOM   1005 C C   . GLY A 1 125 ? 15.782 43.639 38.791 1.00 10.10 ? 127 GLY A C   1 
ATOM   1006 O O   . GLY A 1 125 ? 14.732 43.920 38.214 1.00 11.02 ? 127 GLY A O   1 
ATOM   1007 N N   . ILE A 1 126 ? 16.447 44.512 39.538 1.00 10.89 ? 128 ILE A N   1 
ATOM   1008 C CA  . ILE A 1 126 ? 15.974 45.878 39.684 1.00 10.58 ? 128 ILE A CA  1 
ATOM   1009 C C   . ILE A 1 126 ? 17.134 46.858 39.631 1.00 10.72 ? 128 ILE A C   1 
ATOM   1010 O O   . ILE A 1 126 ? 18.302 46.481 39.762 1.00 12.07 ? 128 ILE A O   1 
ATOM   1011 C CB  . ILE A 1 126 ? 15.209 46.102 41.024 1.00 11.67 ? 128 ILE A CB  1 
ATOM   1012 C CG1 . ILE A 1 126 ? 16.132 45.879 42.232 1.00 11.75 ? 128 ILE A CG1 1 
ATOM   1013 C CG2 . ILE A 1 126 ? 13.989 45.196 41.069 1.00 12.70 ? 128 ILE A CG2 1 
ATOM   1014 C CD1 . ILE A 1 126 ? 15.491 46.257 43.567 1.00 14.11 ? 128 ILE A CD1 1 
ATOM   1015 N N   . ASP A 1 127 ? 16.788 48.121 39.421 1.00 11.73 ? 129 ASP A N   1 
ATOM   1016 C CA  . ASP A 1 127 ? 17.749 49.212 39.391 1.00 13.16 ? 129 ASP A CA  1 
ATOM   1017 C C   . ASP A 1 127 ? 18.748 49.210 38.249 1.00 12.01 ? 129 ASP A C   1 
ATOM   1018 O O   . ASP A 1 127 ? 19.823 49.794 38.363 1.00 12.76 ? 129 ASP A O   1 
ATOM   1019 C CB  . ASP A 1 127 ? 18.501 49.291 40.724 1.00 18.96 ? 129 ASP A CB  1 
ATOM   1020 C CG  . ASP A 1 127 ? 17.581 49.570 41.893 1.00 26.10 ? 129 ASP A CG  1 
ATOM   1021 O OD1 . ASP A 1 127 ? 16.657 50.393 41.738 1.00 28.91 ? 129 ASP A OD1 1 
ATOM   1022 O OD2 . ASP A 1 127 ? 17.786 48.978 42.969 1.00 29.89 ? 129 ASP A OD2 1 
ATOM   1023 N N   . PHE A 1 128 ? 18.398 48.573 37.138 1.00 11.58 ? 130 PHE A N   1 
ATOM   1024 C CA  . PHE A 1 128 ? 19.296 48.575 35.998 1.00 12.63 ? 130 PHE A CA  1 
ATOM   1025 C C   . PHE A 1 128 ? 19.131 49.832 35.172 1.00 13.22 ? 130 PHE A C   1 
ATOM   1026 O O   . PHE A 1 128 ? 18.059 50.446 35.142 1.00 13.62 ? 130 PHE A O   1 
ATOM   1027 C CB  . PHE A 1 128 ? 19.064 47.359 35.107 1.00 12.60 ? 130 PHE A CB  1 
ATOM   1028 C CG  . PHE A 1 128 ? 19.605 46.098 35.684 1.00 11.94 ? 130 PHE A CG  1 
ATOM   1029 C CD1 . PHE A 1 128 ? 18.837 45.333 36.551 1.00 12.02 ? 130 PHE A CD1 1 
ATOM   1030 C CD2 . PHE A 1 128 ? 20.918 45.718 35.427 1.00 11.97 ? 130 PHE A CD2 1 
ATOM   1031 C CE1 . PHE A 1 128 ? 19.372 44.210 37.162 1.00 11.96 ? 130 PHE A CE1 1 
ATOM   1032 C CE2 . PHE A 1 128 ? 21.463 44.596 36.035 1.00 11.81 ? 130 PHE A CE2 1 
ATOM   1033 C CZ  . PHE A 1 128 ? 20.690 43.843 36.906 1.00 11.46 ? 130 PHE A CZ  1 
ATOM   1034 N N   . LYS A 1 129 ? 20.216 50.220 34.518 1.00 12.38 ? 131 LYS A N   1 
ATOM   1035 C CA  . LYS A 1 129 ? 20.209 51.379 33.647 1.00 12.35 ? 131 LYS A CA  1 
ATOM   1036 C C   . LYS A 1 129 ? 19.680 50.911 32.289 1.00 14.63 ? 131 LYS A C   1 
ATOM   1037 O O   . LYS A 1 129 ? 20.124 49.893 31.753 1.00 14.29 ? 131 LYS A O   1 
ATOM   1038 C CB  . LYS A 1 129 ? 21.628 51.938 33.517 1.00 16.69 ? 131 LYS A CB  1 
ATOM   1039 C CG  . LYS A 1 129 ? 22.200 52.425 34.846 1.00 19.80 ? 131 LYS A CG  1 
ATOM   1040 C CD  . LYS A 1 129 ? 23.638 52.903 34.722 1.00 24.52 ? 131 LYS A CD  1 
ATOM   1041 C CE  . LYS A 1 129 ? 24.168 53.401 36.063 1.00 27.90 ? 131 LYS A CE  1 
ATOM   1042 N NZ  . LYS A 1 129 ? 25.605 53.785 35.993 1.00 31.43 ? 131 LYS A NZ  1 
ATOM   1043 N N   . GLU A 1 130 ? 18.718 51.650 31.741 1.00 18.92 ? 132 GLU A N   1 
ATOM   1044 C CA  . GLU A 1 130 ? 18.116 51.306 30.458 1.00 23.95 ? 132 GLU A CA  1 
ATOM   1045 C C   . GLU A 1 130 ? 19.142 51.160 29.341 1.00 24.53 ? 132 GLU A C   1 
ATOM   1046 O O   . GLU A 1 130 ? 19.003 50.297 28.474 1.00 26.53 ? 132 GLU A O   1 
ATOM   1047 C CB  . GLU A 1 130 ? 17.078 52.357 30.074 1.00 37.23 ? 132 GLU A CB  1 
ATOM   1048 N N   . ASP A 1 131 ? 20.165 52.007 29.361 1.00 26.76 ? 133 ASP A N   1 
ATOM   1049 C CA  . ASP A 1 131 ? 21.208 51.968 28.344 1.00 28.21 ? 133 ASP A CA  1 
ATOM   1050 C C   . ASP A 1 131 ? 22.520 51.469 28.934 1.00 26.95 ? 133 ASP A C   1 
ATOM   1051 O O   . ASP A 1 131 ? 23.602 51.837 28.474 1.00 27.25 ? 133 ASP A O   1 
ATOM   1052 C CB  . ASP A 1 131 ? 21.399 53.355 27.739 1.00 33.09 ? 133 ASP A CB  1 
ATOM   1053 N N   . GLY A 1 132 ? 22.416 50.633 29.961 1.00 20.34 ? 134 GLY A N   1 
ATOM   1054 C CA  . GLY A 1 132 ? 23.603 50.092 30.592 1.00 18.03 ? 134 GLY A CA  1 
ATOM   1055 C C   . GLY A 1 132 ? 24.109 48.879 29.842 1.00 13.64 ? 134 GLY A C   1 
ATOM   1056 O O   . GLY A 1 132 ? 23.558 48.494 28.811 1.00 13.81 ? 134 GLY A O   1 
ATOM   1057 N N   . ASN A 1 133 ? 25.158 48.261 30.361 1.00 13.28 ? 135 ASN A N   1 
ATOM   1058 C CA  . ASN A 1 133 ? 25.730 47.093 29.711 1.00 12.28 ? 135 ASN A CA  1 
ATOM   1059 C C   . ASN A 1 133 ? 24.807 45.890 29.673 1.00 12.16 ? 135 ASN A C   1 
ATOM   1060 O O   . ASN A 1 133 ? 24.929 45.038 28.792 1.00 12.44 ? 135 ASN A O   1 
ATOM   1061 C CB  . ASN A 1 133 ? 27.024 46.687 30.401 1.00 13.62 ? 135 ASN A CB  1 
ATOM   1062 C CG  . ASN A 1 133 ? 28.081 47.742 30.293 1.00 13.86 ? 135 ASN A CG  1 
ATOM   1063 O OD1 . ASN A 1 133 ? 28.210 48.394 29.253 1.00 15.27 ? 135 ASN A OD1 1 
ATOM   1064 N ND2 . ASN A 1 133 ? 28.861 47.912 31.351 1.00 13.70 ? 135 ASN A ND2 1 
ATOM   1065 N N   . ILE A 1 134 ? 23.894 45.809 30.635 1.00 12.52 ? 136 ILE A N   1 
ATOM   1066 C CA  . ILE A 1 134 ? 22.977 44.685 30.707 1.00 11.18 ? 136 ILE A CA  1 
ATOM   1067 C C   . ILE A 1 134 ? 21.755 44.900 29.827 1.00 11.41 ? 136 ILE A C   1 
ATOM   1068 O O   . ILE A 1 134 ? 21.580 44.201 28.829 1.00 12.38 ? 136 ILE A O   1 
ATOM   1069 C CB  . ILE A 1 134 ? 22.552 44.408 32.179 1.00 11.85 ? 136 ILE A CB  1 
ATOM   1070 C CG1 . ILE A 1 134 ? 23.758 43.939 32.998 1.00 16.41 ? 136 ILE A CG1 1 
ATOM   1071 C CG2 . ILE A 1 134 ? 21.478 43.342 32.230 1.00 14.70 ? 136 ILE A CG2 1 
ATOM   1072 C CD1 . ILE A 1 134 ? 24.728 45.031 33.355 1.00 19.88 ? 136 ILE A CD1 1 
ATOM   1073 N N   . LEU A 1 135 ? 20.918 45.871 30.166 1.00 11.19 ? 137 LEU A N   1 
ATOM   1074 C CA  . LEU A 1 135 ? 19.737 46.103 29.349 1.00 11.96 ? 137 LEU A CA  1 
ATOM   1075 C C   . LEU A 1 135 ? 20.085 46.584 27.938 1.00 13.60 ? 137 LEU A C   1 
ATOM   1076 O O   . LEU A 1 135 ? 19.284 46.431 27.008 1.00 15.40 ? 137 LEU A O   1 
ATOM   1077 C CB  . LEU A 1 135 ? 18.794 47.085 30.051 1.00 12.56 ? 137 LEU A CB  1 
ATOM   1078 C CG  . LEU A 1 135 ? 18.132 46.490 31.306 1.00 13.80 ? 137 LEU A CG  1 
ATOM   1079 C CD1 . LEU A 1 135 ? 17.294 47.547 32.012 1.00 15.95 ? 137 LEU A CD1 1 
ATOM   1080 C CD2 . LEU A 1 135 ? 17.255 45.302 30.912 1.00 16.04 ? 137 LEU A CD2 1 
ATOM   1081 N N   . GLY A 1 136 ? 21.288 47.136 27.782 1.00 13.85 ? 138 GLY A N   1 
ATOM   1082 C CA  . GLY A 1 136 ? 21.735 47.614 26.482 1.00 13.49 ? 138 GLY A CA  1 
ATOM   1083 C C   . GLY A 1 136 ? 22.467 46.555 25.675 1.00 14.02 ? 138 GLY A C   1 
ATOM   1084 O O   . GLY A 1 136 ? 22.935 46.831 24.569 1.00 15.60 ? 138 GLY A O   1 
ATOM   1085 N N   . HIS A 1 137 ? 22.581 45.346 26.220 1.00 13.62 ? 139 HIS A N   1 
ATOM   1086 C CA  . HIS A 1 137 ? 23.245 44.241 25.525 1.00 12.80 ? 139 HIS A CA  1 
ATOM   1087 C C   . HIS A 1 137 ? 24.625 44.624 24.991 1.00 12.35 ? 139 HIS A C   1 
ATOM   1088 O O   . HIS A 1 137 ? 24.889 44.536 23.782 1.00 14.09 ? 139 HIS A O   1 
ATOM   1089 C CB  . HIS A 1 137 ? 22.369 43.754 24.367 1.00 14.50 ? 139 HIS A CB  1 
ATOM   1090 C CG  . HIS A 1 137 ? 21.041 43.211 24.794 1.00 15.81 ? 139 HIS A CG  1 
ATOM   1091 N ND1 . HIS A 1 137 ? 20.851 41.891 25.143 1.00 17.50 ? 139 HIS A ND1 1 
ATOM   1092 C CD2 . HIS A 1 137 ? 19.834 43.812 24.921 1.00 16.36 ? 139 HIS A CD2 1 
ATOM   1093 C CE1 . HIS A 1 137 ? 19.582 41.701 25.462 1.00 16.43 ? 139 HIS A CE1 1 
ATOM   1094 N NE2 . HIS A 1 137 ? 18.944 42.851 25.336 1.00 20.00 ? 139 HIS A NE2 1 
ATOM   1095 N N   . LYS A 1 138 ? 25.511 45.038 25.889 1.00 12.38 ? 140 LYS A N   1 
ATOM   1096 C CA  . LYS A 1 138 ? 26.855 45.443 25.495 1.00 11.74 ? 140 LYS A CA  1 
ATOM   1097 C C   . LYS A 1 138 ? 27.923 44.457 25.946 1.00 11.75 ? 140 LYS A C   1 
ATOM   1098 O O   . LYS A 1 138 ? 29.114 44.755 25.881 1.00 12.75 ? 140 LYS A O   1 
ATOM   1099 C CB  . LYS A 1 138 ? 27.173 46.829 26.061 1.00 13.43 ? 140 LYS A CB  1 
ATOM   1100 C CG  . LYS A 1 138 ? 26.097 47.859 25.775 1.00 14.09 ? 140 LYS A CG  1 
ATOM   1101 C CD  . LYS A 1 138 ? 26.520 49.237 26.253 1.00 17.80 ? 140 LYS A CD  1 
ATOM   1102 C CE  . LYS A 1 138 ? 25.399 50.248 26.097 1.00 18.40 ? 140 LYS A CE  1 
ATOM   1103 N NZ  . LYS A 1 138 ? 25.829 51.623 26.500 1.00 23.14 ? 140 LYS A NZ  1 
ATOM   1104 N N   . LEU A 1 139 ? 27.500 43.285 26.407 1.00 12.07 ? 141 LEU A N   1 
ATOM   1105 C CA  . LEU A 1 139 ? 28.433 42.274 26.878 1.00 11.18 ? 141 LEU A CA  1 
ATOM   1106 C C   . LEU A 1 139 ? 28.759 41.254 25.804 1.00 12.28 ? 141 LEU A C   1 
ATOM   1107 O O   . LEU A 1 139 ? 27.880 40.820 25.057 1.00 13.05 ? 141 LEU A O   1 
ATOM   1108 C CB  . LEU A 1 139 ? 27.857 41.558 28.100 1.00 11.57 ? 141 LEU A CB  1 
ATOM   1109 C CG  . LEU A 1 139 ? 27.527 42.469 29.285 1.00 11.40 ? 141 LEU A CG  1 
ATOM   1110 C CD1 . LEU A 1 139 ? 27.110 41.634 30.483 1.00 13.52 ? 141 LEU A CD1 1 
ATOM   1111 C CD2 . LEU A 1 139 ? 28.751 43.315 29.632 1.00 13.75 ? 141 LEU A CD2 1 
ATOM   1112 N N   . GLU A 1 140 ? 30.026 40.868 25.741 1.00 11.79 ? 142 GLU A N   1 
ATOM   1113 C CA  . GLU A 1 140 ? 30.478 39.888 24.765 1.00 11.83 ? 142 GLU A CA  1 
ATOM   1114 C C   . GLU A 1 140 ? 29.935 38.505 25.103 1.00 12.07 ? 142 GLU A C   1 
ATOM   1115 O O   . GLU A 1 140 ? 29.686 38.183 26.268 1.00 12.73 ? 142 GLU A O   1 
ATOM   1116 C CB  . GLU A 1 140 ? 32.007 39.869 24.723 1.00 14.02 ? 142 GLU A CB  1 
ATOM   1117 C CG  . GLU A 1 140 ? 32.586 41.179 24.211 1.00 17.47 ? 142 GLU A CG  1 
ATOM   1118 C CD  . GLU A 1 140 ? 34.101 41.207 24.179 1.00 20.19 ? 142 GLU A CD  1 
ATOM   1119 O OE1 . GLU A 1 140 ? 34.647 42.200 23.652 1.00 20.60 ? 142 GLU A OE1 1 
ATOM   1120 O OE2 . GLU A 1 140 ? 34.743 40.257 24.679 1.00 22.25 ? 142 GLU A OE2 1 
ATOM   1121 N N   . TYR A 1 141 ? 29.756 37.688 24.073 1.00 13.15 ? 143 TYR A N   1 
ATOM   1122 C CA  . TYR A 1 141 ? 29.236 36.342 24.240 1.00 12.63 ? 143 TYR A CA  1 
ATOM   1123 C C   . TYR A 1 141 ? 30.396 35.399 24.507 1.00 13.86 ? 143 TYR A C   1 
ATOM   1124 O O   . TYR A 1 141 ? 30.843 34.666 23.624 1.00 14.78 ? 143 TYR A O   1 
ATOM   1125 C CB  . TYR A 1 141 ? 28.485 35.915 22.978 1.00 13.20 ? 143 TYR A CB  1 
ATOM   1126 C CG  . TYR A 1 141 ? 27.666 34.662 23.141 1.00 12.53 ? 143 TYR A CG  1 
ATOM   1127 C CD1 . TYR A 1 141 ? 26.501 34.664 23.904 1.00 13.83 ? 143 TYR A CD1 1 
ATOM   1128 C CD2 . TYR A 1 141 ? 28.031 33.481 22.500 1.00 12.75 ? 143 TYR A CD2 1 
ATOM   1129 C CE1 . TYR A 1 141 ? 25.716 33.523 24.018 1.00 12.75 ? 143 TYR A CE1 1 
ATOM   1130 C CE2 . TYR A 1 141 ? 27.260 32.338 22.608 1.00 11.39 ? 143 TYR A CE2 1 
ATOM   1131 C CZ  . TYR A 1 141 ? 26.102 32.364 23.364 1.00 11.83 ? 143 TYR A CZ  1 
ATOM   1132 O OH  . TYR A 1 141 ? 25.315 31.241 23.457 1.00 13.46 ? 143 TYR A OH  1 
ATOM   1133 N N   . ASN A 1 142 ? 30.900 35.456 25.734 1.00 15.10 ? 144 ASN A N   1 
ATOM   1134 C CA  . ASN A 1 142 ? 31.996 34.607 26.171 1.00 16.59 ? 144 ASN A CA  1 
ATOM   1135 C C   . ASN A 1 142 ? 31.996 34.583 27.692 1.00 16.53 ? 144 ASN A C   1 
ATOM   1136 O O   . ASN A 1 142 ? 31.089 35.124 28.328 1.00 17.10 ? 144 ASN A O   1 
ATOM   1137 C CB  . ASN A 1 142 ? 33.345 35.109 25.636 1.00 18.70 ? 144 ASN A CB  1 
ATOM   1138 C CG  . ASN A 1 142 ? 33.563 36.586 25.877 1.00 22.23 ? 144 ASN A CG  1 
ATOM   1139 O OD1 . ASN A 1 142 ? 33.317 37.097 26.969 1.00 22.76 ? 144 ASN A OD1 1 
ATOM   1140 N ND2 . ASN A 1 142 ? 34.045 37.281 24.855 1.00 21.57 ? 144 ASN A ND2 1 
ATOM   1141 N N   . TYR A 1 143 ? 33.013 33.957 28.270 1.00 16.81 ? 145 TYR A N   1 
ATOM   1142 C CA  . TYR A 1 143 ? 33.102 33.840 29.717 1.00 15.24 ? 145 TYR A CA  1 
ATOM   1143 C C   . TYR A 1 143 ? 34.566 33.717 30.123 1.00 17.25 ? 145 TYR A C   1 
ATOM   1144 O O   . TYR A 1 143 ? 35.348 33.062 29.435 1.00 20.86 ? 145 TYR A O   1 
ATOM   1145 C CB  . TYR A 1 143 ? 32.336 32.600 30.169 1.00 16.44 ? 145 TYR A CB  1 
ATOM   1146 C CG  . TYR A 1 143 ? 31.534 32.808 31.429 1.00 14.63 ? 145 TYR A CG  1 
ATOM   1147 C CD1 . TYR A 1 143 ? 30.309 33.473 31.399 1.00 15.06 ? 145 TYR A CD1 1 
ATOM   1148 C CD2 . TYR A 1 143 ? 32.006 32.356 32.656 1.00 15.77 ? 145 TYR A CD2 1 
ATOM   1149 C CE1 . TYR A 1 143 ? 29.573 33.682 32.563 1.00 14.90 ? 145 TYR A CE1 1 
ATOM   1150 C CE2 . TYR A 1 143 ? 31.282 32.560 33.827 1.00 14.57 ? 145 TYR A CE2 1 
ATOM   1151 C CZ  . TYR A 1 143 ? 30.066 33.222 33.773 1.00 14.53 ? 145 TYR A CZ  1 
ATOM   1152 O OH  . TYR A 1 143 ? 29.342 33.412 34.926 1.00 15.44 ? 145 TYR A OH  1 
ATOM   1153 N N   . ILE A 1 144 ? 34.932 34.327 31.247 1.00 16.98 ? 146 ILE A N   1 
ATOM   1154 C CA  . ILE A 1 144 ? 36.317 34.286 31.709 1.00 19.15 ? 146 ILE A CA  1 
ATOM   1155 C C   . ILE A 1 144 ? 36.548 33.928 33.184 1.00 19.01 ? 146 ILE A C   1 
ATOM   1156 O O   . ILE A 1 144 ? 37.665 33.563 33.553 1.00 21.18 ? 146 ILE A O   1 
ATOM   1157 C CB  . ILE A 1 144 ? 37.025 35.636 31.430 1.00 20.02 ? 146 ILE A CB  1 
ATOM   1158 C CG1 . ILE A 1 144 ? 36.291 36.768 32.155 1.00 22.06 ? 146 ILE A CG1 1 
ATOM   1159 C CG2 . ILE A 1 144 ? 37.086 35.895 29.929 1.00 22.81 ? 146 ILE A CG2 1 
ATOM   1160 C CD1 . ILE A 1 144 ? 36.908 38.148 31.948 1.00 23.76 ? 146 ILE A CD1 1 
ATOM   1161 N N   . SER A 1 145 ? 35.519 34.023 34.023 1.00 16.85 ? 147 SER A N   1 
ATOM   1162 C CA  . SER A 1 145 ? 35.667 33.711 35.451 1.00 15.91 ? 147 SER A CA  1 
ATOM   1163 C C   . SER A 1 145 ? 35.491 32.220 35.736 1.00 15.38 ? 147 SER A C   1 
ATOM   1164 O O   . SER A 1 145 ? 34.743 31.534 35.031 1.00 16.02 ? 147 SER A O   1 
ATOM   1165 C CB  . SER A 1 145 ? 34.677 34.538 36.270 1.00 19.25 ? 147 SER A CB  1 
ATOM   1166 O OG  . SER A 1 145 ? 34.958 35.922 36.121 1.00 19.23 ? 147 SER A OG  1 
ATOM   1167 N N   . HIS A 1 146 ? 36.156 31.734 36.789 1.00 17.69 ? 148 HIS A N   1 
ATOM   1168 C CA  . HIS A 1 146 ? 36.137 30.309 37.124 1.00 16.93 ? 148 HIS A CA  1 
ATOM   1169 C C   . HIS A 1 146 ? 35.807 29.854 38.552 1.00 15.94 ? 148 HIS A C   1 
ATOM   1170 O O   . HIS A 1 146 ? 35.170 28.826 38.726 1.00 15.36 ? 148 HIS A O   1 
ATOM   1171 C CB  . HIS A 1 146 ? 37.505 29.689 36.803 1.00 18.51 ? 148 HIS A CB  1 
ATOM   1172 C CG  . HIS A 1 146 ? 38.073 30.087 35.477 1.00 19.78 ? 148 HIS A CG  1 
ATOM   1173 N ND1 . HIS A 1 146 ? 37.618 29.570 34.283 1.00 22.40 ? 148 HIS A ND1 1 
ATOM   1174 C CD2 . HIS A 1 146 ? 39.072 30.943 35.160 1.00 22.00 ? 148 HIS A CD2 1 
ATOM   1175 C CE1 . HIS A 1 146 ? 38.315 30.089 33.288 1.00 22.30 ? 148 HIS A CE1 1 
ATOM   1176 N NE2 . HIS A 1 146 ? 39.203 30.926 33.793 1.00 24.69 ? 148 HIS A NE2 1 
ATOM   1177 N N   . ASN A 1 147 ? 36.245 30.593 39.569 1.00 16.13 ? 149 ASN A N   1 
ATOM   1178 C CA  . ASN A 1 147 ? 36.067 30.145 40.954 1.00 17.97 ? 149 ASN A CA  1 
ATOM   1179 C C   . ASN A 1 147 ? 34.866 30.548 41.803 1.00 17.89 ? 149 ASN A C   1 
ATOM   1180 O O   . ASN A 1 147 ? 34.345 31.661 41.703 1.00 17.63 ? 149 ASN A O   1 
ATOM   1181 C CB  . ASN A 1 147 ? 37.330 30.487 41.753 1.00 22.68 ? 149 ASN A CB  1 
ATOM   1182 C CG  . ASN A 1 147 ? 38.568 29.770 41.240 1.00 26.29 ? 149 ASN A CG  1 
ATOM   1183 O OD1 . ASN A 1 147 ? 39.675 29.995 41.733 1.00 29.69 ? 149 ASN A OD1 1 
ATOM   1184 N ND2 . ASN A 1 147 ? 38.389 28.901 40.255 1.00 24.58 ? 149 ASN A ND2 1 
ATOM   1185 N N   . VAL A 1 148 ? 34.453 29.609 42.654 1.00 13.50 ? 150 VAL A N   1 
ATOM   1186 C CA  . VAL A 1 148 ? 33.358 29.797 43.608 1.00 13.22 ? 150 VAL A CA  1 
ATOM   1187 C C   . VAL A 1 148 ? 33.916 29.361 44.959 1.00 12.80 ? 150 VAL A C   1 
ATOM   1188 O O   . VAL A 1 148 ? 34.257 28.194 45.139 1.00 12.91 ? 150 VAL A O   1 
ATOM   1189 C CB  . VAL A 1 148 ? 32.130 28.911 43.281 1.00 13.56 ? 150 VAL A CB  1 
ATOM   1190 C CG1 . VAL A 1 148 ? 31.093 29.023 44.394 1.00 16.77 ? 150 VAL A CG1 1 
ATOM   1191 C CG2 . VAL A 1 148 ? 31.525 29.329 41.953 1.00 16.77 ? 150 VAL A CG2 1 
ATOM   1192 N N   . TYR A 1 149 ? 34.002 30.299 45.900 1.00 12.89 ? 151 TYR A N   1 
ATOM   1193 C CA  . TYR A 1 149 ? 34.541 30.012 47.224 1.00 13.44 ? 151 TYR A CA  1 
ATOM   1194 C C   . TYR A 1 149 ? 33.432 29.658 48.193 1.00 13.41 ? 151 TYR A C   1 
ATOM   1195 O O   . TYR A 1 149 ? 32.581 30.483 48.509 1.00 14.47 ? 151 TYR A O   1 
ATOM   1196 C CB  . TYR A 1 149 ? 35.344 31.215 47.709 1.00 15.92 ? 151 TYR A CB  1 
ATOM   1197 C CG  . TYR A 1 149 ? 36.477 31.536 46.763 1.00 18.07 ? 151 TYR A CG  1 
ATOM   1198 C CD1 . TYR A 1 149 ? 36.322 32.475 45.742 1.00 18.24 ? 151 TYR A CD1 1 
ATOM   1199 C CD2 . TYR A 1 149 ? 37.688 30.848 46.848 1.00 18.84 ? 151 TYR A CD2 1 
ATOM   1200 C CE1 . TYR A 1 149 ? 37.347 32.717 44.825 1.00 19.54 ? 151 TYR A CE1 1 
ATOM   1201 C CE2 . TYR A 1 149 ? 38.714 31.081 45.940 1.00 22.15 ? 151 TYR A CE2 1 
ATOM   1202 C CZ  . TYR A 1 149 ? 38.537 32.015 44.931 1.00 21.15 ? 151 TYR A CZ  1 
ATOM   1203 O OH  . TYR A 1 149 ? 39.547 32.245 44.024 1.00 24.37 ? 151 TYR A OH  1 
ATOM   1204 N N   . ILE A 1 150 ? 33.465 28.418 48.669 1.00 12.80 ? 152 ILE A N   1 
ATOM   1205 C CA  . ILE A 1 150 ? 32.443 27.893 49.562 1.00 12.92 ? 152 ILE A CA  1 
ATOM   1206 C C   . ILE A 1 150 ? 32.822 27.791 51.029 1.00 12.99 ? 152 ILE A C   1 
ATOM   1207 O O   . ILE A 1 150 ? 33.944 27.413 51.368 1.00 14.91 ? 152 ILE A O   1 
ATOM   1208 C CB  . ILE A 1 150 ? 32.007 26.492 49.087 1.00 13.43 ? 152 ILE A CB  1 
ATOM   1209 C CG1 . ILE A 1 150 ? 31.414 26.587 47.681 1.00 15.28 ? 152 ILE A CG1 1 
ATOM   1210 C CG2 . ILE A 1 150 ? 30.995 25.896 50.055 1.00 15.68 ? 152 ILE A CG2 1 
ATOM   1211 C CD1 . ILE A 1 150 ? 31.165 25.249 47.032 1.00 15.93 ? 152 ILE A CD1 1 
ATOM   1212 N N   . THR A 1 151 ? 31.866 28.127 51.886 1.00 12.81 ? 153 THR A N   1 
ATOM   1213 C CA  . THR A 1 151 ? 32.051 28.038 53.330 1.00 14.45 ? 153 THR A CA  1 
ATOM   1214 C C   . THR A 1 151 ? 30.792 27.419 53.937 1.00 14.83 ? 153 THR A C   1 
ATOM   1215 O O   . THR A 1 151 ? 29.697 27.544 53.382 1.00 13.92 ? 153 THR A O   1 
ATOM   1216 C CB  . THR A 1 151 ? 32.274 29.425 53.964 1.00 22.17 ? 153 THR A CB  1 
ATOM   1217 O OG1 . THR A 1 151 ? 33.395 30.063 53.338 1.00 29.30 ? 153 THR A OG1 1 
ATOM   1218 C CG2 . THR A 1 151 ? 32.556 29.289 55.453 1.00 27.89 ? 153 THR A CG2 1 
ATOM   1219 N N   . ALA A 1 152 ? 30.942 26.745 55.073 1.00 14.13 ? 154 ALA A N   1 
ATOM   1220 C CA  . ALA A 1 152 ? 29.795 26.137 55.730 1.00 14.80 ? 154 ALA A CA  1 
ATOM   1221 C C   . ALA A 1 152 ? 28.954 27.202 56.428 1.00 16.46 ? 154 ALA A C   1 
ATOM   1222 O O   . ALA A 1 152 ? 29.475 28.221 56.881 1.00 18.90 ? 154 ALA A O   1 
ATOM   1223 C CB  . ALA A 1 152 ? 30.262 25.103 56.747 1.00 15.86 ? 154 ALA A CB  1 
ATOM   1224 N N   . ASP A 1 153 ? 27.651 26.958 56.493 1.00 16.11 ? 155 ASP A N   1 
ATOM   1225 C CA  . ASP A 1 153 ? 26.712 27.849 57.167 1.00 17.48 ? 155 ASP A CA  1 
ATOM   1226 C C   . ASP A 1 153 ? 25.942 26.937 58.122 1.00 18.53 ? 155 ASP A C   1 
ATOM   1227 O O   . ASP A 1 153 ? 24.790 26.579 57.869 1.00 18.36 ? 155 ASP A O   1 
ATOM   1228 C CB  . ASP A 1 153 ? 25.745 28.481 56.164 1.00 23.43 ? 155 ASP A CB  1 
ATOM   1229 C CG  . ASP A 1 153 ? 24.930 29.604 56.769 1.00 28.08 ? 155 ASP A CG  1 
ATOM   1230 O OD1 . ASP A 1 153 ? 24.667 29.558 57.990 1.00 30.49 ? 155 ASP A OD1 1 
ATOM   1231 O OD2 . ASP A 1 153 ? 24.543 30.526 56.021 1.00 29.96 ? 155 ASP A OD2 1 
ATOM   1232 N N   . LYS A 1 154 ? 26.602 26.554 59.211 1.00 19.68 ? 156 LYS A N   1 
ATOM   1233 C CA  . LYS A 1 154 ? 26.023 25.653 60.203 1.00 21.84 ? 156 LYS A CA  1 
ATOM   1234 C C   . LYS A 1 154 ? 24.641 26.058 60.706 1.00 22.45 ? 156 LYS A C   1 
ATOM   1235 O O   . LYS A 1 154 ? 23.756 25.215 60.848 1.00 23.03 ? 156 LYS A O   1 
ATOM   1236 C CB  . LYS A 1 154 ? 26.980 25.503 61.385 1.00 27.58 ? 156 LYS A CB  1 
ATOM   1237 N N   . GLN A 1 155 ? 24.461 27.345 60.976 1.00 26.35 ? 157 GLN A N   1 
ATOM   1238 C CA  . GLN A 1 155 ? 23.192 27.857 61.483 1.00 28.33 ? 157 GLN A CA  1 
ATOM   1239 C C   . GLN A 1 155 ? 22.008 27.549 60.572 1.00 27.44 ? 157 GLN A C   1 
ATOM   1240 O O   . GLN A 1 155 ? 20.870 27.463 61.035 1.00 28.64 ? 157 GLN A O   1 
ATOM   1241 C CB  . GLN A 1 155 ? 23.296 29.362 61.707 1.00 35.78 ? 157 GLN A CB  1 
ATOM   1242 N N   . LYS A 1 156 ? 22.273 27.385 59.281 1.00 23.19 ? 158 LYS A N   1 
ATOM   1243 C CA  . LYS A 1 156 ? 21.216 27.094 58.318 1.00 21.51 ? 158 LYS A CA  1 
ATOM   1244 C C   . LYS A 1 156 ? 21.341 25.675 57.766 1.00 18.22 ? 158 LYS A C   1 
ATOM   1245 O O   . LYS A 1 156 ? 20.625 25.295 56.836 1.00 18.19 ? 158 LYS A O   1 
ATOM   1246 C CB  . LYS A 1 156 ? 21.264 28.104 57.175 1.00 28.87 ? 158 LYS A CB  1 
ATOM   1247 N N   . ASN A 1 157 ? 22.252 24.896 58.346 1.00 17.44 ? 159 ASN A N   1 
ATOM   1248 C CA  . ASN A 1 157 ? 22.486 23.522 57.914 1.00 15.56 ? 159 ASN A CA  1 
ATOM   1249 C C   . ASN A 1 157 ? 22.806 23.508 56.420 1.00 13.06 ? 159 ASN A C   1 
ATOM   1250 O O   . ASN A 1 157 ? 22.403 22.609 55.683 1.00 14.41 ? 159 ASN A O   1 
ATOM   1251 C CB  . ASN A 1 157 ? 21.248 22.668 58.206 1.00 18.69 ? 159 ASN A CB  1 
ATOM   1252 C CG  . ASN A 1 157 ? 21.524 21.184 58.090 1.00 19.58 ? 159 ASN A CG  1 
ATOM   1253 O OD1 . ASN A 1 157 ? 22.574 20.702 58.518 1.00 19.04 ? 159 ASN A OD1 1 
ATOM   1254 N ND2 . ASN A 1 157 ? 20.576 20.447 57.523 1.00 22.82 ? 159 ASN A ND2 1 
ATOM   1255 N N   . GLY A 1 158 ? 23.554 24.515 55.983 1.00 13.07 ? 160 GLY A N   1 
ATOM   1256 C CA  . GLY A 1 158 ? 23.894 24.612 54.576 1.00 12.63 ? 160 GLY A CA  1 
ATOM   1257 C C   . GLY A 1 158 ? 25.246 25.237 54.314 1.00 13.33 ? 160 GLY A C   1 
ATOM   1258 O O   . GLY A 1 158 ? 26.195 25.048 55.081 1.00 14.99 ? 160 GLY A O   1 
ATOM   1259 N N   . ILE A 1 159 ? 25.333 25.992 53.223 1.00 12.73 ? 161 ILE A N   1 
ATOM   1260 C CA  . ILE A 1 159 ? 26.574 26.631 52.832 1.00 12.54 ? 161 ILE A CA  1 
ATOM   1261 C C   . ILE A 1 159 ? 26.327 28.024 52.297 1.00 11.84 ? 161 ILE A C   1 
ATOM   1262 O O   . ILE A 1 159 ? 25.193 28.416 52.019 1.00 12.47 ? 161 ILE A O   1 
ATOM   1263 C CB  . ILE A 1 159 ? 27.282 25.835 51.712 1.00 12.78 ? 161 ILE A CB  1 
ATOM   1264 C CG1 . ILE A 1 159 ? 26.369 25.733 50.484 1.00 14.46 ? 161 ILE A CG1 1 
ATOM   1265 C CG2 . ILE A 1 159 ? 27.674 24.454 52.224 1.00 14.90 ? 161 ILE A CG2 1 
ATOM   1266 C CD1 . ILE A 1 159 ? 27.009 25.054 49.285 1.00 20.13 ? 161 ILE A CD1 1 
ATOM   1267 N N   . LYS A 1 160 ? 27.410 28.774 52.174 1.00 11.98 ? 162 LYS A N   1 
ATOM   1268 C CA  . LYS A 1 160 ? 27.358 30.107 51.606 1.00 12.14 ? 162 LYS A CA  1 
ATOM   1269 C C   . LYS A 1 160 ? 28.557 30.210 50.680 1.00 12.07 ? 162 LYS A C   1 
ATOM   1270 O O   . LYS A 1 160 ? 29.502 29.422 50.773 1.00 13.38 ? 162 LYS A O   1 
ATOM   1271 C CB  . LYS A 1 160 ? 27.436 31.183 52.694 1.00 17.75 ? 162 LYS A CB  1 
ATOM   1272 C CG  . LYS A 1 160 ? 28.674 31.106 53.562 1.00 24.27 ? 162 LYS A CG  1 
ATOM   1273 C CD  . LYS A 1 160 ? 28.637 32.171 54.649 1.00 26.74 ? 162 LYS A CD  1 
ATOM   1274 C CE  . LYS A 1 160 ? 29.876 32.108 55.525 1.00 30.00 ? 162 LYS A CE  1 
ATOM   1275 N NZ  . LYS A 1 160 ? 29.990 30.793 56.206 1.00 30.69 ? 162 LYS A NZ  1 
ATOM   1276 N N   . ALA A 1 161 ? 28.509 31.161 49.760 1.00 12.53 ? 163 ALA A N   1 
ATOM   1277 C CA  . ALA A 1 161 ? 29.609 31.356 48.841 1.00 14.16 ? 163 ALA A CA  1 
ATOM   1278 C C   . ALA A 1 161 ? 29.580 32.782 48.330 1.00 13.34 ? 163 ALA A C   1 
ATOM   1279 O O   . ALA A 1 161 ? 28.532 33.420 48.284 1.00 12.37 ? 163 ALA A O   1 
ATOM   1280 C CB  . ALA A 1 161 ? 29.511 30.373 47.681 1.00 15.38 ? 163 ALA A CB  1 
ATOM   1281 N N   . ASN A 1 162 ? 30.750 33.288 47.973 1.00 18.47 ? 164 ASN A N   1 
ATOM   1282 C CA  . ASN A 1 162 ? 30.858 34.631 47.427 1.00 19.81 ? 164 ASN A CA  1 
ATOM   1283 C C   . ASN A 1 162 ? 31.976 34.583 46.404 1.00 20.56 ? 164 ASN A C   1 
ATOM   1284 O O   . ASN A 1 162 ? 33.020 33.974 46.641 1.00 22.82 ? 164 ASN A O   1 
ATOM   1285 C CB  . ASN A 1 162 ? 31.190 35.647 48.521 1.00 29.90 ? 164 ASN A CB  1 
ATOM   1286 C CG  . ASN A 1 162 ? 32.500 35.349 49.214 1.00 34.15 ? 164 ASN A CG  1 
ATOM   1287 O OD1 . ASN A 1 162 ? 32.590 34.428 50.027 1.00 36.16 ? 164 ASN A OD1 1 
ATOM   1288 N ND2 . ASN A 1 162 ? 33.530 36.121 48.887 1.00 35.58 ? 164 ASN A ND2 1 
ATOM   1289 N N   . PHE A 1 163 ? 31.747 35.206 45.256 1.00 16.07 ? 165 PHE A N   1 
ATOM   1290 C CA  . PHE A 1 163 ? 32.740 35.218 44.201 1.00 14.83 ? 165 PHE A CA  1 
ATOM   1291 C C   . PHE A 1 163 ? 32.453 36.306 43.187 1.00 12.41 ? 165 PHE A C   1 
ATOM   1292 O O   . PHE A 1 163 ? 31.350 36.839 43.116 1.00 13.55 ? 165 PHE A O   1 
ATOM   1293 C CB  . PHE A 1 163 ? 32.788 33.865 43.485 1.00 15.53 ? 165 PHE A CB  1 
ATOM   1294 C CG  . PHE A 1 163 ? 31.450 33.392 42.979 1.00 14.18 ? 165 PHE A CG  1 
ATOM   1295 C CD1 . PHE A 1 163 ? 30.527 32.819 43.852 1.00 15.86 ? 165 PHE A CD1 1 
ATOM   1296 C CD2 . PHE A 1 163 ? 31.121 33.496 41.630 1.00 14.72 ? 165 PHE A CD2 1 
ATOM   1297 C CE1 . PHE A 1 163 ? 29.298 32.349 43.392 1.00 17.10 ? 165 PHE A CE1 1 
ATOM   1298 C CE2 . PHE A 1 163 ? 29.892 33.029 41.158 1.00 14.22 ? 165 PHE A CE2 1 
ATOM   1299 C CZ  . PHE A 1 163 ? 28.981 32.453 42.045 1.00 15.29 ? 165 PHE A CZ  1 
ATOM   1300 N N   . LYS A 1 164 ? 33.474 36.642 42.413 1.00 12.97 ? 166 LYS A N   1 
ATOM   1301 C CA  . LYS A 1 164 ? 33.350 37.655 41.386 1.00 11.26 ? 166 LYS A CA  1 
ATOM   1302 C C   . LYS A 1 164 ? 33.294 37.047 40.002 1.00 12.06 ? 166 LYS A C   1 
ATOM   1303 O O   . LYS A 1 164 ? 34.017 36.097 39.700 1.00 14.90 ? 166 LYS A O   1 
ATOM   1304 C CB  . LYS A 1 164 ? 34.546 38.604 41.426 1.00 13.77 ? 166 LYS A CB  1 
ATOM   1305 C CG  . LYS A 1 164 ? 34.611 39.456 42.659 1.00 17.19 ? 166 LYS A CG  1 
ATOM   1306 C CD  . LYS A 1 164 ? 35.856 40.315 42.647 1.00 20.33 ? 166 LYS A CD  1 
ATOM   1307 C CE  . LYS A 1 164 ? 35.809 41.346 43.758 1.00 23.90 ? 166 LYS A CE  1 
ATOM   1308 N NZ  . LYS A 1 164 ? 35.588 40.708 45.083 1.00 28.64 ? 166 LYS A NZ  1 
ATOM   1309 N N   . ILE A 1 165 ? 32.420 37.595 39.170 1.00 13.05 ? 167 ILE A N   1 
ATOM   1310 C CA  . ILE A 1 165 ? 32.329 37.176 37.786 1.00 13.34 ? 167 ILE A CA  1 
ATOM   1311 C C   . ILE A 1 165 ? 32.600 38.457 37.009 1.00 13.84 ? 167 ILE A C   1 
ATOM   1312 O O   . ILE A 1 165 ? 32.026 39.506 37.310 1.00 12.29 ? 167 ILE A O   1 
ATOM   1313 C CB  . ILE A 1 165 ? 30.926 36.654 37.403 1.00 15.68 ? 167 ILE A CB  1 
ATOM   1314 C CG1 . ILE A 1 165 ? 30.615 35.347 38.142 1.00 16.86 ? 167 ILE A CG1 1 
ATOM   1315 C CG2 . ILE A 1 165 ? 30.852 36.442 35.894 1.00 16.62 ? 167 ILE A CG2 1 
ATOM   1316 C CD1 . ILE A 1 165 ? 31.521 34.181 37.784 1.00 16.49 ? 167 ILE A CD1 1 
ATOM   1317 N N   . ARG A 1 166 ? 33.499 38.380 36.039 1.00 14.30 ? 168 ARG A N   1 
ATOM   1318 C CA  . ARG A 1 166 ? 33.811 39.538 35.220 1.00 13.68 ? 168 ARG A CA  1 
ATOM   1319 C C   . ARG A 1 166 ? 33.320 39.256 33.810 1.00 14.06 ? 168 ARG A C   1 
ATOM   1320 O O   . ARG A 1 166 ? 33.704 38.254 33.201 1.00 19.00 ? 168 ARG A O   1 
ATOM   1321 C CB  . ARG A 1 166 ? 35.318 39.797 35.207 1.00 17.92 ? 168 ARG A CB  1 
ATOM   1322 C CG  . ARG A 1 166 ? 35.890 40.105 36.580 1.00 20.09 ? 168 ARG A CG  1 
ATOM   1323 C CD  . ARG A 1 166 ? 37.392 40.339 36.518 1.00 25.96 ? 168 ARG A CD  1 
ATOM   1324 N NE  . ARG A 1 166 ? 38.026 40.166 37.823 1.00 31.80 ? 168 ARG A NE  1 
ATOM   1325 C CZ  . ARG A 1 166 ? 37.674 40.826 38.920 1.00 32.92 ? 168 ARG A CZ  1 
ATOM   1326 N NH1 . ARG A 1 166 ? 36.687 41.710 38.873 1.00 35.80 ? 168 ARG A NH1 1 
ATOM   1327 N NH2 . ARG A 1 166 ? 38.306 40.604 40.064 1.00 34.11 ? 168 ARG A NH2 1 
ATOM   1328 N N   . HIS A 1 167 ? 32.455 40.123 33.302 1.00 12.06 ? 169 HIS A N   1 
ATOM   1329 C CA  . HIS A 1 167 ? 31.926 39.962 31.955 1.00 12.18 ? 169 HIS A CA  1 
ATOM   1330 C C   . HIS A 1 167 ? 32.602 40.961 31.026 1.00 12.45 ? 169 HIS A C   1 
ATOM   1331 O O   . HIS A 1 167 ? 32.560 42.159 31.271 1.00 13.98 ? 169 HIS A O   1 
ATOM   1332 C CB  . HIS A 1 167 ? 30.421 40.238 31.920 1.00 11.95 ? 169 HIS A CB  1 
ATOM   1333 C CG  . HIS A 1 167 ? 29.598 39.309 32.757 1.00 11.92 ? 169 HIS A CG  1 
ATOM   1334 N ND1 . HIS A 1 167 ? 29.443 37.974 32.456 1.00 11.81 ? 169 HIS A ND1 1 
ATOM   1335 C CD2 . HIS A 1 167 ? 28.836 39.537 33.853 1.00 11.99 ? 169 HIS A CD2 1 
ATOM   1336 C CE1 . HIS A 1 167 ? 28.615 37.421 33.325 1.00 13.18 ? 169 HIS A CE1 1 
ATOM   1337 N NE2 . HIS A 1 167 ? 28.231 38.349 34.182 1.00 13.22 ? 169 HIS A NE2 1 
ATOM   1338 N N   . ASN A 1 168 ? 33.215 40.478 29.953 1.00 13.15 ? 170 ASN A N   1 
ATOM   1339 C CA  . ASN A 1 168 ? 33.853 41.377 28.997 1.00 13.56 ? 170 ASN A CA  1 
ATOM   1340 C C   . ASN A 1 168 ? 32.792 42.246 28.324 1.00 12.76 ? 170 ASN A C   1 
ATOM   1341 O O   . ASN A 1 168 ? 31.735 41.749 27.914 1.00 13.21 ? 170 ASN A O   1 
ATOM   1342 C CB  . ASN A 1 168 ? 34.579 40.580 27.907 1.00 17.51 ? 170 ASN A CB  1 
ATOM   1343 C CG  . ASN A 1 168 ? 35.873 39.949 28.388 1.00 20.84 ? 170 ASN A CG  1 
ATOM   1344 O OD1 . ASN A 1 168 ? 36.404 39.047 27.742 1.00 24.28 ? 170 ASN A OD1 1 
ATOM   1345 N ND2 . ASN A 1 168 ? 36.394 40.427 29.507 1.00 21.09 ? 170 ASN A ND2 1 
ATOM   1346 N N   . ILE A 1 169 ? 33.086 43.537 28.212 1.00 13.56 ? 171 ILE A N   1 
ATOM   1347 C CA  . ILE A 1 169 ? 32.196 44.483 27.553 1.00 13.78 ? 171 ILE A CA  1 
ATOM   1348 C C   . ILE A 1 169 ? 32.736 44.636 26.129 1.00 13.20 ? 171 ILE A C   1 
ATOM   1349 O O   . ILE A 1 169 ? 33.933 44.476 25.898 1.00 13.22 ? 171 ILE A O   1 
ATOM   1350 C CB  . ILE A 1 169 ? 32.210 45.854 28.272 1.00 11.88 ? 171 ILE A CB  1 
ATOM   1351 C CG1 . ILE A 1 169 ? 31.790 45.677 29.736 1.00 13.26 ? 171 ILE A CG1 1 
ATOM   1352 C CG2 . ILE A 1 169 ? 31.279 46.832 27.564 1.00 13.62 ? 171 ILE A CG2 1 
ATOM   1353 C CD1 . ILE A 1 169 ? 32.019 46.903 30.603 1.00 11.81 ? 171 ILE A CD1 1 
ATOM   1354 N N   . GLU A 1 170 ? 31.849 44.941 25.188 1.00 13.44 ? 172 GLU A N   1 
ATOM   1355 C CA  . GLU A 1 170 ? 32.197 45.097 23.773 1.00 16.03 ? 172 GLU A CA  1 
ATOM   1356 C C   . GLU A 1 170 ? 33.316 46.091 23.470 1.00 17.29 ? 172 GLU A C   1 
ATOM   1357 O O   . GLU A 1 170 ? 33.907 46.054 22.386 1.00 16.87 ? 172 GLU A O   1 
ATOM   1358 C CB  . GLU A 1 170 ? 30.947 45.502 22.987 1.00 28.05 ? 172 GLU A CB  1 
ATOM   1359 C CG  . GLU A 1 170 ? 30.236 46.713 23.574 1.00 30.05 ? 172 GLU A CG  1 
ATOM   1360 C CD  . GLU A 1 170 ? 28.973 47.082 22.821 1.00 31.14 ? 172 GLU A CD  1 
ATOM   1361 O OE1 . GLU A 1 170 ? 28.167 46.174 22.528 1.00 32.07 ? 172 GLU A OE1 1 
ATOM   1362 O OE2 . GLU A 1 170 ? 28.784 48.282 22.534 1.00 31.73 ? 172 GLU A OE2 1 
ATOM   1363 N N   . ASP A 1 171 ? 33.603 46.985 24.408 1.00 15.74 ? 173 ASP A N   1 
ATOM   1364 C CA  . ASP A 1 171 ? 34.654 47.974 24.201 1.00 17.13 ? 173 ASP A CA  1 
ATOM   1365 C C   . ASP A 1 171 ? 35.991 47.560 24.794 1.00 15.27 ? 173 ASP A C   1 
ATOM   1366 O O   . ASP A 1 171 ? 36.942 48.345 24.797 1.00 17.73 ? 173 ASP A O   1 
ATOM   1367 C CB  . ASP A 1 171 ? 34.243 49.332 24.777 1.00 16.25 ? 173 ASP A CB  1 
ATOM   1368 C CG  . ASP A 1 171 ? 34.029 49.301 26.282 1.00 15.05 ? 173 ASP A CG  1 
ATOM   1369 O OD1 . ASP A 1 171 ? 34.210 48.239 26.908 1.00 14.47 ? 173 ASP A OD1 1 
ATOM   1370 O OD2 . ASP A 1 171 ? 33.675 50.359 26.842 1.00 17.15 ? 173 ASP A OD2 1 
ATOM   1371 N N   . GLY A 1 172 ? 36.070 46.334 25.294 1.00 15.45 ? 174 GLY A N   1 
ATOM   1372 C CA  . GLY A 1 172 ? 37.314 45.864 25.870 1.00 14.70 ? 174 GLY A CA  1 
ATOM   1373 C C   . GLY A 1 172 ? 37.376 45.977 27.381 1.00 13.02 ? 174 GLY A C   1 
ATOM   1374 O O   . GLY A 1 172 ? 38.294 45.450 28.004 1.00 14.08 ? 174 GLY A O   1 
ATOM   1375 N N   . SER A 1 173 ? 36.405 46.665 27.975 1.00 12.57 ? 175 SER A N   1 
ATOM   1376 C CA  . SER A 1 173 ? 36.371 46.835 29.418 1.00 13.19 ? 175 SER A CA  1 
ATOM   1377 C C   . SER A 1 173 ? 35.687 45.640 30.082 1.00 11.88 ? 175 SER A C   1 
ATOM   1378 O O   . SER A 1 173 ? 35.422 44.627 29.428 1.00 12.11 ? 175 SER A O   1 
ATOM   1379 C CB  . SER A 1 173 ? 35.640 48.132 29.765 1.00 13.41 ? 175 SER A CB  1 
ATOM   1380 O OG  . SER A 1 173 ? 35.747 48.427 31.149 1.00 13.47 ? 175 SER A OG  1 
ATOM   1381 N N   . VAL A 1 174 ? 35.414 45.749 31.379 1.00 13.02 ? 176 VAL A N   1 
ATOM   1382 C CA  . VAL A 1 174 ? 34.772 44.656 32.089 1.00 14.72 ? 176 VAL A CA  1 
ATOM   1383 C C   . VAL A 1 174 ? 33.641 45.112 32.996 1.00 12.30 ? 176 VAL A C   1 
ATOM   1384 O O   . VAL A 1 174 ? 33.712 46.173 33.632 1.00 12.54 ? 176 VAL A O   1 
ATOM   1385 C CB  . VAL A 1 174 ? 35.801 43.859 32.924 1.00 24.17 ? 176 VAL A CB  1 
ATOM   1386 C CG1 . VAL A 1 174 ? 36.496 44.774 33.907 1.00 29.08 ? 176 VAL A CG1 1 
ATOM   1387 C CG2 . VAL A 1 174 ? 35.115 42.719 33.651 1.00 27.81 ? 176 VAL A CG2 1 
ATOM   1388 N N   . GLN A 1 175 ? 32.593 44.293 33.016 1.00 11.25 ? 177 GLN A N   1 
ATOM   1389 C CA  . GLN A 1 175 ? 31.419 44.507 33.842 1.00 11.10 ? 177 GLN A CA  1 
ATOM   1390 C C   . GLN A 1 175 ? 31.500 43.487 34.967 1.00 11.08 ? 177 GLN A C   1 
ATOM   1391 O O   . GLN A 1 175 ? 31.356 42.287 34.749 1.00 11.86 ? 177 GLN A O   1 
ATOM   1392 C CB  . GLN A 1 175 ? 30.134 44.274 33.043 1.00 12.18 ? 177 GLN A CB  1 
ATOM   1393 C CG  . GLN A 1 175 ? 28.867 44.299 33.906 1.00 12.70 ? 177 GLN A CG  1 
ATOM   1394 C CD  . GLN A 1 175 ? 28.632 45.647 34.551 1.00 12.00 ? 177 GLN A CD  1 
ATOM   1395 O OE1 . GLN A 1 175 ? 28.355 46.629 33.868 1.00 13.38 ? 177 GLN A OE1 1 
ATOM   1396 N NE2 . GLN A 1 175 ? 28.746 45.704 35.876 1.00 11.47 ? 177 GLN A NE2 1 
ATOM   1397 N N   . LEU A 1 176 ? 31.760 43.970 36.173 1.00 11.09 ? 178 LEU A N   1 
ATOM   1398 C CA  . LEU A 1 176 ? 31.851 43.093 37.324 1.00 10.61 ? 178 LEU A CA  1 
ATOM   1399 C C   . LEU A 1 176 ? 30.469 42.724 37.843 1.00 10.01 ? 178 LEU A C   1 
ATOM   1400 O O   . LEU A 1 176 ? 29.563 43.556 37.867 1.00 10.20 ? 178 LEU A O   1 
ATOM   1401 C CB  . LEU A 1 176 ? 32.648 43.780 38.433 1.00 11.80 ? 178 LEU A CB  1 
ATOM   1402 C CG  . LEU A 1 176 ? 32.742 43.073 39.782 1.00 12.06 ? 178 LEU A CG  1 
ATOM   1403 C CD1 . LEU A 1 176 ? 33.525 41.782 39.645 1.00 15.36 ? 178 LEU A CD1 1 
ATOM   1404 C CD2 . LEU A 1 176 ? 33.431 43.998 40.772 1.00 15.32 ? 178 LEU A CD2 1 
ATOM   1405 N N   . ALA A 1 177 ? 30.329 41.463 38.247 1.00 10.42 ? 179 ALA A N   1 
ATOM   1406 C CA  . ALA A 1 177 ? 29.094 40.923 38.822 1.00 10.61 ? 179 ALA A CA  1 
ATOM   1407 C C   . ALA A 1 177 ? 29.504 40.205 40.110 1.00 10.11 ? 179 ALA A C   1 
ATOM   1408 O O   . ALA A 1 177 ? 30.018 39.090 40.073 1.00 11.34 ? 179 ALA A O   1 
ATOM   1409 C CB  . ALA A 1 177 ? 28.433 39.940 37.855 1.00 12.68 ? 179 ALA A CB  1 
ATOM   1410 N N   . ASP A 1 178 ? 29.311 40.871 41.245 1.00 10.61 ? 180 ASP A N   1 
ATOM   1411 C CA  . ASP A 1 178 ? 29.666 40.311 42.548 1.00 10.86 ? 180 ASP A CA  1 
ATOM   1412 C C   . ASP A 1 178 ? 28.550 39.392 43.015 1.00 11.09 ? 180 ASP A C   1 
ATOM   1413 O O   . ASP A 1 178 ? 27.419 39.831 43.222 1.00 11.07 ? 180 ASP A O   1 
ATOM   1414 C CB  . ASP A 1 178 ? 29.879 41.426 43.574 1.00 12.92 ? 180 ASP A CB  1 
ATOM   1415 C CG  . ASP A 1 178 ? 31.207 42.145 43.395 1.00 16.34 ? 180 ASP A CG  1 
ATOM   1416 O OD1 . ASP A 1 178 ? 32.260 41.474 43.459 1.00 18.75 ? 180 ASP A OD1 1 
ATOM   1417 O OD2 . ASP A 1 178 ? 31.198 43.379 43.200 1.00 17.49 ? 180 ASP A OD2 1 
ATOM   1418 N N   . HIS A 1 179 ? 28.885 38.119 43.182 1.00 10.16 ? 181 HIS A N   1 
ATOM   1419 C CA  . HIS A 1 179 ? 27.928 37.097 43.586 1.00 10.94 ? 181 HIS A CA  1 
ATOM   1420 C C   . HIS A 1 179 ? 27.964 36.739 45.065 1.00 11.20 ? 181 HIS A C   1 
ATOM   1421 O O   . HIS A 1 179 ? 29.036 36.510 45.624 1.00 11.39 ? 181 HIS A O   1 
ATOM   1422 C CB  . HIS A 1 179 ? 28.186 35.798 42.821 1.00 10.56 ? 181 HIS A CB  1 
ATOM   1423 C CG  . HIS A 1 179 ? 27.758 35.817 41.385 1.00 10.20 ? 181 HIS A CG  1 
ATOM   1424 N ND1 . HIS A 1 179 ? 28.234 36.724 40.461 1.00 10.95 ? 181 HIS A ND1 1 
ATOM   1425 C CD2 . HIS A 1 179 ? 26.916 34.998 40.707 1.00 10.23 ? 181 HIS A CD2 1 
ATOM   1426 C CE1 . HIS A 1 179 ? 27.703 36.460 39.278 1.00 12.02 ? 181 HIS A CE1 1 
ATOM   1427 N NE2 . HIS A 1 179 ? 26.901 35.418 39.400 1.00 10.58 ? 181 HIS A NE2 1 
ATOM   1428 N N   . TYR A 1 180 ? 26.781 36.653 45.664 1.00 9.57  ? 182 TYR A N   1 
ATOM   1429 C CA  . TYR A 1 180 ? 26.618 36.258 47.064 1.00 9.61  ? 182 TYR A CA  1 
ATOM   1430 C C   . TYR A 1 180 ? 25.605 35.132 46.998 1.00 10.68 ? 182 TYR A C   1 
ATOM   1431 O O   . TYR A 1 180 ? 24.522 35.286 46.433 1.00 11.61 ? 182 TYR A O   1 
ATOM   1432 C CB  . TYR A 1 180 ? 26.114 37.428 47.902 1.00 11.73 ? 182 TYR A CB  1 
ATOM   1433 C CG  . TYR A 1 180 ? 27.154 38.508 47.981 1.00 12.75 ? 182 TYR A CG  1 
ATOM   1434 C CD1 . TYR A 1 180 ? 28.152 38.472 48.952 1.00 15.85 ? 182 TYR A CD1 1 
ATOM   1435 C CD2 . TYR A 1 180 ? 27.210 39.504 47.012 1.00 13.86 ? 182 TYR A CD2 1 
ATOM   1436 C CE1 . TYR A 1 180 ? 29.185 39.400 48.951 1.00 17.79 ? 182 TYR A CE1 1 
ATOM   1437 C CE2 . TYR A 1 180 ? 28.240 40.433 46.999 1.00 17.38 ? 182 TYR A CE2 1 
ATOM   1438 C CZ  . TYR A 1 180 ? 29.223 40.374 47.969 1.00 17.69 ? 182 TYR A CZ  1 
ATOM   1439 O OH  . TYR A 1 180 ? 30.255 41.282 47.943 1.00 22.06 ? 182 TYR A OH  1 
ATOM   1440 N N   . GLN A 1 181 ? 25.956 34.005 47.602 1.00 10.76 ? 183 GLN A N   1 
ATOM   1441 C CA  . GLN A 1 181 ? 25.141 32.806 47.515 1.00 11.02 ? 183 GLN A CA  1 
ATOM   1442 C C   . GLN A 1 181 ? 24.897 32.110 48.846 1.00 10.56 ? 183 GLN A C   1 
ATOM   1443 O O   . GLN A 1 181 ? 25.748 32.136 49.732 1.00 11.77 ? 183 GLN A O   1 
ATOM   1444 C CB  . GLN A 1 181 ? 25.869 31.842 46.564 1.00 10.21 ? 183 GLN A CB  1 
ATOM   1445 C CG  . GLN A 1 181 ? 25.182 30.521 46.277 1.00 11.02 ? 183 GLN A CG  1 
ATOM   1446 C CD  . GLN A 1 181 ? 26.016 29.636 45.373 1.00 11.25 ? 183 GLN A CD  1 
ATOM   1447 O OE1 . GLN A 1 181 ? 26.796 30.125 44.546 1.00 11.34 ? 183 GLN A OE1 1 
ATOM   1448 N NE2 . GLN A 1 181 ? 25.841 28.328 45.505 1.00 13.06 ? 183 GLN A NE2 1 
ATOM   1449 N N   . GLN A 1 182 ? 23.736 31.482 48.971 1.00 9.95  ? 184 GLN A N   1 
ATOM   1450 C CA  . GLN A 1 182 ? 23.392 30.711 50.156 1.00 11.47 ? 184 GLN A CA  1 
ATOM   1451 C C   . GLN A 1 182 ? 22.588 29.502 49.696 1.00 12.87 ? 184 GLN A C   1 
ATOM   1452 O O   . GLN A 1 182 ? 21.692 29.626 48.849 1.00 14.42 ? 184 GLN A O   1 
ATOM   1453 C CB  . GLN A 1 182 ? 22.560 31.547 51.130 1.00 17.71 ? 184 GLN A CB  1 
ATOM   1454 C CG  . GLN A 1 182 ? 23.334 32.636 51.842 1.00 26.79 ? 184 GLN A CG  1 
ATOM   1455 C CD  . GLN A 1 182 ? 22.420 33.661 52.485 1.00 28.20 ? 184 GLN A CD  1 
ATOM   1456 O OE1 . GLN A 1 182 ? 21.437 33.310 53.136 1.00 28.68 ? 184 GLN A OE1 1 
ATOM   1457 N NE2 . GLN A 1 182 ? 22.744 34.935 52.309 1.00 28.38 ? 184 GLN A NE2 1 
ATOM   1458 N N   . ASN A 1 183 ? 22.921 28.330 50.229 1.00 10.92 ? 185 ASN A N   1 
ATOM   1459 C CA  . ASN A 1 183 ? 22.199 27.111 49.886 1.00 11.11 ? 185 ASN A CA  1 
ATOM   1460 C C   . ASN A 1 183 ? 21.755 26.428 51.165 1.00 11.14 ? 185 ASN A C   1 
ATOM   1461 O O   . ASN A 1 183 ? 22.519 26.347 52.136 1.00 12.70 ? 185 ASN A O   1 
ATOM   1462 C CB  . ASN A 1 183 ? 23.081 26.127 49.113 1.00 11.90 ? 185 ASN A CB  1 
ATOM   1463 C CG  . ASN A 1 183 ? 23.430 26.612 47.727 1.00 11.46 ? 185 ASN A CG  1 
ATOM   1464 O OD1 . ASN A 1 183 ? 23.943 27.713 47.560 1.00 16.47 ? 185 ASN A OD1 1 
ATOM   1465 N ND2 . ASN A 1 183 ? 23.165 25.788 46.722 1.00 12.75 ? 185 ASN A ND2 1 
ATOM   1466 N N   . THR A 1 184 ? 20.529 25.925 51.167 1.00 11.10 ? 186 THR A N   1 
ATOM   1467 C CA  . THR A 1 184 ? 20.000 25.237 52.335 1.00 12.44 ? 186 THR A CA  1 
ATOM   1468 C C   . THR A 1 184 ? 19.256 24.003 51.860 1.00 12.40 ? 186 THR A C   1 
ATOM   1469 O O   . THR A 1 184 ? 18.627 24.014 50.805 1.00 12.40 ? 186 THR A O   1 
ATOM   1470 C CB  . THR A 1 184 ? 19.048 26.145 53.126 1.00 15.73 ? 186 THR A CB  1 
ATOM   1471 O OG1 . THR A 1 184 ? 18.081 26.721 52.238 1.00 18.09 ? 186 THR A OG1 1 
ATOM   1472 C CG2 . THR A 1 184 ? 19.830 27.248 53.818 1.00 18.59 ? 186 THR A CG2 1 
ATOM   1473 N N   . PRO A 1 185 ? 19.325 22.910 52.625 1.00 11.48 ? 187 PRO A N   1 
ATOM   1474 C CA  . PRO A 1 185 ? 18.630 21.690 52.214 1.00 12.29 ? 187 PRO A CA  1 
ATOM   1475 C C   . PRO A 1 185 ? 17.119 21.808 52.308 1.00 11.96 ? 187 PRO A C   1 
ATOM   1476 O O   . PRO A 1 185 ? 16.595 22.518 53.167 1.00 12.87 ? 187 PRO A O   1 
ATOM   1477 C CB  . PRO A 1 185 ? 19.189 20.642 53.170 1.00 13.35 ? 187 PRO A CB  1 
ATOM   1478 C CG  . PRO A 1 185 ? 19.429 21.429 54.418 1.00 16.33 ? 187 PRO A CG  1 
ATOM   1479 C CD  . PRO A 1 185 ? 20.025 22.721 53.908 1.00 12.86 ? 187 PRO A CD  1 
ATOM   1480 N N   . ILE A 1 186 ? 16.423 21.114 51.415 1.00 10.64 ? 188 ILE A N   1 
ATOM   1481 C CA  . ILE A 1 186 ? 14.968 21.104 51.424 1.00 12.79 ? 188 ILE A CA  1 
ATOM   1482 C C   . ILE A 1 186 ? 14.504 20.000 52.379 1.00 13.48 ? 188 ILE A C   1 
ATOM   1483 O O   . ILE A 1 186 ? 13.520 20.170 53.101 1.00 16.75 ? 188 ILE A O   1 
ATOM   1484 C CB  . ILE A 1 186 ? 14.395 20.855 50.007 1.00 11.67 ? 188 ILE A CB  1 
ATOM   1485 C CG1 . ILE A 1 186 ? 14.667 22.069 49.112 1.00 11.81 ? 188 ILE A CG1 1 
ATOM   1486 C CG2 . ILE A 1 186 ? 12.894 20.594 50.087 1.00 16.18 ? 188 ILE A CG2 1 
ATOM   1487 C CD1 . ILE A 1 186 ? 14.342 21.865 47.652 1.00 13.33 ? 188 ILE A CD1 1 
ATOM   1488 N N   . GLY A 1 187 ? 15.228 18.884 52.396 1.00 13.49 ? 189 GLY A N   1 
ATOM   1489 C CA  . GLY A 1 187 ? 14.878 17.778 53.276 1.00 16.12 ? 189 GLY A CA  1 
ATOM   1490 C C   . GLY A 1 187 ? 15.390 17.960 54.696 1.00 15.40 ? 189 GLY A C   1 
ATOM   1491 O O   . GLY A 1 187 ? 16.125 18.901 54.985 1.00 16.70 ? 189 GLY A O   1 
ATOM   1492 N N   . ASP A 1 188 ? 15.010 17.050 55.589 1.00 17.96 ? 190 ASP A N   1 
ATOM   1493 C CA  . ASP A 1 188 ? 15.429 17.145 56.984 1.00 18.90 ? 190 ASP A CA  1 
ATOM   1494 C C   . ASP A 1 188 ? 16.557 16.176 57.340 1.00 20.06 ? 190 ASP A C   1 
ATOM   1495 O O   . ASP A 1 188 ? 17.012 16.146 58.486 1.00 21.01 ? 190 ASP A O   1 
ATOM   1496 C CB  . ASP A 1 188 ? 14.230 16.896 57.906 1.00 21.81 ? 190 ASP A CB  1 
ATOM   1497 C CG  . ASP A 1 188 ? 14.465 17.391 59.325 1.00 23.99 ? 190 ASP A CG  1 
ATOM   1498 O OD1 . ASP A 1 188 ? 14.098 16.667 60.276 1.00 27.41 ? 190 ASP A OD1 1 
ATOM   1499 O OD2 . ASP A 1 188 ? 15.004 18.508 59.491 1.00 25.09 ? 190 ASP A OD2 1 
ATOM   1500 N N   . GLY A 1 189 ? 17.006 15.393 56.362 1.00 18.73 ? 191 GLY A N   1 
ATOM   1501 C CA  . GLY A 1 189 ? 18.074 14.436 56.603 1.00 18.99 ? 191 GLY A CA  1 
ATOM   1502 C C   . GLY A 1 189 ? 19.440 15.082 56.726 1.00 17.93 ? 191 GLY A C   1 
ATOM   1503 O O   . GLY A 1 189 ? 19.613 16.243 56.354 1.00 18.14 ? 191 GLY A O   1 
ATOM   1504 N N   . PRO A 1 190 ? 20.441 14.356 57.246 1.00 15.91 ? 192 PRO A N   1 
ATOM   1505 C CA  . PRO A 1 190 ? 21.773 14.944 57.380 1.00 13.99 ? 192 PRO A CA  1 
ATOM   1506 C C   . PRO A 1 190 ? 22.410 15.261 56.037 1.00 12.29 ? 192 PRO A C   1 
ATOM   1507 O O   . PRO A 1 190 ? 22.208 14.549 55.048 1.00 12.99 ? 192 PRO A O   1 
ATOM   1508 C CB  . PRO A 1 190 ? 22.546 13.877 58.155 1.00 16.69 ? 192 PRO A CB  1 
ATOM   1509 C CG  . PRO A 1 190 ? 21.896 12.615 57.725 1.00 18.59 ? 192 PRO A CG  1 
ATOM   1510 C CD  . PRO A 1 190 ? 20.428 12.965 57.730 1.00 16.76 ? 192 PRO A CD  1 
ATOM   1511 N N   . VAL A 1 191 ? 23.174 16.344 56.013 1.00 12.37 ? 193 VAL A N   1 
ATOM   1512 C CA  . VAL A 1 191 ? 23.878 16.751 54.807 1.00 13.11 ? 193 VAL A CA  1 
ATOM   1513 C C   . VAL A 1 191 ? 25.339 16.927 55.176 1.00 13.46 ? 193 VAL A C   1 
ATOM   1514 O O   . VAL A 1 191 ? 25.695 16.923 56.361 1.00 14.78 ? 193 VAL A O   1 
ATOM   1515 C CB  . VAL A 1 191 ? 23.333 18.078 54.231 1.00 13.97 ? 193 VAL A CB  1 
ATOM   1516 C CG1 . VAL A 1 191 ? 21.908 17.879 53.724 1.00 16.60 ? 193 VAL A CG1 1 
ATOM   1517 C CG2 . VAL A 1 191 ? 23.384 19.167 55.289 1.00 16.63 ? 193 VAL A CG2 1 
ATOM   1518 N N   . LEU A 1 192 ? 26.188 17.067 54.167 1.00 13.25 ? 194 LEU A N   1 
ATOM   1519 C CA  . LEU A 1 192 ? 27.608 17.245 54.398 1.00 14.43 ? 194 LEU A CA  1 
ATOM   1520 C C   . LEU A 1 192 ? 27.954 18.727 54.420 1.00 13.62 ? 194 LEU A C   1 
ATOM   1521 O O   . LEU A 1 192 ? 27.847 19.415 53.396 1.00 16.36 ? 194 LEU A O   1 
ATOM   1522 C CB  . LEU A 1 192 ? 28.403 16.529 53.305 1.00 13.13 ? 194 LEU A CB  1 
ATOM   1523 C CG  . LEU A 1 192 ? 28.171 15.016 53.239 1.00 13.26 ? 194 LEU A CG  1 
ATOM   1524 C CD1 . LEU A 1 192 ? 28.913 14.438 52.050 1.00 13.85 ? 194 LEU A CD1 1 
ATOM   1525 C CD2 . LEU A 1 192 ? 28.639 14.357 54.534 1.00 15.49 ? 194 LEU A CD2 1 
ATOM   1526 N N   . LEU A 1 193 ? 28.337 19.227 55.594 1.00 14.03 ? 195 LEU A N   1 
ATOM   1527 C CA  . LEU A 1 193 ? 28.727 20.625 55.753 1.00 14.88 ? 195 LEU A CA  1 
ATOM   1528 C C   . LEU A 1 193 ? 30.231 20.601 55.534 1.00 15.89 ? 195 LEU A C   1 
ATOM   1529 O O   . LEU A 1 193 ? 30.973 19.956 56.274 1.00 16.50 ? 195 LEU A O   1 
ATOM   1530 C CB  . LEU A 1 193 ? 28.360 21.129 57.148 1.00 16.23 ? 195 LEU A CB  1 
ATOM   1531 C CG  . LEU A 1 193 ? 26.856 21.033 57.436 1.00 18.72 ? 195 LEU A CG  1 
ATOM   1532 C CD1 . LEU A 1 193 ? 26.568 21.582 58.826 1.00 21.46 ? 195 LEU A CD1 1 
ATOM   1533 C CD2 . LEU A 1 193 ? 26.066 21.801 56.379 1.00 19.88 ? 195 LEU A CD2 1 
ATOM   1534 N N   . PRO A 1 194 ? 30.703 21.322 54.515 1.00 16.12 ? 196 PRO A N   1 
ATOM   1535 C CA  . PRO A 1 194 ? 32.112 21.391 54.136 1.00 14.03 ? 196 PRO A CA  1 
ATOM   1536 C C   . PRO A 1 194 ? 33.072 22.333 54.827 1.00 14.92 ? 196 PRO A C   1 
ATOM   1537 O O   . PRO A 1 194 ? 32.684 23.356 55.381 1.00 15.17 ? 196 PRO A O   1 
ATOM   1538 C CB  . PRO A 1 194 ? 32.022 21.761 52.670 1.00 15.79 ? 196 PRO A CB  1 
ATOM   1539 C CG  . PRO A 1 194 ? 30.949 22.838 52.732 1.00 15.31 ? 196 PRO A CG  1 
ATOM   1540 C CD  . PRO A 1 194 ? 29.896 22.209 53.651 1.00 15.14 ? 196 PRO A CD  1 
ATOM   1541 N N   . ASP A 1 195 ? 34.347 21.963 54.771 1.00 13.88 ? 197 ASP A N   1 
ATOM   1542 C CA  . ASP A 1 195 ? 35.399 22.836 55.248 1.00 15.40 ? 197 ASP A CA  1 
ATOM   1543 C C   . ASP A 1 195 ? 35.530 23.773 54.045 1.00 15.22 ? 197 ASP A C   1 
ATOM   1544 O O   . ASP A 1 195 ? 35.029 23.466 52.952 1.00 15.18 ? 197 ASP A O   1 
ATOM   1545 C CB  . ASP A 1 195 ? 36.718 22.085 55.435 1.00 20.46 ? 197 ASP A CB  1 
ATOM   1546 C CG  . ASP A 1 195 ? 36.749 21.261 56.698 1.00 22.39 ? 197 ASP A CG  1 
ATOM   1547 O OD1 . ASP A 1 195 ? 36.041 21.620 57.662 1.00 26.22 ? 197 ASP A OD1 1 
ATOM   1548 O OD2 . ASP A 1 195 ? 37.499 20.264 56.731 1.00 26.79 ? 197 ASP A OD2 1 
ATOM   1549 N N   . ASN A 1 196 ? 36.199 24.901 54.226 1.00 15.15 ? 198 ASN A N   1 
ATOM   1550 C CA  . ASN A 1 196 ? 36.366 25.845 53.128 1.00 15.33 ? 198 ASN A CA  1 
ATOM   1551 C C   . ASN A 1 196 ? 37.054 25.209 51.923 1.00 15.04 ? 198 ASN A C   1 
ATOM   1552 O O   . ASN A 1 196 ? 38.023 24.473 52.067 1.00 15.17 ? 198 ASN A O   1 
ATOM   1553 C CB  . ASN A 1 196 ? 37.195 27.049 53.576 1.00 17.47 ? 198 ASN A CB  1 
ATOM   1554 C CG  . ASN A 1 196 ? 36.526 27.847 54.669 1.00 16.78 ? 198 ASN A CG  1 
ATOM   1555 O OD1 . ASN A 1 196 ? 35.399 27.565 55.062 1.00 16.87 ? 198 ASN A OD1 1 
ATOM   1556 N ND2 . ASN A 1 196 ? 37.224 28.862 55.165 1.00 22.80 ? 198 ASN A ND2 1 
ATOM   1557 N N   . HIS A 1 197 ? 36.540 25.491 50.731 1.00 13.13 ? 199 HIS A N   1 
ATOM   1558 C CA  . HIS A 1 197 ? 37.125 24.991 49.496 1.00 13.17 ? 199 HIS A CA  1 
ATOM   1559 C C   . HIS A 1 197 ? 36.510 25.784 48.359 1.00 12.77 ? 199 HIS A C   1 
ATOM   1560 O O   . HIS A 1 197 ? 35.736 26.715 48.592 1.00 13.13 ? 199 HIS A O   1 
ATOM   1561 C CB  . HIS A 1 197 ? 36.857 23.486 49.305 1.00 14.73 ? 199 HIS A CB  1 
ATOM   1562 C CG  . HIS A 1 197 ? 35.419 23.133 49.066 1.00 12.44 ? 199 HIS A CG  1 
ATOM   1563 N ND1 . HIS A 1 197 ? 34.468 23.144 50.064 1.00 14.09 ? 199 HIS A ND1 1 
ATOM   1564 C CD2 . HIS A 1 197 ? 34.775 22.738 47.941 1.00 12.21 ? 199 HIS A CD2 1 
ATOM   1565 C CE1 . HIS A 1 197 ? 33.302 22.771 49.565 1.00 12.34 ? 199 HIS A CE1 1 
ATOM   1566 N NE2 . HIS A 1 197 ? 33.461 22.521 48.277 1.00 11.83 ? 199 HIS A NE2 1 
ATOM   1567 N N   . TYR A 1 198 ? 36.865 25.448 47.128 1.00 13.23 ? 200 TYR A N   1 
ATOM   1568 C CA  . TYR A 1 198 ? 36.287 26.160 46.002 1.00 14.01 ? 200 TYR A CA  1 
ATOM   1569 C C   . TYR A 1 198 ? 35.992 25.243 44.833 1.00 12.75 ? 200 TYR A C   1 
ATOM   1570 O O   . TYR A 1 198 ? 36.478 24.112 44.771 1.00 13.14 ? 200 TYR A O   1 
ATOM   1571 C CB  . TYR A 1 198 ? 37.202 27.317 45.559 1.00 14.92 ? 200 TYR A CB  1 
ATOM   1572 C CG  . TYR A 1 198 ? 38.521 26.910 44.939 1.00 16.99 ? 200 TYR A CG  1 
ATOM   1573 C CD1 . TYR A 1 198 ? 38.654 26.771 43.557 1.00 18.31 ? 200 TYR A CD1 1 
ATOM   1574 C CD2 . TYR A 1 198 ? 39.644 26.685 45.734 1.00 19.64 ? 200 TYR A CD2 1 
ATOM   1575 C CE1 . TYR A 1 198 ? 39.876 26.420 42.981 1.00 23.44 ? 200 TYR A CE1 1 
ATOM   1576 C CE2 . TYR A 1 198 ? 40.869 26.332 45.170 1.00 21.88 ? 200 TYR A CE2 1 
ATOM   1577 C CZ  . TYR A 1 198 ? 40.977 26.202 43.795 1.00 22.03 ? 200 TYR A CZ  1 
ATOM   1578 O OH  . TYR A 1 198 ? 42.187 25.855 43.236 1.00 24.80 ? 200 TYR A OH  1 
ATOM   1579 N N   . LEU A 1 199 ? 35.147 25.739 43.935 1.00 12.88 ? 201 LEU A N   1 
ATOM   1580 C CA  . LEU A 1 199 ? 34.780 25.028 42.720 1.00 12.57 ? 201 LEU A CA  1 
ATOM   1581 C C   . LEU A 1 199 ? 35.376 25.813 41.568 1.00 13.62 ? 201 LEU A C   1 
ATOM   1582 O O   . LEU A 1 199 ? 35.204 27.030 41.477 1.00 14.96 ? 201 LEU A O   1 
ATOM   1583 C CB  . LEU A 1 199 ? 33.263 24.965 42.552 1.00 11.95 ? 201 LEU A CB  1 
ATOM   1584 C CG  . LEU A 1 199 ? 32.453 24.304 43.663 1.00 12.13 ? 201 LEU A CG  1 
ATOM   1585 C CD1 . LEU A 1 199 ? 30.992 24.293 43.258 1.00 15.85 ? 201 LEU A CD1 1 
ATOM   1586 C CD2 . LEU A 1 199 ? 32.941 22.882 43.913 1.00 14.04 ? 201 LEU A CD2 1 
ATOM   1587 N N   . SER A 1 200 ? 36.097 25.115 40.706 1.00 13.47 ? 202 SER A N   1 
ATOM   1588 C CA  . SER A 1 200 ? 36.701 25.740 39.545 1.00 14.07 ? 202 SER A CA  1 
ATOM   1589 C C   . SER A 1 200 ? 35.863 25.317 38.350 1.00 14.02 ? 202 SER A C   1 
ATOM   1590 O O   . SER A 1 200 ? 35.767 24.128 38.055 1.00 12.97 ? 202 SER A O   1 
ATOM   1591 C CB  . SER A 1 200 ? 38.136 25.253 39.380 1.00 15.93 ? 202 SER A CB  1 
ATOM   1592 O OG  . SER A 1 200 ? 38.703 25.769 38.186 1.00 17.65 ? 202 SER A OG  1 
ATOM   1593 N N   . THR A 1 201 ? 35.248 26.284 37.669 1.00 15.08 ? 203 THR A N   1 
ATOM   1594 C CA  . THR A 1 201 ? 34.402 25.987 36.516 1.00 19.55 ? 203 THR A CA  1 
ATOM   1595 C C   . THR A 1 201 ? 34.877 26.618 35.215 1.00 17.25 ? 203 THR A C   1 
ATOM   1596 O O   . THR A 1 201 ? 35.281 27.780 35.190 1.00 18.75 ? 203 THR A O   1 
ATOM   1597 C CB  . THR A 1 201 ? 32.950 26.471 36.738 1.00 19.65 ? 203 THR A CB  1 
ATOM   1598 O OG1 . THR A 1 201 ? 32.387 25.802 37.872 1.00 24.17 ? 203 THR A OG1 1 
ATOM   1599 C CG2 . THR A 1 201 ? 32.094 26.183 35.509 1.00 25.79 ? 203 THR A CG2 1 
ATOM   1600 N N   . GLN A 1 202 ? 34.827 25.829 34.145 1.00 17.97 ? 204 GLN A N   1 
ATOM   1601 C CA  . GLN A 1 202 ? 35.190 26.283 32.806 1.00 16.79 ? 204 GLN A CA  1 
ATOM   1602 C C   . GLN A 1 202 ? 33.858 26.279 32.058 1.00 17.52 ? 204 GLN A C   1 
ATOM   1603 O O   . GLN A 1 202 ? 33.185 25.247 31.996 1.00 17.28 ? 204 GLN A O   1 
ATOM   1604 C CB  . GLN A 1 202 ? 36.148 25.294 32.143 1.00 22.14 ? 204 GLN A CB  1 
ATOM   1605 C CG  . GLN A 1 202 ? 37.440 25.067 32.901 1.00 29.28 ? 204 GLN A CG  1 
ATOM   1606 C CD  . GLN A 1 202 ? 38.220 23.899 32.348 1.00 33.37 ? 204 GLN A CD  1 
ATOM   1607 O OE1 . GLN A 1 202 ? 38.665 23.922 31.199 1.00 36.20 ? 204 GLN A OE1 1 
ATOM   1608 N NE2 . GLN A 1 202 ? 38.380 22.860 33.159 1.00 36.29 ? 204 GLN A NE2 1 
ATOM   1609 N N   . SER A 1 203 ? 33.461 27.430 31.523 1.00 18.36 ? 205 SER A N   1 
ATOM   1610 C CA  . SER A 1 203 ? 32.199 27.539 30.795 1.00 16.10 ? 205 SER A CA  1 
ATOM   1611 C C   . SER A 1 203 ? 32.443 28.057 29.382 1.00 15.26 ? 205 SER A C   1 
ATOM   1612 O O   . SER A 1 203 ? 33.041 29.120 29.206 1.00 18.27 ? 205 SER A O   1 
ATOM   1613 C CB  . SER A 1 203 ? 31.246 28.497 31.517 1.00 22.57 ? 205 SER A CB  1 
ATOM   1614 O OG  . SER A 1 203 ? 30.996 28.079 32.848 1.00 27.18 ? 205 SER A OG  1 
ATOM   1615 N N   . ALA A 1 204 ? 31.989 27.300 28.386 1.00 13.18 ? 206 ALA A N   1 
ATOM   1616 C CA  . ALA A 1 204 ? 32.134 27.682 26.983 1.00 12.95 ? 206 ALA A CA  1 
ATOM   1617 C C   . ALA A 1 204 ? 30.743 27.900 26.407 1.00 12.12 ? 206 ALA A C   1 
ATOM   1618 O O   . ALA A 1 204 ? 29.890 27.015 26.465 1.00 11.81 ? 206 ALA A O   1 
ATOM   1619 C CB  . ALA A 1 204 ? 32.855 26.592 26.204 1.00 15.84 ? 206 ALA A CB  1 
ATOM   1620 N N   . LEU A 1 205 ? 30.529 29.084 25.847 1.00 11.73 ? 207 LEU A N   1 
ATOM   1621 C CA  . LEU A 1 205 ? 29.242 29.457 25.270 1.00 11.35 ? 207 LEU A CA  1 
ATOM   1622 C C   . LEU A 1 205 ? 29.279 29.389 23.757 1.00 11.91 ? 207 LEU A C   1 
ATOM   1623 O O   . LEU A 1 205 ? 30.242 29.829 23.138 1.00 13.08 ? 207 LEU A O   1 
ATOM   1624 C CB  . LEU A 1 205 ? 28.865 30.881 25.683 1.00 12.21 ? 207 LEU A CB  1 
ATOM   1625 C CG  . LEU A 1 205 ? 28.387 31.112 27.120 1.00 13.81 ? 207 LEU A CG  1 
ATOM   1626 C CD1 . LEU A 1 205 ? 29.492 30.813 28.125 1.00 16.16 ? 207 LEU A CD1 1 
ATOM   1627 C CD2 . LEU A 1 205 ? 27.926 32.559 27.252 1.00 20.83 ? 207 LEU A CD2 1 
ATOM   1628 N N   . SER A 1 206 ? 28.229 28.842 23.156 1.00 10.31 ? 208 SER A N   1 
ATOM   1629 C CA  . SER A 1 206 ? 28.181 28.741 21.706 1.00 10.77 ? 208 SER A CA  1 
ATOM   1630 C C   . SER A 1 206 ? 26.748 28.832 21.217 1.00 11.21 ? 208 SER A C   1 
ATOM   1631 O O   . SER A 1 206 ? 25.824 29.028 22.004 1.00 11.28 ? 208 SER A O   1 
ATOM   1632 C CB  . SER A 1 206 ? 28.813 27.426 21.242 1.00 13.63 ? 208 SER A CB  1 
ATOM   1633 O OG  . SER A 1 206 ? 28.141 26.310 21.792 1.00 14.06 ? 208 SER A OG  1 
ATOM   1634 N N   . LYS A 1 207 ? 26.568 28.697 19.907 1.00 13.38 ? 209 LYS A N   1 
ATOM   1635 C CA  . LYS A 1 207 ? 25.240 28.755 19.307 1.00 14.86 ? 209 LYS A CA  1 
ATOM   1636 C C   . LYS A 1 207 ? 24.972 27.491 18.496 1.00 15.69 ? 209 LYS A C   1 
ATOM   1637 O O   . LYS A 1 207 ? 25.902 26.864 17.980 1.00 17.85 ? 209 LYS A O   1 
ATOM   1638 C CB  . LYS A 1 207 ? 25.126 29.966 18.376 1.00 15.47 ? 209 LYS A CB  1 
ATOM   1639 C CG  . LYS A 1 207 ? 25.276 31.312 19.056 1.00 14.60 ? 209 LYS A CG  1 
ATOM   1640 C CD  . LYS A 1 207 ? 24.113 31.604 19.992 1.00 13.80 ? 209 LYS A CD  1 
ATOM   1641 C CE  . LYS A 1 207 ? 24.192 33.029 20.513 1.00 14.27 ? 209 LYS A CE  1 
ATOM   1642 N NZ  . LYS A 1 207 ? 23.108 33.325 21.494 1.00 12.32 ? 209 LYS A NZ  1 
ATOM   1643 N N   . ASP A 1 208 ? 23.697 27.124 18.403 1.00 15.07 ? 210 ASP A N   1 
ATOM   1644 C CA  . ASP A 1 208 ? 23.250 25.969 17.628 1.00 17.43 ? 210 ASP A CA  1 
ATOM   1645 C C   . ASP A 1 208 ? 22.972 26.580 16.253 1.00 19.23 ? 210 ASP A C   1 
ATOM   1646 O O   . ASP A 1 208 ? 22.069 27.401 16.103 1.00 16.29 ? 210 ASP A O   1 
ATOM   1647 C CB  . ASP A 1 208 ? 21.961 25.406 18.243 1.00 17.20 ? 210 ASP A CB  1 
ATOM   1648 C CG  . ASP A 1 208 ? 21.335 24.299 17.408 1.00 18.26 ? 210 ASP A CG  1 
ATOM   1649 O OD1 . ASP A 1 208 ? 21.738 24.124 16.238 1.00 19.38 ? 210 ASP A OD1 1 
ATOM   1650 O OD2 . ASP A 1 208 ? 20.424 23.612 17.920 1.00 19.18 ? 210 ASP A OD2 1 
ATOM   1651 N N   . PRO A 1 209 ? 23.749 26.192 15.231 1.00 23.94 ? 211 PRO A N   1 
ATOM   1652 C CA  . PRO A 1 209 ? 23.559 26.737 13.882 1.00 25.21 ? 211 PRO A CA  1 
ATOM   1653 C C   . PRO A 1 209 ? 22.166 26.579 13.271 1.00 25.10 ? 211 PRO A C   1 
ATOM   1654 O O   . PRO A 1 209 ? 21.790 27.337 12.378 1.00 26.92 ? 211 PRO A O   1 
ATOM   1655 C CB  . PRO A 1 209 ? 24.642 26.025 13.070 1.00 23.42 ? 211 PRO A CB  1 
ATOM   1656 C CG  . PRO A 1 209 ? 24.761 24.703 13.763 1.00 23.52 ? 211 PRO A CG  1 
ATOM   1657 C CD  . PRO A 1 209 ? 24.745 25.105 15.220 1.00 22.82 ? 211 PRO A CD  1 
ATOM   1658 N N   . ASN A 1 210 ? 21.397 25.608 13.752 1.00 22.05 ? 212 ASN A N   1 
ATOM   1659 C CA  . ASN A 1 210 ? 20.061 25.380 13.214 1.00 22.52 ? 212 ASN A CA  1 
ATOM   1660 C C   . ASN A 1 210 ? 18.947 25.922 14.104 1.00 20.13 ? 212 ASN A C   1 
ATOM   1661 O O   . ASN A 1 210 ? 17.769 25.696 13.835 1.00 20.52 ? 212 ASN A O   1 
ATOM   1662 C CB  . ASN A 1 210 ? 19.848 23.883 12.979 1.00 24.39 ? 212 ASN A CB  1 
ATOM   1663 C CG  . ASN A 1 210 ? 20.874 23.295 12.031 1.00 27.06 ? 212 ASN A CG  1 
ATOM   1664 O OD1 . ASN A 1 210 ? 21.023 23.756 10.900 1.00 28.26 ? 212 ASN A OD1 1 
ATOM   1665 N ND2 . ASN A 1 210 ? 21.589 22.274 12.490 1.00 28.15 ? 212 ASN A ND2 1 
ATOM   1666 N N   . GLU A 1 211 ? 19.317 26.651 15.152 1.00 16.90 ? 213 GLU A N   1 
ATOM   1667 C CA  . GLU A 1 211 ? 18.339 27.205 16.077 1.00 15.47 ? 213 GLU A CA  1 
ATOM   1668 C C   . GLU A 1 211 ? 18.059 28.680 15.811 1.00 14.91 ? 213 GLU A C   1 
ATOM   1669 O O   . GLU A 1 211 ? 18.967 29.507 15.871 1.00 16.70 ? 213 GLU A O   1 
ATOM   1670 C CB  . GLU A 1 211 ? 18.832 27.024 17.513 1.00 14.22 ? 213 GLU A CB  1 
ATOM   1671 C CG  . GLU A 1 211 ? 17.871 27.553 18.554 1.00 14.69 ? 213 GLU A CG  1 
ATOM   1672 C CD  . GLU A 1 211 ? 16.525 26.870 18.486 1.00 13.11 ? 213 GLU A CD  1 
ATOM   1673 O OE1 . GLU A 1 211 ? 16.452 25.666 18.810 1.00 13.87 ? 213 GLU A OE1 1 
ATOM   1674 O OE2 . GLU A 1 211 ? 15.541 27.539 18.096 1.00 15.00 ? 213 GLU A OE2 1 
ATOM   1675 N N   . LYS A 1 212 ? 16.796 29.006 15.543 1.00 14.65 ? 214 LYS A N   1 
ATOM   1676 C CA  . LYS A 1 212 ? 16.395 30.378 15.260 1.00 16.06 ? 214 LYS A CA  1 
ATOM   1677 C C   . LYS A 1 212 ? 15.872 31.137 16.477 1.00 15.18 ? 214 LYS A C   1 
ATOM   1678 O O   . LYS A 1 212 ? 15.774 32.362 16.449 1.00 16.26 ? 214 LYS A O   1 
ATOM   1679 C CB  . LYS A 1 212 ? 15.346 30.396 14.145 1.00 22.58 ? 214 LYS A CB  1 
ATOM   1680 C CG  . LYS A 1 212 ? 15.856 29.863 12.811 1.00 27.95 ? 214 LYS A CG  1 
ATOM   1681 C CD  . LYS A 1 212 ? 16.987 30.726 12.269 1.00 32.09 ? 214 LYS A CD  1 
ATOM   1682 C CE  . LYS A 1 212 ? 17.518 30.184 10.949 1.00 34.30 ? 214 LYS A CE  1 
ATOM   1683 N NZ  . LYS A 1 212 ? 18.121 28.829 11.102 1.00 35.34 ? 214 LYS A NZ  1 
ATOM   1684 N N   . ARG A 1 213 ? 15.517 30.416 17.538 1.00 14.47 ? 215 ARG A N   1 
ATOM   1685 C CA  . ARG A 1 213 ? 15.053 31.060 18.764 1.00 13.06 ? 215 ARG A CA  1 
ATOM   1686 C C   . ARG A 1 213 ? 16.284 31.617 19.490 1.00 11.82 ? 215 ARG A C   1 
ATOM   1687 O O   . ARG A 1 213 ? 17.401 31.153 19.264 1.00 12.41 ? 215 ARG A O   1 
ATOM   1688 C CB  . ARG A 1 213 ? 14.347 30.041 19.663 1.00 14.62 ? 215 ARG A CB  1 
ATOM   1689 C CG  . ARG A 1 213 ? 13.021 29.538 19.113 1.00 14.77 ? 215 ARG A CG  1 
ATOM   1690 C CD  . ARG A 1 213 ? 12.497 28.346 19.913 1.00 14.29 ? 215 ARG A CD  1 
ATOM   1691 N NE  . ARG A 1 213 ? 13.330 27.165 19.714 1.00 14.44 ? 215 ARG A NE  1 
ATOM   1692 C CZ  . ARG A 1 213 ? 13.114 25.984 20.286 1.00 15.09 ? 215 ARG A CZ  1 
ATOM   1693 N NH1 . ARG A 1 213 ? 12.085 25.815 21.106 1.00 16.80 ? 215 ARG A NH1 1 
ATOM   1694 N NH2 . ARG A 1 213 ? 13.925 24.967 20.034 1.00 15.95 ? 215 ARG A NH2 1 
ATOM   1695 N N   . ASP A 1 214 ? 16.082 32.616 20.346 1.00 12.33 ? 216 ASP A N   1 
ATOM   1696 C CA  . ASP A 1 214 ? 17.189 33.196 21.113 1.00 11.94 ? 216 ASP A CA  1 
ATOM   1697 C C   . ASP A 1 214 ? 17.607 32.070 22.061 1.00 10.45 ? 216 ASP A C   1 
ATOM   1698 O O   . ASP A 1 214 ? 16.774 31.537 22.796 1.00 11.13 ? 216 ASP A O   1 
ATOM   1699 C CB  . ASP A 1 214 ? 16.697 34.410 21.892 1.00 12.99 ? 216 ASP A CB  1 
ATOM   1700 C CG  . ASP A 1 214 ? 17.820 35.347 22.298 1.00 12.23 ? 216 ASP A CG  1 
ATOM   1701 O OD1 . ASP A 1 214 ? 19.007 35.003 22.103 1.00 12.72 ? 216 ASP A OD1 1 
ATOM   1702 O OD2 . ASP A 1 214 ? 17.501 36.439 22.815 1.00 15.58 ? 216 ASP A OD2 1 
ATOM   1703 N N   . HIS A 1 215 ? 18.887 31.710 22.052 1.00 10.29 ? 217 HIS A N   1 
ATOM   1704 C CA  . HIS A 1 215 ? 19.325 30.572 22.846 1.00 10.18 ? 217 HIS A CA  1 
ATOM   1705 C C   . HIS A 1 215 ? 20.794 30.644 23.207 1.00 10.59 ? 217 HIS A C   1 
ATOM   1706 O O   . HIS A 1 215 ? 21.511 31.518 22.739 1.00 11.20 ? 217 HIS A O   1 
ATOM   1707 C CB  . HIS A 1 215 ? 19.102 29.302 22.024 1.00 11.71 ? 217 HIS A CB  1 
ATOM   1708 C CG  . HIS A 1 215 ? 20.036 29.178 20.856 1.00 11.54 ? 217 HIS A CG  1 
ATOM   1709 N ND1 . HIS A 1 215 ? 19.919 29.946 19.715 1.00 11.92 ? 217 HIS A ND1 1 
ATOM   1710 C CD2 . HIS A 1 215 ? 21.137 28.410 20.679 1.00 12.61 ? 217 HIS A CD2 1 
ATOM   1711 C CE1 . HIS A 1 215 ? 20.910 29.657 18.890 1.00 13.02 ? 217 HIS A CE1 1 
ATOM   1712 N NE2 . HIS A 1 215 ? 21.663 28.728 19.450 1.00 13.93 ? 217 HIS A NE2 1 
ATOM   1713 N N   . MET A 1 216 ? 21.228 29.684 24.020 1.00 10.50 ? 218 MET A N   1 
ATOM   1714 C CA  . MET A 1 216 ? 22.619 29.577 24.438 1.00 10.65 ? 218 MET A CA  1 
ATOM   1715 C C   . MET A 1 216 ? 22.977 28.115 24.651 1.00 10.47 ? 218 MET A C   1 
ATOM   1716 O O   . MET A 1 216 ? 22.265 27.398 25.363 1.00 11.39 ? 218 MET A O   1 
ATOM   1717 C CB  . MET A 1 216 ? 22.865 30.333 25.755 1.00 10.75 ? 218 MET A CB  1 
ATOM   1718 C CG  . MET A 1 216 ? 24.222 30.036 26.411 1.00 11.14 ? 218 MET A CG  1 
ATOM   1719 S SD  . MET A 1 216 ? 24.578 31.022 27.888 1.00 12.17 ? 218 MET A SD  1 
ATOM   1720 C CE  . MET A 1 216 ? 23.434 30.316 29.074 1.00 12.19 ? 218 MET A CE  1 
ATOM   1721 N N   . VAL A 1 217 ? 24.070 27.678 24.030 1.00 10.72 ? 219 VAL A N   1 
ATOM   1722 C CA  . VAL A 1 217 ? 24.561 26.318 24.209 1.00 11.82 ? 219 VAL A CA  1 
ATOM   1723 C C   . VAL A 1 217 ? 25.739 26.469 25.159 1.00 10.46 ? 219 VAL A C   1 
ATOM   1724 O O   . VAL A 1 217 ? 26.589 27.337 24.978 1.00 11.28 ? 219 VAL A O   1 
ATOM   1725 C CB  . VAL A 1 217 ? 25.025 25.689 22.884 1.00 11.72 ? 219 VAL A CB  1 
ATOM   1726 C CG1 . VAL A 1 217 ? 25.667 24.324 23.151 1.00 13.52 ? 219 VAL A CG1 1 
ATOM   1727 C CG2 . VAL A 1 217 ? 23.833 25.540 21.946 1.00 15.07 ? 219 VAL A CG2 1 
ATOM   1728 N N   . LEU A 1 218 ? 25.776 25.621 26.176 1.00 10.91 ? 220 LEU A N   1 
ATOM   1729 C CA  . LEU A 1 218 ? 26.813 25.703 27.190 1.00 11.63 ? 220 LEU A CA  1 
ATOM   1730 C C   . LEU A 1 218 ? 27.476 24.366 27.462 1.00 12.71 ? 220 LEU A C   1 
ATOM   1731 O O   . LEU A 1 218 ? 26.794 23.351 27.623 1.00 13.98 ? 220 LEU A O   1 
ATOM   1732 C CB  . LEU A 1 218 ? 26.178 26.239 28.480 1.00 16.21 ? 220 LEU A CB  1 
ATOM   1733 C CG  . LEU A 1 218 ? 27.003 26.622 29.707 1.00 18.92 ? 220 LEU A CG  1 
ATOM   1734 C CD1 . LEU A 1 218 ? 28.014 27.705 29.363 1.00 20.35 ? 220 LEU A CD1 1 
ATOM   1735 C CD2 . LEU A 1 218 ? 26.044 27.120 30.779 1.00 19.26 ? 220 LEU A CD2 1 
ATOM   1736 N N   . LEU A 1 219 ? 28.808 24.380 27.483 1.00 12.50 ? 221 LEU A N   1 
ATOM   1737 C CA  . LEU A 1 219 ? 29.614 23.205 27.789 1.00 12.13 ? 221 LEU A CA  1 
ATOM   1738 C C   . LEU A 1 219 ? 30.431 23.622 29.005 1.00 11.00 ? 221 LEU A C   1 
ATOM   1739 O O   . LEU A 1 219 ? 31.187 24.589 28.943 1.00 12.49 ? 221 LEU A O   1 
ATOM   1740 C CB  . LEU A 1 219 ? 30.543 22.851 26.624 1.00 14.15 ? 221 LEU A CB  1 
ATOM   1741 C CG  . LEU A 1 219 ? 31.563 21.741 26.913 1.00 15.73 ? 221 LEU A CG  1 
ATOM   1742 C CD1 . LEU A 1 219 ? 30.849 20.432 27.205 1.00 16.02 ? 221 LEU A CD1 1 
ATOM   1743 C CD2 . LEU A 1 219 ? 32.492 21.577 25.721 1.00 17.37 ? 221 LEU A CD2 1 
ATOM   1744 N N   . GLU A 1 220 ? 30.275 22.900 30.107 1.00 11.58 ? 222 GLU A N   1 
ATOM   1745 C CA  . GLU A 1 220 ? 30.986 23.241 31.327 1.00 11.87 ? 222 GLU A CA  1 
ATOM   1746 C C   . GLU A 1 220 ? 31.668 22.061 31.983 1.00 12.35 ? 222 GLU A C   1 
ATOM   1747 O O   . GLU A 1 220 ? 31.237 20.923 31.852 1.00 11.50 ? 222 GLU A O   1 
ATOM   1748 C CB  . GLU A 1 220 ? 30.025 23.879 32.334 1.00 19.32 ? 222 GLU A CB  1 
ATOM   1749 C CG  . GLU A 1 220 ? 29.643 25.314 32.009 1.00 25.66 ? 222 GLU A CG  1 
ATOM   1750 C CD  . GLU A 1 220 ? 28.602 25.873 32.962 1.00 29.00 ? 222 GLU A CD  1 
ATOM   1751 O OE1 . GLU A 1 220 ? 28.401 27.105 32.966 1.00 32.42 ? 222 GLU A OE1 1 
ATOM   1752 O OE2 . GLU A 1 220 ? 27.979 25.080 33.698 1.00 30.37 ? 222 GLU A OE2 1 
ATOM   1753 N N   . PHE A 1 221 ? 32.757 22.359 32.678 1.00 11.83 ? 223 PHE A N   1 
ATOM   1754 C CA  . PHE A 1 221 ? 33.518 21.367 33.425 1.00 12.26 ? 223 PHE A CA  1 
ATOM   1755 C C   . PHE A 1 221 ? 33.767 22.025 34.771 1.00 12.34 ? 223 PHE A C   1 
ATOM   1756 O O   . PHE A 1 221 ? 34.257 23.148 34.835 1.00 13.65 ? 223 PHE A O   1 
ATOM   1757 C CB  . PHE A 1 221 ? 34.843 21.055 32.730 1.00 13.25 ? 223 PHE A CB  1 
ATOM   1758 C CG  . PHE A 1 221 ? 34.680 20.427 31.376 1.00 12.95 ? 223 PHE A CG  1 
ATOM   1759 C CD1 . PHE A 1 221 ? 34.469 19.059 31.242 1.00 13.72 ? 223 PHE A CD1 1 
ATOM   1760 C CD2 . PHE A 1 221 ? 34.716 21.213 30.229 1.00 11.84 ? 223 PHE A CD2 1 
ATOM   1761 C CE1 . PHE A 1 221 ? 34.299 18.491 29.977 1.00 13.14 ? 223 PHE A CE1 1 
ATOM   1762 C CE2 . PHE A 1 221 ? 34.546 20.648 28.965 1.00 14.88 ? 223 PHE A CE2 1 
ATOM   1763 C CZ  . PHE A 1 221 ? 34.338 19.289 28.841 1.00 15.47 ? 223 PHE A CZ  1 
ATOM   1764 N N   . VAL A 1 222 ? 33.419 21.324 35.844 1.00 13.08 ? 224 VAL A N   1 
ATOM   1765 C CA  . VAL A 1 222 ? 33.573 21.866 37.187 1.00 13.85 ? 224 VAL A CA  1 
ATOM   1766 C C   . VAL A 1 222 ? 34.255 20.867 38.102 1.00 13.34 ? 224 VAL A C   1 
ATOM   1767 O O   . VAL A 1 222 ? 33.873 19.701 38.151 1.00 14.21 ? 224 VAL A O   1 
ATOM   1768 C CB  . VAL A 1 222 ? 32.206 22.233 37.791 1.00 16.01 ? 224 VAL A CB  1 
ATOM   1769 C CG1 . VAL A 1 222 ? 32.394 22.904 39.145 1.00 18.65 ? 224 VAL A CG1 1 
ATOM   1770 C CG2 . VAL A 1 222 ? 31.445 23.134 36.843 1.00 24.56 ? 224 VAL A CG2 1 
ATOM   1771 N N   . THR A 1 223 ? 35.254 21.349 38.835 1.00 12.47 ? 225 THR A N   1 
ATOM   1772 C CA  . THR A 1 223 ? 36.024 20.514 39.740 1.00 13.20 ? 225 THR A CA  1 
ATOM   1773 C C   . THR A 1 223 ? 36.231 21.205 41.079 1.00 12.23 ? 225 THR A C   1 
ATOM   1774 O O   . THR A 1 223 ? 36.551 22.391 41.120 1.00 14.02 ? 225 THR A O   1 
ATOM   1775 C CB  . THR A 1 223 ? 37.414 20.226 39.155 1.00 14.17 ? 225 THR A CB  1 
ATOM   1776 O OG1 . THR A 1 223 ? 37.277 19.719 37.823 1.00 20.99 ? 225 THR A OG1 1 
ATOM   1777 C CG2 . THR A 1 223 ? 38.149 19.204 40.005 1.00 22.39 ? 225 THR A CG2 1 
ATOM   1778 N N   . ALA A 1 224 ? 36.051 20.461 42.168 1.00 11.80 ? 226 ALA A N   1 
ATOM   1779 C CA  . ALA A 1 224 ? 36.260 20.992 43.512 1.00 11.66 ? 226 ALA A CA  1 
ATOM   1780 C C   . ALA A 1 224 ? 37.753 20.904 43.808 1.00 13.02 ? 226 ALA A C   1 
ATOM   1781 O O   . ALA A 1 224 ? 38.438 20.006 43.314 1.00 13.42 ? 226 ALA A O   1 
ATOM   1782 C CB  . ALA A 1 224 ? 35.476 20.176 44.530 1.00 13.68 ? 226 ALA A CB  1 
ATOM   1783 N N   . ALA A 1 225 ? 38.255 21.837 44.609 1.00 13.46 ? 227 ALA A N   1 
ATOM   1784 C CA  . ALA A 1 225 ? 39.671 21.866 44.962 1.00 14.00 ? 227 ALA A CA  1 
ATOM   1785 C C   . ALA A 1 225 ? 39.871 22.743 46.195 1.00 14.96 ? 227 ALA A C   1 
ATOM   1786 O O   . ALA A 1 225 ? 38.914 23.280 46.744 1.00 14.07 ? 227 ALA A O   1 
ATOM   1787 C CB  . ALA A 1 225 ? 40.483 22.417 43.796 1.00 18.88 ? 227 ALA A CB  1 
ATOM   1788 N N   . GLY A 1 226 ? 41.119 22.883 46.632 1.00 19.65 ? 228 GLY A N   1 
ATOM   1789 C CA  . GLY A 1 226 ? 41.397 23.722 47.785 1.00 24.18 ? 228 GLY A CA  1 
ATOM   1790 C C   . GLY A 1 226 ? 41.730 22.979 49.063 1.00 28.40 ? 228 GLY A C   1 
ATOM   1791 O O   . GLY A 1 226 ? 42.183 23.585 50.035 1.00 29.30 ? 228 GLY A O   1 
ATOM   1792 N N   . ILE A 1 227 ? 41.503 21.672 49.074 1.00 26.69 ? 229 ILE A N   1 
ATOM   1793 C CA  . ILE A 1 227 ? 41.798 20.865 50.251 1.00 30.45 ? 229 ILE A CA  1 
ATOM   1794 C C   . ILE A 1 227 ? 42.794 19.764 49.909 1.00 32.13 ? 229 ILE A C   1 
ATOM   1795 O O   . ILE A 1 227 ? 43.875 19.734 50.533 1.00 33.59 ? 229 ILE A O   1 
ATOM   1796 C CB  . ILE A 1 227 ? 40.520 20.222 50.828 1.00 29.12 ? 229 ILE A CB  1 
ATOM   1797 C CG1 . ILE A 1 227 ? 39.555 21.317 51.292 1.00 28.87 ? 229 ILE A CG1 1 
ATOM   1798 C CG2 . ILE A 1 227 ? 40.880 19.299 51.989 1.00 29.07 ? 229 ILE A CG2 1 
ATOM   1799 C CD1 . ILE A 1 227 ? 38.250 20.793 51.855 1.00 28.69 ? 229 ILE A CD1 1 
ATOM   1800 O OXT . ILE A 1 227 ? 42.481 18.950 49.018 1.00 30.56 ? 229 ILE A OXT 1 
HETATM 1801 O O   . HOH B 2 .   ? 23.409 34.403 36.592 1.00 11.12 ? 230 HOH A O   1 
HETATM 1802 O O   . HOH B 2 .   ? 22.100 33.087 40.735 1.00 11.94 ? 231 HOH A O   1 
HETATM 1803 O O   . HOH B 2 .   ? 26.132 12.754 37.001 1.00 12.68 ? 232 HOH A O   1 
HETATM 1804 O O   . HOH B 2 .   ? 20.694 29.336 40.760 1.00 11.51 ? 233 HOH A O   1 
HETATM 1805 O O   . HOH B 2 .   ? 11.587 18.474 28.168 1.00 14.04 ? 234 HOH A O   1 
HETATM 1806 O O   . HOH B 2 .   ? 26.727 34.487 34.884 1.00 12.84 ? 235 HOH A O   1 
HETATM 1807 O O   . HOH B 2 .   ? 20.080 26.746 41.133 1.00 11.27 ? 236 HOH A O   1 
HETATM 1808 O O   . HOH B 2 .   ? 25.242 41.634 25.415 1.00 13.98 ? 237 HOH A O   1 
HETATM 1809 O O   . HOH B 2 .   ? 19.588 31.036 42.617 1.00 14.16 ? 238 HOH A O   1 
HETATM 1810 O O   . HOH B 2 .   ? 20.566 33.490 20.319 1.00 13.81 ? 239 HOH A O   1 
HETATM 1811 O O   . HOH B 2 .   ? 23.571 24.509 42.399 1.00 13.26 ? 240 HOH A O   1 
HETATM 1812 O O   . HOH B 2 .   ? 24.796 46.504 41.864 1.00 14.42 ? 241 HOH A O   1 
HETATM 1813 O O   . HOH B 2 .   ? 26.572 36.974 36.125 1.00 12.84 ? 242 HOH A O   1 
HETATM 1814 O O   . HOH B 2 .   ? 30.935 37.027 30.265 1.00 13.92 ? 243 HOH A O   1 
HETATM 1815 O O   . HOH B 2 .   ? 21.907 47.803 32.119 1.00 13.12 ? 244 HOH A O   1 
HETATM 1816 O O   . HOH B 2 .   ? 30.003 21.604 49.137 1.00 14.08 ? 245 HOH A O   1 
HETATM 1817 O O   . HOH B 2 .   ? 29.403 25.535 24.036 1.00 16.52 ? 246 HOH A O   1 
HETATM 1818 O O   . HOH B 2 .   ? 33.563 25.854 56.000 1.00 15.88 ? 247 HOH A O   1 
HETATM 1819 O O   . HOH B 2 .   ? 35.339 11.377 39.807 1.00 12.30 ? 248 HOH A O   1 
HETATM 1820 O O   . HOH B 2 .   ? 28.624 18.611 43.794 1.00 12.66 ? 249 HOH A O   1 
HETATM 1821 O O   . HOH B 2 .   ? 10.775 22.639 29.459 1.00 15.91 ? 250 HOH A O   1 
HETATM 1822 O O   . HOH B 2 .   ? 23.521 36.059 22.283 1.00 18.13 ? 251 HOH A O   1 
HETATM 1823 O O   . HOH B 2 .   ? 28.899 10.545 36.736 1.00 14.35 ? 252 HOH A O   1 
HETATM 1824 O O   . HOH B 2 .   ? 9.674  47.711 32.051 1.00 14.94 ? 253 HOH A O   1 
HETATM 1825 O O   . HOH B 2 .   ? 37.417 50.517 31.265 1.00 14.99 ? 254 HOH A O   1 
HETATM 1826 O O   . HOH B 2 .   ? 29.457 44.989 41.904 1.00 17.57 ? 255 HOH A O   1 
HETATM 1827 O O   . HOH B 2 .   ? 16.884 44.988 27.290 1.00 17.70 ? 256 HOH A O   1 
HETATM 1828 O O   . HOH B 2 .   ? 23.299 17.787 58.637 1.00 17.70 ? 257 HOH A O   1 
HETATM 1829 O O   . HOH B 2 .   ? 17.671 17.988 51.432 1.00 15.83 ? 258 HOH A O   1 
HETATM 1830 O O   . HOH B 2 .   ? 18.988 29.095 50.685 1.00 21.44 ? 259 HOH A O   1 
HETATM 1831 O O   . HOH B 2 .   ? 13.375 33.147 21.247 1.00 20.54 ? 260 HOH A O   1 
HETATM 1832 O O   . HOH B 2 .   ? 19.457 14.365 51.643 1.00 19.18 ? 261 HOH A O   1 
HETATM 1833 O O   . HOH B 2 .   ? 14.701 23.935 26.502 1.00 17.72 ? 262 HOH A O   1 
HETATM 1834 O O   . HOH B 2 .   ? 30.547 39.240 28.624 1.00 13.33 ? 263 HOH A O   1 
HETATM 1835 O O   . HOH B 2 .   ? 32.712 46.687 36.220 1.00 12.82 ? 264 HOH A O   1 
HETATM 1836 O O   . HOH B 2 .   ? 39.543 45.327 30.655 1.00 15.52 ? 265 HOH A O   1 
HETATM 1837 O O   . HOH B 2 .   ? 36.353 14.123 52.392 1.00 20.74 ? 266 HOH A O   1 
HETATM 1838 O O   . HOH B 2 .   ? 19.369 9.990  36.808 1.00 16.99 ? 267 HOH A O   1 
HETATM 1839 O O   . HOH B 2 .   ? 11.851 12.001 42.459 1.00 24.34 ? 268 HOH A O   1 
HETATM 1840 O O   . HOH B 2 .   ? 31.859 14.206 42.713 1.00 19.79 ? 269 HOH A O   1 
HETATM 1841 O O   . HOH B 2 .   ? 6.245  44.817 33.082 1.00 15.57 ? 270 HOH A O   1 
HETATM 1842 O O   . HOH B 2 .   ? 28.879 29.022 18.220 1.00 23.89 ? 271 HOH A O   1 
HETATM 1843 O O   . HOH B 2 .   ? 19.766 9.438  39.431 1.00 17.69 ? 272 HOH A O   1 
HETATM 1844 O O   . HOH B 2 .   ? 28.092 17.426 57.855 1.00 18.40 ? 273 HOH A O   1 
HETATM 1845 O O   . HOH B 2 .   ? 7.993  44.072 37.840 1.00 16.23 ? 274 HOH A O   1 
HETATM 1846 O O   . HOH B 2 .   ? 41.048 19.231 42.483 1.00 21.29 ? 275 HOH A O   1 
HETATM 1847 O O   . HOH B 2 .   ? 36.207 8.363  44.671 1.00 22.69 ? 276 HOH A O   1 
HETATM 1848 O O   . HOH B 2 .   ? 31.189 14.050 45.453 1.00 17.87 ? 277 HOH A O   1 
HETATM 1849 O O   . HOH B 2 .   ? 12.412 22.465 27.160 1.00 19.58 ? 278 HOH A O   1 
HETATM 1850 O O   . HOH B 2 .   ? 41.500 12.614 45.861 1.00 17.78 ? 279 HOH A O   1 
HETATM 1851 O O   . HOH B 2 .   ? 27.968 49.832 41.898 1.00 22.92 ? 280 HOH A O   1 
HETATM 1852 O O   . HOH B 2 .   ? 23.444 8.503  37.811 1.00 18.17 ? 281 HOH A O   1 
HETATM 1853 O O   . HOH B 2 .   ? 19.736 11.183 50.375 1.00 20.11 ? 282 HOH A O   1 
HETATM 1854 O O   . HOH B 2 .   ? 32.415 50.577 29.081 1.00 19.08 ? 283 HOH A O   1 
HETATM 1855 O O   . HOH B 2 .   ? 26.461 24.274 37.846 1.00 23.96 ? 284 HOH A O   1 
HETATM 1856 O O   . HOH B 2 .   ? 11.181 40.987 28.217 1.00 19.38 ? 285 HOH A O   1 
HETATM 1857 O O   . HOH B 2 .   ? 36.806 44.042 37.502 1.00 26.52 ? 286 HOH A O   1 
HETATM 1858 O O   . HOH B 2 .   ? 11.030 20.272 40.520 1.00 24.63 ? 287 HOH A O   1 
HETATM 1859 O O   . HOH B 2 .   ? 33.588 37.637 29.611 1.00 18.38 ? 288 HOH A O   1 
HETATM 1860 O O   . HOH B 2 .   ? 7.777  35.219 31.753 1.00 27.29 ? 289 HOH A O   1 
HETATM 1861 O O   . HOH B 2 .   ? 13.904 50.141 32.901 1.00 21.44 ? 290 HOH A O   1 
HETATM 1862 O O   . HOH B 2 .   ? 13.747 56.599 27.542 1.00 29.13 ? 291 HOH A O   1 
HETATM 1863 O O   . HOH B 2 .   ? 30.058 8.193  31.276 1.00 26.54 ? 292 HOH A O   1 
HETATM 1864 O O   . HOH B 2 .   ? 26.483 38.294 24.728 1.00 21.89 ? 293 HOH A O   1 
HETATM 1865 O O   . HOH B 2 .   ? 32.977 35.497 33.062 1.00 18.58 ? 294 HOH A O   1 
HETATM 1866 O O   . HOH B 2 .   ? 36.304 17.686 36.390 1.00 27.69 ? 295 HOH A O   1 
HETATM 1867 O O   . HOH B 2 .   ? 32.508 31.163 25.693 1.00 20.54 ? 296 HOH A O   1 
HETATM 1868 O O   . HOH B 2 .   ? 29.738 12.472 49.145 1.00 17.89 ? 297 HOH A O   1 
HETATM 1869 O O   . HOH B 2 .   ? 41.416 17.044 40.548 1.00 21.28 ? 298 HOH A O   1 
HETATM 1870 O O   . HOH B 2 .   ? 33.281 45.157 43.929 1.00 24.31 ? 299 HOH A O   1 
HETATM 1871 O O   . HOH B 2 .   ? 16.899 23.075 25.255 1.00 18.24 ? 300 HOH A O   1 
HETATM 1872 O O   . HOH B 2 .   ? 29.795 8.172  34.681 1.00 19.80 ? 301 HOH A O   1 
HETATM 1873 O O   . HOH B 2 .   ? 19.057 38.613 23.332 1.00 28.79 ? 302 HOH A O   1 
HETATM 1874 O O   . HOH B 2 .   ? 12.977 22.067 41.303 1.00 21.49 ? 303 HOH A O   1 
HETATM 1875 O O   . HOH B 2 .   ? 26.938 34.713 50.777 1.00 24.11 ? 304 HOH A O   1 
HETATM 1876 O O   . HOH B 2 .   ? 27.711 14.231 48.646 1.00 14.31 ? 305 HOH A O   1 
HETATM 1877 O O   . HOH B 2 .   ? 33.246 51.969 39.683 1.00 18.41 ? 306 HOH A O   1 
HETATM 1878 O O   . HOH B 2 .   ? 35.489 33.742 40.379 1.00 27.46 ? 307 HOH A O   1 
HETATM 1879 O O   . HOH B 2 .   ? 37.336 25.206 56.876 1.00 24.66 ? 308 HOH A O   1 
HETATM 1880 O O   . HOH B 2 .   ? 15.071 19.247 62.346 1.00 20.73 ? 309 HOH A O   1 
HETATM 1881 O O   . HOH B 2 .   ? 30.237 38.507 21.328 1.00 25.31 ? 310 HOH A O   1 
HETATM 1882 O O   . HOH B 2 .   ? 11.300 37.485 26.275 1.00 19.90 ? 311 HOH A O   1 
HETATM 1883 O O   . HOH B 2 .   ? 20.140 13.025 54.081 1.00 22.80 ? 312 HOH A O   1 
HETATM 1884 O O   . HOH B 2 .   ? 37.107 22.271 36.005 1.00 24.73 ? 313 HOH A O   1 
HETATM 1885 O O   . HOH B 2 .   ? 29.739 50.316 28.324 1.00 29.39 ? 314 HOH A O   1 
HETATM 1886 O O   . HOH B 2 .   ? 18.468 18.832 56.601 1.00 26.28 ? 315 HOH A O   1 
HETATM 1887 O O   . HOH B 2 .   ? 42.040 9.413  48.578 1.00 22.33 ? 316 HOH A O   1 
HETATM 1888 O O   . HOH B 2 .   ? 37.488 8.332  59.253 1.00 24.35 ? 317 HOH A O   1 
HETATM 1889 O O   . HOH B 2 .   ? 17.245 9.908  40.618 1.00 22.81 ? 318 HOH A O   1 
HETATM 1890 O O   . HOH B 2 .   ? 23.056 40.232 24.528 1.00 19.58 ? 319 HOH A O   1 
HETATM 1891 O O   . HOH B 2 .   ? 30.822 49.964 32.048 1.00 22.21 ? 320 HOH A O   1 
HETATM 1892 O O   . HOH B 2 .   ? 22.341 47.483 42.199 1.00 23.23 ? 321 HOH A O   1 
HETATM 1893 O O   . HOH B 2 .   ? 16.349 16.897 29.840 1.00 21.43 ? 322 HOH A O   1 
HETATM 1894 O O   . HOH B 2 .   ? 31.976 12.448 28.561 1.00 23.22 ? 323 HOH A O   1 
HETATM 1895 O O   . HOH B 2 .   ? 16.702 42.334 42.587 1.00 22.78 ? 324 HOH A O   1 
HETATM 1896 O O   . HOH B 2 .   ? 18.189 37.213 47.075 1.00 32.61 ? 325 HOH A O   1 
HETATM 1897 O O   . HOH B 2 .   ? 8.559  36.129 34.235 1.00 20.02 ? 326 HOH A O   1 
HETATM 1898 O O   . HOH B 2 .   ? 37.505 50.771 25.841 1.00 22.65 ? 327 HOH A O   1 
HETATM 1899 O O   . HOH B 2 .   ? 37.020 42.705 24.100 1.00 29.47 ? 328 HOH A O   1 
HETATM 1900 O O   . HOH B 2 .   ? 31.658 17.347 56.111 1.00 22.13 ? 329 HOH A O   1 
HETATM 1901 O O   . HOH B 2 .   ? 40.318 27.805 38.913 1.00 25.77 ? 330 HOH A O   1 
HETATM 1902 O O   . HOH B 2 .   ? 34.132 24.432 28.846 1.00 20.77 ? 331 HOH A O   1 
HETATM 1903 O O   . HOH B 2 .   ? 13.726 31.906 50.370 1.00 33.70 ? 332 HOH A O   1 
HETATM 1904 O O   . HOH B 2 .   ? 26.307 29.499 60.460 1.00 30.69 ? 333 HOH A O   1 
HETATM 1905 O O   . HOH B 2 .   ? 9.985  27.563 22.355 1.00 32.28 ? 334 HOH A O   1 
HETATM 1906 O O   . HOH B 2 .   ? 13.009 15.190 45.025 1.00 24.61 ? 335 HOH A O   1 
HETATM 1907 O O   . HOH B 2 .   ? 8.509  21.192 40.580 1.00 37.01 ? 336 HOH A O   1 
HETATM 1908 O O   . HOH B 2 .   ? 25.379 6.671  32.364 1.00 30.83 ? 337 HOH A O   1 
HETATM 1909 O O   . HOH B 2 .   ? 11.915 17.876 47.857 1.00 24.32 ? 338 HOH A O   1 
HETATM 1910 O O   . HOH B 2 .   ? 11.047 13.550 35.614 1.00 24.46 ? 339 HOH A O   1 
HETATM 1911 O O   . HOH B 2 .   ? 26.071 49.192 32.903 1.00 25.25 ? 340 HOH A O   1 
HETATM 1912 O O   . HOH B 2 .   ? 36.062 36.082 43.447 1.00 22.53 ? 341 HOH A O   1 
HETATM 1913 O O   . HOH B 2 .   ? 22.339 7.894  35.260 1.00 27.93 ? 342 HOH A O   1 
HETATM 1914 O O   . HOH B 2 .   ? 26.890 51.315 29.252 1.00 28.93 ? 343 HOH A O   1 
HETATM 1915 O O   . HOH B 2 .   ? 14.742 27.033 14.861 1.00 25.16 ? 344 HOH A O   1 
HETATM 1916 O O   . HOH B 2 .   ? 18.292 16.304 53.478 1.00 27.29 ? 345 HOH A O   1 
HETATM 1917 O O   . HOH B 2 .   ? 28.621 24.642 36.276 1.00 25.76 ? 346 HOH A O   1 
HETATM 1918 O O   . HOH B 2 .   ? 29.651 25.091 38.372 1.00 25.49 ? 347 HOH A O   1 
HETATM 1919 O O   . HOH B 2 .   ? 20.927 7.044  46.899 1.00 20.11 ? 348 HOH A O   1 
HETATM 1920 O O   . HOH B 2 .   ? 19.800 3.232  45.989 1.00 20.11 ? 349 HOH A O   1 
HETATM 1921 O O   . HOH B 2 .   ? 26.728 5.764  50.036 1.00 20.11 ? 350 HOH A O   1 
HETATM 1922 O O   . HOH B 2 .   ? 24.066 13.251 53.399 1.00 20.11 ? 351 HOH A O   1 
HETATM 1923 O O   . HOH B 2 .   ? 23.660 10.498 52.940 1.00 20.11 ? 352 HOH A O   1 
HETATM 1924 O O   . HOH B 2 .   ? 16.196 10.278 43.070 1.00 20.11 ? 353 HOH A O   1 
HETATM 1925 O O   . HOH B 2 .   ? 19.783 6.804  39.726 1.00 20.11 ? 354 HOH A O   1 
HETATM 1926 O O   . HOH B 2 .   ? 16.424 8.241  45.271 1.00 20.11 ? 355 HOH A O   1 
HETATM 1927 O O   . HOH B 2 .   ? 18.233 9.069  49.816 1.00 20.11 ? 356 HOH A O   1 
HETATM 1928 O O   . HOH B 2 .   ? 22.401 12.095 50.985 1.00 20.11 ? 357 HOH A O   1 
HETATM 1929 O O   . HOH B 2 .   ? 28.335 9.990  53.483 1.00 20.11 ? 358 HOH A O   1 
HETATM 1930 O O   . HOH B 2 .   ? 24.342 16.371 60.894 1.00 20.11 ? 359 HOH A O   1 
HETATM 1931 O O   . HOH B 2 .   ? 33.890 16.701 57.573 1.00 22.13 ? 360 HOH A O   1 
HETATM 1932 O O   . HOH B 2 .   ? 36.330 17.400 57.920 1.00 22.13 ? 361 HOH A O   1 
HETATM 1933 O O   . HOH B 2 .   ? 32.032 11.257 52.481 1.00 22.13 ? 362 HOH A O   1 
HETATM 1934 O O   . HOH B 2 .   ? 30.585 11.289 54.702 1.00 22.13 ? 363 HOH A O   1 
HETATM 1935 O O   . HOH B 2 .   ? 28.267 18.584 60.288 1.00 22.13 ? 364 HOH A O   1 
HETATM 1936 O O   . HOH B 2 .   ? 30.134 15.638 57.719 1.00 22.13 ? 365 HOH A O   1 
HETATM 1937 O O   . HOH B 2 .   ? 30.972 13.127 56.767 1.00 22.13 ? 366 HOH A O   1 
HETATM 1938 O O   . HOH B 2 .   ? 22.067 4.452  48.177 1.00 20.11 ? 367 HOH A O   1 
HETATM 1939 O O   . HOH B 2 .   ? 31.374 8.472  44.198 1.00 22.69 ? 368 HOH A O   1 
HETATM 1940 O O   . HOH B 2 .   ? 33.344 10.736 41.497 1.00 22.69 ? 369 HOH A O   1 
HETATM 1941 O O   . HOH B 2 .   ? 37.217 11.621 51.607 1.00 22.69 ? 370 HOH A O   1 
HETATM 1942 O O   . HOH B 2 .   ? 34.940 8.657  50.184 1.00 22.69 ? 371 HOH A O   1 
HETATM 1943 O O   . HOH B 2 .   ? 19.489 7.852  35.195 1.00 27.93 ? 372 HOH A O   1 
HETATM 1944 O O   . HOH B 2 .   ? 18.681 8.319  32.521 1.00 27.93 ? 373 HOH A O   1 
HETATM 1945 O O   . HOH B 2 .   ? 28.220 6.604  32.361 1.00 30.83 ? 374 HOH A O   1 
HETATM 1946 O O   . HOH B 2 .   ? 29.574 11.744 29.608 1.00 23.22 ? 375 HOH A O   1 
HETATM 1947 O O   . HOH B 2 .   ? 27.475 13.565 29.406 1.00 23.22 ? 376 HOH A O   1 
HETATM 1948 O O   . HOH B 2 .   ? 28.108 15.862 28.363 1.00 23.22 ? 377 HOH A O   1 
HETATM 1949 O O   . HOH B 2 .   ? 12.123 50.575 29.385 1.00 14.94 ? 378 HOH A O   1 
HETATM 1950 O O   . HOH B 2 .   ? 11.171 50.024 27.273 1.00 14.94 ? 379 HOH A O   1 
HETATM 1951 O O   . HOH B 2 .   ? 9.702  47.451 27.064 1.00 14.94 ? 380 HOH A O   1 
HETATM 1952 O O   . HOH B 2 .   ? 14.523 49.486 30.522 1.00 21.44 ? 381 HOH A O   1 
HETATM 1953 O O   . HOH B 2 .   ? 15.940 49.293 28.417 1.00 21.44 ? 382 HOH A O   1 
HETATM 1954 O O   . HOH B 2 .   ? 15.003 46.741 27.616 1.00 21.44 ? 383 HOH A O   1 
HETATM 1955 O O   . HOH B 2 .   ? 17.792 53.977 33.018 1.00 21.44 ? 384 HOH A O   1 
HETATM 1956 O O   . HOH B 2 .   ? 36.436 10.959 60.024 1.00 24.35 ? 385 HOH A O   1 
HETATM 1957 O O   . HOH B 2 .   ? 18.629 47.627 44.699 1.00 22.78 ? 386 HOH A O   1 
HETATM 1958 O O   . HOH B 2 .   ? 10.294 25.195 26.620 1.00 17.72 ? 387 HOH A O   1 
HETATM 1959 O O   . HOH B 2 .   ? 17.529 21.050 23.401 1.00 18.24 ? 388 HOH A O   1 
HETATM 1960 O O   . HOH B 2 .   ? 11.059 25.972 16.878 1.00 25.16 ? 389 HOH A O   1 
HETATM 1961 O O   . HOH B 2 .   ? 15.041 24.636 16.593 1.00 25.16 ? 390 HOH A O   1 
HETATM 1962 O O   . HOH B 2 .   ? 32.881 27.489 39.754 1.00 23.96 ? 391 HOH A O   1 
HETATM 1963 O O   . HOH B 2 .   ? 30.146 26.590 40.423 1.00 23.96 ? 392 HOH A O   1 
HETATM 1964 O O   . HOH B 2 .   ? 22.873 29.001 53.967 1.00 32.61 ? 393 HOH A O   1 
HETATM 1965 O O   . HOH B 2 .   ? 20.970 35.940 48.620 1.00 32.61 ? 394 HOH A O   1 
HETATM 1966 O O   . HOH B 2 .   ? 29.616 34.465 51.578 1.00 24.11 ? 395 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   LYS 3   3   3   LYS LYS A . n 
A 1 4   GLY 4   4   4   GLY GLY A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  GLY 10  10  10  GLY GLY A . n 
A 1 11  VAL 11  11  11  VAL VAL A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  PRO 13  13  13  PRO PRO A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  ASP 19  19  19  ASP ASP A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  ASN 23  23  23  ASN ASN A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  HIS 25  25  25  HIS HIS A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  PHE 27  27  27  PHE PHE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  THR 38  38  38  THR THR A . n 
A 1 39  TYR 39  39  39  TYR TYR A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  THR 43  43  43  THR THR A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  CYS 48  48  48  CYS CYS A . n 
A 1 49  THR 49  49  49  THR THR A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  TRP 57  57  57  TRP TRP A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  CRF 65  66  66  CRF CRF A . n 
A 1 66  VAL 66  68  68  VAL VAL A . n 
A 1 67  GLN 67  69  69  GLN GLN A . n 
A 1 68  CYS 68  70  70  CYS CYS A . n 
A 1 69  PHE 69  71  71  PHE PHE A . n 
A 1 70  SER 70  72  72  SER SER A . n 
A 1 71  ARG 71  73  73  ARG ARG A . n 
A 1 72  TYR 72  74  74  TYR TYR A . n 
A 1 73  PRO 73  75  75  PRO PRO A . n 
A 1 74  ASP 74  76  76  ASP ASP A . n 
A 1 75  HIS 75  77  77  HIS HIS A . n 
A 1 76  MET 76  78  78  MET MET A . n 
A 1 77  LYS 77  79  79  LYS LYS A . n 
A 1 78  ARG 78  80  80  ARG ARG A . n 
A 1 79  HIS 79  81  81  HIS HIS A . n 
A 1 80  ASP 80  82  82  ASP ASP A . n 
A 1 81  PHE 81  83  83  PHE PHE A . n 
A 1 82  PHE 82  84  84  PHE PHE A . n 
A 1 83  LYS 83  85  85  LYS LYS A . n 
A 1 84  SER 84  86  86  SER SER A . n 
A 1 85  ALA 85  87  87  ALA ALA A . n 
A 1 86  MET 86  88  88  MET MET A . n 
A 1 87  PRO 87  89  89  PRO PRO A . n 
A 1 88  GLU 88  90  90  GLU GLU A . n 
A 1 89  GLY 89  91  91  GLY GLY A . n 
A 1 90  TYR 90  92  92  TYR TYR A . n 
A 1 91  VAL 91  93  93  VAL VAL A . n 
A 1 92  GLN 92  94  94  GLN GLN A . n 
A 1 93  GLU 93  95  95  GLU GLU A . n 
A 1 94  ARG 94  96  96  ARG ARG A . n 
A 1 95  THR 95  97  97  THR THR A . n 
A 1 96  ILE 96  98  98  ILE ILE A . n 
A 1 97  PHE 97  99  99  PHE PHE A . n 
A 1 98  PHE 98  100 100 PHE PHE A . n 
A 1 99  LYS 99  101 101 LYS LYS A . n 
A 1 100 ASP 100 102 102 ASP ASP A . n 
A 1 101 ASP 101 103 103 ASP ASP A . n 
A 1 102 GLY 102 104 104 GLY GLY A . n 
A 1 103 ASN 103 105 105 ASN ASN A . n 
A 1 104 TYR 104 106 106 TYR TYR A . n 
A 1 105 LYS 105 107 107 LYS LYS A . n 
A 1 106 THR 106 108 108 THR THR A . n 
A 1 107 ARG 107 109 109 ARG ARG A . n 
A 1 108 ALA 108 110 110 ALA ALA A . n 
A 1 109 GLU 109 111 111 GLU GLU A . n 
A 1 110 VAL 110 112 112 VAL VAL A . n 
A 1 111 LYS 111 113 113 LYS LYS A . n 
A 1 112 PHE 112 114 114 PHE PHE A . n 
A 1 113 GLU 113 115 115 GLU GLU A . n 
A 1 114 GLY 114 116 116 GLY GLY A . n 
A 1 115 ASP 115 117 117 ASP ASP A . n 
A 1 116 THR 116 118 118 THR THR A . n 
A 1 117 LEU 117 119 119 LEU LEU A . n 
A 1 118 VAL 118 120 120 VAL VAL A . n 
A 1 119 ASN 119 121 121 ASN ASN A . n 
A 1 120 ARG 120 122 122 ARG ARG A . n 
A 1 121 ILE 121 123 123 ILE ILE A . n 
A 1 122 GLU 122 124 124 GLU GLU A . n 
A 1 123 LEU 123 125 125 LEU LEU A . n 
A 1 124 LYS 124 126 126 LYS LYS A . n 
A 1 125 GLY 125 127 127 GLY GLY A . n 
A 1 126 ILE 126 128 128 ILE ILE A . n 
A 1 127 ASP 127 129 129 ASP ASP A . n 
A 1 128 PHE 128 130 130 PHE PHE A . n 
A 1 129 LYS 129 131 131 LYS LYS A . n 
A 1 130 GLU 130 132 132 GLU GLU A . n 
A 1 131 ASP 131 133 133 ASP ASP A . n 
A 1 132 GLY 132 134 134 GLY GLY A . n 
A 1 133 ASN 133 135 135 ASN ASN A . n 
A 1 134 ILE 134 136 136 ILE ILE A . n 
A 1 135 LEU 135 137 137 LEU LEU A . n 
A 1 136 GLY 136 138 138 GLY GLY A . n 
A 1 137 HIS 137 139 139 HIS HIS A . n 
A 1 138 LYS 138 140 140 LYS LYS A . n 
A 1 139 LEU 139 141 141 LEU LEU A . n 
A 1 140 GLU 140 142 142 GLU GLU A . n 
A 1 141 TYR 141 143 143 TYR TYR A . n 
A 1 142 ASN 142 144 144 ASN ASN A . n 
A 1 143 TYR 143 145 145 TYR TYR A . n 
A 1 144 ILE 144 146 146 ILE ILE A . n 
A 1 145 SER 145 147 147 SER SER A . n 
A 1 146 HIS 146 148 148 HIS HIS A . n 
A 1 147 ASN 147 149 149 ASN ASN A . n 
A 1 148 VAL 148 150 150 VAL VAL A . n 
A 1 149 TYR 149 151 151 TYR TYR A . n 
A 1 150 ILE 150 152 152 ILE ILE A . n 
A 1 151 THR 151 153 153 THR THR A . n 
A 1 152 ALA 152 154 154 ALA ALA A . n 
A 1 153 ASP 153 155 155 ASP ASP A . n 
A 1 154 LYS 154 156 156 LYS LYS A . n 
A 1 155 GLN 155 157 157 GLN GLN A . n 
A 1 156 LYS 156 158 158 LYS LYS A . n 
A 1 157 ASN 157 159 159 ASN ASN A . n 
A 1 158 GLY 158 160 160 GLY GLY A . n 
A 1 159 ILE 159 161 161 ILE ILE A . n 
A 1 160 LYS 160 162 162 LYS LYS A . n 
A 1 161 ALA 161 163 163 ALA ALA A . n 
A 1 162 ASN 162 164 164 ASN ASN A . n 
A 1 163 PHE 163 165 165 PHE PHE A . n 
A 1 164 LYS 164 166 166 LYS LYS A . n 
A 1 165 ILE 165 167 167 ILE ILE A . n 
A 1 166 ARG 166 168 168 ARG ARG A . n 
A 1 167 HIS 167 169 169 HIS HIS A . n 
A 1 168 ASN 168 170 170 ASN ASN A . n 
A 1 169 ILE 169 171 171 ILE ILE A . n 
A 1 170 GLU 170 172 172 GLU GLU A . n 
A 1 171 ASP 171 173 173 ASP ASP A . n 
A 1 172 GLY 172 174 174 GLY GLY A . n 
A 1 173 SER 173 175 175 SER SER A . n 
A 1 174 VAL 174 176 176 VAL VAL A . n 
A 1 175 GLN 175 177 177 GLN GLN A . n 
A 1 176 LEU 176 178 178 LEU LEU A . n 
A 1 177 ALA 177 179 179 ALA ALA A . n 
A 1 178 ASP 178 180 180 ASP ASP A . n 
A 1 179 HIS 179 181 181 HIS HIS A . n 
A 1 180 TYR 180 182 182 TYR TYR A . n 
A 1 181 GLN 181 183 183 GLN GLN A . n 
A 1 182 GLN 182 184 184 GLN GLN A . n 
A 1 183 ASN 183 185 185 ASN ASN A . n 
A 1 184 THR 184 186 186 THR THR A . n 
A 1 185 PRO 185 187 187 PRO PRO A . n 
A 1 186 ILE 186 188 188 ILE ILE A . n 
A 1 187 GLY 187 189 189 GLY GLY A . n 
A 1 188 ASP 188 190 190 ASP ASP A . n 
A 1 189 GLY 189 191 191 GLY GLY A . n 
A 1 190 PRO 190 192 192 PRO PRO A . n 
A 1 191 VAL 191 193 193 VAL VAL A . n 
A 1 192 LEU 192 194 194 LEU LEU A . n 
A 1 193 LEU 193 195 195 LEU LEU A . n 
A 1 194 PRO 194 196 196 PRO PRO A . n 
A 1 195 ASP 195 197 197 ASP ASP A . n 
A 1 196 ASN 196 198 198 ASN ASN A . n 
A 1 197 HIS 197 199 199 HIS HIS A . n 
A 1 198 TYR 198 200 200 TYR TYR A . n 
A 1 199 LEU 199 201 201 LEU LEU A . n 
A 1 200 SER 200 202 202 SER SER A . n 
A 1 201 THR 201 203 203 THR THR A . n 
A 1 202 GLN 202 204 204 GLN GLN A . n 
A 1 203 SER 203 205 205 SER SER A . n 
A 1 204 ALA 204 206 206 ALA ALA A . n 
A 1 205 LEU 205 207 207 LEU LEU A . n 
A 1 206 SER 206 208 208 SER SER A . n 
A 1 207 LYS 207 209 209 LYS LYS A . n 
A 1 208 ASP 208 210 210 ASP ASP A . n 
A 1 209 PRO 209 211 211 PRO PRO A . n 
A 1 210 ASN 210 212 212 ASN ASN A . n 
A 1 211 GLU 211 213 213 GLU GLU A . n 
A 1 212 LYS 212 214 214 LYS LYS A . n 
A 1 213 ARG 213 215 215 ARG ARG A . n 
A 1 214 ASP 214 216 216 ASP ASP A . n 
A 1 215 HIS 215 217 217 HIS HIS A . n 
A 1 216 MET 216 218 218 MET MET A . n 
A 1 217 VAL 217 219 219 VAL VAL A . n 
A 1 218 LEU 218 220 220 LEU LEU A . n 
A 1 219 LEU 219 221 221 LEU LEU A . n 
A 1 220 GLU 220 222 222 GLU GLU A . n 
A 1 221 PHE 221 223 223 PHE PHE A . n 
A 1 222 VAL 222 224 224 VAL VAL A . n 
A 1 223 THR 223 225 225 THR THR A . n 
A 1 224 ALA 224 226 226 ALA ALA A . n 
A 1 225 ALA 225 227 227 ALA ALA A . n 
A 1 226 GLY 226 228 228 GLY GLY A . n 
A 1 227 ILE 227 229 229 ILE ILE A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   230 230 HOH HOH A . 
B 2 HOH 2   231 231 HOH HOH A . 
B 2 HOH 3   232 232 HOH HOH A . 
B 2 HOH 4   233 233 HOH HOH A . 
B 2 HOH 5   234 234 HOH HOH A . 
B 2 HOH 6   235 235 HOH HOH A . 
B 2 HOH 7   236 236 HOH HOH A . 
B 2 HOH 8   237 237 HOH HOH A . 
B 2 HOH 9   238 238 HOH HOH A . 
B 2 HOH 10  239 239 HOH HOH A . 
B 2 HOH 11  240 240 HOH HOH A . 
B 2 HOH 12  241 241 HOH HOH A . 
B 2 HOH 13  242 242 HOH HOH A . 
B 2 HOH 14  243 243 HOH HOH A . 
B 2 HOH 15  244 244 HOH HOH A . 
B 2 HOH 16  245 245 HOH HOH A . 
B 2 HOH 17  246 246 HOH HOH A . 
B 2 HOH 18  247 247 HOH HOH A . 
B 2 HOH 19  248 248 HOH HOH A . 
B 2 HOH 20  249 249 HOH HOH A . 
B 2 HOH 21  250 250 HOH HOH A . 
B 2 HOH 22  251 251 HOH HOH A . 
B 2 HOH 23  252 252 HOH HOH A . 
B 2 HOH 24  253 253 HOH HOH A . 
B 2 HOH 25  254 254 HOH HOH A . 
B 2 HOH 26  255 255 HOH HOH A . 
B 2 HOH 27  256 256 HOH HOH A . 
B 2 HOH 28  257 257 HOH HOH A . 
B 2 HOH 29  258 258 HOH HOH A . 
B 2 HOH 30  259 259 HOH HOH A . 
B 2 HOH 31  260 260 HOH HOH A . 
B 2 HOH 32  261 261 HOH HOH A . 
B 2 HOH 33  262 262 HOH HOH A . 
B 2 HOH 34  263 263 HOH HOH A . 
B 2 HOH 35  264 264 HOH HOH A . 
B 2 HOH 36  265 265 HOH HOH A . 
B 2 HOH 37  266 266 HOH HOH A . 
B 2 HOH 38  267 267 HOH HOH A . 
B 2 HOH 39  268 268 HOH HOH A . 
B 2 HOH 40  269 269 HOH HOH A . 
B 2 HOH 41  270 270 HOH HOH A . 
B 2 HOH 42  271 271 HOH HOH A . 
B 2 HOH 43  272 272 HOH HOH A . 
B 2 HOH 44  273 273 HOH HOH A . 
B 2 HOH 45  274 274 HOH HOH A . 
B 2 HOH 46  275 275 HOH HOH A . 
B 2 HOH 47  276 276 HOH HOH A . 
B 2 HOH 48  277 277 HOH HOH A . 
B 2 HOH 49  278 278 HOH HOH A . 
B 2 HOH 50  279 279 HOH HOH A . 
B 2 HOH 51  280 280 HOH HOH A . 
B 2 HOH 52  281 281 HOH HOH A . 
B 2 HOH 53  282 282 HOH HOH A . 
B 2 HOH 54  283 283 HOH HOH A . 
B 2 HOH 55  284 284 HOH HOH A . 
B 2 HOH 56  285 285 HOH HOH A . 
B 2 HOH 57  286 286 HOH HOH A . 
B 2 HOH 58  287 287 HOH HOH A . 
B 2 HOH 59  288 288 HOH HOH A . 
B 2 HOH 60  289 289 HOH HOH A . 
B 2 HOH 61  290 290 HOH HOH A . 
B 2 HOH 62  291 291 HOH HOH A . 
B 2 HOH 63  292 292 HOH HOH A . 
B 2 HOH 64  293 293 HOH HOH A . 
B 2 HOH 65  294 294 HOH HOH A . 
B 2 HOH 66  295 295 HOH HOH A . 
B 2 HOH 67  296 296 HOH HOH A . 
B 2 HOH 68  297 297 HOH HOH A . 
B 2 HOH 69  298 298 HOH HOH A . 
B 2 HOH 70  299 299 HOH HOH A . 
B 2 HOH 71  300 300 HOH HOH A . 
B 2 HOH 72  301 301 HOH HOH A . 
B 2 HOH 73  302 302 HOH HOH A . 
B 2 HOH 74  303 303 HOH HOH A . 
B 2 HOH 75  304 304 HOH HOH A . 
B 2 HOH 76  305 305 HOH HOH A . 
B 2 HOH 77  306 306 HOH HOH A . 
B 2 HOH 78  307 307 HOH HOH A . 
B 2 HOH 79  308 308 HOH HOH A . 
B 2 HOH 80  309 309 HOH HOH A . 
B 2 HOH 81  310 310 HOH HOH A . 
B 2 HOH 82  311 311 HOH HOH A . 
B 2 HOH 83  312 312 HOH HOH A . 
B 2 HOH 84  313 313 HOH HOH A . 
B 2 HOH 85  314 314 HOH HOH A . 
B 2 HOH 86  315 315 HOH HOH A . 
B 2 HOH 87  316 316 HOH HOH A . 
B 2 HOH 88  317 317 HOH HOH A . 
B 2 HOH 89  318 318 HOH HOH A . 
B 2 HOH 90  319 319 HOH HOH A . 
B 2 HOH 91  320 320 HOH HOH A . 
B 2 HOH 92  321 321 HOH HOH A . 
B 2 HOH 93  322 322 HOH HOH A . 
B 2 HOH 94  323 323 HOH HOH A . 
B 2 HOH 95  324 324 HOH HOH A . 
B 2 HOH 96  325 325 HOH HOH A . 
B 2 HOH 97  326 326 HOH HOH A . 
B 2 HOH 98  327 327 HOH HOH A . 
B 2 HOH 99  328 328 HOH HOH A . 
B 2 HOH 100 329 329 HOH HOH A . 
B 2 HOH 101 330 330 HOH HOH A . 
B 2 HOH 102 331 331 HOH HOH A . 
B 2 HOH 103 332 332 HOH HOH A . 
B 2 HOH 104 333 333 HOH HOH A . 
B 2 HOH 105 334 334 HOH HOH A . 
B 2 HOH 106 335 335 HOH HOH A . 
B 2 HOH 107 336 336 HOH HOH A . 
B 2 HOH 108 337 337 HOH HOH A . 
B 2 HOH 109 338 338 HOH HOH A . 
B 2 HOH 110 339 339 HOH HOH A . 
B 2 HOH 111 340 340 HOH HOH A . 
B 2 HOH 112 341 341 HOH HOH A . 
B 2 HOH 113 342 342 HOH HOH A . 
B 2 HOH 114 343 343 HOH HOH A . 
B 2 HOH 115 344 344 HOH HOH A . 
B 2 HOH 116 345 345 HOH HOH A . 
B 2 HOH 117 346 346 HOH HOH A . 
B 2 HOH 118 347 347 HOH HOH A . 
B 2 HOH 119 348 348 HOH HOH A . 
B 2 HOH 120 349 349 HOH HOH A . 
B 2 HOH 121 350 350 HOH HOH A . 
B 2 HOH 122 351 351 HOH HOH A . 
B 2 HOH 123 352 352 HOH HOH A . 
B 2 HOH 124 353 353 HOH HOH A . 
B 2 HOH 125 354 354 HOH HOH A . 
B 2 HOH 126 355 355 HOH HOH A . 
B 2 HOH 127 356 356 HOH HOH A . 
B 2 HOH 128 357 357 HOH HOH A . 
B 2 HOH 129 358 358 HOH HOH A . 
B 2 HOH 130 359 359 HOH HOH A . 
B 2 HOH 131 360 360 HOH HOH A . 
B 2 HOH 132 361 361 HOH HOH A . 
B 2 HOH 133 362 362 HOH HOH A . 
B 2 HOH 134 363 363 HOH HOH A . 
B 2 HOH 135 364 364 HOH HOH A . 
B 2 HOH 136 365 365 HOH HOH A . 
B 2 HOH 137 366 366 HOH HOH A . 
B 2 HOH 138 367 367 HOH HOH A . 
B 2 HOH 139 368 368 HOH HOH A . 
B 2 HOH 140 369 369 HOH HOH A . 
B 2 HOH 141 370 370 HOH HOH A . 
B 2 HOH 142 371 371 HOH HOH A . 
B 2 HOH 143 372 372 HOH HOH A . 
B 2 HOH 144 373 373 HOH HOH A . 
B 2 HOH 145 374 374 HOH HOH A . 
B 2 HOH 146 375 375 HOH HOH A . 
B 2 HOH 147 376 376 HOH HOH A . 
B 2 HOH 148 377 377 HOH HOH A . 
B 2 HOH 149 378 378 HOH HOH A . 
B 2 HOH 150 379 379 HOH HOH A . 
B 2 HOH 151 380 380 HOH HOH A . 
B 2 HOH 152 381 381 HOH HOH A . 
B 2 HOH 153 382 382 HOH HOH A . 
B 2 HOH 154 383 383 HOH HOH A . 
B 2 HOH 155 384 384 HOH HOH A . 
B 2 HOH 156 385 385 HOH HOH A . 
B 2 HOH 157 386 386 HOH HOH A . 
B 2 HOH 158 387 387 HOH HOH A . 
B 2 HOH 159 388 388 HOH HOH A . 
B 2 HOH 160 389 389 HOH HOH A . 
B 2 HOH 161 390 390 HOH HOH A . 
B 2 HOH 162 391 391 HOH HOH A . 
B 2 HOH 163 392 392 HOH HOH A . 
B 2 HOH 164 393 393 HOH HOH A . 
B 2 HOH 165 394 394 HOH HOH A . 
B 2 HOH 166 395 395 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A CRF 65 A CRF 66 ? THR ? 
2 A CRF 65 A CRF 66 ? TRP ? 
3 A CRF 65 A CRF 66 ? GLY ? 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-12-02 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2011-09-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Non-polymer description'   
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
CNS       phasing          .   ? 4 
# 
_pdbx_entry_details.entry_id             1OXD 
_pdbx_entry_details.sequence_details     
;RESIDUES 65THR, 66TRP AND 67GLY ARE                          
MODIFIED TO MAKE THE CHROMOPHORE CRF66
;
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASP 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     103 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -150.64 
_pdbx_validate_torsion.psi             -157.76 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 132 ? CG  ? A GLU 130 CG  
2  1 Y 1 A GLU 132 ? CD  ? A GLU 130 CD  
3  1 Y 1 A GLU 132 ? OE1 ? A GLU 130 OE1 
4  1 Y 1 A GLU 132 ? OE2 ? A GLU 130 OE2 
5  1 Y 1 A ASP 133 ? CG  ? A ASP 131 CG  
6  1 Y 1 A ASP 133 ? OD1 ? A ASP 131 OD1 
7  1 Y 1 A ASP 133 ? OD2 ? A ASP 131 OD2 
8  1 Y 1 A LYS 156 ? CG  ? A LYS 154 CG  
9  1 Y 1 A LYS 156 ? CD  ? A LYS 154 CD  
10 1 Y 1 A LYS 156 ? CE  ? A LYS 154 CE  
11 1 Y 1 A LYS 156 ? NZ  ? A LYS 154 NZ  
12 1 Y 1 A GLN 157 ? CG  ? A GLN 155 CG  
13 1 Y 1 A GLN 157 ? CD  ? A GLN 155 CD  
14 1 Y 1 A GLN 157 ? OE1 ? A GLN 155 OE1 
15 1 Y 1 A GLN 157 ? NE2 ? A GLN 155 NE2 
16 1 Y 1 A LYS 158 ? CG  ? A LYS 156 CG  
17 1 Y 1 A LYS 158 ? CD  ? A LYS 156 CD  
18 1 Y 1 A LYS 158 ? CE  ? A LYS 156 CE  
19 1 Y 1 A LYS 158 ? NZ  ? A LYS 156 NZ  
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#