data_1P8J
# 
_entry.id   1P8J 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1P8J         
RCSB  RCSB019141   
WWPDB D_1000019141 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1P8J 
_pdbx_database_status.recvd_initial_deposition_date   2003-05-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Henrich, S.'     1 
'Cameron, A.'     2 
'Bourenkov, G.P.' 3 
'Kiefersauer, R.' 4 
'Huber, R.'       5 
'Lindberg, I.'    6 
'Bode, W.'        7 
'Than, M.E.'      8 
# 
_citation.id                        primary 
_citation.title                     
'The Crystal Structure of the Proprotein Processing Proteinase Furin Explains its Stringent Specificity' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            10 
_citation.page_first                520 
_citation.page_last                 526 
_citation.year                      2003 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12794637 
_citation.pdbx_database_id_DOI      10.1038/nsb941 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Henrich, S.'     1 ? 
primary 'Cameron, A.'     2 ? 
primary 'Bourenkov, G.P.' 3 ? 
primary 'Kiefersauer, R.' 4 ? 
primary 'Huber, R.'       5 ? 
primary 'Lindberg, I.'    6 ? 
primary 'Bode, W.'        7 ? 
primary 'Than, M.E.'      8 ? 
# 
_cell.entry_id           1P8J 
_cell.length_a           93.305 
_cell.length_b           135.392 
_cell.length_c           137.806 
_cell.angle_alpha        103.56 
_cell.angle_beta         98.98 
_cell.angle_gamma        107.09 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1P8J 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Furin precursor' 51151.336 8    3.4.21.75 ? ? ? 
2 polymer     syn 'DECANOYL-ARG-VAL-LYS-ARG-CHLOROMETHYLKETONE INHIBITOR' 749.452   8    ?         ? ? ? 
3 branched    man 
;beta-D-galactopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-2)-[beta-D-galactopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)]alpha-D-mannopyranose-(1-3)-[2-acetamido-2-deoxy-beta-D-glucopyranose-(1-2)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[beta-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose
;
1990.824  1    ?         ? ? ? 
4 branched    man 
;beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose
;
732.682   1    ?         ? ? ? 
5 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   6    ?         ? ? ? 
6 non-polymer syn 'CALCIUM ION' 40.078    16   ?         ? ? ? 
7 non-polymer syn 'SULFATE ION' 96.063    70   ?         ? ? ? 
8 water       nat water 18.015    2305 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Paired basic amino acid residue cleaving enzyme, PACE, Dibasic processing enzyme' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;DVYQEPTDPKFPQQWYLSGVTQRDLNVKEAWAQGFTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYT
QMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPA
RLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQN
EKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNADDWATNGVGRKVSHSYGYG
LLDAGAMVALAQNWTTVAPQRKCIVEILVEPKDIGKRLEVRKAVTACLGEPNHITRLEHVQARLTLSYNRRGDLAIHLIS
PMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPAGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGL
;
;DVYQEPTDPKFPQQWYLSGVTQRDLNVKEAWAQGFTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYT
QMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPA
RLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQN
EKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNADDWATNGVGRKVSHSYGYG
LLDAGAMVALAQNWTTVAPQRKCIVEILVEPKDIGKRLEVRKAVTACLGEPNHITRLEHVQARLTLSYNRRGDLAIHLIS
PMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPAGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGL
;
A,B,C,D,E,F,G,H ? 
2 'polypeptide(L)' no yes '(DKA)RVK(AR7)(0QE)' XRVKRX J,K,L,M,N,P,Q,R ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   VAL n 
1 3   TYR n 
1 4   GLN n 
1 5   GLU n 
1 6   PRO n 
1 7   THR n 
1 8   ASP n 
1 9   PRO n 
1 10  LYS n 
1 11  PHE n 
1 12  PRO n 
1 13  GLN n 
1 14  GLN n 
1 15  TRP n 
1 16  TYR n 
1 17  LEU n 
1 18  SER n 
1 19  GLY n 
1 20  VAL n 
1 21  THR n 
1 22  GLN n 
1 23  ARG n 
1 24  ASP n 
1 25  LEU n 
1 26  ASN n 
1 27  VAL n 
1 28  LYS n 
1 29  GLU n 
1 30  ALA n 
1 31  TRP n 
1 32  ALA n 
1 33  GLN n 
1 34  GLY n 
1 35  PHE n 
1 36  THR n 
1 37  GLY n 
1 38  HIS n 
1 39  GLY n 
1 40  ILE n 
1 41  VAL n 
1 42  VAL n 
1 43  SER n 
1 44  ILE n 
1 45  LEU n 
1 46  ASP n 
1 47  ASP n 
1 48  GLY n 
1 49  ILE n 
1 50  GLU n 
1 51  LYS n 
1 52  ASN n 
1 53  HIS n 
1 54  PRO n 
1 55  ASP n 
1 56  LEU n 
1 57  ALA n 
1 58  GLY n 
1 59  ASN n 
1 60  TYR n 
1 61  ASP n 
1 62  PRO n 
1 63  GLY n 
1 64  ALA n 
1 65  SER n 
1 66  PHE n 
1 67  ASP n 
1 68  VAL n 
1 69  ASN n 
1 70  ASP n 
1 71  GLN n 
1 72  ASP n 
1 73  PRO n 
1 74  ASP n 
1 75  PRO n 
1 76  GLN n 
1 77  PRO n 
1 78  ARG n 
1 79  TYR n 
1 80  THR n 
1 81  GLN n 
1 82  MET n 
1 83  ASN n 
1 84  ASP n 
1 85  ASN n 
1 86  ARG n 
1 87  HIS n 
1 88  GLY n 
1 89  THR n 
1 90  ARG n 
1 91  CYS n 
1 92  ALA n 
1 93  GLY n 
1 94  GLU n 
1 95  VAL n 
1 96  ALA n 
1 97  ALA n 
1 98  VAL n 
1 99  ALA n 
1 100 ASN n 
1 101 ASN n 
1 102 GLY n 
1 103 VAL n 
1 104 CYS n 
1 105 GLY n 
1 106 VAL n 
1 107 GLY n 
1 108 VAL n 
1 109 ALA n 
1 110 TYR n 
1 111 ASN n 
1 112 ALA n 
1 113 ARG n 
1 114 ILE n 
1 115 GLY n 
1 116 GLY n 
1 117 VAL n 
1 118 ARG n 
1 119 MET n 
1 120 LEU n 
1 121 ASP n 
1 122 GLY n 
1 123 GLU n 
1 124 VAL n 
1 125 THR n 
1 126 ASP n 
1 127 ALA n 
1 128 VAL n 
1 129 GLU n 
1 130 ALA n 
1 131 ARG n 
1 132 SER n 
1 133 LEU n 
1 134 GLY n 
1 135 LEU n 
1 136 ASN n 
1 137 PRO n 
1 138 ASN n 
1 139 HIS n 
1 140 ILE n 
1 141 HIS n 
1 142 ILE n 
1 143 TYR n 
1 144 SER n 
1 145 ALA n 
1 146 SER n 
1 147 TRP n 
1 148 GLY n 
1 149 PRO n 
1 150 GLU n 
1 151 ASP n 
1 152 ASP n 
1 153 GLY n 
1 154 LYS n 
1 155 THR n 
1 156 VAL n 
1 157 ASP n 
1 158 GLY n 
1 159 PRO n 
1 160 ALA n 
1 161 ARG n 
1 162 LEU n 
1 163 ALA n 
1 164 GLU n 
1 165 GLU n 
1 166 ALA n 
1 167 PHE n 
1 168 PHE n 
1 169 ARG n 
1 170 GLY n 
1 171 VAL n 
1 172 SER n 
1 173 GLN n 
1 174 GLY n 
1 175 ARG n 
1 176 GLY n 
1 177 GLY n 
1 178 LEU n 
1 179 GLY n 
1 180 SER n 
1 181 ILE n 
1 182 PHE n 
1 183 VAL n 
1 184 TRP n 
1 185 ALA n 
1 186 SER n 
1 187 GLY n 
1 188 ASN n 
1 189 GLY n 
1 190 GLY n 
1 191 ARG n 
1 192 GLU n 
1 193 HIS n 
1 194 ASP n 
1 195 SER n 
1 196 CYS n 
1 197 ASN n 
1 198 CYS n 
1 199 ASP n 
1 200 GLY n 
1 201 TYR n 
1 202 THR n 
1 203 ASN n 
1 204 SER n 
1 205 ILE n 
1 206 TYR n 
1 207 THR n 
1 208 LEU n 
1 209 SER n 
1 210 ILE n 
1 211 SER n 
1 212 SER n 
1 213 ALA n 
1 214 THR n 
1 215 GLN n 
1 216 PHE n 
1 217 GLY n 
1 218 ASN n 
1 219 VAL n 
1 220 PRO n 
1 221 TRP n 
1 222 TYR n 
1 223 SER n 
1 224 GLU n 
1 225 ALA n 
1 226 CYS n 
1 227 SER n 
1 228 SER n 
1 229 THR n 
1 230 LEU n 
1 231 ALA n 
1 232 THR n 
1 233 THR n 
1 234 TYR n 
1 235 SER n 
1 236 SER n 
1 237 GLY n 
1 238 ASN n 
1 239 GLN n 
1 240 ASN n 
1 241 GLU n 
1 242 LYS n 
1 243 GLN n 
1 244 ILE n 
1 245 VAL n 
1 246 THR n 
1 247 THR n 
1 248 ASP n 
1 249 LEU n 
1 250 ARG n 
1 251 GLN n 
1 252 LYS n 
1 253 CYS n 
1 254 THR n 
1 255 GLU n 
1 256 SER n 
1 257 HIS n 
1 258 THR n 
1 259 GLY n 
1 260 THR n 
1 261 SER n 
1 262 ALA n 
1 263 SER n 
1 264 ALA n 
1 265 PRO n 
1 266 LEU n 
1 267 ALA n 
1 268 ALA n 
1 269 GLY n 
1 270 ILE n 
1 271 ILE n 
1 272 ALA n 
1 273 LEU n 
1 274 THR n 
1 275 LEU n 
1 276 GLU n 
1 277 ALA n 
1 278 ASN n 
1 279 LYS n 
1 280 ASN n 
1 281 LEU n 
1 282 THR n 
1 283 TRP n 
1 284 ARG n 
1 285 ASP n 
1 286 MET n 
1 287 GLN n 
1 288 HIS n 
1 289 LEU n 
1 290 VAL n 
1 291 VAL n 
1 292 GLN n 
1 293 THR n 
1 294 SER n 
1 295 LYS n 
1 296 PRO n 
1 297 ALA n 
1 298 HIS n 
1 299 LEU n 
1 300 ASN n 
1 301 ALA n 
1 302 ASP n 
1 303 ASP n 
1 304 TRP n 
1 305 ALA n 
1 306 THR n 
1 307 ASN n 
1 308 GLY n 
1 309 VAL n 
1 310 GLY n 
1 311 ARG n 
1 312 LYS n 
1 313 VAL n 
1 314 SER n 
1 315 HIS n 
1 316 SER n 
1 317 TYR n 
1 318 GLY n 
1 319 TYR n 
1 320 GLY n 
1 321 LEU n 
1 322 LEU n 
1 323 ASP n 
1 324 ALA n 
1 325 GLY n 
1 326 ALA n 
1 327 MET n 
1 328 VAL n 
1 329 ALA n 
1 330 LEU n 
1 331 ALA n 
1 332 GLN n 
1 333 ASN n 
1 334 TRP n 
1 335 THR n 
1 336 THR n 
1 337 VAL n 
1 338 ALA n 
1 339 PRO n 
1 340 GLN n 
1 341 ARG n 
1 342 LYS n 
1 343 CYS n 
1 344 ILE n 
1 345 VAL n 
1 346 GLU n 
1 347 ILE n 
1 348 LEU n 
1 349 VAL n 
1 350 GLU n 
1 351 PRO n 
1 352 LYS n 
1 353 ASP n 
1 354 ILE n 
1 355 GLY n 
1 356 LYS n 
1 357 ARG n 
1 358 LEU n 
1 359 GLU n 
1 360 VAL n 
1 361 ARG n 
1 362 LYS n 
1 363 ALA n 
1 364 VAL n 
1 365 THR n 
1 366 ALA n 
1 367 CYS n 
1 368 LEU n 
1 369 GLY n 
1 370 GLU n 
1 371 PRO n 
1 372 ASN n 
1 373 HIS n 
1 374 ILE n 
1 375 THR n 
1 376 ARG n 
1 377 LEU n 
1 378 GLU n 
1 379 HIS n 
1 380 VAL n 
1 381 GLN n 
1 382 ALA n 
1 383 ARG n 
1 384 LEU n 
1 385 THR n 
1 386 LEU n 
1 387 SER n 
1 388 TYR n 
1 389 ASN n 
1 390 ARG n 
1 391 ARG n 
1 392 GLY n 
1 393 ASP n 
1 394 LEU n 
1 395 ALA n 
1 396 ILE n 
1 397 HIS n 
1 398 LEU n 
1 399 ILE n 
1 400 SER n 
1 401 PRO n 
1 402 MET n 
1 403 GLY n 
1 404 THR n 
1 405 ARG n 
1 406 SER n 
1 407 THR n 
1 408 LEU n 
1 409 LEU n 
1 410 ALA n 
1 411 ALA n 
1 412 ARG n 
1 413 PRO n 
1 414 HIS n 
1 415 ASP n 
1 416 TYR n 
1 417 SER n 
1 418 ALA n 
1 419 ASP n 
1 420 GLY n 
1 421 PHE n 
1 422 ASN n 
1 423 ASP n 
1 424 TRP n 
1 425 ALA n 
1 426 PHE n 
1 427 MET n 
1 428 THR n 
1 429 THR n 
1 430 HIS n 
1 431 SER n 
1 432 TRP n 
1 433 ASP n 
1 434 GLU n 
1 435 ASP n 
1 436 PRO n 
1 437 ALA n 
1 438 GLY n 
1 439 GLU n 
1 440 TRP n 
1 441 VAL n 
1 442 LEU n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 ASN n 
1 447 THR n 
1 448 SER n 
1 449 GLU n 
1 450 ALA n 
1 451 ASN n 
1 452 ASN n 
1 453 TYR n 
1 454 GLY n 
1 455 THR n 
1 456 LEU n 
1 457 THR n 
1 458 LYS n 
1 459 PHE n 
1 460 THR n 
1 461 LEU n 
1 462 VAL n 
1 463 LEU n 
1 464 TYR n 
1 465 GLY n 
1 466 THR n 
1 467 ALA n 
1 468 PRO n 
1 469 GLU n 
1 470 GLY n 
1 471 LEU n 
2 1   DKA n 
2 2   ARG n 
2 3   VAL n 
2 4   LYS n 
2 5   AR7 n 
2 6   0QE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 'FURIN OR FUR OR PCSK3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'Chinese hamster' 
_entity_src_gen.pdbx_host_org_scientific_name      'Cricetulus griseus' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10029 
_entity_src_gen.host_org_genus                     Cricetulus 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                'Ovary cells' 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               DG44 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pcDNA3.1(-)-Myc-His' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'THe peptide (decanoyl-Arg-Val-Lys-Arg-chloromethylketone) was chemically synthesized' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP FURI_MOUSE P23188 1 
;DVYQEPTDPKFPQQWYLSGVTQRDLNVKEAWAQGFTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYT
QMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPA
RLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQN
EKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNADDWATNGVGRKVSHSYGYG
LLDAGAMVALAQNWTTVAPQRKCIVEILVEPKDIGKRLEVRKAVTACLGEPNHITRLEHVQARLTLSYNRRGDLAIHLIS
PMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPAGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGL
;
108 ? 
2 PDB 1P8J       1P8J   2 '(DKA)RVKR(0QE)' 1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1P8J A 1 ? 471 ? P23188 108 ? 578 ? 108 578 
2  1 1P8J B 1 ? 471 ? P23188 108 ? 578 ? 108 578 
3  1 1P8J C 1 ? 471 ? P23188 108 ? 578 ? 108 578 
4  1 1P8J D 1 ? 471 ? P23188 108 ? 578 ? 108 578 
5  1 1P8J E 1 ? 471 ? P23188 108 ? 578 ? 108 578 
6  1 1P8J F 1 ? 471 ? P23188 108 ? 578 ? 108 578 
7  1 1P8J G 1 ? 471 ? P23188 108 ? 578 ? 108 578 
8  1 1P8J H 1 ? 471 ? P23188 108 ? 578 ? 108 578 
9  2 1P8J J 1 ? 6   ? 1P8J   801 ? 806 ? 801 806 
10 2 1P8J K 1 ? 6   ? 1P8J   801 ? 806 ? 801 806 
11 2 1P8J L 1 ? 6   ? 1P8J   801 ? 806 ? 801 806 
12 2 1P8J M 1 ? 6   ? 1P8J   801 ? 806 ? 801 806 
13 2 1P8J N 1 ? 6   ? 1P8J   801 ? 806 ? 801 806 
14 2 1P8J P 1 ? 6   ? 1P8J   801 ? 806 ? 801 806 
15 2 1P8J Q 1 ? 6   ? 1P8J   801 ? 806 ? 801 806 
16 2 1P8J R 1 ? 6   ? 1P8J   801 ? 806 ? 801 806 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
0QE non-polymer                   . chloromethane                                                 'Chloro Methyl group'    
'C H3 Cl'        50.488  
ALA 'L-peptide linking'           y ALANINE                                                       ?                        
'C3 H7 N O2'     89.093  
AR7 peptide-like                  n 'amino{[(4S)-4-amino-5,5-dihydroxypentyl]amino}methaniminium' ?                        
'C6 H17 N4 O2 1' 177.225 
ARG 'L-peptide linking'           y ARGININE                                                      ?                        
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                                    ?                        
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                               ?                        
'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                                          ?                        
'C6 H12 O6'      180.156 
CA  non-polymer                   . 'CALCIUM ION'                                                 ?                        'Ca 2' 
40.078  
CYS 'L-peptide linking'           y CYSTEINE                                                      ?                        
'C3 H7 N O2 S'   121.158 
DKA non-polymer                   . 'DECANOIC ACID'                                               ?                        
'C10 H20 O2'     172.265 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                                          ?                        
'C6 H12 O5'      164.156 
FUL 'L-saccharide, beta linking'  . beta-L-fucopyranose                                           6-DEOXY-BETA-L-GALACTOSE 
'C6 H12 O5'      164.156 
GAL 'D-saccharide, beta linking'  . beta-D-galactopyranose                                        ?                        
'C6 H12 O6'      180.156 
GLN 'L-peptide linking'           y GLUTAMINE                                                     ?                        
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                               ?                        
'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                                       ?                        
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                                     ?                        
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                                         ?                        'H2 O' 
18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                                    ?                        
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                                       ?                        
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                                        ?                        
'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                                         ?                        
'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE                                                    ?                        
'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose                      ?                        
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                                                 ?                        
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                                       ?                        
'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                                        ?                        
'C3 H7 N O3'     105.093 
SO4 non-polymer                   . 'SULFATE ION'                                                 ?                        
'O4 S -2'        96.063  
THR 'L-peptide linking'           y THREONINE                                                     ?                        
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                                    ?                        
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                                      ?                        
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                                        ?                        
'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1P8J 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.78 
_exptl_crystal.density_percent_sol   67.46 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'1.0M (NH4)2SO4, 0.4M Li2SO4, 0.1M Na3Citrate, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2001-07-28 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111) double crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.05 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MPG/DESY, HAMBURG BEAMLINE BW6' 
_diffrn_source.pdbx_synchrotron_site       'MPG/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   BW6 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.05 
# 
_reflns.entry_id                     1P8J 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             18.83 
_reflns.d_resolution_high            2.60 
_reflns.number_obs                   182735 
_reflns.number_all                   182735 
_reflns.percent_possible_obs         97.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.1 
_reflns.pdbx_netI_over_sigmaI        5.2 
_reflns.B_iso_Wilson_estimate        27.4 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.74 
_reflns_shell.percent_possible_all   97.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.347 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1P8J 
_refine.ls_number_reflns_obs                     182726 
_refine.ls_number_reflns_all                     182735 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               1894579.24 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           1894579.24 
_refine.ls_d_res_low                             18.82 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    97.9 
_refine.ls_R_factor_obs                          0.188 
_refine.ls_R_factor_all                          0.188 
_refine.ls_R_factor_R_work                       0.188 
_refine.ls_R_factor_R_free                       0.219 
_refine.ls_R_factor_R_free_error                 0.002 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  9564 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               21.3 
_refine.aniso_B[1][1]                            1.35 
_refine.aniso_B[2][2]                            -1.67 
_refine.aniso_B[3][3]                            0.32 
_refine.aniso_B[1][2]                            1.49 
_refine.aniso_B[1][3]                            3.37 
_refine.aniso_B[2][3]                            3.13 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.326073 
_refine.solvent_model_param_bsol                 31.8965 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;waters 1-8: potential third calcium binding-site
(identical to the suggest Ca401 binding site in subtilisin
Carlsberg, 1CSE)
waters 9-14: potential ion binding-site with low B factors
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            SHELLS 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1P8J 
_refine_analyze.Luzzati_coordinate_error_obs    0.27 
_refine_analyze.Luzzati_sigma_a_obs             0.34 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.32 
_refine_analyze.Luzzati_sigma_a_free            0.41 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        28984 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         634 
_refine_hist.number_atoms_solvent             2305 
_refine_hist.number_atoms_total               31923 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        18.82 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 25.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.82  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.02  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.66  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.71  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.57  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.60 
_refine_ls_shell.d_res_low                        2.76 
_refine_ls_shell.number_reflns_R_work             29128 
_refine_ls_shell.R_factor_R_work                  0.264 
_refine_ls_shell.percent_reflns_obs               97.2 
_refine_ls_shell.R_factor_R_free                  0.31 
_refine_ls_shell.R_factor_R_free_error            0.010 
_refine_ls_shell.percent_reflns_R_free            3.5 
_refine_ls_shell.number_reflns_R_free             1056 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM  PROTEIN.TOP      'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM    WATER.TOP        'X-RAY DIFFRACTION' 
3 MY_ION.PARAM       CARBOHYDRATE.TOP 'X-RAY DIFFRACTION' 
4 CARBOHYDRATE.PARAM MY_ION.TOP       'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1P8J 
_struct.title                     'CRYSTAL STRUCTURE OF THE PROPROTEIN CONVERTASE FURIN' 
_struct.pdbx_descriptor           'Furin (E.C.3.4.21.75)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1P8J 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            
'PROHORMONE CONVERTASE, SPC1, PACE, P-DOMAIN, CHLOROMETHYLKETONE, HYDROLASE-HYDROLASE INHIBITOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 2 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 2 ? 
Q  N N 3 ? 
R  N N 4 ? 
S  N N 5 ? 
T  N N 6 ? 
U  N N 6 ? 
V  N N 7 ? 
W  N N 7 ? 
X  N N 7 ? 
Y  N N 7 ? 
Z  N N 7 ? 
AA N N 7 ? 
BA N N 7 ? 
CA N N 7 ? 
DA N N 7 ? 
EA N N 7 ? 
FA N N 7 ? 
GA N N 5 ? 
HA N N 6 ? 
IA N N 6 ? 
JA N N 7 ? 
KA N N 7 ? 
LA N N 7 ? 
MA N N 7 ? 
NA N N 7 ? 
OA N N 7 ? 
PA N N 6 ? 
QA N N 6 ? 
RA N N 7 ? 
SA N N 7 ? 
TA N N 7 ? 
UA N N 7 ? 
VA N N 7 ? 
WA N N 7 ? 
XA N N 6 ? 
YA N N 6 ? 
ZA N N 7 ? 
AB N N 7 ? 
BB N N 7 ? 
CB N N 7 ? 
DB N N 7 ? 
EB N N 7 ? 
FB N N 7 ? 
GB N N 7 ? 
HB N N 7 ? 
IB N N 5 ? 
JB N N 6 ? 
KB N N 6 ? 
LB N N 7 ? 
MB N N 7 ? 
NB N N 7 ? 
OB N N 7 ? 
PB N N 7 ? 
QB N N 7 ? 
RB N N 7 ? 
SB N N 7 ? 
TB N N 7 ? 
UB N N 5 ? 
VB N N 5 ? 
WB N N 6 ? 
XB N N 6 ? 
YB N N 7 ? 
ZB N N 7 ? 
AC N N 7 ? 
BC N N 7 ? 
CC N N 7 ? 
DC N N 7 ? 
EC N N 7 ? 
FC N N 7 ? 
GC N N 7 ? 
HC N N 6 ? 
IC N N 6 ? 
JC N N 7 ? 
KC N N 7 ? 
LC N N 7 ? 
MC N N 7 ? 
NC N N 7 ? 
OC N N 7 ? 
PC N N 5 ? 
QC N N 6 ? 
RC N N 6 ? 
SC N N 7 ? 
TC N N 7 ? 
UC N N 7 ? 
VC N N 7 ? 
WC N N 7 ? 
XC N N 7 ? 
YC N N 7 ? 
ZC N N 7 ? 
AD N N 7 ? 
BD N N 7 ? 
CD N N 7 ? 
DD N N 7 ? 
ED N N 7 ? 
FD N N 7 ? 
GD N N 8 ? 
HD N N 8 ? 
ID N N 8 ? 
JD N N 8 ? 
KD N N 8 ? 
LD N N 8 ? 
MD N N 8 ? 
ND N N 8 ? 
OD N N 8 ? 
PD N N 8 ? 
QD N N 8 ? 
RD N N 8 ? 
SD N N 8 ? 
TD N N 8 ? 
UD N N 8 ? 
VD N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 27  ? GLN A 33  ? VAL A 134 GLN A 140 1 ? 7  
HELX_P HELX_P2  2  ARG A 86  ? ALA A 96  ? ARG A 193 ALA A 203 1 ? 11 
HELX_P HELX_P3  3  THR A 125 ? GLY A 134 ? THR A 232 GLY A 241 1 ? 10 
HELX_P HELX_P4  4  ALA A 160 ? GLY A 174 ? ALA A 267 GLY A 281 1 ? 15 
HELX_P HELX_P5  5  GLY A 259 ? ASN A 278 ? GLY A 366 ASN A 385 1 ? 20 
HELX_P HELX_P6  6  TRP A 283 ? THR A 293 ? TRP A 390 THR A 400 1 ? 11 
HELX_P HELX_P7  7  ASP A 323 ? GLN A 332 ? ASP A 430 GLN A 439 1 ? 10 
HELX_P HELX_P8  8  VAL B 27  ? GLN B 33  ? VAL B 134 GLN B 140 1 ? 7  
HELX_P HELX_P9  9  ARG B 86  ? ALA B 96  ? ARG B 193 ALA B 203 1 ? 11 
HELX_P HELX_P10 10 THR B 125 ? GLY B 134 ? THR B 232 GLY B 241 1 ? 10 
HELX_P HELX_P11 11 ALA B 160 ? GLY B 174 ? ALA B 267 GLY B 281 1 ? 15 
HELX_P HELX_P12 12 GLY B 259 ? ASN B 278 ? GLY B 366 ASN B 385 1 ? 20 
HELX_P HELX_P13 13 TRP B 283 ? THR B 293 ? TRP B 390 THR B 400 1 ? 11 
HELX_P HELX_P14 14 ASP B 323 ? GLN B 332 ? ASP B 430 GLN B 439 1 ? 10 
HELX_P HELX_P15 15 VAL C 27  ? GLN C 33  ? VAL C 134 GLN C 140 1 ? 7  
HELX_P HELX_P16 16 ARG C 86  ? ALA C 96  ? ARG C 193 ALA C 203 1 ? 11 
HELX_P HELX_P17 17 THR C 125 ? GLY C 134 ? THR C 232 GLY C 241 1 ? 10 
HELX_P HELX_P18 18 ALA C 160 ? GLY C 174 ? ALA C 267 GLY C 281 1 ? 15 
HELX_P HELX_P19 19 GLY C 259 ? ASN C 278 ? GLY C 366 ASN C 385 1 ? 20 
HELX_P HELX_P20 20 TRP C 283 ? THR C 293 ? TRP C 390 THR C 400 1 ? 11 
HELX_P HELX_P21 21 ASP C 323 ? GLN C 332 ? ASP C 430 GLN C 439 1 ? 10 
HELX_P HELX_P22 22 VAL D 27  ? GLN D 33  ? VAL D 134 GLN D 140 1 ? 7  
HELX_P HELX_P23 23 ARG D 86  ? ALA D 96  ? ARG D 193 ALA D 203 1 ? 11 
HELX_P HELX_P24 24 THR D 125 ? GLY D 134 ? THR D 232 GLY D 241 1 ? 10 
HELX_P HELX_P25 25 ALA D 160 ? GLY D 174 ? ALA D 267 GLY D 281 1 ? 15 
HELX_P HELX_P26 26 GLY D 259 ? ASN D 278 ? GLY D 366 ASN D 385 1 ? 20 
HELX_P HELX_P27 27 TRP D 283 ? THR D 293 ? TRP D 390 THR D 400 1 ? 11 
HELX_P HELX_P28 28 ASP D 323 ? GLN D 332 ? ASP D 430 GLN D 439 1 ? 10 
HELX_P HELX_P29 29 VAL E 27  ? GLN E 33  ? VAL E 134 GLN E 140 1 ? 7  
HELX_P HELX_P30 30 ARG E 86  ? ALA E 96  ? ARG E 193 ALA E 203 1 ? 11 
HELX_P HELX_P31 31 THR E 125 ? GLY E 134 ? THR E 232 GLY E 241 1 ? 10 
HELX_P HELX_P32 32 ALA E 160 ? GLY E 174 ? ALA E 267 GLY E 281 1 ? 15 
HELX_P HELX_P33 33 GLY E 259 ? ASN E 278 ? GLY E 366 ASN E 385 1 ? 20 
HELX_P HELX_P34 34 TRP E 283 ? THR E 293 ? TRP E 390 THR E 400 1 ? 11 
HELX_P HELX_P35 35 ASP E 323 ? GLN E 332 ? ASP E 430 GLN E 439 1 ? 10 
HELX_P HELX_P36 36 VAL F 27  ? GLN F 33  ? VAL F 134 GLN F 140 1 ? 7  
HELX_P HELX_P37 37 ARG F 86  ? ALA F 96  ? ARG F 193 ALA F 203 1 ? 11 
HELX_P HELX_P38 38 THR F 125 ? GLY F 134 ? THR F 232 GLY F 241 1 ? 10 
HELX_P HELX_P39 39 ALA F 160 ? GLY F 174 ? ALA F 267 GLY F 281 1 ? 15 
HELX_P HELX_P40 40 GLY F 259 ? ASN F 278 ? GLY F 366 ASN F 385 1 ? 20 
HELX_P HELX_P41 41 TRP F 283 ? THR F 293 ? TRP F 390 THR F 400 1 ? 11 
HELX_P HELX_P42 42 ASP F 323 ? GLN F 332 ? ASP F 430 GLN F 439 1 ? 10 
HELX_P HELX_P43 43 VAL G 27  ? GLN G 33  ? VAL G 134 GLN G 140 1 ? 7  
HELX_P HELX_P44 44 ARG G 86  ? ALA G 96  ? ARG G 193 ALA G 203 1 ? 11 
HELX_P HELX_P45 45 THR G 125 ? GLY G 134 ? THR G 232 GLY G 241 1 ? 10 
HELX_P HELX_P46 46 ALA G 160 ? GLY G 174 ? ALA G 267 GLY G 281 1 ? 15 
HELX_P HELX_P47 47 GLY G 259 ? ASN G 278 ? GLY G 366 ASN G 385 1 ? 20 
HELX_P HELX_P48 48 TRP G 283 ? THR G 293 ? TRP G 390 THR G 400 1 ? 11 
HELX_P HELX_P49 49 ASP G 323 ? GLN G 332 ? ASP G 430 GLN G 439 1 ? 10 
HELX_P HELX_P50 50 VAL H 27  ? GLN H 33  ? VAL H 134 GLN H 140 1 ? 7  
HELX_P HELX_P51 51 ARG H 86  ? ALA H 96  ? ARG H 193 ALA H 203 1 ? 11 
HELX_P HELX_P52 52 THR H 125 ? GLY H 134 ? THR H 232 GLY H 241 1 ? 10 
HELX_P HELX_P53 53 ALA H 160 ? GLY H 174 ? ALA H 267 GLY H 281 1 ? 15 
HELX_P HELX_P54 54 GLY H 259 ? ASN H 278 ? GLY H 366 ASN H 385 1 ? 20 
HELX_P HELX_P55 55 TRP H 283 ? THR H 293 ? TRP H 390 THR H 400 1 ? 11 
HELX_P HELX_P56 56 ASP H 323 ? GLN H 332 ? ASP H 430 GLN H 439 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1   disulf ?    ? A  CYS 104 SG  ? ? ? 1_555 A  CYS 253 SG ? ? A CYS 211  A CYS 360  1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf2   disulf ?    ? A  CYS 196 SG  ? ? ? 1_555 A  CYS 226 SG ? ? A CYS 303  A CYS 333  1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf3   disulf ?    ? A  CYS 343 SG  ? ? ? 1_555 A  CYS 367 SG ? ? A CYS 450  A CYS 474  1_555 ? ? ? ? ? ? ? 2.055 ? ? 
disulf4   disulf ?    ? B  CYS 104 SG  ? ? ? 1_555 B  CYS 253 SG ? ? B CYS 211  B CYS 360  1_555 ? ? ? ? ? ? ? 2.045 ? ? 
disulf5   disulf ?    ? B  CYS 196 SG  ? ? ? 1_555 B  CYS 226 SG ? ? B CYS 303  B CYS 333  1_555 ? ? ? ? ? ? ? 2.047 ? ? 
disulf6   disulf ?    ? B  CYS 343 SG  ? ? ? 1_555 B  CYS 367 SG ? ? B CYS 450  B CYS 474  1_555 ? ? ? ? ? ? ? 2.053 ? ? 
disulf7   disulf ?    ? C  CYS 104 SG  ? ? ? 1_555 C  CYS 253 SG ? ? C CYS 211  C CYS 360  1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf8   disulf ?    ? C  CYS 196 SG  ? ? ? 1_555 C  CYS 226 SG ? ? C CYS 303  C CYS 333  1_555 ? ? ? ? ? ? ? 2.052 ? ? 
disulf9   disulf ?    ? C  CYS 343 SG  ? ? ? 1_555 C  CYS 367 SG ? ? C CYS 450  C CYS 474  1_555 ? ? ? ? ? ? ? 2.059 ? ? 
disulf10  disulf ?    ? D  CYS 104 SG  ? ? ? 1_555 D  CYS 253 SG ? ? D CYS 211  D CYS 360  1_555 ? ? ? ? ? ? ? 2.046 ? ? 
disulf11  disulf ?    ? D  CYS 196 SG  ? ? ? 1_555 D  CYS 226 SG ? ? D CYS 303  D CYS 333  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf12  disulf ?    ? D  CYS 343 SG  ? ? ? 1_555 D  CYS 367 SG ? ? D CYS 450  D CYS 474  1_555 ? ? ? ? ? ? ? 2.048 ? ? 
disulf13  disulf ?    ? E  CYS 104 SG  ? ? ? 1_555 E  CYS 253 SG ? ? E CYS 211  E CYS 360  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf14  disulf ?    ? E  CYS 196 SG  ? ? ? 1_555 E  CYS 226 SG ? ? E CYS 303  E CYS 333  1_555 ? ? ? ? ? ? ? 2.048 ? ? 
disulf15  disulf ?    ? E  CYS 343 SG  ? ? ? 1_555 E  CYS 367 SG ? ? E CYS 450  E CYS 474  1_555 ? ? ? ? ? ? ? 2.051 ? ? 
disulf16  disulf ?    ? F  CYS 104 SG  ? ? ? 1_555 F  CYS 253 SG ? ? F CYS 211  F CYS 360  1_555 ? ? ? ? ? ? ? 2.045 ? ? 
disulf17  disulf ?    ? F  CYS 196 SG  ? ? ? 1_555 F  CYS 226 SG ? ? F CYS 303  F CYS 333  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf18  disulf ?    ? F  CYS 343 SG  ? ? ? 1_555 F  CYS 367 SG ? ? F CYS 450  F CYS 474  1_555 ? ? ? ? ? ? ? 2.054 ? ? 
disulf19  disulf ?    ? G  CYS 104 SG  ? ? ? 1_555 G  CYS 253 SG ? ? G CYS 211  G CYS 360  1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf20  disulf ?    ? G  CYS 196 SG  ? ? ? 1_555 G  CYS 226 SG ? ? G CYS 303  G CYS 333  1_555 ? ? ? ? ? ? ? 2.045 ? ? 
disulf21  disulf ?    ? G  CYS 343 SG  ? ? ? 1_555 G  CYS 367 SG ? ? G CYS 450  G CYS 474  1_555 ? ? ? ? ? ? ? 2.055 ? ? 
disulf22  disulf ?    ? H  CYS 104 SG  ? ? ? 1_555 H  CYS 253 SG ? ? H CYS 211  H CYS 360  1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf23  disulf ?    ? H  CYS 196 SG  ? ? ? 1_555 H  CYS 226 SG ? ? H CYS 303  H CYS 333  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf24  disulf ?    ? H  CYS 343 SG  ? ? ? 1_555 H  CYS 367 SG ? ? H CYS 450  H CYS 474  1_555 ? ? ? ? ? ? ? 2.062 ? ? 
covale1   covale one  ? A  HIS 87  NE2 ? ? ? 1_555 I  0QE 6   C1 ? ? A HIS 194  J 0QE 806  1_555 ? ? ? ? ? ? ? 1.465 ? ? 
covale2   covale one  ? A  ASN 280 ND2 ? ? ? 1_555 S  NAG .   C1 ? ? A ASN 387  A NAG 901  1_555 ? ? ? ? ? ? ? 1.452 ? 
N-Glycosylation 
covale3   covale one  ? A  ASN 333 ND2 ? ? ? 1_555 Q  NAG .   C1 ? ? A ASN 440  I NAG 1    1_555 ? ? ? ? ? ? ? 1.449 ? 
N-Glycosylation 
covale4   covale one  ? B  HIS 87  NE2 ? ? ? 1_555 J  0QE 6   C1 ? ? B HIS 194  K 0QE 806  1_555 ? ? ? ? ? ? ? 1.470 ? ? 
covale5   covale one  ? B  ASN 280 ND2 ? ? ? 1_555 GA NAG .   C1 ? ? B ASN 387  B NAG 901  1_555 ? ? ? ? ? ? ? 1.452 ? 
N-Glycosylation 
covale6   covale one  ? C  HIS 87  NE2 ? ? ? 1_555 K  0QE 6   C1 ? ? C HIS 194  L 0QE 806  1_555 ? ? ? ? ? ? ? 1.462 ? ? 
covale7   covale one  ? D  HIS 87  NE2 ? ? ? 1_555 L  0QE 6   C1 ? ? D HIS 194  M 0QE 806  1_555 ? ? ? ? ? ? ? 1.458 ? ? 
covale8   covale one  ? E  HIS 87  NE2 ? ? ? 1_555 M  0QE 6   C1 ? ? E HIS 194  N 0QE 806  1_555 ? ? ? ? ? ? ? 1.464 ? ? 
covale9   covale one  ? E  ASN 280 ND2 ? ? ? 1_555 IB NAG .   C1 ? ? E ASN 387  E NAG 901  1_555 ? ? ? ? ? ? ? 1.453 ? 
N-Glycosylation 
covale10  covale one  ? F  HIS 87  NE2 ? ? ? 1_555 N  0QE 6   C1 ? ? F HIS 194  P 0QE 806  1_555 ? ? ? ? ? ? ? 1.467 ? ? 
covale11  covale one  ? F  ASN 280 ND2 ? ? ? 1_555 UB NAG .   C1 ? ? F ASN 387  F NAG 901  1_555 ? ? ? ? ? ? ? 1.451 ? 
N-Glycosylation 
covale12  covale one  ? F  ASN 333 ND2 ? ? ? 1_555 VB NAG .   C1 ? ? F ASN 440  F NAG 951  1_555 ? ? ? ? ? ? ? 1.448 ? 
N-Glycosylation 
covale13  covale one  ? G  HIS 87  NE2 ? ? ? 1_555 O  0QE 6   C1 ? ? G HIS 194  Q 0QE 806  1_555 ? ? ? ? ? ? ? 1.464 ? ? 
covale14  covale one  ? G  ASN 333 ND2 ? ? ? 1_555 R  NAG .   C1 ? ? G ASN 440  O NAG 1    1_555 ? ? ? ? ? ? ? 1.449 ? 
N-Glycosylation 
covale15  covale one  ? H  HIS 87  NE2 ? ? ? 1_555 P  0QE 6   C1 ? ? H HIS 194  R 0QE 806  1_555 ? ? ? ? ? ? ? 1.466 ? ? 
covale16  covale one  ? H  ASN 280 ND2 ? ? ? 1_555 PC NAG .   C1 ? ? H ASN 387  H NAG 901  1_555 ? ? ? ? ? ? ? 1.452 ? 
N-Glycosylation 
covale17  covale both ? I  DKA 1   C1  ? ? ? 1_555 I  ARG 2   N  ? ? J DKA 801  J ARG 802  1_555 ? ? ? ? ? ? ? 1.325 ? ? 
covale18  covale both ? I  LYS 4   C   ? ? ? 1_555 I  AR7 5   N  ? ? J LYS 804  J AR7 805  1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale19  covale both ? J  DKA 1   C1  ? ? ? 1_555 J  ARG 2   N  ? ? K DKA 801  K ARG 802  1_555 ? ? ? ? ? ? ? 1.325 ? ? 
covale20  covale both ? J  LYS 4   C   ? ? ? 1_555 J  AR7 5   N  ? ? K LYS 804  K AR7 805  1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale21  covale both ? K  LYS 4   C   ? ? ? 1_555 K  AR7 5   N  ? ? L LYS 804  L AR7 805  1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale22  covale both ? L  DKA 1   C1  ? ? ? 1_555 L  ARG 2   N  ? ? M DKA 801  M ARG 802  1_555 ? ? ? ? ? ? ? 1.323 ? ? 
covale23  covale both ? L  LYS 4   C   ? ? ? 1_555 L  AR7 5   N  ? ? M LYS 804  M AR7 805  1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale24  covale both ? M  DKA 1   C1  ? ? ? 1_555 M  ARG 2   N  ? ? N DKA 801  N ARG 802  1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale25  covale both ? M  LYS 4   C   ? ? ? 1_555 M  AR7 5   N  ? ? N LYS 804  N AR7 805  1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale26  covale both ? N  DKA 1   C1  ? ? ? 1_555 N  ARG 2   N  ? ? P DKA 801  P ARG 802  1_555 ? ? ? ? ? ? ? 1.325 ? ? 
covale27  covale both ? N  LYS 4   C   ? ? ? 1_555 N  AR7 5   N  ? ? P LYS 804  P AR7 805  1_555 ? ? ? ? ? ? ? 1.326 ? ? 
covale28  covale both ? O  DKA 1   C1  ? ? ? 1_555 O  ARG 2   N  ? ? Q DKA 801  Q ARG 802  1_555 ? ? ? ? ? ? ? 1.323 ? ? 
covale29  covale both ? O  LYS 4   C   ? ? ? 1_555 O  AR7 5   N  ? ? Q LYS 804  Q AR7 805  1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale30  covale both ? P  DKA 1   C1  ? ? ? 1_555 P  ARG 2   N  ? ? R DKA 801  R ARG 802  1_555 ? ? ? ? ? ? ? 1.321 ? ? 
covale31  covale both ? P  LYS 4   C   ? ? ? 1_555 P  AR7 5   N  ? ? R LYS 804  R AR7 805  1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale32  covale both ? Q  NAG .   O4  ? ? ? 1_555 Q  NAG .   C1 ? ? I NAG 1    I NAG 2    1_555 ? ? ? ? ? ? ? 1.377 ? ? 
covale33  covale both ? Q  NAG .   O6  ? ? ? 1_555 Q  FUL .   C1 ? ? I NAG 1    I FUL 11   1_555 ? ? ? ? ? ? ? 1.393 ? ? 
covale34  covale both ? Q  NAG .   O4  ? ? ? 1_555 Q  BMA .   C1 ? ? I NAG 2    I BMA 3    1_555 ? ? ? ? ? ? ? 1.385 ? ? 
covale35  covale both ? Q  BMA .   O3  ? ? ? 1_555 Q  MAN .   C1 ? ? I BMA 3    I MAN 4    1_555 ? ? ? ? ? ? ? 1.391 ? ? 
covale36  covale both ? Q  BMA .   O6  ? ? ? 1_555 Q  MAN .   C1 ? ? I BMA 3    I MAN 9    1_555 ? ? ? ? ? ? ? 1.405 ? ? 
covale37  covale both ? Q  MAN .   O2  ? ? ? 1_555 Q  NAG .   C1 ? ? I MAN 4    I NAG 5    1_555 ? ? ? ? ? ? ? 1.389 ? ? 
covale38  covale both ? Q  MAN .   O4  ? ? ? 1_555 Q  NAG .   C1 ? ? I MAN 4    I NAG 7    1_555 ? ? ? ? ? ? ? 1.379 ? ? 
covale39  covale both ? Q  NAG .   O4  ? ? ? 1_555 Q  GAL .   C1 ? ? I NAG 5    I GAL 6    1_555 ? ? ? ? ? ? ? 1.392 ? ? 
covale40  covale both ? Q  NAG .   O4  ? ? ? 1_555 Q  GAL .   C1 ? ? I NAG 7    I GAL 8    1_555 ? ? ? ? ? ? ? 1.387 ? ? 
covale41  covale both ? Q  MAN .   O2  ? ? ? 1_555 Q  NAG .   C1 ? ? I MAN 9    I NAG 10   1_555 ? ? ? ? ? ? ? 1.393 ? ? 
covale42  covale both ? R  NAG .   O4  ? ? ? 1_555 R  NAG .   C1 ? ? O NAG 1    O NAG 2    1_555 ? ? ? ? ? ? ? 1.382 ? ? 
covale43  covale both ? R  NAG .   O6  ? ? ? 1_555 R  FUC .   C1 ? ? O NAG 1    O FUC 4    1_555 ? ? ? ? ? ? ? 1.393 ? ? 
covale44  covale both ? R  NAG .   O4  ? ? ? 1_555 R  BMA .   C1 ? ? O NAG 2    O BMA 3    1_555 ? ? ? ? ? ? ? 1.408 ? ? 
metalc1   metalc ?    ? A  ASP 8   OD1 ? ? ? 1_555 T  CA  .   CA ? ? A ASP 115  A CA  3001 1_555 ? ? ? ? ? ? ? 2.389 ? ? 
metalc2   metalc ?    ? A  ASP 55  OD1 ? ? ? 1_555 T  CA  .   CA ? ? A ASP 162  A CA  3001 1_555 ? ? ? ? ? ? ? 2.406 ? ? 
metalc3   metalc ?    ? A  ASP 55  OD2 ? ? ? 1_555 T  CA  .   CA ? ? A ASP 162  A CA  3001 1_555 ? ? ? ? ? ? ? 2.760 ? ? 
metalc4   metalc ?    ? A  VAL 98  O   ? ? ? 1_555 T  CA  .   CA ? ? A VAL 205  A CA  3001 1_555 ? ? ? ? ? ? ? 2.223 ? ? 
metalc5   metalc ?    ? A  ASN 101 OD1 ? ? ? 1_555 T  CA  .   CA ? ? A ASN 208  A CA  3001 1_555 ? ? ? ? ? ? ? 2.585 ? ? 
metalc6   metalc ?    ? A  VAL 103 O   ? ? ? 1_555 T  CA  .   CA ? ? A VAL 210  A CA  3001 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc7   metalc ?    ? A  GLY 105 O   ? ? ? 1_555 T  CA  .   CA ? ? A GLY 212  A CA  3001 1_555 ? ? ? ? ? ? ? 2.275 ? ? 
metalc8   metalc ?    ? A  ASP 151 OD1 ? ? ? 1_555 U  CA  .   CA ? ? A ASP 258  A CA  3002 1_555 ? ? ? ? ? ? ? 2.184 ? ? 
metalc9   metalc ?    ? A  ASP 194 OD1 ? ? ? 1_555 U  CA  .   CA ? ? A ASP 301  A CA  3002 1_555 ? ? ? ? ? ? ? 2.351 ? ? 
metalc10  metalc ?    ? A  GLU 224 OE1 ? ? ? 1_555 U  CA  .   CA ? ? A GLU 331  A CA  3002 1_555 ? ? ? ? ? ? ? 2.310 ? ? 
metalc11  metalc ?    ? A  GLU 224 OE2 ? ? ? 1_555 U  CA  .   CA ? ? A GLU 331  A CA  3002 1_555 ? ? ? ? ? ? ? 2.465 ? ? 
metalc12  metalc ?    ? U  CA  .   CA  ? ? ? 1_555 GD HOH .   O  ? ? A CA  3002 A HOH 4269 1_555 ? ? ? ? ? ? ? 2.394 ? ? 
metalc13  metalc ?    ? U  CA  .   CA  ? ? ? 1_555 GD HOH .   O  ? ? A CA  3002 A HOH 4270 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc14  metalc ?    ? U  CA  .   CA  ? ? ? 1_555 GD HOH .   O  ? ? A CA  3002 A HOH 4271 1_555 ? ? ? ? ? ? ? 2.340 ? ? 
metalc15  metalc ?    ? B  ASP 8   OD1 ? ? ? 1_555 HA CA  .   CA ? ? B ASP 115  B CA  3003 1_555 ? ? ? ? ? ? ? 2.422 ? ? 
metalc16  metalc ?    ? B  ASP 55  OD1 ? ? ? 1_555 HA CA  .   CA ? ? B ASP 162  B CA  3003 1_555 ? ? ? ? ? ? ? 2.351 ? ? 
metalc17  metalc ?    ? B  ASP 55  OD2 ? ? ? 1_555 HA CA  .   CA ? ? B ASP 162  B CA  3003 1_555 ? ? ? ? ? ? ? 2.758 ? ? 
metalc18  metalc ?    ? B  VAL 98  O   ? ? ? 1_555 HA CA  .   CA ? ? B VAL 205  B CA  3003 1_555 ? ? ? ? ? ? ? 2.238 ? ? 
metalc19  metalc ?    ? B  ASN 101 OD1 ? ? ? 1_555 HA CA  .   CA ? ? B ASN 208  B CA  3003 1_555 ? ? ? ? ? ? ? 2.470 ? ? 
metalc20  metalc ?    ? B  VAL 103 O   ? ? ? 1_555 HA CA  .   CA ? ? B VAL 210  B CA  3003 1_555 ? ? ? ? ? ? ? 2.302 ? ? 
metalc21  metalc ?    ? B  GLY 105 O   ? ? ? 1_555 HA CA  .   CA ? ? B GLY 212  B CA  3003 1_555 ? ? ? ? ? ? ? 2.390 ? ? 
metalc22  metalc ?    ? B  ASP 151 OD1 ? ? ? 1_555 IA CA  .   CA ? ? B ASP 258  B CA  3004 1_555 ? ? ? ? ? ? ? 2.184 ? ? 
metalc23  metalc ?    ? B  ASP 194 OD1 ? ? ? 1_555 IA CA  .   CA ? ? B ASP 301  B CA  3004 1_555 ? ? ? ? ? ? ? 2.355 ? ? 
metalc24  metalc ?    ? B  GLU 224 OE1 ? ? ? 1_555 IA CA  .   CA ? ? B GLU 331  B CA  3004 1_555 ? ? ? ? ? ? ? 2.257 ? ? 
metalc25  metalc ?    ? B  GLU 224 OE2 ? ? ? 1_555 IA CA  .   CA ? ? B GLU 331  B CA  3004 1_555 ? ? ? ? ? ? ? 2.415 ? ? 
metalc26  metalc ?    ? IA CA  .   CA  ? ? ? 1_555 HD HOH .   O  ? ? B CA  3004 B HOH 4199 1_555 ? ? ? ? ? ? ? 2.230 ? ? 
metalc27  metalc ?    ? IA CA  .   CA  ? ? ? 1_555 HD HOH .   O  ? ? B CA  3004 B HOH 4248 1_555 ? ? ? ? ? ? ? 2.382 ? ? 
metalc28  metalc ?    ? IA CA  .   CA  ? ? ? 1_555 HD HOH .   O  ? ? B CA  3004 B HOH 4258 1_555 ? ? ? ? ? ? ? 2.410 ? ? 
metalc29  metalc ?    ? C  ASP 8   OD1 ? ? ? 1_555 PA CA  .   CA ? ? C ASP 115  C CA  3005 1_555 ? ? ? ? ? ? ? 2.370 ? ? 
metalc30  metalc ?    ? C  ASP 55  OD1 ? ? ? 1_555 PA CA  .   CA ? ? C ASP 162  C CA  3005 1_555 ? ? ? ? ? ? ? 2.402 ? ? 
metalc31  metalc ?    ? C  ASP 55  OD2 ? ? ? 1_555 PA CA  .   CA ? ? C ASP 162  C CA  3005 1_555 ? ? ? ? ? ? ? 2.683 ? ? 
metalc32  metalc ?    ? C  VAL 98  O   ? ? ? 1_555 PA CA  .   CA ? ? C VAL 205  C CA  3005 1_555 ? ? ? ? ? ? ? 2.274 ? ? 
metalc33  metalc ?    ? C  ASN 101 OD1 ? ? ? 1_555 PA CA  .   CA ? ? C ASN 208  C CA  3005 1_555 ? ? ? ? ? ? ? 2.538 ? ? 
metalc34  metalc ?    ? C  VAL 103 O   ? ? ? 1_555 PA CA  .   CA ? ? C VAL 210  C CA  3005 1_555 ? ? ? ? ? ? ? 2.244 ? ? 
metalc35  metalc ?    ? C  GLY 105 O   ? ? ? 1_555 PA CA  .   CA ? ? C GLY 212  C CA  3005 1_555 ? ? ? ? ? ? ? 2.336 ? ? 
metalc36  metalc ?    ? C  ASP 151 OD1 ? ? ? 1_555 QA CA  .   CA ? ? C ASP 258  C CA  3006 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc37  metalc ?    ? C  ASP 194 OD1 ? ? ? 1_555 QA CA  .   CA ? ? C ASP 301  C CA  3006 1_555 ? ? ? ? ? ? ? 2.356 ? ? 
metalc38  metalc ?    ? C  GLU 224 OE1 ? ? ? 1_555 QA CA  .   CA ? ? C GLU 331  C CA  3006 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc39  metalc ?    ? C  GLU 224 OE2 ? ? ? 1_555 QA CA  .   CA ? ? C GLU 331  C CA  3006 1_555 ? ? ? ? ? ? ? 2.457 ? ? 
metalc40  metalc ?    ? QA CA  .   CA  ? ? ? 1_555 ID HOH .   O  ? ? C CA  3006 C HOH 4063 1_555 ? ? ? ? ? ? ? 2.391 ? ? 
metalc41  metalc ?    ? QA CA  .   CA  ? ? ? 1_555 ID HOH .   O  ? ? C CA  3006 C HOH 4102 1_555 ? ? ? ? ? ? ? 2.376 ? ? 
metalc42  metalc ?    ? QA CA  .   CA  ? ? ? 1_555 ID HOH .   O  ? ? C CA  3006 C HOH 4135 1_555 ? ? ? ? ? ? ? 2.234 ? ? 
metalc43  metalc ?    ? D  ASP 8   OD1 ? ? ? 1_555 XA CA  .   CA ? ? D ASP 115  D CA  3007 1_555 ? ? ? ? ? ? ? 2.393 ? ? 
metalc44  metalc ?    ? D  ASP 55  OD1 ? ? ? 1_555 XA CA  .   CA ? ? D ASP 162  D CA  3007 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc45  metalc ?    ? D  ASP 55  OD2 ? ? ? 1_555 XA CA  .   CA ? ? D ASP 162  D CA  3007 1_555 ? ? ? ? ? ? ? 2.726 ? ? 
metalc46  metalc ?    ? D  VAL 98  O   ? ? ? 1_555 XA CA  .   CA ? ? D VAL 205  D CA  3007 1_555 ? ? ? ? ? ? ? 2.188 ? ? 
metalc47  metalc ?    ? D  ASN 101 OD1 ? ? ? 1_555 XA CA  .   CA ? ? D ASN 208  D CA  3007 1_555 ? ? ? ? ? ? ? 2.570 ? ? 
metalc48  metalc ?    ? D  VAL 103 O   ? ? ? 1_555 XA CA  .   CA ? ? D VAL 210  D CA  3007 1_555 ? ? ? ? ? ? ? 2.311 ? ? 
metalc49  metalc ?    ? D  GLY 105 O   ? ? ? 1_555 XA CA  .   CA ? ? D GLY 212  D CA  3007 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc50  metalc ?    ? D  ASP 151 OD1 ? ? ? 1_555 YA CA  .   CA ? ? D ASP 258  D CA  3008 1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc51  metalc ?    ? D  ASP 194 OD1 ? ? ? 1_555 YA CA  .   CA ? ? D ASP 301  D CA  3008 1_555 ? ? ? ? ? ? ? 2.338 ? ? 
metalc52  metalc ?    ? D  GLU 224 OE1 ? ? ? 1_555 YA CA  .   CA ? ? D GLU 331  D CA  3008 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc53  metalc ?    ? D  GLU 224 OE2 ? ? ? 1_555 YA CA  .   CA ? ? D GLU 331  D CA  3008 1_555 ? ? ? ? ? ? ? 2.443 ? ? 
metalc54  metalc ?    ? YA CA  .   CA  ? ? ? 1_555 JD HOH .   O  ? ? D CA  3008 D HOH 4070 1_555 ? ? ? ? ? ? ? 2.398 ? ? 
metalc55  metalc ?    ? YA CA  .   CA  ? ? ? 1_555 JD HOH .   O  ? ? D CA  3008 D HOH 4160 1_555 ? ? ? ? ? ? ? 2.304 ? ? 
metalc56  metalc ?    ? YA CA  .   CA  ? ? ? 1_555 JD HOH .   O  ? ? D CA  3008 D HOH 4192 1_555 ? ? ? ? ? ? ? 2.334 ? ? 
metalc57  metalc ?    ? E  ASP 8   OD1 ? ? ? 1_555 JB CA  .   CA ? ? E ASP 115  E CA  3009 1_555 ? ? ? ? ? ? ? 2.403 ? ? 
metalc58  metalc ?    ? E  ASP 55  OD1 ? ? ? 1_555 JB CA  .   CA ? ? E ASP 162  E CA  3009 1_555 ? ? ? ? ? ? ? 2.394 ? ? 
metalc59  metalc ?    ? E  ASP 55  OD2 ? ? ? 1_555 JB CA  .   CA ? ? E ASP 162  E CA  3009 1_555 ? ? ? ? ? ? ? 2.777 ? ? 
metalc60  metalc ?    ? E  VAL 98  O   ? ? ? 1_555 JB CA  .   CA ? ? E VAL 205  E CA  3009 1_555 ? ? ? ? ? ? ? 2.196 ? ? 
metalc61  metalc ?    ? E  ASN 101 OD1 ? ? ? 1_555 JB CA  .   CA ? ? E ASN 208  E CA  3009 1_555 ? ? ? ? ? ? ? 2.628 ? ? 
metalc62  metalc ?    ? E  VAL 103 O   ? ? ? 1_555 JB CA  .   CA ? ? E VAL 210  E CA  3009 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc63  metalc ?    ? E  GLY 105 O   ? ? ? 1_555 JB CA  .   CA ? ? E GLY 212  E CA  3009 1_555 ? ? ? ? ? ? ? 2.261 ? ? 
metalc64  metalc ?    ? E  ASP 151 OD1 ? ? ? 1_555 KB CA  .   CA ? ? E ASP 258  E CA  3010 1_555 ? ? ? ? ? ? ? 2.204 ? ? 
metalc65  metalc ?    ? E  ASP 194 OD1 ? ? ? 1_555 KB CA  .   CA ? ? E ASP 301  E CA  3010 1_555 ? ? ? ? ? ? ? 2.384 ? ? 
metalc66  metalc ?    ? E  GLU 224 OE1 ? ? ? 1_555 KB CA  .   CA ? ? E GLU 331  E CA  3010 1_555 ? ? ? ? ? ? ? 2.243 ? ? 
metalc67  metalc ?    ? E  GLU 224 OE2 ? ? ? 1_555 KB CA  .   CA ? ? E GLU 331  E CA  3010 1_555 ? ? ? ? ? ? ? 2.492 ? ? 
metalc68  metalc ?    ? KB CA  .   CA  ? ? ? 1_555 KD HOH .   O  ? ? E CA  3010 E HOH 4104 1_555 ? ? ? ? ? ? ? 2.277 ? ? 
metalc69  metalc ?    ? KB CA  .   CA  ? ? ? 1_555 KD HOH .   O  ? ? E CA  3010 E HOH 4252 1_555 ? ? ? ? ? ? ? 2.347 ? ? 
metalc70  metalc ?    ? KB CA  .   CA  ? ? ? 1_555 KD HOH .   O  ? ? E CA  3010 E HOH 4253 1_555 ? ? ? ? ? ? ? 2.311 ? ? 
metalc71  metalc ?    ? F  ASP 8   OD1 ? ? ? 1_555 WB CA  .   CA ? ? F ASP 115  F CA  3011 1_555 ? ? ? ? ? ? ? 2.258 ? ? 
metalc72  metalc ?    ? F  ASP 55  OD1 ? ? ? 1_555 WB CA  .   CA ? ? F ASP 162  F CA  3011 1_555 ? ? ? ? ? ? ? 2.520 ? ? 
metalc73  metalc ?    ? F  ASP 55  OD2 ? ? ? 1_555 WB CA  .   CA ? ? F ASP 162  F CA  3011 1_555 ? ? ? ? ? ? ? 2.755 ? ? 
metalc74  metalc ?    ? F  VAL 98  O   ? ? ? 1_555 WB CA  .   CA ? ? F VAL 205  F CA  3011 1_555 ? ? ? ? ? ? ? 2.187 ? ? 
metalc75  metalc ?    ? F  ASN 101 OD1 ? ? ? 1_555 WB CA  .   CA ? ? F ASN 208  F CA  3011 1_555 ? ? ? ? ? ? ? 2.607 ? ? 
metalc76  metalc ?    ? F  VAL 103 O   ? ? ? 1_555 WB CA  .   CA ? ? F VAL 210  F CA  3011 1_555 ? ? ? ? ? ? ? 2.359 ? ? 
metalc77  metalc ?    ? F  GLY 105 O   ? ? ? 1_555 WB CA  .   CA ? ? F GLY 212  F CA  3011 1_555 ? ? ? ? ? ? ? 2.178 ? ? 
metalc78  metalc ?    ? F  ASP 151 OD1 ? ? ? 1_555 XB CA  .   CA ? ? F ASP 258  F CA  3012 1_555 ? ? ? ? ? ? ? 2.272 ? ? 
metalc79  metalc ?    ? F  ASP 194 OD1 ? ? ? 1_555 XB CA  .   CA ? ? F ASP 301  F CA  3012 1_555 ? ? ? ? ? ? ? 2.279 ? ? 
metalc80  metalc ?    ? F  GLU 224 OE1 ? ? ? 1_555 XB CA  .   CA ? ? F GLU 331  F CA  3012 1_555 ? ? ? ? ? ? ? 2.373 ? ? 
metalc81  metalc ?    ? F  GLU 224 OE2 ? ? ? 1_555 XB CA  .   CA ? ? F GLU 331  F CA  3012 1_555 ? ? ? ? ? ? ? 2.468 ? ? 
metalc82  metalc ?    ? XB CA  .   CA  ? ? ? 1_555 LD HOH .   O  ? ? F CA  3012 F HOH 4157 1_555 ? ? ? ? ? ? ? 2.377 ? ? 
metalc83  metalc ?    ? XB CA  .   CA  ? ? ? 1_555 LD HOH .   O  ? ? F CA  3012 F HOH 4158 1_555 ? ? ? ? ? ? ? 2.372 ? ? 
metalc84  metalc ?    ? XB CA  .   CA  ? ? ? 1_555 LD HOH .   O  ? ? F CA  3012 F HOH 4236 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc85  metalc ?    ? G  ASP 8   OD1 ? ? ? 1_555 HC CA  .   CA ? ? G ASP 115  G CA  3013 1_555 ? ? ? ? ? ? ? 2.414 ? ? 
metalc86  metalc ?    ? G  ASP 55  OD1 ? ? ? 1_555 HC CA  .   CA ? ? G ASP 162  G CA  3013 1_555 ? ? ? ? ? ? ? 2.477 ? ? 
metalc87  metalc ?    ? G  ASP 55  OD2 ? ? ? 1_555 HC CA  .   CA ? ? G ASP 162  G CA  3013 1_555 ? ? ? ? ? ? ? 2.721 ? ? 
metalc88  metalc ?    ? G  VAL 98  O   ? ? ? 1_555 HC CA  .   CA ? ? G VAL 205  G CA  3013 1_555 ? ? ? ? ? ? ? 2.286 ? ? 
metalc89  metalc ?    ? G  ASN 101 OD1 ? ? ? 1_555 HC CA  .   CA ? ? G ASN 208  G CA  3013 1_555 ? ? ? ? ? ? ? 2.594 ? ? 
metalc90  metalc ?    ? G  VAL 103 O   ? ? ? 1_555 HC CA  .   CA ? ? G VAL 210  G CA  3013 1_555 ? ? ? ? ? ? ? 2.254 ? ? 
metalc91  metalc ?    ? G  GLY 105 O   ? ? ? 1_555 HC CA  .   CA ? ? G GLY 212  G CA  3013 1_555 ? ? ? ? ? ? ? 2.234 ? ? 
metalc92  metalc ?    ? G  ASP 151 OD1 ? ? ? 1_555 IC CA  .   CA ? ? G ASP 258  G CA  3014 1_555 ? ? ? ? ? ? ? 2.271 ? ? 
metalc93  metalc ?    ? G  ASP 194 OD1 ? ? ? 1_555 IC CA  .   CA ? ? G ASP 301  G CA  3014 1_555 ? ? ? ? ? ? ? 2.383 ? ? 
metalc94  metalc ?    ? G  GLU 224 OE1 ? ? ? 1_555 IC CA  .   CA ? ? G GLU 331  G CA  3014 1_555 ? ? ? ? ? ? ? 2.255 ? ? 
metalc95  metalc ?    ? G  GLU 224 OE2 ? ? ? 1_555 IC CA  .   CA ? ? G GLU 331  G CA  3014 1_555 ? ? ? ? ? ? ? 2.368 ? ? 
metalc96  metalc ?    ? IC CA  .   CA  ? ? ? 1_555 MD HOH .   O  ? ? G CA  3014 G HOH 4182 1_555 ? ? ? ? ? ? ? 2.441 ? ? 
metalc97  metalc ?    ? IC CA  .   CA  ? ? ? 1_555 MD HOH .   O  ? ? G CA  3014 G HOH 4228 1_555 ? ? ? ? ? ? ? 2.311 ? ? 
metalc98  metalc ?    ? H  ASP 8   OD1 ? ? ? 1_555 QC CA  .   CA ? ? H ASP 115  H CA  3015 1_555 ? ? ? ? ? ? ? 2.363 ? ? 
metalc99  metalc ?    ? H  ASP 55  OD1 ? ? ? 1_555 QC CA  .   CA ? ? H ASP 162  H CA  3015 1_555 ? ? ? ? ? ? ? 2.436 ? ? 
metalc100 metalc ?    ? H  ASP 55  OD2 ? ? ? 1_555 QC CA  .   CA ? ? H ASP 162  H CA  3015 1_555 ? ? ? ? ? ? ? 2.671 ? ? 
metalc101 metalc ?    ? H  VAL 98  O   ? ? ? 1_555 QC CA  .   CA ? ? H VAL 205  H CA  3015 1_555 ? ? ? ? ? ? ? 2.268 ? ? 
metalc102 metalc ?    ? H  ASN 101 OD1 ? ? ? 1_555 QC CA  .   CA ? ? H ASN 208  H CA  3015 1_555 ? ? ? ? ? ? ? 2.610 ? ? 
metalc103 metalc ?    ? H  VAL 103 O   ? ? ? 1_555 QC CA  .   CA ? ? H VAL 210  H CA  3015 1_555 ? ? ? ? ? ? ? 2.283 ? ? 
metalc104 metalc ?    ? H  GLY 105 O   ? ? ? 1_555 QC CA  .   CA ? ? H GLY 212  H CA  3015 1_555 ? ? ? ? ? ? ? 2.218 ? ? 
metalc105 metalc ?    ? H  ASP 151 OD1 ? ? ? 1_555 RC CA  .   CA ? ? H ASP 258  H CA  3016 1_555 ? ? ? ? ? ? ? 2.189 ? ? 
metalc106 metalc ?    ? H  ASP 194 OD1 ? ? ? 1_555 RC CA  .   CA ? ? H ASP 301  H CA  3016 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc107 metalc ?    ? H  GLU 224 OE1 ? ? ? 1_555 RC CA  .   CA ? ? H GLU 331  H CA  3016 1_555 ? ? ? ? ? ? ? 2.435 ? ? 
metalc108 metalc ?    ? H  GLU 224 OE2 ? ? ? 1_555 RC CA  .   CA ? ? H GLU 331  H CA  3016 1_555 ? ? ? ? ? ? ? 2.627 ? ? 
metalc109 metalc ?    ? RC CA  .   CA  ? ? ? 1_555 ND HOH .   O  ? ? H CA  3016 H HOH 4162 1_555 ? ? ? ? ? ? ? 2.211 ? ? 
metalc110 metalc ?    ? RC CA  .   CA  ? ? ? 1_555 ND HOH .   O  ? ? H CA  3016 H HOH 4208 1_555 ? ? ? ? ? ? ? 2.338 ? ? 
metalc111 metalc ?    ? RC CA  .   CA  ? ? ? 1_555 ND HOH .   O  ? ? H CA  3016 H HOH 4209 1_555 ? ? ? ? ? ? ? 2.596 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 21 ? 
B ? 21 ? 
C ? 21 ? 
D ? 21 ? 
E ? 21 ? 
F ? 21 ? 
G ? 21 ? 
H ? 21 ? 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  ILE A 40  ? ASP A 46  ? ILE A 147 ASP A 153 
A 2  PHE A 66  ? ASN A 69  ? PHE A 173 ASN A 176 
A 3  GLN A 71  ? ASP A 72  ? GLN A 178 ASP A 179 
A 4  ARG A 113 ? MET A 119 ? ARG A 220 MET A 226 
A 5  HIS A 141 ? ALA A 145 ? HIS A 248 ALA A 252 
A 6  ILE A 181 ? SER A 186 ? ILE A 288 SER A 293 
A 7  TYR A 206 ? ALA A 213 ? TYR A 313 ALA A 320 
A 8  ALA A 231 ? SER A 235 ? ALA A 338 SER A 342 
A 9  THR A 246 ? ASP A 248 ? THR A 353 ASP A 355 
A 10 LYS A 252 ? THR A 254 ? LYS A 359 THR A 361 
A 11 ALA A 305 ? ASN A 307 ? ALA A 412 ASN A 414 
A 12 ARG A 311 ? VAL A 313 ? ARG A 418 VAL A 420 
A 13 ARG A 341 ? LEU A 348 ? ARG A 448 LEU A 455 
A 14 LYS A 352 ? ILE A 354 ? LYS A 459 ILE A 461 
A 15 LYS A 356 ? VAL A 364 ? LYS A 463 VAL A 471 
A 16 VAL A 380 ? TYR A 388 ? VAL A 487 TYR A 495 
A 17 ASP A 393 ? ILE A 399 ? ASP A 500 ILE A 506 
A 18 THR A 404 ? LEU A 409 ? THR A 511 LEU A 516 
A 19 PHE A 421 ? THR A 428 ? PHE A 528 THR A 535 
A 20 GLY A 438 ? THR A 447 ? GLY A 545 THR A 554 
A 21 TYR A 453 ? THR A 466 ? TYR A 560 THR A 573 
B 1  ILE B 40  ? ASP B 46  ? ILE B 147 ASP B 153 
B 2  PHE B 66  ? ASN B 69  ? PHE B 173 ASN B 176 
B 3  GLN B 71  ? ASP B 72  ? GLN B 178 ASP B 179 
B 4  ARG B 113 ? MET B 119 ? ARG B 220 MET B 226 
B 5  HIS B 141 ? ALA B 145 ? HIS B 248 ALA B 252 
B 6  ILE B 181 ? SER B 186 ? ILE B 288 SER B 293 
B 7  TYR B 206 ? ALA B 213 ? TYR B 313 ALA B 320 
B 8  ALA B 231 ? SER B 235 ? ALA B 338 SER B 342 
B 9  THR B 246 ? ASP B 248 ? THR B 353 ASP B 355 
B 10 LYS B 252 ? THR B 254 ? LYS B 359 THR B 361 
B 11 ALA B 305 ? ASN B 307 ? ALA B 412 ASN B 414 
B 12 ARG B 311 ? VAL B 313 ? ARG B 418 VAL B 420 
B 13 ARG B 341 ? LEU B 348 ? ARG B 448 LEU B 455 
B 14 LYS B 352 ? ILE B 354 ? LYS B 459 ILE B 461 
B 15 LYS B 356 ? VAL B 364 ? LYS B 463 VAL B 471 
B 16 VAL B 380 ? TYR B 388 ? VAL B 487 TYR B 495 
B 17 ASP B 393 ? ILE B 399 ? ASP B 500 ILE B 506 
B 18 THR B 404 ? LEU B 409 ? THR B 511 LEU B 516 
B 19 PHE B 421 ? THR B 428 ? PHE B 528 THR B 535 
B 20 GLY B 438 ? THR B 447 ? GLY B 545 THR B 554 
B 21 TYR B 453 ? THR B 466 ? TYR B 560 THR B 573 
C 1  ILE C 40  ? ASP C 46  ? ILE C 147 ASP C 153 
C 2  PHE C 66  ? ASN C 69  ? PHE C 173 ASN C 176 
C 3  GLN C 71  ? ASP C 72  ? GLN C 178 ASP C 179 
C 4  ARG C 113 ? MET C 119 ? ARG C 220 MET C 226 
C 5  HIS C 141 ? ALA C 145 ? HIS C 248 ALA C 252 
C 6  ILE C 181 ? SER C 186 ? ILE C 288 SER C 293 
C 7  TYR C 206 ? ALA C 213 ? TYR C 313 ALA C 320 
C 8  ALA C 231 ? SER C 235 ? ALA C 338 SER C 342 
C 9  THR C 246 ? ASP C 248 ? THR C 353 ASP C 355 
C 10 LYS C 252 ? THR C 254 ? LYS C 359 THR C 361 
C 11 ALA C 305 ? ASN C 307 ? ALA C 412 ASN C 414 
C 12 ARG C 311 ? VAL C 313 ? ARG C 418 VAL C 420 
C 13 ARG C 341 ? LEU C 348 ? ARG C 448 LEU C 455 
C 14 LYS C 352 ? ILE C 354 ? LYS C 459 ILE C 461 
C 15 LYS C 356 ? VAL C 364 ? LYS C 463 VAL C 471 
C 16 VAL C 380 ? TYR C 388 ? VAL C 487 TYR C 495 
C 17 ASP C 393 ? ILE C 399 ? ASP C 500 ILE C 506 
C 18 THR C 404 ? LEU C 409 ? THR C 511 LEU C 516 
C 19 PHE C 421 ? THR C 428 ? PHE C 528 THR C 535 
C 20 GLY C 438 ? THR C 447 ? GLY C 545 THR C 554 
C 21 TYR C 453 ? THR C 466 ? TYR C 560 THR C 573 
D 1  ILE D 40  ? ASP D 46  ? ILE D 147 ASP D 153 
D 2  PHE D 66  ? ASN D 69  ? PHE D 173 ASN D 176 
D 3  GLN D 71  ? ASP D 72  ? GLN D 178 ASP D 179 
D 4  ARG D 113 ? MET D 119 ? ARG D 220 MET D 226 
D 5  HIS D 141 ? ALA D 145 ? HIS D 248 ALA D 252 
D 6  ILE D 181 ? SER D 186 ? ILE D 288 SER D 293 
D 7  TYR D 206 ? ALA D 213 ? TYR D 313 ALA D 320 
D 8  ALA D 231 ? SER D 235 ? ALA D 338 SER D 342 
D 9  THR D 246 ? ASP D 248 ? THR D 353 ASP D 355 
D 10 LYS D 252 ? THR D 254 ? LYS D 359 THR D 361 
D 11 ALA D 305 ? ASN D 307 ? ALA D 412 ASN D 414 
D 12 ARG D 311 ? VAL D 313 ? ARG D 418 VAL D 420 
D 13 ARG D 341 ? LEU D 348 ? ARG D 448 LEU D 455 
D 14 LYS D 352 ? ILE D 354 ? LYS D 459 ILE D 461 
D 15 LYS D 356 ? VAL D 364 ? LYS D 463 VAL D 471 
D 16 VAL D 380 ? TYR D 388 ? VAL D 487 TYR D 495 
D 17 ASP D 393 ? ILE D 399 ? ASP D 500 ILE D 506 
D 18 THR D 404 ? LEU D 409 ? THR D 511 LEU D 516 
D 19 PHE D 421 ? THR D 428 ? PHE D 528 THR D 535 
D 20 GLY D 438 ? THR D 447 ? GLY D 545 THR D 554 
D 21 TYR D 453 ? THR D 466 ? TYR D 560 THR D 573 
E 1  ILE E 40  ? ASP E 46  ? ILE E 147 ASP E 153 
E 2  PHE E 66  ? ASN E 69  ? PHE E 173 ASN E 176 
E 3  GLN E 71  ? ASP E 72  ? GLN E 178 ASP E 179 
E 4  ARG E 113 ? MET E 119 ? ARG E 220 MET E 226 
E 5  HIS E 141 ? ALA E 145 ? HIS E 248 ALA E 252 
E 6  ILE E 181 ? SER E 186 ? ILE E 288 SER E 293 
E 7  TYR E 206 ? ALA E 213 ? TYR E 313 ALA E 320 
E 8  ALA E 231 ? SER E 235 ? ALA E 338 SER E 342 
E 9  THR E 246 ? ASP E 248 ? THR E 353 ASP E 355 
E 10 LYS E 252 ? THR E 254 ? LYS E 359 THR E 361 
E 11 ALA E 305 ? ASN E 307 ? ALA E 412 ASN E 414 
E 12 ARG E 311 ? VAL E 313 ? ARG E 418 VAL E 420 
E 13 ARG E 341 ? LEU E 348 ? ARG E 448 LEU E 455 
E 14 LYS E 352 ? ILE E 354 ? LYS E 459 ILE E 461 
E 15 LYS E 356 ? VAL E 364 ? LYS E 463 VAL E 471 
E 16 VAL E 380 ? TYR E 388 ? VAL E 487 TYR E 495 
E 17 ASP E 393 ? ILE E 399 ? ASP E 500 ILE E 506 
E 18 THR E 404 ? LEU E 409 ? THR E 511 LEU E 516 
E 19 PHE E 421 ? THR E 428 ? PHE E 528 THR E 535 
E 20 GLY E 438 ? THR E 447 ? GLY E 545 THR E 554 
E 21 TYR E 453 ? THR E 466 ? TYR E 560 THR E 573 
F 1  ILE F 40  ? ASP F 46  ? ILE F 147 ASP F 153 
F 2  PHE F 66  ? ASN F 69  ? PHE F 173 ASN F 176 
F 3  GLN F 71  ? ASP F 72  ? GLN F 178 ASP F 179 
F 4  ARG F 113 ? MET F 119 ? ARG F 220 MET F 226 
F 5  HIS F 141 ? ALA F 145 ? HIS F 248 ALA F 252 
F 6  ILE F 181 ? SER F 186 ? ILE F 288 SER F 293 
F 7  TYR F 206 ? ALA F 213 ? TYR F 313 ALA F 320 
F 8  ALA F 231 ? SER F 235 ? ALA F 338 SER F 342 
F 9  THR F 246 ? ASP F 248 ? THR F 353 ASP F 355 
F 10 LYS F 252 ? THR F 254 ? LYS F 359 THR F 361 
F 11 ALA F 305 ? ASN F 307 ? ALA F 412 ASN F 414 
F 12 ARG F 311 ? VAL F 313 ? ARG F 418 VAL F 420 
F 13 ARG F 341 ? LEU F 348 ? ARG F 448 LEU F 455 
F 14 LYS F 352 ? ILE F 354 ? LYS F 459 ILE F 461 
F 15 LYS F 356 ? VAL F 364 ? LYS F 463 VAL F 471 
F 16 VAL F 380 ? TYR F 388 ? VAL F 487 TYR F 495 
F 17 ASP F 393 ? ILE F 399 ? ASP F 500 ILE F 506 
F 18 THR F 404 ? LEU F 409 ? THR F 511 LEU F 516 
F 19 PHE F 421 ? THR F 428 ? PHE F 528 THR F 535 
F 20 GLY F 438 ? THR F 447 ? GLY F 545 THR F 554 
F 21 TYR F 453 ? THR F 466 ? TYR F 560 THR F 573 
G 1  ILE G 40  ? ASP G 46  ? ILE G 147 ASP G 153 
G 2  PHE G 66  ? ASN G 69  ? PHE G 173 ASN G 176 
G 3  GLN G 71  ? ASP G 72  ? GLN G 178 ASP G 179 
G 4  ARG G 113 ? MET G 119 ? ARG G 220 MET G 226 
G 5  HIS G 141 ? ALA G 145 ? HIS G 248 ALA G 252 
G 6  ILE G 181 ? SER G 186 ? ILE G 288 SER G 293 
G 7  TYR G 206 ? ALA G 213 ? TYR G 313 ALA G 320 
G 8  ALA G 231 ? SER G 235 ? ALA G 338 SER G 342 
G 9  THR G 246 ? ASP G 248 ? THR G 353 ASP G 355 
G 10 LYS G 252 ? THR G 254 ? LYS G 359 THR G 361 
G 11 ALA G 305 ? ASN G 307 ? ALA G 412 ASN G 414 
G 12 ARG G 311 ? VAL G 313 ? ARG G 418 VAL G 420 
G 13 ARG G 341 ? LEU G 348 ? ARG G 448 LEU G 455 
G 14 LYS G 352 ? ILE G 354 ? LYS G 459 ILE G 461 
G 15 LYS G 356 ? VAL G 364 ? LYS G 463 VAL G 471 
G 16 VAL G 380 ? TYR G 388 ? VAL G 487 TYR G 495 
G 17 ASP G 393 ? ILE G 399 ? ASP G 500 ILE G 506 
G 18 THR G 404 ? LEU G 409 ? THR G 511 LEU G 516 
G 19 PHE G 421 ? THR G 428 ? PHE G 528 THR G 535 
G 20 GLY G 438 ? THR G 447 ? GLY G 545 THR G 554 
G 21 TYR G 453 ? THR G 466 ? TYR G 560 THR G 573 
H 1  ILE H 40  ? ASP H 46  ? ILE H 147 ASP H 153 
H 2  PHE H 66  ? ASN H 69  ? PHE H 173 ASN H 176 
H 3  GLN H 71  ? ASP H 72  ? GLN H 178 ASP H 179 
H 4  ARG H 113 ? MET H 119 ? ARG H 220 MET H 226 
H 5  HIS H 141 ? ALA H 145 ? HIS H 248 ALA H 252 
H 6  ILE H 181 ? SER H 186 ? ILE H 288 SER H 293 
H 7  TYR H 206 ? ALA H 213 ? TYR H 313 ALA H 320 
H 8  ALA H 231 ? SER H 235 ? ALA H 338 SER H 342 
H 9  THR H 246 ? ASP H 248 ? THR H 353 ASP H 355 
H 10 LYS H 252 ? THR H 254 ? LYS H 359 THR H 361 
H 11 ALA H 305 ? ASN H 307 ? ALA H 412 ASN H 414 
H 12 ARG H 311 ? VAL H 313 ? ARG H 418 VAL H 420 
H 13 ARG H 341 ? LEU H 348 ? ARG H 448 LEU H 455 
H 14 LYS H 352 ? ILE H 354 ? LYS H 459 ILE H 461 
H 15 LYS H 356 ? VAL H 364 ? LYS H 463 VAL H 471 
H 16 VAL H 380 ? TYR H 388 ? VAL H 487 TYR H 495 
H 17 ASP H 393 ? ILE H 399 ? ASP H 500 ILE H 506 
H 18 THR H 404 ? LEU H 409 ? THR H 511 LEU H 516 
H 19 PHE H 421 ? THR H 428 ? PHE H 528 THR H 535 
H 20 GLY H 438 ? THR H 447 ? GLY H 545 THR H 554 
H 21 TYR H 453 ? THR H 466 ? TYR H 560 THR H 573 
# 
_database_PDB_matrix.entry_id          1P8J 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1P8J 
_atom_sites.fract_transf_matrix[1][1]   0.010718 
_atom_sites.fract_transf_matrix[1][2]   0.003295 
_atom_sites.fract_transf_matrix[1][3]   0.002798 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007727 
_atom_sites.fract_transf_matrix[2][3]   0.002403 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007694 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . VAL A  1 2   ? 69.400  19.856  147.927 1.00 44.20  ? 109  VAL A N   1 
ATOM   2     C  CA  . VAL A  1 2   ? 69.957  19.631  146.557 1.00 44.87  ? 109  VAL A CA  1 
ATOM   3     C  C   . VAL A  1 2   ? 69.329  18.368  145.943 1.00 45.24  ? 109  VAL A C   1 
ATOM   4     O  O   . VAL A  1 2   ? 69.233  17.317  146.604 1.00 44.64  ? 109  VAL A O   1 
ATOM   5     C  CB  . VAL A  1 2   ? 71.496  19.450  146.602 1.00 44.47  ? 109  VAL A CB  1 
ATOM   6     C  CG1 . VAL A  1 2   ? 72.067  19.450  145.196 1.00 43.43  ? 109  VAL A CG1 1 
ATOM   7     C  CG2 . VAL A  1 2   ? 72.122  20.550  147.435 1.00 44.61  ? 109  VAL A CG2 1 
ATOM   8     N  N   . TYR A  1 3   ? 68.902  18.468  144.682 1.00 44.07  ? 110  TYR A N   1 
ATOM   9     C  CA  . TYR A  1 3   ? 68.280  17.322  144.019 1.00 42.39  ? 110  TYR A CA  1 
ATOM   10    C  C   . TYR A  1 3   ? 69.297  16.332  143.450 1.00 41.46  ? 110  TYR A C   1 
ATOM   11    O  O   . TYR A  1 3   ? 70.134  16.700  142.611 1.00 41.87  ? 110  TYR A O   1 
ATOM   12    C  CB  . TYR A  1 3   ? 67.345  17.766  142.880 1.00 40.21  ? 110  TYR A CB  1 
ATOM   13    C  CG  . TYR A  1 3   ? 66.682  16.576  142.232 1.00 37.22  ? 110  TYR A CG  1 
ATOM   14    C  CD1 . TYR A  1 3   ? 65.805  15.778  142.964 1.00 35.82  ? 110  TYR A CD1 1 
ATOM   15    C  CD2 . TYR A  1 3   ? 67.028  16.167  140.942 1.00 35.03  ? 110  TYR A CD2 1 
ATOM   16    C  CE1 . TYR A  1 3   ? 65.300  14.602  142.441 1.00 34.32  ? 110  TYR A CE1 1 
ATOM   17    C  CE2 . TYR A  1 3   ? 66.526  14.984  140.410 1.00 33.49  ? 110  TYR A CE2 1 
ATOM   18    C  CZ  . TYR A  1 3   ? 65.665  14.208  141.172 1.00 33.81  ? 110  TYR A CZ  1 
ATOM   19    O  OH  . TYR A  1 3   ? 65.182  13.012  140.695 1.00 35.78  ? 110  TYR A OH  1 
ATOM   20    N  N   . GLN A  1 4   ? 69.220  15.082  143.909 1.00 39.14  ? 111  GLN A N   1 
ATOM   21    C  CA  . GLN A  1 4   ? 70.118  14.037  143.428 1.00 36.59  ? 111  GLN A CA  1 
ATOM   22    C  C   . GLN A  1 4   ? 69.273  13.162  142.511 1.00 34.73  ? 111  GLN A C   1 
ATOM   23    O  O   . GLN A  1 4   ? 68.299  12.544  142.940 1.00 33.76  ? 111  GLN A O   1 
ATOM   24    C  CB  . GLN A  1 4   ? 70.665  13.213  144.599 1.00 37.03  ? 111  GLN A CB  1 
ATOM   25    C  CG  . GLN A  1 4   ? 71.779  12.249  144.225 0.00 36.75  ? 111  GLN A CG  1 
ATOM   26    C  CD  . GLN A  1 4   ? 73.045  12.963  143.790 0.00 36.73  ? 111  GLN A CD  1 
ATOM   27    O  OE1 . GLN A  1 4   ? 73.048  13.705  142.807 0.00 36.64  ? 111  GLN A OE1 1 
ATOM   28    N  NE2 . GLN A  1 4   ? 74.129  12.742  144.524 0.00 36.64  ? 111  GLN A NE2 1 
ATOM   29    N  N   . GLU A  1 5   ? 69.636  13.131  141.238 1.00 32.99  ? 112  GLU A N   1 
ATOM   30    C  CA  . GLU A  1 5   ? 68.889  12.342  140.282 1.00 32.18  ? 112  GLU A CA  1 
ATOM   31    C  C   . GLU A  1 5   ? 68.977  10.845  140.578 1.00 31.34  ? 112  GLU A C   1 
ATOM   32    O  O   . GLU A  1 5   ? 69.816  10.394  141.366 1.00 31.27  ? 112  GLU A O   1 
ATOM   33    C  CB  . GLU A  1 5   ? 69.388  12.631  138.872 1.00 33.22  ? 112  GLU A CB  1 
ATOM   34    C  CG  . GLU A  1 5   ? 70.751  12.072  138.560 1.00 34.24  ? 112  GLU A CG  1 
ATOM   35    C  CD  . GLU A  1 5   ? 71.272  12.594  137.241 1.00 36.30  ? 112  GLU A CD  1 
ATOM   36    O  OE1 . GLU A  1 5   ? 72.294  12.075  136.750 1.00 38.61  ? 112  GLU A OE1 1 
ATOM   37    O  OE2 . GLU A  1 5   ? 70.658  13.533  136.694 1.00 37.40  ? 112  GLU A OE2 1 
ATOM   38    N  N   . PRO A  1 6   ? 68.094  10.054  139.952 1.00 29.42  ? 113  PRO A N   1 
ATOM   39    C  CA  . PRO A  1 6   ? 68.059  8.606   140.140 1.00 27.89  ? 113  PRO A CA  1 
ATOM   40    C  C   . PRO A  1 6   ? 69.419  7.930   139.977 1.00 26.49  ? 113  PRO A C   1 
ATOM   41    O  O   . PRO A  1 6   ? 70.231  8.322   139.139 1.00 25.87  ? 113  PRO A O   1 
ATOM   42    C  CB  . PRO A  1 6   ? 67.052  8.157   139.086 1.00 28.42  ? 113  PRO A CB  1 
ATOM   43    C  CG  . PRO A  1 6   ? 66.098  9.289   139.053 1.00 27.93  ? 113  PRO A CG  1 
ATOM   44    C  CD  . PRO A  1 6   ? 67.014  10.482  139.045 1.00 28.47  ? 113  PRO A CD  1 
ATOM   45    N  N   . THR A  1 7   ? 69.651  6.899   140.779 1.00 25.38  ? 114  THR A N   1 
ATOM   46    C  CA  . THR A  1 7   ? 70.907  6.167   140.730 1.00 25.19  ? 114  THR A CA  1 
ATOM   47    C  C   . THR A  1 7   ? 70.737  4.823   140.042 1.00 25.00  ? 114  THR A C   1 
ATOM   48    O  O   . THR A  1 7   ? 71.683  4.047   139.939 1.00 24.47  ? 114  THR A O   1 
ATOM   49    C  CB  . THR A  1 7   ? 71.439  5.914   142.131 1.00 25.41  ? 114  THR A CB  1 
ATOM   50    O  OG1 . THR A  1 7   ? 70.442  5.216   142.885 1.00 27.49  ? 114  THR A OG1 1 
ATOM   51    C  CG2 . THR A  1 7   ? 71.777  7.227   142.821 1.00 25.34  ? 114  THR A CG2 1 
ATOM   52    N  N   . ASP A  1 8   ? 69.522  4.548   139.578 1.00 25.10  ? 115  ASP A N   1 
ATOM   53    C  CA  . ASP A  1 8   ? 69.219  3.292   138.897 1.00 24.19  ? 115  ASP A CA  1 
ATOM   54    C  C   . ASP A  1 8   ? 70.189  3.030   137.755 1.00 23.67  ? 115  ASP A C   1 
ATOM   55    O  O   . ASP A  1 8   ? 70.558  3.939   137.006 1.00 24.35  ? 115  ASP A O   1 
ATOM   56    C  CB  . ASP A  1 8   ? 67.789  3.330   138.378 1.00 23.83  ? 115  ASP A CB  1 
ATOM   57    C  CG  . ASP A  1 8   ? 66.798  3.618   139.472 1.00 23.55  ? 115  ASP A CG  1 
ATOM   58    O  OD1 . ASP A  1 8   ? 66.104  2.680   139.910 1.00 23.77  ? 115  ASP A OD1 1 
ATOM   59    O  OD2 . ASP A  1 8   ? 66.726  4.785   139.906 1.00 24.68  ? 115  ASP A OD2 1 
ATOM   60    N  N   . PRO A  1 9   ? 70.606  1.771   137.602 1.00 23.40  ? 116  PRO A N   1 
ATOM   61    C  CA  . PRO A  1 9   ? 71.547  1.340   136.564 1.00 23.02  ? 116  PRO A CA  1 
ATOM   62    C  C   . PRO A  1 9   ? 71.255  1.751   135.127 1.00 23.52  ? 116  PRO A C   1 
ATOM   63    O  O   . PRO A  1 9   ? 72.181  2.068   134.377 1.00 24.81  ? 116  PRO A O   1 
ATOM   64    C  CB  . PRO A  1 9   ? 71.587  -0.177  136.741 1.00 22.16  ? 116  PRO A CB  1 
ATOM   65    C  CG  . PRO A  1 9   ? 70.260  -0.499  137.367 1.00 22.96  ? 116  PRO A CG  1 
ATOM   66    C  CD  . PRO A  1 9   ? 70.091  0.616   138.359 1.00 22.93  ? 116  PRO A CD  1 
ATOM   67    N  N   . LYS A  1 10  ? 69.985  1.760   134.735 1.00 23.52  ? 117  LYS A N   1 
ATOM   68    C  CA  . LYS A  1 10  ? 69.641  2.126   133.360 1.00 23.39  ? 117  LYS A CA  1 
ATOM   69    C  C   . LYS A  1 10  ? 69.196  3.566   133.166 1.00 22.65  ? 117  LYS A C   1 
ATOM   70    O  O   . LYS A  1 10  ? 68.874  3.966   132.048 1.00 22.34  ? 117  LYS A O   1 
ATOM   71    C  CB  . LYS A  1 10  ? 68.551  1.199   132.814 1.00 24.11  ? 117  LYS A CB  1 
ATOM   72    C  CG  . LYS A  1 10  ? 68.956  -0.262  132.684 1.00 25.10  ? 117  LYS A CG  1 
ATOM   73    C  CD  . LYS A  1 10  ? 70.139  -0.409  131.749 1.00 27.92  ? 117  LYS A CD  1 
ATOM   74    C  CE  . LYS A  1 10  ? 70.639  -1.844  131.675 1.00 29.82  ? 117  LYS A CE  1 
ATOM   75    N  NZ  . LYS A  1 10  ? 71.922  -1.922  130.909 1.00 30.72  ? 117  LYS A NZ  1 
ATOM   76    N  N   . PHE A  1 11  ? 69.179  4.350   134.239 1.00 22.87  ? 118  PHE A N   1 
ATOM   77    C  CA  . PHE A  1 11  ? 68.755  5.738   134.116 1.00 23.57  ? 118  PHE A CA  1 
ATOM   78    C  C   . PHE A  1 11  ? 69.576  6.512   133.086 1.00 23.46  ? 118  PHE A C   1 
ATOM   79    O  O   . PHE A  1 11  ? 69.050  7.351   132.359 1.00 22.41  ? 118  PHE A O   1 
ATOM   80    C  CB  . PHE A  1 11  ? 68.825  6.463   135.458 1.00 23.85  ? 118  PHE A CB  1 
ATOM   81    C  CG  . PHE A  1 11  ? 68.402  7.899   135.376 1.00 22.74  ? 118  PHE A CG  1 
ATOM   82    C  CD1 . PHE A  1 11  ? 67.104  8.229   134.998 1.00 22.33  ? 118  PHE A CD1 1 
ATOM   83    C  CD2 . PHE A  1 11  ? 69.319  8.918   135.595 1.00 22.09  ? 118  PHE A CD2 1 
ATOM   84    C  CE1 . PHE A  1 11  ? 66.720  9.556   134.836 1.00 22.79  ? 118  PHE A CE1 1 
ATOM   85    C  CE2 . PHE A  1 11  ? 68.951  10.248  135.436 1.00 23.52  ? 118  PHE A CE2 1 
ATOM   86    C  CZ  . PHE A  1 11  ? 67.643  10.571  135.050 1.00 23.37  ? 118  PHE A CZ  1 
ATOM   87    N  N   . PRO A  1 12  ? 70.886  6.256   133.025 1.00 24.45  ? 119  PRO A N   1 
ATOM   88    C  CA  . PRO A  1 12  ? 71.685  6.988   132.038 1.00 26.10  ? 119  PRO A CA  1 
ATOM   89    C  C   . PRO A  1 12  ? 71.220  6.693   130.609 1.00 26.86  ? 119  PRO A C   1 
ATOM   90    O  O   . PRO A  1 12  ? 71.335  7.541   129.721 1.00 26.99  ? 119  PRO A O   1 
ATOM   91    C  CB  . PRO A  1 12  ? 73.102  6.486   132.305 1.00 25.68  ? 119  PRO A CB  1 
ATOM   92    C  CG  . PRO A  1 12  ? 73.077  6.200   133.776 1.00 24.89  ? 119  PRO A CG  1 
ATOM   93    C  CD  . PRO A  1 12  ? 71.751  5.504   133.951 1.00 24.30  ? 119  PRO A CD  1 
ATOM   94    N  N   . GLN A  1 13  ? 70.689  5.490   130.399 1.00 27.20  ? 120  GLN A N   1 
ATOM   95    C  CA  . GLN A  1 13  ? 70.204  5.090   129.084 1.00 27.09  ? 120  GLN A CA  1 
ATOM   96    C  C   . GLN A  1 13  ? 68.836  5.683   128.744 1.00 26.29  ? 120  GLN A C   1 
ATOM   97    O  O   . GLN A  1 13  ? 68.399  5.640   127.591 1.00 26.86  ? 120  GLN A O   1 
ATOM   98    C  CB  . GLN A  1 13  ? 70.190  3.562   128.982 1.00 28.14  ? 120  GLN A CB  1 
ATOM   99    C  CG  . GLN A  1 13  ? 71.602  3.005   128.814 1.00 31.77  ? 120  GLN A CG  1 
ATOM   100   C  CD  . GLN A  1 13  ? 71.959  1.951   129.836 1.00 35.49  ? 120  GLN A CD  1 
ATOM   101   O  OE1 . GLN A  1 13  ? 71.632  0.772   129.665 1.00 38.58  ? 120  GLN A OE1 1 
ATOM   102   N  NE2 . GLN A  1 13  ? 72.628  2.366   130.917 1.00 35.10  ? 120  GLN A NE2 1 
ATOM   103   N  N   . GLN A  1 14  ? 68.170  6.256   129.743 1.00 24.41  ? 121  GLN A N   1 
ATOM   104   C  CA  . GLN A  1 14  ? 66.868  6.873   129.524 1.00 21.66  ? 121  GLN A CA  1 
ATOM   105   C  C   . GLN A  1 14  ? 67.058  8.284   129.002 1.00 20.19  ? 121  GLN A C   1 
ATOM   106   O  O   . GLN A  1 14  ? 66.667  9.269   129.624 1.00 19.18  ? 121  GLN A O   1 
ATOM   107   C  CB  . GLN A  1 14  ? 66.054  6.851   130.819 1.00 21.31  ? 121  GLN A CB  1 
ATOM   108   C  CG  . GLN A  1 14  ? 65.752  5.416   131.256 1.00 22.26  ? 121  GLN A CG  1 
ATOM   109   C  CD  . GLN A  1 14  ? 64.808  5.314   132.434 1.00 22.45  ? 121  GLN A CD  1 
ATOM   110   O  OE1 . GLN A  1 14  ? 65.212  5.467   133.586 1.00 21.57  ? 121  GLN A OE1 1 
ATOM   111   N  NE2 . GLN A  1 14  ? 63.535  5.050   132.148 1.00 22.82  ? 121  GLN A NE2 1 
ATOM   112   N  N   . TRP A  1 15  ? 67.665  8.345   127.824 1.00 20.47  ? 122  TRP A N   1 
ATOM   113   C  CA  . TRP A  1 15  ? 67.973  9.589   127.124 1.00 21.02  ? 122  TRP A CA  1 
ATOM   114   C  C   . TRP A  1 15  ? 66.833  10.590  127.010 1.00 21.10  ? 122  TRP A C   1 
ATOM   115   O  O   . TRP A  1 15  ? 67.064  11.792  126.950 1.00 22.46  ? 122  TRP A O   1 
ATOM   116   C  CB  . TRP A  1 15  ? 68.471  9.267   125.713 1.00 19.62  ? 122  TRP A CB  1 
ATOM   117   C  CG  . TRP A  1 15  ? 67.492  8.443   124.919 1.00 20.10  ? 122  TRP A CG  1 
ATOM   118   C  CD1 . TRP A  1 15  ? 67.371  7.076   124.914 1.00 21.12  ? 122  TRP A CD1 1 
ATOM   119   C  CD2 . TRP A  1 15  ? 66.482  8.934   124.030 1.00 19.17  ? 122  TRP A CD2 1 
ATOM   120   N  NE1 . TRP A  1 15  ? 66.348  6.690   124.072 1.00 18.38  ? 122  TRP A NE1 1 
ATOM   121   C  CE2 . TRP A  1 15  ? 65.787  7.811   123.520 1.00 18.48  ? 122  TRP A CE2 1 
ATOM   122   C  CE3 . TRP A  1 15  ? 66.095  10.215  123.614 1.00 16.92  ? 122  TRP A CE3 1 
ATOM   123   C  CZ2 . TRP A  1 15  ? 64.732  7.935   122.618 1.00 17.44  ? 122  TRP A CZ2 1 
ATOM   124   C  CZ3 . TRP A  1 15  ? 65.052  10.335  122.719 1.00 16.25  ? 122  TRP A CZ3 1 
ATOM   125   C  CH2 . TRP A  1 15  ? 64.381  9.203   122.230 1.00 16.96  ? 122  TRP A CH2 1 
ATOM   126   N  N   . TYR A  1 16  ? 65.606  10.092  126.960 1.00 22.27  ? 123  TYR A N   1 
ATOM   127   C  CA  . TYR A  1 16  ? 64.423  10.941  126.818 1.00 20.86  ? 123  TYR A CA  1 
ATOM   128   C  C   . TYR A  1 16  ? 63.985  11.595  128.122 1.00 21.51  ? 123  TYR A C   1 
ATOM   129   O  O   . TYR A  1 16  ? 63.257  12.586  128.111 1.00 20.16  ? 123  TYR A O   1 
ATOM   130   C  CB  . TYR A  1 16  ? 63.287  10.107  126.233 1.00 19.67  ? 123  TYR A CB  1 
ATOM   131   C  CG  . TYR A  1 16  ? 63.151  8.758   126.909 1.00 19.07  ? 123  TYR A CG  1 
ATOM   132   C  CD1 . TYR A  1 16  ? 62.289  8.576   128.001 1.00 19.29  ? 123  TYR A CD1 1 
ATOM   133   C  CD2 . TYR A  1 16  ? 63.949  7.684   126.517 1.00 17.59  ? 123  TYR A CD2 1 
ATOM   134   C  CE1 . TYR A  1 16  ? 62.239  7.357   128.687 1.00 18.25  ? 123  TYR A CE1 1 
ATOM   135   C  CE2 . TYR A  1 16  ? 63.904  6.468   127.194 1.00 16.78  ? 123  TYR A CE2 1 
ATOM   136   C  CZ  . TYR A  1 16  ? 63.052  6.315   128.277 1.00 16.86  ? 123  TYR A CZ  1 
ATOM   137   O  OH  . TYR A  1 16  ? 63.037  5.136   128.969 1.00 15.57  ? 123  TYR A OH  1 
ATOM   138   N  N   . LEU A  1 17  ? 64.397  11.015  129.245 1.00 21.88  ? 124  LEU A N   1 
ATOM   139   C  CA  . LEU A  1 17  ? 64.067  11.590  130.544 1.00 22.09  ? 124  LEU A CA  1 
ATOM   140   C  C   . LEU A  1 17  ? 65.089  12.685  130.825 1.00 22.72  ? 124  LEU A C   1 
ATOM   141   O  O   . LEU A  1 17  ? 64.752  13.759  131.313 1.00 23.14  ? 124  LEU A O   1 
ATOM   142   C  CB  . LEU A  1 17  ? 64.149  10.537  131.648 1.00 20.18  ? 124  LEU A CB  1 
ATOM   143   C  CG  . LEU A  1 17  ? 63.042  9.499   131.654 1.00 19.68  ? 124  LEU A CG  1 
ATOM   144   C  CD1 . LEU A  1 17  ? 63.047  8.779   132.987 1.00 18.15  ? 124  LEU A CD1 1 
ATOM   145   C  CD2 . LEU A  1 17  ? 61.709  10.177  131.422 1.00 18.39  ? 124  LEU A CD2 1 
ATOM   146   N  N   . SER A  1 18  ? 66.341  12.391  130.500 1.00 23.15  ? 125  SER A N   1 
ATOM   147   C  CA  . SER A  1 18  ? 67.432  13.317  130.709 1.00 24.30  ? 125  SER A CA  1 
ATOM   148   C  C   . SER A  1 18  ? 68.566  12.965  129.762 1.00 25.64  ? 125  SER A C   1 
ATOM   149   O  O   . SER A  1 18  ? 69.116  11.867  129.823 1.00 26.53  ? 125  SER A O   1 
ATOM   150   C  CB  . SER A  1 18  ? 67.922  13.219  132.151 1.00 25.35  ? 125  SER A CB  1 
ATOM   151   O  OG  . SER A  1 18  ? 69.101  13.982  132.349 1.00 27.36  ? 125  SER A OG  1 
ATOM   152   N  N   . GLY A  1 19  ? 68.914  13.893  128.882 1.00 26.15  ? 126  GLY A N   1 
ATOM   153   C  CA  . GLY A  1 19  ? 69.992  13.646  127.947 1.00 27.07  ? 126  GLY A CA  1 
ATOM   154   C  C   . GLY A  1 19  ? 71.068  14.715  128.049 1.00 29.26  ? 126  GLY A C   1 
ATOM   155   O  O   . GLY A  1 19  ? 70.812  15.834  128.508 1.00 29.09  ? 126  GLY A O   1 
ATOM   156   N  N   . VAL A  1 20  ? 72.274  14.373  127.611 1.00 29.88  ? 127  VAL A N   1 
ATOM   157   C  CA  . VAL A  1 20  ? 73.396  15.298  127.654 1.00 31.49  ? 127  VAL A CA  1 
ATOM   158   C  C   . VAL A  1 20  ? 73.207  16.427  126.649 1.00 33.00  ? 127  VAL A C   1 
ATOM   159   O  O   . VAL A  1 20  ? 73.881  17.457  126.719 1.00 34.86  ? 127  VAL A O   1 
ATOM   160   C  CB  . VAL A  1 20  ? 74.697  14.578  127.309 1.00 31.13  ? 127  VAL A CB  1 
ATOM   161   C  CG1 . VAL A  1 20  ? 74.869  13.381  128.213 1.00 31.44  ? 127  VAL A CG1 1 
ATOM   162   C  CG2 . VAL A  1 20  ? 74.670  14.136  125.849 1.00 31.14  ? 127  VAL A CG2 1 
ATOM   163   N  N   . THR A  1 21  ? 72.281  16.228  125.719 1.00 33.62  ? 128  THR A N   1 
ATOM   164   C  CA  . THR A  1 21  ? 72.004  17.199  124.663 1.00 33.08  ? 128  THR A CA  1 
ATOM   165   C  C   . THR A  1 21  ? 70.830  18.115  125.033 1.00 32.12  ? 128  THR A C   1 
ATOM   166   O  O   . THR A  1 21  ? 70.595  19.139  124.387 1.00 29.83  ? 128  THR A O   1 
ATOM   167   C  CB  . THR A  1 21  ? 71.704  16.431  123.337 1.00 34.47  ? 128  THR A CB  1 
ATOM   168   O  OG1 . THR A  1 21  ? 71.582  17.350  122.242 1.00 36.02  ? 128  THR A OG1 1 
ATOM   169   C  CG2 . THR A  1 21  ? 70.420  15.611  123.479 1.00 34.47  ? 128  THR A CG2 1 
ATOM   170   N  N   . GLN A  1 22  ? 70.111  17.736  126.088 1.00 32.86  ? 129  GLN A N   1 
ATOM   171   C  CA  . GLN A  1 22  ? 68.943  18.480  126.571 1.00 33.73  ? 129  GLN A CA  1 
ATOM   172   C  C   . GLN A  1 22  ? 67.693  18.208  125.743 1.00 31.74  ? 129  GLN A C   1 
ATOM   173   O  O   . GLN A  1 22  ? 66.632  18.755  126.033 1.00 31.93  ? 129  GLN A O   1 
ATOM   174   C  CB  . GLN A  1 22  ? 69.193  19.993  126.573 1.00 36.11  ? 129  GLN A CB  1 
ATOM   175   C  CG  . GLN A  1 22  ? 69.663  20.582  127.899 1.00 39.76  ? 129  GLN A CG  1 
ATOM   176   C  CD  . GLN A  1 22  ? 71.103  20.248  128.207 1.00 42.78  ? 129  GLN A CD  1 
ATOM   177   O  OE1 . GLN A  1 22  ? 71.406  19.166  128.719 1.00 45.14  ? 129  GLN A OE1 1 
ATOM   178   N  NE2 . GLN A  1 22  ? 72.010  21.172  127.879 1.00 43.77  ? 129  GLN A NE2 1 
ATOM   179   N  N   . ARG A  1 23  ? 67.827  17.389  124.703 1.00 29.88  ? 130  ARG A N   1 
ATOM   180   C  CA  . ARG A  1 23  ? 66.695  17.040  123.844 1.00 26.74  ? 130  ARG A CA  1 
ATOM   181   C  C   . ARG A  1 23  ? 65.976  15.899  124.546 1.00 24.51  ? 130  ARG A C   1 
ATOM   182   O  O   . ARG A  1 23  ? 66.161  14.734  124.205 1.00 24.12  ? 130  ARG A O   1 
ATOM   183   C  CB  . ARG A  1 23  ? 67.196  16.591  122.472 1.00 25.76  ? 130  ARG A CB  1 
ATOM   184   C  CG  . ARG A  1 23  ? 68.015  17.650  121.768 1.00 25.52  ? 130  ARG A CG  1 
ATOM   185   C  CD  . ARG A  1 23  ? 67.147  18.804  121.326 1.00 28.22  ? 130  ARG A CD  1 
ATOM   186   N  NE  . ARG A  1 23  ? 67.909  20.035  121.101 1.00 32.41  ? 130  ARG A NE  1 
ATOM   187   C  CZ  . ARG A  1 23  ? 68.382  20.816  122.072 1.00 31.95  ? 130  ARG A CZ  1 
ATOM   188   N  NH1 . ARG A  1 23  ? 68.171  20.499  123.342 0.00 32.15  ? 130  ARG A NH1 1 
ATOM   189   N  NH2 . ARG A  1 23  ? 69.064  21.912  121.771 0.00 32.15  ? 130  ARG A NH2 1 
ATOM   190   N  N   . ASP A  1 24  ? 65.161  16.253  125.535 1.00 23.13  ? 131  ASP A N   1 
ATOM   191   C  CA  . ASP A  1 24  ? 64.427  15.283  126.342 1.00 21.73  ? 131  ASP A CA  1 
ATOM   192   C  C   . ASP A  1 24  ? 63.099  15.850  126.807 1.00 20.08  ? 131  ASP A C   1 
ATOM   193   O  O   . ASP A  1 24  ? 62.728  16.955  126.426 1.00 21.01  ? 131  ASP A O   1 
ATOM   194   C  CB  . ASP A  1 24  ? 65.249  14.914  127.564 1.00 23.52  ? 131  ASP A CB  1 
ATOM   195   C  CG  . ASP A  1 24  ? 65.757  16.137  128.299 1.00 26.04  ? 131  ASP A CG  1 
ATOM   196   O  OD1 . ASP A  1 24  ? 64.940  17.048  128.582 1.00 26.61  ? 131  ASP A OD1 1 
ATOM   197   O  OD2 . ASP A  1 24  ? 66.974  16.188  128.584 1.00 27.18  ? 131  ASP A OD2 1 
ATOM   198   N  N   . LEU A  1 25  ? 62.403  15.096  127.655 1.00 18.32  ? 132  LEU A N   1 
ATOM   199   C  CA  . LEU A  1 25  ? 61.098  15.500  128.169 1.00 16.60  ? 132  LEU A CA  1 
ATOM   200   C  C   . LEU A  1 25  ? 61.168  16.477  129.335 1.00 17.32  ? 132  LEU A C   1 
ATOM   201   O  O   . LEU A  1 25  ? 60.140  16.840  129.921 1.00 16.67  ? 132  LEU A O   1 
ATOM   202   C  CB  . LEU A  1 25  ? 60.297  14.259  128.556 1.00 15.66  ? 132  LEU A CB  1 
ATOM   203   C  CG  . LEU A  1 25  ? 59.902  13.426  127.332 1.00 12.36  ? 132  LEU A CG  1 
ATOM   204   C  CD1 . LEU A  1 25  ? 59.410  12.070  127.767 1.00 12.52  ? 132  LEU A CD1 1 
ATOM   205   C  CD2 . LEU A  1 25  ? 58.851  14.165  126.542 1.00 10.33  ? 132  LEU A CD2 1 
ATOM   206   N  N   . ASN A  1 26  ? 62.390  16.891  129.663 1.00 17.34  ? 133  ASN A N   1 
ATOM   207   C  CA  . ASN A  1 26  ? 62.643  17.857  130.715 1.00 17.59  ? 133  ASN A CA  1 
ATOM   208   C  C   . ASN A  1 26  ? 61.961  17.516  132.029 1.00 18.44  ? 133  ASN A C   1 
ATOM   209   O  O   . ASN A  1 26  ? 61.416  18.383  132.704 1.00 19.27  ? 133  ASN A O   1 
ATOM   210   C  CB  . ASN A  1 26  ? 62.197  19.239  130.235 1.00 17.89  ? 133  ASN A CB  1 
ATOM   211   C  CG  . ASN A  1 26  ? 62.634  20.341  131.166 1.00 18.71  ? 133  ASN A CG  1 
ATOM   212   O  OD1 . ASN A  1 26  ? 63.767  20.341  131.644 1.00 18.89  ? 133  ASN A OD1 1 
ATOM   213   N  ND2 . ASN A  1 26  ? 61.742  21.298  131.424 1.00 19.62  ? 133  ASN A ND2 1 
ATOM   214   N  N   . VAL A  1 27  ? 61.999  16.251  132.404 1.00 19.72  ? 134  VAL A N   1 
ATOM   215   C  CA  . VAL A  1 27  ? 61.358  15.842  133.639 1.00 21.46  ? 134  VAL A CA  1 
ATOM   216   C  C   . VAL A  1 27  ? 62.203  16.142  134.865 1.00 22.75  ? 134  VAL A C   1 
ATOM   217   O  O   . VAL A  1 27  ? 61.663  16.405  135.931 1.00 22.92  ? 134  VAL A O   1 
ATOM   218   C  CB  . VAL A  1 27  ? 61.009  14.333  133.650 1.00 20.66  ? 134  VAL A CB  1 
ATOM   219   C  CG1 . VAL A  1 27  ? 60.124  13.989  132.461 1.00 19.81  ? 134  VAL A CG1 1 
ATOM   220   C  CG2 . VAL A  1 27  ? 62.275  13.510  133.654 1.00 19.89  ? 134  VAL A CG2 1 
ATOM   221   N  N   . LYS A  1 28  ? 63.523  16.111  134.722 1.00 24.79  ? 135  LYS A N   1 
ATOM   222   C  CA  . LYS A  1 28  ? 64.399  16.378  135.857 1.00 25.94  ? 135  LYS A CA  1 
ATOM   223   C  C   . LYS A  1 28  ? 64.057  17.724  136.492 1.00 26.73  ? 135  LYS A C   1 
ATOM   224   O  O   . LYS A  1 28  ? 64.092  17.868  137.713 1.00 25.86  ? 135  LYS A O   1 
ATOM   225   C  CB  . LYS A  1 28  ? 65.868  16.342  135.421 1.00 28.51  ? 135  LYS A CB  1 
ATOM   226   C  CG  . LYS A  1 28  ? 66.855  16.118  136.577 1.00 30.12  ? 135  LYS A CG  1 
ATOM   227   C  CD  . LYS A  1 28  ? 68.295  15.970  136.081 1.00 30.58  ? 135  LYS A CD  1 
ATOM   228   C  CE  . LYS A  1 28  ? 69.281  16.048  137.233 0.00 30.56  ? 135  LYS A CE  1 
ATOM   229   N  NZ  . LYS A  1 28  ? 70.690  16.084  136.754 0.00 30.60  ? 135  LYS A NZ  1 
ATOM   230   N  N   . GLU A  1 29  ? 63.701  18.703  135.666 1.00 26.92  ? 136  GLU A N   1 
ATOM   231   C  CA  . GLU A  1 29  ? 63.340  20.013  136.175 1.00 26.46  ? 136  GLU A CA  1 
ATOM   232   C  C   . GLU A  1 29  ? 62.104  19.929  137.066 1.00 26.60  ? 136  GLU A C   1 
ATOM   233   O  O   . GLU A  1 29  ? 61.975  20.674  138.031 1.00 28.05  ? 136  GLU A O   1 
ATOM   234   C  CB  . GLU A  1 29  ? 63.098  20.961  135.011 1.00 27.80  ? 136  GLU A CB  1 
ATOM   235   C  CG  . GLU A  1 29  ? 62.682  22.363  135.407 1.00 29.74  ? 136  GLU A CG  1 
ATOM   236   C  CD  . GLU A  1 29  ? 62.597  23.290  134.204 1.00 31.79  ? 136  GLU A CD  1 
ATOM   237   O  OE1 . GLU A  1 29  ? 61.752  24.211  134.225 1.00 33.43  ? 136  GLU A OE1 1 
ATOM   238   O  OE2 . GLU A  1 29  ? 63.381  23.106  133.243 1.00 32.44  ? 136  GLU A OE2 1 
ATOM   239   N  N   . ALA A  1 30  ? 61.196  19.013  136.743 1.00 26.46  ? 137  ALA A N   1 
ATOM   240   C  CA  . ALA A  1 30  ? 59.979  18.830  137.526 1.00 24.72  ? 137  ALA A CA  1 
ATOM   241   C  C   . ALA A  1 30  ? 60.312  18.098  138.821 1.00 24.85  ? 137  ALA A C   1 
ATOM   242   O  O   . ALA A  1 30  ? 59.798  18.432  139.893 1.00 23.38  ? 137  ALA A O   1 
ATOM   243   C  CB  . ALA A  1 30  ? 58.962  18.033  136.727 1.00 24.82  ? 137  ALA A CB  1 
ATOM   244   N  N   . TRP A  1 31  ? 61.164  17.084  138.717 1.00 24.70  ? 138  TRP A N   1 
ATOM   245   C  CA  . TRP A  1 31  ? 61.567  16.321  139.892 1.00 24.87  ? 138  TRP A CA  1 
ATOM   246   C  C   . TRP A  1 31  ? 62.237  17.241  140.912 1.00 25.96  ? 138  TRP A C   1 
ATOM   247   O  O   . TRP A  1 31  ? 61.940  17.181  142.104 1.00 25.16  ? 138  TRP A O   1 
ATOM   248   C  CB  . TRP A  1 31  ? 62.549  15.204  139.515 1.00 23.13  ? 138  TRP A CB  1 
ATOM   249   C  CG  . TRP A  1 31  ? 61.967  14.101  138.670 1.00 21.58  ? 138  TRP A CG  1 
ATOM   250   C  CD1 . TRP A  1 31  ? 60.643  13.781  138.521 1.00 21.65  ? 138  TRP A CD1 1 
ATOM   251   C  CD2 . TRP A  1 31  ? 62.695  13.155  137.877 1.00 19.64  ? 138  TRP A CD2 1 
ATOM   252   N  NE1 . TRP A  1 31  ? 60.506  12.698  137.683 1.00 18.68  ? 138  TRP A NE1 1 
ATOM   253   C  CE2 . TRP A  1 31  ? 61.750  12.296  137.275 1.00 19.48  ? 138  TRP A CE2 1 
ATOM   254   C  CE3 . TRP A  1 31  ? 64.055  12.949  137.618 1.00 19.03  ? 138  TRP A CE3 1 
ATOM   255   C  CZ2 . TRP A  1 31  ? 62.124  11.250  136.432 1.00 17.85  ? 138  TRP A CZ2 1 
ATOM   256   C  CZ3 . TRP A  1 31  ? 64.424  11.909  136.780 1.00 18.09  ? 138  TRP A CZ3 1 
ATOM   257   C  CH2 . TRP A  1 31  ? 63.462  11.074  136.199 1.00 18.67  ? 138  TRP A CH2 1 
ATOM   258   N  N   . ALA A  1 32  ? 63.142  18.089  140.429 1.00 27.09  ? 139  ALA A N   1 
ATOM   259   C  CA  . ALA A  1 32  ? 63.859  19.019  141.289 1.00 26.95  ? 139  ALA A CA  1 
ATOM   260   C  C   . ALA A  1 32  ? 62.899  19.917  142.067 1.00 27.87  ? 139  ALA A C   1 
ATOM   261   O  O   . ALA A  1 32  ? 63.158  20.237  143.226 1.00 28.42  ? 139  ALA A O   1 
ATOM   262   C  CB  . ALA A  1 32  ? 64.809  19.853  140.464 1.00 27.11  ? 139  ALA A CB  1 
ATOM   263   N  N   . GLN A  1 33  ? 61.795  20.321  141.440 1.00 27.95  ? 140  GLN A N   1 
ATOM   264   C  CA  . GLN A  1 33  ? 60.812  21.167  142.110 1.00 27.36  ? 140  GLN A CA  1 
ATOM   265   C  C   . GLN A  1 33  ? 60.000  20.360  143.112 1.00 26.63  ? 140  GLN A C   1 
ATOM   266   O  O   . GLN A  1 33  ? 59.075  20.885  143.724 1.00 28.18  ? 140  GLN A O   1 
ATOM   267   C  CB  . GLN A  1 33  ? 59.849  21.795  141.103 1.00 29.11  ? 140  GLN A CB  1 
ATOM   268   C  CG  . GLN A  1 33  ? 60.479  22.715  140.080 1.00 32.40  ? 140  GLN A CG  1 
ATOM   269   C  CD  . GLN A  1 33  ? 59.429  23.371  139.179 1.00 37.26  ? 140  GLN A CD  1 
ATOM   270   O  OE1 . GLN A  1 33  ? 58.482  24.007  139.672 1.00 37.85  ? 140  GLN A OE1 1 
ATOM   271   N  NE2 . GLN A  1 33  ? 59.591  23.224  137.851 1.00 37.75  ? 140  GLN A NE2 1 
ATOM   272   N  N   . GLY A  1 34  ? 60.323  19.080  143.264 1.00 25.72  ? 141  GLY A N   1 
ATOM   273   C  CA  . GLY A  1 34  ? 59.596  18.247  144.215 1.00 24.73  ? 141  GLY A CA  1 
ATOM   274   C  C   . GLY A  1 34  ? 58.397  17.474  143.680 1.00 24.80  ? 141  GLY A C   1 
ATOM   275   O  O   . GLY A  1 34  ? 57.604  16.942  144.463 1.00 25.65  ? 141  GLY A O   1 
ATOM   276   N  N   . PHE A  1 35  ? 58.260  17.391  142.358 1.00 23.41  ? 142  PHE A N   1 
ATOM   277   C  CA  . PHE A  1 35  ? 57.134  16.674  141.758 1.00 22.00  ? 142  PHE A CA  1 
ATOM   278   C  C   . PHE A  1 35  ? 57.567  15.359  141.119 1.00 22.45  ? 142  PHE A C   1 
ATOM   279   O  O   . PHE A  1 35  ? 58.255  15.336  140.094 1.00 23.73  ? 142  PHE A O   1 
ATOM   280   C  CB  . PHE A  1 35  ? 56.438  17.575  140.742 1.00 20.11  ? 142  PHE A CB  1 
ATOM   281   C  CG  . PHE A  1 35  ? 55.907  18.840  141.345 1.00 17.57  ? 142  PHE A CG  1 
ATOM   282   C  CD1 . PHE A  1 35  ? 54.927  18.795  142.329 1.00 16.50  ? 142  PHE A CD1 1 
ATOM   283   C  CD2 . PHE A  1 35  ? 56.413  20.073  140.962 1.00 16.98  ? 142  PHE A CD2 1 
ATOM   284   C  CE1 . PHE A  1 35  ? 54.465  19.958  142.933 1.00 15.87  ? 142  PHE A CE1 1 
ATOM   285   C  CE2 . PHE A  1 35  ? 55.958  21.247  141.559 1.00 16.22  ? 142  PHE A CE2 1 
ATOM   286   C  CZ  . PHE A  1 35  ? 54.980  21.189  142.545 1.00 15.45  ? 142  PHE A CZ  1 
ATOM   287   N  N   . THR A  1 36  ? 57.159  14.259  141.742 1.00 22.58  ? 143  THR A N   1 
ATOM   288   C  CA  . THR A  1 36  ? 57.524  12.935  141.262 1.00 22.45  ? 143  THR A CA  1 
ATOM   289   C  C   . THR A  1 36  ? 56.348  11.976  141.197 1.00 21.66  ? 143  THR A C   1 
ATOM   290   O  O   . THR A  1 36  ? 56.525  10.786  140.940 1.00 20.86  ? 143  THR A O   1 
ATOM   291   C  CB  . THR A  1 36  ? 58.589  12.314  142.160 1.00 22.52  ? 143  THR A CB  1 
ATOM   292   O  OG1 . THR A  1 36  ? 58.123  12.341  143.513 1.00 21.73  ? 143  THR A OG1 1 
ATOM   293   C  CG2 . THR A  1 36  ? 59.902  13.084  142.043 1.00 22.71  ? 143  THR A CG2 1 
ATOM   294   N  N   . GLY A  1 37  ? 55.151  12.486  141.450 1.00 22.33  ? 144  GLY A N   1 
ATOM   295   C  CA  . GLY A  1 37  ? 53.978  11.636  141.377 1.00 23.58  ? 144  GLY A CA  1 
ATOM   296   C  C   . GLY A  1 37  ? 53.325  11.244  142.682 1.00 23.52  ? 144  GLY A C   1 
ATOM   297   O  O   . GLY A  1 37  ? 52.326  10.530  142.666 1.00 24.78  ? 144  GLY A O   1 
ATOM   298   N  N   . HIS A  1 38  ? 53.872  11.696  143.804 1.00 24.11  ? 145  HIS A N   1 
ATOM   299   C  CA  . HIS A  1 38  ? 53.300  11.379  145.112 1.00 24.23  ? 145  HIS A CA  1 
ATOM   300   C  C   . HIS A  1 38  ? 51.805  11.615  145.136 1.00 21.83  ? 145  HIS A C   1 
ATOM   301   O  O   . HIS A  1 38  ? 51.336  12.665  144.718 1.00 22.44  ? 145  HIS A O   1 
ATOM   302   C  CB  . HIS A  1 38  ? 53.926  12.250  146.204 1.00 29.30  ? 145  HIS A CB  1 
ATOM   303   C  CG  . HIS A  1 38  ? 55.240  11.745  146.722 1.00 36.51  ? 145  HIS A CG  1 
ATOM   304   N  ND1 . HIS A  1 38  ? 55.343  10.642  147.548 1.00 38.06  ? 145  HIS A ND1 1 
ATOM   305   C  CD2 . HIS A  1 38  ? 56.505  12.206  146.545 1.00 37.54  ? 145  HIS A CD2 1 
ATOM   306   C  CE1 . HIS A  1 38  ? 56.616  10.446  147.855 1.00 39.32  ? 145  HIS A CE1 1 
ATOM   307   N  NE2 . HIS A  1 38  ? 57.341  11.380  147.259 1.00 39.23  ? 145  HIS A NE2 1 
ATOM   308   N  N   . GLY A  1 39  ? 51.057  10.640  145.632 1.00 20.17  ? 146  GLY A N   1 
ATOM   309   C  CA  . GLY A  1 39  ? 49.620  10.804  145.736 1.00 19.19  ? 146  GLY A CA  1 
ATOM   310   C  C   . GLY A  1 39  ? 48.812  10.657  144.468 1.00 19.59  ? 146  GLY A C   1 
ATOM   311   O  O   . GLY A  1 39  ? 47.584  10.754  144.513 1.00 20.65  ? 146  GLY A O   1 
ATOM   312   N  N   . ILE A  1 40  ? 49.477  10.425  143.341 1.00 18.71  ? 147  ILE A N   1 
ATOM   313   C  CA  . ILE A  1 40  ? 48.768  10.270  142.080 1.00 17.69  ? 147  ILE A CA  1 
ATOM   314   C  C   . ILE A  1 40  ? 48.680  8.791   141.697 1.00 18.02  ? 147  ILE A C   1 
ATOM   315   O  O   . ILE A  1 40  ? 49.636  8.031   141.871 1.00 16.87  ? 147  ILE A O   1 
ATOM   316   C  CB  . ILE A  1 40  ? 49.469  11.063  140.954 1.00 17.40  ? 147  ILE A CB  1 
ATOM   317   C  CG1 . ILE A  1 40  ? 49.573  12.541  141.343 1.00 16.02  ? 147  ILE A CG1 1 
ATOM   318   C  CG2 . ILE A  1 40  ? 48.697  10.913  139.641 1.00 17.72  ? 147  ILE A CG2 1 
ATOM   319   C  CD1 . ILE A  1 40  ? 48.271  13.165  141.771 1.00 13.86  ? 147  ILE A CD1 1 
ATOM   320   N  N   . VAL A  1 41  ? 47.519  8.393   141.185 1.00 17.59  ? 148  VAL A N   1 
ATOM   321   C  CA  . VAL A  1 41  ? 47.278  7.011   140.779 1.00 16.62  ? 148  VAL A CA  1 
ATOM   322   C  C   . VAL A  1 41  ? 47.047  6.899   139.277 1.00 15.66  ? 148  VAL A C   1 
ATOM   323   O  O   . VAL A  1 41  ? 46.177  7.571   138.720 1.00 15.66  ? 148  VAL A O   1 
ATOM   324   C  CB  . VAL A  1 41  ? 46.052  6.422   141.526 1.00 17.29  ? 148  VAL A CB  1 
ATOM   325   C  CG1 . VAL A  1 41  ? 45.797  4.993   141.086 1.00 15.37  ? 148  VAL A CG1 1 
ATOM   326   C  CG2 . VAL A  1 41  ? 46.299  6.462   143.027 1.00 14.89  ? 148  VAL A CG2 1 
ATOM   327   N  N   . VAL A  1 42  ? 47.834  6.045   138.634 1.00 14.61  ? 149  VAL A N   1 
ATOM   328   C  CA  . VAL A  1 42  ? 47.745  5.821   137.197 1.00 14.35  ? 149  VAL A CA  1 
ATOM   329   C  C   . VAL A  1 42  ? 47.457  4.355   136.895 1.00 14.93  ? 149  VAL A C   1 
ATOM   330   O  O   . VAL A  1 42  ? 48.038  3.452   137.498 1.00 14.59  ? 149  VAL A O   1 
ATOM   331   C  CB  . VAL A  1 42  ? 49.058  6.185   136.495 1.00 14.77  ? 149  VAL A CB  1 
ATOM   332   C  CG1 . VAL A  1 42  ? 48.933  5.922   135.010 1.00 13.93  ? 149  VAL A CG1 1 
ATOM   333   C  CG2 . VAL A  1 42  ? 49.415  7.637   136.764 1.00 13.76  ? 149  VAL A CG2 1 
ATOM   334   N  N   . SER A  1 43  ? 46.570  4.116   135.941 1.00 15.40  ? 150  SER A N   1 
ATOM   335   C  CA  . SER A  1 43  ? 46.220  2.747   135.580 1.00 15.12  ? 150  SER A CA  1 
ATOM   336   C  C   . SER A  1 43  ? 46.488  2.486   134.107 1.00 14.14  ? 150  SER A C   1 
ATOM   337   O  O   . SER A  1 43  ? 46.146  3.299   133.257 1.00 16.52  ? 150  SER A O   1 
ATOM   338   C  CB  . SER A  1 43  ? 44.748  2.506   135.893 1.00 14.76  ? 150  SER A CB  1 
ATOM   339   O  OG  . SER A  1 43  ? 44.414  1.157   135.699 1.00 18.13  ? 150  SER A OG  1 
ATOM   340   N  N   . ILE A  1 44  ? 47.110  1.354   133.810 1.00 13.84  ? 151  ILE A N   1 
ATOM   341   C  CA  . ILE A  1 44  ? 47.415  0.977   132.433 1.00 13.41  ? 151  ILE A CA  1 
ATOM   342   C  C   . ILE A  1 44  ? 46.349  0.009   131.912 1.00 13.85  ? 151  ILE A C   1 
ATOM   343   O  O   . ILE A  1 44  ? 46.211  -1.099  132.434 1.00 14.25  ? 151  ILE A O   1 
ATOM   344   C  CB  . ILE A  1 44  ? 48.774  0.249   132.341 1.00 13.93  ? 151  ILE A CB  1 
ATOM   345   C  CG1 . ILE A  1 44  ? 49.893  1.131   132.906 1.00 13.75  ? 151  ILE A CG1 1 
ATOM   346   C  CG2 . ILE A  1 44  ? 49.050  -0.142  130.891 1.00 15.13  ? 151  ILE A CG2 1 
ATOM   347   C  CD1 . ILE A  1 44  ? 50.135  2.413   132.119 1.00 12.23  ? 151  ILE A CD1 1 
ATOM   348   N  N   . LEU A  1 45  ? 45.591  0.422   130.899 1.00 12.80  ? 152  LEU A N   1 
ATOM   349   C  CA  . LEU A  1 45  ? 44.570  -0.445  130.318 1.00 12.10  ? 152  LEU A CA  1 
ATOM   350   C  C   . LEU A  1 45  ? 45.254  -1.206  129.202 1.00 12.88  ? 152  LEU A C   1 
ATOM   351   O  O   . LEU A  1 45  ? 45.510  -0.656  128.137 1.00 13.62  ? 152  LEU A O   1 
ATOM   352   C  CB  . LEU A  1 45  ? 43.411  0.384   129.757 1.00 12.29  ? 152  LEU A CB  1 
ATOM   353   C  CG  . LEU A  1 45  ? 42.734  1.344   130.747 1.00 12.49  ? 152  LEU A CG  1 
ATOM   354   C  CD1 . LEU A  1 45  ? 41.453  1.869   130.156 1.00 11.60  ? 152  LEU A CD1 1 
ATOM   355   C  CD2 . LEU A  1 45  ? 42.435  0.635   132.043 1.00 13.14  ? 152  LEU A CD2 1 
ATOM   356   N  N   . ASP A  1 46  ? 45.552  -2.480  129.435 1.00 15.02  ? 153  ASP A N   1 
ATOM   357   C  CA  . ASP A  1 46  ? 46.270  -3.264  128.430 1.00 16.11  ? 153  ASP A CA  1 
ATOM   358   C  C   . ASP A  1 46  ? 46.064  -4.780  128.621 1.00 16.09  ? 153  ASP A C   1 
ATOM   359   O  O   . ASP A  1 46  ? 44.953  -5.239  128.885 1.00 16.32  ? 153  ASP A O   1 
ATOM   360   C  CB  . ASP A  1 46  ? 47.765  -2.896  128.526 1.00 17.61  ? 153  ASP A CB  1 
ATOM   361   C  CG  . ASP A  1 46  ? 48.505  -3.041  127.209 1.00 18.64  ? 153  ASP A CG  1 
ATOM   362   O  OD1 . ASP A  1 46  ? 49.053  -2.022  126.732 1.00 18.38  ? 153  ASP A OD1 1 
ATOM   363   O  OD2 . ASP A  1 46  ? 48.552  -4.167  126.658 1.00 20.93  ? 153  ASP A OD2 1 
ATOM   364   N  N   . ASP A  1 47  ? 47.138  -5.552  128.487 1.00 16.51  ? 154  ASP A N   1 
ATOM   365   C  CA  . ASP A  1 47  ? 47.061  -7.000  128.635 1.00 16.90  ? 154  ASP A CA  1 
ATOM   366   C  C   . ASP A  1 47  ? 47.471  -7.497  130.022 1.00 17.12  ? 154  ASP A C   1 
ATOM   367   O  O   . ASP A  1 47  ? 47.759  -8.680  130.199 1.00 16.56  ? 154  ASP A O   1 
ATOM   368   C  CB  . ASP A  1 47  ? 47.933  -7.678  127.579 1.00 17.08  ? 154  ASP A CB  1 
ATOM   369   C  CG  . ASP A  1 47  ? 49.361  -7.175  127.595 1.00 17.22  ? 154  ASP A CG  1 
ATOM   370   O  OD1 . ASP A  1 47  ? 49.775  -6.599  128.624 1.00 16.69  ? 154  ASP A OD1 1 
ATOM   371   O  OD2 . ASP A  1 47  ? 50.076  -7.368  126.588 1.00 16.92  ? 154  ASP A OD2 1 
ATOM   372   N  N   . GLY A  1 48  ? 47.487  -6.597  131.002 1.00 17.38  ? 155  GLY A N   1 
ATOM   373   C  CA  . GLY A  1 48  ? 47.868  -6.988  132.349 1.00 17.54  ? 155  GLY A CA  1 
ATOM   374   C  C   . GLY A  1 48  ? 49.164  -6.352  132.819 1.00 17.50  ? 155  GLY A C   1 
ATOM   375   O  O   . GLY A  1 48  ? 49.905  -5.756  132.035 1.00 17.75  ? 155  GLY A O   1 
ATOM   376   N  N   . ILE A  1 49  ? 49.450  -6.496  134.105 1.00 17.38  ? 156  ILE A N   1 
ATOM   377   C  CA  . ILE A  1 49  ? 50.650  -5.916  134.675 1.00 17.82  ? 156  ILE A CA  1 
ATOM   378   C  C   . ILE A  1 49  ? 51.327  -6.909  135.599 1.00 17.71  ? 156  ILE A C   1 
ATOM   379   O  O   . ILE A  1 49  ? 50.675  -7.520  136.443 1.00 16.61  ? 156  ILE A O   1 
ATOM   380   C  CB  . ILE A  1 49  ? 50.295  -4.628  135.459 1.00 18.62  ? 156  ILE A CB  1 
ATOM   381   C  CG1 . ILE A  1 49  ? 51.557  -3.997  136.032 1.00 19.54  ? 156  ILE A CG1 1 
ATOM   382   C  CG2 . ILE A  1 49  ? 49.316  -4.943  136.590 1.00 17.01  ? 156  ILE A CG2 1 
ATOM   383   C  CD1 . ILE A  1 49  ? 51.299  -2.665  136.718 1.00 19.76  ? 156  ILE A CD1 1 
ATOM   384   N  N   . GLU A  1 50  ? 52.631  -7.088  135.421 1.00 18.39  ? 157  GLU A N   1 
ATOM   385   C  CA  . GLU A  1 50  ? 53.394  -8.000  136.268 1.00 19.55  ? 157  GLU A CA  1 
ATOM   386   C  C   . GLU A  1 50  ? 53.600  -7.265  137.586 1.00 19.29  ? 157  GLU A C   1 
ATOM   387   O  O   . GLU A  1 50  ? 54.646  -6.673  137.813 1.00 19.41  ? 157  GLU A O   1 
ATOM   388   C  CB  . GLU A  1 50  ? 54.737  -8.324  135.610 1.00 19.13  ? 157  GLU A CB  1 
ATOM   389   C  CG  . GLU A  1 50  ? 55.394  -9.567  136.179 1.00 21.32  ? 157  GLU A CG  1 
ATOM   390   C  CD  . GLU A  1 50  ? 56.624  -9.978  135.408 1.00 21.16  ? 157  GLU A CD  1 
ATOM   391   O  OE1 . GLU A  1 50  ? 57.609  -9.223  135.425 1.00 22.89  ? 157  GLU A OE1 1 
ATOM   392   O  OE2 . GLU A  1 50  ? 56.610  -11.055 134.782 1.00 22.21  ? 157  GLU A OE2 1 
ATOM   393   N  N   . LYS A  1 51  ? 52.582  -7.311  138.440 1.00 20.69  ? 158  LYS A N   1 
ATOM   394   C  CA  . LYS A  1 51  ? 52.581  -6.616  139.719 1.00 22.12  ? 158  LYS A CA  1 
ATOM   395   C  C   . LYS A  1 51  ? 53.713  -6.941  140.687 1.00 22.58  ? 158  LYS A C   1 
ATOM   396   O  O   . LYS A  1 51  ? 53.996  -6.166  141.598 1.00 22.67  ? 158  LYS A O   1 
ATOM   397   C  CB  . LYS A  1 51  ? 51.241  -6.839  140.414 1.00 22.24  ? 158  LYS A CB  1 
ATOM   398   C  CG  . LYS A  1 51  ? 50.985  -8.260  140.844 1.00 22.90  ? 158  LYS A CG  1 
ATOM   399   C  CD  . LYS A  1 51  ? 49.678  -8.336  141.605 1.00 24.21  ? 158  LYS A CD  1 
ATOM   400   C  CE  . LYS A  1 51  ? 49.395  -9.740  142.085 1.00 25.87  ? 158  LYS A CE  1 
ATOM   401   N  NZ  . LYS A  1 51  ? 49.292  -10.699 140.952 1.00 27.52  ? 158  LYS A NZ  1 
ATOM   402   N  N   . ASN A  1 52  ? 54.358  -8.080  140.481 1.00 22.48  ? 159  ASN A N   1 
ATOM   403   C  CA  . ASN A  1 52  ? 55.449  -8.516  141.341 1.00 22.84  ? 159  ASN A CA  1 
ATOM   404   C  C   . ASN A  1 52  ? 56.802  -8.225  140.712 1.00 21.43  ? 159  ASN A C   1 
ATOM   405   O  O   . ASN A  1 52  ? 57.811  -8.765  141.144 1.00 22.16  ? 159  ASN A O   1 
ATOM   406   C  CB  . ASN A  1 52  ? 55.327  -10.015 141.567 1.00 24.80  ? 159  ASN A CB  1 
ATOM   407   C  CG  . ASN A  1 52  ? 55.268  -10.791 140.250 1.00 26.34  ? 159  ASN A CG  1 
ATOM   408   O  OD1 . ASN A  1 52  ? 54.325  -10.648 139.470 1.00 24.56  ? 159  ASN A OD1 1 
ATOM   409   N  ND2 . ASN A  1 52  ? 56.294  -11.596 139.990 1.00 28.28  ? 159  ASN A ND2 1 
ATOM   410   N  N   . HIS A  1 53  ? 56.821  -7.397  139.679 1.00 20.91  ? 160  HIS A N   1 
ATOM   411   C  CA  . HIS A  1 53  ? 58.070  -7.058  139.014 1.00 20.99  ? 160  HIS A CA  1 
ATOM   412   C  C   . HIS A  1 53  ? 58.940  -6.264  139.998 1.00 21.66  ? 160  HIS A C   1 
ATOM   413   O  O   . HIS A  1 53  ? 58.460  -5.353  140.677 1.00 21.61  ? 160  HIS A O   1 
ATOM   414   C  CB  . HIS A  1 53  ? 57.779  -6.246  137.747 1.00 19.58  ? 160  HIS A CB  1 
ATOM   415   C  CG  . HIS A  1 53  ? 58.967  -6.073  136.853 1.00 20.53  ? 160  HIS A CG  1 
ATOM   416   N  ND1 . HIS A  1 53  ? 60.074  -5.337  137.215 1.00 20.41  ? 160  HIS A ND1 1 
ATOM   417   C  CD2 . HIS A  1 53  ? 59.224  -6.547  135.610 1.00 20.19  ? 160  HIS A CD2 1 
ATOM   418   C  CE1 . HIS A  1 53  ? 60.959  -5.364  136.235 1.00 20.11  ? 160  HIS A CE1 1 
ATOM   419   N  NE2 . HIS A  1 53  ? 60.469  -6.092  135.249 1.00 19.29  ? 160  HIS A NE2 1 
ATOM   420   N  N   . PRO A  1 54  ? 60.233  -6.609  140.096 1.00 22.07  ? 161  PRO A N   1 
ATOM   421   C  CA  . PRO A  1 54  ? 61.132  -5.906  141.018 1.00 22.37  ? 161  PRO A CA  1 
ATOM   422   C  C   . PRO A  1 54  ? 61.168  -4.386  140.900 1.00 22.69  ? 161  PRO A C   1 
ATOM   423   O  O   . PRO A  1 54  ? 61.526  -3.698  141.860 1.00 23.42  ? 161  PRO A O   1 
ATOM   424   C  CB  . PRO A  1 54  ? 62.490  -6.562  140.754 1.00 21.69  ? 161  PRO A CB  1 
ATOM   425   C  CG  . PRO A  1 54  ? 62.351  -7.126  139.370 1.00 22.67  ? 161  PRO A CG  1 
ATOM   426   C  CD  . PRO A  1 54  ? 60.954  -7.654  139.353 1.00 22.15  ? 161  PRO A CD  1 
ATOM   427   N  N   . ASP A  1 55  ? 60.773  -3.855  139.745 1.00 21.71  ? 162  ASP A N   1 
ATOM   428   C  CA  . ASP A  1 55  ? 60.780  -2.411  139.561 1.00 20.11  ? 162  ASP A CA  1 
ATOM   429   C  C   . ASP A  1 55  ? 59.376  -1.812  139.527 1.00 18.80  ? 162  ASP A C   1 
ATOM   430   O  O   . ASP A  1 55  ? 59.200  -0.630  139.241 1.00 19.44  ? 162  ASP A O   1 
ATOM   431   C  CB  . ASP A  1 55  ? 61.546  -2.058  138.287 1.00 21.50  ? 162  ASP A CB  1 
ATOM   432   C  CG  . ASP A  1 55  ? 62.407  -0.816  138.449 1.00 21.58  ? 162  ASP A CG  1 
ATOM   433   O  OD1 . ASP A  1 55  ? 62.807  -0.510  139.593 1.00 22.43  ? 162  ASP A OD1 1 
ATOM   434   O  OD2 . ASP A  1 55  ? 62.698  -0.157  137.430 1.00 22.03  ? 162  ASP A OD2 1 
ATOM   435   N  N   . LEU A  1 56  ? 58.375  -2.626  139.841 1.00 17.67  ? 163  LEU A N   1 
ATOM   436   C  CA  . LEU A  1 56  ? 56.990  -2.159  139.863 1.00 16.24  ? 163  LEU A CA  1 
ATOM   437   C  C   . LEU A  1 56  ? 56.326  -2.407  141.210 1.00 15.68  ? 163  LEU A C   1 
ATOM   438   O  O   . LEU A  1 56  ? 55.510  -1.610  141.661 1.00 16.93  ? 163  LEU A O   1 
ATOM   439   C  CB  . LEU A  1 56  ? 56.163  -2.863  138.780 1.00 14.90  ? 163  LEU A CB  1 
ATOM   440   C  CG  . LEU A  1 56  ? 56.464  -2.567  137.309 1.00 14.27  ? 163  LEU A CG  1 
ATOM   441   C  CD1 . LEU A  1 56  ? 55.523  -3.391  136.455 1.00 14.01  ? 163  LEU A CD1 1 
ATOM   442   C  CD2 . LEU A  1 56  ? 56.293  -1.078  137.008 1.00 12.39  ? 163  LEU A CD2 1 
ATOM   443   N  N   . ALA A  1 57  ? 56.680  -3.517  141.845 1.00 15.32  ? 164  ALA A N   1 
ATOM   444   C  CA  . ALA A  1 57  ? 56.085  -3.906  143.118 1.00 16.48  ? 164  ALA A CA  1 
ATOM   445   C  C   . ALA A  1 57  ? 55.966  -2.768  144.117 1.00 16.63  ? 164  ALA A C   1 
ATOM   446   O  O   . ALA A  1 57  ? 54.924  -2.604  144.742 1.00 15.89  ? 164  ALA A O   1 
ATOM   447   C  CB  . ALA A  1 57  ? 56.871  -5.057  143.717 1.00 16.47  ? 164  ALA A CB  1 
ATOM   448   N  N   . GLY A  1 58  ? 57.030  -1.978  144.240 1.00 17.45  ? 165  GLY A N   1 
ATOM   449   C  CA  . GLY A  1 58  ? 57.033  -0.863  145.166 1.00 17.01  ? 165  GLY A CA  1 
ATOM   450   C  C   . GLY A  1 58  ? 55.935  0.157   144.961 1.00 17.58  ? 165  GLY A C   1 
ATOM   451   O  O   . GLY A  1 58  ? 55.476  0.767   145.925 1.00 18.65  ? 165  GLY A O   1 
ATOM   452   N  N   . ASN A  1 59  ? 55.513  0.357   143.716 1.00 17.50  ? 166  ASN A N   1 
ATOM   453   C  CA  . ASN A  1 59  ? 54.464  1.321   143.433 1.00 18.19  ? 166  ASN A CA  1 
ATOM   454   C  C   . ASN A  1 59  ? 53.148  0.678   143.036 1.00 19.06  ? 166  ASN A C   1 
ATOM   455   O  O   . ASN A  1 59  ? 52.173  1.379   142.765 1.00 19.83  ? 166  ASN A O   1 
ATOM   456   C  CB  . ASN A  1 59  ? 54.892  2.273   142.316 1.00 19.08  ? 166  ASN A CB  1 
ATOM   457   C  CG  . ASN A  1 59  ? 56.007  3.204   142.738 1.00 19.83  ? 166  ASN A CG  1 
ATOM   458   O  OD1 . ASN A  1 59  ? 56.093  3.594   143.898 1.00 21.00  ? 166  ASN A OD1 1 
ATOM   459   N  ND2 . ASN A  1 59  ? 56.860  3.578   141.793 1.00 19.51  ? 166  ASN A ND2 1 
ATOM   460   N  N   . TYR A  1 60  ? 53.105  -0.648  143.001 1.00 18.23  ? 167  TYR A N   1 
ATOM   461   C  CA  . TYR A  1 60  ? 51.885  -1.324  142.593 1.00 18.03  ? 167  TYR A CA  1 
ATOM   462   C  C   . TYR A  1 60  ? 50.690  -0.973  143.453 1.00 18.35  ? 167  TYR A C   1 
ATOM   463   O  O   . TYR A  1 60  ? 50.798  -0.910  144.668 1.00 19.33  ? 167  TYR A O   1 
ATOM   464   C  CB  . TYR A  1 60  ? 52.077  -2.838  142.606 1.00 18.14  ? 167  TYR A CB  1 
ATOM   465   C  CG  . TYR A  1 60  ? 50.833  -3.579  142.183 1.00 17.11  ? 167  TYR A CG  1 
ATOM   466   C  CD1 . TYR A  1 60  ? 50.362  -3.500  140.874 1.00 16.42  ? 167  TYR A CD1 1 
ATOM   467   C  CD2 . TYR A  1 60  ? 50.109  -4.328  143.099 1.00 17.54  ? 167  TYR A CD2 1 
ATOM   468   C  CE1 . TYR A  1 60  ? 49.195  -4.152  140.489 1.00 17.69  ? 167  TYR A CE1 1 
ATOM   469   C  CE2 . TYR A  1 60  ? 48.939  -4.985  142.730 1.00 19.25  ? 167  TYR A CE2 1 
ATOM   470   C  CZ  . TYR A  1 60  ? 48.483  -4.893  141.418 1.00 19.66  ? 167  TYR A CZ  1 
ATOM   471   O  OH  . TYR A  1 60  ? 47.314  -5.537  141.039 1.00 20.67  ? 167  TYR A OH  1 
ATOM   472   N  N   . ASP A  1 61  ? 49.542  -0.769  142.813 1.00 18.98  ? 168  ASP A N   1 
ATOM   473   C  CA  . ASP A  1 61  ? 48.307  -0.422  143.514 1.00 19.35  ? 168  ASP A CA  1 
ATOM   474   C  C   . ASP A  1 61  ? 47.150  -1.339  143.110 1.00 19.94  ? 168  ASP A C   1 
ATOM   475   O  O   . ASP A  1 61  ? 46.586  -1.197  142.026 1.00 20.40  ? 168  ASP A O   1 
ATOM   476   C  CB  . ASP A  1 61  ? 47.929  1.026   143.206 1.00 18.53  ? 168  ASP A CB  1 
ATOM   477   C  CG  . ASP A  1 61  ? 46.682  1.474   143.942 1.00 19.41  ? 168  ASP A CG  1 
ATOM   478   O  OD1 . ASP A  1 61  ? 45.993  0.623   144.552 1.00 20.29  ? 168  ASP A OD1 1 
ATOM   479   O  OD2 . ASP A  1 61  ? 46.386  2.684   143.904 1.00 18.87  ? 168  ASP A OD2 1 
ATOM   480   N  N   . PRO A  1 62  ? 46.765  -2.280  143.990 1.00 20.75  ? 169  PRO A N   1 
ATOM   481   C  CA  . PRO A  1 62  ? 45.666  -3.205  143.687 1.00 19.21  ? 169  PRO A CA  1 
ATOM   482   C  C   . PRO A  1 62  ? 44.395  -2.452  143.358 1.00 18.76  ? 169  PRO A C   1 
ATOM   483   O  O   . PRO A  1 62  ? 43.575  -2.923  142.580 1.00 20.02  ? 169  PRO A O   1 
ATOM   484   C  CB  . PRO A  1 62  ? 45.516  -4.010  144.974 1.00 18.47  ? 169  PRO A CB  1 
ATOM   485   C  CG  . PRO A  1 62  ? 46.867  -3.969  145.566 1.00 19.92  ? 169  PRO A CG  1 
ATOM   486   C  CD  . PRO A  1 62  ? 47.290  -2.532  145.342 1.00 20.74  ? 169  PRO A CD  1 
ATOM   487   N  N   . GLY A  1 63  ? 44.244  -1.272  143.946 1.00 18.08  ? 170  GLY A N   1 
ATOM   488   C  CA  . GLY A  1 63  ? 43.050  -0.484  143.722 1.00 17.48  ? 170  GLY A CA  1 
ATOM   489   C  C   . GLY A  1 63  ? 42.939  0.132   142.349 1.00 17.49  ? 170  GLY A C   1 
ATOM   490   O  O   . GLY A  1 63  ? 41.864  0.577   141.950 1.00 19.20  ? 170  GLY A O   1 
ATOM   491   N  N   . ALA A  1 64  ? 44.048  0.179   141.627 1.00 17.13  ? 171  ALA A N   1 
ATOM   492   C  CA  . ALA A  1 64  ? 44.041  0.744   140.288 1.00 17.37  ? 171  ALA A CA  1 
ATOM   493   C  C   . ALA A  1 64  ? 44.150  -0.410  139.295 1.00 18.95  ? 171  ALA A C   1 
ATOM   494   O  O   . ALA A  1 64  ? 44.482  -0.211  138.121 1.00 17.60  ? 171  ALA A O   1 
ATOM   495   C  CB  . ALA A  1 64  ? 45.216  1.683   140.124 1.00 16.67  ? 171  ALA A CB  1 
ATOM   496   N  N   . SER A  1 65  ? 43.865  -1.619  139.775 1.00 19.23  ? 172  SER A N   1 
ATOM   497   C  CA  . SER A  1 65  ? 43.974  -2.805  138.944 1.00 19.36  ? 172  SER A CA  1 
ATOM   498   C  C   . SER A  1 65  ? 42.745  -3.696  138.935 1.00 20.51  ? 172  SER A C   1 
ATOM   499   O  O   . SER A  1 65  ? 41.911  -3.673  139.846 1.00 20.90  ? 172  SER A O   1 
ATOM   500   C  CB  . SER A  1 65  ? 45.161  -3.648  139.400 1.00 18.41  ? 172  SER A CB  1 
ATOM   501   O  OG  . SER A  1 65  ? 46.353  -2.895  139.423 1.00 19.56  ? 172  SER A OG  1 
ATOM   502   N  N   . PHE A  1 66  ? 42.646  -4.492  137.883 1.00 20.75  ? 173  PHE A N   1 
ATOM   503   C  CA  . PHE A  1 66  ? 41.560  -5.450  137.749 1.00 21.45  ? 173  PHE A CA  1 
ATOM   504   C  C   . PHE A  1 66  ? 41.756  -6.262  136.487 1.00 21.38  ? 173  PHE A C   1 
ATOM   505   O  O   . PHE A  1 66  ? 42.441  -5.833  135.564 1.00 23.03  ? 173  PHE A O   1 
ATOM   506   C  CB  . PHE A  1 66  ? 40.211  -4.745  137.706 1.00 22.34  ? 173  PHE A CB  1 
ATOM   507   C  CG  . PHE A  1 66  ? 39.064  -5.637  138.067 1.00 22.97  ? 173  PHE A CG  1 
ATOM   508   C  CD1 . PHE A  1 66  ? 38.380  -6.344  137.090 1.00 23.18  ? 173  PHE A CD1 1 
ATOM   509   C  CD2 . PHE A  1 66  ? 38.705  -5.814  139.405 1.00 24.11  ? 173  PHE A CD2 1 
ATOM   510   C  CE1 . PHE A  1 66  ? 37.348  -7.226  137.435 1.00 23.25  ? 173  PHE A CE1 1 
ATOM   511   C  CE2 . PHE A  1 66  ? 37.679  -6.690  139.764 1.00 23.94  ? 173  PHE A CE2 1 
ATOM   512   C  CZ  . PHE A  1 66  ? 36.998  -7.400  138.771 1.00 23.39  ? 173  PHE A CZ  1 
ATOM   513   N  N   . ASP A  1 67  ? 41.182  -7.455  136.460 1.00 21.51  ? 174  ASP A N   1 
ATOM   514   C  CA  . ASP A  1 67  ? 41.279  -8.317  135.291 1.00 20.68  ? 174  ASP A CA  1 
ATOM   515   C  C   . ASP A  1 67  ? 39.867  -8.445  134.750 1.00 20.73  ? 174  ASP A C   1 
ATOM   516   O  O   . ASP A  1 67  ? 39.074  -9.247  135.232 1.00 20.90  ? 174  ASP A O   1 
ATOM   517   C  CB  . ASP A  1 67  ? 41.836  -9.685  135.683 1.00 20.37  ? 174  ASP A CB  1 
ATOM   518   C  CG  . ASP A  1 67  ? 41.953  -10.630 134.505 1.00 21.09  ? 174  ASP A CG  1 
ATOM   519   O  OD1 . ASP A  1 67  ? 42.681  -11.641 134.624 1.00 21.42  ? 174  ASP A OD1 1 
ATOM   520   O  OD2 . ASP A  1 67  ? 41.317  -10.374 133.462 1.00 20.62  ? 174  ASP A OD2 1 
ATOM   521   N  N   . VAL A  1 68  ? 39.548  -7.626  133.757 1.00 21.96  ? 175  VAL A N   1 
ATOM   522   C  CA  . VAL A  1 68  ? 38.216  -7.634  133.160 1.00 23.61  ? 175  VAL A CA  1 
ATOM   523   C  C   . VAL A  1 68  ? 38.010  -8.852  132.263 1.00 24.72  ? 175  VAL A C   1 
ATOM   524   O  O   . VAL A  1 68  ? 36.894  -9.338  132.109 1.00 26.55  ? 175  VAL A O   1 
ATOM   525   C  CB  . VAL A  1 68  ? 37.966  -6.350  132.334 1.00 22.50  ? 175  VAL A CB  1 
ATOM   526   C  CG1 . VAL A  1 68  ? 36.573  -6.363  131.751 1.00 23.46  ? 175  VAL A CG1 1 
ATOM   527   C  CG2 . VAL A  1 68  ? 38.130  -5.135  133.215 1.00 22.96  ? 175  VAL A CG2 1 
ATOM   528   N  N   . ASN A  1 69  ? 39.087  -9.346  131.674 1.00 25.41  ? 176  ASN A N   1 
ATOM   529   C  CA  . ASN A  1 69  ? 39.006  -10.507 130.810 1.00 25.72  ? 176  ASN A CA  1 
ATOM   530   C  C   . ASN A  1 69  ? 38.592  -11.745 131.591 1.00 27.92  ? 176  ASN A C   1 
ATOM   531   O  O   . ASN A  1 69  ? 37.890  -12.599 131.073 1.00 29.22  ? 176  ASN A O   1 
ATOM   532   C  CB  . ASN A  1 69  ? 40.361  -10.764 130.154 1.00 24.17  ? 176  ASN A CB  1 
ATOM   533   C  CG  . ASN A  1 69  ? 40.669  -9.785  129.047 1.00 23.29  ? 176  ASN A CG  1 
ATOM   534   O  OD1 . ASN A  1 69  ? 41.821  -9.576  128.691 1.00 24.88  ? 176  ASN A OD1 1 
ATOM   535   N  ND2 . ASN A  1 69  ? 39.638  -9.194  128.483 1.00 22.96  ? 176  ASN A ND2 1 
ATOM   536   N  N   . ASP A  1 70  ? 39.019  -11.841 132.843 1.00 30.25  ? 177  ASP A N   1 
ATOM   537   C  CA  . ASP A  1 70  ? 38.712  -13.010 133.658 1.00 31.26  ? 177  ASP A CA  1 
ATOM   538   C  C   . ASP A  1 70  ? 37.798  -12.690 134.835 1.00 31.55  ? 177  ASP A C   1 
ATOM   539   O  O   . ASP A  1 70  ? 37.566  -13.536 135.689 1.00 32.30  ? 177  ASP A O   1 
ATOM   540   C  CB  . ASP A  1 70  ? 40.036  -13.613 134.134 1.00 32.68  ? 177  ASP A CB  1 
ATOM   541   C  CG  . ASP A  1 70  ? 39.871  -14.959 134.791 1.00 35.45  ? 177  ASP A CG  1 
ATOM   542   O  OD1 . ASP A  1 70  ? 38.996  -15.737 134.356 0.00 35.47  ? 177  ASP A OD1 1 
ATOM   543   O  OD2 . ASP A  1 70  ? 40.640  -15.248 135.737 1.00 37.69  ? 177  ASP A OD2 1 
ATOM   544   N  N   . GLN A  1 71  ? 37.262  -11.472 134.857 1.00 32.48  ? 178  GLN A N   1 
ATOM   545   C  CA  . GLN A  1 71  ? 36.385  -11.022 135.934 1.00 32.67  ? 178  GLN A CA  1 
ATOM   546   C  C   . GLN A  1 71  ? 36.983  -11.402 137.279 1.00 32.61  ? 178  GLN A C   1 
ATOM   547   O  O   . GLN A  1 71  ? 36.387  -12.141 138.059 1.00 33.74  ? 178  GLN A O   1 
ATOM   548   C  CB  . GLN A  1 71  ? 34.987  -11.620 135.777 1.00 32.60  ? 178  GLN A CB  1 
ATOM   549   C  CG  . GLN A  1 71  ? 33.936  -10.604 135.366 1.00 32.87  ? 178  GLN A CG  1 
ATOM   550   C  CD  . GLN A  1 71  ? 33.679  -9.559  136.437 0.00 32.82  ? 178  GLN A CD  1 
ATOM   551   O  OE1 . GLN A  1 71  ? 34.574  -8.804  136.813 0.00 32.88  ? 178  GLN A OE1 1 
ATOM   552   N  NE2 . GLN A  1 71  ? 32.447  -9.514  136.934 0.00 32.88  ? 178  GLN A NE2 1 
ATOM   553   N  N   . ASP A  1 72  ? 38.172  -10.874 137.537 1.00 31.82  ? 179  ASP A N   1 
ATOM   554   C  CA  . ASP A  1 72  ? 38.897  -11.144 138.765 1.00 30.88  ? 179  ASP A CA  1 
ATOM   555   C  C   . ASP A  1 72  ? 39.756  -9.921  139.089 1.00 29.16  ? 179  ASP A C   1 
ATOM   556   O  O   . ASP A  1 72  ? 40.084  -9.137  138.211 1.00 28.15  ? 179  ASP A O   1 
ATOM   557   C  CB  . ASP A  1 72  ? 39.761  -12.395 138.567 1.00 31.92  ? 179  ASP A CB  1 
ATOM   558   C  CG  . ASP A  1 72  ? 40.610  -12.718 139.776 1.00 33.81  ? 179  ASP A CG  1 
ATOM   559   O  OD1 . ASP A  1 72  ? 41.662  -12.066 139.962 1.00 35.30  ? 179  ASP A OD1 1 
ATOM   560   O  OD2 . ASP A  1 72  ? 40.220  -13.623 140.542 1.00 35.62  ? 179  ASP A OD2 1 
ATOM   561   N  N   . PRO A  1 73  ? 40.101  -9.724  140.366 1.00 28.89  ? 180  PRO A N   1 
ATOM   562   C  CA  . PRO A  1 73  ? 40.926  -8.556  140.701 1.00 28.21  ? 180  PRO A CA  1 
ATOM   563   C  C   . PRO A  1 73  ? 42.407  -8.617  140.341 1.00 26.45  ? 180  PRO A C   1 
ATOM   564   O  O   . PRO A  1 73  ? 43.057  -7.577  140.245 1.00 26.57  ? 180  PRO A O   1 
ATOM   565   C  CB  . PRO A  1 73  ? 40.692  -8.380  142.204 1.00 28.48  ? 180  PRO A CB  1 
ATOM   566   C  CG  . PRO A  1 73  ? 40.307  -9.747  142.663 1.00 28.94  ? 180  PRO A CG  1 
ATOM   567   C  CD  . PRO A  1 73  ? 39.419  -10.245 141.561 1.00 28.29  ? 180  PRO A CD  1 
ATOM   568   N  N   . ASP A  1 74  ? 42.935  -9.816  140.118 1.00 24.80  ? 181  ASP A N   1 
ATOM   569   C  CA  . ASP A  1 74  ? 44.354  -9.982  139.793 1.00 24.06  ? 181  ASP A CA  1 
ATOM   570   C  C   . ASP A  1 74  ? 44.672  -9.710  138.321 1.00 22.50  ? 181  ASP A C   1 
ATOM   571   O  O   . ASP A  1 74  ? 44.255  -10.451 137.437 1.00 21.34  ? 181  ASP A O   1 
ATOM   572   C  CB  . ASP A  1 74  ? 44.809  -11.397 140.157 1.00 25.90  ? 181  ASP A CB  1 
ATOM   573   C  CG  . ASP A  1 74  ? 46.304  -11.574 140.031 1.00 26.97  ? 181  ASP A CG  1 
ATOM   574   O  OD1 . ASP A  1 74  ? 46.782  -12.715 140.186 1.00 27.50  ? 181  ASP A OD1 1 
ATOM   575   O  OD2 . ASP A  1 74  ? 46.999  -10.566 139.784 1.00 28.97  ? 181  ASP A OD2 1 
ATOM   576   N  N   . PRO A  1 75  ? 45.448  -8.655  138.045 1.00 21.20  ? 182  PRO A N   1 
ATOM   577   C  CA  . PRO A  1 75  ? 45.819  -8.279  136.681 1.00 19.48  ? 182  PRO A CA  1 
ATOM   578   C  C   . PRO A  1 75  ? 47.077  -8.950  136.127 1.00 19.96  ? 182  PRO A C   1 
ATOM   579   O  O   . PRO A  1 75  ? 47.629  -8.498  135.116 1.00 19.19  ? 182  PRO A O   1 
ATOM   580   C  CB  . PRO A  1 75  ? 45.982  -6.777  136.798 1.00 18.54  ? 182  PRO A CB  1 
ATOM   581   C  CG  . PRO A  1 75  ? 46.681  -6.668  138.121 1.00 18.31  ? 182  PRO A CG  1 
ATOM   582   C  CD  . PRO A  1 75  ? 45.921  -7.642  139.008 1.00 20.39  ? 182  PRO A CD  1 
ATOM   583   N  N   . GLN A  1 76  ? 47.535  -10.018 136.773 1.00 19.48  ? 183  GLN A N   1 
ATOM   584   C  CA  . GLN A  1 76  ? 48.741  -10.703 136.312 1.00 19.79  ? 183  GLN A CA  1 
ATOM   585   C  C   . GLN A  1 76  ? 48.596  -11.098 134.836 1.00 20.00  ? 183  GLN A C   1 
ATOM   586   O  O   . GLN A  1 76  ? 47.574  -11.651 134.423 1.00 17.86  ? 183  GLN A O   1 
ATOM   587   C  CB  . GLN A  1 76  ? 48.995  -11.949 137.158 1.00 21.38  ? 183  GLN A CB  1 
ATOM   588   C  CG  . GLN A  1 76  ? 50.394  -12.535 137.026 1.00 23.26  ? 183  GLN A CG  1 
ATOM   589   C  CD  . GLN A  1 76  ? 51.443  -11.649 137.666 1.00 25.65  ? 183  GLN A CD  1 
ATOM   590   O  OE1 . GLN A  1 76  ? 51.170  -10.966 138.659 1.00 26.31  ? 183  GLN A OE1 1 
ATOM   591   N  NE2 . GLN A  1 76  ? 52.653  -11.662 137.112 1.00 25.42  ? 183  GLN A NE2 1 
ATOM   592   N  N   . PRO A  1 77  ? 49.616  -10.809 134.016 1.00 19.94  ? 184  PRO A N   1 
ATOM   593   C  CA  . PRO A  1 77  ? 49.508  -11.173 132.602 1.00 19.83  ? 184  PRO A CA  1 
ATOM   594   C  C   . PRO A  1 77  ? 49.632  -12.675 132.385 1.00 20.43  ? 184  PRO A C   1 
ATOM   595   O  O   . PRO A  1 77  ? 50.171  -13.384 133.235 1.00 22.50  ? 184  PRO A O   1 
ATOM   596   C  CB  . PRO A  1 77  ? 50.652  -10.385 131.961 1.00 19.27  ? 184  PRO A CB  1 
ATOM   597   C  CG  . PRO A  1 77  ? 51.680  -10.344 133.040 1.00 18.49  ? 184  PRO A CG  1 
ATOM   598   C  CD  . PRO A  1 77  ? 50.864  -10.069 134.279 1.00 19.64  ? 184  PRO A CD  1 
ATOM   599   N  N   . ARG A  1 78  ? 49.120  -13.159 131.255 1.00 19.90  ? 185  ARG A N   1 
ATOM   600   C  CA  . ARG A  1 78  ? 49.193  -14.581 130.913 1.00 19.30  ? 185  ARG A CA  1 
ATOM   601   C  C   . ARG A  1 78  ? 50.526  -14.834 130.199 1.00 19.94  ? 185  ARG A C   1 
ATOM   602   O  O   . ARG A  1 78  ? 50.782  -14.251 129.146 1.00 18.83  ? 185  ARG A O   1 
ATOM   603   C  CB  . ARG A  1 78  ? 48.026  -14.950 129.993 1.00 19.87  ? 185  ARG A CB  1 
ATOM   604   C  CG  . ARG A  1 78  ? 47.990  -16.388 129.503 1.00 17.84  ? 185  ARG A CG  1 
ATOM   605   C  CD  . ARG A  1 78  ? 46.681  -16.665 128.798 1.00 19.21  ? 185  ARG A CD  1 
ATOM   606   N  NE  . ARG A  1 78  ? 46.491  -15.794 127.643 1.00 21.93  ? 185  ARG A NE  1 
ATOM   607   C  CZ  . ARG A  1 78  ? 46.979  -16.030 126.428 1.00 21.44  ? 185  ARG A CZ  1 
ATOM   608   N  NH1 . ARG A  1 78  ? 46.758  -15.166 125.446 1.00 22.02  ? 185  ARG A NH1 1 
ATOM   609   N  NH2 . ARG A  1 78  ? 47.671  -17.134 126.186 1.00 20.46  ? 185  ARG A NH2 1 
ATOM   610   N  N   . TYR A  1 79  ? 51.380  -15.699 130.745 1.00 19.47  ? 186  TYR A N   1 
ATOM   611   C  CA  . TYR A  1 79  ? 52.679  -15.949 130.106 1.00 19.58  ? 186  TYR A CA  1 
ATOM   612   C  C   . TYR A  1 79  ? 52.622  -16.934 128.945 1.00 19.80  ? 186  TYR A C   1 
ATOM   613   O  O   . TYR A  1 79  ? 51.978  -17.979 129.034 1.00 20.28  ? 186  TYR A O   1 
ATOM   614   C  CB  . TYR A  1 79  ? 53.713  -16.433 131.132 1.00 17.89  ? 186  TYR A CB  1 
ATOM   615   C  CG  . TYR A  1 79  ? 53.962  -15.437 132.231 1.00 17.14  ? 186  TYR A CG  1 
ATOM   616   C  CD1 . TYR A  1 79  ? 53.041  -15.267 133.261 1.00 17.86  ? 186  TYR A CD1 1 
ATOM   617   C  CD2 . TYR A  1 79  ? 55.073  -14.606 132.204 1.00 18.29  ? 186  TYR A CD2 1 
ATOM   618   C  CE1 . TYR A  1 79  ? 53.213  -14.285 134.238 1.00 18.33  ? 186  TYR A CE1 1 
ATOM   619   C  CE2 . TYR A  1 79  ? 55.259  -13.619 133.177 1.00 19.64  ? 186  TYR A CE2 1 
ATOM   620   C  CZ  . TYR A  1 79  ? 54.321  -13.464 134.191 1.00 19.17  ? 186  TYR A CZ  1 
ATOM   621   O  OH  . TYR A  1 79  ? 54.486  -12.490 135.148 1.00 19.24  ? 186  TYR A OH  1 
ATOM   622   N  N   . THR A  1 80  ? 53.307  -16.582 127.860 1.00 19.99  ? 187  THR A N   1 
ATOM   623   C  CA  . THR A  1 80  ? 53.375  -17.404 126.665 1.00 20.07  ? 187  THR A CA  1 
ATOM   624   C  C   . THR A  1 80  ? 54.808  -17.408 126.159 1.00 21.99  ? 187  THR A C   1 
ATOM   625   O  O   . THR A  1 80  ? 55.601  -16.560 126.544 1.00 22.34  ? 187  THR A O   1 
ATOM   626   C  CB  . THR A  1 80  ? 52.477  -16.847 125.581 1.00 20.02  ? 187  THR A CB  1 
ATOM   627   O  OG1 . THR A  1 80  ? 52.900  -15.522 125.248 1.00 21.59  ? 187  THR A OG1 1 
ATOM   628   C  CG2 . THR A  1 80  ? 51.050  -16.793 126.064 1.00 20.21  ? 187  THR A CG2 1 
ATOM   629   N  N   . GLN A  1 81  ? 55.135  -18.363 125.296 1.00 24.76  ? 188  GLN A N   1 
ATOM   630   C  CA  . GLN A  1 81  ? 56.479  -18.496 124.732 1.00 27.39  ? 188  GLN A CA  1 
ATOM   631   C  C   . GLN A  1 81  ? 57.028  -17.222 124.079 1.00 28.89  ? 188  GLN A C   1 
ATOM   632   O  O   . GLN A  1 81  ? 58.206  -16.889 124.243 1.00 28.60  ? 188  GLN A O   1 
ATOM   633   C  CB  . GLN A  1 81  ? 56.497  -19.614 123.694 1.00 28.57  ? 188  GLN A CB  1 
ATOM   634   C  CG  . GLN A  1 81  ? 57.884  -19.963 123.183 1.00 30.82  ? 188  GLN A CG  1 
ATOM   635   C  CD  . GLN A  1 81  ? 58.674  -20.795 124.176 1.00 32.59  ? 188  GLN A CD  1 
ATOM   636   O  OE1 . GLN A  1 81  ? 58.127  -21.698 124.820 1.00 33.84  ? 188  GLN A OE1 1 
ATOM   637   N  NE2 . GLN A  1 81  ? 59.969  -20.511 124.294 1.00 33.62  ? 188  GLN A NE2 1 
ATOM   638   N  N   . MET A  1 82  ? 56.180  -16.533 123.318 1.00 30.06  ? 189  MET A N   1 
ATOM   639   C  CA  . MET A  1 82  ? 56.572  -15.301 122.638 1.00 30.73  ? 189  MET A CA  1 
ATOM   640   C  C   . MET A  1 82  ? 56.455  -14.066 123.535 1.00 29.58  ? 189  MET A C   1 
ATOM   641   O  O   . MET A  1 82  ? 56.785  -12.957 123.113 1.00 28.19  ? 189  MET A O   1 
ATOM   642   C  CB  . MET A  1 82  ? 55.716  -15.093 121.380 1.00 34.84  ? 189  MET A CB  1 
ATOM   643   C  CG  . MET A  1 82  ? 55.903  -16.167 120.308 1.00 38.96  ? 189  MET A CG  1 
ATOM   644   S  SD  . MET A  1 82  ? 57.668  -16.556 120.100 1.00 46.97  ? 189  MET A SD  1 
ATOM   645   C  CE  . MET A  1 82  ? 58.258  -15.093 119.137 1.00 44.12  ? 189  MET A CE  1 
ATOM   646   N  N   . ASN A  1 83  ? 55.995  -14.256 124.768 1.00 28.34  ? 190  ASN A N   1 
ATOM   647   C  CA  . ASN A  1 83  ? 55.845  -13.139 125.696 1.00 28.36  ? 190  ASN A CA  1 
ATOM   648   C  C   . ASN A  1 83  ? 54.932  -12.134 125.034 1.00 27.41  ? 190  ASN A C   1 
ATOM   649   O  O   . ASN A  1 83  ? 55.198  -10.934 124.993 1.00 26.76  ? 190  ASN A O   1 
ATOM   650   C  CB  . ASN A  1 83  ? 57.197  -12.490 125.990 1.00 29.06  ? 190  ASN A CB  1 
ATOM   651   C  CG  . ASN A  1 83  ? 58.146  -13.430 126.683 1.00 28.78  ? 190  ASN A CG  1 
ATOM   652   O  OD1 . ASN A  1 83  ? 57.895  -13.869 127.802 1.00 29.98  ? 190  ASN A OD1 1 
ATOM   653   N  ND2 . ASN A  1 83  ? 59.245  -13.754 126.017 1.00 30.38  ? 190  ASN A ND2 1 
ATOM   654   N  N   . ASP A  1 84  ? 53.838  -12.655 124.513 1.00 26.68  ? 191  ASP A N   1 
ATOM   655   C  CA  . ASP A  1 84  ? 52.872  -11.836 123.822 1.00 24.80  ? 191  ASP A CA  1 
ATOM   656   C  C   . ASP A  1 84  ? 52.217  -10.809 124.723 1.00 23.54  ? 191  ASP A C   1 
ATOM   657   O  O   . ASP A  1 84  ? 51.845  -9.737  124.259 1.00 24.25  ? 191  ASP A O   1 
ATOM   658   C  CB  . ASP A  1 84  ? 51.787  -12.722 123.205 1.00 26.32  ? 191  ASP A CB  1 
ATOM   659   C  CG  . ASP A  1 84  ? 52.350  -13.747 122.226 1.00 26.93  ? 191  ASP A CG  1 
ATOM   660   O  OD1 . ASP A  1 84  ? 52.683  -13.362 121.082 1.00 25.99  ? 191  ASP A OD1 1 
ATOM   661   O  OD2 . ASP A  1 84  ? 52.467  -14.935 122.608 1.00 27.20  ? 191  ASP A OD2 1 
ATOM   662   N  N   . ASN A  1 85  ? 52.078  -11.118 126.007 1.00 21.66  ? 192  ASN A N   1 
ATOM   663   C  CA  . ASN A  1 85  ? 51.413  -10.190 126.915 1.00 20.20  ? 192  ASN A CA  1 
ATOM   664   C  C   . ASN A  1 85  ? 52.319  -9.358  127.815 1.00 19.20  ? 192  ASN A C   1 
ATOM   665   O  O   . ASN A  1 85  ? 52.050  -9.187  129.005 1.00 19.01  ? 192  ASN A O   1 
ATOM   666   C  CB  . ASN A  1 85  ? 50.392  -10.954 127.751 1.00 20.18  ? 192  ASN A CB  1 
ATOM   667   C  CG  . ASN A  1 85  ? 49.382  -11.681 126.895 1.00 20.88  ? 192  ASN A CG  1 
ATOM   668   O  OD1 . ASN A  1 85  ? 48.726  -11.077 126.039 1.00 21.51  ? 192  ASN A OD1 1 
ATOM   669   N  ND2 . ASN A  1 85  ? 49.254  -12.985 127.108 1.00 21.08  ? 192  ASN A ND2 1 
ATOM   670   N  N   . ARG A  1 86  ? 53.377  -8.820  127.223 1.00 17.06  ? 193  ARG A N   1 
ATOM   671   C  CA  . ARG A  1 86  ? 54.346  -8.003  127.931 1.00 16.97  ? 193  ARG A CA  1 
ATOM   672   C  C   . ARG A  1 86  ? 54.027  -6.510  127.755 1.00 17.16  ? 193  ARG A C   1 
ATOM   673   O  O   . ARG A  1 86  ? 54.653  -5.650  128.382 1.00 18.57  ? 193  ARG A O   1 
ATOM   674   C  CB  . ARG A  1 86  ? 55.726  -8.264  127.344 1.00 16.75  ? 193  ARG A CB  1 
ATOM   675   C  CG  . ARG A  1 86  ? 55.859  -7.664  125.958 1.00 14.57  ? 193  ARG A CG  1 
ATOM   676   C  CD  . ARG A  1 86  ? 57.102  -8.096  125.250 1.00 14.59  ? 193  ARG A CD  1 
ATOM   677   N  NE  . ARG A  1 86  ? 57.231  -7.392  123.980 1.00 15.90  ? 193  ARG A NE  1 
ATOM   678   C  CZ  . ARG A  1 86  ? 58.141  -7.682  123.057 1.00 16.77  ? 193  ARG A CZ  1 
ATOM   679   N  NH1 . ARG A  1 86  ? 58.998  -8.673  123.269 1.00 17.97  ? 193  ARG A NH1 1 
ATOM   680   N  NH2 . ARG A  1 86  ? 58.204  -6.973  121.931 1.00 14.97  ? 193  ARG A NH2 1 
ATOM   681   N  N   . HIS A  1 87  ? 53.057  -6.215  126.896 1.00 15.87  ? 194  HIS A N   1 
ATOM   682   C  CA  . HIS A  1 87  ? 52.682  -4.843  126.578 1.00 14.04  ? 194  HIS A CA  1 
ATOM   683   C  C   . HIS A  1 87  ? 52.344  -3.988  127.797 1.00 13.64  ? 194  HIS A C   1 
ATOM   684   O  O   . HIS A  1 87  ? 52.906  -2.911  127.968 1.00 13.30  ? 194  HIS A O   1 
ATOM   685   C  CB  . HIS A  1 87  ? 51.511  -4.857  125.576 1.00 12.44  ? 194  HIS A CB  1 
ATOM   686   C  CG  . HIS A  1 87  ? 51.472  -3.677  124.650 1.00 11.08  ? 194  HIS A CG  1 
ATOM   687   N  ND1 . HIS A  1 87  ? 50.671  -2.576  124.874 1.00 11.35  ? 194  HIS A ND1 1 
ATOM   688   C  CD2 . HIS A  1 87  ? 52.122  -3.437  123.484 1.00 12.27  ? 194  HIS A CD2 1 
ATOM   689   C  CE1 . HIS A  1 87  ? 50.825  -1.707  123.889 1.00 11.09  ? 194  HIS A CE1 1 
ATOM   690   N  NE2 . HIS A  1 87  ? 51.697  -2.211  123.041 1.00 10.76  ? 194  HIS A NE2 1 
ATOM   691   N  N   . GLY A  1 88  ? 51.438  -4.469  128.638 1.00 13.67  ? 195  GLY A N   1 
ATOM   692   C  CA  . GLY A  1 88  ? 51.038  -3.708  129.807 1.00 14.88  ? 195  GLY A CA  1 
ATOM   693   C  C   . GLY A  1 88  ? 52.162  -3.413  130.780 1.00 16.60  ? 195  GLY A C   1 
ATOM   694   O  O   . GLY A  1 88  ? 52.279  -2.302  131.295 1.00 18.01  ? 195  GLY A O   1 
ATOM   695   N  N   . THR A  1 89  ? 52.997  -4.413  131.029 1.00 16.38  ? 196  THR A N   1 
ATOM   696   C  CA  . THR A  1 89  ? 54.101  -4.270  131.950 1.00 16.12  ? 196  THR A CA  1 
ATOM   697   C  C   . THR A  1 89  ? 55.094  -3.237  131.464 1.00 17.13  ? 196  THR A C   1 
ATOM   698   O  O   . THR A  1 89  ? 55.625  -2.453  132.256 1.00 18.14  ? 196  THR A O   1 
ATOM   699   C  CB  . THR A  1 89  ? 54.805  -5.617  132.145 1.00 15.73  ? 196  THR A CB  1 
ATOM   700   O  OG1 . THR A  1 89  ? 53.905  -6.522  132.796 1.00 16.09  ? 196  THR A OG1 1 
ATOM   701   C  CG2 . THR A  1 89  ? 56.045  -5.457  132.997 1.00 16.12  ? 196  THR A CG2 1 
ATOM   702   N  N   . ARG A  1 90  ? 55.357  -3.231  130.163 1.00 16.85  ? 197  ARG A N   1 
ATOM   703   C  CA  . ARG A  1 90  ? 56.288  -2.263  129.614 1.00 17.05  ? 197  ARG A CA  1 
ATOM   704   C  C   . ARG A  1 90  ? 55.752  -0.843  129.797 1.00 17.62  ? 197  ARG A C   1 
ATOM   705   O  O   . ARG A  1 90  ? 56.498  0.078   130.119 1.00 19.86  ? 197  ARG A O   1 
ATOM   706   C  CB  . ARG A  1 90  ? 56.537  -2.554  128.137 1.00 15.93  ? 197  ARG A CB  1 
ATOM   707   C  CG  . ARG A  1 90  ? 57.305  -3.839  127.909 1.00 16.91  ? 197  ARG A CG  1 
ATOM   708   C  CD  . ARG A  1 90  ? 57.752  -4.005  126.464 1.00 14.03  ? 197  ARG A CD  1 
ATOM   709   N  NE  . ARG A  1 90  ? 58.622  -5.165  126.316 1.00 14.13  ? 197  ARG A NE  1 
ATOM   710   C  CZ  . ARG A  1 90  ? 59.406  -5.370  125.264 1.00 15.86  ? 197  ARG A CZ  1 
ATOM   711   N  NH1 . ARG A  1 90  ? 60.179  -6.443  125.197 1.00 15.90  ? 197  ARG A NH1 1 
ATOM   712   N  NH2 . ARG A  1 90  ? 59.417  -4.496  124.274 1.00 16.02  ? 197  ARG A NH2 1 
ATOM   713   N  N   . CYS A  1 91  ? 54.455  -0.663  129.605 1.00 16.81  ? 198  CYS A N   1 
ATOM   714   C  CA  . CYS A  1 91  ? 53.866  0.652   129.766 1.00 17.26  ? 198  CYS A CA  1 
ATOM   715   C  C   . CYS A  1 91  ? 53.896  1.092   131.212 1.00 16.93  ? 198  CYS A C   1 
ATOM   716   O  O   . CYS A  1 91  ? 54.169  2.257   131.492 1.00 18.36  ? 198  CYS A O   1 
ATOM   717   C  CB  . CYS A  1 91  ? 52.425  0.660   129.261 1.00 18.09  ? 198  CYS A CB  1 
ATOM   718   S  SG  . CYS A  1 91  ? 52.288  0.416   127.483 1.00 19.80  ? 198  CYS A SG  1 
ATOM   719   N  N   . ALA A  1 92  ? 53.612  0.165   132.123 1.00 14.89  ? 199  ALA A N   1 
ATOM   720   C  CA  . ALA A  1 92  ? 53.606  0.468   133.548 1.00 14.58  ? 199  ALA A CA  1 
ATOM   721   C  C   . ALA A  1 92  ? 54.957  1.042   133.994 1.00 16.06  ? 199  ALA A C   1 
ATOM   722   O  O   . ALA A  1 92  ? 55.018  2.065   134.671 1.00 16.72  ? 199  ALA A O   1 
ATOM   723   C  CB  . ALA A  1 92  ? 53.279  -0.788  134.343 1.00 13.16  ? 199  ALA A CB  1 
ATOM   724   N  N   . GLY A  1 93  ? 56.039  0.385   133.599 1.00 16.26  ? 200  GLY A N   1 
ATOM   725   C  CA  . GLY A  1 93  ? 57.354  0.839   133.983 1.00 17.99  ? 200  GLY A CA  1 
ATOM   726   C  C   . GLY A  1 93  ? 57.671  2.252   133.549 1.00 19.74  ? 200  GLY A C   1 
ATOM   727   O  O   . GLY A  1 93  ? 58.341  2.988   134.266 1.00 21.44  ? 200  GLY A O   1 
ATOM   728   N  N   . GLU A  1 94  ? 57.194  2.644   132.375 1.00 20.40  ? 201  GLU A N   1 
ATOM   729   C  CA  . GLU A  1 94  ? 57.470  3.981   131.871 1.00 20.04  ? 201  GLU A CA  1 
ATOM   730   C  C   . GLU A  1 94  ? 56.795  5.060   132.688 1.00 19.36  ? 201  GLU A C   1 
ATOM   731   O  O   . GLU A  1 94  ? 57.300  6.181   132.797 1.00 18.98  ? 201  GLU A O   1 
ATOM   732   C  CB  . GLU A  1 94  ? 57.053  4.072   130.409 1.00 21.60  ? 201  GLU A CB  1 
ATOM   733   C  CG  . GLU A  1 94  ? 58.049  3.368   129.506 1.00 26.97  ? 201  GLU A CG  1 
ATOM   734   C  CD  . GLU A  1 94  ? 57.444  2.849   128.223 1.00 29.17  ? 201  GLU A CD  1 
ATOM   735   O  OE1 . GLU A  1 94  ? 58.205  2.289   127.408 1.00 31.78  ? 201  GLU A OE1 1 
ATOM   736   O  OE2 . GLU A  1 94  ? 56.218  2.989   128.030 1.00 31.47  ? 201  GLU A OE2 1 
ATOM   737   N  N   . VAL A  1 95  ? 55.652  4.719   133.266 1.00 18.71  ? 202  VAL A N   1 
ATOM   738   C  CA  . VAL A  1 95  ? 54.923  5.666   134.088 1.00 17.79  ? 202  VAL A CA  1 
ATOM   739   C  C   . VAL A  1 95  ? 55.492  5.705   135.508 1.00 17.28  ? 202  VAL A C   1 
ATOM   740   O  O   . VAL A  1 95  ? 55.858  6.767   135.994 1.00 16.53  ? 202  VAL A O   1 
ATOM   741   C  CB  . VAL A  1 95  ? 53.410  5.303   134.176 1.00 17.16  ? 202  VAL A CB  1 
ATOM   742   C  CG1 . VAL A  1 95  ? 52.686  6.277   135.107 1.00 15.27  ? 202  VAL A CG1 1 
ATOM   743   C  CG2 . VAL A  1 95  ? 52.781  5.336   132.797 1.00 16.55  ? 202  VAL A CG2 1 
ATOM   744   N  N   . ALA A  1 96  ? 55.602  4.544   136.150 1.00 16.38  ? 203  ALA A N   1 
ATOM   745   C  CA  . ALA A  1 96  ? 56.050  4.515   137.524 1.00 16.74  ? 203  ALA A CA  1 
ATOM   746   C  C   . ALA A  1 96  ? 57.027  3.433   137.958 1.00 17.84  ? 203  ALA A C   1 
ATOM   747   O  O   . ALA A  1 96  ? 56.841  2.819   139.005 1.00 17.29  ? 203  ALA A O   1 
ATOM   748   C  CB  . ALA A  1 96  ? 54.829  4.480   138.423 1.00 16.82  ? 203  ALA A CB  1 
ATOM   749   N  N   . ALA A  1 97  ? 58.073  3.180   137.184 1.00 18.76  ? 204  ALA A N   1 
ATOM   750   C  CA  . ALA A  1 97  ? 59.035  2.181   137.634 1.00 19.24  ? 204  ALA A CA  1 
ATOM   751   C  C   . ALA A  1 97  ? 59.704  2.813   138.860 1.00 19.05  ? 204  ALA A C   1 
ATOM   752   O  O   . ALA A  1 97  ? 59.965  4.018   138.881 1.00 19.15  ? 204  ALA A O   1 
ATOM   753   C  CB  . ALA A  1 97  ? 60.065  1.886   136.543 1.00 18.04  ? 204  ALA A CB  1 
ATOM   754   N  N   . VAL A  1 98  ? 59.953  2.001   139.879 1.00 19.03  ? 205  VAL A N   1 
ATOM   755   C  CA  . VAL A  1 98  ? 60.576  2.459   141.114 1.00 19.88  ? 205  VAL A CA  1 
ATOM   756   C  C   . VAL A  1 98  ? 61.971  3.048   140.914 1.00 20.28  ? 205  VAL A C   1 
ATOM   757   O  O   . VAL A  1 98  ? 62.773  2.534   140.132 1.00 19.65  ? 205  VAL A O   1 
ATOM   758   C  CB  . VAL A  1 98  ? 60.658  1.308   142.113 1.00 20.40  ? 205  VAL A CB  1 
ATOM   759   C  CG1 . VAL A  1 98  ? 61.381  1.744   143.353 1.00 19.86  ? 205  VAL A CG1 1 
ATOM   760   C  CG2 . VAL A  1 98  ? 59.251  0.835   142.455 1.00 20.82  ? 205  VAL A CG2 1 
ATOM   761   N  N   . ALA A  1 99  ? 62.258  4.126   141.639 1.00 21.42  ? 206  ALA A N   1 
ATOM   762   C  CA  . ALA A  1 99  ? 63.544  4.810   141.535 1.00 21.82  ? 206  ALA A CA  1 
ATOM   763   C  C   . ALA A  1 99  ? 64.512  4.500   142.676 1.00 22.07  ? 206  ALA A C   1 
ATOM   764   O  O   . ALA A  1 99  ? 64.112  4.138   143.783 1.00 21.35  ? 206  ALA A O   1 
ATOM   765   C  CB  . ALA A  1 99  ? 63.317  6.312   141.457 1.00 22.06  ? 206  ALA A CB  1 
ATOM   766   N  N   . ASN A  1 100 ? 65.797  4.651   142.384 1.00 22.45  ? 207  ASN A N   1 
ATOM   767   C  CA  . ASN A  1 100 ? 66.856  4.424   143.359 1.00 22.26  ? 207  ASN A CA  1 
ATOM   768   C  C   . ASN A  1 100 ? 66.756  3.092   144.068 1.00 22.41  ? 207  ASN A C   1 
ATOM   769   O  O   . ASN A  1 100 ? 66.965  3.008   145.267 1.00 23.62  ? 207  ASN A O   1 
ATOM   770   C  CB  . ASN A  1 100 ? 66.861  5.553   144.387 1.00 22.06  ? 207  ASN A CB  1 
ATOM   771   C  CG  . ASN A  1 100 ? 67.011  6.911   143.746 1.00 22.53  ? 207  ASN A CG  1 
ATOM   772   O  OD1 . ASN A  1 100 ? 68.003  7.185   143.061 1.00 22.96  ? 207  ASN A OD1 1 
ATOM   773   N  ND2 . ASN A  1 100 ? 66.025  7.769   143.952 1.00 22.07  ? 207  ASN A ND2 1 
ATOM   774   N  N   . ASN A  1 101 ? 66.435  2.043   143.330 1.00 23.03  ? 208  ASN A N   1 
ATOM   775   C  CA  . ASN A  1 101 ? 66.344  0.723   143.932 1.00 22.88  ? 208  ASN A CA  1 
ATOM   776   C  C   . ASN A  1 101 ? 67.322  -0.224  143.243 1.00 23.33  ? 208  ASN A C   1 
ATOM   777   O  O   . ASN A  1 101 ? 67.219  -1.444  143.358 1.00 23.14  ? 208  ASN A O   1 
ATOM   778   C  CB  . ASN A  1 101 ? 64.911  0.195   143.838 1.00 23.35  ? 208  ASN A CB  1 
ATOM   779   C  CG  . ASN A  1 101 ? 64.486  -0.119  142.416 1.00 24.32  ? 208  ASN A CG  1 
ATOM   780   O  OD1 . ASN A  1 101 ? 65.026  0.424   141.449 1.00 24.27  ? 208  ASN A OD1 1 
ATOM   781   N  ND2 . ASN A  1 101 ? 63.490  -0.991  142.284 1.00 24.37  ? 208  ASN A ND2 1 
ATOM   782   N  N   . GLY A  1 102 ? 68.277  0.356   142.524 1.00 23.33  ? 209  GLY A N   1 
ATOM   783   C  CA  . GLY A  1 102 ? 69.273  -0.441  141.840 1.00 24.78  ? 209  GLY A CA  1 
ATOM   784   C  C   . GLY A  1 102 ? 68.748  -1.376  140.765 1.00 25.82  ? 209  GLY A C   1 
ATOM   785   O  O   . GLY A  1 102 ? 69.443  -2.305  140.344 1.00 26.68  ? 209  GLY A O   1 
ATOM   786   N  N   . VAL A  1 103 ? 67.531  -1.135  140.298 1.00 25.67  ? 210  VAL A N   1 
ATOM   787   C  CA  . VAL A  1 103 ? 66.964  -1.987  139.269 1.00 24.66  ? 210  VAL A CA  1 
ATOM   788   C  C   . VAL A  1 103 ? 66.509  -1.202  138.062 1.00 23.87  ? 210  VAL A C   1 
ATOM   789   O  O   . VAL A  1 103 ? 65.863  -0.165  138.189 1.00 22.64  ? 210  VAL A O   1 
ATOM   790   C  CB  . VAL A  1 103 ? 65.762  -2.795  139.806 1.00 25.29  ? 210  VAL A CB  1 
ATOM   791   C  CG1 . VAL A  1 103 ? 65.165  -3.654  138.698 1.00 24.29  ? 210  VAL A CG1 1 
ATOM   792   C  CG2 . VAL A  1 103 ? 66.203  -3.657  140.966 1.00 24.42  ? 210  VAL A CG2 1 
ATOM   793   N  N   . CYS A  1 104 ? 66.867  -1.716  136.892 1.00 24.54  ? 211  CYS A N   1 
ATOM   794   C  CA  . CYS A  1 104 ? 66.494  -1.123  135.612 1.00 25.91  ? 211  CYS A CA  1 
ATOM   795   C  C   . CYS A  1 104 ? 66.611  0.410   135.625 1.00 24.30  ? 211  CYS A C   1 
ATOM   796   O  O   . CYS A  1 104 ? 67.671  0.950   135.962 1.00 25.43  ? 211  CYS A O   1 
ATOM   797   C  CB  . CYS A  1 104 ? 65.070  -1.582  135.278 1.00 28.09  ? 211  CYS A CB  1 
ATOM   798   S  SG  . CYS A  1 104 ? 64.548  -1.612  133.528 1.00 34.96  ? 211  CYS A SG  1 
ATOM   799   N  N   . GLY A  1 105 ? 65.537  1.104   135.253 1.00 21.53  ? 212  GLY A N   1 
ATOM   800   C  CA  . GLY A  1 105 ? 65.560  2.556   135.237 1.00 18.91  ? 212  GLY A CA  1 
ATOM   801   C  C   . GLY A  1 105 ? 64.514  3.134   136.168 1.00 18.56  ? 212  GLY A C   1 
ATOM   802   O  O   . GLY A  1 105 ? 64.277  2.601   137.255 1.00 17.74  ? 212  GLY A O   1 
ATOM   803   N  N   . VAL A  1 106 ? 63.882  4.227   135.752 1.00 17.89  ? 213  VAL A N   1 
ATOM   804   C  CA  . VAL A  1 106 ? 62.847  4.854   136.568 1.00 18.22  ? 213  VAL A CA  1 
ATOM   805   C  C   . VAL A  1 106 ? 61.707  5.335   135.685 1.00 18.35  ? 213  VAL A C   1 
ATOM   806   O  O   . VAL A  1 106 ? 61.895  5.542   134.490 1.00 19.51  ? 213  VAL A O   1 
ATOM   807   C  CB  . VAL A  1 106 ? 63.388  6.089   137.353 1.00 18.14  ? 213  VAL A CB  1 
ATOM   808   C  CG1 . VAL A  1 106 ? 64.644  5.728   138.092 1.00 19.00  ? 213  VAL A CG1 1 
ATOM   809   C  CG2 . VAL A  1 106 ? 63.645  7.252   136.409 1.00 18.48  ? 213  VAL A CG2 1 
ATOM   810   N  N   . GLY A  1 107 ? 60.530  5.516   136.275 1.00 17.31  ? 214  GLY A N   1 
ATOM   811   C  CA  . GLY A  1 107 ? 59.406  6.009   135.504 1.00 17.73  ? 214  GLY A CA  1 
ATOM   812   C  C   . GLY A  1 107 ? 59.351  7.520   135.607 1.00 17.94  ? 214  GLY A C   1 
ATOM   813   O  O   . GLY A  1 107 ? 60.007  8.099   136.469 1.00 17.79  ? 214  GLY A O   1 
ATOM   814   N  N   . VAL A  1 108 ? 58.586  8.169   134.733 1.00 18.10  ? 215  VAL A N   1 
ATOM   815   C  CA  . VAL A  1 108 ? 58.478  9.621   134.784 1.00 17.41  ? 215  VAL A CA  1 
ATOM   816   C  C   . VAL A  1 108 ? 57.982  10.047  136.164 1.00 17.78  ? 215  VAL A C   1 
ATOM   817   O  O   . VAL A  1 108 ? 58.522  10.974  136.759 1.00 18.43  ? 215  VAL A O   1 
ATOM   818   C  CB  . VAL A  1 108 ? 57.513  10.159  133.708 1.00 17.09  ? 215  VAL A CB  1 
ATOM   819   C  CG1 . VAL A  1 108 ? 57.373  11.668  133.846 1.00 18.13  ? 215  VAL A CG1 1 
ATOM   820   C  CG2 . VAL A  1 108 ? 58.032  9.822   132.329 1.00 15.50  ? 215  VAL A CG2 1 
ATOM   821   N  N   . ALA A  1 109 ? 56.954  9.366   136.661 1.00 16.32  ? 216  ALA A N   1 
ATOM   822   C  CA  . ALA A  1 109 ? 56.390  9.647   137.967 1.00 15.49  ? 216  ALA A CA  1 
ATOM   823   C  C   . ALA A  1 109 ? 56.756  8.471   138.869 1.00 17.33  ? 216  ALA A C   1 
ATOM   824   O  O   . ALA A  1 109 ? 55.891  7.683   139.279 1.00 17.78  ? 216  ALA A O   1 
ATOM   825   C  CB  . ALA A  1 109 ? 54.900  9.774   137.864 1.00 13.85  ? 216  ALA A CB  1 
ATOM   826   N  N   . TYR A  1 110 ? 58.040  8.358   139.190 1.00 17.47  ? 217  TYR A N   1 
ATOM   827   C  CA  . TYR A  1 110 ? 58.504  7.252   140.007 1.00 18.61  ? 217  TYR A CA  1 
ATOM   828   C  C   . TYR A  1 110 ? 57.978  7.145   141.440 1.00 19.18  ? 217  TYR A C   1 
ATOM   829   O  O   . TYR A  1 110 ? 58.290  6.178   142.135 1.00 17.67  ? 217  TYR A O   1 
ATOM   830   C  CB  . TYR A  1 110 ? 60.035  7.184   139.980 1.00 18.98  ? 217  TYR A CB  1 
ATOM   831   C  CG  . TYR A  1 110 ? 60.763  8.423   140.440 1.00 21.75  ? 217  TYR A CG  1 
ATOM   832   C  CD1 . TYR A  1 110 ? 60.738  8.818   141.780 1.00 23.24  ? 217  TYR A CD1 1 
ATOM   833   C  CD2 . TYR A  1 110 ? 61.549  9.163   139.552 1.00 21.52  ? 217  TYR A CD2 1 
ATOM   834   C  CE1 . TYR A  1 110 ? 61.488  9.916   142.228 1.00 23.13  ? 217  TYR A CE1 1 
ATOM   835   C  CE2 . TYR A  1 110 ? 62.303  10.259  139.990 1.00 22.17  ? 217  TYR A CE2 1 
ATOM   836   C  CZ  . TYR A  1 110 ? 62.270  10.627  141.330 1.00 23.11  ? 217  TYR A CZ  1 
ATOM   837   O  OH  . TYR A  1 110 ? 63.040  11.678  141.784 1.00 23.08  ? 217  TYR A OH  1 
ATOM   838   N  N   . ASN A  1 111 ? 57.175  8.111   141.884 1.00 19.53  ? 218  ASN A N   1 
ATOM   839   C  CA  . ASN A  1 111 ? 56.599  8.024   143.224 1.00 19.46  ? 218  ASN A CA  1 
ATOM   840   C  C   . ASN A  1 111 ? 55.085  7.899   143.164 1.00 20.99  ? 218  ASN A C   1 
ATOM   841   O  O   . ASN A  1 111 ? 54.405  7.959   144.190 1.00 21.12  ? 218  ASN A O   1 
ATOM   842   C  CB  . ASN A  1 111 ? 56.987  9.222   144.087 1.00 19.45  ? 218  ASN A CB  1 
ATOM   843   C  CG  . ASN A  1 111 ? 58.395  9.097   144.650 1.00 20.27  ? 218  ASN A CG  1 
ATOM   844   O  OD1 . ASN A  1 111 ? 58.785  8.045   145.166 1.00 19.78  ? 218  ASN A OD1 1 
ATOM   845   N  ND2 . ASN A  1 111 ? 59.164  10.172  144.561 1.00 20.85  ? 218  ASN A ND2 1 
ATOM   846   N  N   . ALA A  1 112 ? 54.558  7.719   141.955 1.00 20.83  ? 219  ALA A N   1 
ATOM   847   C  CA  . ALA A  1 112 ? 53.121  7.555   141.774 1.00 20.90  ? 219  ALA A CA  1 
ATOM   848   C  C   . ALA A  1 112 ? 52.775  6.091   142.011 1.00 20.35  ? 219  ALA A C   1 
ATOM   849   O  O   . ALA A  1 112 ? 53.660  5.244   142.074 1.00 20.46  ? 219  ALA A O   1 
ATOM   850   C  CB  . ALA A  1 112 ? 52.725  7.946   140.358 1.00 19.94  ? 219  ALA A CB  1 
ATOM   851   N  N   . ARG A  1 113 ? 51.490  5.798   142.161 1.00 20.60  ? 220  ARG A N   1 
ATOM   852   C  CA  . ARG A  1 113 ? 51.047  4.423   142.331 1.00 20.80  ? 220  ARG A CA  1 
ATOM   853   C  C   . ARG A  1 113 ? 50.618  3.957   140.955 1.00 19.81  ? 220  ARG A C   1 
ATOM   854   O  O   . ARG A  1 113 ? 49.963  4.687   140.217 1.00 19.18  ? 220  ARG A O   1 
ATOM   855   C  CB  . ARG A  1 113 ? 49.881  4.326   143.308 1.00 23.12  ? 220  ARG A CB  1 
ATOM   856   C  CG  . ARG A  1 113 ? 50.329  3.977   144.716 1.00 26.68  ? 220  ARG A CG  1 
ATOM   857   C  CD  . ARG A  1 113 ? 49.637  4.872   145.720 1.00 33.49  ? 220  ARG A CD  1 
ATOM   858   N  NE  . ARG A  1 113 ? 48.287  4.431   146.083 1.00 37.46  ? 220  ARG A NE  1 
ATOM   859   C  CZ  . ARG A  1 113 ? 47.282  5.256   146.394 1.00 39.18  ? 220  ARG A CZ  1 
ATOM   860   N  NH1 . ARG A  1 113 ? 46.096  4.756   146.724 1.00 39.60  ? 220  ARG A NH1 1 
ATOM   861   N  NH2 . ARG A  1 113 ? 47.448  6.582   146.353 1.00 38.59  ? 220  ARG A NH2 1 
ATOM   862   N  N   . ILE A  1 114 ? 51.002  2.741   140.598 1.00 19.37  ? 221  ILE A N   1 
ATOM   863   C  CA  . ILE A  1 114 ? 50.671  2.217   139.289 1.00 17.19  ? 221  ILE A CA  1 
ATOM   864   C  C   . ILE A  1 114 ? 49.848  0.947   139.368 1.00 17.59  ? 221  ILE A C   1 
ATOM   865   O  O   . ILE A  1 114 ? 50.146  0.039   140.142 1.00 18.34  ? 221  ILE A O   1 
ATOM   866   C  CB  . ILE A  1 114 ? 51.953  1.940   138.487 1.00 16.64  ? 221  ILE A CB  1 
ATOM   867   C  CG1 . ILE A  1 114 ? 51.607  1.653   137.031 1.00 15.62  ? 221  ILE A CG1 1 
ATOM   868   C  CG2 . ILE A  1 114 ? 52.713  0.791   139.100 1.00 14.69  ? 221  ILE A CG2 1 
ATOM   869   C  CD1 . ILE A  1 114 ? 50.984  2.838   136.320 1.00 16.11  ? 221  ILE A CD1 1 
ATOM   870   N  N   . GLY A  1 115 ? 48.798  0.896   138.561 1.00 18.28  ? 222  GLY A N   1 
ATOM   871   C  CA  . GLY A  1 115 ? 47.949  -0.278  138.520 1.00 17.04  ? 222  GLY A CA  1 
ATOM   872   C  C   . GLY A  1 115 ? 47.783  -0.733  137.083 1.00 17.91  ? 222  GLY A C   1 
ATOM   873   O  O   . GLY A  1 115 ? 48.217  -0.061  136.141 1.00 16.95  ? 222  GLY A O   1 
ATOM   874   N  N   . GLY A  1 116 ? 47.156  -1.886  136.900 1.00 18.68  ? 223  GLY A N   1 
ATOM   875   C  CA  . GLY A  1 116 ? 46.946  -2.377  135.553 1.00 18.46  ? 223  GLY A CA  1 
ATOM   876   C  C   . GLY A  1 116 ? 45.599  -3.050  135.384 1.00 17.69  ? 223  GLY A C   1 
ATOM   877   O  O   . GLY A  1 116 ? 45.091  -3.688  136.305 1.00 18.40  ? 223  GLY A O   1 
ATOM   878   N  N   . VAL A  1 117 ? 44.999  -2.881  134.214 1.00 17.22  ? 224  VAL A N   1 
ATOM   879   C  CA  . VAL A  1 117 ? 43.729  -3.529  133.912 1.00 16.59  ? 224  VAL A CA  1 
ATOM   880   C  C   . VAL A  1 117 ? 43.951  -4.473  132.739 1.00 16.73  ? 224  VAL A C   1 
ATOM   881   O  O   . VAL A  1 117 ? 44.280  -4.038  131.629 1.00 16.12  ? 224  VAL A O   1 
ATOM   882   C  CB  . VAL A  1 117 ? 42.649  -2.541  133.505 1.00 15.57  ? 224  VAL A CB  1 
ATOM   883   C  CG1 . VAL A  1 117 ? 41.373  -3.293  133.209 1.00 15.69  ? 224  VAL A CG1 1 
ATOM   884   C  CG2 . VAL A  1 117 ? 42.430  -1.529  134.614 1.00 16.29  ? 224  VAL A CG2 1 
ATOM   885   N  N   . ARG A  1 118 ? 43.802  -5.767  133.005 1.00 16.07  ? 225  ARG A N   1 
ATOM   886   C  CA  . ARG A  1 118 ? 43.950  -6.787  131.982 1.00 15.92  ? 225  ARG A CA  1 
ATOM   887   C  C   . ARG A  1 118 ? 42.631  -6.846  131.226 1.00 16.23  ? 225  ARG A C   1 
ATOM   888   O  O   . ARG A  1 118 ? 41.632  -7.353  131.742 1.00 15.31  ? 225  ARG A O   1 
ATOM   889   C  CB  . ARG A  1 118 ? 44.243  -8.139  132.625 1.00 15.67  ? 225  ARG A CB  1 
ATOM   890   C  CG  . ARG A  1 118 ? 44.415  -9.273  131.645 1.00 15.93  ? 225  ARG A CG  1 
ATOM   891   C  CD  . ARG A  1 118 ? 45.016  -10.493 132.317 1.00 15.98  ? 225  ARG A CD  1 
ATOM   892   N  NE  . ARG A  1 118 ? 45.149  -11.610 131.387 1.00 17.43  ? 225  ARG A NE  1 
ATOM   893   C  CZ  . ARG A  1 118 ? 44.229  -12.556 131.220 1.00 17.99  ? 225  ARG A CZ  1 
ATOM   894   N  NH1 . ARG A  1 118 ? 44.436  -13.532 130.349 1.00 17.46  ? 225  ARG A NH1 1 
ATOM   895   N  NH2 . ARG A  1 118 ? 43.109  -12.537 131.934 1.00 18.09  ? 225  ARG A NH2 1 
ATOM   896   N  N   . MET A  1 119 ? 42.615  -6.299  130.014 1.00 16.71  ? 226  MET A N   1 
ATOM   897   C  CA  . MET A  1 119 ? 41.398  -6.306  129.216 1.00 16.98  ? 226  MET A CA  1 
ATOM   898   C  C   . MET A  1 119 ? 41.595  -6.531  127.727 1.00 17.51  ? 226  MET A C   1 
ATOM   899   O  O   . MET A  1 119 ? 40.631  -6.516  126.978 1.00 18.72  ? 226  MET A O   1 
ATOM   900   C  CB  . MET A  1 119 ? 40.592  -5.016  129.442 1.00 17.47  ? 226  MET A CB  1 
ATOM   901   C  CG  . MET A  1 119 ? 41.399  -3.710  129.497 1.00 18.30  ? 226  MET A CG  1 
ATOM   902   S  SD  . MET A  1 119 ? 41.785  -2.954  127.910 1.00 18.52  ? 226  MET A SD  1 
ATOM   903   C  CE  . MET A  1 119 ? 40.204  -2.285  127.472 1.00 13.98  ? 226  MET A CE  1 
ATOM   904   N  N   . LEU A  1 120 ? 42.830  -6.750  127.290 1.00 17.50  ? 227  LEU A N   1 
ATOM   905   C  CA  . LEU A  1 120 ? 43.066  -6.978  125.869 1.00 17.42  ? 227  LEU A CA  1 
ATOM   906   C  C   . LEU A  1 120 ? 43.303  -8.441  125.552 1.00 18.22  ? 227  LEU A C   1 
ATOM   907   O  O   . LEU A  1 120 ? 43.276  -8.829  124.390 1.00 18.45  ? 227  LEU A O   1 
ATOM   908   C  CB  . LEU A  1 120 ? 44.273  -6.183  125.374 1.00 15.35  ? 227  LEU A CB  1 
ATOM   909   C  CG  . LEU A  1 120 ? 44.156  -4.663  125.325 1.00 17.22  ? 227  LEU A CG  1 
ATOM   910   C  CD1 . LEU A  1 120 ? 45.484  -4.081  124.833 1.00 16.62  ? 227  LEU A CD1 1 
ATOM   911   C  CD2 . LEU A  1 120 ? 43.003  -4.246  124.409 1.00 15.49  ? 227  LEU A CD2 1 
ATOM   912   N  N   . ASP A  1 121 ? 43.533  -9.250  126.581 1.00 18.37  ? 228  ASP A N   1 
ATOM   913   C  CA  . ASP A  1 121 ? 43.816  -10.660 126.373 1.00 18.41  ? 228  ASP A CA  1 
ATOM   914   C  C   . ASP A  1 121 ? 42.562  -11.495 126.266 1.00 18.50  ? 228  ASP A C   1 
ATOM   915   O  O   . ASP A  1 121 ? 42.328  -12.398 127.070 1.00 18.55  ? 228  ASP A O   1 
ATOM   916   C  CB  . ASP A  1 121 ? 44.681  -11.190 127.503 1.00 18.88  ? 228  ASP A CB  1 
ATOM   917   C  CG  . ASP A  1 121 ? 45.393  -12.457 127.126 1.00 20.25  ? 228  ASP A CG  1 
ATOM   918   O  OD1 . ASP A  1 121 ? 46.036  -13.061 128.007 1.00 20.88  ? 228  ASP A OD1 1 
ATOM   919   O  OD2 . ASP A  1 121 ? 45.315  -12.840 125.938 1.00 20.72  ? 228  ASP A OD2 1 
ATOM   920   N  N   . GLY A  1 122 ? 41.759  -11.192 125.259 1.00 17.90  ? 229  GLY A N   1 
ATOM   921   C  CA  . GLY A  1 122 ? 40.516  -11.911 125.050 1.00 18.10  ? 229  GLY A CA  1 
ATOM   922   C  C   . GLY A  1 122 ? 39.638  -11.088 124.132 1.00 18.14  ? 229  GLY A C   1 
ATOM   923   O  O   . GLY A  1 122 ? 40.125  -10.195 123.445 1.00 17.37  ? 229  GLY A O   1 
ATOM   924   N  N   . GLU A  1 123 ? 38.345  -11.376 124.110 1.00 18.88  ? 230  GLU A N   1 
ATOM   925   C  CA  . GLU A  1 123 ? 37.444  -10.619 123.262 1.00 19.29  ? 230  GLU A CA  1 
ATOM   926   C  C   . GLU A  1 123 ? 37.242  -9.249  123.907 1.00 19.16  ? 230  GLU A C   1 
ATOM   927   O  O   . GLU A  1 123 ? 36.749  -9.137  125.028 1.00 17.99  ? 230  GLU A O   1 
ATOM   928   C  CB  . GLU A  1 123 ? 36.103  -11.344 123.112 1.00 21.03  ? 230  GLU A CB  1 
ATOM   929   C  CG  . GLU A  1 123 ? 35.074  -10.557 122.305 1.00 24.07  ? 230  GLU A CG  1 
ATOM   930   C  CD  . GLU A  1 123 ? 33.773  -11.308 122.141 1.00 26.04  ? 230  GLU A CD  1 
ATOM   931   O  OE1 . GLU A  1 123 ? 33.579  -12.315 122.861 1.00 27.55  ? 230  GLU A OE1 1 
ATOM   932   O  OE2 . GLU A  1 123 ? 32.943  -10.886 121.305 1.00 26.66  ? 230  GLU A OE2 1 
ATOM   933   N  N   . VAL A  1 124 ? 37.638  -8.204  123.196 1.00 18.11  ? 231  VAL A N   1 
ATOM   934   C  CA  . VAL A  1 124 ? 37.510  -6.860  123.719 1.00 15.50  ? 231  VAL A CA  1 
ATOM   935   C  C   . VAL A  1 124 ? 36.163  -6.292  123.325 1.00 15.74  ? 231  VAL A C   1 
ATOM   936   O  O   . VAL A  1 124 ? 36.036  -5.559  122.346 1.00 15.49  ? 231  VAL A O   1 
ATOM   937   C  CB  . VAL A  1 124 ? 38.619  -5.947  123.181 1.00 15.25  ? 231  VAL A CB  1 
ATOM   938   C  CG1 . VAL A  1 124 ? 38.571  -4.603  123.879 1.00 14.74  ? 231  VAL A CG1 1 
ATOM   939   C  CG2 . VAL A  1 124 ? 39.976  -6.607  123.380 1.00 15.62  ? 231  VAL A CG2 1 
ATOM   940   N  N   . THR A  1 125 ? 35.154  -6.629  124.113 1.00 15.17  ? 232  THR A N   1 
ATOM   941   C  CA  . THR A  1 125 ? 33.804  -6.171  123.865 1.00 13.45  ? 232  THR A CA  1 
ATOM   942   C  C   . THR A  1 125 ? 33.575  -4.749  124.362 1.00 14.69  ? 232  THR A C   1 
ATOM   943   O  O   . THR A  1 125 ? 34.399  -4.175  125.053 1.00 16.07  ? 232  THR A O   1 
ATOM   944   C  CB  . THR A  1 125 ? 32.806  -7.043  124.577 1.00 12.50  ? 232  THR A CB  1 
ATOM   945   O  OG1 . THR A  1 125 ? 32.904  -6.788  125.978 1.00 14.56  ? 232  THR A OG1 1 
ATOM   946   C  CG2 . THR A  1 125 ? 33.086  -8.522  124.301 1.00 12.73  ? 232  THR A CG2 1 
ATOM   947   N  N   . ASP A  1 126 ? 32.435  -4.187  123.989 1.00 15.18  ? 233  ASP A N   1 
ATOM   948   C  CA  . ASP A  1 126 ? 32.049  -2.855  124.392 1.00 14.51  ? 233  ASP A CA  1 
ATOM   949   C  C   . ASP A  1 126 ? 32.000  -2.808  125.915 1.00 15.59  ? 233  ASP A C   1 
ATOM   950   O  O   . ASP A  1 126 ? 32.512  -1.875  126.530 1.00 15.88  ? 233  ASP A O   1 
ATOM   951   C  CB  . ASP A  1 126 ? 30.662  -2.544  123.836 1.00 16.23  ? 233  ASP A CB  1 
ATOM   952   C  CG  . ASP A  1 126 ? 30.247  -1.098  124.055 1.00 17.88  ? 233  ASP A CG  1 
ATOM   953   O  OD1 . ASP A  1 126 ? 29.019  -0.838  124.125 1.00 19.08  ? 233  ASP A OD1 1 
ATOM   954   O  OD2 . ASP A  1 126 ? 31.136  -0.219  124.135 1.00 17.59  ? 233  ASP A OD2 1 
ATOM   955   N  N   . ALA A  1 127 ? 31.383  -3.821  126.524 1.00 14.88  ? 234  ALA A N   1 
ATOM   956   C  CA  . ALA A  1 127 ? 31.273  -3.869  127.978 1.00 14.41  ? 234  ALA A CA  1 
ATOM   957   C  C   . ALA A  1 127 ? 32.647  -3.942  128.641 1.00 14.73  ? 234  ALA A C   1 
ATOM   958   O  O   . ALA A  1 127 ? 32.847  -3.390  129.718 1.00 14.73  ? 234  ALA A O   1 
ATOM   959   C  CB  . ALA A  1 127 ? 30.415  -5.052  128.409 1.00 14.60  ? 234  ALA A CB  1 
ATOM   960   N  N   . VAL A  1 128 ? 33.591  -4.619  127.996 1.00 14.40  ? 235  VAL A N   1 
ATOM   961   C  CA  . VAL A  1 128 ? 34.943  -4.745  128.533 1.00 13.67  ? 235  VAL A CA  1 
ATOM   962   C  C   . VAL A  1 128 ? 35.622  -3.385  128.557 1.00 13.72  ? 235  VAL A C   1 
ATOM   963   O  O   . VAL A  1 128 ? 36.249  -3.006  129.546 1.00 13.59  ? 235  VAL A O   1 
ATOM   964   C  CB  . VAL A  1 128 ? 35.781  -5.723  127.682 1.00 12.72  ? 235  VAL A CB  1 
ATOM   965   C  CG1 . VAL A  1 128 ? 37.254  -5.589  128.002 1.00 14.03  ? 235  VAL A CG1 1 
ATOM   966   C  CG2 . VAL A  1 128 ? 35.323  -7.137  127.958 1.00 13.63  ? 235  VAL A CG2 1 
ATOM   967   N  N   . GLU A  1 129 ? 35.487  -2.646  127.464 1.00 13.55  ? 236  GLU A N   1 
ATOM   968   C  CA  . GLU A  1 129 ? 36.100  -1.330  127.382 1.00 12.94  ? 236  GLU A CA  1 
ATOM   969   C  C   . GLU A  1 129 ? 35.451  -0.379  128.379 1.00 13.55  ? 236  GLU A C   1 
ATOM   970   O  O   . GLU A  1 129 ? 36.137  0.385   129.046 1.00 15.38  ? 236  GLU A O   1 
ATOM   971   C  CB  . GLU A  1 129 ? 35.969  -0.764  125.972 1.00 10.78  ? 236  GLU A CB  1 
ATOM   972   C  CG  . GLU A  1 129 ? 36.611  -1.615  124.903 1.00 10.42  ? 236  GLU A CG  1 
ATOM   973   C  CD  . GLU A  1 129 ? 36.706  -0.890  123.585 1.00 10.99  ? 236  GLU A CD  1 
ATOM   974   O  OE1 . GLU A  1 129 ? 35.953  0.087   123.390 1.00 9.90   ? 236  GLU A OE1 1 
ATOM   975   O  OE2 . GLU A  1 129 ? 37.520  -1.301  122.734 1.00 12.45  ? 236  GLU A OE2 1 
ATOM   976   N  N   . ALA A  1 130 ? 34.128  -0.437  128.487 1.00 13.50  ? 237  ALA A N   1 
ATOM   977   C  CA  . ALA A  1 130 ? 33.400  0.429   129.403 1.00 12.68  ? 237  ALA A CA  1 
ATOM   978   C  C   . ALA A  1 130 ? 33.767  0.175   130.862 1.00 13.75  ? 237  ALA A C   1 
ATOM   979   O  O   . ALA A  1 130 ? 33.856  1.109   131.658 1.00 14.35  ? 237  ALA A O   1 
ATOM   980   C  CB  . ALA A  1 130 ? 31.916  0.253   129.204 1.00 12.49  ? 237  ALA A CB  1 
ATOM   981   N  N   . ARG A  1 131 ? 33.976  -1.084  131.223 1.00 14.37  ? 238  ARG A N   1 
ATOM   982   C  CA  . ARG A  1 131 ? 34.330  -1.403  132.597 1.00 16.22  ? 238  ARG A CA  1 
ATOM   983   C  C   . ARG A  1 131 ? 35.767  -0.983  132.880 1.00 16.72  ? 238  ARG A C   1 
ATOM   984   O  O   . ARG A  1 131 ? 36.094  -0.603  134.003 1.00 18.25  ? 238  ARG A O   1 
ATOM   985   C  CB  . ARG A  1 131 ? 34.158  -2.897  132.869 1.00 16.37  ? 238  ARG A CB  1 
ATOM   986   C  CG  . ARG A  1 131 ? 32.738  -3.389  132.718 1.00 21.12  ? 238  ARG A CG  1 
ATOM   987   C  CD  . ARG A  1 131 ? 32.632  -4.814  133.186 1.00 25.20  ? 238  ARG A CD  1 
ATOM   988   N  NE  . ARG A  1 131 ? 32.827  -4.879  134.630 1.00 30.22  ? 238  ARG A NE  1 
ATOM   989   C  CZ  . ARG A  1 131 ? 33.405  -5.896  135.265 1.00 33.42  ? 238  ARG A CZ  1 
ATOM   990   N  NH1 . ARG A  1 131 ? 33.527  -5.861  136.591 1.00 34.29  ? 238  ARG A NH1 1 
ATOM   991   N  NH2 . ARG A  1 131 ? 33.877  -6.940  134.578 1.00 32.96  ? 238  ARG A NH2 1 
ATOM   992   N  N   . SER A  1 132 ? 36.618  -1.045  131.860 1.00 15.69  ? 239  SER A N   1 
ATOM   993   C  CA  . SER A  1 132 ? 38.010  -0.663  132.008 1.00 16.29  ? 239  SER A CA  1 
ATOM   994   C  C   . SER A  1 132 ? 38.136  0.861   132.148 1.00 17.05  ? 239  SER A C   1 
ATOM   995   O  O   . SER A  1 132 ? 38.763  1.374   133.075 1.00 18.76  ? 239  SER A O   1 
ATOM   996   C  CB  . SER A  1 132 ? 38.805  -1.137  130.795 1.00 16.38  ? 239  SER A CB  1 
ATOM   997   O  OG  . SER A  1 132 ? 38.812  -2.550  130.715 1.00 19.11  ? 239  SER A OG  1 
ATOM   998   N  N   . LEU A  1 133 ? 37.532  1.587   131.223 1.00 16.63  ? 240  LEU A N   1 
ATOM   999   C  CA  . LEU A  1 133 ? 37.579  3.035   131.255 1.00 15.66  ? 240  LEU A CA  1 
ATOM   1000  C  C   . LEU A  1 133 ? 36.935  3.592   132.517 1.00 16.70  ? 240  LEU A C   1 
ATOM   1001  O  O   . LEU A  1 133 ? 37.327  4.647   133.006 1.00 17.40  ? 240  LEU A O   1 
ATOM   1002  C  CB  . LEU A  1 133 ? 36.860  3.604   130.036 1.00 13.49  ? 240  LEU A CB  1 
ATOM   1003  C  CG  . LEU A  1 133 ? 37.511  3.288   128.692 1.00 13.76  ? 240  LEU A CG  1 
ATOM   1004  C  CD1 . LEU A  1 133 ? 36.558  3.652   127.577 1.00 14.78  ? 240  LEU A CD1 1 
ATOM   1005  C  CD2 . LEU A  1 133 ? 38.808  4.049   128.553 1.00 11.91  ? 240  LEU A CD2 1 
ATOM   1006  N  N   . GLY A  1 134 ? 35.942  2.890   133.045 1.00 17.78  ? 241  GLY A N   1 
ATOM   1007  C  CA  . GLY A  1 134 ? 35.260  3.377   134.230 1.00 17.83  ? 241  GLY A CA  1 
ATOM   1008  C  C   . GLY A  1 134 ? 35.622  2.696   135.533 1.00 18.45  ? 241  GLY A C   1 
ATOM   1009  O  O   . GLY A  1 134 ? 34.836  2.696   136.477 1.00 18.55  ? 241  GLY A O   1 
ATOM   1010  N  N   . LEU A  1 135 ? 36.812  2.120   135.592 1.00 18.27  ? 242  LEU A N   1 
ATOM   1011  C  CA  . LEU A  1 135 ? 37.274  1.431   136.784 1.00 18.77  ? 242  LEU A CA  1 
ATOM   1012  C  C   . LEU A  1 135 ? 37.758  2.416   137.855 1.00 20.92  ? 242  LEU A C   1 
ATOM   1013  O  O   . LEU A  1 135 ? 38.697  3.178   137.615 1.00 22.57  ? 242  LEU A O   1 
ATOM   1014  C  CB  . LEU A  1 135 ? 38.406  0.489   136.390 1.00 15.85  ? 242  LEU A CB  1 
ATOM   1015  C  CG  . LEU A  1 135 ? 39.033  -0.260  137.553 1.00 16.01  ? 242  LEU A CG  1 
ATOM   1016  C  CD1 . LEU A  1 135 ? 38.039  -1.275  138.099 1.00 16.51  ? 242  LEU A CD1 1 
ATOM   1017  C  CD2 . LEU A  1 135 ? 40.289  -0.936  137.095 1.00 14.18  ? 242  LEU A CD2 1 
ATOM   1018  N  N   . ASN A  1 136 ? 37.128  2.407   139.030 1.00 22.71  ? 243  ASN A N   1 
ATOM   1019  C  CA  . ASN A  1 136 ? 37.527  3.300   140.125 1.00 23.72  ? 243  ASN A CA  1 
ATOM   1020  C  C   . ASN A  1 136 ? 37.705  4.749   139.731 1.00 23.24  ? 243  ASN A C   1 
ATOM   1021  O  O   . ASN A  1 136 ? 38.752  5.338   139.987 1.00 23.52  ? 243  ASN A O   1 
ATOM   1022  C  CB  . ASN A  1 136 ? 38.843  2.846   140.732 1.00 27.15  ? 243  ASN A CB  1 
ATOM   1023  C  CG  . ASN A  1 136 ? 38.667  1.745   141.731 1.00 31.67  ? 243  ASN A CG  1 
ATOM   1024  O  OD1 . ASN A  1 136 ? 38.261  0.626   141.380 1.00 32.73  ? 243  ASN A OD1 1 
ATOM   1025  N  ND2 . ASN A  1 136 ? 38.966  2.049   143.000 1.00 31.74  ? 243  ASN A ND2 1 
ATOM   1026  N  N   . PRO A  1 137 ? 36.677  5.360   139.144 1.00 22.57  ? 244  PRO A N   1 
ATOM   1027  C  CA  . PRO A  1 137 ? 36.785  6.759   138.728 1.00 21.66  ? 244  PRO A CA  1 
ATOM   1028  C  C   . PRO A  1 137 ? 37.283  7.714   139.819 1.00 20.94  ? 244  PRO A C   1 
ATOM   1029  O  O   . PRO A  1 137 ? 37.860  8.746   139.502 1.00 21.74  ? 244  PRO A O   1 
ATOM   1030  C  CB  . PRO A  1 137 ? 35.361  7.099   138.276 1.00 22.39  ? 244  PRO A CB  1 
ATOM   1031  C  CG  . PRO A  1 137 ? 34.742  5.768   137.981 1.00 21.52  ? 244  PRO A CG  1 
ATOM   1032  C  CD  . PRO A  1 137 ? 35.285  4.896   139.062 1.00 21.11  ? 244  PRO A CD  1 
ATOM   1033  N  N   . ASN A  1 138 ? 37.054  7.388   141.092 1.00 20.53  ? 245  ASN A N   1 
ATOM   1034  C  CA  . ASN A  1 138 ? 37.503  8.270   142.178 1.00 20.50  ? 245  ASN A CA  1 
ATOM   1035  C  C   . ASN A  1 138 ? 38.801  7.859   142.872 1.00 20.05  ? 245  ASN A C   1 
ATOM   1036  O  O   . ASN A  1 138 ? 39.190  8.469   143.866 1.00 20.27  ? 245  ASN A O   1 
ATOM   1037  C  CB  . ASN A  1 138 ? 36.423  8.447   143.254 1.00 18.84  ? 245  ASN A CB  1 
ATOM   1038  C  CG  . ASN A  1 138 ? 35.326  9.399   142.830 1.00 20.54  ? 245  ASN A CG  1 
ATOM   1039  O  OD1 . ASN A  1 138 ? 35.505  10.214  141.916 1.00 20.32  ? 245  ASN A OD1 1 
ATOM   1040  N  ND2 . ASN A  1 138 ? 34.180  9.316   143.506 1.00 21.14  ? 245  ASN A ND2 1 
ATOM   1041  N  N   . HIS A  1 139 ? 39.458  6.823   142.370 1.00 19.16  ? 246  HIS A N   1 
ATOM   1042  C  CA  . HIS A  1 139 ? 40.717  6.405   142.953 1.00 18.51  ? 246  HIS A CA  1 
ATOM   1043  C  C   . HIS A  1 139 ? 41.813  6.585   141.923 1.00 18.62  ? 246  HIS A C   1 
ATOM   1044  O  O   . HIS A  1 139 ? 42.907  7.023   142.249 1.00 19.96  ? 246  HIS A O   1 
ATOM   1045  C  CB  . HIS A  1 139 ? 40.673  4.949   143.377 1.00 19.06  ? 246  HIS A CB  1 
ATOM   1046  C  CG  . HIS A  1 139 ? 41.978  4.449   143.902 1.00 20.61  ? 246  HIS A CG  1 
ATOM   1047  N  ND1 . HIS A  1 139 ? 42.502  4.868   145.105 1.00 21.92  ? 246  HIS A ND1 1 
ATOM   1048  C  CD2 . HIS A  1 139 ? 42.879  3.586   143.378 1.00 21.47  ? 246  HIS A CD2 1 
ATOM   1049  C  CE1 . HIS A  1 139 ? 43.670  4.283   145.300 1.00 22.49  ? 246  HIS A CE1 1 
ATOM   1050  N  NE2 . HIS A  1 139 ? 43.923  3.499   144.267 1.00 21.43  ? 246  HIS A NE2 1 
ATOM   1051  N  N   . ILE A  1 140 ? 41.510  6.236   140.675 1.00 17.80  ? 247  ILE A N   1 
ATOM   1052  C  CA  . ILE A  1 140 ? 42.470  6.358   139.591 1.00 16.62  ? 247  ILE A CA  1 
ATOM   1053  C  C   . ILE A  1 140 ? 42.325  7.747   138.996 1.00 16.68  ? 247  ILE A C   1 
ATOM   1054  O  O   . ILE A  1 140 ? 41.208  8.163   138.679 1.00 17.25  ? 247  ILE A O   1 
ATOM   1055  C  CB  . ILE A  1 140 ? 42.195  5.327   138.486 1.00 14.91  ? 247  ILE A CB  1 
ATOM   1056  C  CG1 . ILE A  1 140 ? 42.286  3.909   139.052 1.00 14.05  ? 247  ILE A CG1 1 
ATOM   1057  C  CG2 . ILE A  1 140 ? 43.188  5.527   137.349 1.00 13.93  ? 247  ILE A CG2 1 
ATOM   1058  C  CD1 . ILE A  1 140 ? 41.790  2.829   138.089 1.00 12.39  ? 247  ILE A CD1 1 
ATOM   1059  N  N   . HIS A  1 141 ? 43.440  8.459   138.842 1.00 15.09  ? 248  HIS A N   1 
ATOM   1060  C  CA  . HIS A  1 141 ? 43.402  9.805   138.284 1.00 16.39  ? 248  HIS A CA  1 
ATOM   1061  C  C   . HIS A  1 141 ? 43.600  9.803   136.777 1.00 15.92  ? 248  HIS A C   1 
ATOM   1062  O  O   . HIS A  1 141 ? 42.912  10.504  136.040 1.00 15.68  ? 248  HIS A O   1 
ATOM   1063  C  CB  . HIS A  1 141 ? 44.505  10.682  138.889 1.00 17.36  ? 248  HIS A CB  1 
ATOM   1064  C  CG  . HIS A  1 141 ? 44.474  10.761  140.381 1.00 18.25  ? 248  HIS A CG  1 
ATOM   1065  N  ND1 . HIS A  1 141 ? 45.362  10.072  141.178 1.00 19.12  ? 248  HIS A ND1 1 
ATOM   1066  C  CD2 . HIS A  1 141 ? 43.655  11.434  141.223 1.00 18.03  ? 248  HIS A CD2 1 
ATOM   1067  C  CE1 . HIS A  1 141 ? 45.090  10.317  142.447 1.00 18.21  ? 248  HIS A CE1 1 
ATOM   1068  N  NE2 . HIS A  1 141 ? 44.059  11.140  142.501 1.00 18.27  ? 248  HIS A NE2 1 
ATOM   1069  N  N   . ILE A  1 142 ? 44.558  9.000   136.338 1.00 15.25  ? 249  ILE A N   1 
ATOM   1070  C  CA  . ILE A  1 142 ? 44.926  8.915   134.938 1.00 13.28  ? 249  ILE A CA  1 
ATOM   1071  C  C   . ILE A  1 142 ? 44.878  7.511   134.374 1.00 12.48  ? 249  ILE A C   1 
ATOM   1072  O  O   . ILE A  1 142 ? 45.384  6.569   134.990 1.00 12.79  ? 249  ILE A O   1 
ATOM   1073  C  CB  . ILE A  1 142 ? 46.346  9.434   134.766 1.00 12.93  ? 249  ILE A CB  1 
ATOM   1074  C  CG1 . ILE A  1 142 ? 46.431  10.851  135.330 1.00 12.41  ? 249  ILE A CG1 1 
ATOM   1075  C  CG2 . ILE A  1 142 ? 46.751  9.370   133.316 1.00 12.74  ? 249  ILE A CG2 1 
ATOM   1076  C  CD1 . ILE A  1 142 ? 47.834  11.348  135.526 1.00 11.00  ? 249  ILE A CD1 1 
ATOM   1077  N  N   . TYR A  1 143 ? 44.283  7.380   133.191 1.00 11.76  ? 250  TYR A N   1 
ATOM   1078  C  CA  . TYR A  1 143 ? 44.197  6.087   132.507 1.00 10.82  ? 250  TYR A CA  1 
ATOM   1079  C  C   . TYR A  1 143 ? 45.086  6.181   131.291 1.00 10.27  ? 250  TYR A C   1 
ATOM   1080  O  O   . TYR A  1 143 ? 45.029  7.155   130.562 1.00 10.74  ? 250  TYR A O   1 
ATOM   1081  C  CB  . TYR A  1 143 ? 42.774  5.790   132.044 1.00 10.54  ? 250  TYR A CB  1 
ATOM   1082  C  CG  . TYR A  1 143 ? 41.768  5.669   133.154 1.00 11.13  ? 250  TYR A CG  1 
ATOM   1083  C  CD1 . TYR A  1 143 ? 41.231  6.804   133.770 1.00 11.79  ? 250  TYR A CD1 1 
ATOM   1084  C  CD2 . TYR A  1 143 ? 41.362  4.425   133.605 1.00 11.59  ? 250  TYR A CD2 1 
ATOM   1085  C  CE1 . TYR A  1 143 ? 40.307  6.690   134.814 1.00 12.08  ? 250  TYR A CE1 1 
ATOM   1086  C  CE2 . TYR A  1 143 ? 40.437  4.300   134.653 1.00 12.14  ? 250  TYR A CE2 1 
ATOM   1087  C  CZ  . TYR A  1 143 ? 39.917  5.430   135.249 1.00 10.45  ? 250  TYR A CZ  1 
ATOM   1088  O  OH  . TYR A  1 143 ? 39.018  5.301   136.278 1.00 11.15  ? 250  TYR A OH  1 
ATOM   1089  N  N   . SER A  1 144 ? 45.916  5.175   131.072 1.00 11.04  ? 251  SER A N   1 
ATOM   1090  C  CA  . SER A  1 144 ? 46.805  5.179   129.922 1.00 11.24  ? 251  SER A CA  1 
ATOM   1091  C  C   . SER A  1 144 ? 46.441  4.006   129.016 1.00 11.71  ? 251  SER A C   1 
ATOM   1092  O  O   . SER A  1 144 ? 46.541  2.844   129.433 1.00 12.13  ? 251  SER A O   1 
ATOM   1093  C  CB  . SER A  1 144 ? 48.257  5.055   130.381 1.00 11.08  ? 251  SER A CB  1 
ATOM   1094  O  OG  . SER A  1 144 ? 49.143  5.222   129.289 1.00 10.48  ? 251  SER A OG  1 
ATOM   1095  N  N   . ALA A  1 145 ? 46.036  4.305   127.782 1.00 10.22  ? 252  ALA A N   1 
ATOM   1096  C  CA  . ALA A  1 145 ? 45.630  3.265   126.843 1.00 10.43  ? 252  ALA A CA  1 
ATOM   1097  C  C   . ALA A  1 145 ? 46.454  3.228   125.569 1.00 11.35  ? 252  ALA A C   1 
ATOM   1098  O  O   . ALA A  1 145 ? 46.338  4.110   124.725 1.00 12.63  ? 252  ALA A O   1 
ATOM   1099  C  CB  . ALA A  1 145 ? 44.159  3.438   126.498 1.00 9.33   ? 252  ALA A CB  1 
ATOM   1100  N  N   . SER A  1 146 ? 47.286  2.202   125.430 1.00 12.16  ? 253  SER A N   1 
ATOM   1101  C  CA  . SER A  1 146 ? 48.122  2.048   124.248 1.00 12.83  ? 253  SER A CA  1 
ATOM   1102  C  C   . SER A  1 146 ? 47.567  0.956   123.333 1.00 14.15  ? 253  SER A C   1 
ATOM   1103  O  O   . SER A  1 146 ? 48.195  -0.093  123.138 1.00 15.07  ? 253  SER A O   1 
ATOM   1104  C  CB  . SER A  1 146 ? 49.553  1.706   124.659 1.00 13.20  ? 253  SER A CB  1 
ATOM   1105  O  OG  . SER A  1 146 ? 50.179  2.809   125.287 1.00 13.67  ? 253  SER A OG  1 
ATOM   1106  N  N   . TRP A  1 147 ? 46.382  1.209   122.785 1.00 13.52  ? 254  TRP A N   1 
ATOM   1107  C  CA  . TRP A  1 147 ? 45.721  0.263   121.895 1.00 13.68  ? 254  TRP A CA  1 
ATOM   1108  C  C   . TRP A  1 147 ? 44.607  0.966   121.161 1.00 14.20  ? 254  TRP A C   1 
ATOM   1109  O  O   . TRP A  1 147 ? 44.274  2.101   121.487 1.00 16.60  ? 254  TRP A O   1 
ATOM   1110  C  CB  . TRP A  1 147 ? 45.139  -0.909  122.680 1.00 11.22  ? 254  TRP A CB  1 
ATOM   1111  C  CG  . TRP A  1 147 ? 44.316  -0.520  123.869 1.00 11.46  ? 254  TRP A CG  1 
ATOM   1112  C  CD1 . TRP A  1 147 ? 44.736  -0.456  125.168 1.00 10.63  ? 254  TRP A CD1 1 
ATOM   1113  C  CD2 . TRP A  1 147 ? 42.912  -0.209  123.887 1.00 10.83  ? 254  TRP A CD2 1 
ATOM   1114  N  NE1 . TRP A  1 147 ? 43.682  -0.134  125.994 1.00 9.38   ? 254  TRP A NE1 1 
ATOM   1115  C  CE2 . TRP A  1 147 ? 42.552  0.025   125.235 1.00 9.67   ? 254  TRP A CE2 1 
ATOM   1116  C  CE3 . TRP A  1 147 ? 41.924  -0.111  122.897 1.00 10.99  ? 254  TRP A CE3 1 
ATOM   1117  C  CZ2 . TRP A  1 147 ? 41.246  0.350   125.620 1.00 9.83   ? 254  TRP A CZ2 1 
ATOM   1118  C  CZ3 . TRP A  1 147 ? 40.621  0.211   123.278 1.00 9.84   ? 254  TRP A CZ3 1 
ATOM   1119  C  CH2 . TRP A  1 147 ? 40.297  0.437   124.633 1.00 10.72  ? 254  TRP A CH2 1 
ATOM   1120  N  N   . GLY A  1 148 ? 44.037  0.296   120.168 1.00 14.25  ? 255  GLY A N   1 
ATOM   1121  C  CA  . GLY A  1 148 ? 42.957  0.886   119.400 1.00 13.19  ? 255  GLY A CA  1 
ATOM   1122  C  C   . GLY A  1 148 ? 42.593  0.002   118.229 1.00 12.82  ? 255  GLY A C   1 
ATOM   1123  O  O   . GLY A  1 148 ? 43.052  -1.139  118.155 1.00 13.20  ? 255  GLY A O   1 
ATOM   1124  N  N   . PRO A  1 149 ? 41.770  0.498   117.296 1.00 12.86  ? 256  PRO A N   1 
ATOM   1125  C  CA  . PRO A  1 149 ? 41.374  -0.295  116.135 1.00 13.25  ? 256  PRO A CA  1 
ATOM   1126  C  C   . PRO A  1 149 ? 42.597  -0.649  115.295 1.00 14.30  ? 256  PRO A C   1 
ATOM   1127  O  O   . PRO A  1 149 ? 43.633  -0.013  115.396 1.00 14.40  ? 256  PRO A O   1 
ATOM   1128  C  CB  . PRO A  1 149 ? 40.420  0.632   115.390 1.00 12.96  ? 256  PRO A CB  1 
ATOM   1129  C  CG  . PRO A  1 149 ? 39.908  1.538   116.449 1.00 11.40  ? 256  PRO A CG  1 
ATOM   1130  C  CD  . PRO A  1 149 ? 41.125  1.818   117.262 1.00 11.87  ? 256  PRO A CD  1 
ATOM   1131  N  N   . GLU A  1 150 ? 42.455  -1.670  114.464 1.00 15.81  ? 257  GLU A N   1 
ATOM   1132  C  CA  . GLU A  1 150 ? 43.516  -2.141  113.585 1.00 15.56  ? 257  GLU A CA  1 
ATOM   1133  C  C   . GLU A  1 150 ? 44.205  -0.967  112.873 1.00 14.77  ? 257  GLU A C   1 
ATOM   1134  O  O   . GLU A  1 150 ? 43.539  -0.086  112.324 1.00 12.67  ? 257  GLU A O   1 
ATOM   1135  C  CB  . GLU A  1 150 ? 42.894  -3.097  112.552 1.00 17.09  ? 257  GLU A CB  1 
ATOM   1136  C  CG  . GLU A  1 150 ? 43.875  -3.952  111.792 1.00 23.07  ? 257  GLU A CG  1 
ATOM   1137  C  CD  . GLU A  1 150 ? 44.294  -5.179  112.577 1.00 27.57  ? 257  GLU A CD  1 
ATOM   1138  O  OE1 . GLU A  1 150 ? 45.415  -5.681  112.336 1.00 30.48  ? 257  GLU A OE1 1 
ATOM   1139  O  OE2 . GLU A  1 150 ? 43.497  -5.655  113.424 1.00 30.49  ? 257  GLU A OE2 1 
ATOM   1140  N  N   . ASP A  1 151 ? 45.536  -0.954  112.875 1.00 14.84  ? 258  ASP A N   1 
ATOM   1141  C  CA  . ASP A  1 151 ? 46.273  0.115   112.200 1.00 15.22  ? 258  ASP A CA  1 
ATOM   1142  C  C   . ASP A  1 151 ? 46.715  -0.333  110.810 1.00 15.95  ? 258  ASP A C   1 
ATOM   1143  O  O   . ASP A  1 151 ? 47.877  -0.169  110.439 1.00 17.18  ? 258  ASP A O   1 
ATOM   1144  C  CB  . ASP A  1 151 ? 47.512  0.537   113.007 1.00 14.87  ? 258  ASP A CB  1 
ATOM   1145  C  CG  . ASP A  1 151 ? 47.164  1.263   114.310 1.00 14.56  ? 258  ASP A CG  1 
ATOM   1146  O  OD1 . ASP A  1 151 ? 46.260  2.127   114.317 1.00 12.96  ? 258  ASP A OD1 1 
ATOM   1147  O  OD2 . ASP A  1 151 ? 47.814  0.976   115.331 1.00 13.46  ? 258  ASP A OD2 1 
ATOM   1148  N  N   . ASP A  1 152 ? 45.785  -0.891  110.038 1.00 15.91  ? 259  ASP A N   1 
ATOM   1149  C  CA  . ASP A  1 152 ? 46.099  -1.374  108.703 1.00 14.71  ? 259  ASP A CA  1 
ATOM   1150  C  C   . ASP A  1 152 ? 45.874  -0.307  107.641 1.00 14.84  ? 259  ASP A C   1 
ATOM   1151  O  O   . ASP A  1 152 ? 46.183  -0.514  106.470 1.00 15.16  ? 259  ASP A O   1 
ATOM   1152  C  CB  . ASP A  1 152 ? 45.267  -2.620  108.405 1.00 15.82  ? 259  ASP A CB  1 
ATOM   1153  C  CG  . ASP A  1 152 ? 43.773  -2.361  108.500 1.00 17.63  ? 259  ASP A CG  1 
ATOM   1154  O  OD1 . ASP A  1 152 ? 42.993  -3.332  108.420 1.00 18.51  ? 259  ASP A OD1 1 
ATOM   1155  O  OD2 . ASP A  1 152 ? 43.382  -1.184  108.645 1.00 18.15  ? 259  ASP A OD2 1 
ATOM   1156  N  N   . GLY A  1 153 ? 45.344  0.837   108.060 1.00 15.55  ? 260  GLY A N   1 
ATOM   1157  C  CA  . GLY A  1 153 ? 45.106  1.932   107.139 1.00 14.48  ? 260  GLY A CA  1 
ATOM   1158  C  C   . GLY A  1 153 ? 43.882  1.691   106.291 1.00 15.05  ? 260  GLY A C   1 
ATOM   1159  O  O   . GLY A  1 153 ? 43.710  2.333   105.257 1.00 15.51  ? 260  GLY A O   1 
ATOM   1160  N  N   . LYS A  1 154 ? 43.023  0.778   106.740 1.00 14.97  ? 261  LYS A N   1 
ATOM   1161  C  CA  . LYS A  1 154 ? 41.811  0.418   106.008 1.00 14.43  ? 261  LYS A CA  1 
ATOM   1162  C  C   . LYS A  1 154 ? 40.582  0.563   106.883 1.00 14.06  ? 261  LYS A C   1 
ATOM   1163  O  O   . LYS A  1 154 ? 39.461  0.606   106.376 1.00 14.30  ? 261  LYS A O   1 
ATOM   1164  C  CB  . LYS A  1 154 ? 41.836  -1.058  105.587 1.00 15.16  ? 261  LYS A CB  1 
ATOM   1165  C  CG  . LYS A  1 154 ? 43.020  -1.559  104.809 1.00 17.51  ? 261  LYS A CG  1 
ATOM   1166  C  CD  . LYS A  1 154 ? 42.931  -3.090  104.721 1.00 21.31  ? 261  LYS A CD  1 
ATOM   1167  C  CE  . LYS A  1 154 ? 43.891  -3.674  103.683 1.00 24.64  ? 261  LYS A CE  1 
ATOM   1168  N  NZ  . LYS A  1 154 ? 43.594  -3.223  102.264 1.00 27.69  ? 261  LYS A NZ  1 
ATOM   1169  N  N   . THR A  1 155 ? 40.781  0.627   108.196 1.00 13.58  ? 262  THR A N   1 
ATOM   1170  C  CA  . THR A  1 155 ? 39.640  0.663   109.091 1.00 13.00  ? 262  THR A CA  1 
ATOM   1171  C  C   . THR A  1 155 ? 39.199  1.978   109.725 1.00 12.53  ? 262  THR A C   1 
ATOM   1172  O  O   . THR A  1 155 ? 39.994  2.886   109.949 1.00 14.24  ? 262  THR A O   1 
ATOM   1173  C  CB  . THR A  1 155 ? 39.808  -0.465  110.184 1.00 13.13  ? 262  THR A CB  1 
ATOM   1174  O  OG1 . THR A  1 155 ? 39.503  0.038   111.487 1.00 14.83  ? 262  THR A OG1 1 
ATOM   1175  C  CG2 . THR A  1 155 ? 41.208  -1.020  110.169 1.00 11.30  ? 262  THR A CG2 1 
ATOM   1176  N  N   . VAL A  1 156 ? 37.897  2.074   109.965 1.00 10.46  ? 263  VAL A N   1 
ATOM   1177  C  CA  . VAL A  1 156 ? 37.301  3.227   110.606 1.00 11.00  ? 263  VAL A CA  1 
ATOM   1178  C  C   . VAL A  1 156 ? 36.480  2.633   111.733 1.00 13.25  ? 263  VAL A C   1 
ATOM   1179  O  O   . VAL A  1 156 ? 35.465  1.994   111.496 1.00 14.85  ? 263  VAL A O   1 
ATOM   1180  C  CB  . VAL A  1 156 ? 36.366  3.988   109.677 1.00 9.36   ? 263  VAL A CB  1 
ATOM   1181  C  CG1 . VAL A  1 156 ? 35.655  5.091   110.462 1.00 7.58   ? 263  VAL A CG1 1 
ATOM   1182  C  CG2 . VAL A  1 156 ? 37.165  4.572   108.515 1.00 8.21   ? 263  VAL A CG2 1 
ATOM   1183  N  N   . ASP A  1 157 ? 36.917  2.830   112.964 1.00 14.25  ? 264  ASP A N   1 
ATOM   1184  C  CA  . ASP A  1 157 ? 36.204  2.259   114.086 1.00 15.11  ? 264  ASP A CA  1 
ATOM   1185  C  C   . ASP A  1 157 ? 36.442  3.096   115.344 1.00 15.26  ? 264  ASP A C   1 
ATOM   1186  O  O   . ASP A  1 157 ? 37.433  3.808   115.447 1.00 15.96  ? 264  ASP A O   1 
ATOM   1187  C  CB  . ASP A  1 157 ? 36.676  0.811   114.278 1.00 16.56  ? 264  ASP A CB  1 
ATOM   1188  C  CG  . ASP A  1 157 ? 35.822  0.040   115.267 1.00 19.29  ? 264  ASP A CG  1 
ATOM   1189  O  OD1 . ASP A  1 157 ? 34.663  0.448   115.494 1.00 21.40  ? 264  ASP A OD1 1 
ATOM   1190  O  OD2 . ASP A  1 157 ? 36.296  -0.986  115.809 1.00 21.26  ? 264  ASP A OD2 1 
ATOM   1191  N  N   . GLY A  1 158 ? 35.522  3.015   116.293 1.00 14.07  ? 265  GLY A N   1 
ATOM   1192  C  CA  . GLY A  1 158 ? 35.663  3.782   117.513 1.00 14.30  ? 265  GLY A CA  1 
ATOM   1193  C  C   . GLY A  1 158 ? 34.878  3.152   118.643 1.00 15.29  ? 265  GLY A C   1 
ATOM   1194  O  O   . GLY A  1 158 ? 34.339  2.052   118.491 1.00 15.67  ? 265  GLY A O   1 
ATOM   1195  N  N   . PRO A  1 159 ? 34.793  3.819   119.800 1.00 15.30  ? 266  PRO A N   1 
ATOM   1196  C  CA  . PRO A  1 159 ? 34.043  3.240   120.917 1.00 14.28  ? 266  PRO A CA  1 
ATOM   1197  C  C   . PRO A  1 159 ? 32.588  3.017   120.569 1.00 12.45  ? 266  PRO A C   1 
ATOM   1198  O  O   . PRO A  1 159 ? 32.014  3.782   119.805 1.00 11.59  ? 266  PRO A O   1 
ATOM   1199  C  CB  . PRO A  1 159 ? 34.225  4.280   122.033 1.00 13.91  ? 266  PRO A CB  1 
ATOM   1200  C  CG  . PRO A  1 159 ? 34.409  5.551   121.291 1.00 12.51  ? 266  PRO A CG  1 
ATOM   1201  C  CD  . PRO A  1 159 ? 35.332  5.142   120.165 1.00 14.74  ? 266  PRO A CD  1 
ATOM   1202  N  N   . ALA A  1 160 ? 31.996  1.966   121.129 1.00 12.93  ? 267  ALA A N   1 
ATOM   1203  C  CA  . ALA A  1 160 ? 30.586  1.674   120.881 1.00 13.57  ? 267  ALA A CA  1 
ATOM   1204  C  C   . ALA A  1 160 ? 29.737  2.366   121.965 1.00 14.30  ? 267  ALA A C   1 
ATOM   1205  O  O   . ALA A  1 160 ? 30.225  3.234   122.676 1.00 13.90  ? 267  ALA A O   1 
ATOM   1206  C  CB  . ALA A  1 160 ? 30.343  0.160   120.864 1.00 13.48  ? 267  ALA A CB  1 
ATOM   1207  N  N   . ARG A  1 161 ? 28.477  1.975   122.104 1.00 15.82  ? 268  ARG A N   1 
ATOM   1208  C  CA  . ARG A  1 161 ? 27.593  2.623   123.065 1.00 15.92  ? 268  ARG A CA  1 
ATOM   1209  C  C   . ARG A  1 161 ? 28.044  2.746   124.515 1.00 16.91  ? 268  ARG A C   1 
ATOM   1210  O  O   . ARG A  1 161 ? 28.059  3.854   125.059 1.00 17.27  ? 268  ARG A O   1 
ATOM   1211  C  CB  . ARG A  1 161 ? 26.220  1.973   123.049 1.00 17.87  ? 268  ARG A CB  1 
ATOM   1212  C  CG  . ARG A  1 161 ? 25.171  2.749   122.278 1.00 22.04  ? 268  ARG A CG  1 
ATOM   1213  C  CD  . ARG A  1 161 ? 25.224  2.432   120.820 1.00 26.77  ? 268  ARG A CD  1 
ATOM   1214  N  NE  . ARG A  1 161 ? 23.977  1.835   120.342 1.00 31.57  ? 268  ARG A NE  1 
ATOM   1215  C  CZ  . ARG A  1 161 ? 23.842  1.233   119.156 1.00 34.82  ? 268  ARG A CZ  1 
ATOM   1216  N  NH1 . ARG A  1 161 ? 24.879  1.142   118.323 1.00 34.64  ? 268  ARG A NH1 1 
ATOM   1217  N  NH2 . ARG A  1 161 ? 22.668  0.722   118.794 1.00 36.56  ? 268  ARG A NH2 1 
ATOM   1218  N  N   . LEU A  1 162 ? 28.385  1.630   125.157 1.00 15.97  ? 269  LEU A N   1 
ATOM   1219  C  CA  . LEU A  1 162 ? 28.795  1.682   126.557 1.00 14.48  ? 269  LEU A CA  1 
ATOM   1220  C  C   . LEU A  1 162 ? 30.133  2.378   126.783 1.00 14.76  ? 269  LEU A C   1 
ATOM   1221  O  O   . LEU A  1 162 ? 30.312  3.078   127.783 1.00 14.05  ? 269  LEU A O   1 
ATOM   1222  C  CB  . LEU A  1 162 ? 28.836  0.277   127.160 1.00 12.94  ? 269  LEU A CB  1 
ATOM   1223  C  CG  . LEU A  1 162 ? 27.487  -0.419  127.337 1.00 12.74  ? 269  LEU A CG  1 
ATOM   1224  C  CD1 . LEU A  1 162 ? 27.738  -1.781  127.954 1.00 10.70  ? 269  LEU A CD1 1 
ATOM   1225  C  CD2 . LEU A  1 162 ? 26.546  0.426   128.203 1.00 9.65   ? 269  LEU A CD2 1 
ATOM   1226  N  N   . ALA A  1 163 ? 31.075  2.182   125.867 1.00 14.23  ? 270  ALA A N   1 
ATOM   1227  C  CA  . ALA A  1 163 ? 32.377  2.817   125.993 1.00 13.15  ? 270  ALA A CA  1 
ATOM   1228  C  C   . ALA A  1 163 ? 32.203  4.327   125.837 1.00 13.91  ? 270  ALA A C   1 
ATOM   1229  O  O   . ALA A  1 163 ? 32.807  5.116   126.563 1.00 13.20  ? 270  ALA A O   1 
ATOM   1230  C  CB  . ALA A  1 163 ? 33.320  2.295   124.933 1.00 13.01  ? 270  ALA A CB  1 
ATOM   1231  N  N   . GLU A  1 164 ? 31.376  4.735   124.883 1.00 13.79  ? 271  GLU A N   1 
ATOM   1232  C  CA  . GLU A  1 164 ? 31.145  6.152   124.675 1.00 12.76  ? 271  GLU A CA  1 
ATOM   1233  C  C   . GLU A  1 164 ? 30.577  6.749   125.956 1.00 12.88  ? 271  GLU A C   1 
ATOM   1234  O  O   . GLU A  1 164 ? 30.956  7.847   126.353 1.00 13.66  ? 271  GLU A O   1 
ATOM   1235  C  CB  . GLU A  1 164 ? 30.180  6.384   123.520 1.00 13.38  ? 271  GLU A CB  1 
ATOM   1236  C  CG  . GLU A  1 164 ? 30.079  7.833   123.118 1.00 17.46  ? 271  GLU A CG  1 
ATOM   1237  C  CD  . GLU A  1 164 ? 31.352  8.327   122.440 1.00 21.95  ? 271  GLU A CD  1 
ATOM   1238  O  OE1 . GLU A  1 164 ? 31.726  9.521   122.600 1.00 22.10  ? 271  GLU A OE1 1 
ATOM   1239  O  OE2 . GLU A  1 164 ? 31.976  7.511   121.732 1.00 23.55  ? 271  GLU A OE2 1 
ATOM   1240  N  N   . GLU A  1 165 ? 29.658  6.034   126.600 1.00 13.09  ? 272  GLU A N   1 
ATOM   1241  C  CA  . GLU A  1 165 ? 29.076  6.497   127.858 1.00 12.71  ? 272  GLU A CA  1 
ATOM   1242  C  C   . GLU A  1 165 ? 30.171  6.569   128.917 1.00 12.33  ? 272  GLU A C   1 
ATOM   1243  O  O   . GLU A  1 165 ? 30.258  7.541   129.648 1.00 12.30  ? 272  GLU A O   1 
ATOM   1244  C  CB  . GLU A  1 165 ? 27.953  5.552   128.339 1.00 13.05  ? 272  GLU A CB  1 
ATOM   1245  C  CG  . GLU A  1 165 ? 26.586  5.778   127.676 1.00 13.94  ? 272  GLU A CG  1 
ATOM   1246  C  CD  . GLU A  1 165 ? 25.485  4.857   128.207 1.00 15.85  ? 272  GLU A CD  1 
ATOM   1247  O  OE1 . GLU A  1 165 ? 24.299  5.077   127.866 1.00 15.86  ? 272  GLU A OE1 1 
ATOM   1248  O  OE2 . GLU A  1 165 ? 25.796  3.910   128.963 1.00 15.34  ? 272  GLU A OE2 1 
ATOM   1249  N  N   . ALA A  1 166 ? 31.010  5.540   128.989 1.00 13.96  ? 273  ALA A N   1 
ATOM   1250  C  CA  . ALA A  1 166 ? 32.100  5.501   129.962 1.00 13.67  ? 273  ALA A CA  1 
ATOM   1251  C  C   . ALA A  1 166 ? 32.990  6.737   129.838 1.00 14.94  ? 273  ALA A C   1 
ATOM   1252  O  O   . ALA A  1 166 ? 33.351  7.358   130.837 1.00 16.17  ? 273  ALA A O   1 
ATOM   1253  C  CB  . ALA A  1 166 ? 32.927  4.251   129.770 1.00 12.72  ? 273  ALA A CB  1 
ATOM   1254  N  N   . PHE A  1 167 ? 33.341  7.093   128.607 1.00 14.03  ? 274  PHE A N   1 
ATOM   1255  C  CA  . PHE A  1 167 ? 34.182  8.252   128.370 1.00 13.49  ? 274  PHE A CA  1 
ATOM   1256  C  C   . PHE A  1 167 ? 33.551  9.513   128.928 1.00 14.84  ? 274  PHE A C   1 
ATOM   1257  O  O   . PHE A  1 167 ? 34.181  10.255  129.667 1.00 14.77  ? 274  PHE A O   1 
ATOM   1258  C  CB  . PHE A  1 167 ? 34.426  8.456   126.874 1.00 12.56  ? 274  PHE A CB  1 
ATOM   1259  C  CG  . PHE A  1 167 ? 35.643  7.762   126.357 1.00 12.53  ? 274  PHE A CG  1 
ATOM   1260  C  CD1 . PHE A  1 167 ? 35.592  7.037   125.172 1.00 13.60  ? 274  PHE A CD1 1 
ATOM   1261  C  CD2 . PHE A  1 167 ? 36.853  7.846   127.038 1.00 12.75  ? 274  PHE A CD2 1 
ATOM   1262  C  CE1 . PHE A  1 167 ? 36.731  6.406   124.673 1.00 12.23  ? 274  PHE A CE1 1 
ATOM   1263  C  CE2 . PHE A  1 167 ? 37.996  7.220   126.547 1.00 11.83  ? 274  PHE A CE2 1 
ATOM   1264  C  CZ  . PHE A  1 167 ? 37.934  6.500   125.363 1.00 11.60  ? 274  PHE A CZ  1 
ATOM   1265  N  N   . PHE A  1 168 ? 32.305  9.778   128.570 1.00 15.74  ? 275  PHE A N   1 
ATOM   1266  C  CA  . PHE A  1 168 ? 31.699  10.994  129.065 1.00 16.26  ? 275  PHE A CA  1 
ATOM   1267  C  C   . PHE A  1 168 ? 31.428  10.935  130.560 1.00 17.20  ? 275  PHE A C   1 
ATOM   1268  O  O   . PHE A  1 168 ? 31.591  11.929  131.265 1.00 16.59  ? 275  PHE A O   1 
ATOM   1269  C  CB  . PHE A  1 168 ? 30.423  11.329  128.307 1.00 17.85  ? 275  PHE A CB  1 
ATOM   1270  C  CG  . PHE A  1 168 ? 29.833  12.652  128.701 1.00 20.94  ? 275  PHE A CG  1 
ATOM   1271  C  CD1 . PHE A  1 168 ? 28.725  12.717  129.543 1.00 23.51  ? 275  PHE A CD1 1 
ATOM   1272  C  CD2 . PHE A  1 168 ? 30.431  13.835  128.291 1.00 21.68  ? 275  PHE A CD2 1 
ATOM   1273  C  CE1 . PHE A  1 168 ? 28.229  13.954  129.971 1.00 25.70  ? 275  PHE A CE1 1 
ATOM   1274  C  CE2 . PHE A  1 168 ? 29.947  15.072  128.712 1.00 22.59  ? 275  PHE A CE2 1 
ATOM   1275  C  CZ  . PHE A  1 168 ? 28.850  15.137  129.550 1.00 23.37  ? 275  PHE A CZ  1 
ATOM   1276  N  N   . ARG A  1 169 ? 31.029  9.770   131.051 1.00 16.99  ? 276  ARG A N   1 
ATOM   1277  C  CA  . ARG A  1 169 ? 30.754  9.617   132.465 1.00 15.97  ? 276  ARG A CA  1 
ATOM   1278  C  C   . ARG A  1 169 ? 32.030  9.871   133.258 1.00 17.03  ? 276  ARG A C   1 
ATOM   1279  O  O   . ARG A  1 169 ? 31.999  10.520  134.296 1.00 17.18  ? 276  ARG A O   1 
ATOM   1280  C  CB  . ARG A  1 169 ? 30.253  8.205   132.737 1.00 15.67  ? 276  ARG A CB  1 
ATOM   1281  C  CG  . ARG A  1 169 ? 29.747  7.966   134.136 1.00 14.26  ? 276  ARG A CG  1 
ATOM   1282  C  CD  . ARG A  1 169 ? 29.508  6.483   134.346 1.00 16.32  ? 276  ARG A CD  1 
ATOM   1283  N  NE  . ARG A  1 169 ? 28.964  6.206   135.666 1.00 15.83  ? 276  ARG A NE  1 
ATOM   1284  C  CZ  . ARG A  1 169 ? 27.709  6.451   136.012 1.00 16.58  ? 276  ARG A CZ  1 
ATOM   1285  N  NH1 . ARG A  1 169 ? 27.306  6.173   137.242 1.00 16.43  ? 276  ARG A NH1 1 
ATOM   1286  N  NH2 . ARG A  1 169 ? 26.857  6.954   135.120 1.00 16.03  ? 276  ARG A NH2 1 
ATOM   1287  N  N   . GLY A  1 170 ? 33.153  9.360   132.761 1.00 17.07  ? 277  GLY A N   1 
ATOM   1288  C  CA  . GLY A  1 170 ? 34.412  9.534   133.461 1.00 17.49  ? 277  GLY A CA  1 
ATOM   1289  C  C   . GLY A  1 170 ? 34.899  10.967  133.459 1.00 17.77  ? 277  GLY A C   1 
ATOM   1290  O  O   . GLY A  1 170 ? 35.468  11.463  134.437 1.00 19.59  ? 277  GLY A O   1 
ATOM   1291  N  N   . VAL A  1 171 ? 34.665  11.641  132.347 1.00 15.94  ? 278  VAL A N   1 
ATOM   1292  C  CA  . VAL A  1 171 ? 35.083  13.016  132.182 1.00 14.47  ? 278  VAL A CA  1 
ATOM   1293  C  C   . VAL A  1 171 ? 34.194  13.961  133.014 1.00 16.54  ? 278  VAL A C   1 
ATOM   1294  O  O   . VAL A  1 171 ? 34.610  15.062  133.394 1.00 17.00  ? 278  VAL A O   1 
ATOM   1295  C  CB  . VAL A  1 171 ? 35.053  13.361  130.664 1.00 12.62  ? 278  VAL A CB  1 
ATOM   1296  C  CG1 . VAL A  1 171 ? 34.258  14.609  130.397 1.00 11.04  ? 278  VAL A CG1 1 
ATOM   1297  C  CG2 . VAL A  1 171 ? 36.469  13.469  130.134 1.00 11.44  ? 278  VAL A CG2 1 
ATOM   1298  N  N   . SER A  1 172 ? 32.979  13.516  133.318 1.00 16.91  ? 279  SER A N   1 
ATOM   1299  C  CA  . SER A  1 172 ? 32.036  14.322  134.093 1.00 18.81  ? 279  SER A CA  1 
ATOM   1300  C  C   . SER A  1 172 ? 32.074  14.051  135.585 1.00 18.71  ? 279  SER A C   1 
ATOM   1301  O  O   . SER A  1 172 ? 32.018  14.971  136.389 1.00 19.62  ? 279  SER A O   1 
ATOM   1302  C  CB  . SER A  1 172 ? 30.595  14.067  133.642 1.00 18.45  ? 279  SER A CB  1 
ATOM   1303  O  OG  . SER A  1 172 ? 30.436  14.287  132.258 1.00 22.98  ? 279  SER A OG  1 
ATOM   1304  N  N   . GLN A  1 173 ? 32.169  12.782  135.946 1.00 18.17  ? 280  GLN A N   1 
ATOM   1305  C  CA  . GLN A  1 173 ? 32.129  12.386  137.339 1.00 18.16  ? 280  GLN A CA  1 
ATOM   1306  C  C   . GLN A  1 173 ? 33.431  11.877  137.938 1.00 17.45  ? 280  GLN A C   1 
ATOM   1307  O  O   . GLN A  1 173 ? 33.575  11.829  139.156 1.00 18.03  ? 280  GLN A O   1 
ATOM   1308  C  CB  . GLN A  1 173 ? 31.040  11.326  137.499 1.00 18.93  ? 280  GLN A CB  1 
ATOM   1309  C  CG  . GLN A  1 173 ? 29.650  11.818  137.129 1.00 22.67  ? 280  GLN A CG  1 
ATOM   1310  C  CD  . GLN A  1 173 ? 28.659  10.692  136.854 1.00 24.82  ? 280  GLN A CD  1 
ATOM   1311  O  OE1 . GLN A  1 173 ? 28.761  9.591   137.410 1.00 25.36  ? 280  GLN A OE1 1 
ATOM   1312  N  NE2 . GLN A  1 173 ? 27.683  10.972  135.998 1.00 26.25  ? 280  GLN A NE2 1 
ATOM   1313  N  N   . GLY A  1 174 ? 34.377  11.483  137.096 1.00 17.00  ? 281  GLY A N   1 
ATOM   1314  C  CA  . GLY A  1 174 ? 35.636  10.973  137.617 1.00 16.87  ? 281  GLY A CA  1 
ATOM   1315  C  C   . GLY A  1 174 ? 36.363  11.995  138.473 1.00 17.03  ? 281  GLY A C   1 
ATOM   1316  O  O   . GLY A  1 174 ? 36.106  13.199  138.379 1.00 17.35  ? 281  GLY A O   1 
ATOM   1317  N  N   . ARG A  1 175 ? 37.282  11.526  139.306 1.00 16.15  ? 282  ARG A N   1 
ATOM   1318  C  CA  . ARG A  1 175 ? 38.035  12.419  140.177 1.00 15.60  ? 282  ARG A CA  1 
ATOM   1319  C  C   . ARG A  1 175 ? 37.127  13.420  140.855 1.00 15.52  ? 282  ARG A C   1 
ATOM   1320  O  O   . ARG A  1 175 ? 37.379  14.618  140.843 1.00 17.21  ? 282  ARG A O   1 
ATOM   1321  C  CB  . ARG A  1 175 ? 39.108  13.164  139.387 1.00 14.66  ? 282  ARG A CB  1 
ATOM   1322  C  CG  . ARG A  1 175 ? 40.301  12.295  139.024 1.00 16.31  ? 282  ARG A CG  1 
ATOM   1323  C  CD  . ARG A  1 175 ? 41.148  12.947  137.952 1.00 13.28  ? 282  ARG A CD  1 
ATOM   1324  N  NE  . ARG A  1 175 ? 41.646  14.215  138.426 1.00 14.27  ? 282  ARG A NE  1 
ATOM   1325  C  CZ  . ARG A  1 175 ? 41.626  15.336  137.723 1.00 13.26  ? 282  ARG A CZ  1 
ATOM   1326  N  NH1 . ARG A  1 175 ? 41.130  15.348  136.502 1.00 11.56  ? 282  ARG A NH1 1 
ATOM   1327  N  NH2 . ARG A  1 175 ? 42.094  16.450  138.257 1.00 13.63  ? 282  ARG A NH2 1 
ATOM   1328  N  N   . GLY A  1 176 ? 36.054  12.925  141.439 1.00 15.30  ? 283  GLY A N   1 
ATOM   1329  C  CA  . GLY A  1 176 ? 35.141  13.804  142.131 1.00 14.51  ? 283  GLY A CA  1 
ATOM   1330  C  C   . GLY A  1 176 ? 34.596  14.944  141.305 1.00 14.95  ? 283  GLY A C   1 
ATOM   1331  O  O   . GLY A  1 176 ? 34.335  16.011  141.846 1.00 17.46  ? 283  GLY A O   1 
ATOM   1332  N  N   . GLY A  1 177 ? 34.412  14.745  140.005 1.00 14.75  ? 284  GLY A N   1 
ATOM   1333  C  CA  . GLY A  1 177 ? 33.873  15.816  139.185 1.00 12.28  ? 284  GLY A CA  1 
ATOM   1334  C  C   . GLY A  1 177 ? 34.900  16.594  138.389 1.00 13.37  ? 284  GLY A C   1 
ATOM   1335  O  O   . GLY A  1 177 ? 34.542  17.410  137.548 1.00 13.22  ? 284  GLY A O   1 
ATOM   1336  N  N   . LEU A  1 178 ? 36.181  16.360  138.643 1.00 13.94  ? 285  LEU A N   1 
ATOM   1337  C  CA  . LEU A  1 178 ? 37.219  17.061  137.901 1.00 14.26  ? 285  LEU A CA  1 
ATOM   1338  C  C   . LEU A  1 178 ? 37.427  16.391  136.545 1.00 15.16  ? 285  LEU A C   1 
ATOM   1339  O  O   . LEU A  1 178 ? 37.927  17.011  135.606 1.00 14.20  ? 285  LEU A O   1 
ATOM   1340  C  CB  . LEU A  1 178 ? 38.526  17.074  138.695 1.00 15.64  ? 285  LEU A CB  1 
ATOM   1341  C  CG  . LEU A  1 178 ? 38.490  17.861  140.015 1.00 15.58  ? 285  LEU A CG  1 
ATOM   1342  C  CD1 . LEU A  1 178 ? 39.847  17.784  140.688 1.00 14.23  ? 285  LEU A CD1 1 
ATOM   1343  C  CD2 . LEU A  1 178 ? 38.108  19.306  139.742 1.00 13.82  ? 285  LEU A CD2 1 
ATOM   1344  N  N   . GLY A  1 179 ? 37.039  15.116  136.460 1.00 15.68  ? 286  GLY A N   1 
ATOM   1345  C  CA  . GLY A  1 179 ? 37.145  14.372  135.218 1.00 14.09  ? 286  GLY A CA  1 
ATOM   1346  C  C   . GLY A  1 179 ? 38.331  13.442  135.106 1.00 13.90  ? 286  GLY A C   1 
ATOM   1347  O  O   . GLY A  1 179 ? 39.453  13.835  135.389 1.00 14.15  ? 286  GLY A O   1 
ATOM   1348  N  N   . SER A  1 180 ? 38.086  12.203  134.686 1.00 12.85  ? 287  SER A N   1 
ATOM   1349  C  CA  . SER A  1 180 ? 39.160  11.242  134.520 1.00 10.96  ? 287  SER A CA  1 
ATOM   1350  C  C   . SER A  1 180 ? 40.020  11.730  133.383 1.00 11.81  ? 287  SER A C   1 
ATOM   1351  O  O   . SER A  1 180 ? 39.522  12.381  132.461 1.00 11.94  ? 287  SER A O   1 
ATOM   1352  C  CB  . SER A  1 180 ? 38.610  9.881   134.144 1.00 11.49  ? 287  SER A CB  1 
ATOM   1353  O  OG  . SER A  1 180 ? 37.801  9.380   135.178 1.00 11.97  ? 287  SER A OG  1 
ATOM   1354  N  N   . ILE A  1 181 ? 41.310  11.429  133.434 1.00 9.51   ? 288  ILE A N   1 
ATOM   1355  C  CA  . ILE A  1 181 ? 42.188  11.843  132.355 1.00 10.35  ? 288  ILE A CA  1 
ATOM   1356  C  C   . ILE A  1 181 ? 42.598  10.619  131.560 1.00 9.60   ? 288  ILE A C   1 
ATOM   1357  O  O   . ILE A  1 181 ? 43.278  9.725   132.070 1.00 8.97   ? 288  ILE A O   1 
ATOM   1358  C  CB  . ILE A  1 181 ? 43.419  12.606  132.890 1.00 10.39  ? 288  ILE A CB  1 
ATOM   1359  C  CG1 . ILE A  1 181 ? 42.951  13.928  133.487 1.00 10.22  ? 288  ILE A CG1 1 
ATOM   1360  C  CG2 . ILE A  1 181 ? 44.395  12.893  131.776 1.00 7.17   ? 288  ILE A CG2 1 
ATOM   1361  C  CD1 . ILE A  1 181 ? 43.952  14.570  134.396 1.00 14.90  ? 288  ILE A CD1 1 
ATOM   1362  N  N   . PHE A  1 182 ? 42.159  10.591  130.305 1.00 10.35  ? 289  PHE A N   1 
ATOM   1363  C  CA  . PHE A  1 182 ? 42.426  9.477   129.406 1.00 10.13  ? 289  PHE A CA  1 
ATOM   1364  C  C   . PHE A  1 182 ? 43.529  9.803   128.412 1.00 9.87   ? 289  PHE A C   1 
ATOM   1365  O  O   . PHE A  1 182 ? 43.342  10.622  127.521 1.00 11.60  ? 289  PHE A O   1 
ATOM   1366  C  CB  . PHE A  1 182 ? 41.147  9.124   128.648 1.00 8.63   ? 289  PHE A CB  1 
ATOM   1367  C  CG  . PHE A  1 182 ? 39.993  8.747   129.536 1.00 6.13   ? 289  PHE A CG  1 
ATOM   1368  C  CD1 . PHE A  1 182 ? 38.900  9.590   129.672 1.00 5.88   ? 289  PHE A CD1 1 
ATOM   1369  C  CD2 . PHE A  1 182 ? 39.989  7.536   130.218 1.00 7.48   ? 289  PHE A CD2 1 
ATOM   1370  C  CE1 . PHE A  1 182 ? 37.806  9.236   130.475 1.00 4.53   ? 289  PHE A CE1 1 
ATOM   1371  C  CE2 . PHE A  1 182 ? 38.899  7.166   131.028 1.00 7.73   ? 289  PHE A CE2 1 
ATOM   1372  C  CZ  . PHE A  1 182 ? 37.807  8.024   131.152 1.00 5.71   ? 289  PHE A CZ  1 
ATOM   1373  N  N   . VAL A  1 183 ? 44.673  9.155   128.568 1.00 9.01   ? 290  VAL A N   1 
ATOM   1374  C  CA  . VAL A  1 183 ? 45.813  9.365   127.680 1.00 9.65   ? 290  VAL A CA  1 
ATOM   1375  C  C   . VAL A  1 183 ? 45.843  8.227   126.660 1.00 10.47  ? 290  VAL A C   1 
ATOM   1376  O  O   . VAL A  1 183 ? 45.773  7.055   127.028 1.00 10.63  ? 290  VAL A O   1 
ATOM   1377  C  CB  . VAL A  1 183 ? 47.129  9.379   128.486 1.00 9.02   ? 290  VAL A CB  1 
ATOM   1378  C  CG1 . VAL A  1 183 ? 48.308  9.564   127.566 1.00 8.03   ? 290  VAL A CG1 1 
ATOM   1379  C  CG2 . VAL A  1 183 ? 47.076  10.494  129.527 1.00 8.86   ? 290  VAL A CG2 1 
ATOM   1380  N  N   . TRP A  1 184 ? 45.970  8.566   125.381 1.00 11.18  ? 291  TRP A N   1 
ATOM   1381  C  CA  . TRP A  1 184 ? 45.947  7.549   124.331 1.00 12.06  ? 291  TRP A CA  1 
ATOM   1382  C  C   . TRP A  1 184 ? 47.121  7.585   123.368 1.00 12.59  ? 291  TRP A C   1 
ATOM   1383  O  O   . TRP A  1 184 ? 47.631  8.659   123.054 1.00 13.88  ? 291  TRP A O   1 
ATOM   1384  C  CB  . TRP A  1 184 ? 44.644  7.696   123.527 1.00 11.73  ? 291  TRP A CB  1 
ATOM   1385  C  CG  . TRP A  1 184 ? 43.940  6.403   123.282 1.00 12.06  ? 291  TRP A CG  1 
ATOM   1386  C  CD1 . TRP A  1 184 ? 44.203  5.496   122.290 1.00 12.55  ? 291  TRP A CD1 1 
ATOM   1387  C  CD2 . TRP A  1 184 ? 42.902  5.829   124.086 1.00 10.70  ? 291  TRP A CD2 1 
ATOM   1388  N  NE1 . TRP A  1 184 ? 43.393  4.389   122.436 1.00 11.20  ? 291  TRP A NE1 1 
ATOM   1389  C  CE2 . TRP A  1 184 ? 42.587  4.567   123.527 1.00 10.23  ? 291  TRP A CE2 1 
ATOM   1390  C  CE3 . TRP A  1 184 ? 42.210  6.255   125.229 1.00 10.78  ? 291  TRP A CE3 1 
ATOM   1391  C  CZ2 . TRP A  1 184 ? 41.611  3.726   124.069 1.00 10.79  ? 291  TRP A CZ2 1 
ATOM   1392  C  CZ3 . TRP A  1 184 ? 41.236  5.417   125.773 1.00 11.91  ? 291  TRP A CZ3 1 
ATOM   1393  C  CH2 . TRP A  1 184 ? 40.949  4.160   125.187 1.00 11.21  ? 291  TRP A CH2 1 
ATOM   1394  N  N   . ALA A  1 185 ? 47.533  6.406   122.897 1.00 12.29  ? 292  ALA A N   1 
ATOM   1395  C  CA  . ALA A  1 185 ? 48.618  6.283   121.926 1.00 11.92  ? 292  ALA A CA  1 
ATOM   1396  C  C   . ALA A  1 185 ? 47.972  6.535   120.571 1.00 13.06  ? 292  ALA A C   1 
ATOM   1397  O  O   . ALA A  1 185 ? 46.992  5.885   120.235 1.00 13.48  ? 292  ALA A O   1 
ATOM   1398  C  CB  . ALA A  1 185 ? 49.185  4.898   121.972 1.00 11.31  ? 292  ALA A CB  1 
ATOM   1399  N  N   . SER A  1 186 ? 48.510  7.454   119.779 1.00 14.01  ? 293  SER A N   1 
ATOM   1400  C  CA  . SER A  1 186 ? 47.871  7.775   118.500 1.00 15.31  ? 293  SER A CA  1 
ATOM   1401  C  C   . SER A  1 186 ? 47.860  6.712   117.401 1.00 14.89  ? 293  SER A C   1 
ATOM   1402  O  O   . SER A  1 186 ? 47.059  6.810   116.474 1.00 15.16  ? 293  SER A O   1 
ATOM   1403  C  CB  . SER A  1 186 ? 48.427  9.086   117.935 1.00 13.97  ? 293  SER A CB  1 
ATOM   1404  O  OG  . SER A  1 186 ? 49.742  8.905   117.470 1.00 17.29  ? 293  SER A OG  1 
ATOM   1405  N  N   . GLY A  1 187 ? 48.727  5.708   117.477 1.00 14.69  ? 294  GLY A N   1 
ATOM   1406  C  CA  . GLY A  1 187 ? 48.688  4.675   116.454 1.00 14.60  ? 294  GLY A CA  1 
ATOM   1407  C  C   . GLY A  1 187 ? 50.005  4.358   115.789 1.00 15.20  ? 294  GLY A C   1 
ATOM   1408  O  O   . GLY A  1 187 ? 50.860  5.230   115.662 1.00 14.80  ? 294  GLY A O   1 
ATOM   1409  N  N   . ASN A  1 188 ? 50.168  3.108   115.359 1.00 15.39  ? 295  ASN A N   1 
ATOM   1410  C  CA  . ASN A  1 188 ? 51.402  2.681   114.699 1.00 15.34  ? 295  ASN A CA  1 
ATOM   1411  C  C   . ASN A  1 188 ? 51.231  2.343   113.221 1.00 16.14  ? 295  ASN A C   1 
ATOM   1412  O  O   . ASN A  1 188 ? 52.066  1.652   112.656 1.00 14.94  ? 295  ASN A O   1 
ATOM   1413  C  CB  . ASN A  1 188 ? 51.987  1.455   115.401 1.00 14.74  ? 295  ASN A CB  1 
ATOM   1414  C  CG  . ASN A  1 188 ? 52.299  1.713   116.860 1.00 14.64  ? 295  ASN A CG  1 
ATOM   1415  O  OD1 . ASN A  1 188 ? 52.715  2.808   117.230 1.00 14.96  ? 295  ASN A OD1 1 
ATOM   1416  N  ND2 . ASN A  1 188 ? 52.128  0.699   117.691 1.00 14.40  ? 295  ASN A ND2 1 
ATOM   1417  N  N   . GLY A  1 189 ? 50.168  2.837   112.589 1.00 17.49  ? 296  GLY A N   1 
ATOM   1418  C  CA  . GLY A  1 189 ? 49.940  2.512   111.191 1.00 17.75  ? 296  GLY A CA  1 
ATOM   1419  C  C   . GLY A  1 189 ? 50.616  3.400   110.169 1.00 18.73  ? 296  GLY A C   1 
ATOM   1420  O  O   . GLY A  1 189 ? 50.176  3.476   109.022 1.00 20.04  ? 296  GLY A O   1 
ATOM   1421  N  N   . GLY A  1 190 ? 51.692  4.061   110.567 1.00 19.70  ? 297  GLY A N   1 
ATOM   1422  C  CA  . GLY A  1 190 ? 52.381  4.947   109.647 1.00 20.36  ? 297  GLY A CA  1 
ATOM   1423  C  C   . GLY A  1 190 ? 52.752  4.332   108.313 1.00 21.14  ? 297  GLY A C   1 
ATOM   1424  O  O   . GLY A  1 190 ? 52.473  4.893   107.251 1.00 21.69  ? 297  GLY A O   1 
ATOM   1425  N  N   . ARG A  1 191 ? 53.383  3.169   108.358 1.00 22.14  ? 298  ARG A N   1 
ATOM   1426  C  CA  . ARG A  1 191 ? 53.805  2.501   107.137 1.00 22.72  ? 298  ARG A CA  1 
ATOM   1427  C  C   . ARG A  1 191 ? 52.627  2.227   106.205 1.00 23.19  ? 298  ARG A C   1 
ATOM   1428  O  O   . ARG A  1 191 ? 52.799  2.133   104.995 1.00 23.62  ? 298  ARG A O   1 
ATOM   1429  C  CB  . ARG A  1 191 ? 54.519  1.192   107.478 1.00 24.28  ? 298  ARG A CB  1 
ATOM   1430  C  CG  . ARG A  1 191 ? 55.619  0.808   106.499 1.00 27.50  ? 298  ARG A CG  1 
ATOM   1431  C  CD  . ARG A  1 191 ? 56.797  0.123   107.200 1.00 29.30  ? 298  ARG A CD  1 
ATOM   1432  N  NE  . ARG A  1 191 ? 56.568  -1.301  107.418 0.00 28.70  ? 298  ARG A NE  1 
ATOM   1433  C  CZ  . ARG A  1 191 ? 56.553  -2.207  106.447 0.00 28.79  ? 298  ARG A CZ  1 
ATOM   1434  N  NH1 . ARG A  1 191 ? 56.335  -3.483  106.730 0.00 28.72  ? 298  ARG A NH1 1 
ATOM   1435  N  NH2 . ARG A  1 191 ? 56.762  -1.837  105.190 0.00 28.72  ? 298  ARG A NH2 1 
ATOM   1436  N  N   . GLU A  1 192 ? 51.429  2.112   106.771 1.00 22.99  ? 299  GLU A N   1 
ATOM   1437  C  CA  . GLU A  1 192 ? 50.228  1.851   105.994 1.00 22.33  ? 299  GLU A CA  1 
ATOM   1438  C  C   . GLU A  1 192 ? 49.522  3.150   105.627 1.00 21.73  ? 299  GLU A C   1 
ATOM   1439  O  O   . GLU A  1 192 ? 48.448  3.128   105.029 1.00 21.46  ? 299  GLU A O   1 
ATOM   1440  C  CB  . GLU A  1 192 ? 49.273  0.984   106.807 1.00 24.78  ? 299  GLU A CB  1 
ATOM   1441  C  CG  . GLU A  1 192 ? 49.921  -0.238  107.444 1.00 28.76  ? 299  GLU A CG  1 
ATOM   1442  C  CD  . GLU A  1 192 ? 50.650  -1.097  106.425 1.00 32.87  ? 299  GLU A CD  1 
ATOM   1443  O  OE1 . GLU A  1 192 ? 50.108  -1.304  105.311 1.00 35.13  ? 299  GLU A OE1 1 
ATOM   1444  O  OE2 . GLU A  1 192 ? 51.764  -1.572  106.738 1.00 35.38  ? 299  GLU A OE2 1 
ATOM   1445  N  N   . HIS A  1 193 ? 50.130  4.275   105.999 1.00 20.96  ? 300  HIS A N   1 
ATOM   1446  C  CA  . HIS A  1 193 ? 49.572  5.595   105.746 1.00 19.92  ? 300  HIS A CA  1 
ATOM   1447  C  C   . HIS A  1 193 ? 48.239  5.770   106.436 1.00 18.91  ? 300  HIS A C   1 
ATOM   1448  O  O   . HIS A  1 193 ? 47.337  6.443   105.940 1.00 18.78  ? 300  HIS A O   1 
ATOM   1449  C  CB  . HIS A  1 193 ? 49.449  5.849   104.248 1.00 21.75  ? 300  HIS A CB  1 
ATOM   1450  C  CG  . HIS A  1 193 ? 50.773  6.030   103.579 1.00 26.14  ? 300  HIS A CG  1 
ATOM   1451  N  ND1 . HIS A  1 193 ? 51.490  4.977   103.048 1.00 27.12  ? 300  HIS A ND1 1 
ATOM   1452  C  CD2 . HIS A  1 193 ? 51.564  7.124   103.458 1.00 26.72  ? 300  HIS A CD2 1 
ATOM   1453  C  CE1 . HIS A  1 193 ? 52.668  5.414   102.636 1.00 27.30  ? 300  HIS A CE1 1 
ATOM   1454  N  NE2 . HIS A  1 193 ? 52.738  6.712   102.874 1.00 28.09  ? 300  HIS A NE2 1 
ATOM   1455  N  N   . ASP A  1 194 ? 48.132  5.163   107.608 1.00 17.61  ? 301  ASP A N   1 
ATOM   1456  C  CA  . ASP A  1 194 ? 46.915  5.251   108.393 1.00 17.48  ? 301  ASP A CA  1 
ATOM   1457  C  C   . ASP A  1 194 ? 46.743  6.681   108.924 1.00 17.47  ? 301  ASP A C   1 
ATOM   1458  O  O   . ASP A  1 194 ? 47.710  7.437   109.036 1.00 15.76  ? 301  ASP A O   1 
ATOM   1459  C  CB  . ASP A  1 194 ? 46.989  4.263   109.558 1.00 16.11  ? 301  ASP A CB  1 
ATOM   1460  C  CG  . ASP A  1 194 ? 45.633  3.959   110.148 1.00 17.00  ? 301  ASP A CG  1 
ATOM   1461  O  OD1 . ASP A  1 194 ? 45.586  3.264   111.180 1.00 14.42  ? 301  ASP A OD1 1 
ATOM   1462  O  OD2 . ASP A  1 194 ? 44.612  4.410   109.574 1.00 18.09  ? 301  ASP A OD2 1 
ATOM   1463  N  N   . SER A  1 195 ? 45.506  7.048   109.238 1.00 18.11  ? 302  SER A N   1 
ATOM   1464  C  CA  . SER A  1 195 ? 45.195  8.372   109.776 1.00 19.05  ? 302  SER A CA  1 
ATOM   1465  C  C   . SER A  1 195 ? 44.533  8.188   111.131 1.00 19.58  ? 302  SER A C   1 
ATOM   1466  O  O   . SER A  1 195 ? 43.526  7.485   111.234 1.00 20.77  ? 302  SER A O   1 
ATOM   1467  C  CB  . SER A  1 195 ? 44.239  9.109   108.844 1.00 19.86  ? 302  SER A CB  1 
ATOM   1468  O  OG  . SER A  1 195 ? 43.699  10.253  109.484 1.00 23.45  ? 302  SER A OG  1 
ATOM   1469  N  N   . CYS A  1 196 ? 45.070  8.804   112.179 1.00 19.25  ? 303  CYS A N   1 
ATOM   1470  C  CA  . CYS A  1 196 ? 44.447  8.614   113.487 1.00 20.44  ? 303  CYS A CA  1 
ATOM   1471  C  C   . CYS A  1 196 ? 43.081  9.259   113.667 1.00 19.84  ? 303  CYS A C   1 
ATOM   1472  O  O   . CYS A  1 196 ? 42.470  9.112   114.723 1.00 20.47  ? 303  CYS A O   1 
ATOM   1473  C  CB  . CYS A  1 196 ? 45.369  9.032   114.647 1.00 22.08  ? 303  CYS A CB  1 
ATOM   1474  S  SG  . CYS A  1 196 ? 46.650  10.278  114.320 1.00 25.34  ? 303  CYS A SG  1 
ATOM   1475  N  N   . ASN A  1 197 ? 42.593  9.965   112.652 1.00 19.15  ? 304  ASN A N   1 
ATOM   1476  C  CA  . ASN A  1 197 ? 41.269  10.571  112.744 1.00 18.79  ? 304  ASN A CA  1 
ATOM   1477  C  C   . ASN A  1 197 ? 40.229  9.492   112.417 1.00 18.14  ? 304  ASN A C   1 
ATOM   1478  O  O   . ASN A  1 197 ? 39.024  9.717   112.543 1.00 18.89  ? 304  ASN A O   1 
ATOM   1479  C  CB  . ASN A  1 197 ? 41.135  11.753  111.773 1.00 20.66  ? 304  ASN A CB  1 
ATOM   1480  C  CG  . ASN A  1 197 ? 41.683  13.065  112.344 1.00 20.80  ? 304  ASN A CG  1 
ATOM   1481  O  OD1 . ASN A  1 197 ? 42.539  13.072  113.217 1.00 24.31  ? 304  ASN A OD1 1 
ATOM   1482  N  ND2 . ASN A  1 197 ? 41.198  14.177  111.826 1.00 21.51  ? 304  ASN A ND2 1 
ATOM   1483  N  N   . CYS A  1 198 ? 40.705  8.321   111.998 1.00 16.70  ? 305  CYS A N   1 
ATOM   1484  C  CA  . CYS A  1 198 ? 39.831  7.188   111.674 1.00 15.33  ? 305  CYS A CA  1 
ATOM   1485  C  C   . CYS A  1 198 ? 39.809  6.231   112.867 1.00 15.08  ? 305  CYS A C   1 
ATOM   1486  O  O   . CYS A  1 198 ? 39.341  5.093   112.762 1.00 14.52  ? 305  CYS A O   1 
ATOM   1487  C  CB  . CYS A  1 198 ? 40.348  6.437   110.441 1.00 14.61  ? 305  CYS A CB  1 
ATOM   1488  S  SG  . CYS A  1 198 ? 40.268  7.358   108.890 1.00 13.49  ? 305  CYS A SG  1 
ATOM   1489  N  N   . ASP A  1 199 ? 40.338  6.712   113.990 1.00 13.03  ? 306  ASP A N   1 
ATOM   1490  C  CA  . ASP A  1 199 ? 40.422  5.962   115.236 1.00 11.71  ? 306  ASP A CA  1 
ATOM   1491  C  C   . ASP A  1 199 ? 39.581  6.748   116.241 1.00 12.68  ? 306  ASP A C   1 
ATOM   1492  O  O   . ASP A  1 199 ? 40.001  7.782   116.745 1.00 13.90  ? 306  ASP A O   1 
ATOM   1493  C  CB  . ASP A  1 199 ? 41.888  5.902   115.676 1.00 12.12  ? 306  ASP A CB  1 
ATOM   1494  C  CG  . ASP A  1 199 ? 42.079  5.264   117.037 1.00 12.53  ? 306  ASP A CG  1 
ATOM   1495  O  OD1 . ASP A  1 199 ? 41.149  5.347   117.874 1.00 13.65  ? 306  ASP A OD1 1 
ATOM   1496  O  OD2 . ASP A  1 199 ? 43.177  4.701   117.278 1.00 10.04  ? 306  ASP A OD2 1 
ATOM   1497  N  N   . GLY A  1 200 ? 38.383  6.255   116.523 1.00 12.23  ? 307  GLY A N   1 
ATOM   1498  C  CA  . GLY A  1 200 ? 37.493  6.943   117.433 1.00 11.07  ? 307  GLY A CA  1 
ATOM   1499  C  C   . GLY A  1 200 ? 37.997  7.144   118.843 1.00 11.72  ? 307  GLY A C   1 
ATOM   1500  O  O   . GLY A  1 200 ? 37.432  7.950   119.577 1.00 11.40  ? 307  GLY A O   1 
ATOM   1501  N  N   . TYR A  1 201 ? 39.043  6.430   119.239 1.00 10.99  ? 308  TYR A N   1 
ATOM   1502  C  CA  . TYR A  1 201 ? 39.552  6.594   120.595 1.00 12.93  ? 308  TYR A CA  1 
ATOM   1503  C  C   . TYR A  1 201 ? 40.504  7.780   120.650 1.00 14.30  ? 308  TYR A C   1 
ATOM   1504  O  O   . TYR A  1 201 ? 40.405  8.640   121.526 1.00 14.99  ? 308  TYR A O   1 
ATOM   1505  C  CB  . TYR A  1 201 ? 40.236  5.312   121.070 1.00 11.60  ? 308  TYR A CB  1 
ATOM   1506  C  CG  . TYR A  1 201 ? 39.268  4.153   121.129 1.00 11.90  ? 308  TYR A CG  1 
ATOM   1507  C  CD1 . TYR A  1 201 ? 38.949  3.422   119.977 1.00 14.03  ? 308  TYR A CD1 1 
ATOM   1508  C  CD2 . TYR A  1 201 ? 38.623  3.820   122.311 1.00 11.53  ? 308  TYR A CD2 1 
ATOM   1509  C  CE1 . TYR A  1 201 ? 38.014  2.393   120.004 1.00 12.43  ? 308  TYR A CE1 1 
ATOM   1510  C  CE2 . TYR A  1 201 ? 37.689  2.794   122.350 1.00 14.09  ? 308  TYR A CE2 1 
ATOM   1511  C  CZ  . TYR A  1 201 ? 37.391  2.085   121.195 1.00 13.24  ? 308  TYR A CZ  1 
ATOM   1512  O  OH  . TYR A  1 201 ? 36.483  1.061   121.243 1.00 12.60  ? 308  TYR A OH  1 
ATOM   1513  N  N   . THR A  1 202 ? 41.418  7.838   119.693 1.00 14.69  ? 309  THR A N   1 
ATOM   1514  C  CA  . THR A  1 202 ? 42.366  8.936   119.633 1.00 14.17  ? 309  THR A CA  1 
ATOM   1515  C  C   . THR A  1 202 ? 41.642  10.203  119.168 1.00 14.92  ? 309  THR A C   1 
ATOM   1516  O  O   . THR A  1 202 ? 41.963  11.307  119.583 1.00 16.72  ? 309  THR A O   1 
ATOM   1517  C  CB  . THR A  1 202 ? 43.504  8.635   118.628 1.00 13.46  ? 309  THR A CB  1 
ATOM   1518  O  OG1 . THR A  1 202 ? 42.938  8.282   117.362 1.00 12.76  ? 309  THR A OG1 1 
ATOM   1519  C  CG2 . THR A  1 202 ? 44.375  7.491   119.108 1.00 13.17  ? 309  THR A CG2 1 
ATOM   1520  N  N   . ASN A  1 203 ? 40.655  10.028  118.305 1.00 14.55  ? 310  ASN A N   1 
ATOM   1521  C  CA  . ASN A  1 203 ? 39.902  11.140  117.741 1.00 14.20  ? 310  ASN A CA  1 
ATOM   1522  C  C   . ASN A  1 203 ? 38.896  11.742  118.737 1.00 14.26  ? 310  ASN A C   1 
ATOM   1523  O  O   . ASN A  1 203 ? 38.304  12.785  118.482 1.00 13.64  ? 310  ASN A O   1 
ATOM   1524  C  CB  . ASN A  1 203 ? 39.195  10.625  116.484 1.00 15.83  ? 310  ASN A CB  1 
ATOM   1525  C  CG  . ASN A  1 203 ? 38.579  11.714  115.663 1.00 16.78  ? 310  ASN A CG  1 
ATOM   1526  O  OD1 . ASN A  1 203 ? 39.269  12.576  115.129 1.00 19.55  ? 310  ASN A OD1 1 
ATOM   1527  N  ND2 . ASN A  1 203 ? 37.259  11.678  115.544 1.00 19.13  ? 310  ASN A ND2 1 
ATOM   1528  N  N   . SER A  1 204 ? 38.710  11.083  119.876 1.00 14.33  ? 311  SER A N   1 
ATOM   1529  C  CA  . SER A  1 204 ? 37.775  11.557  120.895 1.00 12.63  ? 311  SER A CA  1 
ATOM   1530  C  C   . SER A  1 204 ? 38.263  12.816  121.583 1.00 12.74  ? 311  SER A C   1 
ATOM   1531  O  O   . SER A  1 204 ? 39.457  13.005  121.769 1.00 13.60  ? 311  SER A O   1 
ATOM   1532  C  CB  . SER A  1 204 ? 37.575  10.486  121.958 1.00 12.42  ? 311  SER A CB  1 
ATOM   1533  O  OG  . SER A  1 204 ? 36.667  10.950  122.940 1.00 13.33  ? 311  SER A OG  1 
ATOM   1534  N  N   . ILE A  1 205 ? 37.349  13.685  121.984 1.00 12.29  ? 312  ILE A N   1 
ATOM   1535  C  CA  . ILE A  1 205 ? 37.787  14.893  122.656 1.00 10.40  ? 312  ILE A CA  1 
ATOM   1536  C  C   . ILE A  1 205 ? 38.116  14.570  124.103 1.00 11.73  ? 312  ILE A C   1 
ATOM   1537  O  O   . ILE A  1 205 ? 38.802  15.337  124.765 1.00 12.91  ? 312  ILE A O   1 
ATOM   1538  C  CB  . ILE A  1 205 ? 36.719  16.006  122.654 1.00 9.21   ? 312  ILE A CB  1 
ATOM   1539  C  CG1 . ILE A  1 205 ? 35.582  15.656  123.605 1.00 6.94   ? 312  ILE A CG1 1 
ATOM   1540  C  CG2 . ILE A  1 205 ? 36.199  16.231  121.251 1.00 8.79   ? 312  ILE A CG2 1 
ATOM   1541  C  CD1 . ILE A  1 205 ? 34.597  16.809  123.778 1.00 6.98   ? 312  ILE A CD1 1 
ATOM   1542  N  N   . TYR A  1 206 ? 37.637  13.428  124.590 1.00 11.51  ? 313  TYR A N   1 
ATOM   1543  C  CA  . TYR A  1 206 ? 37.867  13.020  125.974 1.00 9.72   ? 313  TYR A CA  1 
ATOM   1544  C  C   . TYR A  1 206 ? 39.251  12.434  126.222 1.00 9.84   ? 313  TYR A C   1 
ATOM   1545  O  O   . TYR A  1 206 ? 39.621  12.179  127.365 1.00 10.74  ? 313  TYR A O   1 
ATOM   1546  C  CB  . TYR A  1 206 ? 36.826  11.991  126.403 1.00 9.62   ? 313  TYR A CB  1 
ATOM   1547  C  CG  . TYR A  1 206 ? 35.401  12.372  126.089 1.00 10.61  ? 313  TYR A CG  1 
ATOM   1548  C  CD1 . TYR A  1 206 ? 34.612  11.569  125.253 1.00 10.50  ? 313  TYR A CD1 1 
ATOM   1549  C  CD2 . TYR A  1 206 ? 34.835  13.528  126.618 1.00 9.95   ? 313  TYR A CD2 1 
ATOM   1550  C  CE1 . TYR A  1 206 ? 33.293  11.916  124.953 1.00 10.11  ? 313  TYR A CE1 1 
ATOM   1551  C  CE2 . TYR A  1 206 ? 33.516  13.883  126.322 1.00 11.42  ? 313  TYR A CE2 1 
ATOM   1552  C  CZ  . TYR A  1 206 ? 32.754  13.071  125.489 1.00 11.25  ? 313  TYR A CZ  1 
ATOM   1553  O  OH  . TYR A  1 206 ? 31.459  13.415  125.191 1.00 11.13  ? 313  TYR A OH  1 
ATOM   1554  N  N   . THR A  1 207 ? 40.018  12.210  125.164 1.00 8.83   ? 314  THR A N   1 
ATOM   1555  C  CA  . THR A  1 207 ? 41.341  11.636  125.330 1.00 8.98   ? 314  THR A CA  1 
ATOM   1556  C  C   . THR A  1 207 ? 42.427  12.586  124.867 1.00 10.74  ? 314  THR A C   1 
ATOM   1557  O  O   . THR A  1 207 ? 42.189  13.434  124.001 1.00 12.04  ? 314  THR A O   1 
ATOM   1558  C  CB  . THR A  1 207 ? 41.503  10.333  124.502 1.00 9.28   ? 314  THR A CB  1 
ATOM   1559  O  OG1 . THR A  1 207 ? 41.523  10.649  123.100 1.00 5.72   ? 314  THR A OG1 1 
ATOM   1560  C  CG2 . THR A  1 207 ? 40.369  9.375   124.784 1.00 6.13   ? 314  THR A CG2 1 
ATOM   1561  N  N   . LEU A  1 208 ? 43.615  12.464  125.453 1.00 11.08  ? 315  LEU A N   1 
ATOM   1562  C  CA  . LEU A  1 208 ? 44.741  13.278  125.011 1.00 11.94  ? 315  LEU A CA  1 
ATOM   1563  C  C   . LEU A  1 208 ? 45.513  12.311  124.133 1.00 11.79  ? 315  LEU A C   1 
ATOM   1564  O  O   . LEU A  1 208 ? 46.182  11.405  124.630 1.00 12.29  ? 315  LEU A O   1 
ATOM   1565  C  CB  . LEU A  1 208 ? 45.630  13.757  126.176 1.00 11.61  ? 315  LEU A CB  1 
ATOM   1566  C  CG  . LEU A  1 208 ? 45.029  14.699  127.223 1.00 11.70  ? 315  LEU A CG  1 
ATOM   1567  C  CD1 . LEU A  1 208 ? 44.383  13.870  128.310 1.00 12.33  ? 315  LEU A CD1 1 
ATOM   1568  C  CD2 . LEU A  1 208 ? 46.106  15.580  127.830 1.00 11.91  ? 315  LEU A CD2 1 
ATOM   1569  N  N   . SER A  1 209 ? 45.387  12.483  122.823 1.00 12.26  ? 316  SER A N   1 
ATOM   1570  C  CA  . SER A  1 209 ? 46.059  11.604  121.891 1.00 12.29  ? 316  SER A CA  1 
ATOM   1571  C  C   . SER A  1 209 ? 47.508  12.040  121.773 1.00 11.85  ? 316  SER A C   1 
ATOM   1572  O  O   . SER A  1 209 ? 47.793  13.193  121.468 1.00 11.00  ? 316  SER A O   1 
ATOM   1573  C  CB  . SER A  1 209 ? 45.352  11.646  120.541 1.00 12.74  ? 316  SER A CB  1 
ATOM   1574  O  OG  . SER A  1 209 ? 45.969  10.752  119.625 1.00 16.88  ? 316  SER A OG  1 
ATOM   1575  N  N   . ILE A  1 210 ? 48.420  11.102  122.006 1.00 12.28  ? 317  ILE A N   1 
ATOM   1576  C  CA  . ILE A  1 210 ? 49.853  11.378  121.975 1.00 11.78  ? 317  ILE A CA  1 
ATOM   1577  C  C   . ILE A  1 210 ? 50.613  10.683  120.845 1.00 12.63  ? 317  ILE A C   1 
ATOM   1578  O  O   . ILE A  1 210 ? 50.463  9.484   120.623 1.00 13.60  ? 317  ILE A O   1 
ATOM   1579  C  CB  . ILE A  1 210 ? 50.493  10.967  123.334 1.00 11.29  ? 317  ILE A CB  1 
ATOM   1580  C  CG1 . ILE A  1 210 ? 49.762  11.669  124.484 1.00 11.23  ? 317  ILE A CG1 1 
ATOM   1581  C  CG2 . ILE A  1 210 ? 51.974  11.307  123.360 1.00 9.30   ? 317  ILE A CG2 1 
ATOM   1582  C  CD1 . ILE A  1 210 ? 49.684  13.172  124.353 1.00 7.84   ? 317  ILE A CD1 1 
ATOM   1583  N  N   . SER A  1 211 ? 51.439  11.436  120.130 1.00 12.76  ? 318  SER A N   1 
ATOM   1584  C  CA  . SER A  1 211 ? 52.230  10.854  119.054 1.00 13.99  ? 318  SER A CA  1 
ATOM   1585  C  C   . SER A  1 211 ? 53.689  10.715  119.482 1.00 13.80  ? 318  SER A C   1 
ATOM   1586  O  O   . SER A  1 211 ? 54.043  11.036  120.609 1.00 12.76  ? 318  SER A O   1 
ATOM   1587  C  CB  . SER A  1 211 ? 52.137  11.703  117.790 1.00 15.83  ? 318  SER A CB  1 
ATOM   1588  O  OG  . SER A  1 211 ? 50.852  11.594  117.206 1.00 18.66  ? 318  SER A OG  1 
ATOM   1589  N  N   . SER A  1 212 ? 54.535  10.245  118.574 1.00 14.47  ? 319  SER A N   1 
ATOM   1590  C  CA  . SER A  1 212 ? 55.936  10.030  118.901 1.00 15.07  ? 319  SER A CA  1 
ATOM   1591  C  C   . SER A  1 212 ? 56.898  10.806  118.034 1.00 14.97  ? 319  SER A C   1 
ATOM   1592  O  O   . SER A  1 212 ? 56.533  11.318  116.980 1.00 14.04  ? 319  SER A O   1 
ATOM   1593  C  CB  . SER A  1 212 ? 56.280  8.547   118.788 1.00 15.51  ? 319  SER A CB  1 
ATOM   1594  O  OG  . SER A  1 212 ? 55.331  7.764   119.482 1.00 17.80  ? 319  SER A OG  1 
ATOM   1595  N  N   . ALA A  1 213 ? 58.138  10.874  118.507 1.00 15.72  ? 320  ALA A N   1 
ATOM   1596  C  CA  . ALA A  1 213 ? 59.224  11.549  117.811 1.00 16.91  ? 320  ALA A CA  1 
ATOM   1597  C  C   . ALA A  1 213 ? 60.446  10.705  118.093 1.00 17.10  ? 320  ALA A C   1 
ATOM   1598  O  O   . ALA A  1 213 ? 60.584  10.185  119.199 1.00 17.89  ? 320  ALA A O   1 
ATOM   1599  C  CB  . ALA A  1 213 ? 59.419  12.943  118.361 1.00 17.13  ? 320  ALA A CB  1 
ATOM   1600  N  N   . THR A  1 214 ? 61.317  10.549  117.101 1.00 18.09  ? 321  THR A N   1 
ATOM   1601  C  CA  . THR A  1 214 ? 62.522  9.745   117.276 1.00 18.81  ? 321  THR A CA  1 
ATOM   1602  C  C   . THR A  1 214 ? 63.564  10.524  118.062 1.00 19.81  ? 321  THR A C   1 
ATOM   1603  O  O   . THR A  1 214 ? 63.435  11.731  118.260 1.00 19.00  ? 321  THR A O   1 
ATOM   1604  C  CB  . THR A  1 214 ? 63.144  9.347   115.926 1.00 19.09  ? 321  THR A CB  1 
ATOM   1605  O  OG1 . THR A  1 214 ? 63.660  10.516  115.270 1.00 19.84  ? 321  THR A OG1 1 
ATOM   1606  C  CG2 . THR A  1 214 ? 62.100  8.681   115.036 1.00 19.73  ? 321  THR A CG2 1 
ATOM   1607  N  N   . GLN A  1 215 ? 64.601  9.827   118.509 1.00 21.24  ? 322  GLN A N   1 
ATOM   1608  C  CA  . GLN A  1 215 ? 65.663  10.467  119.273 1.00 21.87  ? 322  GLN A CA  1 
ATOM   1609  C  C   . GLN A  1 215 ? 66.237  11.695  118.576 1.00 22.27  ? 322  GLN A C   1 
ATOM   1610  O  O   . GLN A  1 215 ? 66.613  12.652  119.236 1.00 24.14  ? 322  GLN A O   1 
ATOM   1611  C  CB  . GLN A  1 215 ? 66.782  9.471   119.547 1.00 22.05  ? 322  GLN A CB  1 
ATOM   1612  C  CG  . GLN A  1 215 ? 68.032  10.076  120.137 1.00 22.65  ? 322  GLN A CG  1 
ATOM   1613  C  CD  . GLN A  1 215 ? 69.055  9.020   120.464 1.00 23.68  ? 322  GLN A CD  1 
ATOM   1614  O  OE1 . GLN A  1 215 ? 69.241  8.072   119.705 1.00 24.87  ? 322  GLN A OE1 1 
ATOM   1615  N  NE2 . GLN A  1 215 ? 69.731  9.176   121.592 1.00 25.53  ? 322  GLN A NE2 1 
ATOM   1616  N  N   . PHE A  1 216 ? 66.300  11.682  117.250 1.00 22.01  ? 323  PHE A N   1 
ATOM   1617  C  CA  . PHE A  1 216 ? 66.856  12.824  116.541 1.00 21.97  ? 323  PHE A CA  1 
ATOM   1618  C  C   . PHE A  1 216 ? 65.787  13.787  116.081 1.00 21.49  ? 323  PHE A C   1 
ATOM   1619  O  O   . PHE A  1 216 ? 66.006  14.591  115.179 1.00 21.52  ? 323  PHE A O   1 
ATOM   1620  C  CB  . PHE A  1 216 ? 67.713  12.353  115.366 1.00 25.18  ? 323  PHE A CB  1 
ATOM   1621  C  CG  . PHE A  1 216 ? 68.860  11.486  115.790 1.00 29.54  ? 323  PHE A CG  1 
ATOM   1622  C  CD1 . PHE A  1 216 ? 69.239  10.383  115.034 1.00 32.43  ? 323  PHE A CD1 1 
ATOM   1623  C  CD2 . PHE A  1 216 ? 69.504  11.719  117.003 1.00 30.73  ? 323  PHE A CD2 1 
ATOM   1624  C  CE1 . PHE A  1 216 ? 70.236  9.517   115.490 1.00 32.87  ? 323  PHE A CE1 1 
ATOM   1625  C  CE2 . PHE A  1 216 ? 70.496  10.862  117.466 1.00 31.27  ? 323  PHE A CE2 1 
ATOM   1626  C  CZ  . PHE A  1 216 ? 70.861  9.758   116.712 1.00 32.00  ? 323  PHE A CZ  1 
ATOM   1627  N  N   . GLY A  1 217 ? 64.622  13.694  116.713 1.00 21.19  ? 324  GLY A N   1 
ATOM   1628  C  CA  . GLY A  1 217 ? 63.516  14.579  116.399 1.00 19.15  ? 324  GLY A CA  1 
ATOM   1629  C  C   . GLY A  1 217 ? 62.821  14.420  115.062 1.00 19.25  ? 324  GLY A C   1 
ATOM   1630  O  O   . GLY A  1 217 ? 62.322  15.400  114.509 1.00 19.18  ? 324  GLY A O   1 
ATOM   1631  N  N   . ASN A  1 218 ? 62.760  13.200  114.539 1.00 18.79  ? 325  ASN A N   1 
ATOM   1632  C  CA  . ASN A  1 218 ? 62.099  12.980  113.262 1.00 17.20  ? 325  ASN A CA  1 
ATOM   1633  C  C   . ASN A  1 218 ? 60.780  12.273  113.460 1.00 16.76  ? 325  ASN A C   1 
ATOM   1634  O  O   . ASN A  1 218 ? 60.497  11.754  114.541 1.00 16.73  ? 325  ASN A O   1 
ATOM   1635  C  CB  . ASN A  1 218 ? 62.984  12.135  112.350 1.00 17.29  ? 325  ASN A CB  1 
ATOM   1636  C  CG  . ASN A  1 218 ? 64.326  12.765  112.112 1.00 15.71  ? 325  ASN A CG  1 
ATOM   1637  O  OD1 . ASN A  1 218 ? 64.410  13.940  111.774 1.00 18.15  ? 325  ASN A OD1 1 
ATOM   1638  N  ND2 . ASN A  1 218 ? 65.383  11.995  112.282 1.00 14.28  ? 325  ASN A ND2 1 
ATOM   1639  N  N   . VAL A  1 219 ? 59.970  12.257  112.406 1.00 16.46  ? 326  VAL A N   1 
ATOM   1640  C  CA  . VAL A  1 219 ? 58.695  11.566  112.449 1.00 15.25  ? 326  VAL A CA  1 
ATOM   1641  C  C   . VAL A  1 219 ? 59.011  10.087  112.341 1.00 15.05  ? 326  VAL A C   1 
ATOM   1642  O  O   . VAL A  1 219 ? 59.599  9.647   111.353 1.00 15.77  ? 326  VAL A O   1 
ATOM   1643  C  CB  . VAL A  1 219 ? 57.805  11.968  111.269 1.00 14.49  ? 326  VAL A CB  1 
ATOM   1644  C  CG1 . VAL A  1 219 ? 56.512  11.153  111.303 1.00 14.55  ? 326  VAL A CG1 1 
ATOM   1645  C  CG2 . VAL A  1 219 ? 57.507  13.461  111.332 1.00 12.63  ? 326  VAL A CG2 1 
ATOM   1646  N  N   . PRO A  1 220 ? 58.647  9.299   113.364 1.00 16.23  ? 327  PRO A N   1 
ATOM   1647  C  CA  . PRO A  1 220 ? 58.918  7.849   113.338 1.00 16.24  ? 327  PRO A CA  1 
ATOM   1648  C  C   . PRO A  1 220 ? 58.242  7.187   112.129 1.00 15.61  ? 327  PRO A C   1 
ATOM   1649  O  O   . PRO A  1 220 ? 57.254  7.698   111.602 1.00 17.00  ? 327  PRO A O   1 
ATOM   1650  C  CB  . PRO A  1 220 ? 58.335  7.356   114.666 1.00 14.96  ? 327  PRO A CB  1 
ATOM   1651  C  CG  . PRO A  1 220 ? 58.345  8.573   115.539 1.00 15.40  ? 327  PRO A CG  1 
ATOM   1652  C  CD  . PRO A  1 220 ? 57.950  9.689   114.603 1.00 15.08  ? 327  PRO A CD  1 
ATOM   1653  N  N   . TRP A  1 221 ? 58.760  6.048   111.695 1.00 15.33  ? 328  TRP A N   1 
ATOM   1654  C  CA  . TRP A  1 221 ? 58.186  5.367   110.544 1.00 14.44  ? 328  TRP A CA  1 
ATOM   1655  C  C   . TRP A  1 221 ? 56.774  4.826   110.798 1.00 14.51  ? 328  TRP A C   1 
ATOM   1656  O  O   . TRP A  1 221 ? 56.013  4.617   109.864 1.00 14.51  ? 328  TRP A O   1 
ATOM   1657  C  CB  . TRP A  1 221 ? 59.096  4.221   110.115 1.00 13.72  ? 328  TRP A CB  1 
ATOM   1658  C  CG  . TRP A  1 221 ? 59.238  3.136   111.130 1.00 14.72  ? 328  TRP A CG  1 
ATOM   1659  C  CD1 . TRP A  1 221 ? 60.228  3.003   112.053 1.00 15.60  ? 328  TRP A CD1 1 
ATOM   1660  C  CD2 . TRP A  1 221 ? 58.352  2.021   111.327 1.00 15.79  ? 328  TRP A CD2 1 
ATOM   1661  N  NE1 . TRP A  1 221 ? 60.020  1.869   112.818 1.00 14.97  ? 328  TRP A NE1 1 
ATOM   1662  C  CE2 . TRP A  1 221 ? 58.876  1.251   112.389 1.00 14.74  ? 328  TRP A CE2 1 
ATOM   1663  C  CE3 . TRP A  1 221 ? 57.165  1.600   110.708 1.00 16.50  ? 328  TRP A CE3 1 
ATOM   1664  C  CZ2 . TRP A  1 221 ? 58.258  0.086   112.845 1.00 15.61  ? 328  TRP A CZ2 1 
ATOM   1665  C  CZ3 . TRP A  1 221 ? 56.549  0.439   111.165 1.00 15.54  ? 328  TRP A CZ3 1 
ATOM   1666  C  CH2 . TRP A  1 221 ? 57.099  -0.303  112.224 1.00 14.72  ? 328  TRP A CH2 1 
ATOM   1667  N  N   . TYR A  1 222 ? 56.426  4.617   112.064 1.00 13.20  ? 329  TYR A N   1 
ATOM   1668  C  CA  . TYR A  1 222 ? 55.119  4.075   112.429 1.00 13.01  ? 329  TYR A CA  1 
ATOM   1669  C  C   . TYR A  1 222 ? 54.084  5.141   112.715 1.00 12.78  ? 329  TYR A C   1 
ATOM   1670  O  O   . TYR A  1 222 ? 52.902  4.851   112.888 1.00 12.12  ? 329  TYR A O   1 
ATOM   1671  C  CB  . TYR A  1 222 ? 55.272  3.181   113.663 1.00 12.11  ? 329  TYR A CB  1 
ATOM   1672  C  CG  . TYR A  1 222 ? 56.023  3.848   114.780 1.00 11.77  ? 329  TYR A CG  1 
ATOM   1673  C  CD1 . TYR A  1 222 ? 55.394  4.769   115.619 1.00 12.81  ? 329  TYR A CD1 1 
ATOM   1674  C  CD2 . TYR A  1 222 ? 57.372  3.591   114.987 1.00 11.24  ? 329  TYR A CD2 1 
ATOM   1675  C  CE1 . TYR A  1 222 ? 56.090  5.417   116.630 1.00 10.80  ? 329  TYR A CE1 1 
ATOM   1676  C  CE2 . TYR A  1 222 ? 58.077  4.232   116.000 1.00 11.01  ? 329  TYR A CE2 1 
ATOM   1677  C  CZ  . TYR A  1 222 ? 57.428  5.146   116.811 1.00 11.72  ? 329  TYR A CZ  1 
ATOM   1678  O  OH  . TYR A  1 222 ? 58.131  5.828   117.773 1.00 13.46  ? 329  TYR A OH  1 
ATOM   1679  N  N   . SER A  1 223 ? 54.538  6.384   112.753 1.00 14.43  ? 330  SER A N   1 
ATOM   1680  C  CA  . SER A  1 223 ? 53.674  7.510   113.059 1.00 15.04  ? 330  SER A CA  1 
ATOM   1681  C  C   . SER A  1 223 ? 52.553  7.795   112.070 1.00 15.76  ? 330  SER A C   1 
ATOM   1682  O  O   . SER A  1 223 ? 52.773  7.858   110.858 1.00 15.82  ? 330  SER A O   1 
ATOM   1683  C  CB  . SER A  1 223 ? 54.516  8.777   113.227 1.00 15.83  ? 330  SER A CB  1 
ATOM   1684  O  OG  . SER A  1 223 ? 53.689  9.932   113.339 1.00 16.69  ? 330  SER A OG  1 
ATOM   1685  N  N   . GLU A  1 224 ? 51.356  7.989   112.615 1.00 15.21  ? 331  GLU A N   1 
ATOM   1686  C  CA  . GLU A  1 224 ? 50.181  8.314   111.832 1.00 15.20  ? 331  GLU A CA  1 
ATOM   1687  C  C   . GLU A  1 224 ? 49.936  9.804   112.022 1.00 16.41  ? 331  GLU A C   1 
ATOM   1688  O  O   . GLU A  1 224 ? 50.024  10.314  113.138 1.00 18.23  ? 331  GLU A O   1 
ATOM   1689  C  CB  . GLU A  1 224 ? 48.959  7.554   112.340 1.00 14.61  ? 331  GLU A CB  1 
ATOM   1690  C  CG  . GLU A  1 224 ? 49.096  6.057   112.372 1.00 13.77  ? 331  GLU A CG  1 
ATOM   1691  C  CD  . GLU A  1 224 ? 47.805  5.381   112.781 1.00 15.18  ? 331  GLU A CD  1 
ATOM   1692  O  OE1 . GLU A  1 224 ? 47.861  4.204   113.220 1.00 15.63  ? 331  GLU A OE1 1 
ATOM   1693  O  OE2 . GLU A  1 224 ? 46.735  6.028   112.659 1.00 15.09  ? 331  GLU A OE2 1 
ATOM   1694  N  N   . ALA A  1 225 ? 49.630  10.509  110.943 1.00 16.15  ? 332  ALA A N   1 
ATOM   1695  C  CA  . ALA A  1 225 ? 49.367  11.932  111.055 1.00 17.13  ? 332  ALA A CA  1 
ATOM   1696  C  C   . ALA A  1 225 ? 47.864  12.165  111.139 1.00 18.50  ? 332  ALA A C   1 
ATOM   1697  O  O   . ALA A  1 225 ? 47.081  11.393  110.576 1.00 19.74  ? 332  ALA A O   1 
ATOM   1698  C  CB  . ALA A  1 225 ? 49.933  12.654  109.864 1.00 15.02  ? 332  ALA A CB  1 
ATOM   1699  N  N   . CYS A  1 226 ? 47.465  13.206  111.863 1.00 18.10  ? 333  CYS A N   1 
ATOM   1700  C  CA  . CYS A  1 226 ? 46.056  13.563  111.988 1.00 20.02  ? 333  CYS A CA  1 
ATOM   1701  C  C   . CYS A  1 226 ? 45.912  14.850  112.792 1.00 19.17  ? 333  CYS A C   1 
ATOM   1702  O  O   . CYS A  1 226 ? 46.835  15.261  113.494 1.00 19.78  ? 333  CYS A O   1 
ATOM   1703  C  CB  . CYS A  1 226 ? 45.246  12.428  112.627 1.00 21.40  ? 333  CYS A CB  1 
ATOM   1704  S  SG  . CYS A  1 226 ? 45.674  12.074  114.354 1.00 27.12  ? 333  CYS A SG  1 
ATOM   1705  N  N   . SER A  1 227 ? 44.756  15.491  112.675 1.00 18.07  ? 334  SER A N   1 
ATOM   1706  C  CA  . SER A  1 227 ? 44.510  16.752  113.360 1.00 15.68  ? 334  SER A CA  1 
ATOM   1707  C  C   . SER A  1 227 ? 44.036  16.602  114.793 1.00 15.44  ? 334  SER A C   1 
ATOM   1708  O  O   . SER A  1 227 ? 43.915  17.593  115.506 1.00 16.51  ? 334  SER A O   1 
ATOM   1709  C  CB  . SER A  1 227 ? 43.477  17.574  112.581 1.00 15.50  ? 334  SER A CB  1 
ATOM   1710  O  OG  . SER A  1 227 ? 42.246  16.871  112.459 1.00 14.44  ? 334  SER A OG  1 
ATOM   1711  N  N   . SER A  1 228 ? 43.757  15.380  115.225 1.00 13.94  ? 335  SER A N   1 
ATOM   1712  C  CA  . SER A  1 228 ? 43.268  15.201  116.584 1.00 14.26  ? 335  SER A CA  1 
ATOM   1713  C  C   . SER A  1 228 ? 44.374  15.003  117.607 1.00 13.29  ? 335  SER A C   1 
ATOM   1714  O  O   . SER A  1 228 ? 44.126  15.063  118.807 1.00 12.42  ? 335  SER A O   1 
ATOM   1715  C  CB  . SER A  1 228 ? 42.260  14.042  116.649 1.00 12.62  ? 335  SER A CB  1 
ATOM   1716  O  OG  . SER A  1 228 ? 42.850  12.821  116.259 1.00 13.23  ? 335  SER A OG  1 
ATOM   1717  N  N   . THR A  1 229 ? 45.593  14.765  117.138 1.00 13.69  ? 336  THR A N   1 
ATOM   1718  C  CA  . THR A  1 229 ? 46.710  14.583  118.050 1.00 14.58  ? 336  THR A CA  1 
ATOM   1719  C  C   . THR A  1 229 ? 46.912  15.883  118.818 1.00 14.34  ? 336  THR A C   1 
ATOM   1720  O  O   . THR A  1 229 ? 46.749  16.966  118.257 1.00 13.70  ? 336  THR A O   1 
ATOM   1721  C  CB  . THR A  1 229 ? 48.000  14.231  117.293 1.00 15.60  ? 336  THR A CB  1 
ATOM   1722  O  OG1 . THR A  1 229 ? 47.825  12.984  116.602 1.00 16.80  ? 336  THR A OG1 1 
ATOM   1723  C  CG2 . THR A  1 229 ? 49.154  14.097  118.266 1.00 14.03  ? 336  THR A CG2 1 
ATOM   1724  N  N   . LEU A  1 230 ? 47.255  15.775  120.101 1.00 14.33  ? 337  LEU A N   1 
ATOM   1725  C  CA  . LEU A  1 230 ? 47.460  16.957  120.938 1.00 13.64  ? 337  LEU A CA  1 
ATOM   1726  C  C   . LEU A  1 230 ? 48.928  17.288  121.186 1.00 14.65  ? 337  LEU A C   1 
ATOM   1727  O  O   . LEU A  1 230 ? 49.334  18.436  121.036 1.00 15.50  ? 337  LEU A O   1 
ATOM   1728  C  CB  . LEU A  1 230 ? 46.754  16.774  122.277 1.00 12.96  ? 337  LEU A CB  1 
ATOM   1729  C  CG  . LEU A  1 230 ? 46.440  18.058  123.037 1.00 12.82  ? 337  LEU A CG  1 
ATOM   1730  C  CD1 . LEU A  1 230 ? 45.532  18.940  122.203 1.00 12.22  ? 337  LEU A CD1 1 
ATOM   1731  C  CD2 . LEU A  1 230 ? 45.770  17.712  124.354 1.00 12.71  ? 337  LEU A CD2 1 
ATOM   1732  N  N   . ALA A  1 231 ? 49.724  16.288  121.566 1.00 14.86  ? 338  ALA A N   1 
ATOM   1733  C  CA  . ALA A  1 231 ? 51.148  16.494  121.833 1.00 14.11  ? 338  ALA A CA  1 
ATOM   1734  C  C   . ALA A  1 231 ? 51.987  15.255  121.509 1.00 14.69  ? 338  ALA A C   1 
ATOM   1735  O  O   . ALA A  1 231 ? 51.460  14.224  121.082 1.00 14.53  ? 338  ALA A O   1 
ATOM   1736  C  CB  . ALA A  1 231 ? 51.352  16.890  123.280 1.00 13.47  ? 338  ALA A CB  1 
ATOM   1737  N  N   . THR A  1 232 ? 53.291  15.360  121.750 1.00 13.40  ? 339  THR A N   1 
ATOM   1738  C  CA  . THR A  1 232 ? 54.228  14.290  121.450 1.00 12.57  ? 339  THR A CA  1 
ATOM   1739  C  C   . THR A  1 232 ? 55.175  13.968  122.598 1.00 13.50  ? 339  THR A C   1 
ATOM   1740  O  O   . THR A  1 232 ? 55.410  14.783  123.482 1.00 14.36  ? 339  THR A O   1 
ATOM   1741  C  CB  . THR A  1 232 ? 55.084  14.682  120.245 1.00 11.50  ? 339  THR A CB  1 
ATOM   1742  O  OG1 . THR A  1 232 ? 54.232  15.076  119.175 1.00 14.74  ? 339  THR A OG1 1 
ATOM   1743  C  CG2 . THR A  1 232 ? 55.938  13.551  119.793 1.00 12.65  ? 339  THR A CG2 1 
ATOM   1744  N  N   . THR A  1 233 ? 55.747  12.776  122.543 1.00 13.84  ? 340  THR A N   1 
ATOM   1745  C  CA  . THR A  1 233 ? 56.689  12.296  123.534 1.00 15.08  ? 340  THR A CA  1 
ATOM   1746  C  C   . THR A  1 233 ? 57.681  11.509  122.716 1.00 15.96  ? 340  THR A C   1 
ATOM   1747  O  O   . THR A  1 233 ? 57.315  11.014  121.658 1.00 17.84  ? 340  THR A O   1 
ATOM   1748  C  CB  . THR A  1 233 ? 55.979  11.350  124.492 1.00 15.13  ? 340  THR A CB  1 
ATOM   1749  O  OG1 . THR A  1 233 ? 55.482  12.095  125.605 1.00 17.37  ? 340  THR A OG1 1 
ATOM   1750  C  CG2 . THR A  1 233 ? 56.890  10.269  124.957 1.00 16.28  ? 340  THR A CG2 1 
ATOM   1751  N  N   . TYR A  1 234 ? 58.921  11.395  123.182 1.00 15.44  ? 341  TYR A N   1 
ATOM   1752  C  CA  . TYR A  1 234 ? 59.927  10.634  122.453 1.00 15.92  ? 341  TYR A CA  1 
ATOM   1753  C  C   . TYR A  1 234 ? 59.629  9.136   122.482 1.00 16.67  ? 341  TYR A C   1 
ATOM   1754  O  O   . TYR A  1 234 ? 58.947  8.641   123.382 1.00 16.75  ? 341  TYR A O   1 
ATOM   1755  C  CB  . TYR A  1 234 ? 61.313  10.864  123.061 1.00 16.25  ? 341  TYR A CB  1 
ATOM   1756  C  CG  . TYR A  1 234 ? 61.951  12.164  122.674 1.00 17.00  ? 341  TYR A CG  1 
ATOM   1757  C  CD1 . TYR A  1 234 ? 62.140  13.183  123.615 1.00 17.87  ? 341  TYR A CD1 1 
ATOM   1758  C  CD2 . TYR A  1 234 ? 62.363  12.390  121.366 1.00 17.51  ? 341  TYR A CD2 1 
ATOM   1759  C  CE1 . TYR A  1 234 ? 62.726  14.399  123.257 1.00 16.17  ? 341  TYR A CE1 1 
ATOM   1760  C  CE2 . TYR A  1 234 ? 62.952  13.605  120.997 1.00 18.52  ? 341  TYR A CE2 1 
ATOM   1761  C  CZ  . TYR A  1 234 ? 63.129  14.600  121.951 1.00 17.08  ? 341  TYR A CZ  1 
ATOM   1762  O  OH  . TYR A  1 234 ? 63.722  15.785  121.597 1.00 17.28  ? 341  TYR A OH  1 
ATOM   1763  N  N   . SER A  1 235 ? 60.154  8.417   121.495 1.00 16.44  ? 342  SER A N   1 
ATOM   1764  C  CA  . SER A  1 235 ? 59.987  6.971   121.428 1.00 16.67  ? 342  SER A CA  1 
ATOM   1765  C  C   . SER A  1 235 ? 61.033  6.425   120.470 1.00 16.28  ? 342  SER A C   1 
ATOM   1766  O  O   . SER A  1 235 ? 61.996  7.119   120.161 1.00 15.73  ? 342  SER A O   1 
ATOM   1767  C  CB  . SER A  1 235 ? 58.584  6.600   120.950 1.00 15.40  ? 342  SER A CB  1 
ATOM   1768  O  OG  . SER A  1 235 ? 58.372  5.210   121.114 1.00 14.17  ? 342  SER A OG  1 
ATOM   1769  N  N   . SER A  1 236 ? 60.844  5.195   120.000 1.00 16.45  ? 343  SER A N   1 
ATOM   1770  C  CA  . SER A  1 236 ? 61.794  4.574   119.084 1.00 16.70  ? 343  SER A CA  1 
ATOM   1771  C  C   . SER A  1 236 ? 61.769  5.196   117.689 1.00 17.20  ? 343  SER A C   1 
ATOM   1772  O  O   . SER A  1 236 ? 60.829  5.892   117.322 1.00 16.57  ? 343  SER A O   1 
ATOM   1773  C  CB  . SER A  1 236 ? 61.520  3.076   118.975 1.00 15.21  ? 343  SER A CB  1 
ATOM   1774  O  OG  . SER A  1 236 ? 60.253  2.841   118.393 1.00 17.03  ? 343  SER A OG  1 
ATOM   1775  N  N   . GLY A  1 237 ? 62.817  4.929   116.919 1.00 18.96  ? 344  GLY A N   1 
ATOM   1776  C  CA  . GLY A  1 237 ? 62.927  5.456   115.574 1.00 20.22  ? 344  GLY A CA  1 
ATOM   1777  C  C   . GLY A  1 237 ? 63.592  4.444   114.660 1.00 22.14  ? 344  GLY A C   1 
ATOM   1778  O  O   . GLY A  1 237 ? 63.219  3.268   114.675 1.00 21.32  ? 344  GLY A O   1 
ATOM   1779  N  N   . ASN A  1 238 ? 64.572  4.885   113.870 1.00 22.54  ? 345  ASN A N   1 
ATOM   1780  C  CA  . ASN A  1 238 ? 65.255  3.971   112.969 1.00 25.11  ? 345  ASN A CA  1 
ATOM   1781  C  C   . ASN A  1 238 ? 66.297  3.130   113.709 1.00 25.59  ? 345  ASN A C   1 
ATOM   1782  O  O   . ASN A  1 238 ? 66.461  3.253   114.925 1.00 24.92  ? 345  ASN A O   1 
ATOM   1783  C  CB  . ASN A  1 238 ? 65.893  4.730   111.786 1.00 27.49  ? 345  ASN A CB  1 
ATOM   1784  C  CG  . ASN A  1 238 ? 67.017  5.701   112.209 1.00 32.21  ? 345  ASN A CG  1 
ATOM   1785  O  OD1 . ASN A  1 238 ? 67.900  5.362   113.007 1.00 33.75  ? 345  ASN A OD1 1 
ATOM   1786  N  ND2 . ASN A  1 238 ? 66.998  6.904   111.642 1.00 32.81  ? 345  ASN A ND2 1 
ATOM   1787  N  N   . GLN A  1 239 ? 66.991  2.267   112.976 1.00 27.05  ? 346  GLN A N   1 
ATOM   1788  C  CA  . GLN A  1 239 ? 67.999  1.391   113.569 1.00 28.27  ? 346  GLN A CA  1 
ATOM   1789  C  C   . GLN A  1 239 ? 69.146  2.097   114.288 1.00 28.54  ? 346  GLN A C   1 
ATOM   1790  O  O   . GLN A  1 239 ? 69.829  1.492   115.112 1.00 29.13  ? 346  GLN A O   1 
ATOM   1791  C  CB  . GLN A  1 239 ? 68.589  0.468   112.500 1.00 29.53  ? 346  GLN A CB  1 
ATOM   1792  C  CG  . GLN A  1 239 ? 67.757  -0.783  112.227 1.00 32.93  ? 346  GLN A CG  1 
ATOM   1793  C  CD  . GLN A  1 239 ? 68.445  -1.756  111.290 0.00 32.16  ? 346  GLN A CD  1 
ATOM   1794  O  OE1 . GLN A  1 239 ? 67.938  -2.847  111.031 0.00 32.60  ? 346  GLN A OE1 1 
ATOM   1795  N  NE2 . GLN A  1 239 ? 69.605  -1.365  110.774 0.00 32.60  ? 346  GLN A NE2 1 
ATOM   1796  N  N   . ASN A  1 240 ? 69.366  3.369   113.979 1.00 28.05  ? 347  ASN A N   1 
ATOM   1797  C  CA  . ASN A  1 240 ? 70.456  4.114   114.593 1.00 27.81  ? 347  ASN A CA  1 
ATOM   1798  C  C   . ASN A  1 240 ? 70.033  4.980   115.778 1.00 27.84  ? 347  ASN A C   1 
ATOM   1799  O  O   . ASN A  1 240 ? 70.859  5.693   116.343 1.00 27.79  ? 347  ASN A O   1 
ATOM   1800  C  CB  . ASN A  1 240 ? 71.143  5.005   113.549 1.00 28.31  ? 347  ASN A CB  1 
ATOM   1801  C  CG  . ASN A  1 240 ? 71.864  4.207   112.478 1.00 29.36  ? 347  ASN A CG  1 
ATOM   1802  O  OD1 . ASN A  1 240 ? 72.441  4.774   111.550 0.00 29.05  ? 347  ASN A OD1 1 
ATOM   1803  N  ND2 . ASN A  1 240 ? 71.836  2.884   112.602 0.00 29.05  ? 347  ASN A ND2 1 
ATOM   1804  N  N   . GLU A  1 241 ? 68.760  4.926   116.158 1.00 26.62  ? 348  GLU A N   1 
ATOM   1805  C  CA  . GLU A  1 241 ? 68.284  5.739   117.268 1.00 24.75  ? 348  GLU A CA  1 
ATOM   1806  C  C   . GLU A  1 241 ? 67.936  4.879   118.468 1.00 23.89  ? 348  GLU A C   1 
ATOM   1807  O  O   . GLU A  1 241 ? 67.494  3.748   118.312 1.00 23.69  ? 348  GLU A O   1 
ATOM   1808  C  CB  . GLU A  1 241 ? 67.075  6.560   116.820 1.00 24.28  ? 348  GLU A CB  1 
ATOM   1809  C  CG  . GLU A  1 241 ? 67.357  7.359   115.562 1.00 25.48  ? 348  GLU A CG  1 
ATOM   1810  C  CD  . GLU A  1 241 ? 66.152  8.130   115.056 1.00 27.68  ? 348  GLU A CD  1 
ATOM   1811  O  OE1 . GLU A  1 241 ? 65.988  9.317   115.426 1.00 26.17  ? 348  GLU A OE1 1 
ATOM   1812  O  OE2 . GLU A  1 241 ? 65.363  7.534   114.287 1.00 29.47  ? 348  GLU A OE2 1 
ATOM   1813  N  N   . LYS A  1 242 ? 68.159  5.421   119.661 1.00 23.21  ? 349  LYS A N   1 
ATOM   1814  C  CA  . LYS A  1 242 ? 67.874  4.718   120.902 1.00 22.97  ? 349  LYS A CA  1 
ATOM   1815  C  C   . LYS A  1 242 ? 66.386  4.491   121.067 1.00 22.59  ? 349  LYS A C   1 
ATOM   1816  O  O   . LYS A  1 242 ? 65.579  5.140   120.408 1.00 22.91  ? 349  LYS A O   1 
ATOM   1817  C  CB  . LYS A  1 242 ? 68.374  5.531   122.095 1.00 24.42  ? 349  LYS A CB  1 
ATOM   1818  C  CG  . LYS A  1 242 ? 69.697  5.075   122.665 1.00 25.71  ? 349  LYS A CG  1 
ATOM   1819  C  CD  . LYS A  1 242 ? 70.790  5.205   121.652 1.00 28.07  ? 349  LYS A CD  1 
ATOM   1820  C  CE  . LYS A  1 242 ? 72.117  4.758   122.223 1.00 29.14  ? 349  LYS A CE  1 
ATOM   1821  N  NZ  . LYS A  1 242 ? 73.199  5.006   121.218 1.00 32.33  ? 349  LYS A NZ  1 
ATOM   1822  N  N   . GLN A  1 243 ? 66.029  3.583   121.966 1.00 22.07  ? 350  GLN A N   1 
ATOM   1823  C  CA  . GLN A  1 243 ? 64.633  3.276   122.234 1.00 21.59  ? 350  GLN A CA  1 
ATOM   1824  C  C   . GLN A  1 243 ? 64.288  3.487   123.710 1.00 21.86  ? 350  GLN A C   1 
ATOM   1825  O  O   . GLN A  1 243 ? 65.103  4.012   124.474 1.00 22.43  ? 350  GLN A O   1 
ATOM   1826  C  CB  . GLN A  1 243 ? 64.340  1.846   121.786 1.00 21.48  ? 350  GLN A CB  1 
ATOM   1827  C  CG  . GLN A  1 243 ? 64.919  1.586   120.395 1.00 21.70  ? 350  GLN A CG  1 
ATOM   1828  C  CD  . GLN A  1 243 ? 64.355  0.358   119.726 1.00 22.37  ? 350  GLN A CD  1 
ATOM   1829  O  OE1 . GLN A  1 243 ? 64.238  -0.698  120.347 1.00 22.51  ? 350  GLN A OE1 1 
ATOM   1830  N  NE2 . GLN A  1 243 ? 64.015  0.483   118.442 1.00 20.92  ? 350  GLN A NE2 1 
ATOM   1831  N  N   . ILE A  1 244 ? 63.089  3.081   124.117 1.00 21.19  ? 351  ILE A N   1 
ATOM   1832  C  CA  . ILE A  1 244 ? 62.655  3.298   125.489 1.00 20.24  ? 351  ILE A CA  1 
ATOM   1833  C  C   . ILE A  1 244 ? 63.043  2.183   126.442 1.00 20.56  ? 351  ILE A C   1 
ATOM   1834  O  O   . ILE A  1 244 ? 62.948  1.007   126.105 1.00 20.73  ? 351  ILE A O   1 
ATOM   1835  C  CB  . ILE A  1 244 ? 61.128  3.520   125.544 1.00 20.02  ? 351  ILE A CB  1 
ATOM   1836  C  CG1 . ILE A  1 244 ? 60.737  4.624   124.563 1.00 20.93  ? 351  ILE A CG1 1 
ATOM   1837  C  CG2 . ILE A  1 244 ? 60.696  3.924   126.937 1.00 20.11  ? 351  ILE A CG2 1 
ATOM   1838  C  CD1 . ILE A  1 244 ? 61.517  5.912   124.719 1.00 19.46  ? 351  ILE A CD1 1 
ATOM   1839  N  N   . VAL A  1 245 ? 63.477  2.573   127.638 1.00 19.67  ? 352  VAL A N   1 
ATOM   1840  C  CA  . VAL A  1 245 ? 63.906  1.639   128.669 1.00 19.22  ? 352  VAL A CA  1 
ATOM   1841  C  C   . VAL A  1 245 ? 62.805  1.426   129.679 1.00 18.88  ? 352  VAL A C   1 
ATOM   1842  O  O   . VAL A  1 245 ? 62.291  2.382   130.248 1.00 19.21  ? 352  VAL A O   1 
ATOM   1843  C  CB  . VAL A  1 245 ? 65.148  2.174   129.399 1.00 19.84  ? 352  VAL A CB  1 
ATOM   1844  C  CG1 . VAL A  1 245 ? 65.587  1.187   130.455 1.00 19.69  ? 352  VAL A CG1 1 
ATOM   1845  C  CG2 . VAL A  1 245 ? 66.275  2.421   128.398 1.00 18.08  ? 352  VAL A CG2 1 
ATOM   1846  N  N   . THR A  1 246 ? 62.440  0.172   129.916 1.00 18.92  ? 353  THR A N   1 
ATOM   1847  C  CA  . THR A  1 246 ? 61.369  -0.098  130.860 1.00 19.57  ? 353  THR A CA  1 
ATOM   1848  C  C   . THR A  1 246 ? 61.337  -1.530  131.380 1.00 20.35  ? 353  THR A C   1 
ATOM   1849  O  O   . THR A  1 246 ? 62.170  -2.363  131.019 1.00 20.35  ? 353  THR A O   1 
ATOM   1850  C  CB  . THR A  1 246 ? 59.998  0.237   130.238 1.00 19.21  ? 353  THR A CB  1 
ATOM   1851  O  OG1 . THR A  1 246 ? 58.982  0.133   131.237 1.00 20.11  ? 353  THR A OG1 1 
ATOM   1852  C  CG2 . THR A  1 246 ? 59.676  -0.711  129.111 1.00 19.18  ? 353  THR A CG2 1 
ATOM   1853  N  N   . THR A  1 247 ? 60.360  -1.800  132.238 1.00 20.53  ? 354  THR A N   1 
ATOM   1854  C  CA  . THR A  1 247 ? 60.187  -3.104  132.846 1.00 21.18  ? 354  THR A CA  1 
ATOM   1855  C  C   . THR A  1 247 ? 59.570  -4.069  131.858 1.00 21.67  ? 354  THR A C   1 
ATOM   1856  O  O   . THR A  1 247 ? 58.595  -3.736  131.196 1.00 23.54  ? 354  THR A O   1 
ATOM   1857  C  CB  . THR A  1 247 ? 59.277  -2.990  134.070 1.00 21.36  ? 354  THR A CB  1 
ATOM   1858  O  OG1 . THR A  1 247 ? 58.054  -2.356  133.685 1.00 21.03  ? 354  THR A OG1 1 
ATOM   1859  C  CG2 . THR A  1 247 ? 59.949  -2.152  135.166 1.00 20.49  ? 354  THR A CG2 1 
ATOM   1860  N  N   . ASP A  1 248 ? 60.127  -5.269  131.758 1.00 22.20  ? 355  ASP A N   1 
ATOM   1861  C  CA  . ASP A  1 248 ? 59.603  -6.251  130.815 1.00 22.89  ? 355  ASP A CA  1 
ATOM   1862  C  C   . ASP A  1 248 ? 59.123  -7.487  131.557 1.00 23.00  ? 355  ASP A C   1 
ATOM   1863  O  O   . ASP A  1 248 ? 59.430  -7.655  132.739 1.00 23.74  ? 355  ASP A O   1 
ATOM   1864  C  CB  . ASP A  1 248 ? 60.686  -6.633  129.798 1.00 23.42  ? 355  ASP A CB  1 
ATOM   1865  C  CG  . ASP A  1 248 ? 60.109  -7.209  128.503 1.00 23.54  ? 355  ASP A CG  1 
ATOM   1866  O  OD1 . ASP A  1 248 ? 60.898  -7.577  127.610 1.00 25.28  ? 355  ASP A OD1 1 
ATOM   1867  O  OD2 . ASP A  1 248 ? 58.876  -7.293  128.366 1.00 22.60  ? 355  ASP A OD2 1 
ATOM   1868  N  N   . LEU A  1 249 ? 58.356  -8.335  130.872 1.00 22.88  ? 356  LEU A N   1 
ATOM   1869  C  CA  . LEU A  1 249 ? 57.838  -9.567  131.476 1.00 23.28  ? 356  LEU A CA  1 
ATOM   1870  C  C   . LEU A  1 249 ? 58.943  -10.443 132.038 1.00 23.11  ? 356  LEU A C   1 
ATOM   1871  O  O   . LEU A  1 249 ? 60.090  -10.374 131.604 1.00 23.28  ? 356  LEU A O   1 
ATOM   1872  C  CB  . LEU A  1 249 ? 57.077  -10.410 130.451 1.00 21.97  ? 356  LEU A CB  1 
ATOM   1873  C  CG  . LEU A  1 249 ? 55.562  -10.305 130.345 1.00 22.74  ? 356  LEU A CG  1 
ATOM   1874  C  CD1 . LEU A  1 249 ? 55.089  -11.550 129.647 1.00 23.67  ? 356  LEU A CD1 1 
ATOM   1875  C  CD2 . LEU A  1 249 ? 54.899  -10.218 131.706 1.00 21.26  ? 356  LEU A CD2 1 
ATOM   1876  N  N   . ARG A  1 250 ? 58.579  -11.277 133.001 1.00 23.46  ? 357  ARG A N   1 
ATOM   1877  C  CA  . ARG A  1 250 ? 59.518  -12.199 133.594 1.00 24.54  ? 357  ARG A CA  1 
ATOM   1878  C  C   . ARG A  1 250 ? 60.595  -11.484 134.390 1.00 25.11  ? 357  ARG A C   1 
ATOM   1879  O  O   . ARG A  1 250 ? 61.749  -11.903 134.440 1.00 24.40  ? 357  ARG A O   1 
ATOM   1880  C  CB  . ARG A  1 250 ? 60.095  -13.081 132.478 1.00 25.54  ? 357  ARG A CB  1 
ATOM   1881  C  CG  . ARG A  1 250 ? 58.972  -13.724 131.635 1.00 26.60  ? 357  ARG A CG  1 
ATOM   1882  C  CD  . ARG A  1 250 ? 59.463  -14.688 130.574 1.00 26.97  ? 357  ARG A CD  1 
ATOM   1883  N  NE  . ARG A  1 250 ? 58.880  -16.013 130.785 1.00 32.83  ? 357  ARG A NE  1 
ATOM   1884  C  CZ  . ARG A  1 250 ? 57.780  -16.472 130.191 1.00 32.85  ? 357  ARG A CZ  1 
ATOM   1885  N  NH1 . ARG A  1 250 ? 57.337  -17.692 130.468 1.00 33.94  ? 357  ARG A NH1 1 
ATOM   1886  N  NH2 . ARG A  1 250 ? 57.134  -15.731 129.304 1.00 33.39  ? 357  ARG A NH2 1 
ATOM   1887  N  N   . GLN A  1 251 ? 60.185  -10.383 135.006 1.00 26.30  ? 358  GLN A N   1 
ATOM   1888  C  CA  . GLN A  1 251 ? 61.049  -9.599  135.859 1.00 26.33  ? 358  GLN A CA  1 
ATOM   1889  C  C   . GLN A  1 251 ? 62.305  -9.103  135.182 1.00 26.60  ? 358  GLN A C   1 
ATOM   1890  O  O   . GLN A  1 251 ? 63.334  -8.901  135.827 1.00 27.85  ? 358  GLN A O   1 
ATOM   1891  C  CB  . GLN A  1 251 ? 61.377  -10.451 137.069 1.00 27.02  ? 358  GLN A CB  1 
ATOM   1892  C  CG  . GLN A  1 251 ? 60.148  -11.203 137.550 1.00 28.52  ? 358  GLN A CG  1 
ATOM   1893  C  CD  . GLN A  1 251 ? 60.349  -11.812 138.901 1.00 30.25  ? 358  GLN A CD  1 
ATOM   1894  O  OE1 . GLN A  1 251 ? 59.710  -11.409 139.882 1.00 32.88  ? 358  GLN A OE1 1 
ATOM   1895  N  NE2 . GLN A  1 251 ? 61.248  -12.782 138.978 1.00 31.06  ? 358  GLN A NE2 1 
ATOM   1896  N  N   . LYS A  1 252 ? 62.220  -8.889  133.878 1.00 26.53  ? 359  LYS A N   1 
ATOM   1897  C  CA  . LYS A  1 252 ? 63.376  -8.405  133.142 1.00 27.98  ? 359  LYS A CA  1 
ATOM   1898  C  C   . LYS A  1 252 ? 63.311  -6.903  132.904 1.00 27.30  ? 359  LYS A C   1 
ATOM   1899  O  O   . LYS A  1 252 ? 62.363  -6.226  133.310 1.00 26.66  ? 359  LYS A O   1 
ATOM   1900  C  CB  . LYS A  1 252 ? 63.509  -9.137  131.801 1.00 28.86  ? 359  LYS A CB  1 
ATOM   1901  C  CG  . LYS A  1 252 ? 63.358  -10.637 131.933 1.00 32.29  ? 359  LYS A CG  1 
ATOM   1902  C  CD  . LYS A  1 252 ? 64.172  -11.397 130.910 1.00 34.89  ? 359  LYS A CD  1 
ATOM   1903  C  CE  . LYS A  1 252 ? 65.593  -11.623 131.413 1.00 38.40  ? 359  LYS A CE  1 
ATOM   1904  N  NZ  . LYS A  1 252 ? 66.395  -12.473 130.467 1.00 40.78  ? 359  LYS A NZ  1 
ATOM   1905  N  N   . CYS A  1 253 ? 64.339  -6.396  132.237 1.00 27.07  ? 360  CYS A N   1 
ATOM   1906  C  CA  . CYS A  1 253 ? 64.445  -4.988  131.921 1.00 27.74  ? 360  CYS A CA  1 
ATOM   1907  C  C   . CYS A  1 253 ? 64.736  -4.899  130.426 1.00 26.46  ? 360  CYS A C   1 
ATOM   1908  O  O   . CYS A  1 253 ? 65.586  -5.622  129.914 1.00 28.23  ? 360  CYS A O   1 
ATOM   1909  C  CB  . CYS A  1 253 ? 65.580  -4.389  132.749 1.00 29.11  ? 360  CYS A CB  1 
ATOM   1910  S  SG  . CYS A  1 253 ? 65.975  -2.636  132.483 1.00 33.24  ? 360  CYS A SG  1 
ATOM   1911  N  N   . THR A  1 254 ? 64.020  -4.038  129.716 1.00 24.47  ? 361  THR A N   1 
ATOM   1912  C  CA  . THR A  1 254 ? 64.240  -3.910  128.284 1.00 23.50  ? 361  THR A CA  1 
ATOM   1913  C  C   . THR A  1 254 ? 64.660  -2.505  127.901 1.00 23.36  ? 361  THR A C   1 
ATOM   1914  O  O   . THR A  1 254 ? 64.260  -1.530  128.538 1.00 23.80  ? 361  THR A O   1 
ATOM   1915  C  CB  . THR A  1 254 ? 62.963  -4.294  127.458 1.00 23.25  ? 361  THR A CB  1 
ATOM   1916  O  OG1 . THR A  1 254 ? 63.211  -4.092  126.061 1.00 22.39  ? 361  THR A OG1 1 
ATOM   1917  C  CG2 . THR A  1 254 ? 61.785  -3.442  127.850 1.00 21.70  ? 361  THR A CG2 1 
ATOM   1918  N  N   . GLU A  1 255 ? 65.471  -2.414  126.855 1.00 23.14  ? 362  GLU A N   1 
ATOM   1919  C  CA  . GLU A  1 255 ? 65.942  -1.130  126.358 1.00 25.46  ? 362  GLU A CA  1 
ATOM   1920  C  C   . GLU A  1 255 ? 65.414  -0.942  124.956 1.00 25.14  ? 362  GLU A C   1 
ATOM   1921  O  O   . GLU A  1 255 ? 65.842  -0.034  124.234 1.00 25.72  ? 362  GLU A O   1 
ATOM   1922  C  CB  . GLU A  1 255 ? 67.461  -1.099  126.297 1.00 27.18  ? 362  GLU A CB  1 
ATOM   1923  C  CG  . GLU A  1 255 ? 68.146  -1.089  127.641 1.00 31.16  ? 362  GLU A CG  1 
ATOM   1924  C  CD  . GLU A  1 255 ? 69.640  -1.267  127.515 1.00 33.30  ? 362  GLU A CD  1 
ATOM   1925  O  OE1 . GLU A  1 255 ? 70.283  -0.515  126.746 1.00 34.66  ? 362  GLU A OE1 1 
ATOM   1926  O  OE2 . GLU A  1 255 ? 70.169  -2.165  128.193 1.00 35.74  ? 362  GLU A OE2 1 
ATOM   1927  N  N   . SER A  1 256 ? 64.484  -1.804  124.562 1.00 24.71  ? 363  SER A N   1 
ATOM   1928  C  CA  . SER A  1 256 ? 63.944  -1.705  123.223 1.00 24.39  ? 363  SER A CA  1 
ATOM   1929  C  C   . SER A  1 256 ? 62.424  -1.637  123.097 1.00 23.84  ? 363  SER A C   1 
ATOM   1930  O  O   . SER A  1 256 ? 61.840  -2.298  122.241 1.00 24.53  ? 363  SER A O   1 
ATOM   1931  C  CB  . SER A  1 256 ? 64.500  -2.849  122.371 1.00 24.49  ? 363  SER A CB  1 
ATOM   1932  O  OG  . SER A  1 256 ? 64.401  -4.076  123.058 1.00 25.08  ? 363  SER A OG  1 
ATOM   1933  N  N   . HIS A  1 257 ? 61.776  -0.847  123.947 1.00 22.69  ? 364  HIS A N   1 
ATOM   1934  C  CA  . HIS A  1 257 ? 60.335  -0.702  123.835 1.00 20.83  ? 364  HIS A CA  1 
ATOM   1935  C  C   . HIS A  1 257 ? 60.162  0.307   122.704 1.00 20.85  ? 364  HIS A C   1 
ATOM   1936  O  O   . HIS A  1 257 ? 60.924  1.273   122.592 1.00 20.41  ? 364  HIS A O   1 
ATOM   1937  C  CB  . HIS A  1 257 ? 59.719  -0.155  125.108 1.00 20.31  ? 364  HIS A CB  1 
ATOM   1938  C  CG  . HIS A  1 257 ? 58.230  -0.230  125.121 1.00 20.75  ? 364  HIS A CG  1 
ATOM   1939  N  ND1 . HIS A  1 257 ? 57.453  0.480   126.011 1.00 21.29  ? 364  HIS A ND1 1 
ATOM   1940  C  CD2 . HIS A  1 257 ? 57.370  -0.955  124.365 1.00 21.17  ? 364  HIS A CD2 1 
ATOM   1941  C  CE1 . HIS A  1 257 ? 56.179  0.196   125.804 1.00 21.17  ? 364  HIS A CE1 1 
ATOM   1942  N  NE2 . HIS A  1 257 ? 56.102  -0.674  124.812 1.00 21.77  ? 364  HIS A NE2 1 
ATOM   1943  N  N   . THR A  1 258 ? 59.153  0.096   121.870 1.00 20.21  ? 365  THR A N   1 
ATOM   1944  C  CA  . THR A  1 258 ? 58.958  0.954   120.713 1.00 19.07  ? 365  THR A CA  1 
ATOM   1945  C  C   . THR A  1 258 ? 57.519  1.380   120.482 1.00 18.71  ? 365  THR A C   1 
ATOM   1946  O  O   . THR A  1 258 ? 56.611  0.986   121.217 1.00 18.28  ? 365  THR A O   1 
ATOM   1947  C  CB  . THR A  1 258 ? 59.415  0.214   119.441 1.00 19.43  ? 365  THR A CB  1 
ATOM   1948  O  OG1 . THR A  1 258 ? 58.619  -0.970  119.287 1.00 19.38  ? 365  THR A OG1 1 
ATOM   1949  C  CG2 . THR A  1 258 ? 60.893  -0.198  119.542 1.00 17.82  ? 365  THR A CG2 1 
ATOM   1950  N  N   . GLY A  1 259 ? 57.339  2.184   119.434 1.00 17.53  ? 366  GLY A N   1 
ATOM   1951  C  CA  . GLY A  1 259 ? 56.024  2.642   119.024 1.00 16.88  ? 366  GLY A CA  1 
ATOM   1952  C  C   . GLY A  1 259 ? 55.340  3.694   119.867 1.00 17.32  ? 366  GLY A C   1 
ATOM   1953  O  O   . GLY A  1 259 ? 55.879  4.153   120.871 1.00 18.90  ? 366  GLY A O   1 
ATOM   1954  N  N   . THR A  1 260 ? 54.138  4.082   119.455 1.00 16.27  ? 367  THR A N   1 
ATOM   1955  C  CA  . THR A  1 260 ? 53.391  5.080   120.192 1.00 15.53  ? 367  THR A CA  1 
ATOM   1956  C  C   . THR A  1 260 ? 52.945  4.534   121.546 1.00 15.20  ? 367  THR A C   1 
ATOM   1957  O  O   . THR A  1 260 ? 52.476  5.284   122.392 1.00 14.29  ? 367  THR A O   1 
ATOM   1958  C  CB  . THR A  1 260 ? 52.158  5.577   119.397 1.00 15.08  ? 367  THR A CB  1 
ATOM   1959  O  OG1 . THR A  1 260 ? 51.351  4.464   119.004 1.00 15.09  ? 367  THR A OG1 1 
ATOM   1960  C  CG2 . THR A  1 260 ? 52.594  6.349   118.161 1.00 14.55  ? 367  THR A CG2 1 
ATOM   1961  N  N   . SER A  1 261 ? 53.099  3.231   121.751 1.00 14.58  ? 368  SER A N   1 
ATOM   1962  C  CA  . SER A  1 261 ? 52.716  2.628   123.017 1.00 15.72  ? 368  SER A CA  1 
ATOM   1963  C  C   . SER A  1 261 ? 53.657  3.056   124.117 1.00 16.44  ? 368  SER A C   1 
ATOM   1964  O  O   . SER A  1 261 ? 53.323  2.945   125.287 1.00 18.75  ? 368  SER A O   1 
ATOM   1965  C  CB  . SER A  1 261 ? 52.725  1.102   122.927 1.00 15.26  ? 368  SER A CB  1 
ATOM   1966  O  OG  . SER A  1 261 ? 51.552  0.634   122.292 1.00 15.74  ? 368  SER A OG  1 
ATOM   1967  N  N   . ALA A  1 262 ? 54.844  3.514   123.747 1.00 16.06  ? 369  ALA A N   1 
ATOM   1968  C  CA  . ALA A  1 262 ? 55.811  3.961   124.738 1.00 17.15  ? 369  ALA A CA  1 
ATOM   1969  C  C   . ALA A  1 262 ? 55.559  5.435   125.036 1.00 18.45  ? 369  ALA A C   1 
ATOM   1970  O  O   . ALA A  1 262 ? 55.836  5.905   126.136 1.00 19.25  ? 369  ALA A O   1 
ATOM   1971  C  CB  . ALA A  1 262 ? 57.227  3.772   124.220 1.00 17.68  ? 369  ALA A CB  1 
ATOM   1972  N  N   . SER A  1 263 ? 55.020  6.153   124.051 1.00 18.35  ? 370  SER A N   1 
ATOM   1973  C  CA  . SER A  1 263 ? 54.736  7.576   124.197 1.00 17.57  ? 370  SER A CA  1 
ATOM   1974  C  C   . SER A  1 263 ? 53.566  7.896   125.104 1.00 17.45  ? 370  SER A C   1 
ATOM   1975  O  O   . SER A  1 263 ? 53.631  8.848   125.874 1.00 19.63  ? 370  SER A O   1 
ATOM   1976  C  CB  . SER A  1 263 ? 54.473  8.227   122.840 1.00 17.06  ? 370  SER A CB  1 
ATOM   1977  O  OG  . SER A  1 263 ? 55.650  8.315   122.060 1.00 18.85  ? 370  SER A OG  1 
ATOM   1978  N  N   . ALA A  1 264 ? 52.492  7.124   125.017 1.00 16.90  ? 371  ALA A N   1 
ATOM   1979  C  CA  . ALA A  1 264 ? 51.322  7.401   125.843 1.00 16.53  ? 371  ALA A CA  1 
ATOM   1980  C  C   . ALA A  1 264 ? 51.630  7.327   127.342 1.00 16.12  ? 371  ALA A C   1 
ATOM   1981  O  O   . ALA A  1 264 ? 51.312  8.251   128.080 1.00 17.18  ? 371  ALA A O   1 
ATOM   1982  C  CB  . ALA A  1 264 ? 50.180  6.456   125.474 1.00 14.50  ? 371  ALA A CB  1 
ATOM   1983  N  N   . PRO A  1 265 ? 52.245  6.225   127.815 1.00 16.13  ? 372  PRO A N   1 
ATOM   1984  C  CA  . PRO A  1 265 ? 52.552  6.141   129.247 1.00 15.95  ? 372  PRO A CA  1 
ATOM   1985  C  C   . PRO A  1 265 ? 53.539  7.226   129.707 1.00 16.28  ? 372  PRO A C   1 
ATOM   1986  O  O   . PRO A  1 265 ? 53.436  7.724   130.832 1.00 15.42  ? 372  PRO A O   1 
ATOM   1987  C  CB  . PRO A  1 265 ? 53.092  4.717   129.412 1.00 14.99  ? 372  PRO A CB  1 
ATOM   1988  C  CG  . PRO A  1 265 ? 53.587  4.360   128.059 1.00 14.86  ? 372  PRO A CG  1 
ATOM   1989  C  CD  . PRO A  1 265 ? 52.566  4.959   127.137 1.00 15.88  ? 372  PRO A CD  1 
ATOM   1990  N  N   . LEU A  1 266 ? 54.489  7.594   128.848 1.00 15.15  ? 373  LEU A N   1 
ATOM   1991  C  CA  . LEU A  1 266 ? 55.429  8.650   129.204 1.00 15.49  ? 373  LEU A CA  1 
ATOM   1992  C  C   . LEU A  1 266 ? 54.618  9.933   129.426 1.00 15.59  ? 373  LEU A C   1 
ATOM   1993  O  O   . LEU A  1 266 ? 54.895  10.704  130.349 1.00 17.09  ? 373  LEU A O   1 
ATOM   1994  C  CB  . LEU A  1 266 ? 56.466  8.861   128.089 1.00 13.64  ? 373  LEU A CB  1 
ATOM   1995  C  CG  . LEU A  1 266 ? 57.555  7.786   127.976 1.00 14.46  ? 373  LEU A CG  1 
ATOM   1996  C  CD1 . LEU A  1 266 ? 58.460  8.086   126.797 1.00 12.69  ? 373  LEU A CD1 1 
ATOM   1997  C  CD2 . LEU A  1 266 ? 58.365  7.729   129.266 1.00 13.06  ? 373  LEU A CD2 1 
ATOM   1998  N  N   . ALA A  1 267 ? 53.610  10.155  128.585 1.00 14.43  ? 374  ALA A N   1 
ATOM   1999  C  CA  . ALA A  1 267 ? 52.763  11.336  128.718 1.00 13.83  ? 374  ALA A CA  1 
ATOM   2000  C  C   . ALA A  1 267 ? 51.933  11.226  129.991 1.00 14.49  ? 374  ALA A C   1 
ATOM   2001  O  O   . ALA A  1 267 ? 51.725  12.216  130.692 1.00 17.59  ? 374  ALA A O   1 
ATOM   2002  C  CB  . ALA A  1 267 ? 51.854  11.487  127.507 1.00 11.09  ? 374  ALA A CB  1 
ATOM   2003  N  N   . ALA A  1 268 ? 51.456  10.026  130.298 1.00 13.84  ? 375  ALA A N   1 
ATOM   2004  C  CA  . ALA A  1 268 ? 50.664  9.830   131.505 1.00 14.25  ? 375  ALA A CA  1 
ATOM   2005  C  C   . ALA A  1 268 ? 51.501  10.177  132.731 1.00 14.41  ? 375  ALA A C   1 
ATOM   2006  O  O   . ALA A  1 268 ? 51.000  10.763  133.683 1.00 14.14  ? 375  ALA A O   1 
ATOM   2007  C  CB  . ALA A  1 268 ? 50.189  8.399   131.589 1.00 13.47  ? 375  ALA A CB  1 
ATOM   2008  N  N   . GLY A  1 269 ? 52.778  9.804   132.702 1.00 15.04  ? 376  GLY A N   1 
ATOM   2009  C  CA  . GLY A  1 269 ? 53.668  10.105  133.808 1.00 14.48  ? 376  GLY A CA  1 
ATOM   2010  C  C   . GLY A  1 269 ? 53.807  11.607  133.970 1.00 15.35  ? 376  GLY A C   1 
ATOM   2011  O  O   . GLY A  1 269 ? 53.671  12.139  135.076 1.00 16.54  ? 376  GLY A O   1 
ATOM   2012  N  N   . ILE A  1 270 ? 54.061  12.298  132.864 1.00 14.60  ? 377  ILE A N   1 
ATOM   2013  C  CA  . ILE A  1 270 ? 54.204  13.744  132.897 1.00 14.73  ? 377  ILE A CA  1 
ATOM   2014  C  C   . ILE A  1 270 ? 52.916  14.392  133.389 1.00 15.70  ? 377  ILE A C   1 
ATOM   2015  O  O   . ILE A  1 270 ? 52.941  15.417  134.081 1.00 17.30  ? 377  ILE A O   1 
ATOM   2016  C  CB  . ILE A  1 270 ? 54.558  14.295  131.507 1.00 13.74  ? 377  ILE A CB  1 
ATOM   2017  C  CG1 . ILE A  1 270 ? 55.945  13.791  131.095 1.00 12.59  ? 377  ILE A CG1 1 
ATOM   2018  C  CG2 . ILE A  1 270 ? 54.472  15.816  131.514 1.00 12.90  ? 377  ILE A CG2 1 
ATOM   2019  C  CD1 . ILE A  1 270 ? 56.444  14.344  129.773 1.00 12.21  ? 377  ILE A CD1 1 
ATOM   2020  N  N   . ILE A  1 271 ? 51.784  13.797  133.036 1.00 14.93  ? 378  ILE A N   1 
ATOM   2021  C  CA  . ILE A  1 271 ? 50.502  14.339  133.469 1.00 14.36  ? 378  ILE A CA  1 
ATOM   2022  C  C   . ILE A  1 271 ? 50.309  14.050  134.957 1.00 13.77  ? 378  ILE A C   1 
ATOM   2023  O  O   . ILE A  1 271 ? 49.614  14.777  135.654 1.00 14.27  ? 378  ILE A O   1 
ATOM   2024  C  CB  . ILE A  1 271 ? 49.351  13.766  132.601 1.00 13.25  ? 378  ILE A CB  1 
ATOM   2025  C  CG1 . ILE A  1 271 ? 49.459  14.367  131.192 1.00 14.17  ? 378  ILE A CG1 1 
ATOM   2026  C  CG2 . ILE A  1 271 ? 48.004  14.103  133.191 1.00 11.20  ? 378  ILE A CG2 1 
ATOM   2027  C  CD1 . ILE A  1 271 ? 48.499  13.801  130.188 1.00 14.55  ? 378  ILE A CD1 1 
ATOM   2028  N  N   . ALA A  1 272 ? 50.955  12.998  135.447 1.00 13.79  ? 379  ALA A N   1 
ATOM   2029  C  CA  . ALA A  1 272 ? 50.873  12.653  136.858 1.00 13.33  ? 379  ALA A CA  1 
ATOM   2030  C  C   . ALA A  1 272 ? 51.636  13.714  137.655 1.00 13.57  ? 379  ALA A C   1 
ATOM   2031  O  O   . ALA A  1 272 ? 51.183  14.142  138.709 1.00 15.29  ? 379  ALA A O   1 
ATOM   2032  C  CB  . ALA A  1 272 ? 51.477  11.286  137.102 1.00 12.61  ? 379  ALA A CB  1 
ATOM   2033  N  N   . LEU A  1 273 ? 52.791  14.137  137.155 1.00 12.73  ? 380  LEU A N   1 
ATOM   2034  C  CA  . LEU A  1 273 ? 53.576  15.165  137.832 1.00 13.19  ? 380  LEU A CA  1 
ATOM   2035  C  C   . LEU A  1 273 ? 52.774  16.468  137.867 1.00 14.98  ? 380  LEU A C   1 
ATOM   2036  O  O   . LEU A  1 273 ? 52.741  17.178  138.878 1.00 15.78  ? 380  LEU A O   1 
ATOM   2037  C  CB  . LEU A  1 273 ? 54.891  15.417  137.094 1.00 12.11  ? 380  LEU A CB  1 
ATOM   2038  C  CG  . LEU A  1 273 ? 55.782  14.204  136.809 1.00 12.16  ? 380  LEU A CG  1 
ATOM   2039  C  CD1 . LEU A  1 273 ? 57.074  14.659  136.181 1.00 10.04  ? 380  LEU A CD1 1 
ATOM   2040  C  CD2 . LEU A  1 273 ? 56.052  13.443  138.096 1.00 11.16  ? 380  LEU A CD2 1 
ATOM   2041  N  N   . THR A  1 274 ? 52.125  16.781  136.755 1.00 14.14  ? 381  THR A N   1 
ATOM   2042  C  CA  . THR A  1 274 ? 51.335  17.988  136.671 1.00 14.36  ? 381  THR A CA  1 
ATOM   2043  C  C   . THR A  1 274 ? 50.192  17.963  137.682 1.00 16.03  ? 381  THR A C   1 
ATOM   2044  O  O   . THR A  1 274 ? 49.881  18.980  138.296 1.00 16.67  ? 381  THR A O   1 
ATOM   2045  C  CB  . THR A  1 274 ? 50.799  18.171  135.241 1.00 13.71  ? 381  THR A CB  1 
ATOM   2046  O  OG1 . THR A  1 274 ? 51.898  18.089  134.328 1.00 13.05  ? 381  THR A OG1 1 
ATOM   2047  C  CG2 . THR A  1 274 ? 50.140  19.519  135.062 1.00 10.46  ? 381  THR A CG2 1 
ATOM   2048  N  N   . LEU A  1 275 ? 49.568  16.808  137.875 1.00 17.23  ? 382  LEU A N   1 
ATOM   2049  C  CA  . LEU A  1 275 ? 48.474  16.717  138.836 1.00 18.91  ? 382  LEU A CA  1 
ATOM   2050  C  C   . LEU A  1 275 ? 48.957  16.890  140.273 1.00 20.15  ? 382  LEU A C   1 
ATOM   2051  O  O   . LEU A  1 275 ? 48.247  17.446  141.113 1.00 21.77  ? 382  LEU A O   1 
ATOM   2052  C  CB  . LEU A  1 275 ? 47.751  15.381  138.718 1.00 19.25  ? 382  LEU A CB  1 
ATOM   2053  C  CG  . LEU A  1 275 ? 46.491  15.354  137.863 1.00 19.81  ? 382  LEU A CG  1 
ATOM   2054  C  CD1 . LEU A  1 275 ? 45.818  14.001  138.018 1.00 20.45  ? 382  LEU A CD1 1 
ATOM   2055  C  CD2 . LEU A  1 275 ? 45.548  16.440  138.298 1.00 19.63  ? 382  LEU A CD2 1 
ATOM   2056  N  N   . GLU A  1 276 ? 50.150  16.393  140.572 1.00 20.47  ? 383  GLU A N   1 
ATOM   2057  C  CA  . GLU A  1 276 ? 50.677  16.549  141.914 1.00 21.11  ? 383  GLU A CA  1 
ATOM   2058  C  C   . GLU A  1 276 ? 50.849  18.044  142.164 1.00 21.05  ? 383  GLU A C   1 
ATOM   2059  O  O   . GLU A  1 276 ? 50.532  18.538  143.245 1.00 22.86  ? 383  GLU A O   1 
ATOM   2060  C  CB  . GLU A  1 276 ? 52.021  15.832  142.065 1.00 22.75  ? 383  GLU A CB  1 
ATOM   2061  C  CG  . GLU A  1 276 ? 52.639  15.988  143.459 1.00 25.54  ? 383  GLU A CG  1 
ATOM   2062  C  CD  . GLU A  1 276 ? 53.929  15.192  143.648 1.00 27.24  ? 383  GLU A CD  1 
ATOM   2063  O  OE1 . GLU A  1 276 ? 54.581  14.850  142.632 1.00 29.52  ? 383  GLU A OE1 1 
ATOM   2064  O  OE2 . GLU A  1 276 ? 54.301  14.923  144.814 1.00 26.29  ? 383  GLU A OE2 1 
ATOM   2065  N  N   . ALA A  1 277 ? 51.328  18.764  141.153 1.00 19.42  ? 384  ALA A N   1 
ATOM   2066  C  CA  . ALA A  1 277 ? 51.535  20.193  141.269 1.00 18.12  ? 384  ALA A CA  1 
ATOM   2067  C  C   . ALA A  1 277 ? 50.225  20.960  141.430 1.00 19.17  ? 384  ALA A C   1 
ATOM   2068  O  O   . ALA A  1 277 ? 50.214  22.083  141.925 1.00 20.59  ? 384  ALA A O   1 
ATOM   2069  C  CB  . ALA A  1 277 ? 52.291  20.699  140.069 1.00 17.59  ? 384  ALA A CB  1 
ATOM   2070  N  N   . ASN A  1 278 ? 49.119  20.361  141.010 1.00 19.38  ? 385  ASN A N   1 
ATOM   2071  C  CA  . ASN A  1 278 ? 47.814  21.006  141.138 1.00 18.77  ? 385  ASN A CA  1 
ATOM   2072  C  C   . ASN A  1 278 ? 46.714  19.966  140.975 1.00 19.19  ? 385  ASN A C   1 
ATOM   2073  O  O   . ASN A  1 278 ? 46.224  19.719  139.881 1.00 19.19  ? 385  ASN A O   1 
ATOM   2074  C  CB  . ASN A  1 278 ? 47.643  22.107  140.093 1.00 17.22  ? 385  ASN A CB  1 
ATOM   2075  C  CG  . ASN A  1 278 ? 46.370  22.905  140.297 1.00 16.22  ? 385  ASN A CG  1 
ATOM   2076  O  OD1 . ASN A  1 278 ? 45.457  22.478  141.006 1.00 14.75  ? 385  ASN A OD1 1 
ATOM   2077  N  ND2 . ASN A  1 278 ? 46.298  24.062  139.667 1.00 15.96  ? 385  ASN A ND2 1 
ATOM   2078  N  N   . LYS A  1 279 ? 46.329  19.366  142.089 1.00 21.19  ? 386  LYS A N   1 
ATOM   2079  C  CA  . LYS A  1 279 ? 45.306  18.330  142.124 1.00 22.39  ? 386  LYS A CA  1 
ATOM   2080  C  C   . LYS A  1 279 ? 43.926  18.765  141.669 1.00 23.23  ? 386  LYS A C   1 
ATOM   2081  O  O   . LYS A  1 279 ? 43.049  17.924  141.501 1.00 24.13  ? 386  LYS A O   1 
ATOM   2082  C  CB  . LYS A  1 279 ? 45.194  17.785  143.547 1.00 22.45  ? 386  LYS A CB  1 
ATOM   2083  C  CG  . LYS A  1 279 ? 46.498  17.226  144.106 1.00 26.11  ? 386  LYS A CG  1 
ATOM   2084  C  CD  . LYS A  1 279 ? 46.639  15.737  143.853 1.00 27.36  ? 386  LYS A CD  1 
ATOM   2085  C  CE  . LYS A  1 279 ? 45.612  14.960  144.669 1.00 28.51  ? 386  LYS A CE  1 
ATOM   2086  N  NZ  . LYS A  1 279 ? 45.626  13.513  144.355 1.00 29.73  ? 386  LYS A NZ  1 
ATOM   2087  N  N   . ASN A  1 280 ? 43.717  20.062  141.469 1.00 23.78  ? 387  ASN A N   1 
ATOM   2088  C  CA  . ASN A  1 280 ? 42.398  20.532  141.080 1.00 23.89  ? 387  ASN A CA  1 
ATOM   2089  C  C   . ASN A  1 280 ? 42.178  20.832  139.612 1.00 21.71  ? 387  ASN A C   1 
ATOM   2090  O  O   . ASN A  1 280 ? 41.161  21.414  139.244 1.00 21.94  ? 387  ASN A O   1 
ATOM   2091  C  CB  . ASN A  1 280 ? 42.029  21.734  141.939 1.00 27.13  ? 387  ASN A CB  1 
ATOM   2092  C  CG  . ASN A  1 280 ? 41.877  21.355  143.383 1.00 32.01  ? 387  ASN A CG  1 
ATOM   2093  O  OD1 . ASN A  1 280 ? 41.461  20.240  143.670 1.00 32.91  ? 387  ASN A OD1 1 
ATOM   2094  N  ND2 . ASN A  1 280 ? 42.190  22.254  144.305 1.00 39.10  ? 387  ASN A ND2 1 
ATOM   2095  N  N   . LEU A  1 281 ? 43.121  20.423  138.775 1.00 18.65  ? 388  LEU A N   1 
ATOM   2096  C  CA  . LEU A  1 281 ? 42.997  20.648  137.346 1.00 17.33  ? 388  LEU A CA  1 
ATOM   2097  C  C   . LEU A  1 281 ? 41.890  19.746  136.791 1.00 16.71  ? 388  LEU A C   1 
ATOM   2098  O  O   . LEU A  1 281 ? 41.815  18.569  137.139 1.00 16.81  ? 388  LEU A O   1 
ATOM   2099  C  CB  . LEU A  1 281 ? 44.326  20.323  136.663 1.00 15.60  ? 388  LEU A CB  1 
ATOM   2100  C  CG  . LEU A  1 281 ? 45.546  21.141  137.078 1.00 15.24  ? 388  LEU A CG  1 
ATOM   2101  C  CD1 . LEU A  1 281 ? 46.823  20.448  136.605 1.00 13.77  ? 388  LEU A CD1 1 
ATOM   2102  C  CD2 . LEU A  1 281 ? 45.449  22.536  136.499 1.00 13.40  ? 388  LEU A CD2 1 
ATOM   2103  N  N   . THR A  1 282 ? 41.025  20.289  135.940 1.00 15.28  ? 389  THR A N   1 
ATOM   2104  C  CA  . THR A  1 282 ? 39.964  19.481  135.350 1.00 14.79  ? 389  THR A CA  1 
ATOM   2105  C  C   . THR A  1 282 ? 40.534  18.783  134.127 1.00 15.07  ? 389  THR A C   1 
ATOM   2106  O  O   . THR A  1 282 ? 41.655  19.088  133.713 1.00 16.09  ? 389  THR A O   1 
ATOM   2107  C  CB  . THR A  1 282 ? 38.784  20.346  134.909 1.00 15.18  ? 389  THR A CB  1 
ATOM   2108  O  OG1 . THR A  1 282 ? 39.182  21.185  133.814 1.00 11.55  ? 389  THR A OG1 1 
ATOM   2109  C  CG2 . THR A  1 282 ? 38.311  21.209  136.069 1.00 14.08  ? 389  THR A CG2 1 
ATOM   2110  N  N   . TRP A  1 283 ? 39.775  17.849  133.551 1.00 14.95  ? 390  TRP A N   1 
ATOM   2111  C  CA  . TRP A  1 283 ? 40.234  17.127  132.364 1.00 13.10  ? 390  TRP A CA  1 
ATOM   2112  C  C   . TRP A  1 283 ? 40.500  18.118  131.236 1.00 12.95  ? 390  TRP A C   1 
ATOM   2113  O  O   . TRP A  1 283 ? 41.360  17.887  130.388 1.00 13.80  ? 390  TRP A O   1 
ATOM   2114  C  CB  . TRP A  1 283 ? 39.206  16.070  131.919 1.00 11.77  ? 390  TRP A CB  1 
ATOM   2115  C  CG  . TRP A  1 283 ? 37.892  16.606  131.405 1.00 9.63   ? 390  TRP A CG  1 
ATOM   2116  C  CD1 . TRP A  1 283 ? 36.826  17.012  132.144 1.00 10.14  ? 390  TRP A CD1 1 
ATOM   2117  C  CD2 . TRP A  1 283 ? 37.513  16.770  130.035 1.00 8.60   ? 390  TRP A CD2 1 
ATOM   2118  N  NE1 . TRP A  1 283 ? 35.802  17.417  131.324 1.00 9.07   ? 390  TRP A NE1 1 
ATOM   2119  C  CE2 . TRP A  1 283 ? 36.199  17.279  130.022 1.00 8.70   ? 390  TRP A CE2 1 
ATOM   2120  C  CE3 . TRP A  1 283 ? 38.158  16.533  128.815 1.00 8.95   ? 390  TRP A CE3 1 
ATOM   2121  C  CZ2 . TRP A  1 283 ? 35.510  17.554  128.837 1.00 9.13   ? 390  TRP A CZ2 1 
ATOM   2122  C  CZ3 . TRP A  1 283 ? 37.472  16.804  127.633 1.00 9.37   ? 390  TRP A CZ3 1 
ATOM   2123  C  CH2 . TRP A  1 283 ? 36.160  17.307  127.657 1.00 9.13   ? 390  TRP A CH2 1 
ATOM   2124  N  N   . ARG A  1 284 ? 39.763  19.224  131.228 1.00 11.37  ? 391  ARG A N   1 
ATOM   2125  C  CA  . ARG A  1 284 ? 39.964  20.238  130.198 1.00 12.82  ? 391  ARG A CA  1 
ATOM   2126  C  C   . ARG A  1 284 ? 41.183  21.110  130.527 1.00 12.14  ? 391  ARG A C   1 
ATOM   2127  O  O   . ARG A  1 284 ? 41.973  21.455  129.642 1.00 10.69  ? 391  ARG A O   1 
ATOM   2128  C  CB  . ARG A  1 284 ? 38.718  21.121  130.033 1.00 11.21  ? 391  ARG A CB  1 
ATOM   2129  C  CG  . ARG A  1 284 ? 37.604  20.484  129.221 1.00 13.28  ? 391  ARG A CG  1 
ATOM   2130  C  CD  . ARG A  1 284 ? 36.699  21.548  128.648 1.00 12.78  ? 391  ARG A CD  1 
ATOM   2131  N  NE  . ARG A  1 284 ? 36.041  22.266  129.722 1.00 15.43  ? 391  ARG A NE  1 
ATOM   2132  C  CZ  . ARG A  1 284 ? 35.836  23.576  129.742 1.00 13.45  ? 391  ARG A CZ  1 
ATOM   2133  N  NH1 . ARG A  1 284 ? 35.226  24.113  130.781 1.00 14.81  ? 391  ARG A NH1 1 
ATOM   2134  N  NH2 . ARG A  1 284 ? 36.228  24.337  128.736 1.00 10.52  ? 391  ARG A NH2 1 
ATOM   2135  N  N   . ASP A  1 285 ? 41.324  21.469  131.799 1.00 12.18  ? 392  ASP A N   1 
ATOM   2136  C  CA  . ASP A  1 285 ? 42.458  22.268  132.242 1.00 11.97  ? 392  ASP A CA  1 
ATOM   2137  C  C   . ASP A  1 285 ? 43.729  21.587  131.738 1.00 12.32  ? 392  ASP A C   1 
ATOM   2138  O  O   . ASP A  1 285 ? 44.616  22.235  131.174 1.00 11.76  ? 392  ASP A O   1 
ATOM   2139  C  CB  . ASP A  1 285 ? 42.509  22.337  133.772 1.00 12.49  ? 392  ASP A CB  1 
ATOM   2140  C  CG  . ASP A  1 285 ? 41.566  23.380  134.362 1.00 14.26  ? 392  ASP A CG  1 
ATOM   2141  O  OD1 . ASP A  1 285 ? 41.197  23.233  135.548 1.00 15.38  ? 392  ASP A OD1 1 
ATOM   2142  O  OD2 . ASP A  1 285 ? 41.201  24.355  133.669 1.00 15.29  ? 392  ASP A OD2 1 
ATOM   2143  N  N   . MET A  1 286 ? 43.796  20.270  131.928 1.00 13.43  ? 393  MET A N   1 
ATOM   2144  C  CA  . MET A  1 286 ? 44.956  19.487  131.523 1.00 13.54  ? 393  MET A CA  1 
ATOM   2145  C  C   . MET A  1 286 ? 45.273  19.623  130.051 1.00 14.30  ? 393  MET A C   1 
ATOM   2146  O  O   . MET A  1 286 ? 46.436  19.760  129.670 1.00 15.87  ? 393  MET A O   1 
ATOM   2147  C  CB  . MET A  1 286 ? 44.749  18.015  131.862 1.00 13.72  ? 393  MET A CB  1 
ATOM   2148  C  CG  . MET A  1 286 ? 46.023  17.183  131.813 1.00 16.07  ? 393  MET A CG  1 
ATOM   2149  S  SD  . MET A  1 286 ? 47.316  17.739  132.972 1.00 18.39  ? 393  MET A SD  1 
ATOM   2150  C  CE  . MET A  1 286 ? 46.615  17.214  134.524 1.00 15.55  ? 393  MET A CE  1 
ATOM   2151  N  N   . GLN A  1 287 ? 44.246  19.586  129.213 1.00 14.54  ? 394  GLN A N   1 
ATOM   2152  C  CA  . GLN A  1 287 ? 44.473  19.702  127.785 1.00 13.90  ? 394  GLN A CA  1 
ATOM   2153  C  C   . GLN A  1 287 ? 44.962  21.095  127.457 1.00 13.31  ? 394  GLN A C   1 
ATOM   2154  O  O   . GLN A  1 287 ? 45.809  21.267  126.587 1.00 14.32  ? 394  GLN A O   1 
ATOM   2155  C  CB  . GLN A  1 287 ? 43.201  19.334  127.014 1.00 12.94  ? 394  GLN A CB  1 
ATOM   2156  C  CG  . GLN A  1 287 ? 42.962  17.837  127.025 1.00 13.75  ? 394  GLN A CG  1 
ATOM   2157  C  CD  . GLN A  1 287 ? 41.845  17.395  126.123 1.00 13.00  ? 394  GLN A CD  1 
ATOM   2158  O  OE1 . GLN A  1 287 ? 41.701  17.890  125.016 1.00 13.76  ? 394  GLN A OE1 1 
ATOM   2159  N  NE2 . GLN A  1 287 ? 41.058  16.437  126.586 1.00 13.00  ? 394  GLN A NE2 1 
ATOM   2160  N  N   . HIS A  1 288 ? 44.447  22.089  128.171 1.00 12.66  ? 395  HIS A N   1 
ATOM   2161  C  CA  . HIS A  1 288 ? 44.880  23.462  127.960 1.00 13.19  ? 395  HIS A CA  1 
ATOM   2162  C  C   . HIS A  1 288 ? 46.371  23.596  128.293 1.00 13.84  ? 395  HIS A C   1 
ATOM   2163  O  O   . HIS A  1 288 ? 47.120  24.258  127.576 1.00 12.48  ? 395  HIS A O   1 
ATOM   2164  C  CB  . HIS A  1 288 ? 44.070  24.415  128.839 1.00 12.32  ? 395  HIS A CB  1 
ATOM   2165  C  CG  . HIS A  1 288 ? 42.764  24.839  128.240 1.00 9.58   ? 395  HIS A CG  1 
ATOM   2166  N  ND1 . HIS A  1 288 ? 42.667  25.822  127.282 1.00 8.85   ? 395  HIS A ND1 1 
ATOM   2167  C  CD2 . HIS A  1 288 ? 41.502  24.413  128.469 1.00 10.56  ? 395  HIS A CD2 1 
ATOM   2168  C  CE1 . HIS A  1 288 ? 41.400  25.985  126.945 1.00 8.82   ? 395  HIS A CE1 1 
ATOM   2169  N  NE2 . HIS A  1 288 ? 40.672  25.140  127.651 1.00 9.48   ? 395  HIS A NE2 1 
ATOM   2170  N  N   . LEU A  1 289 ? 46.802  22.955  129.378 1.00 14.43  ? 396  LEU A N   1 
ATOM   2171  C  CA  . LEU A  1 289 ? 48.198  23.028  129.773 1.00 14.86  ? 396  LEU A CA  1 
ATOM   2172  C  C   . LEU A  1 289 ? 49.099  22.405  128.719 1.00 16.10  ? 396  LEU A C   1 
ATOM   2173  O  O   . LEU A  1 289 ? 50.177  22.930  128.426 1.00 16.89  ? 396  LEU A O   1 
ATOM   2174  C  CB  . LEU A  1 289 ? 48.419  22.331  131.117 1.00 15.91  ? 396  LEU A CB  1 
ATOM   2175  C  CG  . LEU A  1 289 ? 47.775  22.953  132.362 1.00 15.16  ? 396  LEU A CG  1 
ATOM   2176  C  CD1 . LEU A  1 289 ? 48.017  22.097  133.584 1.00 14.53  ? 396  LEU A CD1 1 
ATOM   2177  C  CD2 . LEU A  1 289 ? 48.354  24.297  132.581 1.00 15.28  ? 396  LEU A CD2 1 
ATOM   2178  N  N   . VAL A  1 290 ? 48.667  21.283  128.149 1.00 16.57  ? 397  VAL A N   1 
ATOM   2179  C  CA  . VAL A  1 290 ? 49.460  20.619  127.127 1.00 15.07  ? 397  VAL A CA  1 
ATOM   2180  C  C   . VAL A  1 290 ? 49.597  21.524  125.913 1.00 15.15  ? 397  VAL A C   1 
ATOM   2181  O  O   . VAL A  1 290 ? 50.679  21.659  125.353 1.00 15.03  ? 397  VAL A O   1 
ATOM   2182  C  CB  . VAL A  1 290 ? 48.824  19.274  126.705 1.00 15.26  ? 397  VAL A CB  1 
ATOM   2183  C  CG1 . VAL A  1 290 ? 49.548  18.704  125.498 1.00 14.11  ? 397  VAL A CG1 1 
ATOM   2184  C  CG2 . VAL A  1 290 ? 48.910  18.290  127.856 1.00 13.96  ? 397  VAL A CG2 1 
ATOM   2185  N  N   . VAL A  1 291 ? 48.503  22.166  125.524 1.00 15.03  ? 398  VAL A N   1 
ATOM   2186  C  CA  . VAL A  1 291 ? 48.523  23.040  124.362 1.00 15.91  ? 398  VAL A CA  1 
ATOM   2187  C  C   . VAL A  1 291 ? 49.452  24.237  124.560 1.00 17.29  ? 398  VAL A C   1 
ATOM   2188  O  O   . VAL A  1 291 ? 50.195  24.634  123.654 1.00 18.07  ? 398  VAL A O   1 
ATOM   2189  C  CB  . VAL A  1 291 ? 47.105  23.569  124.035 1.00 14.79  ? 398  VAL A CB  1 
ATOM   2190  C  CG1 . VAL A  1 291 ? 47.172  24.607  122.927 1.00 13.73  ? 398  VAL A CG1 1 
ATOM   2191  C  CG2 . VAL A  1 291 ? 46.214  22.427  123.611 1.00 14.49  ? 398  VAL A CG2 1 
ATOM   2192  N  N   . GLN A  1 292 ? 49.415  24.812  125.751 1.00 17.42  ? 399  GLN A N   1 
ATOM   2193  C  CA  . GLN A  1 292 ? 50.226  25.981  126.041 1.00 18.83  ? 399  GLN A CA  1 
ATOM   2194  C  C   . GLN A  1 292 ? 51.705  25.743  126.297 1.00 19.16  ? 399  GLN A C   1 
ATOM   2195  O  O   . GLN A  1 292 ? 52.530  26.582  125.947 1.00 19.58  ? 399  GLN A O   1 
ATOM   2196  C  CB  . GLN A  1 292 ? 49.649  26.732  127.231 1.00 19.01  ? 399  GLN A CB  1 
ATOM   2197  C  CG  . GLN A  1 292 ? 48.344  27.399  126.945 1.00 23.51  ? 399  GLN A CG  1 
ATOM   2198  C  CD  . GLN A  1 292 ? 47.916  28.296  128.075 1.00 25.59  ? 399  GLN A CD  1 
ATOM   2199  O  OE1 . GLN A  1 292 ? 47.925  29.499  127.958 1.00 30.77  ? 399  GLN A OE1 1 
ATOM   2200  N  NE2 . GLN A  1 292 ? 47.554  27.709  129.180 1.00 29.66  ? 399  GLN A NE2 1 
ATOM   2201  N  N   . THR A  1 293 ? 52.044  24.614  126.910 1.00 18.46  ? 400  THR A N   1 
ATOM   2202  C  CA  . THR A  1 293 ? 53.434  24.315  127.218 1.00 17.87  ? 400  THR A CA  1 
ATOM   2203  C  C   . THR A  1 293 ? 54.208  23.460  126.203 1.00 17.87  ? 400  THR A C   1 
ATOM   2204  O  O   . THR A  1 293 ? 55.434  23.578  126.098 1.00 17.90  ? 400  THR A O   1 
ATOM   2205  C  CB  . THR A  1 293 ? 53.547  23.640  128.614 1.00 18.42  ? 400  THR A CB  1 
ATOM   2206  O  OG1 . THR A  1 293 ? 52.753  22.444  128.640 1.00 18.95  ? 400  THR A OG1 1 
ATOM   2207  C  CG2 . THR A  1 293 ? 53.063  24.588  129.711 1.00 14.97  ? 400  THR A CG2 1 
ATOM   2208  N  N   . SER A  1 294 ? 53.526  22.605  125.453 1.00 17.01  ? 401  SER A N   1 
ATOM   2209  C  CA  . SER A  1 294 ? 54.244  21.748  124.508 1.00 17.09  ? 401  SER A CA  1 
ATOM   2210  C  C   . SER A  1 294 ? 55.143  22.530  123.568 1.00 17.53  ? 401  SER A C   1 
ATOM   2211  O  O   . SER A  1 294 ? 54.750  23.564  123.043 1.00 18.25  ? 401  SER A O   1 
ATOM   2212  C  CB  . SER A  1 294 ? 53.259  20.892  123.725 1.00 15.91  ? 401  SER A CB  1 
ATOM   2213  O  OG  . SER A  1 294 ? 52.548  20.077  124.635 1.00 14.80  ? 401  SER A OG  1 
ATOM   2214  N  N   . LYS A  1 295 ? 56.349  22.018  123.341 1.00 18.59  ? 402  LYS A N   1 
ATOM   2215  C  CA  . LYS A  1 295 ? 57.326  22.707  122.498 1.00 19.35  ? 402  LYS A CA  1 
ATOM   2216  C  C   . LYS A  1 295 ? 57.545  22.103  121.128 1.00 18.49  ? 402  LYS A C   1 
ATOM   2217  O  O   . LYS A  1 295 ? 57.856  20.922  121.010 1.00 19.10  ? 402  LYS A O   1 
ATOM   2218  C  CB  . LYS A  1 295 ? 58.694  22.747  123.191 1.00 20.49  ? 402  LYS A CB  1 
ATOM   2219  C  CG  . LYS A  1 295 ? 58.681  23.073  124.668 1.00 23.98  ? 402  LYS A CG  1 
ATOM   2220  C  CD  . LYS A  1 295 ? 58.107  24.451  124.962 1.00 26.70  ? 402  LYS A CD  1 
ATOM   2221  C  CE  . LYS A  1 295 ? 58.202  24.734  126.456 1.00 28.82  ? 402  LYS A CE  1 
ATOM   2222  N  NZ  . LYS A  1 295 ? 57.467  25.971  126.839 1.00 32.35  ? 402  LYS A NZ  1 
ATOM   2223  N  N   . PRO A  1 296 ? 57.382  22.905  120.072 1.00 17.99  ? 403  PRO A N   1 
ATOM   2224  C  CA  . PRO A  1 296 ? 57.592  22.401  118.712 1.00 20.21  ? 403  PRO A CA  1 
ATOM   2225  C  C   . PRO A  1 296 ? 59.065  22.449  118.317 1.00 21.19  ? 403  PRO A C   1 
ATOM   2226  O  O   . PRO A  1 296 ? 59.443  22.069  117.213 1.00 21.99  ? 403  PRO A O   1 
ATOM   2227  C  CB  . PRO A  1 296 ? 56.727  23.329  117.856 1.00 19.31  ? 403  PRO A CB  1 
ATOM   2228  C  CG  . PRO A  1 296 ? 56.634  24.557  118.657 1.00 19.87  ? 403  PRO A CG  1 
ATOM   2229  C  CD  . PRO A  1 296 ? 56.482  24.064  120.057 1.00 17.85  ? 403  PRO A CD  1 
ATOM   2230  N  N   . ALA A  1 297 ? 59.892  22.903  119.245 1.00 22.77  ? 404  ALA A N   1 
ATOM   2231  C  CA  . ALA A  1 297 ? 61.324  23.039  119.019 1.00 23.70  ? 404  ALA A CA  1 
ATOM   2232  C  C   . ALA A  1 297 ? 62.094  21.730  118.897 1.00 24.74  ? 404  ALA A C   1 
ATOM   2233  O  O   . ALA A  1 297 ? 61.937  20.812  119.707 1.00 24.81  ? 404  ALA A O   1 
ATOM   2234  C  CB  . ALA A  1 297 ? 61.930  23.880  120.142 1.00 24.41  ? 404  ALA A CB  1 
ATOM   2235  N  N   . HIS A  1 298 ? 62.941  21.655  117.881 1.00 25.12  ? 405  HIS A N   1 
ATOM   2236  C  CA  . HIS A  1 298 ? 63.777  20.476  117.671 1.00 26.25  ? 405  HIS A CA  1 
ATOM   2237  C  C   . HIS A  1 298 ? 63.043  19.236  117.216 1.00 25.45  ? 405  HIS A C   1 
ATOM   2238  O  O   . HIS A  1 298 ? 63.551  18.118  117.363 1.00 26.39  ? 405  HIS A O   1 
ATOM   2239  C  CB  . HIS A  1 298 ? 64.563  20.180  118.944 1.00 29.41  ? 405  HIS A CB  1 
ATOM   2240  C  CG  . HIS A  1 298 ? 65.320  21.365  119.448 1.00 33.25  ? 405  HIS A CG  1 
ATOM   2241  N  ND1 . HIS A  1 298 ? 66.189  22.080  118.647 1.00 34.06  ? 405  HIS A ND1 1 
ATOM   2242  C  CD2 . HIS A  1 298 ? 65.264  22.023  120.630 1.00 33.93  ? 405  HIS A CD2 1 
ATOM   2243  C  CE1 . HIS A  1 298 ? 66.628  23.132  119.312 1.00 35.37  ? 405  HIS A CE1 1 
ATOM   2244  N  NE2 . HIS A  1 298 ? 66.081  23.122  120.518 1.00 36.89  ? 405  HIS A NE2 1 
ATOM   2245  N  N   . LEU A  1 299 ? 61.853  19.448  116.663 1.00 23.26  ? 406  LEU A N   1 
ATOM   2246  C  CA  . LEU A  1 299 ? 61.020  18.378  116.142 1.00 20.99  ? 406  LEU A CA  1 
ATOM   2247  C  C   . LEU A  1 299 ? 60.871  18.681  114.655 1.00 20.74  ? 406  LEU A C   1 
ATOM   2248  O  O   . LEU A  1 299 ? 60.335  19.716  114.294 1.00 20.49  ? 406  LEU A O   1 
ATOM   2249  C  CB  . LEU A  1 299 ? 59.654  18.410  116.829 1.00 19.80  ? 406  LEU A CB  1 
ATOM   2250  C  CG  . LEU A  1 299 ? 59.272  17.304  117.821 1.00 18.84  ? 406  LEU A CG  1 
ATOM   2251  C  CD1 . LEU A  1 299 ? 60.436  16.952  118.734 1.00 18.41  ? 406  LEU A CD1 1 
ATOM   2252  C  CD2 . LEU A  1 299 ? 58.072  17.765  118.621 1.00 16.56  ? 406  LEU A CD2 1 
ATOM   2253  N  N   . ASN A  1 300 ? 61.354  17.788  113.794 1.00 22.23  ? 407  ASN A N   1 
ATOM   2254  C  CA  . ASN A  1 300 ? 61.267  17.997  112.347 1.00 22.38  ? 407  ASN A CA  1 
ATOM   2255  C  C   . ASN A  1 300 ? 60.006  17.420  111.708 1.00 21.78  ? 407  ASN A C   1 
ATOM   2256  O  O   . ASN A  1 300 ? 59.629  16.272  111.945 1.00 20.76  ? 407  ASN A O   1 
ATOM   2257  C  CB  . ASN A  1 300 ? 62.486  17.401  111.640 1.00 24.48  ? 407  ASN A CB  1 
ATOM   2258  C  CG  . ASN A  1 300 ? 63.794  17.901  112.218 1.00 27.41  ? 407  ASN A CG  1 
ATOM   2259  O  OD1 . ASN A  1 300 ? 64.021  19.114  112.313 1.00 26.84  ? 407  ASN A OD1 1 
ATOM   2260  N  ND2 . ASN A  1 300 ? 64.669  16.965  112.608 1.00 26.89  ? 407  ASN A ND2 1 
ATOM   2261  N  N   . ALA A  1 301 ? 59.367  18.241  110.888 1.00 20.66  ? 408  ALA A N   1 
ATOM   2262  C  CA  . ALA A  1 301 ? 58.160  17.851  110.181 1.00 21.46  ? 408  ALA A CA  1 
ATOM   2263  C  C   . ALA A  1 301 ? 58.025  18.782  108.991 1.00 21.02  ? 408  ALA A C   1 
ATOM   2264  O  O   . ALA A  1 301 ? 58.520  19.900  109.024 1.00 21.14  ? 408  ALA A O   1 
ATOM   2265  C  CB  . ALA A  1 301 ? 56.953  17.982  111.094 1.00 20.66  ? 408  ALA A CB  1 
ATOM   2266  N  N   . ASP A  1 302 ? 57.368  18.324  107.936 1.00 21.68  ? 409  ASP A N   1 
ATOM   2267  C  CA  . ASP A  1 302 ? 57.197  19.165  106.760 1.00 22.25  ? 409  ASP A CA  1 
ATOM   2268  C  C   . ASP A  1 302 ? 55.883  19.932  106.796 1.00 22.79  ? 409  ASP A C   1 
ATOM   2269  O  O   . ASP A  1 302 ? 55.523  20.594  105.823 1.00 24.72  ? 409  ASP A O   1 
ATOM   2270  C  CB  . ASP A  1 302 ? 57.272  18.318  105.487 1.00 20.07  ? 409  ASP A CB  1 
ATOM   2271  C  CG  . ASP A  1 302 ? 58.694  17.872  105.166 1.00 21.04  ? 409  ASP A CG  1 
ATOM   2272  O  OD1 . ASP A  1 302 ? 58.888  17.190  104.137 0.00 20.80  ? 409  ASP A OD1 1 
ATOM   2273  O  OD2 . ASP A  1 302 ? 59.614  18.206  105.943 0.00 20.80  ? 409  ASP A OD2 1 
ATOM   2274  N  N   . ASP A  1 303 ? 55.171  19.875  107.918 1.00 22.02  ? 410  ASP A N   1 
ATOM   2275  C  CA  . ASP A  1 303 ? 53.890  20.560  107.986 1.00 20.77  ? 410  ASP A CA  1 
ATOM   2276  C  C   . ASP A  1 303 ? 53.662  21.497  109.167 1.00 19.96  ? 410  ASP A C   1 
ATOM   2277  O  O   . ASP A  1 303 ? 52.520  21.766  109.522 1.00 21.81  ? 410  ASP A O   1 
ATOM   2278  C  CB  . ASP A  1 303 ? 52.770  19.528  107.929 1.00 20.44  ? 410  ASP A CB  1 
ATOM   2279  C  CG  . ASP A  1 303 ? 52.617  18.771  109.224 1.00 21.58  ? 410  ASP A CG  1 
ATOM   2280  O  OD1 . ASP A  1 303 ? 53.641  18.469  109.871 1.00 21.54  ? 410  ASP A OD1 1 
ATOM   2281  O  OD2 . ASP A  1 303 ? 51.464  18.470  109.591 1.00 23.53  ? 410  ASP A OD2 1 
ATOM   2282  N  N   . TRP A  1 304 ? 54.727  21.994  109.784 1.00 17.73  ? 411  TRP A N   1 
ATOM   2283  C  CA  . TRP A  1 304 ? 54.554  22.927  110.886 1.00 16.57  ? 411  TRP A CA  1 
ATOM   2284  C  C   . TRP A  1 304 ? 53.855  24.178  110.362 1.00 16.51  ? 411  TRP A C   1 
ATOM   2285  O  O   . TRP A  1 304 ? 54.325  24.811  109.423 1.00 16.53  ? 411  TRP A O   1 
ATOM   2286  C  CB  . TRP A  1 304 ? 55.905  23.320  111.475 1.00 14.85  ? 411  TRP A CB  1 
ATOM   2287  C  CG  . TRP A  1 304 ? 56.437  22.348  112.455 1.00 11.93  ? 411  TRP A CG  1 
ATOM   2288  C  CD1 . TRP A  1 304 ? 57.568  21.607  112.333 1.00 11.45  ? 411  TRP A CD1 1 
ATOM   2289  C  CD2 . TRP A  1 304 ? 55.867  22.009  113.723 1.00 10.05  ? 411  TRP A CD2 1 
ATOM   2290  N  NE1 . TRP A  1 304 ? 57.745  20.823  113.448 1.00 10.49  ? 411  TRP A NE1 1 
ATOM   2291  C  CE2 . TRP A  1 304 ? 56.714  21.051  114.318 1.00 10.39  ? 411  TRP A CE2 1 
ATOM   2292  C  CE3 . TRP A  1 304 ? 54.724  22.421  114.413 1.00 10.68  ? 411  TRP A CE3 1 
ATOM   2293  C  CZ2 . TRP A  1 304 ? 56.456  20.493  115.570 1.00 10.68  ? 411  TRP A CZ2 1 
ATOM   2294  C  CZ3 . TRP A  1 304 ? 54.463  21.861  115.671 1.00 11.81  ? 411  TRP A CZ3 1 
ATOM   2295  C  CH2 . TRP A  1 304 ? 55.331  20.905  116.231 1.00 11.17  ? 411  TRP A CH2 1 
ATOM   2296  N  N   . ALA A  1 305 ? 52.719  24.523  110.954 1.00 17.00  ? 412  ALA A N   1 
ATOM   2297  C  CA  . ALA A  1 305 ? 51.985  25.711  110.534 1.00 16.51  ? 412  ALA A CA  1 
ATOM   2298  C  C   . ALA A  1 305 ? 51.561  26.473  111.776 1.00 17.40  ? 412  ALA A C   1 
ATOM   2299  O  O   . ALA A  1 305 ? 51.315  25.874  112.828 1.00 18.76  ? 412  ALA A O   1 
ATOM   2300  C  CB  . ALA A  1 305 ? 50.770  25.318  109.721 1.00 16.56  ? 412  ALA A CB  1 
ATOM   2301  N  N   . THR A  1 306 ? 51.486  27.793  111.663 1.00 17.11  ? 413  THR A N   1 
ATOM   2302  C  CA  . THR A  1 306 ? 51.077  28.622  112.790 1.00 17.97  ? 413  THR A CA  1 
ATOM   2303  C  C   . THR A  1 306 ? 49.572  28.867  112.719 1.00 17.79  ? 413  THR A C   1 
ATOM   2304  O  O   . THR A  1 306 ? 49.038  29.232  111.667 1.00 19.12  ? 413  THR A O   1 
ATOM   2305  C  CB  . THR A  1 306 ? 51.832  29.970  112.776 1.00 18.61  ? 413  THR A CB  1 
ATOM   2306  O  OG1 . THR A  1 306 ? 53.229  29.721  112.948 1.00 18.96  ? 413  THR A OG1 1 
ATOM   2307  C  CG2 . THR A  1 306 ? 51.368  30.868  113.895 1.00 17.80  ? 413  THR A CG2 1 
ATOM   2308  N  N   . ASN A  1 307 ? 48.874  28.655  113.826 1.00 16.40  ? 414  ASN A N   1 
ATOM   2309  C  CA  . ASN A  1 307 ? 47.446  28.870  113.794 1.00 14.97  ? 414  ASN A CA  1 
ATOM   2310  C  C   . ASN A  1 307 ? 47.081  30.325  114.026 1.00 15.55  ? 414  ASN A C   1 
ATOM   2311  O  O   . ASN A  1 307 ? 47.954  31.204  114.043 1.00 14.24  ? 414  ASN A O   1 
ATOM   2312  C  CB  . ASN A  1 307 ? 46.732  27.959  114.797 1.00 14.23  ? 414  ASN A CB  1 
ATOM   2313  C  CG  . ASN A  1 307 ? 47.232  28.123  116.208 1.00 14.02  ? 414  ASN A CG  1 
ATOM   2314  O  OD1 . ASN A  1 307 ? 47.770  29.166  116.583 1.00 15.02  ? 414  ASN A OD1 1 
ATOM   2315  N  ND2 . ASN A  1 307 ? 47.028  27.095  117.016 1.00 13.80  ? 414  ASN A ND2 1 
ATOM   2316  N  N   . GLY A  1 308 ? 45.782  30.558  114.197 1.00 16.08  ? 415  GLY A N   1 
ATOM   2317  C  CA  . GLY A  1 308 ? 45.251  31.891  114.396 1.00 18.34  ? 415  GLY A CA  1 
ATOM   2318  C  C   . GLY A  1 308 ? 45.631  32.595  115.682 1.00 20.16  ? 415  GLY A C   1 
ATOM   2319  O  O   . GLY A  1 308 ? 45.367  33.793  115.822 1.00 21.50  ? 415  GLY A O   1 
ATOM   2320  N  N   . VAL A  1 309 ? 46.234  31.874  116.625 1.00 19.79  ? 416  VAL A N   1 
ATOM   2321  C  CA  . VAL A  1 309 ? 46.647  32.491  117.875 1.00 18.64  ? 416  VAL A CA  1 
ATOM   2322  C  C   . VAL A  1 309 ? 48.162  32.462  118.007 1.00 18.81  ? 416  VAL A C   1 
ATOM   2323  O  O   . VAL A  1 309 ? 48.707  32.622  119.092 1.00 18.38  ? 416  VAL A O   1 
ATOM   2324  C  CB  . VAL A  1 309 ? 46.008  31.800  119.086 1.00 17.90  ? 416  VAL A CB  1 
ATOM   2325  C  CG1 . VAL A  1 309 ? 44.508  31.923  118.999 1.00 19.31  ? 416  VAL A CG1 1 
ATOM   2326  C  CG2 . VAL A  1 309 ? 46.416  30.346  119.139 1.00 17.57  ? 416  VAL A CG2 1 
ATOM   2327  N  N   . GLY A  1 310 ? 48.846  32.249  116.891 1.00 18.70  ? 417  GLY A N   1 
ATOM   2328  C  CA  . GLY A  1 310 ? 50.294  32.240  116.926 1.00 19.21  ? 417  GLY A CA  1 
ATOM   2329  C  C   . GLY A  1 310 ? 51.018  30.986  117.377 1.00 18.83  ? 417  GLY A C   1 
ATOM   2330  O  O   . GLY A  1 310 ? 52.230  31.023  117.550 1.00 20.13  ? 417  GLY A O   1 
ATOM   2331  N  N   . ARG A  1 311 ? 50.317  29.881  117.580 1.00 18.50  ? 418  ARG A N   1 
ATOM   2332  C  CA  . ARG A  1 311 ? 51.003  28.669  117.995 1.00 18.64  ? 418  ARG A CA  1 
ATOM   2333  C  C   . ARG A  1 311 ? 51.287  27.766  116.805 1.00 18.95  ? 418  ARG A C   1 
ATOM   2334  O  O   . ARG A  1 311 ? 50.498  27.702  115.857 1.00 20.07  ? 418  ARG A O   1 
ATOM   2335  C  CB  . ARG A  1 311 ? 50.195  27.916  119.060 1.00 18.78  ? 418  ARG A CB  1 
ATOM   2336  C  CG  . ARG A  1 311 ? 50.357  28.524  120.444 1.00 21.11  ? 418  ARG A CG  1 
ATOM   2337  C  CD  . ARG A  1 311 ? 49.795  27.659  121.546 1.00 18.56  ? 418  ARG A CD  1 
ATOM   2338  N  NE  . ARG A  1 311 ? 48.367  27.876  121.692 1.00 21.02  ? 418  ARG A NE  1 
ATOM   2339  C  CZ  . ARG A  1 311 ? 47.798  28.535  122.694 1.00 20.13  ? 418  ARG A CZ  1 
ATOM   2340  N  NH1 . ARG A  1 311 ? 46.489  28.669  122.709 1.00 19.41  ? 418  ARG A NH1 1 
ATOM   2341  N  NH2 . ARG A  1 311 ? 48.520  29.041  123.683 1.00 18.94  ? 418  ARG A NH2 1 
ATOM   2342  N  N   . LYS A  1 312 ? 52.431  27.091  116.839 1.00 17.93  ? 419  LYS A N   1 
ATOM   2343  C  CA  . LYS A  1 312 ? 52.789  26.190  115.761 1.00 18.38  ? 419  LYS A CA  1 
ATOM   2344  C  C   . LYS A  1 312 ? 52.186  24.820  116.022 1.00 18.56  ? 419  LYS A C   1 
ATOM   2345  O  O   . LYS A  1 312 ? 52.239  24.309  117.137 1.00 19.22  ? 419  LYS A O   1 
ATOM   2346  C  CB  . LYS A  1 312 ? 54.307  26.100  115.620 1.00 20.28  ? 419  LYS A CB  1 
ATOM   2347  C  CG  . LYS A  1 312 ? 54.915  27.348  115.022 1.00 21.61  ? 419  LYS A CG  1 
ATOM   2348  C  CD  . LYS A  1 312 ? 56.246  27.068  114.361 1.00 23.79  ? 419  LYS A CD  1 
ATOM   2349  C  CE  . LYS A  1 312 ? 57.304  26.762  115.391 1.00 26.87  ? 419  LYS A CE  1 
ATOM   2350  N  NZ  . LYS A  1 312 ? 57.492  27.900  116.335 0.00 25.71  ? 419  LYS A NZ  1 
ATOM   2351  N  N   . VAL A  1 313 ? 51.593  24.238  114.987 1.00 18.08  ? 420  VAL A N   1 
ATOM   2352  C  CA  . VAL A  1 313 ? 50.954  22.940  115.109 1.00 16.04  ? 420  VAL A CA  1 
ATOM   2353  C  C   . VAL A  1 313 ? 51.355  22.046  113.938 1.00 14.97  ? 420  VAL A C   1 
ATOM   2354  O  O   . VAL A  1 313 ? 51.575  22.530  112.830 1.00 14.78  ? 420  VAL A O   1 
ATOM   2355  C  CB  . VAL A  1 313 ? 49.419  23.116  115.119 1.00 15.75  ? 420  VAL A CB  1 
ATOM   2356  C  CG1 . VAL A  1 313 ? 48.752  21.937  115.805 1.00 15.19  ? 420  VAL A CG1 1 
ATOM   2357  C  CG2 . VAL A  1 313 ? 49.063  24.381  115.839 1.00 16.16  ? 420  VAL A CG2 1 
ATOM   2358  N  N   . SER A  1 314 ? 51.465  20.748  114.195 1.00 13.49  ? 421  SER A N   1 
ATOM   2359  C  CA  . SER A  1 314 ? 51.809  19.781  113.164 1.00 13.52  ? 421  SER A CA  1 
ATOM   2360  C  C   . SER A  1 314 ? 50.895  18.572  113.275 1.00 14.06  ? 421  SER A C   1 
ATOM   2361  O  O   . SER A  1 314 ? 50.524  18.168  114.382 1.00 14.84  ? 421  SER A O   1 
ATOM   2362  C  CB  . SER A  1 314 ? 53.252  19.324  113.315 1.00 13.06  ? 421  SER A CB  1 
ATOM   2363  O  OG  . SER A  1 314 ? 53.457  18.122  112.592 1.00 14.31  ? 421  SER A OG  1 
ATOM   2364  N  N   . HIS A  1 315 ? 50.530  17.992  112.135 1.00 13.40  ? 422  HIS A N   1 
ATOM   2365  C  CA  . HIS A  1 315 ? 49.663  16.822  112.136 1.00 11.96  ? 422  HIS A CA  1 
ATOM   2366  C  C   . HIS A  1 315 ? 50.411  15.584  112.619 1.00 10.79  ? 422  HIS A C   1 
ATOM   2367  O  O   . HIS A  1 315 ? 49.812  14.560  112.900 1.00 11.32  ? 422  HIS A O   1 
ATOM   2368  C  CB  . HIS A  1 315 ? 49.087  16.588  110.739 1.00 11.66  ? 422  HIS A CB  1 
ATOM   2369  C  CG  . HIS A  1 315 ? 48.105  17.633  110.306 1.00 11.40  ? 422  HIS A CG  1 
ATOM   2370  N  ND1 . HIS A  1 315 ? 48.488  18.860  109.805 1.00 10.24  ? 422  HIS A ND1 1 
ATOM   2371  C  CD2 . HIS A  1 315 ? 46.750  17.640  110.321 1.00 11.13  ? 422  HIS A CD2 1 
ATOM   2372  C  CE1 . HIS A  1 315 ? 47.412  19.577  109.532 1.00 10.18  ? 422  HIS A CE1 1 
ATOM   2373  N  NE2 . HIS A  1 315 ? 46.344  18.860  109.835 1.00 9.72   ? 422  HIS A NE2 1 
ATOM   2374  N  N   . SER A  1 316 ? 51.726  15.691  112.730 1.00 11.04  ? 423  SER A N   1 
ATOM   2375  C  CA  . SER A  1 316 ? 52.532  14.580  113.202 1.00 11.60  ? 423  SER A CA  1 
ATOM   2376  C  C   . SER A  1 316 ? 52.836  14.713  114.685 1.00 12.11  ? 423  SER A C   1 
ATOM   2377  O  O   . SER A  1 316 ? 53.083  13.719  115.363 1.00 12.62  ? 423  SER A O   1 
ATOM   2378  C  CB  . SER A  1 316 ? 53.858  14.527  112.452 1.00 11.41  ? 423  SER A CB  1 
ATOM   2379  O  OG  . SER A  1 316 ? 53.653  14.293  111.078 1.00 14.59  ? 423  SER A OG  1 
ATOM   2380  N  N   . TYR A  1 317 ? 52.815  15.942  115.191 1.00 12.35  ? 424  TYR A N   1 
ATOM   2381  C  CA  . TYR A  1 317 ? 53.156  16.175  116.587 1.00 12.74  ? 424  TYR A CA  1 
ATOM   2382  C  C   . TYR A  1 317 ? 52.166  16.962  117.413 1.00 13.78  ? 424  TYR A C   1 
ATOM   2383  O  O   . TYR A  1 317 ? 52.426  17.216  118.588 1.00 14.76  ? 424  TYR A O   1 
ATOM   2384  C  CB  . TYR A  1 317 ? 54.481  16.918  116.670 1.00 11.07  ? 424  TYR A CB  1 
ATOM   2385  C  CG  . TYR A  1 317 ? 55.615  16.277  115.921 1.00 9.86   ? 424  TYR A CG  1 
ATOM   2386  C  CD1 . TYR A  1 317 ? 56.293  16.978  114.935 1.00 10.28  ? 424  TYR A CD1 1 
ATOM   2387  C  CD2 . TYR A  1 317 ? 56.075  15.014  116.260 1.00 9.77   ? 424  TYR A CD2 1 
ATOM   2388  C  CE1 . TYR A  1 317 ? 57.412  16.449  114.308 1.00 10.70  ? 424  TYR A CE1 1 
ATOM   2389  C  CE2 . TYR A  1 317 ? 57.197  14.471  115.639 1.00 12.53  ? 424  TYR A CE2 1 
ATOM   2390  C  CZ  . TYR A  1 317 ? 57.861  15.199  114.664 1.00 11.84  ? 424  TYR A CZ  1 
ATOM   2391  O  OH  . TYR A  1 317 ? 58.978  14.686  114.050 1.00 15.04  ? 424  TYR A OH  1 
ATOM   2392  N  N   . GLY A  1 318 ? 51.041  17.355  116.832 1.00 13.95  ? 425  GLY A N   1 
ATOM   2393  C  CA  . GLY A  1 318 ? 50.116  18.157  117.601 1.00 14.14  ? 425  GLY A CA  1 
ATOM   2394  C  C   . GLY A  1 318 ? 50.829  19.474  117.912 1.00 15.50  ? 425  GLY A C   1 
ATOM   2395  O  O   . GLY A  1 318 ? 51.418  20.100  117.032 1.00 16.51  ? 425  GLY A O   1 
ATOM   2396  N  N   . TYR A  1 319 ? 50.813  19.899  119.166 1.00 15.12  ? 426  TYR A N   1 
ATOM   2397  C  CA  . TYR A  1 319 ? 51.455  21.154  119.513 1.00 14.31  ? 426  TYR A CA  1 
ATOM   2398  C  C   . TYR A  1 319 ? 52.935  21.023  119.853 1.00 15.64  ? 426  TYR A C   1 
ATOM   2399  O  O   . TYR A  1 319 ? 53.591  22.017  120.211 1.00 14.74  ? 426  TYR A O   1 
ATOM   2400  C  CB  . TYR A  1 319 ? 50.713  21.829  120.666 1.00 11.68  ? 426  TYR A CB  1 
ATOM   2401  C  CG  . TYR A  1 319 ? 49.441  22.484  120.225 1.00 10.16  ? 426  TYR A CG  1 
ATOM   2402  C  CD1 . TYR A  1 319 ? 48.242  21.782  120.214 1.00 10.43  ? 426  TYR A CD1 1 
ATOM   2403  C  CD2 . TYR A  1 319 ? 49.444  23.788  119.747 1.00 8.75   ? 426  TYR A CD2 1 
ATOM   2404  C  CE1 . TYR A  1 319 ? 47.075  22.365  119.729 1.00 10.04  ? 426  TYR A CE1 1 
ATOM   2405  C  CE2 . TYR A  1 319 ? 48.287  24.380  119.260 1.00 8.67   ? 426  TYR A CE2 1 
ATOM   2406  C  CZ  . TYR A  1 319 ? 47.109  23.665  119.248 1.00 10.38  ? 426  TYR A CZ  1 
ATOM   2407  O  OH  . TYR A  1 319 ? 45.970  24.237  118.726 1.00 10.88  ? 426  TYR A OH  1 
ATOM   2408  N  N   . GLY A  1 320 ? 53.460  19.806  119.748 1.00 13.96  ? 427  GLY A N   1 
ATOM   2409  C  CA  . GLY A  1 320 ? 54.868  19.603  120.027 1.00 13.80  ? 427  GLY A CA  1 
ATOM   2410  C  C   . GLY A  1 320 ? 55.196  18.640  121.150 1.00 14.77  ? 427  GLY A C   1 
ATOM   2411  O  O   . GLY A  1 320 ? 54.348  17.904  121.656 1.00 14.89  ? 427  GLY A O   1 
ATOM   2412  N  N   . LEU A  1 321 ? 56.458  18.660  121.548 1.00 15.08  ? 428  LEU A N   1 
ATOM   2413  C  CA  . LEU A  1 321 ? 56.947  17.785  122.595 1.00 15.31  ? 428  LEU A CA  1 
ATOM   2414  C  C   . LEU A  1 321 ? 56.483  18.236  123.965 1.00 15.29  ? 428  LEU A C   1 
ATOM   2415  O  O   . LEU A  1 321 ? 56.487  19.421  124.274 1.00 16.05  ? 428  LEU A O   1 
ATOM   2416  C  CB  . LEU A  1 321 ? 58.463  17.778  122.569 1.00 15.23  ? 428  LEU A CB  1 
ATOM   2417  C  CG  . LEU A  1 321 ? 59.119  16.648  123.336 1.00 17.40  ? 428  LEU A CG  1 
ATOM   2418  C  CD1 . LEU A  1 321 ? 58.914  15.356  122.579 1.00 16.58  ? 428  LEU A CD1 1 
ATOM   2419  C  CD2 . LEU A  1 321 ? 60.609  16.937  123.487 1.00 20.48  ? 428  LEU A CD2 1 
ATOM   2420  N  N   . LEU A  1 322 ? 56.071  17.287  124.789 1.00 16.01  ? 429  LEU A N   1 
ATOM   2421  C  CA  . LEU A  1 322 ? 55.650  17.609  126.139 1.00 16.63  ? 429  LEU A CA  1 
ATOM   2422  C  C   . LEU A  1 322 ? 56.845  18.133  126.933 1.00 17.12  ? 429  LEU A C   1 
ATOM   2423  O  O   . LEU A  1 322 ? 57.971  17.668  126.756 1.00 16.76  ? 429  LEU A O   1 
ATOM   2424  C  CB  . LEU A  1 322 ? 55.092  16.373  126.831 1.00 14.86  ? 429  LEU A CB  1 
ATOM   2425  C  CG  . LEU A  1 322 ? 53.675  15.974  126.466 1.00 13.97  ? 429  LEU A CG  1 
ATOM   2426  C  CD1 . LEU A  1 322 ? 53.247  14.829  127.350 1.00 14.02  ? 429  LEU A CD1 1 
ATOM   2427  C  CD2 . LEU A  1 322 ? 52.744  17.146  126.660 1.00 12.98  ? 429  LEU A CD2 1 
ATOM   2428  N  N   . ASP A  1 323 ? 56.591  19.093  127.815 1.00 18.03  ? 430  ASP A N   1 
ATOM   2429  C  CA  . ASP A  1 323 ? 57.638  19.693  128.639 1.00 17.49  ? 430  ASP A CA  1 
ATOM   2430  C  C   . ASP A  1 323 ? 57.213  19.604  130.102 1.00 16.96  ? 430  ASP A C   1 
ATOM   2431  O  O   . ASP A  1 323 ? 56.450  20.446  130.596 1.00 16.52  ? 430  ASP A O   1 
ATOM   2432  C  CB  . ASP A  1 323 ? 57.833  21.147  128.215 1.00 19.79  ? 430  ASP A CB  1 
ATOM   2433  C  CG  . ASP A  1 323 ? 59.000  21.807  128.900 1.00 21.88  ? 430  ASP A CG  1 
ATOM   2434  O  OD1 . ASP A  1 323 ? 59.484  22.827  128.357 1.00 24.32  ? 430  ASP A OD1 1 
ATOM   2435  O  OD2 . ASP A  1 323 ? 59.425  21.320  129.972 1.00 22.20  ? 430  ASP A OD2 1 
ATOM   2436  N  N   . ALA A  1 324 ? 57.696  18.571  130.786 1.00 15.47  ? 431  ALA A N   1 
ATOM   2437  C  CA  . ALA A  1 324 ? 57.350  18.354  132.185 1.00 15.45  ? 431  ALA A CA  1 
ATOM   2438  C  C   . ALA A  1 324 ? 57.571  19.600  133.041 1.00 16.51  ? 431  ALA A C   1 
ATOM   2439  O  O   . ALA A  1 324 ? 56.708  19.987  133.829 1.00 14.67  ? 431  ALA A O   1 
ATOM   2440  C  CB  . ALA A  1 324 ? 58.148  17.195  132.738 1.00 15.39  ? 431  ALA A CB  1 
ATOM   2441  N  N   . GLY A  1 325 ? 58.729  20.229  132.879 1.00 17.69  ? 432  GLY A N   1 
ATOM   2442  C  CA  . GLY A  1 325 ? 59.032  21.427  133.642 1.00 18.97  ? 432  GLY A CA  1 
ATOM   2443  C  C   . GLY A  1 325 ? 58.014  22.531  133.445 1.00 18.73  ? 432  GLY A C   1 
ATOM   2444  O  O   . GLY A  1 325 ? 57.504  23.102  134.408 1.00 20.41  ? 432  GLY A O   1 
ATOM   2445  N  N   . ALA A  1 326 ? 57.711  22.832  132.191 1.00 18.13  ? 433  ALA A N   1 
ATOM   2446  C  CA  . ALA A  1 326 ? 56.750  23.871  131.885 1.00 17.35  ? 433  ALA A CA  1 
ATOM   2447  C  C   . ALA A  1 326 ? 55.362  23.482  132.376 1.00 16.71  ? 433  ALA A C   1 
ATOM   2448  O  O   . ALA A  1 326 ? 54.642  24.301  132.943 1.00 16.96  ? 433  ALA A O   1 
ATOM   2449  C  CB  . ALA A  1 326 ? 56.742  24.121  130.393 1.00 18.21  ? 433  ALA A CB  1 
ATOM   2450  N  N   . MET A  1 327 ? 54.998  22.222  132.164 1.00 16.80  ? 434  MET A N   1 
ATOM   2451  C  CA  . MET A  1 327 ? 53.690  21.714  132.575 1.00 17.76  ? 434  MET A CA  1 
ATOM   2452  C  C   . MET A  1 327 ? 53.471  21.991  134.058 1.00 18.68  ? 434  MET A C   1 
ATOM   2453  O  O   . MET A  1 327 ? 52.502  22.638  134.469 1.00 18.27  ? 434  MET A O   1 
ATOM   2454  C  CB  . MET A  1 327 ? 53.615  20.205  132.319 1.00 16.37  ? 434  MET A CB  1 
ATOM   2455  C  CG  . MET A  1 327 ? 53.306  19.805  130.879 1.00 15.47  ? 434  MET A CG  1 
ATOM   2456  S  SD  . MET A  1 327 ? 51.588  20.079  130.445 1.00 14.28  ? 434  MET A SD  1 
ATOM   2457  C  CE  . MET A  1 327 ? 50.808  18.700  131.200 1.00 10.36  ? 434  MET A CE  1 
ATOM   2458  N  N   . VAL A  1 328 ? 54.394  21.483  134.857 1.00 19.43  ? 435  VAL A N   1 
ATOM   2459  C  CA  . VAL A  1 328 ? 54.353  21.651  136.294 1.00 20.81  ? 435  VAL A CA  1 
ATOM   2460  C  C   . VAL A  1 328 ? 54.352  23.121  136.698 1.00 21.25  ? 435  VAL A C   1 
ATOM   2461  O  O   . VAL A  1 328 ? 53.626  23.521  137.605 1.00 21.90  ? 435  VAL A O   1 
ATOM   2462  C  CB  . VAL A  1 328 ? 55.550  20.936  136.926 1.00 21.63  ? 435  VAL A CB  1 
ATOM   2463  C  CG1 . VAL A  1 328 ? 55.980  21.643  138.176 1.00 23.89  ? 435  VAL A CG1 1 
ATOM   2464  C  CG2 . VAL A  1 328 ? 55.173  19.504  137.238 1.00 20.61  ? 435  VAL A CG2 1 
ATOM   2465  N  N   . ALA A  1 329 ? 55.163  23.923  136.019 1.00 21.08  ? 436  ALA A N   1 
ATOM   2466  C  CA  . ALA A  1 329 ? 55.250  25.347  136.314 1.00 21.22  ? 436  ALA A CA  1 
ATOM   2467  C  C   . ALA A  1 329 ? 53.941  26.078  136.083 1.00 20.72  ? 436  ALA A C   1 
ATOM   2468  O  O   . ALA A  1 329 ? 53.484  26.826  136.943 1.00 21.43  ? 436  ALA A O   1 
ATOM   2469  C  CB  . ALA A  1 329 ? 56.349  25.986  135.471 1.00 20.33  ? 436  ALA A CB  1 
ATOM   2470  N  N   . LEU A  1 330 ? 53.341  25.869  134.916 1.00 20.77  ? 437  LEU A N   1 
ATOM   2471  C  CA  . LEU A  1 330 ? 52.101  26.550  134.592 1.00 18.39  ? 437  LEU A CA  1 
ATOM   2472  C  C   . LEU A  1 330 ? 50.911  25.994  135.369 1.00 18.69  ? 437  LEU A C   1 
ATOM   2473  O  O   . LEU A  1 330 ? 49.931  26.698  135.595 1.00 20.46  ? 437  LEU A O   1 
ATOM   2474  C  CB  . LEU A  1 330 ? 51.880  26.492  133.082 1.00 14.16  ? 437  LEU A CB  1 
ATOM   2475  C  CG  . LEU A  1 330 ? 50.810  27.414  132.510 1.00 11.77  ? 437  LEU A CG  1 
ATOM   2476  C  CD1 . LEU A  1 330 ? 51.015  28.838  132.953 1.00 7.90   ? 437  LEU A CD1 1 
ATOM   2477  C  CD2 . LEU A  1 330 ? 50.867  27.318  131.015 1.00 12.64  ? 437  LEU A CD2 1 
ATOM   2478  N  N   . ALA A  1 331 ? 51.011  24.748  135.815 1.00 18.61  ? 438  ALA A N   1 
ATOM   2479  C  CA  . ALA A  1 331 ? 49.930  24.132  136.557 1.00 19.05  ? 438  ALA A CA  1 
ATOM   2480  C  C   . ALA A  1 331 ? 49.723  24.709  137.944 1.00 19.44  ? 438  ALA A C   1 
ATOM   2481  O  O   . ALA A  1 331 ? 48.600  24.999  138.343 1.00 21.05  ? 438  ALA A O   1 
ATOM   2482  C  CB  . ALA A  1 331 ? 50.171  22.644  136.661 1.00 20.03  ? 438  ALA A CB  1 
ATOM   2483  N  N   . GLN A  1 332 ? 50.802  24.872  138.691 1.00 20.00  ? 439  GLN A N   1 
ATOM   2484  C  CA  . GLN A  1 332 ? 50.691  25.352  140.067 1.00 21.55  ? 439  GLN A CA  1 
ATOM   2485  C  C   . GLN A  1 332 ? 49.641  26.388  140.424 1.00 21.32  ? 439  GLN A C   1 
ATOM   2486  O  O   . GLN A  1 332 ? 48.763  26.101  141.234 1.00 21.32  ? 439  GLN A O   1 
ATOM   2487  C  CB  . GLN A  1 332 ? 52.051  25.798  140.583 1.00 22.85  ? 439  GLN A CB  1 
ATOM   2488  C  CG  . GLN A  1 332 ? 52.953  24.621  140.803 1.00 24.71  ? 439  GLN A CG  1 
ATOM   2489  C  CD  . GLN A  1 332 ? 54.174  24.970  141.579 1.00 27.18  ? 439  GLN A CD  1 
ATOM   2490  O  OE1 . GLN A  1 332 ? 54.106  25.238  142.784 1.00 29.21  ? 439  GLN A OE1 1 
ATOM   2491  N  NE2 . GLN A  1 332 ? 55.317  24.977  140.902 1.00 28.66  ? 439  GLN A NE2 1 
ATOM   2492  N  N   . ASN A  1 333 ? 49.706  27.586  139.856 1.00 21.37  ? 440  ASN A N   1 
ATOM   2493  C  CA  . ASN A  1 333 ? 48.688  28.570  140.205 1.00 21.86  ? 440  ASN A CA  1 
ATOM   2494  C  C   . ASN A  1 333 ? 47.742  28.830  139.032 1.00 20.71  ? 440  ASN A C   1 
ATOM   2495  O  O   . ASN A  1 333 ? 47.350  29.957  138.742 1.00 19.87  ? 440  ASN A O   1 
ATOM   2496  C  CB  . ASN A  1 333 ? 49.360  29.855  140.706 1.00 24.59  ? 440  ASN A CB  1 
ATOM   2497  C  CG  . ASN A  1 333 ? 50.255  29.606  141.931 1.00 28.42  ? 440  ASN A CG  1 
ATOM   2498  O  OD1 . ASN A  1 333 ? 49.903  28.827  142.821 1.00 28.23  ? 440  ASN A OD1 1 
ATOM   2499  N  ND2 . ASN A  1 333 ? 51.405  30.272  141.980 1.00 30.84  ? 440  ASN A ND2 1 
ATOM   2500  N  N   . TRP A  1 334 ? 47.367  27.741  138.376 1.00 19.68  ? 441  TRP A N   1 
ATOM   2501  C  CA  . TRP A  1 334 ? 46.476  27.763  137.226 1.00 18.47  ? 441  TRP A CA  1 
ATOM   2502  C  C   . TRP A  1 334 ? 45.023  28.095  137.592 1.00 19.27  ? 441  TRP A C   1 
ATOM   2503  O  O   . TRP A  1 334 ? 44.522  27.619  138.613 1.00 18.86  ? 441  TRP A O   1 
ATOM   2504  C  CB  . TRP A  1 334 ? 46.550  26.389  136.550 1.00 16.14  ? 441  TRP A CB  1 
ATOM   2505  C  CG  . TRP A  1 334 ? 45.643  26.233  135.376 1.00 13.70  ? 441  TRP A CG  1 
ATOM   2506  C  CD1 . TRP A  1 334 ? 44.335  25.829  135.388 1.00 11.59  ? 441  TRP A CD1 1 
ATOM   2507  C  CD2 . TRP A  1 334 ? 45.961  26.520  134.017 1.00 11.41  ? 441  TRP A CD2 1 
ATOM   2508  N  NE1 . TRP A  1 334 ? 43.827  25.849  134.122 1.00 10.33  ? 441  TRP A NE1 1 
ATOM   2509  C  CE2 . TRP A  1 334 ? 44.802  26.270  133.257 1.00 10.66  ? 441  TRP A CE2 1 
ATOM   2510  C  CE3 . TRP A  1 334 ? 47.115  26.971  133.364 1.00 12.05  ? 441  TRP A CE3 1 
ATOM   2511  C  CZ2 . TRP A  1 334 ? 44.762  26.453  131.877 1.00 10.42  ? 441  TRP A CZ2 1 
ATOM   2512  C  CZ3 . TRP A  1 334 ? 47.074  27.153  131.991 1.00 11.49  ? 441  TRP A CZ3 1 
ATOM   2513  C  CH2 . TRP A  1 334 ? 45.902  26.893  131.265 1.00 10.74  ? 441  TRP A CH2 1 
ATOM   2514  N  N   . THR A  1 335 ? 44.347  28.903  136.766 1.00 20.40  ? 442  THR A N   1 
ATOM   2515  C  CA  . THR A  1 335 ? 42.951  29.232  137.029 1.00 21.75  ? 442  THR A CA  1 
ATOM   2516  C  C   . THR A  1 335 ? 42.090  28.300  136.189 1.00 21.56  ? 442  THR A C   1 
ATOM   2517  O  O   . THR A  1 335 ? 42.176  28.318  134.962 1.00 22.72  ? 442  THR A O   1 
ATOM   2518  C  CB  . THR A  1 335 ? 42.631  30.668  136.632 1.00 22.67  ? 442  THR A CB  1 
ATOM   2519  O  OG1 . THR A  1 335 ? 43.509  31.551  137.331 1.00 23.24  ? 442  THR A OG1 1 
ATOM   2520  C  CG2 . THR A  1 335 ? 41.179  31.000  136.985 1.00 25.33  ? 442  THR A CG2 1 
ATOM   2521  N  N   . THR A  1 336 ? 41.260  27.493  136.844 1.00 20.89  ? 443  THR A N   1 
ATOM   2522  C  CA  . THR A  1 336 ? 40.423  26.553  136.119 1.00 20.18  ? 443  THR A CA  1 
ATOM   2523  C  C   . THR A  1 336 ? 39.602  27.294  135.066 1.00 18.33  ? 443  THR A C   1 
ATOM   2524  O  O   . THR A  1 336 ? 39.074  28.377  135.322 1.00 17.56  ? 443  THR A O   1 
ATOM   2525  C  CB  . THR A  1 336 ? 39.519  25.758  137.082 1.00 20.47  ? 443  THR A CB  1 
ATOM   2526  O  OG1 . THR A  1 336 ? 39.035  24.592  136.411 1.00 24.45  ? 443  THR A OG1 1 
ATOM   2527  C  CG2 . THR A  1 336 ? 38.352  26.588  137.542 1.00 19.71  ? 443  THR A CG2 1 
ATOM   2528  N  N   . VAL A  1 337 ? 39.534  26.719  133.870 1.00 16.83  ? 444  VAL A N   1 
ATOM   2529  C  CA  . VAL A  1 337 ? 38.804  27.321  132.758 1.00 15.72  ? 444  VAL A CA  1 
ATOM   2530  C  C   . VAL A  1 337 ? 37.298  27.431  132.955 1.00 16.04  ? 444  VAL A C   1 
ATOM   2531  O  O   . VAL A  1 337 ? 36.690  26.684  133.730 1.00 17.24  ? 444  VAL A O   1 
ATOM   2532  C  CB  . VAL A  1 337 ? 39.061  26.545  131.446 1.00 15.19  ? 444  VAL A CB  1 
ATOM   2533  C  CG1 . VAL A  1 337 ? 40.533  26.626  131.071 1.00 14.13  ? 444  VAL A CG1 1 
ATOM   2534  C  CG2 . VAL A  1 337 ? 38.646  25.090  131.613 1.00 14.16  ? 444  VAL A CG2 1 
ATOM   2535  N  N   . ALA A  1 338 ? 36.705  28.369  132.225 1.00 15.93  ? 445  ALA A N   1 
ATOM   2536  C  CA  . ALA A  1 338 ? 35.268  28.617  132.271 1.00 16.38  ? 445  ALA A CA  1 
ATOM   2537  C  C   . ALA A  1 338 ? 34.473  27.393  131.795 1.00 15.66  ? 445  ALA A C   1 
ATOM   2538  O  O   . ALA A  1 338 ? 35.007  26.518  131.128 1.00 14.05  ? 445  ALA A O   1 
ATOM   2539  C  CB  . ALA A  1 338 ? 34.946  29.821  131.408 1.00 14.11  ? 445  ALA A CB  1 
ATOM   2540  N  N   . PRO A  1 339 ? 33.182  27.325  132.138 1.00 16.88  ? 446  PRO A N   1 
ATOM   2541  C  CA  . PRO A  1 339 ? 32.359  26.185  131.721 1.00 16.76  ? 446  PRO A CA  1 
ATOM   2542  C  C   . PRO A  1 339 ? 32.394  25.947  130.227 1.00 16.29  ? 446  PRO A C   1 
ATOM   2543  O  O   . PRO A  1 339 ? 32.429  26.890  129.442 1.00 15.78  ? 446  PRO A O   1 
ATOM   2544  C  CB  . PRO A  1 339 ? 30.971  26.542  132.245 1.00 16.61  ? 446  PRO A CB  1 
ATOM   2545  C  CG  . PRO A  1 339 ? 31.046  28.045  132.505 1.00 17.89  ? 446  PRO A CG  1 
ATOM   2546  C  CD  . PRO A  1 339 ? 32.425  28.235  133.011 1.00 16.93  ? 446  PRO A CD  1 
ATOM   2547  N  N   . GLN A  1 340 ? 32.399  24.671  129.853 1.00 15.82  ? 447  GLN A N   1 
ATOM   2548  C  CA  . GLN A  1 340 ? 32.450  24.268  128.458 1.00 15.48  ? 447  GLN A CA  1 
ATOM   2549  C  C   . GLN A  1 340 ? 31.140  24.509  127.721 1.00 15.76  ? 447  GLN A C   1 
ATOM   2550  O  O   . GLN A  1 340 ? 30.072  24.099  128.167 1.00 16.63  ? 447  GLN A O   1 
ATOM   2551  C  CB  . GLN A  1 340 ? 32.807  22.789  128.365 1.00 15.65  ? 447  GLN A CB  1 
ATOM   2552  C  CG  . GLN A  1 340 ? 32.889  22.266  126.950 1.00 17.51  ? 447  GLN A CG  1 
ATOM   2553  C  CD  . GLN A  1 340 ? 32.717  20.761  126.880 1.00 18.28  ? 447  GLN A CD  1 
ATOM   2554  O  OE1 . GLN A  1 340 ? 31.702  20.220  127.326 1.00 17.96  ? 447  GLN A OE1 1 
ATOM   2555  N  NE2 . GLN A  1 340 ? 33.705  20.077  126.314 1.00 17.41  ? 447  GLN A NE2 1 
ATOM   2556  N  N   . ARG A  1 341 ? 31.227  25.180  126.587 1.00 14.91  ? 448  ARG A N   1 
ATOM   2557  C  CA  . ARG A  1 341 ? 30.057  25.428  125.788 1.00 15.20  ? 448  ARG A CA  1 
ATOM   2558  C  C   . ARG A  1 341 ? 30.129  24.480  124.590 1.00 15.16  ? 448  ARG A C   1 
ATOM   2559  O  O   . ARG A  1 341 ? 31.208  24.025  124.207 1.00 14.98  ? 448  ARG A O   1 
ATOM   2560  C  CB  . ARG A  1 341 ? 30.033  26.891  125.367 1.00 15.75  ? 448  ARG A CB  1 
ATOM   2561  C  CG  . ARG A  1 341 ? 29.831  27.795  126.555 1.00 14.54  ? 448  ARG A CG  1 
ATOM   2562  C  CD  . ARG A  1 341 ? 29.769  29.236  126.146 1.00 16.73  ? 448  ARG A CD  1 
ATOM   2563  N  NE  . ARG A  1 341 ? 29.333  30.072  127.260 1.00 17.80  ? 448  ARG A NE  1 
ATOM   2564  C  CZ  . ARG A  1 341 ? 28.773  31.265  127.119 1.00 16.73  ? 448  ARG A CZ  1 
ATOM   2565  N  NH1 . ARG A  1 341 ? 28.402  31.950  128.188 1.00 18.91  ? 448  ARG A NH1 1 
ATOM   2566  N  NH2 . ARG A  1 341 ? 28.578  31.768  125.909 1.00 16.30  ? 448  ARG A NH2 1 
ATOM   2567  N  N   . LYS A  1 342 ? 28.973  24.156  124.025 1.00 15.12  ? 449  LYS A N   1 
ATOM   2568  C  CA  . LYS A  1 342 ? 28.903  23.254  122.884 1.00 15.34  ? 449  LYS A CA  1 
ATOM   2569  C  C   . LYS A  1 342 ? 27.987  23.860  121.829 1.00 14.75  ? 449  LYS A C   1 
ATOM   2570  O  O   . LYS A  1 342 ? 26.781  23.941  122.016 1.00 14.60  ? 449  LYS A O   1 
ATOM   2571  C  CB  . LYS A  1 342 ? 28.352  21.899  123.330 1.00 15.25  ? 449  LYS A CB  1 
ATOM   2572  C  CG  . LYS A  1 342 ? 28.368  20.833  122.260 1.00 16.13  ? 449  LYS A CG  1 
ATOM   2573  C  CD  . LYS A  1 342 ? 27.777  19.538  122.781 1.00 16.10  ? 449  LYS A CD  1 
ATOM   2574  C  CE  . LYS A  1 342 ? 27.754  18.452  121.709 1.00 14.63  ? 449  LYS A CE  1 
ATOM   2575  N  NZ  . LYS A  1 342 ? 27.273  17.176  122.288 1.00 12.43  ? 449  LYS A NZ  1 
ATOM   2576  N  N   . CYS A  1 343 ? 28.558  24.305  120.725 1.00 15.04  ? 450  CYS A N   1 
ATOM   2577  C  CA  . CYS A  1 343 ? 27.738  24.894  119.690 1.00 16.57  ? 450  CYS A CA  1 
ATOM   2578  C  C   . CYS A  1 343 ? 27.616  23.950  118.497 1.00 15.57  ? 450  CYS A C   1 
ATOM   2579  O  O   . CYS A  1 343 ? 28.610  23.584  117.873 1.00 14.14  ? 450  CYS A O   1 
ATOM   2580  C  CB  . CYS A  1 343 ? 28.312  26.235  119.256 1.00 16.38  ? 450  CYS A CB  1 
ATOM   2581  S  SG  . CYS A  1 343 ? 27.275  27.036  118.001 1.00 22.66  ? 450  CYS A SG  1 
ATOM   2582  N  N   . ILE A  1 344 ? 26.383  23.543  118.208 1.00 14.40  ? 451  ILE A N   1 
ATOM   2583  C  CA  . ILE A  1 344 ? 26.100  22.640  117.100 1.00 13.76  ? 451  ILE A CA  1 
ATOM   2584  C  C   . ILE A  1 344 ? 25.560  23.439  115.927 1.00 14.10  ? 451  ILE A C   1 
ATOM   2585  O  O   . ILE A  1 344 ? 24.568  24.150  116.064 1.00 14.74  ? 451  ILE A O   1 
ATOM   2586  C  CB  . ILE A  1 344 ? 25.023  21.602  117.483 1.00 13.96  ? 451  ILE A CB  1 
ATOM   2587  C  CG1 . ILE A  1 344 ? 25.502  20.761  118.663 1.00 12.47  ? 451  ILE A CG1 1 
ATOM   2588  C  CG2 . ILE A  1 344 ? 24.686  20.725  116.288 1.00 12.21  ? 451  ILE A CG2 1 
ATOM   2589  C  CD1 . ILE A  1 344 ? 24.433  19.849  119.243 1.00 10.35  ? 451  ILE A CD1 1 
ATOM   2590  N  N   . VAL A  1 345 ? 26.204  23.331  114.774 1.00 13.97  ? 452  VAL A N   1 
ATOM   2591  C  CA  . VAL A  1 345 ? 25.721  24.054  113.607 1.00 15.32  ? 452  VAL A CA  1 
ATOM   2592  C  C   . VAL A  1 345 ? 25.648  23.160  112.361 1.00 15.94  ? 452  VAL A C   1 
ATOM   2593  O  O   . VAL A  1 345 ? 26.636  22.565  111.942 1.00 16.46  ? 452  VAL A O   1 
ATOM   2594  C  CB  . VAL A  1 345 ? 26.576  25.343  113.363 1.00 12.52  ? 452  VAL A CB  1 
ATOM   2595  C  CG1 . VAL A  1 345 ? 27.973  25.122  113.810 1.00 14.78  ? 452  VAL A CG1 1 
ATOM   2596  C  CG2 . VAL A  1 345 ? 26.548  25.740  111.923 1.00 11.03  ? 452  VAL A CG2 1 
ATOM   2597  N  N   . GLU A  1 346 ? 24.445  23.058  111.803 1.00 17.41  ? 453  GLU A N   1 
ATOM   2598  C  CA  . GLU A  1 346 ? 24.182  22.261  110.610 1.00 19.09  ? 453  GLU A CA  1 
ATOM   2599  C  C   . GLU A  1 346 ? 24.624  23.068  109.408 1.00 19.05  ? 453  GLU A C   1 
ATOM   2600  O  O   . GLU A  1 346 ? 24.041  24.095  109.111 1.00 18.47  ? 453  GLU A O   1 
ATOM   2601  C  CB  . GLU A  1 346 ? 22.688  21.964  110.518 1.00 21.15  ? 453  GLU A CB  1 
ATOM   2602  C  CG  . GLU A  1 346 ? 22.140  21.313  111.773 1.00 25.01  ? 453  GLU A CG  1 
ATOM   2603  C  CD  . GLU A  1 346 ? 20.620  21.215  111.783 1.00 29.55  ? 453  GLU A CD  1 
ATOM   2604  O  OE1 . GLU A  1 346 ? 20.060  20.247  111.187 1.00 29.67  ? 453  GLU A OE1 1 
ATOM   2605  O  OE2 . GLU A  1 346 ? 19.989  22.121  112.387 1.00 29.75  ? 453  GLU A OE2 1 
ATOM   2606  N  N   . ILE A  1 347 ? 25.658  22.600  108.724 1.00 20.90  ? 454  ILE A N   1 
ATOM   2607  C  CA  . ILE A  1 347 ? 26.200  23.310  107.577 1.00 22.10  ? 454  ILE A CA  1 
ATOM   2608  C  C   . ILE A  1 347 ? 25.459  23.037  106.278 1.00 24.73  ? 454  ILE A C   1 
ATOM   2609  O  O   . ILE A  1 347 ? 25.171  23.955  105.503 1.00 25.57  ? 454  ILE A O   1 
ATOM   2610  C  CB  . ILE A  1 347 ? 27.688  22.938  107.365 1.00 20.61  ? 454  ILE A CB  1 
ATOM   2611  C  CG1 . ILE A  1 347 ? 28.488  23.221  108.645 1.00 18.74  ? 454  ILE A CG1 1 
ATOM   2612  C  CG2 . ILE A  1 347 ? 28.254  23.696  106.163 1.00 20.37  ? 454  ILE A CG2 1 
ATOM   2613  C  CD1 . ILE A  1 347 ? 28.407  24.633  109.126 1.00 16.07  ? 454  ILE A CD1 1 
ATOM   2614  N  N   . LEU A  1 348 ? 25.133  21.767  106.064 1.00 27.60  ? 455  LEU A N   1 
ATOM   2615  C  CA  . LEU A  1 348 ? 24.494  21.352  104.831 1.00 30.15  ? 455  LEU A CA  1 
ATOM   2616  C  C   . LEU A  1 348 ? 23.370  20.299  104.924 1.00 32.63  ? 455  LEU A C   1 
ATOM   2617  O  O   . LEU A  1 348 ? 23.597  19.159  105.337 1.00 34.30  ? 455  LEU A O   1 
ATOM   2618  C  CB  . LEU A  1 348 ? 25.630  20.903  103.893 1.00 29.21  ? 455  LEU A CB  1 
ATOM   2619  C  CG  . LEU A  1 348 ? 25.555  19.782  102.861 1.00 29.08  ? 455  LEU A CG  1 
ATOM   2620  C  CD1 . LEU A  1 348 ? 26.643  20.022  101.832 1.00 28.82  ? 455  LEU A CD1 1 
ATOM   2621  C  CD2 . LEU A  1 348 ? 25.738  18.422  103.515 1.00 27.51  ? 455  LEU A CD2 1 
ATOM   2622  N  N   . VAL A  1 349 ? 22.148  20.688  104.559 1.00 34.15  ? 456  VAL A N   1 
ATOM   2623  C  CA  . VAL A  1 349 ? 21.020  19.751  104.563 0.00 34.82  ? 456  VAL A CA  1 
ATOM   2624  C  C   . VAL A  1 349 ? 20.915  19.076  103.184 1.00 35.96  ? 456  VAL A C   1 
ATOM   2625  O  O   . VAL A  1 349 ? 20.872  17.842  103.090 1.00 35.70  ? 456  VAL A O   1 
ATOM   2626  C  CB  . VAL A  1 349 ? 19.693  20.467  104.885 0.00 34.93  ? 456  VAL A CB  1 
ATOM   2627  C  CG1 . VAL A  1 349 ? 18.556  19.457  104.924 0.00 34.88  ? 456  VAL A CG1 1 
ATOM   2628  C  CG2 . VAL A  1 349 ? 19.806  21.186  106.220 0.00 34.88  ? 456  VAL A CG2 1 
ATOM   2629  N  N   . GLU A  1 350 ? 20.879  19.902  102.128 1.00 35.01  ? 457  GLU A N   1 
ATOM   2630  C  CA  . GLU A  1 350 ? 20.833  19.450  100.732 1.00 32.77  ? 457  GLU A CA  1 
ATOM   2631  C  C   . GLU A  1 350 ? 22.108  18.650  100.381 1.00 31.57  ? 457  GLU A C   1 
ATOM   2632  O  O   . GLU A  1 350 ? 23.219  19.125  100.591 1.00 29.90  ? 457  GLU A O   1 
ATOM   2633  C  CB  . GLU A  1 350 ? 20.741  20.675  99.827  1.00 33.66  ? 457  GLU A CB  1 
ATOM   2634  C  CG  . GLU A  1 350 ? 20.976  20.411  98.347  1.00 35.15  ? 457  GLU A CG  1 
ATOM   2635  C  CD  . GLU A  1 350 ? 21.414  21.664  97.586  1.00 34.95  ? 457  GLU A CD  1 
ATOM   2636  O  OE1 . GLU A  1 350 ? 22.493  22.206  97.905  0.00 35.11  ? 457  GLU A OE1 1 
ATOM   2637  O  OE2 . GLU A  1 350 ? 20.677  22.097  96.675  0.00 35.11  ? 457  GLU A OE2 1 
ATOM   2638  N  N   . PRO A  1 351 ? 21.960  17.437  99.815  1.00 30.64  ? 458  PRO A N   1 
ATOM   2639  C  CA  . PRO A  1 351 ? 23.097  16.584  99.443  1.00 30.28  ? 458  PRO A CA  1 
ATOM   2640  C  C   . PRO A  1 351 ? 24.073  17.316  98.532  1.00 29.80  ? 458  PRO A C   1 
ATOM   2641  O  O   . PRO A  1 351 ? 23.725  18.313  97.917  1.00 31.33  ? 458  PRO A O   1 
ATOM   2642  C  CB  . PRO A  1 351 ? 22.443  15.418  98.707  1.00 29.71  ? 458  PRO A CB  1 
ATOM   2643  C  CG  . PRO A  1 351 ? 21.047  15.430  99.185  1.00 32.23  ? 458  PRO A CG  1 
ATOM   2644  C  CD  . PRO A  1 351 ? 20.715  16.887  99.265  1.00 31.20  ? 458  PRO A CD  1 
ATOM   2645  N  N   . LYS A  1 352 ? 25.285  16.800  98.404  1.00 29.00  ? 459  LYS A N   1 
ATOM   2646  C  CA  . LYS A  1 352 ? 26.255  17.463  97.560  1.00 28.58  ? 459  LYS A CA  1 
ATOM   2647  C  C   . LYS A  1 352 ? 27.175  16.484  96.853  1.00 28.60  ? 459  LYS A C   1 
ATOM   2648  O  O   . LYS A  1 352 ? 27.811  15.641  97.482  1.00 29.45  ? 459  LYS A O   1 
ATOM   2649  C  CB  . LYS A  1 352 ? 27.070  18.436  98.406  1.00 30.21  ? 459  LYS A CB  1 
ATOM   2650  C  CG  . LYS A  1 352 ? 27.732  19.539  97.611  1.00 34.82  ? 459  LYS A CG  1 
ATOM   2651  C  CD  . LYS A  1 352 ? 27.308  20.921  98.099  1.00 36.42  ? 459  LYS A CD  1 
ATOM   2652  C  CE  . LYS A  1 352 ? 25.850  21.200  97.804  1.00 37.45  ? 459  LYS A CE  1 
ATOM   2653  N  NZ  . LYS A  1 352 ? 25.446  22.540  98.314  1.00 39.59  ? 459  LYS A NZ  1 
ATOM   2654  N  N   . ASP A  1 353 ? 27.229  16.592  95.531  1.00 28.94  ? 460  ASP A N   1 
ATOM   2655  C  CA  . ASP A  1 353 ? 28.083  15.729  94.726  1.00 28.18  ? 460  ASP A CA  1 
ATOM   2656  C  C   . ASP A  1 353 ? 29.537  16.043  95.062  1.00 27.57  ? 460  ASP A C   1 
ATOM   2657  O  O   . ASP A  1 353 ? 29.947  17.204  95.094  1.00 28.40  ? 460  ASP A O   1 
ATOM   2658  C  CB  . ASP A  1 353 ? 27.850  15.994  93.237  1.00 28.60  ? 460  ASP A CB  1 
ATOM   2659  C  CG  . ASP A  1 353 ? 28.633  15.048  92.348  1.00 29.70  ? 460  ASP A CG  1 
ATOM   2660  O  OD1 . ASP A  1 353 ? 29.171  15.503  91.313  1.00 31.84  ? 460  ASP A OD1 1 
ATOM   2661  O  OD2 . ASP A  1 353 ? 28.700  13.846  92.678  1.00 30.06  ? 460  ASP A OD2 1 
ATOM   2662  N  N   . ILE A  1 354 ? 30.315  15.008  95.332  1.00 26.32  ? 461  ILE A N   1 
ATOM   2663  C  CA  . ILE A  1 354 ? 31.723  15.195  95.631  1.00 26.29  ? 461  ILE A CA  1 
ATOM   2664  C  C   . ILE A  1 354 ? 32.482  15.256  94.313  1.00 27.73  ? 461  ILE A C   1 
ATOM   2665  O  O   . ILE A  1 354 ? 33.234  16.210  94.044  1.00 29.55  ? 461  ILE A O   1 
ATOM   2666  C  CB  . ILE A  1 354 ? 32.269  14.032  96.474  1.00 23.91  ? 461  ILE A CB  1 
ATOM   2667  C  CG1 . ILE A  1 354 ? 31.684  14.105  97.884  1.00 22.70  ? 461  ILE A CG1 1 
ATOM   2668  C  CG2 . ILE A  1 354 ? 33.784  14.082  96.517  1.00 21.60  ? 461  ILE A CG2 1 
ATOM   2669  C  CD1 . ILE A  1 354 ? 32.067  12.927  98.750  1.00 22.79  ? 461  ILE A CD1 1 
ATOM   2670  N  N   . GLY A  1 355 ? 32.280  14.233  93.485  1.00 28.38  ? 462  GLY A N   1 
ATOM   2671  C  CA  . GLY A  1 355 ? 32.953  14.192  92.202  1.00 28.45  ? 462  GLY A CA  1 
ATOM   2672  C  C   . GLY A  1 355 ? 34.460  14.251  92.366  1.00 29.21  ? 462  GLY A C   1 
ATOM   2673  O  O   . GLY A  1 355 ? 35.039  13.480  93.146  1.00 30.92  ? 462  GLY A O   1 
ATOM   2674  N  N   . LYS A  1 356 ? 35.097  15.171  91.646  1.00 28.71  ? 463  LYS A N   1 
ATOM   2675  C  CA  . LYS A  1 356 ? 36.554  15.327  91.698  1.00 28.16  ? 463  LYS A CA  1 
ATOM   2676  C  C   . LYS A  1 356 ? 36.978  16.179  92.887  1.00 28.03  ? 463  LYS A C   1 
ATOM   2677  O  O   . LYS A  1 356 ? 37.988  15.905  93.547  1.00 25.93  ? 463  LYS A O   1 
ATOM   2678  C  CB  . LYS A  1 356 ? 37.064  15.982  90.408  1.00 28.12  ? 463  LYS A CB  1 
ATOM   2679  C  CG  . LYS A  1 356 ? 38.560  16.285  90.412  1.00 29.55  ? 463  LYS A CG  1 
ATOM   2680  C  CD  . LYS A  1 356 ? 39.401  15.021  90.621  1.00 31.80  ? 463  LYS A CD  1 
ATOM   2681  C  CE  . LYS A  1 356 ? 40.896  15.331  90.694  1.00 31.73  ? 463  LYS A CE  1 
ATOM   2682  N  NZ  . LYS A  1 356 ? 41.706  14.097  90.885  0.00 32.04  ? 463  LYS A NZ  1 
ATOM   2683  N  N   . ARG A  1 357 ? 36.204  17.230  93.138  1.00 28.14  ? 464  ARG A N   1 
ATOM   2684  C  CA  . ARG A  1 357 ? 36.483  18.126  94.238  1.00 28.18  ? 464  ARG A CA  1 
ATOM   2685  C  C   . ARG A  1 357 ? 35.222  18.832  94.666  1.00 27.30  ? 464  ARG A C   1 
ATOM   2686  O  O   . ARG A  1 357 ? 34.365  19.146  93.842  1.00 28.67  ? 464  ARG A O   1 
ATOM   2687  C  CB  . ARG A  1 357 ? 37.519  19.178  93.863  1.00 30.51  ? 464  ARG A CB  1 
ATOM   2688  C  CG  . ARG A  1 357 ? 38.004  19.890  95.108  1.00 36.63  ? 464  ARG A CG  1 
ATOM   2689  C  CD  . ARG A  1 357 ? 38.754  21.185  94.871  1.00 41.30  ? 464  ARG A CD  1 
ATOM   2690  N  NE  . ARG A  1 357 ? 38.716  21.977  96.102  1.00 46.42  ? 464  ARG A NE  1 
ATOM   2691  C  CZ  . ARG A  1 357 ? 39.254  23.186  96.251  1.00 49.43  ? 464  ARG A CZ  1 
ATOM   2692  N  NH1 . ARG A  1 357 ? 39.154  23.820  97.419  1.00 50.07  ? 464  ARG A NH1 1 
ATOM   2693  N  NH2 . ARG A  1 357 ? 39.897  23.762  95.239  1.00 50.71  ? 464  ARG A NH2 1 
ATOM   2694  N  N   . LEU A  1 358 ? 35.117  19.082  95.963  1.00 25.29  ? 465  LEU A N   1 
ATOM   2695  C  CA  . LEU A  1 358 ? 33.958  19.753  96.522  1.00 23.63  ? 465  LEU A CA  1 
ATOM   2696  C  C   . LEU A  1 358 ? 34.413  20.751  97.579  1.00 23.70  ? 465  LEU A C   1 
ATOM   2697  O  O   . LEU A  1 358 ? 35.302  20.454  98.378  1.00 23.64  ? 465  LEU A O   1 
ATOM   2698  C  CB  . LEU A  1 358 ? 33.020  18.731  97.164  1.00 21.59  ? 465  LEU A CB  1 
ATOM   2699  C  CG  . LEU A  1 358 ? 31.906  19.397  97.962  1.00 21.23  ? 465  LEU A CG  1 
ATOM   2700  C  CD1 . LEU A  1 358 ? 30.968  20.104  97.004  1.00 22.22  ? 465  LEU A CD1 1 
ATOM   2701  C  CD2 . LEU A  1 358 ? 31.163  18.380  98.773  1.00 20.14  ? 465  LEU A CD2 1 
ATOM   2702  N  N   . GLU A  1 359 ? 33.807  21.932  97.582  1.00 22.55  ? 466  GLU A N   1 
ATOM   2703  C  CA  . GLU A  1 359 ? 34.152  22.947  98.565  1.00 22.52  ? 466  GLU A CA  1 
ATOM   2704  C  C   . GLU A  1 359 ? 32.861  23.462  99.180  1.00 20.56  ? 466  GLU A C   1 
ATOM   2705  O  O   . GLU A  1 359 ? 31.952  23.869  98.462  1.00 20.74  ? 466  GLU A O   1 
ATOM   2706  C  CB  . GLU A  1 359 ? 34.893  24.104  97.899  1.00 24.08  ? 466  GLU A CB  1 
ATOM   2707  C  CG  . GLU A  1 359 ? 35.625  24.996  98.866  1.00 29.91  ? 466  GLU A CG  1 
ATOM   2708  C  CD  . GLU A  1 359 ? 36.091  26.307  98.239  1.00 34.54  ? 466  GLU A CD  1 
ATOM   2709  O  OE1 . GLU A  1 359 ? 35.231  27.174  97.932  1.00 37.05  ? 466  GLU A OE1 1 
ATOM   2710  O  OE2 . GLU A  1 359 ? 37.319  26.472  98.052  1.00 36.34  ? 466  GLU A OE2 1 
ATOM   2711  N  N   . VAL A  1 360 ? 32.770  23.421  100.502 1.00 19.26  ? 467  VAL A N   1 
ATOM   2712  C  CA  . VAL A  1 360 ? 31.585  23.910  101.204 1.00 19.52  ? 467  VAL A CA  1 
ATOM   2713  C  C   . VAL A  1 360 ? 32.002  25.073  102.096 1.00 19.61  ? 467  VAL A C   1 
ATOM   2714  O  O   . VAL A  1 360 ? 32.844  24.911  102.971 1.00 21.20  ? 467  VAL A O   1 
ATOM   2715  C  CB  . VAL A  1 360 ? 30.923  22.791  102.084 1.00 19.66  ? 467  VAL A CB  1 
ATOM   2716  C  CG1 . VAL A  1 360 ? 29.852  23.389  102.994 1.00 17.47  ? 467  VAL A CG1 1 
ATOM   2717  C  CG2 . VAL A  1 360 ? 30.290  21.721  101.191 1.00 16.90  ? 467  VAL A CG2 1 
ATOM   2718  N  N   . ARG A  1 361 ? 31.435  26.248  101.853 1.00 20.28  ? 468  ARG A N   1 
ATOM   2719  C  CA  . ARG A  1 361 ? 31.756  27.424  102.647 1.00 20.34  ? 468  ARG A CA  1 
ATOM   2720  C  C   . ARG A  1 361 ? 30.503  27.834  103.397 1.00 20.15  ? 468  ARG A C   1 
ATOM   2721  O  O   . ARG A  1 361 ? 29.410  27.799  102.844 1.00 20.92  ? 468  ARG A O   1 
ATOM   2722  C  CB  . ARG A  1 361 ? 32.201  28.568  101.744 1.00 22.07  ? 468  ARG A CB  1 
ATOM   2723  C  CG  . ARG A  1 361 ? 33.243  28.182  100.718 1.00 26.23  ? 468  ARG A CG  1 
ATOM   2724  C  CD  . ARG A  1 361 ? 33.640  29.386  99.861  1.00 30.88  ? 468  ARG A CD  1 
ATOM   2725  N  NE  . ARG A  1 361 ? 34.543  30.305  100.560 1.00 34.80  ? 468  ARG A NE  1 
ATOM   2726  C  CZ  . ARG A  1 361 ? 35.870  30.314  100.410 1.00 37.41  ? 468  ARG A CZ  1 
ATOM   2727  N  NH1 . ARG A  1 361 ? 36.613  31.182  101.093 1.00 37.93  ? 468  ARG A NH1 1 
ATOM   2728  N  NH2 . ARG A  1 361 ? 36.464  29.465  99.570  1.00 36.59  ? 468  ARG A NH2 1 
ATOM   2729  N  N   . LYS A  1 362 ? 30.649  28.213  104.658 1.00 20.24  ? 469  LYS A N   1 
ATOM   2730  C  CA  . LYS A  1 362 ? 29.494  28.637  105.433 1.00 19.67  ? 469  LYS A CA  1 
ATOM   2731  C  C   . LYS A  1 362 ? 29.896  29.671  106.471 1.00 19.52  ? 469  LYS A C   1 
ATOM   2732  O  O   . LYS A  1 362 ? 30.908  29.520  107.146 1.00 21.45  ? 469  LYS A O   1 
ATOM   2733  C  CB  . LYS A  1 362 ? 28.857  27.429  106.124 1.00 20.76  ? 469  LYS A CB  1 
ATOM   2734  C  CG  . LYS A  1 362 ? 27.439  27.662  106.648 1.00 20.17  ? 469  LYS A CG  1 
ATOM   2735  C  CD  . LYS A  1 362 ? 26.445  27.859  105.510 1.00 21.32  ? 469  LYS A CD  1 
ATOM   2736  C  CE  . LYS A  1 362 ? 25.023  28.038  106.032 1.00 22.28  ? 469  LYS A CE  1 
ATOM   2737  N  NZ  . LYS A  1 362 ? 24.041  28.224  104.927 0.00 21.89  ? 469  LYS A NZ  1 
ATOM   2738  N  N   . ALA A  1 363 ? 29.111  30.731  106.586 1.00 18.30  ? 470  ALA A N   1 
ATOM   2739  C  CA  . ALA A  1 363 ? 29.391  31.755  107.579 1.00 17.80  ? 470  ALA A CA  1 
ATOM   2740  C  C   . ALA A  1 363 ? 28.825  31.224  108.888 1.00 18.15  ? 470  ALA A C   1 
ATOM   2741  O  O   . ALA A  1 363 ? 27.672  30.809  108.944 1.00 18.60  ? 470  ALA A O   1 
ATOM   2742  C  CB  . ALA A  1 363 ? 28.710  33.044  107.203 1.00 17.56  ? 470  ALA A CB  1 
ATOM   2743  N  N   . VAL A  1 364 ? 29.639  31.228  109.934 1.00 17.77  ? 471  VAL A N   1 
ATOM   2744  C  CA  . VAL A  1 364 ? 29.215  30.731  111.235 1.00 17.56  ? 471  VAL A CA  1 
ATOM   2745  C  C   . VAL A  1 364 ? 29.281  31.824  112.288 1.00 17.65  ? 471  VAL A C   1 
ATOM   2746  O  O   . VAL A  1 364 ? 30.276  32.547  112.372 1.00 17.32  ? 471  VAL A O   1 
ATOM   2747  C  CB  . VAL A  1 364 ? 30.109  29.561  111.674 1.00 17.09  ? 471  VAL A CB  1 
ATOM   2748  C  CG1 . VAL A  1 364 ? 29.686  29.053  113.012 1.00 17.90  ? 471  VAL A CG1 1 
ATOM   2749  C  CG2 . VAL A  1 364 ? 30.034  28.459  110.658 1.00 18.85  ? 471  VAL A CG2 1 
ATOM   2750  N  N   . THR A  1 365 ? 28.219  31.943  113.083 1.00 18.12  ? 472  THR A N   1 
ATOM   2751  C  CA  . THR A  1 365 ? 28.168  32.953  114.135 1.00 18.85  ? 472  THR A CA  1 
ATOM   2752  C  C   . THR A  1 365 ? 28.541  32.341  115.474 1.00 18.53  ? 472  THR A C   1 
ATOM   2753  O  O   . THR A  1 365 ? 28.645  33.045  116.468 1.00 20.77  ? 472  THR A O   1 
ATOM   2754  C  CB  . THR A  1 365 ? 26.765  33.579  114.257 1.00 19.04  ? 472  THR A CB  1 
ATOM   2755  O  OG1 . THR A  1 365 ? 25.804  32.555  114.529 1.00 18.60  ? 472  THR A OG1 1 
ATOM   2756  C  CG2 . THR A  1 365 ? 26.394  34.289  112.986 1.00 17.30  ? 472  THR A CG2 1 
ATOM   2757  N  N   . ALA A  1 366 ? 28.735  31.028  115.487 1.00 18.10  ? 473  ALA A N   1 
ATOM   2758  C  CA  . ALA A  1 366 ? 29.116  30.293  116.689 1.00 17.64  ? 473  ALA A CA  1 
ATOM   2759  C  C   . ALA A  1 366 ? 28.145  30.503  117.847 1.00 18.71  ? 473  ALA A C   1 
ATOM   2760  O  O   . ALA A  1 366 ? 28.550  30.785  118.978 1.00 18.50  ? 473  ALA A O   1 
ATOM   2761  C  CB  . ALA A  1 366 ? 30.534  30.673  117.109 1.00 17.76  ? 473  ALA A CB  1 
ATOM   2762  N  N   . CYS A  1 367 ? 26.856  30.364  117.547 1.00 19.69  ? 474  CYS A N   1 
ATOM   2763  C  CA  . CYS A  1 367 ? 25.811  30.502  118.547 1.00 20.49  ? 474  CYS A CA  1 
ATOM   2764  C  C   . CYS A  1 367 ? 25.749  31.878  119.205 1.00 21.94  ? 474  CYS A C   1 
ATOM   2765  O  O   . CYS A  1 367 ? 25.498  31.982  120.407 1.00 23.43  ? 474  CYS A O   1 
ATOM   2766  C  CB  . CYS A  1 367 ? 25.991  29.412  119.603 1.00 20.82  ? 474  CYS A CB  1 
ATOM   2767  S  SG  . CYS A  1 367 ? 25.623  27.710  119.021 1.00 22.43  ? 474  CYS A SG  1 
ATOM   2768  N  N   . LEU A  1 368 ? 25.976  32.926  118.413 1.00 21.90  ? 475  LEU A N   1 
ATOM   2769  C  CA  . LEU A  1 368 ? 25.936  34.301  118.906 1.00 22.94  ? 475  LEU A CA  1 
ATOM   2770  C  C   . LEU A  1 368 ? 24.550  34.584  119.465 1.00 24.74  ? 475  LEU A C   1 
ATOM   2771  O  O   . LEU A  1 368 ? 23.544  34.261  118.828 1.00 24.28  ? 475  LEU A O   1 
ATOM   2772  C  CB  . LEU A  1 368 ? 26.213  35.279  117.769 1.00 21.95  ? 475  LEU A CB  1 
ATOM   2773  C  CG  . LEU A  1 368 ? 26.128  36.748  118.159 1.00 20.53  ? 475  LEU A CG  1 
ATOM   2774  C  CD1 . LEU A  1 368 ? 27.270  37.074  119.097 1.00 21.92  ? 475  LEU A CD1 1 
ATOM   2775  C  CD2 . LEU A  1 368 ? 26.204  37.610  116.916 1.00 21.33  ? 475  LEU A CD2 1 
ATOM   2776  N  N   . GLY A  1 369 ? 24.490  35.187  120.649 1.00 25.46  ? 476  GLY A N   1 
ATOM   2777  C  CA  . GLY A  1 369 ? 23.203  35.479  121.246 1.00 26.47  ? 476  GLY A CA  1 
ATOM   2778  C  C   . GLY A  1 369 ? 22.561  34.296  121.965 1.00 27.88  ? 476  GLY A C   1 
ATOM   2779  O  O   . GLY A  1 369 ? 21.433  34.396  122.459 1.00 28.90  ? 476  GLY A O   1 
ATOM   2780  N  N   . GLU A  1 370 ? 23.259  33.167  122.026 1.00 27.36  ? 477  GLU A N   1 
ATOM   2781  C  CA  . GLU A  1 370 ? 22.728  31.997  122.714 1.00 27.00  ? 477  GLU A CA  1 
ATOM   2782  C  C   . GLU A  1 370 ? 23.678  31.611  123.845 1.00 26.34  ? 477  GLU A C   1 
ATOM   2783  O  O   . GLU A  1 370 ? 24.825  32.042  123.881 1.00 26.55  ? 477  GLU A O   1 
ATOM   2784  C  CB  . GLU A  1 370 ? 22.581  30.829  121.742 1.00 29.58  ? 477  GLU A CB  1 
ATOM   2785  C  CG  . GLU A  1 370 ? 21.865  31.178  120.434 1.00 33.70  ? 477  GLU A CG  1 
ATOM   2786  C  CD  . GLU A  1 370 ? 21.795  29.997  119.454 1.00 35.90  ? 477  GLU A CD  1 
ATOM   2787  O  OE1 . GLU A  1 370 ? 21.433  30.216  118.275 1.00 37.18  ? 477  GLU A OE1 1 
ATOM   2788  O  OE2 . GLU A  1 370 ? 22.102  28.850  119.858 1.00 36.49  ? 477  GLU A OE2 1 
ATOM   2789  N  N   . PRO A  1 371 ? 23.209  30.785  124.786 1.00 25.53  ? 478  PRO A N   1 
ATOM   2790  C  CA  . PRO A  1 371 ? 24.020  30.342  125.926 1.00 24.04  ? 478  PRO A CA  1 
ATOM   2791  C  C   . PRO A  1 371 ? 25.312  29.628  125.547 1.00 22.87  ? 478  PRO A C   1 
ATOM   2792  O  O   . PRO A  1 371 ? 26.279  29.628  126.302 1.00 23.38  ? 478  PRO A O   1 
ATOM   2793  C  CB  . PRO A  1 371 ? 23.065  29.421  126.685 1.00 23.61  ? 478  PRO A CB  1 
ATOM   2794  C  CG  . PRO A  1 371 ? 21.725  30.009  126.386 1.00 24.19  ? 478  PRO A CG  1 
ATOM   2795  C  CD  . PRO A  1 371 ? 21.819  30.311  124.916 1.00 24.71  ? 478  PRO A CD  1 
ATOM   2796  N  N   . ASN A  1 372 ? 25.327  29.007  124.379 1.00 21.91  ? 479  ASN A N   1 
ATOM   2797  C  CA  . ASN A  1 372 ? 26.510  28.282  123.943 1.00 20.76  ? 479  ASN A CA  1 
ATOM   2798  C  C   . ASN A  1 372 ? 27.416  29.084  123.017 1.00 20.22  ? 479  ASN A C   1 
ATOM   2799  O  O   . ASN A  1 372 ? 28.241  28.509  122.307 1.00 20.55  ? 479  ASN A O   1 
ATOM   2800  C  CB  . ASN A  1 372 ? 26.109  26.971  123.257 1.00 20.85  ? 479  ASN A CB  1 
ATOM   2801  C  CG  . ASN A  1 372 ? 25.640  25.914  124.240 1.00 21.08  ? 479  ASN A CG  1 
ATOM   2802  O  OD1 . ASN A  1 372 ? 26.424  25.385  125.034 1.00 20.43  ? 479  ASN A OD1 1 
ATOM   2803  N  ND2 . ASN A  1 372 ? 24.354  25.603  124.195 1.00 21.45  ? 479  ASN A ND2 1 
ATOM   2804  N  N   . HIS A  1 373 ? 27.255  30.405  123.017 1.00 18.90  ? 480  HIS A N   1 
ATOM   2805  C  CA  . HIS A  1 373 ? 28.084  31.274  122.195 1.00 17.69  ? 480  HIS A CA  1 
ATOM   2806  C  C   . HIS A  1 373 ? 29.541  31.009  122.573 1.00 16.58  ? 480  HIS A C   1 
ATOM   2807  O  O   . HIS A  1 373 ? 29.882  30.959  123.748 1.00 16.87  ? 480  HIS A O   1 
ATOM   2808  C  CB  . HIS A  1 373 ? 27.697  32.727  122.450 1.00 18.63  ? 480  HIS A CB  1 
ATOM   2809  C  CG  . HIS A  1 373 ? 28.548  33.725  121.734 1.00 21.08  ? 480  HIS A CG  1 
ATOM   2810  N  ND1 . HIS A  1 373 ? 28.888  33.604  120.409 1.00 22.62  ? 480  HIS A ND1 1 
ATOM   2811  C  CD2 . HIS A  1 373 ? 29.098  34.887  122.152 1.00 22.43  ? 480  HIS A CD2 1 
ATOM   2812  C  CE1 . HIS A  1 373 ? 29.611  34.647  120.037 1.00 22.62  ? 480  HIS A CE1 1 
ATOM   2813  N  NE2 . HIS A  1 373 ? 29.753  35.441  121.078 1.00 23.15  ? 480  HIS A NE2 1 
ATOM   2814  N  N   . ILE A  1 374 ? 30.390  30.817  121.572 1.00 15.54  ? 481  ILE A N   1 
ATOM   2815  C  CA  . ILE A  1 374 ? 31.802  30.530  121.801 1.00 14.91  ? 481  ILE A CA  1 
ATOM   2816  C  C   . ILE A  1 374 ? 32.703  31.556  121.132 1.00 14.76  ? 481  ILE A C   1 
ATOM   2817  O  O   . ILE A  1 374 ? 32.477  31.930  119.989 1.00 14.58  ? 481  ILE A O   1 
ATOM   2818  C  CB  . ILE A  1 374 ? 32.168  29.136  121.238 1.00 14.43  ? 481  ILE A CB  1 
ATOM   2819  C  CG1 . ILE A  1 374 ? 31.451  28.049  122.030 1.00 13.28  ? 481  ILE A CG1 1 
ATOM   2820  C  CG2 . ILE A  1 374 ? 33.664  28.914  121.298 1.00 15.45  ? 481  ILE A CG2 1 
ATOM   2821  C  CD1 . ILE A  1 374 ? 31.636  26.676  121.460 1.00 13.27  ? 481  ILE A CD1 1 
ATOM   2822  N  N   . THR A  1 375 ? 33.723  32.021  121.838 1.00 15.87  ? 482  THR A N   1 
ATOM   2823  C  CA  . THR A  1 375 ? 34.633  32.967  121.225 1.00 15.94  ? 482  THR A CA  1 
ATOM   2824  C  C   . THR A  1 375 ? 36.057  32.478  121.388 1.00 16.24  ? 482  THR A C   1 
ATOM   2825  O  O   . THR A  1 375 ? 36.988  33.030  120.819 1.00 19.03  ? 482  THR A O   1 
ATOM   2826  C  CB  . THR A  1 375 ? 34.422  34.359  121.778 1.00 15.03  ? 482  THR A CB  1 
ATOM   2827  O  OG1 . THR A  1 375 ? 34.279  34.291  123.196 1.00 18.11  ? 482  THR A OG1 1 
ATOM   2828  C  CG2 . THR A  1 375 ? 33.151  34.949  121.189 1.00 15.15  ? 482  THR A CG2 1 
ATOM   2829  N  N   . ARG A  1 376 ? 36.202  31.381  122.119 1.00 16.89  ? 483  ARG A N   1 
ATOM   2830  C  CA  . ARG A  1 376 ? 37.497  30.770  122.358 1.00 18.08  ? 483  ARG A CA  1 
ATOM   2831  C  C   . ARG A  1 376 ? 37.339  29.271  122.157 1.00 17.21  ? 483  ARG A C   1 
ATOM   2832  O  O   . ARG A  1 376 ? 36.802  28.584  123.026 1.00 18.46  ? 483  ARG A O   1 
ATOM   2833  C  CB  . ARG A  1 376 ? 37.923  31.047  123.790 1.00 19.30  ? 483  ARG A CB  1 
ATOM   2834  C  CG  . ARG A  1 376 ? 39.193  31.788  123.883 1.00 22.69  ? 483  ARG A CG  1 
ATOM   2835  C  CD  . ARG A  1 376 ? 40.194  31.017  124.707 1.00 27.35  ? 483  ARG A CD  1 
ATOM   2836  N  NE  . ARG A  1 376 ? 40.490  31.724  125.947 1.00 31.03  ? 483  ARG A NE  1 
ATOM   2837  C  CZ  . ARG A  1 376 ? 41.606  31.574  126.651 1.00 32.65  ? 483  ARG A CZ  1 
ATOM   2838  N  NH1 . ARG A  1 376 ? 41.767  32.275  127.765 1.00 34.66  ? 483  ARG A NH1 1 
ATOM   2839  N  NH2 . ARG A  1 376 ? 42.557  30.734  126.249 1.00 33.29  ? 483  ARG A NH2 1 
ATOM   2840  N  N   . LEU A  1 377 ? 37.813  28.762  121.026 1.00 15.68  ? 484  LEU A N   1 
ATOM   2841  C  CA  . LEU A  1 377 ? 37.696  27.337  120.718 1.00 14.82  ? 484  LEU A CA  1 
ATOM   2842  C  C   . LEU A  1 377 ? 38.552  26.379  121.526 1.00 14.71  ? 484  LEU A C   1 
ATOM   2843  O  O   . LEU A  1 377 ? 39.594  26.736  122.075 1.00 15.99  ? 484  LEU A O   1 
ATOM   2844  C  CB  . LEU A  1 377 ? 38.007  27.073  119.237 1.00 12.14  ? 484  LEU A CB  1 
ATOM   2845  C  CG  . LEU A  1 377 ? 36.992  27.407  118.141 1.00 11.78  ? 484  LEU A CG  1 
ATOM   2846  C  CD1 . LEU A  1 377 ? 37.641  27.182  116.780 1.00 9.91   ? 484  LEU A CD1 1 
ATOM   2847  C  CD2 . LEU A  1 377 ? 35.744  26.558  118.298 1.00 8.43   ? 484  LEU A CD2 1 
ATOM   2848  N  N   . GLU A  1 378 ? 38.073  25.146  121.585 1.00 14.03  ? 485  GLU A N   1 
ATOM   2849  C  CA  . GLU A  1 378 ? 38.779  24.046  122.203 1.00 13.35  ? 485  GLU A CA  1 
ATOM   2850  C  C   . GLU A  1 378 ? 38.695  22.999  121.093 1.00 11.77  ? 485  GLU A C   1 
ATOM   2851  O  O   . GLU A  1 378 ? 39.272  23.210  120.019 1.00 9.60   ? 485  GLU A O   1 
ATOM   2852  C  CB  . GLU A  1 378 ? 38.107  23.612  123.505 1.00 15.26  ? 485  GLU A CB  1 
ATOM   2853  C  CG  . GLU A  1 378 ? 38.389  24.610  124.627 1.00 15.88  ? 485  GLU A CG  1 
ATOM   2854  C  CD  . GLU A  1 378 ? 37.889  24.186  126.002 1.00 17.33  ? 485  GLU A CD  1 
ATOM   2855  O  OE1 . GLU A  1 378 ? 38.137  24.950  126.958 1.00 17.85  ? 485  GLU A OE1 1 
ATOM   2856  O  OE2 . GLU A  1 378 ? 37.262  23.113  126.149 1.00 17.99  ? 485  GLU A OE2 1 
ATOM   2857  N  N   . HIS A  1 379 ? 37.968  21.908  121.297 1.00 11.34  ? 486  HIS A N   1 
ATOM   2858  C  CA  . HIS A  1 379 ? 37.857  20.901  120.242 1.00 9.96   ? 486  HIS A CA  1 
ATOM   2859  C  C   . HIS A  1 379 ? 36.872  21.307  119.154 1.00 10.86  ? 486  HIS A C   1 
ATOM   2860  O  O   . HIS A  1 379 ? 35.897  22.010  119.407 1.00 11.79  ? 486  HIS A O   1 
ATOM   2861  C  CB  . HIS A  1 379 ? 37.401  19.566  120.815 1.00 10.60  ? 486  HIS A CB  1 
ATOM   2862  C  CG  . HIS A  1 379 ? 38.178  19.123  122.010 1.00 10.30  ? 486  HIS A CG  1 
ATOM   2863  N  ND1 . HIS A  1 379 ? 37.889  19.557  123.284 1.00 10.01  ? 486  HIS A ND1 1 
ATOM   2864  C  CD2 . HIS A  1 379 ? 39.253  18.312  122.122 1.00 9.80   ? 486  HIS A CD2 1 
ATOM   2865  C  CE1 . HIS A  1 379 ? 38.751  19.032  124.132 1.00 9.96   ? 486  HIS A CE1 1 
ATOM   2866  N  NE2 . HIS A  1 379 ? 39.589  18.273  123.452 1.00 13.10  ? 486  HIS A NE2 1 
ATOM   2867  N  N   . VAL A  1 380 ? 37.139  20.872  117.930 1.00 12.04  ? 487  VAL A N   1 
ATOM   2868  C  CA  . VAL A  1 380 ? 36.243  21.132  116.807 1.00 11.84  ? 487  VAL A CA  1 
ATOM   2869  C  C   . VAL A  1 380 ? 35.983  19.811  116.101 1.00 12.06  ? 487  VAL A C   1 
ATOM   2870  O  O   . VAL A  1 380 ? 36.928  19.090  115.769 1.00 14.02  ? 487  VAL A O   1 
ATOM   2871  C  CB  . VAL A  1 380 ? 36.844  22.092  115.774 1.00 11.99  ? 487  VAL A CB  1 
ATOM   2872  C  CG1 . VAL A  1 380 ? 36.014  22.051  114.505 1.00 10.30  ? 487  VAL A CG1 1 
ATOM   2873  C  CG2 . VAL A  1 380 ? 36.878  23.504  116.327 1.00 11.58  ? 487  VAL A CG2 1 
ATOM   2874  N  N   . GLN A  1 381 ? 34.713  19.486  115.886 1.00 10.62  ? 488  GLN A N   1 
ATOM   2875  C  CA  . GLN A  1 381 ? 34.344  18.257  115.191 1.00 9.22   ? 488  GLN A CA  1 
ATOM   2876  C  C   . GLN A  1 381 ? 33.665  18.600  113.888 1.00 10.02  ? 488  GLN A C   1 
ATOM   2877  O  O   . GLN A  1 381 ? 32.784  19.446  113.847 1.00 10.99  ? 488  GLN A O   1 
ATOM   2878  C  CB  . GLN A  1 381 ? 33.339  17.418  115.989 1.00 10.32  ? 488  GLN A CB  1 
ATOM   2879  C  CG  . GLN A  1 381 ? 33.835  16.807  117.287 1.00 10.79  ? 488  GLN A CG  1 
ATOM   2880  C  CD  . GLN A  1 381 ? 32.781  15.940  117.972 1.00 10.78  ? 488  GLN A CD  1 
ATOM   2881  O  OE1 . GLN A  1 381 ? 31.574  16.222  117.906 1.00 10.79  ? 488  GLN A OE1 1 
ATOM   2882  N  NE2 . GLN A  1 381 ? 33.236  14.891  118.651 1.00 8.57   ? 488  GLN A NE2 1 
ATOM   2883  N  N   . ALA A  1 382 ? 34.078  17.940  112.818 1.00 10.80  ? 489  ALA A N   1 
ATOM   2884  C  CA  . ALA A  1 382 ? 33.445  18.122  111.523 1.00 10.86  ? 489  ALA A CA  1 
ATOM   2885  C  C   . ALA A  1 382 ? 32.789  16.758  111.327 1.00 11.76  ? 489  ALA A C   1 
ATOM   2886  O  O   . ALA A  1 382 ? 33.465  15.789  110.984 1.00 11.93  ? 489  ALA A O   1 
ATOM   2887  C  CB  . ALA A  1 382 ? 34.483  18.376  110.450 1.00 10.27  ? 489  ALA A CB  1 
ATOM   2888  N  N   . ARG A  1 383 ? 31.485  16.678  111.602 1.00 12.53  ? 490  ARG A N   1 
ATOM   2889  C  CA  . ARG A  1 383 ? 30.728  15.432  111.478 1.00 12.53  ? 490  ARG A CA  1 
ATOM   2890  C  C   . ARG A  1 383 ? 30.259  15.228  110.058 1.00 13.27  ? 490  ARG A C   1 
ATOM   2891  O  O   . ARG A  1 383 ? 29.344  15.912  109.606 1.00 14.34  ? 490  ARG A O   1 
ATOM   2892  C  CB  . ARG A  1 383 ? 29.498  15.463  112.366 1.00 14.16  ? 490  ARG A CB  1 
ATOM   2893  C  CG  . ARG A  1 383 ? 29.787  15.568  113.814 1.00 14.31  ? 490  ARG A CG  1 
ATOM   2894  C  CD  . ARG A  1 383 ? 28.550  15.261  114.607 1.00 14.66  ? 490  ARG A CD  1 
ATOM   2895  N  NE  . ARG A  1 383 ? 28.996  14.842  115.913 1.00 18.92  ? 490  ARG A NE  1 
ATOM   2896  C  CZ  . ARG A  1 383 ? 28.945  13.601  116.362 1.00 18.03  ? 490  ARG A CZ  1 
ATOM   2897  N  NH1 . ARG A  1 383 ? 29.408  13.353  117.564 1.00 21.10  ? 490  ARG A NH1 1 
ATOM   2898  N  NH2 . ARG A  1 383 ? 28.402  12.628  115.646 1.00 18.41  ? 490  ARG A NH2 1 
ATOM   2899  N  N   . LEU A  1 384 ? 30.860  14.270  109.365 1.00 13.14  ? 491  LEU A N   1 
ATOM   2900  C  CA  . LEU A  1 384 ? 30.496  14.015  107.979 1.00 12.88  ? 491  LEU A CA  1 
ATOM   2901  C  C   . LEU A  1 384 ? 29.806  12.684  107.739 1.00 13.71  ? 491  LEU A C   1 
ATOM   2902  O  O   . LEU A  1 384 ? 30.110  11.670  108.375 1.00 14.48  ? 491  LEU A O   1 
ATOM   2903  C  CB  . LEU A  1 384 ? 31.737  14.078  107.092 1.00 11.49  ? 491  LEU A CB  1 
ATOM   2904  C  CG  . LEU A  1 384 ? 32.606  15.321  107.292 1.00 11.89  ? 491  LEU A CG  1 
ATOM   2905  C  CD1 . LEU A  1 384 ? 33.799  15.267  106.364 1.00 9.72   ? 491  LEU A CD1 1 
ATOM   2906  C  CD2 . LEU A  1 384 ? 31.769  16.570  107.031 1.00 12.01  ? 491  LEU A CD2 1 
ATOM   2907  N  N   . THR A  1 385 ? 28.857  12.713  106.817 1.00 13.15  ? 492  THR A N   1 
ATOM   2908  C  CA  . THR A  1 385 ? 28.147  11.524  106.407 1.00 12.35  ? 492  THR A CA  1 
ATOM   2909  C  C   . THR A  1 385 ? 28.235  11.622  104.895 1.00 12.10  ? 492  THR A C   1 
ATOM   2910  O  O   . THR A  1 385 ? 27.698  12.549  104.284 1.00 13.13  ? 492  THR A O   1 
ATOM   2911  C  CB  . THR A  1 385 ? 26.681  11.533  106.855 1.00 13.41  ? 492  THR A CB  1 
ATOM   2912  O  OG1 . THR A  1 385 ? 26.606  11.489  108.287 1.00 13.67  ? 492  THR A OG1 1 
ATOM   2913  C  CG2 . THR A  1 385 ? 25.983  10.321  106.301 1.00 12.71  ? 492  THR A CG2 1 
ATOM   2914  N  N   . LEU A  1 386 ? 28.942  10.683  104.290 1.00 11.51  ? 493  LEU A N   1 
ATOM   2915  C  CA  . LEU A  1 386 ? 29.112  10.710  102.854 1.00 11.70  ? 493  LEU A CA  1 
ATOM   2916  C  C   . LEU A  1 386 ? 29.236  9.311   102.296 1.00 11.99  ? 493  LEU A C   1 
ATOM   2917  O  O   . LEU A  1 386 ? 29.505  8.361   103.022 1.00 11.81  ? 493  LEU A O   1 
ATOM   2918  C  CB  . LEU A  1 386 ? 30.370  11.513  102.501 1.00 11.04  ? 493  LEU A CB  1 
ATOM   2919  C  CG  . LEU A  1 386 ? 31.737  10.970  102.941 1.00 9.97   ? 493  LEU A CG  1 
ATOM   2920  C  CD1 . LEU A  1 386 ? 32.175  9.860   102.002 1.00 6.64   ? 493  LEU A CD1 1 
ATOM   2921  C  CD2 . LEU A  1 386 ? 32.781  12.093  102.926 1.00 8.76   ? 493  LEU A CD2 1 
ATOM   2922  N  N   . SER A  1 387 ? 29.026  9.192   100.996 1.00 12.39  ? 494  SER A N   1 
ATOM   2923  C  CA  . SER A  1 387 ? 29.161  7.917   100.316 1.00 13.28  ? 494  SER A CA  1 
ATOM   2924  C  C   . SER A  1 387 ? 30.191  8.140   99.227  1.00 13.83  ? 494  SER A C   1 
ATOM   2925  O  O   . SER A  1 387 ? 30.194  9.175   98.567  1.00 14.73  ? 494  SER A O   1 
ATOM   2926  C  CB  . SER A  1 387 ? 27.827  7.478   99.696  1.00 14.60  ? 494  SER A CB  1 
ATOM   2927  O  OG  . SER A  1 387 ? 27.325  8.456   98.797  1.00 17.05  ? 494  SER A OG  1 
ATOM   2928  N  N   . TYR A  1 388 ? 31.088  7.183   99.056  1.00 14.11  ? 495  TYR A N   1 
ATOM   2929  C  CA  . TYR A  1 388 ? 32.107  7.302   98.029  1.00 15.45  ? 495  TYR A CA  1 
ATOM   2930  C  C   . TYR A  1 388 ? 32.452  5.870   97.631  1.00 16.25  ? 495  TYR A C   1 
ATOM   2931  O  O   . TYR A  1 388 ? 32.252  4.949   98.412  1.00 15.27  ? 495  TYR A O   1 
ATOM   2932  C  CB  . TYR A  1 388 ? 33.339  8.042   98.573  1.00 14.46  ? 495  TYR A CB  1 
ATOM   2933  C  CG  . TYR A  1 388 ? 34.116  8.781   97.509  1.00 13.30  ? 495  TYR A CG  1 
ATOM   2934  C  CD1 . TYR A  1 388 ? 33.533  9.826   96.803  1.00 15.36  ? 495  TYR A CD1 1 
ATOM   2935  C  CD2 . TYR A  1 388 ? 35.427  8.425   97.187  1.00 15.47  ? 495  TYR A CD2 1 
ATOM   2936  C  CE1 . TYR A  1 388 ? 34.231  10.502  95.796  1.00 15.40  ? 495  TYR A CE1 1 
ATOM   2937  C  CE2 . TYR A  1 388 ? 36.141  9.098   96.170  1.00 14.30  ? 495  TYR A CE2 1 
ATOM   2938  C  CZ  . TYR A  1 388 ? 35.533  10.129  95.485  1.00 15.35  ? 495  TYR A CZ  1 
ATOM   2939  O  OH  . TYR A  1 388 ? 36.210  10.788  94.473  1.00 19.86  ? 495  TYR A OH  1 
ATOM   2940  N  N   . ASN A  1 389 ? 32.964  5.676   96.422  1.00 16.78  ? 496  ASN A N   1 
ATOM   2941  C  CA  . ASN A  1 389 ? 33.281  4.331   95.973  1.00 17.55  ? 496  ASN A CA  1 
ATOM   2942  C  C   . ASN A  1 389 ? 34.631  3.792   96.466  1.00 18.91  ? 496  ASN A C   1 
ATOM   2943  O  O   . ASN A  1 389 ? 34.781  2.589   96.670  1.00 18.43  ? 496  ASN A O   1 
ATOM   2944  C  CB  . ASN A  1 389 ? 33.230  4.279   94.449  1.00 16.11  ? 496  ASN A CB  1 
ATOM   2945  C  CG  . ASN A  1 389 ? 34.283  5.140   93.817  1.00 17.90  ? 496  ASN A CG  1 
ATOM   2946  O  OD1 . ASN A  1 389 ? 34.303  6.364   94.008  1.00 20.41  ? 496  ASN A OD1 1 
ATOM   2947  N  ND2 . ASN A  1 389 ? 35.183  4.513   93.068  1.00 15.69  ? 496  ASN A ND2 1 
ATOM   2948  N  N   . ARG A  1 390 ? 35.613  4.673   96.647  1.00 20.59  ? 497  ARG A N   1 
ATOM   2949  C  CA  . ARG A  1 390 ? 36.953  4.270   97.110  1.00 20.67  ? 497  ARG A CA  1 
ATOM   2950  C  C   . ARG A  1 390 ? 37.398  5.304   98.157  1.00 19.35  ? 497  ARG A C   1 
ATOM   2951  O  O   . ARG A  1 390 ? 38.031  6.320   97.850  1.00 18.91  ? 497  ARG A O   1 
ATOM   2952  C  CB  . ARG A  1 390 ? 37.905  4.203   95.904  1.00 23.72  ? 497  ARG A CB  1 
ATOM   2953  C  CG  . ARG A  1 390 ? 39.392  4.085   96.204  1.00 28.30  ? 497  ARG A CG  1 
ATOM   2954  C  CD  . ARG A  1 390 ? 39.880  2.655   96.143  1.00 29.97  ? 497  ARG A CD  1 
ATOM   2955  N  NE  . ARG A  1 390 ? 41.344  2.557   96.053  1.00 33.51  ? 497  ARG A NE  1 
ATOM   2956  C  CZ  . ARG A  1 390 ? 42.219  3.086   96.918  1.00 34.11  ? 497  ARG A CZ  1 
ATOM   2957  N  NH1 . ARG A  1 390 ? 43.521  2.915   96.721  1.00 35.11  ? 497  ARG A NH1 1 
ATOM   2958  N  NH2 . ARG A  1 390 ? 41.814  3.794   97.968  1.00 33.82  ? 497  ARG A NH2 1 
ATOM   2959  N  N   . ARG A  1 391 ? 37.029  5.023   99.402  1.00 17.56  ? 498  ARG A N   1 
ATOM   2960  C  CA  . ARG A  1 391 ? 37.287  5.910   100.530 1.00 15.97  ? 498  ARG A CA  1 
ATOM   2961  C  C   . ARG A  1 391 ? 38.707  6.416   100.662 1.00 15.63  ? 498  ARG A C   1 
ATOM   2962  O  O   . ARG A  1 391 ? 38.927  7.607   100.840 1.00 17.71  ? 498  ARG A O   1 
ATOM   2963  C  CB  . ARG A  1 391 ? 36.862  5.225   101.826 1.00 14.42  ? 498  ARG A CB  1 
ATOM   2964  C  CG  . ARG A  1 391 ? 36.610  6.179   102.982 1.00 11.31  ? 498  ARG A CG  1 
ATOM   2965  C  CD  . ARG A  1 391 ? 35.877  5.464   104.084 1.00 10.95  ? 498  ARG A CD  1 
ATOM   2966  N  NE  . ARG A  1 391 ? 36.604  4.277   104.556 1.00 11.92  ? 498  ARG A NE  1 
ATOM   2967  C  CZ  . ARG A  1 391 ? 36.079  3.351   105.364 1.00 11.66  ? 498  ARG A CZ  1 
ATOM   2968  N  NH1 . ARG A  1 391 ? 36.803  2.305   105.755 1.00 8.88   ? 498  ARG A NH1 1 
ATOM   2969  N  NH2 . ARG A  1 391 ? 34.817  3.464   105.775 1.00 10.09  ? 498  ARG A NH2 1 
ATOM   2970  N  N   . GLY A  1 392 ? 39.668  5.510   100.574 1.00 15.92  ? 499  GLY A N   1 
ATOM   2971  C  CA  . GLY A  1 392 ? 41.062  5.885   100.692 1.00 15.33  ? 499  GLY A CA  1 
ATOM   2972  C  C   . GLY A  1 392 ? 41.561  6.936   99.714  1.00 15.33  ? 499  GLY A C   1 
ATOM   2973  O  O   . GLY A  1 392 ? 42.645  7.478   99.905  1.00 15.47  ? 499  GLY A O   1 
ATOM   2974  N  N   . ASP A  1 393 ? 40.796  7.229   98.669  1.00 15.37  ? 500  ASP A N   1 
ATOM   2975  C  CA  . ASP A  1 393 ? 41.226  8.230   97.696  1.00 16.40  ? 500  ASP A CA  1 
ATOM   2976  C  C   . ASP A  1 393 ? 40.862  9.642   98.142  1.00 16.20  ? 500  ASP A C   1 
ATOM   2977  O  O   . ASP A  1 393 ? 41.361  10.627  97.599  1.00 17.77  ? 500  ASP A O   1 
ATOM   2978  C  CB  . ASP A  1 393 ? 40.610  7.945   96.323  1.00 17.91  ? 500  ASP A CB  1 
ATOM   2979  C  CG  . ASP A  1 393 ? 41.339  6.836   95.573  1.00 20.65  ? 500  ASP A CG  1 
ATOM   2980  O  OD1 . ASP A  1 393 ? 40.809  6.366   94.541  1.00 23.27  ? 500  ASP A OD1 1 
ATOM   2981  O  OD2 . ASP A  1 393 ? 42.446  6.442   96.003  1.00 19.81  ? 500  ASP A OD2 1 
ATOM   2982  N  N   . LEU A  1 394 ? 40.007  9.740   99.150  1.00 15.09  ? 501  LEU A N   1 
ATOM   2983  C  CA  . LEU A  1 394 ? 39.577  11.040  99.644  1.00 13.94  ? 501  LEU A CA  1 
ATOM   2984  C  C   . LEU A  1 394 ? 40.577  11.720  100.561 1.00 13.08  ? 501  LEU A C   1 
ATOM   2985  O  O   . LEU A  1 394 ? 41.313  11.064  101.298 1.00 12.70  ? 501  LEU A O   1 
ATOM   2986  C  CB  . LEU A  1 394 ? 38.256  10.897  100.399 1.00 12.48  ? 501  LEU A CB  1 
ATOM   2987  C  CG  . LEU A  1 394 ? 36.999  10.506  99.627  1.00 10.94  ? 501  LEU A CG  1 
ATOM   2988  C  CD1 . LEU A  1 394 ? 35.862  10.320  100.613 1.00 10.59  ? 501  LEU A CD1 1 
ATOM   2989  C  CD2 . LEU A  1 394 ? 36.653  11.582  98.610  1.00 9.54   ? 501  LEU A CD2 1 
ATOM   2990  N  N   . ALA A  1 395 ? 40.588  13.047  100.498 1.00 12.41  ? 502  ALA A N   1 
ATOM   2991  C  CA  . ALA A  1 395 ? 41.427  13.879  101.351 1.00 11.51  ? 502  ALA A CA  1 
ATOM   2992  C  C   . ALA A  1 395 ? 40.463  14.972  101.773 1.00 11.58  ? 502  ALA A C   1 
ATOM   2993  O  O   . ALA A  1 395 ? 39.859  15.622  100.930 1.00 11.77  ? 502  ALA A O   1 
ATOM   2994  C  CB  . ALA A  1 395 ? 42.576  14.460  100.577 1.00 10.73  ? 502  ALA A CB  1 
ATOM   2995  N  N   . ILE A  1 396 ? 40.295  15.158  103.076 1.00 12.95  ? 503  ILE A N   1 
ATOM   2996  C  CA  . ILE A  1 396 ? 39.364  16.161  103.589 1.00 13.21  ? 503  ILE A CA  1 
ATOM   2997  C  C   . ILE A  1 396 ? 40.071  17.192  104.456 1.00 13.62  ? 503  ILE A C   1 
ATOM   2998  O  O   . ILE A  1 396 ? 40.886  16.841  105.312 1.00 14.71  ? 503  ILE A O   1 
ATOM   2999  C  CB  . ILE A  1 396 ? 38.253  15.477  104.410 1.00 13.22  ? 503  ILE A CB  1 
ATOM   3000  C  CG1 . ILE A  1 396 ? 37.544  14.432  103.546 1.00 12.15  ? 503  ILE A CG1 1 
ATOM   3001  C  CG2 . ILE A  1 396 ? 37.252  16.497  104.900 1.00 13.29  ? 503  ILE A CG2 1 
ATOM   3002  C  CD1 . ILE A  1 396 ? 36.584  13.547  104.326 1.00 10.83  ? 503  ILE A CD1 1 
ATOM   3003  N  N   . HIS A  1 397 ? 39.765  18.467  104.220 1.00 14.56  ? 504  HIS A N   1 
ATOM   3004  C  CA  . HIS A  1 397 ? 40.364  19.566  104.979 1.00 13.54  ? 504  HIS A CA  1 
ATOM   3005  C  C   . HIS A  1 397 ? 39.305  20.517  105.516 1.00 13.62  ? 504  HIS A C   1 
ATOM   3006  O  O   . HIS A  1 397 ? 38.261  20.721  104.897 1.00 13.71  ? 504  HIS A O   1 
ATOM   3007  C  CB  . HIS A  1 397 ? 41.333  20.375  104.113 1.00 13.49  ? 504  HIS A CB  1 
ATOM   3008  C  CG  . HIS A  1 397 ? 42.546  19.614  103.681 1.00 13.51  ? 504  HIS A CG  1 
ATOM   3009  N  ND1 . HIS A  1 397 ? 42.531  18.725  102.630 1.00 13.40  ? 504  HIS A ND1 1 
ATOM   3010  C  CD2 . HIS A  1 397 ? 43.811  19.603  104.165 1.00 14.45  ? 504  HIS A CD2 1 
ATOM   3011  C  CE1 . HIS A  1 397 ? 43.735  18.200  102.485 1.00 15.12  ? 504  HIS A CE1 1 
ATOM   3012  N  NE2 . HIS A  1 397 ? 44.532  18.715  103.404 1.00 12.07  ? 504  HIS A NE2 1 
ATOM   3013  N  N   . LEU A  1 398 ? 39.579  21.094  106.678 1.00 13.33  ? 505  LEU A N   1 
ATOM   3014  C  CA  . LEU A  1 398 ? 38.668  22.049  107.290 1.00 12.59  ? 505  LEU A CA  1 
ATOM   3015  C  C   . LEU A  1 398 ? 39.495  23.308  107.545 1.00 13.23  ? 505  LEU A C   1 
ATOM   3016  O  O   . LEU A  1 398 ? 40.576  23.236  108.131 1.00 14.23  ? 505  LEU A O   1 
ATOM   3017  C  CB  . LEU A  1 398 ? 38.131  21.500  108.610 1.00 10.22  ? 505  LEU A CB  1 
ATOM   3018  C  CG  . LEU A  1 398 ? 37.151  22.412  109.334 1.00 9.82   ? 505  LEU A CG  1 
ATOM   3019  C  CD1 . LEU A  1 398 ? 35.929  22.659  108.452 1.00 8.34   ? 505  LEU A CD1 1 
ATOM   3020  C  CD2 . LEU A  1 398 ? 36.755  21.772  110.644 1.00 9.57   ? 505  LEU A CD2 1 
ATOM   3021  N  N   . ILE A  1 399 ? 39.001  24.453  107.093 1.00 12.66  ? 506  ILE A N   1 
ATOM   3022  C  CA  . ILE A  1 399 ? 39.715  25.703  107.285 1.00 13.76  ? 506  ILE A CA  1 
ATOM   3023  C  C   . ILE A  1 399 ? 38.910  26.612  108.189 1.00 14.33  ? 506  ILE A C   1 
ATOM   3024  O  O   . ILE A  1 399 ? 37.762  26.928  107.879 1.00 13.83  ? 506  ILE A O   1 
ATOM   3025  C  CB  . ILE A  1 399 ? 39.940  26.447  105.941 1.00 15.47  ? 506  ILE A CB  1 
ATOM   3026  C  CG1 . ILE A  1 399 ? 40.537  25.492  104.902 1.00 16.39  ? 506  ILE A CG1 1 
ATOM   3027  C  CG2 . ILE A  1 399 ? 40.900  27.628  106.148 1.00 13.33  ? 506  ILE A CG2 1 
ATOM   3028  C  CD1 . ILE A  1 399 ? 40.858  26.164  103.570 1.00 16.25  ? 506  ILE A CD1 1 
ATOM   3029  N  N   . SER A  1 400 ? 39.517  27.036  109.297 1.00 14.70  ? 507  SER A N   1 
ATOM   3030  C  CA  . SER A  1 400 ? 38.854  27.918  110.253 1.00 15.18  ? 507  SER A CA  1 
ATOM   3031  C  C   . SER A  1 400 ? 38.816  29.356  109.734 1.00 15.22  ? 507  SER A C   1 
ATOM   3032  O  O   . SER A  1 400 ? 39.615  29.736  108.877 1.00 15.68  ? 507  SER A O   1 
ATOM   3033  C  CB  . SER A  1 400 ? 39.606  27.894  111.584 1.00 16.40  ? 507  SER A CB  1 
ATOM   3034  O  OG  . SER A  1 400 ? 40.873  28.535  111.456 1.00 18.57  ? 507  SER A OG  1 
ATOM   3035  N  N   . PRO A  1 401 ? 37.889  30.181  110.255 1.00 16.15  ? 508  PRO A N   1 
ATOM   3036  C  CA  . PRO A  1 401 ? 37.809  31.573  109.801 1.00 15.98  ? 508  PRO A CA  1 
ATOM   3037  C  C   . PRO A  1 401 ? 39.163  32.287  109.916 1.00 16.70  ? 508  PRO A C   1 
ATOM   3038  O  O   . PRO A  1 401 ? 39.469  33.169  109.117 1.00 16.81  ? 508  PRO A O   1 
ATOM   3039  C  CB  . PRO A  1 401 ? 36.758  32.178  110.723 1.00 15.35  ? 508  PRO A CB  1 
ATOM   3040  C  CG  . PRO A  1 401 ? 35.878  31.020  111.032 1.00 16.33  ? 508  PRO A CG  1 
ATOM   3041  C  CD  . PRO A  1 401 ? 36.860  29.901  111.272 1.00 15.18  ? 508  PRO A CD  1 
ATOM   3042  N  N   . MET A  1 402 ? 39.969  31.904  110.906 1.00 17.59  ? 509  MET A N   1 
ATOM   3043  C  CA  . MET A  1 402 ? 41.280  32.516  111.095 1.00 17.91  ? 509  MET A CA  1 
ATOM   3044  C  C   . MET A  1 402 ? 42.345  31.903  110.192 1.00 17.44  ? 509  MET A C   1 
ATOM   3045  O  O   . MET A  1 402 ? 43.539  32.105  110.400 1.00 17.50  ? 509  MET A O   1 
ATOM   3046  C  CB  . MET A  1 402 ? 41.709  32.390  112.547 1.00 19.70  ? 509  MET A CB  1 
ATOM   3047  C  CG  . MET A  1 402 ? 40.661  32.885  113.505 1.00 24.01  ? 509  MET A CG  1 
ATOM   3048  S  SD  . MET A  1 402 ? 41.340  34.086  114.662 1.00 29.40  ? 509  MET A SD  1 
ATOM   3049  C  CE  . MET A  1 402 ? 41.320  33.219  116.191 1.00 25.01  ? 509  MET A CE  1 
ATOM   3050  N  N   . GLY A  1 403 ? 41.908  31.130  109.206 1.00 17.19  ? 510  GLY A N   1 
ATOM   3051  C  CA  . GLY A  1 403 ? 42.836  30.543  108.259 1.00 15.46  ? 510  GLY A CA  1 
ATOM   3052  C  C   . GLY A  1 403 ? 43.588  29.280  108.617 1.00 15.59  ? 510  GLY A C   1 
ATOM   3053  O  O   . GLY A  1 403 ? 44.481  28.875  107.868 1.00 14.89  ? 510  GLY A O   1 
ATOM   3054  N  N   . THR A  1 404 ? 43.257  28.642  109.732 1.00 14.89  ? 511  THR A N   1 
ATOM   3055  C  CA  . THR A  1 404 ? 43.971  27.418  110.082 1.00 16.12  ? 511  THR A CA  1 
ATOM   3056  C  C   . THR A  1 404 ? 43.401  26.234  109.316 1.00 15.76  ? 511  THR A C   1 
ATOM   3057  O  O   . THR A  1 404 ? 42.234  25.883  109.459 1.00 16.24  ? 511  THR A O   1 
ATOM   3058  C  CB  . THR A  1 404 ? 43.901  27.165  111.572 1.00 15.56  ? 511  THR A CB  1 
ATOM   3059  O  OG1 . THR A  1 404 ? 44.489  28.284  112.245 1.00 14.56  ? 511  THR A OG1 1 
ATOM   3060  C  CG2 . THR A  1 404 ? 44.656  25.892  111.934 1.00 15.01  ? 511  THR A CG2 1 
ATOM   3061  N  N   . ARG A  1 405 ? 44.241  25.633  108.488 1.00 16.06  ? 512  ARG A N   1 
ATOM   3062  C  CA  . ARG A  1 405 ? 43.833  24.516  107.656 1.00 16.62  ? 512  ARG A CA  1 
ATOM   3063  C  C   . ARG A  1 405 ? 44.164  23.178  108.302 1.00 16.02  ? 512  ARG A C   1 
ATOM   3064  O  O   . ARG A  1 405 ? 45.327  22.784  108.381 1.00 17.57  ? 512  ARG A O   1 
ATOM   3065  C  CB  . ARG A  1 405 ? 44.515  24.648  106.294 1.00 17.21  ? 512  ARG A CB  1 
ATOM   3066  C  CG  . ARG A  1 405 ? 44.053  23.674  105.230 1.00 20.75  ? 512  ARG A CG  1 
ATOM   3067  C  CD  . ARG A  1 405 ? 44.361  24.235  103.841 1.00 23.88  ? 512  ARG A CD  1 
ATOM   3068  N  NE  . ARG A  1 405 ? 43.820  23.405  102.769 1.00 26.02  ? 512  ARG A NE  1 
ATOM   3069  C  CZ  . ARG A  1 405 ? 44.430  22.334  102.273 1.00 27.22  ? 512  ARG A CZ  1 
ATOM   3070  N  NH1 . ARG A  1 405 ? 43.849  21.643  101.302 1.00 27.89  ? 512  ARG A NH1 1 
ATOM   3071  N  NH2 . ARG A  1 405 ? 45.625  21.963  102.733 1.00 26.91  ? 512  ARG A NH2 1 
ATOM   3072  N  N   . SER A  1 406 ? 43.134  22.485  108.771 1.00 15.03  ? 513  SER A N   1 
ATOM   3073  C  CA  . SER A  1 406 ? 43.306  21.188  109.413 1.00 14.17  ? 513  SER A CA  1 
ATOM   3074  C  C   . SER A  1 406 ? 43.015  20.066  108.421 1.00 13.82  ? 513  SER A C   1 
ATOM   3075  O  O   . SER A  1 406 ? 41.995  20.086  107.728 1.00 13.41  ? 513  SER A O   1 
ATOM   3076  C  CB  . SER A  1 406 ? 42.344  21.038  110.606 1.00 14.88  ? 513  SER A CB  1 
ATOM   3077  O  OG  . SER A  1 406 ? 42.549  22.027  111.609 1.00 17.31  ? 513  SER A OG  1 
ATOM   3078  N  N   . THR A  1 407 ? 43.908  19.088  108.350 1.00 13.19  ? 514  THR A N   1 
ATOM   3079  C  CA  . THR A  1 407 ? 43.688  17.959  107.472 1.00 13.02  ? 514  THR A CA  1 
ATOM   3080  C  C   . THR A  1 407 ? 42.881  16.946  108.267 1.00 12.69  ? 514  THR A C   1 
ATOM   3081  O  O   . THR A  1 407 ? 43.429  16.255  109.127 1.00 14.14  ? 514  THR A O   1 
ATOM   3082  C  CB  . THR A  1 407 ? 44.997  17.317  107.057 1.00 12.82  ? 514  THR A CB  1 
ATOM   3083  O  OG1 . THR A  1 407 ? 45.761  18.254  106.301 1.00 16.75  ? 514  THR A OG1 1 
ATOM   3084  C  CG2 . THR A  1 407 ? 44.743  16.105  106.202 1.00 13.41  ? 514  THR A CG2 1 
ATOM   3085  N  N   . LEU A  1 408 ? 41.583  16.870  107.989 1.00 10.71  ? 515  LEU A N   1 
ATOM   3086  C  CA  . LEU A  1 408 ? 40.708  15.936  108.685 1.00 10.72  ? 515  LEU A CA  1 
ATOM   3087  C  C   . LEU A  1 408 ? 40.986  14.498  108.251 1.00 11.60  ? 515  LEU A C   1 
ATOM   3088  O  O   . LEU A  1 408 ? 40.880  13.568  109.048 1.00 12.08  ? 515  LEU A O   1 
ATOM   3089  C  CB  . LEU A  1 408 ? 39.242  16.277  108.416 1.00 7.62   ? 515  LEU A CB  1 
ATOM   3090  C  CG  . LEU A  1 408 ? 38.767  17.657  108.854 1.00 7.07   ? 515  LEU A CG  1 
ATOM   3091  C  CD1 . LEU A  1 408 ? 37.273  17.724  108.686 1.00 6.88   ? 515  LEU A CD1 1 
ATOM   3092  C  CD2 . LEU A  1 408 ? 39.137  17.903  110.309 1.00 5.28   ? 515  LEU A CD2 1 
ATOM   3093  N  N   . LEU A  1 409 ? 41.348  14.320  106.986 1.00 12.05  ? 516  LEU A N   1 
ATOM   3094  C  CA  . LEU A  1 409 ? 41.623  12.996  106.454 1.00 11.96  ? 516  LEU A CA  1 
ATOM   3095  C  C   . LEU A  1 409 ? 42.553  13.077  105.258 1.00 13.13  ? 516  LEU A C   1 
ATOM   3096  O  O   . LEU A  1 409 ? 42.269  13.775  104.289 1.00 14.22  ? 516  LEU A O   1 
ATOM   3097  C  CB  . LEU A  1 409 ? 40.316  12.324  106.030 1.00 12.64  ? 516  LEU A CB  1 
ATOM   3098  C  CG  . LEU A  1 409 ? 40.378  10.904  105.437 1.00 12.34  ? 516  LEU A CG  1 
ATOM   3099  C  CD1 . LEU A  1 409 ? 40.831  9.922   106.494 1.00 11.16  ? 516  LEU A CD1 1 
ATOM   3100  C  CD2 . LEU A  1 409 ? 39.011  10.494  104.921 1.00 8.77   ? 516  LEU A CD2 1 
ATOM   3101  N  N   . ALA A  1 410 ? 43.674  12.375  105.337 1.00 13.23  ? 517  ALA A N   1 
ATOM   3102  C  CA  . ALA A  1 410 ? 44.627  12.346  104.241 1.00 14.42  ? 517  ALA A CA  1 
ATOM   3103  C  C   . ALA A  1 410 ? 44.374  11.034  103.490 1.00 16.00  ? 517  ALA A C   1 
ATOM   3104  O  O   . ALA A  1 410 ? 43.723  10.130  104.025 1.00 16.94  ? 517  ALA A O   1 
ATOM   3105  C  CB  . ALA A  1 410 ? 46.044  12.385  104.785 1.00 13.75  ? 517  ALA A CB  1 
ATOM   3106  N  N   . ALA A  1 411 ? 44.877  10.915  102.267 1.00 15.25  ? 518  ALA A N   1 
ATOM   3107  C  CA  . ALA A  1 411 ? 44.661  9.697   101.497 1.00 16.95  ? 518  ALA A CA  1 
ATOM   3108  C  C   . ALA A  1 411 ? 45.209  8.463   102.202 1.00 17.69  ? 518  ALA A C   1 
ATOM   3109  O  O   . ALA A  1 411 ? 46.263  8.517   102.822 1.00 19.03  ? 518  ALA A O   1 
ATOM   3110  C  CB  . ALA A  1 411 ? 45.309  9.826   100.127 1.00 16.34  ? 518  ALA A CB  1 
ATOM   3111  N  N   . ARG A  1 412 ? 44.474  7.358   102.111 1.00 18.56  ? 519  ARG A N   1 
ATOM   3112  C  CA  . ARG A  1 412 ? 44.883  6.075   102.688 1.00 18.45  ? 519  ARG A CA  1 
ATOM   3113  C  C   . ARG A  1 412 ? 44.840  5.075   101.529 1.00 19.64  ? 519  ARG A C   1 
ATOM   3114  O  O   . ARG A  1 412 ? 43.803  4.475   101.239 1.00 20.00  ? 519  ARG A O   1 
ATOM   3115  C  CB  . ARG A  1 412 ? 43.915  5.627   103.776 1.00 17.47  ? 519  ARG A CB  1 
ATOM   3116  C  CG  . ARG A  1 412 ? 43.916  6.473   105.019 1.00 15.37  ? 519  ARG A CG  1 
ATOM   3117  C  CD  . ARG A  1 412 ? 42.611  6.267   105.746 1.00 16.19  ? 519  ARG A CD  1 
ATOM   3118  N  NE  . ARG A  1 412 ? 42.652  5.212   106.750 1.00 16.45  ? 519  ARG A NE  1 
ATOM   3119  C  CZ  . ARG A  1 412 ? 41.583  4.543   107.185 1.00 16.31  ? 519  ARG A CZ  1 
ATOM   3120  N  NH1 . ARG A  1 412 ? 41.721  3.619   108.120 1.00 18.43  ? 519  ARG A NH1 1 
ATOM   3121  N  NH2 . ARG A  1 412 ? 40.384  4.760   106.667 1.00 13.85  ? 519  ARG A NH2 1 
ATOM   3122  N  N   . PRO A  1 413 ? 45.973  4.890   100.847 1.00 20.22  ? 520  PRO A N   1 
ATOM   3123  C  CA  . PRO A  1 413 ? 46.091  3.982   99.709  1.00 20.16  ? 520  PRO A CA  1 
ATOM   3124  C  C   . PRO A  1 413 ? 45.571  2.565   99.869  1.00 20.92  ? 520  PRO A C   1 
ATOM   3125  O  O   . PRO A  1 413 ? 45.243  1.920   98.873  1.00 23.45  ? 520  PRO A O   1 
ATOM   3126  C  CB  . PRO A  1 413 ? 47.585  4.024   99.390  1.00 20.23  ? 520  PRO A CB  1 
ATOM   3127  C  CG  . PRO A  1 413 ? 48.207  4.378   100.694 1.00 20.15  ? 520  PRO A CG  1 
ATOM   3128  C  CD  . PRO A  1 413 ? 47.288  5.447   101.199 1.00 21.12  ? 520  PRO A CD  1 
ATOM   3129  N  N   . HIS A  1 414 ? 45.486  2.072   101.101 1.00 20.38  ? 521  HIS A N   1 
ATOM   3130  C  CA  . HIS A  1 414 ? 45.003  0.711   101.346 1.00 18.26  ? 521  HIS A CA  1 
ATOM   3131  C  C   . HIS A  1 414 ? 43.518  0.643   101.668 1.00 17.57  ? 521  HIS A C   1 
ATOM   3132  O  O   . HIS A  1 414 ? 42.973  -0.437  101.857 1.00 17.77  ? 521  HIS A O   1 
ATOM   3133  C  CB  . HIS A  1 414 ? 45.776  0.086   102.504 1.00 19.07  ? 521  HIS A CB  1 
ATOM   3134  C  CG  . HIS A  1 414 ? 47.246  -0.001  102.265 1.00 20.82  ? 521  HIS A CG  1 
ATOM   3135  N  ND1 . HIS A  1 414 ? 47.794  -0.833  101.314 1.00 21.15  ? 521  HIS A ND1 1 
ATOM   3136  C  CD2 . HIS A  1 414 ? 48.282  0.665   102.827 1.00 21.36  ? 521  HIS A CD2 1 
ATOM   3137  C  CE1 . HIS A  1 414 ? 49.105  -0.675  101.298 1.00 22.66  ? 521  HIS A CE1 1 
ATOM   3138  N  NE2 . HIS A  1 414 ? 49.428  0.228   102.206 1.00 22.72  ? 521  HIS A NE2 1 
ATOM   3139  N  N   . ASP A  1 415 ? 42.863  1.794   101.742 1.00 17.60  ? 522  ASP A N   1 
ATOM   3140  C  CA  . ASP A  1 415 ? 41.444  1.833   102.074 1.00 17.48  ? 522  ASP A CA  1 
ATOM   3141  C  C   . ASP A  1 415 ? 40.597  1.796   100.812 1.00 17.66  ? 522  ASP A C   1 
ATOM   3142  O  O   . ASP A  1 415 ? 40.440  2.803   100.132 1.00 17.53  ? 522  ASP A O   1 
ATOM   3143  C  CB  . ASP A  1 415 ? 41.129  3.103   102.865 1.00 16.01  ? 522  ASP A CB  1 
ATOM   3144  C  CG  . ASP A  1 415 ? 39.739  3.089   103.454 1.00 16.49  ? 522  ASP A CG  1 
ATOM   3145  O  OD1 . ASP A  1 415 ? 39.273  4.141   103.937 1.00 16.01  ? 522  ASP A OD1 1 
ATOM   3146  O  OD2 . ASP A  1 415 ? 39.107  2.016   103.447 1.00 18.43  ? 522  ASP A OD2 1 
ATOM   3147  N  N   . TYR A  1 416 ? 40.044  0.630   100.510 1.00 19.37  ? 523  TYR A N   1 
ATOM   3148  C  CA  . TYR A  1 416 ? 39.228  0.458   99.317  1.00 21.30  ? 523  TYR A CA  1 
ATOM   3149  C  C   . TYR A  1 416 ? 37.748  0.420   99.629  1.00 20.26  ? 523  TYR A C   1 
ATOM   3150  O  O   . TYR A  1 416 ? 36.924  0.218   98.733  1.00 22.45  ? 523  TYR A O   1 
ATOM   3151  C  CB  . TYR A  1 416 ? 39.618  -0.840  98.601  1.00 23.30  ? 523  TYR A CB  1 
ATOM   3152  C  CG  . TYR A  1 416 ? 41.021  -0.818  98.050  1.00 27.09  ? 523  TYR A CG  1 
ATOM   3153  C  CD1 . TYR A  1 416 ? 42.098  -1.327  98.786  1.00 28.86  ? 523  TYR A CD1 1 
ATOM   3154  C  CD2 . TYR A  1 416 ? 41.282  -0.252  96.801  1.00 28.89  ? 523  TYR A CD2 1 
ATOM   3155  C  CE1 . TYR A  1 416 ? 43.401  -1.272  98.287  1.00 30.38  ? 523  TYR A CE1 1 
ATOM   3156  C  CE2 . TYR A  1 416 ? 42.576  -0.190  96.292  1.00 31.41  ? 523  TYR A CE2 1 
ATOM   3157  C  CZ  . TYR A  1 416 ? 43.630  -0.701  97.037  1.00 32.29  ? 523  TYR A CZ  1 
ATOM   3158  O  OH  . TYR A  1 416 ? 44.906  -0.640  96.516  1.00 35.17  ? 523  TYR A OH  1 
ATOM   3159  N  N   . SER A  1 417 ? 37.407  0.617   100.894 1.00 17.90  ? 524  SER A N   1 
ATOM   3160  C  CA  . SER A  1 417 ? 36.016  0.576   101.317 1.00 16.75  ? 524  SER A CA  1 
ATOM   3161  C  C   . SER A  1 417 ? 35.083  1.425   100.475 1.00 16.37  ? 524  SER A C   1 
ATOM   3162  O  O   . SER A  1 417 ? 35.468  2.470   99.962  1.00 16.86  ? 524  SER A O   1 
ATOM   3163  C  CB  . SER A  1 417 ? 35.897  1.005   102.776 1.00 16.40  ? 524  SER A CB  1 
ATOM   3164  O  OG  . SER A  1 417 ? 34.569  0.830   103.243 1.00 17.80  ? 524  SER A OG  1 
ATOM   3165  N  N   . ALA A  1 418 ? 33.846  0.963   100.338 1.00 16.39  ? 525  ALA A N   1 
ATOM   3166  C  CA  . ALA A  1 418 ? 32.846  1.687   99.572  1.00 17.83  ? 525  ALA A CA  1 
ATOM   3167  C  C   . ALA A  1 418 ? 31.752  2.096   100.548 1.00 18.49  ? 525  ALA A C   1 
ATOM   3168  O  O   . ALA A  1 418 ? 30.684  2.560   100.154 1.00 18.34  ? 525  ALA A O   1 
ATOM   3169  C  CB  . ALA A  1 418 ? 32.282  0.799   98.482  1.00 18.09  ? 525  ALA A CB  1 
ATOM   3170  N  N   . ASP A  1 419 ? 32.059  1.923   101.830 1.00 19.49  ? 526  ASP A N   1 
ATOM   3171  C  CA  . ASP A  1 419 ? 31.177  2.240   102.952 1.00 21.19  ? 526  ASP A CA  1 
ATOM   3172  C  C   . ASP A  1 419 ? 31.028  3.726   103.284 1.00 20.47  ? 526  ASP A C   1 
ATOM   3173  O  O   . ASP A  1 419 ? 30.056  4.119   103.932 1.00 20.67  ? 526  ASP A O   1 
ATOM   3174  C  CB  . ASP A  1 419 ? 31.707  1.583   104.228 1.00 26.28  ? 526  ASP A CB  1 
ATOM   3175  C  CG  . ASP A  1 419 ? 31.586  0.061   104.230 1.00 30.90  ? 526  ASP A CG  1 
ATOM   3176  O  OD1 . ASP A  1 419 ? 32.108  -0.551  105.201 1.00 31.68  ? 526  ASP A OD1 1 
ATOM   3177  O  OD2 . ASP A  1 419 ? 30.976  -0.515  103.292 1.00 32.64  ? 526  ASP A OD2 1 
ATOM   3178  N  N   . GLY A  1 420 ? 32.009  4.534   102.893 1.00 18.68  ? 527  GLY A N   1 
ATOM   3179  C  CA  . GLY A  1 420 ? 31.957  5.954   103.199 1.00 17.65  ? 527  GLY A CA  1 
ATOM   3180  C  C   . GLY A  1 420 ? 32.063  6.215   104.696 1.00 15.61  ? 527  GLY A C   1 
ATOM   3181  O  O   . GLY A  1 420 ? 32.711  5.465   105.417 1.00 15.08  ? 527  GLY A O   1 
ATOM   3182  N  N   . PHE A  1 421 ? 31.426  7.285   105.157 1.00 14.76  ? 528  PHE A N   1 
ATOM   3183  C  CA  . PHE A  1 421 ? 31.427  7.651   106.569 1.00 13.88  ? 528  PHE A CA  1 
ATOM   3184  C  C   . PHE A  1 421 ? 30.001  7.923   107.027 1.00 15.22  ? 528  PHE A C   1 
ATOM   3185  O  O   . PHE A  1 421 ? 29.207  8.526   106.296 1.00 17.31  ? 528  PHE A O   1 
ATOM   3186  C  CB  . PHE A  1 421 ? 32.256  8.921   106.812 1.00 12.45  ? 528  PHE A CB  1 
ATOM   3187  C  CG  . PHE A  1 421 ? 33.716  8.760   106.536 1.00 7.82   ? 528  PHE A CG  1 
ATOM   3188  C  CD1 . PHE A  1 421 ? 34.270  9.219   105.340 1.00 7.24   ? 528  PHE A CD1 1 
ATOM   3189  C  CD2 . PHE A  1 421 ? 34.540  8.151   107.472 1.00 6.43   ? 528  PHE A CD2 1 
ATOM   3190  C  CE1 . PHE A  1 421 ? 35.631  9.072   105.081 1.00 6.16   ? 528  PHE A CE1 1 
ATOM   3191  C  CE2 . PHE A  1 421 ? 35.906  7.996   107.229 1.00 7.51   ? 528  PHE A CE2 1 
ATOM   3192  C  CZ  . PHE A  1 421 ? 36.458  8.456   106.032 1.00 6.68   ? 528  PHE A CZ  1 
ATOM   3193  N  N   . ASN A  1 422 ? 29.675  7.490   108.238 1.00 16.04  ? 529  ASN A N   1 
ATOM   3194  C  CA  . ASN A  1 422 ? 28.344  7.714   108.773 1.00 18.69  ? 529  ASN A CA  1 
ATOM   3195  C  C   . ASN A  1 422 ? 28.422  8.497   110.062 1.00 18.09  ? 529  ASN A C   1 
ATOM   3196  O  O   . ASN A  1 422 ? 28.692  7.937   111.128 1.00 17.88  ? 529  ASN A O   1 
ATOM   3197  C  CB  . ASN A  1 422 ? 27.626  6.383   108.981 1.00 21.45  ? 529  ASN A CB  1 
ATOM   3198  C  CG  . ASN A  1 422 ? 27.268  5.733   107.657 1.00 29.10  ? 529  ASN A CG  1 
ATOM   3199  O  OD1 . ASN A  1 422 ? 26.195  6.003   107.089 1.00 31.65  ? 529  ASN A OD1 1 
ATOM   3200  N  ND2 . ASN A  1 422 ? 28.185  4.903   107.125 1.00 30.13  ? 529  ASN A ND2 1 
ATOM   3201  N  N   . ASP A  1 423 ? 28.184  9.802   109.944 1.00 16.75  ? 530  ASP A N   1 
ATOM   3202  C  CA  . ASP A  1 423 ? 28.236  10.706  111.075 1.00 16.13  ? 530  ASP A CA  1 
ATOM   3203  C  C   . ASP A  1 423 ? 29.555  10.529  111.824 1.00 15.27  ? 530  ASP A C   1 
ATOM   3204  O  O   . ASP A  1 423 ? 29.571  10.420  113.054 1.00 14.50  ? 530  ASP A O   1 
ATOM   3205  C  CB  . ASP A  1 423 ? 27.078  10.446  112.027 1.00 16.01  ? 530  ASP A CB  1 
ATOM   3206  C  CG  . ASP A  1 423 ? 26.877  11.582  113.010 1.00 18.85  ? 530  ASP A CG  1 
ATOM   3207  O  OD1 . ASP A  1 423 ? 26.353  11.330  114.127 1.00 18.58  ? 530  ASP A OD1 1 
ATOM   3208  O  OD2 . ASP A  1 423 ? 27.228  12.736  112.654 1.00 19.19  ? 530  ASP A OD2 1 
ATOM   3209  N  N   . TRP A  1 424 ? 30.655  10.475  111.076 1.00 13.29  ? 531  TRP A N   1 
ATOM   3210  C  CA  . TRP A  1 424 ? 31.973  10.332  111.679 1.00 12.20  ? 531  TRP A CA  1 
ATOM   3211  C  C   . TRP A  1 424 ? 32.453  11.721  112.072 1.00 12.61  ? 531  TRP A C   1 
ATOM   3212  O  O   . TRP A  1 424 ? 32.486  12.641  111.250 1.00 13.56  ? 531  TRP A O   1 
ATOM   3213  C  CB  . TRP A  1 424 ? 32.962  9.706   110.698 1.00 10.83  ? 531  TRP A CB  1 
ATOM   3214  C  CG  . TRP A  1 424 ? 34.257  9.366   111.343 1.00 7.65   ? 531  TRP A CG  1 
ATOM   3215  C  CD1 . TRP A  1 424 ? 35.444  9.997   111.168 1.00 6.89   ? 531  TRP A CD1 1 
ATOM   3216  C  CD2 . TRP A  1 424 ? 34.486  8.339   112.320 1.00 6.14   ? 531  TRP A CD2 1 
ATOM   3217  N  NE1 . TRP A  1 424 ? 36.407  9.437   111.975 1.00 4.72   ? 531  TRP A NE1 1 
ATOM   3218  C  CE2 . TRP A  1 424 ? 35.844  8.415   112.694 1.00 6.52   ? 531  TRP A CE2 1 
ATOM   3219  C  CE3 . TRP A  1 424 ? 33.674  7.366   112.919 1.00 4.67   ? 531  TRP A CE3 1 
ATOM   3220  C  CZ2 . TRP A  1 424 ? 36.412  7.551   113.644 1.00 4.15   ? 531  TRP A CZ2 1 
ATOM   3221  C  CZ3 . TRP A  1 424 ? 34.238  6.510   113.862 1.00 2.23   ? 531  TRP A CZ3 1 
ATOM   3222  C  CH2 . TRP A  1 424 ? 35.592  6.609   114.213 1.00 2.86   ? 531  TRP A CH2 1 
ATOM   3223  N  N   . ALA A  1 425 ? 32.830  11.874  113.333 1.00 12.67  ? 532  ALA A N   1 
ATOM   3224  C  CA  . ALA A  1 425 ? 33.259  13.170  113.837 1.00 13.15  ? 532  ALA A CA  1 
ATOM   3225  C  C   . ALA A  1 425 ? 34.752  13.445  113.739 1.00 14.58  ? 532  ALA A C   1 
ATOM   3226  O  O   . ALA A  1 425 ? 35.461  13.332  114.733 1.00 17.12  ? 532  ALA A O   1 
ATOM   3227  C  CB  . ALA A  1 425 ? 32.804  13.321  115.279 1.00 12.29  ? 532  ALA A CB  1 
ATOM   3228  N  N   . PHE A  1 426 ? 35.243  13.804  112.555 1.00 14.75  ? 533  PHE A N   1 
ATOM   3229  C  CA  . PHE A  1 426 ? 36.659  14.104  112.425 1.00 13.08  ? 533  PHE A CA  1 
ATOM   3230  C  C   . PHE A  1 426 ? 36.903  15.256  113.397 1.00 13.10  ? 533  PHE A C   1 
ATOM   3231  O  O   . PHE A  1 426 ? 36.150  16.233  113.408 1.00 13.68  ? 533  PHE A O   1 
ATOM   3232  C  CB  . PHE A  1 426 ? 36.999  14.532  110.999 1.00 13.49  ? 533  PHE A CB  1 
ATOM   3233  C  CG  . PHE A  1 426 ? 36.689  13.492  109.961 1.00 12.74  ? 533  PHE A CG  1 
ATOM   3234  C  CD1 . PHE A  1 426 ? 35.424  13.424  109.370 1.00 13.79  ? 533  PHE A CD1 1 
ATOM   3235  C  CD2 . PHE A  1 426 ? 37.660  12.580  109.563 1.00 11.95  ? 533  PHE A CD2 1 
ATOM   3236  C  CE1 . PHE A  1 426 ? 35.136  12.456  108.391 1.00 12.49  ? 533  PHE A CE1 1 
ATOM   3237  C  CE2 . PHE A  1 426 ? 37.385  11.612  108.590 1.00 11.86  ? 533  PHE A CE2 1 
ATOM   3238  C  CZ  . PHE A  1 426 ? 36.121  11.552  108.004 1.00 12.57  ? 533  PHE A CZ  1 
ATOM   3239  N  N   . MET A  1 427 ? 37.941  15.147  114.216 1.00 11.77  ? 534  MET A N   1 
ATOM   3240  C  CA  . MET A  1 427 ? 38.208  16.189  115.194 1.00 12.85  ? 534  MET A CA  1 
ATOM   3241  C  C   . MET A  1 427 ? 39.564  16.867  115.023 1.00 13.10  ? 534  MET A C   1 
ATOM   3242  O  O   . MET A  1 427 ? 40.555  16.213  114.709 1.00 13.69  ? 534  MET A O   1 
ATOM   3243  C  CB  . MET A  1 427 ? 38.081  15.599  116.611 1.00 12.72  ? 534  MET A CB  1 
ATOM   3244  C  CG  . MET A  1 427 ? 38.193  16.608  117.765 1.00 11.62  ? 534  MET A CG  1 
ATOM   3245  S  SD  . MET A  1 427 ? 39.893  17.053  118.192 1.00 9.80   ? 534  MET A SD  1 
ATOM   3246  C  CE  . MET A  1 427 ? 40.377  15.673  119.212 1.00 7.96   ? 534  MET A CE  1 
ATOM   3247  N  N   . THR A  1 428 ? 39.599  18.184  115.219 1.00 13.04  ? 535  THR A N   1 
ATOM   3248  C  CA  . THR A  1 428 ? 40.850  18.933  115.118 1.00 12.98  ? 535  THR A CA  1 
ATOM   3249  C  C   . THR A  1 428 ? 41.123  19.764  116.364 1.00 13.50  ? 535  THR A C   1 
ATOM   3250  O  O   . THR A  1 428 ? 40.225  20.396  116.925 1.00 12.78  ? 535  THR A O   1 
ATOM   3251  C  CB  . THR A  1 428 ? 40.873  19.880  113.918 1.00 12.20  ? 535  THR A CB  1 
ATOM   3252  O  OG1 . THR A  1 428 ? 42.080  20.645  113.957 1.00 12.86  ? 535  THR A OG1 1 
ATOM   3253  C  CG2 . THR A  1 428 ? 39.695  20.816  113.944 1.00 11.27  ? 535  THR A CG2 1 
ATOM   3254  N  N   . THR A  1 429 ? 42.374  19.748  116.804 1.00 13.73  ? 536  THR A N   1 
ATOM   3255  C  CA  . THR A  1 429 ? 42.777  20.503  117.983 1.00 14.10  ? 536  THR A CA  1 
ATOM   3256  C  C   . THR A  1 429 ? 43.580  21.717  117.530 1.00 14.85  ? 536  THR A C   1 
ATOM   3257  O  O   . THR A  1 429 ? 43.990  22.540  118.350 1.00 15.91  ? 536  THR A O   1 
ATOM   3258  C  CB  . THR A  1 429 ? 43.690  19.669  118.877 1.00 14.70  ? 536  THR A CB  1 
ATOM   3259  O  OG1 . THR A  1 429 ? 44.807  19.218  118.094 1.00 14.98  ? 536  THR A OG1 1 
ATOM   3260  C  CG2 . THR A  1 429 ? 42.956  18.471  119.448 1.00 11.06  ? 536  THR A CG2 1 
ATOM   3261  N  N   . HIS A  1 430 ? 43.790  21.824  116.220 1.00 13.83  ? 537  HIS A N   1 
ATOM   3262  C  CA  . HIS A  1 430 ? 44.581  22.901  115.650 1.00 11.93  ? 537  HIS A CA  1 
ATOM   3263  C  C   . HIS A  1 430 ? 44.033  24.323  115.750 1.00 12.53  ? 537  HIS A C   1 
ATOM   3264  O  O   . HIS A  1 430 ? 44.777  25.289  115.577 1.00 11.48  ? 537  HIS A O   1 
ATOM   3265  C  CB  . HIS A  1 430 ? 44.925  22.563  114.193 1.00 11.14  ? 537  HIS A CB  1 
ATOM   3266  C  CG  . HIS A  1 430 ? 45.824  21.370  114.051 1.00 9.67   ? 537  HIS A CG  1 
ATOM   3267  N  ND1 . HIS A  1 430 ? 46.656  21.187  112.969 1.00 8.54   ? 537  HIS A ND1 1 
ATOM   3268  C  CD2 . HIS A  1 430 ? 46.032  20.307  114.864 1.00 10.61  ? 537  HIS A CD2 1 
ATOM   3269  C  CE1 . HIS A  1 430 ? 47.342  20.068  113.124 1.00 8.82   ? 537  HIS A CE1 1 
ATOM   3270  N  NE2 . HIS A  1 430 ? 46.983  19.514  114.267 1.00 8.32   ? 537  HIS A NE2 1 
ATOM   3271  N  N   . SER A  1 431 ? 42.745  24.472  116.036 1.00 12.34  ? 538  SER A N   1 
ATOM   3272  C  CA  . SER A  1 431 ? 42.179  25.812  116.142 1.00 11.48  ? 538  SER A CA  1 
ATOM   3273  C  C   . SER A  1 431 ? 41.909  26.191  117.590 1.00 11.14  ? 538  SER A C   1 
ATOM   3274  O  O   . SER A  1 431 ? 41.143  27.110  117.879 1.00 10.82  ? 538  SER A O   1 
ATOM   3275  C  CB  . SER A  1 431 ? 40.896  25.915  115.320 1.00 11.13  ? 538  SER A CB  1 
ATOM   3276  O  OG  . SER A  1 431 ? 41.203  25.932  113.944 1.00 10.71  ? 538  SER A OG  1 
ATOM   3277  N  N   . TRP A  1 432 ? 42.549  25.467  118.498 1.00 11.01  ? 539  TRP A N   1 
ATOM   3278  C  CA  . TRP A  1 432 ? 42.402  25.710  119.923 1.00 11.88  ? 539  TRP A CA  1 
ATOM   3279  C  C   . TRP A  1 432 ? 42.661  27.187  120.224 1.00 13.11  ? 539  TRP A C   1 
ATOM   3280  O  O   . TRP A  1 432 ? 43.662  27.754  119.781 1.00 11.87  ? 539  TRP A O   1 
ATOM   3281  C  CB  . TRP A  1 432 ? 43.402  24.840  120.671 1.00 11.46  ? 539  TRP A CB  1 
ATOM   3282  C  CG  . TRP A  1 432 ? 43.122  24.657  122.113 1.00 11.89  ? 539  TRP A CG  1 
ATOM   3283  C  CD1 . TRP A  1 432 ? 43.442  25.509  123.124 1.00 11.28  ? 539  TRP A CD1 1 
ATOM   3284  C  CD2 . TRP A  1 432 ? 42.500  23.520  122.719 1.00 11.81  ? 539  TRP A CD2 1 
ATOM   3285  N  NE1 . TRP A  1 432 ? 43.064  24.974  124.329 1.00 12.58  ? 539  TRP A NE1 1 
ATOM   3286  C  CE2 . TRP A  1 432 ? 42.480  23.751  124.113 1.00 13.46  ? 539  TRP A CE2 1 
ATOM   3287  C  CE3 . TRP A  1 432 ? 41.954  22.328  122.219 1.00 11.54  ? 539  TRP A CE3 1 
ATOM   3288  C  CZ2 . TRP A  1 432 ? 41.937  22.825  125.029 1.00 12.68  ? 539  TRP A CZ2 1 
ATOM   3289  C  CZ3 . TRP A  1 432 ? 41.413  21.406  123.122 1.00 14.20  ? 539  TRP A CZ3 1 
ATOM   3290  C  CH2 . TRP A  1 432 ? 41.410  21.664  124.516 1.00 14.19  ? 539  TRP A CH2 1 
ATOM   3291  N  N   . ASP A  1 433 ? 41.740  27.796  120.969 1.00 13.73  ? 540  ASP A N   1 
ATOM   3292  C  CA  . ASP A  1 433 ? 41.806  29.203  121.372 1.00 14.05  ? 540  ASP A CA  1 
ATOM   3293  C  C   . ASP A  1 433 ? 41.433  30.220  120.308 1.00 14.23  ? 540  ASP A C   1 
ATOM   3294  O  O   . ASP A  1 433 ? 41.390  31.404  120.601 1.00 15.92  ? 540  ASP A O   1 
ATOM   3295  C  CB  . ASP A  1 433 ? 43.188  29.551  121.942 1.00 12.41  ? 540  ASP A CB  1 
ATOM   3296  C  CG  . ASP A  1 433 ? 43.320  29.195  123.413 1.00 14.31  ? 540  ASP A CG  1 
ATOM   3297  O  OD1 . ASP A  1 433 ? 44.419  28.820  123.845 1.00 13.45  ? 540  ASP A OD1 1 
ATOM   3298  O  OD2 . ASP A  1 433 ? 42.327  29.298  124.162 1.00 16.92  ? 540  ASP A OD2 1 
ATOM   3299  N  N   . GLU A  1 434 ? 41.160  29.779  119.085 1.00 14.15  ? 541  GLU A N   1 
ATOM   3300  C  CA  . GLU A  1 434 ? 40.788  30.710  118.029 1.00 14.55  ? 541  GLU A CA  1 
ATOM   3301  C  C   . GLU A  1 434 ? 39.337  31.116  118.183 1.00 15.73  ? 541  GLU A C   1 
ATOM   3302  O  O   . GLU A  1 434 ? 38.558  30.435  118.837 1.00 16.43  ? 541  GLU A O   1 
ATOM   3303  C  CB  . GLU A  1 434 ? 40.933  30.080  116.648 1.00 14.52  ? 541  GLU A CB  1 
ATOM   3304  C  CG  . GLU A  1 434 ? 42.283  29.511  116.323 1.00 16.01  ? 541  GLU A CG  1 
ATOM   3305  C  CD  . GLU A  1 434 ? 42.388  29.144  114.858 1.00 15.72  ? 541  GLU A CD  1 
ATOM   3306  O  OE1 . GLU A  1 434 ? 41.331  28.961  114.222 1.00 17.01  ? 541  GLU A OE1 1 
ATOM   3307  O  OE2 . GLU A  1 434 ? 43.514  29.030  114.344 1.00 15.26  ? 541  GLU A OE2 1 
ATOM   3308  N  N   . ASP A  1 435 ? 38.974  32.235  117.572 1.00 17.00  ? 542  ASP A N   1 
ATOM   3309  C  CA  . ASP A  1 435 ? 37.598  32.690  117.600 1.00 16.93  ? 542  ASP A CA  1 
ATOM   3310  C  C   . ASP A  1 435 ? 36.938  31.999  116.399 1.00 16.13  ? 542  ASP A C   1 
ATOM   3311  O  O   . ASP A  1 435 ? 37.361  32.170  115.256 1.00 15.59  ? 542  ASP A O   1 
ATOM   3312  C  CB  . ASP A  1 435 ? 37.537  34.209  117.454 1.00 17.53  ? 542  ASP A CB  1 
ATOM   3313  C  CG  . ASP A  1 435 ? 36.119  34.733  117.430 1.00 20.23  ? 542  ASP A CG  1 
ATOM   3314  O  OD1 . ASP A  1 435 ? 35.933  35.958  117.537 1.00 24.53  ? 542  ASP A OD1 1 
ATOM   3315  O  OD2 . ASP A  1 435 ? 35.175  33.933  117.298 1.00 21.84  ? 542  ASP A OD2 1 
ATOM   3316  N  N   . PRO A  1 436 ? 35.894  31.206  116.648 1.00 15.87  ? 543  PRO A N   1 
ATOM   3317  C  CA  . PRO A  1 436 ? 35.175  30.479  115.594 1.00 16.80  ? 543  PRO A CA  1 
ATOM   3318  C  C   . PRO A  1 436 ? 34.254  31.298  114.693 1.00 18.12  ? 543  PRO A C   1 
ATOM   3319  O  O   . PRO A  1 436 ? 33.800  30.799  113.668 1.00 18.22  ? 543  PRO A O   1 
ATOM   3320  C  CB  . PRO A  1 436 ? 34.392  29.444  116.375 1.00 15.85  ? 543  PRO A CB  1 
ATOM   3321  C  CG  . PRO A  1 436 ? 34.008  30.230  117.595 1.00 16.78  ? 543  PRO A CG  1 
ATOM   3322  C  CD  . PRO A  1 436 ? 35.299  30.935  117.968 1.00 15.61  ? 543  PRO A CD  1 
ATOM   3323  N  N   . ALA A  1 437 ? 33.969  32.544  115.063 1.00 18.75  ? 544  ALA A N   1 
ATOM   3324  C  CA  . ALA A  1 437 ? 33.078  33.370  114.255 1.00 17.97  ? 544  ALA A CA  1 
ATOM   3325  C  C   . ALA A  1 437 ? 33.690  33.697  112.903 1.00 19.20  ? 544  ALA A C   1 
ATOM   3326  O  O   . ALA A  1 437 ? 34.835  34.137  112.808 1.00 20.69  ? 544  ALA A O   1 
ATOM   3327  C  CB  . ALA A  1 437 ? 32.725  34.647  114.991 1.00 16.45  ? 544  ALA A CB  1 
ATOM   3328  N  N   . GLY A  1 438 ? 32.918  33.483  111.847 1.00 19.47  ? 545  GLY A N   1 
ATOM   3329  C  CA  . GLY A  1 438 ? 33.418  33.766  110.519 1.00 19.54  ? 545  GLY A CA  1 
ATOM   3330  C  C   . GLY A  1 438 ? 33.072  32.668  109.537 1.00 19.35  ? 545  GLY A C   1 
ATOM   3331  O  O   . GLY A  1 438 ? 32.199  31.848  109.795 1.00 19.74  ? 545  GLY A O   1 
ATOM   3332  N  N   . GLU A  1 439 ? 33.770  32.639  108.410 1.00 19.47  ? 546  GLU A N   1 
ATOM   3333  C  CA  . GLU A  1 439 ? 33.509  31.639  107.391 1.00 19.54  ? 546  GLU A CA  1 
ATOM   3334  C  C   . GLU A  1 439 ? 34.365  30.377  107.484 1.00 19.03  ? 546  GLU A C   1 
ATOM   3335  O  O   . GLU A  1 439 ? 35.597  30.440  107.455 1.00 20.10  ? 546  GLU A O   1 
ATOM   3336  C  CB  . GLU A  1 439 ? 33.675  32.257  106.005 1.00 20.84  ? 546  GLU A CB  1 
ATOM   3337  C  CG  . GLU A  1 439 ? 33.881  31.215  104.917 1.00 27.01  ? 546  GLU A CG  1 
ATOM   3338  C  CD  . GLU A  1 439 ? 33.706  31.774  103.520 1.00 30.72  ? 546  GLU A CD  1 
ATOM   3339  O  OE1 . GLU A  1 439 ? 32.541  32.035  103.129 1.00 33.12  ? 546  GLU A OE1 1 
ATOM   3340  O  OE2 . GLU A  1 439 ? 34.735  31.956  102.823 1.00 31.62  ? 546  GLU A OE2 1 
ATOM   3341  N  N   . TRP A  1 440 ? 33.708  29.227  107.599 1.00 16.90  ? 547  TRP A N   1 
ATOM   3342  C  CA  . TRP A  1 440 ? 34.418  27.963  107.661 1.00 15.11  ? 547  TRP A CA  1 
ATOM   3343  C  C   . TRP A  1 440 ? 34.373  27.343  106.280 1.00 15.92  ? 547  TRP A C   1 
ATOM   3344  O  O   . TRP A  1 440 ? 33.428  27.564  105.522 1.00 17.06  ? 547  TRP A O   1 
ATOM   3345  C  CB  . TRP A  1 440 ? 33.775  27.015  108.657 1.00 13.71  ? 547  TRP A CB  1 
ATOM   3346  C  CG  . TRP A  1 440 ? 34.080  27.339  110.069 1.00 12.56  ? 547  TRP A CG  1 
ATOM   3347  C  CD1 . TRP A  1 440 ? 33.499  28.311  110.833 1.00 12.29  ? 547  TRP A CD1 1 
ATOM   3348  C  CD2 . TRP A  1 440 ? 35.035  26.683  110.905 1.00 11.56  ? 547  TRP A CD2 1 
ATOM   3349  N  NE1 . TRP A  1 440 ? 34.030  28.300  112.098 1.00 11.62  ? 547  TRP A NE1 1 
ATOM   3350  C  CE2 . TRP A  1 440 ? 34.977  27.310  112.173 1.00 11.95  ? 547  TRP A CE2 1 
ATOM   3351  C  CE3 . TRP A  1 440 ? 35.939  25.627  110.708 1.00 11.68  ? 547  TRP A CE3 1 
ATOM   3352  C  CZ2 . TRP A  1 440 ? 35.785  26.919  113.242 1.00 10.17  ? 547  TRP A CZ2 1 
ATOM   3353  C  CZ3 . TRP A  1 440 ? 36.747  25.239  111.769 1.00 11.47  ? 547  TRP A CZ3 1 
ATOM   3354  C  CH2 . TRP A  1 440 ? 36.663  25.890  113.027 1.00 11.49  ? 547  TRP A CH2 1 
ATOM   3355  N  N   . VAL A  1 441 ? 35.398  26.569  105.947 1.00 14.53  ? 548  VAL A N   1 
ATOM   3356  C  CA  . VAL A  1 441 ? 35.463  25.934  104.646 1.00 13.94  ? 548  VAL A CA  1 
ATOM   3357  C  C   . VAL A  1 441 ? 35.823  24.460  104.748 1.00 14.47  ? 548  VAL A C   1 
ATOM   3358  O  O   . VAL A  1 441 ? 36.809  24.098  105.383 1.00 14.97  ? 548  VAL A O   1 
ATOM   3359  C  CB  . VAL A  1 441 ? 36.509  26.631  103.750 1.00 14.60  ? 548  VAL A CB  1 
ATOM   3360  C  CG1 . VAL A  1 441 ? 36.627  25.903  102.411 1.00 13.82  ? 548  VAL A CG1 1 
ATOM   3361  C  CG2 . VAL A  1 441 ? 36.115  28.085  103.522 1.00 12.88  ? 548  VAL A CG2 1 
ATOM   3362  N  N   . LEU A  1 442 ? 35.009  23.610  104.127 1.00 14.20  ? 549  LEU A N   1 
ATOM   3363  C  CA  . LEU A  1 442 ? 35.267  22.175  104.116 1.00 13.69  ? 549  LEU A CA  1 
ATOM   3364  C  C   . LEU A  1 442 ? 35.703  21.825  102.703 1.00 15.44  ? 549  LEU A C   1 
ATOM   3365  O  O   . LEU A  1 442 ? 35.077  22.240  101.719 1.00 15.02  ? 549  LEU A O   1 
ATOM   3366  C  CB  . LEU A  1 442 ? 34.013  21.375  104.462 1.00 12.87  ? 549  LEU A CB  1 
ATOM   3367  C  CG  . LEU A  1 442 ? 34.199  19.850  104.447 1.00 11.04  ? 549  LEU A CG  1 
ATOM   3368  C  CD1 . LEU A  1 442 ? 35.007  19.407  105.643 1.00 10.52  ? 549  LEU A CD1 1 
ATOM   3369  C  CD2 . LEU A  1 442 ? 32.853  19.170  104.480 1.00 11.47  ? 549  LEU A CD2 1 
ATOM   3370  N  N   . GLU A  1 443 ? 36.783  21.067  102.601 1.00 15.66  ? 550  GLU A N   1 
ATOM   3371  C  CA  . GLU A  1 443 ? 37.296  20.678  101.303 1.00 17.23  ? 550  GLU A CA  1 
ATOM   3372  C  C   . GLU A  1 443 ? 37.373  19.168  101.207 1.00 17.38  ? 550  GLU A C   1 
ATOM   3373  O  O   . GLU A  1 443 ? 37.976  18.524  102.065 1.00 17.58  ? 550  GLU A O   1 
ATOM   3374  C  CB  . GLU A  1 443 ? 38.705  21.241  101.081 1.00 19.11  ? 550  GLU A CB  1 
ATOM   3375  C  CG  . GLU A  1 443 ? 38.827  22.748  100.981 1.00 22.94  ? 550  GLU A CG  1 
ATOM   3376  C  CD  . GLU A  1 443 ? 40.294  23.206  100.877 1.00 26.05  ? 550  GLU A CD  1 
ATOM   3377  O  OE1 . GLU A  1 443 ? 40.535  24.376  100.483 1.00 27.84  ? 550  GLU A OE1 1 
ATOM   3378  O  OE2 . GLU A  1 443 ? 41.206  22.403  101.195 1.00 24.64  ? 550  GLU A OE2 1 
ATOM   3379  N  N   . ILE A  1 444 ? 36.760  18.608  100.167 1.00 17.39  ? 551  ILE A N   1 
ATOM   3380  C  CA  . ILE A  1 444 ? 36.806  17.171  99.929  1.00 17.68  ? 551  ILE A CA  1 
ATOM   3381  C  C   . ILE A  1 444 ? 37.289  16.968  98.502  1.00 19.40  ? 551  ILE A C   1 
ATOM   3382  O  O   . ILE A  1 444 ? 36.721  17.522  97.562  1.00 19.86  ? 551  ILE A O   1 
ATOM   3383  C  CB  . ILE A  1 444 ? 35.440  16.511  100.076 1.00 16.13  ? 551  ILE A CB  1 
ATOM   3384  C  CG1 . ILE A  1 444 ? 34.886  16.745  101.484 1.00 15.84  ? 551  ILE A CG1 1 
ATOM   3385  C  CG2 . ILE A  1 444 ? 35.592  15.024  99.851  1.00 16.12  ? 551  ILE A CG2 1 
ATOM   3386  C  CD1 . ILE A  1 444 ? 33.504  16.170  101.714 1.00 13.22  ? 551  ILE A CD1 1 
ATOM   3387  N  N   . GLU A  1 445 ? 38.335  16.176  98.327  1.00 20.70  ? 552  GLU A N   1 
ATOM   3388  C  CA  . GLU A  1 445 ? 38.873  15.975  96.992  1.00 22.60  ? 552  GLU A CA  1 
ATOM   3389  C  C   . GLU A  1 445 ? 39.339  14.560  96.732  1.00 21.54  ? 552  GLU A C   1 
ATOM   3390  O  O   . GLU A  1 445 ? 39.776  13.853  97.640  1.00 21.69  ? 552  GLU A O   1 
ATOM   3391  C  CB  . GLU A  1 445 ? 40.054  16.920  96.761  1.00 26.64  ? 552  GLU A CB  1 
ATOM   3392  C  CG  . GLU A  1 445 ? 41.226  16.622  97.682  1.00 33.28  ? 552  GLU A CG  1 
ATOM   3393  C  CD  . GLU A  1 445 ? 42.180  17.798  97.833  1.00 38.11  ? 552  GLU A CD  1 
ATOM   3394  O  OE1 . GLU A  1 445 ? 41.694  18.931  98.094  1.00 39.85  ? 552  GLU A OE1 1 
ATOM   3395  O  OE2 . GLU A  1 445 ? 43.412  17.581  97.704  1.00 39.42  ? 552  GLU A OE2 1 
ATOM   3396  N  N   . ASN A  1 446 ? 39.247  14.162  95.469  1.00 20.65  ? 553  ASN A N   1 
ATOM   3397  C  CA  . ASN A  1 446 ? 39.679  12.846  95.045  1.00 19.87  ? 553  ASN A CA  1 
ATOM   3398  C  C   . ASN A  1 446 ? 41.140  12.997  94.681  1.00 19.63  ? 553  ASN A C   1 
ATOM   3399  O  O   . ASN A  1 446 ? 41.478  13.635  93.685  1.00 21.34  ? 553  ASN A O   1 
ATOM   3400  C  CB  . ASN A  1 446 ? 38.882  12.391  93.830  1.00 20.12  ? 553  ASN A CB  1 
ATOM   3401  C  CG  . ASN A  1 446 ? 39.455  11.140  93.194  1.00 20.31  ? 553  ASN A CG  1 
ATOM   3402  O  OD1 . ASN A  1 446 ? 40.349  10.496  93.744  1.00 20.71  ? 553  ASN A OD1 1 
ATOM   3403  N  ND2 . ASN A  1 446 ? 38.939  10.788  92.031  1.00 21.79  ? 553  ASN A ND2 1 
ATOM   3404  N  N   . THR A  1 447 ? 42.009  12.410  95.487  1.00 18.49  ? 554  THR A N   1 
ATOM   3405  C  CA  . THR A  1 447 ? 43.438  12.533  95.259  1.00 19.33  ? 554  THR A CA  1 
ATOM   3406  C  C   . THR A  1 447 ? 43.944  11.606  94.174  1.00 21.40  ? 554  THR A C   1 
ATOM   3407  O  O   . THR A  1 447 ? 45.124  11.649  93.809  1.00 21.76  ? 554  THR A O   1 
ATOM   3408  C  CB  . THR A  1 447 ? 44.210  12.237  96.545  1.00 18.39  ? 554  THR A CB  1 
ATOM   3409  O  OG1 . THR A  1 447 ? 43.943  10.890  96.954  1.00 16.59  ? 554  THR A OG1 1 
ATOM   3410  C  CG2 . THR A  1 447 ? 43.789  13.201  97.653  1.00 14.97  ? 554  THR A CG2 1 
ATOM   3411  N  N   . SER A  1 448 ? 43.047  10.776  93.654  1.00 22.68  ? 555  SER A N   1 
ATOM   3412  C  CA  . SER A  1 448 ? 43.400  9.805   92.625  1.00 23.54  ? 555  SER A CA  1 
ATOM   3413  C  C   . SER A  1 448 ? 43.010  10.270  91.223  1.00 24.52  ? 555  SER A C   1 
ATOM   3414  O  O   . SER A  1 448 ? 42.227  11.212  91.066  1.00 25.15  ? 555  SER A O   1 
ATOM   3415  C  CB  . SER A  1 448 ? 42.716  8.473   92.952  1.00 23.78  ? 555  SER A CB  1 
ATOM   3416  O  OG  . SER A  1 448 ? 42.816  7.556   91.882  1.00 26.50  ? 555  SER A OG  1 
ATOM   3417  N  N   . GLU A  1 449 ? 43.563  9.622   90.201  1.00 24.94  ? 556  GLU A N   1 
ATOM   3418  C  CA  . GLU A  1 449 ? 43.211  9.983   88.833  1.00 25.66  ? 556  GLU A CA  1 
ATOM   3419  C  C   . GLU A  1 449 ? 42.007  9.155   88.397  1.00 24.89  ? 556  GLU A C   1 
ATOM   3420  O  O   . GLU A  1 449 ? 41.426  9.388   87.343  1.00 25.45  ? 556  GLU A O   1 
ATOM   3421  C  CB  . GLU A  1 449 ? 44.394  9.766   87.893  1.00 25.35  ? 556  GLU A CB  1 
ATOM   3422  C  CG  . GLU A  1 449 ? 45.443  10.862  88.003  1.00 27.43  ? 556  GLU A CG  1 
ATOM   3423  C  CD  . GLU A  1 449 ? 44.875  12.248  87.691  1.00 28.97  ? 556  GLU A CD  1 
ATOM   3424  O  OE1 . GLU A  1 449 ? 43.993  12.720  88.438  0.00 28.44  ? 556  GLU A OE1 1 
ATOM   3425  O  OE2 . GLU A  1 449 ? 45.316  12.858  86.694  0.00 28.44  ? 556  GLU A OE2 1 
ATOM   3426  N  N   . ALA A  1 450 ? 41.627  8.202   89.241  1.00 24.41  ? 557  ALA A N   1 
ATOM   3427  C  CA  . ALA A  1 450 ? 40.491  7.332   88.981  1.00 24.64  ? 557  ALA A CA  1 
ATOM   3428  C  C   . ALA A  1 450 ? 39.160  8.079   88.933  1.00 26.01  ? 557  ALA A C   1 
ATOM   3429  O  O   . ALA A  1 450 ? 38.996  9.147   89.522  1.00 26.28  ? 557  ALA A O   1 
ATOM   3430  C  CB  . ALA A  1 450 ? 40.420  6.249   90.040  1.00 23.04  ? 557  ALA A CB  1 
ATOM   3431  N  N   . ASN A  1 451 ? 38.208  7.491   88.222  1.00 27.52  ? 558  ASN A N   1 
ATOM   3432  C  CA  . ASN A  1 451 ? 36.879  8.056   88.085  1.00 27.67  ? 558  ASN A CA  1 
ATOM   3433  C  C   . ASN A  1 451 ? 36.071  7.623   89.297  1.00 25.61  ? 558  ASN A C   1 
ATOM   3434  O  O   . ASN A  1 451 ? 35.275  6.698   89.211  1.00 24.69  ? 558  ASN A O   1 
ATOM   3435  C  CB  . ASN A  1 451 ? 36.224  7.529   86.798  1.00 31.44  ? 558  ASN A CB  1 
ATOM   3436  C  CG  . ASN A  1 451 ? 34.706  7.766   86.757  1.00 36.56  ? 558  ASN A CG  1 
ATOM   3437  O  OD1 . ASN A  1 451 ? 34.004  7.203   85.907  1.00 38.61  ? 558  ASN A OD1 1 
ATOM   3438  N  ND2 . ASN A  1 451 ? 34.196  8.600   87.671  1.00 37.33  ? 558  ASN A ND2 1 
ATOM   3439  N  N   . ASN A  1 452 ? 36.290  8.276   90.433  1.00 25.35  ? 559  ASN A N   1 
ATOM   3440  C  CA  . ASN A  1 452 ? 35.543  7.938   91.651  1.00 23.41  ? 559  ASN A CA  1 
ATOM   3441  C  C   . ASN A  1 452 ? 34.304  8.815   91.706  1.00 21.47  ? 559  ASN A C   1 
ATOM   3442  O  O   . ASN A  1 452 ? 34.191  9.767   90.951  1.00 23.06  ? 559  ASN A O   1 
ATOM   3443  C  CB  . ASN A  1 452 ? 36.406  8.137   92.899  1.00 22.27  ? 559  ASN A CB  1 
ATOM   3444  C  CG  . ASN A  1 452 ? 37.576  7.179   92.946  1.00 22.55  ? 559  ASN A CG  1 
ATOM   3445  O  OD1 . ASN A  1 452 ? 37.425  5.992   92.684  1.00 22.29  ? 559  ASN A OD1 1 
ATOM   3446  N  ND2 . ASN A  1 452 ? 38.748  7.688   93.291  1.00 23.68  ? 559  ASN A ND2 1 
ATOM   3447  N  N   . TYR A  1 453 ? 33.388  8.509   92.607  1.00 19.16  ? 560  TYR A N   1 
ATOM   3448  C  CA  . TYR A  1 453 ? 32.137  9.246   92.699  1.00 18.84  ? 560  TYR A CA  1 
ATOM   3449  C  C   . TYR A  1 453 ? 31.511  9.064   94.081  1.00 18.66  ? 560  TYR A C   1 
ATOM   3450  O  O   . TYR A  1 453 ? 31.759  8.062   94.757  1.00 18.91  ? 560  TYR A O   1 
ATOM   3451  C  CB  . TYR A  1 453 ? 31.183  8.711   91.631  1.00 18.75  ? 560  TYR A CB  1 
ATOM   3452  C  CG  . TYR A  1 453 ? 31.123  7.198   91.619  1.00 18.22  ? 560  TYR A CG  1 
ATOM   3453  C  CD1 . TYR A  1 453 ? 30.159  6.513   92.356  1.00 18.76  ? 560  TYR A CD1 1 
ATOM   3454  C  CD2 . TYR A  1 453 ? 32.080  6.444   90.927  1.00 18.25  ? 560  TYR A CD2 1 
ATOM   3455  C  CE1 . TYR A  1 453 ? 30.148  5.116   92.413  1.00 17.86  ? 560  TYR A CE1 1 
ATOM   3456  C  CE2 . TYR A  1 453 ? 32.077  5.047   90.975  1.00 16.83  ? 560  TYR A CE2 1 
ATOM   3457  C  CZ  . TYR A  1 453 ? 31.109  4.391   91.724  1.00 18.86  ? 560  TYR A CZ  1 
ATOM   3458  O  OH  . TYR A  1 453 ? 31.105  3.011   91.805  1.00 21.09  ? 560  TYR A OH  1 
ATOM   3459  N  N   . GLY A  1 454 ? 30.691  10.026  94.494  1.00 18.41  ? 561  GLY A N   1 
ATOM   3460  C  CA  . GLY A  1 454 ? 30.055  9.939   95.797  1.00 15.89  ? 561  GLY A CA  1 
ATOM   3461  C  C   . GLY A  1 454 ? 29.286  11.194  96.151  1.00 15.64  ? 561  GLY A C   1 
ATOM   3462  O  O   . GLY A  1 454 ? 29.298  12.170  95.395  1.00 16.16  ? 561  GLY A O   1 
ATOM   3463  N  N   . THR A  1 455 ? 28.641  11.178  97.314  1.00 14.80  ? 562  THR A N   1 
ATOM   3464  C  CA  . THR A  1 455 ? 27.831  12.304  97.758  1.00 15.11  ? 562  THR A CA  1 
ATOM   3465  C  C   . THR A  1 455 ? 28.001  12.635  99.240  1.00 15.26  ? 562  THR A C   1 
ATOM   3466  O  O   . THR A  1 455 ? 28.021  11.741  100.085 1.00 13.85  ? 562  THR A O   1 
ATOM   3467  C  CB  . THR A  1 455 ? 26.333  12.008  97.502  1.00 14.54  ? 562  THR A CB  1 
ATOM   3468  O  OG1 . THR A  1 455 ? 26.148  11.685  96.122  1.00 15.39  ? 562  THR A OG1 1 
ATOM   3469  C  CG2 . THR A  1 455 ? 25.468  13.209  97.842  1.00 15.01  ? 562  THR A CG2 1 
ATOM   3470  N  N   . LEU A  1 456 ? 28.122  13.928  99.542  1.00 15.21  ? 563  LEU A N   1 
ATOM   3471  C  CA  . LEU A  1 456 ? 28.234  14.399  100.918 1.00 14.11  ? 563  LEU A CA  1 
ATOM   3472  C  C   . LEU A  1 456 ? 26.797  14.707  101.294 1.00 13.78  ? 563  LEU A C   1 
ATOM   3473  O  O   . LEU A  1 456 ? 26.186  15.609  100.733 1.00 13.25  ? 563  LEU A O   1 
ATOM   3474  C  CB  . LEU A  1 456 ? 29.077  15.672  100.987 1.00 14.45  ? 563  LEU A CB  1 
ATOM   3475  C  CG  . LEU A  1 456 ? 29.167  16.314  102.374 1.00 14.81  ? 563  LEU A CG  1 
ATOM   3476  C  CD1 . LEU A  1 456 ? 29.858  15.362  103.346 1.00 12.21  ? 563  LEU A CD1 1 
ATOM   3477  C  CD2 . LEU A  1 456 ? 29.922  17.627  102.273 1.00 13.69  ? 563  LEU A CD2 1 
ATOM   3478  N  N   . THR A  1 457 ? 26.255  13.959  102.244 1.00 14.15  ? 564  THR A N   1 
ATOM   3479  C  CA  . THR A  1 457 ? 24.865  14.136  102.626 1.00 14.62  ? 564  THR A CA  1 
ATOM   3480  C  C   . THR A  1 457 ? 24.635  14.907  103.907 1.00 14.80  ? 564  THR A C   1 
ATOM   3481  O  O   . THR A  1 457 ? 23.532  15.384  104.149 1.00 15.96  ? 564  THR A O   1 
ATOM   3482  C  CB  . THR A  1 457 ? 24.199  12.779  102.759 1.00 14.87  ? 564  THR A CB  1 
ATOM   3483  O  OG1 . THR A  1 457 ? 24.873  12.032  103.773 1.00 16.22  ? 564  THR A OG1 1 
ATOM   3484  C  CG2 . THR A  1 457 ? 24.297  12.006  101.439 1.00 13.62  ? 564  THR A CG2 1 
ATOM   3485  N  N   . LYS A  1 458 ? 25.663  15.020  104.736 1.00 14.23  ? 565  LYS A N   1 
ATOM   3486  C  CA  . LYS A  1 458 ? 25.542  15.757  105.991 1.00 14.56  ? 565  LYS A CA  1 
ATOM   3487  C  C   . LYS A  1 458 ? 26.877  16.271  106.499 1.00 13.87  ? 565  LYS A C   1 
ATOM   3488  O  O   . LYS A  1 458 ? 27.888  15.579  106.445 1.00 13.52  ? 565  LYS A O   1 
ATOM   3489  C  CB  . LYS A  1 458 ? 24.907  14.897  107.088 1.00 14.95  ? 565  LYS A CB  1 
ATOM   3490  C  CG  . LYS A  1 458 ? 24.850  15.610  108.440 1.00 15.39  ? 565  LYS A CG  1 
ATOM   3491  C  CD  . LYS A  1 458 ? 23.887  14.945  109.426 1.00 16.95  ? 565  LYS A CD  1 
ATOM   3492  C  CE  . LYS A  1 458 ? 24.473  13.686  110.050 1.00 18.76  ? 565  LYS A CE  1 
ATOM   3493  N  NZ  . LYS A  1 458 ? 23.556  12.991  111.033 1.00 18.72  ? 565  LYS A NZ  1 
ATOM   3494  N  N   . PHE A  1 459 ? 26.866  17.500  106.990 1.00 13.44  ? 566  PHE A N   1 
ATOM   3495  C  CA  . PHE A  1 459 ? 28.052  18.126  107.534 1.00 12.77  ? 566  PHE A CA  1 
ATOM   3496  C  C   . PHE A  1 459 ? 27.623  18.996  108.695 1.00 12.87  ? 566  PHE A C   1 
ATOM   3497  O  O   . PHE A  1 459 ? 27.075  20.083  108.516 1.00 13.20  ? 566  PHE A O   1 
ATOM   3498  C  CB  . PHE A  1 459 ? 28.773  18.957  106.470 1.00 13.68  ? 566  PHE A CB  1 
ATOM   3499  C  CG  . PHE A  1 459 ? 29.844  19.879  107.018 1.00 14.27  ? 566  PHE A CG  1 
ATOM   3500  C  CD1 . PHE A  1 459 ? 30.523  19.576  108.193 1.00 13.14  ? 566  PHE A CD1 1 
ATOM   3501  C  CD2 . PHE A  1 459 ? 30.200  21.037  106.326 1.00 14.71  ? 566  PHE A CD2 1 
ATOM   3502  C  CE1 . PHE A  1 459 ? 31.533  20.402  108.669 1.00 12.79  ? 566  PHE A CE1 1 
ATOM   3503  C  CE2 . PHE A  1 459 ? 31.214  21.871  106.800 1.00 13.55  ? 566  PHE A CE2 1 
ATOM   3504  C  CZ  . PHE A  1 459 ? 31.878  21.549  107.972 1.00 13.02  ? 566  PHE A CZ  1 
ATOM   3505  N  N   . THR A  1 460 ? 27.852  18.484  109.895 1.00 12.43  ? 567  THR A N   1 
ATOM   3506  C  CA  . THR A  1 460 ? 27.517  19.212  111.104 1.00 12.94  ? 567  THR A CA  1 
ATOM   3507  C  C   . THR A  1 460 ? 28.815  19.627  111.775 1.00 13.34  ? 567  THR A C   1 
ATOM   3508  O  O   . THR A  1 460 ? 29.688  18.788  112.027 1.00 14.11  ? 567  THR A O   1 
ATOM   3509  C  CB  . THR A  1 460 ? 26.720  18.347  112.085 1.00 12.62  ? 567  THR A CB  1 
ATOM   3510  O  OG1 . THR A  1 460 ? 25.521  17.887  111.456 1.00 13.07  ? 567  THR A OG1 1 
ATOM   3511  C  CG2 . THR A  1 460 ? 26.346  19.149  113.300 1.00 12.21  ? 567  THR A CG2 1 
ATOM   3512  N  N   . LEU A  1 461 ? 28.948  20.922  112.036 1.00 12.56  ? 568  LEU A N   1 
ATOM   3513  C  CA  . LEU A  1 461 ? 30.135  21.454  112.689 1.00 11.71  ? 568  LEU A CA  1 
ATOM   3514  C  C   . LEU A  1 461 ? 29.801  21.591  114.163 1.00 12.37  ? 568  LEU A C   1 
ATOM   3515  O  O   . LEU A  1 461 ? 28.854  22.282  114.519 1.00 14.03  ? 568  LEU A O   1 
ATOM   3516  C  CB  . LEU A  1 461 ? 30.477  22.824  112.117 1.00 11.28  ? 568  LEU A CB  1 
ATOM   3517  C  CG  . LEU A  1 461 ? 31.777  23.496  112.552 1.00 10.53  ? 568  LEU A CG  1 
ATOM   3518  C  CD1 . LEU A  1 461 ? 32.959  22.750  112.017 1.00 6.74   ? 568  LEU A CD1 1 
ATOM   3519  C  CD2 . LEU A  1 461 ? 31.783  24.923  112.029 1.00 11.03  ? 568  LEU A CD2 1 
ATOM   3520  N  N   . VAL A  1 462 ? 30.543  20.905  115.022 1.00 12.39  ? 569  VAL A N   1 
ATOM   3521  C  CA  . VAL A  1 462 ? 30.307  21.012  116.456 1.00 12.20  ? 569  VAL A CA  1 
ATOM   3522  C  C   . VAL A  1 462 ? 31.514  21.705  117.072 1.00 12.97  ? 569  VAL A C   1 
ATOM   3523  O  O   . VAL A  1 462 ? 32.644  21.222  116.992 1.00 11.36  ? 569  VAL A O   1 
ATOM   3524  C  CB  . VAL A  1 462 ? 30.117  19.636  117.132 1.00 12.64  ? 569  VAL A CB  1 
ATOM   3525  C  CG1 . VAL A  1 462 ? 29.843  19.823  118.611 1.00 10.07  ? 569  VAL A CG1 1 
ATOM   3526  C  CG2 . VAL A  1 462 ? 28.958  18.892  116.492 1.00 12.13  ? 569  VAL A CG2 1 
ATOM   3527  N  N   . LEU A  1 463 ? 31.259  22.857  117.677 1.00 14.96  ? 570  LEU A N   1 
ATOM   3528  C  CA  . LEU A  1 463 ? 32.301  23.659  118.291 1.00 14.18  ? 570  LEU A CA  1 
ATOM   3529  C  C   . LEU A  1 463 ? 32.238  23.569  119.800 1.00 14.56  ? 570  LEU A C   1 
ATOM   3530  O  O   . LEU A  1 463 ? 31.185  23.767  120.402 1.00 15.21  ? 570  LEU A O   1 
ATOM   3531  C  CB  . LEU A  1 463 ? 32.136  25.117  117.878 1.00 12.47  ? 570  LEU A CB  1 
ATOM   3532  C  CG  . LEU A  1 463 ? 31.933  25.368  116.384 1.00 13.91  ? 570  LEU A CG  1 
ATOM   3533  C  CD1 . LEU A  1 463 ? 31.685  26.867  116.164 1.00 16.07  ? 570  LEU A CD1 1 
ATOM   3534  C  CD2 . LEU A  1 463 ? 33.147  24.907  115.587 1.00 12.10  ? 570  LEU A CD2 1 
ATOM   3535  N  N   . TYR A  1 464 ? 33.378  23.267  120.408 1.00 15.13  ? 571  TYR A N   1 
ATOM   3536  C  CA  . TYR A  1 464 ? 33.484  23.202  121.859 1.00 15.04  ? 571  TYR A CA  1 
ATOM   3537  C  C   . TYR A  1 464 ? 34.377  24.369  122.285 1.00 15.01  ? 571  TYR A C   1 
ATOM   3538  O  O   . TYR A  1 464 ? 35.349  24.679  121.604 1.00 14.35  ? 571  TYR A O   1 
ATOM   3539  C  CB  . TYR A  1 464 ? 34.131  21.891  122.275 1.00 15.12  ? 571  TYR A CB  1 
ATOM   3540  C  CG  . TYR A  1 464 ? 33.220  20.699  122.215 1.00 14.93  ? 571  TYR A CG  1 
ATOM   3541  C  CD1 . TYR A  1 464 ? 32.358  20.408  123.271 1.00 15.42  ? 571  TYR A CD1 1 
ATOM   3542  C  CD2 . TYR A  1 464 ? 33.249  19.834  121.128 1.00 15.09  ? 571  TYR A CD2 1 
ATOM   3543  C  CE1 . TYR A  1 464 ? 31.551  19.277  123.254 1.00 15.25  ? 571  TYR A CE1 1 
ATOM   3544  C  CE2 . TYR A  1 464 ? 32.449  18.698  121.096 1.00 15.13  ? 571  TYR A CE2 1 
ATOM   3545  C  CZ  . TYR A  1 464 ? 31.605  18.423  122.167 1.00 16.69  ? 571  TYR A CZ  1 
ATOM   3546  O  OH  . TYR A  1 464 ? 30.847  17.271  122.175 1.00 17.60  ? 571  TYR A OH  1 
ATOM   3547  N  N   . GLY A  1 465 ? 34.052  25.024  123.393 1.00 15.20  ? 572  GLY A N   1 
ATOM   3548  C  CA  . GLY A  1 465 ? 34.889  26.126  123.823 1.00 16.59  ? 572  GLY A CA  1 
ATOM   3549  C  C   . GLY A  1 465 ? 34.269  26.963  124.910 1.00 16.48  ? 572  GLY A C   1 
ATOM   3550  O  O   . GLY A  1 465 ? 33.357  26.520  125.591 1.00 15.84  ? 572  GLY A O   1 
ATOM   3551  N  N   . THR A  1 466 ? 34.763  28.186  125.055 1.00 18.28  ? 573  THR A N   1 
ATOM   3552  C  CA  . THR A  1 466 ? 34.271  29.115  126.073 1.00 19.32  ? 573  THR A CA  1 
ATOM   3553  C  C   . THR A  1 466 ? 34.070  30.519  125.490 1.00 20.41  ? 573  THR A C   1 
ATOM   3554  O  O   . THR A  1 466 ? 34.175  30.727  124.275 1.00 17.73  ? 573  THR A O   1 
ATOM   3555  C  CB  . THR A  1 466 ? 35.282  29.224  127.242 1.00 17.39  ? 573  THR A CB  1 
ATOM   3556  O  OG1 . THR A  1 466 ? 36.534  29.703  126.729 1.00 18.14  ? 573  THR A OG1 1 
ATOM   3557  C  CG2 . THR A  1 466 ? 35.507  27.866  127.912 1.00 15.71  ? 573  THR A CG2 1 
ATOM   3558  N  N   . ALA A  1 467 ? 33.785  31.471  126.380 1.00 25.22  ? 574  ALA A N   1 
ATOM   3559  C  CA  . ALA A  1 467 ? 33.609  32.882  126.021 1.00 29.48  ? 574  ALA A CA  1 
ATOM   3560  C  C   . ALA A  1 467 ? 34.431  33.762  126.981 1.00 33.35  ? 574  ALA A C   1 
ATOM   3561  O  O   . ALA A  1 467 ? 34.231  33.687  128.196 1.00 33.94  ? 574  ALA A O   1 
ATOM   3562  C  CB  . ALA A  1 467 ? 32.135  33.263  126.112 1.00 28.23  ? 574  ALA A CB  1 
ATOM   3563  N  N   . PRO A  1 468 ? 35.372  34.597  126.454 1.00 37.50  ? 575  PRO A N   1 
ATOM   3564  C  CA  . PRO A  1 468 ? 36.215  35.496  127.264 1.00 39.64  ? 575  PRO A CA  1 
ATOM   3565  C  C   . PRO A  1 468 ? 35.414  36.413  128.203 1.00 43.02  ? 575  PRO A C   1 
ATOM   3566  O  O   . PRO A  1 468 ? 34.895  37.469  127.811 1.00 43.37  ? 575  PRO A O   1 
ATOM   3567  C  CB  . PRO A  1 468 ? 37.016  36.273  126.214 0.00 39.41  ? 575  PRO A CB  1 
ATOM   3568  C  CG  . PRO A  1 468 ? 36.193  36.152  124.973 0.00 38.68  ? 575  PRO A CG  1 
ATOM   3569  C  CD  . PRO A  1 468 ? 35.746  34.722  125.041 0.00 37.73  ? 575  PRO A CD  1 
ATOM   3570  N  N   . GLU A  1 469 ? 35.332  35.961  129.452 1.00 46.35  ? 576  GLU A N   1 
ATOM   3571  C  CA  . GLU A  1 469 ? 34.636  36.622  130.551 1.00 48.15  ? 576  GLU A CA  1 
ATOM   3572  C  C   . GLU A  1 469 ? 35.623  37.492  131.328 1.00 47.96  ? 576  GLU A C   1 
ATOM   3573  O  O   . GLU A  1 469 ? 36.583  38.014  130.769 1.00 48.57  ? 576  GLU A O   1 
ATOM   3574  C  CB  . GLU A  1 469 ? 34.113  35.550  131.494 1.00 50.93  ? 576  GLU A CB  1 
ATOM   3575  C  CG  . GLU A  1 469 ? 35.245  34.655  131.992 1.00 53.38  ? 576  GLU A CG  1 
ATOM   3576  C  CD  . GLU A  1 469 ? 34.781  33.604  132.972 1.00 55.80  ? 576  GLU A CD  1 
ATOM   3577  O  OE1 . GLU A  1 469 ? 33.900  32.803  132.590 1.00 57.55  ? 576  GLU A OE1 1 
ATOM   3578  O  OE2 . GLU A  1 469 ? 35.297  33.578  134.113 1.00 56.03  ? 576  GLU A OE2 1 
ATOM   3579  N  N   . GLY A  1 470 ? 35.386  37.617  132.630 1.00 47.93  ? 577  GLY A N   1 
ATOM   3580  C  CA  . GLY A  1 470 ? 36.267  38.398  133.487 1.00 47.26  ? 577  GLY A CA  1 
ATOM   3581  C  C   . GLY A  1 470 ? 35.609  38.599  134.835 1.00 46.60  ? 577  GLY A C   1 
ATOM   3582  O  O   . GLY A  1 470 ? 36.172  38.249  135.880 1.00 45.42  ? 577  GLY A O   1 
ATOM   3583  N  N   . LEU A  1 471 ? 34.394  39.148  134.757 1.00 46.10  ? 578  LEU A N   1 
ATOM   3584  C  CA  . LEU A  1 471 ? 33.502  39.479  135.866 1.00 45.36  ? 578  LEU A CA  1 
ATOM   3585  C  C   . LEU A  1 471 ? 33.275  40.986  135.903 0.00 45.32  ? 578  LEU A C   1 
ATOM   3586  O  O   . LEU A  1 471 ? 33.784  41.643  136.832 0.00 45.25  ? 578  LEU A O   1 
ATOM   3587  C  CB  . LEU A  1 471 ? 34.041  38.985  137.209 0.00 45.17  ? 578  LEU A CB  1 
ATOM   3588  C  CG  . LEU A  1 471 ? 33.117  37.936  137.840 0.00 44.91  ? 578  LEU A CG  1 
ATOM   3589  C  CD1 . LEU A  1 471 ? 33.732  37.385  139.111 0.00 44.76  ? 578  LEU A CD1 1 
ATOM   3590  C  CD2 . LEU A  1 471 ? 31.759  38.565  138.125 0.00 44.76  ? 578  LEU A CD2 1 
ATOM   3591  O  OXT . LEU A  1 471 ? 32.595  41.494  134.984 0.00 45.21  ? 578  LEU A OXT 1 
ATOM   3592  N  N   . VAL B  1 2   ? -7.674  31.950  153.597 0.00 50.72  ? 109  VAL B N   1 
ATOM   3593  C  CA  . VAL B  1 2   ? -8.064  30.637  153.010 1.00 50.63  ? 109  VAL B CA  1 
ATOM   3594  C  C   . VAL B  1 2   ? -7.856  30.649  151.492 1.00 50.90  ? 109  VAL B C   1 
ATOM   3595  O  O   . VAL B  1 2   ? -8.633  31.272  150.761 1.00 51.66  ? 109  VAL B O   1 
ATOM   3596  C  CB  . VAL B  1 2   ? -9.547  30.313  153.300 0.00 50.63  ? 109  VAL B CB  1 
ATOM   3597  C  CG1 . VAL B  1 2   ? -9.912  28.963  152.705 0.00 50.52  ? 109  VAL B CG1 1 
ATOM   3598  C  CG2 . VAL B  1 2   ? -9.796  30.322  154.797 0.00 50.52  ? 109  VAL B CG2 1 
ATOM   3599  N  N   . TYR B  1 3   ? -6.808  29.961  151.031 1.00 49.97  ? 110  TYR B N   1 
ATOM   3600  C  CA  . TYR B  1 3   ? -6.473  29.874  149.603 1.00 48.25  ? 110  TYR B CA  1 
ATOM   3601  C  C   . TYR B  1 3   ? -7.714  29.852  148.714 1.00 47.32  ? 110  TYR B C   1 
ATOM   3602  O  O   . TYR B  1 3   ? -8.643  29.074  148.952 1.00 48.03  ? 110  TYR B O   1 
ATOM   3603  C  CB  . TYR B  1 3   ? -5.646  28.606  149.321 1.00 47.76  ? 110  TYR B CB  1 
ATOM   3604  C  CG  . TYR B  1 3   ? -5.492  28.301  147.845 1.00 45.84  ? 110  TYR B CG  1 
ATOM   3605  C  CD1 . TYR B  1 3   ? -4.626  29.045  147.050 1.00 45.36  ? 110  TYR B CD1 1 
ATOM   3606  C  CD2 . TYR B  1 3   ? -6.272  27.317  147.230 1.00 45.71  ? 110  TYR B CD2 1 
ATOM   3607  C  CE1 . TYR B  1 3   ? -4.540  28.828  145.685 1.00 45.26  ? 110  TYR B CE1 1 
ATOM   3608  C  CE2 . TYR B  1 3   ? -6.197  27.087  145.855 1.00 44.96  ? 110  TYR B CE2 1 
ATOM   3609  C  CZ  . TYR B  1 3   ? -5.328  27.851  145.090 1.00 45.40  ? 110  TYR B CZ  1 
ATOM   3610  O  OH  . TYR B  1 3   ? -5.248  27.659  143.724 1.00 45.07  ? 110  TYR B OH  1 
ATOM   3611  N  N   . GLN B  1 4   ? -7.726  30.694  147.688 1.00 45.18  ? 111  GLN B N   1 
ATOM   3612  C  CA  . GLN B  1 4   ? -8.866  30.742  146.786 1.00 43.75  ? 111  GLN B CA  1 
ATOM   3613  C  C   . GLN B  1 4   ? -8.538  30.143  145.417 1.00 42.25  ? 111  GLN B C   1 
ATOM   3614  O  O   . GLN B  1 4   ? -7.667  30.642  144.695 1.00 41.42  ? 111  GLN B O   1 
ATOM   3615  C  CB  . GLN B  1 4   ? -9.356  32.188  146.643 1.00 45.15  ? 111  GLN B CB  1 
ATOM   3616  C  CG  . GLN B  1 4   ? -10.000 32.738  147.913 1.00 45.97  ? 111  GLN B CG  1 
ATOM   3617  C  CD  . GLN B  1 4   ? -11.283 31.997  148.286 1.00 47.64  ? 111  GLN B CD  1 
ATOM   3618  O  OE1 . GLN B  1 4   ? -11.443 31.533  149.421 1.00 47.59  ? 111  GLN B OE1 1 
ATOM   3619  N  NE2 . GLN B  1 4   ? -12.206 31.888  147.330 1.00 47.28  ? 111  GLN B NE2 1 
ATOM   3620  N  N   . GLU B  1 5   ? -9.246  29.065  145.075 1.00 40.08  ? 112  GLU B N   1 
ATOM   3621  C  CA  . GLU B  1 5   ? -9.046  28.368  143.808 1.00 36.88  ? 112  GLU B CA  1 
ATOM   3622  C  C   . GLU B  1 5   ? -9.334  29.302  142.638 1.00 34.06  ? 112  GLU B C   1 
ATOM   3623  O  O   . GLU B  1 5   ? -10.000 30.323  142.804 1.00 33.22  ? 112  GLU B O   1 
ATOM   3624  C  CB  . GLU B  1 5   ? -9.947  27.131  143.740 1.00 37.53  ? 112  GLU B CB  1 
ATOM   3625  C  CG  . GLU B  1 5   ? -11.398 27.422  143.426 1.00 40.01  ? 112  GLU B CG  1 
ATOM   3626  C  CD  . GLU B  1 5   ? -12.279 26.178  143.482 1.00 41.84  ? 112  GLU B CD  1 
ATOM   3627  O  OE1 . GLU B  1 5   ? -13.447 26.267  143.032 1.00 43.32  ? 112  GLU B OE1 1 
ATOM   3628  O  OE2 . GLU B  1 5   ? -11.814 25.121  143.979 1.00 41.92  ? 112  GLU B OE2 1 
ATOM   3629  N  N   . PRO B  1 6   ? -8.820  28.966  141.441 1.00 31.85  ? 113  PRO B N   1 
ATOM   3630  C  CA  . PRO B  1 6   ? -8.983  29.738  140.204 1.00 29.80  ? 113  PRO B CA  1 
ATOM   3631  C  C   . PRO B  1 6   ? -10.425 30.086  139.879 1.00 28.32  ? 113  PRO B C   1 
ATOM   3632  O  O   . PRO B  1 6   ? -11.338 29.310  140.140 1.00 28.27  ? 113  PRO B O   1 
ATOM   3633  C  CB  . PRO B  1 6   ? -8.358  28.833  139.151 1.00 29.75  ? 113  PRO B CB  1 
ATOM   3634  C  CG  . PRO B  1 6   ? -7.265  28.173  139.911 1.00 31.06  ? 113  PRO B CG  1 
ATOM   3635  C  CD  . PRO B  1 6   ? -7.953  27.797  141.204 1.00 31.42  ? 113  PRO B CD  1 
ATOM   3636  N  N   . THR B  1 7   ? -10.615 31.261  139.296 1.00 26.98  ? 114  THR B N   1 
ATOM   3637  C  CA  . THR B  1 7   ? -11.941 31.738  138.939 1.00 26.71  ? 114  THR B CA  1 
ATOM   3638  C  C   . THR B  1 7   ? -12.156 31.655  137.435 1.00 26.41  ? 114  THR B C   1 
ATOM   3639  O  O   . THR B  1 7   ? -13.205 32.053  136.929 1.00 27.44  ? 114  THR B O   1 
ATOM   3640  C  CB  . THR B  1 7   ? -12.134 33.213  139.377 1.00 27.03  ? 114  THR B CB  1 
ATOM   3641  O  OG1 . THR B  1 7   ? -11.136 34.036  138.760 1.00 26.47  ? 114  THR B OG1 1 
ATOM   3642  C  CG2 . THR B  1 7   ? -12.004 33.340  140.882 1.00 26.37  ? 114  THR B CG2 1 
ATOM   3643  N  N   . ASP B  1 8   ? -11.160 31.140  136.725 1.00 25.55  ? 115  ASP B N   1 
ATOM   3644  C  CA  . ASP B  1 8   ? -11.243 31.026  135.278 1.00 25.10  ? 115  ASP B CA  1 
ATOM   3645  C  C   . ASP B  1 8   ? -12.494 30.263  134.864 1.00 25.02  ? 115  ASP B C   1 
ATOM   3646  O  O   . ASP B  1 8   ? -12.867 29.266  135.488 1.00 24.59  ? 115  ASP B O   1 
ATOM   3647  C  CB  . ASP B  1 8   ? -9.990  30.342  134.747 1.00 25.50  ? 115  ASP B CB  1 
ATOM   3648  C  CG  . ASP B  1 8   ? -8.720  31.028  135.219 1.00 26.17  ? 115  ASP B CG  1 
ATOM   3649  O  OD1 . ASP B  1 8   ? -8.079  31.738  134.403 1.00 26.36  ? 115  ASP B OD1 1 
ATOM   3650  O  OD2 . ASP B  1 8   ? -8.376  30.861  136.414 1.00 24.80  ? 115  ASP B OD2 1 
ATOM   3651  N  N   . PRO B  1 9   ? -13.150 30.718  133.787 1.00 24.09  ? 116  PRO B N   1 
ATOM   3652  C  CA  . PRO B  1 9   ? -14.375 30.117  133.254 1.00 24.50  ? 116  PRO B CA  1 
ATOM   3653  C  C   . PRO B  1 9   ? -14.384 28.601  133.024 1.00 25.62  ? 116  PRO B C   1 
ATOM   3654  O  O   . PRO B  1 9   ? -15.399 27.944  133.254 1.00 26.21  ? 116  PRO B O   1 
ATOM   3655  C  CB  . PRO B  1 9   ? -14.613 30.912  131.967 1.00 23.50  ? 116  PRO B CB  1 
ATOM   3656  C  CG  . PRO B  1 9   ? -13.233 31.318  131.558 1.00 23.25  ? 116  PRO B CG  1 
ATOM   3657  C  CD  . PRO B  1 9   ? -12.622 31.733  132.857 1.00 24.11  ? 116  PRO B CD  1 
ATOM   3658  N  N   . LYS B  1 10  ? -13.263 28.042  132.582 1.00 26.42  ? 117  LYS B N   1 
ATOM   3659  C  CA  . LYS B  1 10  ? -13.200 26.612  132.309 1.00 25.89  ? 117  LYS B CA  1 
ATOM   3660  C  C   . LYS B  1 10  ? -12.578 25.777  133.414 1.00 25.38  ? 117  LYS B C   1 
ATOM   3661  O  O   . LYS B  1 10  ? -12.479 24.560  133.293 1.00 26.74  ? 117  LYS B O   1 
ATOM   3662  C  CB  . LYS B  1 10  ? -12.439 26.367  131.003 1.00 26.86  ? 117  LYS B CB  1 
ATOM   3663  C  CG  . LYS B  1 10  ? -13.104 26.975  129.776 1.00 27.77  ? 117  LYS B CG  1 
ATOM   3664  C  CD  . LYS B  1 10  ? -14.494 26.395  129.589 1.00 30.54  ? 117  LYS B CD  1 
ATOM   3665  C  CE  . LYS B  1 10  ? -15.148 26.925  128.324 1.00 31.01  ? 117  LYS B CE  1 
ATOM   3666  N  NZ  . LYS B  1 10  ? -16.543 26.412  128.221 1.00 34.07  ? 117  LYS B NZ  1 
ATOM   3667  N  N   . PHE B  1 11  ? -12.156 26.412  134.499 1.00 25.76  ? 118  PHE B N   1 
ATOM   3668  C  CA  . PHE B  1 11  ? -11.550 25.653  135.585 1.00 24.93  ? 118  PHE B CA  1 
ATOM   3669  C  C   . PHE B  1 11  ? -12.468 24.544  136.086 1.00 25.66  ? 118  PHE B C   1 
ATOM   3670  O  O   . PHE B  1 11  ? -12.011 23.451  136.423 1.00 27.42  ? 118  PHE B O   1 
ATOM   3671  C  CB  . PHE B  1 11  ? -11.186 26.551  136.762 1.00 24.29  ? 118  PHE B CB  1 
ATOM   3672  C  CG  . PHE B  1 11  ? -10.584 25.797  137.912 1.00 22.53  ? 118  PHE B CG  1 
ATOM   3673  C  CD1 . PHE B  1 11  ? -9.375  25.134  137.764 1.00 21.98  ? 118  PHE B CD1 1 
ATOM   3674  C  CD2 . PHE B  1 11  ? -11.246 25.711  139.126 1.00 21.67  ? 118  PHE B CD2 1 
ATOM   3675  C  CE1 . PHE B  1 11  ? -8.840  24.383  138.807 1.00 22.19  ? 118  PHE B CE1 1 
ATOM   3676  C  CE2 . PHE B  1 11  ? -10.724 24.962  140.180 1.00 21.43  ? 118  PHE B CE2 1 
ATOM   3677  C  CZ  . PHE B  1 11  ? -9.515  24.300  140.020 1.00 21.94  ? 118  PHE B CZ  1 
ATOM   3678  N  N   . PRO B  1 12  ? -13.777 24.811  136.161 1.00 25.54  ? 119  PRO B N   1 
ATOM   3679  C  CA  . PRO B  1 12  ? -14.661 23.741  136.642 1.00 26.06  ? 119  PRO B CA  1 
ATOM   3680  C  C   . PRO B  1 12  ? -14.609 22.517  135.726 1.00 26.06  ? 119  PRO B C   1 
ATOM   3681  O  O   . PRO B  1 12  ? -14.792 21.387  136.177 1.00 26.62  ? 119  PRO B O   1 
ATOM   3682  C  CB  . PRO B  1 12  ? -16.034 24.406  136.647 1.00 25.78  ? 119  PRO B CB  1 
ATOM   3683  C  CG  . PRO B  1 12  ? -15.700 25.857  136.909 1.00 25.09  ? 119  PRO B CG  1 
ATOM   3684  C  CD  . PRO B  1 12  ? -14.513 26.080  136.010 1.00 25.08  ? 119  PRO B CD  1 
ATOM   3685  N  N   . GLN B  1 13  ? -14.344 22.756  134.445 1.00 25.91  ? 120  GLN B N   1 
ATOM   3686  C  CA  . GLN B  1 13  ? -14.266 21.695  133.448 1.00 26.94  ? 120  GLN B CA  1 
ATOM   3687  C  C   . GLN B  1 13  ? -12.951 20.909  133.541 1.00 26.28  ? 120  GLN B C   1 
ATOM   3688  O  O   . GLN B  1 13  ? -12.814 19.825  132.958 1.00 26.06  ? 120  GLN B O   1 
ATOM   3689  C  CB  . GLN B  1 13  ? -14.424 22.289  132.041 1.00 29.04  ? 120  GLN B CB  1 
ATOM   3690  C  CG  . GLN B  1 13  ? -15.851 22.741  131.678 1.00 34.34  ? 120  GLN B CG  1 
ATOM   3691  C  CD  . GLN B  1 13  ? -16.462 23.732  132.686 1.00 38.28  ? 120  GLN B CD  1 
ATOM   3692  O  OE1 . GLN B  1 13  ? -16.924 23.336  133.764 1.00 40.59  ? 120  GLN B OE1 1 
ATOM   3693  N  NE2 . GLN B  1 13  ? -16.464 25.026  132.336 1.00 39.49  ? 120  GLN B NE2 1 
ATOM   3694  N  N   . GLN B  1 14  ? -11.983 21.451  134.275 1.00 24.31  ? 121  GLN B N   1 
ATOM   3695  C  CA  . GLN B  1 14  ? -10.706 20.771  134.431 1.00 23.48  ? 121  GLN B CA  1 
ATOM   3696  C  C   . GLN B  1 14  ? -10.796 19.743  135.556 1.00 23.19  ? 121  GLN B C   1 
ATOM   3697  O  O   . GLN B  1 14  ? -10.124 19.835  136.584 1.00 23.46  ? 121  GLN B O   1 
ATOM   3698  C  CB  . GLN B  1 14  ? -9.599  21.798  134.683 1.00 23.64  ? 121  GLN B CB  1 
ATOM   3699  C  CG  . GLN B  1 14  ? -9.435  22.728  133.493 1.00 25.40  ? 121  GLN B CG  1 
ATOM   3700  C  CD  . GLN B  1 14  ? -8.265  23.668  133.608 1.00 25.01  ? 121  GLN B CD  1 
ATOM   3701  O  OE1 . GLN B  1 14  ? -8.282  24.599  134.401 1.00 25.70  ? 121  GLN B OE1 1 
ATOM   3702  N  NE2 . GLN B  1 14  ? -7.236  23.430  132.803 1.00 26.51  ? 121  GLN B NE2 1 
ATOM   3703  N  N   . TRP B  1 15  ? -11.641 18.747  135.317 1.00 22.25  ? 122  TRP B N   1 
ATOM   3704  C  CA  . TRP B  1 15  ? -11.910 17.671  136.256 1.00 21.44  ? 122  TRP B CA  1 
ATOM   3705  C  C   . TRP B  1 15  ? -10.680 16.992  136.822 1.00 22.46  ? 122  TRP B C   1 
ATOM   3706  O  O   . TRP B  1 15  ? -10.717 16.464  137.928 1.00 24.03  ? 122  TRP B O   1 
ATOM   3707  C  CB  . TRP B  1 15  ? -12.784 16.613  135.579 1.00 20.40  ? 122  TRP B CB  1 
ATOM   3708  C  CG  . TRP B  1 15  ? -12.192 16.095  134.310 1.00 19.09  ? 122  TRP B CG  1 
ATOM   3709  C  CD1 . TRP B  1 15  ? -12.283 16.658  133.068 1.00 18.77  ? 122  TRP B CD1 1 
ATOM   3710  C  CD2 . TRP B  1 15  ? -11.363 14.938  134.169 1.00 18.08  ? 122  TRP B CD2 1 
ATOM   3711  N  NE1 . TRP B  1 15  ? -11.557 15.919  132.159 1.00 19.17  ? 122  TRP B NE1 1 
ATOM   3712  C  CE2 . TRP B  1 15  ? -10.982 14.858  132.811 1.00 18.18  ? 122  TRP B CE2 1 
ATOM   3713  C  CE3 . TRP B  1 15  ? -10.900 13.961  135.060 1.00 16.76  ? 122  TRP B CE3 1 
ATOM   3714  C  CZ2 . TRP B  1 15  ? -10.158 13.836  132.323 1.00 17.95  ? 122  TRP B CZ2 1 
ATOM   3715  C  CZ3 . TRP B  1 15  ? -10.083 12.948  134.575 1.00 17.00  ? 122  TRP B CZ3 1 
ATOM   3716  C  CH2 . TRP B  1 15  ? -9.721  12.893  133.218 1.00 16.83  ? 122  TRP B CH2 1 
ATOM   3717  N  N   . TYR B  1 16  ? -9.593  16.997  136.064 1.00 23.60  ? 123  TYR B N   1 
ATOM   3718  C  CA  . TYR B  1 16  ? -8.359  16.336  136.484 1.00 23.83  ? 123  TYR B CA  1 
ATOM   3719  C  C   . TYR B  1 16  ? -7.513  17.121  137.475 1.00 24.93  ? 123  TYR B C   1 
ATOM   3720  O  O   . TYR B  1 16  ? -6.686  16.541  138.175 1.00 25.50  ? 123  TYR B O   1 
ATOM   3721  C  CB  . TYR B  1 16  ? -7.525  15.995  135.248 1.00 22.37  ? 123  TYR B CB  1 
ATOM   3722  C  CG  . TYR B  1 16  ? -7.474  17.139  134.272 1.00 20.85  ? 123  TYR B CG  1 
ATOM   3723  C  CD1 . TYR B  1 16  ? -6.468  18.101  134.345 1.00 21.37  ? 123  TYR B CD1 1 
ATOM   3724  C  CD2 . TYR B  1 16  ? -8.479  17.305  133.322 1.00 19.39  ? 123  TYR B CD2 1 
ATOM   3725  C  CE1 . TYR B  1 16  ? -6.469  19.207  133.496 1.00 19.11  ? 123  TYR B CE1 1 
ATOM   3726  C  CE2 . TYR B  1 16  ? -8.489  18.402  132.467 1.00 18.45  ? 123  TYR B CE2 1 
ATOM   3727  C  CZ  . TYR B  1 16  ? -7.482  19.348  132.562 1.00 19.37  ? 123  TYR B CZ  1 
ATOM   3728  O  OH  . TYR B  1 16  ? -7.488  20.434  131.720 1.00 20.35  ? 123  TYR B OH  1 
ATOM   3729  N  N   . LEU B  1 17  ? -7.685  18.435  137.532 1.00 26.10  ? 124  LEU B N   1 
ATOM   3730  C  CA  . LEU B  1 17  ? -6.911  19.225  138.477 1.00 26.90  ? 124  LEU B CA  1 
ATOM   3731  C  C   . LEU B  1 17  ? -7.550  19.088  139.851 1.00 29.59  ? 124  LEU B C   1 
ATOM   3732  O  O   . LEU B  1 17  ? -6.870  18.891  140.866 1.00 30.76  ? 124  LEU B O   1 
ATOM   3733  C  CB  . LEU B  1 17  ? -6.883  20.685  138.040 1.00 24.35  ? 124  LEU B CB  1 
ATOM   3734  C  CG  . LEU B  1 17  ? -6.260  20.895  136.665 1.00 21.86  ? 124  LEU B CG  1 
ATOM   3735  C  CD1 . LEU B  1 17  ? -6.088  22.374  136.398 1.00 20.38  ? 124  LEU B CD1 1 
ATOM   3736  C  CD2 . LEU B  1 17  ? -4.923  20.188  136.609 1.00 20.49  ? 124  LEU B CD2 1 
ATOM   3737  N  N   . SER B  1 18  ? -8.872  19.177  139.870 1.00 32.61  ? 125  SER B N   1 
ATOM   3738  C  CA  . SER B  1 18  ? -9.647  19.055  141.099 1.00 35.32  ? 125  SER B CA  1 
ATOM   3739  C  C   . SER B  1 18  ? -11.115 18.992  140.689 1.00 37.79  ? 125  SER B C   1 
ATOM   3740  O  O   . SER B  1 18  ? -11.575 19.810  139.878 1.00 39.38  ? 125  SER B O   1 
ATOM   3741  C  CB  . SER B  1 18  ? -9.400  20.270  142.002 1.00 34.39  ? 125  SER B CB  1 
ATOM   3742  O  OG  . SER B  1 18  ? -10.136 20.177  143.209 1.00 34.63  ? 125  SER B OG  1 
ATOM   3743  N  N   . GLY B  1 19  ? -11.847 18.019  141.222 1.00 39.30  ? 126  GLY B N   1 
ATOM   3744  C  CA  . GLY B  1 19  ? -13.255 17.910  140.873 1.00 43.05  ? 126  GLY B CA  1 
ATOM   3745  C  C   . GLY B  1 19  ? -14.086 17.114  141.866 1.00 45.09  ? 126  GLY B C   1 
ATOM   3746  O  O   . GLY B  1 19  ? -15.016 16.391  141.467 1.00 45.41  ? 126  GLY B O   1 
ATOM   3747  N  N   . VAL B  1 20  ? -13.779 17.260  143.157 1.00 46.16  ? 127  VAL B N   1 
ATOM   3748  C  CA  . VAL B  1 20  ? -14.486 16.508  144.189 1.00 46.82  ? 127  VAL B CA  1 
ATOM   3749  C  C   . VAL B  1 20  ? -14.186 15.095  143.737 0.00 46.84  ? 127  VAL B C   1 
ATOM   3750  O  O   . VAL B  1 20  ? -13.292 14.897  142.913 0.00 46.94  ? 127  VAL B O   1 
ATOM   3751  C  CB  . VAL B  1 20  ? -16.008 16.765  144.147 0.00 46.75  ? 127  VAL B CB  1 
ATOM   3752  C  CG1 . VAL B  1 20  ? -16.682 16.101  145.336 0.00 46.85  ? 127  VAL B CG1 1 
ATOM   3753  C  CG2 . VAL B  1 20  ? -16.282 18.260  144.146 0.00 46.85  ? 127  VAL B CG2 1 
ATOM   3754  N  N   . THR B  1 21  ? -14.908 14.111  144.252 0.00 47.03  ? 128  THR B N   1 
ATOM   3755  C  CA  . THR B  1 21  ? -14.648 12.744  143.836 1.00 47.10  ? 128  THR B CA  1 
ATOM   3756  C  C   . THR B  1 21  ? -13.237 12.371  144.289 1.00 47.69  ? 128  THR B C   1 
ATOM   3757  O  O   . THR B  1 21  ? -12.922 11.185  144.476 1.00 48.05  ? 128  THR B O   1 
ATOM   3758  C  CB  . THR B  1 21  ? -14.702 12.618  142.295 1.00 47.00  ? 128  THR B CB  1 
ATOM   3759  O  OG1 . THR B  1 21  ? -15.839 13.331  141.799 1.00 47.18  ? 128  THR B OG1 1 
ATOM   3760  C  CG2 . THR B  1 21  ? -14.803 11.167  141.874 1.00 46.73  ? 128  THR B CG2 1 
ATOM   3761  N  N   . GLN B  1 22  ? -12.394 13.391  144.473 1.00 47.21  ? 129  GLN B N   1 
ATOM   3762  C  CA  . GLN B  1 22  ? -11.008 13.186  144.881 1.00 45.46  ? 129  GLN B CA  1 
ATOM   3763  C  C   . GLN B  1 22  ? -10.421 12.158  143.902 1.00 44.08  ? 129  GLN B C   1 
ATOM   3764  O  O   . GLN B  1 22  ? -9.696  11.232  144.290 1.00 44.27  ? 129  GLN B O   1 
ATOM   3765  C  CB  . GLN B  1 22  ? -10.955 12.670  146.327 1.00 45.96  ? 129  GLN B CB  1 
ATOM   3766  C  CG  . GLN B  1 22  ? -11.629 13.578  147.348 0.00 45.52  ? 129  GLN B CG  1 
ATOM   3767  C  CD  . GLN B  1 22  ? -10.932 14.916  147.500 0.00 45.44  ? 129  GLN B CD  1 
ATOM   3768  O  OE1 . GLN B  1 22  ? -9.754  14.978  147.851 0.00 45.26  ? 129  GLN B OE1 1 
ATOM   3769  N  NE2 . GLN B  1 22  ? -11.659 15.996  147.238 0.00 45.26  ? 129  GLN B NE2 1 
ATOM   3770  N  N   . ARG B  1 23  ? -10.770 12.343  142.626 1.00 41.64  ? 130  ARG B N   1 
ATOM   3771  C  CA  . ARG B  1 23  ? -10.338 11.480  141.524 1.00 38.66  ? 130  ARG B CA  1 
ATOM   3772  C  C   . ARG B  1 23  ? -9.592  12.375  140.536 1.00 35.45  ? 130  ARG B C   1 
ATOM   3773  O  O   . ARG B  1 23  ? -10.031 12.582  139.404 1.00 34.01  ? 130  ARG B O   1 
ATOM   3774  C  CB  . ARG B  1 23  ? -11.568 10.889  140.840 1.00 41.40  ? 130  ARG B CB  1 
ATOM   3775  C  CG  . ARG B  1 23  ? -11.327 9.586   140.143 1.00 44.17  ? 130  ARG B CG  1 
ATOM   3776  C  CD  . ARG B  1 23  ? -11.961 8.465   140.926 1.00 45.56  ? 130  ARG B CD  1 
ATOM   3777  N  NE  . ARG B  1 23  ? -11.562 8.506   142.325 1.00 48.33  ? 130  ARG B NE  1 
ATOM   3778  C  CZ  . ARG B  1 23  ? -12.003 7.651   143.243 1.00 50.60  ? 130  ARG B CZ  1 
ATOM   3779  N  NH1 . ARG B  1 23  ? -12.858 6.685   142.903 1.00 51.20  ? 130  ARG B NH1 1 
ATOM   3780  N  NH2 . ARG B  1 23  ? -11.606 7.769   144.502 1.00 51.14  ? 130  ARG B NH2 1 
ATOM   3781  N  N   . ASP B  1 24  ? -8.459  12.906  140.974 1.00 31.99  ? 131  ASP B N   1 
ATOM   3782  C  CA  . ASP B  1 24  ? -7.695  13.816  140.146 1.00 27.96  ? 131  ASP B CA  1 
ATOM   3783  C  C   . ASP B  1 24  ? -6.223  13.809  140.520 1.00 25.04  ? 131  ASP B C   1 
ATOM   3784  O  O   . ASP B  1 24  ? -5.756  12.914  141.221 1.00 23.25  ? 131  ASP B O   1 
ATOM   3785  C  CB  . ASP B  1 24  ? -8.266  15.225  140.302 1.00 28.84  ? 131  ASP B CB  1 
ATOM   3786  C  CG  . ASP B  1 24  ? -8.592  15.559  141.753 1.00 30.02  ? 131  ASP B CG  1 
ATOM   3787  O  OD1 . ASP B  1 24  ? -7.750  15.266  142.639 1.00 29.16  ? 131  ASP B OD1 1 
ATOM   3788  O  OD2 . ASP B  1 24  ? -9.687  16.115  142.007 1.00 30.36  ? 131  ASP B OD2 1 
ATOM   3789  N  N   . LEU B  1 25  ? -5.503  14.824  140.057 1.00 22.10  ? 132  LEU B N   1 
ATOM   3790  C  CA  . LEU B  1 25  ? -4.073  14.929  140.304 1.00 21.17  ? 132  LEU B CA  1 
ATOM   3791  C  C   . LEU B  1 25  ? -3.694  15.580  141.633 1.00 21.67  ? 132  LEU B C   1 
ATOM   3792  O  O   . LEU B  1 25  ? -2.509  15.791  141.919 1.00 21.25  ? 132  LEU B O   1 
ATOM   3793  C  CB  . LEU B  1 25  ? -3.427  15.677  139.142 1.00 18.93  ? 132  LEU B CB  1 
ATOM   3794  C  CG  . LEU B  1 25  ? -3.639  14.944  137.820 1.00 16.03  ? 132  LEU B CG  1 
ATOM   3795  C  CD1 . LEU B  1 25  ? -3.255  15.843  136.671 1.00 14.86  ? 132  LEU B CD1 1 
ATOM   3796  C  CD2 . LEU B  1 25  ? -2.827  13.662  137.818 1.00 15.43  ? 132  LEU B CD2 1 
ATOM   3797  N  N   . ASN B  1 26  ? -4.705  15.893  142.438 1.00 22.18  ? 133  ASN B N   1 
ATOM   3798  C  CA  . ASN B  1 26  ? -4.500  16.492  143.751 1.00 22.02  ? 133  ASN B CA  1 
ATOM   3799  C  C   . ASN B  1 26  ? -3.561  17.682  143.712 1.00 21.99  ? 133  ASN B C   1 
ATOM   3800  O  O   . ASN B  1 26  ? -2.618  17.758  144.497 1.00 21.57  ? 133  ASN B O   1 
ATOM   3801  C  CB  . ASN B  1 26  ? -3.959  15.437  144.713 1.00 22.42  ? 133  ASN B CB  1 
ATOM   3802  C  CG  . ASN B  1 26  ? -3.935  15.917  146.149 1.00 23.64  ? 133  ASN B CG  1 
ATOM   3803  O  OD1 . ASN B  1 26  ? -4.828  16.652  146.578 1.00 23.28  ? 133  ASN B OD1 1 
ATOM   3804  N  ND2 . ASN B  1 26  ? -2.924  15.487  146.910 1.00 21.71  ? 133  ASN B ND2 1 
ATOM   3805  N  N   . VAL B  1 27  ? -3.844  18.601  142.791 1.00 22.88  ? 134  VAL B N   1 
ATOM   3806  C  CA  . VAL B  1 27  ? -3.078  19.824  142.571 1.00 23.73  ? 134  VAL B CA  1 
ATOM   3807  C  C   . VAL B  1 27  ? -3.485  20.935  143.550 1.00 25.00  ? 134  VAL B C   1 
ATOM   3808  O  O   . VAL B  1 27  ? -2.639  21.667  144.069 1.00 25.90  ? 134  VAL B O   1 
ATOM   3809  C  CB  . VAL B  1 27  ? -3.310  20.299  141.120 1.00 22.20  ? 134  VAL B CB  1 
ATOM   3810  C  CG1 . VAL B  1 27  ? -2.703  21.638  140.903 1.00 23.85  ? 134  VAL B CG1 1 
ATOM   3811  C  CG2 . VAL B  1 27  ? -2.711  19.303  140.159 1.00 21.92  ? 134  VAL B CG2 1 
ATOM   3812  N  N   . LYS B  1 28  ? -4.787  21.062  143.790 1.00 26.73  ? 135  LYS B N   1 
ATOM   3813  C  CA  . LYS B  1 28  ? -5.301  22.080  144.706 1.00 28.21  ? 135  LYS B CA  1 
ATOM   3814  C  C   . LYS B  1 28  ? -4.562  22.051  146.035 1.00 28.51  ? 135  LYS B C   1 
ATOM   3815  O  O   . LYS B  1 28  ? -4.267  23.091  146.616 1.00 28.41  ? 135  LYS B O   1 
ATOM   3816  C  CB  . LYS B  1 28  ? -6.796  21.877  144.979 1.00 28.90  ? 135  LYS B CB  1 
ATOM   3817  C  CG  . LYS B  1 28  ? -7.695  22.956  144.390 1.00 31.60  ? 135  LYS B CG  1 
ATOM   3818  C  CD  . LYS B  1 28  ? -9.142  22.863  144.886 1.00 33.29  ? 135  LYS B CD  1 
ATOM   3819  C  CE  . LYS B  1 28  ? -9.302  23.370  146.319 1.00 34.50  ? 135  LYS B CE  1 
ATOM   3820  N  NZ  . LYS B  1 28  ? -10.709 23.257  146.795 0.00 34.14  ? 135  LYS B NZ  1 
ATOM   3821  N  N   . GLU B  1 29  ? -4.260  20.854  146.511 1.00 29.23  ? 136  GLU B N   1 
ATOM   3822  C  CA  . GLU B  1 29  ? -3.559  20.712  147.773 1.00 30.64  ? 136  GLU B CA  1 
ATOM   3823  C  C   . GLU B  1 29  ? -2.171  21.343  147.715 1.00 29.81  ? 136  GLU B C   1 
ATOM   3824  O  O   . GLU B  1 29  ? -1.682  21.881  148.704 1.00 31.24  ? 136  GLU B O   1 
ATOM   3825  C  CB  . GLU B  1 29  ? -3.435  19.242  148.129 1.00 33.34  ? 136  GLU B CB  1 
ATOM   3826  C  CG  . GLU B  1 29  ? -3.220  19.015  149.597 1.00 38.22  ? 136  GLU B CG  1 
ATOM   3827  C  CD  . GLU B  1 29  ? -2.861  17.584  149.893 1.00 40.72  ? 136  GLU B CD  1 
ATOM   3828  O  OE1 . GLU B  1 29  ? -1.646  17.280  149.873 1.00 41.15  ? 136  GLU B OE1 1 
ATOM   3829  O  OE2 . GLU B  1 29  ? -3.798  16.772  150.125 1.00 42.62  ? 136  GLU B OE2 1 
ATOM   3830  N  N   . ALA B  1 30  ? -1.536  21.274  146.553 1.00 28.61  ? 137  ALA B N   1 
ATOM   3831  C  CA  . ALA B  1 30  ? -0.214  21.853  146.378 1.00 26.84  ? 137  ALA B CA  1 
ATOM   3832  C  C   . ALA B  1 30  ? -0.335  23.371  146.306 1.00 26.31  ? 137  ALA B C   1 
ATOM   3833  O  O   . ALA B  1 30  ? 0.464   24.097  146.899 1.00 26.57  ? 137  ALA B O   1 
ATOM   3834  C  CB  . ALA B  1 30  ? 0.424   21.310  145.104 1.00 25.45  ? 137  ALA B CB  1 
ATOM   3835  N  N   . TRP B  1 31  ? -1.338  23.847  145.575 1.00 26.31  ? 138  TRP B N   1 
ATOM   3836  C  CA  . TRP B  1 31  ? -1.554  25.280  145.435 1.00 26.28  ? 138  TRP B CA  1 
ATOM   3837  C  C   . TRP B  1 31  ? -1.793  25.907  146.806 1.00 27.66  ? 138  TRP B C   1 
ATOM   3838  O  O   . TRP B  1 31  ? -1.219  26.948  147.140 1.00 28.44  ? 138  TRP B O   1 
ATOM   3839  C  CB  . TRP B  1 31  ? -2.759  25.559  144.540 1.00 24.08  ? 138  TRP B CB  1 
ATOM   3840  C  CG  . TRP B  1 31  ? -2.594  25.138  143.114 1.00 22.86  ? 138  TRP B CG  1 
ATOM   3841  C  CD1 . TRP B  1 31  ? -1.421  24.967  142.437 1.00 21.81  ? 138  TRP B CD1 1 
ATOM   3842  C  CD2 . TRP B  1 31  ? -3.642  24.949  142.149 1.00 21.30  ? 138  TRP B CD2 1 
ATOM   3843  N  NE1 . TRP B  1 31  ? -1.674  24.695  141.110 1.00 21.25  ? 138  TRP B NE1 1 
ATOM   3844  C  CE2 . TRP B  1 31  ? -3.026  24.679  140.908 1.00 20.08  ? 138  TRP B CE2 1 
ATOM   3845  C  CE3 . TRP B  1 31  ? -5.041  24.988  142.215 1.00 19.16  ? 138  TRP B CE3 1 
ATOM   3846  C  CZ2 . TRP B  1 31  ? -3.758  24.451  139.744 1.00 20.56  ? 138  TRP B CZ2 1 
ATOM   3847  C  CZ3 . TRP B  1 31  ? -5.770  24.761  141.053 1.00 19.27  ? 138  TRP B CZ3 1 
ATOM   3848  C  CH2 . TRP B  1 31  ? -5.127  24.496  139.835 1.00 19.47  ? 138  TRP B CH2 1 
ATOM   3849  N  N   . ALA B  1 32  ? -2.638  25.265  147.601 1.00 28.02  ? 139  ALA B N   1 
ATOM   3850  C  CA  . ALA B  1 32  ? -2.955  25.767  148.929 1.00 28.77  ? 139  ALA B CA  1 
ATOM   3851  C  C   . ALA B  1 32  ? -1.699  25.943  149.779 1.00 29.67  ? 139  ALA B C   1 
ATOM   3852  O  O   . ALA B  1 32  ? -1.619  26.883  150.579 1.00 30.38  ? 139  ALA B O   1 
ATOM   3853  C  CB  . ALA B  1 32  ? -3.919  24.825  149.622 1.00 28.95  ? 139  ALA B CB  1 
ATOM   3854  N  N   . GLN B  1 33  ? -0.731  25.038  149.621 1.00 29.46  ? 140  GLN B N   1 
ATOM   3855  C  CA  . GLN B  1 33  ? 0.526   25.123  150.376 1.00 29.65  ? 140  GLN B CA  1 
ATOM   3856  C  C   . GLN B  1 33  ? 1.418   26.246  149.827 1.00 28.73  ? 140  GLN B C   1 
ATOM   3857  O  O   . GLN B  1 33  ? 2.536   26.437  150.305 1.00 28.96  ? 140  GLN B O   1 
ATOM   3858  C  CB  . GLN B  1 33  ? 1.328   23.803  150.312 1.00 30.70  ? 140  GLN B CB  1 
ATOM   3859  C  CG  . GLN B  1 33  ? 0.786   22.612  151.108 1.00 32.35  ? 140  GLN B CG  1 
ATOM   3860  C  CD  . GLN B  1 33  ? 1.794   21.435  151.189 1.00 36.26  ? 140  GLN B CD  1 
ATOM   3861  O  OE1 . GLN B  1 33  ? 2.907   21.570  151.744 1.00 34.63  ? 140  GLN B OE1 1 
ATOM   3862  N  NE2 . GLN B  1 33  ? 1.403   20.275  150.636 1.00 35.57  ? 140  GLN B NE2 1 
ATOM   3863  N  N   . GLY B  1 34  ? 0.941   26.969  148.817 1.00 26.88  ? 141  GLY B N   1 
ATOM   3864  C  CA  . GLY B  1 34  ? 1.732   28.050  148.261 1.00 26.16  ? 141  GLY B CA  1 
ATOM   3865  C  C   . GLY B  1 34  ? 2.606   27.691  147.064 1.00 26.44  ? 141  GLY B C   1 
ATOM   3866  O  O   . GLY B  1 34  ? 3.463   28.481  146.648 1.00 27.67  ? 141  GLY B O   1 
ATOM   3867  N  N   . PHE B  1 35  ? 2.395   26.514  146.487 1.00 25.19  ? 142  PHE B N   1 
ATOM   3868  C  CA  . PHE B  1 35  ? 3.187   26.097  145.336 1.00 23.35  ? 142  PHE B CA  1 
ATOM   3869  C  C   . PHE B  1 35  ? 2.390   26.137  144.044 1.00 23.05  ? 142  PHE B C   1 
ATOM   3870  O  O   . PHE B  1 35  ? 1.481   25.335  143.841 1.00 24.01  ? 142  PHE B O   1 
ATOM   3871  C  CB  . PHE B  1 35  ? 3.736   24.705  145.590 1.00 22.98  ? 142  PHE B CB  1 
ATOM   3872  C  CG  . PHE B  1 35  ? 4.593   24.626  146.817 1.00 20.99  ? 142  PHE B CG  1 
ATOM   3873  C  CD1 . PHE B  1 35  ? 5.784   25.337  146.889 1.00 20.14  ? 142  PHE B CD1 1 
ATOM   3874  C  CD2 . PHE B  1 35  ? 4.187   23.892  147.920 1.00 19.79  ? 142  PHE B CD2 1 
ATOM   3875  C  CE1 . PHE B  1 35  ? 6.559   25.316  148.042 1.00 19.02  ? 142  PHE B CE1 1 
ATOM   3876  C  CE2 . PHE B  1 35  ? 4.959   23.866  149.078 1.00 18.93  ? 142  PHE B CE2 1 
ATOM   3877  C  CZ  . PHE B  1 35  ? 6.148   24.586  149.135 1.00 17.96  ? 142  PHE B CZ  1 
ATOM   3878  N  N   . THR B  1 36  ? 2.752   27.075  143.172 1.00 22.98  ? 143  THR B N   1 
ATOM   3879  C  CA  . THR B  1 36  ? 2.070   27.271  141.901 1.00 21.96  ? 143  THR B CA  1 
ATOM   3880  C  C   . THR B  1 36  ? 3.028   27.424  140.720 1.00 22.36  ? 143  THR B C   1 
ATOM   3881  O  O   . THR B  1 36  ? 2.600   27.715  139.606 1.00 21.05  ? 143  THR B O   1 
ATOM   3882  C  CB  . THR B  1 36  ? 1.179   28.525  141.965 1.00 22.30  ? 143  THR B CB  1 
ATOM   3883  O  OG1 . THR B  1 36  ? 1.985   29.656  142.320 1.00 21.76  ? 143  THR B OG1 1 
ATOM   3884  C  CG2 . THR B  1 36  ? 0.068   28.348  143.005 1.00 19.93  ? 143  THR B CG2 1 
ATOM   3885  N  N   . GLY B  1 37  ? 4.323   27.255  140.971 1.00 23.27  ? 144  GLY B N   1 
ATOM   3886  C  CA  . GLY B  1 37  ? 5.287   27.367  139.893 1.00 24.11  ? 144  GLY B CA  1 
ATOM   3887  C  C   . GLY B  1 37  ? 6.182   28.590  139.880 1.00 25.07  ? 144  GLY B C   1 
ATOM   3888  O  O   . GLY B  1 37  ? 7.018   28.705  138.979 1.00 26.11  ? 144  GLY B O   1 
ATOM   3889  N  N   . HIS B  1 38  ? 6.018   29.495  140.849 1.00 24.73  ? 145  HIS B N   1 
ATOM   3890  C  CA  . HIS B  1 38  ? 6.842   30.709  140.941 1.00 25.32  ? 145  HIS B CA  1 
ATOM   3891  C  C   . HIS B  1 38  ? 8.318   30.395  140.766 1.00 23.85  ? 145  HIS B C   1 
ATOM   3892  O  O   . HIS B  1 38  ? 8.846   29.512  141.427 1.00 24.75  ? 145  HIS B O   1 
ATOM   3893  C  CB  . HIS B  1 38  ? 6.705   31.378  142.315 1.00 28.74  ? 145  HIS B CB  1 
ATOM   3894  C  CG  . HIS B  1 38  ? 5.436   32.148  142.512 1.00 32.14  ? 145  HIS B CG  1 
ATOM   3895  N  ND1 . HIS B  1 38  ? 5.105   33.252  141.751 1.00 34.23  ? 145  HIS B ND1 1 
ATOM   3896  C  CD2 . HIS B  1 38  ? 4.438   32.005  143.420 1.00 32.75  ? 145  HIS B CD2 1 
ATOM   3897  C  CE1 . HIS B  1 38  ? 3.960   33.756  142.183 1.00 34.47  ? 145  HIS B CE1 1 
ATOM   3898  N  NE2 . HIS B  1 38  ? 3.535   33.018  143.195 1.00 34.31  ? 145  HIS B NE2 1 
ATOM   3899  N  N   . GLY B  1 39  ? 8.988   31.126  139.891 1.00 22.86  ? 146  GLY B N   1 
ATOM   3900  C  CA  . GLY B  1 39  ? 10.406  30.907  139.696 1.00 21.94  ? 146  GLY B CA  1 
ATOM   3901  C  C   . GLY B  1 39  ? 10.826  29.697  138.889 1.00 21.79  ? 146  GLY B C   1 
ATOM   3902  O  O   . GLY B  1 39  ? 12.022  29.480  138.679 1.00 22.89  ? 146  GLY B O   1 
ATOM   3903  N  N   . ILE B  1 40  ? 9.872   28.899  138.429 1.00 21.29  ? 147  ILE B N   1 
ATOM   3904  C  CA  . ILE B  1 40  ? 10.223  27.724  137.639 1.00 19.86  ? 147  ILE B CA  1 
ATOM   3905  C  C   . ILE B  1 40  ? 9.986   27.982  136.154 1.00 18.79  ? 147  ILE B C   1 
ATOM   3906  O  O   . ILE B  1 40  ? 9.018   28.643  135.770 1.00 17.70  ? 147  ILE B O   1 
ATOM   3907  C  CB  . ILE B  1 40  ? 9.429   26.490  138.107 1.00 20.82  ? 147  ILE B CB  1 
ATOM   3908  C  CG1 . ILE B  1 40  ? 9.643   26.290  139.615 1.00 19.98  ? 147  ILE B CG1 1 
ATOM   3909  C  CG2 . ILE B  1 40  ? 9.883   25.250  137.346 1.00 19.93  ? 147  ILE B CG2 1 
ATOM   3910  C  CD1 . ILE B  1 40  ? 11.102  26.184  140.018 1.00 17.56  ? 147  ILE B CD1 1 
ATOM   3911  N  N   . VAL B  1 41  ? 10.893  27.473  135.328 1.00 17.64  ? 148  VAL B N   1 
ATOM   3912  C  CA  . VAL B  1 41  ? 10.808  27.660  133.889 1.00 16.93  ? 148  VAL B CA  1 
ATOM   3913  C  C   . VAL B  1 41  ? 10.610  26.335  133.180 1.00 16.60  ? 148  VAL B C   1 
ATOM   3914  O  O   . VAL B  1 41  ? 11.370  25.392  133.392 1.00 18.23  ? 148  VAL B O   1 
ATOM   3915  C  CB  . VAL B  1 41  ? 12.089  28.338  133.349 1.00 17.45  ? 148  VAL B CB  1 
ATOM   3916  C  CG1 . VAL B  1 41  ? 12.031  28.450  131.826 1.00 16.16  ? 148  VAL B CG1 1 
ATOM   3917  C  CG2 . VAL B  1 41  ? 12.229  29.729  133.970 1.00 16.68  ? 148  VAL B CG2 1 
ATOM   3918  N  N   . VAL B  1 42  ? 9.584   26.268  132.335 1.00 15.97  ? 149  VAL B N   1 
ATOM   3919  C  CA  . VAL B  1 42  ? 9.277   25.052  131.590 1.00 14.44  ? 149  VAL B CA  1 
ATOM   3920  C  C   . VAL B  1 42  ? 9.241   25.332  130.097 1.00 14.25  ? 149  VAL B C   1 
ATOM   3921  O  O   . VAL B  1 42  ? 8.690   26.335  129.652 1.00 13.61  ? 149  VAL B O   1 
ATOM   3922  C  CB  . VAL B  1 42  ? 7.916   24.470  132.013 1.00 14.16  ? 149  VAL B CB  1 
ATOM   3923  C  CG1 . VAL B  1 42  ? 7.621   23.200  131.222 1.00 13.87  ? 149  VAL B CG1 1 
ATOM   3924  C  CG2 . VAL B  1 42  ? 7.928   24.169  133.491 1.00 12.60  ? 149  VAL B CG2 1 
ATOM   3925  N  N   . SER B  1 43  ? 9.836   24.441  129.319 1.00 14.93  ? 150  SER B N   1 
ATOM   3926  C  CA  . SER B  1 43  ? 9.859   24.613  127.876 1.00 14.56  ? 150  SER B CA  1 
ATOM   3927  C  C   . SER B  1 43  ? 9.193   23.435  127.163 1.00 14.63  ? 150  SER B C   1 
ATOM   3928  O  O   . SER B  1 43  ? 9.423   22.273  127.511 1.00 14.47  ? 150  SER B O   1 
ATOM   3929  C  CB  . SER B  1 43  ? 11.299  24.760  127.401 1.00 14.12  ? 150  SER B CB  1 
ATOM   3930  O  OG  . SER B  1 43  ? 11.334  25.101  126.028 1.00 18.24  ? 150  SER B OG  1 
ATOM   3931  N  N   . ILE B  1 44  ? 8.363   23.745  126.172 1.00 13.59  ? 151  ILE B N   1 
ATOM   3932  C  CA  . ILE B  1 44  ? 7.664   22.725  125.398 1.00 12.95  ? 151  ILE B CA  1 
ATOM   3933  C  C   . ILE B  1 44  ? 8.394   22.484  124.085 1.00 13.41  ? 151  ILE B C   1 
ATOM   3934  O  O   . ILE B  1 44  ? 8.473   23.380  123.245 1.00 14.06  ? 151  ILE B O   1 
ATOM   3935  C  CB  . ILE B  1 44  ? 6.224   23.165  125.062 1.00 12.78  ? 151  ILE B CB  1 
ATOM   3936  C  CG1 . ILE B  1 44  ? 5.460   23.505  126.350 1.00 11.71  ? 151  ILE B CG1 1 
ATOM   3937  C  CG2 . ILE B  1 44  ? 5.521   22.072  124.270 1.00 13.65  ? 151  ILE B CG2 1 
ATOM   3938  C  CD1 . ILE B  1 44  ? 5.224   22.335  127.266 1.00 9.05   ? 151  ILE B CD1 1 
ATOM   3939  N  N   . LEU B  1 45  ? 8.938   21.285  123.903 1.00 13.29  ? 152  LEU B N   1 
ATOM   3940  C  CA  . LEU B  1 45  ? 9.632   20.963  122.655 1.00 13.63  ? 152  LEU B CA  1 
ATOM   3941  C  C   . LEU B  1 45  ? 8.583   20.373  121.722 1.00 15.10  ? 152  LEU B C   1 
ATOM   3942  O  O   . LEU B  1 45  ? 8.199   19.213  121.868 1.00 14.37  ? 152  LEU B O   1 
ATOM   3943  C  CB  . LEU B  1 45  ? 10.754  19.953  122.898 1.00 12.82  ? 152  LEU B CB  1 
ATOM   3944  C  CG  . LEU B  1 45  ? 11.793  20.314  123.979 1.00 13.21  ? 152  LEU B CG  1 
ATOM   3945  C  CD1 . LEU B  1 45  ? 12.902  19.272  123.982 1.00 11.37  ? 152  LEU B CD1 1 
ATOM   3946  C  CD2 . LEU B  1 45  ? 12.384  21.689  123.725 1.00 11.43  ? 152  LEU B CD2 1 
ATOM   3947  N  N   . ASP B  1 46  ? 8.121   21.176  120.762 1.00 16.43  ? 153  ASP B N   1 
ATOM   3948  C  CA  . ASP B  1 46  ? 7.075   20.729  119.856 1.00 16.86  ? 153  ASP B CA  1 
ATOM   3949  C  C   . ASP B  1 46  ? 7.058   21.508  118.526 1.00 17.68  ? 153  ASP B C   1 
ATOM   3950  O  O   . ASP B  1 46  ? 8.107   21.774  117.936 1.00 17.53  ? 153  ASP B O   1 
ATOM   3951  C  CB  . ASP B  1 46  ? 5.740   20.876  120.589 1.00 18.92  ? 153  ASP B CB  1 
ATOM   3952  C  CG  . ASP B  1 46  ? 4.708   19.881  120.133 1.00 20.07  ? 153  ASP B CG  1 
ATOM   3953  O  OD1 . ASP B  1 46  ? 4.268   19.069  120.977 1.00 21.30  ? 153  ASP B OD1 1 
ATOM   3954  O  OD2 . ASP B  1 46  ? 4.334   19.912  118.942 1.00 20.82  ? 153  ASP B OD2 1 
ATOM   3955  N  N   . ASP B  1 47  ? 5.867   21.873  118.052 1.00 18.20  ? 154  ASP B N   1 
ATOM   3956  C  CA  . ASP B  1 47  ? 5.744   22.600  116.788 1.00 18.38  ? 154  ASP B CA  1 
ATOM   3957  C  C   . ASP B  1 47  ? 5.632   24.110  116.961 1.00 18.87  ? 154  ASP B C   1 
ATOM   3958  O  O   . ASP B  1 47  ? 5.224   24.820  116.039 1.00 20.34  ? 154  ASP B O   1 
ATOM   3959  C  CB  . ASP B  1 47  ? 4.531   22.106  115.983 1.00 17.99  ? 154  ASP B CB  1 
ATOM   3960  C  CG  . ASP B  1 47  ? 3.236   22.147  116.781 1.00 20.04  ? 154  ASP B CG  1 
ATOM   3961  O  OD1 . ASP B  1 47  ? 3.155   22.922  117.760 1.00 19.22  ? 154  ASP B OD1 1 
ATOM   3962  O  OD2 . ASP B  1 47  ? 2.288   21.409  116.426 1.00 20.12  ? 154  ASP B OD2 1 
ATOM   3963  N  N   . GLY B  1 48  ? 5.993   24.611  118.133 1.00 18.10  ? 155  GLY B N   1 
ATOM   3964  C  CA  . GLY B  1 48  ? 5.899   26.037  118.353 1.00 17.55  ? 155  GLY B CA  1 
ATOM   3965  C  C   . GLY B  1 48  ? 4.890   26.388  119.429 1.00 18.73  ? 155  GLY B C   1 
ATOM   3966  O  O   . GLY B  1 48  ? 4.129   25.534  119.883 1.00 19.67  ? 155  GLY B O   1 
ATOM   3967  N  N   . ILE B  1 49  ? 4.881   27.653  119.836 1.00 18.56  ? 156  ILE B N   1 
ATOM   3968  C  CA  . ILE B  1 49  ? 3.972   28.118  120.869 1.00 18.43  ? 156  ILE B CA  1 
ATOM   3969  C  C   . ILE B  1 49  ? 3.399   29.474  120.512 1.00 18.65  ? 156  ILE B C   1 
ATOM   3970  O  O   . ILE B  1 49  ? 4.131   30.388  120.134 1.00 17.69  ? 156  ILE B O   1 
ATOM   3971  C  CB  . ILE B  1 49  ? 4.690   28.213  122.224 1.00 18.63  ? 156  ILE B CB  1 
ATOM   3972  C  CG1 . ILE B  1 49  ? 3.738   28.729  123.295 1.00 19.26  ? 156  ILE B CG1 1 
ATOM   3973  C  CG2 . ILE B  1 49  ? 5.876   29.135  122.112 1.00 18.70  ? 156  ILE B CG2 1 
ATOM   3974  C  CD1 . ILE B  1 49  ? 4.376   28.783  124.679 1.00 21.47  ? 156  ILE B CD1 1 
ATOM   3975  N  N   . GLU B  1 50  ? 2.080   29.596  120.616 1.00 19.99  ? 157  GLU B N   1 
ATOM   3976  C  CA  . GLU B  1 50  ? 1.418   30.852  120.303 1.00 21.64  ? 157  GLU B CA  1 
ATOM   3977  C  C   . GLU B  1 50  ? 1.664   31.763  121.487 1.00 22.76  ? 157  GLU B C   1 
ATOM   3978  O  O   . GLU B  1 50  ? 0.802   31.900  122.350 1.00 23.08  ? 157  GLU B O   1 
ATOM   3979  C  CB  . GLU B  1 50  ? -0.078  30.641  120.120 1.00 21.39  ? 157  GLU B CB  1 
ATOM   3980  C  CG  . GLU B  1 50  ? -0.736  31.774  119.389 1.00 22.76  ? 157  GLU B CG  1 
ATOM   3981  C  CD  . GLU B  1 50  ? -2.175  31.488  119.059 1.00 24.46  ? 157  GLU B CD  1 
ATOM   3982  O  OE1 . GLU B  1 50  ? -2.999  31.457  119.996 1.00 24.93  ? 157  GLU B OE1 1 
ATOM   3983  O  OE2 . GLU B  1 50  ? -2.477  31.292  117.860 1.00 26.58  ? 157  GLU B OE2 1 
ATOM   3984  N  N   . LYS B  1 51  ? 2.843   32.384  121.508 1.00 23.74  ? 158  LYS B N   1 
ATOM   3985  C  CA  . LYS B  1 51  ? 3.268   33.252  122.604 1.00 24.88  ? 158  LYS B CA  1 
ATOM   3986  C  C   . LYS B  1 51  ? 2.368   34.433  122.938 1.00 26.35  ? 158  LYS B C   1 
ATOM   3987  O  O   . LYS B  1 51  ? 2.454   34.987  124.041 1.00 26.97  ? 158  LYS B O   1 
ATOM   3988  C  CB  . LYS B  1 51  ? 4.684   33.769  122.346 1.00 23.86  ? 158  LYS B CB  1 
ATOM   3989  C  CG  . LYS B  1 51  ? 4.805   34.714  121.176 1.00 23.68  ? 158  LYS B CG  1 
ATOM   3990  C  CD  . LYS B  1 51  ? 6.246   35.172  121.023 1.00 24.27  ? 158  LYS B CD  1 
ATOM   3991  C  CE  . LYS B  1 51  ? 6.392   36.199  119.917 1.00 25.22  ? 158  LYS B CE  1 
ATOM   3992  N  NZ  . LYS B  1 51  ? 6.003   35.653  118.592 1.00 28.80  ? 158  LYS B NZ  1 
ATOM   3993  N  N   . ASN B  1 52  ? 1.515   34.829  122.001 1.00 26.71  ? 159  ASN B N   1 
ATOM   3994  C  CA  . ASN B  1 52  ? 0.618   35.950  122.245 1.00 26.76  ? 159  ASN B CA  1 
ATOM   3995  C  C   . ASN B  1 52  ? -0.787  35.484  122.591 1.00 26.94  ? 159  ASN B C   1 
ATOM   3996  O  O   . ASN B  1 52  ? -1.738  36.264  122.519 1.00 27.51  ? 159  ASN B O   1 
ATOM   3997  C  CB  . ASN B  1 52  ? 0.570   36.866  121.024 1.00 28.62  ? 159  ASN B CB  1 
ATOM   3998  C  CG  . ASN B  1 52  ? 0.201   36.125  119.749 1.00 30.77  ? 159  ASN B CG  1 
ATOM   3999  O  OD1 . ASN B  1 52  ? 0.831   35.124  119.392 1.00 32.92  ? 159  ASN B OD1 1 
ATOM   4000  N  ND2 . ASN B  1 52  ? -0.820  36.616  119.051 1.00 31.84  ? 159  ASN B ND2 1 
ATOM   4001  N  N   . HIS B  1 53  ? -0.921  34.213  122.957 1.00 25.66  ? 160  HIS B N   1 
ATOM   4002  C  CA  . HIS B  1 53  ? -2.224  33.674  123.314 1.00 24.73  ? 160  HIS B CA  1 
ATOM   4003  C  C   . HIS B  1 53  ? -2.680  34.359  124.599 1.00 24.97  ? 160  HIS B C   1 
ATOM   4004  O  O   . HIS B  1 53  ? -1.909  34.494  125.548 1.00 25.23  ? 160  HIS B O   1 
ATOM   4005  C  CB  . HIS B  1 53  ? -2.136  32.159  123.518 1.00 23.65  ? 160  HIS B CB  1 
ATOM   4006  C  CG  . HIS B  1 53  ? -3.470  31.488  123.627 1.00 23.78  ? 160  HIS B CG  1 
ATOM   4007  N  ND1 . HIS B  1 53  ? -4.297  31.643  124.720 1.00 23.79  ? 160  HIS B ND1 1 
ATOM   4008  C  CD2 . HIS B  1 53  ? -4.130  30.677  122.768 1.00 22.64  ? 160  HIS B CD2 1 
ATOM   4009  C  CE1 . HIS B  1 53  ? -5.409  30.955  124.531 1.00 22.70  ? 160  HIS B CE1 1 
ATOM   4010  N  NE2 . HIS B  1 53  ? -5.332  30.359  123.353 1.00 23.93  ? 160  HIS B NE2 1 
ATOM   4011  N  N   . PRO B  1 54  ? -3.940  34.817  124.642 1.00 24.62  ? 161  PRO B N   1 
ATOM   4012  C  CA  . PRO B  1 54  ? -4.444  35.484  125.842 1.00 24.25  ? 161  PRO B CA  1 
ATOM   4013  C  C   . PRO B  1 54  ? -4.263  34.732  127.158 1.00 24.34  ? 161  PRO B C   1 
ATOM   4014  O  O   . PRO B  1 54  ? -4.261  35.351  128.222 1.00 25.98  ? 161  PRO B O   1 
ATOM   4015  C  CB  . PRO B  1 54  ? -5.916  35.749  125.511 1.00 23.95  ? 161  PRO B CB  1 
ATOM   4016  C  CG  . PRO B  1 54  ? -6.230  34.782  124.422 1.00 26.20  ? 161  PRO B CG  1 
ATOM   4017  C  CD  . PRO B  1 54  ? -4.971  34.796  123.594 1.00 25.43  ? 161  PRO B CD  1 
ATOM   4018  N  N   . ASP B  1 55  ? -4.094  33.413  127.109 1.00 22.71  ? 162  ASP B N   1 
ATOM   4019  C  CA  . ASP B  1 55  ? -3.923  32.658  128.352 1.00 20.23  ? 162  ASP B CA  1 
ATOM   4020  C  C   . ASP B  1 55  ? -2.486  32.168  128.541 1.00 19.04  ? 162  ASP B C   1 
ATOM   4021  O  O   . ASP B  1 55  ? -2.201  31.418  129.470 1.00 18.05  ? 162  ASP B O   1 
ATOM   4022  C  CB  . ASP B  1 55  ? -4.899  31.475  128.395 1.00 20.94  ? 162  ASP B CB  1 
ATOM   4023  C  CG  . ASP B  1 55  ? -5.480  31.239  129.786 1.00 21.46  ? 162  ASP B CG  1 
ATOM   4024  O  OD1 . ASP B  1 55  ? -5.501  32.187  130.588 1.00 24.24  ? 162  ASP B OD1 1 
ATOM   4025  O  OD2 . ASP B  1 55  ? -5.937  30.120  130.078 1.00 21.54  ? 162  ASP B OD2 1 
ATOM   4026  N  N   . LEU B  1 56  ? -1.583  32.607  127.667 1.00 17.51  ? 163  LEU B N   1 
ATOM   4027  C  CA  . LEU B  1 56  ? -0.177  32.224  127.753 1.00 17.47  ? 163  LEU B CA  1 
ATOM   4028  C  C   . LEU B  1 56  ? 0.750   33.434  127.858 1.00 18.35  ? 163  LEU B C   1 
ATOM   4029  O  O   . LEU B  1 56  ? 1.765   33.394  128.557 1.00 18.69  ? 163  LEU B O   1 
ATOM   4030  C  CB  . LEU B  1 56  ? 0.242   31.408  126.530 1.00 17.20  ? 163  LEU B CB  1 
ATOM   4031  C  CG  . LEU B  1 56  ? -0.390  30.027  126.348 1.00 18.47  ? 163  LEU B CG  1 
ATOM   4032  C  CD1 . LEU B  1 56  ? 0.142   29.410  125.048 1.00 18.47  ? 163  LEU B CD1 1 
ATOM   4033  C  CD2 . LEU B  1 56  ? -0.072  29.144  127.547 1.00 16.55  ? 163  LEU B CD2 1 
ATOM   4034  N  N   . ALA B  1 57  ? 0.406   34.507  127.152 1.00 18.77  ? 164  ALA B N   1 
ATOM   4035  C  CA  . ALA B  1 57  ? 1.215   35.725  127.148 1.00 18.83  ? 164  ALA B CA  1 
ATOM   4036  C  C   . ALA B  1 57  ? 1.740   36.109  128.531 1.00 19.15  ? 164  ALA B C   1 
ATOM   4037  O  O   . ALA B  1 57  ? 2.917   36.404  128.689 1.00 20.05  ? 164  ALA B O   1 
ATOM   4038  C  CB  . ALA B  1 57  ? 0.412   36.873  126.558 1.00 18.27  ? 164  ALA B CB  1 
ATOM   4039  N  N   . GLY B  1 58  ? 0.863   36.092  129.527 1.00 19.74  ? 165  GLY B N   1 
ATOM   4040  C  CA  . GLY B  1 58  ? 1.258   36.437  130.879 1.00 19.66  ? 165  GLY B CA  1 
ATOM   4041  C  C   . GLY B  1 58  ? 2.430   35.647  131.445 1.00 21.58  ? 165  GLY B C   1 
ATOM   4042  O  O   . GLY B  1 58  ? 3.204   36.186  132.253 1.00 22.46  ? 165  GLY B O   1 
ATOM   4043  N  N   . ASN B  1 59  ? 2.575   34.381  131.050 1.00 20.40  ? 166  ASN B N   1 
ATOM   4044  C  CA  . ASN B  1 59  ? 3.678   33.570  131.556 1.00 20.44  ? 166  ASN B CA  1 
ATOM   4045  C  C   . ASN B  1 59  ? 4.717   33.254  130.486 1.00 20.76  ? 166  ASN B C   1 
ATOM   4046  O  O   . ASN B  1 59  ? 5.692   32.539  130.748 1.00 20.73  ? 166  ASN B O   1 
ATOM   4047  C  CB  . ASN B  1 59  ? 3.166   32.250  132.151 1.00 21.22  ? 166  ASN B CB  1 
ATOM   4048  C  CG  . ASN B  1 59  ? 2.313   32.454  133.392 1.00 22.71  ? 166  ASN B CG  1 
ATOM   4049  O  OD1 . ASN B  1 59  ? 2.466   33.444  134.100 1.00 23.04  ? 166  ASN B OD1 1 
ATOM   4050  N  ND2 . ASN B  1 59  ? 1.422   31.505  133.670 1.00 22.58  ? 166  ASN B ND2 1 
ATOM   4051  N  N   . TYR B  1 60  ? 4.524   33.783  129.282 1.00 19.68  ? 167  TYR B N   1 
ATOM   4052  C  CA  . TYR B  1 60  ? 5.467   33.496  128.215 1.00 19.56  ? 167  TYR B CA  1 
ATOM   4053  C  C   . TYR B  1 60  ? 6.888   33.922  128.569 1.00 20.88  ? 167  TYR B C   1 
ATOM   4054  O  O   . TYR B  1 60  ? 7.097   34.996  129.132 1.00 23.03  ? 167  TYR B O   1 
ATOM   4055  C  CB  . TYR B  1 60  ? 5.041   34.182  126.920 1.00 17.90  ? 167  TYR B CB  1 
ATOM   4056  C  CG  . TYR B  1 60  ? 6.015   33.923  125.802 1.00 17.46  ? 167  TYR B CG  1 
ATOM   4057  C  CD1 . TYR B  1 60  ? 6.244   32.625  125.335 1.00 16.62  ? 167  TYR B CD1 1 
ATOM   4058  C  CD2 . TYR B  1 60  ? 6.762   34.960  125.251 1.00 17.51  ? 167  TYR B CD2 1 
ATOM   4059  C  CE1 . TYR B  1 60  ? 7.200   32.369  124.350 1.00 16.87  ? 167  TYR B CE1 1 
ATOM   4060  C  CE2 . TYR B  1 60  ? 7.726   34.713  124.261 1.00 17.85  ? 167  TYR B CE2 1 
ATOM   4061  C  CZ  . TYR B  1 60  ? 7.938   33.419  123.818 1.00 17.79  ? 167  TYR B CZ  1 
ATOM   4062  O  OH  . TYR B  1 60  ? 8.879   33.178  122.844 1.00 18.60  ? 167  TYR B OH  1 
ATOM   4063  N  N   . ASP B  1 61  ? 7.865   33.086  128.230 1.00 20.84  ? 168  ASP B N   1 
ATOM   4064  C  CA  . ASP B  1 61  ? 9.266   33.394  128.506 1.00 20.22  ? 168  ASP B CA  1 
ATOM   4065  C  C   . ASP B  1 61  ? 10.109  33.212  127.238 1.00 20.08  ? 168  ASP B C   1 
ATOM   4066  O  O   . ASP B  1 61  ? 10.349  32.091  126.794 1.00 20.62  ? 168  ASP B O   1 
ATOM   4067  C  CB  . ASP B  1 61  ? 9.784   32.485  129.619 1.00 19.37  ? 168  ASP B CB  1 
ATOM   4068  C  CG  . ASP B  1 61  ? 11.217  32.772  129.987 1.00 18.95  ? 168  ASP B CG  1 
ATOM   4069  O  OD1 . ASP B  1 61  ? 11.890  33.544  129.271 1.00 22.43  ? 168  ASP B OD1 1 
ATOM   4070  O  OD2 . ASP B  1 61  ? 11.683  32.219  130.997 1.00 19.05  ? 168  ASP B OD2 1 
ATOM   4071  N  N   . PRO B  1 62  ? 10.583  34.323  126.646 1.00 20.38  ? 169  PRO B N   1 
ATOM   4072  C  CA  . PRO B  1 62  ? 11.395  34.252  125.426 1.00 19.92  ? 169  PRO B CA  1 
ATOM   4073  C  C   . PRO B  1 62  ? 12.663  33.444  125.653 1.00 19.59  ? 169  PRO B C   1 
ATOM   4074  O  O   . PRO B  1 62  ? 13.197  32.834  124.725 1.00 20.67  ? 169  PRO B O   1 
ATOM   4075  C  CB  . PRO B  1 62  ? 11.705  35.721  125.130 1.00 19.47  ? 169  PRO B CB  1 
ATOM   4076  C  CG  . PRO B  1 62  ? 10.590  36.456  125.785 1.00 19.41  ? 169  PRO B CG  1 
ATOM   4077  C  CD  . PRO B  1 62  ? 10.434  35.718  127.085 1.00 19.24  ? 169  PRO B CD  1 
ATOM   4078  N  N   . GLY B  1 63  ? 13.133  33.449  126.898 1.00 19.41  ? 170  GLY B N   1 
ATOM   4079  C  CA  . GLY B  1 63  ? 14.350  32.743  127.258 1.00 19.61  ? 170  GLY B CA  1 
ATOM   4080  C  C   . GLY B  1 63  ? 14.228  31.237  127.259 1.00 21.01  ? 170  GLY B C   1 
ATOM   4081  O  O   . GLY B  1 63  ? 15.232  30.524  127.217 1.00 23.33  ? 170  GLY B O   1 
ATOM   4082  N  N   . ALA B  1 64  ? 13.002  30.743  127.321 1.00 20.45  ? 171  ALA B N   1 
ATOM   4083  C  CA  . ALA B  1 64  ? 12.774  29.307  127.300 1.00 21.37  ? 171  ALA B CA  1 
ATOM   4084  C  C   . ALA B  1 64  ? 12.221  28.929  125.933 1.00 21.97  ? 171  ALA B C   1 
ATOM   4085  O  O   . ALA B  1 64  ? 11.645  27.849  125.770 1.00 22.47  ? 171  ALA B O   1 
ATOM   4086  C  CB  . ALA B  1 64  ? 11.781  28.919  128.384 1.00 20.90  ? 171  ALA B CB  1 
ATOM   4087  N  N   . SER B  1 65  ? 12.410  29.818  124.955 1.00 21.64  ? 172  SER B N   1 
ATOM   4088  C  CA  . SER B  1 65  ? 11.897  29.610  123.608 1.00 20.95  ? 172  SER B CA  1 
ATOM   4089  C  C   . SER B  1 65  ? 12.916  29.789  122.499 1.00 21.72  ? 172  SER B C   1 
ATOM   4090  O  O   . SER B  1 65  ? 13.917  30.486  122.664 1.00 22.03  ? 172  SER B O   1 
ATOM   4091  C  CB  . SER B  1 65  ? 10.740  30.571  123.341 1.00 19.67  ? 172  SER B CB  1 
ATOM   4092  O  OG  . SER B  1 65  ? 9.718   30.402  124.293 1.00 20.67  ? 172  SER B OG  1 
ATOM   4093  N  N   . PHE B  1 66  ? 12.630  29.157  121.363 1.00 21.76  ? 173  PHE B N   1 
ATOM   4094  C  CA  . PHE B  1 66  ? 13.473  29.250  120.190 1.00 21.78  ? 173  PHE B CA  1 
ATOM   4095  C  C   . PHE B  1 66  ? 12.851  28.476  119.048 1.00 22.02  ? 173  PHE B C   1 
ATOM   4096  O  O   . PHE B  1 66  ? 12.051  27.571  119.257 1.00 22.62  ? 173  PHE B O   1 
ATOM   4097  C  CB  . PHE B  1 66  ? 14.870  28.715  120.485 1.00 21.98  ? 173  PHE B CB  1 
ATOM   4098  C  CG  . PHE B  1 66  ? 15.916  29.223  119.537 1.00 23.84  ? 173  PHE B CG  1 
ATOM   4099  C  CD1 . PHE B  1 66  ? 16.186  28.552  118.345 1.00 24.14  ? 173  PHE B CD1 1 
ATOM   4100  C  CD2 . PHE B  1 66  ? 16.609  30.403  119.816 1.00 24.14  ? 173  PHE B CD2 1 
ATOM   4101  C  CE1 . PHE B  1 66  ? 17.133  29.049  117.439 1.00 24.56  ? 173  PHE B CE1 1 
ATOM   4102  C  CE2 . PHE B  1 66  ? 17.556  30.912  118.919 1.00 24.09  ? 173  PHE B CE2 1 
ATOM   4103  C  CZ  . PHE B  1 66  ? 17.819  30.234  117.727 1.00 24.63  ? 173  PHE B CZ  1 
ATOM   4104  N  N   . ASP B  1 67  ? 13.202  28.863  117.834 1.00 22.11  ? 174  ASP B N   1 
ATOM   4105  C  CA  . ASP B  1 67  ? 12.706  28.193  116.651 1.00 22.14  ? 174  ASP B CA  1 
ATOM   4106  C  C   . ASP B  1 67  ? 13.917  27.538  115.993 1.00 22.23  ? 174  ASP B C   1 
ATOM   4107  O  O   . ASP B  1 67  ? 14.656  28.188  115.244 1.00 20.55  ? 174  ASP B O   1 
ATOM   4108  C  CB  . ASP B  1 67  ? 12.054  29.202  115.704 1.00 21.91  ? 174  ASP B CB  1 
ATOM   4109  C  CG  . ASP B  1 67  ? 11.476  28.551  114.455 1.00 22.85  ? 174  ASP B CG  1 
ATOM   4110  O  OD1 . ASP B  1 67  ? 10.680  29.216  113.761 1.00 24.81  ? 174  ASP B OD1 1 
ATOM   4111  O  OD2 . ASP B  1 67  ? 11.819  27.386  114.156 1.00 22.72  ? 174  ASP B OD2 1 
ATOM   4112  N  N   . VAL B  1 68  ? 14.124  26.257  116.295 1.00 22.19  ? 175  VAL B N   1 
ATOM   4113  C  CA  . VAL B  1 68  ? 15.247  25.521  115.733 1.00 23.05  ? 175  VAL B CA  1 
ATOM   4114  C  C   . VAL B  1 68  ? 15.024  25.173  114.257 1.00 24.54  ? 175  VAL B C   1 
ATOM   4115  O  O   . VAL B  1 68  ? 15.976  25.029  113.497 1.00 25.10  ? 175  VAL B O   1 
ATOM   4116  C  CB  . VAL B  1 68  ? 15.500  24.236  116.531 1.00 22.01  ? 175  VAL B CB  1 
ATOM   4117  C  CG1 . VAL B  1 68  ? 16.668  23.488  115.948 1.00 23.18  ? 175  VAL B CG1 1 
ATOM   4118  C  CG2 . VAL B  1 68  ? 15.773  24.574  117.973 1.00 20.71  ? 175  VAL B CG2 1 
ATOM   4119  N  N   . ASN B  1 69  ? 13.763  25.046  113.855 1.00 25.74  ? 176  ASN B N   1 
ATOM   4120  C  CA  . ASN B  1 69  ? 13.434  24.726  112.476 1.00 27.89  ? 176  ASN B CA  1 
ATOM   4121  C  C   . ASN B  1 69  ? 13.826  25.867  111.547 1.00 29.84  ? 176  ASN B C   1 
ATOM   4122  O  O   . ASN B  1 69  ? 14.255  25.636  110.417 1.00 30.37  ? 176  ASN B O   1 
ATOM   4123  C  CB  . ASN B  1 69  ? 11.936  24.461  112.345 1.00 27.91  ? 176  ASN B CB  1 
ATOM   4124  C  CG  . ASN B  1 69  ? 11.532  23.109  112.892 1.00 27.75  ? 176  ASN B CG  1 
ATOM   4125  O  OD1 . ASN B  1 69  ? 10.362  22.878  113.191 1.00 30.58  ? 176  ASN B OD1 1 
ATOM   4126  N  ND2 . ASN B  1 69  ? 12.488  22.202  113.004 1.00 26.43  ? 176  ASN B ND2 1 
ATOM   4127  N  N   . ASP B  1 70  ? 13.673  27.097  112.029 1.00 31.96  ? 177  ASP B N   1 
ATOM   4128  C  CA  . ASP B  1 70  ? 13.985  28.288  111.249 1.00 34.53  ? 177  ASP B CA  1 
ATOM   4129  C  C   . ASP B  1 70  ? 15.211  29.012  111.732 1.00 34.90  ? 177  ASP B C   1 
ATOM   4130  O  O   . ASP B  1 70  ? 15.504  30.102  111.253 1.00 35.55  ? 177  ASP B O   1 
ATOM   4131  C  CB  . ASP B  1 70  ? 12.826  29.282  111.296 1.00 38.38  ? 177  ASP B CB  1 
ATOM   4132  C  CG  . ASP B  1 70  ? 11.792  29.033  110.214 1.00 43.01  ? 177  ASP B CG  1 
ATOM   4133  O  OD1 . ASP B  1 70  ? 10.763  29.757  110.214 1.00 46.20  ? 177  ASP B OD1 1 
ATOM   4134  O  OD2 . ASP B  1 70  ? 12.008  28.131  109.367 1.00 43.02  ? 177  ASP B OD2 1 
ATOM   4135  N  N   . GLN B  1 71  ? 15.915  28.433  112.695 1.00 35.35  ? 178  GLN B N   1 
ATOM   4136  C  CA  . GLN B  1 71  ? 17.113  29.077  113.205 1.00 36.20  ? 178  GLN B CA  1 
ATOM   4137  C  C   . GLN B  1 71  ? 16.812  30.533  113.557 1.00 34.89  ? 178  GLN B C   1 
ATOM   4138  O  O   . GLN B  1 71  ? 17.473  31.442  113.072 1.00 35.61  ? 178  GLN B O   1 
ATOM   4139  C  CB  . GLN B  1 71  ? 18.201  29.017  112.137 1.00 38.15  ? 178  GLN B CB  1 
ATOM   4140  C  CG  . GLN B  1 71  ? 19.430  28.261  112.566 1.00 42.98  ? 178  GLN B CG  1 
ATOM   4141  C  CD  . GLN B  1 71  ? 20.172  28.962  113.687 1.00 45.35  ? 178  GLN B CD  1 
ATOM   4142  O  OE1 . GLN B  1 71  ? 19.600  29.234  114.748 1.00 47.26  ? 178  GLN B OE1 1 
ATOM   4143  N  NE2 . GLN B  1 71  ? 21.453  29.260  113.460 1.00 46.49  ? 178  GLN B NE2 1 
ATOM   4144  N  N   . ASP B  1 72  ? 15.809  30.739  114.401 1.00 33.70  ? 179  ASP B N   1 
ATOM   4145  C  CA  . ASP B  1 72  ? 15.393  32.072  114.813 1.00 32.40  ? 179  ASP B CA  1 
ATOM   4146  C  C   . ASP B  1 72  ? 14.841  31.992  116.238 1.00 31.39  ? 179  ASP B C   1 
ATOM   4147  O  O   . ASP B  1 72  ? 14.393  30.939  116.678 1.00 32.01  ? 179  ASP B O   1 
ATOM   4148  C  CB  . ASP B  1 72  ? 14.326  32.579  113.844 1.00 33.32  ? 179  ASP B CB  1 
ATOM   4149  C  CG  . ASP B  1 72  ? 13.745  33.909  114.255 1.00 35.23  ? 179  ASP B CG  1 
ATOM   4150  O  OD1 . ASP B  1 72  ? 12.909  33.948  115.186 1.00 36.86  ? 179  ASP B OD1 1 
ATOM   4151  O  OD2 . ASP B  1 72  ? 14.129  34.925  113.644 1.00 38.37  ? 179  ASP B OD2 1 
ATOM   4152  N  N   . PRO B  1 73  ? 14.872  33.103  116.986 1.00 30.13  ? 180  PRO B N   1 
ATOM   4153  C  CA  . PRO B  1 73  ? 14.349  33.028  118.350 1.00 27.99  ? 180  PRO B CA  1 
ATOM   4154  C  C   . PRO B  1 73  ? 12.831  33.003  118.537 1.00 27.30  ? 180  PRO B C   1 
ATOM   4155  O  O   . PRO B  1 73  ? 12.350  32.627  119.609 1.00 26.70  ? 180  PRO B O   1 
ATOM   4156  C  CB  . PRO B  1 73  ? 15.024  34.214  119.035 1.00 27.70  ? 180  PRO B CB  1 
ATOM   4157  C  CG  . PRO B  1 73  ? 15.228  35.175  117.930 1.00 27.27  ? 180  PRO B CG  1 
ATOM   4158  C  CD  . PRO B  1 73  ? 15.701  34.308  116.808 1.00 28.57  ? 180  PRO B CD  1 
ATOM   4159  N  N   . ASP B  1 74  ? 12.074  33.381  117.508 1.00 27.06  ? 181  ASP B N   1 
ATOM   4160  C  CA  . ASP B  1 74  ? 10.608  33.396  117.607 1.00 25.95  ? 181  ASP B CA  1 
ATOM   4161  C  C   . ASP B  1 74  ? 9.995   32.018  117.356 1.00 23.86  ? 181  ASP B C   1 
ATOM   4162  O  O   . ASP B  1 74  ? 10.080  31.478  116.250 1.00 23.16  ? 181  ASP B O   1 
ATOM   4163  C  CB  . ASP B  1 74  ? 10.020  34.408  116.618 1.00 28.13  ? 181  ASP B CB  1 
ATOM   4164  C  CG  . ASP B  1 74  ? 8.516   34.594  116.796 1.00 29.96  ? 181  ASP B CG  1 
ATOM   4165  O  OD1 . ASP B  1 74  ? 7.904   35.333  115.990 1.00 30.73  ? 181  ASP B OD1 1 
ATOM   4166  O  OD2 . ASP B  1 74  ? 7.947   34.000  117.743 1.00 31.24  ? 181  ASP B OD2 1 
ATOM   4167  N  N   . PRO B  1 75  ? 9.353   31.443  118.385 1.00 22.27  ? 182  PRO B N   1 
ATOM   4168  C  CA  . PRO B  1 75  ? 8.718   30.123  118.318 1.00 21.45  ? 182  PRO B CA  1 
ATOM   4169  C  C   . PRO B  1 75  ? 7.271   30.109  117.830 1.00 21.47  ? 182  PRO B C   1 
ATOM   4170  O  O   . PRO B  1 75  ? 6.568   29.121  118.016 1.00 22.01  ? 182  PRO B O   1 
ATOM   4171  C  CB  . PRO B  1 75  ? 8.825   29.641  119.752 1.00 20.94  ? 182  PRO B CB  1 
ATOM   4172  C  CG  . PRO B  1 75  ? 8.527   30.909  120.511 1.00 20.35  ? 182  PRO B CG  1 
ATOM   4173  C  CD  . PRO B  1 75  ? 9.340   31.960  119.766 1.00 20.76  ? 182  PRO B CD  1 
ATOM   4174  N  N   . GLN B  1 76  ? 6.820   31.191  117.212 1.00 20.81  ? 183  GLN B N   1 
ATOM   4175  C  CA  . GLN B  1 76  ? 5.438   31.249  116.746 1.00 22.17  ? 183  GLN B CA  1 
ATOM   4176  C  C   . GLN B  1 76  ? 5.149   30.080  115.805 1.00 22.03  ? 183  GLN B C   1 
ATOM   4177  O  O   . GLN B  1 76  ? 5.945   29.779  114.914 1.00 21.36  ? 183  GLN B O   1 
ATOM   4178  C  CB  . GLN B  1 76  ? 5.187   32.574  116.022 1.00 23.47  ? 183  GLN B CB  1 
ATOM   4179  C  CG  . GLN B  1 76  ? 3.724   32.923  115.814 1.00 25.86  ? 183  GLN B CG  1 
ATOM   4180  C  CD  . GLN B  1 76  ? 3.036   33.324  117.108 1.00 27.86  ? 183  GLN B CD  1 
ATOM   4181  O  OE1 . GLN B  1 76  ? 3.661   33.897  118.006 1.00 28.86  ? 183  GLN B OE1 1 
ATOM   4182  N  NE2 . GLN B  1 76  ? 1.742   33.041  117.206 1.00 28.09  ? 183  GLN B NE2 1 
ATOM   4183  N  N   . PRO B  1 77  ? 4.014   29.389  116.004 1.00 22.02  ? 184  PRO B N   1 
ATOM   4184  C  CA  . PRO B  1 77  ? 3.695   28.260  115.126 1.00 21.53  ? 184  PRO B CA  1 
ATOM   4185  C  C   . PRO B  1 77  ? 3.297   28.708  113.727 1.00 21.93  ? 184  PRO B C   1 
ATOM   4186  O  O   . PRO B  1 77  ? 2.851   29.846  113.539 1.00 20.93  ? 184  PRO B O   1 
ATOM   4187  C  CB  . PRO B  1 77  ? 2.554   27.564  115.861 1.00 20.51  ? 184  PRO B CB  1 
ATOM   4188  C  CG  . PRO B  1 77  ? 1.875   28.682  116.559 1.00 20.49  ? 184  PRO B CG  1 
ATOM   4189  C  CD  . PRO B  1 77  ? 3.025   29.500  117.093 1.00 21.16  ? 184  PRO B CD  1 
ATOM   4190  N  N   . ARG B  1 78  ? 3.483   27.815  112.751 1.00 21.77  ? 185  ARG B N   1 
ATOM   4191  C  CA  . ARG B  1 78  ? 3.123   28.093  111.368 1.00 22.18  ? 185  ARG B CA  1 
ATOM   4192  C  C   . ARG B  1 78  ? 1.629   27.819  111.206 1.00 23.77  ? 185  ARG B C   1 
ATOM   4193  O  O   . ARG B  1 78  ? 1.179   26.678  111.340 1.00 23.34  ? 185  ARG B O   1 
ATOM   4194  C  CB  . ARG B  1 78  ? 3.930   27.197  110.431 1.00 21.71  ? 185  ARG B CB  1 
ATOM   4195  C  CG  . ARG B  1 78  ? 3.629   27.393  108.958 1.00 21.31  ? 185  ARG B CG  1 
ATOM   4196  C  CD  . ARG B  1 78  ? 4.654   26.667  108.109 1.00 22.91  ? 185  ARG B CD  1 
ATOM   4197  N  NE  . ARG B  1 78  ? 4.690   25.231  108.390 1.00 25.56  ? 185  ARG B NE  1 
ATOM   4198  C  CZ  . ARG B  1 78  ? 3.784   24.352  107.962 1.00 25.54  ? 185  ARG B CZ  1 
ATOM   4199  N  NH1 . ARG B  1 78  ? 3.901   23.065  108.273 1.00 24.21  ? 185  ARG B NH1 1 
ATOM   4200  N  NH2 . ARG B  1 78  ? 2.764   24.757  107.211 1.00 26.66  ? 185  ARG B NH2 1 
ATOM   4201  N  N   . TYR B  1 79  ? 0.862   28.869  110.927 1.00 26.19  ? 186  TYR B N   1 
ATOM   4202  C  CA  . TYR B  1 79  ? -0.580  28.723  110.782 1.00 28.69  ? 186  TYR B CA  1 
ATOM   4203  C  C   . TYR B  1 79  ? -0.997  28.111  109.463 1.00 29.55  ? 186  TYR B C   1 
ATOM   4204  O  O   . TYR B  1 79  ? -0.491  28.473  108.406 1.00 29.90  ? 186  TYR B O   1 
ATOM   4205  C  CB  . TYR B  1 79  ? -1.268  30.069  110.976 1.00 30.17  ? 186  TYR B CB  1 
ATOM   4206  C  CG  . TYR B  1 79  ? -1.071  30.610  112.370 1.00 32.27  ? 186  TYR B CG  1 
ATOM   4207  C  CD1 . TYR B  1 79  ? 0.102   31.287  112.722 1.00 33.04  ? 186  TYR B CD1 1 
ATOM   4208  C  CD2 . TYR B  1 79  ? -2.032  30.402  113.356 1.00 32.88  ? 186  TYR B CD2 1 
ATOM   4209  C  CE1 . TYR B  1 79  ? 0.313   31.742  114.026 1.00 33.71  ? 186  TYR B CE1 1 
ATOM   4210  C  CE2 . TYR B  1 79  ? -1.833  30.852  114.666 1.00 34.68  ? 186  TYR B CE2 1 
ATOM   4211  C  CZ  . TYR B  1 79  ? -0.659  31.521  114.993 1.00 34.74  ? 186  TYR B CZ  1 
ATOM   4212  O  OH  . TYR B  1 79  ? -0.467  31.962  116.285 1.00 35.92  ? 186  TYR B OH  1 
ATOM   4213  N  N   . THR B  1 80  ? -1.917  27.160  109.547 1.00 30.96  ? 187  THR B N   1 
ATOM   4214  C  CA  . THR B  1 80  ? -2.431  26.465  108.377 1.00 31.69  ? 187  THR B CA  1 
ATOM   4215  C  C   . THR B  1 80  ? -3.950  26.359  108.528 1.00 33.50  ? 187  THR B C   1 
ATOM   4216  O  O   . THR B  1 80  ? -4.489  26.565  109.624 1.00 33.39  ? 187  THR B O   1 
ATOM   4217  C  CB  . THR B  1 80  ? -1.817  25.052  108.267 1.00 31.02  ? 187  THR B CB  1 
ATOM   4218  O  OG1 . THR B  1 80  ? -2.242  24.251  109.374 1.00 30.34  ? 187  THR B OG1 1 
ATOM   4219  C  CG2 . THR B  1 80  ? -0.307  25.128  108.297 1.00 30.88  ? 187  THR B CG2 1 
ATOM   4220  N  N   . GLN B  1 81  ? -4.643  26.044  107.439 1.00 35.00  ? 188  GLN B N   1 
ATOM   4221  C  CA  . GLN B  1 81  ? -6.094  25.924  107.498 1.00 36.14  ? 188  GLN B CA  1 
ATOM   4222  C  C   . GLN B  1 81  ? -6.513  24.912  108.561 1.00 36.60  ? 188  GLN B C   1 
ATOM   4223  O  O   . GLN B  1 81  ? -7.315  25.224  109.440 1.00 37.93  ? 188  GLN B O   1 
ATOM   4224  C  CB  . GLN B  1 81  ? -6.663  25.502  106.136 1.00 36.96  ? 188  GLN B CB  1 
ATOM   4225  C  CG  . GLN B  1 81  ? -8.181  25.442  106.091 0.00 36.55  ? 188  GLN B CG  1 
ATOM   4226  C  CD  . GLN B  1 81  ? -8.712  25.000  104.742 0.00 36.57  ? 188  GLN B CD  1 
ATOM   4227  O  OE1 . GLN B  1 81  ? -9.922  24.896  104.543 0.00 36.47  ? 188  GLN B OE1 1 
ATOM   4228  N  NE2 . GLN B  1 81  ? -7.807  24.736  103.805 0.00 36.47  ? 188  GLN B NE2 1 
ATOM   4229  N  N   . MET B  1 82  ? -5.961  23.706  108.493 1.00 36.56  ? 189  MET B N   1 
ATOM   4230  C  CA  . MET B  1 82  ? -6.316  22.659  109.449 1.00 37.13  ? 189  MET B CA  1 
ATOM   4231  C  C   . MET B  1 82  ? -5.739  22.805  110.860 1.00 35.22  ? 189  MET B C   1 
ATOM   4232  O  O   . MET B  1 82  ? -5.986  21.944  111.709 1.00 34.66  ? 189  MET B O   1 
ATOM   4233  C  CB  . MET B  1 82  ? -5.922  21.281  108.895 1.00 40.32  ? 189  MET B CB  1 
ATOM   4234  C  CG  . MET B  1 82  ? -6.707  20.832  107.661 1.00 44.83  ? 189  MET B CG  1 
ATOM   4235  S  SD  . MET B  1 82  ? -8.512  20.805  107.932 1.00 51.55  ? 189  MET B SD  1 
ATOM   4236  C  CE  . MET B  1 82  ? -9.020  22.350  107.042 1.00 49.31  ? 189  MET B CE  1 
ATOM   4237  N  N   . ASN B  1 83  ? -4.982  23.872  111.115 1.00 32.83  ? 190  ASN B N   1 
ATOM   4238  C  CA  . ASN B  1 83  ? -4.383  24.083  112.433 1.00 31.23  ? 190  ASN B CA  1 
ATOM   4239  C  C   . ASN B  1 83  ? -3.423  22.958  112.831 1.00 30.39  ? 190  ASN B C   1 
ATOM   4240  O  O   . ASN B  1 83  ? -3.294  22.633  114.010 1.00 30.87  ? 190  ASN B O   1 
ATOM   4241  C  CB  . ASN B  1 83  ? -5.478  24.201  113.494 1.00 31.47  ? 190  ASN B CB  1 
ATOM   4242  C  CG  . ASN B  1 83  ? -5.962  25.623  113.681 1.00 32.80  ? 190  ASN B CG  1 
ATOM   4243  O  OD1 . ASN B  1 83  ? -6.129  26.367  112.717 1.00 32.97  ? 190  ASN B OD1 1 
ATOM   4244  N  ND2 . ASN B  1 83  ? -6.201  26.009  114.939 1.00 33.70  ? 190  ASN B ND2 1 
ATOM   4245  N  N   . ASP B  1 84  ? -2.743  22.380  111.847 1.00 28.93  ? 191  ASP B N   1 
ATOM   4246  C  CA  . ASP B  1 84  ? -1.808  21.284  112.060 1.00 27.55  ? 191  ASP B CA  1 
ATOM   4247  C  C   . ASP B  1 84  ? -0.781  21.499  113.169 1.00 25.94  ? 191  ASP B C   1 
ATOM   4248  O  O   . ASP B  1 84  ? -0.394  20.545  113.845 1.00 26.71  ? 191  ASP B O   1 
ATOM   4249  C  CB  . ASP B  1 84  ? -1.090  21.008  110.744 1.00 28.87  ? 191  ASP B CB  1 
ATOM   4250  C  CG  . ASP B  1 84  ? -2.056  20.694  109.620 1.00 31.56  ? 191  ASP B CG  1 
ATOM   4251  O  OD1 . ASP B  1 84  ? -2.684  19.613  109.665 1.00 33.91  ? 191  ASP B OD1 1 
ATOM   4252  O  OD2 . ASP B  1 84  ? -2.203  21.529  108.702 1.00 33.41  ? 191  ASP B OD2 1 
ATOM   4253  N  N   . ASN B  1 85  ? -0.353  22.748  113.361 1.00 23.93  ? 192  ASN B N   1 
ATOM   4254  C  CA  . ASN B  1 85  ? 0.665   23.069  114.367 1.00 21.20  ? 192  ASN B CA  1 
ATOM   4255  C  C   . ASN B  1 85  ? 0.150   23.680  115.673 1.00 19.48  ? 192  ASN B C   1 
ATOM   4256  O  O   . ASN B  1 85  ? 0.715   24.642  116.200 1.00 17.84  ? 192  ASN B O   1 
ATOM   4257  C  CB  . ASN B  1 85  ? 1.722   23.977  113.736 1.00 19.71  ? 192  ASN B CB  1 
ATOM   4258  C  CG  . ASN B  1 85  ? 2.313   23.374  112.490 1.00 19.28  ? 192  ASN B CG  1 
ATOM   4259  O  OD1 . ASN B  1 85  ? 2.863   22.276  112.518 1.00 21.01  ? 192  ASN B OD1 1 
ATOM   4260  N  ND2 . ASN B  1 85  ? 2.191   24.078  111.382 1.00 20.74  ? 192  ASN B ND2 1 
ATOM   4261  N  N   . ARG B  1 86  ? -0.909  23.085  116.201 1.00 17.77  ? 193  ARG B N   1 
ATOM   4262  C  CA  . ARG B  1 86  ? -1.524  23.538  117.435 1.00 16.46  ? 193  ARG B CA  1 
ATOM   4263  C  C   . ARG B  1 86  ? -1.014  22.705  118.610 1.00 15.81  ? 193  ARG B C   1 
ATOM   4264  O  O   . ARG B  1 86  ? -1.312  22.997  119.767 1.00 16.06  ? 193  ARG B O   1 
ATOM   4265  C  CB  . ARG B  1 86  ? -3.036  23.357  117.327 1.00 16.93  ? 193  ARG B CB  1 
ATOM   4266  C  CG  . ARG B  1 86  ? -3.441  21.894  117.327 1.00 16.22  ? 193  ARG B CG  1 
ATOM   4267  C  CD  . ARG B  1 86  ? -4.899  21.683  117.012 1.00 17.31  ? 193  ARG B CD  1 
ATOM   4268  N  NE  . ARG B  1 86  ? -5.259  20.281  117.213 1.00 20.36  ? 193  ARG B NE  1 
ATOM   4269  C  CZ  . ARG B  1 86  ? -6.416  19.731  116.850 1.00 19.29  ? 193  ARG B CZ  1 
ATOM   4270  N  NH1 . ARG B  1 86  ? -7.343  20.469  116.250 1.00 19.10  ? 193  ARG B NH1 1 
ATOM   4271  N  NH2 . ARG B  1 86  ? -6.650  18.443  117.098 1.00 17.93  ? 193  ARG B NH2 1 
ATOM   4272  N  N   . HIS B  1 87  ? -0.237  21.674  118.307 1.00 15.13  ? 194  HIS B N   1 
ATOM   4273  C  CA  . HIS B  1 87  ? 0.251   20.757  119.327 1.00 15.91  ? 194  HIS B CA  1 
ATOM   4274  C  C   . HIS B  1 87  ? 1.007   21.425  120.475 1.00 16.47  ? 194  HIS B C   1 
ATOM   4275  O  O   . HIS B  1 87  ? 0.684   21.224  121.651 1.00 15.91  ? 194  HIS B O   1 
ATOM   4276  C  CB  . HIS B  1 87  ? 1.108   19.672  118.658 1.00 14.75  ? 194  HIS B CB  1 
ATOM   4277  C  CG  . HIS B  1 87  ? 1.086   18.356  119.369 1.00 13.94  ? 194  HIS B CG  1 
ATOM   4278  N  ND1 . HIS B  1 87  ? 2.055   17.990  120.280 1.00 14.56  ? 194  HIS B ND1 1 
ATOM   4279  C  CD2 . HIS B  1 87  ? 0.214   17.316  119.306 1.00 16.34  ? 194  HIS B CD2 1 
ATOM   4280  C  CE1 . HIS B  1 87  ? 1.790   16.780  120.747 1.00 17.29  ? 194  HIS B CE1 1 
ATOM   4281  N  NE2 . HIS B  1 87  ? 0.681   16.355  120.170 1.00 17.15  ? 194  HIS B NE2 1 
ATOM   4282  N  N   . GLY B  1 88  ? 2.004   22.230  120.130 1.00 16.59  ? 195  GLY B N   1 
ATOM   4283  C  CA  . GLY B  1 88  ? 2.795   22.901  121.144 1.00 16.20  ? 195  GLY B CA  1 
ATOM   4284  C  C   . GLY B  1 88  ? 2.007   23.820  122.051 1.00 16.08  ? 195  GLY B C   1 
ATOM   4285  O  O   . GLY B  1 88  ? 2.186   23.813  123.270 1.00 15.71  ? 195  GLY B O   1 
ATOM   4286  N  N   . THR B  1 89  ? 1.131   24.617  121.453 1.00 16.10  ? 196  THR B N   1 
ATOM   4287  C  CA  . THR B  1 89  ? 0.316   25.543  122.210 1.00 15.27  ? 196  THR B CA  1 
ATOM   4288  C  C   . THR B  1 89  ? -0.580  24.828  123.203 1.00 15.81  ? 196  THR B C   1 
ATOM   4289  O  O   . THR B  1 89  ? -0.713  25.258  124.347 1.00 16.32  ? 196  THR B O   1 
ATOM   4290  C  CB  . THR B  1 89  ? -0.522  26.390  121.270 1.00 15.67  ? 196  THR B CB  1 
ATOM   4291  O  OG1 . THR B  1 89  ? 0.361   27.168  120.454 1.00 13.95  ? 196  THR B OG1 1 
ATOM   4292  C  CG2 . THR B  1 89  ? -1.451  27.316  122.050 1.00 14.18  ? 196  THR B CG2 1 
ATOM   4293  N  N   . ARG B  1 90  ? -1.188  23.728  122.782 1.00 16.54  ? 197  ARG B N   1 
ATOM   4294  C  CA  . ARG B  1 90  ? -2.054  22.989  123.687 1.00 17.12  ? 197  ARG B CA  1 
ATOM   4295  C  C   . ARG B  1 90  ? -1.267  22.469  124.875 1.00 17.27  ? 197  ARG B C   1 
ATOM   4296  O  O   . ARG B  1 90  ? -1.757  22.491  126.002 1.00 19.21  ? 197  ARG B O   1 
ATOM   4297  C  CB  . ARG B  1 90  ? -2.743  21.833  122.961 1.00 17.81  ? 197  ARG B CB  1 
ATOM   4298  C  CG  . ARG B  1 90  ? -3.716  22.298  121.898 1.00 17.11  ? 197  ARG B CG  1 
ATOM   4299  C  CD  . ARG B  1 90  ? -4.476  21.144  121.308 1.00 17.91  ? 197  ARG B CD  1 
ATOM   4300  N  NE  . ARG B  1 90  ? -5.551  21.619  120.445 1.00 19.18  ? 197  ARG B NE  1 
ATOM   4301  C  CZ  . ARG B  1 90  ? -6.572  20.866  120.056 1.00 18.84  ? 197  ARG B CZ  1 
ATOM   4302  N  NH1 . ARG B  1 90  ? -7.509  21.380  119.279 1.00 20.30  ? 197  ARG B NH1 1 
ATOM   4303  N  NH2 . ARG B  1 90  ? -6.652  19.601  120.446 1.00 17.95  ? 197  ARG B NH2 1 
ATOM   4304  N  N   . CYS B  1 91  ? -0.043  22.014  124.637 1.00 17.12  ? 198  CYS B N   1 
ATOM   4305  C  CA  . CYS B  1 91  ? 0.775   21.504  125.728 1.00 17.59  ? 198  CYS B CA  1 
ATOM   4306  C  C   . CYS B  1 91  ? 1.182   22.624  126.677 1.00 17.90  ? 198  CYS B C   1 
ATOM   4307  O  O   . CYS B  1 91  ? 1.204   22.443  127.898 1.00 19.14  ? 198  CYS B O   1 
ATOM   4308  C  CB  . CYS B  1 91  ? 2.017   20.808  125.174 1.00 17.73  ? 198  CYS B CB  1 
ATOM   4309  S  SG  . CYS B  1 91  ? 1.651   19.244  124.346 1.00 21.19  ? 198  CYS B SG  1 
ATOM   4310  N  N   . ALA B  1 92  ? 1.494   23.783  126.113 1.00 16.60  ? 199  ALA B N   1 
ATOM   4311  C  CA  . ALA B  1 92  ? 1.908   24.920  126.911 1.00 16.71  ? 199  ALA B CA  1 
ATOM   4312  C  C   . ALA B  1 92  ? 0.840   25.284  127.930 1.00 17.74  ? 199  ALA B C   1 
ATOM   4313  O  O   . ALA B  1 92  ? 1.123   25.447  129.112 1.00 17.65  ? 199  ALA B O   1 
ATOM   4314  C  CB  . ALA B  1 92  ? 2.190   26.102  126.006 1.00 16.40  ? 199  ALA B CB  1 
ATOM   4315  N  N   . GLY B  1 93  ? -0.392  25.409  127.456 1.00 19.19  ? 200  GLY B N   1 
ATOM   4316  C  CA  . GLY B  1 93  ? -1.485  25.772  128.332 1.00 19.87  ? 200  GLY B CA  1 
ATOM   4317  C  C   . GLY B  1 93  ? -1.664  24.846  129.509 1.00 20.95  ? 200  GLY B C   1 
ATOM   4318  O  O   . GLY B  1 93  ? -2.019  25.287  130.596 1.00 22.66  ? 200  GLY B O   1 
ATOM   4319  N  N   . GLU B  1 94  ? -1.424  23.559  129.301 1.00 21.34  ? 201  GLU B N   1 
ATOM   4320  C  CA  . GLU B  1 94  ? -1.584  22.590  130.376 1.00 21.59  ? 201  GLU B CA  1 
ATOM   4321  C  C   . GLU B  1 94  ? -0.575  22.781  131.481 1.00 20.38  ? 201  GLU B C   1 
ATOM   4322  O  O   . GLU B  1 94  ? -0.852  22.494  132.652 1.00 21.06  ? 201  GLU B O   1 
ATOM   4323  C  CB  . GLU B  1 94  ? -1.459  21.183  129.828 1.00 23.56  ? 201  GLU B CB  1 
ATOM   4324  C  CG  . GLU B  1 94  ? -2.587  20.812  128.937 1.00 26.41  ? 201  GLU B CG  1 
ATOM   4325  C  CD  . GLU B  1 94  ? -2.289  19.560  128.208 1.00 28.72  ? 201  GLU B CD  1 
ATOM   4326  O  OE1 . GLU B  1 94  ? -1.951  18.570  128.885 1.00 32.49  ? 201  GLU B OE1 1 
ATOM   4327  O  OE2 . GLU B  1 94  ? -2.381  19.567  126.968 1.00 30.85  ? 201  GLU B OE2 1 
ATOM   4328  N  N   . VAL B  1 95  ? 0.606   23.249  131.108 1.00 18.86  ? 202  VAL B N   1 
ATOM   4329  C  CA  . VAL B  1 95  ? 1.643   23.479  132.089 1.00 17.93  ? 202  VAL B CA  1 
ATOM   4330  C  C   . VAL B  1 95  ? 1.437   24.810  132.803 1.00 18.57  ? 202  VAL B C   1 
ATOM   4331  O  O   . VAL B  1 95  ? 1.375   24.867  134.034 1.00 17.98  ? 202  VAL B O   1 
ATOM   4332  C  CB  . VAL B  1 95  ? 3.044   23.517  131.453 1.00 16.90  ? 202  VAL B CB  1 
ATOM   4333  C  CG1 . VAL B  1 95  ? 4.083   23.780  132.534 1.00 16.83  ? 202  VAL B CG1 1 
ATOM   4334  C  CG2 . VAL B  1 95  ? 3.342   22.223  130.749 1.00 15.74  ? 202  VAL B CG2 1 
ATOM   4335  N  N   . ALA B  1 96  ? 1.301   25.884  132.035 1.00 18.88  ? 203  ALA B N   1 
ATOM   4336  C  CA  . ALA B  1 96  ? 1.193   27.186  132.659 1.00 19.14  ? 203  ALA B CA  1 
ATOM   4337  C  C   . ALA B  1 96  ? 0.213   28.183  132.078 1.00 19.59  ? 203  ALA B C   1 
ATOM   4338  O  O   . ALA B  1 96  ? 0.565   29.336  131.868 1.00 20.44  ? 203  ALA B O   1 
ATOM   4339  C  CB  . ALA B  1 96  ? 2.579   27.819  132.728 1.00 17.17  ? 203  ALA B CB  1 
ATOM   4340  N  N   . ALA B  1 97  ? -1.017  27.767  131.817 1.00 20.95  ? 204  ALA B N   1 
ATOM   4341  C  CA  . ALA B  1 97  ? -1.992  28.728  131.316 1.00 20.98  ? 204  ALA B CA  1 
ATOM   4342  C  C   . ALA B  1 97  ? -2.222  29.698  132.485 1.00 21.71  ? 204  ALA B C   1 
ATOM   4343  O  O   . ALA B  1 97  ? -2.268  29.279  133.650 1.00 21.30  ? 204  ALA B O   1 
ATOM   4344  C  CB  . ALA B  1 97  ? -3.287  28.026  130.955 1.00 20.52  ? 204  ALA B CB  1 
ATOM   4345  N  N   . VAL B  1 98  ? -2.361  30.987  132.180 1.00 21.71  ? 205  VAL B N   1 
ATOM   4346  C  CA  . VAL B  1 98  ? -2.569  31.995  133.220 1.00 22.44  ? 205  VAL B CA  1 
ATOM   4347  C  C   . VAL B  1 98  ? -3.856  31.795  134.028 1.00 22.33  ? 205  VAL B C   1 
ATOM   4348  O  O   . VAL B  1 98  ? -4.906  31.438  133.486 1.00 22.43  ? 205  VAL B O   1 
ATOM   4349  C  CB  . VAL B  1 98  ? -2.567  33.415  132.615 1.00 22.31  ? 205  VAL B CB  1 
ATOM   4350  C  CG1 . VAL B  1 98  ? -2.847  34.453  133.688 1.00 20.75  ? 205  VAL B CG1 1 
ATOM   4351  C  CG2 . VAL B  1 98  ? -1.226  33.684  131.975 1.00 22.56  ? 205  VAL B CG2 1 
ATOM   4352  N  N   . ALA B  1 99  ? -3.769  32.055  135.330 1.00 22.39  ? 206  ALA B N   1 
ATOM   4353  C  CA  . ALA B  1 99  ? -4.906  31.879  136.224 1.00 22.58  ? 206  ALA B CA  1 
ATOM   4354  C  C   . ALA B  1 99  ? -5.608  33.169  136.612 1.00 23.24  ? 206  ALA B C   1 
ATOM   4355  O  O   . ALA B  1 99  ? -5.013  34.244  136.602 1.00 23.68  ? 206  ALA B O   1 
ATOM   4356  C  CB  . ALA B  1 99  ? -4.458  31.162  137.473 1.00 23.25  ? 206  ALA B CB  1 
ATOM   4357  N  N   . ASN B  1 100 ? -6.886  33.043  136.954 1.00 23.18  ? 207  ASN B N   1 
ATOM   4358  C  CA  . ASN B  1 100 ? -7.703  34.175  137.379 1.00 23.61  ? 207  ASN B CA  1 
ATOM   4359  C  C   . ASN B  1 100 ? -7.683  35.354  136.421 1.00 24.41  ? 207  ASN B C   1 
ATOM   4360  O  O   . ASN B  1 100 ? -7.660  36.505  136.854 1.00 24.93  ? 207  ASN B O   1 
ATOM   4361  C  CB  . ASN B  1 100 ? -7.246  34.646  138.756 1.00 21.54  ? 207  ASN B CB  1 
ATOM   4362  C  CG  . ASN B  1 100 ? -7.332  33.559  139.797 1.00 21.83  ? 207  ASN B CG  1 
ATOM   4363  O  OD1 . ASN B  1 100 ? -8.418  33.075  140.112 1.00 22.20  ? 207  ASN B OD1 1 
ATOM   4364  N  ND2 . ASN B  1 100 ? -6.185  33.161  140.336 1.00 20.85  ? 207  ASN B ND2 1 
ATOM   4365  N  N   . ASN B  1 101 ? -7.696  35.077  135.124 1.00 24.85  ? 208  ASN B N   1 
ATOM   4366  C  CA  . ASN B  1 101 ? -7.672  36.144  134.137 1.00 24.56  ? 208  ASN B CA  1 
ATOM   4367  C  C   . ASN B  1 101 ? -8.923  36.074  133.278 1.00 25.60  ? 208  ASN B C   1 
ATOM   4368  O  O   . ASN B  1 101 ? -8.984  36.664  132.198 1.00 26.06  ? 208  ASN B O   1 
ATOM   4369  C  CB  . ASN B  1 101 ? -6.415  36.031  133.272 1.00 24.43  ? 208  ASN B CB  1 
ATOM   4370  C  CG  . ASN B  1 101 ? -6.431  34.817  132.372 1.00 25.81  ? 208  ASN B CG  1 
ATOM   4371  O  OD1 . ASN B  1 101 ? -7.118  33.829  132.645 1.00 25.92  ? 208  ASN B OD1 1 
ATOM   4372  N  ND2 . ASN B  1 101 ? -5.655  34.874  131.293 1.00 26.59  ? 208  ASN B ND2 1 
ATOM   4373  N  N   . GLY B  1 102 ? -9.923  35.341  133.767 1.00 26.04  ? 209  GLY B N   1 
ATOM   4374  C  CA  . GLY B  1 102 ? -11.179 35.212  133.047 1.00 25.96  ? 209  GLY B CA  1 
ATOM   4375  C  C   . GLY B  1 102 ? -11.090 34.564  131.680 1.00 26.85  ? 209  GLY B C   1 
ATOM   4376  O  O   . GLY B  1 102 ? -12.011 34.689  130.873 1.00 27.41  ? 209  GLY B O   1 
ATOM   4377  N  N   . VAL B  1 103 ? -9.993  33.865  131.409 1.00 26.77  ? 210  VAL B N   1 
ATOM   4378  C  CA  . VAL B  1 103 ? -9.838  33.200  130.126 1.00 25.62  ? 210  VAL B CA  1 
ATOM   4379  C  C   . VAL B  1 103 ? -9.568  31.709  130.258 1.00 26.17  ? 210  VAL B C   1 
ATOM   4380  O  O   . VAL B  1 103 ? -8.735  31.283  131.057 1.00 25.63  ? 210  VAL B O   1 
ATOM   4381  C  CB  . VAL B  1 103 ? -8.701  33.823  129.312 1.00 25.58  ? 210  VAL B CB  1 
ATOM   4382  C  CG1 . VAL B  1 103 ? -8.507  33.051  128.023 1.00 25.17  ? 210  VAL B CG1 1 
ATOM   4383  C  CG2 . VAL B  1 103 ? -9.019  35.277  129.005 1.00 26.02  ? 210  VAL B CG2 1 
ATOM   4384  N  N   . CYS B  1 104 ? -10.294 30.926  129.463 1.00 26.71  ? 211  CYS B N   1 
ATOM   4385  C  CA  . CYS B  1 104 ? -10.143 29.479  129.427 1.00 26.28  ? 211  CYS B CA  1 
ATOM   4386  C  C   . CYS B  1 104 ? -10.005 28.888  130.834 1.00 25.55  ? 211  CYS B C   1 
ATOM   4387  O  O   . CYS B  1 104 ? -10.831 29.161  131.713 1.00 26.08  ? 211  CYS B O   1 
ATOM   4388  C  CB  . CYS B  1 104 ? -8.922  29.163  128.562 1.00 27.96  ? 211  CYS B CB  1 
ATOM   4389  S  SG  . CYS B  1 104 ? -8.848  27.545  127.713 1.00 36.25  ? 211  CYS B SG  1 
ATOM   4390  N  N   . GLY B  1 105 ? -8.965  28.086  131.047 1.00 24.24  ? 212  GLY B N   1 
ATOM   4391  C  CA  . GLY B  1 105 ? -8.757  27.480  132.353 1.00 22.49  ? 212  GLY B CA  1 
ATOM   4392  C  C   . GLY B  1 105 ? -7.442  27.905  132.979 1.00 21.70  ? 212  GLY B C   1 
ATOM   4393  O  O   . GLY B  1 105 ? -7.052  29.076  132.897 1.00 20.59  ? 212  GLY B O   1 
ATOM   4394  N  N   . VAL B  1 106 ? -6.753  26.960  133.614 1.00 20.42  ? 213  VAL B N   1 
ATOM   4395  C  CA  . VAL B  1 106 ? -5.468  27.264  134.238 1.00 20.38  ? 213  VAL B CA  1 
ATOM   4396  C  C   . VAL B  1 106 ? -4.509  26.099  134.063 1.00 20.05  ? 213  VAL B C   1 
ATOM   4397  O  O   . VAL B  1 106 ? -4.938  24.975  133.852 1.00 20.90  ? 213  VAL B O   1 
ATOM   4398  C  CB  . VAL B  1 106 ? -5.615  27.540  135.767 1.00 20.16  ? 213  VAL B CB  1 
ATOM   4399  C  CG1 . VAL B  1 106 ? -6.708  28.565  136.014 1.00 20.32  ? 213  VAL B CG1 1 
ATOM   4400  C  CG2 . VAL B  1 106 ? -5.914  26.250  136.515 1.00 18.17  ? 213  VAL B CG2 1 
ATOM   4401  N  N   . GLY B  1 107 ? -3.211  26.370  134.146 1.00 19.92  ? 214  GLY B N   1 
ATOM   4402  C  CA  . GLY B  1 107 ? -2.238  25.302  134.031 1.00 19.07  ? 214  GLY B CA  1 
ATOM   4403  C  C   . GLY B  1 107 ? -1.920  24.768  135.415 1.00 18.56  ? 214  GLY B C   1 
ATOM   4404  O  O   . GLY B  1 107 ? -2.238  25.407  136.414 1.00 18.11  ? 214  GLY B O   1 
ATOM   4405  N  N   . VAL B  1 108 ? -1.302  23.593  135.495 1.00 19.72  ? 215  VAL B N   1 
ATOM   4406  C  CA  . VAL B  1 108 ? -0.955  23.025  136.797 1.00 18.81  ? 215  VAL B CA  1 
ATOM   4407  C  C   . VAL B  1 108 ? -0.053  23.999  137.554 1.00 19.29  ? 215  VAL B C   1 
ATOM   4408  O  O   . VAL B  1 108 ? -0.247  24.241  138.740 1.00 19.13  ? 215  VAL B O   1 
ATOM   4409  C  CB  . VAL B  1 108 ? -0.231  21.690  136.649 1.00 18.48  ? 215  VAL B CB  1 
ATOM   4410  C  CG1 . VAL B  1 108 ? 0.193   21.184  138.006 1.00 17.95  ? 215  VAL B CG1 1 
ATOM   4411  C  CG2 . VAL B  1 108 ? -1.140  20.689  135.965 1.00 19.10  ? 215  VAL B CG2 1 
ATOM   4412  N  N   . ALA B  1 109 ? 0.936   24.551  136.857 1.00 19.04  ? 216  ALA B N   1 
ATOM   4413  C  CA  . ALA B  1 109 ? 1.853   25.515  137.448 1.00 18.09  ? 216  ALA B CA  1 
ATOM   4414  C  C   . ALA B  1 109 ? 1.536   26.862  136.810 1.00 18.25  ? 216  ALA B C   1 
ATOM   4415  O  O   . ALA B  1 109 ? 2.331   27.396  136.032 1.00 17.33  ? 216  ALA B O   1 
ATOM   4416  C  CB  . ALA B  1 109 ? 3.280   25.116  137.150 1.00 18.04  ? 216  ALA B CB  1 
ATOM   4417  N  N   . TYR B  1 110 ? 0.373   27.411  137.154 1.00 19.34  ? 217  TYR B N   1 
ATOM   4418  C  CA  . TYR B  1 110 ? -0.068  28.675  136.569 1.00 21.38  ? 217  TYR B CA  1 
ATOM   4419  C  C   . TYR B  1 110 ? 0.765   29.916  136.880 1.00 21.20  ? 217  TYR B C   1 
ATOM   4420  O  O   . TYR B  1 110 ? 0.482   30.989  136.353 1.00 22.07  ? 217  TYR B O   1 
ATOM   4421  C  CB  . TYR B  1 110 ? -1.567  28.923  136.871 1.00 21.38  ? 217  TYR B CB  1 
ATOM   4422  C  CG  . TYR B  1 110 ? -1.961  28.953  138.332 1.00 22.87  ? 217  TYR B CG  1 
ATOM   4423  C  CD1 . TYR B  1 110 ? -1.582  30.013  139.162 1.00 23.76  ? 217  TYR B CD1 1 
ATOM   4424  C  CD2 . TYR B  1 110 ? -2.762  27.948  138.873 1.00 23.86  ? 217  TYR B CD2 1 
ATOM   4425  C  CE1 . TYR B  1 110 ? -2.000  30.077  140.495 1.00 23.85  ? 217  TYR B CE1 1 
ATOM   4426  C  CE2 . TYR B  1 110 ? -3.185  27.998  140.206 1.00 24.79  ? 217  TYR B CE2 1 
ATOM   4427  C  CZ  . TYR B  1 110 ? -2.804  29.068  141.011 1.00 25.45  ? 217  TYR B CZ  1 
ATOM   4428  O  OH  . TYR B  1 110 ? -3.249  29.137  142.319 1.00 24.56  ? 217  TYR B OH  1 
ATOM   4429  N  N   . ASN B  1 111 ? 1.793   29.776  137.713 1.00 21.27  ? 218  ASN B N   1 
ATOM   4430  C  CA  . ASN B  1 111 ? 2.663   30.911  138.010 1.00 21.50  ? 218  ASN B CA  1 
ATOM   4431  C  C   . ASN B  1 111 ? 4.076   30.685  137.481 1.00 22.31  ? 218  ASN B C   1 
ATOM   4432  O  O   . ASN B  1 111 ? 4.979   31.498  137.715 1.00 24.27  ? 218  ASN B O   1 
ATOM   4433  C  CB  . ASN B  1 111 ? 2.703   31.205  139.513 1.00 20.82  ? 218  ASN B CB  1 
ATOM   4434  C  CG  . ASN B  1 111 ? 1.524   32.046  139.962 1.00 19.93  ? 218  ASN B CG  1 
ATOM   4435  O  OD1 . ASN B  1 111 ? 1.140   32.997  139.275 1.00 21.83  ? 218  ASN B OD1 1 
ATOM   4436  N  ND2 . ASN B  1 111 ? 0.952   31.714  141.110 1.00 15.52  ? 218  ASN B ND2 1 
ATOM   4437  N  N   . ALA B  1 112 ? 4.264   29.582  136.763 1.00 21.52  ? 219  ALA B N   1 
ATOM   4438  C  CA  . ALA B  1 112 ? 5.559   29.261  136.187 1.00 20.02  ? 219  ALA B CA  1 
ATOM   4439  C  C   . ALA B  1 112 ? 5.711   30.036  134.891 1.00 20.24  ? 219  ALA B C   1 
ATOM   4440  O  O   . ALA B  1 112 ? 4.750   30.617  134.395 1.00 20.92  ? 219  ALA B O   1 
ATOM   4441  C  CB  . ALA B  1 112 ? 5.644   27.772  135.910 1.00 19.74  ? 219  ALA B CB  1 
ATOM   4442  N  N   . ARG B  1 113 ? 6.923   30.052  134.354 1.00 21.25  ? 220  ARG B N   1 
ATOM   4443  C  CA  . ARG B  1 113 ? 7.203   30.723  133.092 1.00 21.90  ? 220  ARG B CA  1 
ATOM   4444  C  C   . ARG B  1 113 ? 7.175   29.612  132.050 1.00 20.94  ? 220  ARG B C   1 
ATOM   4445  O  O   . ARG B  1 113 ? 7.749   28.539  132.260 1.00 19.94  ? 220  ARG B O   1 
ATOM   4446  C  CB  . ARG B  1 113 ? 8.587   31.371  133.143 1.00 25.77  ? 220  ARG B CB  1 
ATOM   4447  C  CG  . ARG B  1 113 ? 8.726   32.390  134.256 1.00 29.57  ? 220  ARG B CG  1 
ATOM   4448  C  CD  . ARG B  1 113 ? 7.921   33.623  133.921 1.00 33.76  ? 220  ARG B CD  1 
ATOM   4449  N  NE  . ARG B  1 113 ? 8.584   34.416  132.887 1.00 38.16  ? 220  ARG B NE  1 
ATOM   4450  C  CZ  . ARG B  1 113 ? 8.029   35.451  132.251 1.00 40.58  ? 220  ARG B CZ  1 
ATOM   4451  N  NH1 . ARG B  1 113 ? 8.729   36.113  131.328 1.00 39.68  ? 220  ARG B NH1 1 
ATOM   4452  N  NH2 . ARG B  1 113 ? 6.773   35.821  132.526 1.00 40.68  ? 220  ARG B NH2 1 
ATOM   4453  N  N   . ILE B  1 114 ? 6.513   29.862  130.927 1.00 19.65  ? 221  ILE B N   1 
ATOM   4454  C  CA  . ILE B  1 114 ? 6.403   28.850  129.892 1.00 17.02  ? 221  ILE B CA  1 
ATOM   4455  C  C   . ILE B  1 114 ? 7.002   29.311  128.574 1.00 17.91  ? 221  ILE B C   1 
ATOM   4456  O  O   . ILE B  1 114 ? 6.759   30.431  128.126 1.00 18.48  ? 221  ILE B O   1 
ATOM   4457  C  CB  . ILE B  1 114 ? 4.914   28.472  129.677 1.00 15.79  ? 221  ILE B CB  1 
ATOM   4458  C  CG1 . ILE B  1 114 ? 4.801   27.208  128.830 1.00 14.51  ? 221  ILE B CG1 1 
ATOM   4459  C  CG2 . ILE B  1 114 ? 4.176   29.619  129.039 1.00 12.52  ? 221  ILE B CG2 1 
ATOM   4460  C  CD1 . ILE B  1 114 ? 5.339   25.975  129.517 1.00 14.14  ? 221  ILE B CD1 1 
ATOM   4461  N  N   . GLY B  1 115 ? 7.792   28.439  127.957 1.00 18.72  ? 222  GLY B N   1 
ATOM   4462  C  CA  . GLY B  1 115 ? 8.404   28.765  126.680 1.00 18.50  ? 222  GLY B CA  1 
ATOM   4463  C  C   . GLY B  1 115 ? 8.152   27.641  125.697 1.00 19.16  ? 222  GLY B C   1 
ATOM   4464  O  O   . GLY B  1 115 ? 7.632   26.589  126.066 1.00 20.12  ? 222  GLY B O   1 
ATOM   4465  N  N   . GLY B  1 116 ? 8.510   27.855  124.442 1.00 18.81  ? 223  GLY B N   1 
ATOM   4466  C  CA  . GLY B  1 116 ? 8.307   26.818  123.455 1.00 18.15  ? 223  GLY B CA  1 
ATOM   4467  C  C   . GLY B  1 116 ? 9.435   26.735  122.447 1.00 19.03  ? 223  GLY B C   1 
ATOM   4468  O  O   . GLY B  1 116 ? 10.018  27.750  122.056 1.00 19.75  ? 223  GLY B O   1 
ATOM   4469  N  N   . VAL B  1 117 ? 9.761   25.519  122.029 1.00 18.58  ? 224  VAL B N   1 
ATOM   4470  C  CA  . VAL B  1 117 ? 10.798  25.327  121.035 1.00 17.29  ? 224  VAL B CA  1 
ATOM   4471  C  C   . VAL B  1 117 ? 10.146  24.717  119.815 1.00 17.58  ? 224  VAL B C   1 
ATOM   4472  O  O   . VAL B  1 117 ? 9.623   23.609  119.877 1.00 19.13  ? 224  VAL B O   1 
ATOM   4473  C  CB  . VAL B  1 117 ? 11.887  24.374  121.522 1.00 16.36  ? 224  VAL B CB  1 
ATOM   4474  C  CG1 . VAL B  1 117 ? 12.946  24.227  120.450 1.00 16.59  ? 224  VAL B CG1 1 
ATOM   4475  C  CG2 . VAL B  1 117 ? 12.496  24.893  122.804 1.00 15.56  ? 224  VAL B CG2 1 
ATOM   4476  N  N   . ARG B  1 118 ? 10.154  25.458  118.715 1.00 18.32  ? 225  ARG B N   1 
ATOM   4477  C  CA  . ARG B  1 118 ? 9.590   24.993  117.456 1.00 17.29  ? 225  ARG B CA  1 
ATOM   4478  C  C   . ARG B  1 118 ? 10.658  24.120  116.792 1.00 17.48  ? 225  ARG B C   1 
ATOM   4479  O  O   . ARG B  1 118 ? 11.673  24.626  116.298 1.00 17.37  ? 225  ARG B O   1 
ATOM   4480  C  CB  . ARG B  1 118 ? 9.241   26.198  116.579 1.00 16.23  ? 225  ARG B CB  1 
ATOM   4481  C  CG  . ARG B  1 118 ? 8.649   25.846  115.232 1.00 18.37  ? 225  ARG B CG  1 
ATOM   4482  C  CD  . ARG B  1 118 ? 8.059   27.068  114.546 1.00 18.09  ? 225  ARG B CD  1 
ATOM   4483  N  NE  . ARG B  1 118 ? 7.515   26.733  113.233 1.00 21.75  ? 225  ARG B NE  1 
ATOM   4484  C  CZ  . ARG B  1 118 ? 8.206   26.779  112.098 1.00 21.63  ? 225  ARG B CZ  1 
ATOM   4485  N  NH1 . ARG B  1 118 ? 7.625   26.443  110.952 1.00 21.12  ? 225  ARG B NH1 1 
ATOM   4486  N  NH2 . ARG B  1 118 ? 9.474   27.177  112.106 1.00 23.66  ? 225  ARG B NH2 1 
ATOM   4487  N  N   . MET B  1 119 ? 10.449  22.804  116.805 1.00 17.24  ? 226  MET B N   1 
ATOM   4488  C  CA  . MET B  1 119 ? 11.426  21.910  116.205 1.00 16.91  ? 226  MET B CA  1 
ATOM   4489  C  C   . MET B  1 119 ? 10.863  20.695  115.492 1.00 16.85  ? 226  MET B C   1 
ATOM   4490  O  O   . MET B  1 119 ? 11.615  19.876  114.973 1.00 17.49  ? 226  MET B O   1 
ATOM   4491  C  CB  . MET B  1 119 ? 12.439  21.473  117.265 1.00 18.23  ? 226  MET B CB  1 
ATOM   4492  C  CG  . MET B  1 119 ? 11.848  21.104  118.627 1.00 18.06  ? 226  MET B CG  1 
ATOM   4493  S  SD  . MET B  1 119 ? 11.276  19.399  118.745 1.00 20.14  ? 226  MET B SD  1 
ATOM   4494  C  CE  . MET B  1 119 ? 12.810  18.507  118.717 1.00 15.63  ? 226  MET B CE  1 
ATOM   4495  N  N   . LEU B  1 120 ? 9.545   20.578  115.448 1.00 17.11  ? 227  LEU B N   1 
ATOM   4496  C  CA  . LEU B  1 120 ? 8.917   19.443  114.786 1.00 17.17  ? 227  LEU B CA  1 
ATOM   4497  C  C   . LEU B  1 120 ? 8.394   19.805  113.421 1.00 18.12  ? 227  LEU B C   1 
ATOM   4498  O  O   . LEU B  1 120 ? 8.099   18.931  112.619 1.00 18.32  ? 227  LEU B O   1 
ATOM   4499  C  CB  . LEU B  1 120 ? 7.753   18.910  115.620 1.00 16.45  ? 227  LEU B CB  1 
ATOM   4500  C  CG  . LEU B  1 120 ? 8.121   18.206  116.920 1.00 16.06  ? 227  LEU B CG  1 
ATOM   4501  C  CD1 . LEU B  1 120 ? 6.852   17.711  117.596 1.00 15.32  ? 227  LEU B CD1 1 
ATOM   4502  C  CD2 . LEU B  1 120 ? 9.067   17.051  116.619 1.00 15.57  ? 227  LEU B CD2 1 
ATOM   4503  N  N   . ASP B  1 121 ? 8.266   21.100  113.161 1.00 20.93  ? 228  ASP B N   1 
ATOM   4504  C  CA  . ASP B  1 121 ? 7.739   21.557  111.886 1.00 22.13  ? 228  ASP B CA  1 
ATOM   4505  C  C   . ASP B  1 121 ? 8.817   21.630  110.818 1.00 22.34  ? 228  ASP B C   1 
ATOM   4506  O  O   . ASP B  1 121 ? 9.138   22.698  110.311 1.00 22.41  ? 228  ASP B O   1 
ATOM   4507  C  CB  . ASP B  1 121 ? 7.074   22.918  112.053 1.00 23.40  ? 228  ASP B CB  1 
ATOM   4508  C  CG  . ASP B  1 121 ? 6.088   23.221  110.939 1.00 24.48  ? 228  ASP B CG  1 
ATOM   4509  O  OD1 . ASP B  1 121 ? 5.498   24.324  110.955 1.00 25.11  ? 228  ASP B OD1 1 
ATOM   4510  O  OD2 . ASP B  1 121 ? 5.906   22.353  110.052 1.00 24.58  ? 228  ASP B OD2 1 
ATOM   4511  N  N   . GLY B  1 122 ? 9.374   20.475  110.487 1.00 22.66  ? 229  GLY B N   1 
ATOM   4512  C  CA  . GLY B  1 122 ? 10.402  20.401  109.466 1.00 22.46  ? 229  GLY B CA  1 
ATOM   4513  C  C   . GLY B  1 122 ? 11.101  19.067  109.606 1.00 23.32  ? 229  GLY B C   1 
ATOM   4514  O  O   . GLY B  1 122 ? 10.563  18.151  110.238 1.00 24.58  ? 229  GLY B O   1 
ATOM   4515  N  N   . GLU B  1 123 ? 12.289  18.942  109.023 1.00 23.63  ? 230  GLU B N   1 
ATOM   4516  C  CA  . GLU B  1 123 ? 13.050  17.697  109.138 1.00 23.26  ? 230  GLU B CA  1 
ATOM   4517  C  C   . GLU B  1 123 ? 13.621  17.676  110.554 1.00 22.34  ? 230  GLU B C   1 
ATOM   4518  O  O   . GLU B  1 123 ? 14.393  18.564  110.936 1.00 22.79  ? 230  GLU B O   1 
ATOM   4519  C  CB  . GLU B  1 123 ? 14.183  17.651  108.105 1.00 22.97  ? 230  GLU B CB  1 
ATOM   4520  C  CG  . GLU B  1 123 ? 15.097  16.449  108.252 0.00 24.61  ? 230  GLU B CG  1 
ATOM   4521  C  CD  . GLU B  1 123 ? 16.151  16.385  107.167 0.00 25.45  ? 230  GLU B CD  1 
ATOM   4522  O  OE1 . GLU B  1 123 ? 16.427  17.432  106.544 0.00 25.89  ? 230  GLU B OE1 1 
ATOM   4523  O  OE2 . GLU B  1 123 ? 16.712  15.292  106.945 0.00 25.90  ? 230  GLU B OE2 1 
ATOM   4524  N  N   . VAL B  1 124 ? 13.226  16.681  111.340 1.00 20.26  ? 231  VAL B N   1 
ATOM   4525  C  CA  . VAL B  1 124 ? 13.698  16.586  112.711 1.00 16.80  ? 231  VAL B CA  1 
ATOM   4526  C  C   . VAL B  1 124 ? 14.980  15.783  112.740 1.00 17.41  ? 231  VAL B C   1 
ATOM   4527  O  O   . VAL B  1 124 ? 14.965  14.573  112.988 1.00 17.59  ? 231  VAL B O   1 
ATOM   4528  C  CB  . VAL B  1 124 ? 12.648  15.919  113.592 1.00 16.13  ? 231  VAL B CB  1 
ATOM   4529  C  CG1 . VAL B  1 124 ? 13.095  15.930  115.027 1.00 16.16  ? 231  VAL B CG1 1 
ATOM   4530  C  CG2 . VAL B  1 124 ? 11.311  16.641  113.429 1.00 14.51  ? 231  VAL B CG2 1 
ATOM   4531  N  N   . THR B  1 125 ? 16.090  16.470  112.478 1.00 16.46  ? 232  THR B N   1 
ATOM   4532  C  CA  . THR B  1 125 ? 17.406  15.849  112.451 1.00 14.68  ? 232  THR B CA  1 
ATOM   4533  C  C   . THR B  1 125 ? 17.964  15.659  113.851 1.00 15.09  ? 232  THR B C   1 
ATOM   4534  O  O   . THR B  1 125 ? 17.414  16.163  114.827 1.00 14.59  ? 232  THR B O   1 
ATOM   4535  C  CB  . THR B  1 125 ? 18.418  16.707  111.675 1.00 14.30  ? 232  THR B CB  1 
ATOM   4536  O  OG1 . THR B  1 125 ? 18.659  17.930  112.387 1.00 15.73  ? 232  THR B OG1 1 
ATOM   4537  C  CG2 . THR B  1 125 ? 17.889  17.031  110.289 1.00 13.28  ? 232  THR B CG2 1 
ATOM   4538  N  N   . ASP B  1 126 ? 19.065  14.922  113.932 1.00 14.80  ? 233  ASP B N   1 
ATOM   4539  C  CA  . ASP B  1 126 ? 19.736  14.665  115.194 1.00 14.78  ? 233  ASP B CA  1 
ATOM   4540  C  C   . ASP B  1 126 ? 20.151  16.016  115.800 1.00 14.36  ? 233  ASP B C   1 
ATOM   4541  O  O   . ASP B  1 126 ? 19.927  16.282  116.983 1.00 13.90  ? 233  ASP B O   1 
ATOM   4542  C  CB  . ASP B  1 126 ? 20.974  13.804  114.940 1.00 15.27  ? 233  ASP B CB  1 
ATOM   4543  C  CG  . ASP B  1 126 ? 21.635  13.341  116.217 1.00 16.14  ? 233  ASP B CG  1 
ATOM   4544  O  OD1 . ASP B  1 126 ? 22.848  13.068  116.173 1.00 18.33  ? 233  ASP B OD1 1 
ATOM   4545  O  OD2 . ASP B  1 126 ? 20.956  13.232  117.262 1.00 17.48  ? 233  ASP B OD2 1 
ATOM   4546  N  N   . ALA B  1 127 ? 20.746  16.866  114.969 1.00 13.07  ? 234  ALA B N   1 
ATOM   4547  C  CA  . ALA B  1 127 ? 21.193  18.177  115.399 1.00 12.31  ? 234  ALA B CA  1 
ATOM   4548  C  C   . ALA B  1 127 ? 20.033  19.015  115.933 1.00 13.75  ? 234  ALA B C   1 
ATOM   4549  O  O   . ALA B  1 127 ? 20.201  19.773  116.891 1.00 13.18  ? 234  ALA B O   1 
ATOM   4550  C  CB  . ALA B  1 127 ? 21.871  18.885  114.254 1.00 10.60  ? 234  ALA B CB  1 
ATOM   4551  N  N   . VAL B  1 128 ? 18.854  18.879  115.327 1.00 14.10  ? 235  VAL B N   1 
ATOM   4552  C  CA  . VAL B  1 128 ? 17.694  19.640  115.782 1.00 14.21  ? 235  VAL B CA  1 
ATOM   4553  C  C   . VAL B  1 128 ? 17.255  19.188  117.167 1.00 14.83  ? 235  VAL B C   1 
ATOM   4554  O  O   . VAL B  1 128 ? 16.947  20.020  118.031 1.00 15.59  ? 235  VAL B O   1 
ATOM   4555  C  CB  . VAL B  1 128 ? 16.507  19.515  114.799 1.00 14.29  ? 235  VAL B CB  1 
ATOM   4556  C  CG1 . VAL B  1 128 ? 15.224  20.052  115.429 1.00 13.14  ? 235  VAL B CG1 1 
ATOM   4557  C  CG2 . VAL B  1 128 ? 16.803  20.308  113.552 1.00 13.95  ? 235  VAL B CG2 1 
ATOM   4558  N  N   . GLU B  1 129 ? 17.231  17.877  117.389 1.00 14.68  ? 236  GLU B N   1 
ATOM   4559  C  CA  . GLU B  1 129 ? 16.827  17.353  118.690 1.00 14.26  ? 236  GLU B CA  1 
ATOM   4560  C  C   . GLU B  1 129 ? 17.867  17.745  119.748 1.00 14.26  ? 236  GLU B C   1 
ATOM   4561  O  O   . GLU B  1 129 ? 17.513  18.159  120.860 1.00 14.30  ? 236  GLU B O   1 
ATOM   4562  C  CB  . GLU B  1 129 ? 16.674  15.831  118.639 1.00 12.51  ? 236  GLU B CB  1 
ATOM   4563  C  CG  . GLU B  1 129 ? 15.676  15.337  117.592 1.00 11.94  ? 236  GLU B CG  1 
ATOM   4564  C  CD  . GLU B  1 129 ? 15.363  13.846  117.722 1.00 13.15  ? 236  GLU B CD  1 
ATOM   4565  O  OE1 . GLU B  1 129 ? 16.174  13.105  118.315 1.00 11.44  ? 236  GLU B OE1 1 
ATOM   4566  O  OE2 . GLU B  1 129 ? 14.309  13.403  117.214 1.00 14.60  ? 236  GLU B OE2 1 
ATOM   4567  N  N   . ALA B  1 130 ? 19.144  17.643  119.394 1.00 13.20  ? 237  ALA B N   1 
ATOM   4568  C  CA  . ALA B  1 130 ? 20.209  17.992  120.324 1.00 13.62  ? 237  ALA B CA  1 
ATOM   4569  C  C   . ALA B  1 130 ? 20.168  19.474  120.737 1.00 15.10  ? 237  ALA B C   1 
ATOM   4570  O  O   . ALA B  1 130 ? 20.415  19.816  121.897 1.00 15.05  ? 237  ALA B O   1 
ATOM   4571  C  CB  . ALA B  1 130 ? 21.546  17.654  119.717 1.00 12.22  ? 237  ALA B CB  1 
ATOM   4572  N  N   . ARG B  1 131 ? 19.853  20.350  119.790 1.00 15.74  ? 238  ARG B N   1 
ATOM   4573  C  CA  . ARG B  1 131 ? 19.788  21.772  120.080 1.00 17.57  ? 238  ARG B CA  1 
ATOM   4574  C  C   . ARG B  1 131 ? 18.550  22.083  120.917 1.00 18.23  ? 238  ARG B C   1 
ATOM   4575  O  O   . ARG B  1 131 ? 18.563  22.990  121.747 1.00 19.70  ? 238  ARG B O   1 
ATOM   4576  C  CB  . ARG B  1 131 ? 19.766  22.582  118.784 1.00 17.48  ? 238  ARG B CB  1 
ATOM   4577  C  CG  . ARG B  1 131 ? 21.019  22.421  117.941 1.00 21.97  ? 238  ARG B CG  1 
ATOM   4578  C  CD  . ARG B  1 131 ? 21.047  23.430  116.808 1.00 25.19  ? 238  ARG B CD  1 
ATOM   4579  N  NE  . ARG B  1 131 ? 21.231  24.780  117.335 1.00 30.30  ? 238  ARG B NE  1 
ATOM   4580  C  CZ  . ARG B  1 131 ? 20.616  25.861  116.860 1.00 33.09  ? 238  ARG B CZ  1 
ATOM   4581  N  NH1 . ARG B  1 131 ? 20.855  27.045  117.413 1.00 33.97  ? 238  ARG B NH1 1 
ATOM   4582  N  NH2 . ARG B  1 131 ? 19.756  25.759  115.840 1.00 33.83  ? 238  ARG B NH2 1 
ATOM   4583  N  N   . SER B  1 132 ? 17.482  21.322  120.706 1.00 18.60  ? 239  SER B N   1 
ATOM   4584  C  CA  . SER B  1 132 ? 16.247  21.526  121.452 1.00 17.57  ? 239  SER B CA  1 
ATOM   4585  C  C   . SER B  1 132 ? 16.403  21.033  122.882 1.00 18.29  ? 239  SER B C   1 
ATOM   4586  O  O   . SER B  1 132 ? 16.112  21.755  123.835 1.00 19.35  ? 239  SER B O   1 
ATOM   4587  C  CB  . SER B  1 132 ? 15.105  20.789  120.770 1.00 16.54  ? 239  SER B CB  1 
ATOM   4588  O  OG  . SER B  1 132 ? 14.924  21.302  119.462 1.00 18.11  ? 239  SER B OG  1 
ATOM   4589  N  N   . LEU B  1 133 ? 16.874  19.801  123.027 1.00 18.04  ? 240  LEU B N   1 
ATOM   4590  C  CA  . LEU B  1 133 ? 17.088  19.209  124.342 1.00 17.92  ? 240  LEU B CA  1 
ATOM   4591  C  C   . LEU B  1 133 ? 18.114  20.003  125.169 1.00 18.18  ? 240  LEU B C   1 
ATOM   4592  O  O   . LEU B  1 133 ? 18.034  20.045  126.399 1.00 19.28  ? 240  LEU B O   1 
ATOM   4593  C  CB  . LEU B  1 133 ? 17.572  17.759  124.173 1.00 16.89  ? 240  LEU B CB  1 
ATOM   4594  C  CG  . LEU B  1 133 ? 16.632  16.548  124.281 1.00 16.60  ? 240  LEU B CG  1 
ATOM   4595  C  CD1 . LEU B  1 133 ? 15.181  16.962  124.360 1.00 14.48  ? 240  LEU B CD1 1 
ATOM   4596  C  CD2 . LEU B  1 133 ? 16.888  15.633  123.103 1.00 14.19  ? 240  LEU B CD2 1 
ATOM   4597  N  N   . GLY B  1 134 ? 19.071  20.630  124.495 1.00 18.11  ? 241  GLY B N   1 
ATOM   4598  C  CA  . GLY B  1 134 ? 20.091  21.379  125.204 1.00 18.89  ? 241  GLY B CA  1 
ATOM   4599  C  C   . GLY B  1 134 ? 19.959  22.891  125.183 1.00 20.21  ? 241  GLY B C   1 
ATOM   4600  O  O   . GLY B  1 134 ? 20.950  23.596  125.374 1.00 21.05  ? 241  GLY B O   1 
ATOM   4601  N  N   . LEU B  1 135 ? 18.746  23.393  124.970 1.00 20.10  ? 242  LEU B N   1 
ATOM   4602  C  CA  . LEU B  1 135 ? 18.506  24.832  124.924 1.00 20.71  ? 242  LEU B CA  1 
ATOM   4603  C  C   . LEU B  1 135 ? 18.434  25.445  126.327 1.00 22.13  ? 242  LEU B C   1 
ATOM   4604  O  O   . LEU B  1 135 ? 17.587  25.063  127.131 1.00 21.74  ? 242  LEU B O   1 
ATOM   4605  C  CB  . LEU B  1 135 ? 17.200  25.095  124.169 1.00 20.51  ? 242  LEU B CB  1 
ATOM   4606  C  CG  . LEU B  1 135 ? 16.649  26.515  124.101 1.00 19.87  ? 242  LEU B CG  1 
ATOM   4607  C  CD1 . LEU B  1 135 ? 17.469  27.349  123.167 1.00 20.42  ? 242  LEU B CD1 1 
ATOM   4608  C  CD2 . LEU B  1 135 ? 15.236  26.465  123.607 1.00 20.95  ? 242  LEU B CD2 1 
ATOM   4609  N  N   . ASN B  1 136 ? 19.326  26.392  126.616 1.00 23.51  ? 243  ASN B N   1 
ATOM   4610  C  CA  . ASN B  1 136 ? 19.344  27.073  127.911 1.00 23.27  ? 243  ASN B CA  1 
ATOM   4611  C  C   . ASN B  1 136 ? 19.309  26.149  129.107 1.00 21.45  ? 243  ASN B C   1 
ATOM   4612  O  O   . ASN B  1 136 ? 18.457  26.290  129.980 1.00 21.04  ? 243  ASN B O   1 
ATOM   4613  C  CB  . ASN B  1 136 ? 18.155  28.011  128.025 1.00 27.75  ? 243  ASN B CB  1 
ATOM   4614  C  CG  . ASN B  1 136 ? 18.413  29.350  127.401 1.00 33.16  ? 243  ASN B CG  1 
ATOM   4615  O  OD1 . ASN B  1 136 ? 18.466  29.480  126.164 1.00 36.29  ? 243  ASN B OD1 1 
ATOM   4616  N  ND2 . ASN B  1 136 ? 18.585  30.373  128.250 1.00 34.01  ? 243  ASN B ND2 1 
ATOM   4617  N  N   . PRO B  1 137 ? 20.250  25.215  129.192 1.00 20.57  ? 244  PRO B N   1 
ATOM   4618  C  CA  . PRO B  1 137 ? 20.279  24.278  130.314 1.00 19.38  ? 244  PRO B CA  1 
ATOM   4619  C  C   . PRO B  1 137 ? 20.208  24.940  131.688 1.00 20.03  ? 244  PRO B C   1 
ATOM   4620  O  O   . PRO B  1 137 ? 19.713  24.341  132.636 1.00 20.32  ? 244  PRO B O   1 
ATOM   4621  C  CB  . PRO B  1 137 ? 21.589  23.538  130.109 1.00 19.69  ? 244  PRO B CB  1 
ATOM   4622  C  CG  . PRO B  1 137 ? 21.817  23.651  128.634 1.00 21.49  ? 244  PRO B CG  1 
ATOM   4623  C  CD  . PRO B  1 137 ? 21.444  25.066  128.353 1.00 20.42  ? 244  PRO B CD  1 
ATOM   4624  N  N   . ASN B  1 138 ? 20.702  26.171  131.808 1.00 20.26  ? 245  ASN B N   1 
ATOM   4625  C  CA  . ASN B  1 138 ? 20.673  26.850  133.102 1.00 20.16  ? 245  ASN B CA  1 
ATOM   4626  C  C   . ASN B  1 138 ? 19.548  27.852  133.314 1.00 19.41  ? 245  ASN B C   1 
ATOM   4627  O  O   . ASN B  1 138 ? 19.508  28.530  134.334 1.00 19.57  ? 245  ASN B O   1 
ATOM   4628  C  CB  . ASN B  1 138 ? 22.012  27.518  133.385 1.00 19.95  ? 245  ASN B CB  1 
ATOM   4629  C  CG  . ASN B  1 138 ? 23.119  26.512  133.595 1.00 21.36  ? 245  ASN B CG  1 
ATOM   4630  O  OD1 . ASN B  1 138 ? 22.995  25.588  134.408 1.00 21.58  ? 245  ASN B OD1 1 
ATOM   4631  N  ND2 . ASN B  1 138 ? 24.214  26.683  132.864 1.00 21.92  ? 245  ASN B ND2 1 
ATOM   4632  N  N   . HIS B  1 139 ? 18.638  27.953  132.355 1.00 19.20  ? 246  HIS B N   1 
ATOM   4633  C  CA  . HIS B  1 139 ? 17.501  28.851  132.502 1.00 18.79  ? 246  HIS B CA  1 
ATOM   4634  C  C   . HIS B  1 139 ? 16.222  28.017  132.552 1.00 18.90  ? 246  HIS B C   1 
ATOM   4635  O  O   . HIS B  1 139 ? 15.315  28.293  133.346 1.00 18.77  ? 246  HIS B O   1 
ATOM   4636  C  CB  . HIS B  1 139 ? 17.412  29.830  131.340 1.00 18.54  ? 246  HIS B CB  1 
ATOM   4637  C  CG  . HIS B  1 139 ? 16.219  30.728  131.415 1.00 20.29  ? 246  HIS B CG  1 
ATOM   4638  N  ND1 . HIS B  1 139 ? 16.082  31.705  132.378 1.00 21.90  ? 246  HIS B ND1 1 
ATOM   4639  C  CD2 . HIS B  1 139 ? 15.079  30.761  130.684 1.00 22.02  ? 246  HIS B CD2 1 
ATOM   4640  C  CE1 . HIS B  1 139 ? 14.910  32.298  132.239 1.00 21.88  ? 246  HIS B CE1 1 
ATOM   4641  N  NE2 . HIS B  1 139 ? 14.281  31.743  131.217 1.00 21.85  ? 246  HIS B NE2 1 
ATOM   4642  N  N   . ILE B  1 140 ? 16.155  26.995  131.699 1.00 17.14  ? 247  ILE B N   1 
ATOM   4643  C  CA  . ILE B  1 140 ? 14.999  26.118  131.655 1.00 14.82  ? 247  ILE B CA  1 
ATOM   4644  C  C   . ILE B  1 140 ? 15.233  24.989  132.645 1.00 14.89  ? 247  ILE B C   1 
ATOM   4645  O  O   . ILE B  1 140 ? 16.286  24.360  132.614 1.00 14.96  ? 247  ILE B O   1 
ATOM   4646  C  CB  . ILE B  1 140 ? 14.821  25.512  130.251 1.00 14.46  ? 247  ILE B CB  1 
ATOM   4647  C  CG1 . ILE B  1 140 ? 14.679  26.627  129.214 1.00 12.56  ? 247  ILE B CG1 1 
ATOM   4648  C  CG2 . ILE B  1 140 ? 13.598  24.590  130.233 1.00 14.69  ? 247  ILE B CG2 1 
ATOM   4649  C  CD1 . ILE B  1 140 ? 14.719  26.146  127.791 1.00 9.15   ? 247  ILE B CD1 1 
ATOM   4650  N  N   . HIS B  1 141 ? 14.267  24.735  133.525 1.00 14.60  ? 248  HIS B N   1 
ATOM   4651  C  CA  . HIS B  1 141 ? 14.408  23.654  134.501 1.00 16.89  ? 248  HIS B CA  1 
ATOM   4652  C  C   . HIS B  1 141 ? 13.822  22.342  133.987 1.00 16.26  ? 248  HIS B C   1 
ATOM   4653  O  O   . HIS B  1 141 ? 14.394  21.272  134.191 1.00 15.34  ? 248  HIS B O   1 
ATOM   4654  C  CB  . HIS B  1 141 ? 13.682  23.971  135.813 1.00 18.34  ? 248  HIS B CB  1 
ATOM   4655  C  CG  . HIS B  1 141 ? 14.058  25.281  136.423 1.00 20.75  ? 248  HIS B CG  1 
ATOM   4656  N  ND1 . HIS B  1 141 ? 13.298  26.419  136.262 1.00 21.46  ? 248  HIS B ND1 1 
ATOM   4657  C  CD2 . HIS B  1 141 ? 15.109  25.633  137.198 1.00 20.14  ? 248  HIS B CD2 1 
ATOM   4658  C  CE1 . HIS B  1 141 ? 13.866  27.416  136.914 1.00 22.35  ? 248  HIS B CE1 1 
ATOM   4659  N  NE2 . HIS B  1 141 ? 14.966  26.966  137.490 1.00 22.14  ? 248  HIS B NE2 1 
ATOM   4660  N  N   . ILE B  1 142 ? 12.672  22.449  133.325 1.00 15.09  ? 249  ILE B N   1 
ATOM   4661  C  CA  . ILE B  1 142 ? 11.951  21.300  132.831 1.00 13.21  ? 249  ILE B CA  1 
ATOM   4662  C  C   . ILE B  1 142 ? 11.619  21.371  131.359 1.00 14.31  ? 249  ILE B C   1 
ATOM   4663  O  O   . ILE B  1 142 ? 11.121  22.393  130.879 1.00 15.85  ? 249  ILE B O   1 
ATOM   4664  C  CB  . ILE B  1 142 ? 10.638  21.152  133.607 1.00 12.34  ? 249  ILE B CB  1 
ATOM   4665  C  CG1 . ILE B  1 142 ? 10.938  21.023  135.098 1.00 9.59   ? 249  ILE B CG1 1 
ATOM   4666  C  CG2 . ILE B  1 142 ? 9.867   19.948  133.105 1.00 11.01  ? 249  ILE B CG2 1 
ATOM   4667  C  CD1 . ILE B  1 142 ? 9.763   21.279  135.973 1.00 8.72   ? 249  ILE B CD1 1 
ATOM   4668  N  N   . TYR B  1 143 ? 11.892  20.278  130.650 1.00 14.01  ? 250  TYR B N   1 
ATOM   4669  C  CA  . TYR B  1 143 ? 11.575  20.175  129.226 1.00 13.25  ? 250  TYR B CA  1 
ATOM   4670  C  C   . TYR B  1 143 ? 10.436  19.167  129.073 1.00 13.34  ? 250  TYR B C   1 
ATOM   4671  O  O   . TYR B  1 143 ? 10.476  18.086  129.654 1.00 15.18  ? 250  TYR B O   1 
ATOM   4672  C  CB  . TYR B  1 143 ? 12.770  19.675  128.432 1.00 12.04  ? 250  TYR B CB  1 
ATOM   4673  C  CG  . TYR B  1 143 ? 13.970  20.576  128.484 1.00 12.40  ? 250  TYR B CG  1 
ATOM   4674  C  CD1 . TYR B  1 143 ? 14.833  20.574  129.585 1.00 11.67  ? 250  TYR B CD1 1 
ATOM   4675  C  CD2 . TYR B  1 143 ? 14.257  21.429  127.421 1.00 11.45  ? 250  TYR B CD2 1 
ATOM   4676  C  CE1 . TYR B  1 143 ? 15.958  21.408  129.607 1.00 12.22  ? 250  TYR B CE1 1 
ATOM   4677  C  CE2 . TYR B  1 143 ? 15.364  22.256  127.434 1.00 11.19  ? 250  TYR B CE2 1 
ATOM   4678  C  CZ  . TYR B  1 143 ? 16.207  22.245  128.515 1.00 12.33  ? 250  TYR B CZ  1 
ATOM   4679  O  OH  . TYR B  1 143 ? 17.293  23.077  128.481 1.00 12.93  ? 250  TYR B OH  1 
ATOM   4680  N  N   . SER B  1 144 ? 9.417   19.523  128.305 1.00 12.91  ? 251  SER B N   1 
ATOM   4681  C  CA  . SER B  1 144 ? 8.288   18.633  128.086 1.00 12.59  ? 251  SER B CA  1 
ATOM   4682  C  C   . SER B  1 144 ? 8.220   18.265  126.601 1.00 12.68  ? 251  SER B C   1 
ATOM   4683  O  O   . SER B  1 144 ? 8.037   19.132  125.742 1.00 11.27  ? 251  SER B O   1 
ATOM   4684  C  CB  . SER B  1 144 ? 6.990   19.311  128.514 1.00 12.35  ? 251  SER B CB  1 
ATOM   4685  O  OG  . SER B  1 144 ? 5.886   18.448  128.302 1.00 14.75  ? 251  SER B OG  1 
ATOM   4686  N  N   . ALA B  1 145 ? 8.375   16.978  126.300 1.00 11.85  ? 252  ALA B N   1 
ATOM   4687  C  CA  . ALA B  1 145 ? 8.354   16.521  124.916 1.00 12.32  ? 252  ALA B CA  1 
ATOM   4688  C  C   . ALA B  1 145 ? 7.239   15.498  124.633 1.00 13.53  ? 252  ALA B C   1 
ATOM   4689  O  O   . ALA B  1 145 ? 7.275   14.355  125.117 1.00 15.26  ? 252  ALA B O   1 
ATOM   4690  C  CB  . ALA B  1 145 ? 9.723   15.939  124.551 1.00 9.37   ? 252  ALA B CB  1 
ATOM   4691  N  N   . SER B  1 146 ? 6.243   15.919  123.860 1.00 13.21  ? 253  SER B N   1 
ATOM   4692  C  CA  . SER B  1 146 ? 5.134   15.044  123.497 1.00 14.10  ? 253  SER B CA  1 
ATOM   4693  C  C   . SER B  1 146 ? 5.274   14.611  122.037 1.00 14.89  ? 253  SER B C   1 
ATOM   4694  O  O   . SER B  1 146 ? 4.490   15.016  121.171 1.00 16.32  ? 253  SER B O   1 
ATOM   4695  C  CB  . SER B  1 146 ? 3.802   15.762  123.694 1.00 13.85  ? 253  SER B CB  1 
ATOM   4696  O  OG  . SER B  1 146 ? 3.608   16.071  125.063 1.00 17.48  ? 253  SER B OG  1 
ATOM   4697  N  N   . TRP B  1 147 ? 6.293   13.803  121.769 1.00 13.54  ? 254  TRP B N   1 
ATOM   4698  C  CA  . TRP B  1 147 ? 6.552   13.297  120.433 1.00 13.05  ? 254  TRP B CA  1 
ATOM   4699  C  C   . TRP B  1 147 ? 7.554   12.172  120.527 1.00 13.46  ? 254  TRP B C   1 
ATOM   4700  O  O   . TRP B  1 147 ? 8.148   11.948  121.585 1.00 14.33  ? 254  TRP B O   1 
ATOM   4701  C  CB  . TRP B  1 147 ? 7.097   14.391  119.501 1.00 11.91  ? 254  TRP B CB  1 
ATOM   4702  C  CG  . TRP B  1 147 ? 8.248   15.191  120.052 1.00 13.31  ? 254  TRP B CG  1 
ATOM   4703  C  CD1 . TRP B  1 147 ? 8.169   16.380  120.724 1.00 12.87  ? 254  TRP B CD1 1 
ATOM   4704  C  CD2 . TRP B  1 147 ? 9.644   14.861  119.988 1.00 11.95  ? 254  TRP B CD2 1 
ATOM   4705  N  NE1 . TRP B  1 147 ? 9.421   16.808  121.079 1.00 13.40  ? 254  TRP B NE1 1 
ATOM   4706  C  CE2 . TRP B  1 147 ? 10.347  15.898  120.644 1.00 10.99  ? 254  TRP B CE2 1 
ATOM   4707  C  CE3 . TRP B  1 147 ? 10.369  13.792  119.442 1.00 11.55  ? 254  TRP B CE3 1 
ATOM   4708  C  CZ2 . TRP B  1 147 ? 11.740  15.901  120.770 1.00 10.34  ? 254  TRP B CZ2 1 
ATOM   4709  C  CZ3 . TRP B  1 147 ? 11.760  13.794  119.565 1.00 9.82   ? 254  TRP B CZ3 1 
ATOM   4710  C  CH2 . TRP B  1 147 ? 12.430  14.843  120.226 1.00 10.82  ? 254  TRP B CH2 1 
ATOM   4711  N  N   . GLY B  1 148 ? 7.733   11.460  119.420 1.00 12.71  ? 255  GLY B N   1 
ATOM   4712  C  CA  . GLY B  1 148 ? 8.682   10.365  119.395 1.00 12.29  ? 255  GLY B CA  1 
ATOM   4713  C  C   . GLY B  1 148 ? 8.617   9.633   118.072 1.00 12.42  ? 255  GLY B C   1 
ATOM   4714  O  O   . GLY B  1 148 ? 7.982   10.118  117.125 1.00 10.50  ? 255  GLY B O   1 
ATOM   4715  N  N   . PRO B  1 149 ? 9.265   8.460   117.974 1.00 11.78  ? 256  PRO B N   1 
ATOM   4716  C  CA  . PRO B  1 149 ? 9.247   7.685   116.732 1.00 12.03  ? 256  PRO B CA  1 
ATOM   4717  C  C   . PRO B  1 149 ? 7.807   7.306   116.402 1.00 13.41  ? 256  PRO B C   1 
ATOM   4718  O  O   . PRO B  1 149 ? 6.937   7.310   117.276 1.00 12.37  ? 256  PRO B O   1 
ATOM   4719  C  CB  . PRO B  1 149 ? 10.085  6.461   117.076 1.00 11.99  ? 256  PRO B CB  1 
ATOM   4720  C  CG  . PRO B  1 149 ? 10.969  6.934   118.210 1.00 11.48  ? 256  PRO B CG  1 
ATOM   4721  C  CD  . PRO B  1 149 ? 10.037  7.766   119.021 1.00 10.51  ? 256  PRO B CD  1 
ATOM   4722  N  N   . GLU B  1 150 ? 7.555   6.961   115.146 1.00 15.22  ? 257  GLU B N   1 
ATOM   4723  C  CA  . GLU B  1 150 ? 6.206   6.591   114.752 1.00 16.51  ? 257  GLU B CA  1 
ATOM   4724  C  C   . GLU B  1 150 ? 5.586   5.522   115.655 1.00 15.48  ? 257  GLU B C   1 
ATOM   4725  O  O   . GLU B  1 150 ? 6.228   4.552   116.044 1.00 14.45  ? 257  GLU B O   1 
ATOM   4726  C  CB  . GLU B  1 150 ? 6.183   6.131   113.304 1.00 19.26  ? 257  GLU B CB  1 
ATOM   4727  C  CG  . GLU B  1 150 ? 4.774   5.978   112.783 1.00 24.92  ? 257  GLU B CG  1 
ATOM   4728  C  CD  . GLU B  1 150 ? 4.718   5.834   111.280 1.00 28.37  ? 257  GLU B CD  1 
ATOM   4729  O  OE1 . GLU B  1 150 ? 3.587   5.711   110.743 1.00 30.63  ? 257  GLU B OE1 1 
ATOM   4730  O  OE2 . GLU B  1 150 ? 5.802   5.848   110.645 1.00 28.17  ? 257  GLU B OE2 1 
ATOM   4731  N  N   . ASP B  1 151 ? 4.321   5.718   116.001 1.00 16.00  ? 258  ASP B N   1 
ATOM   4732  C  CA  . ASP B  1 151 ? 3.619   4.764   116.859 1.00 16.88  ? 258  ASP B CA  1 
ATOM   4733  C  C   . ASP B  1 151 ? 2.778   3.781   116.049 1.00 17.22  ? 258  ASP B C   1 
ATOM   4734  O  O   . ASP B  1 151 ? 1.588   3.604   116.324 1.00 16.83  ? 258  ASP B O   1 
ATOM   4735  C  CB  . ASP B  1 151 ? 2.696   5.490   117.839 1.00 16.46  ? 258  ASP B CB  1 
ATOM   4736  C  CG  . ASP B  1 151 ? 3.453   6.278   118.886 1.00 16.99  ? 258  ASP B CG  1 
ATOM   4737  O  OD1 . ASP B  1 151 ? 4.471   5.755   119.410 1.00 12.28  ? 258  ASP B OD1 1 
ATOM   4738  O  OD2 . ASP B  1 151 ? 3.007   7.414   119.187 1.00 16.91  ? 258  ASP B OD2 1 
ATOM   4739  N  N   . ASP B  1 152 ? 3.395   3.145   115.057 1.00 17.18  ? 259  ASP B N   1 
ATOM   4740  C  CA  . ASP B  1 152 ? 2.695   2.199   114.206 1.00 16.36  ? 259  ASP B CA  1 
ATOM   4741  C  C   . ASP B  1 152 ? 2.838   0.771   114.719 1.00 17.25  ? 259  ASP B C   1 
ATOM   4742  O  O   . ASP B  1 152 ? 2.254   -0.164  114.150 1.00 18.48  ? 259  ASP B O   1 
ATOM   4743  C  CB  . ASP B  1 152 ? 3.228   2.295   112.771 1.00 16.29  ? 259  ASP B CB  1 
ATOM   4744  C  CG  . ASP B  1 152 ? 4.721   2.104   112.697 1.00 17.19  ? 259  ASP B CG  1 
ATOM   4745  O  OD1 . ASP B  1 152 ? 5.312   2.239   111.605 1.00 19.08  ? 259  ASP B OD1 1 
ATOM   4746  O  OD2 . ASP B  1 152 ? 5.308   1.815   113.750 1.00 17.44  ? 259  ASP B OD2 1 
ATOM   4747  N  N   . GLY B  1 153 ? 3.615   0.609   115.789 1.00 15.73  ? 260  GLY B N   1 
ATOM   4748  C  CA  . GLY B  1 153 ? 3.832   -0.703  116.367 1.00 14.02  ? 260  GLY B CA  1 
ATOM   4749  C  C   . GLY B  1 153 ? 4.748   -1.562  115.525 1.00 14.67  ? 260  GLY B C   1 
ATOM   4750  O  O   . GLY B  1 153 ? 4.758   -2.782  115.671 1.00 16.23  ? 260  GLY B O   1 
ATOM   4751  N  N   . LYS B  1 154 ? 5.518   -0.928  114.644 1.00 14.17  ? 261  LYS B N   1 
ATOM   4752  C  CA  . LYS B  1 154 ? 6.440   -1.633  113.759 1.00 13.29  ? 261  LYS B CA  1 
ATOM   4753  C  C   . LYS B  1 154 ? 7.854   -1.076  113.876 1.00 13.15  ? 261  LYS B C   1 
ATOM   4754  O  O   . LYS B  1 154 ? 8.813   -1.701  113.426 1.00 13.56  ? 261  LYS B O   1 
ATOM   4755  C  CB  . LYS B  1 154 ? 6.021   -1.473  112.296 1.00 14.48  ? 261  LYS B CB  1 
ATOM   4756  C  CG  . LYS B  1 154 ? 4.581   -1.724  111.980 1.00 17.87  ? 261  LYS B CG  1 
ATOM   4757  C  CD  . LYS B  1 154 ? 4.261   -1.224  110.572 1.00 21.62  ? 261  LYS B CD  1 
ATOM   4758  C  CE  . LYS B  1 154 ? 4.880   -2.096  109.474 1.00 25.65  ? 261  LYS B CE  1 
ATOM   4759  N  NZ  . LYS B  1 154 ? 4.188   -3.430  109.308 1.00 28.83  ? 261  LYS B NZ  1 
ATOM   4760  N  N   . THR B  1 155 ? 8.002   0.094   114.479 1.00 12.53  ? 262  THR B N   1 
ATOM   4761  C  CA  . THR B  1 155 ? 9.319   0.685   114.551 1.00 12.19  ? 262  THR B CA  1 
ATOM   4762  C  C   . THR B  1 155 ? 10.107  0.638   115.866 1.00 12.10  ? 262  THR B C   1 
ATOM   4763  O  O   . THR B  1 155 ? 9.555   0.609   116.966 1.00 12.63  ? 262  THR B O   1 
ATOM   4764  C  CB  . THR B  1 155 ? 9.245   2.135   113.991 1.00 13.05  ? 262  THR B CB  1 
ATOM   4765  O  OG1 . THR B  1 155 ? 9.862   3.065   114.888 1.00 16.67  ? 262  THR B OG1 1 
ATOM   4766  C  CG2 . THR B  1 155 ? 7.824   2.528   113.764 1.00 11.56  ? 262  THR B CG2 1 
ATOM   4767  N  N   . VAL B  1 156 ? 11.424  0.587   115.720 1.00 11.03  ? 263  VAL B N   1 
ATOM   4768  C  CA  . VAL B  1 156 ? 12.340  0.589   116.851 1.00 11.84  ? 263  VAL B CA  1 
ATOM   4769  C  C   . VAL B  1 156 ? 13.293  1.735   116.544 1.00 12.51  ? 263  VAL B C   1 
ATOM   4770  O  O   . VAL B  1 156 ? 14.116  1.625   115.647 1.00 12.64  ? 263  VAL B O   1 
ATOM   4771  C  CB  . VAL B  1 156 ? 13.156  -0.703  116.932 1.00 10.86  ? 263  VAL B CB  1 
ATOM   4772  C  CG1 . VAL B  1 156 ? 14.168  -0.570  118.048 1.00 10.08  ? 263  VAL B CG1 1 
ATOM   4773  C  CG2 . VAL B  1 156 ? 12.236  -1.904  117.176 1.00 9.85   ? 263  VAL B CG2 1 
ATOM   4774  N  N   . ASP B  1 157 ? 13.186  2.833   117.281 1.00 13.56  ? 264  ASP B N   1 
ATOM   4775  C  CA  . ASP B  1 157 ? 14.030  3.989   117.012 1.00 14.54  ? 264  ASP B CA  1 
ATOM   4776  C  C   . ASP B  1 157 ? 14.274  4.789   118.283 1.00 14.39  ? 264  ASP B C   1 
ATOM   4777  O  O   . ASP B  1 157 ? 13.484  4.743   119.215 1.00 15.42  ? 264  ASP B O   1 
ATOM   4778  C  CB  . ASP B  1 157 ? 13.349  4.856   115.945 1.00 16.26  ? 264  ASP B CB  1 
ATOM   4779  C  CG  . ASP B  1 157 ? 14.297  5.842   115.289 1.00 19.27  ? 264  ASP B CG  1 
ATOM   4780  O  OD1 . ASP B  1 157 ? 15.497  5.523   115.145 1.00 22.20  ? 264  ASP B OD1 1 
ATOM   4781  O  OD2 . ASP B  1 157 ? 13.841  6.936   114.893 1.00 20.81  ? 264  ASP B OD2 1 
ATOM   4782  N  N   . GLY B  1 158 ? 15.375  5.522   118.317 1.00 14.19  ? 265  GLY B N   1 
ATOM   4783  C  CA  . GLY B  1 158 ? 15.694  6.306   119.493 1.00 14.99  ? 265  GLY B CA  1 
ATOM   4784  C  C   . GLY B  1 158 ? 16.603  7.461   119.147 1.00 14.87  ? 265  GLY B C   1 
ATOM   4785  O  O   . GLY B  1 158 ? 16.897  7.682   117.970 1.00 17.12  ? 265  GLY B O   1 
ATOM   4786  N  N   . PRO B  1 159 ? 17.065  8.226   120.142 1.00 14.22  ? 266  PRO B N   1 
ATOM   4787  C  CA  . PRO B  1 159 ? 17.948  9.356   119.833 1.00 12.87  ? 266  PRO B CA  1 
ATOM   4788  C  C   . PRO B  1 159 ? 19.228  8.913   119.153 1.00 11.19  ? 266  PRO B C   1 
ATOM   4789  O  O   . PRO B  1 159 ? 19.725  7.828   119.418 1.00 10.96  ? 266  PRO B O   1 
ATOM   4790  C  CB  . PRO B  1 159 ? 18.198  9.988   121.207 1.00 12.66  ? 266  PRO B CB  1 
ATOM   4791  C  CG  . PRO B  1 159 ? 18.047  8.823   122.151 1.00 11.93  ? 266  PRO B CG  1 
ATOM   4792  C  CD  . PRO B  1 159 ? 16.845  8.101   121.593 1.00 13.88  ? 266  PRO B CD  1 
ATOM   4793  N  N   . ALA B  1 160 ? 19.746  9.746   118.258 1.00 11.69  ? 267  ALA B N   1 
ATOM   4794  C  CA  . ALA B  1 160 ? 20.992  9.436   117.563 1.00 12.20  ? 267  ALA B CA  1 
ATOM   4795  C  C   . ALA B  1 160 ? 22.181  9.975   118.381 1.00 12.44  ? 267  ALA B C   1 
ATOM   4796  O  O   . ALA B  1 160 ? 22.014  10.342  119.541 1.00 12.58  ? 267  ALA B O   1 
ATOM   4797  C  CB  . ALA B  1 160 ? 20.976  10.034  116.158 1.00 10.69  ? 267  ALA B CB  1 
ATOM   4798  N  N   . ARG B  1 161 ? 23.364  10.052  117.776 1.00 13.48  ? 268  ARG B N   1 
ATOM   4799  C  CA  . ARG B  1 161 ? 24.558  10.478  118.503 1.00 14.51  ? 268  ARG B CA  1 
ATOM   4800  C  C   . ARG B  1 161 ? 24.486  11.791  119.278 1.00 14.83  ? 268  ARG B C   1 
ATOM   4801  O  O   . ARG B  1 161 ? 24.743  11.796  120.480 1.00 15.12  ? 268  ARG B O   1 
ATOM   4802  C  CB  . ARG B  1 161 ? 25.766  10.542  117.573 1.00 17.30  ? 268  ARG B CB  1 
ATOM   4803  C  CG  . ARG B  1 161 ? 25.932  9.390   116.587 1.00 21.17  ? 268  ARG B CG  1 
ATOM   4804  C  CD  . ARG B  1 161 ? 26.626  8.181   117.156 1.00 23.43  ? 268  ARG B CD  1 
ATOM   4805  N  NE  . ARG B  1 161 ? 27.227  7.347   116.107 1.00 27.18  ? 268  ARG B NE  1 
ATOM   4806  C  CZ  . ARG B  1 161 ? 26.606  6.946   114.989 1.00 31.03  ? 268  ARG B CZ  1 
ATOM   4807  N  NH1 . ARG B  1 161 ? 25.343  7.296   114.731 1.00 30.93  ? 268  ARG B NH1 1 
ATOM   4808  N  NH2 . ARG B  1 161 ? 27.248  6.167   114.122 1.00 32.26  ? 268  ARG B NH2 1 
ATOM   4809  N  N   . LEU B  1 162 ? 24.151  12.894  118.606 1.00 14.42  ? 269  LEU B N   1 
ATOM   4810  C  CA  . LEU B  1 162 ? 24.107  14.196  119.262 1.00 13.20  ? 269  LEU B CA  1 
ATOM   4811  C  C   . LEU B  1 162 ? 22.999  14.329  120.279 1.00 14.30  ? 269  LEU B C   1 
ATOM   4812  O  O   . LEU B  1 162 ? 23.178  14.976  121.318 1.00 15.63  ? 269  LEU B O   1 
ATOM   4813  C  CB  . LEU B  1 162 ? 23.999  15.329  118.234 1.00 12.86  ? 269  LEU B CB  1 
ATOM   4814  C  CG  . LEU B  1 162 ? 25.228  15.573  117.343 1.00 13.29  ? 269  LEU B CG  1 
ATOM   4815  C  CD1 . LEU B  1 162 ? 24.951  16.751  116.422 1.00 9.78   ? 269  LEU B CD1 1 
ATOM   4816  C  CD2 . LEU B  1 162 ? 26.471  15.835  118.196 1.00 10.46  ? 269  LEU B CD2 1 
ATOM   4817  N  N   . ALA B  1 163 ? 21.851  13.729  119.988 1.00 13.66  ? 270  ALA B N   1 
ATOM   4818  C  CA  . ALA B  1 163 ? 20.733  13.790  120.921 1.00 12.80  ? 270  ALA B CA  1 
ATOM   4819  C  C   . ALA B  1 163 ? 21.084  12.999  122.176 1.00 12.23  ? 270  ALA B C   1 
ATOM   4820  O  O   . ALA B  1 163 ? 20.782  13.412  123.288 1.00 11.84  ? 270  ALA B O   1 
ATOM   4821  C  CB  . ALA B  1 163 ? 19.477  13.225  120.271 1.00 12.94  ? 270  ALA B CB  1 
ATOM   4822  N  N   . GLU B  1 164 ? 21.723  11.851  121.990 1.00 12.52  ? 271  GLU B N   1 
ATOM   4823  C  CA  . GLU B  1 164 ? 22.115  11.034  123.122 1.00 14.05  ? 271  GLU B CA  1 
ATOM   4824  C  C   . GLU B  1 164 ? 23.071  11.834  124.008 1.00 13.25  ? 271  GLU B C   1 
ATOM   4825  O  O   . GLU B  1 164 ? 22.957  11.792  125.231 1.00 14.19  ? 271  GLU B O   1 
ATOM   4826  C  CB  . GLU B  1 164 ? 22.786  9.743   122.656 1.00 14.06  ? 271  GLU B CB  1 
ATOM   4827  C  CG  . GLU B  1 164 ? 23.042  8.802   123.802 1.00 18.44  ? 271  GLU B CG  1 
ATOM   4828  C  CD  . GLU B  1 164 ? 21.761  8.175   124.325 1.00 21.30  ? 271  GLU B CD  1 
ATOM   4829  O  OE1 . GLU B  1 164 ? 21.678  7.823   125.529 1.00 19.12  ? 271  GLU B OE1 1 
ATOM   4830  O  OE2 . GLU B  1 164 ? 20.835  8.018   123.506 1.00 25.22  ? 271  GLU B OE2 1 
ATOM   4831  N  N   . GLU B  1 165 ? 24.005  12.554  123.387 1.00 12.52  ? 272  GLU B N   1 
ATOM   4832  C  CA  . GLU B  1 165 ? 24.945  13.391  124.123 1.00 12.66  ? 272  GLU B CA  1 
ATOM   4833  C  C   . GLU B  1 165 ? 24.170  14.492  124.852 1.00 12.64  ? 272  GLU B C   1 
ATOM   4834  O  O   . GLU B  1 165 ? 24.415  14.749  126.016 1.00 12.77  ? 272  GLU B O   1 
ATOM   4835  C  CB  . GLU B  1 165 ? 25.971  14.016  123.171 1.00 12.60  ? 272  GLU B CB  1 
ATOM   4836  C  CG  . GLU B  1 165 ? 27.109  13.091  122.794 1.00 13.15  ? 272  GLU B CG  1 
ATOM   4837  C  CD  . GLU B  1 165 ? 28.142  13.759  121.909 1.00 17.03  ? 272  GLU B CD  1 
ATOM   4838  O  OE1 . GLU B  1 165 ? 29.240  13.181  121.730 1.00 19.20  ? 272  GLU B OE1 1 
ATOM   4839  O  OE2 . GLU B  1 165 ? 27.863  14.859  121.383 1.00 17.10  ? 272  GLU B OE2 1 
ATOM   4840  N  N   . ALA B  1 166 ? 23.227  15.129  124.163 1.00 13.13  ? 273  ALA B N   1 
ATOM   4841  C  CA  . ALA B  1 166 ? 22.428  16.190  124.758 1.00 13.62  ? 273  ALA B CA  1 
ATOM   4842  C  C   . ALA B  1 166 ? 21.753  15.728  126.043 1.00 15.41  ? 273  ALA B C   1 
ATOM   4843  O  O   . ALA B  1 166 ? 21.764  16.438  127.053 1.00 17.32  ? 273  ALA B O   1 
ATOM   4844  C  CB  . ALA B  1 166 ? 21.385  16.660  123.774 1.00 13.20  ? 273  ALA B CB  1 
ATOM   4845  N  N   . PHE B  1 167 ? 21.158  14.541  126.003 1.00 15.58  ? 274  PHE B N   1 
ATOM   4846  C  CA  . PHE B  1 167 ? 20.469  13.983  127.159 1.00 13.78  ? 274  PHE B CA  1 
ATOM   4847  C  C   . PHE B  1 167 ? 21.415  13.840  128.332 1.00 13.73  ? 274  PHE B C   1 
ATOM   4848  O  O   . PHE B  1 167 ? 21.109  14.275  129.432 1.00 14.57  ? 274  PHE B O   1 
ATOM   4849  C  CB  . PHE B  1 167 ? 19.889  12.602  126.829 1.00 14.17  ? 274  PHE B CB  1 
ATOM   4850  C  CG  . PHE B  1 167 ? 18.482  12.632  126.294 1.00 13.69  ? 274  PHE B CG  1 
ATOM   4851  C  CD1 . PHE B  1 167 ? 18.139  11.896  125.161 1.00 12.32  ? 274  PHE B CD1 1 
ATOM   4852  C  CD2 . PHE B  1 167 ? 17.491  13.352  126.945 1.00 12.37  ? 274  PHE B CD2 1 
ATOM   4853  C  CE1 . PHE B  1 167 ? 16.838  11.880  124.693 1.00 11.48  ? 274  PHE B CE1 1 
ATOM   4854  C  CE2 . PHE B  1 167 ? 16.184  13.339  126.481 1.00 11.31  ? 274  PHE B CE2 1 
ATOM   4855  C  CZ  . PHE B  1 167 ? 15.859  12.600  125.353 1.00 11.98  ? 274  PHE B CZ  1 
ATOM   4856  N  N   . PHE B  1 168 ? 22.563  13.218  128.103 1.00 13.61  ? 275  PHE B N   1 
ATOM   4857  C  CA  . PHE B  1 168 ? 23.512  13.023  129.183 1.00 15.34  ? 275  PHE B CA  1 
ATOM   4858  C  C   . PHE B  1 168 ? 24.111  14.353  129.661 1.00 15.87  ? 275  PHE B C   1 
ATOM   4859  O  O   . PHE B  1 168 ? 24.281  14.582  130.860 1.00 16.38  ? 275  PHE B O   1 
ATOM   4860  C  CB  . PHE B  1 168 ? 24.613  12.068  128.737 1.00 15.76  ? 275  PHE B CB  1 
ATOM   4861  C  CG  . PHE B  1 168 ? 25.297  11.369  129.873 1.00 18.47  ? 275  PHE B CG  1 
ATOM   4862  C  CD1 . PHE B  1 168 ? 26.296  10.434  129.631 1.00 20.49  ? 275  PHE B CD1 1 
ATOM   4863  C  CD2 . PHE B  1 168 ? 24.939  11.646  131.193 1.00 18.20  ? 275  PHE B CD2 1 
ATOM   4864  C  CE1 . PHE B  1 168 ? 26.928  9.779   130.696 1.00 22.26  ? 275  PHE B CE1 1 
ATOM   4865  C  CE2 . PHE B  1 168 ? 25.558  11.008  132.255 1.00 18.36  ? 275  PHE B CE2 1 
ATOM   4866  C  CZ  . PHE B  1 168 ? 26.553  10.074  132.015 1.00 20.11  ? 275  PHE B CZ  1 
ATOM   4867  N  N   . ARG B  1 169 ? 24.409  15.227  128.713 1.00 14.50  ? 276  ARG B N   1 
ATOM   4868  C  CA  . ARG B  1 169 ? 24.963  16.525  129.017 1.00 14.88  ? 276  ARG B CA  1 
ATOM   4869  C  C   . ARG B  1 169 ? 23.982  17.318  129.876 1.00 15.17  ? 276  ARG B C   1 
ATOM   4870  O  O   . ARG B  1 169 ? 24.380  17.944  130.863 1.00 14.54  ? 276  ARG B O   1 
ATOM   4871  C  CB  . ARG B  1 169 ? 25.239  17.283  127.716 1.00 15.34  ? 276  ARG B CB  1 
ATOM   4872  C  CG  . ARG B  1 169 ? 26.018  18.558  127.890 1.00 13.98  ? 276  ARG B CG  1 
ATOM   4873  C  CD  . ARG B  1 169 ? 26.119  19.302  126.569 1.00 16.70  ? 276  ARG B CD  1 
ATOM   4874  N  NE  . ARG B  1 169 ? 26.942  20.498  126.697 1.00 16.08  ? 276  ARG B NE  1 
ATOM   4875  C  CZ  . ARG B  1 169 ? 28.267  20.477  126.768 1.00 16.52  ? 276  ARG B CZ  1 
ATOM   4876  N  NH1 . ARG B  1 169 ? 28.941  21.610  126.902 1.00 17.17  ? 276  ARG B NH1 1 
ATOM   4877  N  NH2 . ARG B  1 169 ? 28.917  19.326  126.682 1.00 14.00  ? 276  ARG B NH2 1 
ATOM   4878  N  N   . GLY B  1 170 ? 22.703  17.281  129.501 1.00 14.46  ? 277  GLY B N   1 
ATOM   4879  C  CA  . GLY B  1 170 ? 21.684  18.023  130.228 1.00 14.17  ? 277  GLY B CA  1 
ATOM   4880  C  C   . GLY B  1 170 ? 21.440  17.504  131.629 1.00 13.92  ? 277  GLY B C   1 
ATOM   4881  O  O   . GLY B  1 170 ? 21.170  18.250  132.571 1.00 13.78  ? 277  GLY B O   1 
ATOM   4882  N  N   . VAL B  1 171 ? 21.555  16.198  131.761 1.00 13.78  ? 278  VAL B N   1 
ATOM   4883  C  CA  . VAL B  1 171 ? 21.328  15.535  133.024 1.00 14.80  ? 278  VAL B CA  1 
ATOM   4884  C  C   . VAL B  1 171 ? 22.512  15.737  133.968 1.00 16.95  ? 278  VAL B C   1 
ATOM   4885  O  O   . VAL B  1 171 ? 22.356  15.666  135.193 1.00 18.56  ? 278  VAL B O   1 
ATOM   4886  C  CB  . VAL B  1 171 ? 21.041  14.028  132.746 1.00 12.70  ? 278  VAL B CB  1 
ATOM   4887  C  CG1 . VAL B  1 171 ? 21.930  13.154  133.533 1.00 11.28  ? 278  VAL B CG1 1 
ATOM   4888  C  CG2 . VAL B  1 171 ? 19.590  13.724  133.023 1.00 12.08  ? 278  VAL B CG2 1 
ATOM   4889  N  N   . SER B  1 172 ? 23.682  16.014  133.396 1.00 17.05  ? 279  SER B N   1 
ATOM   4890  C  CA  . SER B  1 172 ? 24.903  16.219  134.169 1.00 19.07  ? 279  SER B CA  1 
ATOM   4891  C  C   . SER B  1 172 ? 25.214  17.679  134.500 1.00 19.61  ? 279  SER B C   1 
ATOM   4892  O  O   . SER B  1 172 ? 25.631  18.001  135.616 1.00 19.85  ? 279  SER B O   1 
ATOM   4893  C  CB  . SER B  1 172 ? 26.101  15.663  133.409 1.00 19.43  ? 279  SER B CB  1 
ATOM   4894  O  OG  . SER B  1 172 ? 25.893  14.318  133.037 1.00 24.51  ? 279  SER B OG  1 
ATOM   4895  N  N   . GLN B  1 173 ? 25.005  18.552  133.523 1.00 19.02  ? 280  GLN B N   1 
ATOM   4896  C  CA  . GLN B  1 173 ? 25.327  19.959  133.671 1.00 18.51  ? 280  GLN B CA  1 
ATOM   4897  C  C   . GLN B  1 173 ? 24.144  20.917  133.753 1.00 18.15  ? 280  GLN B C   1 
ATOM   4898  O  O   . GLN B  1 173 ? 24.297  22.062  134.187 1.00 19.37  ? 280  GLN B O   1 
ATOM   4899  C  CB  . GLN B  1 173 ? 26.232  20.355  132.512 1.00 17.59  ? 280  GLN B CB  1 
ATOM   4900  C  CG  . GLN B  1 173 ? 27.465  19.494  132.422 1.00 19.11  ? 280  GLN B CG  1 
ATOM   4901  C  CD  . GLN B  1 173 ? 28.183  19.633  131.106 1.00 21.41  ? 280  GLN B CD  1 
ATOM   4902  O  OE1 . GLN B  1 173 ? 27.943  20.576  130.347 1.00 23.16  ? 280  GLN B OE1 1 
ATOM   4903  N  NE2 . GLN B  1 173 ? 29.082  18.696  130.826 1.00 21.63  ? 280  GLN B NE2 1 
ATOM   4904  N  N   . GLY B  1 174 ? 22.973  20.463  133.332 1.00 16.06  ? 281  GLY B N   1 
ATOM   4905  C  CA  . GLY B  1 174 ? 21.807  21.325  133.374 1.00 15.13  ? 281  GLY B CA  1 
ATOM   4906  C  C   . GLY B  1 174 ? 21.489  21.778  134.783 1.00 14.91  ? 281  GLY B C   1 
ATOM   4907  O  O   . GLY B  1 174 ? 21.899  21.139  135.753 1.00 13.68  ? 281  GLY B O   1 
ATOM   4908  N  N   . ARG B  1 175 ? 20.750  22.877  134.898 1.00 15.21  ? 282  ARG B N   1 
ATOM   4909  C  CA  . ARG B  1 175 ? 20.377  23.412  136.200 1.00 15.48  ? 282  ARG B CA  1 
ATOM   4910  C  C   . ARG B  1 175 ? 21.581  23.458  137.129 1.00 16.77  ? 282  ARG B C   1 
ATOM   4911  O  O   . ARG B  1 175 ? 21.537  22.973  138.257 1.00 17.27  ? 282  ARG B O   1 
ATOM   4912  C  CB  . ARG B  1 175 ? 19.276  22.562  136.819 1.00 14.39  ? 282  ARG B CB  1 
ATOM   4913  C  CG  . ARG B  1 175 ? 17.915  22.782  136.188 1.00 15.47  ? 282  ARG B CG  1 
ATOM   4914  C  CD  . ARG B  1 175 ? 16.957  21.681  136.582 1.00 13.94  ? 282  ARG B CD  1 
ATOM   4915  N  NE  . ARG B  1 175 ? 16.741  21.670  138.014 1.00 14.13  ? 282  ARG B NE  1 
ATOM   4916  C  CZ  . ARG B  1 175 ? 16.781  20.584  138.770 1.00 13.37  ? 282  ARG B CZ  1 
ATOM   4917  N  NH1 . ARG B  1 175 ? 17.030  19.402  138.238 1.00 12.47  ? 282  ARG B NH1 1 
ATOM   4918  N  NH2 . ARG B  1 175 ? 16.576  20.694  140.068 1.00 16.22  ? 282  ARG B NH2 1 
ATOM   4919  N  N   . GLY B  1 176 ? 22.672  24.025  136.628 1.00 17.16  ? 283  GLY B N   1 
ATOM   4920  C  CA  . GLY B  1 176 ? 23.872  24.142  137.425 1.00 16.04  ? 283  GLY B CA  1 
ATOM   4921  C  C   . GLY B  1 176 ? 24.366  22.846  138.018 1.00 16.53  ? 283  GLY B C   1 
ATOM   4922  O  O   . GLY B  1 176 ? 24.925  22.847  139.115 1.00 16.66  ? 283  GLY B O   1 
ATOM   4923  N  N   . GLY B  1 177 ? 24.165  21.737  137.307 1.00 16.67  ? 284  GLY B N   1 
ATOM   4924  C  CA  . GLY B  1 177 ? 24.642  20.456  137.802 1.00 14.21  ? 284  GLY B CA  1 
ATOM   4925  C  C   . GLY B  1 177 ? 23.599  19.597  138.481 1.00 14.26  ? 284  GLY B C   1 
ATOM   4926  O  O   . GLY B  1 177 ? 23.870  18.454  138.818 1.00 14.51  ? 284  GLY B O   1 
ATOM   4927  N  N   . LEU B  1 178 ? 22.408  20.134  138.701 1.00 14.36  ? 285  LEU B N   1 
ATOM   4928  C  CA  . LEU B  1 178 ? 21.355  19.344  139.327 1.00 14.53  ? 285  LEU B CA  1 
ATOM   4929  C  C   . LEU B  1 178 ? 20.708  18.428  138.272 1.00 14.61  ? 285  LEU B C   1 
ATOM   4930  O  O   . LEU B  1 178 ? 20.102  17.407  138.605 1.00 13.70  ? 285  LEU B O   1 
ATOM   4931  C  CB  . LEU B  1 178 ? 20.307  20.263  139.953 1.00 14.45  ? 285  LEU B CB  1 
ATOM   4932  C  CG  . LEU B  1 178 ? 20.789  21.116  141.127 1.00 13.27  ? 285  LEU B CG  1 
ATOM   4933  C  CD1 . LEU B  1 178 ? 19.648  21.974  141.622 1.00 12.35  ? 285  LEU B CD1 1 
ATOM   4934  C  CD2 . LEU B  1 178 ? 21.299  20.231  142.243 1.00 13.20  ? 285  LEU B CD2 1 
ATOM   4935  N  N   . GLY B  1 179 ? 20.852  18.810  137.003 1.00 13.91  ? 286  GLY B N   1 
ATOM   4936  C  CA  . GLY B  1 179 ? 20.320  18.023  135.906 1.00 12.85  ? 286  GLY B CA  1 
ATOM   4937  C  C   . GLY B  1 179 ? 19.003  18.491  135.322 1.00 13.61  ? 286  GLY B C   1 
ATOM   4938  O  O   . GLY B  1 179 ? 18.050  18.747  136.057 1.00 14.16  ? 286  GLY B O   1 
ATOM   4939  N  N   . SER B  1 180 ? 18.950  18.616  133.996 1.00 12.96  ? 287  SER B N   1 
ATOM   4940  C  CA  . SER B  1 180 ? 17.725  19.022  133.313 1.00 12.40  ? 287  SER B CA  1 
ATOM   4941  C  C   . SER B  1 180 ? 16.701  17.944  133.564 1.00 12.71  ? 287  SER B C   1 
ATOM   4942  O  O   . SER B  1 180 ? 17.049  16.774  133.697 1.00 14.18  ? 287  SER B O   1 
ATOM   4943  C  CB  . SER B  1 180 ? 17.933  19.101  131.801 1.00 11.98  ? 287  SER B CB  1 
ATOM   4944  O  OG  . SER B  1 180 ? 18.848  20.115  131.445 1.00 14.84  ? 287  SER B OG  1 
ATOM   4945  N  N   . ILE B  1 181 ? 15.435  18.318  133.623 1.00 11.82  ? 288  ILE B N   1 
ATOM   4946  C  CA  . ILE B  1 181 ? 14.411  17.313  133.820 1.00 11.88  ? 288  ILE B CA  1 
ATOM   4947  C  C   . ILE B  1 181 ? 13.637  17.163  132.528 1.00 11.22  ? 288  ILE B C   1 
ATOM   4948  O  O   . ILE B  1 181 ? 12.974  18.094  132.071 1.00 11.86  ? 288  ILE B O   1 
ATOM   4949  C  CB  . ILE B  1 181 ? 13.475  17.685  134.972 1.00 11.99  ? 288  ILE B CB  1 
ATOM   4950  C  CG1 . ILE B  1 181 ? 14.246  17.569  136.289 1.00 11.51  ? 288  ILE B CG1 1 
ATOM   4951  C  CG2 . ILE B  1 181 ? 12.275  16.749  134.996 1.00 10.58  ? 288  ILE B CG2 1 
ATOM   4952  C  CD1 . ILE B  1 181 ? 13.575  18.230  137.446 1.00 14.04  ? 288  ILE B CD1 1 
ATOM   4953  N  N   . PHE B  1 182 ? 13.750  15.986  131.928 1.00 10.37  ? 289  PHE B N   1 
ATOM   4954  C  CA  . PHE B  1 182 ? 13.069  15.703  130.671 1.00 10.24  ? 289  PHE B CA  1 
ATOM   4955  C  C   . PHE B  1 182 ? 11.823  14.848  130.874 1.00 9.58   ? 289  PHE B C   1 
ATOM   4956  O  O   . PHE B  1 182 ? 11.922  13.691  131.247 1.00 9.77   ? 289  PHE B O   1 
ATOM   4957  C  CB  . PHE B  1 182 ? 14.017  14.983  129.726 1.00 8.33   ? 289  PHE B CB  1 
ATOM   4958  C  CG  . PHE B  1 182 ? 15.266  15.738  129.439 1.00 6.77   ? 289  PHE B CG  1 
ATOM   4959  C  CD1 . PHE B  1 182 ? 16.474  15.341  129.992 1.00 6.95   ? 289  PHE B CD1 1 
ATOM   4960  C  CD2 . PHE B  1 182 ? 15.252  16.819  128.570 1.00 6.99   ? 289  PHE B CD2 1 
ATOM   4961  C  CE1 . PHE B  1 182 ? 17.654  16.012  129.674 1.00 5.42   ? 289  PHE B CE1 1 
ATOM   4962  C  CE2 . PHE B  1 182 ? 16.432  17.496  128.250 1.00 5.33   ? 289  PHE B CE2 1 
ATOM   4963  C  CZ  . PHE B  1 182 ? 17.626  17.088  128.800 1.00 4.92   ? 289  PHE B CZ  1 
ATOM   4964  N  N   . VAL B  1 183 ? 10.659  15.433  130.620 1.00 10.44  ? 290  VAL B N   1 
ATOM   4965  C  CA  . VAL B  1 183 ? 9.383   14.740  130.767 1.00 11.21  ? 290  VAL B CA  1 
ATOM   4966  C  C   . VAL B  1 183 ? 8.928   14.306  129.378 1.00 11.34  ? 290  VAL B C   1 
ATOM   4967  O  O   . VAL B  1 183 ? 8.914   15.114  128.448 1.00 11.48  ? 290  VAL B O   1 
ATOM   4968  C  CB  . VAL B  1 183 ? 8.328   15.675  131.409 1.00 10.21  ? 290  VAL B CB  1 
ATOM   4969  C  CG1 . VAL B  1 183 ? 6.993   14.973  131.515 1.00 10.02  ? 290  VAL B CG1 1 
ATOM   4970  C  CG2 . VAL B  1 183 ? 8.799   16.103  132.791 1.00 8.82   ? 290  VAL B CG2 1 
ATOM   4971  N  N   . TRP B  1 184 ? 8.557   13.035  129.239 1.00 11.26  ? 291  TRP B N   1 
ATOM   4972  C  CA  . TRP B  1 184 ? 8.146   12.499  127.937 1.00 12.10  ? 291  TRP B CA  1 
ATOM   4973  C  C   . TRP B  1 184 ? 6.786   11.800  127.912 1.00 12.21  ? 291  TRP B C   1 
ATOM   4974  O  O   . TRP B  1 184 ? 6.393   11.151  128.882 1.00 12.31  ? 291  TRP B O   1 
ATOM   4975  C  CB  . TRP B  1 184 ? 9.213   11.513  127.440 1.00 11.09  ? 291  TRP B CB  1 
ATOM   4976  C  CG  . TRP B  1 184 ? 9.600   11.719  126.015 1.00 10.83  ? 291  TRP B CG  1 
ATOM   4977  C  CD1 . TRP B  1 184 ? 8.951   11.257  124.917 1.00 10.06  ? 291  TRP B CD1 1 
ATOM   4978  C  CD2 . TRP B  1 184 ? 10.689  12.514  125.535 1.00 9.64   ? 291  TRP B CD2 1 
ATOM   4979  N  NE1 . TRP B  1 184 ? 9.563   11.717  123.777 1.00 9.84   ? 291  TRP B NE1 1 
ATOM   4980  C  CE2 . TRP B  1 184 ? 10.635  12.491  124.131 1.00 9.85   ? 291  TRP B CE2 1 
ATOM   4981  C  CE3 . TRP B  1 184 ? 11.706  13.246  126.159 1.00 10.48  ? 291  TRP B CE3 1 
ATOM   4982  C  CZ2 . TRP B  1 184 ? 11.556  13.176  123.335 1.00 10.38  ? 291  TRP B CZ2 1 
ATOM   4983  C  CZ3 . TRP B  1 184 ? 12.621  13.929  125.366 1.00 10.96  ? 291  TRP B CZ3 1 
ATOM   4984  C  CH2 . TRP B  1 184 ? 12.538  13.887  123.970 1.00 10.33  ? 291  TRP B CH2 1 
ATOM   4985  N  N   . ALA B  1 185 ? 6.082   11.935  126.788 1.00 12.77  ? 292  ALA B N   1 
ATOM   4986  C  CA  . ALA B  1 185 ? 4.781   11.289  126.591 1.00 11.88  ? 292  ALA B CA  1 
ATOM   4987  C  C   . ALA B  1 185 ? 5.112   9.878   126.114 1.00 13.32  ? 292  ALA B C   1 
ATOM   4988  O  O   . ALA B  1 185 ? 5.850   9.712   125.138 1.00 13.26  ? 292  ALA B O   1 
ATOM   4989  C  CB  . ALA B  1 185 ? 3.992   12.019  125.542 1.00 9.06   ? 292  ALA B CB  1 
ATOM   4990  N  N   . SER B  1 186 ? 4.567   8.863   126.787 1.00 14.55  ? 293  SER B N   1 
ATOM   4991  C  CA  . SER B  1 186 ? 4.885   7.472   126.451 1.00 15.29  ? 293  SER B CA  1 
ATOM   4992  C  C   . SER B  1 186 ? 4.467   6.929   125.086 1.00 15.50  ? 293  SER B C   1 
ATOM   4993  O  O   . SER B  1 186 ? 5.026   5.932   124.631 1.00 16.10  ? 293  SER B O   1 
ATOM   4994  C  CB  . SER B  1 186 ? 4.381   6.530   127.544 1.00 14.04  ? 293  SER B CB  1 
ATOM   4995  O  OG  . SER B  1 186 ? 2.976   6.505   127.586 1.00 16.35  ? 293  SER B OG  1 
ATOM   4996  N  N   . GLY B  1 187 ? 3.505   7.557   124.423 1.00 14.90  ? 294  GLY B N   1 
ATOM   4997  C  CA  . GLY B  1 187 ? 3.129   7.062   123.107 1.00 15.32  ? 294  GLY B CA  1 
ATOM   4998  C  C   . GLY B  1 187 ? 1.649   6.811   122.904 1.00 16.56  ? 294  GLY B C   1 
ATOM   4999  O  O   . GLY B  1 187 ? 0.934   6.482   123.852 1.00 14.67  ? 294  GLY B O   1 
ATOM   5000  N  N   . ASN B  1 188 ? 1.186   6.971   121.662 1.00 16.04  ? 295  ASN B N   1 
ATOM   5001  C  CA  . ASN B  1 188 ? -0.222  6.755   121.343 1.00 15.53  ? 295  ASN B CA  1 
ATOM   5002  C  C   . ASN B  1 188 ? -0.479  5.530   120.467 1.00 15.89  ? 295  ASN B C   1 
ATOM   5003  O  O   . ASN B  1 188 ? -1.541  5.410   119.882 1.00 16.48  ? 295  ASN B O   1 
ATOM   5004  C  CB  . ASN B  1 188 ? -0.808  7.974   120.635 1.00 14.64  ? 295  ASN B CB  1 
ATOM   5005  C  CG  . ASN B  1 188 ? -0.742  9.229   121.469 1.00 14.76  ? 295  ASN B CG  1 
ATOM   5006  O  OD1 . ASN B  1 188 ? -0.871  9.189   122.693 1.00 15.40  ? 295  ASN B OD1 1 
ATOM   5007  N  ND2 . ASN B  1 188 ? -0.568  10.361  120.804 1.00 14.05  ? 295  ASN B ND2 1 
ATOM   5008  N  N   . GLY B  1 189 ? 0.474   4.614   120.381 1.00 16.97  ? 296  GLY B N   1 
ATOM   5009  C  CA  . GLY B  1 189 ? 0.273   3.451   119.533 1.00 18.30  ? 296  GLY B CA  1 
ATOM   5010  C  C   . GLY B  1 189 ? -0.484  2.273   120.129 1.00 19.37  ? 296  GLY B C   1 
ATOM   5011  O  O   . GLY B  1 189 ? -0.353  1.148   119.649 1.00 19.13  ? 296  GLY B O   1 
ATOM   5012  N  N   . GLY B  1 190 ? -1.280  2.517   121.161 1.00 19.76  ? 297  GLY B N   1 
ATOM   5013  C  CA  . GLY B  1 190 ? -2.013  1.429   121.784 1.00 21.08  ? 297  GLY B CA  1 
ATOM   5014  C  C   . GLY B  1 190 ? -2.801  0.554   120.824 1.00 22.53  ? 297  GLY B C   1 
ATOM   5015  O  O   . GLY B  1 190 ? -2.705  -0.672  120.850 1.00 22.07  ? 297  GLY B O   1 
ATOM   5016  N  N   . ARG B  1 191 ? -3.590  1.187   119.970 1.00 24.01  ? 298  ARG B N   1 
ATOM   5017  C  CA  . ARG B  1 191 ? -4.405  0.467   119.009 1.00 25.54  ? 298  ARG B CA  1 
ATOM   5018  C  C   . ARG B  1 191 ? -3.552  -0.451  118.108 1.00 25.24  ? 298  ARG B C   1 
ATOM   5019  O  O   . ARG B  1 191 ? -4.041  -1.462  117.611 1.00 26.38  ? 298  ARG B O   1 
ATOM   5020  C  CB  . ARG B  1 191 ? -5.208  1.493   118.207 1.00 27.46  ? 298  ARG B CB  1 
ATOM   5021  C  CG  . ARG B  1 191 ? -6.268  0.949   117.282 1.00 32.90  ? 298  ARG B CG  1 
ATOM   5022  C  CD  . ARG B  1 191 ? -7.296  2.045   116.947 1.00 36.49  ? 298  ARG B CD  1 
ATOM   5023  N  NE  . ARG B  1 191 ? -8.275  2.221   118.028 1.00 40.28  ? 298  ARG B NE  1 
ATOM   5024  C  CZ  . ARG B  1 191 ? -9.108  3.261   118.138 1.00 41.35  ? 298  ARG B CZ  1 
ATOM   5025  N  NH1 . ARG B  1 191 ? -9.969  3.325   119.156 1.00 40.53  ? 298  ARG B NH1 1 
ATOM   5026  N  NH2 . ARG B  1 191 ? -9.070  4.250   117.245 1.00 40.89  ? 298  ARG B NH2 1 
ATOM   5027  N  N   . GLU B  1 192 ? -2.277  -0.117  117.919 1.00 24.08  ? 299  GLU B N   1 
ATOM   5028  C  CA  . GLU B  1 192 ? -1.394  -0.946  117.096 1.00 23.07  ? 299  GLU B CA  1 
ATOM   5029  C  C   . GLU B  1 192 ? -0.585  -1.903  117.964 1.00 21.50  ? 299  GLU B C   1 
ATOM   5030  O  O   . GLU B  1 192 ? 0.313   -2.589  117.474 1.00 19.58  ? 299  GLU B O   1 
ATOM   5031  C  CB  . GLU B  1 192 ? -0.405  -0.095  116.292 1.00 25.75  ? 299  GLU B CB  1 
ATOM   5032  C  CG  . GLU B  1 192 ? -1.002  1.120   115.620 1.00 29.76  ? 299  GLU B CG  1 
ATOM   5033  C  CD  . GLU B  1 192 ? -2.260  0.791   114.861 1.00 33.02  ? 299  GLU B CD  1 
ATOM   5034  O  OE1 . GLU B  1 192 ? -2.239  -0.180  114.064 1.00 33.62  ? 299  GLU B OE1 1 
ATOM   5035  O  OE2 . GLU B  1 192 ? -3.266  1.509   115.064 1.00 36.03  ? 299  GLU B OE2 1 
ATOM   5036  N  N   . HIS B  1 193 ? -0.898  -1.938  119.256 1.00 21.02  ? 300  HIS B N   1 
ATOM   5037  C  CA  . HIS B  1 193 ? -0.195  -2.803  120.195 1.00 19.92  ? 300  HIS B CA  1 
ATOM   5038  C  C   . HIS B  1 193 ? 1.275   -2.445  120.290 1.00 18.55  ? 300  HIS B C   1 
ATOM   5039  O  O   . HIS B  1 193 ? 2.126   -3.306  120.487 1.00 16.96  ? 300  HIS B O   1 
ATOM   5040  C  CB  . HIS B  1 193 ? -0.342  -4.257  119.773 1.00 22.57  ? 300  HIS B CB  1 
ATOM   5041  C  CG  . HIS B  1 193 ? -1.722  -4.790  119.969 1.00 26.45  ? 300  HIS B CG  1 
ATOM   5042  N  ND1 . HIS B  1 193 ? -2.269  -4.981  121.221 1.00 27.91  ? 300  HIS B ND1 1 
ATOM   5043  C  CD2 . HIS B  1 193 ? -2.693  -5.101  119.078 1.00 27.25  ? 300  HIS B CD2 1 
ATOM   5044  C  CE1 . HIS B  1 193 ? -3.520  -5.384  121.093 1.00 28.04  ? 300  HIS B CE1 1 
ATOM   5045  N  NE2 . HIS B  1 193 ? -3.802  -5.465  119.804 1.00 28.70  ? 300  HIS B NE2 1 
ATOM   5046  N  N   . ASP B  1 194 ? 1.566   -1.160  120.154 1.00 17.24  ? 301  ASP B N   1 
ATOM   5047  C  CA  . ASP B  1 194 ? 2.933   -0.687  120.228 1.00 17.24  ? 301  ASP B CA  1 
ATOM   5048  C  C   . ASP B  1 194 ? 3.464   -0.834  121.656 1.00 17.64  ? 301  ASP B C   1 
ATOM   5049  O  O   . ASP B  1 194 ? 2.686   -0.896  122.612 1.00 17.00  ? 301  ASP B O   1 
ATOM   5050  C  CB  . ASP B  1 194 ? 2.989   0.780   119.803 1.00 16.46  ? 301  ASP B CB  1 
ATOM   5051  C  CG  . ASP B  1 194 ? 4.364   1.203   119.364 1.00 14.30  ? 301  ASP B CG  1 
ATOM   5052  O  OD1 . ASP B  1 194 ? 4.532   2.400   119.115 1.00 14.91  ? 301  ASP B OD1 1 
ATOM   5053  O  OD2 . ASP B  1 194 ? 5.270   0.346   119.255 1.00 14.64  ? 301  ASP B OD2 1 
ATOM   5054  N  N   . SER B  1 195 ? 4.785   -0.909  121.786 1.00 17.03  ? 302  SER B N   1 
ATOM   5055  C  CA  . SER B  1 195 ? 5.433   -1.023  123.082 1.00 18.60  ? 302  SER B CA  1 
ATOM   5056  C  C   . SER B  1 195 ? 6.353   0.176   123.244 1.00 20.13  ? 302  SER B C   1 
ATOM   5057  O  O   . SER B  1 195 ? 7.215   0.413   122.389 1.00 20.16  ? 302  SER B O   1 
ATOM   5058  C  CB  . SER B  1 195 ? 6.263   -2.295  123.146 1.00 19.68  ? 302  SER B CB  1 
ATOM   5059  O  OG  . SER B  1 195 ? 7.045   -2.303  124.330 1.00 23.15  ? 302  SER B OG  1 
ATOM   5060  N  N   . CYS B  1 196 ? 6.194   0.942   124.321 1.00 20.05  ? 303  CYS B N   1 
ATOM   5061  C  CA  . CYS B  1 196 ? 7.059   2.103   124.483 1.00 19.24  ? 303  CYS B CA  1 
ATOM   5062  C  C   . CYS B  1 196 ? 8.520   1.791   124.807 1.00 18.60  ? 303  CYS B C   1 
ATOM   5063  O  O   . CYS B  1 196 ? 9.327   2.714   124.945 1.00 19.65  ? 303  CYS B O   1 
ATOM   5064  C  CB  . CYS B  1 196 ? 6.477   3.104   125.491 1.00 19.69  ? 303  CYS B CB  1 
ATOM   5065  S  SG  . CYS B  1 196 ? 5.415   2.492   126.832 1.00 21.89  ? 303  CYS B SG  1 
ATOM   5066  N  N   . ASN B  1 197 ? 8.870   0.509   124.908 1.00 16.23  ? 304  ASN B N   1 
ATOM   5067  C  CA  . ASN B  1 197 ? 10.255  0.141   125.170 1.00 15.86  ? 304  ASN B CA  1 
ATOM   5068  C  C   . ASN B  1 197 ? 10.996  0.118   123.849 1.00 15.51  ? 304  ASN B C   1 
ATOM   5069  O  O   . ASN B  1 197 ? 12.220  -0.065  123.807 1.00 16.11  ? 304  ASN B O   1 
ATOM   5070  C  CB  . ASN B  1 197 ? 10.352  -1.225  125.832 1.00 17.96  ? 304  ASN B CB  1 
ATOM   5071  C  CG  . ASN B  1 197 ? 10.245  -1.152  127.342 1.00 19.76  ? 304  ASN B CG  1 
ATOM   5072  O  OD1 . ASN B  1 197 ? 9.543   -0.298  127.899 1.00 22.25  ? 304  ASN B OD1 1 
ATOM   5073  N  ND2 . ASN B  1 197 ? 10.925  -2.067  128.017 1.00 21.11  ? 304  ASN B ND2 1 
ATOM   5074  N  N   . CYS B  1 198 ? 10.242  0.304   122.770 1.00 13.51  ? 305  CYS B N   1 
ATOM   5075  C  CA  . CYS B  1 198 ? 10.806  0.335   121.426 1.00 13.85  ? 305  CYS B CA  1 
ATOM   5076  C  C   . CYS B  1 198 ? 10.985  1.783   121.004 1.00 13.62  ? 305  CYS B C   1 
ATOM   5077  O  O   . CYS B  1 198 ? 11.274  2.075   119.843 1.00 14.77  ? 305  CYS B O   1 
ATOM   5078  C  CB  . CYS B  1 198 ? 9.878   -0.362  120.429 1.00 13.43  ? 305  CYS B CB  1 
ATOM   5079  S  SG  . CYS B  1 198 ? 9.836   -2.152  120.559 1.00 12.24  ? 305  CYS B SG  1 
ATOM   5080  N  N   . ASP B  1 199 ? 10.787  2.680   121.964 1.00 12.36  ? 306  ASP B N   1 
ATOM   5081  C  CA  . ASP B  1 199 ? 10.913  4.119   121.768 1.00 11.50  ? 306  ASP B CA  1 
ATOM   5082  C  C   . ASP B  1 199 ? 12.092  4.558   122.650 1.00 11.68  ? 306  ASP B C   1 
ATOM   5083  O  O   . ASP B  1 199 ? 11.966  4.626   123.873 1.00 11.43  ? 306  ASP B O   1 
ATOM   5084  C  CB  . ASP B  1 199 ? 9.616   4.791   122.218 1.00 11.10  ? 306  ASP B CB  1 
ATOM   5085  C  CG  . ASP B  1 199 ? 9.683   6.308   122.168 1.00 11.73  ? 306  ASP B CG  1 
ATOM   5086  O  OD1 . ASP B  1 199 ? 10.797  6.882   122.277 1.00 12.12  ? 306  ASP B OD1 1 
ATOM   5087  O  OD2 . ASP B  1 199 ? 8.605   6.925   122.043 1.00 8.24   ? 306  ASP B OD2 1 
ATOM   5088  N  N   . GLY B  1 200 ? 13.229  4.840   122.019 1.00 10.26  ? 307  GLY B N   1 
ATOM   5089  C  CA  . GLY B  1 200 ? 14.416  5.242   122.745 1.00 11.40  ? 307  GLY B CA  1 
ATOM   5090  C  C   . GLY B  1 200 ? 14.320  6.508   123.578 1.00 12.25  ? 307  GLY B C   1 
ATOM   5091  O  O   . GLY B  1 200 ? 15.160  6.739   124.442 1.00 12.30  ? 307  GLY B O   1 
ATOM   5092  N  N   . TYR B  1 201 ? 13.309  7.335   123.335 1.00 12.41  ? 308  TYR B N   1 
ATOM   5093  C  CA  . TYR B  1 201 ? 13.176  8.559   124.105 1.00 12.25  ? 308  TYR B CA  1 
ATOM   5094  C  C   . TYR B  1 201 ? 12.467  8.267   125.409 1.00 13.11  ? 308  TYR B C   1 
ATOM   5095  O  O   . TYR B  1 201 ? 12.890  8.727   126.474 1.00 15.41  ? 308  TYR B O   1 
ATOM   5096  C  CB  . TYR B  1 201 ? 12.421  9.628   123.304 1.00 11.80  ? 308  TYR B CB  1 
ATOM   5097  C  CG  . TYR B  1 201 ? 13.132  10.010  122.018 1.00 13.81  ? 308  TYR B CG  1 
ATOM   5098  C  CD1 . TYR B  1 201 ? 13.039  9.205   120.881 1.00 14.38  ? 308  TYR B CD1 1 
ATOM   5099  C  CD2 . TYR B  1 201 ? 13.964  11.130  121.959 1.00 13.14  ? 308  TYR B CD2 1 
ATOM   5100  C  CE1 . TYR B  1 201 ? 13.758  9.498   119.725 1.00 13.77  ? 308  TYR B CE1 1 
ATOM   5101  C  CE2 . TYR B  1 201 ? 14.687  11.431  120.817 1.00 12.86  ? 308  TYR B CE2 1 
ATOM   5102  C  CZ  . TYR B  1 201 ? 14.584  10.609  119.699 1.00 15.67  ? 308  TYR B CZ  1 
ATOM   5103  O  OH  . TYR B  1 201 ? 15.328  10.867  118.565 1.00 12.67  ? 308  TYR B OH  1 
ATOM   5104  N  N   . THR B  1 202 ? 11.392  7.494   125.338 1.00 12.29  ? 309  THR B N   1 
ATOM   5105  C  CA  . THR B  1 202 ? 10.646  7.144   126.539 1.00 12.36  ? 309  THR B CA  1 
ATOM   5106  C  C   . THR B  1 202 ? 11.397  6.073   127.332 1.00 12.10  ? 309  THR B C   1 
ATOM   5107  O  O   . THR B  1 202 ? 11.320  6.014   128.548 1.00 13.22  ? 309  THR B O   1 
ATOM   5108  C  CB  . THR B  1 202 ? 9.263   6.589   126.180 1.00 10.86  ? 309  THR B CB  1 
ATOM   5109  O  OG1 . THR B  1 202 ? 9.415   5.495   125.271 1.00 11.74  ? 309  THR B OG1 1 
ATOM   5110  C  CG2 . THR B  1 202 ? 8.412   7.642   125.545 1.00 10.52  ? 309  THR B CG2 1 
ATOM   5111  N  N   . ASN B  1 203 ? 12.129  5.234   126.620 1.00 13.40  ? 310  ASN B N   1 
ATOM   5112  C  CA  . ASN B  1 203 ? 12.885  4.133   127.211 1.00 13.97  ? 310  ASN B CA  1 
ATOM   5113  C  C   . ASN B  1 203 ? 14.181  4.602   127.865 1.00 13.63  ? 310  ASN B C   1 
ATOM   5114  O  O   . ASN B  1 203 ? 14.833  3.843   128.570 1.00 14.47  ? 310  ASN B O   1 
ATOM   5115  C  CB  . ASN B  1 203 ? 13.180  3.114   126.105 1.00 15.89  ? 310  ASN B CB  1 
ATOM   5116  C  CG  . ASN B  1 203 ? 13.738  1.816   126.624 1.00 18.39  ? 310  ASN B CG  1 
ATOM   5117  O  OD1 . ASN B  1 203 ? 13.085  1.098   127.379 1.00 23.35  ? 310  ASN B OD1 1 
ATOM   5118  N  ND2 . ASN B  1 203 ? 14.954  1.494   126.208 1.00 20.58  ? 310  ASN B ND2 1 
ATOM   5119  N  N   . SER B  1 204 ? 14.543  5.860   127.640 1.00 14.90  ? 311  SER B N   1 
ATOM   5120  C  CA  . SER B  1 204 ? 15.763  6.435   128.200 1.00 13.84  ? 311  SER B CA  1 
ATOM   5121  C  C   . SER B  1 204 ? 15.661  6.614   129.706 1.00 13.83  ? 311  SER B C   1 
ATOM   5122  O  O   . SER B  1 204 ? 14.583  6.889   130.226 1.00 14.21  ? 311  SER B O   1 
ATOM   5123  C  CB  . SER B  1 204 ? 16.028  7.786   127.555 1.00 14.22  ? 311  SER B CB  1 
ATOM   5124  O  OG  . SER B  1 204 ? 17.192  8.377   128.107 1.00 18.35  ? 311  SER B OG  1 
ATOM   5125  N  N   . ILE B  1 205 ? 16.773  6.464   130.417 1.00 12.88  ? 312  ILE B N   1 
ATOM   5126  C  CA  . ILE B  1 205 ? 16.718  6.642   131.862 1.00 11.97  ? 312  ILE B CA  1 
ATOM   5127  C  C   . ILE B  1 205 ? 16.697  8.135   132.199 1.00 12.03  ? 312  ILE B C   1 
ATOM   5128  O  O   . ILE B  1 205 ? 16.318  8.524   133.308 1.00 13.51  ? 312  ILE B O   1 
ATOM   5129  C  CB  . ILE B  1 205 ? 17.923  5.985   132.566 1.00 10.08  ? 312  ILE B CB  1 
ATOM   5130  C  CG1 . ILE B  1 205 ? 19.213  6.762   132.286 1.00 8.82   ? 312  ILE B CG1 1 
ATOM   5131  C  CG2 . ILE B  1 205 ? 18.102  4.584   132.058 1.00 9.67   ? 312  ILE B CG2 1 
ATOM   5132  C  CD1 . ILE B  1 205 ? 20.402  6.268   133.096 1.00 4.17   ? 312  ILE B CD1 1 
ATOM   5133  N  N   . TYR B  1 206 ? 17.087  8.961   131.231 1.00 10.94  ? 313  TYR B N   1 
ATOM   5134  C  CA  . TYR B  1 206 ? 17.151  10.405  131.421 1.00 11.17  ? 313  TYR B CA  1 
ATOM   5135  C  C   . TYR B  1 206 ? 15.800  11.088  131.354 1.00 11.93  ? 313  TYR B C   1 
ATOM   5136  O  O   . TYR B  1 206 ? 15.695  12.276  131.647 1.00 14.00  ? 313  TYR B O   1 
ATOM   5137  C  CB  . TYR B  1 206 ? 18.068  11.038  130.367 1.00 10.89  ? 313  TYR B CB  1 
ATOM   5138  C  CG  . TYR B  1 206 ? 19.415  10.376  130.248 1.00 10.11  ? 313  TYR B CG  1 
ATOM   5139  C  CD1 . TYR B  1 206 ? 19.855  9.875   129.029 1.00 9.99   ? 313  TYR B CD1 1 
ATOM   5140  C  CD2 . TYR B  1 206 ? 20.242  10.227  131.360 1.00 9.53   ? 313  TYR B CD2 1 
ATOM   5141  C  CE1 . TYR B  1 206 ? 21.087  9.234   128.911 1.00 9.74   ? 313  TYR B CE1 1 
ATOM   5142  C  CE2 . TYR B  1 206 ? 21.481  9.588   131.259 1.00 10.72  ? 313  TYR B CE2 1 
ATOM   5143  C  CZ  . TYR B  1 206 ? 21.896  9.092   130.029 1.00 11.44  ? 313  TYR B CZ  1 
ATOM   5144  O  OH  . TYR B  1 206 ? 23.111  8.448   129.915 1.00 11.40  ? 313  TYR B OH  1 
ATOM   5145  N  N   . THR B  1 207 ? 14.765  10.356  130.966 1.00 11.58  ? 314  THR B N   1 
ATOM   5146  C  CA  . THR B  1 207 ? 13.450  10.961  130.851 1.00 11.17  ? 314  THR B CA  1 
ATOM   5147  C  C   . THR B  1 207 ? 12.443  10.325  131.776 1.00 12.17  ? 314  THR B C   1 
ATOM   5148  O  O   . THR B  1 207 ? 12.594  9.166   132.144 1.00 12.53  ? 314  THR B O   1 
ATOM   5149  C  CB  . THR B  1 207 ? 12.896  10.808  129.430 1.00 11.56  ? 314  THR B CB  1 
ATOM   5150  O  OG1 . THR B  1 207 ? 12.594  9.427   129.185 1.00 10.24  ? 314  THR B OG1 1 
ATOM   5151  C  CG2 . THR B  1 207 ? 13.918  11.279  128.411 1.00 10.53  ? 314  THR B CG2 1 
ATOM   5152  N  N   . LEU B  1 208 ? 11.431  11.092  132.178 1.00 12.49  ? 315  LEU B N   1 
ATOM   5153  C  CA  . LEU B  1 208 ? 10.361  10.538  133.002 1.00 13.69  ? 315  LEU B CA  1 
ATOM   5154  C  C   . LEU B  1 208 ? 9.273   10.278  131.983 1.00 13.59  ? 315  LEU B C   1 
ATOM   5155  O  O   . LEU B  1 208 ? 8.609   11.205  131.515 1.00 12.29  ? 315  LEU B O   1 
ATOM   5156  C  CB  . LEU B  1 208 ? 9.806   11.517  134.038 1.00 13.71  ? 315  LEU B CB  1 
ATOM   5157  C  CG  . LEU B  1 208 ? 10.779  12.046  135.067 1.00 16.01  ? 315  LEU B CG  1 
ATOM   5158  C  CD1 . LEU B  1 208 ? 11.580  13.164  134.427 1.00 15.77  ? 315  LEU B CD1 1 
ATOM   5159  C  CD2 . LEU B  1 208 ? 10.020  12.538  136.287 1.00 16.05  ? 315  LEU B CD2 1 
ATOM   5160  N  N   . SER B  1 209 ? 9.108   9.012   131.626 1.00 14.07  ? 316  SER B N   1 
ATOM   5161  C  CA  . SER B  1 209 ? 8.103   8.632   130.657 1.00 14.17  ? 316  SER B CA  1 
ATOM   5162  C  C   . SER B  1 209 ? 6.759   8.585   131.376 1.00 14.11  ? 316  SER B C   1 
ATOM   5163  O  O   . SER B  1 209 ? 6.606   7.892   132.378 1.00 13.89  ? 316  SER B O   1 
ATOM   5164  C  CB  . SER B  1 209 ? 8.471   7.278   130.058 1.00 14.29  ? 316  SER B CB  1 
ATOM   5165  O  OG  . SER B  1 209 ? 7.558   6.914   129.048 1.00 18.84  ? 316  SER B OG  1 
ATOM   5166  N  N   . ILE B  1 210 ? 5.789   9.328   130.855 1.00 14.00  ? 317  ILE B N   1 
ATOM   5167  C  CA  . ILE B  1 210 ? 4.470   9.420   131.465 1.00 13.50  ? 317  ILE B CA  1 
ATOM   5168  C  C   . ILE B  1 210 ? 3.347   8.836   130.599 1.00 14.86  ? 317  ILE B C   1 
ATOM   5169  O  O   . ILE B  1 210 ? 3.253   9.142   129.404 1.00 14.12  ? 317  ILE B O   1 
ATOM   5170  C  CB  . ILE B  1 210 ? 4.149   10.913  131.774 1.00 13.32  ? 317  ILE B CB  1 
ATOM   5171  C  CG1 . ILE B  1 210 ? 5.273   11.518  132.622 1.00 12.03  ? 317  ILE B CG1 1 
ATOM   5172  C  CG2 . ILE B  1 210 ? 2.804   11.051  132.483 1.00 11.68  ? 317  ILE B CG2 1 
ATOM   5173  C  CD1 . ILE B  1 210 ? 5.487   10.831  133.940 1.00 9.98   ? 317  ILE B CD1 1 
ATOM   5174  N  N   . SER B  1 211 ? 2.494   8.005   131.206 1.00 14.31  ? 318  SER B N   1 
ATOM   5175  C  CA  . SER B  1 211 ? 1.372   7.406   130.489 1.00 14.06  ? 318  SER B CA  1 
ATOM   5176  C  C   . SER B  1 211 ? 0.059   8.066   130.881 1.00 15.00  ? 318  SER B C   1 
ATOM   5177  O  O   . SER B  1 211 ? 0.035   8.980   131.711 1.00 15.73  ? 318  SER B O   1 
ATOM   5178  C  CB  . SER B  1 211 ? 1.291   5.909   130.752 1.00 13.97  ? 318  SER B CB  1 
ATOM   5179  O  OG  . SER B  1 211 ? 2.254   5.225   129.970 1.00 16.46  ? 318  SER B OG  1 
ATOM   5180  N  N   . SER B  1 212 ? -1.035  7.593   130.290 1.00 14.68  ? 319  SER B N   1 
ATOM   5181  C  CA  . SER B  1 212 ? -2.345  8.172   130.551 1.00 14.81  ? 319  SER B CA  1 
ATOM   5182  C  C   . SER B  1 212 ? -3.348  7.234   131.194 1.00 14.71  ? 319  SER B C   1 
ATOM   5183  O  O   . SER B  1 212 ? -3.176  6.018   131.194 1.00 13.83  ? 319  SER B O   1 
ATOM   5184  C  CB  . SER B  1 212 ? -2.944  8.698   129.246 1.00 14.51  ? 319  SER B CB  1 
ATOM   5185  O  OG  . SER B  1 212 ? -2.032  9.545   128.573 1.00 14.82  ? 319  SER B OG  1 
ATOM   5186  N  N   . ALA B  1 213 ? -4.400  7.834   131.738 1.00 14.26  ? 320  ALA B N   1 
ATOM   5187  C  CA  . ALA B  1 213 ? -5.488  7.113   132.373 1.00 15.37  ? 320  ALA B CA  1 
ATOM   5188  C  C   . ALA B  1 213 ? -6.734  7.907   132.006 1.00 15.95  ? 320  ALA B C   1 
ATOM   5189  O  O   . ALA B  1 213 ? -6.675  9.137   131.919 1.00 15.10  ? 320  ALA B O   1 
ATOM   5190  C  CB  . ALA B  1 213 ? -5.296  7.085   133.884 1.00 16.35  ? 320  ALA B CB  1 
ATOM   5191  N  N   . THR B  1 214 ? -7.848  7.217   131.763 1.00 17.08  ? 321  THR B N   1 
ATOM   5192  C  CA  . THR B  1 214 ? -9.095  7.900   131.402 1.00 17.97  ? 321  THR B CA  1 
ATOM   5193  C  C   . THR B  1 214 ? -9.769  8.447   132.649 1.00 18.64  ? 321  THR B C   1 
ATOM   5194  O  O   . THR B  1 214 ? -9.415  8.088   133.776 1.00 18.13  ? 321  THR B O   1 
ATOM   5195  C  CB  . THR B  1 214 ? -10.100 6.956   130.693 1.00 18.16  ? 321  THR B CB  1 
ATOM   5196  O  OG1 . THR B  1 214 ? -10.559 5.954   131.615 1.00 19.35  ? 321  THR B OG1 1 
ATOM   5197  C  CG2 . THR B  1 214 ? -9.450  6.282   129.497 1.00 17.28  ? 321  THR B CG2 1 
ATOM   5198  N  N   . GLN B  1 215 ? -10.744 9.321   132.442 1.00 19.86  ? 322  GLN B N   1 
ATOM   5199  C  CA  . GLN B  1 215 ? -11.472 9.919   133.550 1.00 20.69  ? 322  GLN B CA  1 
ATOM   5200  C  C   . GLN B  1 215 ? -11.988 8.865   134.526 1.00 21.27  ? 322  GLN B C   1 
ATOM   5201  O  O   . GLN B  1 215 ? -11.999 9.084   135.737 1.00 21.56  ? 322  GLN B O   1 
ATOM   5202  C  CB  . GLN B  1 215 ? -12.634 10.749  133.012 1.00 21.74  ? 322  GLN B CB  1 
ATOM   5203  C  CG  . GLN B  1 215 ? -13.572 11.269  134.074 1.00 24.32  ? 322  GLN B CG  1 
ATOM   5204  C  CD  . GLN B  1 215 ? -14.659 12.148  133.492 1.00 26.40  ? 322  GLN B CD  1 
ATOM   5205  O  OE1 . GLN B  1 215 ? -15.132 11.917  132.373 1.00 26.20  ? 322  GLN B OE1 1 
ATOM   5206  N  NE2 . GLN B  1 215 ? -15.076 13.158  134.255 1.00 27.67  ? 322  GLN B NE2 1 
ATOM   5207  N  N   . PHE B  1 216 ? -12.402 7.713   134.013 1.00 21.58  ? 323  PHE B N   1 
ATOM   5208  C  CA  . PHE B  1 216 ? -12.908 6.682   134.896 1.00 21.41  ? 323  PHE B CA  1 
ATOM   5209  C  C   . PHE B  1 216 ? -11.846 5.695   135.338 1.00 20.54  ? 323  PHE B C   1 
ATOM   5210  O  O   . PHE B  1 216 ? -12.147 4.600   135.804 1.00 22.38  ? 323  PHE B O   1 
ATOM   5211  C  CB  . PHE B  1 216 ? -14.114 6.008   134.249 1.00 21.86  ? 323  PHE B CB  1 
ATOM   5212  C  CG  . PHE B  1 216 ? -15.259 6.954   134.045 1.00 23.69  ? 323  PHE B CG  1 
ATOM   5213  C  CD1 . PHE B  1 216 ? -15.459 7.577   132.824 1.00 26.06  ? 323  PHE B CD1 1 
ATOM   5214  C  CD2 . PHE B  1 216 ? -16.067 7.322   135.116 1.00 25.63  ? 323  PHE B CD2 1 
ATOM   5215  C  CE1 . PHE B  1 216 ? -16.445 8.564   132.671 1.00 25.74  ? 323  PHE B CE1 1 
ATOM   5216  C  CE2 . PHE B  1 216 ? -17.049 8.303   134.975 1.00 25.73  ? 323  PHE B CE2 1 
ATOM   5217  C  CZ  . PHE B  1 216 ? -17.232 8.924   133.750 1.00 26.38  ? 323  PHE B CZ  1 
ATOM   5218  N  N   . GLY B  1 217 ? -10.594 6.111   135.200 1.00 19.50  ? 324  GLY B N   1 
ATOM   5219  C  CA  . GLY B  1 217 ? -9.479  5.289   135.627 1.00 18.82  ? 324  GLY B CA  1 
ATOM   5220  C  C   . GLY B  1 217 ? -9.165  4.053   134.818 1.00 18.98  ? 324  GLY B C   1 
ATOM   5221  O  O   . GLY B  1 217 ? -8.672  3.068   135.374 1.00 19.88  ? 324  GLY B O   1 
ATOM   5222  N  N   . ASN B  1 218 ? -9.430  4.091   133.516 1.00 16.94  ? 325  ASN B N   1 
ATOM   5223  C  CA  . ASN B  1 218 ? -9.147  2.942   132.672 1.00 16.55  ? 325  ASN B CA  1 
ATOM   5224  C  C   . ASN B  1 218 ? -7.952  3.189   131.773 1.00 16.12  ? 325  ASN B C   1 
ATOM   5225  O  O   . ASN B  1 218 ? -7.516  4.324   131.604 1.00 15.60  ? 325  ASN B O   1 
ATOM   5226  C  CB  . ASN B  1 218 ? -10.349 2.618   131.797 1.00 16.40  ? 325  ASN B CB  1 
ATOM   5227  C  CG  . ASN B  1 218 ? -11.594 2.365   132.598 1.00 17.32  ? 325  ASN B CG  1 
ATOM   5228  O  OD1 . ASN B  1 218 ? -11.591 1.560   133.539 1.00 17.30  ? 325  ASN B OD1 1 
ATOM   5229  N  ND2 . ASN B  1 218 ? -12.682 3.046   132.228 1.00 15.74  ? 325  ASN B ND2 1 
ATOM   5230  N  N   . VAL B  1 219 ? -7.423  2.117   131.195 1.00 15.30  ? 326  VAL B N   1 
ATOM   5231  C  CA  . VAL B  1 219 ? -6.300  2.238   130.281 1.00 14.87  ? 326  VAL B CA  1 
ATOM   5232  C  C   . VAL B  1 219 ? -6.872  2.804   128.983 1.00 15.44  ? 326  VAL B C   1 
ATOM   5233  O  O   . VAL B  1 219 ? -7.750  2.194   128.370 1.00 16.02  ? 326  VAL B O   1 
ATOM   5234  C  CB  . VAL B  1 219 ? -5.675  0.868   130.002 1.00 14.09  ? 326  VAL B CB  1 
ATOM   5235  C  CG1 . VAL B  1 219 ? -4.594  0.987   128.936 1.00 12.92  ? 326  VAL B CG1 1 
ATOM   5236  C  CG2 . VAL B  1 219 ? -5.099  0.303   131.283 1.00 13.52  ? 326  VAL B CG2 1 
ATOM   5237  N  N   . PRO B  1 220 ? -6.395  3.985   128.552 1.00 15.51  ? 327  PRO B N   1 
ATOM   5238  C  CA  . PRO B  1 220 ? -6.897  4.597   127.313 1.00 15.03  ? 327  PRO B CA  1 
ATOM   5239  C  C   . PRO B  1 220 ? -6.653  3.676   126.121 1.00 15.20  ? 327  PRO B C   1 
ATOM   5240  O  O   . PRO B  1 220 ? -5.764  2.825   126.154 1.00 15.31  ? 327  PRO B O   1 
ATOM   5241  C  CB  . PRO B  1 220 ? -6.095  5.898   127.209 1.00 14.62  ? 327  PRO B CB  1 
ATOM   5242  C  CG  . PRO B  1 220 ? -5.715  6.200   128.623 1.00 14.32  ? 327  PRO B CG  1 
ATOM   5243  C  CD  . PRO B  1 220 ? -5.354  4.830   129.162 1.00 15.54  ? 327  PRO B CD  1 
ATOM   5244  N  N   . TRP B  1 221 ? -7.431  3.850   125.063 1.00 14.68  ? 328  TRP B N   1 
ATOM   5245  C  CA  . TRP B  1 221 ? -7.277  3.006   123.893 1.00 14.65  ? 328  TRP B CA  1 
ATOM   5246  C  C   . TRP B  1 221 ? -5.962  3.224   123.168 1.00 14.29  ? 328  TRP B C   1 
ATOM   5247  O  O   . TRP B  1 221 ? -5.482  2.337   122.475 1.00 15.17  ? 328  TRP B O   1 
ATOM   5248  C  CB  . TRP B  1 221 ? -8.419  3.236   122.911 1.00 14.05  ? 328  TRP B CB  1 
ATOM   5249  C  CG  . TRP B  1 221 ? -8.485  4.621   122.372 1.00 14.63  ? 328  TRP B CG  1 
ATOM   5250  C  CD1 . TRP B  1 221 ? -9.240  5.657   122.844 1.00 13.64  ? 328  TRP B CD1 1 
ATOM   5251  C  CD2 . TRP B  1 221 ? -7.779  5.125   121.237 1.00 15.21  ? 328  TRP B CD2 1 
ATOM   5252  N  NE1 . TRP B  1 221 ? -9.053  6.773   122.068 1.00 13.00  ? 328  TRP B NE1 1 
ATOM   5253  C  CE2 . TRP B  1 221 ? -8.158  6.475   121.073 1.00 14.74  ? 328  TRP B CE2 1 
ATOM   5254  C  CE3 . TRP B  1 221 ? -6.864  4.564   120.336 1.00 16.58  ? 328  TRP B CE3 1 
ATOM   5255  C  CZ2 . TRP B  1 221 ? -7.650  7.280   120.042 1.00 15.16  ? 328  TRP B CZ2 1 
ATOM   5256  C  CZ3 . TRP B  1 221 ? -6.360  5.364   119.307 1.00 16.71  ? 328  TRP B CZ3 1 
ATOM   5257  C  CH2 . TRP B  1 221 ? -6.758  6.708   119.172 1.00 14.99  ? 328  TRP B CH2 1 
ATOM   5258  N  N   . TYR B  1 222 ? -5.378  4.403   123.334 1.00 13.66  ? 329  TYR B N   1 
ATOM   5259  C  CA  . TYR B  1 222 ? -4.120  4.751   122.666 1.00 13.89  ? 329  TYR B CA  1 
ATOM   5260  C  C   . TYR B  1 222 ? -2.882  4.399   123.473 1.00 13.50  ? 329  TYR B C   1 
ATOM   5261  O  O   . TYR B  1 222 ? -1.772  4.457   122.962 1.00 13.36  ? 329  TYR B O   1 
ATOM   5262  C  CB  . TYR B  1 222 ? -4.104  6.257   122.344 1.00 14.06  ? 329  TYR B CB  1 
ATOM   5263  C  CG  . TYR B  1 222 ? -4.425  7.133   123.543 1.00 14.17  ? 329  TYR B CG  1 
ATOM   5264  C  CD1 . TYR B  1 222 ? -3.464  7.391   124.537 1.00 13.64  ? 329  TYR B CD1 1 
ATOM   5265  C  CD2 . TYR B  1 222 ? -5.708  7.648   123.721 1.00 12.73  ? 329  TYR B CD2 1 
ATOM   5266  C  CE1 . TYR B  1 222 ? -3.784  8.134   125.673 1.00 11.69  ? 329  TYR B CE1 1 
ATOM   5267  C  CE2 . TYR B  1 222 ? -6.034  8.391   124.851 1.00 13.47  ? 329  TYR B CE2 1 
ATOM   5268  C  CZ  . TYR B  1 222 ? -5.072  8.630   125.820 1.00 12.87  ? 329  TYR B CZ  1 
ATOM   5269  O  OH  . TYR B  1 222 ? -5.420  9.365   126.927 1.00 11.55  ? 329  TYR B OH  1 
ATOM   5270  N  N   . SER B  1 223 ? -3.089  4.017   124.725 1.00 13.98  ? 330  SER B N   1 
ATOM   5271  C  CA  . SER B  1 223 ? -2.011  3.689   125.631 1.00 14.28  ? 330  SER B CA  1 
ATOM   5272  C  C   . SER B  1 223 ? -1.133  2.517   125.236 1.00 15.72  ? 330  SER B C   1 
ATOM   5273  O  O   . SER B  1 223 ? -1.631  1.453   124.850 1.00 18.92  ? 330  SER B O   1 
ATOM   5274  C  CB  . SER B  1 223 ? -2.594  3.433   127.017 1.00 14.72  ? 330  SER B CB  1 
ATOM   5275  O  OG  . SER B  1 223 ? -1.644  2.821   127.877 1.00 17.03  ? 330  SER B OG  1 
ATOM   5276  N  N   . GLU B  1 224 ? 0.178   2.718   125.346 1.00 15.10  ? 331  GLU B N   1 
ATOM   5277  C  CA  . GLU B  1 224 ? 1.160   1.674   125.058 1.00 15.65  ? 331  GLU B CA  1 
ATOM   5278  C  C   . GLU B  1 224 ? 1.686   1.173   126.404 1.00 16.73  ? 331  GLU B C   1 
ATOM   5279  O  O   . GLU B  1 224 ? 1.958   1.964   127.308 1.00 18.99  ? 331  GLU B O   1 
ATOM   5280  C  CB  . GLU B  1 224 ? 2.345   2.218   124.255 1.00 14.36  ? 331  GLU B CB  1 
ATOM   5281  C  CG  . GLU B  1 224 ? 1.987   2.910   122.969 1.00 12.57  ? 331  GLU B CG  1 
ATOM   5282  C  CD  . GLU B  1 224 ? 3.207   3.328   122.191 1.00 12.40  ? 331  GLU B CD  1 
ATOM   5283  O  OE1 . GLU B  1 224 ? 3.054   4.203   121.316 1.00 12.52  ? 331  GLU B OE1 1 
ATOM   5284  O  OE2 . GLU B  1 224 ? 4.309   2.775   122.442 1.00 10.46  ? 331  GLU B OE2 1 
ATOM   5285  N  N   . ALA B  1 225 ? 1.826   -0.134  126.547 1.00 16.00  ? 332  ALA B N   1 
ATOM   5286  C  CA  . ALA B  1 225 ? 2.330   -0.687  127.787 1.00 16.60  ? 332  ALA B CA  1 
ATOM   5287  C  C   . ALA B  1 225 ? 3.827   -0.955  127.658 1.00 16.78  ? 332  ALA B C   1 
ATOM   5288  O  O   . ALA B  1 225 ? 4.317   -1.264  126.578 1.00 17.77  ? 332  ALA B O   1 
ATOM   5289  C  CB  . ALA B  1 225 ? 1.593   -1.973  128.106 1.00 14.78  ? 332  ALA B CB  1 
ATOM   5290  N  N   . CYS B  1 226 ? 4.553   -0.813  128.755 1.00 17.15  ? 333  CYS B N   1 
ATOM   5291  C  CA  . CYS B  1 226 ? 5.985   -1.072  128.761 1.00 18.59  ? 333  CYS B CA  1 
ATOM   5292  C  C   . CYS B  1 226 ? 6.534   -0.874  130.169 1.00 17.12  ? 333  CYS B C   1 
ATOM   5293  O  O   . CYS B  1 226 ? 5.913   -0.224  131.004 1.00 16.23  ? 333  CYS B O   1 
ATOM   5294  C  CB  . CYS B  1 226 ? 6.719   -0.174  127.755 1.00 19.90  ? 333  CYS B CB  1 
ATOM   5295  S  SG  . CYS B  1 226 ? 6.686   1.587   128.157 1.00 26.56  ? 333  CYS B SG  1 
ATOM   5296  N  N   . SER B  1 227 ? 7.703   -1.445  130.421 1.00 16.30  ? 334  SER B N   1 
ATOM   5297  C  CA  . SER B  1 227 ? 8.322   -1.379  131.731 1.00 16.09  ? 334  SER B CA  1 
ATOM   5298  C  C   . SER B  1 227 ? 9.108   -0.107  132.023 1.00 15.99  ? 334  SER B C   1 
ATOM   5299  O  O   . SER B  1 227 ? 9.565   0.088   133.149 1.00 17.83  ? 334  SER B O   1 
ATOM   5300  C  CB  . SER B  1 227 ? 9.238   -2.587  131.909 1.00 13.94  ? 334  SER B CB  1 
ATOM   5301  O  OG  . SER B  1 227 ? 10.247  -2.584  130.921 1.00 12.20  ? 334  SER B OG  1 
ATOM   5302  N  N   . SER B  1 228 ? 9.274   0.756   131.029 1.00 14.78  ? 335  SER B N   1 
ATOM   5303  C  CA  . SER B  1 228 ? 10.043  1.975   131.250 1.00 15.92  ? 335  SER B CA  1 
ATOM   5304  C  C   . SER B  1 228 ? 9.203   3.142   131.730 1.00 15.32  ? 335  SER B C   1 
ATOM   5305  O  O   . SER B  1 228 ? 9.735   4.154   132.173 1.00 16.28  ? 335  SER B O   1 
ATOM   5306  C  CB  . SER B  1 228 ? 10.796  2.372   129.981 1.00 15.83  ? 335  SER B CB  1 
ATOM   5307  O  OG  . SER B  1 228 ? 9.897   2.520   128.901 1.00 18.43  ? 335  SER B OG  1 
ATOM   5308  N  N   . THR B  1 229 ? 7.890   3.015   131.637 1.00 14.69  ? 336  THR B N   1 
ATOM   5309  C  CA  . THR B  1 229 ? 7.023   4.083   132.099 1.00 14.65  ? 336  THR B CA  1 
ATOM   5310  C  C   . THR B  1 229 ? 7.208   4.253   133.602 1.00 13.53  ? 336  THR B C   1 
ATOM   5311  O  O   . THR B  1 229 ? 7.374   3.272   134.335 1.00 11.89  ? 336  THR B O   1 
ATOM   5312  C  CB  . THR B  1 229 ? 5.573   3.758   131.783 1.00 15.63  ? 336  THR B CB  1 
ATOM   5313  O  OG1 . THR B  1 229 ? 5.427   3.674   130.362 1.00 15.97  ? 336  THR B OG1 1 
ATOM   5314  C  CG2 . THR B  1 229 ? 4.649   4.818   132.342 1.00 13.08  ? 336  THR B CG2 1 
ATOM   5315  N  N   . LEU B  1 230 ? 7.179   5.500   134.058 1.00 12.99  ? 337  LEU B N   1 
ATOM   5316  C  CA  . LEU B  1 230 ? 7.370   5.787   135.473 1.00 13.04  ? 337  LEU B CA  1 
ATOM   5317  C  C   . LEU B  1 230 ? 6.083   6.124   136.204 1.00 12.44  ? 337  LEU B C   1 
ATOM   5318  O  O   . LEU B  1 230 ? 5.836   5.602   137.279 1.00 14.70  ? 337  LEU B O   1 
ATOM   5319  C  CB  . LEU B  1 230 ? 8.370   6.933   135.630 1.00 13.86  ? 337  LEU B CB  1 
ATOM   5320  C  CG  . LEU B  1 230 ? 9.084   7.053   136.964 1.00 12.45  ? 337  LEU B CG  1 
ATOM   5321  C  CD1 . LEU B  1 230 ? 9.965   5.846   137.166 1.00 12.45  ? 337  LEU B CD1 1 
ATOM   5322  C  CD2 . LEU B  1 230 ? 9.912   8.308   136.967 1.00 13.60  ? 337  LEU B CD2 1 
ATOM   5323  N  N   . ALA B  1 231 ? 5.267   6.996   135.629 1.00 11.82  ? 338  ALA B N   1 
ATOM   5324  C  CA  . ALA B  1 231 ? 4.020   7.384   136.270 1.00 13.02  ? 338  ALA B CA  1 
ATOM   5325  C  C   . ALA B  1 231 ? 2.925   7.749   135.258 1.00 13.94  ? 338  ALA B C   1 
ATOM   5326  O  O   . ALA B  1 231 ? 3.137   7.709   134.038 1.00 14.60  ? 338  ALA B O   1 
ATOM   5327  C  CB  . ALA B  1 231 ? 4.268   8.548   137.213 1.00 12.90  ? 338  ALA B CB  1 
ATOM   5328  N  N   . THR B  1 232 ? 1.766   8.141   135.770 1.00 12.84  ? 339  THR B N   1 
ATOM   5329  C  CA  . THR B  1 232 ? 0.625   8.471   134.928 1.00 13.23  ? 339  THR B CA  1 
ATOM   5330  C  C   . THR B  1 232 ? -0.081  9.766   135.328 1.00 14.02  ? 339  THR B C   1 
ATOM   5331  O  O   . THR B  1 232 ? 0.037   10.223  136.462 1.00 14.21  ? 339  THR B O   1 
ATOM   5332  C  CB  . THR B  1 232 ? -0.435  7.358   135.034 1.00 12.39  ? 339  THR B CB  1 
ATOM   5333  O  OG1 . THR B  1 232 ? 0.181   6.083   134.820 1.00 13.33  ? 339  THR B OG1 1 
ATOM   5334  C  CG2 . THR B  1 232 ? -1.536  7.578   134.040 1.00 13.13  ? 339  THR B CG2 1 
ATOM   5335  N  N   . THR B  1 233 ? -0.802  10.357  134.383 1.00 14.50  ? 340  THR B N   1 
ATOM   5336  C  CA  . THR B  1 233 ? -1.623  11.527  134.666 1.00 16.15  ? 340  THR B CA  1 
ATOM   5337  C  C   . THR B  1 233 ? -2.857  11.305  133.817 1.00 17.79  ? 340  THR B C   1 
ATOM   5338  O  O   . THR B  1 233 ? -2.823  10.522  132.863 1.00 18.41  ? 340  THR B O   1 
ATOM   5339  C  CB  . THR B  1 233 ? -0.986  12.877  134.284 1.00 16.25  ? 340  THR B CB  1 
ATOM   5340  O  OG1 . THR B  1 233 ? -0.958  13.021  132.861 1.00 16.82  ? 340  THR B OG1 1 
ATOM   5341  C  CG2 . THR B  1 233 ? 0.406   12.990  134.859 1.00 16.06  ? 340  THR B CG2 1 
ATOM   5342  N  N   . TYR B  1 234 ? -3.952  11.964  134.181 1.00 18.57  ? 341  TYR B N   1 
ATOM   5343  C  CA  . TYR B  1 234 ? -5.200  11.818  133.448 1.00 18.42  ? 341  TYR B CA  1 
ATOM   5344  C  C   . TYR B  1 234 ? -5.131  12.404  132.052 1.00 18.81  ? 341  TYR B C   1 
ATOM   5345  O  O   . TYR B  1 234 ? -4.327  13.294  131.782 1.00 19.61  ? 341  TYR B O   1 
ATOM   5346  C  CB  . TYR B  1 234 ? -6.345  12.492  134.201 1.00 18.36  ? 341  TYR B CB  1 
ATOM   5347  C  CG  . TYR B  1 234 ? -6.855  11.702  135.379 1.00 18.71  ? 341  TYR B CG  1 
ATOM   5348  C  CD1 . TYR B  1 234 ? -6.693  12.169  136.680 1.00 19.02  ? 341  TYR B CD1 1 
ATOM   5349  C  CD2 . TYR B  1 234 ? -7.495  10.480  135.192 1.00 18.41  ? 341  TYR B CD2 1 
ATOM   5350  C  CE1 . TYR B  1 234 ? -7.157  11.435  137.770 1.00 20.14  ? 341  TYR B CE1 1 
ATOM   5351  C  CE2 . TYR B  1 234 ? -7.962  9.740   136.273 1.00 19.93  ? 341  TYR B CE2 1 
ATOM   5352  C  CZ  . TYR B  1 234 ? -7.789  10.222  137.559 1.00 19.95  ? 341  TYR B CZ  1 
ATOM   5353  O  OH  . TYR B  1 234 ? -8.241  9.486   138.630 1.00 22.37  ? 341  TYR B OH  1 
ATOM   5354  N  N   . SER B  1 235 ? -5.976  11.882  131.166 1.00 19.18  ? 342  SER B N   1 
ATOM   5355  C  CA  . SER B  1 235 ? -6.074  12.368  129.800 1.00 17.93  ? 342  SER B CA  1 
ATOM   5356  C  C   . SER B  1 235 ? -7.403  11.910  129.224 1.00 18.95  ? 342  SER B C   1 
ATOM   5357  O  O   . SER B  1 235 ? -8.293  11.505  129.974 1.00 19.02  ? 342  SER B O   1 
ATOM   5358  C  CB  . SER B  1 235 ? -4.925  11.862  128.939 1.00 16.75  ? 342  SER B CB  1 
ATOM   5359  O  OG  . SER B  1 235 ? -4.912  12.557  127.701 1.00 15.73  ? 342  SER B OG  1 
ATOM   5360  N  N   . SER B  1 236 ? -7.541  11.975  127.900 1.00 19.42  ? 343  SER B N   1 
ATOM   5361  C  CA  . SER B  1 236 ? -8.784  11.583  127.241 1.00 19.69  ? 343  SER B CA  1 
ATOM   5362  C  C   . SER B  1 236 ? -9.001  10.079  127.260 1.00 20.56  ? 343  SER B C   1 
ATOM   5363  O  O   . SER B  1 236 ? -8.072  9.311   127.510 1.00 20.45  ? 343  SER B O   1 
ATOM   5364  C  CB  . SER B  1 236 ? -8.797  12.079  125.802 1.00 18.73  ? 343  SER B CB  1 
ATOM   5365  O  OG  . SER B  1 236 ? -7.737  11.500  125.072 1.00 22.80  ? 343  SER B OG  1 
ATOM   5366  N  N   . GLY B  1 237 ? -10.239 9.674   126.993 1.00 21.10  ? 344  GLY B N   1 
ATOM   5367  C  CA  . GLY B  1 237 ? -10.580 8.267   126.991 1.00 23.33  ? 344  GLY B CA  1 
ATOM   5368  C  C   . GLY B  1 237 ? -11.602 7.984   125.911 1.00 24.71  ? 344  GLY B C   1 
ATOM   5369  O  O   . GLY B  1 237 ? -11.434 8.424   124.772 1.00 23.55  ? 344  GLY B O   1 
ATOM   5370  N  N   . ASN B  1 238 ? -12.661 7.255   126.255 1.00 25.69  ? 345  ASN B N   1 
ATOM   5371  C  CA  . ASN B  1 238 ? -13.684 6.951   125.274 1.00 27.22  ? 345  ASN B CA  1 
ATOM   5372  C  C   . ASN B  1 238 ? -14.630 8.111   125.071 1.00 28.25  ? 345  ASN B C   1 
ATOM   5373  O  O   . ASN B  1 238 ? -14.471 9.165   125.674 1.00 28.50  ? 345  ASN B O   1 
ATOM   5374  C  CB  . ASN B  1 238 ? -14.456 5.717   125.678 1.00 28.30  ? 345  ASN B CB  1 
ATOM   5375  C  CG  . ASN B  1 238 ? -13.675 4.463   125.412 1.00 31.06  ? 345  ASN B CG  1 
ATOM   5376  O  OD1 . ASN B  1 238 ? -12.894 4.408   124.445 1.00 32.06  ? 345  ASN B OD1 1 
ATOM   5377  N  ND2 . ASN B  1 238 ? -13.873 3.440   126.247 1.00 31.15  ? 345  ASN B ND2 1 
ATOM   5378  N  N   . GLN B  1 239 ? -15.615 7.909   124.209 1.00 29.27  ? 346  GLN B N   1 
ATOM   5379  C  CA  . GLN B  1 239 ? -16.610 8.922   123.872 1.00 29.15  ? 346  GLN B CA  1 
ATOM   5380  C  C   . GLN B  1 239 ? -17.404 9.469   125.058 1.00 29.68  ? 346  GLN B C   1 
ATOM   5381  O  O   . GLN B  1 239 ? -17.955 10.565  124.994 1.00 30.14  ? 346  GLN B O   1 
ATOM   5382  C  CB  . GLN B  1 239 ? -17.583 8.321   122.864 1.00 28.90  ? 346  GLN B CB  1 
ATOM   5383  C  CG  . GLN B  1 239 ? -18.644 9.261   122.334 1.00 29.97  ? 346  GLN B CG  1 
ATOM   5384  C  CD  . GLN B  1 239 ? -19.704 8.520   121.530 1.00 29.55  ? 346  GLN B CD  1 
ATOM   5385  O  OE1 . GLN B  1 239 ? -20.552 7.823   122.095 1.00 28.29  ? 346  GLN B OE1 1 
ATOM   5386  N  NE2 . GLN B  1 239 ? -19.650 8.657   120.206 1.00 28.40  ? 346  GLN B NE2 1 
ATOM   5387  N  N   . ASN B  1 240 ? -17.471 8.707   126.141 1.00 30.46  ? 347  ASN B N   1 
ATOM   5388  C  CA  . ASN B  1 240 ? -18.242 9.126   127.309 1.00 29.68  ? 347  ASN B CA  1 
ATOM   5389  C  C   . ASN B  1 240 ? -17.412 9.755   128.430 1.00 28.55  ? 347  ASN B C   1 
ATOM   5390  O  O   . ASN B  1 240 ? -17.947 10.090  129.490 1.00 27.74  ? 347  ASN B O   1 
ATOM   5391  C  CB  . ASN B  1 240 ? -19.027 7.921   127.863 1.00 30.24  ? 347  ASN B CB  1 
ATOM   5392  C  CG  . ASN B  1 240 ? -19.971 7.323   126.839 0.00 30.28  ? 347  ASN B CG  1 
ATOM   5393  O  OD1 . ASN B  1 240 ? -19.543 6.845   125.788 0.00 30.44  ? 347  ASN B OD1 1 
ATOM   5394  N  ND2 . ASN B  1 240 ? -21.264 7.349   127.139 0.00 30.44  ? 347  ASN B ND2 1 
ATOM   5395  N  N   . GLU B  1 241 ? -16.112 9.919   128.209 1.00 27.17  ? 348  GLU B N   1 
ATOM   5396  C  CA  . GLU B  1 241 ? -15.262 10.505  129.235 1.00 24.73  ? 348  GLU B CA  1 
ATOM   5397  C  C   . GLU B  1 241 ? -14.763 11.875  128.808 1.00 24.18  ? 348  GLU B C   1 
ATOM   5398  O  O   . GLU B  1 241 ? -14.546 12.136  127.621 1.00 23.60  ? 348  GLU B O   1 
ATOM   5399  C  CB  . GLU B  1 241 ? -14.098 9.567   129.539 1.00 24.19  ? 348  GLU B CB  1 
ATOM   5400  C  CG  . GLU B  1 241 ? -14.553 8.151   129.799 1.00 24.33  ? 348  GLU B CG  1 
ATOM   5401  C  CD  . GLU B  1 241 ? -13.413 7.200   130.059 1.00 26.42  ? 348  GLU B CD  1 
ATOM   5402  O  OE1 . GLU B  1 241 ? -12.944 7.128   131.217 1.00 28.05  ? 348  GLU B OE1 1 
ATOM   5403  O  OE2 . GLU B  1 241 ? -12.979 6.525   129.101 1.00 27.06  ? 348  GLU B OE2 1 
ATOM   5404  N  N   . LYS B  1 242 ? -14.608 12.757  129.787 1.00 23.83  ? 349  LYS B N   1 
ATOM   5405  C  CA  . LYS B  1 242 ? -14.144 14.115  129.545 1.00 24.12  ? 349  LYS B CA  1 
ATOM   5406  C  C   . LYS B  1 242 ? -12.698 14.138  129.060 1.00 23.66  ? 349  LYS B C   1 
ATOM   5407  O  O   . LYS B  1 242 ? -11.954 13.174  129.236 1.00 24.20  ? 349  LYS B O   1 
ATOM   5408  C  CB  . LYS B  1 242 ? -14.252 14.919  130.829 1.00 25.04  ? 349  LYS B CB  1 
ATOM   5409  C  CG  . LYS B  1 242 ? -15.646 14.982  131.410 1.00 26.74  ? 349  LYS B CG  1 
ATOM   5410  C  CD  . LYS B  1 242 ? -16.424 16.175  130.869 1.00 27.32  ? 349  LYS B CD  1 
ATOM   5411  C  CE  . LYS B  1 242 ? -17.616 16.483  131.767 1.00 27.73  ? 349  LYS B CE  1 
ATOM   5412  N  NZ  . LYS B  1 242 ? -17.206 16.687  133.193 1.00 26.90  ? 349  LYS B NZ  1 
ATOM   5413  N  N   . GLN B  1 243 ? -12.295 15.246  128.457 1.00 23.24  ? 350  GLN B N   1 
ATOM   5414  C  CA  . GLN B  1 243 ? -10.934 15.361  127.958 1.00 22.93  ? 350  GLN B CA  1 
ATOM   5415  C  C   . GLN B  1 243 ? -10.205 16.532  128.615 1.00 22.33  ? 350  GLN B C   1 
ATOM   5416  O  O   . GLN B  1 243 ? -10.695 17.092  129.594 1.00 22.94  ? 350  GLN B O   1 
ATOM   5417  C  CB  . GLN B  1 243 ? -10.966 15.483  126.436 1.00 22.40  ? 350  GLN B CB  1 
ATOM   5418  C  CG  . GLN B  1 243 ? -11.831 14.394  125.822 1.00 21.34  ? 350  GLN B CG  1 
ATOM   5419  C  CD  . GLN B  1 243 ? -11.715 14.311  124.317 1.00 21.41  ? 350  GLN B CD  1 
ATOM   5420  O  OE1 . GLN B  1 243 ? -11.658 15.331  123.625 1.00 20.50  ? 350  GLN B OE1 1 
ATOM   5421  N  NE2 . GLN B  1 243 ? -11.697 13.089  123.796 1.00 19.23  ? 350  GLN B NE2 1 
ATOM   5422  N  N   . ILE B  1 244 ? -9.039  16.894  128.094 1.00 21.30  ? 351  ILE B N   1 
ATOM   5423  C  CA  . ILE B  1 244 ? -8.262  17.965  128.691 1.00 20.64  ? 351  ILE B CA  1 
ATOM   5424  C  C   . ILE B  1 244 ? -8.570  19.350  128.140 1.00 21.27  ? 351  ILE B C   1 
ATOM   5425  O  O   . ILE B  1 244 ? -8.749  19.535  126.938 1.00 21.39  ? 351  ILE B O   1 
ATOM   5426  C  CB  . ILE B  1 244 ? -6.756  17.668  128.561 1.00 20.33  ? 351  ILE B CB  1 
ATOM   5427  C  CG1 . ILE B  1 244 ? -6.471  16.252  129.068 1.00 19.41  ? 351  ILE B CG1 1 
ATOM   5428  C  CG2 . ILE B  1 244 ? -5.940  18.666  129.379 1.00 21.44  ? 351  ILE B CG2 1 
ATOM   5429  C  CD1 . ILE B  1 244 ? -6.976  15.967  130.462 1.00 16.79  ? 351  ILE B CD1 1 
ATOM   5430  N  N   . VAL B  1 245 ? -8.627  20.323  129.046 1.00 21.59  ? 352  VAL B N   1 
ATOM   5431  C  CA  . VAL B  1 245 ? -8.922  21.711  128.703 1.00 22.26  ? 352  VAL B CA  1 
ATOM   5432  C  C   . VAL B  1 245 ? -7.637  22.528  128.619 1.00 22.64  ? 352  VAL B C   1 
ATOM   5433  O  O   . VAL B  1 245 ? -6.838  22.548  129.557 1.00 23.71  ? 352  VAL B O   1 
ATOM   5434  C  CB  . VAL B  1 245 ? -9.835  22.347  129.760 1.00 21.22  ? 352  VAL B CB  1 
ATOM   5435  C  CG1 . VAL B  1 245 ? -10.136 23.772  129.376 1.00 21.39  ? 352  VAL B CG1 1 
ATOM   5436  C  CG2 . VAL B  1 245 ? -11.113 21.533  129.894 1.00 21.44  ? 352  VAL B CG2 1 
ATOM   5437  N  N   . THR B  1 246 ? -7.440  23.219  127.504 1.00 22.61  ? 353  THR B N   1 
ATOM   5438  C  CA  . THR B  1 246 ? -6.223  23.996  127.342 1.00 22.28  ? 353  THR B CA  1 
ATOM   5439  C  C   . THR B  1 246 ? -6.314  25.052  126.243 1.00 22.60  ? 353  THR B C   1 
ATOM   5440  O  O   . THR B  1 246 ? -7.335  25.191  125.565 1.00 22.32  ? 353  THR B O   1 
ATOM   5441  C  CB  . THR B  1 246 ? -5.030  23.058  127.038 1.00 21.54  ? 353  THR B CB  1 
ATOM   5442  O  OG1 . THR B  1 246 ? -3.809  23.798  127.093 1.00 22.24  ? 353  THR B OG1 1 
ATOM   5443  C  CG2 . THR B  1 246 ? -5.169  22.444  125.660 1.00 20.41  ? 353  THR B CG2 1 
ATOM   5444  N  N   . THR B  1 247 ? -5.223  25.791  126.074 1.00 23.38  ? 354  THR B N   1 
ATOM   5445  C  CA  . THR B  1 247 ? -5.142  26.847  125.070 1.00 23.04  ? 354  THR B CA  1 
ATOM   5446  C  C   . THR B  1 247 ? -4.942  26.238  123.694 1.00 23.41  ? 354  THR B C   1 
ATOM   5447  O  O   . THR B  1 247 ? -4.126  25.325  123.525 1.00 23.77  ? 354  THR B O   1 
ATOM   5448  C  CB  . THR B  1 247 ? -3.979  27.790  125.379 1.00 21.79  ? 354  THR B CB  1 
ATOM   5449  O  OG1 . THR B  1 247 ? -2.785  27.021  125.549 1.00 22.56  ? 354  THR B OG1 1 
ATOM   5450  C  CG2 . THR B  1 247 ? -4.246  28.551  126.671 1.00 22.46  ? 354  THR B CG2 1 
ATOM   5451  N  N   . ASP B  1 248 ? -5.685  26.740  122.710 1.00 23.14  ? 355  ASP B N   1 
ATOM   5452  C  CA  . ASP B  1 248 ? -5.581  26.219  121.352 1.00 22.96  ? 355  ASP B CA  1 
ATOM   5453  C  C   . ASP B  1 248 ? -5.112  27.321  120.405 1.00 22.49  ? 355  ASP B C   1 
ATOM   5454  O  O   . ASP B  1 248 ? -5.113  28.490  120.772 1.00 22.03  ? 355  ASP B O   1 
ATOM   5455  C  CB  . ASP B  1 248 ? -6.943  25.668  120.913 1.00 22.76  ? 355  ASP B CB  1 
ATOM   5456  C  CG  . ASP B  1 248 ? -6.834  24.647  119.794 1.00 22.80  ? 355  ASP B CG  1 
ATOM   5457  O  OD1 . ASP B  1 248 ? -7.880  24.113  119.374 1.00 23.68  ? 355  ASP B OD1 1 
ATOM   5458  O  OD2 . ASP B  1 248 ? -5.713  24.370  119.328 1.00 23.36  ? 355  ASP B OD2 1 
ATOM   5459  N  N   . LEU B  1 249 ? -4.699  26.948  119.195 1.00 22.69  ? 356  LEU B N   1 
ATOM   5460  C  CA  . LEU B  1 249 ? -4.251  27.933  118.216 1.00 22.88  ? 356  LEU B CA  1 
ATOM   5461  C  C   . LEU B  1 249 ? -5.327  28.965  117.932 1.00 24.78  ? 356  LEU B C   1 
ATOM   5462  O  O   . LEU B  1 249 ? -6.522  28.730  118.155 1.00 24.73  ? 356  LEU B O   1 
ATOM   5463  C  CB  . LEU B  1 249 ? -3.890  27.283  116.886 1.00 21.02  ? 356  LEU B CB  1 
ATOM   5464  C  CG  . LEU B  1 249 ? -2.441  26.945  116.562 1.00 22.05  ? 356  LEU B CG  1 
ATOM   5465  C  CD1 . LEU B  1 249 ? -2.315  26.916  115.053 1.00 20.29  ? 356  LEU B CD1 1 
ATOM   5466  C  CD2 . LEU B  1 249 ? -1.475  27.990  117.139 1.00 22.57  ? 356  LEU B CD2 1 
ATOM   5467  N  N   . ARG B  1 250 ? -4.886  30.103  117.408 1.00 26.75  ? 357  ARG B N   1 
ATOM   5468  C  CA  . ARG B  1 250 ? -5.773  31.207  117.059 1.00 27.70  ? 357  ARG B CA  1 
ATOM   5469  C  C   . ARG B  1 250 ? -6.493  31.776  118.271 1.00 28.34  ? 357  ARG B C   1 
ATOM   5470  O  O   . ARG B  1 250 ? -7.666  32.134  118.209 1.00 29.65  ? 357  ARG B O   1 
ATOM   5471  C  CB  . ARG B  1 250 ? -6.767  30.748  115.993 1.00 29.16  ? 357  ARG B CB  1 
ATOM   5472  C  CG  . ARG B  1 250 ? -6.070  30.312  114.716 1.00 30.15  ? 357  ARG B CG  1 
ATOM   5473  C  CD  . ARG B  1 250 ? -7.025  29.672  113.733 1.00 33.26  ? 357  ARG B CD  1 
ATOM   5474  N  NE  . ARG B  1 250 ? -6.300  29.079  112.612 1.00 36.46  ? 357  ARG B NE  1 
ATOM   5475  C  CZ  . ARG B  1 250 ? -5.608  29.778  111.714 1.00 38.14  ? 357  ARG B CZ  1 
ATOM   5476  N  NH1 . ARG B  1 250 ? -4.970  29.156  110.726 1.00 39.15  ? 357  ARG B NH1 1 
ATOM   5477  N  NH2 . ARG B  1 250 ? -5.561  31.103  111.795 1.00 38.24  ? 357  ARG B NH2 1 
ATOM   5478  N  N   . GLN B  1 251 ? -5.766  31.851  119.378 1.00 29.08  ? 358  GLN B N   1 
ATOM   5479  C  CA  . GLN B  1 251 ? -6.280  32.391  120.627 1.00 29.25  ? 358  GLN B CA  1 
ATOM   5480  C  C   . GLN B  1 251 ? -7.557  31.755  121.120 1.00 29.01  ? 358  GLN B C   1 
ATOM   5481  O  O   . GLN B  1 251 ? -8.345  32.399  121.807 1.00 29.36  ? 358  GLN B O   1 
ATOM   5482  C  CB  . GLN B  1 251 ? -6.498  33.888  120.493 1.00 29.93  ? 358  GLN B CB  1 
ATOM   5483  C  CG  . GLN B  1 251 ? -5.254  34.621  120.074 1.00 34.14  ? 358  GLN B CG  1 
ATOM   5484  C  CD  . GLN B  1 251 ? -5.338  36.115  120.324 1.00 36.70  ? 358  GLN B CD  1 
ATOM   5485  O  OE1 . GLN B  1 251 ? -4.406  36.858  120.002 1.00 37.95  ? 358  GLN B OE1 1 
ATOM   5486  N  NE2 . GLN B  1 251 ? -6.453  36.567  120.906 1.00 37.57  ? 358  GLN B NE2 1 
ATOM   5487  N  N   . LYS B  1 252 ? -7.766  30.491  120.788 1.00 28.87  ? 359  LYS B N   1 
ATOM   5488  C  CA  . LYS B  1 252 ? -8.974  29.824  121.227 1.00 28.88  ? 359  LYS B CA  1 
ATOM   5489  C  C   . LYS B  1 252 ? -8.722  28.967  122.449 1.00 29.08  ? 359  LYS B C   1 
ATOM   5490  O  O   . LYS B  1 252 ? -7.602  28.893  122.948 1.00 29.25  ? 359  LYS B O   1 
ATOM   5491  C  CB  . LYS B  1 252 ? -9.553  28.981  120.089 1.00 29.64  ? 359  LYS B CB  1 
ATOM   5492  C  CG  . LYS B  1 252 ? -9.970  29.814  118.886 1.00 31.27  ? 359  LYS B CG  1 
ATOM   5493  C  CD  . LYS B  1 252 ? -10.905 29.050  117.957 1.00 32.06  ? 359  LYS B CD  1 
ATOM   5494  C  CE  . LYS B  1 252 ? -11.323 29.913  116.769 1.00 32.98  ? 359  LYS B CE  1 
ATOM   5495  N  NZ  . LYS B  1 252 ? -12.267 29.200  115.864 0.00 32.90  ? 359  LYS B NZ  1 
ATOM   5496  N  N   . CYS B  1 253 ? -9.779  28.318  122.919 1.00 29.17  ? 360  CYS B N   1 
ATOM   5497  C  CA  . CYS B  1 253 ? -9.723  27.465  124.094 1.00 29.38  ? 360  CYS B CA  1 
ATOM   5498  C  C   . CYS B  1 253 ? -10.372 26.141  123.713 1.00 29.04  ? 360  CYS B C   1 
ATOM   5499  O  O   . CYS B  1 253 ? -11.449 26.125  123.116 1.00 31.04  ? 360  CYS B O   1 
ATOM   5500  C  CB  . CYS B  1 253 ? -10.494 28.149  125.217 1.00 30.71  ? 360  CYS B CB  1 
ATOM   5501  S  SG  . CYS B  1 253 ? -10.651 27.259  126.792 1.00 34.69  ? 360  CYS B SG  1 
ATOM   5502  N  N   . THR B  1 254 ? -9.723  25.029  124.030 1.00 27.52  ? 361  THR B N   1 
ATOM   5503  C  CA  . THR B  1 254 ? -10.293 23.739  123.683 1.00 26.25  ? 361  THR B CA  1 
ATOM   5504  C  C   . THR B  1 254 ? -10.526 22.894  124.909 1.00 26.52  ? 361  THR B C   1 
ATOM   5505  O  O   . THR B  1 254 ? -9.831  23.040  125.914 1.00 27.34  ? 361  THR B O   1 
ATOM   5506  C  CB  . THR B  1 254 ? -9.386  22.946  122.727 1.00 26.00  ? 361  THR B CB  1 
ATOM   5507  O  OG1 . THR B  1 254 ? -9.993  21.678  122.453 1.00 25.56  ? 361  THR B OG1 1 
ATOM   5508  C  CG2 . THR B  1 254 ? -8.009  22.712  123.347 1.00 25.63  ? 361  THR B CG2 1 
ATOM   5509  N  N   . GLU B  1 255 ? -11.514 22.012  124.823 1.00 26.50  ? 362  GLU B N   1 
ATOM   5510  C  CA  . GLU B  1 255 ? -11.829 21.111  125.920 1.00 26.96  ? 362  GLU B CA  1 
ATOM   5511  C  C   . GLU B  1 255 ? -11.661 19.688  125.420 1.00 26.50  ? 362  GLU B C   1 
ATOM   5512  O  O   . GLU B  1 255 ? -12.097 18.731  126.073 1.00 26.29  ? 362  GLU B O   1 
ATOM   5513  C  CB  . GLU B  1 255 ? -13.265 21.307  126.398 1.00 28.42  ? 362  GLU B CB  1 
ATOM   5514  C  CG  . GLU B  1 255 ? -13.535 22.649  127.033 1.00 32.11  ? 362  GLU B CG  1 
ATOM   5515  C  CD  . GLU B  1 255 ? -15.000 22.839  127.401 1.00 34.45  ? 362  GLU B CD  1 
ATOM   5516  O  OE1 . GLU B  1 255 ? -15.492 22.150  128.335 1.00 35.68  ? 362  GLU B OE1 1 
ATOM   5517  O  OE2 . GLU B  1 255 ? -15.656 23.677  126.742 1.00 35.54  ? 362  GLU B OE2 1 
ATOM   5518  N  N   . SER B  1 256 ? -11.026 19.544  124.262 1.00 24.87  ? 363  SER B N   1 
ATOM   5519  C  CA  . SER B  1 256 ? -10.838 18.218  123.710 1.00 25.77  ? 363  SER B CA  1 
ATOM   5520  C  C   . SER B  1 256 ? -9.400  17.848  123.330 1.00 24.95  ? 363  SER B C   1 
ATOM   5521  O  O   . SER B  1 256 ? -9.153  17.288  122.259 1.00 24.58  ? 363  SER B O   1 
ATOM   5522  C  CB  . SER B  1 256 ? -11.781 18.027  122.519 1.00 26.15  ? 363  SER B CB  1 
ATOM   5523  O  OG  . SER B  1 256 ? -11.663 19.107  121.620 1.00 28.61  ? 363  SER B OG  1 
ATOM   5524  N  N   . HIS B  1 257 ? -8.447  18.163  124.204 1.00 23.75  ? 364  HIS B N   1 
ATOM   5525  C  CA  . HIS B  1 257 ? -7.072  17.784  123.932 1.00 22.06  ? 364  HIS B CA  1 
ATOM   5526  C  C   . HIS B  1 257 ? -7.025  16.334  124.380 1.00 21.17  ? 364  HIS B C   1 
ATOM   5527  O  O   . HIS B  1 257 ? -7.618  15.981  125.404 1.00 19.19  ? 364  HIS B O   1 
ATOM   5528  C  CB  . HIS B  1 257 ? -6.067  18.604  124.735 1.00 21.57  ? 364  HIS B CB  1 
ATOM   5529  C  CG  . HIS B  1 257 ? -4.654  18.435  124.262 1.00 21.47  ? 364  HIS B CG  1 
ATOM   5530  N  ND1 . HIS B  1 257 ? -3.562  18.768  125.032 1.00 21.71  ? 364  HIS B ND1 1 
ATOM   5531  C  CD2 . HIS B  1 257 ? -4.158  17.970  123.089 1.00 21.63  ? 364  HIS B CD2 1 
ATOM   5532  C  CE1 . HIS B  1 257 ? -2.452  18.513  124.358 1.00 21.17  ? 364  HIS B CE1 1 
ATOM   5533  N  NE2 . HIS B  1 257 ? -2.786  18.028  123.176 1.00 20.66  ? 364  HIS B NE2 1 
ATOM   5534  N  N   . THR B  1 258 ? -6.310  15.502  123.624 1.00 20.95  ? 365  THR B N   1 
ATOM   5535  C  CA  . THR B  1 258 ? -6.259  14.074  123.912 1.00 19.16  ? 365  THR B CA  1 
ATOM   5536  C  C   . THR B  1 258 ? -4.881  13.445  123.827 1.00 19.79  ? 365  THR B C   1 
ATOM   5537  O  O   . THR B  1 258 ? -3.898  14.104  123.495 1.00 21.26  ? 365  THR B O   1 
ATOM   5538  C  CB  . THR B  1 258 ? -7.134  13.339  122.926 1.00 18.10  ? 365  THR B CB  1 
ATOM   5539  O  OG1 . THR B  1 258 ? -6.585  13.510  121.612 1.00 16.09  ? 365  THR B OG1 1 
ATOM   5540  C  CG2 . THR B  1 258 ? -8.556  13.899  122.960 1.00 15.69  ? 365  THR B CG2 1 
ATOM   5541  N  N   . GLY B  1 259 ? -4.827  12.153  124.138 1.00 18.70  ? 366  GLY B N   1 
ATOM   5542  C  CA  . GLY B  1 259 ? -3.587  11.407  124.053 1.00 17.39  ? 366  GLY B CA  1 
ATOM   5543  C  C   . GLY B  1 259 ? -2.557  11.633  125.135 1.00 17.76  ? 366  GLY B C   1 
ATOM   5544  O  O   . GLY B  1 259 ? -2.743  12.462  126.029 1.00 17.96  ? 366  GLY B O   1 
ATOM   5545  N  N   . THR B  1 260 ? -1.462  10.878  125.055 1.00 16.60  ? 367  THR B N   1 
ATOM   5546  C  CA  . THR B  1 260 ? -0.393  11.009  126.025 1.00 15.81  ? 367  THR B CA  1 
ATOM   5547  C  C   . THR B  1 260 ? 0.257   12.392  125.927 1.00 16.01  ? 367  THR B C   1 
ATOM   5548  O  O   . THR B  1 260 ? 1.006   12.790  126.809 1.00 17.47  ? 367  THR B O   1 
ATOM   5549  C  CB  . THR B  1 260 ? 0.681   9.908   125.847 1.00 13.70  ? 367  THR B CB  1 
ATOM   5550  O  OG1 . THR B  1 260 ? 1.134   9.877   124.491 1.00 13.98  ? 367  THR B OG1 1 
ATOM   5551  C  CG2 . THR B  1 260 ? 0.122   8.570   126.211 1.00 13.03  ? 367  THR B CG2 1 
ATOM   5552  N  N   . SER B  1 261 ? -0.038  13.129  124.862 1.00 15.78  ? 368  SER B N   1 
ATOM   5553  C  CA  . SER B  1 261 ? 0.526   14.458  124.698 1.00 17.29  ? 368  SER B CA  1 
ATOM   5554  C  C   . SER B  1 261 ? -0.032  15.425  125.726 1.00 18.26  ? 368  SER B C   1 
ATOM   5555  O  O   . SER B  1 261 ? 0.557   16.475  125.985 1.00 19.79  ? 368  SER B O   1 
ATOM   5556  C  CB  . SER B  1 261 ? 0.239   15.006  123.301 1.00 16.75  ? 368  SER B CB  1 
ATOM   5557  O  OG  . SER B  1 261 ? 1.146   14.473  122.361 1.00 18.33  ? 368  SER B OG  1 
ATOM   5558  N  N   . ALA B  1 262 ? -1.184  15.088  126.293 1.00 17.40  ? 369  ALA B N   1 
ATOM   5559  C  CA  . ALA B  1 262 ? -1.789  15.942  127.298 1.00 16.77  ? 369  ALA B CA  1 
ATOM   5560  C  C   . ALA B  1 262 ? -1.233  15.544  128.663 1.00 17.06  ? 369  ALA B C   1 
ATOM   5561  O  O   . ALA B  1 262 ? -1.165  16.357  129.578 1.00 17.55  ? 369  ALA B O   1 
ATOM   5562  C  CB  . ALA B  1 262 ? -3.314  15.787  127.274 1.00 15.09  ? 369  ALA B CB  1 
ATOM   5563  N  N   . SER B  1 263 ? -0.818  14.288  128.782 1.00 17.13  ? 370  SER B N   1 
ATOM   5564  C  CA  . SER B  1 263 ? -0.293  13.768  130.031 1.00 18.12  ? 370  SER B CA  1 
ATOM   5565  C  C   . SER B  1 263 ? 1.105   14.254  130.410 1.00 18.95  ? 370  SER B C   1 
ATOM   5566  O  O   . SER B  1 263 ? 1.370   14.546  131.584 1.00 19.54  ? 370  SER B O   1 
ATOM   5567  C  CB  . SER B  1 263 ? -0.312  12.246  129.985 1.00 17.84  ? 370  SER B CB  1 
ATOM   5568  O  OG  . SER B  1 263 ? -1.649  11.781  129.994 1.00 19.43  ? 370  SER B OG  1 
ATOM   5569  N  N   . ALA B  1 264 ? 1.998   14.339  129.428 1.00 17.70  ? 371  ALA B N   1 
ATOM   5570  C  CA  . ALA B  1 264 ? 3.356   14.781  129.696 1.00 16.62  ? 371  ALA B CA  1 
ATOM   5571  C  C   . ALA B  1 264 ? 3.397   16.208  130.262 1.00 16.90  ? 371  ALA B C   1 
ATOM   5572  O  O   . ALA B  1 264 ? 4.015   16.452  131.296 1.00 16.78  ? 371  ALA B O   1 
ATOM   5573  C  CB  . ALA B  1 264 ? 4.196   14.677  128.439 1.00 16.15  ? 371  ALA B CB  1 
ATOM   5574  N  N   . PRO B  1 265 ? 2.743   17.170  129.595 1.00 16.73  ? 372  PRO B N   1 
ATOM   5575  C  CA  . PRO B  1 265 ? 2.767   18.534  130.125 1.00 16.44  ? 372  PRO B CA  1 
ATOM   5576  C  C   . PRO B  1 265 ? 2.129   18.649  131.518 1.00 16.81  ? 372  PRO B C   1 
ATOM   5577  O  O   . PRO B  1 265 ? 2.591   19.424  132.352 1.00 17.17  ? 372  PRO B O   1 
ATOM   5578  C  CB  . PRO B  1 265 ? 2.031   19.334  129.052 1.00 16.73  ? 372  PRO B CB  1 
ATOM   5579  C  CG  . PRO B  1 265 ? 1.151   18.330  128.398 1.00 15.94  ? 372  PRO B CG  1 
ATOM   5580  C  CD  . PRO B  1 265 ? 2.044   17.128  128.302 1.00 16.83  ? 372  PRO B CD  1 
ATOM   5581  N  N   . LEU B  1 266 ? 1.077   17.884  131.780 1.00 15.35  ? 373  LEU B N   1 
ATOM   5582  C  CA  . LEU B  1 266 ? 0.462   17.927  133.098 1.00 14.87  ? 373  LEU B CA  1 
ATOM   5583  C  C   . LEU B  1 266 ? 1.488   17.457  134.117 1.00 15.31  ? 373  LEU B C   1 
ATOM   5584  O  O   . LEU B  1 266 ? 1.558   17.972  135.227 1.00 17.29  ? 373  LEU B O   1 
ATOM   5585  C  CB  . LEU B  1 266 ? -0.771  17.023  133.165 1.00 13.14  ? 373  LEU B CB  1 
ATOM   5586  C  CG  . LEU B  1 266 ? -2.001  17.543  132.423 1.00 13.98  ? 373  LEU B CG  1 
ATOM   5587  C  CD1 . LEU B  1 266 ? -3.102  16.508  132.480 1.00 12.48  ? 373  LEU B CD1 1 
ATOM   5588  C  CD2 . LEU B  1 266 ? -2.455  18.866  133.039 1.00 12.09  ? 373  LEU B CD2 1 
ATOM   5589  N  N   . ALA B  1 267 ? 2.284   16.469  133.738 1.00 15.03  ? 374  ALA B N   1 
ATOM   5590  C  CA  . ALA B  1 267 ? 3.300   15.957  134.641 1.00 15.24  ? 374  ALA B CA  1 
ATOM   5591  C  C   . ALA B  1 267 ? 4.376   17.026  134.828 1.00 15.35  ? 374  ALA B C   1 
ATOM   5592  O  O   . ALA B  1 267 ? 4.882   17.226  135.931 1.00 16.00  ? 374  ALA B O   1 
ATOM   5593  C  CB  . ALA B  1 267 ? 3.918   14.681  134.076 1.00 13.30  ? 374  ALA B CB  1 
ATOM   5594  N  N   . ALA B  1 268 ? 4.719   17.713  133.745 1.00 15.28  ? 375  ALA B N   1 
ATOM   5595  C  CA  . ALA B  1 268 ? 5.736   18.758  133.797 1.00 15.75  ? 375  ALA B CA  1 
ATOM   5596  C  C   . ALA B  1 268 ? 5.290   19.848  134.776 1.00 16.48  ? 375  ALA B C   1 
ATOM   5597  O  O   . ALA B  1 268 ? 6.092   20.361  135.550 1.00 18.31  ? 375  ALA B O   1 
ATOM   5598  C  CB  . ALA B  1 268 ? 5.965   19.346  132.399 1.00 12.06  ? 375  ALA B CB  1 
ATOM   5599  N  N   . GLY B  1 269 ? 4.007   20.187  134.743 1.00 16.28  ? 376  GLY B N   1 
ATOM   5600  C  CA  . GLY B  1 269 ? 3.485   21.190  135.641 1.00 15.33  ? 376  GLY B CA  1 
ATOM   5601  C  C   . GLY B  1 269 ? 3.630   20.731  137.077 1.00 16.76  ? 376  GLY B C   1 
ATOM   5602  O  O   . GLY B  1 269 ? 4.089   21.490  137.931 1.00 18.46  ? 376  GLY B O   1 
ATOM   5603  N  N   . ILE B  1 270 ? 3.239   19.491  137.353 1.00 16.99  ? 377  ILE B N   1 
ATOM   5604  C  CA  . ILE B  1 270 ? 3.344   18.935  138.703 1.00 16.80  ? 377  ILE B CA  1 
ATOM   5605  C  C   . ILE B  1 270 ? 4.804   18.896  139.150 1.00 16.80  ? 377  ILE B C   1 
ATOM   5606  O  O   . ILE B  1 270 ? 5.111   19.088  140.323 1.00 18.99  ? 377  ILE B O   1 
ATOM   5607  C  CB  . ILE B  1 270 ? 2.759   17.506  138.763 1.00 15.97  ? 377  ILE B CB  1 
ATOM   5608  C  CG1 . ILE B  1 270 ? 1.252   17.557  138.476 1.00 15.51  ? 377  ILE B CG1 1 
ATOM   5609  C  CG2 . ILE B  1 270 ? 3.057   16.880  140.108 1.00 15.39  ? 377  ILE B CG2 1 
ATOM   5610  C  CD1 . ILE B  1 270 ? 0.529   16.242  138.625 1.00 12.18  ? 377  ILE B CD1 1 
ATOM   5611  N  N   . ILE B  1 271 ? 5.702   18.652  138.206 1.00 15.89  ? 378  ILE B N   1 
ATOM   5612  C  CA  . ILE B  1 271 ? 7.112   18.592  138.518 1.00 15.07  ? 378  ILE B CA  1 
ATOM   5613  C  C   . ILE B  1 271 ? 7.617   19.997  138.788 1.00 15.55  ? 378  ILE B C   1 
ATOM   5614  O  O   . ILE B  1 271 ? 8.562   20.193  139.556 1.00 15.79  ? 378  ILE B O   1 
ATOM   5615  C  CB  . ILE B  1 271 ? 7.889   17.916  137.360 1.00 14.34  ? 378  ILE B CB  1 
ATOM   5616  C  CG1 . ILE B  1 271 ? 7.555   16.417  137.372 1.00 15.26  ? 378  ILE B CG1 1 
ATOM   5617  C  CG2 . ILE B  1 271 ? 9.403   18.130  137.514 1.00 12.85  ? 378  ILE B CG2 1 
ATOM   5618  C  CD1 . ILE B  1 271 ? 8.203   15.608  136.280 1.00 15.04  ? 378  ILE B CD1 1 
ATOM   5619  N  N   . ALA B  1 272 ? 6.969   20.974  138.167 1.00 14.53  ? 379  ALA B N   1 
ATOM   5620  C  CA  . ALA B  1 272 ? 7.332   22.367  138.358 1.00 14.81  ? 379  ALA B CA  1 
ATOM   5621  C  C   . ALA B  1 272 ? 6.988   22.765  139.800 1.00 15.78  ? 379  ALA B C   1 
ATOM   5622  O  O   . ALA B  1 272 ? 7.773   23.431  140.474 1.00 16.16  ? 379  ALA B O   1 
ATOM   5623  C  CB  . ALA B  1 272 ? 6.575   23.241  137.359 1.00 14.29  ? 379  ALA B CB  1 
ATOM   5624  N  N   . LEU B  1 273 ? 5.819   22.339  140.273 1.00 16.01  ? 380  LEU B N   1 
ATOM   5625  C  CA  . LEU B  1 273 ? 5.398   22.651  141.632 1.00 16.65  ? 380  LEU B CA  1 
ATOM   5626  C  C   . LEU B  1 273 ? 6.376   22.017  142.615 1.00 17.67  ? 380  LEU B C   1 
ATOM   5627  O  O   . LEU B  1 273 ? 6.760   22.614  143.627 1.00 18.02  ? 380  LEU B O   1 
ATOM   5628  C  CB  . LEU B  1 273 ? 3.993   22.107  141.895 1.00 15.50  ? 380  LEU B CB  1 
ATOM   5629  C  CG  . LEU B  1 273 ? 2.860   22.552  140.970 1.00 14.00  ? 380  LEU B CG  1 
ATOM   5630  C  CD1 . LEU B  1 273 ? 1.540   22.027  141.499 1.00 13.54  ? 380  LEU B CD1 1 
ATOM   5631  C  CD2 . LEU B  1 273 ? 2.821   24.051  140.883 1.00 13.11  ? 380  LEU B CD2 1 
ATOM   5632  N  N   . THR B  1 274 ? 6.785   20.798  142.302 1.00 17.41  ? 381  THR B N   1 
ATOM   5633  C  CA  . THR B  1 274 ? 7.702   20.082  143.163 1.00 17.78  ? 381  THR B CA  1 
ATOM   5634  C  C   . THR B  1 274 ? 9.035   20.819  143.266 1.00 18.96  ? 381  THR B C   1 
ATOM   5635  O  O   . THR B  1 274 ? 9.622   20.899  144.347 1.00 19.68  ? 381  THR B O   1 
ATOM   5636  C  CB  . THR B  1 274 ? 7.890   18.639  142.641 1.00 16.74  ? 381  THR B CB  1 
ATOM   5637  O  OG1 . THR B  1 274 ? 6.597   18.030  142.502 1.00 13.77  ? 381  THR B OG1 1 
ATOM   5638  C  CG2 . THR B  1 274 ? 8.720   17.802  143.615 1.00 13.92  ? 381  THR B CG2 1 
ATOM   5639  N  N   . LEU B  1 275 ? 9.503   21.375  142.153 1.00 19.80  ? 382  LEU B N   1 
ATOM   5640  C  CA  . LEU B  1 275 ? 10.767  22.109  142.151 1.00 20.20  ? 382  LEU B CA  1 
ATOM   5641  C  C   . LEU B  1 275 ? 10.696  23.392  142.967 1.00 21.09  ? 382  LEU B C   1 
ATOM   5642  O  O   . LEU B  1 275 ? 11.670  23.777  143.613 1.00 22.01  ? 382  LEU B O   1 
ATOM   5643  C  CB  . LEU B  1 275 ? 11.188  22.457  140.729 1.00 20.15  ? 382  LEU B CB  1 
ATOM   5644  C  CG  . LEU B  1 275 ? 12.152  21.476  140.084 1.00 19.93  ? 382  LEU B CG  1 
ATOM   5645  C  CD1 . LEU B  1 275 ? 12.623  22.047  138.756 1.00 19.67  ? 382  LEU B CD1 1 
ATOM   5646  C  CD2 . LEU B  1 275 ? 13.330  21.239  141.021 1.00 20.45  ? 382  LEU B CD2 1 
ATOM   5647  N  N   . GLU B  1 276 ? 9.557   24.069  142.921 1.00 21.70  ? 383  GLU B N   1 
ATOM   5648  C  CA  . GLU B  1 276 ? 9.402   25.285  143.695 1.00 21.63  ? 383  GLU B CA  1 
ATOM   5649  C  C   . GLU B  1 276 ? 9.540   24.896  145.157 1.00 21.13  ? 383  GLU B C   1 
ATOM   5650  O  O   . GLU B  1 276 ? 10.197  25.581  145.926 1.00 22.15  ? 383  GLU B O   1 
ATOM   5651  C  CB  . GLU B  1 276 ? 8.033   25.924  143.438 1.00 22.98  ? 383  GLU B CB  1 
ATOM   5652  C  CG  . GLU B  1 276 ? 7.729   27.121  144.328 1.00 25.91  ? 383  GLU B CG  1 
ATOM   5653  C  CD  . GLU B  1 276 ? 6.453   27.854  143.932 1.00 28.15  ? 383  GLU B CD  1 
ATOM   5654  O  OE1 . GLU B  1 276 ? 5.538   27.207  143.385 1.00 29.85  ? 383  GLU B OE1 1 
ATOM   5655  O  OE2 . GLU B  1 276 ? 6.355   29.075  144.181 1.00 29.49  ? 383  GLU B OE2 1 
ATOM   5656  N  N   . ALA B  1 277 ? 8.948   23.768  145.529 1.00 20.77  ? 384  ALA B N   1 
ATOM   5657  C  CA  . ALA B  1 277 ? 8.997   23.300  146.908 1.00 20.33  ? 384  ALA B CA  1 
ATOM   5658  C  C   . ALA B  1 277 ? 10.409  22.920  147.343 1.00 20.28  ? 384  ALA B C   1 
ATOM   5659  O  O   . ALA B  1 277 ? 10.718  22.897  148.536 1.00 20.34  ? 384  ALA B O   1 
ATOM   5660  C  CB  . ALA B  1 277 ? 8.055   22.123  147.090 1.00 19.06  ? 384  ALA B CB  1 
ATOM   5661  N  N   . ASN B  1 278 ? 11.266  22.616  146.378 1.00 20.40  ? 385  ASN B N   1 
ATOM   5662  C  CA  . ASN B  1 278 ? 12.649  22.257  146.677 1.00 20.01  ? 385  ASN B CA  1 
ATOM   5663  C  C   . ASN B  1 278 ? 13.489  22.376  145.419 1.00 20.30  ? 385  ASN B C   1 
ATOM   5664  O  O   . ASN B  1 278 ? 13.648  21.414  144.673 1.00 21.39  ? 385  ASN B O   1 
ATOM   5665  C  CB  . ASN B  1 278 ? 12.737  20.834  147.230 1.00 18.04  ? 385  ASN B CB  1 
ATOM   5666  C  CG  . ASN B  1 278 ? 14.144  20.476  147.674 1.00 19.12  ? 385  ASN B CG  1 
ATOM   5667  O  OD1 . ASN B  1 278 ? 15.106  21.175  147.332 1.00 20.31  ? 385  ASN B OD1 1 
ATOM   5668  N  ND2 . ASN B  1 278 ? 14.280  19.381  148.427 1.00 16.82  ? 385  ASN B ND2 1 
ATOM   5669  N  N   . LYS B  1 279 ? 14.027  23.566  145.195 1.00 21.69  ? 386  LYS B N   1 
ATOM   5670  C  CA  . LYS B  1 279 ? 14.843  23.850  144.022 1.00 22.88  ? 386  LYS B CA  1 
ATOM   5671  C  C   . LYS B  1 279 ? 16.111  23.026  143.904 1.00 22.54  ? 386  LYS B C   1 
ATOM   5672  O  O   . LYS B  1 279 ? 16.738  23.036  142.856 1.00 24.29  ? 386  LYS B O   1 
ATOM   5673  C  CB  . LYS B  1 279 ? 15.225  25.332  144.009 1.00 24.21  ? 386  LYS B CB  1 
ATOM   5674  C  CG  . LYS B  1 279 ? 14.045  26.268  144.063 1.00 26.17  ? 386  LYS B CG  1 
ATOM   5675  C  CD  . LYS B  1 279 ? 13.356  26.403  142.709 1.00 28.34  ? 386  LYS B CD  1 
ATOM   5676  C  CE  . LYS B  1 279 ? 14.082  27.397  141.791 1.00 31.15  ? 386  LYS B CE  1 
ATOM   5677  N  NZ  . LYS B  1 279 ? 15.462  26.971  141.388 1.00 32.64  ? 386  LYS B NZ  1 
ATOM   5678  N  N   . ASN B  1 280 ? 16.495  22.309  144.954 1.00 23.40  ? 387  ASN B N   1 
ATOM   5679  C  CA  . ASN B  1 280 ? 17.733  21.543  144.894 1.00 24.17  ? 387  ASN B CA  1 
ATOM   5680  C  C   . ASN B  1 280 ? 17.632  20.076  144.518 1.00 22.27  ? 387  ASN B C   1 
ATOM   5681  O  O   . ASN B  1 280 ? 18.625  19.347  144.583 1.00 21.22  ? 387  ASN B O   1 
ATOM   5682  C  CB  . ASN B  1 280 ? 18.492  21.674  146.207 1.00 29.28  ? 387  ASN B CB  1 
ATOM   5683  C  CG  . ASN B  1 280 ? 19.099  23.033  146.377 1.00 36.79  ? 387  ASN B CG  1 
ATOM   5684  O  OD1 . ASN B  1 280 ? 19.387  23.718  145.390 1.00 37.47  ? 387  ASN B OD1 1 
ATOM   5685  N  ND2 . ASN B  1 280 ? 19.318  23.424  147.628 1.00 45.46  ? 387  ASN B ND2 1 
ATOM   5686  N  N   . LEU B  1 281 ? 16.445  19.641  144.113 1.00 19.81  ? 388  LEU B N   1 
ATOM   5687  C  CA  . LEU B  1 281 ? 16.249  18.246  143.726 1.00 17.18  ? 388  LEU B CA  1 
ATOM   5688  C  C   . LEU B  1 281 ? 17.026  17.941  142.456 1.00 16.69  ? 388  LEU B C   1 
ATOM   5689  O  O   . LEU B  1 281 ? 17.003  18.731  141.510 1.00 16.73  ? 388  LEU B O   1 
ATOM   5690  C  CB  . LEU B  1 281 ? 14.768  17.975  143.485 1.00 15.03  ? 388  LEU B CB  1 
ATOM   5691  C  CG  . LEU B  1 281 ? 13.838  18.171  144.682 1.00 13.34  ? 388  LEU B CG  1 
ATOM   5692  C  CD1 . LEU B  1 281 ? 12.415  18.361  144.192 1.00 11.40  ? 388  LEU B CD1 1 
ATOM   5693  C  CD2 . LEU B  1 281 ? 13.946  16.992  145.622 1.00 9.27   ? 388  LEU B CD2 1 
ATOM   5694  N  N   . THR B  1 282 ? 17.722  16.807  142.421 1.00 14.61  ? 389  THR B N   1 
ATOM   5695  C  CA  . THR B  1 282 ? 18.465  16.466  141.218 1.00 13.51  ? 389  THR B CA  1 
ATOM   5696  C  C   . THR B  1 282 ? 17.520  15.737  140.275 1.00 13.80  ? 389  THR B C   1 
ATOM   5697  O  O   . THR B  1 282 ? 16.405  15.380  140.667 1.00 13.55  ? 389  THR B O   1 
ATOM   5698  C  CB  . THR B  1 282 ? 19.648  15.564  141.524 1.00 13.38  ? 389  THR B CB  1 
ATOM   5699  O  OG1 . THR B  1 282 ? 19.172  14.277  141.933 1.00 12.34  ? 389  THR B OG1 1 
ATOM   5700  C  CG2 . THR B  1 282 ? 20.500  16.178  142.616 1.00 10.59  ? 389  THR B CG2 1 
ATOM   5701  N  N   . TRP B  1 283 ? 17.947  15.529  139.031 1.00 13.75  ? 390  TRP B N   1 
ATOM   5702  C  CA  . TRP B  1 283 ? 17.108  14.826  138.062 1.00 13.06  ? 390  TRP B CA  1 
ATOM   5703  C  C   . TRP B  1 283 ? 16.741  13.434  138.587 1.00 12.83  ? 390  TRP B C   1 
ATOM   5704  O  O   . TRP B  1 283 ? 15.671  12.912  138.281 1.00 12.87  ? 390  TRP B O   1 
ATOM   5705  C  CB  . TRP B  1 283 ? 17.802  14.706  136.694 1.00 11.18  ? 390  TRP B CB  1 
ATOM   5706  C  CG  . TRP B  1 283 ? 19.021  13.817  136.653 1.00 10.83  ? 390  TRP B CG  1 
ATOM   5707  C  CD1 . TRP B  1 283 ? 20.285  14.143  137.037 1.00 10.91  ? 390  TRP B CD1 1 
ATOM   5708  C  CD2 . TRP B  1 283 ? 19.084  12.466  136.172 1.00 9.84   ? 390  TRP B CD2 1 
ATOM   5709  N  NE1 . TRP B  1 283 ? 21.138  13.082  136.824 1.00 11.54  ? 390  TRP B NE1 1 
ATOM   5710  C  CE2 . TRP B  1 283 ? 20.425  12.039  136.296 1.00 10.80  ? 390  TRP B CE2 1 
ATOM   5711  C  CE3 . TRP B  1 283 ? 18.136  11.575  135.651 1.00 9.24   ? 390  TRP B CE3 1 
ATOM   5712  C  CZ2 . TRP B  1 283 ? 20.845  10.758  135.916 1.00 10.11  ? 390  TRP B CZ2 1 
ATOM   5713  C  CZ3 . TRP B  1 283 ? 18.550  10.303  135.273 1.00 7.57   ? 390  TRP B CZ3 1 
ATOM   5714  C  CH2 . TRP B  1 283 ? 19.896  9.907   135.409 1.00 9.71   ? 390  TRP B CH2 1 
ATOM   5715  N  N   . ARG B  1 284 ? 17.631  12.834  139.372 1.00 12.10  ? 391  ARG B N   1 
ATOM   5716  C  CA  . ARG B  1 284 ? 17.354  11.531  139.952 1.00 11.95  ? 391  ARG B CA  1 
ATOM   5717  C  C   . ARG B  1 284 ? 16.417  11.670  141.150 1.00 13.67  ? 391  ARG B C   1 
ATOM   5718  O  O   . ARG B  1 284 ? 15.505  10.861  141.319 1.00 14.27  ? 391  ARG B O   1 
ATOM   5719  C  CB  . ARG B  1 284 ? 18.643  10.845  140.376 1.00 11.28  ? 391  ARG B CB  1 
ATOM   5720  C  CG  . ARG B  1 284 ? 19.452  10.300  139.217 1.00 13.31  ? 391  ARG B CG  1 
ATOM   5721  C  CD  . ARG B  1 284 ? 20.325  9.171   139.705 1.00 15.43  ? 391  ARG B CD  1 
ATOM   5722  N  NE  . ARG B  1 284 ? 21.355  9.670   140.601 1.00 17.67  ? 391  ARG B NE  1 
ATOM   5723  C  CZ  . ARG B  1 284 ? 21.768  9.051   141.699 1.00 17.46  ? 391  ARG B CZ  1 
ATOM   5724  N  NH1 . ARG B  1 284 ? 22.720  9.609   142.430 1.00 20.13  ? 391  ARG B NH1 1 
ATOM   5725  N  NH2 . ARG B  1 284 ? 21.233  7.899   142.076 1.00 15.34  ? 391  ARG B NH2 1 
ATOM   5726  N  N   . ASP B  1 285 ? 16.639  12.696  141.974 1.00 13.62  ? 392  ASP B N   1 
ATOM   5727  C  CA  . ASP B  1 285 ? 15.793  12.939  143.132 1.00 13.55  ? 392  ASP B CA  1 
ATOM   5728  C  C   . ASP B  1 285 ? 14.346  12.964  142.670 1.00 13.50  ? 392  ASP B C   1 
ATOM   5729  O  O   . ASP B  1 285 ? 13.478  12.333  143.276 1.00 13.65  ? 392  ASP B O   1 
ATOM   5730  C  CB  . ASP B  1 285 ? 16.124  14.291  143.775 1.00 15.36  ? 392  ASP B CB  1 
ATOM   5731  C  CG  . ASP B  1 285 ? 17.343  14.238  144.673 1.00 17.23  ? 392  ASP B CG  1 
ATOM   5732  O  OD1 . ASP B  1 285 ? 17.971  15.304  144.853 1.00 17.38  ? 392  ASP B OD1 1 
ATOM   5733  O  OD2 . ASP B  1 285 ? 17.663  13.144  145.208 1.00 17.26  ? 392  ASP B OD2 1 
ATOM   5734  N  N   . MET B  1 286 ? 14.098  13.696  141.588 1.00 13.30  ? 393  MET B N   1 
ATOM   5735  C  CA  . MET B  1 286 ? 12.753  13.838  141.037 1.00 13.75  ? 393  MET B CA  1 
ATOM   5736  C  C   . MET B  1 286 ? 12.124  12.494  140.683 1.00 14.69  ? 393  MET B C   1 
ATOM   5737  O  O   . MET B  1 286 ? 10.940  12.261  140.939 1.00 14.58  ? 393  MET B O   1 
ATOM   5738  C  CB  . MET B  1 286 ? 12.784  14.725  139.792 1.00 14.94  ? 393  MET B CB  1 
ATOM   5739  C  CG  . MET B  1 286 ? 11.425  15.210  139.317 1.00 15.67  ? 393  MET B CG  1 
ATOM   5740  S  SD  . MET B  1 286 ? 10.575  16.152  140.583 1.00 19.74  ? 393  MET B SD  1 
ATOM   5741  C  CE  . MET B  1 286 ? 11.526  17.724  140.528 1.00 18.77  ? 393  MET B CE  1 
ATOM   5742  N  N   . GLN B  1 287 ? 12.903  11.603  140.086 1.00 14.81  ? 394  GLN B N   1 
ATOM   5743  C  CA  . GLN B  1 287 ? 12.352  10.318  139.725 1.00 14.72  ? 394  GLN B CA  1 
ATOM   5744  C  C   . GLN B  1 287 ? 12.027  9.524   140.984 1.00 15.71  ? 394  GLN B C   1 
ATOM   5745  O  O   . GLN B  1 287 ? 11.010  8.826   141.033 1.00 17.07  ? 394  GLN B O   1 
ATOM   5746  C  CB  . GLN B  1 287 ? 13.308  9.576   138.784 1.00 14.19  ? 394  GLN B CB  1 
ATOM   5747  C  CG  . GLN B  1 287 ? 13.274  10.159  137.380 1.00 14.98  ? 394  GLN B CG  1 
ATOM   5748  C  CD  . GLN B  1 287 ? 14.079  9.363   136.370 1.00 16.31  ? 394  GLN B CD  1 
ATOM   5749  O  OE1 . GLN B  1 287 ? 14.046  8.140   136.367 1.00 17.50  ? 394  GLN B OE1 1 
ATOM   5750  N  NE2 . GLN B  1 287 ? 14.788  10.059  135.489 1.00 15.27  ? 394  GLN B NE2 1 
ATOM   5751  N  N   . HIS B  1 288 ? 12.866  9.645   142.011 1.00 14.84  ? 395  HIS B N   1 
ATOM   5752  C  CA  . HIS B  1 288 ? 12.606  8.960   143.275 1.00 13.86  ? 395  HIS B CA  1 
ATOM   5753  C  C   . HIS B  1 288 ? 11.287  9.450   143.861 1.00 14.20  ? 395  HIS B C   1 
ATOM   5754  O  O   . HIS B  1 288 ? 10.488  8.662   144.346 1.00 14.59  ? 395  HIS B O   1 
ATOM   5755  C  CB  . HIS B  1 288 ? 13.731  9.217   144.278 1.00 13.01  ? 395  HIS B CB  1 
ATOM   5756  C  CG  . HIS B  1 288 ? 14.932  8.346   144.073 1.00 12.50  ? 395  HIS B CG  1 
ATOM   5757  N  ND1 . HIS B  1 288 ? 15.010  7.062   144.568 1.00 12.20  ? 395  HIS B ND1 1 
ATOM   5758  C  CD2 . HIS B  1 288 ? 16.097  8.565   143.415 1.00 11.20  ? 395  HIS B CD2 1 
ATOM   5759  C  CE1 . HIS B  1 288 ? 16.170  6.529   144.227 1.00 11.99  ? 395  HIS B CE1 1 
ATOM   5760  N  NE2 . HIS B  1 288 ? 16.849  7.420   143.526 1.00 12.68  ? 395  HIS B NE2 1 
ATOM   5761  N  N   . LEU B  1 289 ? 11.056  10.757  143.814 1.00 15.52  ? 396  LEU B N   1 
ATOM   5762  C  CA  . LEU B  1 289 ? 9.819   11.317  144.356 1.00 16.83  ? 396  LEU B CA  1 
ATOM   5763  C  C   . LEU B  1 289 ? 8.592   10.777  143.628 1.00 16.56  ? 396  LEU B C   1 
ATOM   5764  O  O   . LEU B  1 289 ? 7.573   10.481  144.247 1.00 16.60  ? 396  LEU B O   1 
ATOM   5765  C  CB  . LEU B  1 289 ? 9.830   12.849  144.262 1.00 17.34  ? 396  LEU B CB  1 
ATOM   5766  C  CG  . LEU B  1 289 ? 10.902  13.628  145.038 1.00 17.79  ? 396  LEU B CG  1 
ATOM   5767  C  CD1 . LEU B  1 289 ? 10.655  15.121  144.854 1.00 17.25  ? 396  LEU B CD1 1 
ATOM   5768  C  CD2 . LEU B  1 289 ? 10.861  13.266  146.513 1.00 17.39  ? 396  LEU B CD2 1 
ATOM   5769  N  N   . VAL B  1 290 ? 8.689   10.654  142.310 1.00 16.68  ? 397  VAL B N   1 
ATOM   5770  C  CA  . VAL B  1 290 ? 7.571   10.154  141.530 1.00 15.76  ? 397  VAL B CA  1 
ATOM   5771  C  C   . VAL B  1 290 ? 7.283   8.706   141.894 1.00 15.38  ? 397  VAL B C   1 
ATOM   5772  O  O   . VAL B  1 290 ? 6.137   8.310   142.037 1.00 14.63  ? 397  VAL B O   1 
ATOM   5773  C  CB  . VAL B  1 290 ? 7.844   10.262  140.016 1.00 16.26  ? 397  VAL B CB  1 
ATOM   5774  C  CG1 . VAL B  1 290 ? 6.709   9.627   139.242 1.00 16.03  ? 397  VAL B CG1 1 
ATOM   5775  C  CG2 . VAL B  1 290 ? 7.990   11.727  139.606 1.00 13.65  ? 397  VAL B CG2 1 
ATOM   5776  N  N   . VAL B  1 291 ? 8.332   7.917   142.062 1.00 16.45  ? 398  VAL B N   1 
ATOM   5777  C  CA  . VAL B  1 291 ? 8.158   6.517   142.414 1.00 16.65  ? 398  VAL B CA  1 
ATOM   5778  C  C   . VAL B  1 291 ? 7.530   6.346   143.783 1.00 17.48  ? 398  VAL B C   1 
ATOM   5779  O  O   . VAL B  1 291 ? 6.669   5.507   143.963 1.00 19.51  ? 398  VAL B O   1 
ATOM   5780  C  CB  . VAL B  1 291 ? 9.497   5.774   142.410 1.00 15.86  ? 398  VAL B CB  1 
ATOM   5781  C  CG1 . VAL B  1 291 ? 9.313   4.361   142.972 1.00 14.93  ? 398  VAL B CG1 1 
ATOM   5782  C  CG2 . VAL B  1 291 ? 10.061  5.753   141.006 1.00 13.55  ? 398  VAL B CG2 1 
ATOM   5783  N  N   . GLN B  1 292 ? 7.956   7.142   144.752 1.00 19.61  ? 399  GLN B N   1 
ATOM   5784  C  CA  . GLN B  1 292 ? 7.417   7.019   146.103 1.00 20.39  ? 399  GLN B CA  1 
ATOM   5785  C  C   . GLN B  1 292 ? 6.020   7.590   146.330 1.00 19.50  ? 399  GLN B C   1 
ATOM   5786  O  O   . GLN B  1 292 ? 5.283   7.072   147.157 1.00 19.80  ? 399  GLN B O   1 
ATOM   5787  C  CB  . GLN B  1 292 ? 8.380   7.642   147.115 1.00 20.46  ? 399  GLN B CB  1 
ATOM   5788  C  CG  . GLN B  1 292 ? 9.678   6.885   147.270 1.00 25.28  ? 399  GLN B CG  1 
ATOM   5789  C  CD  . GLN B  1 292 ? 10.554  7.476   148.354 1.00 27.17  ? 399  GLN B CD  1 
ATOM   5790  O  OE1 . GLN B  1 292 ? 10.598  7.002   149.474 1.00 28.83  ? 399  GLN B OE1 1 
ATOM   5791  N  NE2 . GLN B  1 292 ? 11.238  8.538   148.018 1.00 33.98  ? 399  GLN B NE2 1 
ATOM   5792  N  N   . THR B  1 293 ? 5.643   8.626   145.585 1.00 18.79  ? 400  THR B N   1 
ATOM   5793  C  CA  . THR B  1 293 ? 4.345   9.271   145.776 1.00 18.16  ? 400  THR B CA  1 
ATOM   5794  C  C   . THR B  1 293 ? 3.214   8.956   144.802 1.00 18.80  ? 400  THR B C   1 
ATOM   5795  O  O   . THR B  1 293 ? 2.058   9.292   145.074 1.00 17.19  ? 400  THR B O   1 
ATOM   5796  C  CB  . THR B  1 293 ? 4.493   10.802  145.774 1.00 18.33  ? 400  THR B CB  1 
ATOM   5797  O  OG1 . THR B  1 293 ? 5.062   11.217  144.522 1.00 16.69  ? 400  THR B OG1 1 
ATOM   5798  C  CG2 . THR B  1 293 ? 5.374   11.263  146.938 1.00 17.53  ? 400  THR B CG2 1 
ATOM   5799  N  N   . SER B  1 294 ? 3.521   8.344   143.665 1.00 19.78  ? 401  SER B N   1 
ATOM   5800  C  CA  . SER B  1 294 ? 2.471   8.043   142.697 1.00 20.55  ? 401  SER B CA  1 
ATOM   5801  C  C   . SER B  1 294 ? 1.499   6.995   143.227 1.00 22.05  ? 401  SER B C   1 
ATOM   5802  O  O   . SER B  1 294 ? 1.895   5.974   143.795 1.00 22.15  ? 401  SER B O   1 
ATOM   5803  C  CB  . SER B  1 294 ? 3.081   7.604   141.378 1.00 19.13  ? 401  SER B CB  1 
ATOM   5804  O  OG  . SER B  1 294 ? 3.807   8.674   140.811 1.00 19.10  ? 401  SER B OG  1 
ATOM   5805  N  N   . LYS B  1 295 ? 0.215   7.264   143.032 1.00 23.02  ? 402  LYS B N   1 
ATOM   5806  C  CA  . LYS B  1 295 ? -0.836  6.396   143.529 1.00 23.38  ? 402  LYS B CA  1 
ATOM   5807  C  C   . LYS B  1 295 ? -1.468  5.474   142.500 1.00 23.81  ? 402  LYS B C   1 
ATOM   5808  O  O   . LYS B  1 295 ? -1.940  5.914   141.453 1.00 23.85  ? 402  LYS B O   1 
ATOM   5809  C  CB  . LYS B  1 295 ? -1.941  7.252   144.156 1.00 22.86  ? 402  LYS B CB  1 
ATOM   5810  C  CG  . LYS B  1 295 ? -1.474  8.183   145.270 1.00 23.16  ? 402  LYS B CG  1 
ATOM   5811  C  CD  . LYS B  1 295 ? -0.826  7.412   146.418 1.00 22.26  ? 402  LYS B CD  1 
ATOM   5812  C  CE  . LYS B  1 295 ? -0.631  8.298   147.634 1.00 20.27  ? 402  LYS B CE  1 
ATOM   5813  N  NZ  . LYS B  1 295 ? 0.287   9.429   147.373 1.00 21.49  ? 402  LYS B NZ  1 
ATOM   5814  N  N   . PRO B  1 296 ? -1.474  4.170   142.784 1.00 24.53  ? 403  PRO B N   1 
ATOM   5815  C  CA  . PRO B  1 296 ? -2.080  3.222   141.847 1.00 25.79  ? 403  PRO B CA  1 
ATOM   5816  C  C   . PRO B  1 296 ? -3.599  3.161   142.039 1.00 27.12  ? 403  PRO B C   1 
ATOM   5817  O  O   . PRO B  1 296 ? -4.332  2.749   141.143 1.00 28.89  ? 403  PRO B O   1 
ATOM   5818  C  CB  . PRO B  1 296 ? -1.387  1.903   142.191 1.00 22.87  ? 403  PRO B CB  1 
ATOM   5819  C  CG  . PRO B  1 296 ? -1.066  2.052   143.617 1.00 23.70  ? 403  PRO B CG  1 
ATOM   5820  C  CD  . PRO B  1 296 ? -0.585  3.472   143.725 1.00 24.22  ? 403  PRO B CD  1 
ATOM   5821  N  N   . ALA B  1 297 ? -4.064  3.601   143.203 1.00 29.09  ? 404  ALA B N   1 
ATOM   5822  C  CA  . ALA B  1 297 ? -5.488  3.578   143.533 1.00 30.24  ? 404  ALA B CA  1 
ATOM   5823  C  C   . ALA B  1 297 ? -6.430  4.196   142.495 1.00 31.20  ? 404  ALA B C   1 
ATOM   5824  O  O   . ALA B  1 297 ? -6.172  5.275   141.947 1.00 32.38  ? 404  ALA B O   1 
ATOM   5825  C  CB  . ALA B  1 297 ? -5.708  4.245   144.877 1.00 29.03  ? 404  ALA B CB  1 
ATOM   5826  N  N   . HIS B  1 298 ? -7.528  3.496   142.237 1.00 30.95  ? 405  HIS B N   1 
ATOM   5827  C  CA  . HIS B  1 298 ? -8.549  3.959   141.304 1.00 31.60  ? 405  HIS B CA  1 
ATOM   5828  C  C   . HIS B  1 298 ? -8.127  3.920   139.843 1.00 30.11  ? 405  HIS B C   1 
ATOM   5829  O  O   . HIS B  1 298 ? -8.810  4.455   138.978 1.00 31.04  ? 405  HIS B O   1 
ATOM   5830  C  CB  . HIS B  1 298 ? -8.996  5.366   141.701 1.00 34.18  ? 405  HIS B CB  1 
ATOM   5831  C  CG  . HIS B  1 298 ? -9.365  5.482   143.149 1.00 38.27  ? 405  HIS B CG  1 
ATOM   5832  N  ND1 . HIS B  1 298 ? -8.606  6.191   144.059 1.00 39.61  ? 405  HIS B ND1 1 
ATOM   5833  C  CD2 . HIS B  1 298 ? -10.364 4.906   143.862 1.00 38.64  ? 405  HIS B CD2 1 
ATOM   5834  C  CE1 . HIS B  1 298 ? -9.120  6.043   145.267 1.00 39.78  ? 405  HIS B CE1 1 
ATOM   5835  N  NE2 . HIS B  1 298 ? -10.186 5.267   145.175 1.00 39.30  ? 405  HIS B NE2 1 
ATOM   5836  N  N   . LEU B  1 299 ? -6.995  3.286   139.580 1.00 28.31  ? 406  LEU B N   1 
ATOM   5837  C  CA  . LEU B  1 299 ? -6.486  3.130   138.225 1.00 26.58  ? 406  LEU B CA  1 
ATOM   5838  C  C   . LEU B  1 299 ? -6.599  1.633   137.903 1.00 26.14  ? 406  LEU B C   1 
ATOM   5839  O  O   . LEU B  1 299 ? -5.877  0.811   138.471 1.00 26.43  ? 406  LEU B O   1 
ATOM   5840  C  CB  . LEU B  1 299 ? -5.030  3.584   138.169 1.00 26.08  ? 406  LEU B CB  1 
ATOM   5841  C  CG  . LEU B  1 299 ? -4.713  4.886   137.434 1.00 25.27  ? 406  LEU B CG  1 
ATOM   5842  C  CD1 . LEU B  1 299 ? -5.743  5.948   137.743 1.00 26.38  ? 406  LEU B CD1 1 
ATOM   5843  C  CD2 . LEU B  1 299 ? -3.330  5.334   137.828 1.00 23.13  ? 406  LEU B CD2 1 
ATOM   5844  N  N   . ASN B  1 300 ? -7.506  1.286   136.995 1.00 24.92  ? 407  ASN B N   1 
ATOM   5845  C  CA  . ASN B  1 300 ? -7.746  -0.103  136.623 1.00 24.20  ? 407  ASN B CA  1 
ATOM   5846  C  C   . ASN B  1 300 ? -6.802  -0.647  135.574 1.00 23.10  ? 407  ASN B C   1 
ATOM   5847  O  O   . ASN B  1 300 ? -6.571  -0.016  134.549 1.00 23.26  ? 407  ASN B O   1 
ATOM   5848  C  CB  . ASN B  1 300 ? -9.182  -0.258  136.128 1.00 25.30  ? 407  ASN B CB  1 
ATOM   5849  C  CG  . ASN B  1 300 ? -10.190 0.307   137.106 1.00 27.78  ? 407  ASN B CG  1 
ATOM   5850  O  OD1 . ASN B  1 300 ? -10.288 -0.159  138.246 1.00 28.97  ? 407  ASN B OD1 1 
ATOM   5851  N  ND2 . ASN B  1 300 ? -10.938 1.328   136.676 1.00 27.64  ? 407  ASN B ND2 1 
ATOM   5852  N  N   . ALA B  1 301 ? -6.262  -1.829  135.845 1.00 22.39  ? 408  ALA B N   1 
ATOM   5853  C  CA  . ALA B  1 301 ? -5.356  -2.510  134.932 1.00 22.53  ? 408  ALA B CA  1 
ATOM   5854  C  C   . ALA B  1 301 ? -5.362  -3.988  135.304 1.00 23.52  ? 408  ALA B C   1 
ATOM   5855  O  O   . ALA B  1 301 ? -5.655  -4.347  136.446 1.00 23.50  ? 408  ALA B O   1 
ATOM   5856  C  CB  . ALA B  1 301 ? -3.951  -1.948  135.063 1.00 22.64  ? 408  ALA B CB  1 
ATOM   5857  N  N   . ASP B  1 302 ? -5.038  -4.847  134.348 1.00 24.35  ? 409  ASP B N   1 
ATOM   5858  C  CA  . ASP B  1 302 ? -5.014  -6.281  134.616 1.00 25.48  ? 409  ASP B CA  1 
ATOM   5859  C  C   . ASP B  1 302 ? -3.626  -6.758  135.015 1.00 24.40  ? 409  ASP B C   1 
ATOM   5860  O  O   . ASP B  1 302 ? -3.402  -7.956  135.182 1.00 24.41  ? 409  ASP B O   1 
ATOM   5861  C  CB  . ASP B  1 302 ? -5.459  -7.068  133.372 1.00 29.34  ? 409  ASP B CB  1 
ATOM   5862  C  CG  . ASP B  1 302 ? -6.984  -7.144  133.225 1.00 34.87  ? 409  ASP B CG  1 
ATOM   5863  O  OD1 . ASP B  1 302 ? -7.448  -7.643  132.167 1.00 37.36  ? 409  ASP B OD1 1 
ATOM   5864  O  OD2 . ASP B  1 302 ? -7.716  -6.717  134.160 1.00 36.14  ? 409  ASP B OD2 1 
ATOM   5865  N  N   . ASP B  1 303 ? -2.688  -5.833  135.180 1.00 23.29  ? 410  ASP B N   1 
ATOM   5866  C  CA  . ASP B  1 303 ? -1.329  -6.242  135.514 1.00 21.55  ? 410  ASP B CA  1 
ATOM   5867  C  C   . ASP B  1 303 ? -0.676  -5.609  136.743 1.00 20.09  ? 410  ASP B C   1 
ATOM   5868  O  O   . ASP B  1 303 ? 0.542   -5.589  136.840 1.00 20.97  ? 410  ASP B O   1 
ATOM   5869  C  CB  . ASP B  1 303 ? -0.424  -6.042  134.295 1.00 20.18  ? 410  ASP B CB  1 
ATOM   5870  C  CG  . ASP B  1 303 ? -0.082  -4.587  134.052 1.00 21.32  ? 410  ASP B CG  1 
ATOM   5871  O  OD1 . ASP B  1 303 ? -0.935  -3.713  134.320 1.00 21.87  ? 410  ASP B OD1 1 
ATOM   5872  O  OD2 . ASP B  1 303 ? 1.042   -4.318  133.580 1.00 21.83  ? 410  ASP B OD2 1 
ATOM   5873  N  N   . TRP B  1 304 ? -1.461  -5.098  137.683 1.00 18.47  ? 411  TRP B N   1 
ATOM   5874  C  CA  . TRP B  1 304 ? -0.862  -4.535  138.887 1.00 17.63  ? 411  TRP B CA  1 
ATOM   5875  C  C   . TRP B  1 304 ? -0.123  -5.642  139.633 1.00 18.50  ? 411  TRP B C   1 
ATOM   5876  O  O   . TRP B  1 304 ? -0.707  -6.666  139.985 1.00 20.38  ? 411  TRP B O   1 
ATOM   5877  C  CB  . TRP B  1 304 ? -1.921  -3.945  139.815 1.00 15.71  ? 411  TRP B CB  1 
ATOM   5878  C  CG  . TRP B  1 304 ? -2.368  -2.583  139.412 1.00 16.64  ? 411  TRP B CG  1 
ATOM   5879  C  CD1 . TRP B  1 304 ? -3.613  -2.217  138.979 1.00 17.03  ? 411  TRP B CD1 1 
ATOM   5880  C  CD2 . TRP B  1 304 ? -1.574  -1.392  139.401 1.00 15.91  ? 411  TRP B CD2 1 
ATOM   5881  N  NE1 . TRP B  1 304 ? -3.644  -0.867  138.701 1.00 17.58  ? 411  TRP B NE1 1 
ATOM   5882  C  CE2 . TRP B  1 304 ? -2.405  -0.337  138.948 1.00 16.66  ? 411  TRP B CE2 1 
ATOM   5883  C  CE3 . TRP B  1 304 ? -0.239  -1.113  139.728 1.00 15.87  ? 411  TRP B CE3 1 
ATOM   5884  C  CZ2 . TRP B  1 304 ? -1.945  0.977   138.816 1.00 15.42  ? 411  TRP B CZ2 1 
ATOM   5885  C  CZ3 . TRP B  1 304 ? 0.222   0.193   139.597 1.00 14.48  ? 411  TRP B CZ3 1 
ATOM   5886  C  CH2 . TRP B  1 304 ? -0.633  1.223   139.144 1.00 15.13  ? 411  TRP B CH2 1 
ATOM   5887  N  N   . ALA B  1 305 ? 1.166   -5.443  139.864 1.00 18.06  ? 412  ALA B N   1 
ATOM   5888  C  CA  . ALA B  1 305 ? 1.979   -6.420  140.575 1.00 17.45  ? 412  ALA B CA  1 
ATOM   5889  C  C   . ALA B  1 305 ? 2.830   -5.688  141.600 1.00 17.52  ? 412  ALA B C   1 
ATOM   5890  O  O   . ALA B  1 305 ? 3.273   -4.563  141.364 1.00 18.48  ? 412  ALA B O   1 
ATOM   5891  C  CB  . ALA B  1 305 ? 2.862   -7.179  139.599 1.00 15.68  ? 412  ALA B CB  1 
ATOM   5892  N  N   . THR B  1 306 ? 3.052   -6.320  142.742 1.00 17.11  ? 413  THR B N   1 
ATOM   5893  C  CA  . THR B  1 306 ? 3.844   -5.708  143.791 1.00 16.89  ? 413  THR B CA  1 
ATOM   5894  C  C   . THR B  1 306 ? 5.301   -6.111  143.629 1.00 16.73  ? 413  THR B C   1 
ATOM   5895  O  O   . THR B  1 306 ? 5.596   -7.293  143.466 1.00 18.01  ? 413  THR B O   1 
ATOM   5896  C  CB  . THR B  1 306 ? 3.323   -6.141  145.163 1.00 18.25  ? 413  THR B CB  1 
ATOM   5897  O  OG1 . THR B  1 306 ? 1.954   -5.742  145.294 1.00 18.81  ? 413  THR B OG1 1 
ATOM   5898  C  CG2 . THR B  1 306 ? 4.124   -5.483  146.274 1.00 19.65  ? 413  THR B CG2 1 
ATOM   5899  N  N   . ASN B  1 307 ? 6.217   -5.143  143.652 1.00 14.50  ? 414  ASN B N   1 
ATOM   5900  C  CA  . ASN B  1 307 ? 7.618   -5.498  143.495 1.00 15.20  ? 414  ASN B CA  1 
ATOM   5901  C  C   . ASN B  1 307 ? 8.269   -5.879  144.815 1.00 16.73  ? 414  ASN B C   1 
ATOM   5902  O  O   . ASN B  1 307 ? 7.612   -5.909  145.859 1.00 17.82  ? 414  ASN B O   1 
ATOM   5903  C  CB  . ASN B  1 307 ? 8.438   -4.394  142.794 1.00 14.88  ? 414  ASN B CB  1 
ATOM   5904  C  CG  . ASN B  1 307 ? 8.531   -3.100  143.595 1.00 16.00  ? 414  ASN B CG  1 
ATOM   5905  O  OD1 . ASN B  1 307 ? 8.323   -3.076  144.806 1.00 17.05  ? 414  ASN B OD1 1 
ATOM   5906  N  ND2 . ASN B  1 307 ? 8.867   -2.016  142.910 1.00 14.76  ? 414  ASN B ND2 1 
ATOM   5907  N  N   . GLY B  1 308 ? 9.566   -6.165  144.752 1.00 16.59  ? 415  GLY B N   1 
ATOM   5908  C  CA  . GLY B  1 308 ? 10.316  -6.596  145.912 1.00 16.94  ? 415  GLY B CA  1 
ATOM   5909  C  C   . GLY B  1 308 ? 10.342  -5.679  147.110 1.00 18.12  ? 415  GLY B C   1 
ATOM   5910  O  O   . GLY B  1 308 ? 10.753  -6.099  148.189 1.00 18.27  ? 415  GLY B O   1 
ATOM   5911  N  N   . VAL B  1 309 ? 9.927   -4.431  146.939 1.00 18.12  ? 416  VAL B N   1 
ATOM   5912  C  CA  . VAL B  1 309 ? 9.932   -3.506  148.062 1.00 18.93  ? 416  VAL B CA  1 
ATOM   5913  C  C   . VAL B  1 309 ? 8.520   -3.109  148.442 1.00 20.38  ? 416  VAL B C   1 
ATOM   5914  O  O   . VAL B  1 309 ? 8.309   -2.085  149.096 1.00 21.04  ? 416  VAL B O   1 
ATOM   5915  C  CB  . VAL B  1 309 ? 10.762  -2.230  147.775 1.00 16.87  ? 416  VAL B CB  1 
ATOM   5916  C  CG1 . VAL B  1 309 ? 12.193  -2.610  147.506 1.00 16.50  ? 416  VAL B CG1 1 
ATOM   5917  C  CG2 . VAL B  1 309 ? 10.186  -1.473  146.608 1.00 16.72  ? 416  VAL B CG2 1 
ATOM   5918  N  N   . GLY B  1 310 ? 7.553   -3.912  148.008 1.00 20.23  ? 417  GLY B N   1 
ATOM   5919  C  CA  . GLY B  1 310 ? 6.170   -3.658  148.362 1.00 19.40  ? 417  GLY B CA  1 
ATOM   5920  C  C   . GLY B  1 310 ? 5.387   -2.630  147.586 1.00 19.07  ? 417  GLY B C   1 
ATOM   5921  O  O   . GLY B  1 310 ? 4.261   -2.310  147.954 1.00 19.88  ? 417  GLY B O   1 
ATOM   5922  N  N   . ARG B  1 311 ? 5.949   -2.099  146.514 1.00 19.51  ? 418  ARG B N   1 
ATOM   5923  C  CA  . ARG B  1 311 ? 5.208   -1.119  145.742 1.00 18.82  ? 418  ARG B CA  1 
ATOM   5924  C  C   . ARG B  1 311 ? 4.503   -1.741  144.551 1.00 18.01  ? 418  ARG B C   1 
ATOM   5925  O  O   . ARG B  1 311 ? 5.016   -2.670  143.932 1.00 18.27  ? 418  ARG B O   1 
ATOM   5926  C  CB  . ARG B  1 311 ? 6.137   0.014   145.310 1.00 20.83  ? 418  ARG B CB  1 
ATOM   5927  C  CG  . ARG B  1 311 ? 6.419   0.975   146.454 1.00 21.22  ? 418  ARG B CG  1 
ATOM   5928  C  CD  . ARG B  1 311 ? 7.027   2.270   145.981 1.00 22.27  ? 418  ARG B CD  1 
ATOM   5929  N  NE  . ARG B  1 311 ? 8.465   2.128   145.794 1.00 25.40  ? 418  ARG B NE  1 
ATOM   5930  C  CZ  . ARG B  1 311 ? 9.374   2.679   146.588 1.00 24.27  ? 418  ARG B CZ  1 
ATOM   5931  N  NH1 . ARG B  1 311 ? 10.661  2.491   146.344 1.00 23.33  ? 418  ARG B NH1 1 
ATOM   5932  N  NH2 . ARG B  1 311 ? 8.991   3.426   147.614 1.00 24.40  ? 418  ARG B NH2 1 
ATOM   5933  N  N   . LYS B  1 312 ? 3.307   -1.244  144.251 1.00 17.62  ? 419  LYS B N   1 
ATOM   5934  C  CA  . LYS B  1 312 ? 2.529   -1.762  143.133 1.00 17.54  ? 419  LYS B CA  1 
ATOM   5935  C  C   . LYS B  1 312 ? 2.948   -1.089  141.846 1.00 17.43  ? 419  LYS B C   1 
ATOM   5936  O  O   . LYS B  1 312 ? 3.048   0.130   141.792 1.00 18.10  ? 419  LYS B O   1 
ATOM   5937  C  CB  . LYS B  1 312 ? 1.035   -1.520  143.351 1.00 17.49  ? 419  LYS B CB  1 
ATOM   5938  C  CG  . LYS B  1 312 ? 0.427   -2.402  144.422 1.00 20.39  ? 419  LYS B CG  1 
ATOM   5939  C  CD  . LYS B  1 312 ? -1.054  -2.130  144.593 1.00 22.02  ? 419  LYS B CD  1 
ATOM   5940  C  CE  . LYS B  1 312 ? -1.648  -3.024  145.670 0.00 21.64  ? 419  LYS B CE  1 
ATOM   5941  N  NZ  . LYS B  1 312 ? -3.104  -2.786  145.858 0.00 21.91  ? 419  LYS B NZ  1 
ATOM   5942  N  N   . VAL B  1 313 ? 3.197   -1.878  140.808 1.00 16.35  ? 420  VAL B N   1 
ATOM   5943  C  CA  . VAL B  1 313 ? 3.584   -1.303  139.530 1.00 14.77  ? 420  VAL B CA  1 
ATOM   5944  C  C   . VAL B  1 313 ? 2.777   -1.939  138.410 1.00 14.81  ? 420  VAL B C   1 
ATOM   5945  O  O   . VAL B  1 313 ? 2.386   -3.097  138.500 1.00 15.73  ? 420  VAL B O   1 
ATOM   5946  C  CB  . VAL B  1 313 ? 5.076   -1.523  139.220 1.00 12.78  ? 420  VAL B CB  1 
ATOM   5947  C  CG1 . VAL B  1 313 ? 5.572   -0.430  138.294 1.00 11.51  ? 420  VAL B CG1 1 
ATOM   5948  C  CG2 . VAL B  1 313 ? 5.876   -1.556  140.488 1.00 11.39  ? 420  VAL B CG2 1 
ATOM   5949  N  N   . SER B  1 314 ? 2.525   -1.164  137.363 1.00 14.03  ? 421  SER B N   1 
ATOM   5950  C  CA  . SER B  1 314 ? 1.790   -1.634  136.199 1.00 14.79  ? 421  SER B CA  1 
ATOM   5951  C  C   . SER B  1 314 ? 2.499   -1.185  134.919 1.00 14.94  ? 421  SER B C   1 
ATOM   5952  O  O   . SER B  1 314 ? 3.058   -0.095  134.867 1.00 16.19  ? 421  SER B O   1 
ATOM   5953  C  CB  . SER B  1 314 ? 0.372   -1.068  136.204 1.00 14.57  ? 421  SER B CB  1 
ATOM   5954  O  OG  . SER B  1 314 ? -0.188  -1.126  134.906 1.00 14.41  ? 421  SER B OG  1 
ATOM   5955  N  N   . HIS B  1 315 ? 2.476   -2.018  133.887 1.00 13.77  ? 422  HIS B N   1 
ATOM   5956  C  CA  . HIS B  1 315 ? 3.114   -1.654  132.631 1.00 12.12  ? 422  HIS B CA  1 
ATOM   5957  C  C   . HIS B  1 315 ? 2.308   -0.599  131.902 1.00 11.47  ? 422  HIS B C   1 
ATOM   5958  O  O   . HIS B  1 315 ? 2.772   -0.020  130.924 1.00 11.44  ? 422  HIS B O   1 
ATOM   5959  C  CB  . HIS B  1 315 ? 3.296   -2.883  131.738 1.00 10.90  ? 422  HIS B CB  1 
ATOM   5960  C  CG  . HIS B  1 315 ? 4.306   -3.858  132.262 1.00 10.54  ? 422  HIS B CG  1 
ATOM   5961  N  ND1 . HIS B  1 315 ? 4.071   -4.658  133.358 1.00 10.65  ? 422  HIS B ND1 1 
ATOM   5962  C  CD2 . HIS B  1 315 ? 5.567   -4.138  131.857 1.00 10.41  ? 422  HIS B CD2 1 
ATOM   5963  C  CE1 . HIS B  1 315 ? 5.144   -5.391  133.605 1.00 10.34  ? 422  HIS B CE1 1 
ATOM   5964  N  NE2 . HIS B  1 315 ? 6.066   -5.093  132.709 1.00 9.86   ? 422  HIS B NE2 1 
ATOM   5965  N  N   . SER B  1 316 ? 1.102   -0.339  132.385 1.00 10.75  ? 423  SER B N   1 
ATOM   5966  C  CA  . SER B  1 316 ? 0.258   0.657   131.759 1.00 12.54  ? 423  SER B CA  1 
ATOM   5967  C  C   . SER B  1 316 ? 0.351   1.988   132.481 1.00 13.30  ? 423  SER B C   1 
ATOM   5968  O  O   . SER B  1 316 ? 0.128   3.042   131.881 1.00 12.90  ? 423  SER B O   1 
ATOM   5969  C  CB  . SER B  1 316 ? -1.198  0.200   131.776 1.00 12.91  ? 423  SER B CB  1 
ATOM   5970  O  OG  . SER B  1 316 ? -1.391  -0.940  130.963 1.00 15.92  ? 423  SER B OG  1 
ATOM   5971  N  N   . TYR B  1 317 ? 0.699   1.937   133.764 1.00 13.08  ? 424  TYR B N   1 
ATOM   5972  C  CA  . TYR B  1 317 ? 0.745   3.142   134.574 1.00 13.12  ? 424  TYR B CA  1 
ATOM   5973  C  C   . TYR B  1 317 ? 2.029   3.416   135.345 1.00 13.85  ? 424  TYR B C   1 
ATOM   5974  O  O   . TYR B  1 317 ? 2.119   4.412   136.061 1.00 14.73  ? 424  TYR B O   1 
ATOM   5975  C  CB  . TYR B  1 317 ? -0.393  3.096   135.581 1.00 12.58  ? 424  TYR B CB  1 
ATOM   5976  C  CG  . TYR B  1 317 ? -1.767  2.870   135.000 1.00 11.75  ? 424  TYR B CG  1 
ATOM   5977  C  CD1 . TYR B  1 317 ? -2.559  1.809   135.443 1.00 13.86  ? 424  TYR B CD1 1 
ATOM   5978  C  CD2 . TYR B  1 317 ? -2.311  3.752   134.087 1.00 10.42  ? 424  TYR B CD2 1 
ATOM   5979  C  CE1 . TYR B  1 317 ? -3.863  1.645   134.994 1.00 11.84  ? 424  TYR B CE1 1 
ATOM   5980  C  CE2 . TYR B  1 317 ? -3.614  3.600   133.632 1.00 12.01  ? 424  TYR B CE2 1 
ATOM   5981  C  CZ  . TYR B  1 317 ? -4.386  2.547   134.092 1.00 12.47  ? 424  TYR B CZ  1 
ATOM   5982  O  OH  . TYR B  1 317 ? -5.691  2.423   133.671 1.00 14.09  ? 424  TYR B OH  1 
ATOM   5983  N  N   . GLY B  1 318 ? 3.024   2.556   135.209 1.00 13.81  ? 425  GLY B N   1 
ATOM   5984  C  CA  . GLY B  1 318 ? 4.229   2.765   135.979 1.00 12.93  ? 425  GLY B CA  1 
ATOM   5985  C  C   . GLY B  1 318 ? 3.831   2.596   137.437 1.00 14.80  ? 425  GLY B C   1 
ATOM   5986  O  O   . GLY B  1 318 ? 3.142   1.645   137.798 1.00 15.89  ? 425  GLY B O   1 
ATOM   5987  N  N   . TYR B  1 319 ? 4.237   3.528   138.289 1.00 15.46  ? 426  TYR B N   1 
ATOM   5988  C  CA  . TYR B  1 319 ? 3.905   3.437   139.699 1.00 13.60  ? 426  TYR B CA  1 
ATOM   5989  C  C   . TYR B  1 319 ? 2.543   4.023   140.066 1.00 14.60  ? 426  TYR B C   1 
ATOM   5990  O  O   . TYR B  1 319 ? 2.138   4.003   141.226 1.00 13.02  ? 426  TYR B O   1 
ATOM   5991  C  CB  . TYR B  1 319 ? 5.010   4.078   140.523 1.00 11.70  ? 426  TYR B CB  1 
ATOM   5992  C  CG  . TYR B  1 319 ? 6.232   3.197   140.611 1.00 9.32   ? 426  TYR B CG  1 
ATOM   5993  C  CD1 . TYR B  1 319 ? 7.250   3.282   139.670 1.00 9.49   ? 426  TYR B CD1 1 
ATOM   5994  C  CD2 . TYR B  1 319 ? 6.336   2.235   141.602 1.00 7.52   ? 426  TYR B CD2 1 
ATOM   5995  C  CE1 . TYR B  1 319 ? 8.340   2.428   139.716 1.00 6.97   ? 426  TYR B CE1 1 
ATOM   5996  C  CE2 . TYR B  1 319 ? 7.410   1.381   141.659 1.00 7.14   ? 426  TYR B CE2 1 
ATOM   5997  C  CZ  . TYR B  1 319 ? 8.408   1.478   140.715 1.00 7.37   ? 426  TYR B CZ  1 
ATOM   5998  O  OH  . TYR B  1 319 ? 9.465   0.610   140.769 1.00 6.35   ? 426  TYR B OH  1 
ATOM   5999  N  N   . GLY B  1 320 ? 1.827   4.533   139.070 1.00 15.27  ? 427  GLY B N   1 
ATOM   6000  C  CA  . GLY B  1 320 ? 0.514   5.083   139.341 1.00 14.49  ? 427  GLY B CA  1 
ATOM   6001  C  C   . GLY B  1 320 ? 0.307   6.531   138.953 1.00 15.14  ? 427  GLY B C   1 
ATOM   6002  O  O   . GLY B  1 320 ? 1.110   7.145   138.250 1.00 14.25  ? 427  GLY B O   1 
ATOM   6003  N  N   . LEU B  1 321 ? -0.801  7.080   139.431 1.00 15.66  ? 428  LEU B N   1 
ATOM   6004  C  CA  . LEU B  1 321 ? -1.167  8.455   139.156 1.00 16.00  ? 428  LEU B CA  1 
ATOM   6005  C  C   . LEU B  1 321 ? -0.305  9.424   139.962 1.00 16.44  ? 428  LEU B C   1 
ATOM   6006  O  O   . LEU B  1 321 ? -0.033  9.191   141.143 1.00 16.42  ? 428  LEU B O   1 
ATOM   6007  C  CB  . LEU B  1 321 ? -2.632  8.661   139.526 1.00 16.38  ? 428  LEU B CB  1 
ATOM   6008  C  CG  . LEU B  1 321 ? -3.249  9.946   138.985 1.00 19.01  ? 428  LEU B CG  1 
ATOM   6009  C  CD1 . LEU B  1 321 ? -3.450  9.806   137.474 1.00 17.04  ? 428  LEU B CD1 1 
ATOM   6010  C  CD2 . LEU B  1 321 ? -4.568  10.224  139.692 1.00 19.58  ? 428  LEU B CD2 1 
ATOM   6011  N  N   . LEU B  1 322 ? 0.128   10.508  139.327 1.00 16.61  ? 429  LEU B N   1 
ATOM   6012  C  CA  . LEU B  1 322 ? 0.931   11.509  140.021 1.00 16.55  ? 429  LEU B CA  1 
ATOM   6013  C  C   . LEU B  1 322 ? 0.081   12.195  141.088 1.00 17.40  ? 429  LEU B C   1 
ATOM   6014  O  O   . LEU B  1 322 ? -1.114  12.429  140.890 1.00 17.30  ? 429  LEU B O   1 
ATOM   6015  C  CB  . LEU B  1 322 ? 1.454   12.553  139.040 1.00 14.56  ? 429  LEU B CB  1 
ATOM   6016  C  CG  . LEU B  1 322 ? 2.625   12.121  138.156 1.00 14.97  ? 429  LEU B CG  1 
ATOM   6017  C  CD1 . LEU B  1 322 ? 3.058   13.311  137.320 1.00 14.61  ? 429  LEU B CD1 1 
ATOM   6018  C  CD2 . LEU B  1 322 ? 3.790   11.611  139.007 1.00 13.49  ? 429  LEU B CD2 1 
ATOM   6019  N  N   . ASP B  1 323 ? 0.699   12.513  142.221 1.00 17.91  ? 430  ASP B N   1 
ATOM   6020  C  CA  . ASP B  1 323 ? -0.004  13.164  143.322 1.00 18.54  ? 430  ASP B CA  1 
ATOM   6021  C  C   . ASP B  1 323 ? 0.727   14.455  143.673 1.00 18.06  ? 430  ASP B C   1 
ATOM   6022  O  O   . ASP B  1 323 ? 1.696   14.441  144.431 1.00 17.39  ? 430  ASP B O   1 
ATOM   6023  C  CB  . ASP B  1 323 ? -0.052  12.215  144.526 1.00 19.06  ? 430  ASP B CB  1 
ATOM   6024  C  CG  . ASP B  1 323 ? -0.907  12.749  145.678 1.00 21.37  ? 430  ASP B CG  1 
ATOM   6025  O  OD1 . ASP B  1 323 ? -1.246  11.940  146.572 1.00 20.46  ? 430  ASP B OD1 1 
ATOM   6026  O  OD2 . ASP B  1 323 ? -1.231  13.962  145.702 1.00 21.17  ? 430  ASP B OD2 1 
ATOM   6027  N  N   . ALA B  1 324 ? 0.261   15.567  143.109 1.00 18.24  ? 431  ALA B N   1 
ATOM   6028  C  CA  . ALA B  1 324 ? 0.883   16.872  143.338 1.00 18.86  ? 431  ALA B CA  1 
ATOM   6029  C  C   . ALA B  1 324 ? 1.105   17.161  144.826 1.00 19.71  ? 431  ALA B C   1 
ATOM   6030  O  O   . ALA B  1 324 ? 2.202   17.534  145.239 1.00 20.74  ? 431  ALA B O   1 
ATOM   6031  C  CB  . ALA B  1 324 ? 0.037   17.956  142.716 1.00 16.53  ? 431  ALA B CB  1 
ATOM   6032  N  N   . GLY B  1 325 ? 0.064   16.979  145.629 1.00 20.48  ? 432  GLY B N   1 
ATOM   6033  C  CA  . GLY B  1 325 ? 0.188   17.219  147.054 1.00 20.22  ? 432  GLY B CA  1 
ATOM   6034  C  C   . GLY B  1 325 ? 1.291   16.399  147.697 1.00 20.98  ? 432  GLY B C   1 
ATOM   6035  O  O   . GLY B  1 325 ? 2.128   16.945  148.418 1.00 22.03  ? 432  GLY B O   1 
ATOM   6036  N  N   . ALA B  1 326 ? 1.298   15.090  147.445 1.00 19.94  ? 433  ALA B N   1 
ATOM   6037  C  CA  . ALA B  1 326 ? 2.319   14.217  148.011 1.00 19.12  ? 433  ALA B CA  1 
ATOM   6038  C  C   . ALA B  1 326 ? 3.711   14.589  147.505 1.00 19.83  ? 433  ALA B C   1 
ATOM   6039  O  O   . ALA B  1 326 ? 4.678   14.617  148.275 1.00 20.20  ? 433  ALA B O   1 
ATOM   6040  C  CB  . ALA B  1 326 ? 2.009   12.773  147.670 1.00 18.20  ? 433  ALA B CB  1 
ATOM   6041  N  N   . MET B  1 327 ? 3.808   14.868  146.206 1.00 19.66  ? 434  MET B N   1 
ATOM   6042  C  CA  . MET B  1 327 ? 5.071   15.240  145.579 1.00 19.38  ? 434  MET B CA  1 
ATOM   6043  C  C   . MET B  1 327 ? 5.680   16.426  146.310 1.00 20.85  ? 434  MET B C   1 
ATOM   6044  O  O   . MET B  1 327 ? 6.815   16.381  146.778 1.00 20.32  ? 434  MET B O   1 
ATOM   6045  C  CB  . MET B  1 327 ? 4.832   15.618  144.121 1.00 19.40  ? 434  MET B CB  1 
ATOM   6046  C  CG  . MET B  1 327 ? 4.701   14.441  143.175 1.00 18.11  ? 434  MET B CG  1 
ATOM   6047  S  SD  . MET B  1 327 ? 6.281   13.650  142.872 1.00 19.24  ? 434  MET B SD  1 
ATOM   6048  C  CE  . MET B  1 327 ? 6.940   14.710  141.591 1.00 14.83  ? 434  MET B CE  1 
ATOM   6049  N  N   . VAL B  1 328 ? 4.901   17.493  146.399 1.00 21.94  ? 435  VAL B N   1 
ATOM   6050  C  CA  . VAL B  1 328 ? 5.323   18.708  147.067 1.00 22.48  ? 435  VAL B CA  1 
ATOM   6051  C  C   . VAL B  1 328 ? 5.685   18.460  148.529 1.00 23.44  ? 435  VAL B C   1 
ATOM   6052  O  O   . VAL B  1 328 ? 6.680   18.988  149.028 1.00 23.54  ? 435  VAL B O   1 
ATOM   6053  C  CB  . VAL B  1 328 ? 4.206   19.765  146.972 1.00 22.59  ? 435  VAL B CB  1 
ATOM   6054  C  CG1 . VAL B  1 328 ? 4.230   20.661  148.176 1.00 24.60  ? 435  VAL B CG1 1 
ATOM   6055  C  CG2 . VAL B  1 328 ? 4.385   20.585  145.708 1.00 21.73  ? 435  VAL B CG2 1 
ATOM   6056  N  N   . ALA B  1 329 ? 4.882   17.653  149.213 1.00 23.83  ? 436  ALA B N   1 
ATOM   6057  C  CA  . ALA B  1 329 ? 5.125   17.364  150.620 1.00 23.41  ? 436  ALA B CA  1 
ATOM   6058  C  C   . ALA B  1 329 ? 6.435   16.625  150.835 1.00 23.84  ? 436  ALA B C   1 
ATOM   6059  O  O   . ALA B  1 329 ? 7.227   16.995  151.700 1.00 24.79  ? 436  ALA B O   1 
ATOM   6060  C  CB  . ALA B  1 329 ? 3.976   16.554  151.194 1.00 22.46  ? 436  ALA B CB  1 
ATOM   6061  N  N   . LEU B  1 330 ? 6.667   15.583  150.045 1.00 23.73  ? 437  LEU B N   1 
ATOM   6062  C  CA  . LEU B  1 330 ? 7.877   14.784  150.177 1.00 21.75  ? 437  LEU B CA  1 
ATOM   6063  C  C   . LEU B  1 330 ? 9.125   15.551  149.731 1.00 22.54  ? 437  LEU B C   1 
ATOM   6064  O  O   . LEU B  1 330 ? 10.233  15.317  150.227 1.00 23.06  ? 437  LEU B O   1 
ATOM   6065  C  CB  . LEU B  1 330 ? 7.712   13.499  149.363 1.00 18.36  ? 437  LEU B CB  1 
ATOM   6066  C  CG  . LEU B  1 330 ? 8.793   12.428  149.474 1.00 17.24  ? 437  LEU B CG  1 
ATOM   6067  C  CD1 . LEU B  1 330 ? 8.916   11.997  150.908 1.00 13.97  ? 437  LEU B CD1 1 
ATOM   6068  C  CD2 . LEU B  1 330 ? 8.442   11.245  148.597 1.00 16.99  ? 437  LEU B CD2 1 
ATOM   6069  N  N   . ALA B  1 331 ? 8.947   16.476  148.798 1.00 23.40  ? 438  ALA B N   1 
ATOM   6070  C  CA  . ALA B  1 331 ? 10.067  17.256  148.287 1.00 24.67  ? 438  ALA B CA  1 
ATOM   6071  C  C   . ALA B  1 331 ? 10.674  18.163  149.347 1.00 26.83  ? 438  ALA B C   1 
ATOM   6072  O  O   . ALA B  1 331 ? 11.890  18.304  149.438 1.00 25.63  ? 438  ALA B O   1 
ATOM   6073  C  CB  . ALA B  1 331 ? 9.619   18.085  147.124 1.00 24.29  ? 438  ALA B CB  1 
ATOM   6074  N  N   . GLN B  1 332 ? 9.812   18.772  150.151 1.00 29.32  ? 439  GLN B N   1 
ATOM   6075  C  CA  . GLN B  1 332 ? 10.244  19.696  151.185 1.00 32.21  ? 439  GLN B CA  1 
ATOM   6076  C  C   . GLN B  1 332 ? 11.355  19.190  152.098 1.00 33.74  ? 439  GLN B C   1 
ATOM   6077  O  O   . GLN B  1 332 ? 12.339  19.902  152.325 1.00 35.61  ? 439  GLN B O   1 
ATOM   6078  C  CB  . GLN B  1 332 ? 9.041   20.139  152.008 1.00 32.64  ? 439  GLN B CB  1 
ATOM   6079  C  CG  . GLN B  1 332 ? 7.863   20.473  151.117 1.00 35.60  ? 439  GLN B CG  1 
ATOM   6080  C  CD  . GLN B  1 332 ? 7.030   21.619  151.624 1.00 36.95  ? 439  GLN B CD  1 
ATOM   6081  O  OE1 . GLN B  1 332 ? 7.526   22.743  151.756 1.00 39.50  ? 439  GLN B OE1 1 
ATOM   6082  N  NE2 . GLN B  1 332 ? 5.750   21.352  151.904 1.00 36.94  ? 439  GLN B NE2 1 
ATOM   6083  N  N   . ASN B  1 333 ? 11.240  17.979  152.625 1.00 33.44  ? 440  ASN B N   1 
ATOM   6084  C  CA  . ASN B  1 333 ? 12.313  17.508  153.492 1.00 33.24  ? 440  ASN B CA  1 
ATOM   6085  C  C   . ASN B  1 333 ? 13.173  16.383  152.907 1.00 31.29  ? 440  ASN B C   1 
ATOM   6086  O  O   . ASN B  1 333 ? 13.783  15.592  153.632 1.00 31.79  ? 440  ASN B O   1 
ATOM   6087  C  CB  . ASN B  1 333 ? 11.734  17.120  154.853 1.00 36.82  ? 440  ASN B CB  1 
ATOM   6088  C  CG  . ASN B  1 333 ? 11.414  18.343  155.707 1.00 40.37  ? 440  ASN B CG  1 
ATOM   6089  O  OD1 . ASN B  1 333 ? 12.235  19.263  155.806 1.00 42.49  ? 440  ASN B OD1 1 
ATOM   6090  N  ND2 . ASN B  1 333 ? 10.226  18.362  156.328 1.00 40.46  ? 440  ASN B ND2 1 
ATOM   6091  N  N   . TRP B  1 334 ? 13.243  16.350  151.580 1.00 28.28  ? 441  TRP B N   1 
ATOM   6092  C  CA  . TRP B  1 334 ? 13.998  15.342  150.846 1.00 23.00  ? 441  TRP B CA  1 
ATOM   6093  C  C   . TRP B  1 334 ? 15.510  15.488  150.934 1.00 22.03  ? 441  TRP B C   1 
ATOM   6094  O  O   . TRP B  1 334 ? 16.044  16.565  150.707 1.00 22.95  ? 441  TRP B O   1 
ATOM   6095  C  CB  . TRP B  1 334 ? 13.583  15.391  149.375 1.00 19.95  ? 441  TRP B CB  1 
ATOM   6096  C  CG  . TRP B  1 334 ? 14.221  14.323  148.551 1.00 16.63  ? 441  TRP B CG  1 
ATOM   6097  C  CD1 . TRP B  1 334 ? 15.324  14.437  147.756 1.00 14.21  ? 441  TRP B CD1 1 
ATOM   6098  C  CD2 . TRP B  1 334 ? 13.827  12.949  148.497 1.00 14.54  ? 441  TRP B CD2 1 
ATOM   6099  N  NE1 . TRP B  1 334 ? 15.643  13.215  147.213 1.00 13.94  ? 441  TRP B NE1 1 
ATOM   6100  C  CE2 . TRP B  1 334 ? 14.739  12.286  147.652 1.00 13.01  ? 441  TRP B CE2 1 
ATOM   6101  C  CE3 . TRP B  1 334 ? 12.791  12.215  149.087 1.00 13.99  ? 441  TRP B CE3 1 
ATOM   6102  C  CZ2 . TRP B  1 334 ? 14.646  10.928  147.378 1.00 13.64  ? 441  TRP B CZ2 1 
ATOM   6103  C  CZ3 . TRP B  1 334 ? 12.701  10.864  148.816 1.00 13.47  ? 441  TRP B CZ3 1 
ATOM   6104  C  CH2 . TRP B  1 334 ? 13.626  10.233  147.966 1.00 12.20  ? 441  TRP B CH2 1 
ATOM   6105  N  N   . THR B  1 335 ? 16.205  14.406  151.262 1.00 21.81  ? 442  THR B N   1 
ATOM   6106  C  CA  . THR B  1 335 ? 17.663  14.438  151.308 1.00 22.02  ? 442  THR B CA  1 
ATOM   6107  C  C   . THR B  1 335 ? 18.138  13.939  149.948 1.00 22.02  ? 442  THR B C   1 
ATOM   6108  O  O   . THR B  1 335 ? 17.795  12.835  149.541 1.00 23.67  ? 442  THR B O   1 
ATOM   6109  C  CB  . THR B  1 335 ? 18.229  13.493  152.369 1.00 22.15  ? 442  THR B CB  1 
ATOM   6110  O  OG1 . THR B  1 335 ? 17.708  13.842  153.656 1.00 24.69  ? 442  THR B OG1 1 
ATOM   6111  C  CG2 . THR B  1 335 ? 19.745  13.588  152.388 1.00 20.91  ? 442  THR B CG2 1 
ATOM   6112  N  N   . THR B  1 336 ? 18.926  14.742  149.246 1.00 21.16  ? 443  THR B N   1 
ATOM   6113  C  CA  . THR B  1 336 ? 19.411  14.355  147.929 1.00 20.02  ? 443  THR B CA  1 
ATOM   6114  C  C   . THR B  1 336 ? 20.070  12.965  147.976 1.00 18.87  ? 443  THR B C   1 
ATOM   6115  O  O   . THR B  1 336 ? 20.835  12.666  148.890 1.00 19.95  ? 443  THR B O   1 
ATOM   6116  C  CB  . THR B  1 336 ? 20.380  15.424  147.401 1.00 20.83  ? 443  THR B CB  1 
ATOM   6117  O  OG1 . THR B  1 336 ? 20.478  15.324  145.977 1.00 25.60  ? 443  THR B OG1 1 
ATOM   6118  C  CG2 . THR B  1 336 ? 21.750  15.245  148.009 1.00 21.86  ? 443  THR B CG2 1 
ATOM   6119  N  N   . VAL B  1 337 ? 19.758  12.120  146.995 1.00 17.29  ? 444  VAL B N   1 
ATOM   6120  C  CA  . VAL B  1 337 ? 20.270  10.748  146.939 1.00 16.68  ? 444  VAL B CA  1 
ATOM   6121  C  C   . VAL B  1 337 ? 21.776  10.610  146.741 1.00 16.84  ? 444  VAL B C   1 
ATOM   6122  O  O   . VAL B  1 337 ? 22.430  11.499  146.203 1.00 16.47  ? 444  VAL B O   1 
ATOM   6123  C  CB  . VAL B  1 337 ? 19.552  9.919   145.834 1.00 16.09  ? 444  VAL B CB  1 
ATOM   6124  C  CG1 . VAL B  1 337 ? 18.056  9.861   146.119 1.00 15.82  ? 444  VAL B CG1 1 
ATOM   6125  C  CG2 . VAL B  1 337 ? 19.808  10.522  144.467 1.00 14.22  ? 444  VAL B CG2 1 
ATOM   6126  N  N   . ALA B  1 338 ? 22.312  9.476   147.180 1.00 15.54  ? 445  ALA B N   1 
ATOM   6127  C  CA  . ALA B  1 338 ? 23.735  9.205   147.078 1.00 16.61  ? 445  ALA B CA  1 
ATOM   6128  C  C   . ALA B  1 338 ? 24.175  9.163   145.626 1.00 17.92  ? 445  ALA B C   1 
ATOM   6129  O  O   . ALA B  1 338 ? 23.353  9.053   144.725 1.00 18.30  ? 445  ALA B O   1 
ATOM   6130  C  CB  . ALA B  1 338 ? 24.057  7.891   147.750 1.00 16.95  ? 445  ALA B CB  1 
ATOM   6131  N  N   . PRO B  1 339 ? 25.487  9.234   145.378 1.00 18.11  ? 446  PRO B N   1 
ATOM   6132  C  CA  . PRO B  1 339 ? 26.003  9.205   144.005 1.00 18.75  ? 446  PRO B CA  1 
ATOM   6133  C  C   . PRO B  1 339 ? 25.510  7.990   143.229 1.00 18.81  ? 446  PRO B C   1 
ATOM   6134  O  O   . PRO B  1 339 ? 25.372  6.898   143.788 1.00 19.41  ? 446  PRO B O   1 
ATOM   6135  C  CB  . PRO B  1 339 ? 27.513  9.171   144.208 1.00 17.38  ? 446  PRO B CB  1 
ATOM   6136  C  CG  . PRO B  1 339 ? 27.684  9.895   145.502 1.00 17.85  ? 446  PRO B CG  1 
ATOM   6137  C  CD  . PRO B  1 339 ? 26.591  9.297   146.344 1.00 17.46  ? 446  PRO B CD  1 
ATOM   6138  N  N   . GLN B  1 340 ? 25.265  8.184   141.937 1.00 17.88  ? 447  GLN B N   1 
ATOM   6139  C  CA  . GLN B  1 340 ? 24.778  7.117   141.077 1.00 16.49  ? 447  GLN B CA  1 
ATOM   6140  C  C   . GLN B  1 340 ? 25.876  6.135   140.698 1.00 15.74  ? 447  GLN B C   1 
ATOM   6141  O  O   . GLN B  1 340 ? 26.922  6.519   140.183 1.00 15.71  ? 447  GLN B O   1 
ATOM   6142  C  CB  . GLN B  1 340 ? 24.167  7.716   139.804 1.00 16.74  ? 447  GLN B CB  1 
ATOM   6143  C  CG  . GLN B  1 340 ? 23.616  6.683   138.820 1.00 17.24  ? 447  GLN B CG  1 
ATOM   6144  C  CD  . GLN B  1 340 ? 23.539  7.204   137.382 1.00 17.25  ? 447  GLN B CD  1 
ATOM   6145  O  OE1 . GLN B  1 340 ? 24.548  7.589   136.784 1.00 17.45  ? 447  GLN B OE1 1 
ATOM   6146  N  NE2 . GLN B  1 340 ? 22.341  7.206   136.823 1.00 16.04  ? 447  GLN B NE2 1 
ATOM   6147  N  N   . ARG B  1 341 ? 25.633  4.860   140.957 1.00 16.24  ? 448  ARG B N   1 
ATOM   6148  C  CA  . ARG B  1 341 ? 26.596  3.830   140.611 1.00 17.96  ? 448  ARG B CA  1 
ATOM   6149  C  C   . ARG B  1 341 ? 26.073  3.188   139.318 1.00 16.75  ? 448  ARG B C   1 
ATOM   6150  O  O   . ARG B  1 341 ? 24.877  3.214   139.048 1.00 15.97  ? 448  ARG B O   1 
ATOM   6151  C  CB  . ARG B  1 341 ? 26.683  2.769   141.720 1.00 20.10  ? 448  ARG B CB  1 
ATOM   6152  C  CG  . ARG B  1 341 ? 26.831  3.294   143.128 1.00 22.45  ? 448  ARG B CG  1 
ATOM   6153  C  CD  . ARG B  1 341 ? 28.227  3.804   143.423 1.00 29.15  ? 448  ARG B CD  1 
ATOM   6154  N  NE  . ARG B  1 341 ? 28.267  4.531   144.695 1.00 34.52  ? 448  ARG B NE  1 
ATOM   6155  C  CZ  . ARG B  1 341 ? 29.248  5.357   145.065 1.00 36.28  ? 448  ARG B CZ  1 
ATOM   6156  N  NH1 . ARG B  1 341 ? 29.188  5.980   146.244 1.00 36.19  ? 448  ARG B NH1 1 
ATOM   6157  N  NH2 . ARG B  1 341 ? 30.288  5.565   144.258 1.00 35.05  ? 448  ARG B NH2 1 
ATOM   6158  N  N   . LYS B  1 342 ? 26.972  2.623   138.524 1.00 16.25  ? 449  LYS B N   1 
ATOM   6159  C  CA  . LYS B  1 342 ? 26.591  1.975   137.275 1.00 16.16  ? 449  LYS B CA  1 
ATOM   6160  C  C   . LYS B  1 342 ? 27.324  0.646   137.196 1.00 15.76  ? 449  LYS B C   1 
ATOM   6161  O  O   . LYS B  1 342 ? 28.542  0.598   137.025 1.00 16.04  ? 449  LYS B O   1 
ATOM   6162  C  CB  . LYS B  1 342 ? 26.971  2.866   136.092 1.00 16.89  ? 449  LYS B CB  1 
ATOM   6163  C  CG  . LYS B  1 342 ? 26.589  2.322   134.732 1.00 17.21  ? 449  LYS B CG  1 
ATOM   6164  C  CD  . LYS B  1 342 ? 27.113  3.230   133.631 1.00 16.32  ? 449  LYS B CD  1 
ATOM   6165  C  CE  . LYS B  1 342 ? 26.701  2.730   132.256 1.00 17.28  ? 449  LYS B CE  1 
ATOM   6166  N  NZ  . LYS B  1 342 ? 27.037  3.721   131.197 1.00 16.30  ? 449  LYS B NZ  1 
ATOM   6167  N  N   . CYS B  1 343 ? 26.588  -0.440  137.344 1.00 15.68  ? 450  CYS B N   1 
ATOM   6168  C  CA  . CYS B  1 343 ? 27.211  -1.747  137.295 1.00 17.56  ? 450  CYS B CA  1 
ATOM   6169  C  C   . CYS B  1 343 ? 26.876  -2.458  135.978 1.00 17.08  ? 450  CYS B C   1 
ATOM   6170  O  O   . CYS B  1 343 ? 25.709  -2.723  135.672 1.00 16.75  ? 450  CYS B O   1 
ATOM   6171  C  CB  . CYS B  1 343 ? 26.765  -2.560  138.509 1.00 18.12  ? 450  CYS B CB  1 
ATOM   6172  S  SG  . CYS B  1 343 ? 27.526  -4.204  138.612 1.00 24.43  ? 450  CYS B SG  1 
ATOM   6173  N  N   . ILE B  1 344 ? 27.916  -2.732  135.197 1.00 16.25  ? 451  ILE B N   1 
ATOM   6174  C  CA  . ILE B  1 344 ? 27.775  -3.392  133.906 1.00 15.92  ? 451  ILE B CA  1 
ATOM   6175  C  C   . ILE B  1 344 ? 28.139  -4.858  134.036 1.00 16.90  ? 451  ILE B C   1 
ATOM   6176  O  O   . ILE B  1 344 ? 29.250  -5.188  134.457 1.00 18.14  ? 451  ILE B O   1 
ATOM   6177  C  CB  . ILE B  1 344 ? 28.727  -2.775  132.857 1.00 15.39  ? 451  ILE B CB  1 
ATOM   6178  C  CG1 . ILE B  1 344 ? 28.429  -1.285  132.685 1.00 12.46  ? 451  ILE B CG1 1 
ATOM   6179  C  CG2 . ILE B  1 344 ? 28.606  -3.527  131.546 1.00 13.99  ? 451  ILE B CG2 1 
ATOM   6180  C  CD1 . ILE B  1 344 ? 29.372  -0.619  131.758 1.00 12.23  ? 451  ILE B CD1 1 
ATOM   6181  N  N   . VAL B  1 345 ? 27.220  -5.745  133.675 1.00 16.26  ? 452  VAL B N   1 
ATOM   6182  C  CA  . VAL B  1 345 ? 27.521  -7.161  133.761 1.00 15.63  ? 452  VAL B CA  1 
ATOM   6183  C  C   . VAL B  1 345 ? 27.140  -7.921  132.493 1.00 16.73  ? 452  VAL B C   1 
ATOM   6184  O  O   . VAL B  1 345 ? 25.994  -7.895  132.060 1.00 17.84  ? 452  VAL B O   1 
ATOM   6185  C  CB  . VAL B  1 345 ? 26.870  -7.784  135.031 1.00 13.78  ? 452  VAL B CB  1 
ATOM   6186  C  CG1 . VAL B  1 345 ? 25.646  -7.005  135.432 1.00 13.71  ? 452  VAL B CG1 1 
ATOM   6187  C  CG2 . VAL B  1 345 ? 26.543  -9.244  134.793 1.00 10.81  ? 452  VAL B CG2 1 
ATOM   6188  N  N   . GLU B  1 346 ? 28.134  -8.563  131.885 1.00 18.18  ? 453  GLU B N   1 
ATOM   6189  C  CA  . GLU B  1 346 ? 27.942  -9.345  130.670 1.00 20.09  ? 453  GLU B CA  1 
ATOM   6190  C  C   . GLU B  1 346 ? 27.356  -10.695 131.061 1.00 20.79  ? 453  GLU B C   1 
ATOM   6191  O  O   . GLU B  1 346 ? 28.024  -11.497 131.713 1.00 22.21  ? 453  GLU B O   1 
ATOM   6192  C  CB  . GLU B  1 346 ? 29.283  -9.538  129.969 1.00 20.28  ? 453  GLU B CB  1 
ATOM   6193  C  CG  . GLU B  1 346 ? 29.990  -8.229  129.692 1.00 25.66  ? 453  GLU B CG  1 
ATOM   6194  C  CD  . GLU B  1 346 ? 31.430  -8.408  129.220 1.00 29.88  ? 453  GLU B CD  1 
ATOM   6195  O  OE1 . GLU B  1 346 ? 31.645  -8.636  127.997 1.00 29.20  ? 453  GLU B OE1 1 
ATOM   6196  O  OE2 . GLU B  1 346 ? 32.341  -8.326  130.089 1.00 31.82  ? 453  GLU B OE2 1 
ATOM   6197  N  N   . ILE B  1 347 ? 26.109  -10.945 130.671 1.00 21.36  ? 454  ILE B N   1 
ATOM   6198  C  CA  . ILE B  1 347 ? 25.449  -12.197 131.017 1.00 22.59  ? 454  ILE B CA  1 
ATOM   6199  C  C   . ILE B  1 347 ? 25.889  -13.321 130.102 1.00 24.52  ? 454  ILE B C   1 
ATOM   6200  O  O   . ILE B  1 347 ? 26.053  -14.460 130.536 1.00 25.68  ? 454  ILE B O   1 
ATOM   6201  C  CB  . ILE B  1 347 ? 23.932  -12.052 130.961 1.00 21.13  ? 454  ILE B CB  1 
ATOM   6202  C  CG1 . ILE B  1 347 ? 23.487  -10.888 131.855 1.00 20.14  ? 454  ILE B CG1 1 
ATOM   6203  C  CG2 . ILE B  1 347 ? 23.280  -13.339 131.419 1.00 21.79  ? 454  ILE B CG2 1 
ATOM   6204  C  CD1 . ILE B  1 347 ? 23.902  -11.010 133.291 1.00 18.15  ? 454  ILE B CD1 1 
ATOM   6205  N  N   . LEU B  1 348 ? 26.117  -12.969 128.842 1.00 27.13  ? 455  LEU B N   1 
ATOM   6206  C  CA  . LEU B  1 348 ? 26.581  -13.915 127.840 1.00 29.82  ? 455  LEU B CA  1 
ATOM   6207  C  C   . LEU B  1 348 ? 27.060  -13.172 126.584 1.00 33.00  ? 455  LEU B C   1 
ATOM   6208  O  O   . LEU B  1 348 ? 26.548  -12.093 126.242 1.00 32.95  ? 455  LEU B O   1 
ATOM   6209  C  CB  . LEU B  1 348 ? 25.457  -14.886 127.464 1.00 28.12  ? 455  LEU B CB  1 
ATOM   6210  C  CG  . LEU B  1 348 ? 24.335  -14.389 126.550 1.00 25.15  ? 455  LEU B CG  1 
ATOM   6211  C  CD1 . LEU B  1 348 ? 24.769  -14.469 125.112 1.00 23.20  ? 455  LEU B CD1 1 
ATOM   6212  C  CD2 . LEU B  1 348 ? 23.116  -15.248 126.746 1.00 26.61  ? 455  LEU B CD2 1 
ATOM   6213  N  N   . VAL B  1 349 ? 28.052  -13.762 125.915 1.00 35.72  ? 456  VAL B N   1 
ATOM   6214  C  CA  . VAL B  1 349 ? 28.622  -13.240 124.672 1.00 36.82  ? 456  VAL B CA  1 
ATOM   6215  C  C   . VAL B  1 349 ? 28.881  -14.492 123.796 1.00 37.74  ? 456  VAL B C   1 
ATOM   6216  O  O   . VAL B  1 349 ? 29.491  -14.427 122.719 1.00 38.86  ? 456  VAL B O   1 
ATOM   6217  C  CB  . VAL B  1 349 ? 29.936  -12.426 124.957 1.00 37.54  ? 456  VAL B CB  1 
ATOM   6218  C  CG1 . VAL B  1 349 ? 31.178  -13.256 124.646 1.00 36.38  ? 456  VAL B CG1 1 
ATOM   6219  C  CG2 . VAL B  1 349 ? 29.918  -11.110 124.158 1.00 38.50  ? 456  VAL B CG2 1 
ATOM   6220  N  N   . GLU B  1 350 ? 28.388  -15.631 124.295 1.00 37.79  ? 457  GLU B N   1 
ATOM   6221  C  CA  . GLU B  1 350 ? 28.472  -16.949 123.640 1.00 35.95  ? 457  GLU B CA  1 
ATOM   6222  C  C   . GLU B  1 350 ? 27.028  -17.226 123.161 1.00 33.39  ? 457  GLU B C   1 
ATOM   6223  O  O   . GLU B  1 350 ? 26.168  -17.619 123.947 1.00 31.77  ? 457  GLU B O   1 
ATOM   6224  C  CB  . GLU B  1 350 ? 28.909  -18.015 124.658 1.00 36.90  ? 457  GLU B CB  1 
ATOM   6225  C  CG  . GLU B  1 350 ? 29.598  -17.436 125.907 1.00 39.13  ? 457  GLU B CG  1 
ATOM   6226  C  CD  . GLU B  1 350 ? 28.617  -16.719 126.853 1.00 41.36  ? 457  GLU B CD  1 
ATOM   6227  O  OE1 . GLU B  1 350 ? 29.014  -15.715 127.498 1.00 40.80  ? 457  GLU B OE1 1 
ATOM   6228  O  OE2 . GLU B  1 350 ? 27.451  -17.170 126.961 1.00 42.47  ? 457  GLU B OE2 1 
ATOM   6229  N  N   . PRO B  1 351 ? 26.754  -17.017 121.862 1.00 31.60  ? 458  PRO B N   1 
ATOM   6230  C  CA  . PRO B  1 351 ? 25.442  -17.210 121.240 1.00 30.12  ? 458  PRO B CA  1 
ATOM   6231  C  C   . PRO B  1 351 ? 24.562  -18.354 121.721 1.00 28.51  ? 458  PRO B C   1 
ATOM   6232  O  O   . PRO B  1 351 ? 25.026  -19.428 122.063 1.00 28.42  ? 458  PRO B O   1 
ATOM   6233  C  CB  . PRO B  1 351 ? 25.782  -17.319 119.762 1.00 30.66  ? 458  PRO B CB  1 
ATOM   6234  C  CG  . PRO B  1 351 ? 26.908  -16.353 119.627 1.00 31.31  ? 458  PRO B CG  1 
ATOM   6235  C  CD  . PRO B  1 351 ? 27.768  -16.735 120.826 1.00 32.29  ? 458  PRO B CD  1 
ATOM   6236  N  N   . LYS B  1 352 ? 23.266  -18.094 121.734 1.00 28.09  ? 459  LYS B N   1 
ATOM   6237  C  CA  . LYS B  1 352 ? 22.285  -19.072 122.156 1.00 27.36  ? 459  LYS B CA  1 
ATOM   6238  C  C   . LYS B  1 352 ? 21.052  -19.009 121.255 1.00 25.81  ? 459  LYS B C   1 
ATOM   6239  O  O   . LYS B  1 352 ? 20.541  -17.927 120.942 1.00 24.98  ? 459  LYS B O   1 
ATOM   6240  C  CB  . LYS B  1 352 ? 21.897  -18.835 123.623 1.00 28.71  ? 459  LYS B CB  1 
ATOM   6241  C  CG  . LYS B  1 352 ? 22.897  -19.422 124.618 1.00 30.96  ? 459  LYS B CG  1 
ATOM   6242  C  CD  . LYS B  1 352 ? 22.351  -19.360 126.044 1.00 33.35  ? 459  LYS B CD  1 
ATOM   6243  C  CE  . LYS B  1 352 ? 23.225  -20.168 127.017 1.00 35.47  ? 459  LYS B CE  1 
ATOM   6244  N  NZ  . LYS B  1 352 ? 22.753  -20.116 128.453 1.00 37.17  ? 459  LYS B NZ  1 
ATOM   6245  N  N   . ASP B  1 353 ? 20.600  -20.186 120.837 1.00 23.94  ? 460  ASP B N   1 
ATOM   6246  C  CA  . ASP B  1 353 ? 19.437  -20.342 119.971 1.00 23.65  ? 460  ASP B CA  1 
ATOM   6247  C  C   . ASP B  1 353 ? 18.151  -19.955 120.717 1.00 21.78  ? 460  ASP B C   1 
ATOM   6248  O  O   . ASP B  1 353 ? 17.964  -20.378 121.855 1.00 19.78  ? 460  ASP B O   1 
ATOM   6249  C  CB  . ASP B  1 353 ? 19.382  -21.808 119.507 1.00 25.36  ? 460  ASP B CB  1 
ATOM   6250  C  CG  . ASP B  1 353 ? 18.240  -22.090 118.550 1.00 26.73  ? 460  ASP B CG  1 
ATOM   6251  O  OD1 . ASP B  1 353 ? 17.314  -22.844 118.927 1.00 28.24  ? 460  ASP B OD1 1 
ATOM   6252  O  OD2 . ASP B  1 353 ? 18.271  -21.563 117.419 1.00 28.59  ? 460  ASP B OD2 1 
ATOM   6253  N  N   . ILE B  1 354 ? 17.285  -19.148 120.088 1.00 21.09  ? 461  ILE B N   1 
ATOM   6254  C  CA  . ILE B  1 354 ? 16.027  -18.737 120.708 1.00 21.24  ? 461  ILE B CA  1 
ATOM   6255  C  C   . ILE B  1 354 ? 14.958  -19.789 120.429 1.00 22.13  ? 461  ILE B C   1 
ATOM   6256  O  O   . ILE B  1 354 ? 14.323  -20.297 121.348 1.00 24.17  ? 461  ILE B O   1 
ATOM   6257  C  CB  . ILE B  1 354 ? 15.553  -17.358 120.175 1.00 21.34  ? 461  ILE B CB  1 
ATOM   6258  C  CG1 . ILE B  1 354 ? 16.544  -16.268 120.618 1.00 19.87  ? 461  ILE B CG1 1 
ATOM   6259  C  CG2 . ILE B  1 354 ? 14.122  -17.056 120.672 1.00 19.28  ? 461  ILE B CG2 1 
ATOM   6260  C  CD1 . ILE B  1 354 ? 16.234  -14.892 120.088 1.00 20.36  ? 461  ILE B CD1 1 
ATOM   6261  N  N   . GLY B  1 355 ? 14.771  -20.124 119.158 1.00 22.40  ? 462  GLY B N   1 
ATOM   6262  C  CA  . GLY B  1 355 ? 13.781  -21.114 118.802 1.00 21.12  ? 462  GLY B CA  1 
ATOM   6263  C  C   . GLY B  1 355 ? 12.403  -20.738 119.290 1.00 22.01  ? 462  GLY B C   1 
ATOM   6264  O  O   . GLY B  1 355 ? 11.935  -19.620 119.060 1.00 22.32  ? 462  GLY B O   1 
ATOM   6265  N  N   . LYS B  1 356 ? 11.759  -21.675 119.976 1.00 21.74  ? 463  LYS B N   1 
ATOM   6266  C  CA  . LYS B  1 356 ? 10.416  -21.479 120.499 1.00 21.94  ? 463  LYS B CA  1 
ATOM   6267  C  C   . LYS B  1 356 ? 10.435  -20.673 121.791 1.00 22.85  ? 463  LYS B C   1 
ATOM   6268  O  O   . LYS B  1 356 ? 9.569   -19.828 122.037 1.00 22.31  ? 463  LYS B O   1 
ATOM   6269  C  CB  . LYS B  1 356 ? 9.776   -22.840 120.761 1.00 20.18  ? 463  LYS B CB  1 
ATOM   6270  C  CG  . LYS B  1 356 ? 8.381   -22.765 121.347 1.00 19.33  ? 463  LYS B CG  1 
ATOM   6271  C  CD  . LYS B  1 356 ? 7.461   -22.012 120.412 1.00 18.18  ? 463  LYS B CD  1 
ATOM   6272  C  CE  . LYS B  1 356 ? 6.133   -21.767 121.050 1.00 17.31  ? 463  LYS B CE  1 
ATOM   6273  N  NZ  . LYS B  1 356 ? 5.330   -20.883 120.184 1.00 20.12  ? 463  LYS B NZ  1 
ATOM   6274  N  N   . ARG B  1 357 ? 11.419  -20.962 122.628 1.00 23.92  ? 464  ARG B N   1 
ATOM   6275  C  CA  . ARG B  1 357 ? 11.558  -20.263 123.892 1.00 24.98  ? 464  ARG B CA  1 
ATOM   6276  C  C   . ARG B  1 357 ? 12.978  -20.427 124.408 1.00 24.00  ? 464  ARG B C   1 
ATOM   6277  O  O   . ARG B  1 357 ? 13.629  -21.450 124.188 1.00 23.64  ? 464  ARG B O   1 
ATOM   6278  C  CB  . ARG B  1 357 ? 10.550  -20.787 124.914 1.00 26.21  ? 464  ARG B CB  1 
ATOM   6279  C  CG  . ARG B  1 357 ? 10.767  -22.235 125.273 1.00 32.22  ? 464  ARG B CG  1 
ATOM   6280  C  CD  . ARG B  1 357 ? 9.573   -22.842 126.026 1.00 34.70  ? 464  ARG B CD  1 
ATOM   6281  N  NE  . ARG B  1 357 ? 8.676   -23.621 125.165 1.00 35.23  ? 464  ARG B NE  1 
ATOM   6282  C  CZ  . ARG B  1 357 ? 7.524   -23.169 124.679 1.00 37.33  ? 464  ARG B CZ  1 
ATOM   6283  N  NH1 . ARG B  1 357 ? 6.776   -23.952 123.912 1.00 37.69  ? 464  ARG B NH1 1 
ATOM   6284  N  NH2 . ARG B  1 357 ? 7.113   -21.934 124.964 1.00 38.06  ? 464  ARG B NH2 1 
ATOM   6285  N  N   . LEU B  1 358 ? 13.467  -19.388 125.069 1.00 21.87  ? 465  LEU B N   1 
ATOM   6286  C  CA  . LEU B  1 358 ? 14.807  -19.402 125.625 1.00 20.13  ? 465  LEU B CA  1 
ATOM   6287  C  C   . LEU B  1 358 ? 14.804  -18.748 126.991 1.00 20.20  ? 465  LEU B C   1 
ATOM   6288  O  O   . LEU B  1 358 ? 14.154  -17.730 127.202 1.00 21.17  ? 465  LEU B O   1 
ATOM   6289  C  CB  . LEU B  1 358 ? 15.779  -18.668 124.709 1.00 18.03  ? 465  LEU B CB  1 
ATOM   6290  C  CG  . LEU B  1 358 ? 17.148  -18.348 125.311 1.00 18.98  ? 465  LEU B CG  1 
ATOM   6291  C  CD1 . LEU B  1 358 ? 17.943  -19.618 125.557 1.00 16.78  ? 465  LEU B CD1 1 
ATOM   6292  C  CD2 . LEU B  1 358 ? 17.898  -17.437 124.363 1.00 18.73  ? 465  LEU B CD2 1 
ATOM   6293  N  N   . GLU B  1 359 ? 15.522  -19.351 127.925 1.00 19.98  ? 466  GLU B N   1 
ATOM   6294  C  CA  . GLU B  1 359 ? 15.604  -18.822 129.268 1.00 21.20  ? 466  GLU B CA  1 
ATOM   6295  C  C   . GLU B  1 359 ? 17.065  -18.704 129.638 1.00 21.50  ? 466  GLU B C   1 
ATOM   6296  O  O   . GLU B  1 359 ? 17.802  -19.676 129.512 1.00 22.12  ? 466  GLU B O   1 
ATOM   6297  C  CB  . GLU B  1 359 ? 14.930  -19.757 130.263 1.00 22.37  ? 466  GLU B CB  1 
ATOM   6298  C  CG  . GLU B  1 359 ? 14.926  -19.224 131.679 1.00 26.69  ? 466  GLU B CG  1 
ATOM   6299  C  CD  . GLU B  1 359 ? 14.181  -20.118 132.649 1.00 30.53  ? 466  GLU B CD  1 
ATOM   6300  O  OE1 . GLU B  1 359 ? 14.802  -21.071 133.191 1.00 32.42  ? 466  GLU B OE1 1 
ATOM   6301  O  OE2 . GLU B  1 359 ? 12.971  -19.865 132.864 1.00 32.38  ? 466  GLU B OE2 1 
ATOM   6302  N  N   . VAL B  1 360 ? 17.491  -17.520 130.077 1.00 20.71  ? 467  VAL B N   1 
ATOM   6303  C  CA  . VAL B  1 360 ? 18.877  -17.333 130.485 1.00 20.47  ? 467  VAL B CA  1 
ATOM   6304  C  C   . VAL B  1 360 ? 18.883  -16.915 131.947 1.00 20.86  ? 467  VAL B C   1 
ATOM   6305  O  O   . VAL B  1 360 ? 18.262  -15.920 132.317 1.00 21.58  ? 467  VAL B O   1 
ATOM   6306  C  CB  . VAL B  1 360 ? 19.575  -16.268 129.632 1.00 20.61  ? 467  VAL B CB  1 
ATOM   6307  C  CG1 . VAL B  1 360 ? 20.997  -16.062 130.104 1.00 20.88  ? 467  VAL B CG1 1 
ATOM   6308  C  CG2 . VAL B  1 360 ? 19.587  -16.707 128.194 1.00 21.27  ? 467  VAL B CG2 1 
ATOM   6309  N  N   . ARG B  1 361 ? 19.557  -17.703 132.781 1.00 21.26  ? 468  ARG B N   1 
ATOM   6310  C  CA  . ARG B  1 361 ? 19.639  -17.429 134.213 1.00 21.43  ? 468  ARG B CA  1 
ATOM   6311  C  C   . ARG B  1 361 ? 21.084  -17.113 134.540 1.00 22.03  ? 468  ARG B C   1 
ATOM   6312  O  O   . ARG B  1 361 ? 21.994  -17.757 134.015 1.00 23.44  ? 468  ARG B O   1 
ATOM   6313  C  CB  . ARG B  1 361 ? 19.185  -18.645 135.022 1.00 20.57  ? 468  ARG B CB  1 
ATOM   6314  C  CG  . ARG B  1 361 ? 17.747  -19.057 134.753 1.00 24.60  ? 468  ARG B CG  1 
ATOM   6315  C  CD  . ARG B  1 361 ? 17.337  -20.238 135.615 1.00 27.94  ? 468  ARG B CD  1 
ATOM   6316  N  NE  . ARG B  1 361 ? 16.713  -19.828 136.871 1.00 30.77  ? 468  ARG B NE  1 
ATOM   6317  C  CZ  . ARG B  1 361 ? 15.397  -19.726 137.052 1.00 32.32  ? 468  ARG B CZ  1 
ATOM   6318  N  NH1 . ARG B  1 361 ? 14.908  -19.343 138.231 1.00 31.27  ? 468  ARG B NH1 1 
ATOM   6319  N  NH2 . ARG B  1 361 ? 14.564  -20.018 136.055 1.00 31.90  ? 468  ARG B NH2 1 
ATOM   6320  N  N   . LYS B  1 362 ? 21.305  -16.114 135.387 1.00 21.28  ? 469  LYS B N   1 
ATOM   6321  C  CA  . LYS B  1 362 ? 22.662  -15.750 135.762 1.00 20.15  ? 469  LYS B CA  1 
ATOM   6322  C  C   . LYS B  1 362 ? 22.702  -15.188 137.173 1.00 19.75  ? 469  LYS B C   1 
ATOM   6323  O  O   . LYS B  1 362 ? 21.868  -14.369 137.554 1.00 19.13  ? 469  LYS B O   1 
ATOM   6324  C  CB  . LYS B  1 362 ? 23.218  -14.725 134.774 1.00 22.57  ? 469  LYS B CB  1 
ATOM   6325  C  CG  . LYS B  1 362 ? 24.695  -14.363 134.961 1.00 24.17  ? 469  LYS B CG  1 
ATOM   6326  C  CD  . LYS B  1 362 ? 25.578  -15.602 134.897 1.00 28.68  ? 469  LYS B CD  1 
ATOM   6327  C  CE  . LYS B  1 362 ? 26.807  -15.392 133.996 1.00 30.27  ? 469  LYS B CE  1 
ATOM   6328  N  NZ  . LYS B  1 362 ? 27.659  -14.247 134.431 1.00 31.50  ? 469  LYS B NZ  1 
ATOM   6329  N  N   . ALA B  1 363 ? 23.665  -15.656 137.955 1.00 19.24  ? 470  ALA B N   1 
ATOM   6330  C  CA  . ALA B  1 363 ? 23.823  -15.181 139.317 1.00 18.76  ? 470  ALA B CA  1 
ATOM   6331  C  C   . ALA B  1 363 ? 24.587  -13.870 139.211 1.00 18.69  ? 470  ALA B C   1 
ATOM   6332  O  O   . ALA B  1 363 ? 25.651  -13.815 138.594 1.00 18.66  ? 470  ALA B O   1 
ATOM   6333  C  CB  . ALA B  1 363 ? 24.610  -16.183 140.124 1.00 17.44  ? 470  ALA B CB  1 
ATOM   6334  N  N   . VAL B  1 364 ? 24.045  -12.816 139.807 1.00 18.53  ? 471  VAL B N   1 
ATOM   6335  C  CA  . VAL B  1 364 ? 24.680  -11.502 139.757 1.00 19.14  ? 471  VAL B CA  1 
ATOM   6336  C  C   . VAL B  1 364 ? 25.057  -10.989 141.145 1.00 18.14  ? 471  VAL B C   1 
ATOM   6337  O  O   . VAL B  1 364 ? 24.237  -11.009 142.065 1.00 17.73  ? 471  VAL B O   1 
ATOM   6338  C  CB  . VAL B  1 364 ? 23.736  -10.472 139.100 1.00 18.95  ? 471  VAL B CB  1 
ATOM   6339  C  CG1 . VAL B  1 364 ? 24.368  -9.093  139.122 1.00 19.59  ? 471  VAL B CG1 1 
ATOM   6340  C  CG2 . VAL B  1 364 ? 23.444  -10.883 137.677 1.00 19.48  ? 471  VAL B CG2 1 
ATOM   6341  N  N   . THR B  1 365 ? 26.296  -10.534 141.292 1.00 18.13  ? 472  THR B N   1 
ATOM   6342  C  CA  . THR B  1 365 ? 26.764  -9.990  142.570 1.00 19.87  ? 472  THR B CA  1 
ATOM   6343  C  C   . THR B  1 365 ? 26.614  -8.463  142.608 1.00 20.57  ? 472  THR B C   1 
ATOM   6344  O  O   . THR B  1 365 ? 26.839  -7.837  143.642 1.00 21.86  ? 472  THR B O   1 
ATOM   6345  C  CB  . THR B  1 365 ? 28.241  -10.324 142.826 1.00 19.86  ? 472  THR B CB  1 
ATOM   6346  O  OG1 . THR B  1 365 ? 29.036  -9.759  141.782 1.00 20.60  ? 472  THR B OG1 1 
ATOM   6347  C  CG2 . THR B  1 365 ? 28.459  -11.827 142.850 1.00 19.48  ? 472  THR B CG2 1 
ATOM   6348  N  N   . ALA B  1 366 ? 26.232  -7.872  141.477 1.00 20.22  ? 473  ALA B N   1 
ATOM   6349  C  CA  . ALA B  1 366 ? 26.032  -6.429  141.368 1.00 19.35  ? 473  ALA B CA  1 
ATOM   6350  C  C   . ALA B  1 366 ? 27.279  -5.636  141.750 1.00 20.70  ? 473  ALA B C   1 
ATOM   6351  O  O   . ALA B  1 366 ? 27.217  -4.686  142.535 1.00 19.68  ? 473  ALA B O   1 
ATOM   6352  C  CB  . ALA B  1 366 ? 24.851  -5.996  142.221 1.00 17.64  ? 473  ALA B CB  1 
ATOM   6353  N  N   . CYS B  1 367 ? 28.411  -6.038  141.180 1.00 21.44  ? 474  CYS B N   1 
ATOM   6354  C  CA  . CYS B  1 367 ? 29.677  -5.371  141.422 1.00 22.09  ? 474  CYS B CA  1 
ATOM   6355  C  C   . CYS B  1 367 ? 30.107  -5.350  142.886 1.00 22.96  ? 474  CYS B C   1 
ATOM   6356  O  O   . CYS B  1 367 ? 30.658  -4.353  143.365 1.00 23.02  ? 474  CYS B O   1 
ATOM   6357  C  CB  . CYS B  1 367 ? 29.616  -3.946  140.868 1.00 22.26  ? 474  CYS B CB  1 
ATOM   6358  S  SG  . CYS B  1 367 ? 29.505  -3.874  139.048 1.00 24.85  ? 474  CYS B SG  1 
ATOM   6359  N  N   . LEU B  1 368 ? 29.856  -6.451  143.591 1.00 23.25  ? 475  LEU B N   1 
ATOM   6360  C  CA  . LEU B  1 368 ? 30.249  -6.573  144.993 1.00 23.01  ? 475  LEU B CA  1 
ATOM   6361  C  C   . LEU B  1 368 ? 31.767  -6.432  145.094 1.00 24.16  ? 475  LEU B C   1 
ATOM   6362  O  O   . LEU B  1 368 ? 32.516  -7.042  144.312 1.00 23.79  ? 475  LEU B O   1 
ATOM   6363  C  CB  . LEU B  1 368 ? 29.847  -7.937  145.540 1.00 22.06  ? 475  LEU B CB  1 
ATOM   6364  C  CG  . LEU B  1 368 ? 30.195  -8.209  147.004 1.00 21.88  ? 475  LEU B CG  1 
ATOM   6365  C  CD1 . LEU B  1 368 ? 29.327  -7.326  147.890 1.00 20.36  ? 475  LEU B CD1 1 
ATOM   6366  C  CD2 . LEU B  1 368 ? 29.963  -9.676  147.339 1.00 19.37  ? 475  LEU B CD2 1 
ATOM   6367  N  N   . GLY B  1 369 ? 32.214  -5.623  146.052 1.00 24.56  ? 476  GLY B N   1 
ATOM   6368  C  CA  . GLY B  1 369 ? 33.638  -5.420  146.248 1.00 25.03  ? 476  GLY B CA  1 
ATOM   6369  C  C   . GLY B  1 369 ? 34.241  -4.394  145.313 1.00 27.02  ? 476  GLY B C   1 
ATOM   6370  O  O   . GLY B  1 369 ? 35.453  -4.165  145.327 1.00 27.61  ? 476  GLY B O   1 
ATOM   6371  N  N   . GLU B  1 370 ? 33.402  -3.776  144.487 1.00 27.64  ? 477  GLU B N   1 
ATOM   6372  C  CA  . GLU B  1 370 ? 33.869  -2.769  143.546 1.00 27.40  ? 477  GLU B CA  1 
ATOM   6373  C  C   . GLU B  1 370 ? 33.195  -1.437  143.862 1.00 25.73  ? 477  GLU B C   1 
ATOM   6374  O  O   . GLU B  1 370 ? 32.193  -1.397  144.570 1.00 23.98  ? 477  GLU B O   1 
ATOM   6375  C  CB  . GLU B  1 370 ? 33.540  -3.199  142.120 1.00 29.95  ? 477  GLU B CB  1 
ATOM   6376  C  CG  . GLU B  1 370 ? 33.968  -4.615  141.797 1.00 33.68  ? 477  GLU B CG  1 
ATOM   6377  C  CD  . GLU B  1 370 ? 33.585  -5.020  140.386 1.00 37.19  ? 477  GLU B CD  1 
ATOM   6378  O  OE1 . GLU B  1 370 ? 33.700  -6.225  140.067 1.00 38.67  ? 477  GLU B OE1 1 
ATOM   6379  O  OE2 . GLU B  1 370 ? 33.170  -4.136  139.596 1.00 38.68  ? 477  GLU B OE2 1 
ATOM   6380  N  N   . PRO B  1 371 ? 33.743  -0.325  143.343 1.00 25.57  ? 478  PRO B N   1 
ATOM   6381  C  CA  . PRO B  1 371 ? 33.171  1.006   143.590 1.00 24.33  ? 478  PRO B CA  1 
ATOM   6382  C  C   . PRO B  1 371 ? 31.731  1.168   143.090 1.00 23.78  ? 478  PRO B C   1 
ATOM   6383  O  O   . PRO B  1 371 ? 30.986  2.013   143.588 1.00 23.97  ? 478  PRO B O   1 
ATOM   6384  C  CB  . PRO B  1 371 ? 34.133  1.939   142.859 1.00 24.34  ? 478  PRO B CB  1 
ATOM   6385  C  CG  . PRO B  1 371 ? 35.443  1.193   142.910 1.00 25.86  ? 478  PRO B CG  1 
ATOM   6386  C  CD  . PRO B  1 371 ? 35.020  -0.224  142.611 1.00 25.69  ? 478  PRO B CD  1 
ATOM   6387  N  N   . ASN B  1 372 ? 31.334  0.373   142.101 1.00 22.81  ? 479  ASN B N   1 
ATOM   6388  C  CA  . ASN B  1 372 ? 29.977  0.477   141.572 1.00 21.28  ? 479  ASN B CA  1 
ATOM   6389  C  C   . ASN B  1 372 ? 29.006  -0.515  142.174 1.00 19.91  ? 479  ASN B C   1 
ATOM   6390  O  O   . ASN B  1 372 ? 27.935  -0.744  141.620 1.00 18.68  ? 479  ASN B O   1 
ATOM   6391  C  CB  . ASN B  1 372 ? 29.976  0.334   140.052 1.00 21.39  ? 479  ASN B CB  1 
ATOM   6392  C  CG  . ASN B  1 372 ? 30.433  1.590   139.364 1.00 22.38  ? 479  ASN B CG  1 
ATOM   6393  O  OD1 . ASN B  1 372 ? 29.761  2.627   139.435 1.00 22.71  ? 479  ASN B OD1 1 
ATOM   6394  N  ND2 . ASN B  1 372 ? 31.587  1.521   138.704 1.00 22.82  ? 479  ASN B ND2 1 
ATOM   6395  N  N   . HIS B  1 373 ? 29.388  -1.092  143.313 1.00 19.90  ? 480  HIS B N   1 
ATOM   6396  C  CA  . HIS B  1 373 ? 28.544  -2.044  144.015 1.00 19.27  ? 480  HIS B CA  1 
ATOM   6397  C  C   . HIS B  1 373 ? 27.192  -1.374  144.253 1.00 17.87  ? 480  HIS B C   1 
ATOM   6398  O  O   . HIS B  1 373 ? 27.145  -0.239  144.716 1.00 16.95  ? 480  HIS B O   1 
ATOM   6399  C  CB  . HIS B  1 373 ? 29.198  -2.439  145.349 1.00 19.57  ? 480  HIS B CB  1 
ATOM   6400  C  CG  . HIS B  1 373 ? 28.344  -3.325  146.211 1.00 21.92  ? 480  HIS B CG  1 
ATOM   6401  N  ND1 . HIS B  1 373 ? 27.705  -4.445  145.735 1.00 24.72  ? 480  HIS B ND1 1 
ATOM   6402  C  CD2 . HIS B  1 373 ? 28.025  -3.252  147.522 1.00 21.94  ? 480  HIS B CD2 1 
ATOM   6403  C  CE1 . HIS B  1 373 ? 27.027  -5.021  146.711 1.00 23.98  ? 480  HIS B CE1 1 
ATOM   6404  N  NE2 . HIS B  1 373 ? 27.205  -4.317  147.807 1.00 23.21  ? 480  HIS B NE2 1 
ATOM   6405  N  N   . ILE B  1 374 ? 26.102  -2.066  143.916 1.00 17.08  ? 481  ILE B N   1 
ATOM   6406  C  CA  . ILE B  1 374 ? 24.751  -1.522  144.112 1.00 16.41  ? 481  ILE B CA  1 
ATOM   6407  C  C   . ILE B  1 374 ? 23.901  -2.401  145.028 1.00 16.62  ? 481  ILE B C   1 
ATOM   6408  O  O   . ILE B  1 374 ? 23.903  -3.628  144.897 1.00 16.64  ? 481  ILE B O   1 
ATOM   6409  C  CB  . ILE B  1 374 ? 23.992  -1.384  142.766 1.00 15.54  ? 481  ILE B CB  1 
ATOM   6410  C  CG1 . ILE B  1 374 ? 24.691  -0.353  141.884 1.00 14.45  ? 481  ILE B CG1 1 
ATOM   6411  C  CG2 . ILE B  1 374 ? 22.532  -0.988  143.010 1.00 13.89  ? 481  ILE B CG2 1 
ATOM   6412  C  CD1 . ILE B  1 374 ? 24.090  -0.240  140.530 1.00 16.76  ? 481  ILE B CD1 1 
ATOM   6413  N  N   . THR B  1 375 ? 23.190  -1.785  145.968 1.00 16.16  ? 482  THR B N   1 
ATOM   6414  C  CA  . THR B  1 375 ? 22.320  -2.569  146.841 1.00 17.60  ? 482  THR B CA  1 
ATOM   6415  C  C   . THR B  1 375 ? 20.901  -2.016  146.784 1.00 17.53  ? 482  THR B C   1 
ATOM   6416  O  O   . THR B  1 375 ? 19.986  -2.610  147.332 1.00 17.78  ? 482  THR B O   1 
ATOM   6417  C  CB  . THR B  1 375 ? 22.789  -2.598  148.326 1.00 16.10  ? 482  THR B CB  1 
ATOM   6418  O  OG1 . THR B  1 375 ? 22.658  -1.296  148.903 1.00 19.24  ? 482  THR B OG1 1 
ATOM   6419  C  CG2 . THR B  1 375 ? 24.226  -3.055  148.425 1.00 15.60  ? 482  THR B CG2 1 
ATOM   6420  N  N   . ARG B  1 376 ? 20.728  -0.884  146.107 1.00 18.70  ? 483  ARG B N   1 
ATOM   6421  C  CA  . ARG B  1 376 ? 19.417  -0.261  145.958 1.00 19.50  ? 483  ARG B CA  1 
ATOM   6422  C  C   . ARG B  1 376 ? 19.305  0.195   144.503 1.00 18.60  ? 483  ARG B C   1 
ATOM   6423  O  O   . ARG B  1 376 ? 19.921  1.182   144.101 1.00 19.67  ? 483  ARG B O   1 
ATOM   6424  C  CB  . ARG B  1 376 ? 19.298  0.931   146.914 1.00 23.74  ? 483  ARG B CB  1 
ATOM   6425  C  CG  . ARG B  1 376 ? 17.883  1.215   147.392 1.00 31.56  ? 483  ARG B CG  1 
ATOM   6426  C  CD  . ARG B  1 376 ? 17.812  1.496   148.904 1.00 36.27  ? 483  ARG B CD  1 
ATOM   6427  N  NE  . ARG B  1 376 ? 17.995  2.911   149.248 1.00 43.53  ? 483  ARG B NE  1 
ATOM   6428  C  CZ  . ARG B  1 376 ? 19.173  3.538   149.347 1.00 46.82  ? 483  ARG B CZ  1 
ATOM   6429  N  NH1 . ARG B  1 376 ? 19.209  4.827   149.668 1.00 48.29  ? 483  ARG B NH1 1 
ATOM   6430  N  NH2 . ARG B  1 376 ? 20.320  2.889   149.136 1.00 48.99  ? 483  ARG B NH2 1 
ATOM   6431  N  N   . LEU B  1 377 ? 18.535  -0.542  143.710 1.00 16.31  ? 484  LEU B N   1 
ATOM   6432  C  CA  . LEU B  1 377 ? 18.362  -0.237  142.292 1.00 14.25  ? 484  LEU B CA  1 
ATOM   6433  C  C   . LEU B  1 377 ? 17.595  1.021   141.951 1.00 14.33  ? 484  LEU B C   1 
ATOM   6434  O  O   . LEU B  1 377 ? 16.791  1.531   142.734 1.00 13.52  ? 484  LEU B O   1 
ATOM   6435  C  CB  . LEU B  1 377 ? 17.642  -1.391  141.580 1.00 13.70  ? 484  LEU B CB  1 
ATOM   6436  C  CG  . LEU B  1 377 ? 18.396  -2.680  141.262 1.00 13.91  ? 484  LEU B CG  1 
ATOM   6437  C  CD1 . LEU B  1 377 ? 17.421  -3.714  140.784 1.00 11.36  ? 484  LEU B CD1 1 
ATOM   6438  C  CD2 . LEU B  1 377 ? 19.472  -2.405  140.206 1.00 12.50  ? 484  LEU B CD2 1 
ATOM   6439  N  N   . GLU B  1 378 ? 17.866  1.502   140.746 1.00 14.67  ? 485  GLU B N   1 
ATOM   6440  C  CA  . GLU B  1 378 ? 17.172  2.628   140.162 1.00 13.99  ? 485  GLU B CA  1 
ATOM   6441  C  C   . GLU B  1 378 ? 16.799  2.055   138.800 1.00 13.44  ? 485  GLU B C   1 
ATOM   6442  O  O   . GLU B  1 378 ? 16.025  1.101   138.748 1.00 12.28  ? 485  GLU B O   1 
ATOM   6443  C  CB  . GLU B  1 378 ? 18.078  3.847   140.089 1.00 14.25  ? 485  GLU B CB  1 
ATOM   6444  C  CG  . GLU B  1 378 ? 18.200  4.492   141.465 1.00 15.45  ? 485  GLU B CG  1 
ATOM   6445  C  CD  . GLU B  1 378 ? 18.890  5.839   141.468 1.00 15.39  ? 485  GLU B CD  1 
ATOM   6446  O  OE1 . GLU B  1 378 ? 19.005  6.410   142.572 1.00 13.97  ? 485  GLU B OE1 1 
ATOM   6447  O  OE2 . GLU B  1 378 ? 19.308  6.325   140.390 1.00 15.87  ? 485  GLU B OE2 1 
ATOM   6448  N  N   . HIS B  1 379 ? 17.346  2.575   137.709 1.00 13.30  ? 486  HIS B N   1 
ATOM   6449  C  CA  . HIS B  1 379 ? 17.008  2.017   136.401 1.00 12.99  ? 486  HIS B CA  1 
ATOM   6450  C  C   . HIS B  1 379 ? 17.766  0.719   136.125 1.00 12.72  ? 486  HIS B C   1 
ATOM   6451  O  O   . HIS B  1 379 ? 18.874  0.510   136.623 1.00 14.19  ? 486  HIS B O   1 
ATOM   6452  C  CB  . HIS B  1 379 ? 17.334  3.007   135.288 1.00 12.49  ? 486  HIS B CB  1 
ATOM   6453  C  CG  . HIS B  1 379 ? 16.834  4.387   135.548 1.00 11.75  ? 486  HIS B CG  1 
ATOM   6454  N  ND1 . HIS B  1 379 ? 17.497  5.273   136.368 1.00 12.32  ? 486  HIS B ND1 1 
ATOM   6455  C  CD2 . HIS B  1 379 ? 15.722  5.028   135.122 1.00 12.33  ? 486  HIS B CD2 1 
ATOM   6456  C  CE1 . HIS B  1 379 ? 16.815  6.402   136.437 1.00 12.57  ? 486  HIS B CE1 1 
ATOM   6457  N  NE2 . HIS B  1 379 ? 15.732  6.279   135.691 1.00 14.50  ? 486  HIS B NE2 1 
ATOM   6458  N  N   . VAL B  1 380 ? 17.151  -0.154  135.335 1.00 12.21  ? 487  VAL B N   1 
ATOM   6459  C  CA  . VAL B  1 380 ? 17.772  -1.410  134.926 1.00 10.98  ? 487  VAL B CA  1 
ATOM   6460  C  C   . VAL B  1 380 ? 17.624  -1.558  133.418 1.00 10.29  ? 487  VAL B C   1 
ATOM   6461  O  O   . VAL B  1 380 ? 16.522  -1.427  132.881 1.00 10.13  ? 487  VAL B O   1 
ATOM   6462  C  CB  . VAL B  1 380 ? 17.124  -2.617  135.583 1.00 11.15  ? 487  VAL B CB  1 
ATOM   6463  C  CG1 . VAL B  1 380 ? 17.617  -3.884  134.910 1.00 10.21  ? 487  VAL B CG1 1 
ATOM   6464  C  CG2 . VAL B  1 380 ? 17.463  -2.641  137.064 1.00 11.24  ? 487  VAL B CG2 1 
ATOM   6465  N  N   . GLN B  1 381 ? 18.738  -1.799  132.740 1.00 9.90   ? 488  GLN B N   1 
ATOM   6466  C  CA  . GLN B  1 381 ? 18.726  -1.986  131.291 1.00 11.07  ? 488  GLN B CA  1 
ATOM   6467  C  C   . GLN B  1 381 ? 19.132  -3.405  130.941 1.00 11.72  ? 488  GLN B C   1 
ATOM   6468  O  O   . GLN B  1 381 ? 20.120  -3.925  131.457 1.00 11.89  ? 488  GLN B O   1 
ATOM   6469  C  CB  . GLN B  1 381 ? 19.728  -1.073  130.570 1.00 11.47  ? 488  GLN B CB  1 
ATOM   6470  C  CG  . GLN B  1 381 ? 19.551  0.425   130.705 1.00 10.50  ? 488  GLN B CG  1 
ATOM   6471  C  CD  . GLN B  1 381 ? 20.546  1.174   129.829 1.00 12.15  ? 488  GLN B CD  1 
ATOM   6472  O  OE1 . GLN B  1 381 ? 21.716  0.775   129.707 1.00 9.88   ? 488  GLN B OE1 1 
ATOM   6473  N  NE2 . GLN B  1 381 ? 20.091  2.269   129.215 1.00 11.29  ? 488  GLN B NE2 1 
ATOM   6474  N  N   . ALA B  1 382 ? 18.363  -4.031  130.063 1.00 12.96  ? 489  ALA B N   1 
ATOM   6475  C  CA  . ALA B  1 382 ? 18.685  -5.360  129.583 1.00 11.84  ? 489  ALA B CA  1 
ATOM   6476  C  C   . ALA B  1 382 ? 19.036  -5.065  128.128 1.00 12.10  ? 489  ALA B C   1 
ATOM   6477  O  O   . ALA B  1 382 ? 18.150  -4.833  127.309 1.00 12.46  ? 489  ALA B O   1 
ATOM   6478  C  CB  . ALA B  1 382 ? 17.479  -6.266  129.674 1.00 12.81  ? 489  ALA B CB  1 
ATOM   6479  N  N   . ARG B  1 383 ? 20.333  -5.010  127.833 1.00 12.66  ? 490  ARG B N   1 
ATOM   6480  C  CA  . ARG B  1 383 ? 20.821  -4.718  126.486 1.00 12.97  ? 490  ARG B CA  1 
ATOM   6481  C  C   . ARG B  1 383 ? 20.897  -5.965  125.659 1.00 13.58  ? 490  ARG B C   1 
ATOM   6482  O  O   . ARG B  1 383 ? 21.783  -6.797  125.866 1.00 13.99  ? 490  ARG B O   1 
ATOM   6483  C  CB  . ARG B  1 383 ? 22.213  -4.121  126.529 1.00 13.96  ? 490  ARG B CB  1 
ATOM   6484  C  CG  . ARG B  1 383 ? 22.297  -2.839  127.266 1.00 14.18  ? 490  ARG B CG  1 
ATOM   6485  C  CD  . ARG B  1 383 ? 23.611  -2.173  126.964 1.00 14.44  ? 490  ARG B CD  1 
ATOM   6486  N  NE  . ARG B  1 383 ? 23.429  -0.753  127.166 1.00 18.30  ? 490  ARG B NE  1 
ATOM   6487  C  CZ  . ARG B  1 383 ? 23.446  0.154   126.204 1.00 16.32  ? 490  ARG B CZ  1 
ATOM   6488  N  NH1 . ARG B  1 383 ? 23.243  1.408   126.536 1.00 20.10  ? 490  ARG B NH1 1 
ATOM   6489  N  NH2 . ARG B  1 383 ? 23.702  -0.174  124.941 1.00 15.37  ? 490  ARG B NH2 1 
ATOM   6490  N  N   . LEU B  1 384 ? 19.996  -6.083  124.694 1.00 13.69  ? 491  LEU B N   1 
ATOM   6491  C  CA  . LEU B  1 384 ? 19.965  -7.274  123.857 1.00 12.99  ? 491  LEU B CA  1 
ATOM   6492  C  C   . LEU B  1 384 ? 20.375  -7.044  122.408 1.00 12.87  ? 491  LEU B C   1 
ATOM   6493  O  O   . LEU B  1 384 ? 20.136  -5.990  121.824 1.00 13.37  ? 491  LEU B O   1 
ATOM   6494  C  CB  . LEU B  1 384 ? 18.562  -7.884  123.887 1.00 10.20  ? 491  LEU B CB  1 
ATOM   6495  C  CG  . LEU B  1 384 ? 17.971  -8.058  125.281 1.00 10.16  ? 491  LEU B CG  1 
ATOM   6496  C  CD1 . LEU B  1 384 ? 16.557  -8.586  125.161 1.00 10.35  ? 491  LEU B CD1 1 
ATOM   6497  C  CD2 . LEU B  1 384 ? 18.844  -9.016  126.083 1.00 10.17  ? 491  LEU B CD2 1 
ATOM   6498  N  N   . THR B  1 385 ? 21.019  -8.054  121.849 1.00 12.62  ? 492  THR B N   1 
ATOM   6499  C  CA  . THR B  1 385 ? 21.422  -8.058  120.462 1.00 11.98  ? 492  THR B CA  1 
ATOM   6500  C  C   . THR B  1 385 ? 20.982  -9.436  120.033 1.00 12.19  ? 492  THR B C   1 
ATOM   6501  O  O   . THR B  1 385 ? 21.493  -10.444 120.518 1.00 13.48  ? 492  THR B O   1 
ATOM   6502  C  CB  . THR B  1 385 ? 22.931  -7.943  120.290 1.00 11.43  ? 492  THR B CB  1 
ATOM   6503  O  OG1 . THR B  1 385 ? 23.363  -6.656  120.748 1.00 16.44  ? 492  THR B OG1 1 
ATOM   6504  C  CG2 . THR B  1 385 ? 23.296  -8.085  118.844 1.00 8.62   ? 492  THR B CG2 1 
ATOM   6505  N  N   . LEU B  1 386 ? 20.002  -9.486  119.150 1.00 13.08  ? 493  LEU B N   1 
ATOM   6506  C  CA  . LEU B  1 386 ? 19.490  -10.769 118.685 1.00 12.97  ? 493  LEU B CA  1 
ATOM   6507  C  C   . LEU B  1 386 ? 18.980  -10.667 117.263 1.00 13.26  ? 493  LEU B C   1 
ATOM   6508  O  O   . LEU B  1 386 ? 18.703  -9.568  116.754 1.00 13.15  ? 493  LEU B O   1 
ATOM   6509  C  CB  . LEU B  1 386 ? 18.357  -11.240 119.600 1.00 10.99  ? 493  LEU B CB  1 
ATOM   6510  C  CG  . LEU B  1 386 ? 17.104  -10.362 119.660 1.00 11.10  ? 493  LEU B CG  1 
ATOM   6511  C  CD1 . LEU B  1 386 ? 16.254  -10.591 118.423 1.00 10.66  ? 493  LEU B CD1 1 
ATOM   6512  C  CD2 . LEU B  1 386 ? 16.308  -10.693 120.913 1.00 10.64  ? 493  LEU B CD2 1 
ATOM   6513  N  N   . SER B  1 387 ? 18.876  -11.822 116.621 1.00 12.63  ? 494  SER B N   1 
ATOM   6514  C  CA  . SER B  1 387 ? 18.352  -11.888 115.271 1.00 13.17  ? 494  SER B CA  1 
ATOM   6515  C  C   . SER B  1 387 ? 17.130  -12.786 115.346 1.00 13.74  ? 494  SER B C   1 
ATOM   6516  O  O   . SER B  1 387 ? 17.126  -13.777 116.073 1.00 13.87  ? 494  SER B O   1 
ATOM   6517  C  CB  . SER B  1 387 ? 19.385  -12.475 114.317 1.00 11.56  ? 494  SER B CB  1 
ATOM   6518  O  OG  . SER B  1 387 ? 19.900  -13.686 114.833 1.00 15.00  ? 494  SER B OG  1 
ATOM   6519  N  N   . TYR B  1 388 ? 16.079  -12.418 114.628 1.00 14.28  ? 495  TYR B N   1 
ATOM   6520  C  CA  . TYR B  1 388 ? 14.858  -13.217 114.607 1.00 14.28  ? 495  TYR B CA  1 
ATOM   6521  C  C   . TYR B  1 388 ? 14.194  -12.929 113.267 1.00 14.78  ? 495  TYR B C   1 
ATOM   6522  O  O   . TYR B  1 388 ? 14.428  -11.867 112.684 1.00 16.00  ? 495  TYR B O   1 
ATOM   6523  C  CB  . TYR B  1 388 ? 13.943  -12.828 115.768 1.00 11.98  ? 495  TYR B CB  1 
ATOM   6524  C  CG  . TYR B  1 388 ? 13.103  -13.964 116.275 1.00 8.84   ? 495  TYR B CG  1 
ATOM   6525  C  CD1 . TYR B  1 388 ? 13.697  -15.080 116.839 1.00 10.90  ? 495  TYR B CD1 1 
ATOM   6526  C  CD2 . TYR B  1 388 ? 11.712  -13.939 116.171 1.00 10.99  ? 495  TYR B CD2 1 
ATOM   6527  C  CE1 . TYR B  1 388 ? 12.938  -16.155 117.287 1.00 11.91  ? 495  TYR B CE1 1 
ATOM   6528  C  CE2 . TYR B  1 388 ? 10.926  -15.017 116.619 1.00 9.39   ? 495  TYR B CE2 1 
ATOM   6529  C  CZ  . TYR B  1 388 ? 11.557  -16.122 117.175 1.00 12.16  ? 495  TYR B CZ  1 
ATOM   6530  O  OH  . TYR B  1 388 ? 10.843  -17.212 117.625 1.00 13.84  ? 495  TYR B OH  1 
ATOM   6531  N  N   . ASN B  1 389 ? 13.375  -13.858 112.778 1.00 14.08  ? 496  ASN B N   1 
ATOM   6532  C  CA  . ASN B  1 389 ? 12.734  -13.680 111.476 1.00 14.74  ? 496  ASN B CA  1 
ATOM   6533  C  C   . ASN B  1 389 ? 11.468  -12.840 111.495 1.00 15.38  ? 496  ASN B C   1 
ATOM   6534  O  O   . ASN B  1 389 ? 11.148  -12.161 110.514 1.00 15.38  ? 496  ASN B O   1 
ATOM   6535  C  CB  . ASN B  1 389 ? 12.453  -15.046 110.827 1.00 14.41  ? 496  ASN B CB  1 
ATOM   6536  C  CG  . ASN B  1 389 ? 11.427  -15.878 111.591 1.00 15.95  ? 496  ASN B CG  1 
ATOM   6537  O  OD1 . ASN B  1 389 ? 11.657  -16.284 112.735 1.00 17.66  ? 496  ASN B OD1 1 
ATOM   6538  N  ND2 . ASN B  1 389 ? 10.286  -16.145 110.953 1.00 13.50  ? 496  ASN B ND2 1 
ATOM   6539  N  N   . ARG B  1 390 ? 10.773  -12.868 112.625 1.00 15.89  ? 497  ARG B N   1 
ATOM   6540  C  CA  . ARG B  1 390 ? 9.532   -12.137 112.799 1.00 17.75  ? 497  ARG B CA  1 
ATOM   6541  C  C   . ARG B  1 390 ? 9.601   -11.470 114.173 1.00 17.55  ? 497  ARG B C   1 
ATOM   6542  O  O   . ARG B  1 390 ? 9.117   -12.034 115.145 1.00 18.29  ? 497  ARG B O   1 
ATOM   6543  C  CB  . ARG B  1 390 ? 8.379   -13.137 112.777 1.00 18.96  ? 497  ARG B CB  1 
ATOM   6544  C  CG  . ARG B  1 390 ? 7.178   -12.726 111.966 1.00 22.14  ? 497  ARG B CG  1 
ATOM   6545  C  CD  . ARG B  1 390 ? 7.336   -13.123 110.501 1.00 25.46  ? 497  ARG B CD  1 
ATOM   6546  N  NE  . ARG B  1 390 ? 7.863   -12.033 109.688 1.00 28.40  ? 497  ARG B NE  1 
ATOM   6547  C  CZ  . ARG B  1 390 ? 7.925   -12.047 108.357 1.00 30.01  ? 497  ARG B CZ  1 
ATOM   6548  N  NH1 . ARG B  1 390 ? 8.429   -11.002 107.708 1.00 32.32  ? 497  ARG B NH1 1 
ATOM   6549  N  NH2 . ARG B  1 390 ? 7.489   -13.095 107.670 1.00 28.29  ? 497  ARG B NH2 1 
ATOM   6550  N  N   . ARG B  1 391 ? 10.184  -10.275 114.251 1.00 17.09  ? 498  ARG B N   1 
ATOM   6551  C  CA  . ARG B  1 391 ? 10.343  -9.565  115.524 1.00 14.41  ? 498  ARG B CA  1 
ATOM   6552  C  C   . ARG B  1 391 ? 9.090   -9.416  116.384 1.00 14.60  ? 498  ARG B C   1 
ATOM   6553  O  O   . ARG B  1 391 ? 9.125   -9.681  117.585 1.00 14.20  ? 498  ARG B O   1 
ATOM   6554  C  CB  . ARG B  1 391 ? 10.947  -8.187  115.269 1.00 13.44  ? 498  ARG B CB  1 
ATOM   6555  C  CG  . ARG B  1 391 ? 11.580  -7.543  116.493 1.00 11.78  ? 498  ARG B CG  1 
ATOM   6556  C  CD  . ARG B  1 391 ? 12.473  -6.388  116.087 1.00 9.16   ? 498  ARG B CD  1 
ATOM   6557  N  NE  . ARG B  1 391 ? 11.711  -5.344  115.409 1.00 8.33   ? 498  ARG B NE  1 
ATOM   6558  C  CZ  . ARG B  1 391 ? 12.264  -4.377  114.691 1.00 6.86   ? 498  ARG B CZ  1 
ATOM   6559  N  NH1 . ARG B  1 391 ? 11.502  -3.461  114.111 1.00 5.32   ? 498  ARG B NH1 1 
ATOM   6560  N  NH2 . ARG B  1 391 ? 13.583  -4.341  114.552 1.00 6.39   ? 498  ARG B NH2 1 
ATOM   6561  N  N   . GLY B  1 392 ? 7.992   -8.988  115.773 1.00 14.26  ? 499  GLY B N   1 
ATOM   6562  C  CA  . GLY B  1 392 ? 6.760   -8.795  116.509 1.00 14.35  ? 499  GLY B CA  1 
ATOM   6563  C  C   . GLY B  1 392 ? 6.216   -10.026 117.219 1.00 15.93  ? 499  GLY B C   1 
ATOM   6564  O  O   . GLY B  1 392 ? 5.331   -9.911  118.076 1.00 17.06  ? 499  GLY B O   1 
ATOM   6565  N  N   . ASP B  1 393 ? 6.723   -11.204 116.873 1.00 14.05  ? 500  ASP B N   1 
ATOM   6566  C  CA  . ASP B  1 393 ? 6.254   -12.424 117.515 1.00 15.07  ? 500  ASP B CA  1 
ATOM   6567  C  C   . ASP B  1 393 ? 6.935   -12.668 118.849 1.00 15.13  ? 500  ASP B C   1 
ATOM   6568  O  O   . ASP B  1 393 ? 6.502   -13.530 119.623 1.00 16.54  ? 500  ASP B O   1 
ATOM   6569  C  CB  . ASP B  1 393 ? 6.487   -13.633 116.608 1.00 15.80  ? 500  ASP B CB  1 
ATOM   6570  C  CG  . ASP B  1 393 ? 5.417   -13.770 115.542 1.00 19.22  ? 500  ASP B CG  1 
ATOM   6571  O  OD1 . ASP B  1 393 ? 5.616   -14.568 114.604 1.00 20.09  ? 500  ASP B OD1 1 
ATOM   6572  O  OD2 . ASP B  1 393 ? 4.371   -13.083 115.642 1.00 19.58  ? 500  ASP B OD2 1 
ATOM   6573  N  N   . LEU B  1 394 ? 7.994   -11.909 119.126 1.00 13.49  ? 501  LEU B N   1 
ATOM   6574  C  CA  . LEU B  1 394 ? 8.731   -12.075 120.370 1.00 11.65  ? 501  LEU B CA  1 
ATOM   6575  C  C   . LEU B  1 394 ? 8.121   -11.374 121.570 1.00 10.87  ? 501  LEU B C   1 
ATOM   6576  O  O   . LEU B  1 394 ? 7.495   -10.329 121.449 1.00 11.82  ? 501  LEU B O   1 
ATOM   6577  C  CB  . LEU B  1 394 ? 10.162  -11.578 120.210 1.00 10.96  ? 501  LEU B CB  1 
ATOM   6578  C  CG  . LEU B  1 394 ? 11.125  -12.308 119.282 1.00 10.56  ? 501  LEU B CG  1 
ATOM   6579  C  CD1 . LEU B  1 394 ? 12.444  -11.553 119.251 1.00 9.23   ? 501  LEU B CD1 1 
ATOM   6580  C  CD2 . LEU B  1 394 ? 11.344  -13.738 119.771 1.00 9.54   ? 501  LEU B CD2 1 
ATOM   6581  N  N   . ALA B  1 395 ? 8.306   -11.981 122.732 1.00 10.17  ? 502  ALA B N   1 
ATOM   6582  C  CA  . ALA B  1 395 ? 7.861   -11.428 123.999 1.00 9.75   ? 502  ALA B CA  1 
ATOM   6583  C  C   . ALA B  1 395 ? 9.078   -11.652 124.892 1.00 11.08  ? 502  ALA B C   1 
ATOM   6584  O  O   . ALA B  1 395 ? 9.591   -12.774 124.997 1.00 10.48  ? 502  ALA B O   1 
ATOM   6585  C  CB  . ALA B  1 395 ? 6.671   -12.178 124.538 1.00 9.91   ? 502  ALA B CB  1 
ATOM   6586  N  N   . ILE B  1 396 ? 9.559   -10.588 125.525 1.00 11.64  ? 503  ILE B N   1 
ATOM   6587  C  CA  . ILE B  1 396 ? 10.742  -10.703 126.372 1.00 11.31  ? 503  ILE B CA  1 
ATOM   6588  C  C   . ILE B  1 396 ? 10.444  -10.247 127.793 1.00 12.68  ? 503  ILE B C   1 
ATOM   6589  O  O   . ILE B  1 396 ? 9.802   -9.216  128.011 1.00 15.34  ? 503  ILE B O   1 
ATOM   6590  C  CB  . ILE B  1 396 ? 11.901  -9.877  125.779 1.00 10.98  ? 503  ILE B CB  1 
ATOM   6591  C  CG1 . ILE B  1 396 ? 12.143  -10.311 124.328 1.00 9.07   ? 503  ILE B CG1 1 
ATOM   6592  C  CG2 . ILE B  1 396 ? 13.168  -10.067 126.594 1.00 10.72  ? 503  ILE B CG2 1 
ATOM   6593  C  CD1 . ILE B  1 396 ? 13.038  -9.389  123.562 1.00 7.66   ? 503  ILE B CD1 1 
ATOM   6594  N  N   . HIS B  1 397 ? 10.893  -11.034 128.762 1.00 12.10  ? 504  HIS B N   1 
ATOM   6595  C  CA  . HIS B  1 397 ? 10.678  -10.714 130.164 1.00 12.48  ? 504  HIS B CA  1 
ATOM   6596  C  C   . HIS B  1 397 ? 11.983  -10.786 130.940 1.00 11.76  ? 504  HIS B C   1 
ATOM   6597  O  O   . HIS B  1 397 ? 12.864  -11.574 130.614 1.00 11.22  ? 504  HIS B O   1 
ATOM   6598  C  CB  . HIS B  1 397 ? 9.679   -11.687 130.800 1.00 12.45  ? 504  HIS B CB  1 
ATOM   6599  C  CG  . HIS B  1 397 ? 8.290   -11.565 130.264 1.00 12.41  ? 504  HIS B CG  1 
ATOM   6600  N  ND1 . HIS B  1 397 ? 7.914   -12.091 129.050 1.00 13.28  ? 504  HIS B ND1 1 
ATOM   6601  C  CD2 . HIS B  1 397 ? 7.191   -10.951 130.763 1.00 13.09  ? 504  HIS B CD2 1 
ATOM   6602  C  CE1 . HIS B  1 397 ? 6.643   -11.807 128.822 1.00 12.76  ? 504  HIS B CE1 1 
ATOM   6603  N  NE2 . HIS B  1 397 ? 6.182   -11.116 129.846 1.00 11.52  ? 504  HIS B NE2 1 
ATOM   6604  N  N   . LEU B  1 398 ? 12.098  -9.952  131.966 1.00 11.51  ? 505  LEU B N   1 
ATOM   6605  C  CA  . LEU B  1 398 ? 13.281  -9.937  132.823 1.00 12.79  ? 505  LEU B CA  1 
ATOM   6606  C  C   . LEU B  1 398 ? 12.766  -10.083 134.252 1.00 13.68  ? 505  LEU B C   1 
ATOM   6607  O  O   . LEU B  1 398 ? 11.865  -9.349  134.677 1.00 15.55  ? 505  LEU B O   1 
ATOM   6608  C  CB  . LEU B  1 398 ? 14.047  -8.615  132.676 1.00 10.94  ? 505  LEU B CB  1 
ATOM   6609  C  CG  . LEU B  1 398 ? 15.326  -8.494  133.511 1.00 11.21  ? 505  LEU B CG  1 
ATOM   6610  C  CD1 . LEU B  1 398 ? 16.321  -9.549  133.060 1.00 9.00   ? 505  LEU B CD1 1 
ATOM   6611  C  CD2 . LEU B  1 398 ? 15.936  -7.094  133.365 1.00 10.34  ? 505  LEU B CD2 1 
ATOM   6612  N  N   . ILE B  1 399 ? 13.304  -11.045 134.990 1.00 13.63  ? 506  ILE B N   1 
ATOM   6613  C  CA  . ILE B  1 399 ? 12.860  -11.239 136.365 1.00 13.87  ? 506  ILE B CA  1 
ATOM   6614  C  C   . ILE B  1 399 ? 14.014  -10.958 137.317 1.00 13.59  ? 506  ILE B C   1 
ATOM   6615  O  O   . ILE B  1 399 ? 15.094  -11.543 137.197 1.00 12.50  ? 506  ILE B O   1 
ATOM   6616  C  CB  . ILE B  1 399 ? 12.332  -12.682 136.628 1.00 14.00  ? 506  ILE B CB  1 
ATOM   6617  C  CG1 . ILE B  1 399 ? 11.185  -13.030 135.675 1.00 15.85  ? 506  ILE B CG1 1 
ATOM   6618  C  CG2 . ILE B  1 399 ? 11.764  -12.769 138.032 1.00 13.20  ? 506  ILE B CG2 1 
ATOM   6619  C  CD1 . ILE B  1 399 ? 11.611  -13.392 134.276 1.00 16.59  ? 506  ILE B CD1 1 
ATOM   6620  N  N   . SER B  1 400 ? 13.778  -10.052 138.258 1.00 13.71  ? 507  SER B N   1 
ATOM   6621  C  CA  . SER B  1 400 ? 14.796  -9.674  139.232 1.00 15.05  ? 507  SER B CA  1 
ATOM   6622  C  C   . SER B  1 400 ? 14.924  -10.730 140.319 1.00 15.38  ? 507  SER B C   1 
ATOM   6623  O  O   . SER B  1 400 ? 14.004  -11.512 140.542 1.00 17.45  ? 507  SER B O   1 
ATOM   6624  C  CB  . SER B  1 400 ? 14.437  -8.339  139.875 1.00 14.73  ? 507  SER B CB  1 
ATOM   6625  O  OG  . SER B  1 400 ? 13.270  -8.462  140.661 1.00 15.50  ? 507  SER B OG  1 
ATOM   6626  N  N   . PRO B  1 401 ? 16.072  -10.767 141.014 1.00 16.11  ? 508  PRO B N   1 
ATOM   6627  C  CA  . PRO B  1 401 ? 16.276  -11.750 142.081 1.00 16.22  ? 508  PRO B CA  1 
ATOM   6628  C  C   . PRO B  1 401 ? 15.116  -11.750 143.070 1.00 16.96  ? 508  PRO B C   1 
ATOM   6629  O  O   . PRO B  1 401 ? 14.759  -12.786 143.611 1.00 17.01  ? 508  PRO B O   1 
ATOM   6630  C  CB  . PRO B  1 401 ? 17.574  -11.289 142.727 1.00 16.10  ? 508  PRO B CB  1 
ATOM   6631  C  CG  . PRO B  1 401 ? 18.325  -10.689 141.572 1.00 17.00  ? 508  PRO B CG  1 
ATOM   6632  C  CD  . PRO B  1 401 ? 17.252  -9.891  140.878 1.00 16.28  ? 508  PRO B CD  1 
ATOM   6633  N  N   . MET B  1 402 ? 14.518  -10.586 143.294 1.00 17.95  ? 509  MET B N   1 
ATOM   6634  C  CA  . MET B  1 402 ? 13.411  -10.501 144.228 1.00 18.43  ? 509  MET B CA  1 
ATOM   6635  C  C   . MET B  1 402 ? 12.060  -10.808 143.595 1.00 17.52  ? 509  MET B C   1 
ATOM   6636  O  O   . MET B  1 402 ? 11.004  -10.437 144.113 1.00 17.26  ? 509  MET B O   1 
ATOM   6637  C  CB  . MET B  1 402 ? 13.429  -9.139  144.915 1.00 20.91  ? 509  MET B CB  1 
ATOM   6638  C  CG  . MET B  1 402 ? 14.614  -9.009  145.842 1.00 21.14  ? 509  MET B CG  1 
ATOM   6639  S  SD  . MET B  1 402 ? 14.532  -7.482  146.716 1.00 28.39  ? 509  MET B SD  1 
ATOM   6640  C  CE  . MET B  1 402 ? 13.220  -7.845  147.903 1.00 26.10  ? 509  MET B CE  1 
ATOM   6641  N  N   . GLY B  1 403 ? 12.114  -11.494 142.458 1.00 16.46  ? 510  GLY B N   1 
ATOM   6642  C  CA  . GLY B  1 403 ? 10.909  -11.929 141.777 1.00 14.42  ? 510  GLY B CA  1 
ATOM   6643  C  C   . GLY B  1 403 ? 10.076  -10.967 140.971 1.00 14.32  ? 510  GLY B C   1 
ATOM   6644  O  O   . GLY B  1 403 ? 8.989   -11.331 140.543 1.00 14.36  ? 510  GLY B O   1 
ATOM   6645  N  N   . THR B  1 404 ? 10.550  -9.753  140.741 1.00 14.67  ? 511  THR B N   1 
ATOM   6646  C  CA  . THR B  1 404 ? 9.755   -8.816  139.962 1.00 15.94  ? 511  THR B CA  1 
ATOM   6647  C  C   . THR B  1 404 ? 9.914   -9.103  138.485 1.00 16.31  ? 511  THR B C   1 
ATOM   6648  O  O   . THR B  1 404 ? 11.005  -9.021  137.930 1.00 17.42  ? 511  THR B O   1 
ATOM   6649  C  CB  . THR B  1 404 ? 10.151  -7.397  140.264 1.00 15.20  ? 511  THR B CB  1 
ATOM   6650  O  OG1 . THR B  1 404 ? 9.925   -7.158  141.654 1.00 16.09  ? 511  THR B OG1 1 
ATOM   6651  C  CG2 . THR B  1 404 ? 9.326   -6.422  139.441 1.00 14.79  ? 511  THR B CG2 1 
ATOM   6652  N  N   . ARG B  1 405 ? 8.805   -9.452  137.854 1.00 17.15  ? 512  ARG B N   1 
ATOM   6653  C  CA  . ARG B  1 405 ? 8.802   -9.806  136.439 1.00 18.10  ? 512  ARG B CA  1 
ATOM   6654  C  C   . ARG B  1 405 ? 8.444   -8.602  135.569 1.00 16.94  ? 512  ARG B C   1 
ATOM   6655  O  O   . ARG B  1 405 ? 7.299   -8.147  135.561 1.00 18.27  ? 512  ARG B O   1 
ATOM   6656  C  CB  . ARG B  1 405 ? 7.807   -10.961 136.225 1.00 18.33  ? 512  ARG B CB  1 
ATOM   6657  C  CG  . ARG B  1 405 ? 7.904   -11.668 134.896 1.00 22.91  ? 512  ARG B CG  1 
ATOM   6658  C  CD  . ARG B  1 405 ? 7.390   -13.109 135.011 1.00 24.97  ? 512  ARG B CD  1 
ATOM   6659  N  NE  . ARG B  1 405 ? 7.516   -13.820 133.744 1.00 26.86  ? 512  ARG B NE  1 
ATOM   6660  C  CZ  . ARG B  1 405 ? 6.663   -13.687 132.729 1.00 30.27  ? 512  ARG B CZ  1 
ATOM   6661  N  NH1 . ARG B  1 405 ? 6.861   -14.369 131.597 1.00 31.04  ? 512  ARG B NH1 1 
ATOM   6662  N  NH2 . ARG B  1 405 ? 5.594   -12.896 132.852 1.00 30.68  ? 512  ARG B NH2 1 
ATOM   6663  N  N   . SER B  1 406 ? 9.435   -8.083  134.851 1.00 14.91  ? 513  SER B N   1 
ATOM   6664  C  CA  . SER B  1 406 ? 9.224   -6.935  133.980 1.00 14.14  ? 513  SER B CA  1 
ATOM   6665  C  C   . SER B  1 406 ? 9.075   -7.397  132.539 1.00 14.00  ? 513  SER B C   1 
ATOM   6666  O  O   . SER B  1 406 ? 9.870   -8.202  132.052 1.00 14.30  ? 513  SER B O   1 
ATOM   6667  C  CB  . SER B  1 406 ? 10.412  -5.968  134.062 1.00 14.32  ? 513  SER B CB  1 
ATOM   6668  O  OG  . SER B  1 406 ? 10.571  -5.422  135.361 1.00 15.88  ? 513  SER B OG  1 
ATOM   6669  N  N   . THR B  1 407 ? 8.054   -6.897  131.856 1.00 13.00  ? 514  THR B N   1 
ATOM   6670  C  CA  . THR B  1 407 ? 7.865   -7.256  130.461 1.00 13.23  ? 514  THR B CA  1 
ATOM   6671  C  C   . THR B  1 407 ? 8.655   -6.260  129.625 1.00 12.19  ? 514  THR B C   1 
ATOM   6672  O  O   . THR B  1 407 ? 8.200   -5.143  129.403 1.00 12.32  ? 514  THR B O   1 
ATOM   6673  C  CB  . THR B  1 407 ? 6.378   -7.193  130.047 1.00 13.15  ? 514  THR B CB  1 
ATOM   6674  O  OG1 . THR B  1 407 ? 5.626   -8.098  130.862 1.00 14.32  ? 514  THR B OG1 1 
ATOM   6675  C  CG2 . THR B  1 407 ? 6.204   -7.577  128.577 1.00 9.94   ? 514  THR B CG2 1 
ATOM   6676  N  N   . LEU B  1 408 ? 9.839   -6.663  129.180 1.00 10.68  ? 515  LEU B N   1 
ATOM   6677  C  CA  . LEU B  1 408 ? 10.682  -5.804  128.366 1.00 10.77  ? 515  LEU B CA  1 
ATOM   6678  C  C   . LEU B  1 408 ? 10.081  -5.574  126.983 1.00 12.02  ? 515  LEU B C   1 
ATOM   6679  O  O   . LEU B  1 408 ? 10.245  -4.505  126.395 1.00 12.91  ? 515  LEU B O   1 
ATOM   6680  C  CB  . LEU B  1 408 ? 12.067  -6.425  128.199 1.00 8.50   ? 515  LEU B CB  1 
ATOM   6681  C  CG  . LEU B  1 408 ? 12.869  -6.641  129.481 1.00 9.30   ? 515  LEU B CG  1 
ATOM   6682  C  CD1 . LEU B  1 408 ? 14.293  -7.078  129.131 1.00 6.74   ? 515  LEU B CD1 1 
ATOM   6683  C  CD2 . LEU B  1 408 ? 12.871  -5.351  130.310 1.00 6.15   ? 515  LEU B CD2 1 
ATOM   6684  N  N   . LEU B  1 409 ? 9.390   -6.583  126.460 1.00 12.18  ? 516  LEU B N   1 
ATOM   6685  C  CA  . LEU B  1 409 ? 8.781   -6.485  125.140 1.00 12.41  ? 516  LEU B CA  1 
ATOM   6686  C  C   . LEU B  1 409 ? 7.603   -7.435  125.012 1.00 12.53  ? 516  LEU B C   1 
ATOM   6687  O  O   . LEU B  1 409 ? 7.748   -8.630  125.225 1.00 14.65  ? 516  LEU B O   1 
ATOM   6688  C  CB  . LEU B  1 409 ? 9.820   -6.819  124.057 1.00 10.67  ? 516  LEU B CB  1 
ATOM   6689  C  CG  . LEU B  1 409 ? 9.363   -6.757  122.590 1.00 11.19  ? 516  LEU B CG  1 
ATOM   6690  C  CD1 . LEU B  1 409 ? 9.021   -5.326  122.184 1.00 8.74   ? 516  LEU B CD1 1 
ATOM   6691  C  CD2 . LEU B  1 409 ? 10.468  -7.301  121.691 1.00 9.42   ? 516  LEU B CD2 1 
ATOM   6692  N  N   . ALA B  1 410 ? 6.439   -6.899  124.677 1.00 12.38  ? 517  ALA B N   1 
ATOM   6693  C  CA  . ALA B  1 410 ? 5.248   -7.709  124.484 1.00 12.75  ? 517  ALA B CA  1 
ATOM   6694  C  C   . ALA B  1 410 ? 5.122   -7.884  122.979 1.00 14.28  ? 517  ALA B C   1 
ATOM   6695  O  O   . ALA B  1 410 ? 5.750   -7.153  122.213 1.00 15.05  ? 517  ALA B O   1 
ATOM   6696  C  CB  . ALA B  1 410 ? 4.034   -6.997  125.031 1.00 9.42   ? 517  ALA B CB  1 
ATOM   6697  N  N   . ALA B  1 411 ? 4.323   -8.846  122.541 1.00 15.71  ? 518  ALA B N   1 
ATOM   6698  C  CA  . ALA B  1 411 ? 4.165   -9.071  121.105 1.00 16.71  ? 518  ALA B CA  1 
ATOM   6699  C  C   . ALA B  1 411 ? 3.587   -7.849  120.397 1.00 16.68  ? 518  ALA B C   1 
ATOM   6700  O  O   . ALA B  1 411 ? 2.714   -7.164  120.939 1.00 15.99  ? 518  ALA B O   1 
ATOM   6701  C  CB  . ALA B  1 411 ? 3.270   -10.290 120.859 1.00 16.55  ? 518  ALA B CB  1 
ATOM   6702  N  N   . ARG B  1 412 ? 4.104   -7.580  119.199 1.00 16.46  ? 519  ARG B N   1 
ATOM   6703  C  CA  . ARG B  1 412 ? 3.636   -6.483  118.363 1.00 16.90  ? 519  ARG B CA  1 
ATOM   6704  C  C   . ARG B  1 412 ? 3.228   -7.124  117.033 1.00 17.86  ? 519  ARG B C   1 
ATOM   6705  O  O   . ARG B  1 412 ? 4.057   -7.307  116.134 1.00 17.33  ? 519  ARG B O   1 
ATOM   6706  C  CB  . ARG B  1 412 ? 4.749   -5.474  118.121 1.00 16.24  ? 519  ARG B CB  1 
ATOM   6707  C  CG  . ARG B  1 412 ? 5.208   -4.731  119.355 1.00 16.17  ? 519  ARG B CG  1 
ATOM   6708  C  CD  . ARG B  1 412 ? 6.593   -4.173  119.081 1.00 16.02  ? 519  ARG B CD  1 
ATOM   6709  N  NE  . ARG B  1 412 ? 6.585   -2.824  118.539 1.00 12.74  ? 519  ARG B NE  1 
ATOM   6710  C  CZ  . ARG B  1 412 ? 7.545   -2.331  117.767 1.00 13.81  ? 519  ARG B CZ  1 
ATOM   6711  N  NH1 . ARG B  1 412 ? 7.472   -1.082  117.339 1.00 15.34  ? 519  ARG B NH1 1 
ATOM   6712  N  NH2 . ARG B  1 412 ? 8.556   -3.094  117.387 1.00 11.97  ? 519  ARG B NH2 1 
ATOM   6713  N  N   . PRO B  1 413 ? 1.940   -7.472  116.895 1.00 17.65  ? 520  PRO B N   1 
ATOM   6714  C  CA  . PRO B  1 413 ? 1.414   -8.100  115.686 1.00 17.92  ? 520  PRO B CA  1 
ATOM   6715  C  C   . PRO B  1 413 ? 1.713   -7.420  114.356 1.00 18.17  ? 520  PRO B C   1 
ATOM   6716  O  O   . PRO B  1 413 ? 1.731   -8.090  113.327 1.00 19.58  ? 520  PRO B O   1 
ATOM   6717  C  CB  . PRO B  1 413 ? -0.077  -8.231  115.985 1.00 17.57  ? 520  PRO B CB  1 
ATOM   6718  C  CG  . PRO B  1 413 ? -0.340  -7.152  116.976 1.00 18.27  ? 520  PRO B CG  1 
ATOM   6719  C  CD  . PRO B  1 413 ? 0.864   -7.233  117.868 1.00 18.22  ? 520  PRO B CD  1 
ATOM   6720  N  N   . HIS B  1 414 ? 1.971   -6.117  114.358 1.00 17.68  ? 521  HIS B N   1 
ATOM   6721  C  CA  . HIS B  1 414 ? 2.273   -5.423  113.105 1.00 18.07  ? 521  HIS B CA  1 
ATOM   6722  C  C   . HIS B  1 414 ? 3.755   -5.352  112.782 1.00 17.76  ? 521  HIS B C   1 
ATOM   6723  O  O   . HIS B  1 414 ? 4.143   -4.845  111.729 1.00 17.92  ? 521  HIS B O   1 
ATOM   6724  C  CB  . HIS B  1 414 ? 1.714   -4.011  113.140 1.00 18.62  ? 521  HIS B CB  1 
ATOM   6725  C  CG  . HIS B  1 414 ? 0.240   -3.970  113.350 1.00 20.71  ? 521  HIS B CG  1 
ATOM   6726  N  ND1 . HIS B  1 414 ? -0.653  -4.378  112.386 1.00 21.74  ? 521  HIS B ND1 1 
ATOM   6727  C  CD2 . HIS B  1 414 ? -0.497  -3.623  114.432 1.00 20.95  ? 521  HIS B CD2 1 
ATOM   6728  C  CE1 . HIS B  1 414 ? -1.882  -4.286  112.866 1.00 22.67  ? 521  HIS B CE1 1 
ATOM   6729  N  NE2 . HIS B  1 414 ? -1.814  -3.831  114.106 1.00 22.82  ? 521  HIS B NE2 1 
ATOM   6730  N  N   . ASP B  1 415 ? 4.587   -5.862  113.680 1.00 16.93  ? 522  ASP B N   1 
ATOM   6731  C  CA  . ASP B  1 415 ? 6.024   -5.805  113.461 1.00 17.22  ? 522  ASP B CA  1 
ATOM   6732  C  C   . ASP B  1 415 ? 6.519   -7.065  112.762 1.00 17.12  ? 522  ASP B C   1 
ATOM   6733  O  O   . ASP B  1 415 ? 6.647   -8.121  113.376 1.00 16.06  ? 522  ASP B O   1 
ATOM   6734  C  CB  . ASP B  1 415 ? 6.735   -5.611  114.803 1.00 16.50  ? 522  ASP B CB  1 
ATOM   6735  C  CG  . ASP B  1 415 ? 8.223   -5.437  114.657 1.00 16.51  ? 522  ASP B CG  1 
ATOM   6736  O  OD1 . ASP B  1 415 ? 8.934   -5.524  115.688 1.00 17.94  ? 522  ASP B OD1 1 
ATOM   6737  O  OD2 . ASP B  1 415 ? 8.683   -5.210  113.514 1.00 17.17  ? 522  ASP B OD2 1 
ATOM   6738  N  N   . TYR B  1 416 ? 6.804   -6.955  111.471 1.00 18.74  ? 523  TYR B N   1 
ATOM   6739  C  CA  . TYR B  1 416 ? 7.276   -8.112  110.722 1.00 19.34  ? 523  TYR B CA  1 
ATOM   6740  C  C   . TYR B  1 416 ? 8.752   -8.034  110.420 1.00 18.09  ? 523  TYR B C   1 
ATOM   6741  O  O   . TYR B  1 416 ? 9.291   -8.867  109.699 1.00 18.43  ? 523  TYR B O   1 
ATOM   6742  C  CB  . TYR B  1 416 ? 6.511   -8.245  109.420 1.00 20.63  ? 523  TYR B CB  1 
ATOM   6743  C  CG  . TYR B  1 416 ? 5.026   -8.196  109.609 1.00 25.10  ? 523  TYR B CG  1 
ATOM   6744  C  CD1 . TYR B  1 416 ? 4.302   -7.073  109.226 1.00 27.59  ? 523  TYR B CD1 1 
ATOM   6745  C  CD2 . TYR B  1 416 ? 4.333   -9.278  110.170 1.00 28.84  ? 523  TYR B CD2 1 
ATOM   6746  C  CE1 . TYR B  1 416 ? 2.919   -7.018  109.389 1.00 31.51  ? 523  TYR B CE1 1 
ATOM   6747  C  CE2 . TYR B  1 416 ? 2.943   -9.235  110.344 1.00 30.60  ? 523  TYR B CE2 1 
ATOM   6748  C  CZ  . TYR B  1 416 ? 2.247   -8.098  109.947 1.00 32.15  ? 523  TYR B CZ  1 
ATOM   6749  O  OH  . TYR B  1 416 ? 0.878   -8.016  110.104 1.00 36.19  ? 523  TYR B OH  1 
ATOM   6750  N  N   . SER B  1 417 ? 9.411   -7.033  110.979 1.00 17.49  ? 524  SER B N   1 
ATOM   6751  C  CA  . SER B  1 417 ? 10.828  -6.867  110.739 1.00 16.96  ? 524  SER B CA  1 
ATOM   6752  C  C   . SER B  1 417 ? 11.630  -8.149  110.951 1.00 17.15  ? 524  SER B C   1 
ATOM   6753  O  O   . SER B  1 417 ? 11.282  -8.999  111.782 1.00 15.30  ? 524  SER B O   1 
ATOM   6754  C  CB  . SER B  1 417 ? 11.387  -5.779  111.643 1.00 15.75  ? 524  SER B CB  1 
ATOM   6755  O  OG  . SER B  1 417 ? 12.774  -5.640  111.397 1.00 18.42  ? 524  SER B OG  1 
ATOM   6756  N  N   . ALA B  1 418 ? 12.710  -8.278  110.190 1.00 17.00  ? 525  ALA B N   1 
ATOM   6757  C  CA  . ALA B  1 418 ? 13.603  -9.419  110.301 1.00 16.44  ? 525  ALA B CA  1 
ATOM   6758  C  C   . ALA B  1 418 ? 14.967  -8.880  110.741 1.00 18.23  ? 525  ALA B C   1 
ATOM   6759  O  O   . ALA B  1 418 ? 15.973  -9.582  110.671 1.00 17.91  ? 525  ALA B O   1 
ATOM   6760  C  CB  . ALA B  1 418 ? 13.727  -10.103 108.963 1.00 15.76  ? 525  ALA B CB  1 
ATOM   6761  N  N   . ASP B  1 419 ? 14.988  -7.630  111.199 1.00 18.80  ? 526  ASP B N   1 
ATOM   6762  C  CA  . ASP B  1 419 ? 16.222  -6.988  111.614 1.00 19.90  ? 526  ASP B CA  1 
ATOM   6763  C  C   . ASP B  1 419 ? 16.641  -7.233  113.056 1.00 19.09  ? 526  ASP B C   1 
ATOM   6764  O  O   . ASP B  1 419 ? 17.781  -6.954  113.423 1.00 20.49  ? 526  ASP B O   1 
ATOM   6765  C  CB  . ASP B  1 419 ? 16.114  -5.492  111.344 1.00 23.65  ? 526  ASP B CB  1 
ATOM   6766  C  CG  . ASP B  1 419 ? 15.966  -5.181  109.861 1.00 26.87  ? 526  ASP B CG  1 
ATOM   6767  O  OD1 . ASP B  1 419 ? 15.524  -4.055  109.534 1.00 29.28  ? 526  ASP B OD1 1 
ATOM   6768  O  OD2 . ASP B  1 419 ? 16.299  -6.060  109.027 1.00 27.21  ? 526  ASP B OD2 1 
ATOM   6769  N  N   . GLY B  1 420 ? 15.731  -7.758  113.868 1.00 17.90  ? 527  GLY B N   1 
ATOM   6770  C  CA  . GLY B  1 420 ? 16.048  -8.020  115.259 1.00 15.87  ? 527  GLY B CA  1 
ATOM   6771  C  C   . GLY B  1 420 ? 16.359  -6.773  116.075 1.00 15.46  ? 527  GLY B C   1 
ATOM   6772  O  O   . GLY B  1 420 ? 15.780  -5.705  115.859 1.00 14.91  ? 527  GLY B O   1 
ATOM   6773  N  N   . PHE B  1 421 ? 17.275  -6.919  117.029 1.00 14.53  ? 528  PHE B N   1 
ATOM   6774  C  CA  . PHE B  1 421 ? 17.681  -5.821  117.884 1.00 13.45  ? 528  PHE B CA  1 
ATOM   6775  C  C   . PHE B  1 421 ? 19.191  -5.743  117.943 1.00 14.87  ? 528  PHE B C   1 
ATOM   6776  O  O   . PHE B  1 421 ? 19.861  -6.765  117.991 1.00 16.05  ? 528  PHE B O   1 
ATOM   6777  C  CB  . PHE B  1 421 ? 17.156  -6.021  119.298 1.00 11.00  ? 528  PHE B CB  1 
ATOM   6778  C  CG  . PHE B  1 421 ? 15.677  -5.926  119.410 1.00 7.19   ? 528  PHE B CG  1 
ATOM   6779  C  CD1 . PHE B  1 421 ? 14.910  -7.066  119.558 1.00 6.22   ? 528  PHE B CD1 1 
ATOM   6780  C  CD2 . PHE B  1 421 ? 15.044  -4.691  119.360 1.00 5.81   ? 528  PHE B CD2 1 
ATOM   6781  C  CE1 . PHE B  1 421 ? 13.526  -6.985  119.653 1.00 5.15   ? 528  PHE B CE1 1 
ATOM   6782  C  CE2 . PHE B  1 421 ? 13.658  -4.603  119.454 1.00 6.36   ? 528  PHE B CE2 1 
ATOM   6783  C  CZ  . PHE B  1 421 ? 12.897  -5.753  119.599 1.00 3.65   ? 528  PHE B CZ  1 
ATOM   6784  N  N   . ASN B  1 422 ? 19.731  -4.533  117.937 1.00 17.04  ? 529  ASN B N   1 
ATOM   6785  C  CA  . ASN B  1 422 ? 21.171  -4.381  118.023 1.00 19.91  ? 529  ASN B CA  1 
ATOM   6786  C  C   . ASN B  1 422 ? 21.541  -3.502  119.186 1.00 18.72  ? 529  ASN B C   1 
ATOM   6787  O  O   . ASN B  1 422 ? 21.436  -2.280  119.126 1.00 19.49  ? 529  ASN B O   1 
ATOM   6788  C  CB  . ASN B  1 422 ? 21.733  -3.861  116.707 1.00 24.78  ? 529  ASN B CB  1 
ATOM   6789  C  CG  . ASN B  1 422 ? 21.642  -4.915  115.622 1.00 31.66  ? 529  ASN B CG  1 
ATOM   6790  O  OD1 . ASN B  1 422 ? 20.543  -5.220  115.116 1.00 33.58  ? 529  ASN B OD1 1 
ATOM   6791  N  ND2 . ASN B  1 422 ? 22.788  -5.521  115.286 1.00 34.11  ? 529  ASN B ND2 1 
ATOM   6792  N  N   . ASP B  1 423 ? 21.953  -4.163  120.261 1.00 17.00  ? 530  ASP B N   1 
ATOM   6793  C  CA  . ASP B  1 423 ? 22.327  -3.486  121.485 1.00 16.03  ? 530  ASP B CA  1 
ATOM   6794  C  C   . ASP B  1 423 ? 21.201  -2.558  121.912 1.00 14.71  ? 530  ASP B C   1 
ATOM   6795  O  O   . ASP B  1 423 ? 21.437  -1.407  122.281 1.00 15.14  ? 530  ASP B O   1 
ATOM   6796  C  CB  . ASP B  1 423 ? 23.607  -2.668  121.303 1.00 16.71  ? 530  ASP B CB  1 
ATOM   6797  C  CG  . ASP B  1 423 ? 24.216  -2.255  122.625 1.00 18.78  ? 530  ASP B CG  1 
ATOM   6798  O  OD1 . ASP B  1 423 ? 24.998  -1.283  122.657 1.00 19.43  ? 530  ASP B OD1 1 
ATOM   6799  O  OD2 . ASP B  1 423 ? 23.917  -2.920  123.644 1.00 21.83  ? 530  ASP B OD2 1 
ATOM   6800  N  N   . TRP B  1 424 ? 19.970  -3.050  121.848 1.00 12.71  ? 531  TRP B N   1 
ATOM   6801  C  CA  . TRP B  1 424 ? 18.841  -2.236  122.264 1.00 11.85  ? 531  TRP B CA  1 
ATOM   6802  C  C   . TRP B  1 424 ? 18.725  -2.380  123.774 1.00 12.01  ? 531  TRP B C   1 
ATOM   6803  O  O   . TRP B  1 424 ? 18.682  -3.492  124.298 1.00 12.20  ? 531  TRP B O   1 
ATOM   6804  C  CB  . TRP B  1 424 ? 17.552  -2.688  121.573 1.00 10.27  ? 531  TRP B CB  1 
ATOM   6805  C  CG  . TRP B  1 424 ? 16.418  -1.766  121.844 1.00 9.18   ? 531  TRP B CG  1 
ATOM   6806  C  CD1 . TRP B  1 424 ? 15.378  -1.974  122.706 1.00 8.99   ? 531  TRP B CD1 1 
ATOM   6807  C  CD2 . TRP B  1 424 ? 16.253  -0.436  121.327 1.00 6.65   ? 531  TRP B CD2 1 
ATOM   6808  N  NE1 . TRP B  1 424 ? 14.580  -0.851  122.760 1.00 8.66   ? 531  TRP B NE1 1 
ATOM   6809  C  CE2 . TRP B  1 424 ? 15.098  0.106   121.925 1.00 7.37   ? 531  TRP B CE2 1 
ATOM   6810  C  CE3 . TRP B  1 424 ? 16.973  0.349   120.418 1.00 9.13   ? 531  TRP B CE3 1 
ATOM   6811  C  CZ2 . TRP B  1 424 ? 14.647  1.404   121.646 1.00 7.37   ? 531  TRP B CZ2 1 
ATOM   6812  C  CZ3 . TRP B  1 424 ? 16.521  1.648   120.137 1.00 6.96   ? 531  TRP B CZ3 1 
ATOM   6813  C  CH2 . TRP B  1 424 ? 15.374  2.157   120.753 1.00 6.63   ? 531  TRP B CH2 1 
ATOM   6814  N  N   . ALA B  1 425 ? 18.688  -1.249  124.470 1.00 12.25  ? 532  ALA B N   1 
ATOM   6815  C  CA  . ALA B  1 425 ? 18.620  -1.253  125.920 1.00 12.67  ? 532  ALA B CA  1 
ATOM   6816  C  C   . ALA B  1 425 ? 17.205  -1.208  126.503 1.00 13.57  ? 532  ALA B C   1 
ATOM   6817  O  O   . ALA B  1 425 ? 16.736  -0.145  126.907 1.00 15.72  ? 532  ALA B O   1 
ATOM   6818  C  CB  . ALA B  1 425 ? 19.438  -0.093  126.445 1.00 11.84  ? 532  ALA B CB  1 
ATOM   6819  N  N   . PHE B  1 426 ? 16.523  -2.349  126.561 1.00 13.26  ? 533  PHE B N   1 
ATOM   6820  C  CA  . PHE B  1 426 ? 15.179  -2.355  127.126 1.00 12.41  ? 533  PHE B CA  1 
ATOM   6821  C  C   . PHE B  1 426 ? 15.358  -1.928  128.572 1.00 12.37  ? 533  PHE B C   1 
ATOM   6822  O  O   . PHE B  1 426 ? 16.228  -2.445  129.264 1.00 11.86  ? 533  PHE B O   1 
ATOM   6823  C  CB  . PHE B  1 426 ? 14.550  -3.749  127.051 1.00 12.62  ? 533  PHE B CB  1 
ATOM   6824  C  CG  . PHE B  1 426 ? 14.422  -4.285  125.658 1.00 11.49  ? 533  PHE B CG  1 
ATOM   6825  C  CD1 . PHE B  1 426 ? 15.469  -4.981  125.068 1.00 11.83  ? 533  PHE B CD1 1 
ATOM   6826  C  CD2 . PHE B  1 426 ? 13.241  -4.110  124.940 1.00 11.28  ? 533  PHE B CD2 1 
ATOM   6827  C  CE1 . PHE B  1 426 ? 15.343  -5.511  123.772 1.00 12.13  ? 533  PHE B CE1 1 
ATOM   6828  C  CE2 . PHE B  1 426 ? 13.099  -4.632  123.643 1.00 10.95  ? 533  PHE B CE2 1 
ATOM   6829  C  CZ  . PHE B  1 426 ? 14.156  -5.337  123.061 1.00 11.99  ? 533  PHE B CZ  1 
ATOM   6830  N  N   . MET B  1 427 ? 14.546  -0.981  129.030 1.00 12.13  ? 534  MET B N   1 
ATOM   6831  C  CA  . MET B  1 427 ? 14.693  -0.483  130.388 1.00 11.44  ? 534  MET B CA  1 
ATOM   6832  C  C   . MET B  1 427 ? 13.470  -0.709  131.256 1.00 11.96  ? 534  MET B C   1 
ATOM   6833  O  O   . MET B  1 427 ? 12.344  -0.547  130.796 1.00 11.78  ? 534  MET B O   1 
ATOM   6834  C  CB  . MET B  1 427 ? 15.022  1.016   130.332 1.00 11.45  ? 534  MET B CB  1 
ATOM   6835  C  CG  . MET B  1 427 ? 15.407  1.677   131.659 1.00 10.26  ? 534  MET B CG  1 
ATOM   6836  S  SD  . MET B  1 427 ? 14.017  2.280   132.661 1.00 11.39  ? 534  MET B SD  1 
ATOM   6837  C  CE  . MET B  1 427 ? 13.603  3.780   131.875 1.00 8.95   ? 534  MET B CE  1 
ATOM   6838  N  N   . THR B  1 428 ? 13.694  -1.094  132.512 1.00 11.92  ? 535  THR B N   1 
ATOM   6839  C  CA  . THR B  1 428 ? 12.589  -1.278  133.451 1.00 10.72  ? 535  THR B CA  1 
ATOM   6840  C  C   . THR B  1 428 ? 12.773  -0.448  134.730 1.00 11.32  ? 535  THR B C   1 
ATOM   6841  O  O   . THR B  1 428 ? 13.877  -0.343  135.273 1.00 9.61   ? 535  THR B O   1 
ATOM   6842  C  CB  . THR B  1 428 ? 12.404  -2.749  133.858 1.00 9.92   ? 535  THR B CB  1 
ATOM   6843  O  OG1 . THR B  1 428 ? 11.340  -2.838  134.817 1.00 9.77   ? 535  THR B OG1 1 
ATOM   6844  C  CG2 . THR B  1 428 ? 13.676  -3.319  134.452 1.00 8.92   ? 535  THR B CG2 1 
ATOM   6845  N  N   . THR B  1 429 ? 11.681  0.152   135.192 1.00 11.28  ? 536  THR B N   1 
ATOM   6846  C  CA  . THR B  1 429 ? 11.693  0.948   136.408 1.00 11.79  ? 536  THR B CA  1 
ATOM   6847  C  C   . THR B  1 429 ? 11.022  0.159   137.525 1.00 12.14  ? 536  THR B C   1 
ATOM   6848  O  O   . THR B  1 429 ? 10.973  0.598   138.671 1.00 12.37  ? 536  THR B O   1 
ATOM   6849  C  CB  . THR B  1 429 ? 10.913  2.267   136.227 1.00 12.51  ? 536  THR B CB  1 
ATOM   6850  O  OG1 . THR B  1 429 ? 9.555   1.978   135.878 1.00 11.95  ? 536  THR B OG1 1 
ATOM   6851  C  CG2 . THR B  1 429 ? 11.548  3.123   135.135 1.00 12.14  ? 536  THR B CG2 1 
ATOM   6852  N  N   . HIS B  1 430 ? 10.525  -1.023  137.184 1.00 11.65  ? 537  HIS B N   1 
ATOM   6853  C  CA  . HIS B  1 430 ? 9.808   -1.855  138.133 1.00 11.94  ? 537  HIS B CA  1 
ATOM   6854  C  C   . HIS B  1 430 ? 10.591  -2.452  139.295 1.00 12.58  ? 537  HIS B C   1 
ATOM   6855  O  O   . HIS B  1 430 ? 9.989   -2.896  140.274 1.00 11.85  ? 537  HIS B O   1 
ATOM   6856  C  CB  . HIS B  1 430 ? 9.070   -2.963  137.383 1.00 12.27  ? 537  HIS B CB  1 
ATOM   6857  C  CG  . HIS B  1 430 ? 8.012   -2.456  136.456 1.00 10.69  ? 537  HIS B CG  1 
ATOM   6858  N  ND1 . HIS B  1 430 ? 6.888   -3.188  136.138 1.00 9.84   ? 537  HIS B ND1 1 
ATOM   6859  C  CD2 . HIS B  1 430 ? 7.898   -1.282  135.788 1.00 12.00  ? 537  HIS B CD2 1 
ATOM   6860  C  CE1 . HIS B  1 430 ? 6.126   -2.484  135.319 1.00 11.53  ? 537  HIS B CE1 1 
ATOM   6861  N  NE2 . HIS B  1 430 ? 6.717   -1.324  135.089 1.00 11.24  ? 537  HIS B NE2 1 
ATOM   6862  N  N   . SER B  1 431 ? 11.917  -2.464  139.208 1.00 12.47  ? 538  SER B N   1 
ATOM   6863  C  CA  . SER B  1 431 ? 12.716  -3.006  140.301 1.00 12.53  ? 538  SER B CA  1 
ATOM   6864  C  C   . SER B  1 431 ? 13.386  -1.911  141.109 1.00 12.75  ? 538  SER B C   1 
ATOM   6865  O  O   . SER B  1 431 ? 14.346  -2.161  141.839 1.00 13.55  ? 538  SER B O   1 
ATOM   6866  C  CB  . SER B  1 431 ? 13.772  -3.962  139.773 1.00 11.22  ? 538  SER B CB  1 
ATOM   6867  O  OG  . SER B  1 431 ? 13.199  -5.232  139.533 1.00 11.77  ? 538  SER B OG  1 
ATOM   6868  N  N   . TRP B  1 432 ? 12.870  -0.697  140.973 1.00 11.88  ? 539  TRP B N   1 
ATOM   6869  C  CA  . TRP B  1 432 ? 13.402  0.448   141.683 1.00 12.25  ? 539  TRP B CA  1 
ATOM   6870  C  C   . TRP B  1 432 ? 13.461  0.152   143.172 1.00 13.43  ? 539  TRP B C   1 
ATOM   6871  O  O   . TRP B  1 432 ? 12.475  -0.299  143.759 1.00 12.41  ? 539  TRP B O   1 
ATOM   6872  C  CB  . TRP B  1 432 ? 12.499  1.640   141.421 1.00 13.65  ? 539  TRP B CB  1 
ATOM   6873  C  CG  . TRP B  1 432 ? 13.087  2.980   141.719 1.00 15.50  ? 539  TRP B CG  1 
ATOM   6874  C  CD1 . TRP B  1 432 ? 13.116  3.619   142.933 1.00 15.42  ? 539  TRP B CD1 1 
ATOM   6875  C  CD2 . TRP B  1 432 ? 13.650  3.894   140.769 1.00 14.63  ? 539  TRP B CD2 1 
ATOM   6876  N  NE1 . TRP B  1 432 ? 13.649  4.877   142.787 1.00 14.55  ? 539  TRP B NE1 1 
ATOM   6877  C  CE2 . TRP B  1 432 ? 13.987  5.073   141.473 1.00 14.84  ? 539  TRP B CE2 1 
ATOM   6878  C  CE3 . TRP B  1 432 ? 13.901  3.833   139.390 1.00 14.25  ? 539  TRP B CE3 1 
ATOM   6879  C  CZ2 . TRP B  1 432 ? 14.567  6.191   140.841 1.00 16.58  ? 539  TRP B CZ2 1 
ATOM   6880  C  CZ3 . TRP B  1 432 ? 14.481  4.949   138.758 1.00 15.58  ? 539  TRP B CZ3 1 
ATOM   6881  C  CH2 . TRP B  1 432 ? 14.803  6.110   139.489 1.00 14.59  ? 539  TRP B CH2 1 
ATOM   6882  N  N   . ASP B  1 433 ? 14.628  0.402   143.768 1.00 14.08  ? 540  ASP B N   1 
ATOM   6883  C  CA  . ASP B  1 433 ? 14.868  0.203   145.196 1.00 14.77  ? 540  ASP B CA  1 
ATOM   6884  C  C   . ASP B  1 433 ? 15.094  -1.233  145.632 1.00 16.04  ? 540  ASP B C   1 
ATOM   6885  O  O   . ASP B  1 433 ? 15.321  -1.485  146.815 1.00 17.58  ? 540  ASP B O   1 
ATOM   6886  C  CB  . ASP B  1 433 ? 13.734  0.810   146.033 1.00 15.24  ? 540  ASP B CB  1 
ATOM   6887  C  CG  . ASP B  1 433 ? 13.946  2.295   146.328 1.00 17.00  ? 540  ASP B CG  1 
ATOM   6888  O  OD1 . ASP B  1 433 ? 12.955  3.047   146.381 1.00 17.69  ? 540  ASP B OD1 1 
ATOM   6889  O  OD2 . ASP B  1 433 ? 15.106  2.718   146.526 1.00 19.05  ? 540  ASP B OD2 1 
ATOM   6890  N  N   . GLU B  1 434 ? 15.046  -2.182  144.704 1.00 15.81  ? 541  GLU B N   1 
ATOM   6891  C  CA  . GLU B  1 434 ? 15.273  -3.568  145.094 1.00 16.45  ? 541  GLU B CA  1 
ATOM   6892  C  C   . GLU B  1 434 ? 16.761  -3.828  145.140 1.00 17.39  ? 541  GLU B C   1 
ATOM   6893  O  O   . GLU B  1 434 ? 17.547  -3.095  144.545 1.00 19.46  ? 541  GLU B O   1 
ATOM   6894  C  CB  . GLU B  1 434 ? 14.661  -4.559  144.095 1.00 16.64  ? 541  GLU B CB  1 
ATOM   6895  C  CG  . GLU B  1 434 ? 13.198  -4.367  143.750 1.00 16.31  ? 541  GLU B CG  1 
ATOM   6896  C  CD  . GLU B  1 434 ? 12.657  -5.513  142.910 1.00 16.71  ? 541  GLU B CD  1 
ATOM   6897  O  OE1 . GLU B  1 434 ? 13.437  -6.152  142.164 1.00 15.80  ? 541  GLU B OE1 1 
ATOM   6898  O  OE2 . GLU B  1 434 ? 11.442  -5.768  142.992 1.00 16.42  ? 541  GLU B OE2 1 
ATOM   6899  N  N   . ASP B  1 435 ? 17.147  -4.882  145.842 1.00 18.06  ? 542  ASP B N   1 
ATOM   6900  C  CA  . ASP B  1 435 ? 18.542  -5.256  145.914 1.00 18.62  ? 542  ASP B CA  1 
ATOM   6901  C  C   . ASP B  1 435 ? 18.765  -6.154  144.692 1.00 19.76  ? 542  ASP B C   1 
ATOM   6902  O  O   . ASP B  1 435 ? 18.113  -7.187  144.542 1.00 20.59  ? 542  ASP B O   1 
ATOM   6903  C  CB  . ASP B  1 435 ? 18.813  -6.013  147.211 1.00 18.67  ? 542  ASP B CB  1 
ATOM   6904  C  CG  . ASP B  1 435 ? 20.242  -6.476  147.322 1.00 20.63  ? 542  ASP B CG  1 
ATOM   6905  O  OD1 . ASP B  1 435 ? 20.639  -6.913  148.423 1.00 25.52  ? 542  ASP B OD1 1 
ATOM   6906  O  OD2 . ASP B  1 435 ? 20.976  -6.414  146.313 1.00 20.84  ? 542  ASP B OD2 1 
ATOM   6907  N  N   . PRO B  1 436 ? 19.694  -5.770  143.804 1.00 19.20  ? 543  PRO B N   1 
ATOM   6908  C  CA  . PRO B  1 436 ? 19.993  -6.540  142.589 1.00 18.05  ? 543  PRO B CA  1 
ATOM   6909  C  C   . PRO B  1 436 ? 20.793  -7.822  142.773 1.00 18.76  ? 543  PRO B C   1 
ATOM   6910  O  O   . PRO B  1 436 ? 20.916  -8.602  141.836 1.00 19.65  ? 543  PRO B O   1 
ATOM   6911  C  CB  . PRO B  1 436 ? 20.748  -5.536  141.737 1.00 17.86  ? 543  PRO B CB  1 
ATOM   6912  C  CG  . PRO B  1 436 ? 21.570  -4.817  142.775 1.00 17.97  ? 543  PRO B CG  1 
ATOM   6913  C  CD  . PRO B  1 436 ? 20.551  -4.574  143.893 1.00 17.80  ? 543  PRO B CD  1 
ATOM   6914  N  N   . ALA B  1 437 ? 21.349  -8.045  143.959 1.00 18.57  ? 544  ALA B N   1 
ATOM   6915  C  CA  . ALA B  1 437 ? 22.149  -9.246  144.184 1.00 18.55  ? 544  ALA B CA  1 
ATOM   6916  C  C   . ALA B  1 437 ? 21.288  -10.495 144.124 1.00 18.91  ? 544  ALA B C   1 
ATOM   6917  O  O   . ALA B  1 437 ? 20.252  -10.573 144.784 1.00 19.94  ? 544  ALA B O   1 
ATOM   6918  C  CB  . ALA B  1 437 ? 22.852  -9.162  145.523 1.00 16.94  ? 544  ALA B CB  1 
ATOM   6919  N  N   . GLY B  1 438 ? 21.724  -11.478 143.342 1.00 19.03  ? 545  GLY B N   1 
ATOM   6920  C  CA  . GLY B  1 438 ? 20.963  -12.707 143.219 1.00 18.72  ? 545  GLY B CA  1 
ATOM   6921  C  C   . GLY B  1 438 ? 20.892  -13.187 141.783 1.00 18.66  ? 545  GLY B C   1 
ATOM   6922  O  O   . GLY B  1 438 ? 21.661  -12.751 140.934 1.00 18.12  ? 545  GLY B O   1 
ATOM   6923  N  N   . GLU B  1 439 ? 19.954  -14.079 141.504 1.00 19.95  ? 546  GLU B N   1 
ATOM   6924  C  CA  . GLU B  1 439 ? 19.809  -14.626 140.165 1.00 18.98  ? 546  GLU B CA  1 
ATOM   6925  C  C   . GLU B  1 439 ? 18.791  -13.895 139.300 1.00 17.40  ? 546  GLU B C   1 
ATOM   6926  O  O   . GLU B  1 439 ? 17.615  -13.773 139.657 1.00 15.30  ? 546  GLU B O   1 
ATOM   6927  C  CB  . GLU B  1 439 ? 19.442  -16.103 140.243 1.00 20.33  ? 546  GLU B CB  1 
ATOM   6928  C  CG  . GLU B  1 439 ? 18.836  -16.616 138.964 1.00 26.60  ? 546  GLU B CG  1 
ATOM   6929  C  CD  . GLU B  1 439 ? 18.726  -18.119 138.925 1.00 30.03  ? 546  GLU B CD  1 
ATOM   6930  O  OE1 . GLU B  1 439 ? 19.777  -18.775 138.726 1.00 31.37  ? 546  GLU B OE1 1 
ATOM   6931  O  OE2 . GLU B  1 439 ? 17.593  -18.636 139.093 1.00 32.00  ? 546  GLU B OE2 1 
ATOM   6932  N  N   . TRP B  1 440 ? 19.261  -13.402 138.158 1.00 16.38  ? 547  TRP B N   1 
ATOM   6933  C  CA  . TRP B  1 440 ? 18.391  -12.713 137.216 1.00 15.56  ? 547  TRP B CA  1 
ATOM   6934  C  C   . TRP B  1 440 ? 18.022  -13.699 136.115 1.00 16.44  ? 547  TRP B C   1 
ATOM   6935  O  O   . TRP B  1 440 ? 18.798  -14.607 135.780 1.00 16.33  ? 547  TRP B O   1 
ATOM   6936  C  CB  . TRP B  1 440 ? 19.081  -11.503 136.604 1.00 14.10  ? 547  TRP B CB  1 
ATOM   6937  C  CG  . TRP B  1 440 ? 19.180  -10.336 137.510 1.00 12.74  ? 547  TRP B CG  1 
ATOM   6938  C  CD1 . TRP B  1 440 ? 20.063  -10.160 138.533 1.00 12.90  ? 547  TRP B CD1 1 
ATOM   6939  C  CD2 . TRP B  1 440 ? 18.378  -9.157  137.465 1.00 13.55  ? 547  TRP B CD2 1 
ATOM   6940  N  NE1 . TRP B  1 440 ? 19.866  -8.941  139.129 1.00 10.46  ? 547  TRP B NE1 1 
ATOM   6941  C  CE2 . TRP B  1 440 ? 18.833  -8.303  138.497 1.00 13.01  ? 547  TRP B CE2 1 
ATOM   6942  C  CE3 . TRP B  1 440 ? 17.311  -8.736  136.657 1.00 11.75  ? 547  TRP B CE3 1 
ATOM   6943  C  CZ2 . TRP B  1 440 ? 18.257  -7.050  138.742 1.00 11.66  ? 547  TRP B CZ2 1 
ATOM   6944  C  CZ3 . TRP B  1 440 ? 16.742  -7.499  136.900 1.00 10.88  ? 547  TRP B CZ3 1 
ATOM   6945  C  CH2 . TRP B  1 440 ? 17.214  -6.668  137.935 1.00 11.25  ? 547  TRP B CH2 1 
ATOM   6946  N  N   . VAL B  1 441 ? 16.830  -13.523 135.556 1.00 16.05  ? 548  VAL B N   1 
ATOM   6947  C  CA  . VAL B  1 441 ? 16.354  -14.411 134.516 1.00 13.89  ? 548  VAL B CA  1 
ATOM   6948  C  C   . VAL B  1 441 ? 15.788  -13.646 133.336 1.00 13.44  ? 548  VAL B C   1 
ATOM   6949  O  O   . VAL B  1 441 ? 14.942  -12.766 133.503 1.00 15.05  ? 548  VAL B O   1 
ATOM   6950  C  CB  . VAL B  1 441 ? 15.266  -15.349 135.063 1.00 14.03  ? 548  VAL B CB  1 
ATOM   6951  C  CG1 . VAL B  1 441 ? 14.756  -16.249 133.958 1.00 13.89  ? 548  VAL B CG1 1 
ATOM   6952  C  CG2 . VAL B  1 441 ? 15.826  -16.183 136.211 1.00 14.07  ? 548  VAL B CG2 1 
ATOM   6953  N  N   . LEU B  1 442 ? 16.281  -13.971 132.146 1.00 12.14  ? 549  LEU B N   1 
ATOM   6954  C  CA  . LEU B  1 442 ? 15.796  -13.364 130.921 1.00 11.18  ? 549  LEU B CA  1 
ATOM   6955  C  C   . LEU B  1 442 ? 14.973  -14.425 130.199 1.00 12.43  ? 549  LEU B C   1 
ATOM   6956  O  O   . LEU B  1 442 ? 15.413  -15.577 130.051 1.00 11.10  ? 549  LEU B O   1 
ATOM   6957  C  CB  . LEU B  1 442 ? 16.953  -12.926 130.017 1.00 11.08  ? 549  LEU B CB  1 
ATOM   6958  C  CG  . LEU B  1 442 ? 16.501  -12.297 128.679 1.00 10.63  ? 549  LEU B CG  1 
ATOM   6959  C  CD1 . LEU B  1 442 ? 15.911  -10.908 128.927 1.00 9.32   ? 549  LEU B CD1 1 
ATOM   6960  C  CD2 . LEU B  1 442 ? 17.658  -12.196 127.725 1.00 8.71   ? 549  LEU B CD2 1 
ATOM   6961  N  N   . GLU B  1 443 ? 13.775  -14.045 129.772 1.00 13.74  ? 550  GLU B N   1 
ATOM   6962  C  CA  . GLU B  1 443 ? 12.893  -14.955 129.049 1.00 15.20  ? 550  GLU B CA  1 
ATOM   6963  C  C   . GLU B  1 443 ? 12.552  -14.408 127.665 1.00 15.88  ? 550  GLU B C   1 
ATOM   6964  O  O   . GLU B  1 443 ? 12.064  -13.284 127.536 1.00 16.63  ? 550  GLU B O   1 
ATOM   6965  C  CB  . GLU B  1 443 ? 11.581  -15.170 129.807 1.00 16.49  ? 550  GLU B CB  1 
ATOM   6966  C  CG  . GLU B  1 443 ? 11.693  -15.907 131.131 1.00 19.14  ? 550  GLU B CG  1 
ATOM   6967  C  CD  . GLU B  1 443 ? 10.354  -15.946 131.880 1.00 21.52  ? 550  GLU B CD  1 
ATOM   6968  O  OE1 . GLU B  1 443 ? 10.264  -16.667 132.900 1.00 23.04  ? 550  GLU B OE1 1 
ATOM   6969  O  OE2 . GLU B  1 443 ? 9.397   -15.251 131.452 1.00 20.36  ? 550  GLU B OE2 1 
ATOM   6970  N  N   . ILE B  1 444 ? 12.821  -15.196 126.630 1.00 15.88  ? 551  ILE B N   1 
ATOM   6971  C  CA  . ILE B  1 444 ? 12.474  -14.800 125.269 1.00 16.21  ? 551  ILE B CA  1 
ATOM   6972  C  C   . ILE B  1 444 ? 11.608  -15.922 124.706 1.00 17.44  ? 551  ILE B C   1 
ATOM   6973  O  O   . ILE B  1 444 ? 12.004  -17.090 124.731 1.00 17.47  ? 551  ILE B O   1 
ATOM   6974  C  CB  . ILE B  1 444 ? 13.714  -14.636 124.373 1.00 15.10  ? 551  ILE B CB  1 
ATOM   6975  C  CG1 . ILE B  1 444 ? 14.642  -13.569 124.947 1.00 13.81  ? 551  ILE B CG1 1 
ATOM   6976  C  CG2 . ILE B  1 444 ? 13.295  -14.210 122.977 1.00 13.27  ? 551  ILE B CG2 1 
ATOM   6977  C  CD1 . ILE B  1 444 ? 15.940  -13.434 124.183 1.00 11.57  ? 551  ILE B CD1 1 
ATOM   6978  N  N   . GLU B  1 445 ? 10.421  -15.587 124.215 1.00 18.22  ? 552  GLU B N   1 
ATOM   6979  C  CA  . GLU B  1 445 ? 9.561   -16.621 123.659 1.00 18.43  ? 552  GLU B CA  1 
ATOM   6980  C  C   . GLU B  1 445 ? 8.808   -16.191 122.411 1.00 17.54  ? 552  GLU B C   1 
ATOM   6981  O  O   . GLU B  1 445 ? 8.479   -15.021 122.229 1.00 16.96  ? 552  GLU B O   1 
ATOM   6982  C  CB  . GLU B  1 445 ? 8.562   -17.110 124.707 1.00 18.15  ? 552  GLU B CB  1 
ATOM   6983  C  CG  . GLU B  1 445 ? 7.410   -16.170 124.946 1.00 21.60  ? 552  GLU B CG  1 
ATOM   6984  C  CD  . GLU B  1 445 ? 6.453   -16.683 126.015 1.00 24.35  ? 552  GLU B CD  1 
ATOM   6985  O  OE1 . GLU B  1 445 ? 6.896   -16.886 127.165 0.00 23.30  ? 552  GLU B OE1 1 
ATOM   6986  O  OE2 . GLU B  1 445 ? 5.260   -16.880 125.701 0.00 23.30  ? 552  GLU B OE2 1 
ATOM   6987  N  N   . ASN B  1 446 ? 8.556   -17.165 121.548 1.00 17.05  ? 553  ASN B N   1 
ATOM   6988  C  CA  . ASN B  1 446 ? 7.824   -16.943 120.322 1.00 16.79  ? 553  ASN B CA  1 
ATOM   6989  C  C   . ASN B  1 446 ? 6.359   -17.112 120.696 1.00 16.68  ? 553  ASN B C   1 
ATOM   6990  O  O   . ASN B  1 446 ? 5.914   -18.207 121.022 1.00 16.47  ? 553  ASN B O   1 
ATOM   6991  C  CB  . ASN B  1 446 ? 8.261   -17.967 119.282 1.00 16.67  ? 553  ASN B CB  1 
ATOM   6992  C  CG  . ASN B  1 446 ? 7.370   -17.987 118.078 1.00 17.30  ? 553  ASN B CG  1 
ATOM   6993  O  OD1 . ASN B  1 446 ? 6.627   -17.041 117.821 1.00 17.19  ? 553  ASN B OD1 1 
ATOM   6994  N  ND2 . ASN B  1 446 ? 7.441   -19.072 117.318 1.00 18.26  ? 553  ASN B ND2 1 
ATOM   6995  N  N   . THR B  1 447 ? 5.618   -16.012 120.684 1.00 17.07  ? 554  THR B N   1 
ATOM   6996  C  CA  . THR B  1 447 ? 4.209   -16.044 121.051 1.00 16.82  ? 554  THR B CA  1 
ATOM   6997  C  C   . THR B  1 447 ? 3.329   -16.560 119.929 1.00 16.70  ? 554  THR B C   1 
ATOM   6998  O  O   . THR B  1 447 ? 2.140   -16.738 120.113 1.00 16.94  ? 554  THR B O   1 
ATOM   6999  C  CB  . THR B  1 447 ? 3.712   -14.638 121.457 1.00 16.78  ? 554  THR B CB  1 
ATOM   7000  O  OG1 . THR B  1 447 ? 3.860   -13.730 120.352 1.00 16.33  ? 554  THR B OG1 1 
ATOM   7001  C  CG2 . THR B  1 447 ? 4.511   -14.122 122.649 1.00 15.07  ? 554  THR B CG2 1 
ATOM   7002  N  N   . SER B  1 448 ? 3.924   -16.812 118.772 1.00 17.85  ? 555  SER B N   1 
ATOM   7003  C  CA  . SER B  1 448 ? 3.189   -17.286 117.609 1.00 19.25  ? 555  SER B CA  1 
ATOM   7004  C  C   . SER B  1 448 ? 3.287   -18.793 117.431 1.00 21.49  ? 555  SER B C   1 
ATOM   7005  O  O   . SER B  1 448 ? 4.148   -19.445 118.030 1.00 21.02  ? 555  SER B O   1 
ATOM   7006  C  CB  . SER B  1 448 ? 3.731   -16.613 116.357 1.00 17.00  ? 555  SER B CB  1 
ATOM   7007  O  OG  . SER B  1 448 ? 3.223   -17.226 115.195 1.00 18.64  ? 555  SER B OG  1 
ATOM   7008  N  N   . GLU B  1 449 ? 2.405   -19.362 116.614 1.00 23.04  ? 556  GLU B N   1 
ATOM   7009  C  CA  . GLU B  1 449 ? 2.505   -20.790 116.384 1.00 23.85  ? 556  GLU B CA  1 
ATOM   7010  C  C   . GLU B  1 449 ? 3.381   -21.071 115.167 1.00 22.49  ? 556  GLU B C   1 
ATOM   7011  O  O   . GLU B  1 449 ? 3.676   -22.219 114.848 1.00 23.16  ? 556  GLU B O   1 
ATOM   7012  C  CB  . GLU B  1 449 ? 1.132   -21.434 116.253 1.00 27.67  ? 556  GLU B CB  1 
ATOM   7013  C  CG  . GLU B  1 449 ? 0.915   -22.499 117.325 1.00 34.36  ? 556  GLU B CG  1 
ATOM   7014  C  CD  . GLU B  1 449 ? -0.517  -22.539 117.804 1.00 38.24  ? 556  GLU B CD  1 
ATOM   7015  O  OE1 . GLU B  1 449 ? -1.014  -21.468 118.221 1.00 39.80  ? 556  GLU B OE1 1 
ATOM   7016  O  OE2 . GLU B  1 449 ? -1.144  -23.628 117.764 1.00 40.66  ? 556  GLU B OE2 1 
ATOM   7017  N  N   . ALA B  1 450 ? 3.831   -20.025 114.491 1.00 19.54  ? 557  ALA B N   1 
ATOM   7018  C  CA  . ALA B  1 450 ? 4.704   -20.243 113.357 1.00 16.63  ? 557  ALA B CA  1 
ATOM   7019  C  C   . ALA B  1 450 ? 5.989   -20.832 113.931 1.00 15.99  ? 557  ALA B C   1 
ATOM   7020  O  O   . ALA B  1 450 ? 6.279   -20.662 115.119 1.00 15.40  ? 557  ALA B O   1 
ATOM   7021  C  CB  . ALA B  1 450 ? 4.994   -18.933 112.676 1.00 14.91  ? 557  ALA B CB  1 
ATOM   7022  N  N   . ASN B  1 451 ? 6.742   -21.563 113.119 1.00 14.86  ? 558  ASN B N   1 
ATOM   7023  C  CA  . ASN B  1 451 ? 8.007   -22.078 113.599 1.00 13.89  ? 558  ASN B CA  1 
ATOM   7024  C  C   . ASN B  1 451 ? 9.029   -20.986 113.291 1.00 14.71  ? 558  ASN B C   1 
ATOM   7025  O  O   . ASN B  1 451 ? 9.679   -21.020 112.258 1.00 15.45  ? 558  ASN B O   1 
ATOM   7026  C  CB  . ASN B  1 451 ? 8.402   -23.376 112.891 1.00 13.92  ? 558  ASN B CB  1 
ATOM   7027  C  CG  . ASN B  1 451 ? 7.713   -24.599 113.473 1.00 11.42  ? 558  ASN B CG  1 
ATOM   7028  O  OD1 . ASN B  1 451 ? 7.400   -24.644 114.658 1.00 11.61  ? 558  ASN B OD1 1 
ATOM   7029  N  ND2 . ASN B  1 451 ? 7.500   -25.610 112.641 1.00 12.50  ? 558  ASN B ND2 1 
ATOM   7030  N  N   . ASN B  1 452 ? 9.128   -20.003 114.182 1.00 15.31  ? 559  ASN B N   1 
ATOM   7031  C  CA  . ASN B  1 452 ? 10.054  -18.887 114.044 1.00 14.07  ? 559  ASN B CA  1 
ATOM   7032  C  C   . ASN B  1 452 ? 11.447  -19.257 114.533 1.00 14.40  ? 559  ASN B C   1 
ATOM   7033  O  O   . ASN B  1 452 ? 11.603  -20.221 115.281 1.00 14.17  ? 559  ASN B O   1 
ATOM   7034  C  CB  . ASN B  1 452 ? 9.536   -17.686 114.822 1.00 13.99  ? 559  ASN B CB  1 
ATOM   7035  C  CG  . ASN B  1 452 ? 8.353   -17.049 114.164 1.00 12.44  ? 559  ASN B CG  1 
ATOM   7036  O  OD1 . ASN B  1 452 ? 8.267   -17.023 112.945 1.00 15.03  ? 559  ASN B OD1 1 
ATOM   7037  N  ND2 . ASN B  1 452 ? 7.437   -16.511 114.959 1.00 12.98  ? 559  ASN B ND2 1 
ATOM   7038  N  N   . TYR B  1 453 ? 12.456  -18.482 114.125 1.00 14.85  ? 560  TYR B N   1 
ATOM   7039  C  CA  . TYR B  1 453 ? 13.832  -18.796 114.506 1.00 14.36  ? 560  TYR B CA  1 
ATOM   7040  C  C   . TYR B  1 453 ? 14.737  -17.565 114.639 1.00 14.12  ? 560  TYR B C   1 
ATOM   7041  O  O   . TYR B  1 453 ? 14.495  -16.511 114.043 1.00 13.91  ? 560  TYR B O   1 
ATOM   7042  C  CB  . TYR B  1 453 ? 14.425  -19.772 113.480 1.00 12.84  ? 560  TYR B CB  1 
ATOM   7043  C  CG  . TYR B  1 453 ? 14.470  -19.197 112.080 1.00 12.69  ? 560  TYR B CG  1 
ATOM   7044  C  CD1 . TYR B  1 453 ? 15.653  -18.677 111.558 1.00 14.36  ? 560  TYR B CD1 1 
ATOM   7045  C  CD2 . TYR B  1 453 ? 13.314  -19.107 111.300 1.00 13.67  ? 560  TYR B CD2 1 
ATOM   7046  C  CE1 . TYR B  1 453 ? 15.688  -18.081 110.296 1.00 13.20  ? 560  TYR B CE1 1 
ATOM   7047  C  CE2 . TYR B  1 453 ? 13.334  -18.507 110.037 1.00 13.62  ? 560  TYR B CE2 1 
ATOM   7048  C  CZ  . TYR B  1 453 ? 14.525  -17.997 109.545 1.00 13.66  ? 560  TYR B CZ  1 
ATOM   7049  O  OH  . TYR B  1 453 ? 14.557  -17.379 108.319 1.00 13.44  ? 560  TYR B OH  1 
ATOM   7050  N  N   . GLY B  1 454 ? 15.792  -17.719 115.425 1.00 13.82  ? 561  GLY B N   1 
ATOM   7051  C  CA  . GLY B  1 454 ? 16.714  -16.624 115.635 1.00 14.69  ? 561  GLY B CA  1 
ATOM   7052  C  C   . GLY B  1 454 ? 17.749  -16.937 116.693 1.00 14.65  ? 561  GLY B C   1 
ATOM   7053  O  O   . GLY B  1 454 ? 17.717  -18.002 117.306 1.00 14.56  ? 561  GLY B O   1 
ATOM   7054  N  N   . THR B  1 455 ? 18.654  -15.993 116.930 1.00 15.92  ? 562  THR B N   1 
ATOM   7055  C  CA  . THR B  1 455 ? 19.719  -16.191 117.904 1.00 16.23  ? 562  THR B CA  1 
ATOM   7056  C  C   . THR B  1 455 ? 19.961  -14.971 118.791 1.00 16.84  ? 562  THR B C   1 
ATOM   7057  O  O   . THR B  1 455 ? 19.982  -13.837 118.305 1.00 17.86  ? 562  THR B O   1 
ATOM   7058  C  CB  . THR B  1 455 ? 21.057  -16.512 117.184 1.00 16.59  ? 562  THR B CB  1 
ATOM   7059  O  OG1 . THR B  1 455 ? 20.866  -17.592 116.264 1.00 17.99  ? 562  THR B OG1 1 
ATOM   7060  C  CG2 . THR B  1 455 ? 22.129  -16.897 118.185 1.00 15.98  ? 562  THR B CG2 1 
ATOM   7061  N  N   . LEU B  1 456 ? 20.134  -15.209 120.088 1.00 16.60  ? 563  LEU B N   1 
ATOM   7062  C  CA  . LEU B  1 456 ? 20.450  -14.141 121.035 1.00 15.86  ? 563  LEU B CA  1 
ATOM   7063  C  C   . LEU B  1 456 ? 21.975  -14.162 121.100 1.00 16.70  ? 563  LEU B C   1 
ATOM   7064  O  O   . LEU B  1 456 ? 22.560  -15.129 121.588 1.00 16.14  ? 563  LEU B O   1 
ATOM   7065  C  CB  . LEU B  1 456 ? 19.886  -14.450 122.419 1.00 15.56  ? 563  LEU B CB  1 
ATOM   7066  C  CG  . LEU B  1 456 ? 20.329  -13.484 123.517 1.00 15.44  ? 563  LEU B CG  1 
ATOM   7067  C  CD1 . LEU B  1 456 ? 19.801  -12.087 123.212 1.00 15.57  ? 563  LEU B CD1 1 
ATOM   7068  C  CD2 . LEU B  1 456 ? 19.830  -13.973 124.868 1.00 15.60  ? 563  LEU B CD2 1 
ATOM   7069  N  N   . THR B  1 457 ? 22.623  -13.111 120.607 1.00 17.05  ? 564  THR B N   1 
ATOM   7070  C  CA  . THR B  1 457 ? 24.079  -13.072 120.582 1.00 17.39  ? 564  THR B CA  1 
ATOM   7071  C  C   . THR B  1 457 ? 24.732  -12.264 121.698 1.00 18.87  ? 564  THR B C   1 
ATOM   7072  O  O   . THR B  1 457 ? 25.936  -12.411 121.952 1.00 19.61  ? 564  THR B O   1 
ATOM   7073  C  CB  . THR B  1 457 ? 24.605  -12.513 119.242 1.00 18.33  ? 564  THR B CB  1 
ATOM   7074  O  OG1 . THR B  1 457 ? 24.087  -11.193 119.042 1.00 18.56  ? 564  THR B OG1 1 
ATOM   7075  C  CG2 . THR B  1 457 ? 24.181  -13.403 118.075 1.00 17.38  ? 564  THR B CG2 1 
ATOM   7076  N  N   . LYS B  1 458 ? 23.954  -11.418 122.367 1.00 18.15  ? 565  LYS B N   1 
ATOM   7077  C  CA  . LYS B  1 458 ? 24.507  -10.614 123.442 1.00 16.68  ? 565  LYS B CA  1 
ATOM   7078  C  C   . LYS B  1 458 ? 23.437  -10.165 124.432 1.00 14.07  ? 565  LYS B C   1 
ATOM   7079  O  O   . LYS B  1 458 ? 22.338  -9.793  124.047 1.00 12.83  ? 565  LYS B O   1 
ATOM   7080  C  CB  . LYS B  1 458 ? 25.243  -9.424  122.818 1.00 18.56  ? 565  LYS B CB  1 
ATOM   7081  C  CG  . LYS B  1 458 ? 26.146  -8.654  123.765 1.00 24.20  ? 565  LYS B CG  1 
ATOM   7082  C  CD  . LYS B  1 458 ? 25.381  -7.526  124.424 1.00 28.09  ? 565  LYS B CD  1 
ATOM   7083  C  CE  . LYS B  1 458 ? 24.911  -6.503  123.375 1.00 30.57  ? 565  LYS B CE  1 
ATOM   7084  N  NZ  . LYS B  1 458 ? 23.965  -5.479  123.916 1.00 30.43  ? 565  LYS B NZ  1 
ATOM   7085  N  N   . PHE B  1 459 ? 23.764  -10.243 125.715 1.00 13.19  ? 566  PHE B N   1 
ATOM   7086  C  CA  . PHE B  1 459 ? 22.858  -9.826  126.777 1.00 12.87  ? 566  PHE B CA  1 
ATOM   7087  C  C   . PHE B  1 459 ? 23.683  -9.180  127.873 1.00 13.35  ? 566  PHE B C   1 
ATOM   7088  O  O   . PHE B  1 459 ? 24.368  -9.860  128.632 1.00 13.98  ? 566  PHE B O   1 
ATOM   7089  C  CB  . PHE B  1 459 ? 22.075  -11.025 127.331 1.00 12.08  ? 566  PHE B CB  1 
ATOM   7090  C  CG  . PHE B  1 459 ? 21.303  -10.731 128.593 1.00 11.30  ? 566  PHE B CG  1 
ATOM   7091  C  CD1 . PHE B  1 459 ? 20.887  -9.439  128.904 1.00 10.85  ? 566  PHE B CD1 1 
ATOM   7092  C  CD2 . PHE B  1 459 ? 20.972  -11.759 129.462 1.00 11.26  ? 566  PHE B CD2 1 
ATOM   7093  C  CE1 . PHE B  1 459 ? 20.163  -9.179  130.055 1.00 8.11   ? 566  PHE B CE1 1 
ATOM   7094  C  CE2 . PHE B  1 459 ? 20.247  -11.501 130.613 1.00 10.71  ? 566  PHE B CE2 1 
ATOM   7095  C  CZ  . PHE B  1 459 ? 19.842  -10.208 130.905 1.00 9.93   ? 566  PHE B CZ  1 
ATOM   7096  N  N   . THR B  1 460 ? 23.635  -7.854  127.930 1.00 13.97  ? 567  THR B N   1 
ATOM   7097  C  CA  . THR B  1 460 ? 24.368  -7.102  128.943 1.00 13.73  ? 567  THR B CA  1 
ATOM   7098  C  C   . THR B  1 460 ? 23.379  -6.475  129.901 1.00 12.41  ? 567  THR B C   1 
ATOM   7099  O  O   . THR B  1 460 ? 22.480  -5.747  129.487 1.00 12.71  ? 567  THR B O   1 
ATOM   7100  C  CB  . THR B  1 460 ? 25.188  -5.987  128.326 1.00 12.84  ? 567  THR B CB  1 
ATOM   7101  O  OG1 . THR B  1 460 ? 26.137  -6.556  127.428 1.00 16.91  ? 567  THR B OG1 1 
ATOM   7102  C  CG2 . THR B  1 460 ? 25.922  -5.220  129.394 1.00 14.01  ? 567  THR B CG2 1 
ATOM   7103  N  N   . LEU B  1 461 ? 23.530  -6.781  131.180 1.00 11.70  ? 568  LEU B N   1 
ATOM   7104  C  CA  . LEU B  1 461 ? 22.644  -6.233  132.191 1.00 12.19  ? 568  LEU B CA  1 
ATOM   7105  C  C   . LEU B  1 461 ? 23.357  -5.011  132.760 1.00 13.52  ? 568  LEU B C   1 
ATOM   7106  O  O   . LEU B  1 461 ? 24.487  -5.110  133.221 1.00 15.57  ? 568  LEU B O   1 
ATOM   7107  C  CB  . LEU B  1 461 ? 22.410  -7.267  133.288 1.00 12.07  ? 568  LEU B CB  1 
ATOM   7108  C  CG  . LEU B  1 461 ? 21.400  -6.920  134.379 1.00 13.42  ? 568  LEU B CG  1 
ATOM   7109  C  CD1 . LEU B  1 461 ? 19.993  -6.865  133.782 1.00 11.36  ? 568  LEU B CD1 1 
ATOM   7110  C  CD2 . LEU B  1 461 ? 21.483  -7.952  135.494 1.00 11.98  ? 568  LEU B CD2 1 
ATOM   7111  N  N   . VAL B  1 462 ? 22.729  -3.848  132.678 1.00 13.45  ? 569  VAL B N   1 
ATOM   7112  C  CA  . VAL B  1 462 ? 23.336  -2.649  133.219 1.00 12.96  ? 569  VAL B CA  1 
ATOM   7113  C  C   . VAL B  1 462 ? 22.450  -2.194  134.371 1.00 13.81  ? 569  VAL B C   1 
ATOM   7114  O  O   . VAL B  1 462 ? 21.268  -1.900  134.183 1.00 11.77  ? 569  VAL B O   1 
ATOM   7115  C  CB  . VAL B  1 462 ? 23.447  -1.523  132.172 1.00 11.02  ? 569  VAL B CB  1 
ATOM   7116  C  CG1 . VAL B  1 462 ? 24.066  -0.299  132.803 1.00 9.68   ? 569  VAL B CG1 1 
ATOM   7117  C  CG2 . VAL B  1 462 ? 24.289  -1.962  131.029 1.00 8.27   ? 569  VAL B CG2 1 
ATOM   7118  N  N   . LEU B  1 463 ? 23.036  -2.163  135.565 1.00 14.48  ? 570  LEU B N   1 
ATOM   7119  C  CA  . LEU B  1 463 ? 22.316  -1.766  136.764 1.00 14.81  ? 570  LEU B CA  1 
ATOM   7120  C  C   . LEU B  1 463 ? 22.732  -0.379  137.232 1.00 15.26  ? 570  LEU B C   1 
ATOM   7121  O  O   . LEU B  1 463 ? 23.920  -0.078  137.359 1.00 14.39  ? 570  LEU B O   1 
ATOM   7122  C  CB  . LEU B  1 463 ? 22.583  -2.764  137.890 1.00 13.16  ? 570  LEU B CB  1 
ATOM   7123  C  CG  . LEU B  1 463 ? 22.410  -4.249  137.575 1.00 13.21  ? 570  LEU B CG  1 
ATOM   7124  C  CD1 . LEU B  1 463 ? 22.863  -5.071  138.761 1.00 10.56  ? 570  LEU B CD1 1 
ATOM   7125  C  CD2 . LEU B  1 463 ? 20.960  -4.549  137.226 1.00 12.32  ? 570  LEU B CD2 1 
ATOM   7126  N  N   . TYR B  1 464 ? 21.741  0.466   137.481 1.00 15.88  ? 571  TYR B N   1 
ATOM   7127  C  CA  . TYR B  1 464 ? 21.995  1.813   137.989 1.00 16.01  ? 571  TYR B CA  1 
ATOM   7128  C  C   . TYR B  1 464 ? 21.437  1.845   139.407 1.00 15.13  ? 571  TYR B C   1 
ATOM   7129  O  O   . TYR B  1 464 ? 20.418  1.226   139.680 1.00 16.10  ? 571  TYR B O   1 
ATOM   7130  C  CB  . TYR B  1 464 ? 21.271  2.851   137.133 1.00 15.31  ? 571  TYR B CB  1 
ATOM   7131  C  CG  . TYR B  1 464 ? 21.936  3.123   135.811 1.00 15.19  ? 571  TYR B CG  1 
ATOM   7132  C  CD1 . TYR B  1 464 ? 22.918  4.088   135.706 1.00 15.14  ? 571  TYR B CD1 1 
ATOM   7133  C  CD2 . TYR B  1 464 ? 21.551  2.441   134.655 1.00 15.60  ? 571  TYR B CD2 1 
ATOM   7134  C  CE1 . TYR B  1 464 ? 23.507  4.395   134.483 1.00 17.52  ? 571  TYR B CE1 1 
ATOM   7135  C  CE2 . TYR B  1 464 ? 22.132  2.732   133.417 1.00 15.57  ? 571  TYR B CE2 1 
ATOM   7136  C  CZ  . TYR B  1 464 ? 23.113  3.727   133.339 1.00 18.79  ? 571  TYR B CZ  1 
ATOM   7137  O  OH  . TYR B  1 464 ? 23.667  4.112   132.129 1.00 18.58  ? 571  TYR B OH  1 
ATOM   7138  N  N   . GLY B  1 465 ? 22.095  2.552   140.314 1.00 15.79  ? 572  GLY B N   1 
ATOM   7139  C  CA  . GLY B  1 465 ? 21.581  2.622   141.674 1.00 17.16  ? 572  GLY B CA  1 
ATOM   7140  C  C   . GLY B  1 465 ? 22.566  3.156   142.692 1.00 18.22  ? 572  GLY B C   1 
ATOM   7141  O  O   . GLY B  1 465 ? 23.582  3.747   142.330 1.00 18.15  ? 572  GLY B O   1 
ATOM   7142  N  N   . THR B  1 466 ? 22.283  2.933   143.970 1.00 19.30  ? 573  THR B N   1 
ATOM   7143  C  CA  . THR B  1 466 ? 23.160  3.418   145.023 1.00 21.24  ? 573  THR B CA  1 
ATOM   7144  C  C   . THR B  1 466 ? 23.600  2.338   146.027 1.00 24.63  ? 573  THR B C   1 
ATOM   7145  O  O   . THR B  1 466 ? 23.078  1.216   146.023 1.00 24.26  ? 573  THR B O   1 
ATOM   7146  C  CB  . THR B  1 466 ? 22.480  4.564   145.742 1.00 19.82  ? 573  THR B CB  1 
ATOM   7147  O  OG1 . THR B  1 466 ? 21.253  4.102   146.313 1.00 19.60  ? 573  THR B OG1 1 
ATOM   7148  C  CG2 . THR B  1 466 ? 22.157  5.671   144.751 1.00 18.91  ? 573  THR B CG2 1 
ATOM   7149  N  N   . ALA B  1 467 ? 24.578  2.678   146.871 1.00 28.88  ? 574  ALA B N   1 
ATOM   7150  C  CA  . ALA B  1 467 ? 25.125  1.744   147.863 1.00 33.02  ? 574  ALA B CA  1 
ATOM   7151  C  C   . ALA B  1 467 ? 24.362  1.847   149.174 1.00 36.73  ? 574  ALA B C   1 
ATOM   7152  O  O   . ALA B  1 467 ? 23.940  2.942   149.562 1.00 36.02  ? 574  ALA B O   1 
ATOM   7153  C  CB  . ALA B  1 467 ? 26.613  2.022   148.090 1.00 32.55  ? 574  ALA B CB  1 
ATOM   7154  N  N   . PRO B  1 468 ? 24.224  0.709   149.896 1.00 40.83  ? 575  PRO B N   1 
ATOM   7155  C  CA  . PRO B  1 468 ? 23.525  0.515   151.182 1.00 44.21  ? 575  PRO B CA  1 
ATOM   7156  C  C   . PRO B  1 468 ? 23.318  1.735   152.093 1.00 47.43  ? 575  PRO B C   1 
ATOM   7157  O  O   . PRO B  1 468 ? 24.276  2.419   152.487 1.00 47.55  ? 575  PRO B O   1 
ATOM   7158  C  CB  . PRO B  1 468 ? 24.332  -0.608  151.864 1.00 43.22  ? 575  PRO B CB  1 
ATOM   7159  C  CG  . PRO B  1 468 ? 25.661  -0.564  151.169 0.00 42.46  ? 575  PRO B CG  1 
ATOM   7160  C  CD  . PRO B  1 468 ? 25.255  -0.332  149.746 0.00 41.43  ? 575  PRO B CD  1 
ATOM   7161  N  N   . GLU B  1 469 ? 22.046  1.988   152.415 1.00 50.30  ? 576  GLU B N   1 
ATOM   7162  C  CA  . GLU B  1 469 ? 21.638  3.106   153.273 1.00 52.57  ? 576  GLU B CA  1 
ATOM   7163  C  C   . GLU B  1 469 ? 20.115  3.202   153.322 1.00 53.77  ? 576  GLU B C   1 
ATOM   7164  O  O   . GLU B  1 469 ? 19.529  2.802   154.348 0.00 53.82  ? 576  GLU B O   1 
ATOM   7165  C  CB  . GLU B  1 469 ? 22.193  4.428   152.741 0.00 52.16  ? 576  GLU B CB  1 
ATOM   7166  C  CG  . GLU B  1 469 ? 21.796  5.634   153.580 0.00 51.98  ? 576  GLU B CG  1 
ATOM   7167  C  CD  . GLU B  1 469 ? 21.599  6.885   152.747 0.00 51.80  ? 576  GLU B CD  1 
ATOM   7168  O  OE1 . GLU B  1 469 ? 20.692  6.887   151.889 0.00 51.67  ? 576  GLU B OE1 1 
ATOM   7169  O  OE2 . GLU B  1 469 ? 22.347  7.864   152.951 0.00 51.67  ? 576  GLU B OE2 1 
ATOM   7170  N  N   . VAL C  1 2   ? -19.258 -40.142 73.661  1.00 44.95  ? 109  VAL C N   1 
ATOM   7171  C  CA  . VAL C  1 2   ? -18.734 -38.764 73.921  1.00 44.86  ? 109  VAL C CA  1 
ATOM   7172  C  C   . VAL C  1 2   ? -17.989 -38.722 75.265  1.00 44.42  ? 109  VAL C C   1 
ATOM   7173  O  O   . VAL C  1 2   ? -18.063 -39.668 76.057  1.00 45.33  ? 109  VAL C O   1 
ATOM   7174  C  CB  . VAL C  1 2   ? -19.894 -37.731 73.939  1.00 44.19  ? 109  VAL C CB  1 
ATOM   7175  C  CG1 . VAL C  1 2   ? -19.340 -36.319 74.032  0.00 44.56  ? 109  VAL C CG1 1 
ATOM   7176  C  CG2 . VAL C  1 2   ? -20.747 -37.889 72.691  0.00 44.56  ? 109  VAL C CG2 1 
ATOM   7177  N  N   . TYR C  1 3   ? -17.259 -37.636 75.509  1.00 43.22  ? 110  TYR C N   1 
ATOM   7178  C  CA  . TYR C  1 3   ? -16.512 -37.462 76.762  1.00 41.19  ? 110  TYR C CA  1 
ATOM   7179  C  C   . TYR C  1 3   ? -17.465 -37.027 77.878  1.00 40.36  ? 110  TYR C C   1 
ATOM   7180  O  O   . TYR C  1 3   ? -18.380 -36.221 77.641  1.00 39.86  ? 110  TYR C O   1 
ATOM   7181  C  CB  . TYR C  1 3   ? -15.425 -36.391 76.585  1.00 39.93  ? 110  TYR C CB  1 
ATOM   7182  C  CG  . TYR C  1 3   ? -14.819 -35.930 77.887  1.00 37.30  ? 110  TYR C CG  1 
ATOM   7183  C  CD1 . TYR C  1 3   ? -13.997 -36.773 78.629  1.00 36.28  ? 110  TYR C CD1 1 
ATOM   7184  C  CD2 . TYR C  1 3   ? -15.128 -34.677 78.415  1.00 36.30  ? 110  TYR C CD2 1 
ATOM   7185  C  CE1 . TYR C  1 3   ? -13.505 -36.386 79.863  1.00 35.45  ? 110  TYR C CE1 1 
ATOM   7186  C  CE2 . TYR C  1 3   ? -14.643 -34.280 79.653  1.00 34.84  ? 110  TYR C CE2 1 
ATOM   7187  C  CZ  . TYR C  1 3   ? -13.834 -35.141 80.368  1.00 35.62  ? 110  TYR C CZ  1 
ATOM   7188  O  OH  . TYR C  1 3   ? -13.364 -34.769 81.603  1.00 37.11  ? 110  TYR C OH  1 
ATOM   7189  N  N   . GLN C  1 4   ? -17.260 -37.555 79.085  1.00 38.88  ? 111  GLN C N   1 
ATOM   7190  C  CA  . GLN C  1 4   ? -18.115 -37.184 80.216  1.00 37.75  ? 111  GLN C CA  1 
ATOM   7191  C  C   . GLN C  1 4   ? -17.354 -36.301 81.211  1.00 36.44  ? 111  GLN C C   1 
ATOM   7192  O  O   . GLN C  1 4   ? -16.297 -36.683 81.704  1.00 37.02  ? 111  GLN C O   1 
ATOM   7193  C  CB  . GLN C  1 4   ? -18.642 -38.436 80.921  1.00 36.69  ? 111  GLN C CB  1 
ATOM   7194  C  CG  . GLN C  1 4   ? -19.561 -38.147 82.095  0.00 36.89  ? 111  GLN C CG  1 
ATOM   7195  C  CD  . GLN C  1 4   ? -20.073 -39.408 82.761  0.00 36.72  ? 111  GLN C CD  1 
ATOM   7196  O  OE1 . GLN C  1 4   ? -20.842 -39.348 83.720  0.00 36.66  ? 111  GLN C OE1 1 
ATOM   7197  N  NE2 . GLN C  1 4   ? -19.648 -40.561 82.256  0.00 36.66  ? 111  GLN C NE2 1 
ATOM   7198  N  N   . GLU C  1 5   ? -17.888 -35.116 81.494  1.00 35.70  ? 112  GLU C N   1 
ATOM   7199  C  CA  . GLU C  1 5   ? -17.245 -34.200 82.431  1.00 34.99  ? 112  GLU C CA  1 
ATOM   7200  C  C   . GLU C  1 5   ? -17.410 -34.714 83.866  1.00 33.41  ? 112  GLU C C   1 
ATOM   7201  O  O   . GLU C  1 5   ? -18.306 -35.516 84.145  1.00 34.00  ? 112  GLU C O   1 
ATOM   7202  C  CB  . GLU C  1 5   ? -17.845 -32.796 82.299  1.00 35.36  ? 112  GLU C CB  1 
ATOM   7203  C  CG  . GLU C  1 5   ? -19.215 -32.628 82.925  1.00 38.68  ? 112  GLU C CG  1 
ATOM   7204  C  CD  . GLU C  1 5   ? -19.748 -31.203 82.796  1.00 41.09  ? 112  GLU C CD  1 
ATOM   7205  O  OE1 . GLU C  1 5   ? -20.823 -30.917 83.365  1.00 42.85  ? 112  GLU C OE1 1 
ATOM   7206  O  OE2 . GLU C  1 5   ? -19.096 -30.368 82.127  1.00 42.82  ? 112  GLU C OE2 1 
ATOM   7207  N  N   . PRO C  1 6   ? -16.538 -34.269 84.791  1.00 31.19  ? 113  PRO C N   1 
ATOM   7208  C  CA  . PRO C  1 6   ? -16.575 -34.676 86.199  1.00 28.71  ? 113  PRO C CA  1 
ATOM   7209  C  C   . PRO C  1 6   ? -17.943 -34.523 86.838  1.00 27.75  ? 113  PRO C C   1 
ATOM   7210  O  O   . PRO C  1 6   ? -18.696 -33.594 86.533  1.00 26.59  ? 113  PRO C O   1 
ATOM   7211  C  CB  . PRO C  1 6   ? -15.534 -33.776 86.840  1.00 29.41  ? 113  PRO C CB  1 
ATOM   7212  C  CG  . PRO C  1 6   ? -14.513 -33.648 85.751  1.00 29.72  ? 113  PRO C CG  1 
ATOM   7213  C  CD  . PRO C  1 6   ? -15.383 -33.390 84.539  1.00 30.44  ? 113  PRO C CD  1 
ATOM   7214  N  N   . THR C  1 7   ? -18.250 -35.446 87.738  1.00 26.80  ? 114  THR C N   1 
ATOM   7215  C  CA  . THR C  1 7   ? -19.527 -35.459 88.428  1.00 26.53  ? 114  THR C CA  1 
ATOM   7216  C  C   . THR C  1 7   ? -19.406 -34.959 89.863  1.00 26.03  ? 114  THR C C   1 
ATOM   7217  O  O   . THR C  1 7   ? -20.394 -34.918 90.601  1.00 25.85  ? 114  THR C O   1 
ATOM   7218  C  CB  . THR C  1 7   ? -20.076 -36.880 88.447  1.00 27.67  ? 114  THR C CB  1 
ATOM   7219  O  OG1 . THR C  1 7   ? -19.133 -37.745 89.103  1.00 27.67  ? 114  THR C OG1 1 
ATOM   7220  C  CG2 . THR C  1 7   ? -20.303 -37.369 87.015  1.00 26.57  ? 114  THR C CG2 1 
ATOM   7221  N  N   . ASP C  1 8   ? -18.190 -34.583 90.249  1.00 25.10  ? 115  ASP C N   1 
ATOM   7222  C  CA  . ASP C  1 8   ? -17.917 -34.098 91.597  1.00 24.14  ? 115  ASP C CA  1 
ATOM   7223  C  C   . ASP C  1 8   ? -18.852 -32.951 91.981  1.00 23.77  ? 115  ASP C C   1 
ATOM   7224  O  O   . ASP C  1 8   ? -19.125 -32.054 91.183  1.00 23.37  ? 115  ASP C O   1 
ATOM   7225  C  CB  . ASP C  1 8   ? -16.459 -33.670 91.690  1.00 23.95  ? 115  ASP C CB  1 
ATOM   7226  C  CG  . ASP C  1 8   ? -15.510 -34.780 91.283  1.00 24.51  ? 115  ASP C CG  1 
ATOM   7227  O  OD1 . ASP C  1 8   ? -14.812 -35.331 92.159  1.00 25.75  ? 115  ASP C OD1 1 
ATOM   7228  O  OD2 . ASP C  1 8   ? -15.471 -35.114 90.081  1.00 23.00  ? 115  ASP C OD2 1 
ATOM   7229  N  N   . PRO C  1 9   ? -19.348 -32.967 93.223  1.00 23.42  ? 116  PRO C N   1 
ATOM   7230  C  CA  . PRO C  1 9   ? -20.266 -31.956 93.750  1.00 23.40  ? 116  PRO C CA  1 
ATOM   7231  C  C   . PRO C  1 9   ? -19.894 -30.489 93.563  1.00 24.25  ? 116  PRO C C   1 
ATOM   7232  O  O   . PRO C  1 9   ? -20.768 -29.657 93.354  1.00 25.02  ? 116  PRO C O   1 
ATOM   7233  C  CB  . PRO C  1 9   ? -20.389 -32.343 95.220  1.00 22.70  ? 116  PRO C CB  1 
ATOM   7234  C  CG  . PRO C  1 9   ? -19.082 -33.004 95.512  1.00 22.71  ? 116  PRO C CG  1 
ATOM   7235  C  CD  . PRO C  1 9   ? -18.899 -33.866 94.298  1.00 23.51  ? 116  PRO C CD  1 
ATOM   7236  N  N   . LYS C  1 10  ? -18.611 -30.163 93.627  1.00 25.03  ? 117  LYS C N   1 
ATOM   7237  C  CA  . LYS C  1 10  ? -18.201 -28.773 93.488  1.00 25.28  ? 117  LYS C CA  1 
ATOM   7238  C  C   . LYS C  1 10  ? -17.650 -28.397 92.124  1.00 25.95  ? 117  LYS C C   1 
ATOM   7239  O  O   . LYS C  1 10  ? -17.271 -27.240 91.907  1.00 26.28  ? 117  LYS C O   1 
ATOM   7240  C  CB  . LYS C  1 10  ? -17.170 -28.426 94.559  1.00 26.46  ? 117  LYS C CB  1 
ATOM   7241  C  CG  . LYS C  1 10  ? -17.692 -28.578 95.966  1.00 26.34  ? 117  LYS C CG  1 
ATOM   7242  C  CD  . LYS C  1 10  ? -18.872 -27.678 96.165  1.00 28.22  ? 117  LYS C CD  1 
ATOM   7243  C  CE  . LYS C  1 10  ? -19.406 -27.767 97.573  1.00 30.27  ? 117  LYS C CE  1 
ATOM   7244  N  NZ  . LYS C  1 10  ? -20.559 -26.824 97.735  1.00 32.25  ? 117  LYS C NZ  1 
ATOM   7245  N  N   . PHE C  1 11  ? -17.596 -29.357 91.204  1.00 26.18  ? 118  PHE C N   1 
ATOM   7246  C  CA  . PHE C  1 11  ? -17.084 -29.070 89.863  1.00 25.28  ? 118  PHE C CA  1 
ATOM   7247  C  C   . PHE C  1 11  ? -17.821 -27.902 89.212  1.00 25.62  ? 118  PHE C C   1 
ATOM   7248  O  O   . PHE C  1 11  ? -17.216 -27.066 88.550  1.00 25.23  ? 118  PHE C O   1 
ATOM   7249  C  CB  . PHE C  1 11  ? -17.197 -30.293 88.951  1.00 24.08  ? 118  PHE C CB  1 
ATOM   7250  C  CG  . PHE C  1 11  ? -16.716 -30.042 87.556  1.00 22.19  ? 118  PHE C CG  1 
ATOM   7251  C  CD1 . PHE C  1 11  ? -15.391 -29.686 87.321  1.00 22.68  ? 118  PHE C CD1 1 
ATOM   7252  C  CD2 . PHE C  1 11  ? -17.591 -30.116 86.480  1.00 21.91  ? 118  PHE C CD2 1 
ATOM   7253  C  CE1 . PHE C  1 11  ? -14.937 -29.405 86.029  1.00 22.37  ? 118  PHE C CE1 1 
ATOM   7254  C  CE2 . PHE C  1 11  ? -17.156 -29.839 85.184  1.00 21.92  ? 118  PHE C CE2 1 
ATOM   7255  C  CZ  . PHE C  1 11  ? -15.824 -29.481 84.956  1.00 22.01  ? 118  PHE C CZ  1 
ATOM   7256  N  N   . PRO C  1 12  ? -19.145 -27.836 89.384  1.00 26.59  ? 119  PRO C N   1 
ATOM   7257  C  CA  . PRO C  1 12  ? -19.841 -26.712 88.755  1.00 27.05  ? 119  PRO C CA  1 
ATOM   7258  C  C   . PRO C  1 12  ? -19.349 -25.372 89.289  1.00 27.85  ? 119  PRO C C   1 
ATOM   7259  O  O   . PRO C  1 12  ? -19.362 -24.373 88.579  1.00 29.51  ? 119  PRO C O   1 
ATOM   7260  C  CB  . PRO C  1 12  ? -21.298 -26.997 89.083  1.00 27.24  ? 119  PRO C CB  1 
ATOM   7261  C  CG  . PRO C  1 12  ? -21.321 -28.519 89.097  1.00 26.17  ? 119  PRO C CG  1 
ATOM   7262  C  CD  . PRO C  1 12  ? -20.099 -28.833 89.901  1.00 26.00  ? 119  PRO C CD  1 
ATOM   7263  N  N   . GLN C  1 13  ? -18.890 -25.361 90.534  1.00 28.75  ? 120  GLN C N   1 
ATOM   7264  C  CA  . GLN C  1 13  ? -18.398 -24.142 91.156  1.00 28.07  ? 120  GLN C CA  1 
ATOM   7265  C  C   . GLN C  1 13  ? -17.008 -23.768 90.665  1.00 27.13  ? 120  GLN C C   1 
ATOM   7266  O  O   . GLN C  1 13  ? -16.536 -22.654 90.907  1.00 28.30  ? 120  GLN C O   1 
ATOM   7267  C  CB  . GLN C  1 13  ? -18.373 -24.319 92.664  1.00 29.44  ? 120  GLN C CB  1 
ATOM   7268  C  CG  . GLN C  1 13  ? -19.026 -23.191 93.386  1.00 32.90  ? 120  GLN C CG  1 
ATOM   7269  C  CD  . GLN C  1 13  ? -19.290 -23.533 94.824  1.00 35.18  ? 120  GLN C CD  1 
ATOM   7270  O  OE1 . GLN C  1 13  ? -19.948 -24.531 95.119  1.00 36.10  ? 120  GLN C OE1 1 
ATOM   7271  N  NE2 . GLN C  1 13  ? -18.778 -22.709 95.737  1.00 36.34  ? 120  GLN C NE2 1 
ATOM   7272  N  N   . GLN C  1 14  ? -16.345 -24.697 89.985  1.00 24.95  ? 121  GLN C N   1 
ATOM   7273  C  CA  . GLN C  1 14  ? -15.004 -24.439 89.475  1.00 21.87  ? 121  GLN C CA  1 
ATOM   7274  C  C   . GLN C  1 14  ? -15.097 -23.716 88.140  1.00 21.09  ? 121  GLN C C   1 
ATOM   7275  O  O   . GLN C  1 14  ? -14.669 -24.204 87.097  1.00 19.60  ? 121  GLN C O   1 
ATOM   7276  C  CB  . GLN C  1 14  ? -14.228 -25.755 89.365  1.00 21.70  ? 121  GLN C CB  1 
ATOM   7277  C  CG  . GLN C  1 14  ? -13.969 -26.359 90.735  1.00 23.20  ? 121  GLN C CG  1 
ATOM   7278  C  CD  . GLN C  1 14  ? -13.138 -27.615 90.708  1.00 24.26  ? 121  GLN C CD  1 
ATOM   7279  O  OE1 . GLN C  1 14  ? -13.600 -28.671 90.289  1.00 25.41  ? 121  GLN C OE1 1 
ATOM   7280  N  NE2 . GLN C  1 14  ? -11.900 -27.509 91.164  1.00 25.86  ? 121  GLN C NE2 1 
ATOM   7281  N  N   . TRP C  1 15  ? -15.664 -22.521 88.215  1.00 20.62  ? 122  TRP C N   1 
ATOM   7282  C  CA  . TRP C  1 15  ? -15.884 -21.653 87.073  1.00 21.00  ? 122  TRP C CA  1 
ATOM   7283  C  C   . TRP C  1 15  ? -14.693 -21.470 86.153  1.00 22.25  ? 122  TRP C C   1 
ATOM   7284  O  O   . TRP C  1 15  ? -14.861 -21.224 84.957  1.00 24.08  ? 122  TRP C O   1 
ATOM   7285  C  CB  . TRP C  1 15  ? -16.328 -20.280 87.554  1.00 20.03  ? 122  TRP C CB  1 
ATOM   7286  C  CG  . TRP C  1 15  ? -15.358 -19.658 88.514  1.00 20.51  ? 122  TRP C CG  1 
ATOM   7287  C  CD1 . TRP C  1 15  ? -15.294 -19.853 89.865  1.00 19.69  ? 122  TRP C CD1 1 
ATOM   7288  C  CD2 . TRP C  1 15  ? -14.285 -18.768 88.189  1.00 19.57  ? 122  TRP C CD2 1 
ATOM   7289  N  NE1 . TRP C  1 15  ? -14.251 -19.142 90.398  1.00 17.55  ? 122  TRP C NE1 1 
ATOM   7290  C  CE2 . TRP C  1 15  ? -13.615 -18.468 89.392  1.00 18.15  ? 122  TRP C CE2 1 
ATOM   7291  C  CE3 . TRP C  1 15  ? -13.824 -18.198 86.993  1.00 17.98  ? 122  TRP C CE3 1 
ATOM   7292  C  CZ2 . TRP C  1 15  ? -12.508 -17.619 89.438  1.00 19.34  ? 122  TRP C CZ2 1 
ATOM   7293  C  CZ3 . TRP C  1 15  ? -12.728 -17.356 87.033  1.00 18.48  ? 122  TRP C CZ3 1 
ATOM   7294  C  CH2 . TRP C  1 15  ? -12.079 -17.072 88.250  1.00 19.26  ? 122  TRP C CH2 1 
ATOM   7295  N  N   . TYR C  1 16  ? -13.491 -21.572 86.704  1.00 22.78  ? 123  TYR C N   1 
ATOM   7296  C  CA  . TYR C  1 16  ? -12.267 -21.385 85.916  1.00 22.50  ? 123  TYR C CA  1 
ATOM   7297  C  C   . TYR C  1 16  ? -11.872 -22.594 85.062  1.00 23.15  ? 123  TYR C C   1 
ATOM   7298  O  O   . TYR C  1 16  ? -11.101 -22.465 84.111  1.00 22.96  ? 123  TYR C O   1 
ATOM   7299  C  CB  . TYR C  1 16  ? -11.117 -20.999 86.848  1.00 19.74  ? 123  TYR C CB  1 
ATOM   7300  C  CG  . TYR C  1 16  ? -11.086 -21.847 88.093  1.00 18.82  ? 123  TYR C CG  1 
ATOM   7301  C  CD1 . TYR C  1 16  ? -10.320 -23.008 88.151  1.00 17.53  ? 123  TYR C CD1 1 
ATOM   7302  C  CD2 . TYR C  1 16  ? -11.895 -21.532 89.185  1.00 17.62  ? 123  TYR C CD2 1 
ATOM   7303  C  CE1 . TYR C  1 16  ? -10.364 -23.836 89.263  1.00 17.66  ? 123  TYR C CE1 1 
ATOM   7304  C  CE2 . TYR C  1 16  ? -11.948 -22.352 90.297  1.00 17.12  ? 123  TYR C CE2 1 
ATOM   7305  C  CZ  . TYR C  1 16  ? -11.183 -23.505 90.332  1.00 17.77  ? 123  TYR C CZ  1 
ATOM   7306  O  OH  . TYR C  1 16  ? -11.259 -24.338 91.427  1.00 17.34  ? 123  TYR C OH  1 
ATOM   7307  N  N   . LEU C  1 17  ? -12.378 -23.773 85.406  1.00 24.26  ? 124  LEU C N   1 
ATOM   7308  C  CA  . LEU C  1 17  ? -12.075 -24.959 84.620  1.00 24.63  ? 124  LEU C CA  1 
ATOM   7309  C  C   . LEU C  1 17  ? -13.059 -24.984 83.459  1.00 27.96  ? 124  LEU C C   1 
ATOM   7310  O  O   . LEU C  1 17  ? -12.673 -25.213 82.303  1.00 29.42  ? 124  LEU C O   1 
ATOM   7311  C  CB  . LEU C  1 17  ? -12.212 -26.215 85.473  1.00 20.80  ? 124  LEU C CB  1 
ATOM   7312  C  CG  . LEU C  1 17  ? -11.138 -26.340 86.548  1.00 17.36  ? 124  LEU C CG  1 
ATOM   7313  C  CD1 . LEU C  1 17  ? -11.278 -27.672 87.213  1.00 14.29  ? 124  LEU C CD1 1 
ATOM   7314  C  CD2 . LEU C  1 17  ? -9.758  -26.209 85.942  1.00 15.02  ? 124  LEU C CD2 1 
ATOM   7315  N  N   . SER C  1 18  ? -14.328 -24.722 83.769  1.00 30.96  ? 125  SER C N   1 
ATOM   7316  C  CA  . SER C  1 18  ? -15.379 -24.693 82.755  1.00 34.86  ? 125  SER C CA  1 
ATOM   7317  C  C   . SER C  1 18  ? -16.593 -23.869 83.183  1.00 36.41  ? 125  SER C C   1 
ATOM   7318  O  O   . SER C  1 18  ? -17.047 -23.961 84.325  1.00 36.22  ? 125  SER C O   1 
ATOM   7319  C  CB  . SER C  1 18  ? -15.828 -26.119 82.418  1.00 36.63  ? 125  SER C CB  1 
ATOM   7320  O  OG  . SER C  1 18  ? -16.848 -26.117 81.429  1.00 40.06  ? 125  SER C OG  1 
ATOM   7321  N  N   . GLY C  1 19  ? -17.113 -23.066 82.255  1.00 39.00  ? 126  GLY C N   1 
ATOM   7322  C  CA  . GLY C  1 19  ? -18.280 -22.238 82.536  1.00 42.07  ? 126  GLY C CA  1 
ATOM   7323  C  C   . GLY C  1 19  ? -19.076 -21.947 81.273  1.00 44.16  ? 126  GLY C C   1 
ATOM   7324  O  O   . GLY C  1 19  ? -18.589 -22.201 80.167  1.00 44.46  ? 126  GLY C O   1 
ATOM   7325  N  N   . VAL C  1 20  ? -20.298 -21.429 81.421  1.00 46.26  ? 127  VAL C N   1 
ATOM   7326  C  CA  . VAL C  1 20  ? -21.140 -21.106 80.258  1.00 47.66  ? 127  VAL C CA  1 
ATOM   7327  C  C   . VAL C  1 20  ? -20.353 -20.212 79.294  1.00 48.32  ? 127  VAL C C   1 
ATOM   7328  O  O   . VAL C  1 20  ? -20.313 -20.448 78.087  1.00 48.76  ? 127  VAL C O   1 
ATOM   7329  C  CB  . VAL C  1 20  ? -22.433 -20.375 80.691  0.00 47.66  ? 127  VAL C CB  1 
ATOM   7330  C  CG1 . VAL C  1 20  ? -22.089 -19.127 81.487  0.00 47.85  ? 127  VAL C CG1 1 
ATOM   7331  C  CG2 . VAL C  1 20  ? -23.261 -20.013 79.465  0.00 47.85  ? 127  VAL C CG2 1 
ATOM   7332  N  N   . THR C  1 21  ? -19.714 -19.194 79.859  1.00 49.00  ? 128  THR C N   1 
ATOM   7333  C  CA  . THR C  1 21  ? -18.896 -18.242 79.117  1.00 49.13  ? 128  THR C CA  1 
ATOM   7334  C  C   . THR C  1 21  ? -17.543 -18.871 78.792  1.00 49.12  ? 128  THR C C   1 
ATOM   7335  O  O   . THR C  1 21  ? -17.086 -19.770 79.506  1.00 50.25  ? 128  THR C O   1 
ATOM   7336  C  CB  . THR C  1 21  ? -18.656 -17.006 79.976  1.00 49.52  ? 128  THR C CB  1 
ATOM   7337  O  OG1 . THR C  1 21  ? -18.461 -17.427 81.333  1.00 48.69  ? 128  THR C OG1 1 
ATOM   7338  C  CG2 . THR C  1 21  ? -19.848 -16.060 79.911  1.00 50.18  ? 128  THR C CG2 1 
ATOM   7339  N  N   . GLN C  1 22  ? -16.890 -18.405 77.729  1.00 47.86  ? 129  GLN C N   1 
ATOM   7340  C  CA  . GLN C  1 22  ? -15.580 -18.960 77.382  1.00 46.78  ? 129  GLN C CA  1 
ATOM   7341  C  C   . GLN C  1 22  ? -14.472 -18.259 78.186  1.00 45.37  ? 129  GLN C C   1 
ATOM   7342  O  O   . GLN C  1 22  ? -13.339 -18.083 77.709  1.00 46.34  ? 129  GLN C O   1 
ATOM   7343  C  CB  . GLN C  1 22  ? -15.304 -18.841 75.870  1.00 46.60  ? 129  GLN C CB  1 
ATOM   7344  C  CG  . GLN C  1 22  ? -14.809 -17.486 75.392  0.00 46.58  ? 129  GLN C CG  1 
ATOM   7345  C  CD  . GLN C  1 22  ? -14.138 -17.571 74.032  0.00 46.52  ? 129  GLN C CD  1 
ATOM   7346  O  OE1 . GLN C  1 22  ? -13.616 -16.582 73.520  0.00 46.45  ? 129  GLN C OE1 1 
ATOM   7347  N  NE2 . GLN C  1 22  ? -14.149 -18.762 73.441  0.00 46.45  ? 129  GLN C NE2 1 
ATOM   7348  N  N   . ARG C  1 23  ? -14.817 -17.856 79.408  1.00 41.88  ? 130  ARG C N   1 
ATOM   7349  C  CA  . ARG C  1 23  ? -13.876 -17.197 80.304  1.00 37.61  ? 130  ARG C CA  1 
ATOM   7350  C  C   . ARG C  1 23  ? -13.367 -18.250 81.285  1.00 34.00  ? 130  ARG C C   1 
ATOM   7351  O  O   . ARG C  1 23  ? -13.728 -18.244 82.463  1.00 33.38  ? 130  ARG C O   1 
ATOM   7352  C  CB  . ARG C  1 23  ? -14.575 -16.061 81.060  1.00 38.78  ? 130  ARG C CB  1 
ATOM   7353  C  CG  . ARG C  1 23  ? -14.661 -14.731 80.303  1.00 41.09  ? 130  ARG C CG  1 
ATOM   7354  C  CD  . ARG C  1 23  ? -15.435 -14.829 78.990  1.00 43.16  ? 130  ARG C CD  1 
ATOM   7355  N  NE  . ARG C  1 23  ? -15.465 -13.552 78.272  1.00 44.34  ? 130  ARG C NE  1 
ATOM   7356  C  CZ  . ARG C  1 23  ? -16.009 -12.430 78.744  1.00 44.75  ? 130  ARG C CZ  1 
ATOM   7357  N  NH1 . ARG C  1 23  ? -16.575 -12.415 79.943  0.00 44.68  ? 130  ARG C NH1 1 
ATOM   7358  N  NH2 . ARG C  1 23  ? -15.991 -11.325 78.011  0.00 44.68  ? 130  ARG C NH2 1 
ATOM   7359  N  N   . ASP C  1 24  ? -12.541 -19.164 80.784  1.00 29.93  ? 131  ASP C N   1 
ATOM   7360  C  CA  . ASP C  1 24  ? -11.987 -20.239 81.600  1.00 26.56  ? 131  ASP C CA  1 
ATOM   7361  C  C   . ASP C  1 24  ? -10.635 -20.691 81.063  1.00 23.92  ? 131  ASP C C   1 
ATOM   7362  O  O   . ASP C  1 24  ? -10.162 -20.189 80.048  1.00 22.41  ? 131  ASP C O   1 
ATOM   7363  C  CB  . ASP C  1 24  ? -12.957 -21.429 81.651  1.00 28.14  ? 131  ASP C CB  1 
ATOM   7364  C  CG  . ASP C  1 24  ? -13.392 -21.906 80.259  1.00 30.22  ? 131  ASP C CG  1 
ATOM   7365  O  OD1 . ASP C  1 24  ? -12.513 -22.221 79.418  1.00 28.32  ? 131  ASP C OD1 1 
ATOM   7366  O  OD2 . ASP C  1 24  ? -14.625 -21.970 80.014  1.00 30.67  ? 131  ASP C OD2 1 
ATOM   7367  N  N   . LEU C  1 25  ? -10.012 -21.643 81.745  1.00 21.90  ? 132  LEU C N   1 
ATOM   7368  C  CA  . LEU C  1 25  ? -8.708  -22.128 81.324  1.00 20.94  ? 132  LEU C CA  1 
ATOM   7369  C  C   . LEU C  1 25  ? -8.799  -23.115 80.162  1.00 21.40  ? 132  LEU C C   1 
ATOM   7370  O  O   . LEU C  1 25  ? -7.787  -23.653 79.693  1.00 21.06  ? 132  LEU C O   1 
ATOM   7371  C  CB  . LEU C  1 25  ? -7.991  -22.753 82.519  1.00 19.97  ? 132  LEU C CB  1 
ATOM   7372  C  CG  . LEU C  1 25  ? -7.678  -21.731 83.620  1.00 18.74  ? 132  LEU C CG  1 
ATOM   7373  C  CD1 . LEU C  1 25  ? -7.045  -22.422 84.811  1.00 18.54  ? 132  LEU C CD1 1 
ATOM   7374  C  CD2 . LEU C  1 25  ? -6.747  -20.671 83.082  1.00 18.04  ? 132  LEU C CD2 1 
ATOM   7375  N  N   . ASN C  1 26  ? -10.023 -23.345 79.700  1.00 21.28  ? 133  ASN C N   1 
ATOM   7376  C  CA  . ASN C  1 26  ? -10.266 -24.238 78.577  1.00 22.27  ? 133  ASN C CA  1 
ATOM   7377  C  C   . ASN C  1 26  ? -9.621  -25.617 78.755  1.00 22.43  ? 133  ASN C C   1 
ATOM   7378  O  O   . ASN C  1 26  ? -8.964  -26.134 77.836  1.00 20.97  ? 133  ASN C O   1 
ATOM   7379  C  CB  . ASN C  1 26  ? -9.772  -23.564 77.288  1.00 21.42  ? 133  ASN C CB  1 
ATOM   7380  C  CG  . ASN C  1 26  ? -10.189 -24.310 76.041  1.00 21.89  ? 133  ASN C CG  1 
ATOM   7381  O  OD1 . ASN C  1 26  ? -11.269 -24.901 75.987  1.00 22.70  ? 133  ASN C OD1 1 
ATOM   7382  N  ND2 . ASN C  1 26  ? -9.344  -24.270 75.022  1.00 22.74  ? 133  ASN C ND2 1 
ATOM   7383  N  N   . VAL C  1 27  ? -9.831  -26.209 79.933  1.00 23.19  ? 134  VAL C N   1 
ATOM   7384  C  CA  . VAL C  1 27  ? -9.275  -27.526 80.249  1.00 25.00  ? 134  VAL C CA  1 
ATOM   7385  C  C   . VAL C  1 27  ? -10.141 -28.659 79.708  1.00 25.43  ? 134  VAL C C   1 
ATOM   7386  O  O   . VAL C  1 27  ? -9.627  -29.693 79.289  1.00 25.91  ? 134  VAL C O   1 
ATOM   7387  C  CB  . VAL C  1 27  ? -9.121  -27.749 81.778  1.00 24.27  ? 134  VAL C CB  1 
ATOM   7388  C  CG1 . VAL C  1 27  ? -8.315  -26.635 82.402  1.00 24.78  ? 134  VAL C CG1 1 
ATOM   7389  C  CG2 . VAL C  1 27  ? -10.483 -27.829 82.425  1.00 26.81  ? 134  VAL C CG2 1 
ATOM   7390  N  N   . LYS C  1 28  ? -11.454 -28.458 79.726  1.00 26.42  ? 135  LYS C N   1 
ATOM   7391  C  CA  . LYS C  1 28  ? -12.400 -29.460 79.252  1.00 27.36  ? 135  LYS C CA  1 
ATOM   7392  C  C   . LYS C  1 28  ? -11.990 -29.943 77.859  1.00 27.53  ? 135  LYS C C   1 
ATOM   7393  O  O   . LYS C  1 28  ? -12.053 -31.135 77.552  1.00 26.55  ? 135  LYS C O   1 
ATOM   7394  C  CB  . LYS C  1 28  ? -13.800 -28.842 79.229  1.00 28.02  ? 135  LYS C CB  1 
ATOM   7395  C  CG  . LYS C  1 28  ? -14.940 -29.785 79.589  1.00 29.26  ? 135  LYS C CG  1 
ATOM   7396  C  CD  . LYS C  1 28  ? -16.232 -29.000 79.872  1.00 30.15  ? 135  LYS C CD  1 
ATOM   7397  C  CE  . LYS C  1 28  ? -16.618 -28.100 78.707  0.00 30.05  ? 135  LYS C CE  1 
ATOM   7398  N  NZ  . LYS C  1 28  ? -16.861 -28.871 77.458  0.00 30.18  ? 135  LYS C NZ  1 
ATOM   7399  N  N   . GLU C  1 29  ? -11.536 -29.021 77.019  1.00 28.27  ? 136  GLU C N   1 
ATOM   7400  C  CA  . GLU C  1 29  ? -11.145 -29.426 75.687  1.00 28.31  ? 136  GLU C CA  1 
ATOM   7401  C  C   . GLU C  1 29  ? -9.940  -30.342 75.699  1.00 27.46  ? 136  GLU C C   1 
ATOM   7402  O  O   . GLU C  1 29  ? -9.790  -31.183 74.818  1.00 28.40  ? 136  GLU C O   1 
ATOM   7403  C  CB  . GLU C  1 29  ? -10.861 -28.235 74.791  1.00 30.60  ? 136  GLU C CB  1 
ATOM   7404  C  CG  . GLU C  1 29  ? -10.673 -28.696 73.353  1.00 36.11  ? 136  GLU C CG  1 
ATOM   7405  C  CD  . GLU C  1 29  ? -10.309 -27.584 72.398  1.00 38.91  ? 136  GLU C CD  1 
ATOM   7406  O  OE1 . GLU C  1 29  ? -10.270 -27.872 71.181  1.00 40.73  ? 136  GLU C OE1 1 
ATOM   7407  O  OE2 . GLU C  1 29  ? -10.061 -26.441 72.853  1.00 40.36  ? 136  GLU C OE2 1 
ATOM   7408  N  N   . ALA C  1 30  ? -9.070  -30.185 76.688  1.00 27.30  ? 137  ALA C N   1 
ATOM   7409  C  CA  . ALA C  1 30  ? -7.890  -31.044 76.784  1.00 25.59  ? 137  ALA C CA  1 
ATOM   7410  C  C   . ALA C  1 30  ? -8.314  -32.409 77.311  1.00 24.97  ? 137  ALA C C   1 
ATOM   7411  O  O   . ALA C  1 30  ? -7.838  -33.441 76.839  1.00 24.87  ? 137  ALA C O   1 
ATOM   7412  C  CB  . ALA C  1 30  ? -6.854  -30.425 77.707  1.00 25.63  ? 137  ALA C CB  1 
ATOM   7413  N  N   . TRP C  1 31  ? -9.210  -32.412 78.294  1.00 24.38  ? 138  TRP C N   1 
ATOM   7414  C  CA  . TRP C  1 31  ? -9.696  -33.662 78.862  1.00 24.43  ? 138  TRP C CA  1 
ATOM   7415  C  C   . TRP C  1 31  ? -10.355 -34.510 77.777  1.00 25.02  ? 138  TRP C C   1 
ATOM   7416  O  O   . TRP C  1 31  ? -10.104 -35.708 77.672  1.00 23.91  ? 138  TRP C O   1 
ATOM   7417  C  CB  . TRP C  1 31  ? -10.715 -33.389 79.974  1.00 22.93  ? 138  TRP C CB  1 
ATOM   7418  C  CG  . TRP C  1 31  ? -10.149 -32.736 81.208  1.00 21.02  ? 138  TRP C CG  1 
ATOM   7419  C  CD1 . TRP C  1 31  ? -8.840  -32.721 81.610  1.00 20.38  ? 138  TRP C CD1 1 
ATOM   7420  C  CD2 . TRP C  1 31  ? -10.888 -32.060 82.230  1.00 19.23  ? 138  TRP C CD2 1 
ATOM   7421  N  NE1 . TRP C  1 31  ? -8.723  -32.078 82.817  1.00 19.09  ? 138  TRP C NE1 1 
ATOM   7422  C  CE2 . TRP C  1 31  ? -9.964  -31.662 83.221  1.00 19.49  ? 138  TRP C CE2 1 
ATOM   7423  C  CE3 . TRP C  1 31  ? -12.242 -31.753 82.406  1.00 18.57  ? 138  TRP C CE3 1 
ATOM   7424  C  CZ2 . TRP C  1 31  ? -10.352 -30.972 84.371  1.00 17.71  ? 138  TRP C CZ2 1 
ATOM   7425  C  CZ3 . TRP C  1 31  ? -12.628 -31.067 83.549  1.00 18.59  ? 138  TRP C CZ3 1 
ATOM   7426  C  CH2 . TRP C  1 31  ? -11.686 -30.683 84.516  1.00 18.41  ? 138  TRP C CH2 1 
ATOM   7427  N  N   . ALA C  1 32  ? -11.200 -33.873 76.973  1.00 26.28  ? 139  ALA C N   1 
ATOM   7428  C  CA  . ALA C  1 32  ? -11.911 -34.560 75.904  1.00 27.02  ? 139  ALA C CA  1 
ATOM   7429  C  C   . ALA C  1 32  ? -10.953 -35.263 74.960  1.00 27.87  ? 139  ALA C C   1 
ATOM   7430  O  O   . ALA C  1 32  ? -11.260 -36.348 74.465  1.00 28.41  ? 139  ALA C O   1 
ATOM   7431  C  CB  . ALA C  1 32  ? -12.775 -33.580 75.135  1.00 27.14  ? 139  ALA C CB  1 
ATOM   7432  N  N   . GLN C  1 33  ? -9.797  -34.649 74.706  1.00 28.41  ? 140  GLN C N   1 
ATOM   7433  C  CA  . GLN C  1 33  ? -8.798  -35.242 73.812  1.00 28.24  ? 140  GLN C CA  1 
ATOM   7434  C  C   . GLN C  1 33  ? -8.055  -36.384 74.500  1.00 27.14  ? 140  GLN C C   1 
ATOM   7435  O  O   . GLN C  1 33  ? -7.113  -36.948 73.941  1.00 27.42  ? 140  GLN C O   1 
ATOM   7436  C  CB  . GLN C  1 33  ? -7.768  -34.199 73.354  1.00 29.93  ? 140  GLN C CB  1 
ATOM   7437  C  CG  . GLN C  1 33  ? -8.308  -33.041 72.513  1.00 34.24  ? 140  GLN C CG  1 
ATOM   7438  C  CD  . GLN C  1 33  ? -7.183  -32.154 71.955  1.00 37.87  ? 140  GLN C CD  1 
ATOM   7439  O  OE1 . GLN C  1 33  ? -6.335  -32.620 71.175  1.00 39.93  ? 140  GLN C OE1 1 
ATOM   7440  N  NE2 . GLN C  1 33  ? -7.166  -30.878 72.356  1.00 37.48  ? 140  GLN C NE2 1 
ATOM   7441  N  N   . GLY C  1 34  ? -8.467  -36.708 75.720  1.00 25.84  ? 141  GLY C N   1 
ATOM   7442  C  CA  . GLY C  1 34  ? -7.825  -37.786 76.450  1.00 23.99  ? 141  GLY C CA  1 
ATOM   7443  C  C   . GLY C  1 34  ? -6.655  -37.391 77.341  1.00 23.64  ? 141  GLY C C   1 
ATOM   7444  O  O   . GLY C  1 34  ? -5.917  -38.257 77.804  1.00 24.55  ? 141  GLY C O   1 
ATOM   7445  N  N   . PHE C  1 35  ? -6.471  -36.101 77.596  1.00 22.38  ? 142  PHE C N   1 
ATOM   7446  C  CA  . PHE C  1 35  ? -5.369  -35.668 78.447  1.00 21.67  ? 142  PHE C CA  1 
ATOM   7447  C  C   . PHE C  1 35  ? -5.842  -35.213 79.826  1.00 21.64  ? 142  PHE C C   1 
ATOM   7448  O  O   . PHE C  1 35  ? -6.507  -34.194 79.961  1.00 22.62  ? 142  PHE C O   1 
ATOM   7449  C  CB  . PHE C  1 35  ? -4.589  -34.573 77.739  1.00 20.04  ? 142  PHE C CB  1 
ATOM   7450  C  CG  . PHE C  1 35  ? -4.010  -35.022 76.434  1.00 20.72  ? 142  PHE C CG  1 
ATOM   7451  C  CD1 . PHE C  1 35  ? -3.086  -36.062 76.392  1.00 20.31  ? 142  PHE C CD1 1 
ATOM   7452  C  CD2 . PHE C  1 35  ? -4.418  -34.444 75.239  1.00 20.68  ? 142  PHE C CD2 1 
ATOM   7453  C  CE1 . PHE C  1 35  ? -2.584  -36.522 75.177  1.00 19.58  ? 142  PHE C CE1 1 
ATOM   7454  C  CE2 . PHE C  1 35  ? -3.923  -34.895 74.020  1.00 19.25  ? 142  PHE C CE2 1 
ATOM   7455  C  CZ  . PHE C  1 35  ? -3.005  -35.932 73.989  1.00 19.22  ? 142  PHE C CZ  1 
ATOM   7456  N  N   . THR C  1 36  ? -5.496  -35.988 80.849  1.00 21.19  ? 143  THR C N   1 
ATOM   7457  C  CA  . THR C  1 36  ? -5.901  -35.687 82.213  1.00 20.92  ? 143  THR C CA  1 
ATOM   7458  C  C   . THR C  1 36  ? -4.762  -35.817 83.225  1.00 21.02  ? 143  THR C C   1 
ATOM   7459  O  O   . THR C  1 36  ? -4.989  -35.744 84.437  1.00 19.62  ? 143  THR C O   1 
ATOM   7460  C  CB  . THR C  1 36  ? -7.031  -36.616 82.644  1.00 21.71  ? 143  THR C CB  1 
ATOM   7461  O  OG1 . THR C  1 36  ? -6.631  -37.974 82.428  1.00 22.25  ? 143  THR C OG1 1 
ATOM   7462  C  CG2 . THR C  1 36  ? -8.285  -36.328 81.841  1.00 22.68  ? 143  THR C CG2 1 
ATOM   7463  N  N   . GLY C  1 37  ? -3.544  -36.035 82.734  1.00 20.59  ? 144  GLY C N   1 
ATOM   7464  C  CA  . GLY C  1 37  ? -2.412  -36.135 83.631  1.00 21.33  ? 144  GLY C CA  1 
ATOM   7465  C  C   . GLY C  1 37  ? -1.821  -37.509 83.855  1.00 22.78  ? 144  GLY C C   1 
ATOM   7466  O  O   . GLY C  1 37  ? -0.858  -37.641 84.603  1.00 22.67  ? 144  GLY C O   1 
ATOM   7467  N  N   . HIS C  1 38  ? -2.379  -38.533 83.218  1.00 24.40  ? 145  HIS C N   1 
ATOM   7468  C  CA  . HIS C  1 38  ? -1.864  -39.895 83.380  1.00 24.61  ? 145  HIS C CA  1 
ATOM   7469  C  C   . HIS C  1 38  ? -0.368  -39.957 83.191  1.00 22.22  ? 145  HIS C C   1 
ATOM   7470  O  O   . HIS C  1 38  ? 0.163   -39.417 82.228  1.00 22.07  ? 145  HIS C O   1 
ATOM   7471  C  CB  . HIS C  1 38  ? -2.491  -40.845 82.362  1.00 28.51  ? 145  HIS C CB  1 
ATOM   7472  C  CG  . HIS C  1 38  ? -3.848  -41.339 82.745  1.00 32.88  ? 145  HIS C CG  1 
ATOM   7473  N  ND1 . HIS C  1 38  ? -4.046  -42.263 83.753  1.00 34.89  ? 145  HIS C ND1 1 
ATOM   7474  C  CD2 . HIS C  1 38  ? -5.077  -41.034 82.262  1.00 33.96  ? 145  HIS C CD2 1 
ATOM   7475  C  CE1 . HIS C  1 38  ? -5.341  -42.505 83.873  1.00 36.32  ? 145  HIS C CE1 1 
ATOM   7476  N  NE2 . HIS C  1 38  ? -5.989  -41.772 82.981  1.00 36.49  ? 145  HIS C NE2 1 
ATOM   7477  N  N   . GLY C  1 39  ? 0.306   -40.632 84.108  1.00 20.84  ? 146  GLY C N   1 
ATOM   7478  C  CA  . GLY C  1 39  ? 1.742   -40.795 83.999  1.00 19.06  ? 146  GLY C CA  1 
ATOM   7479  C  C   . GLY C  1 39  ? 2.590   -39.602 84.369  1.00 20.09  ? 146  GLY C C   1 
ATOM   7480  O  O   . GLY C  1 39  ? 3.819   -39.685 84.318  1.00 19.50  ? 146  GLY C O   1 
ATOM   7481  N  N   . ILE C  1 40  ? 1.954   -38.490 84.738  1.00 19.91  ? 147  ILE C N   1 
ATOM   7482  C  CA  . ILE C  1 40  ? 2.699   -37.292 85.106  1.00 19.98  ? 147  ILE C CA  1 
ATOM   7483  C  C   . ILE C  1 40  ? 2.738   -37.103 86.624  1.00 19.82  ? 147  ILE C C   1 
ATOM   7484  O  O   . ILE C  1 40  ? 1.742   -37.314 87.331  1.00 20.26  ? 147  ILE C O   1 
ATOM   7485  C  CB  . ILE C  1 40  ? 2.102   -36.029 84.445  1.00 20.60  ? 147  ILE C CB  1 
ATOM   7486  C  CG1 . ILE C  1 40  ? 2.023   -36.222 82.928  1.00 19.28  ? 147  ILE C CG1 1 
ATOM   7487  C  CG2 . ILE C  1 40  ? 2.976   -34.822 84.749  1.00 20.38  ? 147  ILE C CG2 1 
ATOM   7488  C  CD1 . ILE C  1 40  ? 3.350   -36.570 82.299  1.00 18.29  ? 147  ILE C CD1 1 
ATOM   7489  N  N   . VAL C  1 41  ? 3.905   -36.716 87.118  1.00 18.09  ? 148  VAL C N   1 
ATOM   7490  C  CA  . VAL C  1 41  ? 4.101   -36.513 88.543  1.00 18.29  ? 148  VAL C CA  1 
ATOM   7491  C  C   . VAL C  1 41  ? 4.372   -35.051 88.890  1.00 17.21  ? 148  VAL C C   1 
ATOM   7492  O  O   . VAL C  1 41  ? 5.290   -34.434 88.351  1.00 17.41  ? 148  VAL C O   1 
ATOM   7493  C  CB  . VAL C  1 41  ? 5.273   -37.365 89.044  1.00 18.62  ? 148  VAL C CB  1 
ATOM   7494  C  CG1 . VAL C  1 41  ? 5.475   -37.159 90.527  1.00 17.98  ? 148  VAL C CG1 1 
ATOM   7495  C  CG2 . VAL C  1 41  ? 4.990   -38.823 88.758  1.00 18.08  ? 148  VAL C CG2 1 
ATOM   7496  N  N   . VAL C  1 42  ? 3.561   -34.508 89.789  1.00 16.19  ? 149  VAL C N   1 
ATOM   7497  C  CA  . VAL C  1 42  ? 3.702   -33.126 90.224  1.00 15.79  ? 149  VAL C CA  1 
ATOM   7498  C  C   . VAL C  1 42  ? 3.946   -33.036 91.730  1.00 15.96  ? 149  VAL C C   1 
ATOM   7499  O  O   . VAL C  1 42  ? 3.327   -33.753 92.515  1.00 15.10  ? 149  VAL C O   1 
ATOM   7500  C  CB  . VAL C  1 42  ? 2.448   -32.323 89.900  1.00 13.83  ? 149  VAL C CB  1 
ATOM   7501  C  CG1 . VAL C  1 42  ? 2.612   -30.909 90.377  1.00 12.72  ? 149  VAL C CG1 1 
ATOM   7502  C  CG2 . VAL C  1 42  ? 2.187   -32.366 88.413  1.00 14.22  ? 149  VAL C CG2 1 
ATOM   7503  N  N   . SER C  1 43  ? 4.852   -32.154 92.132  1.00 16.09  ? 150  SER C N   1 
ATOM   7504  C  CA  . SER C  1 43  ? 5.147   -31.989 93.554  1.00 15.55  ? 150  SER C CA  1 
ATOM   7505  C  C   . SER C  1 43  ? 4.931   -30.545 93.996  1.00 15.58  ? 150  SER C C   1 
ATOM   7506  O  O   . SER C  1 43  ? 5.361   -29.605 93.324  1.00 16.46  ? 150  SER C O   1 
ATOM   7507  C  CB  . SER C  1 43  ? 6.587   -32.400 93.845  1.00 14.28  ? 150  SER C CB  1 
ATOM   7508  O  OG  . SER C  1 43  ? 6.802   -32.524 95.236  1.00 15.93  ? 150  SER C OG  1 
ATOM   7509  N  N   . ILE C  1 44  ? 4.250   -30.376 95.124  1.00 15.49  ? 151  ILE C N   1 
ATOM   7510  C  CA  . ILE C  1 44  ? 3.976   -29.050 95.696  1.00 14.04  ? 151  ILE C CA  1 
ATOM   7511  C  C   . ILE C  1 44  ? 5.014   -28.727 96.773  1.00 13.46  ? 151  ILE C C   1 
ATOM   7512  O  O   . ILE C  1 44  ? 5.070   -29.399 97.813  1.00 11.96  ? 151  ILE C O   1 
ATOM   7513  C  CB  . ILE C  1 44  ? 2.590   -29.012 96.380  1.00 14.94  ? 151  ILE C CB  1 
ATOM   7514  C  CG1 . ILE C  1 44  ? 1.491   -29.392 95.383  1.00 14.67  ? 151  ILE C CG1 1 
ATOM   7515  C  CG2 . ILE C  1 44  ? 2.340   -27.639 96.972  1.00 14.85  ? 151  ILE C CG2 1 
ATOM   7516  C  CD1 . ILE C  1 44  ? 1.371   -28.439 94.222  1.00 13.74  ? 151  ILE C CD1 1 
ATOM   7517  N  N   . LEU C  1 45  ? 5.848   -27.722 96.525  1.00 13.80  ? 152  LEU C N   1 
ATOM   7518  C  CA  . LEU C  1 45  ? 6.859   -27.328 97.510  1.00 13.41  ? 152  LEU C CA  1 
ATOM   7519  C  C   . LEU C  1 45  ? 6.184   -26.287 98.384  1.00 14.05  ? 152  LEU C C   1 
ATOM   7520  O  O   . LEU C  1 45  ? 6.002   -25.155 97.959  1.00 15.61  ? 152  LEU C O   1 
ATOM   7521  C  CB  . LEU C  1 45  ? 8.084   -26.731 96.818  1.00 12.89  ? 152  LEU C CB  1 
ATOM   7522  C  CG  . LEU C  1 45  ? 8.751   -27.603 95.739  1.00 13.70  ? 152  LEU C CG  1 
ATOM   7523  C  CD1 . LEU C  1 45  ? 10.028  -26.937 95.253  1.00 12.22  ? 152  LEU C CD1 1 
ATOM   7524  C  CD2 . LEU C  1 45  ? 9.068   -28.974 96.289  1.00 12.17  ? 152  LEU C CD2 1 
ATOM   7525  N  N   . ASP C  1 46  ? 5.804   -26.667 99.600  1.00 14.73  ? 153  ASP C N   1 
ATOM   7526  C  CA  . ASP C  1 46  ? 5.099   -25.741 100.482 1.00 15.69  ? 153  ASP C CA  1 
ATOM   7527  C  C   . ASP C  1 46  ? 5.221   -26.143 101.966 1.00 16.97  ? 153  ASP C C   1 
ATOM   7528  O  O   . ASP C  1 46  ? 6.303   -26.505 102.434 1.00 17.10  ? 153  ASP C O   1 
ATOM   7529  C  CB  . ASP C  1 46  ? 3.625   -25.703 100.059 1.00 17.21  ? 153  ASP C CB  1 
ATOM   7530  C  CG  . ASP C  1 46  ? 2.931   -24.373 100.378 1.00 19.87  ? 153  ASP C CG  1 
ATOM   7531  O  OD1 . ASP C  1 46  ? 2.494   -23.680 99.424  1.00 19.77  ? 153  ASP C OD1 1 
ATOM   7532  O  OD2 . ASP C  1 46  ? 2.803   -24.027 101.574 1.00 20.01  ? 153  ASP C OD2 1 
ATOM   7533  N  N   . ASP C  1 47  ? 4.111   -26.081 102.702 1.00 16.58  ? 154  ASP C N   1 
ATOM   7534  C  CA  . ASP C  1 47  ? 4.117   -26.432 104.119 1.00 17.00  ? 154  ASP C CA  1 
ATOM   7535  C  C   . ASP C  1 47  ? 3.635   -27.855 104.395 1.00 17.15  ? 154  ASP C C   1 
ATOM   7536  O  O   . ASP C  1 47  ? 3.301   -28.186 105.526 1.00 17.73  ? 154  ASP C O   1 
ATOM   7537  C  CB  . ASP C  1 47  ? 3.255   -25.452 104.928 1.00 16.44  ? 154  ASP C CB  1 
ATOM   7538  C  CG  . ASP C  1 47  ? 1.841   -25.340 104.394 1.00 16.30  ? 154  ASP C CG  1 
ATOM   7539  O  OD1 . ASP C  1 47  ? 1.423   -26.217 103.612 1.00 16.70  ? 154  ASP C OD1 1 
ATOM   7540  O  OD2 . ASP C  1 47  ? 1.141   -24.375 104.757 1.00 15.96  ? 154  ASP C OD2 1 
ATOM   7541  N  N   . GLY C  1 48  ? 3.598   -28.694 103.370 1.00 17.12  ? 155  GLY C N   1 
ATOM   7542  C  CA  . GLY C  1 48  ? 3.161   -30.061 103.572 1.00 17.15  ? 155  GLY C CA  1 
ATOM   7543  C  C   . GLY C  1 48  ? 1.883   -30.374 102.836 1.00 16.89  ? 155  GLY C C   1 
ATOM   7544  O  O   . GLY C  1 48  ? 1.216   -29.473 102.328 1.00 17.99  ? 155  GLY C O   1 
ATOM   7545  N  N   . ILE C  1 49  ? 1.535   -31.652 102.783 1.00 16.50  ? 156  ILE C N   1 
ATOM   7546  C  CA  . ILE C  1 49  ? 0.333   -32.087 102.085 1.00 16.11  ? 156  ILE C CA  1 
ATOM   7547  C  C   . ILE C  1 49  ? -0.425  -33.112 102.922 1.00 16.52  ? 156  ILE C C   1 
ATOM   7548  O  O   . ILE C  1 49  ? 0.167   -34.051 103.467 1.00 13.72  ? 156  ILE C O   1 
ATOM   7549  C  CB  . ILE C  1 49  ? 0.710   -32.693 100.715 1.00 16.20  ? 156  ILE C CB  1 
ATOM   7550  C  CG1 . ILE C  1 49  ? -0.528  -33.143 99.963  1.00 18.40  ? 156  ILE C CG1 1 
ATOM   7551  C  CG2 . ILE C  1 49  ? 1.630   -33.874 100.899 1.00 16.47  ? 156  ILE C CG2 1 
ATOM   7552  C  CD1 . ILE C  1 49  ? -0.178  -33.741 98.594  1.00 19.99  ? 156  ILE C CD1 1 
ATOM   7553  N  N   . GLU C  1 50  ? -1.733  -32.912 103.058 1.00 16.90  ? 157  GLU C N   1 
ATOM   7554  C  CA  . GLU C  1 50  ? -2.552  -33.848 103.814 1.00 18.20  ? 157  GLU C CA  1 
ATOM   7555  C  C   . GLU C  1 50  ? -2.770  -35.034 102.883 1.00 18.87  ? 157  GLU C C   1 
ATOM   7556  O  O   . GLU C  1 50  ? -3.787  -35.122 102.207 1.00 19.11  ? 157  GLU C O   1 
ATOM   7557  C  CB  . GLU C  1 50  ? -3.886  -33.206 104.185 1.00 18.47  ? 157  GLU C CB  1 
ATOM   7558  C  CG  . GLU C  1 50  ? -4.621  -33.933 105.296 1.00 20.36  ? 157  GLU C CG  1 
ATOM   7559  C  CD  . GLU C  1 50  ? -5.870  -33.195 105.748 1.00 22.61  ? 157  GLU C CD  1 
ATOM   7560  O  OE1 . GLU C  1 50  ? -6.845  -33.129 104.971 1.00 23.61  ? 157  GLU C OE1 1 
ATOM   7561  O  OE2 . GLU C  1 50  ? -5.882  -32.671 106.880 1.00 23.53  ? 157  GLU C OE2 1 
ATOM   7562  N  N   . LYS C  1 51  ? -1.794  -35.938 102.860 1.00 20.23  ? 158  LYS C N   1 
ATOM   7563  C  CA  . LYS C  1 51  ? -1.807  -37.098 101.985 1.00 21.70  ? 158  LYS C CA  1 
ATOM   7564  C  C   . LYS C  1 51  ? -3.006  -38.031 102.103 1.00 23.39  ? 158  LYS C C   1 
ATOM   7565  O  O   . LYS C  1 51  ? -3.286  -38.796 101.172 1.00 24.43  ? 158  LYS C O   1 
ATOM   7566  C  CB  . LYS C  1 51  ? -0.510  -37.890 102.155 1.00 21.02  ? 158  LYS C CB  1 
ATOM   7567  C  CG  . LYS C  1 51  ? -0.344  -38.557 103.495 1.00 22.56  ? 158  LYS C CG  1 
ATOM   7568  C  CD  . LYS C  1 51  ? 0.943   -39.376 103.523 1.00 24.52  ? 158  LYS C CD  1 
ATOM   7569  C  CE  . LYS C  1 51  ? 1.117   -40.103 104.850 1.00 26.87  ? 158  LYS C CE  1 
ATOM   7570  N  NZ  . LYS C  1 51  ? 1.188   -39.145 106.005 1.00 31.45  ? 158  LYS C NZ  1 
ATOM   7571  N  N   . ASN C  1 52  ? -3.713  -38.001 103.227 1.00 23.02  ? 159  ASN C N   1 
ATOM   7572  C  CA  . ASN C  1 52  ? -4.874  -38.869 103.328 1.00 22.17  ? 159  ASN C CA  1 
ATOM   7573  C  C   . ASN C  1 52  ? -6.176  -38.126 103.158 1.00 21.76  ? 159  ASN C C   1 
ATOM   7574  O  O   . ASN C  1 52  ? -7.231  -38.580 103.585 1.00 22.75  ? 159  ASN C O   1 
ATOM   7575  C  CB  . ASN C  1 52  ? -4.862  -39.676 104.616 1.00 21.92  ? 159  ASN C CB  1 
ATOM   7576  C  CG  . ASN C  1 52  ? -3.970  -40.891 104.511 1.00 21.58  ? 159  ASN C CG  1 
ATOM   7577  O  OD1 . ASN C  1 52  ? -2.790  -40.773 104.184 0.00 21.84  ? 159  ASN C OD1 1 
ATOM   7578  N  ND2 . ASN C  1 52  ? -4.528  -42.066 104.782 0.00 21.84  ? 159  ASN C ND2 1 
ATOM   7579  N  N   . HIS C  1 53  ? -6.103  -36.978 102.505 1.00 21.60  ? 160  HIS C N   1 
ATOM   7580  C  CA  . HIS C  1 53  ? -7.302  -36.199 102.266 1.00 22.07  ? 160  HIS C CA  1 
ATOM   7581  C  C   . HIS C  1 53  ? -8.165  -37.012 101.312 1.00 22.90  ? 160  HIS C C   1 
ATOM   7582  O  O   . HIS C  1 53  ? -7.669  -37.560 100.322 1.00 23.14  ? 160  HIS C O   1 
ATOM   7583  C  CB  . HIS C  1 53  ? -6.954  -34.855 101.638 1.00 20.95  ? 160  HIS C CB  1 
ATOM   7584  C  CG  . HIS C  1 53  ? -8.111  -33.916 101.558 1.00 18.93  ? 160  HIS C CG  1 
ATOM   7585  N  ND1 . HIS C  1 53  ? -9.198  -34.143 100.747 1.00 20.10  ? 160  HIS C ND1 1 
ATOM   7586  C  CD2 . HIS C  1 53  ? -8.354  -32.748 102.194 1.00 19.29  ? 160  HIS C CD2 1 
ATOM   7587  C  CE1 . HIS C  1 53  ? -10.063 -33.153 100.882 1.00 19.23  ? 160  HIS C CE1 1 
ATOM   7588  N  NE2 . HIS C  1 53  ? -9.574  -32.293 101.755 1.00 18.87  ? 160  HIS C NE2 1 
ATOM   7589  N  N   . PRO C  1 54  ? -9.467  -37.114 101.602 1.00 23.21  ? 161  PRO C N   1 
ATOM   7590  C  CA  . PRO C  1 54  ? -10.361 -37.884 100.733 1.00 23.53  ? 161  PRO C CA  1 
ATOM   7591  C  C   . PRO C  1 54  ? -10.311 -37.534 99.247  1.00 23.58  ? 161  PRO C C   1 
ATOM   7592  O  O   . PRO C  1 54  ? -10.664 -38.369 98.411  1.00 26.08  ? 161  PRO C O   1 
ATOM   7593  C  CB  . PRO C  1 54  ? -11.745 -37.659 101.354 1.00 22.73  ? 161  PRO C CB  1 
ATOM   7594  C  CG  . PRO C  1 54  ? -11.587 -36.414 102.181 1.00 23.79  ? 161  PRO C CG  1 
ATOM   7595  C  CD  . PRO C  1 54  ? -10.201 -36.556 102.748 1.00 23.65  ? 161  PRO C CD  1 
ATOM   7596  N  N   . ASP C  1 55  ? -9.859  -36.332 98.901  1.00 21.63  ? 162  ASP C N   1 
ATOM   7597  C  CA  . ASP C  1 55  ? -9.793  -35.966 97.491  1.00 19.85  ? 162  ASP C CA  1 
ATOM   7598  C  C   . ASP C  1 55  ? -8.364  -35.936 96.945  1.00 18.34  ? 162  ASP C C   1 
ATOM   7599  O  O   . ASP C  1 55  ? -8.132  -35.535 95.810  1.00 17.30  ? 162  ASP C O   1 
ATOM   7600  C  CB  . ASP C  1 55  ? -10.480 -34.623 97.267  1.00 20.59  ? 162  ASP C CB  1 
ATOM   7601  C  CG  . ASP C  1 55  ? -11.302 -34.598 95.990  1.00 21.47  ? 162  ASP C CG  1 
ATOM   7602  O  OD1 . ASP C  1 55  ? -11.676 -35.685 95.502  1.00 20.60  ? 162  ASP C OD1 1 
ATOM   7603  O  OD2 . ASP C  1 55  ? -11.592 -33.493 95.482  1.00 22.80  ? 162  ASP C OD2 1 
ATOM   7604  N  N   . LEU C  1 56  ? -7.409  -36.382 97.752  1.00 17.35  ? 163  LEU C N   1 
ATOM   7605  C  CA  . LEU C  1 56  ? -6.013  -36.415 97.336  1.00 16.94  ? 163  LEU C CA  1 
ATOM   7606  C  C   . LEU C  1 56  ? -5.420  -37.817 97.434  1.00 16.49  ? 163  LEU C C   1 
ATOM   7607  O  O   . LEU C  1 56  ? -4.582  -38.203 96.624  1.00 17.59  ? 163  LEU C O   1 
ATOM   7608  C  CB  . LEU C  1 56  ? -5.167  -35.470 98.206  1.00 16.91  ? 163  LEU C CB  1 
ATOM   7609  C  CG  . LEU C  1 56  ? -5.416  -33.966 98.119  1.00 16.43  ? 163  LEU C CG  1 
ATOM   7610  C  CD1 . LEU C  1 56  ? -4.500  -33.241 99.081  1.00 16.29  ? 163  LEU C CD1 1 
ATOM   7611  C  CD2 . LEU C  1 56  ? -5.170  -33.498 96.702  1.00 15.06  ? 163  LEU C CD2 1 
ATOM   7612  N  N   . ALA C  1 57  ? -5.851  -38.572 98.435  1.00 15.64  ? 164  ALA C N   1 
ATOM   7613  C  CA  . ALA C  1 57  ? -5.333  -39.916 98.662  1.00 17.52  ? 164  ALA C CA  1 
ATOM   7614  C  C   . ALA C  1 57  ? -5.195  -40.761 97.392  1.00 17.34  ? 164  ALA C C   1 
ATOM   7615  O  O   . ALA C  1 57  ? -4.178  -41.422 97.176  1.00 15.78  ? 164  ALA C O   1 
ATOM   7616  C  CB  . ALA C  1 57  ? -6.210  -40.625 99.673  1.00 16.57  ? 164  ALA C CB  1 
ATOM   7617  N  N   . GLY C  1 58  ? -6.226  -40.726 96.553  1.00 18.38  ? 165  GLY C N   1 
ATOM   7618  C  CA  . GLY C  1 58  ? -6.207  -41.490 95.322  1.00 18.53  ? 165  GLY C CA  1 
ATOM   7619  C  C   . GLY C  1 58  ? -5.046  -41.186 94.396  1.00 19.71  ? 165  GLY C C   1 
ATOM   7620  O  O   . GLY C  1 58  ? -4.584  -42.075 93.688  1.00 20.99  ? 165  GLY C O   1 
ATOM   7621  N  N   . ASN C  1 59  ? -4.568  -39.944 94.383  1.00 19.74  ? 166  ASN C N   1 
ATOM   7622  C  CA  . ASN C  1 59  ? -3.456  -39.587 93.506  1.00 19.37  ? 166  ASN C CA  1 
ATOM   7623  C  C   . ASN C  1 59  ? -2.167  -39.337 94.258  1.00 19.04  ? 166  ASN C C   1 
ATOM   7624  O  O   . ASN C  1 59  ? -1.152  -39.018 93.649  1.00 19.45  ? 166  ASN C O   1 
ATOM   7625  C  CB  . ASN C  1 59  ? -3.781  -38.340 92.669  1.00 20.02  ? 166  ASN C CB  1 
ATOM   7626  C  CG  . ASN C  1 59  ? -4.887  -38.582 91.654  1.00 20.81  ? 166  ASN C CG  1 
ATOM   7627  O  OD1 . ASN C  1 59  ? -5.041  -39.695 91.139  1.00 22.51  ? 166  ASN C OD1 1 
ATOM   7628  N  ND2 . ASN C  1 59  ? -5.649  -37.538 91.346  1.00 18.51  ? 166  ASN C ND2 1 
ATOM   7629  N  N   . TYR C  1 60  ? -2.196  -39.485 95.575  1.00 18.82  ? 167  TYR C N   1 
ATOM   7630  C  CA  . TYR C  1 60  ? -1.000  -39.237 96.364  1.00 18.40  ? 167  TYR C CA  1 
ATOM   7631  C  C   . TYR C  1 60  ? 0.169   -40.104 95.939  1.00 18.53  ? 167  TYR C C   1 
ATOM   7632  O  O   . TYR C  1 60  ? 0.006   -41.290 95.680  1.00 19.69  ? 167  TYR C O   1 
ATOM   7633  C  CB  . TYR C  1 60  ? -1.271  -39.457 97.847  1.00 17.98  ? 167  TYR C CB  1 
ATOM   7634  C  CG  . TYR C  1 60  ? -0.038  -39.229 98.688  1.00 17.46  ? 167  TYR C CG  1 
ATOM   7635  C  CD1 . TYR C  1 60  ? 0.524   -37.958 98.798  1.00 16.56  ? 167  TYR C CD1 1 
ATOM   7636  C  CD2 . TYR C  1 60  ? 0.588   -40.288 99.343  1.00 16.84  ? 167  TYR C CD2 1 
ATOM   7637  C  CE1 . TYR C  1 60  ? 1.684   -37.746 99.541  1.00 16.57  ? 167  TYR C CE1 1 
ATOM   7638  C  CE2 . TYR C  1 60  ? 1.745   -40.090 100.087 1.00 17.75  ? 167  TYR C CE2 1 
ATOM   7639  C  CZ  . TYR C  1 60  ? 2.288   -38.812 100.179 1.00 18.76  ? 167  TYR C CZ  1 
ATOM   7640  O  OH  . TYR C  1 60  ? 3.447   -38.612 100.895 1.00 20.41  ? 167  TYR C OH  1 
ATOM   7641  N  N   . ASP C  1 61  ? 1.357   -39.508 95.889  1.00 19.12  ? 168  ASP C N   1 
ATOM   7642  C  CA  . ASP C  1 61  ? 2.564   -40.224 95.491  1.00 18.98  ? 168  ASP C CA  1 
ATOM   7643  C  C   . ASP C  1 61  ? 3.688   -39.980 96.501  1.00 19.82  ? 168  ASP C C   1 
ATOM   7644  O  O   . ASP C  1 61  ? 4.262   -38.893 96.569  1.00 20.31  ? 168  ASP C O   1 
ATOM   7645  C  CB  . ASP C  1 61  ? 2.998   -39.771 94.093  1.00 17.62  ? 168  ASP C CB  1 
ATOM   7646  C  CG  . ASP C  1 61  ? 4.260   -40.444 93.629  1.00 18.44  ? 168  ASP C CG  1 
ATOM   7647  O  OD1 . ASP C  1 61  ? 4.832   -41.272 94.367  1.00 19.70  ? 168  ASP C OD1 1 
ATOM   7648  O  OD2 . ASP C  1 61  ? 4.694   -40.147 92.510  1.00 21.42  ? 168  ASP C OD2 1 
ATOM   7649  N  N   . PRO C  1 62  ? 4.019   -41.000 97.301  1.00 19.64  ? 169  PRO C N   1 
ATOM   7650  C  CA  . PRO C  1 62  ? 5.079   -40.865 98.302  1.00 18.86  ? 169  PRO C CA  1 
ATOM   7651  C  C   . PRO C  1 62  ? 6.405   -40.500 97.661  1.00 18.74  ? 169  PRO C C   1 
ATOM   7652  O  O   . PRO C  1 62  ? 7.244   -39.869 98.278  1.00 21.36  ? 169  PRO C O   1 
ATOM   7653  C  CB  . PRO C  1 62  ? 5.132   -42.250 98.939  1.00 18.41  ? 169  PRO C CB  1 
ATOM   7654  C  CG  . PRO C  1 62  ? 3.734   -42.774 98.739  1.00 19.14  ? 169  PRO C CG  1 
ATOM   7655  C  CD  . PRO C  1 62  ? 3.432   -42.347 97.332  1.00 18.39  ? 169  PRO C CD  1 
ATOM   7656  N  N   . GLY C  1 63  ? 6.586   -40.902 96.413  1.00 18.96  ? 170  GLY C N   1 
ATOM   7657  C  CA  . GLY C  1 63  ? 7.834   -40.646 95.720  1.00 18.13  ? 170  GLY C CA  1 
ATOM   7658  C  C   . GLY C  1 63  ? 8.029   -39.216 95.309  1.00 18.66  ? 170  GLY C C   1 
ATOM   7659  O  O   . GLY C  1 63  ? 9.138   -38.809 94.971  1.00 20.61  ? 170  GLY C O   1 
ATOM   7660  N  N   . ALA C  1 64  ? 6.953   -38.447 95.325  1.00 18.62  ? 171  ALA C N   1 
ATOM   7661  C  CA  . ALA C  1 64  ? 7.035   -37.038 94.961  1.00 18.94  ? 171  ALA C CA  1 
ATOM   7662  C  C   . ALA C  1 64  ? 6.911   -36.208 96.240  1.00 18.48  ? 171  ALA C C   1 
ATOM   7663  O  O   . ALA C  1 64  ? 6.664   -35.000 96.204  1.00 17.62  ? 171  ALA C O   1 
ATOM   7664  C  CB  . ALA C  1 64  ? 5.905   -36.684 93.981  1.00 17.73  ? 171  ALA C CB  1 
ATOM   7665  N  N   . SER C  1 65  ? 7.102   -36.869 97.373  1.00 18.42  ? 172  SER C N   1 
ATOM   7666  C  CA  . SER C  1 65  ? 6.966   -36.201 98.653  1.00 19.82  ? 172  SER C CA  1 
ATOM   7667  C  C   . SER C  1 65  ? 8.144   -36.365 99.587  1.00 20.90  ? 172  SER C C   1 
ATOM   7668  O  O   . SER C  1 65  ? 8.930   -37.305 99.466  1.00 22.22  ? 172  SER C O   1 
ATOM   7669  C  CB  . SER C  1 65  ? 5.722   -36.709 99.365  1.00 17.83  ? 172  SER C CB  1 
ATOM   7670  O  OG  . SER C  1 65  ? 4.573   -36.462 98.582  1.00 20.17  ? 172  SER C OG  1 
ATOM   7671  N  N   . PHE C  1 66  ? 8.254   -35.431 100.521 1.00 20.78  ? 173  PHE C N   1 
ATOM   7672  C  CA  . PHE C  1 66  ? 9.296   -35.468 101.527 1.00 21.75  ? 173  PHE C CA  1 
ATOM   7673  C  C   . PHE C  1 66  ? 9.128   -34.327 102.516 1.00 21.59  ? 173  PHE C C   1 
ATOM   7674  O  O   . PHE C  1 66  ? 8.514   -33.306 102.212 1.00 22.10  ? 173  PHE C O   1 
ATOM   7675  C  CB  . PHE C  1 66  ? 10.683  -35.396 100.894 1.00 21.83  ? 173  PHE C CB  1 
ATOM   7676  C  CG  . PHE C  1 66  ? 11.761  -35.938 101.779 1.00 22.93  ? 173  PHE C CG  1 
ATOM   7677  C  CD1 . PHE C  1 66  ? 12.421  -35.112 102.681 1.00 23.68  ? 173  PHE C CD1 1 
ATOM   7678  C  CD2 . PHE C  1 66  ? 12.077  -37.294 101.754 1.00 22.88  ? 173  PHE C CD2 1 
ATOM   7679  C  CE1 . PHE C  1 66  ? 13.388  -35.628 103.556 1.00 25.28  ? 173  PHE C CE1 1 
ATOM   7680  C  CE2 . PHE C  1 66  ? 13.035  -37.825 102.619 1.00 24.74  ? 173  PHE C CE2 1 
ATOM   7681  C  CZ  . PHE C  1 66  ? 13.695  -36.988 103.527 1.00 25.45  ? 173  PHE C CZ  1 
ATOM   7682  N  N   . ASP C  1 67  ? 9.643   -34.518 103.722 1.00 21.61  ? 174  ASP C N   1 
ATOM   7683  C  CA  . ASP C  1 67  ? 9.568   -33.480 104.742 1.00 21.27  ? 174  ASP C CA  1 
ATOM   7684  C  C   . ASP C  1 67  ? 10.993  -33.024 104.993 1.00 20.76  ? 174  ASP C C   1 
ATOM   7685  O  O   . ASP C  1 67  ? 11.725  -33.648 105.747 1.00 20.36  ? 174  ASP C O   1 
ATOM   7686  C  CB  . ASP C  1 67  ? 8.957   -34.034 106.028 1.00 20.55  ? 174  ASP C CB  1 
ATOM   7687  C  CG  . ASP C  1 67  ? 8.877   -32.996 107.126 1.00 20.14  ? 174  ASP C CG  1 
ATOM   7688  O  OD1 . ASP C  1 67  ? 8.145   -33.226 108.115 1.00 19.15  ? 174  ASP C OD1 1 
ATOM   7689  O  OD2 . ASP C  1 67  ? 9.548   -31.950 107.006 1.00 20.46  ? 174  ASP C OD2 1 
ATOM   7690  N  N   . VAL C  1 68  ? 11.390  -31.944 104.336 1.00 21.55  ? 175  VAL C N   1 
ATOM   7691  C  CA  . VAL C  1 68  ? 12.742  -31.433 104.483 1.00 23.57  ? 175  VAL C CA  1 
ATOM   7692  C  C   . VAL C  1 68  ? 12.935  -30.703 105.802 1.00 25.21  ? 175  VAL C C   1 
ATOM   7693  O  O   . VAL C  1 68  ? 14.054  -30.625 106.322 1.00 26.20  ? 175  VAL C O   1 
ATOM   7694  C  CB  . VAL C  1 68  ? 13.098  -30.492 103.337 1.00 23.53  ? 175  VAL C CB  1 
ATOM   7695  C  CG1 . VAL C  1 68  ? 14.505  -29.974 103.518 1.00 25.38  ? 175  VAL C CG1 1 
ATOM   7696  C  CG2 . VAL C  1 68  ? 12.991  -31.235 102.020 1.00 23.65  ? 175  VAL C CG2 1 
ATOM   7697  N  N   . ASN C  1 69  ? 11.843  -30.173 106.342 1.00 25.77  ? 176  ASN C N   1 
ATOM   7698  C  CA  . ASN C  1 69  ? 11.892  -29.461 107.609 1.00 26.72  ? 176  ASN C CA  1 
ATOM   7699  C  C   . ASN C  1 69  ? 12.248  -30.409 108.740 1.00 28.68  ? 176  ASN C C   1 
ATOM   7700  O  O   . ASN C  1 69  ? 12.961  -30.020 109.666 1.00 29.39  ? 176  ASN C O   1 
ATOM   7701  C  CB  . ASN C  1 69  ? 10.548  -28.807 107.906 1.00 25.56  ? 176  ASN C CB  1 
ATOM   7702  C  CG  . ASN C  1 69  ? 10.309  -27.570 107.077 1.00 24.84  ? 176  ASN C CG  1 
ATOM   7703  O  OD1 . ASN C  1 69  ? 9.164   -27.191 106.838 1.00 24.80  ? 176  ASN C OD1 1 
ATOM   7704  N  ND2 . ASN C  1 69  ? 11.385  -26.921 106.647 1.00 23.72  ? 176  ASN C ND2 1 
ATOM   7705  N  N   . ASP C  1 70  ? 11.750  -31.646 108.679 1.00 29.86  ? 177  ASP C N   1 
ATOM   7706  C  CA  . ASP C  1 70  ? 12.057  -32.622 109.721 1.00 29.73  ? 177  ASP C CA  1 
ATOM   7707  C  C   . ASP C  1 70  ? 12.883  -33.799 109.246 1.00 30.49  ? 177  ASP C C   1 
ATOM   7708  O  O   . ASP C  1 70  ? 12.973  -34.810 109.927 1.00 32.91  ? 177  ASP C O   1 
ATOM   7709  C  CB  . ASP C  1 70  ? 10.786  -33.122 110.392 1.00 29.34  ? 177  ASP C CB  1 
ATOM   7710  C  CG  . ASP C  1 70  ? 10.172  -32.083 111.304 1.00 30.23  ? 177  ASP C CG  1 
ATOM   7711  O  OD1 . ASP C  1 70  ? 10.887  -31.577 112.195 0.00 29.96  ? 177  ASP C OD1 1 
ATOM   7712  O  OD2 . ASP C  1 70  ? 8.973   -31.780 111.137 0.00 29.96  ? 177  ASP C OD2 1 
ATOM   7713  N  N   . GLN C  1 71  ? 13.509  -33.660 108.087 1.00 31.20  ? 178  GLN C N   1 
ATOM   7714  C  CA  . GLN C  1 71  ? 14.335  -34.728 107.541 1.00 31.97  ? 178  GLN C CA  1 
ATOM   7715  C  C   . GLN C  1 71  ? 13.635  -36.079 107.704 1.00 32.17  ? 178  GLN C C   1 
ATOM   7716  O  O   . GLN C  1 71  ? 14.160  -36.981 108.351 1.00 33.05  ? 178  GLN C O   1 
ATOM   7717  C  CB  . GLN C  1 71  ? 15.690  -34.754 108.246 1.00 30.77  ? 178  GLN C CB  1 
ATOM   7718  C  CG  . GLN C  1 71  ? 16.493  -33.470 108.104 0.00 31.07  ? 178  GLN C CG  1 
ATOM   7719  C  CD  . GLN C  1 71  ? 17.832  -33.536 108.817 0.00 30.89  ? 178  GLN C CD  1 
ATOM   7720  O  OE1 . GLN C  1 71  ? 18.600  -32.575 108.808 0.00 30.86  ? 178  GLN C OE1 1 
ATOM   7721  N  NE2 . GLN C  1 71  ? 18.118  -34.675 109.438 0.00 30.86  ? 178  GLN C NE2 1 
ATOM   7722  N  N   . ASP C  1 72  ? 12.457  -36.205 107.099 1.00 31.53  ? 179  ASP C N   1 
ATOM   7723  C  CA  . ASP C  1 72  ? 11.654  -37.419 107.168 1.00 31.04  ? 179  ASP C CA  1 
ATOM   7724  C  C   . ASP C  1 72  ? 10.853  -37.542 105.870 1.00 30.38  ? 179  ASP C C   1 
ATOM   7725  O  O   . ASP C  1 72  ? 10.582  -36.541 105.204 1.00 31.56  ? 179  ASP C O   1 
ATOM   7726  C  CB  . ASP C  1 72  ? 10.726  -37.319 108.379 1.00 32.36  ? 179  ASP C CB  1 
ATOM   7727  C  CG  . ASP C  1 72  ? 9.795   -38.503 108.509 1.00 35.43  ? 179  ASP C CG  1 
ATOM   7728  O  OD1 . ASP C  1 72  ? 8.771   -38.537 107.795 1.00 37.43  ? 179  ASP C OD1 1 
ATOM   7729  O  OD2 . ASP C  1 72  ? 10.090  -39.404 109.325 1.00 36.82  ? 179  ASP C OD2 1 
ATOM   7730  N  N   . PRO C  1 73  ? 10.464  -38.767 105.482 1.00 29.21  ? 180  PRO C N   1 
ATOM   7731  C  CA  . PRO C  1 73  ? 9.696   -38.923 104.235 1.00 27.81  ? 180  PRO C CA  1 
ATOM   7732  C  C   . PRO C  1 73  ? 8.219   -38.492 104.261 1.00 26.42  ? 180  PRO C C   1 
ATOM   7733  O  O   . PRO C  1 73  ? 7.625   -38.229 103.212 1.00 26.52  ? 180  PRO C O   1 
ATOM   7734  C  CB  . PRO C  1 73  ? 9.853   -40.412 103.917 1.00 26.51  ? 180  PRO C CB  1 
ATOM   7735  C  CG  . PRO C  1 73  ? 11.117  -40.788 104.619 1.00 26.65  ? 180  PRO C CG  1 
ATOM   7736  C  CD  . PRO C  1 73  ? 11.001  -40.063 105.923 1.00 26.97  ? 180  PRO C CD  1 
ATOM   7737  N  N   . ASP C  1 74  ? 7.632   -38.412 105.449 1.00 25.07  ? 181  ASP C N   1 
ATOM   7738  C  CA  . ASP C  1 74  ? 6.228   -38.040 105.581 1.00 24.19  ? 181  ASP C CA  1 
ATOM   7739  C  C   . ASP C  1 74  ? 6.002   -36.526 105.519 1.00 23.61  ? 181  ASP C C   1 
ATOM   7740  O  O   . ASP C  1 74  ? 6.455   -35.781 106.382 1.00 23.84  ? 181  ASP C O   1 
ATOM   7741  C  CB  . ASP C  1 74  ? 5.683   -38.591 106.891 1.00 25.36  ? 181  ASP C CB  1 
ATOM   7742  C  CG  . ASP C  1 74  ? 4.190   -38.427 107.013 1.00 28.62  ? 181  ASP C CG  1 
ATOM   7743  O  OD1 . ASP C  1 74  ? 3.650   -38.771 108.088 1.00 32.59  ? 181  ASP C OD1 1 
ATOM   7744  O  OD2 . ASP C  1 74  ? 3.555   -37.959 106.045 1.00 29.18  ? 181  ASP C OD2 1 
ATOM   7745  N  N   . PRO C  1 75  ? 5.275   -36.057 104.494 1.00 22.75  ? 182  PRO C N   1 
ATOM   7746  C  CA  . PRO C  1 75  ? 4.970   -34.639 104.285 1.00 20.72  ? 182  PRO C CA  1 
ATOM   7747  C  C   . PRO C  1 75  ? 3.716   -34.118 104.983 1.00 20.25  ? 182  PRO C C   1 
ATOM   7748  O  O   . PRO C  1 75  ? 3.254   -33.026 104.666 1.00 20.72  ? 182  PRO C O   1 
ATOM   7749  C  CB  . PRO C  1 75  ? 4.832   -34.557 102.775 1.00 20.28  ? 182  PRO C CB  1 
ATOM   7750  C  CG  . PRO C  1 75  ? 4.086   -35.819 102.490 1.00 20.40  ? 182  PRO C CG  1 
ATOM   7751  C  CD  . PRO C  1 75  ? 4.825   -36.853 103.334 1.00 21.57  ? 182  PRO C CD  1 
ATOM   7752  N  N   . GLN C  1 76  ? 3.160   -34.880 105.918 1.00 19.78  ? 183  GLN C N   1 
ATOM   7753  C  CA  . GLN C  1 76  ? 1.944   -34.450 106.620 1.00 20.04  ? 183  GLN C CA  1 
ATOM   7754  C  C   . GLN C  1 76  ? 2.155   -33.065 107.214 1.00 19.07  ? 183  GLN C C   1 
ATOM   7755  O  O   . GLN C  1 76  ? 3.183   -32.783 107.815 1.00 18.85  ? 183  GLN C O   1 
ATOM   7756  C  CB  . GLN C  1 76  ? 1.594   -35.443 107.734 1.00 21.75  ? 183  GLN C CB  1 
ATOM   7757  C  CG  . GLN C  1 76  ? 0.177   -35.367 108.269 0.00 24.27  ? 183  GLN C CG  1 
ATOM   7758  C  CD  . GLN C  1 76  ? -0.847  -35.853 107.265 0.00 25.62  ? 183  GLN C CD  1 
ATOM   7759  O  OE1 . GLN C  1 76  ? -0.606  -36.810 106.529 0.00 26.42  ? 183  GLN C OE1 1 
ATOM   7760  N  NE2 . GLN C  1 76  ? -2.006  -35.206 107.240 0.00 26.31  ? 183  GLN C NE2 1 
ATOM   7761  N  N   . PRO C  1 77  ? 1.189   -32.166 107.034 1.00 19.48  ? 184  PRO C N   1 
ATOM   7762  C  CA  . PRO C  1 77  ? 1.350   -30.822 107.591 1.00 19.03  ? 184  PRO C CA  1 
ATOM   7763  C  C   . PRO C  1 77  ? 1.156   -30.803 109.104 1.00 19.12  ? 184  PRO C C   1 
ATOM   7764  O  O   . PRO C  1 77  ? 0.536   -31.707 109.659 1.00 20.24  ? 184  PRO C O   1 
ATOM   7765  C  CB  . PRO C  1 77  ? 0.277   -30.021 106.864 1.00 18.88  ? 184  PRO C CB  1 
ATOM   7766  C  CG  . PRO C  1 77  ? -0.806  -31.040 106.634 1.00 19.72  ? 184  PRO C CG  1 
ATOM   7767  C  CD  . PRO C  1 77  ? -0.022  -32.254 106.198 1.00 20.23  ? 184  PRO C CD  1 
ATOM   7768  N  N   . ARG C  1 78  ? 1.697   -29.776 109.762 1.00 18.55  ? 185  ARG C N   1 
ATOM   7769  C  CA  . ARG C  1 78  ? 1.581   -29.600 111.213 1.00 17.07  ? 185  ARG C CA  1 
ATOM   7770  C  C   . ARG C  1 78  ? 0.255   -28.903 111.503 1.00 17.86  ? 185  ARG C C   1 
ATOM   7771  O  O   . ARG C  1 78  ? 0.032   -27.779 111.052 1.00 17.92  ? 185  ARG C O   1 
ATOM   7772  C  CB  . ARG C  1 78  ? 2.736   -28.739 111.719 1.00 18.26  ? 185  ARG C CB  1 
ATOM   7773  C  CG  . ARG C  1 78  ? 2.720   -28.458 113.211 1.00 16.56  ? 185  ARG C CG  1 
ATOM   7774  C  CD  . ARG C  1 78  ? 4.055   -27.893 113.663 1.00 16.50  ? 185  ARG C CD  1 
ATOM   7775  N  NE  . ARG C  1 78  ? 4.371   -26.630 113.009 1.00 17.64  ? 185  ARG C NE  1 
ATOM   7776  C  CZ  . ARG C  1 78  ? 3.893   -25.446 113.386 1.00 18.30  ? 185  ARG C CZ  1 
ATOM   7777  N  NH1 . ARG C  1 78  ? 4.233   -24.354 112.717 1.00 18.48  ? 185  ARG C NH1 1 
ATOM   7778  N  NH2 . ARG C  1 78  ? 3.090   -25.346 114.437 1.00 17.43  ? 185  ARG C NH2 1 
ATOM   7779  N  N   . TYR C  1 79  ? -0.627  -29.547 112.262 1.00 16.44  ? 186  TYR C N   1 
ATOM   7780  C  CA  . TYR C  1 79  ? -1.935  -28.959 112.525 1.00 16.41  ? 186  TYR C CA  1 
ATOM   7781  C  C   . TYR C  1 79  ? -2.000  -27.939 113.650 1.00 17.19  ? 186  TYR C C   1 
ATOM   7782  O  O   . TYR C  1 79  ? -1.526  -28.185 114.755 1.00 19.37  ? 186  TYR C O   1 
ATOM   7783  C  CB  . TYR C  1 79  ? -2.969  -30.060 112.771 1.00 16.20  ? 186  TYR C CB  1 
ATOM   7784  C  CG  . TYR C  1 79  ? -3.174  -30.948 111.568 1.00 18.08  ? 186  TYR C CG  1 
ATOM   7785  C  CD1 . TYR C  1 79  ? -2.248  -31.943 111.248 1.00 18.57  ? 186  TYR C CD1 1 
ATOM   7786  C  CD2 . TYR C  1 79  ? -4.252  -30.752 110.705 1.00 18.09  ? 186  TYR C CD2 1 
ATOM   7787  C  CE1 . TYR C  1 79  ? -2.385  -32.711 110.100 1.00 18.09  ? 186  TYR C CE1 1 
ATOM   7788  C  CE2 . TYR C  1 79  ? -4.398  -31.521 109.551 1.00 17.03  ? 186  TYR C CE2 1 
ATOM   7789  C  CZ  . TYR C  1 79  ? -3.458  -32.496 109.254 1.00 18.69  ? 186  TYR C CZ  1 
ATOM   7790  O  OH  . TYR C  1 79  ? -3.565  -33.252 108.101 1.00 20.76  ? 186  TYR C OH  1 
ATOM   7791  N  N   . THR C  1 80  ? -2.596  -26.789 113.357 1.00 15.76  ? 187  THR C N   1 
ATOM   7792  C  CA  . THR C  1 80  ? -2.738  -25.729 114.337 1.00 14.92  ? 187  THR C CA  1 
ATOM   7793  C  C   . THR C  1 80  ? -4.171  -25.233 114.245 1.00 16.33  ? 187  THR C C   1 
ATOM   7794  O  O   . THR C  1 80  ? -4.828  -25.431 113.222 1.00 15.86  ? 187  THR C O   1 
ATOM   7795  C  CB  . THR C  1 80  ? -1.736  -24.578 114.075 1.00 13.08  ? 187  THR C CB  1 
ATOM   7796  O  OG1 . THR C  1 80  ? -1.989  -23.971 112.801 1.00 11.54  ? 187  THR C OG1 1 
ATOM   7797  C  CG2 . THR C  1 80  ? -0.322  -25.108 114.106 1.00 9.92   ? 187  THR C CG2 1 
ATOM   7798  N  N   . GLN C  1 81  ? -4.668  -24.594 115.298 1.00 17.27  ? 188  GLN C N   1 
ATOM   7799  C  CA  . GLN C  1 81  ? -6.050  -24.149 115.258 1.00 19.58  ? 188  GLN C CA  1 
ATOM   7800  C  C   . GLN C  1 81  ? -6.383  -23.128 114.204 1.00 19.25  ? 188  GLN C C   1 
ATOM   7801  O  O   . GLN C  1 81  ? -7.521  -23.075 113.737 1.00 18.61  ? 188  GLN C O   1 
ATOM   7802  C  CB  . GLN C  1 81  ? -6.520  -23.685 116.635 1.00 20.50  ? 188  GLN C CB  1 
ATOM   7803  C  CG  . GLN C  1 81  ? -6.873  -24.892 117.552 1.00 25.85  ? 188  GLN C CG  1 
ATOM   7804  C  CD  . GLN C  1 81  ? -7.925  -25.857 116.939 1.00 27.35  ? 188  GLN C CD  1 
ATOM   7805  O  OE1 . GLN C  1 81  ? -9.143  -25.635 117.052 1.00 28.24  ? 188  GLN C OE1 1 
ATOM   7806  N  NE2 . GLN C  1 81  ? -7.448  -26.918 116.279 1.00 25.64  ? 188  GLN C NE2 1 
ATOM   7807  N  N   . MET C  1 82  ? -5.415  -22.315 113.807 1.00 21.19  ? 189  MET C N   1 
ATOM   7808  C  CA  . MET C  1 82  ? -5.710  -21.350 112.755 1.00 22.82  ? 189  MET C CA  1 
ATOM   7809  C  C   . MET C  1 82  ? -5.379  -21.909 111.369 1.00 21.41  ? 189  MET C C   1 
ATOM   7810  O  O   . MET C  1 82  ? -5.407  -21.195 110.381 1.00 20.54  ? 189  MET C O   1 
ATOM   7811  C  CB  . MET C  1 82  ? -4.996  -20.025 113.005 1.00 26.27  ? 189  MET C CB  1 
ATOM   7812  C  CG  . MET C  1 82  ? -5.726  -19.122 113.985 1.00 28.99  ? 189  MET C CG  1 
ATOM   7813  S  SD  . MET C  1 82  ? -4.763  -17.614 114.228 1.00 40.95  ? 189  MET C SD  1 
ATOM   7814  C  CE  . MET C  1 82  ? -3.110  -18.276 114.720 1.00 36.65  ? 189  MET C CE  1 
ATOM   7815  N  N   . ASN C  1 83  ? -5.091  -23.206 111.323 1.00 21.85  ? 190  ASN C N   1 
ATOM   7816  C  CA  . ASN C  1 83  ? -4.807  -23.907 110.085 1.00 22.35  ? 190  ASN C CA  1 
ATOM   7817  C  C   . ASN C  1 83  ? -3.763  -23.199 109.286 1.00 23.39  ? 190  ASN C C   1 
ATOM   7818  O  O   . ASN C  1 83  ? -3.859  -23.055 108.067 1.00 24.25  ? 190  ASN C O   1 
ATOM   7819  C  CB  . ASN C  1 83  ? -6.089  -24.037 109.291 1.00 20.81  ? 190  ASN C CB  1 
ATOM   7820  C  CG  . ASN C  1 83  ? -7.111  -24.851 110.025 1.00 21.52  ? 190  ASN C CG  1 
ATOM   7821  O  OD1 . ASN C  1 83  ? -8.320  -24.712 109.812 1.00 23.58  ? 190  ASN C OD1 1 
ATOM   7822  N  ND2 . ASN C  1 83  ? -6.632  -25.721 110.908 1.00 19.46  ? 190  ASN C ND2 1 
ATOM   7823  N  N   . ASP C  1 84  ? -2.731  -22.780 109.987 1.00 23.98  ? 191  ASP C N   1 
ATOM   7824  C  CA  . ASP C  1 84  ? -1.675  -22.057 109.335 1.00 22.90  ? 191  ASP C CA  1 
ATOM   7825  C  C   . ASP C  1 84  ? -1.027  -22.835 108.226 1.00 22.25  ? 191  ASP C C   1 
ATOM   7826  O  O   . ASP C  1 84  ? -0.615  -22.247 107.240 1.00 24.07  ? 191  ASP C O   1 
ATOM   7827  C  CB  . ASP C  1 84  ? -0.632  -21.651 110.357 1.00 24.90  ? 191  ASP C CB  1 
ATOM   7828  C  CG  . ASP C  1 84  ? -1.219  -20.805 111.458 1.00 28.77  ? 191  ASP C CG  1 
ATOM   7829  O  OD1 . ASP C  1 84  ? -1.492  -19.606 111.196 1.00 29.64  ? 191  ASP C OD1 1 
ATOM   7830  O  OD2 . ASP C  1 84  ? -1.429  -21.346 112.577 1.00 31.33  ? 191  ASP C OD2 1 
ATOM   7831  N  N   . ASN C  1 85  ? -0.944  -24.155 108.360 1.00 20.84  ? 192  ASN C N   1 
ATOM   7832  C  CA  . ASN C  1 85  ? -0.277  -24.971 107.339 1.00 19.30  ? 192  ASN C CA  1 
ATOM   7833  C  C   . ASN C  1 85  ? -1.182  -25.705 106.346 1.00 18.20  ? 192  ASN C C   1 
ATOM   7834  O  O   . ASN C  1 85  ? -0.956  -26.866 106.022 1.00 16.31  ? 192  ASN C O   1 
ATOM   7835  C  CB  . ASN C  1 85  ? 0.667   -25.951 108.031 1.00 18.98  ? 192  ASN C CB  1 
ATOM   7836  C  CG  . ASN C  1 85  ? 1.658   -25.242 108.930 1.00 20.22  ? 192  ASN C CG  1 
ATOM   7837  O  OD1 . ASN C  1 85  ? 2.362   -24.341 108.485 1.00 21.07  ? 192  ASN C OD1 1 
ATOM   7838  N  ND2 . ASN C  1 85  ? 1.712   -25.634 110.202 1.00 20.29  ? 192  ASN C ND2 1 
ATOM   7839  N  N   . ARG C  1 86  ? -2.185  -24.992 105.844 1.00 17.17  ? 193  ARG C N   1 
ATOM   7840  C  CA  . ARG C  1 86  ? -3.140  -25.538 104.895 1.00 16.63  ? 193  ARG C CA  1 
ATOM   7841  C  C   . ARG C  1 86  ? -2.737  -25.192 103.473 1.00 16.77  ? 193  ARG C C   1 
ATOM   7842  O  O   . ARG C  1 86  ? -3.309  -25.708 102.517 1.00 17.17  ? 193  ARG C O   1 
ATOM   7843  C  CB  . ARG C  1 86  ? -4.509  -24.931 105.151 1.00 15.66  ? 193  ARG C CB  1 
ATOM   7844  C  CG  . ARG C  1 86  ? -4.552  -23.473 104.797 1.00 14.69  ? 193  ARG C CG  1 
ATOM   7845  C  CD  . ARG C  1 86  ? -5.829  -22.809 105.231 1.00 14.50  ? 193  ARG C CD  1 
ATOM   7846  N  NE  . ARG C  1 86  ? -5.877  -21.435 104.750 1.00 16.92  ? 193  ARG C NE  1 
ATOM   7847  C  CZ  . ARG C  1 86  ? -6.784  -20.536 105.126 1.00 18.19  ? 193  ARG C CZ  1 
ATOM   7848  N  NH1 . ARG C  1 86  ? -7.728  -20.865 106.002 1.00 17.89  ? 193  ARG C NH1 1 
ATOM   7849  N  NH2 . ARG C  1 86  ? -6.756  -19.310 104.615 1.00 16.13  ? 193  ARG C NH2 1 
ATOM   7850  N  N   . HIS C  1 87  ? -1.745  -24.318 103.348 1.00 16.21  ? 194  HIS C N   1 
ATOM   7851  C  CA  . HIS C  1 87  ? -1.282  -23.834 102.056 1.00 15.26  ? 194  HIS C CA  1 
ATOM   7852  C  C   . HIS C  1 87  ? -0.955  -24.935 101.057 1.00 15.79  ? 194  HIS C C   1 
ATOM   7853  O  O   . HIS C  1 87  ? -1.474  -24.934 99.946  1.00 16.55  ? 194  HIS C O   1 
ATOM   7854  C  CB  . HIS C  1 87  ? -0.071  -22.900 102.261 1.00 14.19  ? 194  HIS C CB  1 
ATOM   7855  C  CG  . HIS C  1 87  ? 0.061   -21.827 101.219 1.00 13.73  ? 194  HIS C CG  1 
ATOM   7856  N  ND1 . HIS C  1 87  ? 0.926   -21.924 100.142 1.00 13.44  ? 194  HIS C ND1 1 
ATOM   7857  C  CD2 . HIS C  1 87  ? -0.568  -20.633 101.085 1.00 13.20  ? 194  HIS C CD2 1 
ATOM   7858  C  CE1 . HIS C  1 87  ? 0.828   -20.838 99.396  1.00 11.63  ? 194  HIS C CE1 1 
ATOM   7859  N  NE2 . HIS C  1 87  ? -0.070  -20.047 99.951  1.00 11.82  ? 194  HIS C NE2 1 
ATOM   7860  N  N   . GLY C  1 88  ? -0.104  -25.874 101.447 1.00 16.37  ? 195  GLY C N   1 
ATOM   7861  C  CA  . GLY C  1 88  ? 0.271   -26.946 100.541 1.00 16.79  ? 195  GLY C CA  1 
ATOM   7862  C  C   . GLY C  1 88  ? -0.885  -27.810 100.073 1.00 16.84  ? 195  GLY C C   1 
ATOM   7863  O  O   . GLY C  1 88  ? -0.987  -28.138 98.889  1.00 19.58  ? 195  GLY C O   1 
ATOM   7864  N  N   . THR C  1 89  ? -1.760  -28.181 100.998 1.00 15.82  ? 196  THR C N   1 
ATOM   7865  C  CA  . THR C  1 89  ? -2.903  -29.023 100.675 1.00 15.08  ? 196  THR C CA  1 
ATOM   7866  C  C   . THR C  1 89  ? -3.813  -28.347 99.656  1.00 16.42  ? 196  THR C C   1 
ATOM   7867  O  O   . THR C  1 89  ? -4.286  -28.979 98.712  1.00 16.40  ? 196  THR C O   1 
ATOM   7868  C  CB  . THR C  1 89  ? -3.697  -29.367 101.962 1.00 14.58  ? 196  THR C CB  1 
ATOM   7869  O  OG1 . THR C  1 89  ? -2.884  -30.184 102.813 1.00 11.45  ? 196  THR C OG1 1 
ATOM   7870  C  CG2 . THR C  1 89  ? -4.984  -30.104 101.638 1.00 11.74  ? 196  THR C CG2 1 
ATOM   7871  N  N   . ARG C  1 90  ? -4.055  -27.055 99.844  1.00 17.05  ? 197  ARG C N   1 
ATOM   7872  C  CA  . ARG C  1 90  ? -4.896  -26.316 98.921  1.00 16.59  ? 197  ARG C CA  1 
ATOM   7873  C  C   . ARG C  1 90  ? -4.306  -26.330 97.517  1.00 17.14  ? 197  ARG C C   1 
ATOM   7874  O  O   . ARG C  1 90  ? -5.034  -26.479 96.537  1.00 19.47  ? 197  ARG C O   1 
ATOM   7875  C  CB  . ARG C  1 90  ? -5.073  -24.879 99.402  1.00 15.97  ? 197  ARG C CB  1 
ATOM   7876  C  CG  . ARG C  1 90  ? -5.889  -24.787 100.680 1.00 15.95  ? 197  ARG C CG  1 
ATOM   7877  C  CD  . ARG C  1 90  ? -6.342  -23.375 101.000 1.00 14.37  ? 197  ARG C CD  1 
ATOM   7878  N  NE  . ARG C  1 90  ? -7.313  -23.382 102.088 1.00 16.40  ? 197  ARG C NE  1 
ATOM   7879  C  CZ  . ARG C  1 90  ? -8.004  -22.319 102.494 1.00 18.79  ? 197  ARG C CZ  1 
ATOM   7880  N  NH1 . ARG C  1 90  ? -8.867  -22.427 103.491 1.00 18.91  ? 197  ARG C NH1 1 
ATOM   7881  N  NH2 . ARG C  1 90  ? -7.843  -21.146 101.902 1.00 18.25  ? 197  ARG C NH2 1 
ATOM   7882  N  N   . CYS C  1 91  ? -2.992  -26.189 97.414  1.00 16.55  ? 198  CYS C N   1 
ATOM   7883  C  CA  . CYS C  1 91  ? -2.349  -26.186 96.109  1.00 16.75  ? 198  CYS C CA  1 
ATOM   7884  C  C   . CYS C  1 91  ? -2.394  -27.560 95.466  1.00 18.01  ? 198  CYS C C   1 
ATOM   7885  O  O   . CYS C  1 91  ? -2.561  -27.674 94.255  1.00 19.41  ? 198  CYS C O   1 
ATOM   7886  C  CB  . CYS C  1 91  ? -0.905  -25.732 96.237  1.00 15.42  ? 198  CYS C CB  1 
ATOM   7887  S  SG  . CYS C  1 91  ? -0.750  -24.004 96.707  1.00 19.10  ? 198  CYS C SG  1 
ATOM   7888  N  N   . ALA C  1 92  ? -2.237  -28.602 96.275  1.00 17.72  ? 199  ALA C N   1 
ATOM   7889  C  CA  . ALA C  1 92  ? -2.261  -29.964 95.771  1.00 17.12  ? 199  ALA C CA  1 
ATOM   7890  C  C   . ALA C  1 92  ? -3.591  -30.250 95.074  1.00 17.65  ? 199  ALA C C   1 
ATOM   7891  O  O   . ALA C  1 92  ? -3.631  -30.733 93.949  1.00 18.06  ? 199  ALA C O   1 
ATOM   7892  C  CB  . ALA C  1 92  ? -2.058  -30.939 96.921  1.00 17.35  ? 199  ALA C CB  1 
ATOM   7893  N  N   . GLY C  1 93  ? -4.684  -29.935 95.749  1.00 18.33  ? 200  GLY C N   1 
ATOM   7894  C  CA  . GLY C  1 93  ? -5.993  -30.185 95.182  1.00 19.47  ? 200  GLY C CA  1 
ATOM   7895  C  C   . GLY C  1 93  ? -6.246  -29.533 93.841  1.00 20.64  ? 200  GLY C C   1 
ATOM   7896  O  O   . GLY C  1 93  ? -6.957  -30.087 93.007  1.00 22.25  ? 200  GLY C O   1 
ATOM   7897  N  N   . GLU C  1 94  ? -5.676  -28.354 93.621  1.00 20.61  ? 201  GLU C N   1 
ATOM   7898  C  CA  . GLU C  1 94  ? -5.891  -27.656 92.362  1.00 20.11  ? 201  GLU C CA  1 
ATOM   7899  C  C   . GLU C  1 94  ? -5.173  -28.351 91.222  1.00 19.08  ? 201  GLU C C   1 
ATOM   7900  O  O   . GLU C  1 94  ? -5.615  -28.296 90.074  1.00 19.26  ? 201  GLU C O   1 
ATOM   7901  C  CB  . GLU C  1 94  ? -5.433  -26.210 92.492  1.00 20.32  ? 201  GLU C CB  1 
ATOM   7902  C  CG  . GLU C  1 94  ? -5.959  -25.605 93.757  1.00 23.18  ? 201  GLU C CG  1 
ATOM   7903  C  CD  . GLU C  1 94  ? -5.475  -24.211 94.001  1.00 24.50  ? 201  GLU C CD  1 
ATOM   7904  O  OE1 . GLU C  1 94  ? -4.260  -23.962 93.881  1.00 24.37  ? 201  GLU C OE1 1 
ATOM   7905  O  OE2 . GLU C  1 94  ? -6.322  -23.364 94.339  1.00 27.30  ? 201  GLU C OE2 1 
ATOM   7906  N  N   . VAL C  1 95  ? -4.075  -29.019 91.541  1.00 17.70  ? 202  VAL C N   1 
ATOM   7907  C  CA  . VAL C  1 95  ? -3.322  -29.729 90.529  1.00 17.15  ? 202  VAL C CA  1 
ATOM   7908  C  C   . VAL C  1 95  ? -3.964  -31.092 90.242  1.00 18.37  ? 202  VAL C C   1 
ATOM   7909  O  O   . VAL C  1 95  ? -4.301  -31.405 89.095  1.00 18.37  ? 202  VAL C O   1 
ATOM   7910  C  CB  . VAL C  1 95  ? -1.839  -29.964 90.975  1.00 15.70  ? 202  VAL C CB  1 
ATOM   7911  C  CG1 . VAL C  1 95  ? -1.079  -30.727 89.894  1.00 13.89  ? 202  VAL C CG1 1 
ATOM   7912  C  CG2 . VAL C  1 95  ? -1.150  -28.645 91.253  1.00 14.16  ? 202  VAL C CG2 1 
ATOM   7913  N  N   . ALA C  1 96  ? -4.166  -31.886 91.290  1.00 17.50  ? 203  ALA C N   1 
ATOM   7914  C  CA  . ALA C  1 96  ? -4.681  -33.219 91.092  1.00 16.78  ? 203  ALA C CA  1 
ATOM   7915  C  C   . ALA C  1 96  ? -5.722  -33.761 92.064  1.00 17.59  ? 203  ALA C C   1 
ATOM   7916  O  O   . ALA C  1 96  ? -5.611  -34.903 92.512  1.00 17.44  ? 203  ALA C O   1 
ATOM   7917  C  CB  . ALA C  1 96  ? -3.510  -34.170 91.025  1.00 15.59  ? 203  ALA C CB  1 
ATOM   7918  N  N   . ALA C  1 97  ? -6.733  -32.975 92.406  1.00 18.21  ? 204  ALA C N   1 
ATOM   7919  C  CA  . ALA C  1 97  ? -7.760  -33.506 93.297  1.00 18.38  ? 204  ALA C CA  1 
ATOM   7920  C  C   . ALA C  1 97  ? -8.439  -34.603 92.487  1.00 18.63  ? 204  ALA C C   1 
ATOM   7921  O  O   . ALA C  1 97  ? -8.650  -34.441 91.288  1.00 19.84  ? 204  ALA C O   1 
ATOM   7922  C  CB  . ALA C  1 97  ? -8.763  -32.432 93.660  1.00 18.56  ? 204  ALA C CB  1 
ATOM   7923  N  N   . VAL C  1 98  ? -8.776  -35.714 93.132  1.00 19.43  ? 205  VAL C N   1 
ATOM   7924  C  CA  . VAL C  1 98  ? -9.420  -36.835 92.448  1.00 19.56  ? 205  VAL C CA  1 
ATOM   7925  C  C   . VAL C  1 98  ? -10.791 -36.494 91.851  1.00 20.16  ? 205  VAL C C   1 
ATOM   7926  O  O   . VAL C  1 98  ? -11.603 -35.790 92.461  1.00 18.38  ? 205  VAL C O   1 
ATOM   7927  C  CB  . VAL C  1 98  ? -9.583  -38.036 93.392  1.00 18.97  ? 205  VAL C CB  1 
ATOM   7928  C  CG1 . VAL C  1 98  ? -10.276 -39.170 92.671  1.00 17.24  ? 205  VAL C CG1 1 
ATOM   7929  C  CG2 . VAL C  1 98  ? -8.229  -38.484 93.889  1.00 18.19  ? 205  VAL C CG2 1 
ATOM   7930  N  N   . ALA C  1 99  ? -11.042 -37.022 90.656  1.00 20.95  ? 206  ALA C N   1 
ATOM   7931  C  CA  . ALA C  1 99  ? -12.296 -36.773 89.946  1.00 21.98  ? 206  ALA C CA  1 
ATOM   7932  C  C   . ALA C  1 99  ? -13.317 -37.893 90.053  1.00 21.95  ? 206  ALA C C   1 
ATOM   7933  O  O   . ALA C  1 99  ? -12.971 -39.048 90.260  1.00 22.47  ? 206  ALA C O   1 
ATOM   7934  C  CB  . ALA C  1 99  ? -12.008 -36.504 88.471  1.00 22.36  ? 206  ALA C CB  1 
ATOM   7935  N  N   . ASN C  1 100 ? -14.586 -37.529 89.904  1.00 23.10  ? 207  ASN C N   1 
ATOM   7936  C  CA  . ASN C  1 100 ? -15.687 -38.491 89.941  1.00 23.84  ? 207  ASN C CA  1 
ATOM   7937  C  C   . ASN C  1 100 ? -15.687 -39.380 91.173  1.00 23.42  ? 207  ASN C C   1 
ATOM   7938  O  O   . ASN C  1 100 ? -15.944 -40.572 91.074  1.00 23.96  ? 207  ASN C O   1 
ATOM   7939  C  CB  . ASN C  1 100 ? -15.646 -39.376 88.691  1.00 23.69  ? 207  ASN C CB  1 
ATOM   7940  C  CG  . ASN C  1 100 ? -15.741 -38.574 87.402  1.00 24.72  ? 207  ASN C CG  1 
ATOM   7941  O  OD1 . ASN C  1 100 ? -16.727 -37.861 87.169  1.00 26.71  ? 207  ASN C OD1 1 
ATOM   7942  N  ND2 . ASN C  1 100 ? -14.713 -38.683 86.559  1.00 22.87  ? 207  ASN C ND2 1 
ATOM   7943  N  N   . ASN C  1 101 ? -15.395 -38.808 92.331  1.00 23.28  ? 208  ASN C N   1 
ATOM   7944  C  CA  . ASN C  1 101 ? -15.382 -39.596 93.543  1.00 22.33  ? 208  ASN C CA  1 
ATOM   7945  C  C   . ASN C  1 101 ? -16.359 -38.996 94.529  1.00 21.55  ? 208  ASN C C   1 
ATOM   7946  O  O   . ASN C  1 101 ? -16.319 -39.287 95.713  1.00 21.98  ? 208  ASN C O   1 
ATOM   7947  C  CB  . ASN C  1 101 ? -13.970 -39.654 94.127  1.00 22.83  ? 208  ASN C CB  1 
ATOM   7948  C  CG  . ASN C  1 101 ? -13.478 -38.311 94.596  1.00 23.36  ? 208  ASN C CG  1 
ATOM   7949  O  OD1 . ASN C  1 101 ? -13.949 -37.267 94.144  1.00 24.70  ? 208  ASN C OD1 1 
ATOM   7950  N  ND2 . ASN C  1 101 ? -12.509 -38.326 95.503  1.00 23.48  ? 208  ASN C ND2 1 
ATOM   7951  N  N   . GLY C  1 102 ? -17.247 -38.155 94.023  1.00 22.04  ? 209  GLY C N   1 
ATOM   7952  C  CA  . GLY C  1 102 ? -18.249 -37.539 94.875  1.00 24.07  ? 209  GLY C CA  1 
ATOM   7953  C  C   . GLY C  1 102 ? -17.732 -36.634 95.979  1.00 24.54  ? 209  GLY C C   1 
ATOM   7954  O  O   . GLY C  1 102 ? -18.448 -36.339 96.938  1.00 25.81  ? 209  GLY C O   1 
ATOM   7955  N  N   . VAL C  1 103 ? -16.492 -36.184 95.855  1.00 23.80  ? 210  VAL C N   1 
ATOM   7956  C  CA  . VAL C  1 103 ? -15.926 -35.315 96.861  1.00 22.65  ? 210  VAL C CA  1 
ATOM   7957  C  C   . VAL C  1 103 ? -15.384 -34.027 96.273  1.00 23.43  ? 210  VAL C C   1 
ATOM   7958  O  O   . VAL C  1 103 ? -14.686 -34.031 95.253  1.00 22.17  ? 210  VAL C O   1 
ATOM   7959  C  CB  . VAL C  1 103 ? -14.791 -36.005 97.614  1.00 22.84  ? 210  VAL C CB  1 
ATOM   7960  C  CG1 . VAL C  1 103 ? -14.212 -35.054 98.648  1.00 20.94  ? 210  VAL C CG1 1 
ATOM   7961  C  CG2 . VAL C  1 103 ? -15.297 -37.281 98.266  1.00 21.64  ? 210  VAL C CG2 1 
ATOM   7962  N  N   . CYS C  1 104 ? -15.730 -32.922 96.926  1.00 23.41  ? 211  CYS C N   1 
ATOM   7963  C  CA  . CYS C  1 104 ? -15.266 -31.602 96.530  1.00 24.78  ? 211  CYS C CA  1 
ATOM   7964  C  C   . CYS C  1 104 ? -15.318 -31.393 95.004  1.00 24.16  ? 211  CYS C C   1 
ATOM   7965  O  O   . CYS C  1 104 ? -16.365 -31.583 94.382  1.00 24.93  ? 211  CYS C O   1 
ATOM   7966  C  CB  . CYS C  1 104 ? -13.840 -31.421 97.068  1.00 27.33  ? 211  CYS C CB  1 
ATOM   7967  S  SG  . CYS C  1 104 ? -13.234 -29.720 97.348  1.00 31.79  ? 211  CYS C SG  1 
ATOM   7968  N  N   . GLY C  1 105 ? -14.195 -30.990 94.412  1.00 21.57  ? 212  GLY C N   1 
ATOM   7969  C  CA  . GLY C  1 105 ? -14.149 -30.765 92.983  1.00 18.95  ? 212  GLY C CA  1 
ATOM   7970  C  C   . GLY C  1 105 ? -13.127 -31.665 92.323  1.00 19.14  ? 212  GLY C C   1 
ATOM   7971  O  O   . GLY C  1 105 ? -12.999 -32.839 92.676  1.00 19.70  ? 212  GLY C O   1 
ATOM   7972  N  N   . VAL C  1 106 ? -12.404 -31.129 91.348  1.00 18.38  ? 213  VAL C N   1 
ATOM   7973  C  CA  . VAL C  1 106 ? -11.374 -31.902 90.659  1.00 18.19  ? 213  VAL C CA  1 
ATOM   7974  C  C   . VAL C  1 106 ? -10.177 -31.009 90.348  1.00 18.53  ? 213  VAL C C   1 
ATOM   7975  O  O   . VAL C  1 106 ? -10.304 -29.789 90.296  1.00 18.66  ? 213  VAL C O   1 
ATOM   7976  C  CB  . VAL C  1 106 ? -11.890 -32.487 89.320  1.00 17.70  ? 213  VAL C CB  1 
ATOM   7977  C  CG1 . VAL C  1 106 ? -13.203 -33.182 89.535  1.00 17.69  ? 213  VAL C CG1 1 
ATOM   7978  C  CG2 . VAL C  1 106 ? -12.028 -31.387 88.271  1.00 17.65  ? 213  VAL C CG2 1 
ATOM   7979  N  N   . GLY C  1 107 ? -9.019  -31.621 90.143  1.00 18.57  ? 214  GLY C N   1 
ATOM   7980  C  CA  . GLY C  1 107 ? -7.834  -30.858 89.807  1.00 18.05  ? 214  GLY C CA  1 
ATOM   7981  C  C   . GLY C  1 107 ? -7.726  -30.770 88.297  1.00 17.45  ? 214  GLY C C   1 
ATOM   7982  O  O   . GLY C  1 107 ? -8.402  -31.508 87.593  1.00 17.12  ? 214  GLY C O   1 
ATOM   7983  N  N   . VAL C  1 108 ? -6.897  -29.864 87.795  1.00 18.05  ? 215  VAL C N   1 
ATOM   7984  C  CA  . VAL C  1 108 ? -6.734  -29.716 86.358  1.00 17.98  ? 215  VAL C CA  1 
ATOM   7985  C  C   . VAL C  1 108 ? -6.262  -31.036 85.759  1.00 17.98  ? 215  VAL C C   1 
ATOM   7986  O  O   . VAL C  1 108 ? -6.759  -31.472 84.726  1.00 19.19  ? 215  VAL C O   1 
ATOM   7987  C  CB  . VAL C  1 108 ? -5.713  -28.629 86.026  1.00 18.54  ? 215  VAL C CB  1 
ATOM   7988  C  CG1 . VAL C  1 108 ? -5.499  -28.577 84.519  1.00 19.72  ? 215  VAL C CG1 1 
ATOM   7989  C  CG2 . VAL C  1 108 ? -6.199  -27.285 86.549  1.00 18.10  ? 215  VAL C CG2 1 
ATOM   7990  N  N   . ALA C  1 109 ? -5.295  -31.664 86.413  1.00 16.44  ? 216  ALA C N   1 
ATOM   7991  C  CA  . ALA C  1 109 ? -4.765  -32.936 85.956  1.00 16.03  ? 216  ALA C CA  1 
ATOM   7992  C  C   . ALA C  1 109 ? -5.221  -33.967 86.973  1.00 17.18  ? 216  ALA C C   1 
ATOM   7993  O  O   . ALA C  1 109 ? -4.407  -34.504 87.728  1.00 17.34  ? 216  ALA C O   1 
ATOM   7994  C  CB  . ALA C  1 109 ? -3.248  -32.882 85.912  1.00 13.85  ? 216  ALA C CB  1 
ATOM   7995  N  N   . TYR C  1 110 ? -6.520  -34.249 86.987  1.00 17.59  ? 217  TYR C N   1 
ATOM   7996  C  CA  . TYR C  1 110 ? -7.076  -35.182 87.951  1.00 18.78  ? 217  TYR C CA  1 
ATOM   7997  C  C   . TYR C  1 110 ? -6.623  -36.635 87.885  1.00 19.23  ? 217  TYR C C   1 
ATOM   7998  O  O   . TYR C  1 110 ? -7.027  -37.436 88.720  1.00 18.99  ? 217  TYR C O   1 
ATOM   7999  C  CB  . TYR C  1 110 ? -8.602  -35.097 87.951  1.00 20.77  ? 217  TYR C CB  1 
ATOM   8000  C  CG  . TYR C  1 110 ? -9.291  -35.375 86.633  1.00 22.80  ? 217  TYR C CG  1 
ATOM   8001  C  CD1 . TYR C  1 110 ? -9.333  -36.666 86.102  1.00 23.29  ? 217  TYR C CD1 1 
ATOM   8002  C  CD2 . TYR C  1 110 ? -9.973  -34.359 85.956  1.00 22.94  ? 217  TYR C CD2 1 
ATOM   8003  C  CE1 . TYR C  1 110 ? -10.046 -36.940 84.938  1.00 23.99  ? 217  TYR C CE1 1 
ATOM   8004  C  CE2 . TYR C  1 110 ? -10.687 -34.621 84.789  1.00 23.31  ? 217  TYR C CE2 1 
ATOM   8005  C  CZ  . TYR C  1 110 ? -10.723 -35.920 84.286  1.00 24.40  ? 217  TYR C CZ  1 
ATOM   8006  O  OH  . TYR C  1 110 ? -11.454 -36.218 83.153  1.00 23.94  ? 217  TYR C OH  1 
ATOM   8007  N  N   . ASN C  1 111 ? -5.782  -36.981 86.914  1.00 19.59  ? 218  ASN C N   1 
ATOM   8008  C  CA  . ASN C  1 111 ? -5.264  -38.344 86.847  1.00 20.43  ? 218  ASN C CA  1 
ATOM   8009  C  C   . ASN C  1 111 ? -3.763  -38.361 87.047  1.00 21.13  ? 218  ASN C C   1 
ATOM   8010  O  O   . ASN C  1 111 ? -3.120  -39.392 86.871  1.00 23.04  ? 218  ASN C O   1 
ATOM   8011  C  CB  . ASN C  1 111 ? -5.596  -39.029 85.518  1.00 19.64  ? 218  ASN C CB  1 
ATOM   8012  C  CG  . ASN C  1 111 ? -6.997  -39.558 85.486  1.00 19.13  ? 218  ASN C CG  1 
ATOM   8013  O  OD1 . ASN C  1 111 ? -7.437  -40.231 86.421  1.00 19.83  ? 218  ASN C OD1 1 
ATOM   8014  N  ND2 . ASN C  1 111 ? -7.714  -39.263 84.416  1.00 19.25  ? 218  ASN C ND2 1 
ATOM   8015  N  N   . ALA C  1 112 ? -3.197  -37.216 87.409  1.00 21.25  ? 219  ALA C N   1 
ATOM   8016  C  CA  . ALA C  1 112 ? -1.761  -37.132 87.639  1.00 20.50  ? 219  ALA C CA  1 
ATOM   8017  C  C   . ALA C  1 112 ? -1.492  -37.586 89.064  1.00 20.44  ? 219  ALA C C   1 
ATOM   8018  O  O   . ALA C  1 112 ? -2.417  -37.720 89.868  1.00 19.13  ? 219  ALA C O   1 
ATOM   8019  C  CB  . ALA C  1 112 ? -1.286  -35.704 87.460  1.00 18.79  ? 219  ALA C CB  1 
ATOM   8020  N  N   . ARG C  1 113 ? -0.229  -37.845 89.375  1.00 20.99  ? 220  ARG C N   1 
ATOM   8021  C  CA  . ARG C  1 113 ? 0.112   -38.230 90.731  1.00 21.86  ? 220  ARG C CA  1 
ATOM   8022  C  C   . ARG C  1 113 ? 0.598   -36.951 91.414  1.00 20.53  ? 220  ARG C C   1 
ATOM   8023  O  O   . ARG C  1 113 ? 1.330   -36.146 90.826  1.00 18.50  ? 220  ARG C O   1 
ATOM   8024  C  CB  . ARG C  1 113 ? 1.184   -39.322 90.749  1.00 26.27  ? 220  ARG C CB  1 
ATOM   8025  C  CG  . ARG C  1 113 ? 0.739   -40.634 90.091  1.00 30.63  ? 220  ARG C CG  1 
ATOM   8026  C  CD  . ARG C  1 113 ? 1.559   -41.824 90.576  1.00 33.96  ? 220  ARG C CD  1 
ATOM   8027  N  NE  . ARG C  1 113 ? 1.049   -42.329 91.850  1.00 39.49  ? 220  ARG C NE  1 
ATOM   8028  C  CZ  . ARG C  1 113 ? 1.678   -43.214 92.630  1.00 42.11  ? 220  ARG C CZ  1 
ATOM   8029  N  NH1 . ARG C  1 113 ? 1.117   -43.604 93.772  1.00 42.13  ? 220  ARG C NH1 1 
ATOM   8030  N  NH2 . ARG C  1 113 ? 2.869   -43.705 92.284  1.00 42.00  ? 220  ARG C NH2 1 
ATOM   8031  N  N   . ILE C  1 114 ? 0.163   -36.750 92.649  1.00 18.98  ? 221  ILE C N   1 
ATOM   8032  C  CA  . ILE C  1 114 ? 0.528   -35.547 93.365  1.00 17.92  ? 221  ILE C CA  1 
ATOM   8033  C  C   . ILE C  1 114 ? 1.289   -35.824 94.646  1.00 18.34  ? 221  ILE C C   1 
ATOM   8034  O  O   . ILE C  1 114 ? 0.930   -36.699 95.423  1.00 19.05  ? 221  ILE C O   1 
ATOM   8035  C  CB  . ILE C  1 114 ? -0.710  -34.738 93.697  1.00 15.91  ? 221  ILE C CB  1 
ATOM   8036  C  CG1 . ILE C  1 114 ? -0.307  -33.352 94.186  1.00 15.31  ? 221  ILE C CG1 1 
ATOM   8037  C  CG2 . ILE C  1 114 ? -1.539  -35.479 94.711  1.00 15.15  ? 221  ILE C CG2 1 
ATOM   8038  C  CD1 . ILE C  1 114 ? 0.368   -32.517 93.126  1.00 16.09  ? 221  ILE C CD1 1 
ATOM   8039  N  N   . GLY C  1 115 ? 2.354   -35.068 94.856  1.00 18.87  ? 222  GLY C N   1 
ATOM   8040  C  CA  . GLY C  1 115 ? 3.152   -35.230 96.054  1.00 18.49  ? 222  GLY C CA  1 
ATOM   8041  C  C   . GLY C  1 115 ? 3.353   -33.879 96.711  1.00 18.16  ? 222  GLY C C   1 
ATOM   8042  O  O   . GLY C  1 115 ? 2.975   -32.838 96.161  1.00 18.32  ? 222  GLY C O   1 
ATOM   8043  N  N   . GLY C  1 116 ? 3.946   -33.884 97.893  1.00 17.92  ? 223  GLY C N   1 
ATOM   8044  C  CA  . GLY C  1 116 ? 4.181   -32.631 98.585  1.00 17.70  ? 223  GLY C CA  1 
ATOM   8045  C  C   . GLY C  1 116 ? 5.496   -32.620 99.333  1.00 17.33  ? 223  GLY C C   1 
ATOM   8046  O  O   . GLY C  1 116 ? 5.936   -33.640 99.856  1.00 17.72  ? 223  GLY C O   1 
ATOM   8047  N  N   . VAL C  1 117 ? 6.150   -31.469 99.356  1.00 18.40  ? 224  VAL C N   1 
ATOM   8048  C  CA  . VAL C  1 117 ? 7.404   -31.337 100.089 1.00 17.90  ? 224  VAL C CA  1 
ATOM   8049  C  C   . VAL C  1 117 ? 7.175   -30.314 101.177 1.00 17.92  ? 224  VAL C C   1 
ATOM   8050  O  O   . VAL C  1 117 ? 6.876   -29.152 100.884 1.00 19.16  ? 224  VAL C O   1 
ATOM   8051  C  CB  . VAL C  1 117 ? 8.548   -30.826 99.217  1.00 17.38  ? 224  VAL C CB  1 
ATOM   8052  C  CG1 . VAL C  1 117 ? 9.790   -30.685 100.061 1.00 18.36  ? 224  VAL C CG1 1 
ATOM   8053  C  CG2 . VAL C  1 117 ? 8.804   -31.785 98.069  1.00 17.88  ? 224  VAL C CG2 1 
ATOM   8054  N  N   . ARG C  1 118 ? 7.272   -30.754 102.427 1.00 17.37  ? 225  ARG C N   1 
ATOM   8055  C  CA  . ARG C  1 118 ? 7.102   -29.857 103.563 1.00 16.20  ? 225  ARG C CA  1 
ATOM   8056  C  C   . ARG C  1 118 ? 8.448   -29.174 103.794 1.00 16.42  ? 225  ARG C C   1 
ATOM   8057  O  O   . ARG C  1 118 ? 9.391   -29.793 104.291 1.00 15.75  ? 225  ARG C O   1 
ATOM   8058  C  CB  . ARG C  1 118 ? 6.691   -30.647 104.801 1.00 16.16  ? 225  ARG C CB  1 
ATOM   8059  C  CG  . ARG C  1 118 ? 6.542   -29.819 106.052 1.00 16.64  ? 225  ARG C CG  1 
ATOM   8060  C  CD  . ARG C  1 118 ? 5.795   -30.579 107.137 1.00 18.48  ? 225  ARG C CD  1 
ATOM   8061  N  NE  . ARG C  1 118 ? 5.717   -29.802 108.372 1.00 18.64  ? 225  ARG C NE  1 
ATOM   8062  C  CZ  . ARG C  1 118 ? 6.624   -29.846 109.343 1.00 18.04  ? 225  ARG C CZ  1 
ATOM   8063  N  NH1 . ARG C  1 118 ? 6.475   -29.094 110.417 1.00 18.69  ? 225  ARG C NH1 1 
ATOM   8064  N  NH2 . ARG C  1 118 ? 7.667   -30.656 109.255 1.00 18.87  ? 225  ARG C NH2 1 
ATOM   8065  N  N   . MET C  1 119 ? 8.547   -27.905 103.405 1.00 16.67  ? 226  MET C N   1 
ATOM   8066  C  CA  . MET C  1 119 ? 9.800   -27.176 103.573 1.00 18.42  ? 226  MET C CA  1 
ATOM   8067  C  C   . MET C  1 119 ? 9.678   -25.724 104.001 1.00 17.91  ? 226  MET C C   1 
ATOM   8068  O  O   . MET C  1 119 ? 10.684  -25.039 104.147 1.00 17.98  ? 226  MET C O   1 
ATOM   8069  C  CB  . MET C  1 119 ? 10.658  -27.268 102.301 1.00 17.97  ? 226  MET C CB  1 
ATOM   8070  C  CG  . MET C  1 119 ? 9.915   -27.104 100.986 1.00 18.52  ? 226  MET C CG  1 
ATOM   8071  S  SD  . MET C  1 119 ? 9.684   -25.427 100.411 1.00 20.45  ? 226  MET C SD  1 
ATOM   8072  C  CE  . MET C  1 119 ? 11.324  -25.033 99.977  1.00 15.32  ? 226  MET C CE  1 
ATOM   8073  N  N   . LEU C  1 120 ? 8.459   -25.254 104.221 1.00 17.44  ? 227  LEU C N   1 
ATOM   8074  C  CA  . LEU C  1 120 ? 8.265   -23.874 104.652 1.00 17.12  ? 227  LEU C CA  1 
ATOM   8075  C  C   . LEU C  1 120 ? 7.938   -23.753 106.142 1.00 18.06  ? 227  LEU C C   1 
ATOM   8076  O  O   . LEU C  1 120 ? 7.963   -22.660 106.691 1.00 19.54  ? 227  LEU C O   1 
ATOM   8077  C  CB  . LEU C  1 120 ? 7.138   -23.220 103.861 1.00 16.63  ? 227  LEU C CB  1 
ATOM   8078  C  CG  . LEU C  1 120 ? 7.335   -23.017 102.365 1.00 16.27  ? 227  LEU C CG  1 
ATOM   8079  C  CD1 . LEU C  1 120 ? 6.100   -22.340 101.795 1.00 15.19  ? 227  LEU C CD1 1 
ATOM   8080  C  CD2 . LEU C  1 120 ? 8.567   -22.171 102.125 1.00 16.30  ? 227  LEU C CD2 1 
ATOM   8081  N  N   . ASP C  1 121 ? 7.626   -24.864 106.799 1.00 18.59  ? 228  ASP C N   1 
ATOM   8082  C  CA  . ASP C  1 121 ? 7.275   -24.818 108.213 1.00 18.57  ? 228  ASP C CA  1 
ATOM   8083  C  C   . ASP C  1 121 ? 8.498   -24.886 109.113 1.00 18.62  ? 228  ASP C C   1 
ATOM   8084  O  O   . ASP C  1 121 ? 8.653   -25.811 109.910 1.00 18.05  ? 228  ASP C O   1 
ATOM   8085  C  CB  . ASP C  1 121 ? 6.325   -25.959 108.558 1.00 19.66  ? 228  ASP C CB  1 
ATOM   8086  C  CG  . ASP C  1 121 ? 5.552   -25.702 109.834 1.00 19.70  ? 228  ASP C CG  1 
ATOM   8087  O  OD1 . ASP C  1 121 ? 4.852   -26.624 110.305 1.00 20.55  ? 228  ASP C OD1 1 
ATOM   8088  O  OD2 . ASP C  1 121 ? 5.637   -24.575 110.360 1.00 16.72  ? 228  ASP C OD2 1 
ATOM   8089  N  N   . GLY C  1 122 ? 9.360   -23.888 108.987 1.00 18.15  ? 229  GLY C N   1 
ATOM   8090  C  CA  . GLY C  1 122 ? 10.576  -23.843 109.777 1.00 18.51  ? 229  GLY C CA  1 
ATOM   8091  C  C   . GLY C  1 122 ? 11.521  -22.851 109.131 1.00 18.67  ? 229  GLY C C   1 
ATOM   8092  O  O   . GLY C  1 122 ? 11.090  -22.010 108.343 1.00 17.75  ? 229  GLY C O   1 
ATOM   8093  N  N   . GLU C  1 123 ? 12.804  -22.926 109.460 1.00 18.49  ? 230  GLU C N   1 
ATOM   8094  C  CA  . GLU C  1 123 ? 13.757  -22.019 108.861 1.00 17.92  ? 230  GLU C CA  1 
ATOM   8095  C  C   . GLU C  1 123 ? 14.003  -22.501 107.437 1.00 17.86  ? 230  GLU C C   1 
ATOM   8096  O  O   . GLU C  1 123 ? 14.451  -23.629 107.220 1.00 17.66  ? 230  GLU C O   1 
ATOM   8097  C  CB  . GLU C  1 123 ? 15.054  -22.014 109.665 1.00 19.34  ? 230  GLU C CB  1 
ATOM   8098  C  CG  . GLU C  1 123 ? 16.126  -21.153 109.052 1.00 22.14  ? 230  GLU C CG  1 
ATOM   8099  C  CD  . GLU C  1 123 ? 17.397  -21.123 109.869 1.00 25.05  ? 230  GLU C CD  1 
ATOM   8100  O  OE1 . GLU C  1 123 ? 17.547  -21.965 110.786 1.00 24.16  ? 230  GLU C OE1 1 
ATOM   8101  O  OE2 . GLU C  1 123 ? 18.253  -20.254 109.573 1.00 27.04  ? 230  GLU C OE2 1 
ATOM   8102  N  N   . VAL C  1 124 ? 13.689  -21.653 106.462 1.00 16.98  ? 231  VAL C N   1 
ATOM   8103  C  CA  . VAL C  1 124 ? 13.878  -22.016 105.059 1.00 15.03  ? 231  VAL C CA  1 
ATOM   8104  C  C   . VAL C  1 124 ? 15.269  -21.627 104.603 1.00 14.83  ? 231  VAL C C   1 
ATOM   8105  O  O   . VAL C  1 124 ? 15.481  -20.564 104.018 1.00 16.07  ? 231  VAL C O   1 
ATOM   8106  C  CB  . VAL C  1 124 ? 12.849  -21.327 104.151 1.00 14.54  ? 231  VAL C CB  1 
ATOM   8107  C  CG1 . VAL C  1 124 ? 12.968  -21.866 102.749 1.00 12.85  ? 231  VAL C CG1 1 
ATOM   8108  C  CG2 . VAL C  1 124 ? 11.438  -21.544 104.694 1.00 14.94  ? 231  VAL C CG2 1 
ATOM   8109  N  N   . THR C  1 125 ? 16.217  -22.507 104.877 1.00 13.64  ? 232  THR C N   1 
ATOM   8110  C  CA  . THR C  1 125 ? 17.603  -22.278 104.527 1.00 13.68  ? 232  THR C CA  1 
ATOM   8111  C  C   . THR C  1 125 ? 17.882  -22.547 103.056 1.00 15.06  ? 232  THR C C   1 
ATOM   8112  O  O   . THR C  1 125 ? 17.054  -23.101 102.342 1.00 17.00  ? 232  THR C O   1 
ATOM   8113  C  CB  . THR C  1 125 ? 18.526  -23.193 105.361 1.00 13.67  ? 232  THR C CB  1 
ATOM   8114  O  OG1 . THR C  1 125 ? 18.301  -24.560 105.001 1.00 10.81  ? 232  THR C OG1 1 
ATOM   8115  C  CG2 . THR C  1 125 ? 18.242  -23.027 106.856 1.00 12.62  ? 232  THR C CG2 1 
ATOM   8116  N  N   . ASP C  1 126 ? 19.064  -22.153 102.613 1.00 14.35  ? 233  ASP C N   1 
ATOM   8117  C  CA  . ASP C  1 126 ? 19.478  -22.377 101.245 1.00 15.29  ? 233  ASP C CA  1 
ATOM   8118  C  C   . ASP C  1 126 ? 19.448  -23.885 100.979 1.00 16.56  ? 233  ASP C C   1 
ATOM   8119  O  O   . ASP C  1 126 ? 18.927  -24.341 99.956  1.00 18.28  ? 233  ASP C O   1 
ATOM   8120  C  CB  . ASP C  1 126 ? 20.901  -21.853 101.051 1.00 16.61  ? 233  ASP C CB  1 
ATOM   8121  C  CG  . ASP C  1 126 ? 21.354  -21.915 99.612  1.00 18.51  ? 233  ASP C CG  1 
ATOM   8122  O  OD1 . ASP C  1 126 ? 22.579  -22.046 99.388  1.00 18.74  ? 233  ASP C OD1 1 
ATOM   8123  O  OD2 . ASP C  1 126 ? 20.490  -21.819 98.708  1.00 19.37  ? 233  ASP C OD2 1 
ATOM   8124  N  N   . ALA C  1 127 ? 20.016  -24.658 101.901 1.00 15.28  ? 234  ALA C N   1 
ATOM   8125  C  CA  . ALA C  1 127 ? 20.051  -26.113 101.763 1.00 14.52  ? 234  ALA C CA  1 
ATOM   8126  C  C   . ALA C  1 127 ? 18.639  -26.709 101.682 1.00 14.75  ? 234  ALA C C   1 
ATOM   8127  O  O   . ALA C  1 127 ? 18.412  -27.692 100.982 1.00 14.26  ? 234  ALA C O   1 
ATOM   8128  C  CB  . ALA C  1 127 ? 20.813  -26.729 102.938 1.00 14.34  ? 234  ALA C CB  1 
ATOM   8129  N  N   . VAL C  1 128 ? 17.693  -26.117 102.404 1.00 14.13  ? 235  VAL C N   1 
ATOM   8130  C  CA  . VAL C  1 128 ? 16.322  -26.612 102.391 1.00 14.09  ? 235  VAL C CA  1 
ATOM   8131  C  C   . VAL C  1 128 ? 15.719  -26.396 101.015 1.00 15.56  ? 235  VAL C C   1 
ATOM   8132  O  O   . VAL C  1 128 ? 15.087  -27.288 100.461 1.00 17.74  ? 235  VAL C O   1 
ATOM   8133  C  CB  . VAL C  1 128 ? 15.441  -25.892 103.444 1.00 13.06  ? 235  VAL C CB  1 
ATOM   8134  C  CG1 . VAL C  1 128 ? 13.977  -26.160 103.176 1.00 10.73  ? 235  VAL C CG1 1 
ATOM   8135  C  CG2 . VAL C  1 128 ? 15.797  -26.376 104.829 1.00 13.13  ? 235  VAL C CG2 1 
ATOM   8136  N  N   . GLU C  1 129 ? 15.906  -25.207 100.458 1.00 14.52  ? 236  GLU C N   1 
ATOM   8137  C  CA  . GLU C  1 129 ? 15.369  -24.939 99.143  1.00 13.52  ? 236  GLU C CA  1 
ATOM   8138  C  C   . GLU C  1 129 ? 16.041  -25.839 98.099  1.00 13.37  ? 236  GLU C C   1 
ATOM   8139  O  O   . GLU C  1 129 ? 15.374  -26.379 97.219  1.00 13.78  ? 236  GLU C O   1 
ATOM   8140  C  CB  . GLU C  1 129 ? 15.569  -23.469 98.776  1.00 12.91  ? 236  GLU C CB  1 
ATOM   8141  C  CG  . GLU C  1 129 ? 14.938  -22.498 99.762  1.00 12.41  ? 236  GLU C CG  1 
ATOM   8142  C  CD  . GLU C  1 129 ? 14.993  -21.065 99.273  1.00 11.47  ? 236  GLU C CD  1 
ATOM   8143  O  OE1 . GLU C  1 129 ? 15.823  -20.781 98.392  1.00 10.91  ? 236  GLU C OE1 1 
ATOM   8144  O  OE2 . GLU C  1 129 ? 14.221  -20.219 99.769  1.00 12.58  ? 236  GLU C OE2 1 
ATOM   8145  N  N   . ALA C  1 130 ? 17.353  -26.009 98.204  1.00 12.67  ? 237  ALA C N   1 
ATOM   8146  C  CA  . ALA C  1 130 ? 18.081  -26.841 97.249  1.00 14.46  ? 237  ALA C CA  1 
ATOM   8147  C  C   . ALA C  1 130 ? 17.647  -28.302 97.273  1.00 15.68  ? 237  ALA C C   1 
ATOM   8148  O  O   . ALA C  1 130 ? 17.581  -28.954 96.240  1.00 17.03  ? 237  ALA C O   1 
ATOM   8149  C  CB  . ALA C  1 130 ? 19.567  -26.751 97.502  1.00 13.24  ? 237  ALA C CB  1 
ATOM   8150  N  N   . ARG C  1 131 ? 17.358  -28.823 98.454  1.00 17.02  ? 238  ARG C N   1 
ATOM   8151  C  CA  . ARG C  1 131 ? 16.937  -30.205 98.561  1.00 18.14  ? 238  ARG C CA  1 
ATOM   8152  C  C   . ARG C  1 131 ? 15.521  -30.355 98.058  1.00 18.90  ? 238  ARG C C   1 
ATOM   8153  O  O   . ARG C  1 131 ? 15.163  -31.398 97.512  1.00 21.45  ? 238  ARG C O   1 
ATOM   8154  C  CB  . ARG C  1 131 ? 17.017  -30.682 100.003 1.00 18.82  ? 238  ARG C CB  1 
ATOM   8155  C  CG  . ARG C  1 131 ? 18.414  -30.622 100.586 1.00 23.22  ? 238  ARG C CG  1 
ATOM   8156  C  CD  . ARG C  1 131 ? 18.447  -31.328 101.925 1.00 27.21  ? 238  ARG C CD  1 
ATOM   8157  N  NE  . ARG C  1 131 ? 18.177  -32.754 101.758 1.00 31.12  ? 238  ARG C NE  1 
ATOM   8158  C  CZ  . ARG C  1 131 ? 17.494  -33.488 102.631 1.00 33.55  ? 238  ARG C CZ  1 
ATOM   8159  N  NH1 . ARG C  1 131 ? 17.300  -34.782 102.399 1.00 34.06  ? 238  ARG C NH1 1 
ATOM   8160  N  NH2 . ARG C  1 131 ? 16.994  -32.922 103.730 1.00 34.63  ? 238  ARG C NH2 1 
ATOM   8161  N  N   . SER C  1 132 ? 14.713  -29.320 98.241  1.00 17.81  ? 239  SER C N   1 
ATOM   8162  C  CA  . SER C  1 132 ? 13.335  -29.355 97.787  1.00 17.51  ? 239  SER C CA  1 
ATOM   8163  C  C   . SER C  1 132 ? 13.260  -29.253 96.269  1.00 17.70  ? 239  SER C C   1 
ATOM   8164  O  O   . SER C  1 132 ? 12.590  -30.052 95.634  1.00 19.43  ? 239  SER C O   1 
ATOM   8165  C  CB  . SER C  1 132 ? 12.542  -28.220 98.427  1.00 18.29  ? 239  SER C CB  1 
ATOM   8166  O  OG  . SER C  1 132 ? 12.506  -28.360 99.835  1.00 17.23  ? 239  SER C OG  1 
ATOM   8167  N  N   . LEU C  1 133 ? 13.948  -28.278 95.691  1.00 15.57  ? 240  LEU C N   1 
ATOM   8168  C  CA  . LEU C  1 133 ? 13.942  -28.099 94.246  1.00 15.96  ? 240  LEU C CA  1 
ATOM   8169  C  C   . LEU C  1 133 ? 14.572  -29.293 93.519  1.00 16.96  ? 240  LEU C C   1 
ATOM   8170  O  O   . LEU C  1 133 ? 14.215  -29.604 92.380  1.00 16.93  ? 240  LEU C O   1 
ATOM   8171  C  CB  . LEU C  1 133 ? 14.692  -26.815 93.881  1.00 13.58  ? 240  LEU C CB  1 
ATOM   8172  C  CG  . LEU C  1 133 ? 13.977  -25.558 94.376  1.00 13.10  ? 240  LEU C CG  1 
ATOM   8173  C  CD1 . LEU C  1 133 ? 14.923  -24.374 94.443  1.00 9.90   ? 240  LEU C CD1 1 
ATOM   8174  C  CD2 . LEU C  1 133 ? 12.807  -25.285 93.458  1.00 11.17  ? 240  LEU C CD2 1 
ATOM   8175  N  N   . GLY C  1 134 ? 15.501  -29.968 94.182  1.00 17.87  ? 241  GLY C N   1 
ATOM   8176  C  CA  . GLY C  1 134 ? 16.170  -31.094 93.557  1.00 18.64  ? 241  GLY C CA  1 
ATOM   8177  C  C   . GLY C  1 134 ? 15.731  -32.465 94.031  1.00 19.73  ? 241  GLY C C   1 
ATOM   8178  O  O   . GLY C  1 134 ? 16.491  -33.429 93.925  1.00 20.50  ? 241  GLY C O   1 
ATOM   8179  N  N   . LEU C  1 135 ? 14.507  -32.560 94.541  1.00 20.11  ? 242  LEU C N   1 
ATOM   8180  C  CA  . LEU C  1 135 ? 13.967  -33.825 95.038  1.00 20.89  ? 242  LEU C CA  1 
ATOM   8181  C  C   . LEU C  1 135 ? 13.473  -34.724 93.902  1.00 22.59  ? 242  LEU C C   1 
ATOM   8182  O  O   . LEU C  1 135 ? 12.565  -34.342 93.160  1.00 23.83  ? 242  LEU C O   1 
ATOM   8183  C  CB  . LEU C  1 135 ? 12.808  -33.543 95.993  1.00 19.15  ? 242  LEU C CB  1 
ATOM   8184  C  CG  . LEU C  1 135 ? 12.183  -34.793 96.598  1.00 21.29  ? 242  LEU C CG  1 
ATOM   8185  C  CD1 . LEU C  1 135 ? 13.139  -35.376 97.637  1.00 20.75  ? 242  LEU C CD1 1 
ATOM   8186  C  CD2 . LEU C  1 135 ? 10.843  -34.457 97.223  1.00 20.84  ? 242  LEU C CD2 1 
ATOM   8187  N  N   . ASN C  1 136 ? 14.061  -35.912 93.766  1.00 23.99  ? 243  ASN C N   1 
ATOM   8188  C  CA  . ASN C  1 136 ? 13.657  -36.860 92.716  1.00 24.96  ? 243  ASN C CA  1 
ATOM   8189  C  C   . ASN C  1 136 ? 13.563  -36.257 91.327  1.00 23.37  ? 243  ASN C C   1 
ATOM   8190  O  O   . ASN C  1 136 ? 12.526  -36.350 90.677  1.00 23.46  ? 243  ASN C O   1 
ATOM   8191  C  CB  . ASN C  1 136 ? 12.298  -37.459 93.042  1.00 28.48  ? 243  ASN C CB  1 
ATOM   8192  C  CG  . ASN C  1 136 ? 12.389  -38.617 93.989  1.00 32.45  ? 243  ASN C CG  1 
ATOM   8193  O  OD1 . ASN C  1 136 ? 12.798  -38.458 95.146  1.00 34.48  ? 243  ASN C OD1 1 
ATOM   8194  N  ND2 . ASN C  1 136 ? 12.012  -39.808 93.506  1.00 33.04  ? 243  ASN C ND2 1 
ATOM   8195  N  N   . PRO C  1 137 ? 14.650  -35.663 90.840  1.00 22.09  ? 244  PRO C N   1 
ATOM   8196  C  CA  . PRO C  1 137 ? 14.642  -35.046 89.515  1.00 21.80  ? 244  PRO C CA  1 
ATOM   8197  C  C   . PRO C  1 137 ? 14.132  -35.953 88.393  1.00 21.67  ? 244  PRO C C   1 
ATOM   8198  O  O   . PRO C  1 137 ? 13.600  -35.461 87.398  1.00 22.20  ? 244  PRO C O   1 
ATOM   8199  C  CB  . PRO C  1 137 ? 16.098  -34.639 89.320  1.00 21.96  ? 244  PRO C CB  1 
ATOM   8200  C  CG  . PRO C  1 137 ? 16.608  -34.475 90.722  1.00 22.28  ? 244  PRO C CG  1 
ATOM   8201  C  CD  . PRO C  1 137 ? 16.003  -35.657 91.414  1.00 21.46  ? 244  PRO C CD  1 
ATOM   8202  N  N   . ASN C  1 138 ? 14.302  -37.267 88.535  1.00 21.24  ? 245  ASN C N   1 
ATOM   8203  C  CA  . ASN C  1 138 ? 13.829  -38.185 87.495  1.00 20.89  ? 245  ASN C CA  1 
ATOM   8204  C  C   . ASN C  1 138 ? 12.502  -38.886 87.770  1.00 20.91  ? 245  ASN C C   1 
ATOM   8205  O  O   . ASN C  1 138 ? 12.120  -39.782 87.026  1.00 21.89  ? 245  ASN C O   1 
ATOM   8206  C  CB  . ASN C  1 138 ? 14.883  -39.236 87.144  1.00 18.81  ? 245  ASN C CB  1 
ATOM   8207  C  CG  . ASN C  1 138 ? 16.006  -38.673 86.286  1.00 19.54  ? 245  ASN C CG  1 
ATOM   8208  O  OD1 . ASN C  1 138 ? 15.814  -37.722 85.522  1.00 20.37  ? 245  ASN C OD1 1 
ATOM   8209  N  ND2 . ASN C  1 138 ? 17.183  -39.273 86.395  1.00 19.56  ? 245  ASN C ND2 1 
ATOM   8210  N  N   . HIS C  1 139 ? 11.810  -38.499 88.837  1.00 19.90  ? 246  HIS C N   1 
ATOM   8211  C  CA  . HIS C  1 139 ? 10.503  -39.067 89.123  1.00 18.67  ? 246  HIS C CA  1 
ATOM   8212  C  C   . HIS C  1 139 ? 9.457   -37.949 89.044  1.00 19.06  ? 246  HIS C C   1 
ATOM   8213  O  O   . HIS C  1 139 ? 8.372   -38.142 88.497  1.00 19.73  ? 246  HIS C O   1 
ATOM   8214  C  CB  . HIS C  1 139 ? 10.459  -39.700 90.504  1.00 18.90  ? 246  HIS C CB  1 
ATOM   8215  C  CG  . HIS C  1 139 ? 9.110   -40.237 90.862  1.00 21.01  ? 246  HIS C CG  1 
ATOM   8216  N  ND1 . HIS C  1 139 ? 8.561   -41.341 90.244  1.00 22.00  ? 246  HIS C ND1 1 
ATOM   8217  C  CD2 . HIS C  1 139 ? 8.174   -39.788 91.733  1.00 22.09  ? 246  HIS C CD2 1 
ATOM   8218  C  CE1 . HIS C  1 139 ? 7.344   -41.547 90.718  1.00 22.46  ? 246  HIS C CE1 1 
ATOM   8219  N  NE2 . HIS C  1 139 ? 7.085   -40.618 91.623  1.00 21.47  ? 246  HIS C NE2 1 
ATOM   8220  N  N   . ILE C  1 140 ? 9.792   -36.781 89.595  1.00 17.72  ? 247  ILE C N   1 
ATOM   8221  C  CA  . ILE C  1 140 ? 8.898   -35.631 89.582  1.00 16.59  ? 247  ILE C CA  1 
ATOM   8222  C  C   . ILE C  1 140 ? 9.147   -34.856 88.298  1.00 16.87  ? 247  ILE C C   1 
ATOM   8223  O  O   . ILE C  1 140 ? 10.295  -34.528 88.011  1.00 17.96  ? 247  ILE C O   1 
ATOM   8224  C  CB  . ILE C  1 140 ? 9.176   -34.697 90.774  1.00 14.64  ? 247  ILE C CB  1 
ATOM   8225  C  CG1 . ILE C  1 140 ? 8.970   -35.456 92.093  1.00 14.93  ? 247  ILE C CG1 1 
ATOM   8226  C  CG2 . ILE C  1 140 ? 8.245   -33.512 90.718  1.00 13.67  ? 247  ILE C CG2 1 
ATOM   8227  C  CD1 . ILE C  1 140 ? 9.409   -34.702 93.351  1.00 8.04   ? 247  ILE C CD1 1 
ATOM   8228  N  N   . HIS C  1 141 ? 8.088   -34.562 87.538  1.00 16.18  ? 248  HIS C N   1 
ATOM   8229  C  CA  . HIS C  1 141 ? 8.218   -33.830 86.277  1.00 16.63  ? 248  HIS C CA  1 
ATOM   8230  C  C   . HIS C  1 141 ? 8.046   -32.345 86.482  1.00 16.75  ? 248  HIS C C   1 
ATOM   8231  O  O   . HIS C  1 141 ? 8.736   -31.536 85.872  1.00 17.52  ? 248  HIS C O   1 
ATOM   8232  C  CB  . HIS C  1 141 ? 7.153   -34.252 85.256  1.00 17.91  ? 248  HIS C CB  1 
ATOM   8233  C  CG  . HIS C  1 141 ? 7.099   -35.724 84.991  1.00 20.03  ? 248  HIS C CG  1 
ATOM   8234  N  ND1 . HIS C  1 141 ? 6.133   -36.543 85.537  1.00 21.36  ? 248  HIS C ND1 1 
ATOM   8235  C  CD2 . HIS C  1 141 ? 7.908   -36.529 84.266  1.00 20.04  ? 248  HIS C CD2 1 
ATOM   8236  C  CE1 . HIS C  1 141 ? 6.353   -37.790 85.163  1.00 20.17  ? 248  HIS C CE1 1 
ATOM   8237  N  NE2 . HIS C  1 141 ? 7.425   -37.809 84.391  1.00 20.11  ? 248  HIS C NE2 1 
ATOM   8238  N  N   . ILE C  1 142 ? 7.099   -31.996 87.338  1.00 16.87  ? 249  ILE C N   1 
ATOM   8239  C  CA  . ILE C  1 142 ? 6.773   -30.607 87.598  1.00 15.27  ? 249  ILE C CA  1 
ATOM   8240  C  C   . ILE C  1 142 ? 6.775   -30.245 89.068  1.00 14.57  ? 249  ILE C C   1 
ATOM   8241  O  O   . ILE C  1 142 ? 6.220   -30.962 89.899  1.00 14.44  ? 249  ILE C O   1 
ATOM   8242  C  CB  . ILE C  1 142 ? 5.374   -30.289 87.054  1.00 15.08  ? 249  ILE C CB  1 
ATOM   8243  C  CG1 . ILE C  1 142 ? 5.319   -30.598 85.553  1.00 14.29  ? 249  ILE C CG1 1 
ATOM   8244  C  CG2 . ILE C  1 142 ? 5.021   -28.844 87.343  1.00 14.48  ? 249  ILE C CG2 1 
ATOM   8245  C  CD1 . ILE C  1 142 ? 3.910   -30.692 85.002  1.00 12.39  ? 249  ILE C CD1 1 
ATOM   8246  N  N   . TYR C  1 143 ? 7.397   -29.115 89.381  1.00 14.77  ? 250  TYR C N   1 
ATOM   8247  C  CA  . TYR C  1 143 ? 7.439   -28.621 90.750  1.00 13.00  ? 250  TYR C CA  1 
ATOM   8248  C  C   . TYR C  1 143 ? 6.620   -27.344 90.782  1.00 13.21  ? 250  TYR C C   1 
ATOM   8249  O  O   . TYR C  1 143 ? 6.785   -26.478 89.930  1.00 14.26  ? 250  TYR C O   1 
ATOM   8250  C  CB  . TYR C  1 143 ? 8.865   -28.303 91.170  1.00 11.95  ? 250  TYR C CB  1 
ATOM   8251  C  CG  . TYR C  1 143 ? 9.797   -29.477 91.187  1.00 12.00  ? 250  TYR C CG  1 
ATOM   8252  C  CD1 . TYR C  1 143 ? 10.417  -29.916 90.020  1.00 11.64  ? 250  TYR C CD1 1 
ATOM   8253  C  CD2 . TYR C  1 143 ? 10.082  -30.140 92.382  1.00 13.29  ? 250  TYR C CD2 1 
ATOM   8254  C  CE1 . TYR C  1 143 ? 11.310  -30.992 90.040  1.00 12.96  ? 250  TYR C CE1 1 
ATOM   8255  C  CE2 . TYR C  1 143 ? 10.968  -31.213 92.419  1.00 13.31  ? 250  TYR C CE2 1 
ATOM   8256  C  CZ  . TYR C  1 143 ? 11.580  -31.632 91.241  1.00 14.38  ? 250  TYR C CZ  1 
ATOM   8257  O  OH  . TYR C  1 143 ? 12.461  -32.686 91.273  1.00 15.69  ? 250  TYR C OH  1 
ATOM   8258  N  N   . SER C  1 144 ? 5.733   -27.228 91.760  1.00 13.01  ? 251  SER C N   1 
ATOM   8259  C  CA  . SER C  1 144 ? 4.903   -26.040 91.892  1.00 11.94  ? 251  SER C CA  1 
ATOM   8260  C  C   . SER C  1 144 ? 5.238   -25.326 93.206  1.00 12.66  ? 251  SER C C   1 
ATOM   8261  O  O   . SER C  1 144 ? 5.047   -25.889 94.291  1.00 12.50  ? 251  SER C O   1 
ATOM   8262  C  CB  . SER C  1 144 ? 3.435   -26.439 91.874  1.00 10.87  ? 251  SER C CB  1 
ATOM   8263  O  OG  . SER C  1 144 ? 2.607   -25.297 91.910  1.00 12.46  ? 251  SER C OG  1 
ATOM   8264  N  N   . ALA C  1 145 ? 5.728   -24.090 93.110  1.00 10.80  ? 252  ALA C N   1 
ATOM   8265  C  CA  . ALA C  1 145 ? 6.115   -23.335 94.299  1.00 10.40  ? 252  ALA C CA  1 
ATOM   8266  C  C   . ALA C  1 145 ? 5.347   -22.033 94.468  1.00 11.16  ? 252  ALA C C   1 
ATOM   8267  O  O   . ALA C  1 145 ? 5.528   -21.087 93.701  1.00 11.36  ? 252  ALA C O   1 
ATOM   8268  C  CB  . ALA C  1 145 ? 7.624   -23.055 94.262  1.00 10.02  ? 252  ALA C CB  1 
ATOM   8269  N  N   . SER C  1 146 ? 4.490   -21.989 95.480  1.00 11.72  ? 253  SER C N   1 
ATOM   8270  C  CA  . SER C  1 146 ? 3.703   -20.795 95.749  1.00 14.20  ? 253  SER C CA  1 
ATOM   8271  C  C   . SER C  1 146 ? 4.242   -20.077 96.979  1.00 14.85  ? 253  SER C C   1 
ATOM   8272  O  O   . SER C  1 146 ? 3.579   -20.010 98.020  1.00 17.45  ? 253  SER C O   1 
ATOM   8273  C  CB  . SER C  1 146 ? 2.239   -21.162 95.966  1.00 14.69  ? 253  SER C CB  1 
ATOM   8274  O  OG  . SER C  1 146 ? 1.684   -21.705 94.780  1.00 17.34  ? 253  SER C OG  1 
ATOM   8275  N  N   . TRP C  1 147 ? 5.453   -19.552 96.855  1.00 12.60  ? 254  TRP C N   1 
ATOM   8276  C  CA  . TRP C  1 147 ? 6.095   -18.832 97.938  1.00 13.10  ? 254  TRP C CA  1 
ATOM   8277  C  C   . TRP C  1 147 ? 7.286   -18.063 97.386  1.00 14.47  ? 254  TRP C C   1 
ATOM   8278  O  O   . TRP C  1 147 ? 7.694   -18.268 96.240  1.00 14.46  ? 254  TRP C O   1 
ATOM   8279  C  CB  . TRP C  1 147 ? 6.565   -19.804 99.017  1.00 10.83  ? 254  TRP C CB  1 
ATOM   8280  C  CG  . TRP C  1 147 ? 7.360   -20.974 98.492  1.00 10.29  ? 254  TRP C CG  1 
ATOM   8281  C  CD1 . TRP C  1 147 ? 6.886   -22.223 98.201  1.00 8.20   ? 254  TRP C CD1 1 
ATOM   8282  C  CD2 . TRP C  1 147 ? 8.779   -21.014 98.236  1.00 9.99   ? 254  TRP C CD2 1 
ATOM   8283  N  NE1 . TRP C  1 147 ? 7.918   -23.040 97.790  1.00 8.91   ? 254  TRP C NE1 1 
ATOM   8284  C  CE2 . TRP C  1 147 ? 9.089   -22.327 97.802  1.00 7.90   ? 254  TRP C CE2 1 
ATOM   8285  C  CE3 . TRP C  1 147 ? 9.816   -20.069 98.335  1.00 9.68   ? 254  TRP C CE3 1 
ATOM   8286  C  CZ2 . TRP C  1 147 ? 10.390  -22.723 97.473  1.00 6.33   ? 254  TRP C CZ2 1 
ATOM   8287  C  CZ3 . TRP C  1 147 ? 11.115  -20.464 98.005  1.00 7.83   ? 254  TRP C CZ3 1 
ATOM   8288  C  CH2 . TRP C  1 147 ? 11.388  -21.783 97.581  1.00 7.46   ? 254  TRP C CH2 1 
ATOM   8289  N  N   . GLY C  1 148 ? 7.842   -17.179 98.202  1.00 14.73  ? 255  GLY C N   1 
ATOM   8290  C  CA  . GLY C  1 148 ? 8.989   -16.399 97.765  1.00 15.16  ? 255  GLY C CA  1 
ATOM   8291  C  C   . GLY C  1 148 ? 9.370   -15.371 98.813  1.00 14.75  ? 255  GLY C C   1 
ATOM   8292  O  O   . GLY C  1 148 ? 8.848   -15.416 99.932  1.00 15.54  ? 255  GLY C O   1 
ATOM   8293  N  N   . PRO C  1 149 ? 10.259  -14.421 98.487  1.00 13.37  ? 256  PRO C N   1 
ATOM   8294  C  CA  . PRO C  1 149 ? 10.663  -13.406 99.458  1.00 13.02  ? 256  PRO C CA  1 
ATOM   8295  C  C   . PRO C  1 149 ? 9.464   -12.568 99.868  1.00 13.29  ? 256  PRO C C   1 
ATOM   8296  O  O   . PRO C  1 149 ? 8.451   -12.542 99.177  1.00 14.17  ? 256  PRO C O   1 
ATOM   8297  C  CB  . PRO C  1 149 ? 11.697  -12.578 98.696  1.00 12.75  ? 256  PRO C CB  1 
ATOM   8298  C  CG  . PRO C  1 149 ? 12.185  -13.501 97.620  1.00 12.71  ? 256  PRO C CG  1 
ATOM   8299  C  CD  . PRO C  1 149 ? 10.927  -14.204 97.196  1.00 13.20  ? 256  PRO C CD  1 
ATOM   8300  N  N   . GLU C  1 150 ? 9.599   -11.883 100.993 1.00 14.04  ? 257  GLU C N   1 
ATOM   8301  C  CA  . GLU C  1 150 ? 8.566   -11.017 101.546 1.00 14.49  ? 257  GLU C CA  1 
ATOM   8302  C  C   . GLU C  1 150 ? 7.941   -10.152 100.450 1.00 14.86  ? 257  GLU C C   1 
ATOM   8303  O  O   . GLU C  1 150 ? 8.659   -9.562  99.650  1.00 13.23  ? 257  GLU C O   1 
ATOM   8304  C  CB  . GLU C  1 150 ? 9.214   -10.108 102.587 1.00 15.07  ? 257  GLU C CB  1 
ATOM   8305  C  CG  . GLU C  1 150 ? 8.278   -9.520  103.583 1.00 19.21  ? 257  GLU C CG  1 
ATOM   8306  C  CD  . GLU C  1 150 ? 7.750   -10.573 104.506 1.00 22.48  ? 257  GLU C CD  1 
ATOM   8307  O  OE1 . GLU C  1 150 ? 6.514   -10.754 104.559 1.00 26.73  ? 257  GLU C OE1 1 
ATOM   8308  O  OE2 . GLU C  1 150 ? 8.575   -11.227 105.172 1.00 23.81  ? 257  GLU C OE2 1 
ATOM   8309  N  N   . ASP C  1 151 ? 6.613   -10.073 100.402 1.00 15.15  ? 258  ASP C N   1 
ATOM   8310  C  CA  . ASP C  1 151 ? 5.959   -9.235  99.398  1.00 15.42  ? 258  ASP C CA  1 
ATOM   8311  C  C   . ASP C  1 151 ? 5.552   -7.906  100.026 1.00 16.89  ? 258  ASP C C   1 
ATOM   8312  O  O   . ASP C  1 151 ? 4.400   -7.480  99.895  1.00 18.21  ? 258  ASP C O   1 
ATOM   8313  C  CB  . ASP C  1 151 ? 4.709   -9.915  98.827  1.00 15.10  ? 258  ASP C CB  1 
ATOM   8314  C  CG  . ASP C  1 151 ? 5.034   -11.116 97.960  1.00 15.78  ? 258  ASP C CG  1 
ATOM   8315  O  OD1 . ASP C  1 151 ? 6.064   -11.096 97.233  1.00 14.89  ? 258  ASP C OD1 1 
ATOM   8316  O  OD2 . ASP C  1 151 ? 4.243   -12.082 97.993  1.00 14.73  ? 258  ASP C OD2 1 
ATOM   8317  N  N   . ASP C  1 152 ? 6.491   -7.247  100.699 1.00 16.67  ? 259  ASP C N   1 
ATOM   8318  C  CA  . ASP C  1 152 ? 6.196   -5.979  101.357 1.00 16.78  ? 259  ASP C CA  1 
ATOM   8319  C  C   . ASP C  1 152 ? 6.510   -4.784  100.461 1.00 16.96  ? 259  ASP C C   1 
ATOM   8320  O  O   . ASP C  1 152 ? 6.246   -3.639  100.816 1.00 17.12  ? 259  ASP C O   1 
ATOM   8321  C  CB  . ASP C  1 152 ? 6.978   -5.888  102.675 1.00 16.86  ? 259  ASP C CB  1 
ATOM   8322  C  CG  . ASP C  1 152 ? 8.473   -6.102  102.482 1.00 18.51  ? 259  ASP C CG  1 
ATOM   8323  O  OD1 . ASP C  1 152 ? 9.220   -6.176  103.489 1.00 17.42  ? 259  ASP C OD1 1 
ATOM   8324  O  OD2 . ASP C  1 152 ? 8.894   -6.191  101.309 1.00 18.57  ? 259  ASP C OD2 1 
ATOM   8325  N  N   . GLY C  1 153 ? 7.064   -5.063  99.287  1.00 17.81  ? 260  GLY C N   1 
ATOM   8326  C  CA  . GLY C  1 153 ? 7.402   -4.004  98.353  1.00 15.16  ? 260  GLY C CA  1 
ATOM   8327  C  C   . GLY C  1 153 ? 8.662   -3.267  98.762  1.00 14.97  ? 260  GLY C C   1 
ATOM   8328  O  O   . GLY C  1 153 ? 8.905   -2.158  98.295  1.00 14.29  ? 260  GLY C O   1 
ATOM   8329  N  N   . LYS C  1 154 ? 9.464   -3.885  99.629  1.00 14.99  ? 261  LYS C N   1 
ATOM   8330  C  CA  . LYS C  1 154 ? 10.703  -3.282  100.132 1.00 14.11  ? 261  LYS C CA  1 
ATOM   8331  C  C   . LYS C  1 154 ? 11.885  -4.202  99.947  1.00 13.74  ? 261  LYS C C   1 
ATOM   8332  O  O   . LYS C  1 154 ? 13.029  -3.778  100.070 1.00 16.01  ? 261  LYS C O   1 
ATOM   8333  C  CB  . LYS C  1 154 ? 10.624  -3.014  101.637 1.00 13.36  ? 261  LYS C CB  1 
ATOM   8334  C  CG  . LYS C  1 154 ? 9.523   -2.104  102.087 1.00 17.71  ? 261  LYS C CG  1 
ATOM   8335  C  CD  . LYS C  1 154 ? 9.048   -2.466  103.507 1.00 21.64  ? 261  LYS C CD  1 
ATOM   8336  C  CE  . LYS C  1 154 ? 10.198  -2.536  104.510 1.00 22.55  ? 261  LYS C CE  1 
ATOM   8337  N  NZ  . LYS C  1 154 ? 9.718   -2.819  105.890 0.00 22.21  ? 261  LYS C NZ  1 
ATOM   8338  N  N   . THR C  1 155 ? 11.634  -5.470  99.678  1.00 12.83  ? 262  THR C N   1 
ATOM   8339  C  CA  . THR C  1 155 ? 12.745  -6.391  99.578  1.00 11.00  ? 262  THR C CA  1 
ATOM   8340  C  C   . THR C  1 155 ? 13.196  -6.858  98.201  1.00 10.95  ? 262  THR C C   1 
ATOM   8341  O  O   . THR C  1 155 ? 12.431  -6.908  97.245  1.00 11.63  ? 262  THR C O   1 
ATOM   8342  C  CB  . THR C  1 155 ? 12.497  -7.618  100.528 1.00 10.55  ? 262  THR C CB  1 
ATOM   8343  O  OG1 . THR C  1 155 ? 12.708  -8.843  99.830  1.00 9.61   ? 262  THR C OG1 1 
ATOM   8344  C  CG2 . THR C  1 155 ? 11.119  -7.585  101.095 1.00 7.67   ? 262  THR C CG2 1 
ATOM   8345  N  N   . VAL C  1 156 ? 14.483  -7.159  98.115  1.00 10.80  ? 263  VAL C N   1 
ATOM   8346  C  CA  . VAL C  1 156 ? 15.097  -7.657  96.900  1.00 10.89  ? 263  VAL C CA  1 
ATOM   8347  C  C   . VAL C  1 156 ? 15.856  -8.881  97.366  1.00 12.32  ? 263  VAL C C   1 
ATOM   8348  O  O   . VAL C  1 156 ? 16.862  -8.768  98.065  1.00 13.46  ? 263  VAL C O   1 
ATOM   8349  C  CB  . VAL C  1 156 ? 16.100  -6.656  96.294  1.00 10.50  ? 263  VAL C CB  1 
ATOM   8350  C  CG1 . VAL C  1 156 ? 16.823  -7.306  95.101  1.00 8.81   ? 263  VAL C CG1 1 
ATOM   8351  C  CG2 . VAL C  1 156 ? 15.370  -5.393  95.844  1.00 8.67   ? 263  VAL C CG2 1 
ATOM   8352  N  N   . ASP C  1 157 ? 15.381  -10.056 96.985  1.00 12.37  ? 264  ASP C N   1 
ATOM   8353  C  CA  . ASP C  1 157 ? 16.028  -11.281 97.430  1.00 13.02  ? 264  ASP C CA  1 
ATOM   8354  C  C   . ASP C  1 157 ? 15.783  -12.391 96.408  1.00 12.62  ? 264  ASP C C   1 
ATOM   8355  O  O   . ASP C  1 157 ? 14.843  -12.331 95.626  1.00 14.11  ? 264  ASP C O   1 
ATOM   8356  C  CB  . ASP C  1 157 ? 15.475  -11.626 98.827  1.00 13.36  ? 264  ASP C CB  1 
ATOM   8357  C  CG  . ASP C  1 157 ? 16.164  -12.815 99.482  1.00 15.78  ? 264  ASP C CG  1 
ATOM   8358  O  OD1 . ASP C  1 157 ? 17.310  -13.152 99.129  1.00 20.35  ? 264  ASP C OD1 1 
ATOM   8359  O  OD2 . ASP C  1 157 ? 15.554  -13.414 100.388 1.00 19.26  ? 264  ASP C OD2 1 
ATOM   8360  N  N   . GLY C  1 158 ? 16.649  -13.389 96.400  1.00 12.26  ? 265  GLY C N   1 
ATOM   8361  C  CA  . GLY C  1 158 ? 16.501  -14.479 95.455  1.00 12.70  ? 265  GLY C CA  1 
ATOM   8362  C  C   . GLY C  1 158 ? 17.220  -15.714 95.952  1.00 12.93  ? 265  GLY C C   1 
ATOM   8363  O  O   . GLY C  1 158 ? 17.760  -15.701 97.050  1.00 13.53  ? 265  GLY C O   1 
ATOM   8364  N  N   . PRO C  1 159 ? 17.254  -16.795 95.166  1.00 13.17  ? 266  PRO C N   1 
ATOM   8365  C  CA  . PRO C  1 159 ? 17.932  -18.009 95.610  1.00 12.80  ? 266  PRO C CA  1 
ATOM   8366  C  C   . PRO C  1 159 ? 19.400  -17.774 95.937  1.00 12.22  ? 266  PRO C C   1 
ATOM   8367  O  O   . PRO C  1 159 ? 20.054  -16.943 95.314  1.00 11.76  ? 266  PRO C O   1 
ATOM   8368  C  CB  . PRO C  1 159 ? 17.735  -18.955 94.425  1.00 13.47  ? 266  PRO C CB  1 
ATOM   8369  C  CG  . PRO C  1 159 ? 17.694  -18.038 93.264  1.00 10.92  ? 266  PRO C CG  1 
ATOM   8370  C  CD  . PRO C  1 159 ? 16.806  -16.933 93.770  1.00 13.45  ? 266  PRO C CD  1 
ATOM   8371  N  N   . ALA C  1 160 ? 19.909  -18.503 96.923  1.00 12.47  ? 267  ALA C N   1 
ATOM   8372  C  CA  . ALA C  1 160 ? 21.307  -18.382 97.312  1.00 13.37  ? 267  ALA C CA  1 
ATOM   8373  C  C   . ALA C  1 160 ? 22.131  -19.382 96.498  1.00 14.58  ? 267  ALA C C   1 
ATOM   8374  O  O   . ALA C  1 160 ? 21.640  -19.929 95.515  1.00 14.82  ? 267  ALA C O   1 
ATOM   8375  C  CB  . ALA C  1 160 ? 21.467  -18.636 98.793  1.00 12.84  ? 267  ALA C CB  1 
ATOM   8376  N  N   . ARG C  1 161 ? 23.372  -19.630 96.904  1.00 15.76  ? 268  ARG C N   1 
ATOM   8377  C  CA  . ARG C  1 161 ? 24.259  -20.531 96.164  1.00 16.49  ? 268  ARG C CA  1 
ATOM   8378  C  C   . ARG C  1 161 ? 23.753  -21.930 95.822  1.00 16.88  ? 268  ARG C C   1 
ATOM   8379  O  O   . ARG C  1 161 ? 23.779  -22.316 94.658  1.00 18.52  ? 268  ARG C O   1 
ATOM   8380  C  CB  . ARG C  1 161 ? 25.594  -20.682 96.884  1.00 18.85  ? 268  ARG C CB  1 
ATOM   8381  C  CG  . ARG C  1 161 ? 26.751  -19.885 96.313  1.00 23.79  ? 268  ARG C CG  1 
ATOM   8382  C  CD  . ARG C  1 161 ? 26.785  -18.498 96.879  1.00 28.09  ? 268  ARG C CD  1 
ATOM   8383  N  NE  . ARG C  1 161 ? 28.140  -18.013 97.181  1.00 33.73  ? 268  ARG C NE  1 
ATOM   8384  C  CZ  . ARG C  1 161 ? 29.114  -17.814 96.287  1.00 36.89  ? 268  ARG C CZ  1 
ATOM   8385  N  NH1 . ARG C  1 161 ? 28.924  -18.066 94.997  1.00 38.45  ? 268  ARG C NH1 1 
ATOM   8386  N  NH2 . ARG C  1 161 ? 30.283  -17.313 96.681  1.00 39.35  ? 268  ARG C NH2 1 
ATOM   8387  N  N   . LEU C  1 162 ? 23.321  -22.701 96.821  1.00 16.93  ? 269  LEU C N   1 
ATOM   8388  C  CA  . LEU C  1 162 ? 22.849  -24.064 96.580  1.00 14.09  ? 269  LEU C CA  1 
ATOM   8389  C  C   . LEU C  1 162 ? 21.538  -24.124 95.819  1.00 14.76  ? 269  LEU C C   1 
ATOM   8390  O  O   . LEU C  1 162 ? 21.339  -25.004 94.989  1.00 16.80  ? 269  LEU C O   1 
ATOM   8391  C  CB  . LEU C  1 162 ? 22.716  -24.835 97.897  1.00 12.12  ? 269  LEU C CB  1 
ATOM   8392  C  CG  . LEU C  1 162 ? 24.024  -25.215 98.610  1.00 11.77  ? 269  LEU C CG  1 
ATOM   8393  C  CD1 . LEU C  1 162 ? 23.705  -26.043 99.826  1.00 9.74   ? 269  LEU C CD1 1 
ATOM   8394  C  CD2 . LEU C  1 162 ? 24.944  -25.998 97.685  1.00 10.94  ? 269  LEU C CD2 1 
ATOM   8395  N  N   . ALA C  1 163 ? 20.633  -23.202 96.099  1.00 14.52  ? 270  ALA C N   1 
ATOM   8396  C  CA  . ALA C  1 163 ? 19.361  -23.185 95.394  1.00 14.42  ? 270  ALA C CA  1 
ATOM   8397  C  C   . ALA C  1 163 ? 19.599  -22.824 93.920  1.00 15.69  ? 270  ALA C C   1 
ATOM   8398  O  O   . ALA C  1 163 ? 18.959  -23.372 93.023  1.00 14.89  ? 270  ALA C O   1 
ATOM   8399  C  CB  . ALA C  1 163 ? 18.429  -22.178 96.034  1.00 13.76  ? 270  ALA C CB  1 
ATOM   8400  N  N   . GLU C  1 164 ? 20.518  -21.894 93.675  1.00 15.66  ? 271  GLU C N   1 
ATOM   8401  C  CA  . GLU C  1 164 ? 20.819  -21.487 92.314  1.00 15.92  ? 271  GLU C CA  1 
ATOM   8402  C  C   . GLU C  1 164 ? 21.350  -22.696 91.573  1.00 16.16  ? 271  GLU C C   1 
ATOM   8403  O  O   . GLU C  1 164 ? 21.019  -22.914 90.410  1.00 15.63  ? 271  GLU C O   1 
ATOM   8404  C  CB  . GLU C  1 164 ? 21.868  -20.376 92.281  1.00 17.00  ? 271  GLU C CB  1 
ATOM   8405  C  CG  . GLU C  1 164 ? 22.071  -19.795 90.889  1.00 19.51  ? 271  GLU C CG  1 
ATOM   8406  C  CD  . GLU C  1 164 ? 20.891  -18.943 90.436  1.00 23.49  ? 271  GLU C CD  1 
ATOM   8407  O  OE1 . GLU C  1 164 ? 20.604  -18.882 89.216  1.00 23.29  ? 271  GLU C OE1 1 
ATOM   8408  O  OE2 . GLU C  1 164 ? 20.254  -18.320 91.312  1.00 27.09  ? 271  GLU C OE2 1 
ATOM   8409  N  N   . GLU C  1 165 ? 22.187  -23.476 92.249  1.00 15.54  ? 272  GLU C N   1 
ATOM   8410  C  CA  . GLU C  1 165 ? 22.741  -24.678 91.650  1.00 15.37  ? 272  GLU C CA  1 
ATOM   8411  C  C   . GLU C  1 165 ? 21.610  -25.662 91.381  1.00 14.69  ? 272  GLU C C   1 
ATOM   8412  O  O   . GLU C  1 165 ? 21.527  -26.251 90.313  1.00 16.49  ? 272  GLU C O   1 
ATOM   8413  C  CB  . GLU C  1 165 ? 23.784  -25.325 92.575  1.00 15.72  ? 272  GLU C CB  1 
ATOM   8414  C  CG  . GLU C  1 165 ? 25.173  -24.694 92.496  1.00 19.19  ? 272  GLU C CG  1 
ATOM   8415  C  CD  . GLU C  1 165 ? 26.210  -25.423 93.350  1.00 21.48  ? 272  GLU C CD  1 
ATOM   8416  O  OE1 . GLU C  1 165 ? 27.422  -25.165 93.178  1.00 24.21  ? 272  GLU C OE1 1 
ATOM   8417  O  OE2 . GLU C  1 165 ? 25.822  -26.249 94.198  1.00 22.06  ? 272  GLU C OE2 1 
ATOM   8418  N  N   . ALA C  1 166 ? 20.732  -25.838 92.355  1.00 15.06  ? 273  ALA C N   1 
ATOM   8419  C  CA  . ALA C  1 166 ? 19.614  -26.753 92.196  1.00 14.71  ? 273  ALA C CA  1 
ATOM   8420  C  C   . ALA C  1 166 ? 18.800  -26.424 90.953  1.00 15.05  ? 273  ALA C C   1 
ATOM   8421  O  O   . ALA C  1 166 ? 18.445  -27.313 90.186  1.00 17.01  ? 273  ALA C O   1 
ATOM   8422  C  CB  . ALA C  1 166 ? 18.732  -26.699 93.416  1.00 15.00  ? 273  ALA C CB  1 
ATOM   8423  N  N   . PHE C  1 167 ? 18.502  -25.146 90.761  1.00 14.06  ? 274  PHE C N   1 
ATOM   8424  C  CA  . PHE C  1 167 ? 17.729  -24.711 89.613  1.00 14.28  ? 274  PHE C CA  1 
ATOM   8425  C  C   . PHE C  1 167 ? 18.391  -25.114 88.307  1.00 16.39  ? 274  PHE C C   1 
ATOM   8426  O  O   . PHE C  1 167 ? 17.757  -25.711 87.440  1.00 16.84  ? 274  PHE C O   1 
ATOM   8427  C  CB  . PHE C  1 167 ? 17.552  -23.191 89.631  1.00 12.97  ? 274  PHE C CB  1 
ATOM   8428  C  CG  . PHE C  1 167 ? 16.323  -22.730 90.350  1.00 11.98  ? 274  PHE C CG  1 
ATOM   8429  C  CD1 . PHE C  1 167 ? 16.383  -21.659 91.224  1.00 13.64  ? 274  PHE C CD1 1 
ATOM   8430  C  CD2 . PHE C  1 167 ? 15.095  -23.325 90.110  1.00 12.12  ? 274  PHE C CD2 1 
ATOM   8431  C  CE1 . PHE C  1 167 ? 15.236  -21.178 91.843  1.00 13.87  ? 274  PHE C CE1 1 
ATOM   8432  C  CE2 . PHE C  1 167 ? 13.941  -22.857 90.723  1.00 12.95  ? 274  PHE C CE2 1 
ATOM   8433  C  CZ  . PHE C  1 167 ? 14.009  -21.780 91.590  1.00 13.79  ? 274  PHE C CZ  1 
ATOM   8434  N  N   . PHE C  1 168 ? 19.670  -24.793 88.154  1.00 17.82  ? 275  PHE C N   1 
ATOM   8435  C  CA  . PHE C  1 168 ? 20.334  -25.119 86.910  1.00 17.94  ? 275  PHE C CA  1 
ATOM   8436  C  C   . PHE C  1 168 ? 20.525  -26.611 86.753  1.00 18.22  ? 275  PHE C C   1 
ATOM   8437  O  O   . PHE C  1 168 ? 20.410  -27.145 85.654  1.00 17.87  ? 275  PHE C O   1 
ATOM   8438  C  CB  . PHE C  1 168 ? 21.670  -24.391 86.790  1.00 19.93  ? 275  PHE C CB  1 
ATOM   8439  C  CG  . PHE C  1 168 ? 22.290  -24.508 85.423  1.00 22.52  ? 275  PHE C CG  1 
ATOM   8440  C  CD1 . PHE C  1 168 ? 23.257  -25.475 85.159  1.00 24.79  ? 275  PHE C CD1 1 
ATOM   8441  C  CD2 . PHE C  1 168 ? 21.862  -23.695 84.387  1.00 23.58  ? 275  PHE C CD2 1 
ATOM   8442  C  CE1 . PHE C  1 168 ? 23.787  -25.628 83.882  1.00 25.98  ? 275  PHE C CE1 1 
ATOM   8443  C  CE2 . PHE C  1 168 ? 22.382  -23.837 83.103  1.00 25.63  ? 275  PHE C CE2 1 
ATOM   8444  C  CZ  . PHE C  1 168 ? 23.344  -24.804 82.848  1.00 26.37  ? 275  PHE C CZ  1 
ATOM   8445  N  N   . ARG C  1 169 ? 20.801  -27.283 87.859  1.00 17.98  ? 276  ARG C N   1 
ATOM   8446  C  CA  . ARG C  1 169 ? 20.999  -28.720 87.843  1.00 17.82  ? 276  ARG C CA  1 
ATOM   8447  C  C   . ARG C  1 169 ? 19.720  -29.415 87.399  1.00 18.41  ? 276  ARG C C   1 
ATOM   8448  O  O   . ARG C  1 169 ? 19.749  -30.341 86.585  1.00 19.63  ? 276  ARG C O   1 
ATOM   8449  C  CB  . ARG C  1 169 ? 21.368  -29.209 89.240  1.00 17.89  ? 276  ARG C CB  1 
ATOM   8450  C  CG  . ARG C  1 169 ? 21.761  -30.671 89.306  1.00 18.26  ? 276  ARG C CG  1 
ATOM   8451  C  CD  . ARG C  1 169 ? 21.907  -31.129 90.750  1.00 19.50  ? 276  ARG C CD  1 
ATOM   8452  N  NE  . ARG C  1 169 ? 22.449  -32.482 90.837  1.00 21.24  ? 276  ARG C NE  1 
ATOM   8453  C  CZ  . ARG C  1 169 ? 23.715  -32.806 90.557  1.00 23.79  ? 276  ARG C CZ  1 
ATOM   8454  N  NH1 . ARG C  1 169 ? 24.105  -34.078 90.662  1.00 23.34  ? 276  ARG C NH1 1 
ATOM   8455  N  NH2 . ARG C  1 169 ? 24.595  -31.864 90.185  1.00 21.82  ? 276  ARG C NH2 1 
ATOM   8456  N  N   . GLY C  1 170 ? 18.594  -28.964 87.935  1.00 17.18  ? 277  GLY C N   1 
ATOM   8457  C  CA  . GLY C  1 170 ? 17.333  -29.586 87.593  1.00 17.11  ? 277  GLY C CA  1 
ATOM   8458  C  C   . GLY C  1 170 ? 16.910  -29.349 86.161  1.00 16.95  ? 277  GLY C C   1 
ATOM   8459  O  O   . GLY C  1 170 ? 16.306  -30.205 85.518  1.00 16.93  ? 277  GLY C O   1 
ATOM   8460  N  N   . VAL C  1 171 ? 17.233  -28.171 85.661  1.00 16.63  ? 278  VAL C N   1 
ATOM   8461  C  CA  . VAL C  1 171 ? 16.871  -27.783 84.316  1.00 16.34  ? 278  VAL C CA  1 
ATOM   8462  C  C   . VAL C  1 171 ? 17.767  -28.500 83.306  1.00 18.38  ? 278  VAL C C   1 
ATOM   8463  O  O   . VAL C  1 171 ? 17.383  -28.694 82.153  1.00 19.52  ? 278  VAL C O   1 
ATOM   8464  C  CB  . VAL C  1 171 ? 16.975  -26.243 84.190  1.00 14.97  ? 278  VAL C CB  1 
ATOM   8465  C  CG1 . VAL C  1 171 ? 17.831  -25.862 83.016  1.00 15.09  ? 278  VAL C CG1 1 
ATOM   8466  C  CG2 . VAL C  1 171 ? 15.595  -25.638 84.092  1.00 12.20  ? 278  VAL C CG2 1 
ATOM   8467  N  N   . SER C  1 172 ? 18.947  -28.915 83.757  1.00 19.12  ? 279  SER C N   1 
ATOM   8468  C  CA  . SER C  1 172 ? 19.914  -29.608 82.905  1.00 20.82  ? 279  SER C CA  1 
ATOM   8469  C  C   . SER C  1 172 ? 19.810  -31.128 82.946  1.00 21.55  ? 279  SER C C   1 
ATOM   8470  O  O   . SER C  1 172 ? 19.862  -31.795 81.912  1.00 21.99  ? 279  SER C O   1 
ATOM   8471  C  CB  . SER C  1 172 ? 21.336  -29.243 83.316  1.00 20.60  ? 279  SER C CB  1 
ATOM   8472  O  OG  . SER C  1 172 ? 21.549  -27.852 83.194  1.00 26.43  ? 279  SER C OG  1 
ATOM   8473  N  N   . GLN C  1 173 ? 19.666  -31.667 84.151  1.00 20.90  ? 280  GLN C N   1 
ATOM   8474  C  CA  . GLN C  1 173 ? 19.615  -33.104 84.343  1.00 20.16  ? 280  GLN C CA  1 
ATOM   8475  C  C   . GLN C  1 173 ? 18.258  -33.698 84.716  1.00 20.02  ? 280  GLN C C   1 
ATOM   8476  O  O   . GLN C  1 173 ? 18.063  -34.906 84.615  1.00 21.22  ? 280  GLN C O   1 
ATOM   8477  C  CB  . GLN C  1 173 ? 20.644  -33.478 85.404  1.00 20.43  ? 280  GLN C CB  1 
ATOM   8478  C  CG  . GLN C  1 173 ? 22.073  -33.136 85.013  1.00 24.87  ? 280  GLN C CG  1 
ATOM   8479  C  CD  . GLN C  1 173 ? 23.021  -33.049 86.216  1.00 28.34  ? 280  GLN C CD  1 
ATOM   8480  O  OE1 . GLN C  1 173 ? 22.868  -33.782 87.211  1.00 29.10  ? 280  GLN C OE1 1 
ATOM   8481  N  NE2 . GLN C  1 173 ? 24.012  -32.159 86.122  1.00 28.28  ? 280  GLN C NE2 1 
ATOM   8482  N  N   . GLY C  1 174 ? 17.325  -32.866 85.155  1.00 19.54  ? 281  GLY C N   1 
ATOM   8483  C  CA  . GLY C  1 174 ? 16.022  -33.381 85.542  1.00 18.24  ? 281  GLY C CA  1 
ATOM   8484  C  C   . GLY C  1 174 ? 15.303  -34.043 84.392  1.00 17.04  ? 281  GLY C C   1 
ATOM   8485  O  O   . GLY C  1 174 ? 15.609  -33.774 83.237  1.00 16.28  ? 281  GLY C O   1 
ATOM   8486  N  N   . ARG C  1 175 ? 14.336  -34.899 84.705  1.00 17.83  ? 282  ARG C N   1 
ATOM   8487  C  CA  . ARG C  1 175 ? 13.583  -35.610 83.670  1.00 18.40  ? 282  ARG C CA  1 
ATOM   8488  C  C   . ARG C  1 175 ? 14.524  -36.179 82.612  1.00 18.54  ? 282  ARG C C   1 
ATOM   8489  O  O   . ARG C  1 175 ? 14.343  -35.965 81.407  1.00 19.58  ? 282  ARG C O   1 
ATOM   8490  C  CB  . ARG C  1 175 ? 12.558  -34.685 83.010  1.00 16.27  ? 282  ARG C CB  1 
ATOM   8491  C  CG  . ARG C  1 175 ? 11.333  -34.451 83.863  1.00 16.17  ? 282  ARG C CG  1 
ATOM   8492  C  CD  . ARG C  1 175 ? 10.557  -33.270 83.344  1.00 16.16  ? 282  ARG C CD  1 
ATOM   8493  N  NE  . ARG C  1 175 ? 10.060  -33.510 82.000  1.00 17.39  ? 282  ARG C NE  1 
ATOM   8494  C  CZ  . ARG C  1 175 ? 10.188  -32.664 80.982  1.00 18.07  ? 282  ARG C CZ  1 
ATOM   8495  N  NH1 . ARG C  1 175 ? 10.807  -31.498 81.135  1.00 17.57  ? 282  ARG C NH1 1 
ATOM   8496  N  NH2 . ARG C  1 175 ? 9.686   -32.993 79.800  1.00 18.49  ? 282  ARG C NH2 1 
ATOM   8497  N  N   . GLY C  1 176 ? 15.539  -36.896 83.074  1.00 17.18  ? 283  GLY C N   1 
ATOM   8498  C  CA  . GLY C  1 176 ? 16.482  -37.498 82.158  1.00 17.47  ? 283  GLY C CA  1 
ATOM   8499  C  C   . GLY C  1 176 ? 17.091  -36.551 81.146  1.00 17.84  ? 283  GLY C C   1 
ATOM   8500  O  O   . GLY C  1 176 ? 17.362  -36.945 80.013  1.00 19.86  ? 283  GLY C O   1 
ATOM   8501  N  N   . GLY C  1 177 ? 17.307  -35.302 81.534  1.00 16.88  ? 284  GLY C N   1 
ATOM   8502  C  CA  . GLY C  1 177 ? 17.921  -34.364 80.617  1.00 14.80  ? 284  GLY C CA  1 
ATOM   8503  C  C   . GLY C  1 177 ? 16.968  -33.435 79.913  1.00 15.01  ? 284  GLY C C   1 
ATOM   8504  O  O   . GLY C  1 177 ? 17.403  -32.524 79.217  1.00 15.76  ? 284  GLY C O   1 
ATOM   8505  N  N   . LEU C  1 178 ? 15.670  -33.653 80.069  1.00 14.61  ? 285  LEU C N   1 
ATOM   8506  C  CA  . LEU C  1 178 ? 14.707  -32.775 79.428  1.00 14.89  ? 285  LEU C CA  1 
ATOM   8507  C  C   . LEU C  1 178 ? 14.526  -31.510 80.273  1.00 16.32  ? 285  LEU C C   1 
ATOM   8508  O  O   . LEU C  1 178 ? 14.089  -30.468 79.770  1.00 16.70  ? 285  LEU C O   1 
ATOM   8509  C  CB  . LEU C  1 178 ? 13.379  -33.503 79.249  1.00 15.85  ? 285  LEU C CB  1 
ATOM   8510  C  CG  . LEU C  1 178 ? 13.408  -34.707 78.297  1.00 15.07  ? 285  LEU C CG  1 
ATOM   8511  C  CD1 . LEU C  1 178 ? 12.047  -35.374 78.253  1.00 14.93  ? 285  LEU C CD1 1 
ATOM   8512  C  CD2 . LEU C  1 178 ? 13.797  -34.244 76.914  1.00 14.41  ? 285  LEU C CD2 1 
ATOM   8513  N  N   . GLY C  1 179 ? 14.865  -31.617 81.561  1.00 15.90  ? 286  GLY C N   1 
ATOM   8514  C  CA  . GLY C  1 179 ? 14.776  -30.486 82.468  1.00 13.93  ? 286  GLY C CA  1 
ATOM   8515  C  C   . GLY C  1 179 ? 13.543  -30.428 83.350  1.00 13.80  ? 286  GLY C C   1 
ATOM   8516  O  O   . GLY C  1 179 ? 12.421  -30.569 82.872  1.00 13.70  ? 286  GLY C O   1 
ATOM   8517  N  N   . SER C  1 180 ? 13.748  -30.220 84.647  1.00 13.12  ? 287  SER C N   1 
ATOM   8518  C  CA  . SER C  1 180 ? 12.637  -30.116 85.581  1.00 12.65  ? 287  SER C CA  1 
ATOM   8519  C  C   . SER C  1 180 ? 11.850  -28.867 85.206  1.00 13.00  ? 287  SER C C   1 
ATOM   8520  O  O   . SER C  1 180 ? 12.410  -27.893 84.703  1.00 13.40  ? 287  SER C O   1 
ATOM   8521  C  CB  . SER C  1 180 ? 13.137  -29.944 87.018  1.00 12.47  ? 287  SER C CB  1 
ATOM   8522  O  OG  . SER C  1 180 ? 13.957  -31.013 87.427  1.00 13.88  ? 287  SER C OG  1 
ATOM   8523  N  N   . ILE C  1 181 ? 10.553  -28.883 85.456  1.00 11.92  ? 288  ILE C N   1 
ATOM   8524  C  CA  . ILE C  1 181 ? 9.740   -27.724 85.156  1.00 11.54  ? 288  ILE C CA  1 
ATOM   8525  C  C   . ILE C  1 181 ? 9.315   -27.095 86.462  1.00 11.13  ? 288  ILE C C   1 
ATOM   8526  O  O   . ILE C  1 181 ? 8.568   -27.683 87.238  1.00 10.85  ? 288  ILE C O   1 
ATOM   8527  C  CB  . ILE C  1 181 ? 8.508   -28.107 84.343  1.00 13.03  ? 288  ILE C CB  1 
ATOM   8528  C  CG1 . ILE C  1 181 ? 8.963   -28.555 82.950  1.00 13.17  ? 288  ILE C CG1 1 
ATOM   8529  C  CG2 . ILE C  1 181 ? 7.538   -26.933 84.277  1.00 8.34   ? 288  ILE C CG2 1 
ATOM   8530  C  CD1 . ILE C  1 181 ? 7.894   -29.264 82.173  1.00 16.49  ? 288  ILE C CD1 1 
ATOM   8531  N  N   . PHE C  1 182 ? 9.809   -25.888 86.698  1.00 10.98  ? 289  PHE C N   1 
ATOM   8532  C  CA  . PHE C  1 182 ? 9.515   -25.159 87.918  1.00 10.20  ? 289  PHE C CA  1 
ATOM   8533  C  C   . PHE C  1 182 ? 8.479   -24.080 87.684  1.00 10.30  ? 289  PHE C C   1 
ATOM   8534  O  O   . PHE C  1 182 ? 8.756   -23.093 87.011  1.00 12.08  ? 289  PHE C O   1 
ATOM   8535  C  CB  . PHE C  1 182 ? 10.786  -24.517 88.451  1.00 8.85   ? 289  PHE C CB  1 
ATOM   8536  C  CG  . PHE C  1 182 ? 11.890  -25.496 88.738  1.00 6.72   ? 289  PHE C CG  1 
ATOM   8537  C  CD1 . PHE C  1 182 ? 13.049  -25.511 87.961  1.00 6.10   ? 289  PHE C CD1 1 
ATOM   8538  C  CD2 . PHE C  1 182 ? 11.802  -26.364 89.825  1.00 6.32   ? 289  PHE C CD2 1 
ATOM   8539  C  CE1 . PHE C  1 182 ? 14.116  -26.378 88.271  1.00 5.69   ? 289  PHE C CE1 1 
ATOM   8540  C  CE2 . PHE C  1 182 ? 12.862  -27.234 90.140  1.00 5.60   ? 289  PHE C CE2 1 
ATOM   8541  C  CZ  . PHE C  1 182 ? 14.018  -27.237 89.364  1.00 4.40   ? 289  PHE C CZ  1 
ATOM   8542  N  N   . VAL C  1 183 ? 7.289   -24.275 88.241  1.00 10.77  ? 290  VAL C N   1 
ATOM   8543  C  CA  . VAL C  1 183 ? 6.196   -23.309 88.112  1.00 11.23  ? 290  VAL C CA  1 
ATOM   8544  C  C   . VAL C  1 183 ? 6.149   -22.456 89.382  1.00 10.54  ? 290  VAL C C   1 
ATOM   8545  O  O   . VAL C  1 183 ? 6.132   -22.981 90.486  1.00 10.33  ? 290  VAL C O   1 
ATOM   8546  C  CB  . VAL C  1 183 ? 4.862   -24.041 87.906  1.00 9.89   ? 290  VAL C CB  1 
ATOM   8547  C  CG1 . VAL C  1 183 ? 3.726   -23.046 87.742  1.00 9.50   ? 290  VAL C CG1 1 
ATOM   8548  C  CG2 . VAL C  1 183 ? 4.968   -24.923 86.690  1.00 8.51   ? 290  VAL C CG2 1 
ATOM   8549  N  N   . TRP C  1 184 ? 6.119   -21.138 89.222  1.00 12.33  ? 291  TRP C N   1 
ATOM   8550  C  CA  . TRP C  1 184 ? 6.133   -20.231 90.370  1.00 11.67  ? 291  TRP C CA  1 
ATOM   8551  C  C   . TRP C  1 184 ? 4.990   -19.228 90.423  1.00 11.98  ? 291  TRP C C   1 
ATOM   8552  O  O   . TRP C  1 184 ? 4.530   -18.757 89.387  1.00 13.77  ? 291  TRP C O   1 
ATOM   8553  C  CB  . TRP C  1 184 ? 7.463   -19.470 90.366  1.00 10.72  ? 291  TRP C CB  1 
ATOM   8554  C  CG  . TRP C  1 184 ? 8.117   -19.430 91.700  1.00 12.41  ? 291  TRP C CG  1 
ATOM   8555  C  CD1 . TRP C  1 184 ? 7.833   -18.574 92.729  1.00 12.04  ? 291  TRP C CD1 1 
ATOM   8556  C  CD2 . TRP C  1 184 ? 9.092   -20.352 92.199  1.00 9.81   ? 291  TRP C CD2 1 
ATOM   8557  N  NE1 . TRP C  1 184 ? 8.563   -18.916 93.838  1.00 13.02  ? 291  TRP C NE1 1 
ATOM   8558  C  CE2 . TRP C  1 184 ? 9.344   -20.003 93.543  1.00 10.81  ? 291  TRP C CE2 1 
ATOM   8559  C  CE3 . TRP C  1 184 ? 9.770   -21.439 91.643  1.00 9.26   ? 291  TRP C CE3 1 
ATOM   8560  C  CZ2 . TRP C  1 184 ? 10.248  -20.703 94.348  1.00 10.83  ? 291  TRP C CZ2 1 
ATOM   8561  C  CZ3 . TRP C  1 184 ? 10.673  -22.142 92.439  1.00 12.22  ? 291  TRP C CZ3 1 
ATOM   8562  C  CH2 . TRP C  1 184 ? 10.902  -21.768 93.787  1.00 11.50  ? 291  TRP C CH2 1 
ATOM   8563  N  N   . ALA C  1 185 ? 4.541   -18.901 91.631  1.00 10.96  ? 292  ALA C N   1 
ATOM   8564  C  CA  . ALA C  1 185 ? 3.489   -17.906 91.823  1.00 12.27  ? 292  ALA C CA  1 
ATOM   8565  C  C   . ALA C  1 185 ? 4.223   -16.562 91.809  1.00 14.05  ? 292  ALA C C   1 
ATOM   8566  O  O   . ALA C  1 185 ? 5.185   -16.387 92.554  1.00 15.41  ? 292  ALA C O   1 
ATOM   8567  C  CB  . ALA C  1 185 ? 2.800   -18.119 93.172  1.00 11.84  ? 292  ALA C CB  1 
ATOM   8568  N  N   . SER C  1 186 ? 3.777   -15.610 90.989  1.00 15.22  ? 293  SER C N   1 
ATOM   8569  C  CA  . SER C  1 186 ? 4.479   -14.327 90.889  1.00 15.51  ? 293  SER C CA  1 
ATOM   8570  C  C   . SER C  1 186 ? 4.491   -13.387 92.104  1.00 16.35  ? 293  SER C C   1 
ATOM   8571  O  O   . SER C  1 186 ? 5.330   -12.487 92.164  1.00 17.35  ? 293  SER C O   1 
ATOM   8572  C  CB  . SER C  1 186 ? 3.998   -13.548 89.661  1.00 13.82  ? 293  SER C CB  1 
ATOM   8573  O  OG  . SER C  1 186 ? 2.663   -13.128 89.821  1.00 17.76  ? 293  SER C OG  1 
ATOM   8574  N  N   . GLY C  1 187 ? 3.590   -13.569 93.066  1.00 15.55  ? 294  GLY C N   1 
ATOM   8575  C  CA  . GLY C  1 187 ? 3.612   -12.690 94.225  1.00 14.25  ? 294  GLY C CA  1 
ATOM   8576  C  C   . GLY C  1 187 ? 2.304   -12.012 94.570  1.00 15.23  ? 294  GLY C C   1 
ATOM   8577  O  O   . GLY C  1 187 ? 1.495   -11.707 93.692  1.00 14.95  ? 294  GLY C O   1 
ATOM   8578  N  N   . ASN C  1 188 ? 2.099   -11.760 95.860  1.00 15.06  ? 295  ASN C N   1 
ATOM   8579  C  CA  . ASN C  1 188 ? 0.874   -11.116 96.321  1.00 15.40  ? 295  ASN C CA  1 
ATOM   8580  C  C   . ASN C  1 188 ? 1.082   -9.703  96.863  1.00 15.14  ? 295  ASN C C   1 
ATOM   8581  O  O   . ASN C  1 188 ? 0.234   -9.191  97.586  1.00 14.38  ? 295  ASN C O   1 
ATOM   8582  C  CB  . ASN C  1 188 ? 0.212   -11.964 97.412  1.00 15.26  ? 295  ASN C CB  1 
ATOM   8583  C  CG  . ASN C  1 188 ? -0.180  -13.353 96.927  1.00 13.99  ? 295  ASN C CG  1 
ATOM   8584  O  OD1 . ASN C  1 188 ? -0.573  -13.535 95.778  1.00 12.98  ? 295  ASN C OD1 1 
ATOM   8585  N  ND2 . ASN C  1 188 ? -0.093  -14.335 97.815  1.00 14.24  ? 295  ASN C ND2 1 
ATOM   8586  N  N   . GLY C  1 189 ? 2.193   -9.066  96.509  1.00 15.36  ? 296  GLY C N   1 
ATOM   8587  C  CA  . GLY C  1 189 ? 2.452   -7.731  97.028  1.00 17.83  ? 296  GLY C CA  1 
ATOM   8588  C  C   . GLY C  1 189 ? 1.856   -6.562  96.263  1.00 19.66  ? 296  GLY C C   1 
ATOM   8589  O  O   . GLY C  1 189 ? 2.336   -5.438  96.374  1.00 20.98  ? 296  GLY C O   1 
ATOM   8590  N  N   . GLY C  1 190 ? 0.802   -6.810  95.499  1.00 20.73  ? 297  GLY C N   1 
ATOM   8591  C  CA  . GLY C  1 190 ? 0.198   -5.744  94.725  1.00 21.46  ? 297  GLY C CA  1 
ATOM   8592  C  C   . GLY C  1 190 ? -0.157  -4.503  95.513  1.00 22.63  ? 297  GLY C C   1 
ATOM   8593  O  O   . GLY C  1 190 ? 0.170   -3.384  95.117  1.00 23.58  ? 297  GLY C O   1 
ATOM   8594  N  N   . ARG C  1 191 ? -0.833  -4.695  96.633  1.00 23.47  ? 298  ARG C N   1 
ATOM   8595  C  CA  . ARG C  1 191 ? -1.248  -3.582  97.464  1.00 24.46  ? 298  ARG C CA  1 
ATOM   8596  C  C   . ARG C  1 191 ? -0.045  -2.738  97.911  1.00 24.29  ? 298  ARG C C   1 
ATOM   8597  O  O   . ARG C  1 191 ? -0.181  -1.539  98.161  1.00 24.44  ? 298  ARG C O   1 
ATOM   8598  C  CB  . ARG C  1 191 ? -2.024  -4.128  98.659  1.00 25.13  ? 298  ARG C CB  1 
ATOM   8599  C  CG  . ARG C  1 191 ? -2.721  -3.088  99.504  1.00 29.76  ? 298  ARG C CG  1 
ATOM   8600  C  CD  . ARG C  1 191 ? -3.744  -3.746  100.420 1.00 33.43  ? 298  ARG C CD  1 
ATOM   8601  N  NE  . ARG C  1 191 ? -4.994  -4.081  99.724  1.00 36.47  ? 298  ARG C NE  1 
ATOM   8602  C  CZ  . ARG C  1 191 ? -5.850  -5.019  100.137 1.00 37.46  ? 298  ARG C CZ  1 
ATOM   8603  N  NH1 . ARG C  1 191 ? -6.968  -5.252  99.454  1.00 37.09  ? 298  ARG C NH1 1 
ATOM   8604  N  NH2 . ARG C  1 191 ? -5.578  -5.745  101.220 1.00 35.97  ? 298  ARG C NH2 1 
ATOM   8605  N  N   . GLU C  1 192 ? 1.132   -3.357  97.985  1.00 23.81  ? 299  GLU C N   1 
ATOM   8606  C  CA  . GLU C  1 192 ? 2.349   -2.650  98.392  1.00 23.35  ? 299  GLU C CA  1 
ATOM   8607  C  C   . GLU C  1 192 ? 3.119   -2.148  97.185  1.00 22.34  ? 299  GLU C C   1 
ATOM   8608  O  O   . GLU C  1 192 ? 4.209   -1.608  97.325  1.00 22.13  ? 299  GLU C O   1 
ATOM   8609  C  CB  . GLU C  1 192 ? 3.275   -3.565  99.202  1.00 25.78  ? 299  GLU C CB  1 
ATOM   8610  C  CG  . GLU C  1 192 ? 2.608   -4.297  100.360 1.00 30.52  ? 299  GLU C CG  1 
ATOM   8611  C  CD  . GLU C  1 192 ? 1.743   -3.376  101.200 1.00 34.92  ? 299  GLU C CD  1 
ATOM   8612  O  OE1 . GLU C  1 192 ? 2.254   -2.322  101.657 1.00 35.89  ? 299  GLU C OE1 1 
ATOM   8613  O  OE2 . GLU C  1 192 ? 0.547   -3.706  101.399 1.00 37.72  ? 299  GLU C OE2 1 
ATOM   8614  N  N   . HIS C  1 193 ? 2.552   -2.345  96.000  1.00 22.34  ? 300  HIS C N   1 
ATOM   8615  C  CA  . HIS C  1 193 ? 3.179   -1.922  94.756  1.00 21.13  ? 300  HIS C CA  1 
ATOM   8616  C  C   . HIS C  1 193 ? 4.487   -2.636  94.540  1.00 20.47  ? 300  HIS C C   1 
ATOM   8617  O  O   . HIS C  1 193 ? 5.438   -2.080  93.986  1.00 20.28  ? 300  HIS C O   1 
ATOM   8618  C  CB  . HIS C  1 193 ? 3.373   -0.411  94.773  1.00 22.90  ? 300  HIS C CB  1 
ATOM   8619  C  CG  . HIS C  1 193 ? 2.080   0.331   94.847  1.00 25.43  ? 300  HIS C CG  1 
ATOM   8620  N  ND1 . HIS C  1 193 ? 1.235   0.454   93.762  1.00 25.86  ? 300  HIS C ND1 1 
ATOM   8621  C  CD2 . HIS C  1 193 ? 1.425   0.879   95.899  1.00 26.19  ? 300  HIS C CD2 1 
ATOM   8622  C  CE1 . HIS C  1 193 ? 0.116   1.044   94.145  1.00 26.39  ? 300  HIS C CE1 1 
ATOM   8623  N  NE2 . HIS C  1 193 ? 0.206   1.312   95.437  1.00 26.46  ? 300  HIS C NE2 1 
ATOM   8624  N  N   . ASP C  1 194 ? 4.521   -3.889  94.977  1.00 19.28  ? 301  ASP C N   1 
ATOM   8625  C  CA  . ASP C  1 194 ? 5.707   -4.721  94.835  1.00 18.32  ? 301  ASP C CA  1 
ATOM   8626  C  C   . ASP C  1 194 ? 5.931   -5.070  93.355  1.00 17.86  ? 301  ASP C C   1 
ATOM   8627  O  O   . ASP C  1 194 ? 4.998   -5.038  92.547  1.00 15.89  ? 301  ASP C O   1 
ATOM   8628  C  CB  . ASP C  1 194 ? 5.531   -5.998  95.658  1.00 17.39  ? 301  ASP C CB  1 
ATOM   8629  C  CG  . ASP C  1 194 ? 6.837   -6.685  95.937  1.00 17.59  ? 301  ASP C CG  1 
ATOM   8630  O  OD1 . ASP C  1 194 ? 6.816   -7.816  96.466  1.00 15.56  ? 301  ASP C OD1 1 
ATOM   8631  O  OD2 . ASP C  1 194 ? 7.889   -6.081  95.627  1.00 20.45  ? 301  ASP C OD2 1 
ATOM   8632  N  N   . SER C  1 195 ? 7.173   -5.392  93.012  1.00 17.45  ? 302  SER C N   1 
ATOM   8633  C  CA  . SER C  1 195 ? 7.529   -5.747  91.647  1.00 19.08  ? 302  SER C CA  1 
ATOM   8634  C  C   . SER C  1 195 ? 8.116   -7.141  91.669  1.00 20.11  ? 302  SER C C   1 
ATOM   8635  O  O   . SER C  1 195 ? 9.063   -7.388  92.416  1.00 20.64  ? 302  SER C O   1 
ATOM   8636  C  CB  . SER C  1 195 ? 8.566   -4.771  91.099  1.00 19.86  ? 302  SER C CB  1 
ATOM   8637  O  OG  . SER C  1 195 ? 9.108   -5.248  89.873  1.00 23.70  ? 302  SER C OG  1 
ATOM   8638  N  N   . CYS C  1 196 ? 7.580   -8.055  90.862  1.00 20.23  ? 303  CYS C N   1 
ATOM   8639  C  CA  . CYS C  1 196 ? 8.110   -9.413  90.885  1.00 20.66  ? 303  CYS C CA  1 
ATOM   8640  C  C   . CYS C  1 196 ? 9.493   -9.565  90.285  1.00 19.43  ? 303  CYS C C   1 
ATOM   8641  O  O   . CYS C  1 196 ? 10.054  -10.655 90.309  1.00 20.07  ? 303  CYS C O   1 
ATOM   8642  C  CB  . CYS C  1 196 ? 7.139   -10.432 90.249  1.00 22.89  ? 303  CYS C CB  1 
ATOM   8643  S  SG  . CYS C  1 196 ? 5.981   -9.884  88.944  1.00 28.99  ? 303  CYS C SG  1 
ATOM   8644  N  N   . ASN C  1 197 ? 10.055  -8.484  89.756  1.00 18.67  ? 304  ASN C N   1 
ATOM   8645  C  CA  . ASN C  1 197 ? 11.406  -8.556  89.207  1.00 18.88  ? 304  ASN C CA  1 
ATOM   8646  C  C   . ASN C  1 197 ? 12.409  -8.458  90.350  1.00 17.88  ? 304  ASN C C   1 
ATOM   8647  O  O   . ASN C  1 197 ? 13.613  -8.657  90.156  1.00 18.34  ? 304  ASN C O   1 
ATOM   8648  C  CB  . ASN C  1 197 ? 11.648  -7.424  88.210  1.00 21.23  ? 304  ASN C CB  1 
ATOM   8649  C  CG  . ASN C  1 197 ? 11.121  -7.743  86.826  1.00 22.88  ? 304  ASN C CG  1 
ATOM   8650  O  OD1 . ASN C  1 197 ? 10.304  -8.644  86.651  1.00 26.45  ? 304  ASN C OD1 1 
ATOM   8651  N  ND2 . ASN C  1 197 ? 11.577  -6.997  85.837  1.00 23.84  ? 304  ASN C ND2 1 
ATOM   8652  N  N   . CYS C  1 198 ? 11.903  -8.142  91.541  1.00 15.90  ? 305  CYS C N   1 
ATOM   8653  C  CA  . CYS C  1 198 ? 12.729  -8.033  92.736  1.00 15.10  ? 305  CYS C CA  1 
ATOM   8654  C  C   . CYS C  1 198 ? 12.666  -9.332  93.519  1.00 15.07  ? 305  CYS C C   1 
ATOM   8655  O  O   . CYS C  1 198 ? 13.104  -9.389  94.667  1.00 15.92  ? 305  CYS C O   1 
ATOM   8656  C  CB  . CYS C  1 198 ? 12.240  -6.901  93.624  1.00 15.30  ? 305  CYS C CB  1 
ATOM   8657  S  SG  . CYS C  1 198 ? 12.466  -5.267  92.929  1.00 15.03  ? 305  CYS C SG  1 
ATOM   8658  N  N   . ASP C  1 199 ? 12.107  -10.359 92.882  1.00 13.36  ? 306  ASP C N   1 
ATOM   8659  C  CA  . ASP C  1 199 ? 11.944  -11.692 93.450  1.00 11.68  ? 306  ASP C CA  1 
ATOM   8660  C  C   . ASP C  1 199 ? 12.768  -12.630 92.553  1.00 12.64  ? 306  ASP C C   1 
ATOM   8661  O  O   . ASP C  1 199 ? 12.347  -12.978 91.452  1.00 11.70  ? 306  ASP C O   1 
ATOM   8662  C  CB  . ASP C  1 199 ? 10.455  -12.065 93.406  1.00 11.72  ? 306  ASP C CB  1 
ATOM   8663  C  CG  . ASP C  1 199 ? 10.180  -13.487 93.850  1.00 10.72  ? 306  ASP C CG  1 
ATOM   8664  O  OD1 . ASP C  1 199 ? 11.072  -14.346 93.698  1.00 13.00  ? 306  ASP C OD1 1 
ATOM   8665  O  OD2 . ASP C  1 199 ? 9.058   -13.755 94.328  1.00 9.31   ? 306  ASP C OD2 1 
ATOM   8666  N  N   . GLY C  1 200 ? 13.942  -13.032 93.032  1.00 12.56  ? 307  GLY C N   1 
ATOM   8667  C  CA  . GLY C  1 200 ? 14.822  -13.896 92.265  1.00 11.06  ? 307  GLY C CA  1 
ATOM   8668  C  C   . GLY C  1 200 ? 14.282  -15.257 91.865  1.00 12.16  ? 307  GLY C C   1 
ATOM   8669  O  O   . GLY C  1 200 ? 14.866  -15.930 91.019  1.00 9.93   ? 307  GLY C O   1 
ATOM   8670  N  N   . TYR C  1 201 ? 13.183  -15.691 92.470  1.00 12.22  ? 308  TYR C N   1 
ATOM   8671  C  CA  . TYR C  1 201 ? 12.628  -16.983 92.101  1.00 11.54  ? 308  TYR C CA  1 
ATOM   8672  C  C   . TYR C  1 201 ? 11.733  -16.824 90.880  1.00 13.11  ? 308  TYR C C   1 
ATOM   8673  O  O   . TYR C  1 201 ? 11.838  -17.578 89.920  1.00 14.74  ? 308  TYR C O   1 
ATOM   8674  C  CB  . TYR C  1 201 ? 11.850  -17.570 93.269  1.00 10.72  ? 308  TYR C CB  1 
ATOM   8675  C  CG  . TYR C  1 201 ? 12.742  -17.845 94.452  1.00 11.52  ? 308  TYR C CG  1 
ATOM   8676  C  CD1 . TYR C  1 201 ? 13.087  -16.825 95.340  1.00 12.98  ? 308  TYR C CD1 1 
ATOM   8677  C  CD2 . TYR C  1 201 ? 13.299  -19.101 94.651  1.00 11.28  ? 308  TYR C CD2 1 
ATOM   8678  C  CE1 . TYR C  1 201 ? 13.965  -17.048 96.390  1.00 12.31  ? 308  TYR C CE1 1 
ATOM   8679  C  CE2 . TYR C  1 201 ? 14.185  -19.334 95.705  1.00 13.73  ? 308  TYR C CE2 1 
ATOM   8680  C  CZ  . TYR C  1 201 ? 14.509  -18.298 96.564  1.00 12.49  ? 308  TYR C CZ  1 
ATOM   8681  O  OH  . TYR C  1 201 ? 15.386  -18.512 97.583  1.00 13.30  ? 308  TYR C OH  1 
ATOM   8682  N  N   . THR C  1 202 ? 10.865  -15.824 90.905  1.00 13.21  ? 309  THR C N   1 
ATOM   8683  C  CA  . THR C  1 202 ? 9.972   -15.585 89.793  1.00 12.75  ? 309  THR C CA  1 
ATOM   8684  C  C   . THR C  1 202 ? 10.760  -14.977 88.639  1.00 13.59  ? 309  THR C C   1 
ATOM   8685  O  O   . THR C  1 202 ? 10.465  -15.209 87.479  1.00 14.47  ? 309  THR C O   1 
ATOM   8686  C  CB  . THR C  1 202 ? 8.846   -14.607 90.201  1.00 11.94  ? 309  THR C CB  1 
ATOM   8687  O  OG1 . THR C  1 202 ? 9.422   -13.436 90.779  1.00 12.77  ? 309  THR C OG1 1 
ATOM   8688  C  CG2 . THR C  1 202 ? 7.919   -15.234 91.215  1.00 12.81  ? 309  THR C CG2 1 
ATOM   8689  N  N   . ASN C  1 203 ? 11.777  -14.205 88.974  1.00 14.64  ? 310  ASN C N   1 
ATOM   8690  C  CA  . ASN C  1 203 ? 12.599  -13.514 87.990  1.00 14.71  ? 310  ASN C CA  1 
ATOM   8691  C  C   . ASN C  1 203 ? 13.593  -14.450 87.298  1.00 14.40  ? 310  ASN C C   1 
ATOM   8692  O  O   . ASN C  1 203 ? 14.246  -14.074 86.323  1.00 13.99  ? 310  ASN C O   1 
ATOM   8693  C  CB  . ASN C  1 203 ? 13.336  -12.373 88.700  1.00 15.56  ? 310  ASN C CB  1 
ATOM   8694  C  CG  . ASN C  1 203 ? 13.999  -11.425 87.753  1.00 18.17  ? 310  ASN C CG  1 
ATOM   8695  O  OD1 . ASN C  1 203 ? 13.340  -10.741 86.969  1.00 21.56  ? 310  ASN C OD1 1 
ATOM   8696  N  ND2 . ASN C  1 203 ? 15.320  -11.364 87.820  1.00 20.63  ? 310  ASN C ND2 1 
ATOM   8697  N  N   . SER C  1 204 ? 13.707  -15.672 87.806  1.00 14.62  ? 311  SER C N   1 
ATOM   8698  C  CA  . SER C  1 204 ? 14.619  -16.662 87.234  1.00 14.24  ? 311  SER C CA  1 
ATOM   8699  C  C   . SER C  1 204 ? 14.149  -17.135 85.859  1.00 14.67  ? 311  SER C C   1 
ATOM   8700  O  O   . SER C  1 204 ? 12.943  -17.195 85.596  1.00 14.61  ? 311  SER C O   1 
ATOM   8701  C  CB  . SER C  1 204 ? 14.717  -17.876 88.157  1.00 14.01  ? 311  SER C CB  1 
ATOM   8702  O  OG  . SER C  1 204 ? 15.596  -18.858 87.620  1.00 15.87  ? 311  SER C OG  1 
ATOM   8703  N  N   . ILE C  1 205 ? 15.085  -17.488 84.981  1.00 12.75  ? 312  ILE C N   1 
ATOM   8704  C  CA  . ILE C  1 205 ? 14.672  -17.962 83.667  1.00 11.38  ? 312  ILE C CA  1 
ATOM   8705  C  C   . ILE C  1 205 ? 14.268  -19.428 83.779  1.00 12.09  ? 312  ILE C C   1 
ATOM   8706  O  O   . ILE C  1 205 ? 13.592  -19.968 82.900  1.00 12.93  ? 312  ILE C O   1 
ATOM   8707  C  CB  . ILE C  1 205 ? 15.790  -17.852 82.606  1.00 8.55   ? 312  ILE C CB  1 
ATOM   8708  C  CG1 . ILE C  1 205 ? 16.882  -18.881 82.882  1.00 7.59   ? 312  ILE C CG1 1 
ATOM   8709  C  CG2 . ILE C  1 205 ? 16.378  -16.455 82.602  1.00 7.86   ? 312  ILE C CG2 1 
ATOM   8710  C  CD1 . ILE C  1 205 ? 17.906  -18.961 81.773  1.00 4.71   ? 312  ILE C CD1 1 
ATOM   8711  N  N   . TYR C  1 206 ? 14.667  -20.065 84.874  1.00 11.79  ? 313  TYR C N   1 
ATOM   8712  C  CA  . TYR C  1 206 ? 14.374  -21.481 85.079  1.00 10.84  ? 313  TYR C CA  1 
ATOM   8713  C  C   . TYR C  1 206 ? 12.969  -21.741 85.562  1.00 10.53  ? 313  TYR C C   1 
ATOM   8714  O  O   . TYR C  1 206 ? 12.561  -22.889 85.676  1.00 11.42  ? 313  TYR C O   1 
ATOM   8715  C  CB  . TYR C  1 206 ? 15.338  -22.092 86.095  1.00 10.25  ? 313  TYR C CB  1 
ATOM   8716  C  CG  . TYR C  1 206 ? 16.785  -21.799 85.817  1.00 11.50  ? 313  TYR C CG  1 
ATOM   8717  C  CD1 . TYR C  1 206 ? 17.563  -21.095 86.737  1.00 11.29  ? 313  TYR C CD1 1 
ATOM   8718  C  CD2 . TYR C  1 206 ? 17.382  -22.215 84.628  1.00 12.75  ? 313  TYR C CD2 1 
ATOM   8719  C  CE1 . TYR C  1 206 ? 18.905  -20.810 86.480  1.00 11.60  ? 313  TYR C CE1 1 
ATOM   8720  C  CE2 . TYR C  1 206 ? 18.723  -21.940 84.359  1.00 13.36  ? 313  TYR C CE2 1 
ATOM   8721  C  CZ  . TYR C  1 206 ? 19.480  -21.236 85.284  1.00 13.59  ? 313  TYR C CZ  1 
ATOM   8722  O  OH  . TYR C  1 206 ? 20.802  -20.952 85.001  1.00 13.66  ? 313  TYR C OH  1 
ATOM   8723  N  N   . THR C  1 207 ? 12.221  -20.688 85.851  1.00 10.64  ? 314  THR C N   1 
ATOM   8724  C  CA  . THR C  1 207 ? 10.868  -20.874 86.353  1.00 10.58  ? 314  THR C CA  1 
ATOM   8725  C  C   . THR C  1 207 ? 9.836   -20.223 85.465  1.00 11.71  ? 314  THR C C   1 
ATOM   8726  O  O   . THR C  1 207 ? 10.128  -19.228 84.811  1.00 12.42  ? 314  THR C O   1 
ATOM   8727  C  CB  . THR C  1 207 ? 10.706  -20.241 87.755  1.00 10.63  ? 314  THR C CB  1 
ATOM   8728  O  OG1 . THR C  1 207 ? 10.773  -18.810 87.640  1.00 10.03  ? 314  THR C OG1 1 
ATOM   8729  C  CG2 . THR C  1 207 ? 11.802  -20.712 88.685  1.00 7.67   ? 314  THR C CG2 1 
ATOM   8730  N  N   . LEU C  1 208 ? 8.631   -20.790 85.428  1.00 12.86  ? 315  LEU C N   1 
ATOM   8731  C  CA  . LEU C  1 208 ? 7.545   -20.171 84.672  1.00 13.33  ? 315  LEU C CA  1 
ATOM   8732  C  C   . LEU C  1 208 ? 6.780   -19.391 85.731  1.00 13.48  ? 315  LEU C C   1 
ATOM   8733  O  O   . LEU C  1 208 ? 6.048   -19.968 86.535  1.00 14.01  ? 315  LEU C O   1 
ATOM   8734  C  CB  . LEU C  1 208 ? 6.597   -21.191 84.035  1.00 13.88  ? 315  LEU C CB  1 
ATOM   8735  C  CG  . LEU C  1 208 ? 7.139   -22.128 82.960  1.00 15.64  ? 315  LEU C CG  1 
ATOM   8736  C  CD1 . LEU C  1 208 ? 7.807   -23.297 83.643  1.00 15.68  ? 315  LEU C CD1 1 
ATOM   8737  C  CD2 . LEU C  1 208 ? 6.005   -22.627 82.073  1.00 14.48  ? 315  LEU C CD2 1 
ATOM   8738  N  N   . SER C  1 209 ? 6.982   -18.082 85.755  1.00 13.47  ? 316  SER C N   1 
ATOM   8739  C  CA  . SER C  1 209 ? 6.307   -17.243 86.719  1.00 13.80  ? 316  SER C CA  1 
ATOM   8740  C  C   . SER C  1 209 ? 4.887   -17.006 86.220  1.00 14.51  ? 316  SER C C   1 
ATOM   8741  O  O   . SER C  1 209 ? 4.685   -16.547 85.096  1.00 14.58  ? 316  SER C O   1 
ATOM   8742  C  CB  . SER C  1 209 ? 7.065   -15.923 86.875  1.00 14.07  ? 316  SER C CB  1 
ATOM   8743  O  OG  . SER C  1 209 ? 6.395   -15.049 87.767  1.00 15.64  ? 316  SER C OG  1 
ATOM   8744  N  N   . ILE C  1 210 ? 3.912   -17.306 87.073  1.00 14.06  ? 317  ILE C N   1 
ATOM   8745  C  CA  . ILE C  1 210 ? 2.500   -17.182 86.737  1.00 13.76  ? 317  ILE C CA  1 
ATOM   8746  C  C   . ILE C  1 210 ? 1.754   -16.131 87.575  1.00 14.77  ? 317  ILE C C   1 
ATOM   8747  O  O   . ILE C  1 210 ? 1.857   -16.116 88.806  1.00 15.99  ? 317  ILE C O   1 
ATOM   8748  C  CB  . ILE C  1 210 ? 1.804   -18.577 86.919  1.00 13.29  ? 317  ILE C CB  1 
ATOM   8749  C  CG1 . ILE C  1 210 ? 2.550   -19.635 86.104  1.00 11.78  ? 317  ILE C CG1 1 
ATOM   8750  C  CG2 . ILE C  1 210 ? 0.342   -18.531 86.490  1.00 13.21  ? 317  ILE C CG2 1 
ATOM   8751  C  CD1 . ILE C  1 210 ? 2.673   -19.319 84.645  1.00 8.22   ? 317  ILE C CD1 1 
ATOM   8752  N  N   . SER C  1 211 ? 0.998   -15.262 86.906  1.00 14.04  ? 318  SER C N   1 
ATOM   8753  C  CA  . SER C  1 211 ? 0.222   -14.236 87.599  1.00 14.96  ? 318  SER C CA  1 
ATOM   8754  C  C   . SER C  1 211 ? -1.255  -14.610 87.617  1.00 15.09  ? 318  SER C C   1 
ATOM   8755  O  O   . SER C  1 211 ? -1.634  -15.660 87.104  1.00 15.78  ? 318  SER C O   1 
ATOM   8756  C  CB  . SER C  1 211 ? 0.394   -12.871 86.936  1.00 15.87  ? 318  SER C CB  1 
ATOM   8757  O  OG  . SER C  1 211 ? 1.682   -12.357 87.205  1.00 18.00  ? 318  SER C OG  1 
ATOM   8758  N  N   . SER C  1 212 ? -2.083  -13.741 88.193  1.00 14.01  ? 319  SER C N   1 
ATOM   8759  C  CA  . SER C  1 212 ? -3.508  -14.010 88.311  1.00 13.68  ? 319  SER C CA  1 
ATOM   8760  C  C   . SER C  1 212 ? -4.393  -13.014 87.589  1.00 14.55  ? 319  SER C C   1 
ATOM   8761  O  O   . SER C  1 212 ? -3.969  -11.912 87.234  1.00 13.54  ? 319  SER C O   1 
ATOM   8762  C  CB  . SER C  1 212 ? -3.925  -14.011 89.787  1.00 13.94  ? 319  SER C CB  1 
ATOM   8763  O  OG  . SER C  1 212 ? -3.097  -14.838 90.568  1.00 14.82  ? 319  SER C OG  1 
ATOM   8764  N  N   . ALA C  1 213 ? -5.645  -13.419 87.404  1.00 15.03  ? 320  ALA C N   1 
ATOM   8765  C  CA  . ALA C  1 213 ? -6.669  -12.594 86.777  1.00 15.52  ? 320  ALA C CA  1 
ATOM   8766  C  C   . ALA C  1 213 ? -7.954  -12.916 87.532  1.00 16.08  ? 320  ALA C C   1 
ATOM   8767  O  O   . ALA C  1 213 ? -8.178  -14.066 87.904  1.00 16.06  ? 320  ALA C O   1 
ATOM   8768  C  CB  . ALA C  1 213 ? -6.809  -12.956 85.319  1.00 15.11  ? 320  ALA C CB  1 
ATOM   8769  N  N   . THR C  1 214 ? -8.786  -11.911 87.783  1.00 17.35  ? 321  THR C N   1 
ATOM   8770  C  CA  . THR C  1 214 ? -10.031 -12.146 88.504  1.00 18.55  ? 321  THR C CA  1 
ATOM   8771  C  C   . THR C  1 214 ? -11.072 -12.761 87.569  1.00 19.93  ? 321  THR C C   1 
ATOM   8772  O  O   . THR C  1 214 ? -10.894 -12.779 86.346  1.00 19.84  ? 321  THR C O   1 
ATOM   8773  C  CB  . THR C  1 214 ? -10.607 -10.843 89.088  1.00 19.33  ? 321  THR C CB  1 
ATOM   8774  O  OG1 . THR C  1 214 ? -11.065 -10.002 88.020  1.00 20.88  ? 321  THR C OG1 1 
ATOM   8775  C  CG2 . THR C  1 214 ? -9.551  -10.111 89.916  1.00 17.25  ? 321  THR C CG2 1 
ATOM   8776  N  N   . GLN C  1 215 ? -12.160 -13.262 88.149  1.00 20.99  ? 322  GLN C N   1 
ATOM   8777  C  CA  . GLN C  1 215 ? -13.224 -13.884 87.368  1.00 21.19  ? 322  GLN C CA  1 
ATOM   8778  C  C   . GLN C  1 215 ? -13.716 -12.985 86.233  1.00 21.64  ? 322  GLN C C   1 
ATOM   8779  O  O   . GLN C  1 215 ? -14.063 -13.466 85.153  1.00 22.32  ? 322  GLN C O   1 
ATOM   8780  C  CB  . GLN C  1 215 ? -14.388 -14.255 88.280  1.00 21.54  ? 322  GLN C CB  1 
ATOM   8781  C  CG  . GLN C  1 215 ? -15.649 -14.670 87.560  1.00 22.88  ? 322  GLN C CG  1 
ATOM   8782  C  CD  . GLN C  1 215 ? -16.721 -15.099 88.530  1.00 24.95  ? 322  GLN C CD  1 
ATOM   8783  O  OE1 . GLN C  1 215 ? -16.920 -14.469 89.569  1.00 26.90  ? 322  GLN C OE1 1 
ATOM   8784  N  NE2 . GLN C  1 215 ? -17.422 -16.172 88.202  1.00 27.61  ? 322  GLN C NE2 1 
ATOM   8785  N  N   . PHE C  1 216 ? -13.736 -11.681 86.467  1.00 21.43  ? 323  PHE C N   1 
ATOM   8786  C  CA  . PHE C  1 216 ? -14.194 -10.756 85.446  1.00 21.80  ? 323  PHE C CA  1 
ATOM   8787  C  C   . PHE C  1 216 ? -13.048 -10.251 84.579  1.00 21.72  ? 323  PHE C C   1 
ATOM   8788  O  O   . PHE C  1 216 ? -13.187 -9.259  83.877  1.00 22.49  ? 323  PHE C O   1 
ATOM   8789  C  CB  . PHE C  1 216 ? -14.936 -9.592  86.110  1.00 23.75  ? 323  PHE C CB  1 
ATOM   8790  C  CG  . PHE C  1 216 ? -16.141 -10.026 86.927  1.00 25.06  ? 323  PHE C CG  1 
ATOM   8791  C  CD1 . PHE C  1 216 ? -16.740 -9.150  87.833  1.00 25.51  ? 323  PHE C CD1 1 
ATOM   8792  C  CD2 . PHE C  1 216 ? -16.672 -11.314 86.788  1.00 25.04  ? 323  PHE C CD2 1 
ATOM   8793  C  CE1 . PHE C  1 216 ? -17.855 -9.545  88.596  1.00 26.39  ? 323  PHE C CE1 1 
ATOM   8794  C  CE2 . PHE C  1 216 ? -17.776 -11.719 87.538  1.00 26.24  ? 323  PHE C CE2 1 
ATOM   8795  C  CZ  . PHE C  1 216 ? -18.373 -10.831 88.449  1.00 26.61  ? 323  PHE C CZ  1 
ATOM   8796  N  N   . GLY C  1 217 ? -11.913 -10.946 84.629  1.00 21.25  ? 324  GLY C N   1 
ATOM   8797  C  CA  . GLY C  1 217 ? -10.762 -10.572 83.823  1.00 19.43  ? 324  GLY C CA  1 
ATOM   8798  C  C   . GLY C  1 217 ? -10.018 -9.295  84.189  1.00 18.59  ? 324  GLY C C   1 
ATOM   8799  O  O   . GLY C  1 217 ? -9.443  -8.630  83.321  1.00 16.43  ? 324  GLY C O   1 
ATOM   8800  N  N   . ASN C  1 218 ? -10.016 -8.950  85.470  1.00 17.52  ? 325  ASN C N   1 
ATOM   8801  C  CA  . ASN C  1 218 ? -9.325  -7.753  85.917  1.00 16.95  ? 325  ASN C CA  1 
ATOM   8802  C  C   . ASN C  1 218 ? -8.045  -8.106  86.651  1.00 16.52  ? 325  ASN C C   1 
ATOM   8803  O  O   . ASN C  1 218 ? -7.847  -9.252  87.048  1.00 16.19  ? 325  ASN C O   1 
ATOM   8804  C  CB  . ASN C  1 218 ? -10.216 -6.951  86.857  1.00 17.55  ? 325  ASN C CB  1 
ATOM   8805  C  CG  . ASN C  1 218 ? -11.521 -6.543  86.216  1.00 17.54  ? 325  ASN C CG  1 
ATOM   8806  O  OD1 . ASN C  1 218 ? -11.534 -5.999  85.116  1.00 18.42  ? 325  ASN C OD1 1 
ATOM   8807  N  ND2 . ASN C  1 218 ? -12.629 -6.788  86.909  1.00 15.87  ? 325  ASN C ND2 1 
ATOM   8808  N  N   . VAL C  1 219 ? -7.176  -7.112  86.822  1.00 16.67  ? 326  VAL C N   1 
ATOM   8809  C  CA  . VAL C  1 219 ? -5.930  -7.309  87.547  1.00 15.90  ? 326  VAL C CA  1 
ATOM   8810  C  C   . VAL C  1 219 ? -6.291  -7.393  89.031  1.00 15.76  ? 326  VAL C C   1 
ATOM   8811  O  O   . VAL C  1 219 ? -6.843  -6.454  89.597  1.00 16.52  ? 326  VAL C O   1 
ATOM   8812  C  CB  . VAL C  1 219 ? -4.972  -6.137  87.333  1.00 14.83  ? 326  VAL C CB  1 
ATOM   8813  C  CG1 . VAL C  1 219 ? -3.716  -6.339  88.171  1.00 15.99  ? 326  VAL C CG1 1 
ATOM   8814  C  CG2 . VAL C  1 219 ? -4.615  -6.022  85.872  1.00 14.94  ? 326  VAL C CG2 1 
ATOM   8815  N  N   . PRO C  1 220 ? -6.003  -8.532  89.673  1.00 15.87  ? 327  PRO C N   1 
ATOM   8816  C  CA  . PRO C  1 220 ? -6.320  -8.694  91.094  1.00 15.87  ? 327  PRO C CA  1 
ATOM   8817  C  C   . PRO C  1 220 ? -5.636  -7.624  91.929  1.00 15.88  ? 327  PRO C C   1 
ATOM   8818  O  O   . PRO C  1 220 ? -4.594  -7.097  91.541  1.00 15.67  ? 327  PRO C O   1 
ATOM   8819  C  CB  . PRO C  1 220 ? -5.786  -10.091 91.415  1.00 15.44  ? 327  PRO C CB  1 
ATOM   8820  C  CG  . PRO C  1 220 ? -5.857  -10.809 90.096  1.00 15.34  ? 327  PRO C CG  1 
ATOM   8821  C  CD  . PRO C  1 220 ? -5.383  -9.755  89.126  1.00 16.09  ? 327  PRO C CD  1 
ATOM   8822  N  N   . TRP C  1 221 ? -6.208  -7.324  93.090  1.00 16.19  ? 328  TRP C N   1 
ATOM   8823  C  CA  . TRP C  1 221 ? -5.638  -6.313  93.963  1.00 16.24  ? 328  TRP C CA  1 
ATOM   8824  C  C   . TRP C  1 221 ? -4.258  -6.696  94.523  1.00 15.50  ? 328  TRP C C   1 
ATOM   8825  O  O   . TRP C  1 221 ? -3.468  -5.823  94.880  1.00 15.29  ? 328  TRP C O   1 
ATOM   8826  C  CB  . TRP C  1 221 ? -6.596  -6.020  95.119  1.00 14.57  ? 328  TRP C CB  1 
ATOM   8827  C  CG  . TRP C  1 221 ? -6.802  -7.170  96.031  1.00 16.14  ? 328  TRP C CG  1 
ATOM   8828  C  CD1 . TRP C  1 221 ? -7.830  -8.072  95.997  1.00 16.81  ? 328  TRP C CD1 1 
ATOM   8829  C  CD2 . TRP C  1 221 ? -5.971  -7.552  97.132  1.00 16.41  ? 328  TRP C CD2 1 
ATOM   8830  N  NE1 . TRP C  1 221 ? -7.692  -8.991  97.012  1.00 15.56  ? 328  TRP C NE1 1 
ATOM   8831  C  CE2 . TRP C  1 221 ? -6.561  -8.695  97.725  1.00 16.27  ? 328  TRP C CE2 1 
ATOM   8832  C  CE3 . TRP C  1 221 ? -4.789  -7.043  97.678  1.00 16.65  ? 328  TRP C CE3 1 
ATOM   8833  C  CZ2 . TRP C  1 221 ? -6.005  -9.336  98.838  1.00 16.77  ? 328  TRP C CZ2 1 
ATOM   8834  C  CZ3 . TRP C  1 221 ? -4.236  -7.688  98.794  1.00 17.78  ? 328  TRP C CZ3 1 
ATOM   8835  C  CH2 . TRP C  1 221 ? -4.848  -8.820  99.357  1.00 15.07  ? 328  TRP C CH2 1 
ATOM   8836  N  N   . TYR C  1 222 ? -3.979  -7.992  94.596  1.00 13.83  ? 329  TYR C N   1 
ATOM   8837  C  CA  . TYR C  1 222 ? -2.713  -8.484  95.127  1.00 13.29  ? 329  TYR C CA  1 
ATOM   8838  C  C   . TYR C  1 222 ? -1.652  -8.688  94.060  1.00 13.62  ? 329  TYR C C   1 
ATOM   8839  O  O   . TYR C  1 222 ? -0.501  -8.995  94.371  1.00 13.34  ? 329  TYR C O   1 
ATOM   8840  C  CB  . TYR C  1 222 ? -2.951  -9.806  95.831  1.00 12.96  ? 329  TYR C CB  1 
ATOM   8841  C  CG  . TYR C  1 222 ? -3.710  -10.789 94.976  1.00 13.55  ? 329  TYR C CG  1 
ATOM   8842  C  CD1 . TYR C  1 222 ? -3.063  -11.540 93.993  1.00 13.20  ? 329  TYR C CD1 1 
ATOM   8843  C  CD2 . TYR C  1 222 ? -5.091  -10.946 95.122  1.00 14.50  ? 329  TYR C CD2 1 
ATOM   8844  C  CE1 . TYR C  1 222 ? -3.771  -12.425 93.178  1.00 13.30  ? 329  TYR C CE1 1 
ATOM   8845  C  CE2 . TYR C  1 222 ? -5.807  -11.826 94.306  1.00 13.88  ? 329  TYR C CE2 1 
ATOM   8846  C  CZ  . TYR C  1 222 ? -5.137  -12.561 93.339  1.00 13.57  ? 329  TYR C CZ  1 
ATOM   8847  O  OH  . TYR C  1 222 ? -5.837  -13.423 92.534  1.00 15.72  ? 329  TYR C OH  1 
ATOM   8848  N  N   . SER C  1 223 ? -2.043  -8.506  92.805  1.00 13.94  ? 330  SER C N   1 
ATOM   8849  C  CA  . SER C  1 223 ? -1.148  -8.710  91.680  1.00 14.88  ? 330  SER C CA  1 
ATOM   8850  C  C   . SER C  1 223 ? 0.046   -7.771  91.592  1.00 15.78  ? 330  SER C C   1 
ATOM   8851  O  O   . SER C  1 223 ? -0.094  -6.555  91.743  1.00 16.88  ? 330  SER C O   1 
ATOM   8852  C  CB  . SER C  1 223 ? -1.944  -8.623  90.379  1.00 15.14  ? 330  SER C CB  1 
ATOM   8853  O  OG  . SER C  1 223 ? -1.075  -8.668  89.256  1.00 16.15  ? 330  SER C OG  1 
ATOM   8854  N  N   . GLU C  1 224 ? 1.220   -8.343  91.328  1.00 15.15  ? 331  GLU C N   1 
ATOM   8855  C  CA  . GLU C  1 224 ? 2.441   -7.561  91.168  1.00 14.66  ? 331  GLU C CA  1 
ATOM   8856  C  C   . GLU C  1 224 ? 2.759   -7.556  89.683  1.00 14.43  ? 331  GLU C C   1 
ATOM   8857  O  O   . GLU C  1 224 ? 2.656   -8.579  89.028  1.00 16.46  ? 331  GLU C O   1 
ATOM   8858  C  CB  . GLU C  1 224 ? 3.619   -8.200  91.897  1.00 14.08  ? 331  GLU C CB  1 
ATOM   8859  C  CG  . GLU C  1 224 ? 3.441   -8.414  93.370  1.00 13.00  ? 331  GLU C CG  1 
ATOM   8860  C  CD  . GLU C  1 224 ? 4.688   -8.994  94.010  1.00 14.47  ? 331  GLU C CD  1 
ATOM   8861  O  OE1 . GLU C  1 224 ? 4.554   -9.602  95.093  1.00 15.42  ? 331  GLU C OE1 1 
ATOM   8862  O  OE2 . GLU C  1 224 ? 5.796   -8.840  93.436  1.00 12.41  ? 331  GLU C OE2 1 
ATOM   8863  N  N   . ALA C  1 225 ? 3.150   -6.411  89.151  1.00 14.44  ? 332  ALA C N   1 
ATOM   8864  C  CA  . ALA C  1 225 ? 3.480   -6.327  87.745  1.00 15.10  ? 332  ALA C CA  1 
ATOM   8865  C  C   . ALA C  1 225 ? 4.985   -6.443  87.567  1.00 16.89  ? 332  ALA C C   1 
ATOM   8866  O  O   . ALA C  1 225 ? 5.755   -6.046  88.443  1.00 17.71  ? 332  ALA C O   1 
ATOM   8867  C  CB  . ALA C  1 225 ? 2.988   -5.012  87.170  1.00 12.90  ? 332  ALA C CB  1 
ATOM   8868  N  N   . CYS C  1 226 ? 5.404   -7.022  86.449  1.00 17.33  ? 333  CYS C N   1 
ATOM   8869  C  CA  . CYS C  1 226 ? 6.818   -7.143  86.139  1.00 19.22  ? 333  CYS C CA  1 
ATOM   8870  C  C   . CYS C  1 226 ? 6.975   -7.785  84.778  1.00 18.68  ? 333  CYS C C   1 
ATOM   8871  O  O   . CYS C  1 226 ? 6.040   -8.390  84.262  1.00 19.87  ? 333  CYS C O   1 
ATOM   8872  C  CB  . CYS C  1 226 ? 7.562   -7.946  87.198  1.00 21.20  ? 333  CYS C CB  1 
ATOM   8873  S  SG  . CYS C  1 226 ? 7.105   -9.692  87.238  1.00 28.81  ? 333  CYS C SG  1 
ATOM   8874  N  N   . SER C  1 227 ? 8.161   -7.642  84.198  1.00 17.48  ? 334  SER C N   1 
ATOM   8875  C  CA  . SER C  1 227 ? 8.451   -8.164  82.875  1.00 15.54  ? 334  SER C CA  1 
ATOM   8876  C  C   . SER C  1 227 ? 8.859   -9.639  82.825  1.00 15.58  ? 334  SER C C   1 
ATOM   8877  O  O   . SER C  1 227 ? 9.003   -10.216 81.736  1.00 16.61  ? 334  SER C O   1 
ATOM   8878  C  CB  . SER C  1 227 ? 9.547   -7.308  82.237  1.00 15.38  ? 334  SER C CB  1 
ATOM   8879  O  OG  . SER C  1 227 ? 10.752  -7.404  82.971  1.00 14.34  ? 334  SER C OG  1 
ATOM   8880  N  N   . SER C  1 228 ? 9.052   -10.255 83.985  1.00 13.65  ? 335  SER C N   1 
ATOM   8881  C  CA  . SER C  1 228 ? 9.467   -11.650 84.005  1.00 14.48  ? 335  SER C CA  1 
ATOM   8882  C  C   . SER C  1 228 ? 8.296   -12.630 84.007  1.00 14.42  ? 335  SER C C   1 
ATOM   8883  O  O   . SER C  1 228 ? 8.478   -13.823 83.776  1.00 15.57  ? 335  SER C O   1 
ATOM   8884  C  CB  . SER C  1 228 ? 10.406  -11.917 85.194  1.00 13.24  ? 335  SER C CB  1 
ATOM   8885  O  OG  . SER C  1 228 ? 9.830   -11.537 86.429  1.00 15.40  ? 335  SER C OG  1 
ATOM   8886  N  N   . THR C  1 229 ? 7.090   -12.133 84.249  1.00 14.11  ? 336  THR C N   1 
ATOM   8887  C  CA  . THR C  1 229 ? 5.929   -13.001 84.241  1.00 14.89  ? 336  THR C CA  1 
ATOM   8888  C  C   . THR C  1 229 ? 5.744   -13.576 82.842  1.00 15.67  ? 336  THR C C   1 
ATOM   8889  O  O   . THR C  1 229 ? 5.919   -12.871 81.849  1.00 16.95  ? 336  THR C O   1 
ATOM   8890  C  CB  . THR C  1 229 ? 4.662   -12.240 84.644  1.00 15.56  ? 336  THR C CB  1 
ATOM   8891  O  OG1 . THR C  1 229 ? 4.794   -11.775 85.996  1.00 15.91  ? 336  THR C OG1 1 
ATOM   8892  C  CG2 . THR C  1 229 ? 3.444   -13.149 84.544  1.00 13.85  ? 336  THR C CG2 1 
ATOM   8893  N  N   . LEU C  1 230 ? 5.392   -14.855 82.763  1.00 15.23  ? 337  LEU C N   1 
ATOM   8894  C  CA  . LEU C  1 230 ? 5.197   -15.503 81.478  1.00 14.11  ? 337  LEU C CA  1 
ATOM   8895  C  C   . LEU C  1 230 ? 3.723   -15.616 81.066  1.00 14.74  ? 337  LEU C C   1 
ATOM   8896  O  O   . LEU C  1 230 ? 3.369   -15.263 79.947  1.00 15.68  ? 337  LEU C O   1 
ATOM   8897  C  CB  . LEU C  1 230 ? 5.838   -16.884 81.506  1.00 13.77  ? 337  LEU C CB  1 
ATOM   8898  C  CG  . LEU C  1 230 ? 6.152   -17.523 80.153  1.00 14.00  ? 337  LEU C CG  1 
ATOM   8899  C  CD1 . LEU C  1 230 ? 7.159   -16.672 79.399  1.00 12.19  ? 337  LEU C CD1 1 
ATOM   8900  C  CD2 . LEU C  1 230 ? 6.709   -18.927 80.374  1.00 14.20  ? 337  LEU C CD2 1 
ATOM   8901  N  N   . ALA C  1 231 ? 2.867   -16.084 81.970  1.00 13.69  ? 338  ALA C N   1 
ATOM   8902  C  CA  . ALA C  1 231 ? 1.451   -16.246 81.663  1.00 13.82  ? 338  ALA C CA  1 
ATOM   8903  C  C   . ALA C  1 231 ? 0.562   -16.076 82.892  1.00 15.18  ? 338  ALA C C   1 
ATOM   8904  O  O   . ALA C  1 231 ? 1.049   -15.831 83.996  1.00 16.84  ? 338  ALA C O   1 
ATOM   8905  C  CB  . ALA C  1 231 ? 1.210   -17.608 81.038  1.00 13.83  ? 338  ALA C CB  1 
ATOM   8906  N  N   . THR C  1 232 ? -0.743  -16.239 82.699  1.00 14.64  ? 339  THR C N   1 
ATOM   8907  C  CA  . THR C  1 232 ? -1.707  -16.055 83.776  1.00 14.39  ? 339  THR C CA  1 
ATOM   8908  C  C   . THR C  1 232 ? -2.738  -17.158 83.870  1.00 14.16  ? 339  THR C C   1 
ATOM   8909  O  O   . THR C  1 232 ? -2.972  -17.867 82.906  1.00 14.22  ? 339  THR C O   1 
ATOM   8910  C  CB  . THR C  1 232 ? -2.499  -14.756 83.550  1.00 14.17  ? 339  THR C CB  1 
ATOM   8911  O  OG1 . THR C  1 232 ? -1.590  -13.670 83.350  1.00 15.84  ? 339  THR C OG1 1 
ATOM   8912  C  CG2 . THR C  1 232 ? -3.398  -14.462 84.721  1.00 12.29  ? 339  THR C CG2 1 
ATOM   8913  N  N   . THR C  1 233 ? -3.342  -17.301 85.047  1.00 14.82  ? 340  THR C N   1 
ATOM   8914  C  CA  . THR C  1 233 ? -4.434  -18.246 85.240  1.00 16.42  ? 340  THR C CA  1 
ATOM   8915  C  C   . THR C  1 233 ? -5.384  -17.501 86.149  1.00 17.23  ? 340  THR C C   1 
ATOM   8916  O  O   . THR C  1 233 ? -4.988  -16.526 86.786  1.00 18.11  ? 340  THR C O   1 
ATOM   8917  C  CB  . THR C  1 233 ? -4.042  -19.572 85.926  1.00 16.00  ? 340  THR C CB  1 
ATOM   8918  O  OG1 . THR C  1 233 ? -3.817  -19.340 87.317  1.00 17.06  ? 340  THR C OG1 1 
ATOM   8919  C  CG2 . THR C  1 233 ? -2.815  -20.178 85.271  1.00 15.12  ? 340  THR C CG2 1 
ATOM   8920  N  N   . TYR C  1 234 ? -6.640  -17.927 86.182  1.00 18.16  ? 341  TYR C N   1 
ATOM   8921  C  CA  . TYR C  1 234 ? -7.626  -17.273 87.031  1.00 18.09  ? 341  TYR C CA  1 
ATOM   8922  C  C   . TYR C  1 234 ? -7.383  -17.532 88.517  1.00 18.22  ? 341  TYR C C   1 
ATOM   8923  O  O   . TYR C  1 234 ? -6.744  -18.518 88.909  1.00 17.79  ? 341  TYR C O   1 
ATOM   8924  C  CB  . TYR C  1 234 ? -9.041  -17.749 86.681  1.00 18.64  ? 341  TYR C CB  1 
ATOM   8925  C  CG  . TYR C  1 234 ? -9.598  -17.163 85.412  1.00 19.17  ? 341  TYR C CG  1 
ATOM   8926  C  CD1 . TYR C  1 234 ? -9.786  -17.944 84.274  1.00 20.06  ? 341  TYR C CD1 1 
ATOM   8927  C  CD2 . TYR C  1 234 ? -9.944  -15.825 85.350  1.00 20.61  ? 341  TYR C CD2 1 
ATOM   8928  C  CE1 . TYR C  1 234 ? -10.309 -17.396 83.103  1.00 19.15  ? 341  TYR C CE1 1 
ATOM   8929  C  CE2 . TYR C  1 234 ? -10.464 -15.269 84.188  1.00 21.19  ? 341  TYR C CE2 1 
ATOM   8930  C  CZ  . TYR C  1 234 ? -10.647 -16.057 83.067  1.00 20.54  ? 341  TYR C CZ  1 
ATOM   8931  O  OH  . TYR C  1 234 ? -11.182 -15.489 81.924  1.00 21.29  ? 341  TYR C OH  1 
ATOM   8932  N  N   . SER C  1 235 ? -7.893  -16.624 89.338  1.00 18.11  ? 342  SER C N   1 
ATOM   8933  C  CA  . SER C  1 235 ? -7.798  -16.752 90.782  1.00 17.68  ? 342  SER C CA  1 
ATOM   8934  C  C   . SER C  1 235 ? -8.829  -15.832 91.410  1.00 17.25  ? 342  SER C C   1 
ATOM   8935  O  O   . SER C  1 235 ? -9.752  -15.387 90.735  1.00 16.39  ? 342  SER C O   1 
ATOM   8936  C  CB  . SER C  1 235 ? -6.407  -16.403 91.283  1.00 16.74  ? 342  SER C CB  1 
ATOM   8937  O  OG  . SER C  1 235 ? -6.303  -16.755 92.652  1.00 16.30  ? 342  SER C OG  1 
ATOM   8938  N  N   . SER C  1 236 ? -8.668  -15.544 92.697  1.00 18.27  ? 343  SER C N   1 
ATOM   8939  C  CA  . SER C  1 236 ? -9.605  -14.686 93.411  1.00 18.52  ? 343  SER C CA  1 
ATOM   8940  C  C   . SER C  1 236 ? -9.508  -13.223 92.983  1.00 19.32  ? 343  SER C C   1 
ATOM   8941  O  O   . SER C  1 236 ? -8.532  -12.816 92.352  1.00 18.99  ? 343  SER C O   1 
ATOM   8942  C  CB  . SER C  1 236 ? -9.370  -14.805 94.915  1.00 17.67  ? 343  SER C CB  1 
ATOM   8943  O  OG  . SER C  1 236 ? -8.032  -14.483 95.243  1.00 18.01  ? 343  SER C OG  1 
ATOM   8944  N  N   . GLY C  1 237 ? -10.528 -12.442 93.330  1.00 19.99  ? 344  GLY C N   1 
ATOM   8945  C  CA  . GLY C  1 237 ? -10.552 -11.035 92.979  1.00 20.64  ? 344  GLY C CA  1 
ATOM   8946  C  C   . GLY C  1 237 ? -11.222 -10.230 94.077  1.00 23.34  ? 344  GLY C C   1 
ATOM   8947  O  O   . GLY C  1 237 ? -10.902 -10.395 95.257  1.00 21.78  ? 344  GLY C O   1 
ATOM   8948  N  N   . ASN C  1 238 ? -12.154 -9.356  93.704  1.00 24.45  ? 345  ASN C N   1 
ATOM   8949  C  CA  . ASN C  1 238 ? -12.842 -8.555  94.701  1.00 27.23  ? 345  ASN C CA  1 
ATOM   8950  C  C   . ASN C  1 238 ? -13.935 -9.367  95.405  1.00 27.46  ? 345  ASN C C   1 
ATOM   8951  O  O   . ASN C  1 238 ? -14.121 -10.549 95.120  1.00 26.44  ? 345  ASN C O   1 
ATOM   8952  C  CB  . ASN C  1 238 ? -13.419 -7.277  94.068  1.00 28.71  ? 345  ASN C CB  1 
ATOM   8953  C  CG  . ASN C  1 238 ? -14.559 -7.545  93.087  1.00 31.28  ? 345  ASN C CG  1 
ATOM   8954  O  OD1 . ASN C  1 238 ? -15.462 -8.343  93.355  1.00 30.81  ? 345  ASN C OD1 1 
ATOM   8955  N  ND2 . ASN C  1 238 ? -14.538 -6.841  91.955  1.00 31.85  ? 345  ASN C ND2 1 
ATOM   8956  N  N   . GLN C  1 239 ? -14.650 -8.731  96.326  1.00 28.91  ? 346  GLN C N   1 
ATOM   8957  C  CA  . GLN C  1 239 ? -15.694 -9.418  97.079  1.00 30.42  ? 346  GLN C CA  1 
ATOM   8958  C  C   . GLN C  1 239 ? -16.864 -9.937  96.238  1.00 30.56  ? 346  GLN C C   1 
ATOM   8959  O  O   . GLN C  1 239 ? -17.622 -10.788 96.691  1.00 32.18  ? 346  GLN C O   1 
ATOM   8960  C  CB  . GLN C  1 239 ? -16.208 -8.516  98.213  1.00 30.55  ? 346  GLN C CB  1 
ATOM   8961  C  CG  . GLN C  1 239 ? -15.152 -8.194  99.258  0.00 30.59  ? 346  GLN C CG  1 
ATOM   8962  C  CD  . GLN C  1 239 ? -15.738 -7.572  100.509 0.00 30.63  ? 346  GLN C CD  1 
ATOM   8963  O  OE1 . GLN C  1 239 ? -16.387 -6.528  100.453 0.00 30.62  ? 346  GLN C OE1 1 
ATOM   8964  N  NE2 . GLN C  1 239 ? -15.510 -8.213  101.650 0.00 30.62  ? 346  GLN C NE2 1 
ATOM   8965  N  N   . ASN C  1 240 ? -17.004 -9.448  95.011  1.00 30.70  ? 347  ASN C N   1 
ATOM   8966  C  CA  . ASN C  1 240 ? -18.090 -9.896  94.147  1.00 29.88  ? 347  ASN C CA  1 
ATOM   8967  C  C   . ASN C  1 240 ? -17.688 -10.955 93.116  1.00 28.95  ? 347  ASN C C   1 
ATOM   8968  O  O   . ASN C  1 240 ? -18.503 -11.347 92.279  1.00 29.66  ? 347  ASN C O   1 
ATOM   8969  C  CB  . ASN C  1 240 ? -18.732 -8.692  93.442  1.00 30.55  ? 347  ASN C CB  1 
ATOM   8970  C  CG  . ASN C  1 240 ? -19.820 -8.040  94.284  1.00 30.97  ? 347  ASN C CG  1 
ATOM   8971  O  OD1 . ASN C  1 240 ? -19.566 -7.572  95.394  0.00 30.92  ? 347  ASN C OD1 1 
ATOM   8972  N  ND2 . ASN C  1 240 ? -21.038 -8.008  93.755  0.00 30.92  ? 347  ASN C ND2 1 
ATOM   8973  N  N   . GLU C  1 241 ? -16.448 -11.428 93.174  1.00 26.98  ? 348  GLU C N   1 
ATOM   8974  C  CA  . GLU C  1 241 ? -16.001 -12.438 92.221  1.00 26.72  ? 348  GLU C CA  1 
ATOM   8975  C  C   . GLU C  1 241 ? -15.722 -13.758 92.923  1.00 26.72  ? 348  GLU C C   1 
ATOM   8976  O  O   . GLU C  1 241 ? -15.303 -13.783 94.078  1.00 27.82  ? 348  GLU C O   1 
ATOM   8977  C  CB  . GLU C  1 241 ? -14.751 -11.957 91.476  1.00 26.17  ? 348  GLU C CB  1 
ATOM   8978  C  CG  . GLU C  1 241 ? -14.916 -10.566 90.903  1.00 26.37  ? 348  GLU C CG  1 
ATOM   8979  C  CD  . GLU C  1 241 ? -13.654 -10.017 90.257  1.00 28.10  ? 348  GLU C CD  1 
ATOM   8980  O  OE1 . GLU C  1 241 ? -13.415 -10.320 89.066  1.00 27.44  ? 348  GLU C OE1 1 
ATOM   8981  O  OE2 . GLU C  1 241 ? -12.905 -9.280  90.946  1.00 28.43  ? 348  GLU C OE2 1 
ATOM   8982  N  N   . LYS C  1 242 ? -15.978 -14.854 92.218  1.00 26.91  ? 349  LYS C N   1 
ATOM   8983  C  CA  . LYS C  1 242 ? -15.769 -16.195 92.751  1.00 26.52  ? 349  LYS C CA  1 
ATOM   8984  C  C   . LYS C  1 242 ? -14.293 -16.479 93.008  1.00 25.34  ? 349  LYS C C   1 
ATOM   8985  O  O   . LYS C  1 242 ? -13.414 -15.794 92.489  1.00 25.44  ? 349  LYS C O   1 
ATOM   8986  C  CB  . LYS C  1 242 ? -16.330 -17.233 91.769  1.00 29.59  ? 349  LYS C CB  1 
ATOM   8987  C  CG  . LYS C  1 242 ? -17.725 -17.756 92.114  1.00 32.77  ? 349  LYS C CG  1 
ATOM   8988  C  CD  . LYS C  1 242 ? -18.731 -16.624 92.227  1.00 36.63  ? 349  LYS C CD  1 
ATOM   8989  C  CE  . LYS C  1 242 ? -20.032 -17.090 92.888  1.00 39.08  ? 349  LYS C CE  1 
ATOM   8990  N  NZ  . LYS C  1 242 ? -20.940 -15.937 93.181  1.00 40.46  ? 349  LYS C NZ  1 
ATOM   8991  N  N   . GLN C  1 243 ? -14.019 -17.502 93.805  1.00 24.15  ? 350  GLN C N   1 
ATOM   8992  C  CA  . GLN C  1 243 ? -12.643 -17.856 94.109  1.00 22.97  ? 350  GLN C CA  1 
ATOM   8993  C  C   . GLN C  1 243 ? -12.348 -19.298 93.722  1.00 22.39  ? 350  GLN C C   1 
ATOM   8994  O  O   . GLN C  1 243 ? -13.158 -19.943 93.061  1.00 23.30  ? 350  GLN C O   1 
ATOM   8995  C  CB  . GLN C  1 243 ? -12.367 -17.609 95.587  1.00 23.49  ? 350  GLN C CB  1 
ATOM   8996  C  CG  . GLN C  1 243 ? -12.896 -16.253 96.024  1.00 24.60  ? 350  GLN C CG  1 
ATOM   8997  C  CD  . GLN C  1 243 ? -12.379 -15.811 97.372  1.00 24.81  ? 350  GLN C CD  1 
ATOM   8998  O  OE1 . GLN C  1 243 ? -12.395 -16.576 98.335  1.00 25.30  ? 350  GLN C OE1 1 
ATOM   8999  N  NE2 . GLN C  1 243 ? -11.927 -14.557 97.454  1.00 23.61  ? 350  GLN C NE2 1 
ATOM   9000  N  N   . ILE C  1 244 ? -11.194 -19.814 94.127  1.00 21.76  ? 351  ILE C N   1 
ATOM   9001  C  CA  . ILE C  1 244 ? -10.819 -21.168 93.745  1.00 20.82  ? 351  ILE C CA  1 
ATOM   9002  C  C   . ILE C  1 244 ? -11.301 -22.248 94.693  1.00 20.65  ? 351  ILE C C   1 
ATOM   9003  O  O   . ILE C  1 244 ? -11.268 -22.082 95.907  1.00 21.23  ? 351  ILE C O   1 
ATOM   9004  C  CB  . ILE C  1 244 ? -9.294  -21.276 93.575  1.00 20.58  ? 351  ILE C CB  1 
ATOM   9005  C  CG1 . ILE C  1 244 ? -8.810  -20.169 92.639  1.00 20.06  ? 351  ILE C CG1 1 
ATOM   9006  C  CG2 . ILE C  1 244 ? -8.920  -22.624 92.982  1.00 21.21  ? 351  ILE C CG2 1 
ATOM   9007  C  CD1 . ILE C  1 244 ? -9.578  -20.089 91.345  1.00 18.72  ? 351  ILE C CD1 1 
ATOM   9008  N  N   . VAL C  1 245 ? -11.761 -23.356 94.123  1.00 20.59  ? 352  VAL C N   1 
ATOM   9009  C  CA  . VAL C  1 245 ? -12.271 -24.475 94.905  1.00 19.96  ? 352  VAL C CA  1 
ATOM   9010  C  C   . VAL C  1 245 ? -11.219 -25.563 94.990  1.00 20.62  ? 352  VAL C C   1 
ATOM   9011  O  O   . VAL C  1 245 ? -10.672 -25.984 93.974  1.00 22.80  ? 352  VAL C O   1 
ATOM   9012  C  CB  . VAL C  1 245 ? -13.545 -25.039 94.263  1.00 19.85  ? 352  VAL C CB  1 
ATOM   9013  C  CG1 . VAL C  1 245 ? -14.053 -26.222 95.054  1.00 18.38  ? 352  VAL C CG1 1 
ATOM   9014  C  CG2 . VAL C  1 245 ? -14.600 -23.948 94.195  1.00 17.31  ? 352  VAL C CG2 1 
ATOM   9015  N  N   . THR C  1 246 ? -10.929 -26.023 96.199  1.00 19.99  ? 353  THR C N   1 
ATOM   9016  C  CA  . THR C  1 246 ? -9.911  -27.043 96.357  1.00 19.39  ? 353  THR C CA  1 
ATOM   9017  C  C   . THR C  1 246 ? -9.978  -27.741 97.718  1.00 20.80  ? 353  THR C C   1 
ATOM   9018  O  O   . THR C  1 246 ? -10.837 -27.436 98.559  1.00 19.90  ? 353  THR C O   1 
ATOM   9019  C  CB  . THR C  1 246 ? -8.501  -26.429 96.172  1.00 19.00  ? 353  THR C CB  1 
ATOM   9020  O  OG1 . THR C  1 246 ? -7.513  -27.466 96.205  1.00 17.66  ? 353  THR C OG1 1 
ATOM   9021  C  CG2 . THR C  1 246 ? -8.202  -25.428 97.286  1.00 19.28  ? 353  THR C CG2 1 
ATOM   9022  N  N   . THR C  1 247 ? -9.059  -28.685 97.914  1.00 20.41  ? 354  THR C N   1 
ATOM   9023  C  CA  . THR C  1 247 ? -8.965  -29.457 99.141  1.00 20.79  ? 354  THR C CA  1 
ATOM   9024  C  C   . THR C  1 247 ? -8.344  -28.624 100.257 1.00 21.87  ? 354  THR C C   1 
ATOM   9025  O  O   . THR C  1 247 ? -7.328  -27.963 100.055 1.00 23.72  ? 354  THR C O   1 
ATOM   9026  C  CB  . THR C  1 247 ? -8.118  -30.713 98.908  1.00 20.13  ? 354  THR C CB  1 
ATOM   9027  O  OG1 . THR C  1 247 ? -6.868  -30.341 98.319  1.00 20.36  ? 354  THR C OG1 1 
ATOM   9028  C  CG2 . THR C  1 247 ? -8.830  -31.662 97.965  1.00 20.54  ? 354  THR C CG2 1 
ATOM   9029  N  N   . ASP C  1 248 ? -8.951  -28.659 101.438 1.00 22.44  ? 355  ASP C N   1 
ATOM   9030  C  CA  . ASP C  1 248 ? -8.452  -27.888 102.571 1.00 22.31  ? 355  ASP C CA  1 
ATOM   9031  C  C   . ASP C  1 248 ? -8.034  -28.824 103.705 1.00 22.99  ? 355  ASP C C   1 
ATOM   9032  O  O   . ASP C  1 248 ? -8.359  -30.012 103.688 1.00 22.84  ? 355  ASP C O   1 
ATOM   9033  C  CB  . ASP C  1 248 ? -9.540  -26.923 103.051 1.00 21.82  ? 355  ASP C CB  1 
ATOM   9034  C  CG  . ASP C  1 248 ? -8.980  -25.762 103.840 1.00 23.11  ? 355  ASP C CG  1 
ATOM   9035  O  OD1 . ASP C  1 248 ? -9.758  -24.904 104.286 1.00 24.32  ? 355  ASP C OD1 1 
ATOM   9036  O  OD2 . ASP C  1 248 ? -7.755  -25.693 104.019 1.00 24.52  ? 355  ASP C OD2 1 
ATOM   9037  N  N   . LEU C  1 249 ? -7.312  -28.296 104.688 1.00 22.97  ? 356  LEU C N   1 
ATOM   9038  C  CA  . LEU C  1 249 ? -6.867  -29.113 105.809 1.00 22.87  ? 356  LEU C CA  1 
ATOM   9039  C  C   . LEU C  1 249 ? -8.032  -29.726 106.542 1.00 22.98  ? 356  LEU C C   1 
ATOM   9040  O  O   . LEU C  1 249 ? -9.154  -29.228 106.468 1.00 23.14  ? 356  LEU C O   1 
ATOM   9041  C  CB  . LEU C  1 249 ? -6.053  -28.287 106.803 1.00 22.44  ? 356  LEU C CB  1 
ATOM   9042  C  CG  . LEU C  1 249 ? -4.540  -28.325 106.645 1.00 21.93  ? 356  LEU C CG  1 
ATOM   9043  C  CD1 . LEU C  1 249 ? -3.947  -27.650 107.858 1.00 21.86  ? 356  LEU C CD1 1 
ATOM   9044  C  CD2 . LEU C  1 249 ? -4.033  -29.773 106.535 1.00 20.72  ? 356  LEU C CD2 1 
ATOM   9045  N  N   . ARG C  1 250 ? -7.747  -30.804 107.265 1.00 23.24  ? 357  ARG C N   1 
ATOM   9046  C  CA  . ARG C  1 250 ? -8.753  -31.504 108.048 1.00 23.51  ? 357  ARG C CA  1 
ATOM   9047  C  C   . ARG C  1 250 ? -9.832  -32.125 107.176 1.00 24.61  ? 357  ARG C C   1 
ATOM   9048  O  O   . ARG C  1 250 ? -11.018 -32.132 107.526 1.00 24.37  ? 357  ARG C O   1 
ATOM   9049  C  CB  . ARG C  1 250 ? -9.366  -30.554 109.082 1.00 21.76  ? 357  ARG C CB  1 
ATOM   9050  C  CG  . ARG C  1 250 ? -8.334  -30.001 110.064 1.00 19.58  ? 357  ARG C CG  1 
ATOM   9051  C  CD  . ARG C  1 250 ? -8.906  -28.900 110.954 1.00 18.57  ? 357  ARG C CD  1 
ATOM   9052  N  NE  . ARG C  1 250 ? -7.847  -28.170 111.652 1.00 17.82  ? 357  ARG C NE  1 
ATOM   9053  C  CZ  . ARG C  1 250 ? -7.120  -28.653 112.656 1.00 15.01  ? 357  ARG C CZ  1 
ATOM   9054  N  NH1 . ARG C  1 250 ? -6.177  -27.902 113.204 1.00 14.38  ? 357  ARG C NH1 1 
ATOM   9055  N  NH2 . ARG C  1 250 ? -7.350  -29.872 113.122 1.00 14.07  ? 357  ARG C NH2 1 
ATOM   9056  N  N   . GLN C  1 251 ? -9.400  -32.640 106.028 1.00 25.42  ? 358  GLN C N   1 
ATOM   9057  C  CA  . GLN C  1 251 ? -10.287 -33.310 105.092 1.00 24.81  ? 358  GLN C CA  1 
ATOM   9058  C  C   . GLN C  1 251 ? -11.475 -32.489 104.647 1.00 25.11  ? 358  GLN C C   1 
ATOM   9059  O  O   . GLN C  1 251 ? -12.530 -33.038 104.337 1.00 24.90  ? 358  GLN C O   1 
ATOM   9060  C  CB  . GLN C  1 251 ? -10.805 -34.578 105.727 1.00 25.04  ? 358  GLN C CB  1 
ATOM   9061  C  CG  . GLN C  1 251 ? -9.734  -35.520 106.130 1.00 25.87  ? 358  GLN C CG  1 
ATOM   9062  C  CD  . GLN C  1 251 ? -10.315 -36.793 106.657 1.00 27.34  ? 358  GLN C CD  1 
ATOM   9063  O  OE1 . GLN C  1 251 ? -9.607  -37.783 106.833 1.00 30.05  ? 358  GLN C OE1 1 
ATOM   9064  N  NE2 . GLN C  1 251 ? -11.619 -36.784 106.919 1.00 26.60  ? 358  GLN C NE2 1 
ATOM   9065  N  N   . LYS C  1 252 ? -11.322 -31.176 104.625 1.00 25.14  ? 359  LYS C N   1 
ATOM   9066  C  CA  . LYS C  1 252 ? -12.412 -30.327 104.208 1.00 25.11  ? 359  LYS C CA  1 
ATOM   9067  C  C   . LYS C  1 252 ? -12.264 -29.867 102.766 1.00 25.34  ? 359  LYS C C   1 
ATOM   9068  O  O   . LYS C  1 252 ? -11.292 -30.193 102.087 1.00 25.19  ? 359  LYS C O   1 
ATOM   9069  C  CB  . LYS C  1 252 ? -12.514 -29.123 105.134 1.00 25.80  ? 359  LYS C CB  1 
ATOM   9070  C  CG  . LYS C  1 252 ? -13.121 -29.447 106.471 1.00 26.48  ? 359  LYS C CG  1 
ATOM   9071  C  CD  . LYS C  1 252 ? -13.413 -28.179 107.231 1.00 29.75  ? 359  LYS C CD  1 
ATOM   9072  C  CE  . LYS C  1 252 ? -14.120 -28.473 108.546 1.00 32.65  ? 359  LYS C CE  1 
ATOM   9073  N  NZ  . LYS C  1 252 ? -14.274 -27.219 109.346 1.00 34.49  ? 359  LYS C NZ  1 
ATOM   9074  N  N   . CYS C  1 253 ? -13.245 -29.101 102.310 1.00 25.52  ? 360  CYS C N   1 
ATOM   9075  C  CA  . CYS C  1 253 ? -13.264 -28.580 100.953 1.00 26.38  ? 360  CYS C CA  1 
ATOM   9076  C  C   . CYS C  1 253 ? -13.515 -27.075 101.051 1.00 26.11  ? 360  CYS C C   1 
ATOM   9077  O  O   . CYS C  1 253 ? -14.422 -26.632 101.751 1.00 25.53  ? 360  CYS C O   1 
ATOM   9078  C  CB  . CYS C  1 253 ? -14.380 -29.279 100.172 1.00 27.71  ? 360  CYS C CB  1 
ATOM   9079  S  SG  . CYS C  1 253 ? -14.677 -28.774 98.444  1.00 32.15  ? 360  CYS C SG  1 
ATOM   9080  N  N   . THR C  1 254 ? -12.699 -26.283 100.367 1.00 25.46  ? 361  THR C N   1 
ATOM   9081  C  CA  . THR C  1 254 ? -12.863 -24.839 100.417 1.00 24.78  ? 361  THR C CA  1 
ATOM   9082  C  C   . THR C  1 254 ? -13.197 -24.271 99.058  1.00 25.05  ? 361  THR C C   1 
ATOM   9083  O  O   . THR C  1 254 ? -12.794 -24.810 98.030  1.00 24.97  ? 361  THR C O   1 
ATOM   9084  C  CB  . THR C  1 254 ? -11.577 -24.130 100.942 1.00 24.59  ? 361  THR C CB  1 
ATOM   9085  O  OG1 . THR C  1 254 ? -11.792 -22.714 101.002 1.00 21.56  ? 361  THR C OG1 1 
ATOM   9086  C  CG2 . THR C  1 254 ? -10.393 -24.397 100.023 1.00 23.60  ? 361  THR C CG2 1 
ATOM   9087  N  N   . GLU C  1 255 ? -13.942 -23.175 99.072  1.00 26.41  ? 362  GLU C N   1 
ATOM   9088  C  CA  . GLU C  1 255 ? -14.338 -22.482 97.860  1.00 28.89  ? 362  GLU C CA  1 
ATOM   9089  C  C   . GLU C  1 255 ? -13.750 -21.092 97.896  1.00 27.76  ? 362  GLU C C   1 
ATOM   9090  O  O   . GLU C  1 255 ? -14.107 -20.232 97.093  1.00 29.08  ? 362  GLU C O   1 
ATOM   9091  C  CB  . GLU C  1 255 ? -15.863 -22.376 97.771  1.00 31.83  ? 362  GLU C CB  1 
ATOM   9092  C  CG  . GLU C  1 255 ? -16.537 -23.632 97.243  1.00 37.52  ? 362  GLU C CG  1 
ATOM   9093  C  CD  . GLU C  1 255 ? -17.376 -24.331 98.293  1.00 41.93  ? 362  GLU C CD  1 
ATOM   9094  O  OE1 . GLU C  1 255 ? -18.266 -23.666 98.872  1.00 44.22  ? 362  GLU C OE1 1 
ATOM   9095  O  OE2 . GLU C  1 255 ? -17.148 -25.544 98.533  1.00 43.95  ? 362  GLU C OE2 1 
ATOM   9096  N  N   . SER C  1 256 ? -12.841 -20.869 98.830  1.00 26.19  ? 363  SER C N   1 
ATOM   9097  C  CA  . SER C  1 256 ? -12.248 -19.559 98.953  1.00 25.75  ? 363  SER C CA  1 
ATOM   9098  C  C   . SER C  1 256 ? -10.721 -19.506 98.973  1.00 24.35  ? 363  SER C C   1 
ATOM   9099  O  O   . SER C  1 256 ? -10.135 -18.786 99.782  1.00 23.92  ? 363  SER C O   1 
ATOM   9100  C  CB  . SER C  1 256 ? -12.821 -18.855 100.186 1.00 25.57  ? 363  SER C CB  1 
ATOM   9101  O  OG  . SER C  1 256 ? -12.608 -19.630 101.344 1.00 26.01  ? 363  SER C OG  1 
ATOM   9102  N  N   . HIS C  1 257 ? -10.074 -20.270 98.095  1.00 22.66  ? 364  HIS C N   1 
ATOM   9103  C  CA  . HIS C  1 257 ? -8.624  -20.206 98.016  1.00 21.41  ? 364  HIS C CA  1 
ATOM   9104  C  C   . HIS C  1 257 ? -8.358  -18.953 97.176  1.00 21.34  ? 364  HIS C C   1 
ATOM   9105  O  O   . HIS C  1 257 ? -9.064  -18.688 96.195  1.00 19.31  ? 364  HIS C O   1 
ATOM   9106  C  CB  . HIS C  1 257 ? -8.033  -21.422 97.322  1.00 20.69  ? 364  HIS C CB  1 
ATOM   9107  C  CG  . HIS C  1 257 ? -6.548  -21.517 97.471  1.00 20.99  ? 364  HIS C CG  1 
ATOM   9108  N  ND1 . HIS C  1 257 ? -5.758  -22.268 96.628  1.00 20.93  ? 364  HIS C ND1 1 
ATOM   9109  C  CD2 . HIS C  1 257 ? -5.714  -20.988 98.398  1.00 20.79  ? 364  HIS C CD2 1 
ATOM   9110  C  CE1 . HIS C  1 257 ? -4.501  -22.203 97.032  1.00 21.05  ? 364  HIS C CE1 1 
ATOM   9111  N  NE2 . HIS C  1 257 ? -4.449  -21.434 98.105  1.00 21.06  ? 364  HIS C NE2 1 
ATOM   9112  N  N   . THR C  1 258 ? -7.331  -18.196 97.547  1.00 21.43  ? 365  THR C N   1 
ATOM   9113  C  CA  . THR C  1 258 ? -7.044  -16.943 96.866  1.00 19.48  ? 365  THR C CA  1 
ATOM   9114  C  C   . THR C  1 258 ? -5.575  -16.720 96.547  1.00 19.20  ? 365  THR C C   1 
ATOM   9115  O  O   . THR C  1 258 ? -4.723  -17.544 96.866  1.00 20.53  ? 365  THR C O   1 
ATOM   9116  C  CB  . THR C  1 258 ? -7.489  -15.784 97.753  1.00 19.66  ? 365  THR C CB  1 
ATOM   9117  O  OG1 . THR C  1 258 ? -6.708  -15.803 98.955  1.00 18.81  ? 365  THR C OG1 1 
ATOM   9118  C  CG2 . THR C  1 258 ? -8.965  -15.915 98.121  1.00 16.78  ? 365  THR C CG2 1 
ATOM   9119  N  N   . GLY C  1 259 ? -5.301  -15.582 95.914  1.00 18.72  ? 366  GLY C N   1 
ATOM   9120  C  CA  . GLY C  1 259 ? -3.941  -15.190 95.587  1.00 16.89  ? 366  GLY C CA  1 
ATOM   9121  C  C   . GLY C  1 259 ? -3.255  -15.917 94.457  1.00 16.91  ? 366  GLY C C   1 
ATOM   9122  O  O   . GLY C  1 259 ? -3.819  -16.826 93.851  1.00 18.15  ? 366  GLY C O   1 
ATOM   9123  N  N   . THR C  1 260 ? -2.024  -15.506 94.170  1.00 15.65  ? 367  THR C N   1 
ATOM   9124  C  CA  . THR C  1 260 ? -1.257  -16.121 93.105  1.00 14.35  ? 367  THR C CA  1 
ATOM   9125  C  C   . THR C  1 260 ? -0.901  -17.558 93.460  1.00 15.07  ? 367  THR C C   1 
ATOM   9126  O  O   . THR C  1 260 ? -0.442  -18.317 92.609  1.00 15.05  ? 367  THR C O   1 
ATOM   9127  C  CB  . THR C  1 260 ? 0.042   -15.321 92.785  1.00 14.64  ? 367  THR C CB  1 
ATOM   9128  O  OG1 . THR C  1 260 ? 0.804   -15.104 93.979  1.00 13.56  ? 367  THR C OG1 1 
ATOM   9129  C  CG2 . THR C  1 260 ? -0.300  -13.989 92.156  1.00 13.13  ? 367  THR C CG2 1 
ATOM   9130  N  N   . SER C  1 261 ? -1.116  -17.936 94.715  1.00 15.73  ? 368  SER C N   1 
ATOM   9131  C  CA  . SER C  1 261 ? -0.823  -19.300 95.141  1.00 15.64  ? 368  SER C CA  1 
ATOM   9132  C  C   . SER C  1 261 ? -1.795  -20.283 94.510  1.00 16.15  ? 368  SER C C   1 
ATOM   9133  O  O   . SER C  1 261 ? -1.519  -21.476 94.437  1.00 17.49  ? 368  SER C O   1 
ATOM   9134  C  CB  . SER C  1 261 ? -0.904  -19.419 96.656  1.00 14.60  ? 368  SER C CB  1 
ATOM   9135  O  OG  . SER C  1 261 ? 0.254   -18.873 97.248  1.00 16.91  ? 368  SER C OG  1 
ATOM   9136  N  N   . ALA C  1 262 ? -2.944  -19.781 94.078  1.00 15.81  ? 369  ALA C N   1 
ATOM   9137  C  CA  . ALA C  1 262 ? -3.945  -20.620 93.445  1.00 16.67  ? 369  ALA C CA  1 
ATOM   9138  C  C   . ALA C  1 262 ? -3.622  -20.718 91.958  1.00 17.87  ? 369  ALA C C   1 
ATOM   9139  O  O   . ALA C  1 262 ? -3.925  -21.714 91.309  1.00 19.44  ? 369  ALA C O   1 
ATOM   9140  C  CB  . ALA C  1 262 ? -5.325  -20.024 93.637  1.00 15.46  ? 369  ALA C CB  1 
ATOM   9141  N  N   . SER C  1 263 ? -2.991  -19.679 91.427  1.00 17.96  ? 370  SER C N   1 
ATOM   9142  C  CA  . SER C  1 263 ? -2.633  -19.637 90.019  1.00 17.69  ? 370  SER C CA  1 
ATOM   9143  C  C   . SER C  1 263 ? -1.500  -20.560 89.602  1.00 18.42  ? 370  SER C C   1 
ATOM   9144  O  O   . SER C  1 263 ? -1.559  -21.177 88.531  1.00 18.84  ? 370  SER C O   1 
ATOM   9145  C  CB  . SER C  1 263 ? -2.271  -18.213 89.607  1.00 16.16  ? 370  SER C CB  1 
ATOM   9146  O  OG  . SER C  1 263 ? -3.408  -17.374 89.624  1.00 15.16  ? 370  SER C OG  1 
ATOM   9147  N  N   . ALA C  1 264 ? -0.466  -20.654 90.431  1.00 17.63  ? 371  ALA C N   1 
ATOM   9148  C  CA  . ALA C  1 264 ? 0.670   -21.497 90.084  1.00 17.16  ? 371  ALA C CA  1 
ATOM   9149  C  C   . ALA C  1 264 ? 0.278   -22.964 89.938  1.00 17.48  ? 371  ALA C C   1 
ATOM   9150  O  O   . ALA C  1 264 ? 0.583   -23.595 88.927  1.00 17.60  ? 371  ALA C O   1 
ATOM   9151  C  CB  . ALA C  1 264 ? 1.777   -21.350 91.110  1.00 16.53  ? 371  ALA C CB  1 
ATOM   9152  N  N   . PRO C  1 265 ? -0.390  -23.536 90.951  1.00 17.19  ? 372  PRO C N   1 
ATOM   9153  C  CA  . PRO C  1 265 ? -0.771  -24.948 90.813  1.00 16.76  ? 372  PRO C CA  1 
ATOM   9154  C  C   . PRO C  1 265 ? -1.712  -25.221 89.629  1.00 15.99  ? 372  PRO C C   1 
ATOM   9155  O  O   . PRO C  1 265 ? -1.617  -26.269 88.995  1.00 15.00  ? 372  PRO C O   1 
ATOM   9156  C  CB  . PRO C  1 265 ? -1.380  -25.286 92.178  1.00 15.66  ? 372  PRO C CB  1 
ATOM   9157  C  CG  . PRO C  1 265 ? -1.773  -23.959 92.729  1.00 16.96  ? 372  PRO C CG  1 
ATOM   9158  C  CD  . PRO C  1 265 ? -0.691  -23.033 92.298  1.00 15.77  ? 372  PRO C CD  1 
ATOM   9159  N  N   . LEU C  1 266 ? -2.603  -24.282 89.318  1.00 15.21  ? 373  LEU C N   1 
ATOM   9160  C  CA  . LEU C  1 266 ? -3.496  -24.467 88.181  1.00 14.42  ? 373  LEU C CA  1 
ATOM   9161  C  C   . LEU C  1 266 ? -2.635  -24.527 86.922  1.00 15.23  ? 373  LEU C C   1 
ATOM   9162  O  O   . LEU C  1 266 ? -2.889  -25.316 86.014  1.00 16.81  ? 373  LEU C O   1 
ATOM   9163  C  CB  . LEU C  1 266 ? -4.499  -23.321 88.069  1.00 12.43  ? 373  LEU C CB  1 
ATOM   9164  C  CG  . LEU C  1 266 ? -5.593  -23.284 89.142  1.00 13.02  ? 373  LEU C CG  1 
ATOM   9165  C  CD1 . LEU C  1 266 ? -6.450  -22.039 88.952  1.00 11.33  ? 373  LEU C CD1 1 
ATOM   9166  C  CD2 . LEU C  1 266 ? -6.452  -24.530 89.069  1.00 11.14  ? 373  LEU C CD2 1 
ATOM   9167  N  N   . ALA C  1 267 ? -1.602  -23.699 86.869  1.00 14.36  ? 374  ALA C N   1 
ATOM   9168  C  CA  . ALA C  1 267 ? -0.711  -23.703 85.725  1.00 13.17  ? 374  ALA C CA  1 
ATOM   9169  C  C   . ALA C  1 267 ? 0.054   -25.021 85.674  1.00 14.69  ? 374  ALA C C   1 
ATOM   9170  O  O   . ALA C  1 267 ? 0.269   -25.569 84.601  1.00 16.73  ? 374  ALA C O   1 
ATOM   9171  C  CB  . ALA C  1 267 ? 0.259   -22.539 85.817  1.00 11.19  ? 374  ALA C CB  1 
ATOM   9172  N  N   . ALA C  1 268 ? 0.472   -25.527 86.833  1.00 15.26  ? 375  ALA C N   1 
ATOM   9173  C  CA  . ALA C  1 268 ? 1.209   -26.788 86.889  1.00 15.37  ? 375  ALA C CA  1 
ATOM   9174  C  C   . ALA C  1 268 ? 0.334   -27.910 86.355  1.00 16.44  ? 375  ALA C C   1 
ATOM   9175  O  O   . ALA C  1 268 ? 0.813   -28.806 85.671  1.00 16.89  ? 375  ALA C O   1 
ATOM   9176  C  CB  . ALA C  1 268 ? 1.629   -27.096 88.314  1.00 15.48  ? 375  ALA C CB  1 
ATOM   9177  N  N   . GLY C  1 269 ? -0.955  -27.859 86.677  1.00 17.09  ? 376  GLY C N   1 
ATOM   9178  C  CA  . GLY C  1 269 ? -1.869  -28.874 86.200  1.00 16.85  ? 376  GLY C CA  1 
ATOM   9179  C  C   . GLY C  1 269 ? -1.942  -28.843 84.686  1.00 16.89  ? 376  GLY C C   1 
ATOM   9180  O  O   . GLY C  1 269 ? -1.849  -29.881 84.030  1.00 16.63  ? 376  GLY C O   1 
ATOM   9181  N  N   . ILE C  1 270 ? -2.113  -27.647 84.132  1.00 16.67  ? 377  ILE C N   1 
ATOM   9182  C  CA  . ILE C  1 270 ? -2.195  -27.475 82.690  1.00 15.67  ? 377  ILE C CA  1 
ATOM   9183  C  C   . ILE C  1 270 ? -0.896  -27.934 82.043  1.00 16.82  ? 377  ILE C C   1 
ATOM   9184  O  O   . ILE C  1 270 ? -0.896  -28.511 80.962  1.00 19.74  ? 377  ILE C O   1 
ATOM   9185  C  CB  . ILE C  1 270 ? -2.456  -26.008 82.320  1.00 14.88  ? 377  ILE C CB  1 
ATOM   9186  C  CG1 . ILE C  1 270 ? -3.873  -25.619 82.743  1.00 13.31  ? 377  ILE C CG1 1 
ATOM   9187  C  CG2 . ILE C  1 270 ? -2.256  -25.801 80.834  1.00 15.57  ? 377  ILE C CG2 1 
ATOM   9188  C  CD1 . ILE C  1 270 ? -4.277  -24.217 82.355  1.00 10.98  ? 377  ILE C CD1 1 
ATOM   9189  N  N   . ILE C  1 271 ? 0.220   -27.691 82.709  1.00 16.13  ? 378  ILE C N   1 
ATOM   9190  C  CA  . ILE C  1 271 ? 1.496   -28.100 82.159  1.00 14.32  ? 378  ILE C CA  1 
ATOM   9191  C  C   . ILE C  1 271 ? 1.611   -29.613 82.255  1.00 14.79  ? 378  ILE C C   1 
ATOM   9192  O  O   . ILE C  1 271 ? 2.318   -30.242 81.466  1.00 15.96  ? 378  ILE C O   1 
ATOM   9193  C  CB  . ILE C  1 271 ? 2.647   -27.390 82.900  1.00 13.38  ? 378  ILE C CB  1 
ATOM   9194  C  CG1 . ILE C  1 271 ? 2.595   -25.902 82.560  1.00 12.39  ? 378  ILE C CG1 1 
ATOM   9195  C  CG2 . ILE C  1 271 ? 3.994   -27.984 82.515  1.00 12.14  ? 378  ILE C CG2 1 
ATOM   9196  C  CD1 . ILE C  1 271 ? 3.660   -25.083 83.230  1.00 15.55  ? 378  ILE C CD1 1 
ATOM   9197  N  N   . ALA C  1 272 ? 0.905   -30.205 83.210  1.00 14.21  ? 379  ALA C N   1 
ATOM   9198  C  CA  . ALA C  1 272 ? 0.935   -31.655 83.358  1.00 14.88  ? 379  ALA C CA  1 
ATOM   9199  C  C   . ALA C  1 272 ? 0.190   -32.277 82.163  1.00 15.55  ? 379  ALA C C   1 
ATOM   9200  O  O   . ALA C  1 272 ? 0.630   -33.282 81.600  1.00 15.39  ? 379  ALA C O   1 
ATOM   9201  C  CB  . ALA C  1 272 ? 0.288   -32.065 84.663  1.00 14.08  ? 379  ALA C CB  1 
ATOM   9202  N  N   . LEU C  1 273 ? -0.925  -31.665 81.770  1.00 15.29  ? 380  LEU C N   1 
ATOM   9203  C  CA  . LEU C  1 273 ? -1.693  -32.163 80.636  1.00 15.43  ? 380  LEU C CA  1 
ATOM   9204  C  C   . LEU C  1 273 ? -0.830  -32.068 79.383  1.00 16.01  ? 380  LEU C C   1 
ATOM   9205  O  O   . LEU C  1 273 ? -0.791  -32.982 78.561  1.00 17.05  ? 380  LEU C O   1 
ATOM   9206  C  CB  . LEU C  1 273 ? -2.963  -31.338 80.436  1.00 12.21  ? 380  LEU C CB  1 
ATOM   9207  C  CG  . LEU C  1 273 ? -3.922  -31.233 81.620  1.00 11.61  ? 380  LEU C CG  1 
ATOM   9208  C  CD1 . LEU C  1 273 ? -5.215  -30.589 81.155  1.00 11.15  ? 380  LEU C CD1 1 
ATOM   9209  C  CD2 . LEU C  1 273 ? -4.204  -32.594 82.192  1.00 9.30   ? 380  LEU C CD2 1 
ATOM   9210  N  N   . THR C  1 274 ? -0.122  -30.958 79.256  1.00 16.38  ? 381  THR C N   1 
ATOM   9211  C  CA  . THR C  1 274 ? 0.731   -30.742 78.107  1.00 16.92  ? 381  THR C CA  1 
ATOM   9212  C  C   . THR C  1 274 ? 1.803   -31.807 78.027  1.00 18.76  ? 381  THR C C   1 
ATOM   9213  O  O   . THR C  1 274 ? 2.087   -32.316 76.942  1.00 20.72  ? 381  THR C O   1 
ATOM   9214  C  CB  . THR C  1 274 ? 1.381   -29.363 78.171  1.00 16.89  ? 381  THR C CB  1 
ATOM   9215  O  OG1 . THR C  1 274 ? 0.352   -28.377 78.324  1.00 17.08  ? 381  THR C OG1 1 
ATOM   9216  C  CG2 . THR C  1 274 ? 2.162   -29.073 76.891  1.00 13.52  ? 381  THR C CG2 1 
ATOM   9217  N  N   . LEU C  1 275 ? 2.405   -32.152 79.162  1.00 19.06  ? 382  LEU C N   1 
ATOM   9218  C  CA  . LEU C  1 275 ? 3.435   -33.183 79.164  1.00 19.83  ? 382  LEU C CA  1 
ATOM   9219  C  C   . LEU C  1 275 ? 2.880   -34.547 78.769  1.00 20.77  ? 382  LEU C C   1 
ATOM   9220  O  O   . LEU C  1 275 ? 3.565   -35.326 78.113  1.00 22.64  ? 382  LEU C O   1 
ATOM   9221  C  CB  . LEU C  1 275 ? 4.100   -33.301 80.534  1.00 20.59  ? 382  LEU C CB  1 
ATOM   9222  C  CG  . LEU C  1 275 ? 5.370   -32.485 80.744  1.00 20.78  ? 382  LEU C CG  1 
ATOM   9223  C  CD1 . LEU C  1 275 ? 5.997   -32.853 82.083  1.00 20.38  ? 382  LEU C CD1 1 
ATOM   9224  C  CD2 . LEU C  1 275 ? 6.335   -32.768 79.615  1.00 21.74  ? 382  LEU C CD2 1 
ATOM   9225  N  N   . GLU C  1 276 ? 1.657   -34.853 79.186  1.00 20.55  ? 383  GLU C N   1 
ATOM   9226  C  CA  . GLU C  1 276 ? 1.073   -36.129 78.814  1.00 22.00  ? 383  GLU C CA  1 
ATOM   9227  C  C   . GLU C  1 276 ? 0.982   -36.170 77.290  1.00 21.49  ? 383  GLU C C   1 
ATOM   9228  O  O   . GLU C  1 276 ? 1.326   -37.171 76.663  1.00 21.29  ? 383  GLU C O   1 
ATOM   9229  C  CB  . GLU C  1 276 ? -0.321  -36.298 79.426  1.00 22.77  ? 383  GLU C CB  1 
ATOM   9230  C  CG  . GLU C  1 276 ? -0.974  -37.635 79.054  1.00 25.14  ? 383  GLU C CG  1 
ATOM   9231  C  CD  . GLU C  1 276 ? -2.290  -37.887 79.783  1.00 26.82  ? 383  GLU C CD  1 
ATOM   9232  O  OE1 . GLU C  1 276 ? -2.943  -36.902 80.198  1.00 28.00  ? 383  GLU C OE1 1 
ATOM   9233  O  OE2 . GLU C  1 276 ? -2.676  -39.069 79.928  1.00 26.18  ? 383  GLU C OE2 1 
ATOM   9234  N  N   . ALA C  1 277 ? 0.538   -35.064 76.703  1.00 20.52  ? 384  ALA C N   1 
ATOM   9235  C  CA  . ALA C  1 277 ? 0.406   -34.973 75.263  1.00 19.60  ? 384  ALA C CA  1 
ATOM   9236  C  C   . ALA C  1 277 ? 1.745   -35.088 74.537  1.00 20.94  ? 384  ALA C C   1 
ATOM   9237  O  O   . ALA C  1 277 ? 1.781   -35.440 73.356  1.00 21.16  ? 384  ALA C O   1 
ATOM   9238  C  CB  . ALA C  1 277 ? -0.275  -33.690 74.893  1.00 19.36  ? 384  ALA C CB  1 
ATOM   9239  N  N   . ASN C  1 278 ? 2.843   -34.793 75.232  1.00 20.99  ? 385  ASN C N   1 
ATOM   9240  C  CA  . ASN C  1 278 ? 4.175   -34.899 74.630  1.00 20.54  ? 385  ASN C CA  1 
ATOM   9241  C  C   . ASN C  1 278 ? 5.243   -34.947 75.721  1.00 21.58  ? 385  ASN C C   1 
ATOM   9242  O  O   . ASN C  1 278 ? 5.777   -33.920 76.131  1.00 23.06  ? 385  ASN C O   1 
ATOM   9243  C  CB  . ASN C  1 278 ? 4.431   -33.719 73.689  1.00 17.79  ? 385  ASN C CB  1 
ATOM   9244  C  CG  . ASN C  1 278 ? 5.752   -33.837 72.950  1.00 18.36  ? 385  ASN C CG  1 
ATOM   9245  O  OD1 . ASN C  1 278 ? 6.629   -34.625 73.331  1.00 19.18  ? 385  ASN C OD1 1 
ATOM   9246  N  ND2 . ASN C  1 278 ? 5.916   -33.037 71.902  1.00 17.33  ? 385  ASN C ND2 1 
ATOM   9247  N  N   . LYS C  1 279 ? 5.549   -36.150 76.185  1.00 23.10  ? 386  LYS C N   1 
ATOM   9248  C  CA  . LYS C  1 279 ? 6.535   -36.347 77.240  1.00 25.00  ? 386  LYS C CA  1 
ATOM   9249  C  C   . LYS C  1 279 ? 7.950   -35.908 76.906  1.00 24.87  ? 386  LYS C C   1 
ATOM   9250  O  O   . LYS C  1 279 ? 8.801   -35.863 77.791  1.00 25.29  ? 386  LYS C O   1 
ATOM   9251  C  CB  . LYS C  1 279 ? 6.562   -37.817 77.661  1.00 26.54  ? 386  LYS C CB  1 
ATOM   9252  C  CG  . LYS C  1 279 ? 5.352   -38.222 78.486  1.00 31.48  ? 386  LYS C CG  1 
ATOM   9253  C  CD  . LYS C  1 279 ? 5.489   -37.743 79.928  1.00 34.54  ? 386  LYS C CD  1 
ATOM   9254  C  CE  . LYS C  1 279 ? 6.078   -38.846 80.819  1.00 37.03  ? 386  LYS C CE  1 
ATOM   9255  N  NZ  . LYS C  1 279 ? 5.149   -40.031 80.957  1.00 38.43  ? 386  LYS C NZ  1 
ATOM   9256  N  N   . ASN C  1 280 ? 8.213   -35.571 75.650  1.00 24.66  ? 387  ASN C N   1 
ATOM   9257  C  CA  . ASN C  1 280 ? 9.569   -35.180 75.280  1.00 24.80  ? 387  ASN C CA  1 
ATOM   9258  C  C   . ASN C  1 280 ? 9.872   -33.690 75.244  1.00 22.67  ? 387  ASN C C   1 
ATOM   9259  O  O   . ASN C  1 280 ? 10.942  -33.283 74.788  1.00 23.30  ? 387  ASN C O   1 
ATOM   9260  C  CB  . ASN C  1 280 ? 9.942   -35.816 73.937  1.00 26.01  ? 387  ASN C CB  1 
ATOM   9261  C  CG  . ASN C  1 280 ? 10.285  -37.289 74.071  1.00 28.44  ? 387  ASN C CG  1 
ATOM   9262  O  OD1 . ASN C  1 280 ? 10.518  -37.985 73.073  1.00 30.95  ? 387  ASN C OD1 1 
ATOM   9263  N  ND2 . ASN C  1 280 ? 10.325  -37.774 75.313  1.00 28.44  ? 387  ASN C ND2 1 
ATOM   9264  N  N   . LEU C  1 281 ? 8.942   -32.882 75.732  1.00 20.40  ? 388  LEU C N   1 
ATOM   9265  C  CA  . LEU C  1 281 ? 9.129   -31.436 75.756  1.00 19.07  ? 388  LEU C CA  1 
ATOM   9266  C  C   . LEU C  1 281 ? 10.221  -31.072 76.748  1.00 18.22  ? 388  LEU C C   1 
ATOM   9267  O  O   . LEU C  1 281 ? 10.229  -31.590 77.860  1.00 18.85  ? 388  LEU C O   1 
ATOM   9268  C  CB  . LEU C  1 281 ? 7.823   -30.764 76.176  1.00 17.13  ? 388  LEU C CB  1 
ATOM   9269  C  CG  . LEU C  1 281 ? 6.646   -30.965 75.225  1.00 16.20  ? 388  LEU C CG  1 
ATOM   9270  C  CD1 . LEU C  1 281 ? 5.349   -30.542 75.912  1.00 16.59  ? 388  LEU C CD1 1 
ATOM   9271  C  CD2 . LEU C  1 281 ? 6.883   -30.165 73.954  1.00 13.50  ? 388  LEU C CD2 1 
ATOM   9272  N  N   . THR C  1 282 ? 11.150  -30.201 76.359  1.00 17.69  ? 389  THR C N   1 
ATOM   9273  C  CA  . THR C  1 282 ? 12.204  -29.782 77.290  1.00 16.87  ? 389  THR C CA  1 
ATOM   9274  C  C   . THR C  1 282 ? 11.649  -28.628 78.113  1.00 16.44  ? 389  THR C C   1 
ATOM   9275  O  O   . THR C  1 282 ? 10.573  -28.100 77.802  1.00 16.06  ? 389  THR C O   1 
ATOM   9276  C  CB  . THR C  1 282 ? 13.472  -29.277 76.573  1.00 17.40  ? 389  THR C CB  1 
ATOM   9277  O  OG1 . THR C  1 282 ? 13.189  -28.033 75.912  1.00 17.20  ? 389  THR C OG1 1 
ATOM   9278  C  CG2 . THR C  1 282 ? 13.950  -30.303 75.563  1.00 15.84  ? 389  THR C CG2 1 
ATOM   9279  N  N   . TRP C  1 283 ? 12.378  -28.234 79.156  1.00 16.25  ? 390  TRP C N   1 
ATOM   9280  C  CA  . TRP C  1 283 ? 11.927  -27.133 80.010  1.00 14.64  ? 390  TRP C CA  1 
ATOM   9281  C  C   . TRP C  1 283 ? 11.751  -25.859 79.184  1.00 13.65  ? 390  TRP C C   1 
ATOM   9282  O  O   . TRP C  1 283 ? 10.902  -25.033 79.492  1.00 14.37  ? 390  TRP C O   1 
ATOM   9283  C  CB  . TRP C  1 283 ? 12.909  -26.899 81.169  1.00 12.92  ? 390  TRP C CB  1 
ATOM   9284  C  CG  . TRP C  1 283 ? 14.278  -26.381 80.777  1.00 12.30  ? 390  TRP C CG  1 
ATOM   9285  C  CD1 . TRP C  1 283 ? 15.345  -27.112 80.321  1.00 11.91  ? 390  TRP C CD1 1 
ATOM   9286  C  CD2 . TRP C  1 283 ? 14.725  -25.015 80.836  1.00 11.50  ? 390  TRP C CD2 1 
ATOM   9287  N  NE1 . TRP C  1 283 ? 16.425  -26.286 80.098  1.00 10.95  ? 390  TRP C NE1 1 
ATOM   9288  C  CE2 . TRP C  1 283 ? 16.071  -24.996 80.402  1.00 10.78  ? 390  TRP C CE2 1 
ATOM   9289  C  CE3 . TRP C  1 283 ? 14.115  -23.808 81.213  1.00 9.33   ? 390  TRP C CE3 1 
ATOM   9290  C  CZ2 . TRP C  1 283 ? 16.816  -23.817 80.335  1.00 10.26  ? 390  TRP C CZ2 1 
ATOM   9291  C  CZ3 . TRP C  1 283 ? 14.861  -22.638 81.145  1.00 10.16  ? 390  TRP C CZ3 1 
ATOM   9292  C  CH2 . TRP C  1 283 ? 16.199  -22.653 80.708  1.00 9.03   ? 390  TRP C CH2 1 
ATOM   9293  N  N   . ARG C  1 284 ? 12.551  -25.706 78.133  1.00 12.63  ? 391  ARG C N   1 
ATOM   9294  C  CA  . ARG C  1 284 ? 12.429  -24.541 77.267  1.00 13.04  ? 391  ARG C CA  1 
ATOM   9295  C  C   . ARG C  1 284 ? 11.247  -24.715 76.320  1.00 13.17  ? 391  ARG C C   1 
ATOM   9296  O  O   . ARG C  1 284 ? 10.493  -23.772 76.082  1.00 14.12  ? 391  ARG C O   1 
ATOM   9297  C  CB  . ARG C  1 284 ? 13.703  -24.318 76.461  1.00 12.33  ? 391  ARG C CB  1 
ATOM   9298  C  CG  . ARG C  1 284 ? 14.843  -23.755 77.275  1.00 15.45  ? 391  ARG C CG  1 
ATOM   9299  C  CD  . ARG C  1 284 ? 15.823  -23.046 76.359  1.00 16.34  ? 391  ARG C CD  1 
ATOM   9300  N  NE  . ARG C  1 284 ? 16.532  -24.002 75.528  1.00 16.41  ? 391  ARG C NE  1 
ATOM   9301  C  CZ  . ARG C  1 284 ? 16.777  -23.836 74.237  1.00 15.27  ? 391  ARG C CZ  1 
ATOM   9302  N  NH1 . ARG C  1 284 ? 17.434  -24.778 73.580  1.00 17.21  ? 391  ARG C NH1 1 
ATOM   9303  N  NH2 . ARG C  1 284 ? 16.367  -22.746 73.610  1.00 12.32  ? 391  ARG C NH2 1 
ATOM   9304  N  N   . ASP C  1 285 ? 11.080  -25.920 75.781  1.00 13.29  ? 392  ASP C N   1 
ATOM   9305  C  CA  . ASP C  1 285 ? 9.967   -26.196 74.885  1.00 13.50  ? 392  ASP C CA  1 
ATOM   9306  C  C   . ASP C  1 285 ? 8.682   -25.733 75.559  1.00 14.00  ? 392  ASP C C   1 
ATOM   9307  O  O   . ASP C  1 285 ? 7.855   -25.057 74.948  1.00 15.10  ? 392  ASP C O   1 
ATOM   9308  C  CB  . ASP C  1 285 ? 9.874   -27.697 74.606  1.00 14.50  ? 392  ASP C CB  1 
ATOM   9309  C  CG  . ASP C  1 285 ? 10.846  -28.162 73.530  1.00 16.11  ? 392  ASP C CG  1 
ATOM   9310  O  OD1 . ASP C  1 285 ? 11.269  -29.339 73.605  1.00 16.15  ? 392  ASP C OD1 1 
ATOM   9311  O  OD2 . ASP C  1 285 ? 11.172  -27.369 72.605  1.00 14.17  ? 392  ASP C OD2 1 
ATOM   9312  N  N   . MET C  1 286 ? 8.529   -26.097 76.829  1.00 14.10  ? 393  MET C N   1 
ATOM   9313  C  CA  . MET C  1 286 ? 7.346   -25.738 77.605  1.00 13.89  ? 393  MET C CA  1 
ATOM   9314  C  C   . MET C  1 286 ? 7.110   -24.241 77.687  1.00 14.24  ? 393  MET C C   1 
ATOM   9315  O  O   . MET C  1 286 ? 5.971   -23.778 77.599  1.00 14.92  ? 393  MET C O   1 
ATOM   9316  C  CB  . MET C  1 286 ? 7.449   -26.307 79.013  1.00 13.95  ? 393  MET C CB  1 
ATOM   9317  C  CG  . MET C  1 286 ? 6.141   -26.269 79.782  1.00 16.72  ? 393  MET C CG  1 
ATOM   9318  S  SD  . MET C  1 286 ? 4.875   -27.283 78.975  1.00 17.00  ? 393  MET C SD  1 
ATOM   9319  C  CE  . MET C  1 286 ? 5.539   -28.907 79.310  1.00 18.68  ? 393  MET C CE  1 
ATOM   9320  N  N   . GLN C  1 287 ? 8.172   -23.466 77.857  1.00 14.76  ? 394  GLN C N   1 
ATOM   9321  C  CA  . GLN C  1 287 ? 7.986   -22.030 77.936  1.00 14.92  ? 394  GLN C CA  1 
ATOM   9322  C  C   . GLN C  1 287 ? 7.590   -21.492 76.579  1.00 15.13  ? 394  GLN C C   1 
ATOM   9323  O  O   . GLN C  1 287 ? 6.790   -20.564 76.491  1.00 15.39  ? 394  GLN C O   1 
ATOM   9324  C  CB  . GLN C  1 287 ? 9.239   -21.351 78.474  1.00 15.90  ? 394  GLN C CB  1 
ATOM   9325  C  CG  . GLN C  1 287 ? 9.403   -21.586 79.959  1.00 17.67  ? 394  GLN C CG  1 
ATOM   9326  C  CD  . GLN C  1 287 ? 10.547  -20.818 80.558  1.00 18.87  ? 394  GLN C CD  1 
ATOM   9327  O  OE1 . GLN C  1 287 ? 10.732  -19.632 80.266  1.00 19.95  ? 394  GLN C OE1 1 
ATOM   9328  N  NE2 . GLN C  1 287 ? 11.317  -21.479 81.424  1.00 18.49  ? 394  GLN C NE2 1 
ATOM   9329  N  N   . HIS C  1 288 ? 8.124   -22.085 75.514  1.00 14.26  ? 395  HIS C N   1 
ATOM   9330  C  CA  . HIS C  1 288 ? 7.753   -21.656 74.167  1.00 14.09  ? 395  HIS C CA  1 
ATOM   9331  C  C   . HIS C  1 288 ? 6.258   -21.899 73.946  1.00 14.97  ? 395  HIS C C   1 
ATOM   9332  O  O   . HIS C  1 288 ? 5.556   -21.046 73.402  1.00 15.98  ? 395  HIS C O   1 
ATOM   9333  C  CB  . HIS C  1 288 ? 8.535   -22.439 73.123  1.00 14.19  ? 395  HIS C CB  1 
ATOM   9334  C  CG  . HIS C  1 288 ? 9.900   -21.898 72.860  1.00 12.32  ? 395  HIS C CG  1 
ATOM   9335  N  ND1 . HIS C  1 288 ? 10.118  -20.799 72.055  1.00 12.80  ? 395  HIS C ND1 1 
ATOM   9336  C  CD2 . HIS C  1 288 ? 11.118  -22.303 73.288  1.00 10.38  ? 395  HIS C CD2 1 
ATOM   9337  C  CE1 . HIS C  1 288 ? 11.414  -20.553 71.997  1.00 13.68  ? 395  HIS C CE1 1 
ATOM   9338  N  NE2 . HIS C  1 288 ? 12.043  -21.451 72.738  1.00 14.50  ? 395  HIS C NE2 1 
ATOM   9339  N  N   . LEU C  1 289 ? 5.763   -23.061 74.367  1.00 14.18  ? 396  LEU C N   1 
ATOM   9340  C  CA  . LEU C  1 289 ? 4.352   -23.367 74.183  1.00 14.13  ? 396  LEU C CA  1 
ATOM   9341  C  C   . LEU C  1 289 ? 3.477   -22.369 74.913  1.00 14.79  ? 396  LEU C C   1 
ATOM   9342  O  O   . LEU C  1 289 ? 2.460   -21.945 74.384  1.00 14.69  ? 396  LEU C O   1 
ATOM   9343  C  CB  . LEU C  1 289 ? 4.025   -24.782 74.669  1.00 16.01  ? 396  LEU C CB  1 
ATOM   9344  C  CG  . LEU C  1 289 ? 4.758   -25.965 74.014  1.00 16.53  ? 396  LEU C CG  1 
ATOM   9345  C  CD1 . LEU C  1 289 ? 4.192   -27.262 74.559  1.00 15.62  ? 396  LEU C CD1 1 
ATOM   9346  C  CD2 . LEU C  1 289 ? 4.604   -25.925 72.507  1.00 16.21  ? 396  LEU C CD2 1 
ATOM   9347  N  N   . VAL C  1 290 ? 3.872   -21.988 76.126  1.00 16.13  ? 397  VAL C N   1 
ATOM   9348  C  CA  . VAL C  1 290 ? 3.096   -21.026 76.911  1.00 15.33  ? 397  VAL C CA  1 
ATOM   9349  C  C   . VAL C  1 290 ? 3.048   -19.670 76.204  1.00 16.12  ? 397  VAL C C   1 
ATOM   9350  O  O   . VAL C  1 290 ? 1.999   -19.021 76.136  1.00 15.07  ? 397  VAL C O   1 
ATOM   9351  C  CB  . VAL C  1 290 ? 3.693   -20.838 78.334  1.00 15.70  ? 397  VAL C CB  1 
ATOM   9352  C  CG1 . VAL C  1 290 ? 3.002   -19.688 79.044  1.00 14.96  ? 397  VAL C CG1 1 
ATOM   9353  C  CG2 . VAL C  1 290 ? 3.521   -22.113 79.150  1.00 14.75  ? 397  VAL C CG2 1 
ATOM   9354  N  N   . VAL C  1 291 ? 4.184   -19.248 75.661  1.00 16.28  ? 398  VAL C N   1 
ATOM   9355  C  CA  . VAL C  1 291 ? 4.241   -17.971 74.976  1.00 16.54  ? 398  VAL C CA  1 
ATOM   9356  C  C   . VAL C  1 291 ? 3.357   -17.962 73.737  1.00 17.68  ? 398  VAL C C   1 
ATOM   9357  O  O   . VAL C  1 291 ? 2.631   -16.999 73.492  1.00 17.80  ? 398  VAL C O   1 
ATOM   9358  C  CB  . VAL C  1 291 ? 5.690   -17.615 74.553  1.00 15.47  ? 398  VAL C CB  1 
ATOM   9359  C  CG1 . VAL C  1 291 ? 5.682   -16.368 73.703  1.00 13.55  ? 398  VAL C CG1 1 
ATOM   9360  C  CG2 . VAL C  1 291 ? 6.554   -17.394 75.772  1.00 11.72  ? 398  VAL C CG2 1 
ATOM   9361  N  N   . GLN C  1 292 ? 3.405   -19.040 72.961  1.00 19.68  ? 399  GLN C N   1 
ATOM   9362  C  CA  . GLN C  1 292 ? 2.630   -19.112 71.726  1.00 19.90  ? 399  GLN C CA  1 
ATOM   9363  C  C   . GLN C  1 292 ? 1.140   -19.341 71.876  1.00 20.07  ? 399  GLN C C   1 
ATOM   9364  O  O   . GLN C  1 292 ? 0.362   -18.820 71.082  1.00 20.94  ? 399  GLN C O   1 
ATOM   9365  C  CB  . GLN C  1 292 ? 3.199   -20.190 70.804  1.00 20.83  ? 399  GLN C CB  1 
ATOM   9366  C  CG  . GLN C  1 292 ? 4.578   -19.877 70.269  1.00 24.18  ? 399  GLN C CG  1 
ATOM   9367  C  CD  . GLN C  1 292 ? 5.034   -20.883 69.230  1.00 25.77  ? 399  GLN C CD  1 
ATOM   9368  O  OE1 . GLN C  1 292 ? 4.829   -20.707 68.038  1.00 26.41  ? 399  GLN C OE1 1 
ATOM   9369  N  NE2 . GLN C  1 292 ? 5.640   -21.957 69.688  1.00 30.99  ? 399  GLN C NE2 1 
ATOM   9370  N  N   . THR C  1 293 ? 0.732   -20.101 72.888  1.00 20.25  ? 400  THR C N   1 
ATOM   9371  C  CA  . THR C  1 293 ? -0.684  -20.408 73.067  1.00 20.94  ? 400  THR C CA  1 
ATOM   9372  C  C   . THR C  1 293 ? -1.502  -19.559 74.033  1.00 22.24  ? 400  THR C C   1 
ATOM   9373  O  O   . THR C  1 293 ? -2.730  -19.593 73.988  1.00 23.54  ? 400  THR C O   1 
ATOM   9374  C  CB  . THR C  1 293 ? -0.862  -21.862 73.492  1.00 20.47  ? 400  THR C CB  1 
ATOM   9375  O  OG1 . THR C  1 293 ? -0.244  -22.057 74.768  1.00 21.73  ? 400  THR C OG1 1 
ATOM   9376  C  CG2 . THR C  1 293 ? -0.224  -22.795 72.477  1.00 19.00  ? 400  THR C CG2 1 
ATOM   9377  N  N   . SER C  1 294 ? -0.849  -18.797 74.904  1.00 24.05  ? 401  SER C N   1 
ATOM   9378  C  CA  . SER C  1 294 ? -1.583  -17.979 75.871  1.00 24.95  ? 401  SER C CA  1 
ATOM   9379  C  C   . SER C  1 294 ? -2.406  -16.886 75.209  1.00 26.59  ? 401  SER C C   1 
ATOM   9380  O  O   . SER C  1 294 ? -2.036  -16.359 74.165  1.00 27.33  ? 401  SER C O   1 
ATOM   9381  C  CB  . SER C  1 294 ? -0.616  -17.404 76.895  1.00 23.90  ? 401  SER C CB  1 
ATOM   9382  O  OG  . SER C  1 294 ? 0.011   -18.473 77.594  1.00 21.13  ? 401  SER C OG  1 
ATOM   9383  N  N   . LYS C  1 295 ? -3.527  -16.535 75.824  1.00 28.61  ? 402  LYS C N   1 
ATOM   9384  C  CA  . LYS C  1 295 ? -4.420  -15.556 75.225  1.00 29.41  ? 402  LYS C CA  1 
ATOM   9385  C  C   . LYS C  1 295 ? -4.633  -14.297 76.046  1.00 29.64  ? 402  LYS C C   1 
ATOM   9386  O  O   . LYS C  1 295 ? -4.933  -14.364 77.232  1.00 29.86  ? 402  LYS C O   1 
ATOM   9387  C  CB  . LYS C  1 295 ? -5.794  -16.204 74.976  1.00 30.88  ? 402  LYS C CB  1 
ATOM   9388  C  CG  . LYS C  1 295 ? -5.783  -17.608 74.333  1.00 31.97  ? 402  LYS C CG  1 
ATOM   9389  C  CD  . LYS C  1 295 ? -5.342  -17.586 72.869  1.00 32.73  ? 402  LYS C CD  1 
ATOM   9390  C  CE  . LYS C  1 295 ? -5.681  -18.889 72.129  1.00 31.07  ? 402  LYS C CE  1 
ATOM   9391  N  NZ  . LYS C  1 295 ? -4.887  -20.060 72.584  1.00 31.91  ? 402  LYS C NZ  1 
ATOM   9392  N  N   . PRO C  1 296 ? -4.472  -13.122 75.418  1.00 30.72  ? 403  PRO C N   1 
ATOM   9393  C  CA  . PRO C  1 296 ? -4.671  -11.845 76.113  1.00 31.57  ? 403  PRO C CA  1 
ATOM   9394  C  C   . PRO C  1 296 ? -6.173  -11.603 76.252  1.00 33.02  ? 403  PRO C C   1 
ATOM   9395  O  O   . PRO C  1 296 ? -6.638  -11.028 77.234  1.00 34.37  ? 403  PRO C O   1 
ATOM   9396  C  CB  . PRO C  1 296 ? -4.032  -10.831 75.166  1.00 29.55  ? 403  PRO C CB  1 
ATOM   9397  C  CG  . PRO C  1 296 ? -2.978  -11.626 74.491  1.00 30.46  ? 403  PRO C CG  1 
ATOM   9398  C  CD  . PRO C  1 296 ? -3.696  -12.914 74.184  1.00 30.41  ? 403  PRO C CD  1 
ATOM   9399  N  N   . ALA C  1 297 ? -6.914  -12.073 75.251  1.00 33.66  ? 404  ALA C N   1 
ATOM   9400  C  CA  . ALA C  1 297 ? -8.361  -11.923 75.172  1.00 33.51  ? 404  ALA C CA  1 
ATOM   9401  C  C   . ALA C  1 297 ? -9.116  -12.001 76.495  1.00 34.26  ? 404  ALA C C   1 
ATOM   9402  O  O   . ALA C  1 297 ? -8.993  -12.972 77.249  1.00 34.46  ? 404  ALA C O   1 
ATOM   9403  C  CB  . ALA C  1 297 ? -8.914  -12.945 74.209  1.00 33.66  ? 404  ALA C CB  1 
ATOM   9404  N  N   . HIS C  1 298 ? -9.899  -10.959 76.757  1.00 33.43  ? 405  HIS C N   1 
ATOM   9405  C  CA  . HIS C  1 298 ? -10.725 -10.858 77.953  1.00 33.66  ? 405  HIS C CA  1 
ATOM   9406  C  C   . HIS C  1 298 ? -10.013 -10.537 79.243  1.00 31.23  ? 405  HIS C C   1 
ATOM   9407  O  O   . HIS C  1 298 ? -10.625 -10.502 80.305  1.00 30.41  ? 405  HIS C O   1 
ATOM   9408  C  CB  . HIS C  1 298 ? -11.559 -12.122 78.095  1.00 37.51  ? 405  HIS C CB  1 
ATOM   9409  C  CG  . HIS C  1 298 ? -12.465 -12.345 76.931  1.00 41.73  ? 405  HIS C CG  1 
ATOM   9410  N  ND1 . HIS C  1 298 ? -12.943 -13.589 76.577  1.00 43.88  ? 405  HIS C ND1 1 
ATOM   9411  C  CD2 . HIS C  1 298 ? -12.934 -11.480 75.999  1.00 42.40  ? 405  HIS C CD2 1 
ATOM   9412  C  CE1 . HIS C  1 298 ? -13.660 -13.481 75.472  1.00 45.15  ? 405  HIS C CE1 1 
ATOM   9413  N  NE2 . HIS C  1 298 ? -13.669 -12.212 75.100  1.00 44.62  ? 405  HIS C NE2 1 
ATOM   9414  N  N   . LEU C  1 299 ? -8.715  -10.289 79.148  1.00 29.04  ? 406  LEU C N   1 
ATOM   9415  C  CA  . LEU C  1 299 ? -7.940  -9.926  80.318  1.00 26.67  ? 406  LEU C CA  1 
ATOM   9416  C  C   . LEU C  1 299 ? -7.695  -8.436  80.199  1.00 25.52  ? 406  LEU C C   1 
ATOM   9417  O  O   . LEU C  1 299 ? -6.983  -7.994  79.309  1.00 25.04  ? 406  LEU C O   1 
ATOM   9418  C  CB  . LEU C  1 299 ? -6.620  -10.692 80.341  1.00 25.02  ? 406  LEU C CB  1 
ATOM   9419  C  CG  . LEU C  1 299 ? -6.489  -11.844 81.342  1.00 23.42  ? 406  LEU C CG  1 
ATOM   9420  C  CD1 . LEU C  1 299 ? -7.763  -12.656 81.392  1.00 21.87  ? 406  LEU C CD1 1 
ATOM   9421  C  CD2 . LEU C  1 299 ? -5.304  -12.710 80.952  1.00 22.20  ? 406  LEU C CD2 1 
ATOM   9422  N  N   . ASN C  1 300 ? -8.314  -7.666  81.087  1.00 25.56  ? 407  ASN C N   1 
ATOM   9423  C  CA  . ASN C  1 300 ? -8.180  -6.218  81.088  1.00 24.38  ? 407  ASN C CA  1 
ATOM   9424  C  C   . ASN C  1 300 ? -6.937  -5.708  81.793  1.00 23.98  ? 407  ASN C C   1 
ATOM   9425  O  O   . ASN C  1 300 ? -6.614  -6.118  82.913  1.00 23.10  ? 407  ASN C O   1 
ATOM   9426  C  CB  . ASN C  1 300 ? -9.412  -5.610  81.726  1.00 26.12  ? 407  ASN C CB  1 
ATOM   9427  C  CG  . ASN C  1 300 ? -10.667 -6.074  81.057  1.00 28.94  ? 407  ASN C CG  1 
ATOM   9428  O  OD1 . ASN C  1 300 ? -10.836 -5.886  79.848  1.00 30.41  ? 407  ASN C OD1 1 
ATOM   9429  N  ND2 . ASN C  1 300 ? -11.560 -6.698  81.824  1.00 30.47  ? 407  ASN C ND2 1 
ATOM   9430  N  N   . ALA C  1 301 ? -6.243  -4.799  81.121  1.00 23.31  ? 408  ALA C N   1 
ATOM   9431  C  CA  . ALA C  1 301 ? -5.041  -4.199  81.664  1.00 24.07  ? 408  ALA C CA  1 
ATOM   9432  C  C   . ALA C  1 301 ? -4.814  -2.908  80.907  1.00 23.98  ? 408  ALA C C   1 
ATOM   9433  O  O   . ALA C  1 301 ? -5.276  -2.767  79.782  1.00 24.40  ? 408  ALA C O   1 
ATOM   9434  C  CB  . ALA C  1 301 ? -3.858  -5.138  81.475  1.00 25.08  ? 408  ALA C CB  1 
ATOM   9435  N  N   . ASP C  1 302 ? -4.116  -1.958  81.516  1.00 24.51  ? 409  ASP C N   1 
ATOM   9436  C  CA  . ASP C  1 302 ? -3.848  -0.696  80.833  1.00 24.41  ? 409  ASP C CA  1 
ATOM   9437  C  C   . ASP C  1 302 ? -2.492  -0.711  80.133  1.00 23.78  ? 409  ASP C C   1 
ATOM   9438  O  O   . ASP C  1 302 ? -2.044  0.317   79.644  1.00 24.08  ? 409  ASP C O   1 
ATOM   9439  C  CB  . ASP C  1 302 ? -3.892  0.481   81.816  1.00 24.22  ? 409  ASP C CB  1 
ATOM   9440  C  CG  . ASP C  1 302 ? -5.303  0.813   82.268  1.00 25.69  ? 409  ASP C CG  1 
ATOM   9441  O  OD1 . ASP C  1 302 ? -5.959  -0.066  82.867  0.00 25.21  ? 409  ASP C OD1 1 
ATOM   9442  O  OD2 . ASP C  1 302 ? -5.756  1.951   82.023  0.00 25.21  ? 409  ASP C OD2 1 
ATOM   9443  N  N   . ASP C  1 303 ? -1.838  -1.864  80.061  1.00 22.36  ? 410  ASP C N   1 
ATOM   9444  C  CA  . ASP C  1 303 ? -0.526  -1.893  79.437  1.00 21.37  ? 410  ASP C CA  1 
ATOM   9445  C  C   . ASP C  1 303 ? -0.308  -2.929  78.343  1.00 20.59  ? 410  ASP C C   1 
ATOM   9446  O  O   . ASP C  1 303 ? 0.829   -3.286  78.056  1.00 21.58  ? 410  ASP C O   1 
ATOM   9447  C  CB  . ASP C  1 303 ? 0.548   -2.061  80.514  1.00 21.36  ? 410  ASP C CB  1 
ATOM   9448  C  CG  . ASP C  1 303 ? 0.595   -3.474  81.087  1.00 22.65  ? 410  ASP C CG  1 
ATOM   9449  O  OD1 . ASP C  1 303 ? -0.477  -4.073  81.288  1.00 23.67  ? 410  ASP C OD1 1 
ATOM   9450  O  OD2 . ASP C  1 303 ? 1.706   -3.984  81.350  1.00 23.75  ? 410  ASP C OD2 1 
ATOM   9451  N  N   . TRP C  1 304 ? -1.375  -3.416  77.724  1.00 19.43  ? 411  TRP C N   1 
ATOM   9452  C  CA  . TRP C  1 304 ? -1.196  -4.395  76.660  1.00 18.92  ? 411  TRP C CA  1 
ATOM   9453  C  C   . TRP C  1 304 ? -0.408  -3.740  75.533  1.00 19.51  ? 411  TRP C C   1 
ATOM   9454  O  O   . TRP C  1 304 ? -0.797  -2.689  75.029  1.00 21.22  ? 411  TRP C O   1 
ATOM   9455  C  CB  . TRP C  1 304 ? -2.541  -4.881  76.119  1.00 17.36  ? 411  TRP C CB  1 
ATOM   9456  C  CG  . TRP C  1 304 ? -3.168  -5.957  76.943  1.00 17.14  ? 411  TRP C CG  1 
ATOM   9457  C  CD1 . TRP C  1 304 ? -4.332  -5.874  77.656  1.00 16.55  ? 411  TRP C CD1 1 
ATOM   9458  C  CD2 . TRP C  1 304 ? -2.669  -7.287  77.141  1.00 15.61  ? 411  TRP C CD2 1 
ATOM   9459  N  NE1 . TRP C  1 304 ? -4.589  -7.069  78.282  1.00 17.37  ? 411  TRP C NE1 1 
ATOM   9460  C  CE2 . TRP C  1 304 ? -3.583  -7.954  77.987  1.00 16.18  ? 411  TRP C CE2 1 
ATOM   9461  C  CE3 . TRP C  1 304 ? -1.540  -7.977  76.689  1.00 15.40  ? 411  TRP C CE3 1 
ATOM   9462  C  CZ2 . TRP C  1 304 ? -3.403  -9.281  78.391  1.00 14.23  ? 411  TRP C CZ2 1 
ATOM   9463  C  CZ3 . TRP C  1 304 ? -1.362  -9.298  77.091  1.00 15.35  ? 411  TRP C CZ3 1 
ATOM   9464  C  CH2 . TRP C  1 304 ? -2.291  -9.933  77.937  1.00 13.64  ? 411  TRP C CH2 1 
ATOM   9465  N  N   . ALA C  1 305 ? 0.706   -4.352  75.147  1.00 18.98  ? 412  ALA C N   1 
ATOM   9466  C  CA  . ALA C  1 305 ? 1.530   -3.814  74.077  1.00 18.13  ? 412  ALA C CA  1 
ATOM   9467  C  C   . ALA C  1 305 ? 1.936   -4.949  73.162  1.00 18.15  ? 412  ALA C C   1 
ATOM   9468  O  O   . ALA C  1 305 ? 2.111   -6.079  73.604  1.00 19.51  ? 412  ALA C O   1 
ATOM   9469  C  CB  . ALA C  1 305 ? 2.761   -3.139  74.647  1.00 16.86  ? 412  ALA C CB  1 
ATOM   9470  N  N   . THR C  1 306 ? 2.089   -4.648  71.883  1.00 18.14  ? 413  THR C N   1 
ATOM   9471  C  CA  . THR C  1 306 ? 2.468   -5.663  70.916  1.00 18.70  ? 413  THR C CA  1 
ATOM   9472  C  C   . THR C  1 306 ? 3.967   -5.610  70.748  1.00 18.70  ? 413  THR C C   1 
ATOM   9473  O  O   . THR C  1 306 ? 4.522   -4.541  70.562  1.00 22.11  ? 413  THR C O   1 
ATOM   9474  C  CB  . THR C  1 306 ? 1.785   -5.396  69.562  1.00 18.43  ? 413  THR C CB  1 
ATOM   9475  O  OG1 . THR C  1 306 ? 0.363   -5.457  69.737  1.00 19.44  ? 413  THR C OG1 1 
ATOM   9476  C  CG2 . THR C  1 306 ? 2.216   -6.417  68.530  1.00 17.97  ? 413  THR C CG2 1 
ATOM   9477  N  N   . ASN C  1 307 ? 4.635   -6.748  70.814  1.00 18.14  ? 414  ASN C N   1 
ATOM   9478  C  CA  . ASN C  1 307 ? 6.073   -6.729  70.672  1.00 19.51  ? 414  ASN C CA  1 
ATOM   9479  C  C   . ASN C  1 307 ? 6.500   -6.932  69.221  1.00 20.49  ? 414  ASN C C   1 
ATOM   9480  O  O   . ASN C  1 307 ? 5.677   -7.099  68.328  1.00 21.78  ? 414  ASN C O   1 
ATOM   9481  C  CB  . ASN C  1 307 ? 6.713   -7.795  71.565  1.00 18.93  ? 414  ASN C CB  1 
ATOM   9482  C  CG  . ASN C  1 307 ? 6.357   -9.180  71.131  1.00 18.21  ? 414  ASN C CG  1 
ATOM   9483  O  OD1 . ASN C  1 307 ? 5.960   -9.391  69.985  1.00 18.08  ? 414  ASN C OD1 1 
ATOM   9484  N  ND2 . ASN C  1 307 ? 6.512   -10.144 72.028  1.00 18.68  ? 414  ASN C ND2 1 
ATOM   9485  N  N   . GLY C  1 308 ? 7.806   -6.956  69.013  1.00 20.94  ? 415  GLY C N   1 
ATOM   9486  C  CA  . GLY C  1 308 ? 8.361   -7.083  67.685  1.00 21.10  ? 415  GLY C CA  1 
ATOM   9487  C  C   . GLY C  1 308 ? 7.925   -8.238  66.819  1.00 21.97  ? 415  GLY C C   1 
ATOM   9488  O  O   . GLY C  1 308 ? 8.196   -8.221  65.612  1.00 24.25  ? 415  GLY C O   1 
ATOM   9489  N  N   . VAL C  1 309 ? 7.281   -9.249  67.395  1.00 20.85  ? 416  VAL C N   1 
ATOM   9490  C  CA  . VAL C  1 309 ? 6.840   -10.375 66.580  1.00 19.90  ? 416  VAL C CA  1 
ATOM   9491  C  C   . VAL C  1 309 ? 5.328   -10.443 66.542  1.00 19.97  ? 416  VAL C C   1 
ATOM   9492  O  O   . VAL C  1 309 ? 4.751   -11.482 66.243  1.00 21.23  ? 416  VAL C O   1 
ATOM   9493  C  CB  . VAL C  1 309 ? 7.389   -11.724 67.078  1.00 18.46  ? 416  VAL C CB  1 
ATOM   9494  C  CG1 . VAL C  1 309 ? 8.896   -11.728 66.997  1.00 19.58  ? 416  VAL C CG1 1 
ATOM   9495  C  CG2 . VAL C  1 309 ? 6.925   -11.987 68.485  1.00 18.93  ? 416  VAL C CG2 1 
ATOM   9496  N  N   . GLY C  1 310 ? 4.689   -9.330  66.870  1.00 19.23  ? 417  GLY C N   1 
ATOM   9497  C  CA  . GLY C  1 310 ? 3.245   -9.278  66.815  1.00 19.67  ? 417  GLY C CA  1 
ATOM   9498  C  C   . GLY C  1 310 ? 2.441   -9.831  67.966  1.00 20.94  ? 417  GLY C C   1 
ATOM   9499  O  O   . GLY C  1 310 ? 1.210   -9.857  67.885  1.00 22.02  ? 417  GLY C O   1 
ATOM   9500  N  N   . ARG C  1 311 ? 3.095   -10.278 69.034  1.00 21.11  ? 418  ARG C N   1 
ATOM   9501  C  CA  . ARG C  1 311 ? 2.345   -10.813 70.168  1.00 20.61  ? 418  ARG C CA  1 
ATOM   9502  C  C   . ARG C  1 311 ? 2.058   -9.748  71.224  1.00 20.09  ? 418  ARG C C   1 
ATOM   9503  O  O   . ARG C  1 311 ? 2.876   -8.871  71.471  1.00 20.66  ? 418  ARG C O   1 
ATOM   9504  C  CB  . ARG C  1 311 ? 3.087   -12.005 70.785  1.00 20.33  ? 418  ARG C CB  1 
ATOM   9505  C  CG  . ARG C  1 311 ? 2.856   -13.290 70.003  1.00 22.72  ? 418  ARG C CG  1 
ATOM   9506  C  CD  . ARG C  1 311 ? 3.324   -14.544 70.729  1.00 20.28  ? 418  ARG C CD  1 
ATOM   9507  N  NE  . ARG C  1 311 ? 4.762   -14.725 70.584  1.00 22.83  ? 418  ARG C NE  1 
ATOM   9508  C  CZ  . ARG C  1 311 ? 5.341   -15.639 69.812  1.00 20.94  ? 418  ARG C CZ  1 
ATOM   9509  N  NH1 . ARG C  1 311 ? 6.661   -15.694 69.764  1.00 20.38  ? 418  ARG C NH1 1 
ATOM   9510  N  NH2 . ARG C  1 311 ? 4.614   -16.503 69.109  1.00 19.79  ? 418  ARG C NH2 1 
ATOM   9511  N  N   . LYS C  1 312 ? 0.876   -9.811  71.828  1.00 19.77  ? 419  LYS C N   1 
ATOM   9512  C  CA  . LYS C  1 312 ? 0.514   -8.846  72.857  1.00 19.41  ? 419  LYS C CA  1 
ATOM   9513  C  C   . LYS C  1 312 ? 1.014   -9.321  74.213  1.00 19.35  ? 419  LYS C C   1 
ATOM   9514  O  O   . LYS C  1 312 ? 0.842   -10.482 74.572  1.00 19.36  ? 419  LYS C O   1 
ATOM   9515  C  CB  . LYS C  1 312 ? -1.005  -8.618  72.872  1.00 19.37  ? 419  LYS C CB  1 
ATOM   9516  C  CG  . LYS C  1 312 ? -1.478  -7.686  71.744  1.00 21.72  ? 419  LYS C CG  1 
ATOM   9517  C  CD  . LYS C  1 312 ? -3.001  -7.601  71.590  1.00 23.37  ? 419  LYS C CD  1 
ATOM   9518  C  CE  . LYS C  1 312 ? -3.687  -6.862  72.732  1.00 23.69  ? 419  LYS C CE  1 
ATOM   9519  N  NZ  . LYS C  1 312 ? -5.161  -6.784  72.541  0.00 23.65  ? 419  LYS C NZ  1 
ATOM   9520  N  N   . VAL C  1 313 ? 1.665   -8.420  74.947  1.00 19.55  ? 420  VAL C N   1 
ATOM   9521  C  CA  . VAL C  1 313 ? 2.207   -8.738  76.267  1.00 18.17  ? 420  VAL C CA  1 
ATOM   9522  C  C   . VAL C  1 313 ? 1.811   -7.681  77.279  1.00 17.22  ? 420  VAL C C   1 
ATOM   9523  O  O   . VAL C  1 313 ? 1.634   -6.517  76.939  1.00 17.23  ? 420  VAL C O   1 
ATOM   9524  C  CB  . VAL C  1 313 ? 3.746   -8.783  76.283  1.00 18.12  ? 420  VAL C CB  1 
ATOM   9525  C  CG1 . VAL C  1 313 ? 4.212   -9.984  77.096  1.00 18.49  ? 420  VAL C CG1 1 
ATOM   9526  C  CG2 . VAL C  1 313 ? 4.285   -8.833  74.888  1.00 20.25  ? 420  VAL C CG2 1 
ATOM   9527  N  N   . SER C  1 314 ? 1.685   -8.095  78.532  1.00 16.22  ? 421  SER C N   1 
ATOM   9528  C  CA  . SER C  1 314 ? 1.326   -7.188  79.614  1.00 15.05  ? 421  SER C CA  1 
ATOM   9529  C  C   . SER C  1 314 ? 2.172   -7.506  80.831  1.00 14.79  ? 421  SER C C   1 
ATOM   9530  O  O   . SER C  1 314 ? 2.495   -8.666  81.091  1.00 15.92  ? 421  SER C O   1 
ATOM   9531  C  CB  . SER C  1 314 ? -0.146  -7.340  79.982  1.00 15.26  ? 421  SER C CB  1 
ATOM   9532  O  OG  . SER C  1 314 ? -0.385  -6.757  81.248  1.00 16.30  ? 421  SER C OG  1 
ATOM   9533  N  N   . HIS C  1 315 ? 2.536   -6.483  81.587  1.00 13.77  ? 422  HIS C N   1 
ATOM   9534  C  CA  . HIS C  1 315 ? 3.349   -6.717  82.765  1.00 13.06  ? 422  HIS C CA  1 
ATOM   9535  C  C   . HIS C  1 315 ? 2.524   -7.342  83.879  1.00 13.03  ? 422  HIS C C   1 
ATOM   9536  O  O   . HIS C  1 315 ? 3.063   -7.814  84.876  1.00 13.14  ? 422  HIS C O   1 
ATOM   9537  C  CB  . HIS C  1 315 ? 4.001   -5.415  83.242  1.00 13.69  ? 422  HIS C CB  1 
ATOM   9538  C  CG  . HIS C  1 315 ? 5.051   -4.890  82.312  1.00 13.38  ? 422  HIS C CG  1 
ATOM   9539  N  ND1 . HIS C  1 315 ? 4.749   -4.235  81.135  1.00 14.50  ? 422  HIS C ND1 1 
ATOM   9540  C  CD2 . HIS C  1 315 ? 6.403   -4.947  82.372  1.00 13.56  ? 422  HIS C CD2 1 
ATOM   9541  C  CE1 . HIS C  1 315 ? 5.870   -3.909  80.514  1.00 12.78  ? 422  HIS C CE1 1 
ATOM   9542  N  NE2 . HIS C  1 315 ? 6.888   -4.330  81.243  1.00 13.29  ? 422  HIS C NE2 1 
ATOM   9543  N  N   . SER C  1 316 ? 1.211   -7.361  83.704  1.00 13.03  ? 423  SER C N   1 
ATOM   9544  C  CA  . SER C  1 316 ? 0.337   -7.948  84.705  1.00 12.91  ? 423  SER C CA  1 
ATOM   9545  C  C   . SER C  1 316 ? -0.018  -9.389  84.359  1.00 13.92  ? 423  SER C C   1 
ATOM   9546  O  O   . SER C  1 316 ? -0.324  -10.192 85.242  1.00 15.96  ? 423  SER C O   1 
ATOM   9547  C  CB  . SER C  1 316 ? -0.960  -7.144  84.822  1.00 12.58  ? 423  SER C CB  1 
ATOM   9548  O  OG  . SER C  1 316 ? -0.733  -5.851  85.358  1.00 16.36  ? 423  SER C OG  1 
ATOM   9549  N  N   . TYR C  1 317 ? 0.037   -9.727  83.077  1.00 14.02  ? 424  TYR C N   1 
ATOM   9550  C  CA  . TYR C  1 317 ? -0.361  -11.057 82.641  1.00 13.39  ? 424  TYR C CA  1 
ATOM   9551  C  C   . TYR C  1 317 ? 0.631   -11.796 81.771  1.00 14.03  ? 424  TYR C C   1 
ATOM   9552  O  O   . TYR C  1 317 ? 0.328   -12.892 81.316  1.00 15.10  ? 424  TYR C O   1 
ATOM   9553  C  CB  . TYR C  1 317 ? -1.663  -10.973 81.846  1.00 12.72  ? 424  TYR C CB  1 
ATOM   9554  C  CG  . TYR C  1 317 ? -2.805  -10.248 82.521  1.00 11.86  ? 424  TYR C CG  1 
ATOM   9555  C  CD1 . TYR C  1 317 ? -3.361  -9.097  81.953  1.00 11.70  ? 424  TYR C CD1 1 
ATOM   9556  C  CD2 . TYR C  1 317 ? -3.381  -10.751 83.681  1.00 10.06  ? 424  TYR C CD2 1 
ATOM   9557  C  CE1 . TYR C  1 317 ? -4.464  -8.478  82.526  1.00 11.36  ? 424  TYR C CE1 1 
ATOM   9558  C  CE2 . TYR C  1 317 ? -4.481  -10.147 84.256  1.00 9.69   ? 424  TYR C CE2 1 
ATOM   9559  C  CZ  . TYR C  1 317 ? -5.024  -9.015  83.682  1.00 11.54  ? 424  TYR C CZ  1 
ATOM   9560  O  OH  . TYR C  1 317 ? -6.134  -8.436  84.260  1.00 12.20  ? 424  TYR C OH  1 
ATOM   9561  N  N   . GLY C  1 318 ? 1.802   -11.223 81.529  1.00 14.76  ? 425  GLY C N   1 
ATOM   9562  C  CA  . GLY C  1 318 ? 2.744   -11.899 80.659  1.00 14.59  ? 425  GLY C CA  1 
ATOM   9563  C  C   . GLY C  1 318 ? 2.073   -11.979 79.293  1.00 15.77  ? 425  GLY C C   1 
ATOM   9564  O  O   . GLY C  1 318 ? 1.537   -10.973 78.805  1.00 14.58  ? 425  GLY C O   1 
ATOM   9565  N  N   . TYR C  1 319 ? 2.066   -13.164 78.683  1.00 15.34  ? 426  TYR C N   1 
ATOM   9566  C  CA  . TYR C  1 319 ? 1.450   -13.319 77.368  1.00 14.63  ? 426  TYR C CA  1 
ATOM   9567  C  C   . TYR C  1 319 ? -0.049  -13.594 77.390  1.00 15.76  ? 426  TYR C C   1 
ATOM   9568  O  O   . TYR C  1 319 ? -0.678  -13.745 76.338  1.00 15.97  ? 426  TYR C O   1 
ATOM   9569  C  CB  . TYR C  1 319 ? 2.174   -14.397 76.566  1.00 13.18  ? 426  TYR C CB  1 
ATOM   9570  C  CG  . TYR C  1 319 ? 3.506   -13.918 76.046  1.00 11.93  ? 426  TYR C CG  1 
ATOM   9571  C  CD1 . TYR C  1 319 ? 4.664   -14.062 76.803  1.00 12.88  ? 426  TYR C CD1 1 
ATOM   9572  C  CD2 . TYR C  1 319 ? 3.600   -13.270 74.824  1.00 10.64  ? 426  TYR C CD2 1 
ATOM   9573  C  CE1 . TYR C  1 319 ? 5.888   -13.572 76.355  1.00 11.25  ? 426  TYR C CE1 1 
ATOM   9574  C  CE2 . TYR C  1 319 ? 4.811   -12.770 74.365  1.00 11.33  ? 426  TYR C CE2 1 
ATOM   9575  C  CZ  . TYR C  1 319 ? 5.954   -12.925 75.135  1.00 11.87  ? 426  TYR C CZ  1 
ATOM   9576  O  OH  . TYR C  1 319 ? 7.164   -12.432 74.691  1.00 12.58  ? 426  TYR C OH  1 
ATOM   9577  N  N   . GLY C  1 320 ? -0.626  -13.646 78.586  1.00 15.80  ? 427  GLY C N   1 
ATOM   9578  C  CA  . GLY C  1 320 ? -2.053  -13.871 78.694  1.00 14.70  ? 427  GLY C CA  1 
ATOM   9579  C  C   . GLY C  1 320 ? -2.460  -15.094 79.483  1.00 15.80  ? 427  GLY C C   1 
ATOM   9580  O  O   . GLY C  1 320 ? -1.647  -15.724 80.164  1.00 15.84  ? 427  GLY C O   1 
ATOM   9581  N  N   . LEU C  1 321 ? -3.740  -15.427 79.374  1.00 16.55  ? 428  LEU C N   1 
ATOM   9582  C  CA  . LEU C  1 321 ? -4.326  -16.570 80.060  1.00 16.91  ? 428  LEU C CA  1 
ATOM   9583  C  C   . LEU C  1 321 ? -3.899  -17.887 79.428  1.00 17.51  ? 428  LEU C C   1 
ATOM   9584  O  O   . LEU C  1 321 ? -3.856  -18.014 78.203  1.00 19.25  ? 428  LEU C O   1 
ATOM   9585  C  CB  . LEU C  1 321 ? -5.851  -16.469 80.002  1.00 16.84  ? 428  LEU C CB  1 
ATOM   9586  C  CG  . LEU C  1 321 ? -6.615  -17.382 80.954  1.00 17.93  ? 428  LEU C CG  1 
ATOM   9587  C  CD1 . LEU C  1 321 ? -6.408  -16.885 82.394  1.00 18.37  ? 428  LEU C CD1 1 
ATOM   9588  C  CD2 . LEU C  1 321 ? -8.097  -17.378 80.593  1.00 17.93  ? 428  LEU C CD2 1 
ATOM   9589  N  N   . LEU C  1 322 ? -3.581  -18.869 80.264  1.00 17.59  ? 429  LEU C N   1 
ATOM   9590  C  CA  . LEU C  1 322 ? -3.190  -20.177 79.762  1.00 17.28  ? 429  LEU C CA  1 
ATOM   9591  C  C   . LEU C  1 322 ? -4.380  -20.821 79.074  1.00 17.69  ? 429  LEU C C   1 
ATOM   9592  O  O   . LEU C  1 322 ? -5.526  -20.650 79.500  1.00 17.09  ? 429  LEU C O   1 
ATOM   9593  C  CB  . LEU C  1 322 ? -2.723  -21.083 80.899  1.00 16.07  ? 429  LEU C CB  1 
ATOM   9594  C  CG  . LEU C  1 322 ? -1.321  -20.811 81.439  1.00 17.98  ? 429  LEU C CG  1 
ATOM   9595  C  CD1 . LEU C  1 322 ? -0.963  -21.862 82.474  1.00 16.20  ? 429  LEU C CD1 1 
ATOM   9596  C  CD2 . LEU C  1 322 ? -0.312  -20.839 80.293  1.00 16.95  ? 429  LEU C CD2 1 
ATOM   9597  N  N   . ASP C  1 323 ? -4.102  -21.568 78.011  1.00 18.13  ? 430  ASP C N   1 
ATOM   9598  C  CA  . ASP C  1 323 ? -5.146  -22.253 77.254  1.00 18.14  ? 430  ASP C CA  1 
ATOM   9599  C  C   . ASP C  1 323 ? -4.792  -23.732 77.171  1.00 16.98  ? 430  ASP C C   1 
ATOM   9600  O  O   . ASP C  1 323 ? -3.991  -24.139 76.332  1.00 16.46  ? 430  ASP C O   1 
ATOM   9601  C  CB  . ASP C  1 323 ? -5.253  -21.638 75.855  1.00 19.95  ? 430  ASP C CB  1 
ATOM   9602  C  CG  . ASP C  1 323 ? -6.421  -22.182 75.059  1.00 23.12  ? 430  ASP C CG  1 
ATOM   9603  O  OD1 . ASP C  1 323 ? -6.858  -21.476 74.126  1.00 26.51  ? 430  ASP C OD1 1 
ATOM   9604  O  OD2 . ASP C  1 323 ? -6.896  -23.305 75.346  1.00 23.05  ? 430  ASP C OD2 1 
ATOM   9605  N  N   . ALA C  1 324 ? -5.381  -24.524 78.063  1.00 16.30  ? 431  ALA C N   1 
ATOM   9606  C  CA  . ALA C  1 324 ? -5.122  -25.959 78.117  1.00 17.57  ? 431  ALA C CA  1 
ATOM   9607  C  C   . ALA C  1 324 ? -5.284  -26.627 76.751  1.00 18.38  ? 431  ALA C C   1 
ATOM   9608  O  O   . ALA C  1 324 ? -4.403  -27.367 76.286  1.00 16.85  ? 431  ALA C O   1 
ATOM   9609  C  CB  . ALA C  1 324 ? -6.047  -26.614 79.129  1.00 16.80  ? 431  ALA C CB  1 
ATOM   9610  N  N   . GLY C  1 325 ? -6.416  -26.359 76.109  1.00 19.13  ? 432  GLY C N   1 
ATOM   9611  C  CA  . GLY C  1 325 ? -6.661  -26.927 74.799  1.00 20.03  ? 432  GLY C CA  1 
ATOM   9612  C  C   . GLY C  1 325 ? -5.552  -26.622 73.803  1.00 19.70  ? 432  GLY C C   1 
ATOM   9613  O  O   . GLY C  1 325 ? -4.999  -27.529 73.178  1.00 20.11  ? 432  GLY C O   1 
ATOM   9614  N  N   . ALA C  1 326 ? -5.226  -25.342 73.655  1.00 19.52  ? 433  ALA C N   1 
ATOM   9615  C  CA  . ALA C  1 326 ? -4.190  -24.923 72.720  1.00 19.29  ? 433  ALA C CA  1 
ATOM   9616  C  C   . ALA C  1 326 ? -2.838  -25.505 73.095  1.00 19.80  ? 433  ALA C C   1 
ATOM   9617  O  O   . ALA C  1 326 ? -2.089  -25.948 72.227  1.00 20.59  ? 433  ALA C O   1 
ATOM   9618  C  CB  . ALA C  1 326 ? -4.123  -23.410 72.670  1.00 18.58  ? 433  ALA C CB  1 
ATOM   9619  N  N   . MET C  1 327 ? -2.528  -25.505 74.390  1.00 20.55  ? 434  MET C N   1 
ATOM   9620  C  CA  . MET C  1 327 ? -1.267  -26.053 74.888  1.00 20.22  ? 434  MET C CA  1 
ATOM   9621  C  C   . MET C  1 327 ? -1.121  -27.488 74.423  1.00 20.91  ? 434  MET C C   1 
ATOM   9622  O  O   . MET C  1 327 ? -0.145  -27.859 73.776  1.00 21.56  ? 434  MET C O   1 
ATOM   9623  C  CB  . MET C  1 327 ? -1.248  -26.025 76.414  1.00 19.39  ? 434  MET C CB  1 
ATOM   9624  C  CG  . MET C  1 327 ? -0.908  -24.672 77.010  1.00 17.86  ? 434  MET C CG  1 
ATOM   9625  S  SD  . MET C  1 327 ? 0.832   -24.277 76.811  1.00 18.28  ? 434  MET C SD  1 
ATOM   9626  C  CE  . MET C  1 327 ? 1.558   -25.192 78.172  1.00 12.48  ? 434  MET C CE  1 
ATOM   9627  N  N   . VAL C  1 328 ? -2.113  -28.298 74.761  1.00 22.50  ? 435  VAL C N   1 
ATOM   9628  C  CA  . VAL C  1 328 ? -2.113  -29.704 74.387  1.00 23.61  ? 435  VAL C CA  1 
ATOM   9629  C  C   . VAL C  1 328 ? -2.059  -29.904 72.873  1.00 23.88  ? 435  VAL C C   1 
ATOM   9630  O  O   . VAL C  1 328 ? -1.366  -30.793 72.375  1.00 23.68  ? 435  VAL C O   1 
ATOM   9631  C  CB  . VAL C  1 328 ? -3.351  -30.394 74.959  1.00 23.53  ? 435  VAL C CB  1 
ATOM   9632  C  CG1 . VAL C  1 328 ? -3.796  -31.515 74.050  1.00 25.41  ? 435  VAL C CG1 1 
ATOM   9633  C  CG2 . VAL C  1 328 ? -3.025  -30.924 76.344  1.00 24.03  ? 435  VAL C CG2 1 
ATOM   9634  N  N   . ALA C  1 329 ? -2.789  -29.071 72.142  1.00 24.12  ? 436  ALA C N   1 
ATOM   9635  C  CA  . ALA C  1 329 ? -2.812  -29.169 70.689  1.00 24.14  ? 436  ALA C CA  1 
ATOM   9636  C  C   . ALA C  1 329 ? -1.442  -28.898 70.072  1.00 24.43  ? 436  ALA C C   1 
ATOM   9637  O  O   . ALA C  1 329 ? -0.954  -29.673 69.243  1.00 25.07  ? 436  ALA C O   1 
ATOM   9638  C  CB  . ALA C  1 329 ? -3.835  -28.200 70.125  1.00 22.45  ? 436  ALA C CB  1 
ATOM   9639  N  N   . LEU C  1 330 ? -0.818  -27.795 70.476  1.00 24.02  ? 437  LEU C N   1 
ATOM   9640  C  CA  . LEU C  1 330 ? 0.482   -27.432 69.936  1.00 22.89  ? 437  LEU C CA  1 
ATOM   9641  C  C   . LEU C  1 330 ? 1.596   -28.370 70.397  1.00 24.12  ? 437  LEU C C   1 
ATOM   9642  O  O   . LEU C  1 330 ? 2.591   -28.565 69.690  1.00 24.57  ? 437  LEU C O   1 
ATOM   9643  C  CB  . LEU C  1 330 ? 0.814   -25.996 70.319  1.00 22.03  ? 437  LEU C CB  1 
ATOM   9644  C  CG  . LEU C  1 330 ? 2.176   -25.474 69.873  1.00 21.87  ? 437  LEU C CG  1 
ATOM   9645  C  CD1 . LEU C  1 330 ? 2.341   -25.703 68.386  1.00 21.51  ? 437  LEU C CD1 1 
ATOM   9646  C  CD2 . LEU C  1 330 ? 2.293   -23.997 70.212  1.00 20.18  ? 437  LEU C CD2 1 
ATOM   9647  N  N   . ALA C  1 331 ? 1.428   -28.961 71.577  1.00 24.17  ? 438  ALA C N   1 
ATOM   9648  C  CA  . ALA C  1 331 ? 2.441   -29.860 72.110  1.00 25.21  ? 438  ALA C CA  1 
ATOM   9649  C  C   . ALA C  1 331 ? 2.603   -31.097 71.230  1.00 26.75  ? 438  ALA C C   1 
ATOM   9650  O  O   . ALA C  1 331 ? 3.717   -31.596 71.035  1.00 26.32  ? 438  ALA C O   1 
ATOM   9651  C  CB  . ALA C  1 331 ? 2.082   -30.262 73.531  1.00 24.01  ? 438  ALA C CB  1 
ATOM   9652  N  N   . GLN C  1 332 ? 1.493   -31.572 70.676  1.00 28.36  ? 439  GLN C N   1 
ATOM   9653  C  CA  . GLN C  1 332 ? 1.527   -32.752 69.827  1.00 30.00  ? 439  GLN C CA  1 
ATOM   9654  C  C   . GLN C  1 332 ? 2.330   -32.489 68.554  1.00 31.89  ? 439  GLN C C   1 
ATOM   9655  O  O   . GLN C  1 332 ? 3.203   -33.283 68.196  1.00 34.14  ? 439  GLN C O   1 
ATOM   9656  C  CB  . GLN C  1 332 ? 0.103   -33.191 69.506  1.00 29.12  ? 439  GLN C CB  1 
ATOM   9657  C  CG  . GLN C  1 332 ? -0.776  -33.173 70.734  1.00 30.03  ? 439  GLN C CG  1 
ATOM   9658  C  CD  . GLN C  1 332 ? -2.028  -33.986 70.582  1.00 30.37  ? 439  GLN C CD  1 
ATOM   9659  O  OE1 . GLN C  1 332 ? -1.964  -35.205 70.444  1.00 33.26  ? 439  GLN C OE1 1 
ATOM   9660  N  NE2 . GLN C  1 332 ? -3.183  -33.323 70.612  1.00 29.98  ? 439  GLN C NE2 1 
ATOM   9661  N  N   . ASN C  1 333 ? 2.063   -31.381 67.868  1.00 31.99  ? 440  ASN C N   1 
ATOM   9662  C  CA  . ASN C  1 333 ? 2.834   -31.081 66.664  1.00 32.52  ? 440  ASN C CA  1 
ATOM   9663  C  C   . ASN C  1 333 ? 3.960   -30.105 67.017  1.00 30.71  ? 440  ASN C C   1 
ATOM   9664  O  O   . ASN C  1 333 ? 3.977   -28.964 66.543  1.00 30.91  ? 440  ASN C O   1 
ATOM   9665  C  CB  . ASN C  1 333 ? 1.945   -30.456 65.582  1.00 35.55  ? 440  ASN C CB  1 
ATOM   9666  C  CG  . ASN C  1 333 ? 2.619   -30.438 64.201  1.00 37.95  ? 440  ASN C CG  1 
ATOM   9667  O  OD1 . ASN C  1 333 ? 2.235   -29.659 63.309  1.00 38.86  ? 440  ASN C OD1 1 
ATOM   9668  N  ND2 . ASN C  1 333 ? 3.619   -31.310 64.017  1.00 37.43  ? 440  ASN C ND2 1 
ATOM   9669  N  N   . TRP C  1 334 ? 4.903   -30.553 67.839  1.00 27.84  ? 441  TRP C N   1 
ATOM   9670  C  CA  . TRP C  1 334 ? 6.005   -29.687 68.250  1.00 24.59  ? 441  TRP C CA  1 
ATOM   9671  C  C   . TRP C  1 334 ? 7.393   -30.288 68.104  1.00 23.70  ? 441  TRP C C   1 
ATOM   9672  O  O   . TRP C  1 334 ? 7.661   -31.397 68.563  1.00 25.00  ? 441  TRP C O   1 
ATOM   9673  C  CB  . TRP C  1 334 ? 5.816   -29.249 69.700  1.00 22.74  ? 441  TRP C CB  1 
ATOM   9674  C  CG  . TRP C  1 334 ? 6.879   -28.306 70.167  1.00 19.56  ? 441  TRP C CG  1 
ATOM   9675  C  CD1 . TRP C  1 334 ? 8.043   -28.624 70.809  1.00 17.23  ? 441  TRP C CD1 1 
ATOM   9676  C  CD2 . TRP C  1 334 ? 6.895   -26.890 69.977  1.00 16.38  ? 441  TRP C CD2 1 
ATOM   9677  N  NE1 . TRP C  1 334 ? 8.781   -27.490 71.027  1.00 16.50  ? 441  TRP C NE1 1 
ATOM   9678  C  CE2 . TRP C  1 334 ? 8.100   -26.410 70.526  1.00 15.05  ? 441  TRP C CE2 1 
ATOM   9679  C  CE3 . TRP C  1 334 ? 6.007   -25.980 69.393  1.00 15.89  ? 441  TRP C CE3 1 
ATOM   9680  C  CZ2 . TRP C  1 334 ? 8.443   -25.052 70.509  1.00 16.20  ? 441  TRP C CZ2 1 
ATOM   9681  C  CZ3 . TRP C  1 334 ? 6.348   -24.628 69.372  1.00 16.38  ? 441  TRP C CZ3 1 
ATOM   9682  C  CH2 . TRP C  1 334 ? 7.554   -24.177 69.927  1.00 16.08  ? 441  TRP C CH2 1 
ATOM   9683  N  N   . THR C  1 335 ? 8.277   -29.524 67.485  1.00 22.37  ? 442  THR C N   1 
ATOM   9684  C  CA  . THR C  1 335 ? 9.647   -29.941 67.268  1.00 22.26  ? 442  THR C CA  1 
ATOM   9685  C  C   . THR C  1 335 ? 10.506  -29.285 68.334  1.00 21.80  ? 442  THR C C   1 
ATOM   9686  O  O   . THR C  1 335 ? 10.538  -28.066 68.449  1.00 21.07  ? 442  THR C O   1 
ATOM   9687  C  CB  . THR C  1 335 ? 10.147  -29.488 65.883  1.00 23.56  ? 442  THR C CB  1 
ATOM   9688  O  OG1 . THR C  1 335 ? 9.285   -30.021 64.868  1.00 24.10  ? 442  THR C OG1 1 
ATOM   9689  C  CG2 . THR C  1 335 ? 11.579  -29.971 65.646  1.00 22.54  ? 442  THR C CG2 1 
ATOM   9690  N  N   . THR C  1 336 ? 11.210  -30.097 69.107  1.00 21.46  ? 443  THR C N   1 
ATOM   9691  C  CA  . THR C  1 336 ? 12.045  -29.576 70.173  1.00 21.28  ? 443  THR C CA  1 
ATOM   9692  C  C   . THR C  1 336 ? 12.961  -28.469 69.641  1.00 19.92  ? 443  THR C C   1 
ATOM   9693  O  O   . THR C  1 336 ? 13.575  -28.625 68.583  1.00 20.77  ? 443  THR C O   1 
ATOM   9694  C  CB  . THR C  1 336 ? 12.856  -30.716 70.807  1.00 20.38  ? 443  THR C CB  1 
ATOM   9695  O  OG1 . THR C  1 336 ? 13.291  -30.321 72.111  1.00 25.04  ? 443  THR C OG1 1 
ATOM   9696  C  CG2 . THR C  1 336 ? 14.053  -31.048 69.958  1.00 21.52  ? 443  THR C CG2 1 
ATOM   9697  N  N   . VAL C  1 337 ? 13.046  -27.358 70.378  1.00 18.66  ? 444  VAL C N   1 
ATOM   9698  C  CA  . VAL C  1 337 ? 13.854  -26.201 69.974  1.00 16.84  ? 444  VAL C CA  1 
ATOM   9699  C  C   . VAL C  1 337 ? 15.355  -26.437 69.871  1.00 17.72  ? 444  VAL C C   1 
ATOM   9700  O  O   . VAL C  1 337 ? 15.903  -27.344 70.495  1.00 18.85  ? 444  VAL C O   1 
ATOM   9701  C  CB  . VAL C  1 337 ? 13.617  -25.003 70.912  1.00 15.75  ? 444  VAL C CB  1 
ATOM   9702  C  CG1 . VAL C  1 337 ? 12.160  -24.580 70.848  1.00 14.25  ? 444  VAL C CG1 1 
ATOM   9703  C  CG2 . VAL C  1 337 ? 14.011  -25.368 72.336  1.00 15.14  ? 444  VAL C CG2 1 
ATOM   9704  N  N   . ALA C  1 338 ? 16.020  -25.611 69.070  1.00 17.99  ? 445  ALA C N   1 
ATOM   9705  C  CA  . ALA C  1 338 ? 17.465  -25.728 68.870  1.00 18.56  ? 445  ALA C CA  1 
ATOM   9706  C  C   . ALA C  1 338 ? 18.214  -25.462 70.171  1.00 18.57  ? 445  ALA C C   1 
ATOM   9707  O  O   . ALA C  1 338 ? 17.658  -24.879 71.102  1.00 18.14  ? 445  ALA C O   1 
ATOM   9708  C  CB  . ALA C  1 338 ? 17.915  -24.754 67.805  1.00 18.23  ? 445  ALA C CB  1 
ATOM   9709  N  N   . PRO C  1 339 ? 19.488  -25.879 70.252  1.00 19.12  ? 446  PRO C N   1 
ATOM   9710  C  CA  . PRO C  1 339 ? 20.239  -25.642 71.492  1.00 18.92  ? 446  PRO C CA  1 
ATOM   9711  C  C   . PRO C  1 339 ? 20.279  -24.179 71.913  1.00 19.16  ? 446  PRO C C   1 
ATOM   9712  O  O   . PRO C  1 339 ? 20.345  -23.275 71.077  1.00 20.35  ? 446  PRO C O   1 
ATOM   9713  C  CB  . PRO C  1 339 ? 21.620  -26.242 71.202  1.00 18.43  ? 446  PRO C CB  1 
ATOM   9714  C  CG  . PRO C  1 339 ? 21.682  -26.338 69.699  1.00 19.52  ? 446  PRO C CG  1 
ATOM   9715  C  CD  . PRO C  1 339 ? 20.277  -26.669 69.293  1.00 19.01  ? 446  PRO C CD  1 
ATOM   9716  N  N   . GLN C  1 340 ? 20.218  -23.962 73.223  1.00 18.26  ? 447  GLN C N   1 
ATOM   9717  C  CA  . GLN C  1 340 ? 20.210  -22.626 73.795  1.00 16.81  ? 447  GLN C CA  1 
ATOM   9718  C  C   . GLN C  1 340 ? 21.553  -21.935 73.718  1.00 16.69  ? 447  GLN C C   1 
ATOM   9719  O  O   . GLN C  1 340 ? 22.566  -22.480 74.141  1.00 18.20  ? 447  GLN C O   1 
ATOM   9720  C  CB  . GLN C  1 340 ? 19.776  -22.697 75.258  1.00 16.16  ? 447  GLN C CB  1 
ATOM   9721  C  CG  . GLN C  1 340 ? 19.752  -21.364 75.986  1.00 17.11  ? 447  GLN C CG  1 
ATOM   9722  C  CD  . GLN C  1 340 ? 19.823  -21.538 77.498  1.00 19.60  ? 447  GLN C CD  1 
ATOM   9723  O  OE1 . GLN C  1 340 ? 20.799  -22.090 78.022  1.00 21.75  ? 447  GLN C OE1 1 
ATOM   9724  N  NE2 . GLN C  1 340 ? 18.789  -21.077 78.207  1.00 16.51  ? 447  GLN C NE2 1 
ATOM   9725  N  N   . ARG C  1 341 ? 21.555  -20.727 73.180  1.00 16.89  ? 448  ARG C N   1 
ATOM   9726  C  CA  . ARG C  1 341 ? 22.775  -19.947 73.086  1.00 18.33  ? 448  ARG C CA  1 
ATOM   9727  C  C   . ARG C  1 341 ? 22.690  -18.889 74.196  1.00 17.30  ? 448  ARG C C   1 
ATOM   9728  O  O   . ARG C  1 341 ? 21.600  -18.507 74.620  1.00 16.17  ? 448  ARG C O   1 
ATOM   9729  C  CB  . ARG C  1 341 ? 22.878  -19.269 71.714  1.00 20.27  ? 448  ARG C CB  1 
ATOM   9730  C  CG  . ARG C  1 341 ? 22.581  -20.173 70.521  1.00 24.47  ? 448  ARG C CG  1 
ATOM   9731  C  CD  . ARG C  1 341 ? 23.654  -21.228 70.288  1.00 29.88  ? 448  ARG C CD  1 
ATOM   9732  N  NE  . ARG C  1 341 ? 23.284  -22.157 69.212  1.00 34.85  ? 448  ARG C NE  1 
ATOM   9733  C  CZ  . ARG C  1 341 ? 24.007  -23.219 68.833  1.00 36.31  ? 448  ARG C CZ  1 
ATOM   9734  N  NH1 . ARG C  1 341 ? 23.576  -24.006 67.846  1.00 36.31  ? 448  ARG C NH1 1 
ATOM   9735  N  NH2 . ARG C  1 341 ? 25.161  -23.501 69.434  1.00 35.51  ? 448  ARG C NH2 1 
ATOM   9736  N  N   . LYS C  1 342 ? 23.843  -18.424 74.664  1.00 17.51  ? 449  LYS C N   1 
ATOM   9737  C  CA  . LYS C  1 342 ? 23.907  -17.428 75.729  1.00 15.62  ? 449  LYS C CA  1 
ATOM   9738  C  C   . LYS C  1 342 ? 24.894  -16.364 75.313  1.00 15.43  ? 449  LYS C C   1 
ATOM   9739  O  O   . LYS C  1 342 ? 26.090  -16.611 75.257  1.00 16.70  ? 449  LYS C O   1 
ATOM   9740  C  CB  . LYS C  1 342 ? 24.373  -18.079 77.029  1.00 15.35  ? 449  LYS C CB  1 
ATOM   9741  C  CG  . LYS C  1 342 ? 24.406  -17.149 78.225  1.00 16.16  ? 449  LYS C CG  1 
ATOM   9742  C  CD  . LYS C  1 342 ? 24.921  -17.893 79.441  1.00 16.27  ? 449  LYS C CD  1 
ATOM   9743  C  CE  . LYS C  1 342 ? 24.887  -17.033 80.678  1.00 16.42  ? 449  LYS C CE  1 
ATOM   9744  N  NZ  . LYS C  1 342 ? 25.228  -17.826 81.888  1.00 15.26  ? 449  LYS C NZ  1 
ATOM   9745  N  N   . CYS C  1 343 ? 24.402  -15.177 75.012  1.00 14.72  ? 450  CYS C N   1 
ATOM   9746  C  CA  . CYS C  1 343 ? 25.291  -14.117 74.590  1.00 16.26  ? 450  CYS C CA  1 
ATOM   9747  C  C   . CYS C  1 343 ? 25.407  -13.064 75.683  1.00 16.02  ? 450  CYS C C   1 
ATOM   9748  O  O   . CYS C  1 343 ? 24.420  -12.433 76.059  1.00 16.18  ? 450  CYS C O   1 
ATOM   9749  C  CB  . CYS C  1 343 ? 24.781  -13.498 73.285  1.00 17.70  ? 450  CYS C CB  1 
ATOM   9750  S  SG  . CYS C  1 343 ? 25.865  -12.193 72.635  1.00 21.79  ? 450  CYS C SG  1 
ATOM   9751  N  N   . ILE C  1 344 ? 26.623  -12.899 76.196  1.00 15.75  ? 451  ILE C N   1 
ATOM   9752  C  CA  . ILE C  1 344 ? 26.918  -11.939 77.252  1.00 14.60  ? 451  ILE C CA  1 
ATOM   9753  C  C   . ILE C  1 344 ? 27.539  -10.703 76.641  1.00 14.58  ? 451  ILE C C   1 
ATOM   9754  O  O   . ILE C  1 344 ? 28.540  -10.804 75.950  1.00 15.76  ? 451  ILE C O   1 
ATOM   9755  C  CB  . ILE C  1 344 ? 27.945  -12.510 78.247  1.00 14.94  ? 451  ILE C CB  1 
ATOM   9756  C  CG1 . ILE C  1 344 ? 27.396  -13.777 78.896  1.00 14.25  ? 451  ILE C CG1 1 
ATOM   9757  C  CG2 . ILE C  1 344 ? 28.299  -11.473 79.294  1.00 14.91  ? 451  ILE C CG2 1 
ATOM   9758  C  CD1 . ILE C  1 344 ? 28.411  -14.507 79.749  1.00 13.51  ? 451  ILE C CD1 1 
ATOM   9759  N  N   . VAL C  1 345 ? 26.955  -9.539  76.891  1.00 14.58  ? 452  VAL C N   1 
ATOM   9760  C  CA  . VAL C  1 345 ? 27.513  -8.307  76.360  1.00 15.19  ? 452  VAL C CA  1 
ATOM   9761  C  C   . VAL C  1 345 ? 27.589  -7.196  77.415  1.00 18.26  ? 452  VAL C C   1 
ATOM   9762  O  O   . VAL C  1 345 ? 26.582  -6.801  78.006  1.00 18.35  ? 452  VAL C O   1 
ATOM   9763  C  CB  . VAL C  1 345 ? 26.726  -7.831  75.101  1.00 14.82  ? 452  VAL C CB  1 
ATOM   9764  C  CG1 . VAL C  1 345 ? 25.296  -8.261  75.190  1.00 16.29  ? 452  VAL C CG1 1 
ATOM   9765  C  CG2 . VAL C  1 345 ? 26.812  -6.322  74.949  1.00 13.03  ? 452  VAL C CG2 1 
ATOM   9766  N  N   . GLU C  1 346 ? 28.809  -6.719  77.655  1.00 19.99  ? 453  GLU C N   1 
ATOM   9767  C  CA  . GLU C  1 346 ? 29.074  -5.657  78.617  1.00 21.28  ? 453  GLU C CA  1 
ATOM   9768  C  C   . GLU C  1 346 ? 28.712  -4.337  77.955  1.00 22.15  ? 453  GLU C C   1 
ATOM   9769  O  O   . GLU C  1 346 ? 29.359  -3.932  76.995  1.00 22.63  ? 453  GLU C O   1 
ATOM   9770  C  CB  . GLU C  1 346 ? 30.559  -5.671  78.995  1.00 22.71  ? 453  GLU C CB  1 
ATOM   9771  C  CG  . GLU C  1 346 ? 31.033  -7.021  79.521  1.00 25.89  ? 453  GLU C CG  1 
ATOM   9772  C  CD  . GLU C  1 346 ? 32.546  -7.110  79.683  1.00 29.21  ? 453  GLU C CD  1 
ATOM   9773  O  OE1 . GLU C  1 346 ? 33.089  -6.636  80.716  1.00 28.81  ? 453  GLU C OE1 1 
ATOM   9774  O  OE2 . GLU C  1 346 ? 33.193  -7.657  78.759  1.00 31.40  ? 453  GLU C OE2 1 
ATOM   9775  N  N   . ILE C  1 347 ? 27.679  -3.672  78.466  1.00 23.17  ? 454  ILE C N   1 
ATOM   9776  C  CA  . ILE C  1 347 ? 27.226  -2.411  77.894  1.00 23.67  ? 454  ILE C CA  1 
ATOM   9777  C  C   . ILE C  1 347 ? 28.043  -1.227  78.374  1.00 26.59  ? 454  ILE C C   1 
ATOM   9778  O  O   . ILE C  1 347 ? 28.420  -0.360  77.581  1.00 26.92  ? 454  ILE C O   1 
ATOM   9779  C  CB  . ILE C  1 347 ? 25.749  -2.155  78.228  1.00 22.26  ? 454  ILE C CB  1 
ATOM   9780  C  CG1 . ILE C  1 347 ? 24.897  -3.345  77.761  1.00 20.30  ? 454  ILE C CG1 1 
ATOM   9781  C  CG2 . ILE C  1 347 ? 25.286  -0.845  77.573  1.00 19.67  ? 454  ILE C CG2 1 
ATOM   9782  C  CD1 . ILE C  1 347 ? 24.943  -3.601  76.270  1.00 18.49  ? 454  ILE C CD1 1 
ATOM   9783  N  N   . LEU C  1 348 ? 28.286  -1.181  79.680  1.00 30.07  ? 455  LEU C N   1 
ATOM   9784  C  CA  . LEU C  1 348 ? 29.084  -0.121  80.274  1.00 32.71  ? 455  LEU C CA  1 
ATOM   9785  C  C   . LEU C  1 348 ? 29.787  -0.644  81.513  1.00 35.64  ? 455  LEU C C   1 
ATOM   9786  O  O   . LEU C  1 348 ? 29.179  -1.338  82.346  1.00 36.57  ? 455  LEU C O   1 
ATOM   9787  C  CB  . LEU C  1 348 ? 28.213  1.082   80.647  1.00 32.51  ? 455  LEU C CB  1 
ATOM   9788  C  CG  . LEU C  1 348 ? 27.302  1.132   81.877  1.00 32.11  ? 455  LEU C CG  1 
ATOM   9789  C  CD1 . LEU C  1 348 ? 28.085  1.246   83.179  1.00 31.08  ? 455  LEU C CD1 1 
ATOM   9790  C  CD2 . LEU C  1 348 ? 26.424  2.352   81.727  1.00 31.54  ? 455  LEU C CD2 1 
ATOM   9791  N  N   . VAL C  1 349 ? 31.077  -0.330  81.612  1.00 37.55  ? 456  VAL C N   1 
ATOM   9792  C  CA  . VAL C  1 349 ? 31.889  -0.729  82.757  1.00 38.20  ? 456  VAL C CA  1 
ATOM   9793  C  C   . VAL C  1 349 ? 32.350  0.551   83.476  1.00 38.37  ? 456  VAL C C   1 
ATOM   9794  O  O   . VAL C  1 349 ? 32.770  0.504   84.634  1.00 39.99  ? 456  VAL C O   1 
ATOM   9795  C  CB  . VAL C  1 349 ? 33.115  -1.562  82.311  1.00 37.81  ? 456  VAL C CB  1 
ATOM   9796  C  CG1 . VAL C  1 349 ? 33.901  -2.026  83.529  0.00 38.04  ? 456  VAL C CG1 1 
ATOM   9797  C  CG2 . VAL C  1 349 ? 32.661  -2.754  81.486  0.00 38.04  ? 456  VAL C CG2 1 
ATOM   9798  N  N   . GLU C  1 350 ? 32.260  1.688   82.779  1.00 37.74  ? 457  GLU C N   1 
ATOM   9799  C  CA  . GLU C  1 350 ? 32.633  2.998   83.331  1.00 36.11  ? 457  GLU C CA  1 
ATOM   9800  C  C   . GLU C  1 350 ? 31.358  3.647   83.906  1.00 34.12  ? 457  GLU C C   1 
ATOM   9801  O  O   . GLU C  1 350 ? 30.364  3.810   83.198  1.00 33.07  ? 457  GLU C O   1 
ATOM   9802  C  CB  . GLU C  1 350 ? 33.230  3.884   82.227  1.00 36.56  ? 457  GLU C CB  1 
ATOM   9803  C  CG  . GLU C  1 350 ? 33.968  5.129   82.729  1.00 36.46  ? 457  GLU C CG  1 
ATOM   9804  C  CD  . GLU C  1 350 ? 35.230  4.794   83.500  0.00 36.52  ? 457  GLU C CD  1 
ATOM   9805  O  OE1 . GLU C  1 350 ? 35.133  4.118   84.545  0.00 36.54  ? 457  GLU C OE1 1 
ATOM   9806  O  OE2 . GLU C  1 350 ? 36.322  5.207   83.056  0.00 36.54  ? 457  GLU C OE2 1 
ATOM   9807  N  N   . PRO C  1 351 ? 31.381  4.025   85.197  1.00 32.57  ? 458  PRO C N   1 
ATOM   9808  C  CA  . PRO C  1 351 ? 30.278  4.646   85.938  1.00 31.51  ? 458  PRO C CA  1 
ATOM   9809  C  C   . PRO C  1 351 ? 29.514  5.798   85.298  1.00 30.64  ? 458  PRO C C   1 
ATOM   9810  O  O   . PRO C  1 351 ? 30.054  6.555   84.491  1.00 31.61  ? 458  PRO C O   1 
ATOM   9811  C  CB  . PRO C  1 351 ? 30.944  5.063   87.242  1.00 30.72  ? 458  PRO C CB  1 
ATOM   9812  C  CG  . PRO C  1 351 ? 31.914  3.979   87.451  1.00 31.74  ? 458  PRO C CG  1 
ATOM   9813  C  CD  . PRO C  1 351 ? 32.542  3.853   86.083  1.00 32.51  ? 458  PRO C CD  1 
ATOM   9814  N  N   . LYS C  1 352 ? 28.243  5.921   85.669  1.00 29.15  ? 459  LYS C N   1 
ATOM   9815  C  CA  . LYS C  1 352 ? 27.405  6.999   85.169  1.00 28.77  ? 459  LYS C CA  1 
ATOM   9816  C  C   . LYS C  1 352 ? 26.467  7.506   86.260  1.00 28.04  ? 459  LYS C C   1 
ATOM   9817  O  O   . LYS C  1 352 ? 25.887  6.721   87.010  1.00 27.98  ? 459  LYS C O   1 
ATOM   9818  C  CB  . LYS C  1 352 ? 26.616  6.541   83.939  1.00 29.53  ? 459  LYS C CB  1 
ATOM   9819  C  CG  . LYS C  1 352 ? 27.503  6.269   82.727  1.00 30.43  ? 459  LYS C CG  1 
ATOM   9820  C  CD  . LYS C  1 352 ? 26.690  6.080   81.463  1.00 30.54  ? 459  LYS C CD  1 
ATOM   9821  C  CE  . LYS C  1 352 ? 27.590  5.819   80.266  0.00 30.52  ? 459  LYS C CE  1 
ATOM   9822  N  NZ  . LYS C  1 352 ? 28.420  4.596   80.451  0.00 30.48  ? 459  LYS C NZ  1 
ATOM   9823  N  N   . ASP C  1 353 ? 26.355  8.826   86.365  1.00 27.12  ? 460  ASP C N   1 
ATOM   9824  C  CA  . ASP C  1 353 ? 25.491  9.436   87.356  1.00 27.14  ? 460  ASP C CA  1 
ATOM   9825  C  C   . ASP C  1 353 ? 24.068  9.304   86.871  1.00 26.87  ? 460  ASP C C   1 
ATOM   9826  O  O   . ASP C  1 353 ? 23.717  9.722   85.768  1.00 27.61  ? 460  ASP C O   1 
ATOM   9827  C  CB  . ASP C  1 353 ? 25.819  10.920  87.537  1.00 30.07  ? 460  ASP C CB  1 
ATOM   9828  C  CG  . ASP C  1 353 ? 24.817  11.643  88.455  1.00 33.25  ? 460  ASP C CG  1 
ATOM   9829  O  OD1 . ASP C  1 353 ? 24.377  12.765  88.101  1.00 33.60  ? 460  ASP C OD1 1 
ATOM   9830  O  OD2 . ASP C  1 353 ? 24.474  11.097  89.532  1.00 35.48  ? 460  ASP C OD2 1 
ATOM   9831  N  N   . ILE C  1 354 ? 23.245  8.702   87.699  1.00 26.00  ? 461  ILE C N   1 
ATOM   9832  C  CA  . ILE C  1 354 ? 21.851  8.528   87.357  1.00 26.03  ? 461  ILE C CA  1 
ATOM   9833  C  C   . ILE C  1 354 ? 21.158  9.878   87.458  1.00 27.38  ? 461  ILE C C   1 
ATOM   9834  O  O   . ILE C  1 354 ? 20.452  10.305  86.536  1.00 28.65  ? 461  ILE C O   1 
ATOM   9835  C  CB  . ILE C  1 354 ? 21.181  7.542   88.322  1.00 24.12  ? 461  ILE C CB  1 
ATOM   9836  C  CG1 . ILE C  1 354 ? 21.790  6.163   88.125  1.00 23.34  ? 461  ILE C CG1 1 
ATOM   9837  C  CG2 . ILE C  1 354 ? 19.673  7.528   88.107  1.00 22.64  ? 461  ILE C CG2 1 
ATOM   9838  C  CD1 . ILE C  1 354 ? 21.318  5.146   89.124  1.00 25.33  ? 461  ILE C CD1 1 
ATOM   9839  N  N   . GLY C  1 355 ? 21.363  10.550  88.587  1.00 28.22  ? 462  GLY C N   1 
ATOM   9840  C  CA  . GLY C  1 355 ? 20.739  11.842  88.784  1.00 28.58  ? 462  GLY C CA  1 
ATOM   9841  C  C   . GLY C  1 355 ? 19.231  11.750  88.664  1.00 29.16  ? 462  GLY C C   1 
ATOM   9842  O  O   . GLY C  1 355 ? 18.596  10.910  89.314  1.00 30.67  ? 462  GLY C O   1 
ATOM   9843  N  N   . LYS C  1 356 ? 18.658  12.611  87.828  1.00 29.00  ? 463  LYS C N   1 
ATOM   9844  C  CA  . LYS C  1 356 ? 17.213  12.654  87.629  1.00 28.06  ? 463  LYS C CA  1 
ATOM   9845  C  C   . LYS C  1 356 ? 16.773  11.648  86.570  1.00 27.60  ? 463  LYS C C   1 
ATOM   9846  O  O   . LYS C  1 356 ? 15.708  11.034  86.665  1.00 27.07  ? 463  LYS C O   1 
ATOM   9847  C  CB  . LYS C  1 356 ? 16.792  14.068  87.213  1.00 28.57  ? 463  LYS C CB  1 
ATOM   9848  C  CG  . LYS C  1 356 ? 15.304  14.210  86.958  1.00 31.99  ? 463  LYS C CG  1 
ATOM   9849  C  CD  . LYS C  1 356 ? 14.497  13.886  88.219  1.00 33.76  ? 463  LYS C CD  1 
ATOM   9850  C  CE  . LYS C  1 356 ? 12.999  13.821  87.937  1.00 34.44  ? 463  LYS C CE  1 
ATOM   9851  N  NZ  . LYS C  1 356 ? 12.201  13.807  89.201  1.00 35.64  ? 463  LYS C NZ  1 
ATOM   9852  N  N   . ARG C  1 357 ? 17.606  11.483  85.555  1.00 27.47  ? 464  ARG C N   1 
ATOM   9853  C  CA  . ARG C  1 357 ? 17.304  10.559  84.476  1.00 26.45  ? 464  ARG C CA  1 
ATOM   9854  C  C   . ARG C  1 357 ? 18.595  10.160  83.784  1.00 25.41  ? 464  ARG C C   1 
ATOM   9855  O  O   . ARG C  1 357 ? 19.516  10.966  83.645  1.00 26.39  ? 464  ARG C O   1 
ATOM   9856  C  CB  . ARG C  1 357 ? 16.365  11.223  83.473  1.00 27.20  ? 464  ARG C CB  1 
ATOM   9857  C  CG  . ARG C  1 357 ? 15.865  10.307  82.367  1.00 29.00  ? 464  ARG C CG  1 
ATOM   9858  C  CD  . ARG C  1 357 ? 14.785  10.999  81.544  1.00 29.98  ? 464  ARG C CD  1 
ATOM   9859  N  NE  . ARG C  1 357 ? 14.135  10.091  80.602  0.00 29.76  ? 464  ARG C NE  1 
ATOM   9860  C  CZ  . ARG C  1 357 ? 14.743  9.522   79.567  0.00 29.84  ? 464  ARG C CZ  1 
ATOM   9861  N  NH1 . ARG C  1 357 ? 14.069  8.708   78.766  0.00 29.81  ? 464  ARG C NH1 1 
ATOM   9862  N  NH2 . ARG C  1 357 ? 16.024  9.768   79.329  0.00 29.81  ? 464  ARG C NH2 1 
ATOM   9863  N  N   . LEU C  1 358 ? 18.658  8.908   83.359  1.00 24.07  ? 465  LEU C N   1 
ATOM   9864  C  CA  . LEU C  1 358 ? 19.825  8.380   82.667  1.00 22.27  ? 465  LEU C CA  1 
ATOM   9865  C  C   . LEU C  1 358 ? 19.378  7.472   81.536  1.00 22.00  ? 465  LEU C C   1 
ATOM   9866  O  O   . LEU C  1 358 ? 18.472  6.662   81.703  1.00 21.18  ? 465  LEU C O   1 
ATOM   9867  C  CB  . LEU C  1 358 ? 20.693  7.589   83.638  1.00 21.38  ? 465  LEU C CB  1 
ATOM   9868  C  CG  . LEU C  1 358 ? 21.798  6.767   82.986  1.00 22.06  ? 465  LEU C CG  1 
ATOM   9869  C  CD1 . LEU C  1 358 ? 22.599  7.649   82.045  1.00 20.21  ? 465  LEU C CD1 1 
ATOM   9870  C  CD2 . LEU C  1 358 ? 22.684  6.146   84.074  1.00 21.53  ? 465  LEU C CD2 1 
ATOM   9871  N  N   . GLU C  1 359 ? 20.004  7.614   80.378  1.00 22.14  ? 466  GLU C N   1 
ATOM   9872  C  CA  . GLU C  1 359 ? 19.654  6.774   79.247  1.00 22.21  ? 466  GLU C CA  1 
ATOM   9873  C  C   . GLU C  1 359 ? 20.937  6.210   78.689  1.00 20.83  ? 466  GLU C C   1 
ATOM   9874  O  O   . GLU C  1 359 ? 21.869  6.956   78.431  1.00 21.84  ? 466  GLU C O   1 
ATOM   9875  C  CB  . GLU C  1 359 ? 18.940  7.596   78.179  1.00 25.08  ? 466  GLU C CB  1 
ATOM   9876  C  CG  . GLU C  1 359 ? 18.433  6.800   76.985  1.00 29.09  ? 466  GLU C CG  1 
ATOM   9877  C  CD  . GLU C  1 359 ? 18.132  7.685   75.776  1.00 31.76  ? 466  GLU C CD  1 
ATOM   9878  O  OE1 . GLU C  1 359 ? 19.074  8.035   75.027  1.00 34.37  ? 466  GLU C OE1 1 
ATOM   9879  O  OE2 . GLU C  1 359 ? 16.957  8.046   75.578  1.00 34.37  ? 466  GLU C OE2 1 
ATOM   9880  N  N   . VAL C  1 360 ? 20.999  4.892   78.543  1.00 19.91  ? 467  VAL C N   1 
ATOM   9881  C  CA  . VAL C  1 360 ? 22.176  4.241   77.980  1.00 20.02  ? 467  VAL C CA  1 
ATOM   9882  C  C   . VAL C  1 360 ? 21.773  3.517   76.697  1.00 19.95  ? 467  VAL C C   1 
ATOM   9883  O  O   . VAL C  1 360 ? 20.893  2.661   76.708  1.00 19.65  ? 467  VAL C O   1 
ATOM   9884  C  CB  . VAL C  1 360 ? 22.791  3.213   78.950  1.00 20.87  ? 467  VAL C CB  1 
ATOM   9885  C  CG1 . VAL C  1 360 ? 23.984  2.523   78.289  1.00 18.79  ? 467  VAL C CG1 1 
ATOM   9886  C  CG2 . VAL C  1 360 ? 23.213  3.905   80.239  1.00 21.40  ? 467  VAL C CG2 1 
ATOM   9887  N  N   . ARG C  1 361 ? 22.405  3.894   75.592  1.00 20.75  ? 468  ARG C N   1 
ATOM   9888  C  CA  . ARG C  1 361 ? 22.144  3.299   74.289  1.00 20.80  ? 468  ARG C CA  1 
ATOM   9889  C  C   . ARG C  1 361 ? 23.367  2.518   73.859  1.00 20.72  ? 468  ARG C C   1 
ATOM   9890  O  O   . ARG C  1 361 ? 24.488  2.965   74.062  1.00 21.24  ? 468  ARG C O   1 
ATOM   9891  C  CB  . ARG C  1 361 ? 21.888  4.385   73.263  1.00 21.30  ? 468  ARG C CB  1 
ATOM   9892  C  CG  . ARG C  1 361 ? 20.555  5.024   73.411  1.00 27.06  ? 468  ARG C CG  1 
ATOM   9893  C  CD  . ARG C  1 361 ? 20.382  6.237   72.517  1.00 28.72  ? 468  ARG C CD  1 
ATOM   9894  N  NE  . ARG C  1 361 ? 19.031  6.745   72.694  1.00 32.51  ? 468  ARG C NE  1 
ATOM   9895  C  CZ  . ARG C  1 361 ? 17.966  6.243   72.079  1.00 34.95  ? 468  ARG C CZ  1 
ATOM   9896  N  NH1 . ARG C  1 361 ? 16.757  6.750   72.315  1.00 35.96  ? 468  ARG C NH1 1 
ATOM   9897  N  NH2 . ARG C  1 361 ? 18.116  5.261   71.196  1.00 34.56  ? 468  ARG C NH2 1 
ATOM   9898  N  N   . LYS C  1 362 ? 23.165  1.351   73.268  1.00 20.94  ? 469  LYS C N   1 
ATOM   9899  C  CA  . LYS C  1 362 ? 24.297  0.562   72.807  1.00 21.03  ? 469  LYS C CA  1 
ATOM   9900  C  C   . LYS C  1 362 ? 23.898  -0.304  71.628  1.00 20.11  ? 469  LYS C C   1 
ATOM   9901  O  O   . LYS C  1 362 ? 22.848  -0.935  71.641  1.00 19.79  ? 469  LYS C O   1 
ATOM   9902  C  CB  . LYS C  1 362 ? 24.825  -0.319  73.940  1.00 22.63  ? 469  LYS C CB  1 
ATOM   9903  C  CG  . LYS C  1 362 ? 26.054  -1.141  73.588  1.00 22.98  ? 469  LYS C CG  1 
ATOM   9904  C  CD  . LYS C  1 362 ? 27.305  -0.296  73.538  1.00 24.79  ? 469  LYS C CD  1 
ATOM   9905  C  CE  . LYS C  1 362 ? 28.546  -1.179  73.381  1.00 26.78  ? 469  LYS C CE  1 
ATOM   9906  N  NZ  . LYS C  1 362 ? 28.698  -2.133  74.514  0.00 25.99  ? 469  LYS C NZ  1 
ATOM   9907  N  N   . ALA C  1 363 ? 24.732  -0.302  70.597  1.00 20.12  ? 470  ALA C N   1 
ATOM   9908  C  CA  . ALA C  1 363 ? 24.488  -1.114  69.412  1.00 19.83  ? 470  ALA C CA  1 
ATOM   9909  C  C   . ALA C  1 363 ? 24.975  -2.514  69.753  1.00 19.44  ? 470  ALA C C   1 
ATOM   9910  O  O   . ALA C  1 363 ? 26.120  -2.696  70.166  1.00 19.18  ? 470  ALA C O   1 
ATOM   9911  C  CB  . ALA C  1 363 ? 25.264  -0.568  68.235  1.00 18.97  ? 470  ALA C CB  1 
ATOM   9912  N  N   . VAL C  1 364 ? 24.105  -3.498  69.577  1.00 19.12  ? 471  VAL C N   1 
ATOM   9913  C  CA  . VAL C  1 364 ? 24.442  -4.870  69.900  1.00 19.19  ? 471  VAL C CA  1 
ATOM   9914  C  C   . VAL C  1 364 ? 24.370  -5.758  68.667  1.00 19.54  ? 471  VAL C C   1 
ATOM   9915  O  O   . VAL C  1 364 ? 23.398  -5.697  67.912  1.00 19.72  ? 471  VAL C O   1 
ATOM   9916  C  CB  . VAL C  1 364 ? 23.473  -5.420  70.973  1.00 19.08  ? 471  VAL C CB  1 
ATOM   9917  C  CG1 . VAL C  1 364 ? 23.845  -6.848  71.327  1.00 19.30  ? 471  VAL C CG1 1 
ATOM   9918  C  CG2 . VAL C  1 364 ? 23.514  -4.548  72.206  1.00 17.31  ? 471  VAL C CG2 1 
ATOM   9919  N  N   . THR C  1 365 ? 25.399  -6.579  68.465  1.00 19.91  ? 472  THR C N   1 
ATOM   9920  C  CA  . THR C  1 365 ? 25.431  -7.499  67.328  1.00 19.04  ? 472  THR C CA  1 
ATOM   9921  C  C   . THR C  1 365 ? 24.984  -8.898  67.756  1.00 18.90  ? 472  THR C C   1 
ATOM   9922  O  O   . THR C  1 365 ? 24.895  -9.802  66.934  1.00 20.97  ? 472  THR C O   1 
ATOM   9923  C  CB  . THR C  1 365 ? 26.841  -7.605  66.718  1.00 18.29  ? 472  THR C CB  1 
ATOM   9924  O  OG1 . THR C  1 365 ? 27.754  -8.094  67.703  1.00 20.54  ? 472  THR C OG1 1 
ATOM   9925  C  CG2 . THR C  1 365 ? 27.314  -6.266  66.236  1.00 16.74  ? 472  THR C CG2 1 
ATOM   9926  N  N   . ALA C  1 366 ? 24.708  -9.071  69.045  1.00 18.22  ? 473  ALA C N   1 
ATOM   9927  C  CA  . ALA C  1 366 ? 24.265  -10.354 69.572  1.00 17.52  ? 473  ALA C CA  1 
ATOM   9928  C  C   . ALA C  1 366 ? 25.210  -11.515 69.235  1.00 18.86  ? 473  ALA C C   1 
ATOM   9929  O  O   . ALA C  1 366 ? 24.779  -12.568 68.768  1.00 17.53  ? 473  ALA C O   1 
ATOM   9930  C  CB  . ALA C  1 366 ? 22.869  -10.659 69.075  1.00 16.29  ? 473  ALA C CB  1 
ATOM   9931  N  N   . CYS C  1 367 ? 26.503  -11.311 69.480  1.00 20.96  ? 474  CYS C N   1 
ATOM   9932  C  CA  . CYS C  1 367 ? 27.509  -12.344 69.245  1.00 21.84  ? 474  CYS C CA  1 
ATOM   9933  C  C   . CYS C  1 367 ? 27.600  -12.814 67.789  1.00 23.08  ? 474  CYS C C   1 
ATOM   9934  O  O   . CYS C  1 367 ? 27.820  -13.997 67.513  1.00 23.16  ? 474  CYS C O   1 
ATOM   9935  C  CB  . CYS C  1 367 ? 27.238  -13.538 70.178  1.00 21.32  ? 474  CYS C CB  1 
ATOM   9936  S  SG  . CYS C  1 367 ? 27.532  -13.193 71.956  1.00 22.69  ? 474  CYS C SG  1 
ATOM   9937  N  N   . LEU C  1 368 ? 27.423  -11.882 66.857  1.00 24.09  ? 475  LEU C N   1 
ATOM   9938  C  CA  . LEU C  1 368 ? 27.509  -12.194 65.435  1.00 23.22  ? 475  LEU C CA  1 
ATOM   9939  C  C   . LEU C  1 368 ? 28.896  -12.756 65.148  1.00 24.41  ? 475  LEU C C   1 
ATOM   9940  O  O   . LEU C  1 368 ? 29.908  -12.215 65.607  1.00 25.37  ? 475  LEU C O   1 
ATOM   9941  C  CB  . LEU C  1 368 ? 27.291  -10.932 64.597  1.00 22.55  ? 475  LEU C CB  1 
ATOM   9942  C  CG  . LEU C  1 368 ? 27.430  -11.086 63.076  1.00 22.25  ? 475  LEU C CG  1 
ATOM   9943  C  CD1 . LEU C  1 368 ? 26.317  -11.973 62.545  1.00 20.75  ? 475  LEU C CD1 1 
ATOM   9944  C  CD2 . LEU C  1 368 ? 27.367  -9.725  62.411  1.00 20.67  ? 475  LEU C CD2 1 
ATOM   9945  N  N   . GLY C  1 369 ? 28.946  -13.847 64.397  1.00 24.73  ? 476  GLY C N   1 
ATOM   9946  C  CA  . GLY C  1 369 ? 30.223  -14.446 64.071  1.00 25.90  ? 476  GLY C CA  1 
ATOM   9947  C  C   . GLY C  1 369 ? 30.776  -15.345 65.155  1.00 26.83  ? 476  GLY C C   1 
ATOM   9948  O  O   . GLY C  1 369 ? 31.879  -15.863 65.034  1.00 28.15  ? 476  GLY C O   1 
ATOM   9949  N  N   . GLU C  1 370 ? 30.017  -15.534 66.224  1.00 27.96  ? 477  GLU C N   1 
ATOM   9950  C  CA  . GLU C  1 370 ? 30.458  -16.386 67.321  1.00 28.26  ? 477  GLU C CA  1 
ATOM   9951  C  C   . GLU C  1 370 ? 29.460  -17.523 67.511  1.00 27.30  ? 477  GLU C C   1 
ATOM   9952  O  O   . GLU C  1 370 ? 28.332  -17.461 67.026  1.00 27.37  ? 477  GLU C O   1 
ATOM   9953  C  CB  . GLU C  1 370 ? 30.564  -15.572 68.613  1.00 31.09  ? 477  GLU C CB  1 
ATOM   9954  C  CG  . GLU C  1 370 ? 31.363  -14.280 68.467  1.00 35.79  ? 477  GLU C CG  1 
ATOM   9955  C  CD  . GLU C  1 370 ? 31.417  -13.479 69.761  1.00 40.06  ? 477  GLU C CD  1 
ATOM   9956  O  OE1 . GLU C  1 370 ? 31.924  -12.330 69.732  1.00 41.84  ? 477  GLU C OE1 1 
ATOM   9957  O  OE2 . GLU C  1 370 ? 30.955  -14.000 70.808  1.00 42.21  ? 477  GLU C OE2 1 
ATOM   9958  N  N   . PRO C  1 371 ? 29.862  -18.582 68.225  1.00 26.65  ? 478  PRO C N   1 
ATOM   9959  C  CA  . PRO C  1 371 ? 28.990  -19.735 68.473  1.00 24.96  ? 478  PRO C CA  1 
ATOM   9960  C  C   . PRO C  1 371 ? 27.682  -19.382 69.179  1.00 24.03  ? 478  PRO C C   1 
ATOM   9961  O  O   . PRO C  1 371 ? 26.685  -20.096 69.041  1.00 24.82  ? 478  PRO C O   1 
ATOM   9962  C  CB  . PRO C  1 371 ? 29.855  -20.639 69.346  1.00 24.41  ? 478  PRO C CB  1 
ATOM   9963  C  CG  . PRO C  1 371 ? 31.228  -20.320 68.911  1.00 26.33  ? 478  PRO C CG  1 
ATOM   9964  C  CD  . PRO C  1 371 ? 31.204  -18.817 68.787  1.00 26.15  ? 478  PRO C CD  1 
ATOM   9965  N  N   . ASN C  1 372 ? 27.691  -18.297 69.948  1.00 22.15  ? 479  ASN C N   1 
ATOM   9966  C  CA  . ASN C  1 372 ? 26.503  -17.888 70.688  1.00 21.43  ? 479  ASN C CA  1 
ATOM   9967  C  C   . ASN C  1 372 ? 25.660  -16.842 69.981  1.00 21.16  ? 479  ASN C C   1 
ATOM   9968  O  O   . ASN C  1 372 ? 24.803  -16.199 70.595  1.00 21.09  ? 479  ASN C O   1 
ATOM   9969  C  CB  . ASN C  1 372 ? 26.885  -17.380 72.086  1.00 20.64  ? 479  ASN C CB  1 
ATOM   9970  C  CG  . ASN C  1 372 ? 27.188  -18.507 73.050  1.00 20.41  ? 479  ASN C CG  1 
ATOM   9971  O  OD1 . ASN C  1 372 ? 26.302  -19.294 73.400  1.00 20.64  ? 479  ASN C OD1 1 
ATOM   9972  N  ND2 . ASN C  1 372 ? 28.443  -18.598 73.482  1.00 18.81  ? 479  ASN C ND2 1 
ATOM   9973  N  N   . HIS C  1 373 ? 25.898  -16.675 68.687  1.00 20.83  ? 480  HIS C N   1 
ATOM   9974  C  CA  . HIS C  1 373 ? 25.127  -15.720 67.904  1.00 20.57  ? 480  HIS C CA  1 
ATOM   9975  C  C   . HIS C  1 373 ? 23.648  -16.065 68.065  1.00 18.81  ? 480  HIS C C   1 
ATOM   9976  O  O   . HIS C  1 373 ? 23.263  -17.220 67.949  1.00 19.71  ? 480  HIS C O   1 
ATOM   9977  C  CB  . HIS C  1 373 ? 25.554  -15.805 66.436  1.00 21.73  ? 480  HIS C CB  1 
ATOM   9978  C  CG  . HIS C  1 373 ? 24.738  -14.957 65.512  1.00 22.63  ? 480  HIS C CG  1 
ATOM   9979  N  ND1 . HIS C  1 373 ? 24.416  -13.649 65.789  1.00 24.87  ? 480  HIS C ND1 1 
ATOM   9980  C  CD2 . HIS C  1 373 ? 24.184  -15.227 64.309  1.00 22.21  ? 480  HIS C CD2 1 
ATOM   9981  C  CE1 . HIS C  1 373 ? 23.695  -13.151 64.800  1.00 24.39  ? 480  HIS C CE1 1 
ATOM   9982  N  NE2 . HIS C  1 373 ? 23.541  -14.090 63.889  1.00 22.81  ? 480  HIS C NE2 1 
ATOM   9983  N  N   . ILE C  1 374 ? 22.824  -15.063 68.343  1.00 17.97  ? 481  ILE C N   1 
ATOM   9984  C  CA  . ILE C  1 374 ? 21.388  -15.274 68.529  1.00 17.03  ? 481  ILE C CA  1 
ATOM   9985  C  C   . ILE C  1 374 ? 20.579  -14.431 67.548  1.00 17.90  ? 481  ILE C C   1 
ATOM   9986  O  O   . ILE C  1 374 ? 20.885  -13.258 67.318  1.00 19.14  ? 481  ILE C O   1 
ATOM   9987  C  CB  . ILE C  1 374 ? 20.936  -14.881 69.973  1.00 16.54  ? 481  ILE C CB  1 
ATOM   9988  C  CG1 . ILE C  1 374 ? 21.602  -15.793 71.008  1.00 16.00  ? 481  ILE C CG1 1 
ATOM   9989  C  CG2 . ILE C  1 374 ? 19.419  -14.948 70.092  1.00 15.58  ? 481  ILE C CG2 1 
ATOM   9990  C  CD1 . ILE C  1 374 ? 21.327  -15.391 72.430  1.00 15.18  ? 481  ILE C CD1 1 
ATOM   9991  N  N   . THR C  1 375 ? 19.539  -15.019 66.973  1.00 17.52  ? 482  THR C N   1 
ATOM   9992  C  CA  . THR C  1 375 ? 18.697  -14.276 66.054  1.00 18.22  ? 482  THR C CA  1 
ATOM   9993  C  C   . THR C  1 375 ? 17.251  -14.391 66.491  1.00 19.32  ? 482  THR C C   1 
ATOM   9994  O  O   . THR C  1 375 ? 16.375  -13.698 65.971  1.00 19.35  ? 482  THR C O   1 
ATOM   9995  C  CB  . THR C  1 375 ? 18.851  -14.763 64.605  1.00 19.31  ? 482  THR C CB  1 
ATOM   9996  O  OG1 . THR C  1 375 ? 18.526  -16.158 64.522  1.00 23.02  ? 482  THR C OG1 1 
ATOM   9997  C  CG2 . THR C  1 375 ? 20.288  -14.548 64.135  1.00 20.58  ? 482  THR C CG2 1 
ATOM   9998  N  N   . ARG C  1 376 ? 17.003  -15.268 67.458  1.00 20.32  ? 483  ARG C N   1 
ATOM   9999  C  CA  . ARG C  1 376 ? 15.657  -15.433 67.992  1.00 20.88  ? 483  ARG C CA  1 
ATOM   10000 C  C   . ARG C  1 376 ? 15.770  -15.510 69.518  1.00 19.26  ? 483  ARG C C   1 
ATOM   10001 O  O   . ARG C  1 376 ? 16.265  -16.494 70.076  1.00 17.49  ? 483  ARG C O   1 
ATOM   10002 C  CB  . ARG C  1 376 ? 15.004  -16.687 67.426  1.00 25.08  ? 483  ARG C CB  1 
ATOM   10003 C  CG  . ARG C  1 376 ? 13.507  -16.643 67.561  1.00 32.57  ? 483  ARG C CG  1 
ATOM   10004 C  CD  . ARG C  1 376 ? 12.875  -18.017 67.455  1.00 37.79  ? 483  ARG C CD  1 
ATOM   10005 N  NE  . ARG C  1 376 ? 12.938  -18.573 66.107  1.00 42.89  ? 483  ARG C NE  1 
ATOM   10006 C  CZ  . ARG C  1 376 ? 12.415  -19.750 65.778  1.00 45.38  ? 483  ARG C CZ  1 
ATOM   10007 N  NH1 . ARG C  1 376 ? 12.509  -20.205 64.531  1.00 46.49  ? 483  ARG C NH1 1 
ATOM   10008 N  NH2 . ARG C  1 376 ? 11.791  -20.474 66.707  1.00 47.49  ? 483  ARG C NH2 1 
ATOM   10009 N  N   . LEU C  1 377 ? 15.321  -14.447 70.180  1.00 17.74  ? 484  LEU C N   1 
ATOM   10010 C  CA  . LEU C  1 377 ? 15.406  -14.343 71.631  1.00 16.18  ? 484  LEU C CA  1 
ATOM   10011 C  C   . LEU C  1 377 ? 14.477  -15.219 72.430  1.00 16.22  ? 484  LEU C C   1 
ATOM   10012 O  O   . LEU C  1 377 ? 13.428  -15.656 71.958  1.00 16.59  ? 484  LEU C O   1 
ATOM   10013 C  CB  . LEU C  1 377 ? 15.157  -12.900 72.090  1.00 14.40  ? 484  LEU C CB  1 
ATOM   10014 C  CG  . LEU C  1 377 ? 16.230  -11.825 71.929  1.00 14.78  ? 484  LEU C CG  1 
ATOM   10015 C  CD1 . LEU C  1 377 ? 15.603  -10.467 72.203  1.00 14.33  ? 484  LEU C CD1 1 
ATOM   10016 C  CD2 . LEU C  1 377 ? 17.409  -12.091 72.874  1.00 14.28  ? 484  LEU C CD2 1 
ATOM   10017 N  N   . GLU C  1 378 ? 14.900  -15.461 73.661  1.00 15.41  ? 485  GLU C N   1 
ATOM   10018 C  CA  . GLU C  1 378 ? 14.133  -16.189 74.643  1.00 15.51  ? 485  GLU C CA  1 
ATOM   10019 C  C   . GLU C  1 378 ? 14.212  -15.242 75.831  1.00 15.29  ? 485  GLU C C   1 
ATOM   10020 O  O   . GLU C  1 378 ? 13.683  -14.129 75.744  1.00 14.98  ? 485  GLU C O   1 
ATOM   10021 C  CB  . GLU C  1 378 ? 14.743  -17.561 74.925  1.00 16.36  ? 485  GLU C CB  1 
ATOM   10022 C  CG  . GLU C  1 378 ? 14.425  -18.507 73.801  1.00 16.78  ? 485  GLU C CG  1 
ATOM   10023 C  CD  . GLU C  1 378 ? 14.862  -19.912 74.047  1.00 17.44  ? 485  GLU C CD  1 
ATOM   10024 O  OE1 . GLU C  1 378 ? 14.670  -20.738 73.125  1.00 18.19  ? 485  GLU C OE1 1 
ATOM   10025 O  OE2 . GLU C  1 378 ? 15.389  -20.197 75.143  1.00 18.10  ? 485  GLU C OE2 1 
ATOM   10026 N  N   . HIS C  1 379 ? 14.883  -15.627 76.912  1.00 14.30  ? 486  HIS C N   1 
ATOM   10027 C  CA  . HIS C  1 379 ? 14.969  -14.732 78.063  1.00 13.77  ? 486  HIS C CA  1 
ATOM   10028 C  C   . HIS C  1 379 ? 16.014  -13.646 77.838  1.00 14.24  ? 486  HIS C C   1 
ATOM   10029 O  O   . HIS C  1 379 ? 17.007  -13.866 77.134  1.00 14.06  ? 486  HIS C O   1 
ATOM   10030 C  CB  . HIS C  1 379 ? 15.338  -15.508 79.328  1.00 13.37  ? 486  HIS C CB  1 
ATOM   10031 C  CG  . HIS C  1 379 ? 14.497  -16.720 79.554  1.00 14.21  ? 486  HIS C CG  1 
ATOM   10032 N  ND1 . HIS C  1 379 ? 14.744  -17.923 78.925  1.00 14.43  ? 486  HIS C ND1 1 
ATOM   10033 C  CD2 . HIS C  1 379 ? 13.377  -16.904 80.294  1.00 13.55  ? 486  HIS C CD2 1 
ATOM   10034 C  CE1 . HIS C  1 379 ? 13.810  -18.794 79.268  1.00 14.88  ? 486  HIS C CE1 1 
ATOM   10035 N  NE2 . HIS C  1 379 ? 12.968  -18.200 80.098  1.00 14.48  ? 486  HIS C NE2 1 
ATOM   10036 N  N   . VAL C  1 380 ? 15.775  -12.475 78.429  1.00 14.15  ? 487  VAL C N   1 
ATOM   10037 C  CA  . VAL C  1 380 ? 16.710  -11.352 78.359  1.00 13.43  ? 487  VAL C CA  1 
ATOM   10038 C  C   . VAL C  1 380 ? 16.951  -10.851 79.781  1.00 13.76  ? 487  VAL C C   1 
ATOM   10039 O  O   . VAL C  1 380 ? 15.999  -10.557 80.508  1.00 15.53  ? 487  VAL C O   1 
ATOM   10040 C  CB  . VAL C  1 380 ? 16.161  -10.173 77.533  1.00 13.90  ? 487  VAL C CB  1 
ATOM   10041 C  CG1 . VAL C  1 380 ? 17.019  -8.940  77.767  1.00 14.20  ? 487  VAL C CG1 1 
ATOM   10042 C  CG2 . VAL C  1 380 ? 16.181  -10.509 76.051  1.00 13.55  ? 487  VAL C CG2 1 
ATOM   10043 N  N   . GLN C  1 381 ? 18.216  -10.776 80.181  1.00 12.74  ? 488  GLN C N   1 
ATOM   10044 C  CA  . GLN C  1 381 ? 18.569  -10.278 81.508  1.00 11.83  ? 488  GLN C CA  1 
ATOM   10045 C  C   . GLN C  1 381 ? 19.329  -8.967  81.370  1.00 12.18  ? 488  GLN C C   1 
ATOM   10046 O  O   . GLN C  1 381 ? 20.262  -8.858  80.567  1.00 11.21  ? 488  GLN C O   1 
ATOM   10047 C  CB  . GLN C  1 381 ? 19.498  -11.242 82.265  1.00 10.93  ? 488  GLN C CB  1 
ATOM   10048 C  CG  . GLN C  1 381 ? 18.959  -12.609 82.595  1.00 9.24   ? 488  GLN C CG  1 
ATOM   10049 C  CD  . GLN C  1 381 ? 19.942  -13.402 83.432  1.00 10.23  ? 488  GLN C CD  1 
ATOM   10050 O  OE1 . GLN C  1 381 ? 21.148  -13.362 83.191  1.00 10.06  ? 488  GLN C OE1 1 
ATOM   10051 N  NE2 . GLN C  1 381 ? 19.434  -14.136 84.412  1.00 10.49  ? 488  GLN C NE2 1 
ATOM   10052 N  N   . ALA C  1 382 ? 18.927  -7.978  82.156  1.00 12.32  ? 489  ALA C N   1 
ATOM   10053 C  CA  . ALA C  1 382 ? 19.617  -6.701  82.183  1.00 12.20  ? 489  ALA C CA  1 
ATOM   10054 C  C   . ALA C  1 382 ? 20.217  -6.729  83.589  1.00 13.12  ? 489  ALA C C   1 
ATOM   10055 O  O   . ALA C  1 382 ? 19.511  -6.504  84.573  1.00 13.78  ? 489  ALA C O   1 
ATOM   10056 C  CB  . ALA C  1 382 ? 18.632  -5.562  82.031  1.00 11.01  ? 489  ALA C CB  1 
ATOM   10057 N  N   . ARG C  1 383 ? 21.503  -7.067  83.677  1.00 13.57  ? 490  ARG C N   1 
ATOM   10058 C  CA  . ARG C  1 383 ? 22.203  -7.146  84.959  1.00 13.63  ? 490  ARG C CA  1 
ATOM   10059 C  C   . ARG C  1 383 ? 22.731  -5.791  85.380  1.00 14.48  ? 490  ARG C C   1 
ATOM   10060 O  O   . ARG C  1 383 ? 23.702  -5.293  84.799  1.00 13.92  ? 490  ARG C O   1 
ATOM   10061 C  CB  . ARG C  1 383 ? 23.385  -8.096  84.868  1.00 14.66  ? 490  ARG C CB  1 
ATOM   10062 C  CG  . ARG C  1 383 ? 23.028  -9.499  84.553  1.00 14.75  ? 490  ARG C CG  1 
ATOM   10063 C  CD  . ARG C  1 383 ? 24.211  -10.378 84.813  1.00 15.28  ? 490  ARG C CD  1 
ATOM   10064 N  NE  . ARG C  1 383 ? 23.729  -11.724 85.052  1.00 19.83  ? 490  ARG C NE  1 
ATOM   10065 C  CZ  . ARG C  1 383 ? 23.755  -12.345 86.223  1.00 16.95  ? 490  ARG C CZ  1 
ATOM   10066 N  NH1 . ARG C  1 383 ? 23.270  -13.562 86.301  1.00 21.04  ? 490  ARG C NH1 1 
ATOM   10067 N  NH2 . ARG C  1 383 ? 24.283  -11.782 87.291  1.00 14.77  ? 490  ARG C NH2 1 
ATOM   10068 N  N   . LEU C  1 384 ? 22.115  -5.209  86.408  1.00 13.83  ? 491  LEU C N   1 
ATOM   10069 C  CA  . LEU C  1 384 ? 22.525  -3.894  86.878  1.00 12.08  ? 491  LEU C CA  1 
ATOM   10070 C  C   . LEU C  1 384 ? 23.177  -3.879  88.251  1.00 12.95  ? 491  LEU C C   1 
ATOM   10071 O  O   . LEU C  1 384 ? 22.837  -4.660  89.147  1.00 12.74  ? 491  LEU C O   1 
ATOM   10072 C  CB  . LEU C  1 384 ? 21.321  -2.949  86.896  1.00 9.29   ? 491  LEU C CB  1 
ATOM   10073 C  CG  . LEU C  1 384 ? 20.512  -2.919  85.602  1.00 9.41   ? 491  LEU C CG  1 
ATOM   10074 C  CD1 . LEU C  1 384 ? 19.345  -1.952  85.723  1.00 7.37   ? 491  LEU C CD1 1 
ATOM   10075 C  CD2 . LEU C  1 384 ? 21.430  -2.544  84.461  1.00 7.64   ? 491  LEU C CD2 1 
ATOM   10076 N  N   . THR C  1 385 ? 24.149  -2.990  88.388  1.00 12.46  ? 492  THR C N   1 
ATOM   10077 C  CA  . THR C  1 385 ? 24.825  -2.778  89.649  1.00 12.14  ? 492  THR C CA  1 
ATOM   10078 C  C   . THR C  1 385 ? 24.796  -1.278  89.748  1.00 12.19  ? 492  THR C C   1 
ATOM   10079 O  O   . THR C  1 385 ? 25.407  -0.583  88.927  1.00 13.15  ? 492  THR C O   1 
ATOM   10080 C  CB  . THR C  1 385 ? 26.275  -3.240  89.643  1.00 11.76  ? 492  THR C CB  1 
ATOM   10081 O  OG1 . THR C  1 385 ? 26.322  -4.653  89.429  1.00 13.11  ? 492  THR C OG1 1 
ATOM   10082 C  CG2 . THR C  1 385 ? 26.926  -2.917  90.982  1.00 9.03   ? 492  THR C CG2 1 
ATOM   10083 N  N   . LEU C  1 386 ? 24.053  -0.776  90.726  1.00 11.59  ? 493  LEU C N   1 
ATOM   10084 C  CA  . LEU C  1 386 ? 23.940  0.659   90.902  1.00 12.15  ? 493  LEU C CA  1 
ATOM   10085 C  C   . LEU C  1 386 ? 23.772  1.030   92.367  1.00 12.92  ? 493  LEU C C   1 
ATOM   10086 O  O   . LEU C  1 386 ? 23.419  0.190   93.203  1.00 12.72  ? 493  LEU C O   1 
ATOM   10087 C  CB  . LEU C  1 386 ? 22.745  1.179   90.096  1.00 10.59  ? 493  LEU C CB  1 
ATOM   10088 C  CG  . LEU C  1 386 ? 21.347  0.720   90.529  1.00 10.05  ? 493  LEU C CG  1 
ATOM   10089 C  CD1 . LEU C  1 386 ? 20.896  1.543   91.726  1.00 8.97   ? 493  LEU C CD1 1 
ATOM   10090 C  CD2 . LEU C  1 386 ? 20.356  0.899   89.389  1.00 9.06   ? 493  LEU C CD2 1 
ATOM   10091 N  N   . SER C  1 387 ? 24.045  2.290   92.675  1.00 12.16  ? 494  SER C N   1 
ATOM   10092 C  CA  . SER C  1 387 ? 23.868  2.784   94.029  1.00 13.51  ? 494  SER C CA  1 
ATOM   10093 C  C   . SER C  1 387 ? 22.908  3.941   93.920  1.00 12.90  ? 494  SER C C   1 
ATOM   10094 O  O   . SER C  1 387 ? 22.987  4.729   92.984  1.00 13.78  ? 494  SER C O   1 
ATOM   10095 C  CB  . SER C  1 387 ? 25.192  3.252   94.630  1.00 13.34  ? 494  SER C CB  1 
ATOM   10096 O  OG  . SER C  1 387 ? 25.836  4.158   93.762  1.00 17.22  ? 494  SER C OG  1 
ATOM   10097 N  N   . TYR C  1 388 ? 21.974  4.020   94.856  1.00 13.43  ? 495  TYR C N   1 
ATOM   10098 C  CA  . TYR C  1 388 ? 20.997  5.100   94.858  1.00 14.52  ? 495  TYR C CA  1 
ATOM   10099 C  C   . TYR C  1 388 ? 20.624  5.314   96.322  1.00 16.17  ? 495  TYR C C   1 
ATOM   10100 O  O   . TYR C  1 388 ? 20.786  4.403   97.142  1.00 14.98  ? 495  TYR C O   1 
ATOM   10101 C  CB  . TYR C  1 388 ? 19.753  4.714   94.046  1.00 14.02  ? 495  TYR C CB  1 
ATOM   10102 C  CG  . TYR C  1 388 ? 19.048  5.899   93.424  1.00 13.38  ? 495  TYR C CG  1 
ATOM   10103 C  CD1 . TYR C  1 388 ? 19.702  6.698   92.488  1.00 13.84  ? 495  TYR C CD1 1 
ATOM   10104 C  CD2 . TYR C  1 388 ? 17.744  6.236   93.781  1.00 13.49  ? 495  TYR C CD2 1 
ATOM   10105 C  CE1 . TYR C  1 388 ? 19.083  7.805   91.920  1.00 15.05  ? 495  TYR C CE1 1 
ATOM   10106 C  CE2 . TYR C  1 388 ? 17.103  7.358   93.210  1.00 14.09  ? 495  TYR C CE2 1 
ATOM   10107 C  CZ  . TYR C  1 388 ? 17.782  8.133   92.283  1.00 15.86  ? 495  TYR C CZ  1 
ATOM   10108 O  OH  . TYR C  1 388 ? 17.164  9.236   91.710  1.00 18.53  ? 495  TYR C OH  1 
ATOM   10109 N  N   . ASN C  1 389 ? 20.126  6.503   96.657  1.00 16.18  ? 496  ASN C N   1 
ATOM   10110 C  CA  . ASN C  1 389 ? 19.770  6.784   98.039  1.00 16.42  ? 496  ASN C CA  1 
ATOM   10111 C  C   . ASN C  1 389 ? 18.382  6.288   98.445  1.00 17.50  ? 496  ASN C C   1 
ATOM   10112 O  O   . ASN C  1 389 ? 18.165  5.935   99.595  1.00 17.32  ? 496  ASN C O   1 
ATOM   10113 C  CB  . ASN C  1 389 ? 19.883  8.285   98.318  1.00 14.92  ? 496  ASN C CB  1 
ATOM   10114 C  CG  . ASN C  1 389 ? 18.888  9.092   97.532  1.00 15.29  ? 496  ASN C CG  1 
ATOM   10115 O  OD1 . ASN C  1 389 ? 18.891  9.082   96.295  1.00 17.59  ? 496  ASN C OD1 1 
ATOM   10116 N  ND2 . ASN C  1 389 ? 18.019  9.795   98.239  1.00 13.32  ? 496  ASN C ND2 1 
ATOM   10117 N  N   . ARG C  1 390 ? 17.439  6.269   97.509  1.00 19.81  ? 497  ARG C N   1 
ATOM   10118 C  CA  . ARG C  1 390 ? 16.062  5.826   97.781  1.00 19.85  ? 497  ARG C CA  1 
ATOM   10119 C  C   . ARG C  1 390 ? 15.648  4.948   96.600  1.00 19.07  ? 497  ARG C C   1 
ATOM   10120 O  O   . ARG C  1 390 ? 15.103  5.417   95.601  1.00 20.11  ? 497  ARG C O   1 
ATOM   10121 C  CB  . ARG C  1 390 ? 15.149  7.048   97.920  1.00 21.27  ? 497  ARG C CB  1 
ATOM   10122 C  CG  . ARG C  1 390 ? 13.661  6.777   97.902  1.00 26.01  ? 497  ARG C CG  1 
ATOM   10123 C  CD  . ARG C  1 390 ? 13.122  6.478   99.276  1.00 30.68  ? 497  ARG C CD  1 
ATOM   10124 N  NE  . ARG C  1 390 ? 11.737  6.938   99.442  1.00 35.47  ? 497  ARG C NE  1 
ATOM   10125 C  CZ  . ARG C  1 390 ? 10.681  6.451   98.786  1.00 37.85  ? 497  ARG C CZ  1 
ATOM   10126 N  NH1 . ARG C  1 390 ? 9.468   6.946   99.019  1.00 38.92  ? 497  ARG C NH1 1 
ATOM   10127 N  NH2 . ARG C  1 390 ? 10.826  5.470   97.898  1.00 38.60  ? 497  ARG C NH2 1 
ATOM   10128 N  N   . ARG C  1 391 ? 15.937  3.662   96.736  1.00 17.78  ? 498  ARG C N   1 
ATOM   10129 C  CA  . ARG C  1 391 ? 15.679  2.683   95.694  1.00 16.29  ? 498  ARG C CA  1 
ATOM   10130 C  C   . ARG C  1 391 ? 14.279  2.688   95.096  1.00 15.85  ? 498  ARG C C   1 
ATOM   10131 O  O   . ARG C  1 391 ? 14.120  2.668   93.876  1.00 17.11  ? 498  ARG C O   1 
ATOM   10132 C  CB  . ARG C  1 391 ? 16.024  1.294   96.225  1.00 13.97  ? 498  ARG C CB  1 
ATOM   10133 C  CG  . ARG C  1 391 ? 16.281  0.271   95.140  1.00 11.82  ? 498  ARG C CG  1 
ATOM   10134 C  CD  . ARG C  1 391 ? 16.953  -0.932  95.739  1.00 10.61  ? 498  ARG C CD  1 
ATOM   10135 N  NE  . ARG C  1 391 ? 16.128  -1.553  96.766  1.00 8.15   ? 498  ARG C NE  1 
ATOM   10136 C  CZ  . ARG C  1 391 ? 16.555  -2.529  97.561  1.00 10.65  ? 498  ARG C CZ  1 
ATOM   10137 N  NH1 . ARG C  1 391 ? 15.754  -3.063  98.474  1.00 9.24   ? 498  ARG C NH1 1 
ATOM   10138 N  NH2 . ARG C  1 391 ? 17.801  -2.960  97.458  1.00 9.54   ? 498  ARG C NH2 1 
ATOM   10139 N  N   . GLY C  1 392 ? 13.272  2.722   95.958  1.00 15.62  ? 499  GLY C N   1 
ATOM   10140 C  CA  . GLY C  1 392 ? 11.892  2.709   95.511  1.00 15.04  ? 499  GLY C CA  1 
ATOM   10141 C  C   . GLY C  1 392 ? 11.478  3.839   94.588  1.00 16.31  ? 499  GLY C C   1 
ATOM   10142 O  O   . GLY C  1 392 ? 10.409  3.777   93.974  1.00 16.88  ? 499  GLY C O   1 
ATOM   10143 N  N   . ASP C  1 393 ? 12.301  4.875   94.481  1.00 15.83  ? 500  ASP C N   1 
ATOM   10144 C  CA  . ASP C  1 393 ? 11.962  5.993   93.617  1.00 16.63  ? 500  ASP C CA  1 
ATOM   10145 C  C   . ASP C  1 393 ? 12.374  5.743   92.167  1.00 16.43  ? 500  ASP C C   1 
ATOM   10146 O  O   . ASP C  1 393 ? 11.953  6.461   91.252  1.00 17.12  ? 500  ASP C O   1 
ATOM   10147 C  CB  . ASP C  1 393 ? 12.612  7.277   94.140  1.00 17.56  ? 500  ASP C CB  1 
ATOM   10148 C  CG  . ASP C  1 393 ? 11.797  7.941   95.249  1.00 19.17  ? 500  ASP C CG  1 
ATOM   10149 O  OD1 . ASP C  1 393 ? 12.312  8.894   95.882  1.00 20.51  ? 500  ASP C OD1 1 
ATOM   10150 O  OD2 . ASP C  1 393 ? 10.639  7.522   95.480  1.00 17.63  ? 500  ASP C OD2 1 
ATOM   10151 N  N   . LEU C  1 394 ? 13.184  4.712   91.956  1.00 14.97  ? 501  LEU C N   1 
ATOM   10152 C  CA  . LEU C  1 394 ? 13.648  4.384   90.617  1.00 13.92  ? 501  LEU C CA  1 
ATOM   10153 C  C   . LEU C  1 394 ? 12.634  3.606   89.782  1.00 14.27  ? 501  LEU C C   1 
ATOM   10154 O  O   . LEU C  1 394 ? 11.835  2.823   90.301  1.00 15.59  ? 501  LEU C O   1 
ATOM   10155 C  CB  . LEU C  1 394 ? 14.926  3.556   90.696  1.00 12.19  ? 501  LEU C CB  1 
ATOM   10156 C  CG  . LEU C  1 394 ? 16.194  4.181   91.262  1.00 11.68  ? 501  LEU C CG  1 
ATOM   10157 C  CD1 . LEU C  1 394 ? 17.251  3.104   91.405  1.00 11.81  ? 501  LEU C CD1 1 
ATOM   10158 C  CD2 . LEU C  1 394 ? 16.678  5.295   90.354  1.00 10.92  ? 501  LEU C CD2 1 
ATOM   10159 N  N   . ALA C  1 395 ? 12.685  3.840   88.477  1.00 13.56  ? 502  ALA C N   1 
ATOM   10160 C  CA  . ALA C  1 395 ? 11.856  3.150   87.496  1.00 12.21  ? 502  ALA C CA  1 
ATOM   10161 C  C   . ALA C  1 395 ? 12.861  2.828   86.393  1.00 12.91  ? 502  ALA C C   1 
ATOM   10162 O  O   . ALA C  1 395 ? 13.538  3.730   85.879  1.00 13.20  ? 502  ALA C O   1 
ATOM   10163 C  CB  . ALA C  1 395 ? 10.773  4.060   86.971  1.00 11.22  ? 502  ALA C CB  1 
ATOM   10164 N  N   . ILE C  1 396 ? 12.984  1.552   86.042  1.00 12.40  ? 503  ILE C N   1 
ATOM   10165 C  CA  . ILE C  1 396 ? 13.944  1.154   85.019  1.00 12.19  ? 503  ILE C CA  1 
ATOM   10166 C  C   . ILE C  1 396 ? 13.262  0.475   83.843  1.00 13.02  ? 503  ILE C C   1 
ATOM   10167 O  O   . ILE C  1 396 ? 12.411  -0.391  84.038  1.00 14.14  ? 503  ILE C O   1 
ATOM   10168 C  CB  . ILE C  1 396 ? 14.989  0.214   85.628  1.00 11.71  ? 503  ILE C CB  1 
ATOM   10169 C  CG1 . ILE C  1 396 ? 15.587  0.881   86.878  1.00 10.67  ? 503  ILE C CG1 1 
ATOM   10170 C  CG2 . ILE C  1 396 ? 16.069  -0.126  84.604  1.00 9.50   ? 503  ILE C CG2 1 
ATOM   10171 C  CD1 . ILE C  1 396 ? 16.483  -0.022  87.720  1.00 9.13   ? 503  ILE C CD1 1 
ATOM   10172 N  N   . HIS C  1 397 ? 13.627  0.883   82.629  1.00 13.56  ? 504  HIS C N   1 
ATOM   10173 C  CA  . HIS C  1 397 ? 13.059  0.308   81.405  1.00 14.46  ? 504  HIS C CA  1 
ATOM   10174 C  C   . HIS C  1 397 ? 14.128  -0.146  80.431  1.00 14.12  ? 504  HIS C C   1 
ATOM   10175 O  O   . HIS C  1 397 ? 15.206  0.430   80.371  1.00 16.57  ? 504  HIS C O   1 
ATOM   10176 C  CB  . HIS C  1 397 ? 12.159  1.310   80.688  1.00 14.78  ? 504  HIS C CB  1 
ATOM   10177 C  CG  . HIS C  1 397 ? 10.936  1.679   81.462  1.00 15.29  ? 504  HIS C CG  1 
ATOM   10178 N  ND1 . HIS C  1 397 ? 10.955  2.604   82.483  1.00 16.66  ? 504  HIS C ND1 1 
ATOM   10179 C  CD2 . HIS C  1 397 ? 9.659   1.237   81.376  1.00 16.15  ? 504  HIS C CD2 1 
ATOM   10180 C  CE1 . HIS C  1 397 ? 9.739   2.720   82.989  1.00 16.90  ? 504  HIS C CE1 1 
ATOM   10181 N  NE2 . HIS C  1 397 ? 8.934   1.900   82.335  1.00 15.67  ? 504  HIS C NE2 1 
ATOM   10182 N  N   . LEU C  1 398 ? 13.826  -1.192  79.674  1.00 13.32  ? 505  LEU C N   1 
ATOM   10183 C  CA  . LEU C  1 398 ? 14.753  -1.718  78.685  1.00 13.19  ? 505  LEU C CA  1 
ATOM   10184 C  C   . LEU C  1 398 ? 13.966  -1.761  77.379  1.00 14.62  ? 505  LEU C C   1 
ATOM   10185 O  O   . LEU C  1 398 ? 12.855  -2.286  77.339  1.00 15.07  ? 505  LEU C O   1 
ATOM   10186 C  CB  . LEU C  1 398 ? 15.207  -3.131  79.065  1.00 11.03  ? 505  LEU C CB  1 
ATOM   10187 C  CG  . LEU C  1 398 ? 16.237  -3.788  78.142  1.00 9.70   ? 505  LEU C CG  1 
ATOM   10188 C  CD1 . LEU C  1 398 ? 17.511  -2.967  78.111  1.00 9.42   ? 505  LEU C CD1 1 
ATOM   10189 C  CD2 . LEU C  1 398 ? 16.546  -5.187  78.629  1.00 8.47   ? 505  LEU C CD2 1 
ATOM   10190 N  N   . ILE C  1 399 ? 14.523  -1.186  76.319  1.00 15.03  ? 506  ILE C N   1 
ATOM   10191 C  CA  . ILE C  1 399 ? 13.850  -1.183  75.027  1.00 13.77  ? 506  ILE C CA  1 
ATOM   10192 C  C   . ILE C  1 399 ? 14.670  -1.986  74.035  1.00 14.43  ? 506  ILE C C   1 
ATOM   10193 O  O   . ILE C  1 399 ? 15.853  -1.712  73.836  1.00 15.21  ? 506  ILE C O   1 
ATOM   10194 C  CB  . ILE C  1 399 ? 13.701  0.230   74.473  1.00 13.68  ? 506  ILE C CB  1 
ATOM   10195 C  CG1 . ILE C  1 399 ? 12.986  1.127   75.478  1.00 14.04  ? 506  ILE C CG1 1 
ATOM   10196 C  CG2 . ILE C  1 399 ? 12.913  0.189   73.208  1.00 12.61  ? 506  ILE C CG2 1 
ATOM   10197 C  CD1 . ILE C  1 399 ? 12.822  2.565   74.986  1.00 15.74  ? 506  ILE C CD1 1 
ATOM   10198 N  N   . SER C  1 400 ? 14.039  -2.980  73.420  1.00 14.21  ? 507  SER C N   1 
ATOM   10199 C  CA  . SER C  1 400 ? 14.708  -3.843  72.450  1.00 14.50  ? 507  SER C CA  1 
ATOM   10200 C  C   . SER C  1 400 ? 14.835  -3.137  71.105  1.00 14.65  ? 507  SER C C   1 
ATOM   10201 O  O   . SER C  1 400 ? 14.094  -2.192  70.816  1.00 14.25  ? 507  SER C O   1 
ATOM   10202 C  CB  . SER C  1 400 ? 13.905  -5.129  72.261  1.00 14.59  ? 507  SER C CB  1 
ATOM   10203 O  OG  . SER C  1 400 ? 12.637  -4.841  71.694  1.00 14.58  ? 507  SER C OG  1 
ATOM   10204 N  N   . PRO C  1 401 ? 15.775  -3.589  70.260  1.00 14.71  ? 508  PRO C N   1 
ATOM   10205 C  CA  . PRO C  1 401 ? 15.954  -2.964  68.947  1.00 15.68  ? 508  PRO C CA  1 
ATOM   10206 C  C   . PRO C  1 401 ? 14.625  -2.886  68.191  1.00 15.99  ? 508  PRO C C   1 
ATOM   10207 O  O   . PRO C  1 401 ? 14.374  -1.921  67.476  1.00 16.88  ? 508  PRO C O   1 
ATOM   10208 C  CB  . PRO C  1 401 ? 16.957  -3.884  68.264  1.00 15.37  ? 508  PRO C CB  1 
ATOM   10209 C  CG  . PRO C  1 401 ? 17.785  -4.358  69.406  1.00 15.68  ? 508  PRO C CG  1 
ATOM   10210 C  CD  . PRO C  1 401 ? 16.735  -4.686  70.449  1.00 14.77  ? 508  PRO C CD  1 
ATOM   10211 N  N   . MET C  1 402 ? 13.778  -3.901  68.357  1.00 16.31  ? 509  MET C N   1 
ATOM   10212 C  CA  . MET C  1 402 ? 12.477  -3.929  67.695  1.00 15.92  ? 509  MET C CA  1 
ATOM   10213 C  C   . MET C  1 402 ? 11.414  -3.088  68.413  1.00 16.68  ? 509  MET C C   1 
ATOM   10214 O  O   . MET C  1 402 ? 10.212  -3.240  68.172  1.00 17.19  ? 509  MET C O   1 
ATOM   10215 C  CB  . MET C  1 402 ? 11.999  -5.380  67.511  1.00 13.94  ? 509  MET C CB  1 
ATOM   10216 C  CG  . MET C  1 402 ? 12.775  -6.096  66.409  1.00 16.48  ? 509  MET C CG  1 
ATOM   10217 S  SD  . MET C  1 402 ? 12.347  -7.808  66.031  1.00 18.71  ? 509  MET C SD  1 
ATOM   10218 C  CE  . MET C  1 402 ? 11.003  -7.586  64.884  1.00 18.85  ? 509  MET C CE  1 
ATOM   10219 N  N   . GLY C  1 403 ? 11.866  -2.216  69.311  1.00 16.07  ? 510  GLY C N   1 
ATOM   10220 C  CA  . GLY C  1 403 ? 10.959  -1.320  70.002  1.00 14.51  ? 510  GLY C CA  1 
ATOM   10221 C  C   . GLY C  1 403 ? 10.126  -1.807  71.159  1.00 14.98  ? 510  GLY C C   1 
ATOM   10222 O  O   . GLY C  1 403 ? 9.246   -1.077  71.615  1.00 14.85  ? 510  GLY C O   1 
ATOM   10223 N  N   . THR C  1 404 ? 10.365  -3.018  71.646  1.00 15.24  ? 511  THR C N   1 
ATOM   10224 C  CA  . THR C  1 404 ? 9.582   -3.501  72.786  1.00 15.28  ? 511  THR C CA  1 
ATOM   10225 C  C   . THR C  1 404 ? 10.140  -2.924  74.082  1.00 14.84  ? 511  THR C C   1 
ATOM   10226 O  O   . THR C  1 404 ? 11.286  -3.171  74.454  1.00 14.75  ? 511  THR C O   1 
ATOM   10227 C  CB  . THR C  1 404 ? 9.597   -5.020  72.871  1.00 15.14  ? 511  THR C CB  1 
ATOM   10228 O  OG1 . THR C  1 404 ? 9.047   -5.559  71.666  1.00 16.23  ? 511  THR C OG1 1 
ATOM   10229 C  CG2 . THR C  1 404 ? 8.779   -5.490  74.058  1.00 14.49  ? 511  THR C CG2 1 
ATOM   10230 N  N   . ARG C  1 405 ? 9.315   -2.142  74.758  1.00 16.08  ? 512  ARG C N   1 
ATOM   10231 C  CA  . ARG C  1 405 ? 9.705   -1.487  75.998  1.00 16.62  ? 512  ARG C CA  1 
ATOM   10232 C  C   . ARG C  1 405 ? 9.289   -2.307  77.212  1.00 16.12  ? 512  ARG C C   1 
ATOM   10233 O  O   . ARG C  1 405 ? 8.096   -2.413  77.525  1.00 15.99  ? 512  ARG C O   1 
ATOM   10234 C  CB  . ARG C  1 405 ? 9.070   -0.097  76.043  1.00 17.54  ? 512  ARG C CB  1 
ATOM   10235 C  CG  . ARG C  1 405 ? 9.563   0.809   77.155  1.00 21.50  ? 512  ARG C CG  1 
ATOM   10236 C  CD  . ARG C  1 405 ? 9.297   2.271   76.811  1.00 23.58  ? 512  ARG C CD  1 
ATOM   10237 N  NE  . ARG C  1 405 ? 9.852   3.197   77.801  1.00 25.97  ? 512  ARG C NE  1 
ATOM   10238 C  CZ  . ARG C  1 405 ? 9.219   3.592   78.905  1.00 27.54  ? 512  ARG C CZ  1 
ATOM   10239 N  NH1 . ARG C  1 405 ? 9.814   4.435   79.738  1.00 28.18  ? 512  ARG C NH1 1 
ATOM   10240 N  NH2 . ARG C  1 405 ? 7.987   3.162   79.176  1.00 27.96  ? 512  ARG C NH2 1 
ATOM   10241 N  N   . SER C  1 406 ? 10.276  -2.900  77.879  1.00 14.27  ? 513  SER C N   1 
ATOM   10242 C  CA  . SER C  1 406 ? 10.025  -3.708  79.065  1.00 14.63  ? 513  SER C CA  1 
ATOM   10243 C  C   . SER C  1 406 ? 10.298  -2.905  80.331  1.00 14.45  ? 513  SER C C   1 
ATOM   10244 O  O   . SER C  1 406 ? 11.342  -2.273  80.458  1.00 15.13  ? 513  SER C O   1 
ATOM   10245 C  CB  . SER C  1 406 ? 10.927  -4.947  79.078  1.00 15.40  ? 513  SER C CB  1 
ATOM   10246 O  OG  . SER C  1 406 ? 10.595  -5.866  78.045  1.00 17.25  ? 513  SER C OG  1 
ATOM   10247 N  N   . THR C  1 407 ? 9.359   -2.922  81.266  1.00 14.16  ? 514  THR C N   1 
ATOM   10248 C  CA  . THR C  1 407 ? 9.560   -2.223  82.526  1.00 13.73  ? 514  THR C CA  1 
ATOM   10249 C  C   . THR C  1 407 ? 10.274  -3.188  83.464  1.00 12.65  ? 514  THR C C   1 
ATOM   10250 O  O   . THR C  1 407 ? 9.649   -4.085  84.029  1.00 12.22  ? 514  THR C O   1 
ATOM   10251 C  CB  . THR C  1 407 ? 8.233   -1.812  83.176  1.00 13.98  ? 514  THR C CB  1 
ATOM   10252 O  OG1 . THR C  1 407 ? 7.546   -0.894  82.321  1.00 16.56  ? 514  THR C OG1 1 
ATOM   10253 C  CG2 . THR C  1 407 ? 8.491   -1.140  84.521  1.00 13.22  ? 514  THR C CG2 1 
ATOM   10254 N  N   . LEU C  1 408 ? 11.581  -3.007  83.613  1.00 11.56  ? 515  LEU C N   1 
ATOM   10255 C  CA  . LEU C  1 408 ? 12.380  -3.866  84.477  1.00 11.72  ? 515  LEU C CA  1 
ATOM   10256 C  C   . LEU C  1 408 ? 12.071  -3.608  85.939  1.00 11.99  ? 515  LEU C C   1 
ATOM   10257 O  O   . LEU C  1 408 ? 12.130  -4.521  86.755  1.00 12.19  ? 515  LEU C O   1 
ATOM   10258 C  CB  . LEU C  1 408 ? 13.876  -3.640  84.229  1.00 10.15  ? 515  LEU C CB  1 
ATOM   10259 C  CG  . LEU C  1 408 ? 14.372  -3.936  82.811  1.00 9.67   ? 515  LEU C CG  1 
ATOM   10260 C  CD1 . LEU C  1 408 ? 15.887  -3.832  82.770  1.00 9.41   ? 515  LEU C CD1 1 
ATOM   10261 C  CD2 . LEU C  1 408 ? 13.932  -5.340  82.379  1.00 7.88   ? 515  LEU C CD2 1 
ATOM   10262 N  N   . LEU C  1 409 ? 11.755  -2.357  86.266  1.00 12.64  ? 516  LEU C N   1 
ATOM   10263 C  CA  . LEU C  1 409 ? 11.435  -1.980  87.642  1.00 13.18  ? 516  LEU C CA  1 
ATOM   10264 C  C   . LEU C  1 409 ? 10.553  -0.742  87.679  1.00 13.65  ? 516  LEU C C   1 
ATOM   10265 O  O   . LEU C  1 409 ? 10.895  0.295   87.096  1.00 13.50  ? 516  LEU C O   1 
ATOM   10266 C  CB  . LEU C  1 409 ? 12.718  -1.709  88.442  1.00 12.30  ? 516  LEU C CB  1 
ATOM   10267 C  CG  . LEU C  1 409 ? 12.563  -1.296  89.920  1.00 13.06  ? 516  LEU C CG  1 
ATOM   10268 C  CD1 . LEU C  1 409 ? 12.037  -2.462  90.773  1.00 9.89   ? 516  LEU C CD1 1 
ATOM   10269 C  CD2 . LEU C  1 409 ? 13.913  -0.833  90.449  1.00 10.66  ? 516  LEU C CD2 1 
ATOM   10270 N  N   . ALA C  1 410 ? 9.409   -0.865  88.348  1.00 13.76  ? 517  ALA C N   1 
ATOM   10271 C  CA  . ALA C  1 410 ? 8.477   0.251   88.490  1.00 14.77  ? 517  ALA C CA  1 
ATOM   10272 C  C   . ALA C  1 410 ? 8.692   0.795   89.891  1.00 15.28  ? 517  ALA C C   1 
ATOM   10273 O  O   . ALA C  1 410 ? 9.262   0.110   90.733  1.00 17.42  ? 517  ALA C O   1 
ATOM   10274 C  CB  . ALA C  1 410 ? 7.043   -0.223  88.320  1.00 11.45  ? 517  ALA C CB  1 
ATOM   10275 N  N   . ALA C  1 411 ? 8.246   2.014   90.151  1.00 15.82  ? 518  ALA C N   1 
ATOM   10276 C  CA  . ALA C  1 411 ? 8.439   2.597   91.474  1.00 16.67  ? 518  ALA C CA  1 
ATOM   10277 C  C   . ALA C  1 411 ? 7.818   1.747   92.579  1.00 16.91  ? 518  ALA C C   1 
ATOM   10278 O  O   . ALA C  1 411 ? 6.742   1.172   92.400  1.00 16.82  ? 518  ALA C O   1 
ATOM   10279 C  CB  . ALA C  1 411 ? 7.846   3.995   91.518  1.00 14.60  ? 518  ALA C CB  1 
ATOM   10280 N  N   . ARG C  1 412 ? 8.516   1.659   93.710  1.00 16.76  ? 519  ARG C N   1 
ATOM   10281 C  CA  . ARG C  1 412 ? 8.018   0.938   94.881  1.00 17.17  ? 519  ARG C CA  1 
ATOM   10282 C  C   . ARG C  1 412 ? 8.054   1.945   96.036  1.00 17.48  ? 519  ARG C C   1 
ATOM   10283 O  O   . ARG C  1 412 ? 9.072   2.098   96.718  1.00 17.54  ? 519  ARG C O   1 
ATOM   10284 C  CB  . ARG C  1 412 ? 8.911   -0.250  95.209  1.00 16.66  ? 519  ARG C CB  1 
ATOM   10285 C  CG  . ARG C  1 412 ? 8.949   -1.328  94.166  1.00 15.16  ? 519  ARG C CG  1 
ATOM   10286 C  CD  . ARG C  1 412 ? 10.217  -2.131  94.369  1.00 15.91  ? 519  ARG C CD  1 
ATOM   10287 N  NE  . ARG C  1 412 ? 10.046  -3.317  95.196  1.00 15.37  ? 519  ARG C NE  1 
ATOM   10288 C  CZ  . ARG C  1 412 ? 11.033  -3.907  95.860  1.00 16.36  ? 519  ARG C CZ  1 
ATOM   10289 N  NH1 . ARG C  1 412 ? 10.784  -4.994  96.570  1.00 19.12  ? 519  ARG C NH1 1 
ATOM   10290 N  NH2 . ARG C  1 412 ? 12.255  -3.399  95.841  1.00 12.95  ? 519  ARG C NH2 1 
ATOM   10291 N  N   . PRO C  1 413 ? 6.938   2.647   96.263  1.00 17.36  ? 520  PRO C N   1 
ATOM   10292 C  CA  . PRO C  1 413 ? 6.828   3.649   97.320  1.00 18.48  ? 520  PRO C CA  1 
ATOM   10293 C  C   . PRO C  1 413 ? 7.268   3.260   98.724  1.00 18.62  ? 520  PRO C C   1 
ATOM   10294 O  O   . PRO C  1 413 ? 7.617   4.131   99.513  1.00 20.53  ? 520  PRO C O   1 
ATOM   10295 C  CB  . PRO C  1 413 ? 5.356   4.062   97.255  1.00 17.85  ? 520  PRO C CB  1 
ATOM   10296 C  CG  . PRO C  1 413 ? 4.684   2.888   96.665  1.00 17.80  ? 520  PRO C CG  1 
ATOM   10297 C  CD  . PRO C  1 413 ? 5.645   2.474   95.589  1.00 18.29  ? 520  PRO C CD  1 
ATOM   10298 N  N   . HIS C  1 414 ? 7.270   1.973   99.041  1.00 17.88  ? 521  HIS C N   1 
ATOM   10299 C  CA  . HIS C  1 414 ? 7.670   1.544   100.379 1.00 18.04  ? 521  HIS C CA  1 
ATOM   10300 C  C   . HIS C  1 414 ? 9.127   1.158   100.473 1.00 17.86  ? 521  HIS C C   1 
ATOM   10301 O  O   . HIS C  1 414 ? 9.610   0.836   101.555 1.00 17.73  ? 521  HIS C O   1 
ATOM   10302 C  CB  . HIS C  1 414 ? 6.839   0.352   100.838 1.00 18.81  ? 521  HIS C CB  1 
ATOM   10303 C  CG  . HIS C  1 414 ? 5.382   0.640   100.915 1.00 20.47  ? 521  HIS C CG  1 
ATOM   10304 N  ND1 . HIS C  1 414 ? 4.847   1.489   101.856 1.00 22.64  ? 521  HIS C ND1 1 
ATOM   10305 C  CD2 . HIS C  1 414 ? 4.354   0.249   100.128 1.00 22.61  ? 521  HIS C CD2 1 
ATOM   10306 C  CE1 . HIS C  1 414 ? 3.548   1.613   101.643 1.00 22.90  ? 521  HIS C CE1 1 
ATOM   10307 N  NE2 . HIS C  1 414 ? 3.225   0.872   100.600 1.00 23.81  ? 521  HIS C NE2 1 
ATOM   10308 N  N   . ASP C  1 415 ? 9.828   1.180   99.348  1.00 17.52  ? 522  ASP C N   1 
ATOM   10309 C  CA  . ASP C  1 415 ? 11.231  0.796   99.346  1.00 16.91  ? 522  ASP C CA  1 
ATOM   10310 C  C   . ASP C  1 415 ? 12.120  2.010   99.584  1.00 17.58  ? 522  ASP C C   1 
ATOM   10311 O  O   . ASP C  1 415 ? 12.311  2.832   98.690  1.00 16.86  ? 522  ASP C O   1 
ATOM   10312 C  CB  . ASP C  1 415 ? 11.572  0.145   98.011  1.00 15.25  ? 522  ASP C CB  1 
ATOM   10313 C  CG  . ASP C  1 415 ? 12.952  -0.438  97.997  1.00 15.91  ? 522  ASP C CG  1 
ATOM   10314 O  OD1 . ASP C  1 415 ? 13.418  -0.825  96.911  1.00 18.64  ? 522  ASP C OD1 1 
ATOM   10315 O  OD2 . ASP C  1 415 ? 13.576  -0.521  99.074  1.00 17.20  ? 522  ASP C OD2 1 
ATOM   10316 N  N   . TYR C  1 416 ? 12.660  2.121   100.791 1.00 19.00  ? 523  TYR C N   1 
ATOM   10317 C  CA  . TYR C  1 416 ? 13.522  3.247   101.147 1.00 20.60  ? 523  TYR C CA  1 
ATOM   10318 C  C   . TYR C  1 416 ? 14.987  2.846   101.216 1.00 20.10  ? 523  TYR C C   1 
ATOM   10319 O  O   . TYR C  1 416 ? 15.837  3.642   101.612 1.00 21.64  ? 523  TYR C O   1 
ATOM   10320 C  CB  . TYR C  1 416 ? 13.126  3.805   102.505 1.00 23.40  ? 523  TYR C CB  1 
ATOM   10321 C  CG  . TYR C  1 416 ? 11.700  4.280   102.593 1.00 29.00  ? 523  TYR C CG  1 
ATOM   10322 C  CD1 . TYR C  1 416 ? 11.285  5.455   101.954 1.00 30.67  ? 523  TYR C CD1 1 
ATOM   10323 C  CD2 . TYR C  1 416 ? 10.761  3.562   103.339 1.00 32.32  ? 523  TYR C CD2 1 
ATOM   10324 C  CE1 . TYR C  1 416 ? 9.964   5.905   102.062 1.00 34.54  ? 523  TYR C CE1 1 
ATOM   10325 C  CE2 . TYR C  1 416 ? 9.438   3.997   103.454 1.00 35.10  ? 523  TYR C CE2 1 
ATOM   10326 C  CZ  . TYR C  1 416 ? 9.047   5.165   102.817 1.00 36.36  ? 523  TYR C CZ  1 
ATOM   10327 O  OH  . TYR C  1 416 ? 7.736   5.572   102.954 1.00 40.45  ? 523  TYR C OH  1 
ATOM   10328 N  N   . SER C  1 417 ? 15.281  1.613   100.837 1.00 18.57  ? 524  SER C N   1 
ATOM   10329 C  CA  . SER C  1 417 ? 16.644  1.114   100.881 1.00 17.94  ? 524  SER C CA  1 
ATOM   10330 C  C   . SER C  1 417 ? 17.641  2.034   100.196 1.00 18.19  ? 524  SER C C   1 
ATOM   10331 O  O   . SER C  1 417 ? 17.304  2.707   99.221  1.00 20.47  ? 524  SER C O   1 
ATOM   10332 C  CB  . SER C  1 417 ? 16.712  -0.264  100.233 1.00 15.60  ? 524  SER C CB  1 
ATOM   10333 O  OG  . SER C  1 417 ? 18.008  -0.814  100.375 1.00 17.43  ? 524  SER C OG  1 
ATOM   10334 N  N   . ALA C  1 418 ? 18.864  2.059   100.720 1.00 17.78  ? 525  ALA C N   1 
ATOM   10335 C  CA  . ALA C  1 418 ? 19.944  2.865   100.159 1.00 19.34  ? 525  ALA C CA  1 
ATOM   10336 C  C   . ALA C  1 418 ? 21.027  1.898   99.667  1.00 20.56  ? 525  ALA C C   1 
ATOM   10337 O  O   . ALA C  1 418 ? 22.149  2.304   99.346  1.00 21.36  ? 525  ALA C O   1 
ATOM   10338 C  CB  . ALA C  1 418 ? 20.519  3.808   101.217 1.00 16.11  ? 525  ALA C CB  1 
ATOM   10339 N  N   . ASP C  1 419 ? 20.666  0.618   99.609  1.00 21.20  ? 526  ASP C N   1 
ATOM   10340 C  CA  . ASP C  1 419 ? 21.561  -0.449  99.172  1.00 21.75  ? 526  ASP C CA  1 
ATOM   10341 C  C   . ASP C  1 419 ? 21.703  -0.628  97.666  1.00 20.39  ? 526  ASP C C   1 
ATOM   10342 O  O   . ASP C  1 419 ? 22.636  -1.286  97.214  1.00 20.43  ? 526  ASP C O   1 
ATOM   10343 C  CB  . ASP C  1 419 ? 21.104  -1.777  99.760  1.00 26.66  ? 526  ASP C CB  1 
ATOM   10344 C  CG  . ASP C  1 419 ? 21.448  -1.911  101.230 1.00 32.20  ? 526  ASP C CG  1 
ATOM   10345 O  OD1 . ASP C  1 419 ? 20.844  -2.791  101.899 1.00 33.83  ? 526  ASP C OD1 1 
ATOM   10346 O  OD2 . ASP C  1 419 ? 22.329  -1.144  101.704 1.00 33.43  ? 526  ASP C OD2 1 
ATOM   10347 N  N   . GLY C  1 420 ? 20.775  -0.074  96.893  1.00 17.75  ? 527  GLY C N   1 
ATOM   10348 C  CA  . GLY C  1 420 ? 20.848  -0.204  95.448  1.00 16.86  ? 527  GLY C CA  1 
ATOM   10349 C  C   . GLY C  1 420 ? 20.706  -1.636  94.957  1.00 14.98  ? 527  GLY C C   1 
ATOM   10350 O  O   . GLY C  1 420 ? 19.974  -2.423  95.544  1.00 14.55  ? 527  GLY C O   1 
ATOM   10351 N  N   . PHE C  1 421 ? 21.397  -1.965  93.869  1.00 13.38  ? 528  PHE C N   1 
ATOM   10352 C  CA  . PHE C  1 421 ? 21.363  -3.314  93.305  1.00 13.04  ? 528  PHE C CA  1 
ATOM   10353 C  C   . PHE C  1 421 ? 22.781  -3.805  93.055  1.00 13.93  ? 528  PHE C C   1 
ATOM   10354 O  O   . PHE C  1 421 ? 23.639  -3.046  92.617  1.00 15.88  ? 528  PHE C O   1 
ATOM   10355 C  CB  . PHE C  1 421 ? 20.593  -3.346  91.979  1.00 9.70   ? 528  PHE C CB  1 
ATOM   10356 C  CG  . PHE C  1 421 ? 19.133  -3.055  92.116  1.00 5.67   ? 528  PHE C CG  1 
ATOM   10357 C  CD1 . PHE C  1 421 ? 18.641  -1.781  91.869  1.00 4.47   ? 528  PHE C CD1 1 
ATOM   10358 C  CD2 . PHE C  1 421 ? 18.251  -4.049  92.518  1.00 2.67   ? 528  PHE C CD2 1 
ATOM   10359 C  CE1 . PHE C  1 421 ? 17.277  -1.501  92.022  1.00 5.67   ? 528  PHE C CE1 1 
ATOM   10360 C  CE2 . PHE C  1 421 ? 16.897  -3.781  92.672  1.00 2.54   ? 528  PHE C CE2 1 
ATOM   10361 C  CZ  . PHE C  1 421 ? 16.405  -2.510  92.425  1.00 3.38   ? 528  PHE C CZ  1 
ATOM   10362 N  N   . ASN C  1 422 ? 23.033  -5.074  93.339  1.00 14.81  ? 529  ASN C N   1 
ATOM   10363 C  CA  . ASN C  1 422 ? 24.359  -5.629  93.115  1.00 17.53  ? 529  ASN C CA  1 
ATOM   10364 C  C   . ASN C  1 422 ? 24.256  -6.798  92.140  1.00 17.49  ? 529  ASN C C   1 
ATOM   10365 O  O   . ASN C  1 422 ? 23.912  -7.917  92.526  1.00 17.09  ? 529  ASN C O   1 
ATOM   10366 C  CB  . ASN C  1 422 ? 24.998  -6.077  94.443  1.00 18.98  ? 529  ASN C CB  1 
ATOM   10367 C  CG  . ASN C  1 422 ? 26.411  -6.660  94.255  1.00 23.54  ? 529  ASN C CG  1 
ATOM   10368 O  OD1 . ASN C  1 422 ? 27.193  -6.190  93.408  1.00 24.92  ? 529  ASN C OD1 1 
ATOM   10369 N  ND2 . ASN C  1 422 ? 26.747  -7.682  95.054  1.00 24.61  ? 529  ASN C ND2 1 
ATOM   10370 N  N   . ASP C  1 423 ? 24.555  -6.518  90.871  1.00 17.24  ? 530  ASP C N   1 
ATOM   10371 C  CA  . ASP C  1 423 ? 24.485  -7.518  89.813  1.00 16.01  ? 530  ASP C CA  1 
ATOM   10372 C  C   . ASP C  1 423 ? 23.129  -8.210  89.835  1.00 15.36  ? 530  ASP C C   1 
ATOM   10373 O  O   . ASP C  1 423 ? 23.045  -9.438  89.794  1.00 15.39  ? 530  ASP C O   1 
ATOM   10374 C  CB  . ASP C  1 423 ? 25.585  -8.554  89.983  1.00 16.35  ? 530  ASP C CB  1 
ATOM   10375 C  CG  . ASP C  1 423 ? 25.810  -9.360  88.730  1.00 18.30  ? 530  ASP C CG  1 
ATOM   10376 O  OD1 . ASP C  1 423 ? 26.339  -10.489 88.831  1.00 20.85  ? 530  ASP C OD1 1 
ATOM   10377 O  OD2 . ASP C  1 423 ? 25.472  -8.863  87.634  1.00 18.70  ? 530  ASP C OD2 1 
ATOM   10378 N  N   . TRP C  1 424 ? 22.067  -7.418  89.932  1.00 13.70  ? 531  TRP C N   1 
ATOM   10379 C  CA  . TRP C  1 424 ? 20.724  -7.974  89.943  1.00 12.62  ? 531  TRP C CA  1 
ATOM   10380 C  C   . TRP C  1 424 ? 20.294  -8.147  88.491  1.00 13.03  ? 531  TRP C C   1 
ATOM   10381 O  O   . TRP C  1 424 ? 20.347  -7.205  87.690  1.00 12.41  ? 531  TRP C O   1 
ATOM   10382 C  CB  . TRP C  1 424 ? 19.749  -7.047  90.667  1.00 10.52  ? 531  TRP C CB  1 
ATOM   10383 C  CG  . TRP C  1 424 ? 18.416  -7.684  90.852  1.00 8.40   ? 531  TRP C CG  1 
ATOM   10384 C  CD1 . TRP C  1 424 ? 17.255  -7.343  90.233  1.00 8.73   ? 531  TRP C CD1 1 
ATOM   10385 C  CD2 . TRP C  1 424 ? 18.104  -8.791  91.710  1.00 8.11   ? 531  TRP C CD2 1 
ATOM   10386 N  NE1 . TRP C  1 424 ? 16.229  -8.166  90.649  1.00 8.12   ? 531  TRP C NE1 1 
ATOM   10387 C  CE2 . TRP C  1 424 ? 16.725  -9.063  91.557  1.00 8.21   ? 531  TRP C CE2 1 
ATOM   10388 C  CE3 . TRP C  1 424 ? 18.854  -9.579  92.598  1.00 8.00   ? 531  TRP C CE3 1 
ATOM   10389 C  CZ2 . TRP C  1 424 ? 16.080  -10.086 92.260  1.00 7.24   ? 531  TRP C CZ2 1 
ATOM   10390 C  CZ3 . TRP C  1 424 ? 18.210  -10.599 93.303  1.00 4.85   ? 531  TRP C CZ3 1 
ATOM   10391 C  CH2 . TRP C  1 424 ? 16.841  -10.841 93.129  1.00 5.89   ? 531  TRP C CH2 1 
ATOM   10392 N  N   . ALA C  1 425 ? 19.851  -9.352  88.158  1.00 13.69  ? 532  ALA C N   1 
ATOM   10393 C  CA  . ALA C  1 425 ? 19.460  -9.679  86.795  1.00 12.98  ? 532  ALA C CA  1 
ATOM   10394 C  C   . ALA C  1 425 ? 17.999  -9.465  86.476  1.00 13.90  ? 532  ALA C C   1 
ATOM   10395 O  O   . ALA C  1 425 ? 17.249  -10.424 86.429  1.00 15.12  ? 532  ALA C O   1 
ATOM   10396 C  CB  . ALA C  1 425 ? 19.827  -11.119 86.498  1.00 12.69  ? 532  ALA C CB  1 
ATOM   10397 N  N   . PHE C  1 426 ? 17.586  -8.223  86.240  1.00 14.41  ? 533  PHE C N   1 
ATOM   10398 C  CA  . PHE C  1 426 ? 16.189  -7.980  85.901  1.00 13.95  ? 533  PHE C CA  1 
ATOM   10399 C  C   . PHE C  1 426 ? 15.970  -8.762  84.621  1.00 13.44  ? 533  PHE C C   1 
ATOM   10400 O  O   . PHE C  1 426 ? 16.781  -8.667  83.701  1.00 12.48  ? 533  PHE C O   1 
ATOM   10401 C  CB  . PHE C  1 426 ? 15.928  -6.494  85.670  1.00 13.97  ? 533  PHE C CB  1 
ATOM   10402 C  CG  . PHE C  1 426 ? 16.211  -5.639  86.875  1.00 13.64  ? 533  PHE C CG  1 
ATOM   10403 C  CD1 . PHE C  1 426 ? 17.487  -5.119  87.093  1.00 14.64  ? 533  PHE C CD1 1 
ATOM   10404 C  CD2 . PHE C  1 426 ? 15.209  -5.353  87.795  1.00 12.32  ? 533  PHE C CD2 1 
ATOM   10405 C  CE1 . PHE C  1 426 ? 17.754  -4.324  88.214  1.00 13.83  ? 533  PHE C CE1 1 
ATOM   10406 C  CE2 . PHE C  1 426 ? 15.470  -4.557  88.918  1.00 12.28  ? 533  PHE C CE2 1 
ATOM   10407 C  CZ  . PHE C  1 426 ? 16.739  -4.042  89.126  1.00 11.82  ? 533  PHE C CZ  1 
ATOM   10408 N  N   . MET C  1 427 ? 14.892  -9.544  84.570  1.00 12.18  ? 534  MET C N   1 
ATOM   10409 C  CA  . MET C  1 427 ? 14.621  -10.385 83.406  1.00 11.49  ? 534  MET C CA  1 
ATOM   10410 C  C   . MET C  1 427 ? 13.311  -10.044 82.709  1.00 12.32  ? 534  MET C C   1 
ATOM   10411 O  O   . MET C  1 427 ? 12.305  -9.744  83.359  1.00 9.79   ? 534  MET C O   1 
ATOM   10412 C  CB  . MET C  1 427 ? 14.621  -11.860 83.847  1.00 12.42  ? 534  MET C CB  1 
ATOM   10413 C  CG  . MET C  1 427 ? 14.583  -12.917 82.729  1.00 12.79  ? 534  MET C CG  1 
ATOM   10414 S  SD  . MET C  1 427 ? 12.941  -13.220 82.050  1.00 13.45  ? 534  MET C SD  1 
ATOM   10415 C  CE  . MET C  1 427 ? 12.225  -14.340 83.286  1.00 10.84  ? 534  MET C CE  1 
ATOM   10416 N  N   . THR C  1 428 ? 13.331  -10.075 81.378  1.00 13.03  ? 535  THR C N   1 
ATOM   10417 C  CA  . THR C  1 428 ? 12.122  -9.796  80.607  1.00 13.04  ? 535  THR C CA  1 
ATOM   10418 C  C   . THR C  1 428 ? 11.836  -10.910 79.607  1.00 13.01  ? 535  THR C C   1 
ATOM   10419 O  O   . THR C  1 428 ? 12.749  -11.439 78.969  1.00 11.74  ? 535  THR C O   1 
ATOM   10420 C  CB  . THR C  1 428 ? 12.220  -8.451  79.858  1.00 12.92  ? 535  THR C CB  1 
ATOM   10421 O  OG1 . THR C  1 428 ? 11.006  -8.215  79.132  1.00 13.55  ? 535  THR C OG1 1 
ATOM   10422 C  CG2 . THR C  1 428 ? 13.392  -8.453  78.909  1.00 12.52  ? 535  THR C CG2 1 
ATOM   10423 N  N   . THR C  1 429 ? 10.559  -11.274 79.500  1.00 13.82  ? 536  THR C N   1 
ATOM   10424 C  CA  . THR C  1 429 ? 10.119  -12.314 78.578  1.00 13.48  ? 536  THR C CA  1 
ATOM   10425 C  C   . THR C  1 429 ? 9.397   -11.662 77.405  1.00 15.11  ? 536  THR C C   1 
ATOM   10426 O  O   . THR C  1 429 ? 9.010   -12.333 76.447  1.00 16.58  ? 536  THR C O   1 
ATOM   10427 C  CB  . THR C  1 429 ? 9.123   -13.283 79.244  1.00 13.66  ? 536  THR C CB  1 
ATOM   10428 O  OG1 . THR C  1 429 ? 7.987   -12.551 79.718  1.00 12.86  ? 536  THR C OG1 1 
ATOM   10429 C  CG2 . THR C  1 429 ? 9.765   -14.013 80.409  1.00 13.38  ? 536  THR C CG2 1 
ATOM   10430 N  N   . HIS C  1 430 ? 9.230   -10.347 77.477  1.00 14.82  ? 537  HIS C N   1 
ATOM   10431 C  CA  . HIS C  1 430 ? 8.518   -9.607  76.445  1.00 13.81  ? 537  HIS C CA  1 
ATOM   10432 C  C   . HIS C  1 430 ? 9.149   -9.531  75.048  1.00 13.41  ? 537  HIS C C   1 
ATOM   10433 O  O   . HIS C  1 430 ? 8.465   -9.192  74.089  1.00 13.18  ? 537  HIS C O   1 
ATOM   10434 C  CB  . HIS C  1 430 ? 8.204   -8.195  76.952  1.00 13.46  ? 537  HIS C CB  1 
ATOM   10435 C  CG  . HIS C  1 430 ? 7.312   -8.173  78.156  1.00 12.37  ? 537  HIS C CG  1 
ATOM   10436 N  ND1 . HIS C  1 430 ? 6.528   -7.086  78.484  1.00 11.96  ? 537  HIS C ND1 1 
ATOM   10437 C  CD2 . HIS C  1 430 ? 7.070   -9.109  79.106  1.00 11.14  ? 537  HIS C CD2 1 
ATOM   10438 C  CE1 . HIS C  1 430 ? 5.840   -7.357  79.579  1.00 10.69  ? 537  HIS C CE1 1 
ATOM   10439 N  NE2 . HIS C  1 430 ? 6.150   -8.578  79.976  1.00 8.58   ? 537  HIS C NE2 1 
ATOM   10440 N  N   . SER C  1 431 ? 10.434  -9.838  74.917  1.00 13.74  ? 538  SER C N   1 
ATOM   10441 C  CA  . SER C  1 431 ? 11.072  -9.792  73.601  1.00 12.62  ? 538  SER C CA  1 
ATOM   10442 C  C   . SER C  1 431 ? 11.291  -11.197 73.047  1.00 12.82  ? 538  SER C C   1 
ATOM   10443 O  O   . SER C  1 431 ? 12.102  -11.412 72.145  1.00 12.59  ? 538  SER C O   1 
ATOM   10444 C  CB  . SER C  1 431 ? 12.406  -9.058  73.680  1.00 11.69  ? 538  SER C CB  1 
ATOM   10445 O  OG  . SER C  1 431 ? 12.198  -7.664  73.771  1.00 13.47  ? 538  SER C OG  1 
ATOM   10446 N  N   . TRP C  1 432 ? 10.560  -12.153 73.602  1.00 13.55  ? 539  TRP C N   1 
ATOM   10447 C  CA  . TRP C  1 432 ? 10.660  -13.542 73.176  1.00 15.03  ? 539  TRP C CA  1 
ATOM   10448 C  C   . TRP C  1 432 ? 10.470  -13.627 71.663  1.00 15.63  ? 539  TRP C C   1 
ATOM   10449 O  O   . TRP C  1 432 ? 9.510   -13.069 71.127  1.00 13.65  ? 539  TRP C O   1 
ATOM   10450 C  CB  . TRP C  1 432 ? 9.585   -14.369 73.884  1.00 13.54  ? 539  TRP C CB  1 
ATOM   10451 C  CG  . TRP C  1 432 ? 9.838   -15.852 73.884  1.00 14.91  ? 539  TRP C CG  1 
ATOM   10452 C  CD1 . TRP C  1 432 ? 9.544   -16.733 72.887  1.00 14.65  ? 539  TRP C CD1 1 
ATOM   10453 C  CD2 . TRP C  1 432 ? 10.385  -16.637 74.962  1.00 14.64  ? 539  TRP C CD2 1 
ATOM   10454 N  NE1 . TRP C  1 432 ? 9.863   -18.017 73.275  1.00 13.05  ? 539  TRP C NE1 1 
ATOM   10455 C  CE2 . TRP C  1 432 ? 10.379  -17.985 74.542  1.00 14.29  ? 539  TRP C CE2 1 
ATOM   10456 C  CE3 . TRP C  1 432 ? 10.872  -16.329 76.242  1.00 12.87  ? 539  TRP C CE3 1 
ATOM   10457 C  CZ2 . TRP C  1 432 ? 10.840  -19.029 75.359  1.00 15.14  ? 539  TRP C CZ2 1 
ATOM   10458 C  CZ3 . TRP C  1 432 ? 11.331  -17.366 77.053  1.00 13.99  ? 539  TRP C CZ3 1 
ATOM   10459 C  CH2 . TRP C  1 432 ? 11.310  -18.700 76.607  1.00 13.84  ? 539  TRP C CH2 1 
ATOM   10460 N  N   . ASP C  1 433 ? 11.400  -14.314 70.992  1.00 16.18  ? 540  ASP C N   1 
ATOM   10461 C  CA  . ASP C  1 433 ? 11.373  -14.514 69.540  1.00 16.00  ? 540  ASP C CA  1 
ATOM   10462 C  C   . ASP C  1 433 ? 11.812  -13.326 68.686  1.00 16.78  ? 540  ASP C C   1 
ATOM   10463 O  O   . ASP C  1 433 ? 11.861  -13.437 67.463  1.00 18.85  ? 540  ASP C O   1 
ATOM   10464 C  CB  . ASP C  1 433 ? 9.979   -14.995 69.088  1.00 15.76  ? 540  ASP C CB  1 
ATOM   10465 C  CG  . ASP C  1 433 ? 9.800   -16.511 69.235  1.00 16.19  ? 540  ASP C CG  1 
ATOM   10466 O  OD1 . ASP C  1 433 ? 8.665   -16.961 69.483  1.00 15.65  ? 540  ASP C OD1 1 
ATOM   10467 O  OD2 . ASP C  1 433 ? 10.788  -17.264 69.094  1.00 15.33  ? 540  ASP C OD2 1 
ATOM   10468 N  N   . GLU C  1 434 ? 12.133  -12.193 69.305  1.00 16.89  ? 541  GLU C N   1 
ATOM   10469 C  CA  . GLU C  1 434 ? 12.582  -11.040 68.535  1.00 15.98  ? 541  GLU C CA  1 
ATOM   10470 C  C   . GLU C  1 434 ? 14.049  -11.210 68.174  1.00 16.86  ? 541  GLU C C   1 
ATOM   10471 O  O   . GLU C  1 434 ? 14.770  -11.997 68.799  1.00 16.42  ? 541  GLU C O   1 
ATOM   10472 C  CB  . GLU C  1 434 ? 12.460  -9.756  69.342  1.00 16.04  ? 541  GLU C CB  1 
ATOM   10473 C  CG  . GLU C  1 434 ? 11.119  -9.491  69.946  1.00 16.51  ? 541  GLU C CG  1 
ATOM   10474 C  CD  . GLU C  1 434 ? 11.024  -8.070  70.473  1.00 17.85  ? 541  GLU C CD  1 
ATOM   10475 O  OE1 . GLU C  1 434 ? 12.092  -7.469  70.755  1.00