data_1PE0
# 
_entry.id   1PE0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1PE0         
RCSB  RCSB019261   
WWPDB D_1000019261 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1pdv 'CRYSTAL STRUCTURE OF HUMAN DJ-1, P 31 2 1 SPACE GROUP' unspecified 
PDB 1pdw 'CRYSTAL STRUCTURE OF HUMAN DJ-1, P 1 21 1 SPACE GROUP' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1PE0 
_pdbx_database_status.recvd_initial_deposition_date   2003-05-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tao, X.'  1 
'Tong, L.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Crystal Structure of Human DJ-1, a Protein Associated with Early Onset Parkinson's Disease.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            278 
_citation.page_first                31372 
_citation.page_last                 31379 
_citation.year                      2003 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12761214 
_citation.pdbx_database_id_DOI      10.1074/jbc.M304221200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tao, X.'  1 
primary 'Tong, L.' 2 
# 
_cell.entry_id           1PE0 
_cell.length_a           77.706 
_cell.length_b           78.173 
_cell.length_c           63.819 
_cell.angle_alpha        90.00 
_cell.angle_beta         108.88 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1PE0 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man DJ-1  21016.219 2   ? K130R ? ? 
2 water   nat water 18.015    470 ? ?     ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQ
NLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLARDKMMNGGHYTYSENRVEKDGLILTSRGPGT
SFEFALAIVEALNGKEVAAQVKAPLVLKDLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQ
NLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLARDKMMNGGHYTYSENRVEKDGLILTSRGPGT
SFEFALAIVEALNGKEVAAQVKAPLVLKDLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   SER n 
1 4   LYS n 
1 5   ARG n 
1 6   ALA n 
1 7   LEU n 
1 8   VAL n 
1 9   ILE n 
1 10  LEU n 
1 11  ALA n 
1 12  LYS n 
1 13  GLY n 
1 14  ALA n 
1 15  GLU n 
1 16  GLU n 
1 17  MET n 
1 18  GLU n 
1 19  THR n 
1 20  VAL n 
1 21  ILE n 
1 22  PRO n 
1 23  VAL n 
1 24  ASP n 
1 25  VAL n 
1 26  MET n 
1 27  ARG n 
1 28  ARG n 
1 29  ALA n 
1 30  GLY n 
1 31  ILE n 
1 32  LYS n 
1 33  VAL n 
1 34  THR n 
1 35  VAL n 
1 36  ALA n 
1 37  GLY n 
1 38  LEU n 
1 39  ALA n 
1 40  GLY n 
1 41  LYS n 
1 42  ASP n 
1 43  PRO n 
1 44  VAL n 
1 45  GLN n 
1 46  CYS n 
1 47  SER n 
1 48  ARG n 
1 49  ASP n 
1 50  VAL n 
1 51  VAL n 
1 52  ILE n 
1 53  CYS n 
1 54  PRO n 
1 55  ASP n 
1 56  ALA n 
1 57  SER n 
1 58  LEU n 
1 59  GLU n 
1 60  ASP n 
1 61  ALA n 
1 62  LYS n 
1 63  LYS n 
1 64  GLU n 
1 65  GLY n 
1 66  PRO n 
1 67  TYR n 
1 68  ASP n 
1 69  VAL n 
1 70  VAL n 
1 71  VAL n 
1 72  LEU n 
1 73  PRO n 
1 74  GLY n 
1 75  GLY n 
1 76  ASN n 
1 77  LEU n 
1 78  GLY n 
1 79  ALA n 
1 80  GLN n 
1 81  ASN n 
1 82  LEU n 
1 83  SER n 
1 84  GLU n 
1 85  SER n 
1 86  ALA n 
1 87  ALA n 
1 88  VAL n 
1 89  LYS n 
1 90  GLU n 
1 91  ILE n 
1 92  LEU n 
1 93  LYS n 
1 94  GLU n 
1 95  GLN n 
1 96  GLU n 
1 97  ASN n 
1 98  ARG n 
1 99  LYS n 
1 100 GLY n 
1 101 LEU n 
1 102 ILE n 
1 103 ALA n 
1 104 ALA n 
1 105 ILE n 
1 106 CYS n 
1 107 ALA n 
1 108 GLY n 
1 109 PRO n 
1 110 THR n 
1 111 ALA n 
1 112 LEU n 
1 113 LEU n 
1 114 ALA n 
1 115 HIS n 
1 116 GLU n 
1 117 ILE n 
1 118 GLY n 
1 119 PHE n 
1 120 GLY n 
1 121 SER n 
1 122 LYS n 
1 123 VAL n 
1 124 THR n 
1 125 THR n 
1 126 HIS n 
1 127 PRO n 
1 128 LEU n 
1 129 ALA n 
1 130 ARG n 
1 131 ASP n 
1 132 LYS n 
1 133 MET n 
1 134 MET n 
1 135 ASN n 
1 136 GLY n 
1 137 GLY n 
1 138 HIS n 
1 139 TYR n 
1 140 THR n 
1 141 TYR n 
1 142 SER n 
1 143 GLU n 
1 144 ASN n 
1 145 ARG n 
1 146 VAL n 
1 147 GLU n 
1 148 LYS n 
1 149 ASP n 
1 150 GLY n 
1 151 LEU n 
1 152 ILE n 
1 153 LEU n 
1 154 THR n 
1 155 SER n 
1 156 ARG n 
1 157 GLY n 
1 158 PRO n 
1 159 GLY n 
1 160 THR n 
1 161 SER n 
1 162 PHE n 
1 163 GLU n 
1 164 PHE n 
1 165 ALA n 
1 166 LEU n 
1 167 ALA n 
1 168 ILE n 
1 169 VAL n 
1 170 GLU n 
1 171 ALA n 
1 172 LEU n 
1 173 ASN n 
1 174 GLY n 
1 175 LYS n 
1 176 GLU n 
1 177 VAL n 
1 178 ALA n 
1 179 ALA n 
1 180 GLN n 
1 181 VAL n 
1 182 LYS n 
1 183 ALA n 
1 184 PRO n 
1 185 LEU n 
1 186 VAL n 
1 187 LEU n 
1 188 LYS n 
1 189 ASP n 
1 190 LEU n 
1 191 GLU n 
1 192 HIS n 
1 193 HIS n 
1 194 HIS n 
1 195 HIS n 
1 196 HIS n 
1 197 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PARK7_HUMAN 
_struct_ref.pdbx_db_accession          Q99497 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQ
NLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGT
SFEFALAIVEALNGKEVAAQVKAPLVLKD
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1PE0 A 1 ? 189 ? Q99497 1 ? 189 ? 1   189 
2 1 1PE0 B 1 ? 189 ? Q99497 1 ? 189 ? 201 389 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1PE0 ARG A 130 ? UNP Q99497 LYS 130 ENGINEERED       130 1  
1 1PE0 LEU A 190 ? UNP Q99497 ?   ?   'EXPRESSION TAG' 190 2  
1 1PE0 GLU A 191 ? UNP Q99497 ?   ?   'EXPRESSION TAG' 191 3  
1 1PE0 HIS A 192 ? UNP Q99497 ?   ?   'EXPRESSION TAG' 192 4  
1 1PE0 HIS A 193 ? UNP Q99497 ?   ?   'EXPRESSION TAG' 193 5  
1 1PE0 HIS A 194 ? UNP Q99497 ?   ?   'EXPRESSION TAG' 194 6  
1 1PE0 HIS A 195 ? UNP Q99497 ?   ?   'EXPRESSION TAG' 195 7  
1 1PE0 HIS A 196 ? UNP Q99497 ?   ?   'EXPRESSION TAG' 196 8  
1 1PE0 HIS A 197 ? UNP Q99497 ?   ?   'EXPRESSION TAG' 197 9  
2 1PE0 ARG B 130 ? UNP Q99497 LYS 130 ENGINEERED       330 10 
2 1PE0 LEU B 190 ? UNP Q99497 ?   ?   'EXPRESSION TAG' 390 11 
2 1PE0 GLU B 191 ? UNP Q99497 ?   ?   'EXPRESSION TAG' 391 12 
2 1PE0 HIS B 192 ? UNP Q99497 ?   ?   'EXPRESSION TAG' 392 13 
2 1PE0 HIS B 193 ? UNP Q99497 ?   ?   'EXPRESSION TAG' 393 14 
2 1PE0 HIS B 194 ? UNP Q99497 ?   ?   'EXPRESSION TAG' 394 15 
2 1PE0 HIS B 195 ? UNP Q99497 ?   ?   'EXPRESSION TAG' 395 16 
2 1PE0 HIS B 196 ? UNP Q99497 ?   ?   'EXPRESSION TAG' 396 17 
2 1PE0 HIS B 197 ? UNP Q99497 ?   ?   'EXPRESSION TAG' 397 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1PE0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.18 
_exptl_crystal.density_percent_sol   43.60 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'20% PEG3350, 100 mM Bis-tris(7.0), 50 mM CaCl2, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2003-04-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9724 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9724 
# 
_reflns.entry_id                     1PE0 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             20 
_reflns.d_resolution_high            1.7 
_reflns.number_obs                   39841 
_reflns.number_all                   40915 
_reflns.percent_possible_obs         97.8 
_reflns.pdbx_Rmerge_I_obs            0.065 
_reflns.pdbx_Rsym_value              0.065 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        12.2 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.76 
_reflns_shell.percent_possible_all   82.2 
_reflns_shell.Rmerge_I_obs           0.264 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1PE0 
_refine.ls_number_reflns_obs                     36794 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.54 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    92.6 
_refine.ls_R_factor_obs                          0.191 
_refine.ls_R_factor_all                          0.2 
_refine.ls_R_factor_R_work                       0.191 
_refine.ls_R_factor_R_free                       0.231 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.6 
_refine.ls_number_reflns_R_free                  2790 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               18.7 
_refine.aniso_B[1][1]                            -0.39 
_refine.aniso_B[2][2]                            4.75 
_refine.aniso_B[3][3]                            -4.36 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.54 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.330886 
_refine.solvent_model_param_bsol                 44.4516 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1PE0 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.23 
_refine_analyze.Luzzati_sigma_a_free            0.14 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2754 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             470 
_refine_hist.number_atoms_total               3224 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        19.54 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.005 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.8  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.91  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.17  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.77  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.90  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.69  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       1.70 
_refine_ls_shell.d_res_low                        1.76 
_refine_ls_shell.number_reflns_R_work             2945 
_refine_ls_shell.R_factor_R_work                  0.211 
_refine_ls_shell.percent_reflns_obs               80.2 
_refine_ls_shell.R_factor_R_free                  0.249 
_refine_ls_shell.R_factor_R_free_error            0.017 
_refine_ls_shell.percent_reflns_R_free            7.1 
_refine_ls_shell.number_reflns_R_free             226 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1PE0 
_struct.title                     'Crystal structure of the K130R mutant of human DJ-1' 
_struct.pdbx_descriptor           DJ-1 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1PE0 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            'DJ-1, PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 15  ? ALA A 29  ? GLU A 15  ALA A 29  1 ? 15 
HELX_P HELX_P2  2  LEU A 58  ? GLU A 64  ? LEU A 58  GLU A 64  1 ? 7  
HELX_P HELX_P3  3  GLY A 75  ? GLU A 84  ? GLY A 75  GLU A 84  1 ? 10 
HELX_P HELX_P4  4  SER A 85  ? ARG A 98  ? SER A 85  ARG A 98  1 ? 14 
HELX_P HELX_P5  5  PRO A 109 ? HIS A 115 ? PRO A 109 HIS A 115 1 ? 7  
HELX_P HELX_P6  6  HIS A 126 ? LEU A 128 ? HIS A 126 LEU A 128 5 ? 3  
HELX_P HELX_P7  7  ALA A 129 ? MET A 134 ? ALA A 129 MET A 134 1 ? 6  
HELX_P HELX_P8  8  GLY A 157 ? GLY A 159 ? GLY A 157 GLY A 159 5 ? 3  
HELX_P HELX_P9  9  THR A 160 ? GLY A 174 ? THR A 160 GLY A 174 1 ? 15 
HELX_P HELX_P10 10 GLY A 174 ? ALA A 183 ? GLY A 174 ALA A 183 1 ? 10 
HELX_P HELX_P11 11 PRO A 184 ? VAL A 186 ? PRO A 184 VAL A 186 5 ? 3  
HELX_P HELX_P12 12 GLU B 15  ? ALA B 29  ? GLU B 215 ALA B 229 1 ? 15 
HELX_P HELX_P13 13 LEU B 58  ? LYS B 63  ? LEU B 258 LYS B 263 1 ? 6  
HELX_P HELX_P14 14 GLY B 75  ? SER B 85  ? GLY B 275 SER B 285 1 ? 11 
HELX_P HELX_P15 15 SER B 85  ? ARG B 98  ? SER B 285 ARG B 298 1 ? 14 
HELX_P HELX_P16 16 GLY B 108 ? HIS B 115 ? GLY B 308 HIS B 315 1 ? 8  
HELX_P HELX_P17 17 HIS B 126 ? LEU B 128 ? HIS B 326 LEU B 328 5 ? 3  
HELX_P HELX_P18 18 ALA B 129 ? MET B 134 ? ALA B 329 MET B 334 1 ? 6  
HELX_P HELX_P19 19 GLY B 157 ? GLY B 159 ? GLY B 357 GLY B 359 5 ? 3  
HELX_P HELX_P20 20 THR B 160 ? GLY B 174 ? THR B 360 GLY B 374 1 ? 15 
HELX_P HELX_P21 21 GLY B 174 ? ALA B 183 ? GLY B 374 ALA B 383 1 ? 10 
HELX_P HELX_P22 22 PRO B 184 ? VAL B 186 ? PRO B 384 VAL B 386 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 4 ? 
C ? 2 ? 
D ? 7 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? anti-parallel 
E 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 56  ? SER A 57  ? ALA A 56  SER A 57  
A 2 LYS A 32  ? GLY A 37  ? LYS A 32  GLY A 37  
A 3 ARG A 5   ? LEU A 10  ? ARG A 5   LEU A 10  
A 4 VAL A 69  ? LEU A 72  ? VAL A 69  LEU A 72  
A 5 LEU A 101 ? ILE A 105 ? LEU A 101 ILE A 105 
A 6 ILE A 152 ? SER A 155 ? ILE A 152 SER A 155 
A 7 VAL A 146 ? ASP A 149 ? VAL A 146 ASP A 149 
B 1 VAL A 44  ? GLN A 45  ? VAL A 44  GLN A 45  
B 2 VAL A 51  ? CYS A 53  ? VAL A 51  CYS A 53  
B 3 VAL B 51  ? CYS B 53  ? VAL B 251 CYS B 253 
B 4 VAL B 44  ? GLN B 45  ? VAL B 244 GLN B 245 
C 1 LYS A 122 ? VAL A 123 ? LYS A 122 VAL A 123 
C 2 THR A 140 ? TYR A 141 ? THR A 140 TYR A 141 
D 1 ALA B 56  ? SER B 57  ? ALA B 256 SER B 257 
D 2 LYS B 32  ? GLY B 37  ? LYS B 232 GLY B 237 
D 3 ARG B 5   ? LEU B 10  ? ARG B 205 LEU B 210 
D 4 VAL B 69  ? LEU B 72  ? VAL B 269 LEU B 272 
D 5 LEU B 101 ? ILE B 105 ? LEU B 301 ILE B 305 
D 6 ILE B 152 ? SER B 155 ? ILE B 352 SER B 355 
D 7 VAL B 146 ? ASP B 149 ? VAL B 346 ASP B 349 
E 1 LYS B 122 ? VAL B 123 ? LYS B 322 VAL B 323 
E 2 THR B 140 ? TYR B 141 ? THR B 340 TYR B 341 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ALA A 56  ? O ALA A 56  N GLY A 37  ? N GLY A 37  
A 2 3 O ALA A 36  ? O ALA A 36  N LEU A 10  ? N LEU A 10  
A 3 4 N LEU A 7   ? N LEU A 7   O VAL A 71  ? O VAL A 71  
A 4 5 N LEU A 72  ? N LEU A 72  O ALA A 103 ? O ALA A 103 
A 5 6 N ILE A 102 ? N ILE A 102 O LEU A 153 ? O LEU A 153 
A 6 7 O THR A 154 ? O THR A 154 N GLU A 147 ? N GLU A 147 
B 1 2 N VAL A 44  ? N VAL A 44  O ILE A 52  ? O ILE A 52  
B 2 3 N VAL A 51  ? N VAL A 51  O CYS B 53  ? O CYS B 253 
B 3 4 O ILE B 52  ? O ILE B 252 N VAL B 44  ? N VAL B 244 
C 1 2 N VAL A 123 ? N VAL A 123 O THR A 140 ? O THR A 140 
D 1 2 O ALA B 56  ? O ALA B 256 N GLY B 37  ? N GLY B 237 
D 2 3 O ALA B 36  ? O ALA B 236 N LEU B 10  ? N LEU B 210 
D 3 4 N LEU B 7   ? N LEU B 207 O VAL B 71  ? O VAL B 271 
D 4 5 N LEU B 72  ? N LEU B 272 O ALA B 103 ? O ALA B 303 
D 5 6 N ILE B 102 ? N ILE B 302 O LEU B 153 ? O LEU B 353 
D 6 7 O THR B 154 ? O THR B 354 N GLU B 147 ? N GLU B 347 
E 1 2 N VAL B 123 ? N VAL B 323 O THR B 140 ? O THR B 340 
# 
_database_PDB_matrix.entry_id          1PE0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1PE0 
_atom_sites.fract_transf_matrix[1][1]   0.012869 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004401 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012792 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016560 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 2   ? 38.071  13.612  6.741   1.00 32.82 ? 2    ALA A N   1 
ATOM   2    C CA  . ALA A 1 2   ? 36.854  13.636  5.881   1.00 31.63 ? 2    ALA A CA  1 
ATOM   3    C C   . ALA A 1 2   ? 36.008  12.392  6.134   1.00 30.76 ? 2    ALA A C   1 
ATOM   4    O O   . ALA A 1 2   ? 36.460  11.266  5.917   1.00 30.57 ? 2    ALA A O   1 
ATOM   5    C CB  . ALA A 1 2   ? 37.254  13.708  4.411   1.00 32.38 ? 2    ALA A CB  1 
ATOM   6    N N   . SER A 1 3   ? 34.781  12.606  6.596   1.00 28.49 ? 3    SER A N   1 
ATOM   7    C CA  . SER A 1 3   ? 33.865  11.511  6.885   1.00 26.70 ? 3    SER A CA  1 
ATOM   8    C C   . SER A 1 3   ? 33.572  10.685  5.643   1.00 24.19 ? 3    SER A C   1 
ATOM   9    O O   . SER A 1 3   ? 33.463  11.224  4.543   1.00 24.10 ? 3    SER A O   1 
ATOM   10   C CB  . SER A 1 3   ? 32.545  12.057  7.436   1.00 27.61 ? 3    SER A CB  1 
ATOM   11   O OG  . SER A 1 3   ? 32.742  12.731  8.665   1.00 31.43 ? 3    SER A OG  1 
ATOM   12   N N   . LYS A 1 4   ? 33.456  9.373   5.819   1.00 21.53 ? 4    LYS A N   1 
ATOM   13   C CA  . LYS A 1 4   ? 33.131  8.500   4.703   1.00 19.05 ? 4    LYS A CA  1 
ATOM   14   C C   . LYS A 1 4   ? 31.685  8.805   4.321   1.00 17.98 ? 4    LYS A C   1 
ATOM   15   O O   . LYS A 1 4   ? 30.944  9.401   5.106   1.00 15.49 ? 4    LYS A O   1 
ATOM   16   C CB  . LYS A 1 4   ? 33.286  7.031   5.104   1.00 20.50 ? 4    LYS A CB  1 
ATOM   17   C CG  . LYS A 1 4   ? 34.557  6.386   4.579   1.00 24.22 ? 4    LYS A CG  1 
ATOM   18   C CD  . LYS A 1 4   ? 35.794  7.133   5.031   1.00 27.14 ? 4    LYS A CD  1 
ATOM   19   C CE  . LYS A 1 4   ? 37.026  6.650   4.283   1.00 27.63 ? 4    LYS A CE  1 
ATOM   20   N NZ  . LYS A 1 4   ? 37.244  5.190   4.447   1.00 26.47 ? 4    LYS A NZ  1 
ATOM   21   N N   . ARG A 1 5   ? 31.289  8.398   3.120   1.00 15.58 ? 5    ARG A N   1 
ATOM   22   C CA  . ARG A 1 5   ? 29.942  8.658   2.621   1.00 15.64 ? 5    ARG A CA  1 
ATOM   23   C C   . ARG A 1 5   ? 29.224  7.377   2.222   1.00 13.00 ? 5    ARG A C   1 
ATOM   24   O O   . ARG A 1 5   ? 29.840  6.448   1.700   1.00 13.66 ? 5    ARG A O   1 
ATOM   25   C CB  . ARG A 1 5   ? 30.014  9.569   1.397   1.00 20.02 ? 5    ARG A CB  1 
ATOM   26   C CG  . ARG A 1 5   ? 30.672  10.913  1.641   1.00 25.94 ? 5    ARG A CG  1 
ATOM   27   C CD  . ARG A 1 5   ? 29.647  11.945  2.053   1.00 31.58 ? 5    ARG A CD  1 
ATOM   28   N NE  . ARG A 1 5   ? 29.788  13.170  1.272   1.00 36.58 ? 5    ARG A NE  1 
ATOM   29   C CZ  . ARG A 1 5   ? 29.700  13.226  -0.055  1.00 37.66 ? 5    ARG A CZ  1 
ATOM   30   N NH1 . ARG A 1 5   ? 29.471  12.126  -0.758  1.00 39.19 ? 5    ARG A NH1 1 
ATOM   31   N NH2 . ARG A 1 5   ? 29.841  14.387  -0.679  1.00 37.91 ? 5    ARG A NH2 1 
ATOM   32   N N   . ALA A 1 6   ? 27.917  7.341   2.452   1.00 10.18 ? 6    ALA A N   1 
ATOM   33   C CA  . ALA A 1 6   ? 27.118  6.176   2.096   1.00 9.62  ? 6    ALA A CA  1 
ATOM   34   C C   . ALA A 1 6   ? 25.834  6.584   1.385   1.00 9.25  ? 6    ALA A C   1 
ATOM   35   O O   . ALA A 1 6   ? 25.176  7.551   1.771   1.00 10.04 ? 6    ALA A O   1 
ATOM   36   C CB  . ALA A 1 6   ? 26.782  5.364   3.347   1.00 10.21 ? 6    ALA A CB  1 
ATOM   37   N N   . LEU A 1 7   ? 25.494  5.836   0.337   1.00 9.27  ? 7    LEU A N   1 
ATOM   38   C CA  . LEU A 1 7   ? 24.279  6.070   -0.435  1.00 9.87  ? 7    LEU A CA  1 
ATOM   39   C C   . LEU A 1 7   ? 23.324  4.907   -0.173  1.00 10.09 ? 7    LEU A C   1 
ATOM   40   O O   . LEU A 1 7   ? 23.668  3.749   -0.424  1.00 10.58 ? 7    LEU A O   1 
ATOM   41   C CB  . LEU A 1 7   ? 24.598  6.132   -1.936  1.00 9.90  ? 7    LEU A CB  1 
ATOM   42   C CG  . LEU A 1 7   ? 23.398  6.260   -2.884  1.00 11.03 ? 7    LEU A CG  1 
ATOM   43   C CD1 . LEU A 1 7   ? 22.792  7.660   -2.756  1.00 13.41 ? 7    LEU A CD1 1 
ATOM   44   C CD2 . LEU A 1 7   ? 23.836  5.993   -4.323  1.00 10.38 ? 7    LEU A CD2 1 
ATOM   45   N N   . VAL A 1 8   ? 22.138  5.214   0.347   1.00 9.85  ? 8    VAL A N   1 
ATOM   46   C CA  . VAL A 1 8   ? 21.123  4.195   0.614   1.00 8.61  ? 8    VAL A CA  1 
ATOM   47   C C   . VAL A 1 8   ? 19.968  4.448   -0.350  1.00 9.82  ? 8    VAL A C   1 
ATOM   48   O O   . VAL A 1 8   ? 19.275  5.461   -0.242  1.00 9.81  ? 8    VAL A O   1 
ATOM   49   C CB  . VAL A 1 8   ? 20.590  4.276   2.067   1.00 8.80  ? 8    VAL A CB  1 
ATOM   50   C CG1 . VAL A 1 8   ? 19.531  3.208   2.297   1.00 7.23  ? 8    VAL A CG1 1 
ATOM   51   C CG2 . VAL A 1 8   ? 21.725  4.091   3.054   1.00 5.85  ? 8    VAL A CG2 1 
ATOM   52   N N   . ILE A 1 9   ? 19.766  3.537   -1.296  1.00 8.85  ? 9    ILE A N   1 
ATOM   53   C CA  . ILE A 1 9   ? 18.699  3.700   -2.274  1.00 9.55  ? 9    ILE A CA  1 
ATOM   54   C C   . ILE A 1 9   ? 17.387  3.152   -1.735  1.00 10.67 ? 9    ILE A C   1 
ATOM   55   O O   . ILE A 1 9   ? 17.246  1.949   -1.471  1.00 11.43 ? 9    ILE A O   1 
ATOM   56   C CB  . ILE A 1 9   ? 19.053  3.022   -3.612  1.00 8.79  ? 9    ILE A CB  1 
ATOM   57   C CG1 . ILE A 1 9   ? 20.449  3.469   -4.059  1.00 8.89  ? 9    ILE A CG1 1 
ATOM   58   C CG2 . ILE A 1 9   ? 18.033  3.412   -4.672  1.00 7.34  ? 9    ILE A CG2 1 
ATOM   59   C CD1 . ILE A 1 9   ? 20.924  2.870   -5.376  1.00 8.73  ? 9    ILE A CD1 1 
ATOM   60   N N   . LEU A 1 10  ? 16.434  4.066   -1.579  1.00 10.96 ? 10   LEU A N   1 
ATOM   61   C CA  . LEU A 1 10  ? 15.114  3.776   -1.039  1.00 10.50 ? 10   LEU A CA  1 
ATOM   62   C C   . LEU A 1 10  ? 14.011  3.788   -2.093  1.00 11.01 ? 10   LEU A C   1 
ATOM   63   O O   . LEU A 1 10  ? 13.652  4.839   -2.633  1.00 11.53 ? 10   LEU A O   1 
ATOM   64   C CB  . LEU A 1 10  ? 14.790  4.790   0.061   1.00 8.95  ? 10   LEU A CB  1 
ATOM   65   C CG  . LEU A 1 10  ? 13.393  4.750   0.684   1.00 10.65 ? 10   LEU A CG  1 
ATOM   66   C CD1 . LEU A 1 10  ? 13.133  3.371   1.291   1.00 11.61 ? 10   LEU A CD1 1 
ATOM   67   C CD2 . LEU A 1 10  ? 13.282  5.831   1.748   1.00 10.98 ? 10   LEU A CD2 1 
ATOM   68   N N   . ALA A 1 11  ? 13.475  2.606   -2.367  1.00 8.69  ? 11   ALA A N   1 
ATOM   69   C CA  . ALA A 1 11  ? 12.410  2.439   -3.346  1.00 10.69 ? 11   ALA A CA  1 
ATOM   70   C C   . ALA A 1 11  ? 11.124  2.045   -2.640  1.00 12.03 ? 11   ALA A C   1 
ATOM   71   O O   . ALA A 1 11  ? 11.152  1.524   -1.525  1.00 12.43 ? 11   ALA A O   1 
ATOM   72   C CB  . ALA A 1 11  ? 12.796  1.360   -4.355  1.00 12.24 ? 11   ALA A CB  1 
ATOM   73   N N   . LYS A 1 12  ? 9.991   2.296   -3.289  1.00 12.88 ? 12   LYS A N   1 
ATOM   74   C CA  . LYS A 1 12  ? 8.708   1.937   -2.707  1.00 13.32 ? 12   LYS A CA  1 
ATOM   75   C C   . LYS A 1 12  ? 8.708   0.430   -2.452  1.00 12.44 ? 12   LYS A C   1 
ATOM   76   O O   . LYS A 1 12  ? 9.172   -0.348  -3.286  1.00 11.52 ? 12   LYS A O   1 
ATOM   77   C CB  . LYS A 1 12  ? 7.564   2.305   -3.662  1.00 14.07 ? 12   LYS A CB  1 
ATOM   78   C CG  . LYS A 1 12  ? 6.182   2.129   -3.053  1.00 18.93 ? 12   LYS A CG  1 
ATOM   79   C CD  . LYS A 1 12  ? 5.088   2.687   -3.955  1.00 21.37 ? 12   LYS A CD  1 
ATOM   80   C CE  . LYS A 1 12  ? 3.714   2.515   -3.320  1.00 22.26 ? 12   LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 12  ? 3.369   1.078   -3.110  1.00 23.27 ? 12   LYS A NZ  1 
ATOM   82   N N   . GLY A 1 13  ? 8.210   0.027   -1.286  1.00 12.13 ? 13   GLY A N   1 
ATOM   83   C CA  . GLY A 1 13  ? 8.164   -1.385  -0.949  1.00 9.67  ? 13   GLY A CA  1 
ATOM   84   C C   . GLY A 1 13  ? 9.405   -1.880  -0.226  1.00 9.37  ? 13   GLY A C   1 
ATOM   85   O O   . GLY A 1 13  ? 9.512   -3.065  0.093   1.00 8.61  ? 13   GLY A O   1 
ATOM   86   N N   . ALA A 1 14  ? 10.349  -0.981  0.035   1.00 8.48  ? 14   ALA A N   1 
ATOM   87   C CA  . ALA A 1 14  ? 11.578  -1.367  0.727   1.00 9.12  ? 14   ALA A CA  1 
ATOM   88   C C   . ALA A 1 14  ? 11.243  -1.784  2.149   1.00 8.83  ? 14   ALA A C   1 
ATOM   89   O O   . ALA A 1 14  ? 10.291  -1.271  2.740   1.00 10.74 ? 14   ALA A O   1 
ATOM   90   C CB  . ALA A 1 14  ? 12.560  -0.203  0.749   1.00 9.00  ? 14   ALA A CB  1 
ATOM   91   N N   . GLU A 1 15  ? 12.006  -2.726  2.697   1.00 8.65  ? 15   GLU A N   1 
ATOM   92   C CA  . GLU A 1 15  ? 11.771  -3.167  4.067   1.00 8.61  ? 15   GLU A CA  1 
ATOM   93   C C   . GLU A 1 15  ? 12.281  -2.027  4.947   1.00 9.87  ? 15   GLU A C   1 
ATOM   94   O O   . GLU A 1 15  ? 13.480  -1.738  4.965   1.00 9.66  ? 15   GLU A O   1 
ATOM   95   C CB  . GLU A 1 15  ? 12.537  -4.461  4.351   1.00 10.00 ? 15   GLU A CB  1 
ATOM   96   C CG  . GLU A 1 15  ? 11.725  -5.461  5.158   1.00 11.99 ? 15   GLU A CG  1 
ATOM   97   C CD  . GLU A 1 15  ? 11.317  -4.910  6.508   1.00 12.66 ? 15   GLU A CD  1 
ATOM   98   O OE1 . GLU A 1 15  ? 10.228  -5.275  7.001   1.00 11.89 ? 15   GLU A OE1 1 
ATOM   99   O OE2 . GLU A 1 15  ? 12.088  -4.115  7.082   1.00 10.93 ? 15   GLU A OE2 1 
ATOM   100  N N   . GLU A 1 16  ? 11.372  -1.375  5.664   1.00 6.91  ? 16   GLU A N   1 
ATOM   101  C CA  . GLU A 1 16  ? 11.749  -0.232  6.490   1.00 7.98  ? 16   GLU A CA  1 
ATOM   102  C C   . GLU A 1 16  ? 12.778  -0.501  7.580   1.00 8.71  ? 16   GLU A C   1 
ATOM   103  O O   . GLU A 1 16  ? 13.606  0.360   7.872   1.00 8.20  ? 16   GLU A O   1 
ATOM   104  C CB  . GLU A 1 16  ? 10.508  0.438   7.094   1.00 8.33  ? 16   GLU A CB  1 
ATOM   105  C CG  . GLU A 1 16  ? 9.475   -0.495  7.695   1.00 9.22  ? 16   GLU A CG  1 
ATOM   106  C CD  . GLU A 1 16  ? 8.457   -0.975  6.677   1.00 12.50 ? 16   GLU A CD  1 
ATOM   107  O OE1 . GLU A 1 16  ? 8.795   -1.844  5.844   1.00 11.07 ? 16   GLU A OE1 1 
ATOM   108  O OE2 . GLU A 1 16  ? 7.314   -0.472  6.707   1.00 13.43 ? 16   GLU A OE2 1 
ATOM   109  N N   . MET A 1 17  ? 12.739  -1.683  8.182   1.00 7.47  ? 17   MET A N   1 
ATOM   110  C CA  . MET A 1 17  ? 13.716  -2.005  9.218   1.00 7.77  ? 17   MET A CA  1 
ATOM   111  C C   . MET A 1 17  ? 15.101  -2.128  8.589   1.00 7.75  ? 17   MET A C   1 
ATOM   112  O O   . MET A 1 17  ? 16.096  -1.632  9.129   1.00 7.58  ? 17   MET A O   1 
ATOM   113  C CB  . MET A 1 17  ? 13.357  -3.322  9.905   1.00 7.30  ? 17   MET A CB  1 
ATOM   114  C CG  . MET A 1 17  ? 12.028  -3.296  10.624  1.00 8.36  ? 17   MET A CG  1 
ATOM   115  S SD  . MET A 1 17  ? 11.811  -4.758  11.632  1.00 11.74 ? 17   MET A SD  1 
ATOM   116  C CE  . MET A 1 17  ? 11.470  -5.986  10.379  1.00 12.29 ? 17   MET A CE  1 
ATOM   117  N N   . GLU A 1 18  ? 15.154  -2.798  7.443   1.00 8.03  ? 18   GLU A N   1 
ATOM   118  C CA  . GLU A 1 18  ? 16.407  -3.002  6.726   1.00 9.19  ? 18   GLU A CA  1 
ATOM   119  C C   . GLU A 1 18  ? 16.940  -1.702  6.138   1.00 8.55  ? 18   GLU A C   1 
ATOM   120  O O   . GLU A 1 18  ? 18.077  -1.637  5.672   1.00 8.94  ? 18   GLU A O   1 
ATOM   121  C CB  . GLU A 1 18  ? 16.210  -4.040  5.621   1.00 8.14  ? 18   GLU A CB  1 
ATOM   122  C CG  . GLU A 1 18  ? 15.871  -5.425  6.146   1.00 9.34  ? 18   GLU A CG  1 
ATOM   123  C CD  . GLU A 1 18  ? 15.465  -6.384  5.044   1.00 8.96  ? 18   GLU A CD  1 
ATOM   124  O OE1 . GLU A 1 18  ? 15.771  -6.105  3.873   1.00 9.58  ? 18   GLU A OE1 1 
ATOM   125  O OE2 . GLU A 1 18  ? 14.848  -7.425  5.349   1.00 12.36 ? 18   GLU A OE2 1 
ATOM   126  N N   . THR A 1 19  ? 16.109  -0.666  6.156   1.00 7.74  ? 19   THR A N   1 
ATOM   127  C CA  . THR A 1 19  ? 16.510  0.637   5.653   1.00 7.59  ? 19   THR A CA  1 
ATOM   128  C C   . THR A 1 19  ? 17.006  1.493   6.816   1.00 6.45  ? 19   THR A C   1 
ATOM   129  O O   . THR A 1 19  ? 18.115  2.022   6.785   1.00 7.87  ? 19   THR A O   1 
ATOM   130  C CB  . THR A 1 19  ? 15.325  1.356   4.984   1.00 8.35  ? 19   THR A CB  1 
ATOM   131  O OG1 . THR A 1 19  ? 14.902  0.603   3.843   1.00 9.78  ? 19   THR A OG1 1 
ATOM   132  C CG2 . THR A 1 19  ? 15.720  2.766   4.549   1.00 8.63  ? 19   THR A CG2 1 
ATOM   133  N N   . VAL A 1 20  ? 16.186  1.596   7.852   1.00 6.03  ? 20   VAL A N   1 
ATOM   134  C CA  . VAL A 1 20  ? 16.505  2.413   9.012   1.00 6.76  ? 20   VAL A CA  1 
ATOM   135  C C   . VAL A 1 20  ? 17.676  1.957   9.872   1.00 5.79  ? 20   VAL A C   1 
ATOM   136  O O   . VAL A 1 20  ? 18.467  2.780   10.328  1.00 6.64  ? 20   VAL A O   1 
ATOM   137  C CB  . VAL A 1 20  ? 15.257  2.585   9.907   1.00 7.32  ? 20   VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 20  ? 15.632  3.261   11.223  1.00 10.02 ? 20   VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 20  ? 14.218  3.421   9.164   1.00 9.27  ? 20   VAL A CG2 1 
ATOM   140  N N   . ILE A 1 21  ? 17.799  0.655   10.096  1.00 6.77  ? 21   ILE A N   1 
ATOM   141  C CA  . ILE A 1 21  ? 18.887  0.169   10.930  1.00 6.26  ? 21   ILE A CA  1 
ATOM   142  C C   . ILE A 1 21  ? 20.258  0.510   10.340  1.00 6.49  ? 21   ILE A C   1 
ATOM   143  O O   . ILE A 1 21  ? 21.128  1.013   11.051  1.00 7.66  ? 21   ILE A O   1 
ATOM   144  C CB  . ILE A 1 21  ? 18.744  -1.352  11.189  1.00 6.41  ? 21   ILE A CB  1 
ATOM   145  C CG1 . ILE A 1 21  ? 17.511  -1.598  12.067  1.00 8.93  ? 21   ILE A CG1 1 
ATOM   146  C CG2 . ILE A 1 21  ? 19.994  -1.894  11.877  1.00 7.77  ? 21   ILE A CG2 1 
ATOM   147  C CD1 . ILE A 1 21  ? 17.108  -3.054  12.189  1.00 9.28  ? 21   ILE A CD1 1 
ATOM   148  N N   . PRO A 1 22  ? 20.476  0.244   9.038   1.00 7.52  ? 22   PRO A N   1 
ATOM   149  C CA  . PRO A 1 22  ? 21.782  0.574   8.458   1.00 8.12  ? 22   PRO A CA  1 
ATOM   150  C C   . PRO A 1 22  ? 22.034  2.080   8.447   1.00 8.56  ? 22   PRO A C   1 
ATOM   151  O O   . PRO A 1 22  ? 23.145  2.532   8.716   1.00 7.80  ? 22   PRO A O   1 
ATOM   152  C CB  . PRO A 1 22  ? 21.695  0.003   7.049   1.00 8.28  ? 22   PRO A CB  1 
ATOM   153  C CG  . PRO A 1 22  ? 20.792  -1.174  7.222   1.00 8.75  ? 22   PRO A CG  1 
ATOM   154  C CD  . PRO A 1 22  ? 19.711  -0.632  8.130   1.00 6.07  ? 22   PRO A CD  1 
ATOM   155  N N   . VAL A 1 23  ? 21.002  2.856   8.133   1.00 7.84  ? 23   VAL A N   1 
ATOM   156  C CA  . VAL A 1 23  ? 21.151  4.310   8.104   1.00 6.84  ? 23   VAL A CA  1 
ATOM   157  C C   . VAL A 1 23  ? 21.521  4.845   9.486   1.00 7.63  ? 23   VAL A C   1 
ATOM   158  O O   . VAL A 1 23  ? 22.479  5.609   9.639   1.00 7.31  ? 23   VAL A O   1 
ATOM   159  C CB  . VAL A 1 23  ? 19.850  5.001   7.640   1.00 6.08  ? 23   VAL A CB  1 
ATOM   160  C CG1 . VAL A 1 23  ? 19.982  6.513   7.799   1.00 4.69  ? 23   VAL A CG1 1 
ATOM   161  C CG2 . VAL A 1 23  ? 19.564  4.649   6.189   1.00 7.45  ? 23   VAL A CG2 1 
ATOM   162  N N   . ASP A 1 24  ? 20.751  4.436   10.489  1.00 6.74  ? 24   ASP A N   1 
ATOM   163  C CA  . ASP A 1 24  ? 20.968  4.856   11.866  1.00 7.01  ? 24   ASP A CA  1 
ATOM   164  C C   . ASP A 1 24  ? 22.364  4.453   12.337  1.00 7.96  ? 24   ASP A C   1 
ATOM   165  O O   . ASP A 1 24  ? 23.154  5.285   12.785  1.00 9.12  ? 24   ASP A O   1 
ATOM   166  C CB  . ASP A 1 24  ? 19.908  4.203   12.754  1.00 8.17  ? 24   ASP A CB  1 
ATOM   167  C CG  . ASP A 1 24  ? 19.892  4.748   14.168  1.00 7.08  ? 24   ASP A CG  1 
ATOM   168  O OD1 . ASP A 1 24  ? 20.971  4.911   14.772  1.00 7.20  ? 24   ASP A OD1 1 
ATOM   169  O OD2 . ASP A 1 24  ? 18.782  4.989   14.686  1.00 9.40  ? 24   ASP A OD2 1 
ATOM   170  N N   . VAL A 1 25  ? 22.672  3.164   12.230  1.00 7.46  ? 25   VAL A N   1 
ATOM   171  C CA  . VAL A 1 25  ? 23.971  2.674   12.664  1.00 6.42  ? 25   VAL A CA  1 
ATOM   172  C C   . VAL A 1 25  ? 25.144  3.352   11.951  1.00 6.61  ? 25   VAL A C   1 
ATOM   173  O O   . VAL A 1 25  ? 26.132  3.706   12.592  1.00 7.98  ? 25   VAL A O   1 
ATOM   174  C CB  . VAL A 1 25  ? 24.047  1.141   12.508  1.00 5.90  ? 25   VAL A CB  1 
ATOM   175  C CG1 . VAL A 1 25  ? 25.456  0.639   12.815  1.00 7.84  ? 25   VAL A CG1 1 
ATOM   176  C CG2 . VAL A 1 25  ? 23.048  0.494   13.461  1.00 7.90  ? 25   VAL A CG2 1 
ATOM   177  N N   . MET A 1 26  ? 25.044  3.550   10.641  1.00 6.74  ? 26   MET A N   1 
ATOM   178  C CA  . MET A 1 26  ? 26.131  4.208   9.923   1.00 7.11  ? 26   MET A CA  1 
ATOM   179  C C   . MET A 1 26  ? 26.309  5.650   10.397  1.00 7.28  ? 26   MET A C   1 
ATOM   180  O O   . MET A 1 26  ? 27.437  6.133   10.511  1.00 7.94  ? 26   MET A O   1 
ATOM   181  C CB  . MET A 1 26  ? 25.888  4.184   8.413   1.00 7.04  ? 26   MET A CB  1 
ATOM   182  C CG  . MET A 1 26  ? 26.085  2.812   7.793   1.00 5.21  ? 26   MET A CG  1 
ATOM   183  S SD  . MET A 1 26  ? 26.088  2.837   6.002   1.00 8.08  ? 26   MET A SD  1 
ATOM   184  C CE  . MET A 1 26  ? 24.393  3.141   5.682   1.00 5.21  ? 26   MET A CE  1 
ATOM   185  N N   . ARG A 1 27  ? 25.204  6.334   10.670  1.00 8.81  ? 27   ARG A N   1 
ATOM   186  C CA  . ARG A 1 27  ? 25.286  7.711   11.143  1.00 9.01  ? 27   ARG A CA  1 
ATOM   187  C C   . ARG A 1 27  ? 25.909  7.756   12.535  1.00 11.48 ? 27   ARG A C   1 
ATOM   188  O O   . ARG A 1 27  ? 26.610  8.706   12.878  1.00 9.40  ? 27   ARG A O   1 
ATOM   189  C CB  . ARG A 1 27  ? 23.902  8.373   11.128  1.00 10.76 ? 27   ARG A CB  1 
ATOM   190  C CG  . ARG A 1 27  ? 23.469  8.756   9.717   1.00 7.18  ? 27   ARG A CG  1 
ATOM   191  C CD  . ARG A 1 27  ? 22.131  9.480   9.657   1.00 9.27  ? 27   ARG A CD  1 
ATOM   192  N NE  . ARG A 1 27  ? 21.906  9.998   8.308   1.00 7.11  ? 27   ARG A NE  1 
ATOM   193  C CZ  . ARG A 1 27  ? 20.711  10.224  7.773   1.00 6.92  ? 27   ARG A CZ  1 
ATOM   194  N NH1 . ARG A 1 27  ? 19.606  9.982   8.464   1.00 7.65  ? 27   ARG A NH1 1 
ATOM   195  N NH2 . ARG A 1 27  ? 20.625  10.674  6.529   1.00 9.70  ? 27   ARG A NH2 1 
ATOM   196  N N   . ARG A 1 28  ? 25.673  6.714   13.331  1.00 9.36  ? 28   ARG A N   1 
ATOM   197  C CA  . ARG A 1 28  ? 26.256  6.653   14.666  1.00 8.64  ? 28   ARG A CA  1 
ATOM   198  C C   . ARG A 1 28  ? 27.774  6.553   14.538  1.00 10.50 ? 28   ARG A C   1 
ATOM   199  O O   . ARG A 1 28  ? 28.510  7.046   15.394  1.00 10.56 ? 28   ARG A O   1 
ATOM   200  C CB  . ARG A 1 28  ? 25.721  5.436   15.439  1.00 8.70  ? 28   ARG A CB  1 
ATOM   201  C CG  . ARG A 1 28  ? 24.301  5.597   15.955  1.00 8.46  ? 28   ARG A CG  1 
ATOM   202  C CD  . ARG A 1 28  ? 23.795  4.318   16.627  1.00 8.19  ? 28   ARG A CD  1 
ATOM   203  N NE  . ARG A 1 28  ? 22.442  4.487   17.151  1.00 5.96  ? 28   ARG A NE  1 
ATOM   204  C CZ  . ARG A 1 28  ? 22.109  4.381   18.434  1.00 8.72  ? 28   ARG A CZ  1 
ATOM   205  N NH1 . ARG A 1 28  ? 23.030  4.105   19.347  1.00 11.07 ? 28   ARG A NH1 1 
ATOM   206  N NH2 . ARG A 1 28  ? 20.850  4.557   18.806  1.00 9.62  ? 28   ARG A NH2 1 
ATOM   207  N N   . ALA A 1 29  ? 28.234  5.927   13.456  1.00 9.61  ? 29   ALA A N   1 
ATOM   208  C CA  . ALA A 1 29  ? 29.663  5.745   13.204  1.00 11.01 ? 29   ALA A CA  1 
ATOM   209  C C   . ALA A 1 29  ? 30.324  6.978   12.588  1.00 12.19 ? 29   ALA A C   1 
ATOM   210  O O   . ALA A 1 29  ? 31.517  6.961   12.280  1.00 13.58 ? 29   ALA A O   1 
ATOM   211  C CB  . ALA A 1 29  ? 29.879  4.539   12.296  1.00 11.13 ? 29   ALA A CB  1 
ATOM   212  N N   . GLY A 1 30  ? 29.552  8.040   12.402  1.00 12.34 ? 30   GLY A N   1 
ATOM   213  C CA  . GLY A 1 30  ? 30.111  9.249   11.827  1.00 12.84 ? 30   GLY A CA  1 
ATOM   214  C C   . GLY A 1 30  ? 30.152  9.238   10.312  1.00 13.05 ? 30   GLY A C   1 
ATOM   215  O O   . GLY A 1 30  ? 30.851  10.043  9.699   1.00 12.96 ? 30   GLY A O   1 
ATOM   216  N N   . ILE A 1 31  ? 29.410  8.318   9.705   1.00 10.65 ? 31   ILE A N   1 
ATOM   217  C CA  . ILE A 1 31  ? 29.356  8.230   8.255   1.00 10.77 ? 31   ILE A CA  1 
ATOM   218  C C   . ILE A 1 31  ? 28.255  9.156   7.767   1.00 10.24 ? 31   ILE A C   1 
ATOM   219  O O   . ILE A 1 31  ? 27.165  9.197   8.347   1.00 9.69  ? 31   ILE A O   1 
ATOM   220  C CB  . ILE A 1 31  ? 29.040  6.792   7.790   1.00 10.05 ? 31   ILE A CB  1 
ATOM   221  C CG1 . ILE A 1 31  ? 30.181  5.860   8.197   1.00 11.25 ? 31   ILE A CG1 1 
ATOM   222  C CG2 . ILE A 1 31  ? 28.829  6.759   6.276   1.00 10.29 ? 31   ILE A CG2 1 
ATOM   223  C CD1 . ILE A 1 31  ? 29.888  4.391   7.959   1.00 12.33 ? 31   ILE A CD1 1 
ATOM   224  N N   . LYS A 1 32  ? 28.556  9.922   6.722   1.00 11.93 ? 32   LYS A N   1 
ATOM   225  C CA  . LYS A 1 32  ? 27.580  10.831  6.141   1.00 13.85 ? 32   LYS A CA  1 
ATOM   226  C C   . LYS A 1 32  ? 26.701  9.979   5.245   1.00 11.74 ? 32   LYS A C   1 
ATOM   227  O O   . LYS A 1 32  ? 27.141  9.511   4.197   1.00 12.17 ? 32   LYS A O   1 
ATOM   228  C CB  . LYS A 1 32  ? 28.268  11.911  5.304   1.00 17.15 ? 32   LYS A CB  1 
ATOM   229  C CG  . LYS A 1 32  ? 29.129  12.867  6.108   1.00 24.19 ? 32   LYS A CG  1 
ATOM   230  C CD  . LYS A 1 32  ? 29.813  13.895  5.213   1.00 28.94 ? 32   LYS A CD  1 
ATOM   231  C CE  . LYS A 1 32  ? 28.801  14.785  4.494   1.00 32.72 ? 32   LYS A CE  1 
ATOM   232  N NZ  . LYS A 1 32  ? 29.466  15.765  3.582   1.00 35.00 ? 32   LYS A NZ  1 
ATOM   233  N N   . VAL A 1 33  ? 25.459  9.779   5.663   1.00 10.38 ? 33   VAL A N   1 
ATOM   234  C CA  . VAL A 1 33  ? 24.535  8.955   4.905   1.00 9.19  ? 33   VAL A CA  1 
ATOM   235  C C   . VAL A 1 33  ? 23.510  9.783   4.149   1.00 10.45 ? 33   VAL A C   1 
ATOM   236  O O   . VAL A 1 33  ? 22.980  10.764  4.671   1.00 10.52 ? 33   VAL A O   1 
ATOM   237  C CB  . VAL A 1 33  ? 23.776  7.984   5.843   1.00 9.18  ? 33   VAL A CB  1 
ATOM   238  C CG1 . VAL A 1 33  ? 22.836  7.095   5.035   1.00 11.37 ? 33   VAL A CG1 1 
ATOM   239  C CG2 . VAL A 1 33  ? 24.762  7.145   6.632   1.00 8.52  ? 33   VAL A CG2 1 
ATOM   240  N N   . THR A 1 34  ? 23.247  9.396   2.907   1.00 9.67  ? 34   THR A N   1 
ATOM   241  C CA  . THR A 1 34  ? 22.241  10.072  2.110   1.00 10.12 ? 34   THR A CA  1 
ATOM   242  C C   . THR A 1 34  ? 21.191  9.048   1.695   1.00 12.05 ? 34   THR A C   1 
ATOM   243  O O   . THR A 1 34  ? 21.485  8.107   0.950   1.00 10.69 ? 34   THR A O   1 
ATOM   244  C CB  . THR A 1 34  ? 22.827  10.721  0.837   1.00 10.19 ? 34   THR A CB  1 
ATOM   245  O OG1 . THR A 1 34  ? 23.719  11.781  1.200   1.00 11.25 ? 34   THR A OG1 1 
ATOM   246  C CG2 . THR A 1 34  ? 21.710  11.285  -0.023  1.00 11.63 ? 34   THR A CG2 1 
ATOM   247  N N   . VAL A 1 35  ? 19.979  9.222   2.208   1.00 12.21 ? 35   VAL A N   1 
ATOM   248  C CA  . VAL A 1 35  ? 18.869  8.338   1.878   1.00 12.16 ? 35   VAL A CA  1 
ATOM   249  C C   . VAL A 1 35  ? 18.296  8.932   0.597   1.00 13.87 ? 35   VAL A C   1 
ATOM   250  O O   . VAL A 1 35  ? 17.709  10.014  0.615   1.00 13.12 ? 35   VAL A O   1 
ATOM   251  C CB  . VAL A 1 35  ? 17.805  8.333   3.006   1.00 13.40 ? 35   VAL A CB  1 
ATOM   252  C CG1 . VAL A 1 35  ? 16.613  7.476   2.609   1.00 12.45 ? 35   VAL A CG1 1 
ATOM   253  C CG2 . VAL A 1 35  ? 18.425  7.799   4.293   1.00 13.00 ? 35   VAL A CG2 1 
ATOM   254  N N   . ALA A 1 36  ? 18.502  8.226   -0.512  1.00 13.28 ? 36   ALA A N   1 
ATOM   255  C CA  . ALA A 1 36  ? 18.058  8.681   -1.824  1.00 12.53 ? 36   ALA A CA  1 
ATOM   256  C C   . ALA A 1 36  ? 16.828  7.944   -2.331  1.00 12.80 ? 36   ALA A C   1 
ATOM   257  O O   . ALA A 1 36  ? 16.824  6.718   -2.445  1.00 13.40 ? 36   ALA A O   1 
ATOM   258  C CB  . ALA A 1 36  ? 19.202  8.533   -2.822  1.00 11.20 ? 36   ALA A CB  1 
ATOM   259  N N   . GLY A 1 37  ? 15.783  8.702   -2.640  1.00 13.27 ? 37   GLY A N   1 
ATOM   260  C CA  . GLY A 1 37  ? 14.560  8.104   -3.135  1.00 12.50 ? 37   GLY A CA  1 
ATOM   261  C C   . GLY A 1 37  ? 14.693  7.742   -4.598  1.00 13.98 ? 37   GLY A C   1 
ATOM   262  O O   . GLY A 1 37  ? 15.046  8.578   -5.428  1.00 13.96 ? 37   GLY A O   1 
ATOM   263  N N   . LEU A 1 38  ? 14.409  6.486   -4.915  1.00 14.87 ? 38   LEU A N   1 
ATOM   264  C CA  . LEU A 1 38  ? 14.508  6.015   -6.288  1.00 15.94 ? 38   LEU A CA  1 
ATOM   265  C C   . LEU A 1 38  ? 13.592  6.807   -7.207  1.00 16.89 ? 38   LEU A C   1 
ATOM   266  O O   . LEU A 1 38  ? 13.990  7.203   -8.303  1.00 17.88 ? 38   LEU A O   1 
ATOM   267  C CB  . LEU A 1 38  ? 14.136  4.532   -6.369  1.00 15.64 ? 38   LEU A CB  1 
ATOM   268  C CG  . LEU A 1 38  ? 14.296  3.906   -7.759  1.00 15.18 ? 38   LEU A CG  1 
ATOM   269  C CD1 . LEU A 1 38  ? 15.767  3.902   -8.138  1.00 17.03 ? 38   LEU A CD1 1 
ATOM   270  C CD2 . LEU A 1 38  ? 13.740  2.487   -7.765  1.00 14.92 ? 38   LEU A CD2 1 
ATOM   271  N N   . ALA A 1 39  ? 12.367  7.044   -6.749  1.00 18.77 ? 39   ALA A N   1 
ATOM   272  C CA  . ALA A 1 39  ? 11.372  7.759   -7.543  1.00 18.37 ? 39   ALA A CA  1 
ATOM   273  C C   . ALA A 1 39  ? 11.469  9.277   -7.464  1.00 20.42 ? 39   ALA A C   1 
ATOM   274  O O   . ALA A 1 39  ? 10.838  9.985   -8.249  1.00 21.26 ? 39   ALA A O   1 
ATOM   275  C CB  . ALA A 1 39  ? 9.976   7.308   -7.137  1.00 19.62 ? 39   ALA A CB  1 
ATOM   276  N N   . GLY A 1 40  ? 12.257  9.777   -6.522  1.00 19.86 ? 40   GLY A N   1 
ATOM   277  C CA  . GLY A 1 40  ? 12.396  11.213  -6.377  1.00 19.32 ? 40   GLY A CA  1 
ATOM   278  C C   . GLY A 1 40  ? 12.589  11.626  -4.932  1.00 18.81 ? 40   GLY A C   1 
ATOM   279  O O   . GLY A 1 40  ? 13.049  10.836  -4.108  1.00 17.70 ? 40   GLY A O   1 
ATOM   280  N N   . LYS A 1 41  ? 12.224  12.867  -4.621  1.00 18.17 ? 41   LYS A N   1 
ATOM   281  C CA  . LYS A 1 41  ? 12.372  13.402  -3.270  1.00 18.53 ? 41   LYS A CA  1 
ATOM   282  C C   . LYS A 1 41  ? 11.174  13.137  -2.366  1.00 18.51 ? 41   LYS A C   1 
ATOM   283  O O   . LYS A 1 41  ? 11.280  13.249  -1.145  1.00 19.70 ? 41   LYS A O   1 
ATOM   284  C CB  . LYS A 1 41  ? 12.625  14.914  -3.337  1.00 17.64 ? 41   LYS A CB  1 
ATOM   285  C CG  . LYS A 1 41  ? 12.713  15.613  -1.979  1.00 17.93 ? 41   LYS A CG  1 
ATOM   286  C CD  . LYS A 1 41  ? 13.913  15.134  -1.173  1.00 16.58 ? 41   LYS A CD  1 
ATOM   287  C CE  . LYS A 1 41  ? 13.940  15.759  0.217   1.00 18.51 ? 41   LYS A CE  1 
ATOM   288  N NZ  . LYS A 1 41  ? 12.755  15.375  1.038   1.00 15.56 ? 41   LYS A NZ  1 
ATOM   289  N N   . ASP A 1 42  ? 10.040  12.781  -2.956  1.00 18.99 ? 42   ASP A N   1 
ATOM   290  C CA  . ASP A 1 42  ? 8.834   12.538  -2.174  1.00 19.65 ? 42   ASP A CA  1 
ATOM   291  C C   . ASP A 1 42  ? 8.916   11.341  -1.237  1.00 18.47 ? 42   ASP A C   1 
ATOM   292  O O   . ASP A 1 42  ? 9.724   10.433  -1.436  1.00 17.06 ? 42   ASP A O   1 
ATOM   293  C CB  . ASP A 1 42  ? 7.628   12.380  -3.099  1.00 21.81 ? 42   ASP A CB  1 
ATOM   294  C CG  . ASP A 1 42  ? 7.397   13.605  -3.958  1.00 23.81 ? 42   ASP A CG  1 
ATOM   295  O OD1 . ASP A 1 42  ? 7.639   14.728  -3.466  1.00 25.07 ? 42   ASP A OD1 1 
ATOM   296  O OD2 . ASP A 1 42  ? 6.967   13.446  -5.118  1.00 25.01 ? 42   ASP A OD2 1 
ATOM   297  N N   . PRO A 1 43  ? 8.070   11.333  -0.194  1.00 17.13 ? 43   PRO A N   1 
ATOM   298  C CA  . PRO A 1 43  ? 8.015   10.259  0.803   1.00 16.76 ? 43   PRO A CA  1 
ATOM   299  C C   . PRO A 1 43  ? 7.824   8.891   0.162   1.00 16.57 ? 43   PRO A C   1 
ATOM   300  O O   . PRO A 1 43  ? 7.129   8.759   -0.843  1.00 16.94 ? 43   PRO A O   1 
ATOM   301  C CB  . PRO A 1 43  ? 6.830   10.662  1.674   1.00 16.84 ? 43   PRO A CB  1 
ATOM   302  C CG  . PRO A 1 43  ? 6.884   12.161  1.623   1.00 16.72 ? 43   PRO A CG  1 
ATOM   303  C CD  . PRO A 1 43  ? 7.137   12.418  0.159   1.00 17.91 ? 43   PRO A CD  1 
ATOM   304  N N   . VAL A 1 44  ? 8.442   7.876   0.755   1.00 15.21 ? 44   VAL A N   1 
ATOM   305  C CA  . VAL A 1 44  ? 8.356   6.516   0.243   1.00 14.56 ? 44   VAL A CA  1 
ATOM   306  C C   . VAL A 1 44  ? 7.576   5.605   1.189   1.00 14.91 ? 44   VAL A C   1 
ATOM   307  O O   . VAL A 1 44  ? 7.843   5.562   2.392   1.00 15.71 ? 44   VAL A O   1 
ATOM   308  C CB  . VAL A 1 44  ? 9.773   5.922   0.025   1.00 13.54 ? 44   VAL A CB  1 
ATOM   309  C CG1 . VAL A 1 44  ? 9.674   4.494   -0.496  1.00 12.75 ? 44   VAL A CG1 1 
ATOM   310  C CG2 . VAL A 1 44  ? 10.557  6.794   -0.946  1.00 15.70 ? 44   VAL A CG2 1 
ATOM   311  N N   . GLN A 1 45  ? 6.606   4.884   0.637   1.00 14.77 ? 45   GLN A N   1 
ATOM   312  C CA  . GLN A 1 45  ? 5.796   3.960   1.422   1.00 14.79 ? 45   GLN A CA  1 
ATOM   313  C C   . GLN A 1 45  ? 6.526   2.626   1.437   1.00 13.92 ? 45   GLN A C   1 
ATOM   314  O O   . GLN A 1 45  ? 6.725   2.007   0.389   1.00 14.00 ? 45   GLN A O   1 
ATOM   315  C CB  . GLN A 1 45  ? 4.415   3.796   0.785   1.00 16.14 ? 45   GLN A CB  1 
ATOM   316  C CG  . GLN A 1 45  ? 3.481   2.849   1.517   1.00 20.19 ? 45   GLN A CG  1 
ATOM   317  C CD  . GLN A 1 45  ? 2.097   2.818   0.895   1.00 22.19 ? 45   GLN A CD  1 
ATOM   318  O OE1 . GLN A 1 45  ? 1.950   2.591   -0.305  1.00 24.60 ? 45   GLN A OE1 1 
ATOM   319  N NE2 . GLN A 1 45  ? 1.073   3.048   1.711   1.00 26.05 ? 45   GLN A NE2 1 
ATOM   320  N N   . CYS A 1 46  ? 6.932   2.187   2.624   1.00 12.43 ? 46   CYS A N   1 
ATOM   321  C CA  . CYS A 1 46  ? 7.662   0.934   2.743   1.00 13.01 ? 46   CYS A CA  1 
ATOM   322  C C   . CYS A 1 46  ? 6.764   -0.301  2.831   1.00 13.16 ? 46   CYS A C   1 
ATOM   323  O O   . CYS A 1 46  ? 5.534   -0.190  2.839   1.00 14.38 ? 46   CYS A O   1 
ATOM   324  C CB  . CYS A 1 46  ? 8.629   1.023   3.930   1.00 9.97  ? 46   CYS A CB  1 
ATOM   325  S SG  . CYS A 1 46  ? 9.917   2.286   3.663   1.00 12.96 ? 46   CYS A SG  1 
ATOM   326  N N   . SER A 1 47  ? 7.395   -1.475  2.878   1.00 13.13 ? 47   SER A N   1 
ATOM   327  C CA  . SER A 1 47  ? 6.707   -2.765  2.919   1.00 12.66 ? 47   SER A CA  1 
ATOM   328  C C   . SER A 1 47  ? 5.625   -2.932  3.983   1.00 12.13 ? 47   SER A C   1 
ATOM   329  O O   . SER A 1 47  ? 4.640   -3.634  3.753   1.00 11.10 ? 47   SER A O   1 
ATOM   330  C CB  . SER A 1 47  ? 7.730   -3.898  3.058   1.00 13.36 ? 47   SER A CB  1 
ATOM   331  O OG  . SER A 1 47  ? 8.316   -3.912  4.347   1.00 12.70 ? 47   SER A OG  1 
ATOM   332  N N   . ARG A 1 48  ? 5.812   -2.314  5.146   1.00 12.93 ? 48   ARG A N   1 
ATOM   333  C CA  . ARG A 1 48  ? 4.821   -2.395  6.217   1.00 12.38 ? 48   ARG A CA  1 
ATOM   334  C C   . ARG A 1 48  ? 4.226   -1.018  6.487   1.00 13.97 ? 48   ARG A C   1 
ATOM   335  O O   . ARG A 1 48  ? 3.962   -0.636  7.630   1.00 15.09 ? 48   ARG A O   1 
ATOM   336  C CB  . ARG A 1 48  ? 5.432   -2.980  7.498   1.00 13.25 ? 48   ARG A CB  1 
ATOM   337  C CG  . ARG A 1 48  ? 5.413   -4.511  7.558   1.00 12.74 ? 48   ARG A CG  1 
ATOM   338  C CD  . ARG A 1 48  ? 6.306   -5.134  6.498   1.00 12.65 ? 48   ARG A CD  1 
ATOM   339  N NE  . ARG A 1 48  ? 6.141   -6.587  6.408   1.00 14.32 ? 48   ARG A NE  1 
ATOM   340  C CZ  . ARG A 1 48  ? 6.863   -7.365  5.607   1.00 14.68 ? 48   ARG A CZ  1 
ATOM   341  N NH1 . ARG A 1 48  ? 7.797   -6.830  4.833   1.00 12.76 ? 48   ARG A NH1 1 
ATOM   342  N NH2 . ARG A 1 48  ? 6.650   -8.675  5.574   1.00 14.98 ? 48   ARG A NH2 1 
ATOM   343  N N   . ASP A 1 49  ? 4.038   -0.286  5.395   1.00 15.09 ? 49   ASP A N   1 
ATOM   344  C CA  . ASP A 1 49  ? 3.444   1.044   5.374   1.00 15.75 ? 49   ASP A CA  1 
ATOM   345  C C   . ASP A 1 49  ? 4.093   2.187   6.138   1.00 14.99 ? 49   ASP A C   1 
ATOM   346  O O   . ASP A 1 49  ? 3.503   3.259   6.266   1.00 14.76 ? 49   ASP A O   1 
ATOM   347  C CB  . ASP A 1 49  ? 1.963   0.936   5.735   1.00 17.04 ? 49   ASP A CB  1 
ATOM   348  C CG  . ASP A 1 49  ? 1.199   0.089   4.741   1.00 20.59 ? 49   ASP A CG  1 
ATOM   349  O OD1 . ASP A 1 49  ? 1.400   0.297   3.524   1.00 22.97 ? 49   ASP A OD1 1 
ATOM   350  O OD2 . ASP A 1 49  ? 0.407   -0.779  5.167   1.00 21.42 ? 49   ASP A OD2 1 
ATOM   351  N N   . VAL A 1 50  ? 5.297   1.977   6.654   1.00 13.13 ? 50   VAL A N   1 
ATOM   352  C CA  . VAL A 1 50  ? 5.985   3.072   7.320   1.00 12.26 ? 50   VAL A CA  1 
ATOM   353  C C   . VAL A 1 50  ? 6.394   4.005   6.181   1.00 12.70 ? 50   VAL A C   1 
ATOM   354  O O   . VAL A 1 50  ? 6.900   3.551   5.152   1.00 12.36 ? 50   VAL A O   1 
ATOM   355  C CB  . VAL A 1 50  ? 7.252   2.598   8.055   1.00 11.84 ? 50   VAL A CB  1 
ATOM   356  C CG1 . VAL A 1 50  ? 8.070   3.798   8.514   1.00 11.69 ? 50   VAL A CG1 1 
ATOM   357  C CG2 . VAL A 1 50  ? 6.865   1.746   9.247   1.00 13.19 ? 50   VAL A CG2 1 
ATOM   358  N N   . VAL A 1 51  ? 6.166   5.301   6.352   1.00 11.47 ? 51   VAL A N   1 
ATOM   359  C CA  . VAL A 1 51  ? 6.520   6.261   5.317   1.00 12.28 ? 51   VAL A CA  1 
ATOM   360  C C   . VAL A 1 51  ? 7.774   7.034   5.701   1.00 13.03 ? 51   VAL A C   1 
ATOM   361  O O   . VAL A 1 51  ? 7.808   7.731   6.713   1.00 12.72 ? 51   VAL A O   1 
ATOM   362  C CB  . VAL A 1 51  ? 5.351   7.234   5.051   1.00 12.21 ? 51   VAL A CB  1 
ATOM   363  C CG1 . VAL A 1 51  ? 5.771   8.309   4.055   1.00 13.07 ? 51   VAL A CG1 1 
ATOM   364  C CG2 . VAL A 1 51  ? 4.160   6.455   4.512   1.00 12.74 ? 51   VAL A CG2 1 
ATOM   365  N N   . ILE A 1 52  ? 8.809   6.894   4.877   1.00 12.60 ? 52   ILE A N   1 
ATOM   366  C CA  . ILE A 1 52  ? 10.084  7.551   5.114   1.00 12.59 ? 52   ILE A CA  1 
ATOM   367  C C   . ILE A 1 52  ? 10.344  8.647   4.086   1.00 12.96 ? 52   ILE A C   1 
ATOM   368  O O   . ILE A 1 52  ? 10.116  8.456   2.891   1.00 14.32 ? 52   ILE A O   1 
ATOM   369  C CB  . ILE A 1 52  ? 11.239  6.526   5.049   1.00 12.67 ? 52   ILE A CB  1 
ATOM   370  C CG1 . ILE A 1 52  ? 11.047  5.458   6.130   1.00 14.58 ? 52   ILE A CG1 1 
ATOM   371  C CG2 . ILE A 1 52  ? 12.579  7.229   5.204   1.00 14.89 ? 52   ILE A CG2 1 
ATOM   372  C CD1 . ILE A 1 52  ? 12.131  4.389   6.137   1.00 14.17 ? 52   ILE A CD1 1 
ATOM   373  N N   . CYS A 1 53  ? 10.820  9.793   4.561   1.00 13.48 ? 53   CYS A N   1 
ATOM   374  C CA  . CYS A 1 53  ? 11.135  10.919  3.689   1.00 15.26 ? 53   CYS A CA  1 
ATOM   375  C C   . CYS A 1 53  ? 12.612  10.888  3.333   1.00 13.74 ? 53   CYS A C   1 
ATOM   376  O O   . CYS A 1 53  ? 13.465  11.081  4.196   1.00 15.92 ? 53   CYS A O   1 
ATOM   377  C CB  . CYS A 1 53  ? 10.830  12.245  4.389   1.00 16.77 ? 53   CYS A CB  1 
ATOM   378  S SG  . CYS A 1 53  ? 9.093   12.502  4.751   1.00 24.48 ? 53   CYS A SG  1 
ATOM   379  N N   . PRO A 1 54  ? 12.939  10.638  2.054   1.00 13.79 ? 54   PRO A N   1 
ATOM   380  C CA  . PRO A 1 54  ? 14.354  10.604  1.675   1.00 12.57 ? 54   PRO A CA  1 
ATOM   381  C C   . PRO A 1 54  ? 15.000  11.982  1.813   1.00 14.17 ? 54   PRO A C   1 
ATOM   382  O O   . PRO A 1 54  ? 14.313  13.008  1.788   1.00 14.87 ? 54   PRO A O   1 
ATOM   383  C CB  . PRO A 1 54  ? 14.311  10.113  0.226   1.00 14.03 ? 54   PRO A CB  1 
ATOM   384  C CG  . PRO A 1 54  ? 12.993  10.617  -0.268  1.00 15.02 ? 54   PRO A CG  1 
ATOM   385  C CD  . PRO A 1 54  ? 12.068  10.357  0.901   1.00 12.71 ? 54   PRO A CD  1 
ATOM   386  N N   . ASP A 1 55  ? 16.317  12.000  1.980   1.00 12.32 ? 55   ASP A N   1 
ATOM   387  C CA  . ASP A 1 55  ? 17.053  13.249  2.117   1.00 13.49 ? 55   ASP A CA  1 
ATOM   388  C C   . ASP A 1 55  ? 17.125  13.925  0.760   1.00 14.56 ? 55   ASP A C   1 
ATOM   389  O O   . ASP A 1 55  ? 17.218  15.149  0.659   1.00 13.99 ? 55   ASP A O   1 
ATOM   390  C CB  . ASP A 1 55  ? 18.475  12.986  2.602   1.00 12.75 ? 55   ASP A CB  1 
ATOM   391  C CG  . ASP A 1 55  ? 18.512  12.225  3.902   1.00 14.82 ? 55   ASP A CG  1 
ATOM   392  O OD1 . ASP A 1 55  ? 17.764  12.602  4.828   1.00 15.05 ? 55   ASP A OD1 1 
ATOM   393  O OD2 . ASP A 1 55  ? 19.300  11.258  3.998   1.00 12.83 ? 55   ASP A OD2 1 
ATOM   394  N N   . ALA A 1 56  ? 17.098  13.107  -0.281  1.00 14.57 ? 56   ALA A N   1 
ATOM   395  C CA  . ALA A 1 56  ? 17.173  13.610  -1.637  1.00 13.74 ? 56   ALA A CA  1 
ATOM   396  C C   . ALA A 1 56  ? 16.734  12.545  -2.619  1.00 15.01 ? 56   ALA A C   1 
ATOM   397  O O   . ALA A 1 56  ? 16.512  11.390  -2.251  1.00 15.41 ? 56   ALA A O   1 
ATOM   398  C CB  . ALA A 1 56  ? 18.597  14.039  -1.948  1.00 14.49 ? 56   ALA A CB  1 
ATOM   399  N N   . SER A 1 57  ? 16.595  12.956  -3.873  1.00 14.60 ? 57   SER A N   1 
ATOM   400  C CA  . SER A 1 57  ? 16.218  12.048  -4.938  1.00 13.36 ? 57   SER A CA  1 
ATOM   401  C C   . SER A 1 57  ? 17.515  11.364  -5.326  1.00 13.36 ? 57   SER A C   1 
ATOM   402  O O   . SER A 1 57  ? 18.598  11.871  -5.033  1.00 12.03 ? 57   SER A O   1 
ATOM   403  C CB  . SER A 1 57  ? 15.682  12.836  -6.133  1.00 13.86 ? 57   SER A CB  1 
ATOM   404  O OG  . SER A 1 57  ? 16.666  13.743  -6.603  1.00 13.09 ? 57   SER A OG  1 
ATOM   405  N N   . LEU A 1 58  ? 17.416  10.209  -5.973  1.00 13.37 ? 58   LEU A N   1 
ATOM   406  C CA  . LEU A 1 58  ? 18.613  9.505   -6.396  1.00 14.39 ? 58   LEU A CA  1 
ATOM   407  C C   . LEU A 1 58  ? 19.330  10.413  -7.389  1.00 14.28 ? 58   LEU A C   1 
ATOM   408  O O   . LEU A 1 58  ? 20.557  10.487  -7.415  1.00 14.71 ? 58   LEU A O   1 
ATOM   409  C CB  . LEU A 1 58  ? 18.238  8.180   -7.062  1.00 13.03 ? 58   LEU A CB  1 
ATOM   410  C CG  . LEU A 1 58  ? 19.398  7.273   -7.470  1.00 14.64 ? 58   LEU A CG  1 
ATOM   411  C CD1 . LEU A 1 58  ? 20.295  7.002   -6.270  1.00 14.10 ? 58   LEU A CD1 1 
ATOM   412  C CD2 . LEU A 1 58  ? 18.844  5.976   -8.033  1.00 13.53 ? 58   LEU A CD2 1 
ATOM   413  N N   . GLU A 1 59  ? 18.541  11.123  -8.188  1.00 17.65 ? 59   GLU A N   1 
ATOM   414  C CA  . GLU A 1 59  ? 19.075  12.040  -9.186  1.00 20.27 ? 59   GLU A CA  1 
ATOM   415  C C   . GLU A 1 59  ? 20.030  13.062  -8.569  1.00 19.13 ? 59   GLU A C   1 
ATOM   416  O O   . GLU A 1 59  ? 21.140  13.257  -9.059  1.00 18.93 ? 59   GLU A O   1 
ATOM   417  C CB  . GLU A 1 59  ? 17.918  12.745  -9.903  1.00 22.62 ? 59   GLU A CB  1 
ATOM   418  C CG  . GLU A 1 59  ? 18.344  13.796  -10.911 1.00 28.05 ? 59   GLU A CG  1 
ATOM   419  C CD  . GLU A 1 59  ? 17.251  14.110  -11.917 1.00 29.93 ? 59   GLU A CD  1 
ATOM   420  O OE1 . GLU A 1 59  ? 16.069  14.180  -11.514 1.00 32.47 ? 59   GLU A OE1 1 
ATOM   421  O OE2 . GLU A 1 59  ? 17.574  14.294  -13.111 1.00 34.01 ? 59   GLU A OE2 1 
ATOM   422  N N   . ASP A 1 60  ? 19.604  13.711  -7.490  1.00 19.00 ? 60   ASP A N   1 
ATOM   423  C CA  . ASP A 1 60  ? 20.449  14.695  -6.820  1.00 17.01 ? 60   ASP A CA  1 
ATOM   424  C C   . ASP A 1 60  ? 21.611  14.042  -6.077  1.00 17.11 ? 60   ASP A C   1 
ATOM   425  O O   . ASP A 1 60  ? 22.736  14.538  -6.112  1.00 16.40 ? 60   ASP A O   1 
ATOM   426  C CB  . ASP A 1 60  ? 19.616  15.524  -5.838  1.00 18.62 ? 60   ASP A CB  1 
ATOM   427  C CG  . ASP A 1 60  ? 19.085  16.801  -6.457  1.00 20.51 ? 60   ASP A CG  1 
ATOM   428  O OD1 . ASP A 1 60  ? 18.760  16.789  -7.664  1.00 22.43 ? 60   ASP A OD1 1 
ATOM   429  O OD2 . ASP A 1 60  ? 18.985  17.812  -5.729  1.00 17.12 ? 60   ASP A OD2 1 
ATOM   430  N N   . ALA A 1 61  ? 21.338  12.926  -5.406  1.00 15.53 ? 61   ALA A N   1 
ATOM   431  C CA  . ALA A 1 61  ? 22.365  12.222  -4.647  1.00 16.15 ? 61   ALA A CA  1 
ATOM   432  C C   . ALA A 1 61  ? 23.503  11.730  -5.538  1.00 15.22 ? 61   ALA A C   1 
ATOM   433  O O   . ALA A 1 61  ? 24.667  11.772  -5.144  1.00 14.01 ? 61   ALA A O   1 
ATOM   434  C CB  . ALA A 1 61  ? 21.745  11.048  -3.889  1.00 15.64 ? 61   ALA A CB  1 
ATOM   435  N N   . LYS A 1 62  ? 23.159  11.264  -6.734  1.00 18.39 ? 62   LYS A N   1 
ATOM   436  C CA  . LYS A 1 62  ? 24.154  10.768  -7.681  1.00 20.56 ? 62   LYS A CA  1 
ATOM   437  C C   . LYS A 1 62  ? 25.204  11.840  -7.957  1.00 20.82 ? 62   LYS A C   1 
ATOM   438  O O   . LYS A 1 62  ? 26.398  11.551  -8.039  1.00 20.43 ? 62   LYS A O   1 
ATOM   439  C CB  . LYS A 1 62  ? 23.477  10.365  -8.996  1.00 22.14 ? 62   LYS A CB  1 
ATOM   440  C CG  . LYS A 1 62  ? 24.400  9.691   -10.009 1.00 24.72 ? 62   LYS A CG  1 
ATOM   441  C CD  . LYS A 1 62  ? 23.641  9.332   -11.282 1.00 27.19 ? 62   LYS A CD  1 
ATOM   442  C CE  . LYS A 1 62  ? 24.516  8.583   -12.285 1.00 28.72 ? 62   LYS A CE  1 
ATOM   443  N NZ  . LYS A 1 62  ? 24.813  7.188   -11.844 1.00 29.93 ? 62   LYS A NZ  1 
ATOM   444  N N   . LYS A 1 63  ? 24.748  13.083  -8.095  1.00 21.36 ? 63   LYS A N   1 
ATOM   445  C CA  . LYS A 1 63  ? 25.645  14.200  -8.374  1.00 22.95 ? 63   LYS A CA  1 
ATOM   446  C C   . LYS A 1 63  ? 26.615  14.500  -7.242  1.00 23.37 ? 63   LYS A C   1 
ATOM   447  O O   . LYS A 1 63  ? 27.674  15.081  -7.470  1.00 24.02 ? 63   LYS A O   1 
ATOM   448  C CB  . LYS A 1 63  ? 24.849  15.479  -8.650  1.00 23.43 ? 63   LYS A CB  1 
ATOM   449  C CG  . LYS A 1 63  ? 23.873  15.415  -9.804  1.00 24.97 ? 63   LYS A CG  1 
ATOM   450  C CD  . LYS A 1 63  ? 23.197  16.769  -9.989  1.00 27.90 ? 63   LYS A CD  1 
ATOM   451  C CE  . LYS A 1 63  ? 22.121  16.716  -11.057 1.00 29.26 ? 63   LYS A CE  1 
ATOM   452  N NZ  . LYS A 1 63  ? 21.028  15.779  -10.671 1.00 31.83 ? 63   LYS A NZ  1 
ATOM   453  N N   . GLU A 1 64  ? 26.264  14.108  -6.022  1.00 23.48 ? 64   GLU A N   1 
ATOM   454  C CA  . GLU A 1 64  ? 27.111  14.408  -4.876  1.00 25.38 ? 64   GLU A CA  1 
ATOM   455  C C   . GLU A 1 64  ? 28.285  13.485  -4.580  1.00 27.48 ? 64   GLU A C   1 
ATOM   456  O O   . GLU A 1 64  ? 28.243  12.674  -3.657  1.00 28.22 ? 64   GLU A O   1 
ATOM   457  C CB  . GLU A 1 64  ? 26.230  14.588  -3.634  1.00 25.10 ? 64   GLU A CB  1 
ATOM   458  C CG  . GLU A 1 64  ? 25.593  15.973  -3.593  1.00 23.85 ? 64   GLU A CG  1 
ATOM   459  C CD  . GLU A 1 64  ? 24.459  16.098  -2.596  1.00 24.80 ? 64   GLU A CD  1 
ATOM   460  O OE1 . GLU A 1 64  ? 24.583  15.579  -1.467  1.00 23.93 ? 64   GLU A OE1 1 
ATOM   461  O OE2 . GLU A 1 64  ? 23.444  16.735  -2.944  1.00 20.98 ? 64   GLU A OE2 1 
ATOM   462  N N   . GLY A 1 65  ? 29.347  13.654  -5.369  1.00 29.99 ? 65   GLY A N   1 
ATOM   463  C CA  . GLY A 1 65  ? 30.565  12.876  -5.214  1.00 28.38 ? 65   GLY A CA  1 
ATOM   464  C C   . GLY A 1 65  ? 30.377  11.375  -5.148  1.00 27.29 ? 65   GLY A C   1 
ATOM   465  O O   . GLY A 1 65  ? 29.254  10.892  -5.009  1.00 27.64 ? 65   GLY A O   1 
ATOM   466  N N   . PRO A 1 66  ? 31.468  10.604  -5.270  1.00 25.86 ? 66   PRO A N   1 
ATOM   467  C CA  . PRO A 1 66  ? 31.349  9.143   -5.207  1.00 22.96 ? 66   PRO A CA  1 
ATOM   468  C C   . PRO A 1 66  ? 31.129  8.729   -3.761  1.00 19.49 ? 66   PRO A C   1 
ATOM   469  O O   . PRO A 1 66  ? 31.564  9.420   -2.838  1.00 17.91 ? 66   PRO A O   1 
ATOM   470  C CB  . PRO A 1 66  ? 32.700  8.664   -5.738  1.00 23.80 ? 66   PRO A CB  1 
ATOM   471  C CG  . PRO A 1 66  ? 33.160  9.803   -6.606  1.00 26.84 ? 66   PRO A CG  1 
ATOM   472  C CD  . PRO A 1 66  ? 32.796  10.992  -5.764  1.00 25.47 ? 66   PRO A CD  1 
ATOM   473  N N   . TYR A 1 67  ? 30.455  7.601   -3.561  1.00 15.03 ? 67   TYR A N   1 
ATOM   474  C CA  . TYR A 1 67  ? 30.194  7.115   -2.216  1.00 12.76 ? 67   TYR A CA  1 
ATOM   475  C C   . TYR A 1 67  ? 31.084  5.930   -1.876  1.00 12.69 ? 67   TYR A C   1 
ATOM   476  O O   . TYR A 1 67  ? 31.423  5.127   -2.743  1.00 10.07 ? 67   TYR A O   1 
ATOM   477  C CB  . TYR A 1 67  ? 28.725  6.710   -2.077  1.00 13.40 ? 67   TYR A CB  1 
ATOM   478  C CG  . TYR A 1 67  ? 27.763  7.857   -2.255  1.00 13.82 ? 67   TYR A CG  1 
ATOM   479  C CD1 . TYR A 1 67  ? 27.313  8.232   -3.522  1.00 14.00 ? 67   TYR A CD1 1 
ATOM   480  C CD2 . TYR A 1 67  ? 27.319  8.590   -1.155  1.00 14.28 ? 67   TYR A CD2 1 
ATOM   481  C CE1 . TYR A 1 67  ? 26.438  9.309   -3.688  1.00 14.16 ? 67   TYR A CE1 1 
ATOM   482  C CE2 . TYR A 1 67  ? 26.449  9.668   -1.308  1.00 14.23 ? 67   TYR A CE2 1 
ATOM   483  C CZ  . TYR A 1 67  ? 26.012  10.023  -2.574  1.00 15.08 ? 67   TYR A CZ  1 
ATOM   484  O OH  . TYR A 1 67  ? 25.145  11.087  -2.722  1.00 15.54 ? 67   TYR A OH  1 
ATOM   485  N N   . ASP A 1 68  ? 31.467  5.835   -0.609  1.00 11.04 ? 68   ASP A N   1 
ATOM   486  C CA  . ASP A 1 68  ? 32.312  4.746   -0.147  1.00 10.63 ? 68   ASP A CA  1 
ATOM   487  C C   . ASP A 1 68  ? 31.512  3.451   -0.092  1.00 10.11 ? 68   ASP A C   1 
ATOM   488  O O   . ASP A 1 68  ? 32.079  2.359   -0.085  1.00 11.32 ? 68   ASP A O   1 
ATOM   489  C CB  . ASP A 1 68  ? 32.891  5.103   1.215   1.00 11.63 ? 68   ASP A CB  1 
ATOM   490  C CG  . ASP A 1 68  ? 33.783  6.319   1.143   1.00 13.34 ? 68   ASP A CG  1 
ATOM   491  O OD1 . ASP A 1 68  ? 34.924  6.177   0.659   1.00 14.12 ? 68   ASP A OD1 1 
ATOM   492  O OD2 . ASP A 1 68  ? 33.336  7.415   1.541   1.00 13.54 ? 68   ASP A OD2 1 
ATOM   493  N N   . VAL A 1 69  ? 30.191  3.576   -0.048  1.00 9.35  ? 69   VAL A N   1 
ATOM   494  C CA  . VAL A 1 69  ? 29.332  2.402   -0.049  1.00 8.20  ? 69   VAL A CA  1 
ATOM   495  C C   . VAL A 1 69  ? 27.943  2.723   -0.595  1.00 9.57  ? 69   VAL A C   1 
ATOM   496  O O   . VAL A 1 69  ? 27.396  3.800   -0.354  1.00 8.98  ? 69   VAL A O   1 
ATOM   497  C CB  . VAL A 1 69  ? 29.189  1.774   1.376   1.00 7.41  ? 69   VAL A CB  1 
ATOM   498  C CG1 . VAL A 1 69  ? 28.420  2.707   2.298   1.00 7.52  ? 69   VAL A CG1 1 
ATOM   499  C CG2 . VAL A 1 69  ? 28.476  0.414   1.279   1.00 8.33  ? 69   VAL A CG2 1 
ATOM   500  N N   . VAL A 1 70  ? 27.395  1.798   -1.377  1.00 6.77  ? 70   VAL A N   1 
ATOM   501  C CA  . VAL A 1 70  ? 26.052  1.952   -1.914  1.00 6.77  ? 70   VAL A CA  1 
ATOM   502  C C   . VAL A 1 70  ? 25.308  0.813   -1.236  1.00 7.87  ? 70   VAL A C   1 
ATOM   503  O O   . VAL A 1 70  ? 25.705  -0.344  -1.365  1.00 7.91  ? 70   VAL A O   1 
ATOM   504  C CB  . VAL A 1 70  ? 26.014  1.766   -3.442  1.00 8.55  ? 70   VAL A CB  1 
ATOM   505  C CG1 . VAL A 1 70  ? 24.568  1.773   -3.930  1.00 8.86  ? 70   VAL A CG1 1 
ATOM   506  C CG2 . VAL A 1 70  ? 26.818  2.876   -4.119  1.00 10.49 ? 70   VAL A CG2 1 
ATOM   507  N N   . VAL A 1 71  ? 24.251  1.146   -0.504  1.00 6.60  ? 71   VAL A N   1 
ATOM   508  C CA  . VAL A 1 71  ? 23.476  0.158   0.244   1.00 7.90  ? 71   VAL A CA  1 
ATOM   509  C C   . VAL A 1 71  ? 22.111  -0.109  -0.372  1.00 8.29  ? 71   VAL A C   1 
ATOM   510  O O   . VAL A 1 71  ? 21.378  0.824   -0.709  1.00 7.89  ? 71   VAL A O   1 
ATOM   511  C CB  . VAL A 1 71  ? 23.277  0.631   1.708   1.00 8.37  ? 71   VAL A CB  1 
ATOM   512  C CG1 . VAL A 1 71  ? 22.481  -0.395  2.505   1.00 6.52  ? 71   VAL A CG1 1 
ATOM   513  C CG2 . VAL A 1 71  ? 24.629  0.868   2.355   1.00 10.45 ? 71   VAL A CG2 1 
ATOM   514  N N   . LEU A 1 72  ? 21.773  -1.388  -0.511  1.00 4.89  ? 72   LEU A N   1 
ATOM   515  C CA  . LEU A 1 72  ? 20.488  -1.774  -1.075  1.00 6.52  ? 72   LEU A CA  1 
ATOM   516  C C   . LEU A 1 72  ? 19.659  -2.542  -0.054  1.00 8.16  ? 72   LEU A C   1 
ATOM   517  O O   . LEU A 1 72  ? 19.955  -3.700  0.258   1.00 7.70  ? 72   LEU A O   1 
ATOM   518  C CB  . LEU A 1 72  ? 20.686  -2.649  -2.313  1.00 6.22  ? 72   LEU A CB  1 
ATOM   519  C CG  . LEU A 1 72  ? 21.628  -2.129  -3.400  1.00 7.19  ? 72   LEU A CG  1 
ATOM   520  C CD1 . LEU A 1 72  ? 21.689  -3.131  -4.545  1.00 8.09  ? 72   LEU A CD1 1 
ATOM   521  C CD2 . LEU A 1 72  ? 21.137  -0.780  -3.902  1.00 6.13  ? 72   LEU A CD2 1 
ATOM   522  N N   . PRO A 1 73  ? 18.611  -1.903  0.488   1.00 7.06  ? 73   PRO A N   1 
ATOM   523  C CA  . PRO A 1 73  ? 17.751  -2.561  1.472   1.00 7.80  ? 73   PRO A CA  1 
ATOM   524  C C   . PRO A 1 73  ? 16.965  -3.667  0.779   1.00 8.03  ? 73   PRO A C   1 
ATOM   525  O O   . PRO A 1 73  ? 16.927  -3.735  -0.454  1.00 6.65  ? 73   PRO A O   1 
ATOM   526  C CB  . PRO A 1 73  ? 16.815  -1.442  1.933   1.00 8.50  ? 73   PRO A CB  1 
ATOM   527  C CG  . PRO A 1 73  ? 17.548  -0.175  1.577   1.00 9.46  ? 73   PRO A CG  1 
ATOM   528  C CD  . PRO A 1 73  ? 18.183  -0.511  0.266   1.00 7.41  ? 73   PRO A CD  1 
ATOM   529  N N   . GLY A 1 74  ? 16.328  -4.513  1.579   1.00 7.17  ? 74   GLY A N   1 
ATOM   530  C CA  . GLY A 1 74  ? 15.522  -5.592  1.042   1.00 9.77  ? 74   GLY A CA  1 
ATOM   531  C C   . GLY A 1 74  ? 14.070  -5.180  0.870   1.00 10.64 ? 74   GLY A C   1 
ATOM   532  O O   . GLY A 1 74  ? 13.768  -4.011  0.628   1.00 11.59 ? 74   GLY A O   1 
ATOM   533  N N   . GLY A 1 75  ? 13.165  -6.137  1.036   1.00 10.94 ? 75   GLY A N   1 
ATOM   534  C CA  . GLY A 1 75  ? 11.751  -5.867  0.842   1.00 12.14 ? 75   GLY A CA  1 
ATOM   535  C C   . GLY A 1 75  ? 11.474  -6.391  -0.553  1.00 10.52 ? 75   GLY A C   1 
ATOM   536  O O   . GLY A 1 75  ? 12.142  -5.996  -1.501  1.00 9.71  ? 75   GLY A O   1 
ATOM   537  N N   . ASN A 1 76  ? 10.502  -7.283  -0.695  1.00 12.74 ? 76   ASN A N   1 
ATOM   538  C CA  . ASN A 1 76  ? 10.223  -7.854  -2.004  1.00 14.35 ? 76   ASN A CA  1 
ATOM   539  C C   . ASN A 1 76  ? 9.969   -6.833  -3.105  1.00 13.54 ? 76   ASN A C   1 
ATOM   540  O O   . ASN A 1 76  ? 10.675  -6.827  -4.115  1.00 13.78 ? 76   ASN A O   1 
ATOM   541  C CB  . ASN A 1 76  ? 9.058   -8.843  -1.915  1.00 17.80 ? 76   ASN A CB  1 
ATOM   542  C CG  . ASN A 1 76  ? 9.442   -10.116 -1.188  1.00 20.52 ? 76   ASN A CG  1 
ATOM   543  O OD1 . ASN A 1 76  ? 10.588  -10.562 -1.264  1.00 23.24 ? 76   ASN A OD1 1 
ATOM   544  N ND2 . ASN A 1 76  ? 8.485   -10.717 -0.494  1.00 20.14 ? 76   ASN A ND2 1 
ATOM   545  N N   . LEU A 1 77  ? 8.977   -5.971  -2.917  1.00 13.91 ? 77   LEU A N   1 
ATOM   546  C CA  . LEU A 1 77  ? 8.673   -4.961  -3.927  1.00 13.46 ? 77   LEU A CA  1 
ATOM   547  C C   . LEU A 1 77  ? 9.832   -3.977  -4.067  1.00 13.13 ? 77   LEU A C   1 
ATOM   548  O O   . LEU A 1 77  ? 10.132  -3.499  -5.163  1.00 11.94 ? 77   LEU A O   1 
ATOM   549  C CB  . LEU A 1 77  ? 7.391   -4.206  -3.564  1.00 14.53 ? 77   LEU A CB  1 
ATOM   550  C CG  . LEU A 1 77  ? 6.936   -3.107  -4.533  1.00 16.24 ? 77   LEU A CG  1 
ATOM   551  C CD1 . LEU A 1 77  ? 6.747   -3.684  -5.927  1.00 17.65 ? 77   LEU A CD1 1 
ATOM   552  C CD2 . LEU A 1 77  ? 5.642   -2.490  -4.026  1.00 17.40 ? 77   LEU A CD2 1 
ATOM   553  N N   . GLY A 1 78  ? 10.487  -3.680  -2.951  1.00 12.13 ? 78   GLY A N   1 
ATOM   554  C CA  . GLY A 1 78  ? 11.601  -2.753  -2.988  1.00 11.18 ? 78   GLY A CA  1 
ATOM   555  C C   . GLY A 1 78  ? 12.746  -3.264  -3.842  1.00 9.20  ? 78   GLY A C   1 
ATOM   556  O O   . GLY A 1 78  ? 13.278  -2.544  -4.683  1.00 9.10  ? 78   GLY A O   1 
ATOM   557  N N   . ALA A 1 79  ? 13.127  -4.520  -3.629  1.00 9.37  ? 79   ALA A N   1 
ATOM   558  C CA  . ALA A 1 79  ? 14.222  -5.116  -4.380  1.00 9.58  ? 79   ALA A CA  1 
ATOM   559  C C   . ALA A 1 79  ? 13.858  -5.240  -5.858  1.00 10.91 ? 79   ALA A C   1 
ATOM   560  O O   . ALA A 1 79  ? 14.717  -5.135  -6.736  1.00 10.27 ? 79   ALA A O   1 
ATOM   561  C CB  . ALA A 1 79  ? 14.563  -6.491  -3.794  1.00 9.09  ? 79   ALA A CB  1 
ATOM   562  N N   . GLN A 1 80  ? 12.576  -5.452  -6.127  1.00 11.70 ? 80   GLN A N   1 
ATOM   563  C CA  . GLN A 1 80  ? 12.109  -5.584  -7.498  1.00 12.42 ? 80   GLN A CA  1 
ATOM   564  C C   . GLN A 1 80  ? 12.261  -4.245  -8.208  1.00 11.44 ? 80   GLN A C   1 
ATOM   565  O O   . GLN A 1 80  ? 12.766  -4.185  -9.328  1.00 11.37 ? 80   GLN A O   1 
ATOM   566  C CB  . GLN A 1 80  ? 10.645  -6.030  -7.526  1.00 15.45 ? 80   GLN A CB  1 
ATOM   567  C CG  . GLN A 1 80  ? 10.149  -6.389  -8.916  1.00 19.80 ? 80   GLN A CG  1 
ATOM   568  C CD  . GLN A 1 80  ? 8.709   -6.859  -8.925  1.00 23.68 ? 80   GLN A CD  1 
ATOM   569  O OE1 . GLN A 1 80  ? 7.786   -6.086  -8.662  1.00 27.61 ? 80   GLN A OE1 1 
ATOM   570  N NE2 . GLN A 1 80  ? 8.508   -8.137  -9.226  1.00 27.25 ? 80   GLN A NE2 1 
ATOM   571  N N   . ASN A 1 81  ? 11.831  -3.173  -7.547  1.00 11.11 ? 81   ASN A N   1 
ATOM   572  C CA  . ASN A 1 81  ? 11.936  -1.833  -8.113  1.00 10.66 ? 81   ASN A CA  1 
ATOM   573  C C   . ASN A 1 81  ? 13.407  -1.496  -8.370  1.00 10.41 ? 81   ASN A C   1 
ATOM   574  O O   . ASN A 1 81  ? 13.761  -0.944  -9.419  1.00 10.69 ? 81   ASN A O   1 
ATOM   575  C CB  . ASN A 1 81  ? 11.294  -0.811  -7.162  1.00 11.79 ? 81   ASN A CB  1 
ATOM   576  C CG  . ASN A 1 81  ? 9.772   -0.831  -7.221  1.00 13.60 ? 81   ASN A CG  1 
ATOM   577  O OD1 . ASN A 1 81  ? 9.090   -0.523  -6.238  1.00 17.30 ? 81   ASN A OD1 1 
ATOM   578  N ND2 . ASN A 1 81  ? 9.230   -1.181  -8.383  1.00 12.33 ? 81   ASN A ND2 1 
ATOM   579  N N   . LEU A 1 82  ? 14.274  -1.835  -7.418  1.00 9.38  ? 82   LEU A N   1 
ATOM   580  C CA  . LEU A 1 82  ? 15.697  -1.579  -7.590  1.00 9.17  ? 82   LEU A CA  1 
ATOM   581  C C   . LEU A 1 82  ? 16.209  -2.349  -8.802  1.00 9.39  ? 82   LEU A C   1 
ATOM   582  O O   . LEU A 1 82  ? 16.957  -1.815  -9.618  1.00 8.33  ? 82   LEU A O   1 
ATOM   583  C CB  . LEU A 1 82  ? 16.488  -2.018  -6.349  1.00 9.04  ? 82   LEU A CB  1 
ATOM   584  C CG  . LEU A 1 82  ? 16.287  -1.227  -5.055  1.00 6.96  ? 82   LEU A CG  1 
ATOM   585  C CD1 . LEU A 1 82  ? 17.033  -1.906  -3.919  1.00 7.96  ? 82   LEU A CD1 1 
ATOM   586  C CD2 . LEU A 1 82  ? 16.789  0.204   -5.242  1.00 8.68  ? 82   LEU A CD2 1 
ATOM   587  N N   . SER A 1 83  ? 15.786  -3.609  -8.912  1.00 10.41 ? 83   SER A N   1 
ATOM   588  C CA  . SER A 1 83  ? 16.205  -4.486  -10.004 1.00 11.59 ? 83   SER A CA  1 
ATOM   589  C C   . SER A 1 83  ? 15.760  -4.036  -11.392 1.00 11.90 ? 83   SER A C   1 
ATOM   590  O O   . SER A 1 83  ? 16.419  -4.343  -12.388 1.00 13.08 ? 83   SER A O   1 
ATOM   591  C CB  . SER A 1 83  ? 15.686  -5.911  -9.766  1.00 10.10 ? 83   SER A CB  1 
ATOM   592  O OG  . SER A 1 83  ? 16.198  -6.474  -8.570  1.00 11.61 ? 83   SER A OG  1 
ATOM   593  N N   . GLU A 1 84  ? 14.646  -3.314  -11.461 1.00 13.62 ? 84   GLU A N   1 
ATOM   594  C CA  . GLU A 1 84  ? 14.112  -2.855  -12.742 1.00 13.24 ? 84   GLU A CA  1 
ATOM   595  C C   . GLU A 1 84  ? 14.549  -1.439  -13.110 1.00 13.46 ? 84   GLU A C   1 
ATOM   596  O O   . GLU A 1 84  ? 14.156  -0.910  -14.150 1.00 12.93 ? 84   GLU A O   1 
ATOM   597  C CB  . GLU A 1 84  ? 12.580  -2.935  -12.712 1.00 14.85 ? 84   GLU A CB  1 
ATOM   598  C CG  . GLU A 1 84  ? 12.053  -4.325  -12.368 1.00 16.10 ? 84   GLU A CG  1 
ATOM   599  C CD  . GLU A 1 84  ? 10.545  -4.374  -12.180 1.00 17.52 ? 84   GLU A CD  1 
ATOM   600  O OE1 . GLU A 1 84  ? 9.943   -3.339  -11.820 1.00 18.77 ? 84   GLU A OE1 1 
ATOM   601  O OE2 . GLU A 1 84  ? 9.963   -5.463  -12.371 1.00 20.76 ? 84   GLU A OE2 1 
ATOM   602  N N   . SER A 1 85  ? 15.390  -0.846  -12.271 1.00 11.35 ? 85   SER A N   1 
ATOM   603  C CA  . SER A 1 85  ? 15.858  0.519   -12.477 1.00 11.78 ? 85   SER A CA  1 
ATOM   604  C C   . SER A 1 85  ? 17.174  0.662   -13.235 1.00 12.88 ? 85   SER A C   1 
ATOM   605  O O   . SER A 1 85  ? 18.206  0.150   -12.804 1.00 11.71 ? 85   SER A O   1 
ATOM   606  C CB  . SER A 1 85  ? 15.991  1.218   -11.121 1.00 11.47 ? 85   SER A CB  1 
ATOM   607  O OG  . SER A 1 85  ? 16.582  2.497   -11.266 1.00 10.01 ? 85   SER A OG  1 
ATOM   608  N N   . ALA A 1 86  ? 17.128  1.371   -14.362 1.00 11.34 ? 86   ALA A N   1 
ATOM   609  C CA  . ALA A 1 86  ? 18.321  1.616   -15.168 1.00 12.23 ? 86   ALA A CA  1 
ATOM   610  C C   . ALA A 1 86  ? 19.238  2.555   -14.391 1.00 12.26 ? 86   ALA A C   1 
ATOM   611  O O   . ALA A 1 86  ? 20.464  2.507   -14.528 1.00 12.83 ? 86   ALA A O   1 
ATOM   612  C CB  . ALA A 1 86  ? 17.933  2.256   -16.502 1.00 14.36 ? 86   ALA A CB  1 
ATOM   613  N N   . ALA A 1 87  ? 18.634  3.419   -13.582 1.00 11.69 ? 87   ALA A N   1 
ATOM   614  C CA  . ALA A 1 87  ? 19.398  4.362   -12.780 1.00 10.74 ? 87   ALA A CA  1 
ATOM   615  C C   . ALA A 1 87  ? 20.245  3.595   -11.774 1.00 10.46 ? 87   ALA A C   1 
ATOM   616  O O   . ALA A 1 87  ? 21.410  3.922   -11.554 1.00 9.69  ? 87   ALA A O   1 
ATOM   617  C CB  . ALA A 1 87  ? 18.463  5.319   -12.056 1.00 10.62 ? 87   ALA A CB  1 
ATOM   618  N N   . VAL A 1 88  ? 19.655  2.569   -11.168 1.00 9.91  ? 88   VAL A N   1 
ATOM   619  C CA  . VAL A 1 88  ? 20.373  1.759   -10.188 1.00 9.12  ? 88   VAL A CA  1 
ATOM   620  C C   . VAL A 1 88  ? 21.458  0.938   -10.879 1.00 9.19  ? 88   VAL A C   1 
ATOM   621  O O   . VAL A 1 88  ? 22.553  0.773   -10.346 1.00 8.98  ? 88   VAL A O   1 
ATOM   622  C CB  . VAL A 1 88  ? 19.412  0.820   -9.423  1.00 10.24 ? 88   VAL A CB  1 
ATOM   623  C CG1 . VAL A 1 88  ? 20.195  -0.053  -8.444  1.00 7.79  ? 88   VAL A CG1 1 
ATOM   624  C CG2 . VAL A 1 88  ? 18.391  1.649   -8.660  1.00 11.18 ? 88   VAL A CG2 1 
ATOM   625  N N   . LYS A 1 89  ? 21.159  0.435   -12.071 1.00 7.86  ? 89   LYS A N   1 
ATOM   626  C CA  . LYS A 1 89  ? 22.131  -0.349  -12.829 1.00 9.42  ? 89   LYS A CA  1 
ATOM   627  C C   . LYS A 1 89  ? 23.404  0.471   -13.025 1.00 10.20 ? 89   LYS A C   1 
ATOM   628  O O   . LYS A 1 89  ? 24.514  -0.003  -12.771 1.00 8.29  ? 89   LYS A O   1 
ATOM   629  C CB  . LYS A 1 89  ? 21.561  -0.726  -14.200 1.00 10.63 ? 89   LYS A CB  1 
ATOM   630  C CG  . LYS A 1 89  ? 22.462  -1.654  -15.005 1.00 12.52 ? 89   LYS A CG  1 
ATOM   631  C CD  . LYS A 1 89  ? 21.920  -1.895  -16.414 1.00 15.27 ? 89   LYS A CD  1 
ATOM   632  C CE  . LYS A 1 89  ? 20.496  -2.462  -16.406 1.00 20.06 ? 89   LYS A CE  1 
ATOM   633  N NZ  . LYS A 1 89  ? 20.372  -3.845  -15.837 1.00 18.72 ? 89   LYS A NZ  1 
ATOM   634  N N   . GLU A 1 90  ? 23.223  1.713   -13.472 1.00 10.10 ? 90   GLU A N   1 
ATOM   635  C CA  . GLU A 1 90  ? 24.332  2.627   -13.721 1.00 10.66 ? 90   GLU A CA  1 
ATOM   636  C C   . GLU A 1 90  ? 25.131  2.895   -12.449 1.00 10.48 ? 90   GLU A C   1 
ATOM   637  O O   . GLU A 1 90  ? 26.361  2.820   -12.445 1.00 10.01 ? 90   GLU A O   1 
ATOM   638  C CB  . GLU A 1 90  ? 23.794  3.945   -14.287 1.00 12.79 ? 90   GLU A CB  1 
ATOM   639  C CG  . GLU A 1 90  ? 24.848  4.815   -14.941 1.00 18.45 ? 90   GLU A CG  1 
ATOM   640  C CD  . GLU A 1 90  ? 24.274  6.088   -15.530 1.00 19.69 ? 90   GLU A CD  1 
ATOM   641  O OE1 . GLU A 1 90  ? 23.234  6.012   -16.222 1.00 21.93 ? 90   GLU A OE1 1 
ATOM   642  O OE2 . GLU A 1 90  ? 24.871  7.162   -15.306 1.00 19.82 ? 90   GLU A OE2 1 
ATOM   643  N N   . ILE A 1 91  ? 24.429  3.211   -11.368 1.00 9.54  ? 91   ILE A N   1 
ATOM   644  C CA  . ILE A 1 91  ? 25.089  3.471   -10.100 1.00 9.68  ? 91   ILE A CA  1 
ATOM   645  C C   . ILE A 1 91  ? 25.904  2.255   -9.659  1.00 8.68  ? 91   ILE A C   1 
ATOM   646  O O   . ILE A 1 91  ? 27.068  2.385   -9.300  1.00 6.77  ? 91   ILE A O   1 
ATOM   647  C CB  . ILE A 1 91  ? 24.058  3.834   -9.011  1.00 11.95 ? 91   ILE A CB  1 
ATOM   648  C CG1 . ILE A 1 91  ? 23.498  5.227   -9.300  1.00 15.99 ? 91   ILE A CG1 1 
ATOM   649  C CG2 . ILE A 1 91  ? 24.693  3.772   -7.620  1.00 11.99 ? 91   ILE A CG2 1 
ATOM   650  C CD1 . ILE A 1 91  ? 22.402  5.651   -8.372  1.00 18.44 ? 91   ILE A CD1 1 
ATOM   651  N N   . LEU A 1 92  ? 25.304  1.071   -9.704  1.00 8.33  ? 92   LEU A N   1 
ATOM   652  C CA  . LEU A 1 92  ? 26.016  -0.134  -9.279  1.00 8.77  ? 92   LEU A CA  1 
ATOM   653  C C   . LEU A 1 92  ? 27.207  -0.503  -10.166 1.00 9.15  ? 92   LEU A C   1 
ATOM   654  O O   . LEU A 1 92  ? 28.271  -0.873  -9.664  1.00 10.17 ? 92   LEU A O   1 
ATOM   655  C CB  . LEU A 1 92  ? 25.044  -1.314  -9.191  1.00 8.16  ? 92   LEU A CB  1 
ATOM   656  C CG  . LEU A 1 92  ? 23.928  -1.199  -8.147  1.00 9.22  ? 92   LEU A CG  1 
ATOM   657  C CD1 . LEU A 1 92  ? 23.071  -2.455  -8.197  1.00 6.96  ? 92   LEU A CD1 1 
ATOM   658  C CD2 . LEU A 1 92  ? 24.521  -1.018  -6.751  1.00 8.25  ? 92   LEU A CD2 1 
ATOM   659  N N   . LYS A 1 93  ? 27.036  -0.412  -11.478 1.00 8.74  ? 93   LYS A N   1 
ATOM   660  C CA  . LYS A 1 93  ? 28.122  -0.727  -12.398 1.00 10.34 ? 93   LYS A CA  1 
ATOM   661  C C   . LYS A 1 93  ? 29.314  0.194   -12.150 1.00 10.48 ? 93   LYS A C   1 
ATOM   662  O O   . LYS A 1 93  ? 30.456  -0.252  -12.084 1.00 11.45 ? 93   LYS A O   1 
ATOM   663  C CB  . LYS A 1 93  ? 27.664  -0.558  -13.847 1.00 12.11 ? 93   LYS A CB  1 
ATOM   664  C CG  . LYS A 1 93  ? 26.762  -1.660  -14.376 1.00 17.42 ? 93   LYS A CG  1 
ATOM   665  C CD  . LYS A 1 93  ? 27.537  -2.936  -14.633 1.00 20.06 ? 93   LYS A CD  1 
ATOM   666  C CE  . LYS A 1 93  ? 26.686  -3.941  -15.388 1.00 21.05 ? 93   LYS A CE  1 
ATOM   667  N NZ  . LYS A 1 93  ? 27.430  -5.210  -15.585 1.00 24.30 ? 93   LYS A NZ  1 
ATOM   668  N N   . GLU A 1 94  ? 29.044  1.487   -12.020 1.00 10.21 ? 94   GLU A N   1 
ATOM   669  C CA  . GLU A 1 94  ? 30.112  2.450   -11.803 1.00 9.69  ? 94   GLU A CA  1 
ATOM   670  C C   . GLU A 1 94  ? 30.785  2.291   -10.448 1.00 8.43  ? 94   GLU A C   1 
ATOM   671  O O   . GLU A 1 94  ? 31.993  2.495   -10.331 1.00 10.03 ? 94   GLU A O   1 
ATOM   672  C CB  . GLU A 1 94  ? 29.578  3.872   -11.997 1.00 12.79 ? 94   GLU A CB  1 
ATOM   673  C CG  . GLU A 1 94  ? 29.426  4.230   -13.475 1.00 19.91 ? 94   GLU A CG  1 
ATOM   674  C CD  . GLU A 1 94  ? 28.582  5.469   -13.722 1.00 23.08 ? 94   GLU A CD  1 
ATOM   675  O OE1 . GLU A 1 94  ? 28.721  6.454   -12.968 1.00 26.72 ? 94   GLU A OE1 1 
ATOM   676  O OE2 . GLU A 1 94  ? 27.789  5.460   -14.689 1.00 29.05 ? 94   GLU A OE2 1 
ATOM   677  N N   . GLN A 1 95  ? 30.013  1.923   -9.429  1.00 7.06  ? 95   GLN A N   1 
ATOM   678  C CA  . GLN A 1 95  ? 30.573  1.719   -8.098  1.00 6.52  ? 95   GLN A CA  1 
ATOM   679  C C   . GLN A 1 95  ? 31.518  0.522   -8.135  1.00 9.19  ? 95   GLN A C   1 
ATOM   680  O O   . GLN A 1 95  ? 32.611  0.562   -7.582  1.00 7.67  ? 95   GLN A O   1 
ATOM   681  C CB  . GLN A 1 95  ? 29.465  1.453   -7.079  1.00 7.54  ? 95   GLN A CB  1 
ATOM   682  C CG  . GLN A 1 95  ? 29.986  1.221   -5.672  1.00 7.60  ? 95   GLN A CG  1 
ATOM   683  C CD  . GLN A 1 95  ? 30.393  2.508   -4.984  1.00 5.66  ? 95   GLN A CD  1 
ATOM   684  O OE1 . GLN A 1 95  ? 30.644  3.522   -5.637  1.00 8.10  ? 95   GLN A OE1 1 
ATOM   685  N NE2 . GLN A 1 95  ? 30.472  2.471   -3.658  1.00 7.16  ? 95   GLN A NE2 1 
ATOM   686  N N   . GLU A 1 96  ? 31.088  -0.550  -8.787  1.00 9.56  ? 96   GLU A N   1 
ATOM   687  C CA  . GLU A 1 96  ? 31.931  -1.733  -8.888  1.00 11.67 ? 96   GLU A CA  1 
ATOM   688  C C   . GLU A 1 96  ? 33.218  -1.412  -9.649  1.00 11.18 ? 96   GLU A C   1 
ATOM   689  O O   . GLU A 1 96  ? 34.311  -1.797  -9.232  1.00 11.45 ? 96   GLU A O   1 
ATOM   690  C CB  . GLU A 1 96  ? 31.175  -2.861  -9.590  1.00 13.26 ? 96   GLU A CB  1 
ATOM   691  C CG  . GLU A 1 96  ? 32.019  -4.097  -9.834  1.00 17.57 ? 96   GLU A CG  1 
ATOM   692  C CD  . GLU A 1 96  ? 31.183  -5.344  -10.019 1.00 17.39 ? 96   GLU A CD  1 
ATOM   693  O OE1 . GLU A 1 96  ? 30.219  -5.302  -10.805 1.00 17.15 ? 96   GLU A OE1 1 
ATOM   694  O OE2 . GLU A 1 96  ? 31.494  -6.368  -9.379  1.00 22.67 ? 96   GLU A OE2 1 
ATOM   695  N N   . ASN A 1 97  ? 33.088  -0.692  -10.760 1.00 9.50  ? 97   ASN A N   1 
ATOM   696  C CA  . ASN A 1 97  ? 34.245  -0.333  -11.568 1.00 11.12 ? 97   ASN A CA  1 
ATOM   697  C C   . ASN A 1 97  ? 35.288  0.502   -10.818 1.00 11.29 ? 97   ASN A C   1 
ATOM   698  O O   . ASN A 1 97  ? 36.489  0.367   -11.066 1.00 11.97 ? 97   ASN A O   1 
ATOM   699  C CB  . ASN A 1 97  ? 33.796  0.428   -12.815 1.00 11.54 ? 97   ASN A CB  1 
ATOM   700  C CG  . ASN A 1 97  ? 33.127  -0.467  -13.843 1.00 13.96 ? 97   ASN A CG  1 
ATOM   701  O OD1 . ASN A 1 97  ? 32.578  0.017   -14.831 1.00 16.78 ? 97   ASN A OD1 1 
ATOM   702  N ND2 . ASN A 1 97  ? 33.176  -1.777  -13.621 1.00 13.16 ? 97   ASN A ND2 1 
ATOM   703  N N   . ARG A 1 98  ? 34.840  1.363   -9.907  1.00 9.30  ? 98   ARG A N   1 
ATOM   704  C CA  . ARG A 1 98  ? 35.768  2.206   -9.155  1.00 11.10 ? 98   ARG A CA  1 
ATOM   705  C C   . ARG A 1 98  ? 36.225  1.582   -7.841  1.00 10.09 ? 98   ARG A C   1 
ATOM   706  O O   . ARG A 1 98  ? 36.824  2.257   -7.002  1.00 12.16 ? 98   ARG A O   1 
ATOM   707  C CB  . ARG A 1 98  ? 35.139  3.573   -8.861  1.00 12.71 ? 98   ARG A CB  1 
ATOM   708  C CG  . ARG A 1 98  ? 33.920  3.518   -7.945  1.00 16.52 ? 98   ARG A CG  1 
ATOM   709  C CD  . ARG A 1 98  ? 33.457  4.915   -7.568  1.00 18.38 ? 98   ARG A CD  1 
ATOM   710  N NE  . ARG A 1 98  ? 34.453  5.611   -6.757  1.00 22.72 ? 98   ARG A NE  1 
ATOM   711  C CZ  . ARG A 1 98  ? 34.562  5.505   -5.436  1.00 24.58 ? 98   ARG A CZ  1 
ATOM   712  N NH1 . ARG A 1 98  ? 33.730  4.731   -4.750  1.00 23.73 ? 98   ARG A NH1 1 
ATOM   713  N NH2 . ARG A 1 98  ? 35.514  6.172   -4.794  1.00 25.09 ? 98   ARG A NH2 1 
ATOM   714  N N   . LYS A 1 99  ? 35.951  0.294   -7.667  1.00 10.18 ? 99   LYS A N   1 
ATOM   715  C CA  . LYS A 1 99  ? 36.331  -0.421  -6.453  1.00 10.83 ? 99   LYS A CA  1 
ATOM   716  C C   . LYS A 1 99  ? 35.644  0.141   -5.211  1.00 10.10 ? 99   LYS A C   1 
ATOM   717  O O   . LYS A 1 99  ? 36.256  0.275   -4.151  1.00 9.77  ? 99   LYS A O   1 
ATOM   718  C CB  . LYS A 1 99  ? 37.854  -0.389  -6.262  1.00 11.31 ? 99   LYS A CB  1 
ATOM   719  C CG  . LYS A 1 99  ? 38.649  -0.786  -7.502  1.00 14.13 ? 99   LYS A CG  1 
ATOM   720  C CD  . LYS A 1 99  ? 38.234  -2.140  -8.057  1.00 15.53 ? 99   LYS A CD  1 
ATOM   721  C CE  . LYS A 1 99  ? 38.565  -3.274  -7.108  1.00 18.12 ? 99   LYS A CE  1 
ATOM   722  N NZ  . LYS A 1 99  ? 38.328  -4.605  -7.751  1.00 19.54 ? 99   LYS A NZ  1 
ATOM   723  N N   . GLY A 1 100 ? 34.365  0.472   -5.356  1.00 9.65  ? 100  GLY A N   1 
ATOM   724  C CA  . GLY A 1 100 ? 33.592  0.988   -4.244  1.00 9.59  ? 100  GLY A CA  1 
ATOM   725  C C   . GLY A 1 100 ? 32.712  -0.119  -3.689  1.00 10.02 ? 100  GLY A C   1 
ATOM   726  O O   . GLY A 1 100 ? 32.154  -0.926  -4.441  1.00 9.47  ? 100  GLY A O   1 
ATOM   727  N N   . LEU A 1 101 ? 32.587  -0.155  -2.370  1.00 8.04  ? 101  LEU A N   1 
ATOM   728  C CA  . LEU A 1 101 ? 31.791  -1.170  -1.695  1.00 8.34  ? 101  LEU A CA  1 
ATOM   729  C C   . LEU A 1 101 ? 30.308  -1.106  -2.049  1.00 8.65  ? 101  LEU A C   1 
ATOM   730  O O   . LEU A 1 101 ? 29.739  -0.025  -2.186  1.00 8.95  ? 101  LEU A O   1 
ATOM   731  C CB  . LEU A 1 101 ? 31.953  -1.016  -0.182  1.00 7.35  ? 101  LEU A CB  1 
ATOM   732  C CG  . LEU A 1 101 ? 31.242  -2.030  0.711   1.00 5.44  ? 101  LEU A CG  1 
ATOM   733  C CD1 . LEU A 1 101 ? 31.846  -3.397  0.457   1.00 6.03  ? 101  LEU A CD1 1 
ATOM   734  C CD2 . LEU A 1 101 ? 31.389  -1.644  2.178   1.00 8.61  ? 101  LEU A CD2 1 
ATOM   735  N N   . ILE A 1 102 ? 29.699  -2.278  -2.204  1.00 7.48  ? 102  ILE A N   1 
ATOM   736  C CA  . ILE A 1 102 ? 28.275  -2.395  -2.490  1.00 6.55  ? 102  ILE A CA  1 
ATOM   737  C C   . ILE A 1 102 ? 27.750  -3.365  -1.438  1.00 6.03  ? 102  ILE A C   1 
ATOM   738  O O   . ILE A 1 102 ? 28.297  -4.457  -1.269  1.00 8.93  ? 102  ILE A O   1 
ATOM   739  C CB  . ILE A 1 102 ? 28.008  -2.967  -3.900  1.00 6.83  ? 102  ILE A CB  1 
ATOM   740  C CG1 . ILE A 1 102 ? 28.493  -1.975  -4.961  1.00 7.38  ? 102  ILE A CG1 1 
ATOM   741  C CG2 . ILE A 1 102 ? 26.513  -3.223  -4.081  1.00 8.94  ? 102  ILE A CG2 1 
ATOM   742  C CD1 . ILE A 1 102 ? 28.369  -2.478  -6.383  1.00 6.70  ? 102  ILE A CD1 1 
ATOM   743  N N   . ALA A 1 103 ? 26.707  -2.959  -0.722  1.00 5.62  ? 103  ALA A N   1 
ATOM   744  C CA  . ALA A 1 103 ? 26.125  -3.787  0.333   1.00 5.81  ? 103  ALA A CA  1 
ATOM   745  C C   . ALA A 1 103 ? 24.634  -3.979  0.102   1.00 7.07  ? 103  ALA A C   1 
ATOM   746  O O   . ALA A 1 103 ? 23.913  -3.011  -0.142  1.00 6.17  ? 103  ALA A O   1 
ATOM   747  C CB  . ALA A 1 103 ? 26.360  -3.132  1.686   1.00 5.97  ? 103  ALA A CB  1 
ATOM   748  N N   . ALA A 1 104 ? 24.171  -5.224  0.198   1.00 6.08  ? 104  ALA A N   1 
ATOM   749  C CA  . ALA A 1 104 ? 22.759  -5.530  -0.021  1.00 5.10  ? 104  ALA A CA  1 
ATOM   750  C C   . ALA A 1 104 ? 22.254  -6.562  0.988   1.00 6.95  ? 104  ALA A C   1 
ATOM   751  O O   . ALA A 1 104 ? 22.970  -7.499  1.337   1.00 5.09  ? 104  ALA A O   1 
ATOM   752  C CB  . ALA A 1 104 ? 22.560  -6.035  -1.448  1.00 6.13  ? 104  ALA A CB  1 
ATOM   753  N N   . ILE A 1 105 ? 21.017  -6.402  1.441   1.00 6.24  ? 105  ILE A N   1 
ATOM   754  C CA  . ILE A 1 105 ? 20.472  -7.318  2.437   1.00 6.65  ? 105  ILE A CA  1 
ATOM   755  C C   . ILE A 1 105 ? 19.103  -7.915  2.104   1.00 9.40  ? 105  ILE A C   1 
ATOM   756  O O   . ILE A 1 105 ? 18.271  -7.277  1.451   1.00 8.82  ? 105  ILE A O   1 
ATOM   757  C CB  . ILE A 1 105 ? 20.392  -6.603  3.813   1.00 7.29  ? 105  ILE A CB  1 
ATOM   758  C CG1 . ILE A 1 105 ? 19.927  -7.574  4.898   1.00 8.57  ? 105  ILE A CG1 1 
ATOM   759  C CG2 . ILE A 1 105 ? 19.429  -5.412  3.730   1.00 7.10  ? 105  ILE A CG2 1 
ATOM   760  C CD1 . ILE A 1 105 ? 19.945  -6.986  6.298   1.00 6.95  ? 105  ILE A CD1 1 
ATOM   761  N N   . CYS A 1 106 ? 18.898  -9.155  2.549   1.00 8.20  ? 106  CYS A N   1 
ATOM   762  C CA  . CYS A 1 106 ? 17.637  -9.875  2.375   1.00 10.65 ? 106  CYS A CA  1 
ATOM   763  C C   . CYS A 1 106 ? 17.346  -10.184 0.914   1.00 9.32  ? 106  CYS A C   1 
ATOM   764  O O   . CYS A 1 106 ? 17.966  -11.074 0.332   1.00 9.05  ? 106  CYS A O   1 
ATOM   765  C CB  . CYS A 1 106 ? 16.495  -9.056  2.989   1.00 10.94 ? 106  CYS A CB  1 
ATOM   766  S SG  . CYS A 1 106 ? 15.088  -10.028 3.562   1.00 16.53 ? 106  CYS A SG  1 
ATOM   767  N N   . ALA A 1 107 ? 16.395  -9.459  0.331   1.00 9.73  ? 107  ALA A N   1 
ATOM   768  C CA  . ALA A 1 107 ? 16.046  -9.639  -1.074  1.00 9.06  ? 107  ALA A CA  1 
ATOM   769  C C   . ALA A 1 107 ? 16.889  -8.687  -1.923  1.00 9.50  ? 107  ALA A C   1 
ATOM   770  O O   . ALA A 1 107 ? 16.995  -8.844  -3.141  1.00 10.02 ? 107  ALA A O   1 
ATOM   771  C CB  . ALA A 1 107 ? 14.562  -9.358  -1.288  1.00 10.52 ? 107  ALA A CB  1 
ATOM   772  N N   . GLY A 1 108 ? 17.499  -7.705  -1.259  1.00 7.87  ? 108  GLY A N   1 
ATOM   773  C CA  . GLY A 1 108 ? 18.324  -6.725  -1.943  1.00 7.44  ? 108  GLY A CA  1 
ATOM   774  C C   . GLY A 1 108 ? 19.366  -7.274  -2.906  1.00 7.58  ? 108  GLY A C   1 
ATOM   775  O O   . GLY A 1 108 ? 19.548  -6.724  -3.994  1.00 7.41  ? 108  GLY A O   1 
ATOM   776  N N   . PRO A 1 109 ? 20.082  -8.351  -2.539  1.00 6.87  ? 109  PRO A N   1 
ATOM   777  C CA  . PRO A 1 109 ? 21.099  -8.923  -3.426  1.00 7.89  ? 109  PRO A CA  1 
ATOM   778  C C   . PRO A 1 109 ? 20.590  -9.336  -4.811  1.00 8.86  ? 109  PRO A C   1 
ATOM   779  O O   . PRO A 1 109 ? 21.373  -9.446  -5.751  1.00 9.18  ? 109  PRO A O   1 
ATOM   780  C CB  . PRO A 1 109 ? 21.625  -10.115 -2.621  1.00 8.24  ? 109  PRO A CB  1 
ATOM   781  C CG  . PRO A 1 109 ? 21.473  -9.641  -1.199  1.00 5.23  ? 109  PRO A CG  1 
ATOM   782  C CD  . PRO A 1 109 ? 20.097  -9.017  -1.225  1.00 6.99  ? 109  PRO A CD  1 
ATOM   783  N N   . THR A 1 110 ? 19.288  -9.569  -4.952  1.00 9.72  ? 110  THR A N   1 
ATOM   784  C CA  . THR A 1 110 ? 18.771  -9.964  -6.260  1.00 9.61  ? 110  THR A CA  1 
ATOM   785  C C   . THR A 1 110 ? 18.892  -8.815  -7.260  1.00 10.38 ? 110  THR A C   1 
ATOM   786  O O   . THR A 1 110 ? 18.868  -9.028  -8.471  1.00 9.73  ? 110  THR A O   1 
ATOM   787  C CB  . THR A 1 110 ? 17.305  -10.462 -6.181  1.00 9.81  ? 110  THR A CB  1 
ATOM   788  O OG1 . THR A 1 110 ? 16.449  -9.414  -5.715  1.00 9.69  ? 110  THR A OG1 1 
ATOM   789  C CG2 . THR A 1 110 ? 17.209  -11.651 -5.229  1.00 11.81 ? 110  THR A CG2 1 
ATOM   790  N N   . ALA A 1 111 ? 19.037  -7.595  -6.751  1.00 8.91  ? 111  ALA A N   1 
ATOM   791  C CA  . ALA A 1 111 ? 19.210  -6.443  -7.625  1.00 9.71  ? 111  ALA A CA  1 
ATOM   792  C C   . ALA A 1 111 ? 20.613  -6.553  -8.227  1.00 9.69  ? 111  ALA A C   1 
ATOM   793  O O   . ALA A 1 111 ? 20.878  -6.061  -9.327  1.00 9.75  ? 111  ALA A O   1 
ATOM   794  C CB  . ALA A 1 111 ? 19.068  -5.145  -6.832  1.00 11.24 ? 111  ALA A CB  1 
ATOM   795  N N   . LEU A 1 112 ? 21.514  -7.215  -7.505  1.00 9.83  ? 112  LEU A N   1 
ATOM   796  C CA  . LEU A 1 112 ? 22.873  -7.402  -7.999  1.00 9.76  ? 112  LEU A CA  1 
ATOM   797  C C   . LEU A 1 112 ? 22.836  -8.366  -9.187  1.00 8.58  ? 112  LEU A C   1 
ATOM   798  O O   . LEU A 1 112 ? 23.533  -8.178  -10.186 1.00 9.76  ? 112  LEU A O   1 
ATOM   799  C CB  . LEU A 1 112 ? 23.775  -7.961  -6.894  1.00 10.48 ? 112  LEU A CB  1 
ATOM   800  C CG  . LEU A 1 112 ? 23.887  -7.102  -5.631  1.00 11.32 ? 112  LEU A CG  1 
ATOM   801  C CD1 . LEU A 1 112 ? 24.812  -7.785  -4.627  1.00 11.40 ? 112  LEU A CD1 1 
ATOM   802  C CD2 . LEU A 1 112 ? 24.419  -5.720  -5.993  1.00 12.62 ? 112  LEU A CD2 1 
ATOM   803  N N   . LEU A 1 113 ? 22.015  -9.403  -9.074  1.00 8.96  ? 113  LEU A N   1 
ATOM   804  C CA  . LEU A 1 113 ? 21.892  -10.370 -10.155 1.00 10.15 ? 113  LEU A CA  1 
ATOM   805  C C   . LEU A 1 113 ? 21.289  -9.693  -11.379 1.00 10.03 ? 113  LEU A C   1 
ATOM   806  O O   . LEU A 1 113 ? 21.790  -9.849  -12.488 1.00 11.13 ? 113  LEU A O   1 
ATOM   807  C CB  . LEU A 1 113 ? 21.003  -11.543 -9.734  1.00 9.89  ? 113  LEU A CB  1 
ATOM   808  C CG  . LEU A 1 113 ? 20.610  -12.518 -10.852 1.00 10.33 ? 113  LEU A CG  1 
ATOM   809  C CD1 . LEU A 1 113 ? 21.854  -13.089 -11.513 1.00 10.66 ? 113  LEU A CD1 1 
ATOM   810  C CD2 . LEU A 1 113 ? 19.745  -13.627 -10.277 1.00 9.52  ? 113  LEU A CD2 1 
ATOM   811  N N   . ALA A 1 114 ? 20.220  -8.927  -11.165 1.00 9.56  ? 114  ALA A N   1 
ATOM   812  C CA  . ALA A 1 114 ? 19.536  -8.234  -12.254 1.00 10.37 ? 114  ALA A CA  1 
ATOM   813  C C   . ALA A 1 114 ? 20.453  -7.311  -13.046 1.00 11.26 ? 114  ALA A C   1 
ATOM   814  O O   . ALA A 1 114 ? 20.338  -7.203  -14.270 1.00 12.23 ? 114  ALA A O   1 
ATOM   815  C CB  . ALA A 1 114 ? 18.353  -7.435  -11.705 1.00 10.64 ? 114  ALA A CB  1 
ATOM   816  N N   . HIS A 1 115 ? 21.365  -6.642  -12.347 1.00 10.53 ? 115  HIS A N   1 
ATOM   817  C CA  . HIS A 1 115 ? 22.278  -5.717  -13.001 1.00 11.12 ? 115  HIS A CA  1 
ATOM   818  C C   . HIS A 1 115 ? 23.660  -6.307  -13.252 1.00 11.13 ? 115  HIS A C   1 
ATOM   819  O O   . HIS A 1 115 ? 24.609  -5.587  -13.564 1.00 10.84 ? 115  HIS A O   1 
ATOM   820  C CB  . HIS A 1 115 ? 22.355  -4.429  -12.179 1.00 10.71 ? 115  HIS A CB  1 
ATOM   821  C CG  . HIS A 1 115 ? 21.053  -3.701  -12.101 1.00 11.83 ? 115  HIS A CG  1 
ATOM   822  N ND1 . HIS A 1 115 ? 20.512  -3.237  -10.924 1.00 13.81 ? 115  HIS A ND1 1 
ATOM   823  C CD2 . HIS A 1 115 ? 20.144  -3.408  -13.068 1.00 8.65  ? 115  HIS A CD2 1 
ATOM   824  C CE1 . HIS A 1 115 ? 19.338  -2.696  -11.156 1.00 9.37  ? 115  HIS A CE1 1 
ATOM   825  N NE2 . HIS A 1 115 ? 19.083  -2.785  -12.454 1.00 14.59 ? 115  HIS A NE2 1 
ATOM   826  N N   . GLU A 1 116 ? 23.750  -7.631  -13.135 1.00 11.41 ? 116  GLU A N   1 
ATOM   827  C CA  . GLU A 1 116 ? 24.990  -8.366  -13.360 1.00 13.20 ? 116  GLU A CA  1 
ATOM   828  C C   . GLU A 1 116 ? 26.170  -7.755  -12.616 1.00 11.50 ? 116  GLU A C   1 
ATOM   829  O O   . GLU A 1 116 ? 27.210  -7.455  -13.203 1.00 12.41 ? 116  GLU A O   1 
ATOM   830  C CB  . GLU A 1 116 ? 25.289  -8.441  -14.860 1.00 14.17 ? 116  GLU A CB  1 
ATOM   831  C CG  . GLU A 1 116 ? 24.115  -8.968  -15.682 1.00 17.92 ? 116  GLU A CG  1 
ATOM   832  C CD  . GLU A 1 116 ? 24.519  -9.407  -17.076 1.00 21.94 ? 116  GLU A CD  1 
ATOM   833  O OE1 . GLU A 1 116 ? 25.191  -8.622  -17.776 1.00 22.90 ? 116  GLU A OE1 1 
ATOM   834  O OE2 . GLU A 1 116 ? 24.157  -10.536 -17.474 1.00 25.97 ? 116  GLU A OE2 1 
ATOM   835  N N   . ILE A 1 117 ? 26.001  -7.604  -11.310 1.00 10.44 ? 117  ILE A N   1 
ATOM   836  C CA  . ILE A 1 117 ? 27.021  -7.027  -10.451 1.00 10.63 ? 117  ILE A CA  1 
ATOM   837  C C   . ILE A 1 117 ? 27.720  -8.109  -9.628  1.00 10.70 ? 117  ILE A C   1 
ATOM   838  O O   . ILE A 1 117 ? 27.065  -8.988  -9.069  1.00 11.62 ? 117  ILE A O   1 
ATOM   839  C CB  . ILE A 1 117 ? 26.395  -6.018  -9.462  1.00 9.27  ? 117  ILE A CB  1 
ATOM   840  C CG1 . ILE A 1 117 ? 25.557  -4.983  -10.221 1.00 8.18  ? 117  ILE A CG1 1 
ATOM   841  C CG2 . ILE A 1 117 ? 27.490  -5.348  -8.637  1.00 9.89  ? 117  ILE A CG2 1 
ATOM   842  C CD1 . ILE A 1 117 ? 26.359  -4.075  -11.135 1.00 10.47 ? 117  ILE A CD1 1 
ATOM   843  N N   . GLY A 1 118 ? 29.046  -8.038  -9.570  1.00 11.44 ? 118  GLY A N   1 
ATOM   844  C CA  . GLY A 1 118 ? 29.826  -8.978  -8.782  1.00 11.41 ? 118  GLY A CA  1 
ATOM   845  C C   . GLY A 1 118 ? 29.707  -10.462 -9.072  1.00 10.03 ? 118  GLY A C   1 
ATOM   846  O O   . GLY A 1 118 ? 29.823  -11.277 -8.156  1.00 10.70 ? 118  GLY A O   1 
ATOM   847  N N   . PHE A 1 119 ? 29.484  -10.830 -10.326 1.00 11.79 ? 119  PHE A N   1 
ATOM   848  C CA  . PHE A 1 119 ? 29.378  -12.244 -10.656 1.00 10.97 ? 119  PHE A CA  1 
ATOM   849  C C   . PHE A 1 119 ? 30.614  -12.996 -10.168 1.00 11.28 ? 119  PHE A C   1 
ATOM   850  O O   . PHE A 1 119 ? 31.738  -12.502 -10.270 1.00 12.17 ? 119  PHE A O   1 
ATOM   851  C CB  . PHE A 1 119 ? 29.206  -12.439 -12.166 1.00 11.15 ? 119  PHE A CB  1 
ATOM   852  C CG  . PHE A 1 119 ? 27.791  -12.242 -12.651 1.00 11.23 ? 119  PHE A CG  1 
ATOM   853  C CD1 . PHE A 1 119 ? 27.447  -12.548 -13.966 1.00 11.18 ? 119  PHE A CD1 1 
ATOM   854  C CD2 . PHE A 1 119 ? 26.799  -11.773 -11.792 1.00 8.96  ? 119  PHE A CD2 1 
ATOM   855  C CE1 . PHE A 1 119 ? 26.135  -12.395 -14.420 1.00 9.25  ? 119  PHE A CE1 1 
ATOM   856  C CE2 . PHE A 1 119 ? 25.483  -11.616 -12.233 1.00 9.06  ? 119  PHE A CE2 1 
ATOM   857  C CZ  . PHE A 1 119 ? 25.151  -11.927 -13.550 1.00 10.74 ? 119  PHE A CZ  1 
ATOM   858  N N   . GLY A 1 120 ? 30.390  -14.192 -9.631  1.00 10.97 ? 120  GLY A N   1 
ATOM   859  C CA  . GLY A 1 120 ? 31.486  -14.999 -9.130  1.00 11.71 ? 120  GLY A CA  1 
ATOM   860  C C   . GLY A 1 120 ? 31.692  -14.816 -7.640  1.00 11.19 ? 120  GLY A C   1 
ATOM   861  O O   . GLY A 1 120 ? 32.387  -15.598 -6.999  1.00 13.64 ? 120  GLY A O   1 
ATOM   862  N N   . SER A 1 121 ? 31.085  -13.776 -7.079  1.00 10.74 ? 121  SER A N   1 
ATOM   863  C CA  . SER A 1 121 ? 31.224  -13.513 -5.655  1.00 10.65 ? 121  SER A CA  1 
ATOM   864  C C   . SER A 1 121 ? 30.429  -14.490 -4.803  1.00 10.41 ? 121  SER A C   1 
ATOM   865  O O   . SER A 1 121 ? 29.429  -15.047 -5.252  1.00 10.12 ? 121  SER A O   1 
ATOM   866  C CB  . SER A 1 121 ? 30.752  -12.094 -5.325  1.00 10.78 ? 121  SER A CB  1 
ATOM   867  O OG  . SER A 1 121 ? 31.582  -11.115 -5.923  1.00 13.75 ? 121  SER A OG  1 
ATOM   868  N N   . LYS A 1 122 ? 30.889  -14.692 -3.573  1.00 10.58 ? 122  LYS A N   1 
ATOM   869  C CA  . LYS A 1 122 ? 30.196  -15.551 -2.624  1.00 11.32 ? 122  LYS A CA  1 
ATOM   870  C C   . LYS A 1 122 ? 29.195  -14.586 -1.996  1.00 11.64 ? 122  LYS A C   1 
ATOM   871  O O   . LYS A 1 122 ? 29.572  -13.492 -1.565  1.00 10.36 ? 122  LYS A O   1 
ATOM   872  C CB  . LYS A 1 122 ? 31.165  -16.078 -1.563  1.00 14.31 ? 122  LYS A CB  1 
ATOM   873  C CG  . LYS A 1 122 ? 30.581  -17.185 -0.712  1.00 17.61 ? 122  LYS A CG  1 
ATOM   874  C CD  . LYS A 1 122 ? 31.594  -17.719 0.284   1.00 21.21 ? 122  LYS A CD  1 
ATOM   875  C CE  . LYS A 1 122 ? 31.004  -18.869 1.087   1.00 24.41 ? 122  LYS A CE  1 
ATOM   876  N NZ  . LYS A 1 122 ? 31.987  -19.412 2.061   1.00 27.30 ? 122  LYS A NZ  1 
ATOM   877  N N   . VAL A 1 123 ? 27.927  -14.975 -1.958  1.00 9.33  ? 123  VAL A N   1 
ATOM   878  C CA  . VAL A 1 123 ? 26.890  -14.099 -1.421  1.00 9.16  ? 123  VAL A CA  1 
ATOM   879  C C   . VAL A 1 123 ? 25.837  -14.839 -0.613  1.00 9.61  ? 123  VAL A C   1 
ATOM   880  O O   . VAL A 1 123 ? 25.715  -16.060 -0.699  1.00 9.72  ? 123  VAL A O   1 
ATOM   881  C CB  . VAL A 1 123 ? 26.125  -13.387 -2.561  1.00 8.72  ? 123  VAL A CB  1 
ATOM   882  C CG1 . VAL A 1 123 ? 27.085  -12.622 -3.457  1.00 9.05  ? 123  VAL A CG1 1 
ATOM   883  C CG2 . VAL A 1 123 ? 25.346  -14.421 -3.380  1.00 9.70  ? 123  VAL A CG2 1 
ATOM   884  N N   . THR A 1 124 ? 25.078  -14.087 0.176   1.00 9.07  ? 124  THR A N   1 
ATOM   885  C CA  . THR A 1 124 ? 23.976  -14.668 0.924   1.00 7.27  ? 124  THR A CA  1 
ATOM   886  C C   . THR A 1 124 ? 22.757  -13.785 0.682   1.00 9.45  ? 124  THR A C   1 
ATOM   887  O O   . THR A 1 124 ? 22.881  -12.672 0.161   1.00 8.03  ? 124  THR A O   1 
ATOM   888  C CB  . THR A 1 124 ? 24.247  -14.775 2.441   1.00 9.46  ? 124  THR A CB  1 
ATOM   889  O OG1 . THR A 1 124 ? 23.263  -15.642 3.019   1.00 8.31  ? 124  THR A OG1 1 
ATOM   890  C CG2 . THR A 1 124 ? 24.143  -13.415 3.120   1.00 4.92  ? 124  THR A CG2 1 
ATOM   891  N N   . THR A 1 125 ? 21.584  -14.292 1.043   1.00 7.29  ? 125  THR A N   1 
ATOM   892  C CA  . THR A 1 125 ? 20.324  -13.574 0.867   1.00 8.30  ? 125  THR A CA  1 
ATOM   893  C C   . THR A 1 125 ? 19.362  -14.158 1.881   1.00 8.71  ? 125  THR A C   1 
ATOM   894  O O   . THR A 1 125 ? 19.731  -15.024 2.673   1.00 7.86  ? 125  THR A O   1 
ATOM   895  C CB  . THR A 1 125 ? 19.677  -13.851 -0.500  1.00 9.41  ? 125  THR A CB  1 
ATOM   896  O OG1 . THR A 1 125 ? 19.267  -15.228 -0.545  1.00 8.66  ? 125  THR A OG1 1 
ATOM   897  C CG2 . THR A 1 125 ? 20.643  -13.575 -1.641  1.00 8.04  ? 125  THR A CG2 1 
ATOM   898  N N   . HIS A 1 126 ? 18.121  -13.689 1.854   1.00 9.19  ? 126  HIS A N   1 
ATOM   899  C CA  . HIS A 1 126 ? 17.127  -14.256 2.748   1.00 10.22 ? 126  HIS A CA  1 
ATOM   900  C C   . HIS A 1 126 ? 16.875  -15.648 2.170   1.00 11.53 ? 126  HIS A C   1 
ATOM   901  O O   . HIS A 1 126 ? 16.935  -15.836 0.956   1.00 10.99 ? 126  HIS A O   1 
ATOM   902  C CB  . HIS A 1 126 ? 15.822  -13.466 2.695   1.00 11.08 ? 126  HIS A CB  1 
ATOM   903  C CG  . HIS A 1 126 ? 14.774  -14.003 3.611   1.00 11.61 ? 126  HIS A CG  1 
ATOM   904  N ND1 . HIS A 1 126 ? 14.554  -13.495 4.880   1.00 14.01 ? 126  HIS A ND1 1 
ATOM   905  C CD2 . HIS A 1 126 ? 13.939  -15.060 3.495   1.00 10.70 ? 126  HIS A CD2 1 
ATOM   906  C CE1 . HIS A 1 126 ? 13.647  -14.215 5.493   1.00 11.63 ? 126  HIS A CE1 1 
ATOM   907  N NE2 . HIS A 1 126 ? 13.251  -15.183 4.669   1.00 13.44 ? 126  HIS A NE2 1 
ATOM   908  N N   . PRO A 1 127 ? 16.594  -16.643 3.025   1.00 12.02 ? 127  PRO A N   1 
ATOM   909  C CA  . PRO A 1 127 ? 16.345  -17.982 2.479   1.00 13.85 ? 127  PRO A CA  1 
ATOM   910  C C   . PRO A 1 127 ? 15.332  -17.995 1.327   1.00 14.65 ? 127  PRO A C   1 
ATOM   911  O O   . PRO A 1 127 ? 15.489  -18.750 0.364   1.00 13.76 ? 127  PRO A O   1 
ATOM   912  C CB  . PRO A 1 127 ? 15.846  -18.754 3.696   1.00 14.18 ? 127  PRO A CB  1 
ATOM   913  C CG  . PRO A 1 127 ? 16.646  -18.151 4.809   1.00 14.85 ? 127  PRO A CG  1 
ATOM   914  C CD  . PRO A 1 127 ? 16.596  -16.661 4.498   1.00 11.91 ? 127  PRO A CD  1 
ATOM   915  N N   . LEU A 1 128 ? 14.304  -17.154 1.429   1.00 15.00 ? 128  LEU A N   1 
ATOM   916  C CA  . LEU A 1 128 ? 13.254  -17.075 0.412   1.00 15.58 ? 128  LEU A CA  1 
ATOM   917  C C   . LEU A 1 128 ? 13.696  -16.472 -0.922  1.00 14.08 ? 128  LEU A C   1 
ATOM   918  O O   . LEU A 1 128 ? 12.975  -16.567 -1.918  1.00 13.43 ? 128  LEU A O   1 
ATOM   919  C CB  . LEU A 1 128 ? 12.057  -16.283 0.949   1.00 17.17 ? 128  LEU A CB  1 
ATOM   920  C CG  . LEU A 1 128 ? 11.290  -16.898 2.123   1.00 19.09 ? 128  LEU A CG  1 
ATOM   921  C CD1 . LEU A 1 128 ? 10.208  -15.939 2.586   1.00 19.29 ? 128  LEU A CD1 1 
ATOM   922  C CD2 . LEU A 1 128 ? 10.681  -18.226 1.703   1.00 22.39 ? 128  LEU A CD2 1 
ATOM   923  N N   . ALA A 1 129 ? 14.872  -15.853 -0.947  1.00 11.01 ? 129  ALA A N   1 
ATOM   924  C CA  . ALA A 1 129 ? 15.379  -15.255 -2.177  1.00 11.52 ? 129  ALA A CA  1 
ATOM   925  C C   . ALA A 1 129 ? 16.557  -16.047 -2.742  1.00 11.58 ? 129  ALA A C   1 
ATOM   926  O O   . ALA A 1 129 ? 17.136  -15.676 -3.760  1.00 10.74 ? 129  ALA A O   1 
ATOM   927  C CB  . ALA A 1 129 ? 15.798  -13.807 -1.920  1.00 11.29 ? 129  ALA A CB  1 
ATOM   928  N N   . ARG A 1 130 ? 16.899  -17.148 -2.082  1.00 11.04 ? 130  ARG A N   1 
ATOM   929  C CA  . ARG A 1 130 ? 18.018  -17.982 -2.505  1.00 10.42 ? 130  ARG A CA  1 
ATOM   930  C C   . ARG A 1 130 ? 17.898  -18.501 -3.941  1.00 10.54 ? 130  ARG A C   1 
ATOM   931  O O   . ARG A 1 130 ? 18.831  -18.375 -4.734  1.00 10.91 ? 130  ARG A O   1 
ATOM   932  C CB  . ARG A 1 130 ? 18.173  -19.164 -1.545  1.00 9.13  ? 130  ARG A CB  1 
ATOM   933  C CG  . ARG A 1 130 ? 19.371  -20.048 -1.846  1.00 9.87  ? 130  ARG A CG  1 
ATOM   934  C CD  . ARG A 1 130 ? 19.406  -21.263 -0.923  1.00 13.59 ? 130  ARG A CD  1 
ATOM   935  N NE  . ARG A 1 130 ? 18.213  -22.088 -1.092  1.00 16.82 ? 130  ARG A NE  1 
ATOM   936  C CZ  . ARG A 1 130 ? 17.288  -22.280 -0.155  1.00 17.45 ? 130  ARG A CZ  1 
ATOM   937  N NH1 . ARG A 1 130 ? 17.410  -21.710 1.037   1.00 18.86 ? 130  ARG A NH1 1 
ATOM   938  N NH2 . ARG A 1 130 ? 16.229  -23.033 -0.419  1.00 17.89 ? 130  ARG A NH2 1 
ATOM   939  N N   . ASP A 1 131 ? 16.757  -19.096 -4.271  1.00 12.34 ? 131  ASP A N   1 
ATOM   940  C CA  . ASP A 1 131 ? 16.553  -19.631 -5.614  1.00 15.97 ? 131  ASP A CA  1 
ATOM   941  C C   . ASP A 1 131 ? 16.682  -18.563 -6.687  1.00 15.53 ? 131  ASP A C   1 
ATOM   942  O O   . ASP A 1 131 ? 17.300  -18.785 -7.728  1.00 15.07 ? 131  ASP A O   1 
ATOM   943  C CB  . ASP A 1 131 ? 15.175  -20.286 -5.733  1.00 17.78 ? 131  ASP A CB  1 
ATOM   944  C CG  . ASP A 1 131 ? 15.043  -21.511 -4.861  1.00 21.31 ? 131  ASP A CG  1 
ATOM   945  O OD1 . ASP A 1 131 ? 16.062  -22.206 -4.672  1.00 22.91 ? 131  ASP A OD1 1 
ATOM   946  O OD2 . ASP A 1 131 ? 13.922  -21.784 -4.379  1.00 23.81 ? 131  ASP A OD2 1 
ATOM   947  N N   . LYS A 1 132 ? 16.087  -17.408 -6.423  1.00 15.31 ? 132  LYS A N   1 
ATOM   948  C CA  . LYS A 1 132 ? 16.115  -16.293 -7.356  1.00 15.10 ? 132  LYS A CA  1 
ATOM   949  C C   . LYS A 1 132 ? 17.558  -15.851 -7.581  1.00 12.95 ? 132  LYS A C   1 
ATOM   950  O O   . LYS A 1 132 ? 18.002  -15.680 -8.717  1.00 12.12 ? 132  LYS A O   1 
ATOM   951  C CB  . LYS A 1 132 ? 15.288  -15.140 -6.783  1.00 18.16 ? 132  LYS A CB  1 
ATOM   952  C CG  . LYS A 1 132 ? 15.023  -14.000 -7.743  1.00 23.01 ? 132  LYS A CG  1 
ATOM   953  C CD  . LYS A 1 132 ? 14.056  -12.999 -7.128  1.00 26.92 ? 132  LYS A CD  1 
ATOM   954  C CE  . LYS A 1 132 ? 13.687  -11.912 -8.123  1.00 28.70 ? 132  LYS A CE  1 
ATOM   955  N NZ  . LYS A 1 132 ? 14.903  -11.279 -8.697  1.00 34.27 ? 132  LYS A NZ  1 
ATOM   956  N N   . MET A 1 133 ? 18.288  -15.687 -6.486  1.00 11.14 ? 133  MET A N   1 
ATOM   957  C CA  . MET A 1 133 ? 19.678  -15.257 -6.546  1.00 10.24 ? 133  MET A CA  1 
ATOM   958  C C   . MET A 1 133 ? 20.596  -16.238 -7.276  1.00 10.52 ? 133  MET A C   1 
ATOM   959  O O   . MET A 1 133 ? 21.515  -15.828 -7.988  1.00 10.30 ? 133  MET A O   1 
ATOM   960  C CB  . MET A 1 133 ? 20.216  -15.042 -5.135  1.00 9.15  ? 133  MET A CB  1 
ATOM   961  C CG  . MET A 1 133 ? 21.577  -14.391 -5.101  1.00 7.70  ? 133  MET A CG  1 
ATOM   962  S SD  . MET A 1 133 ? 21.476  -12.660 -5.575  1.00 10.07 ? 133  MET A SD  1 
ATOM   963  C CE  . MET A 1 133 ? 23.183  -12.186 -5.336  1.00 6.91  ? 133  MET A CE  1 
ATOM   964  N N   . MET A 1 134 ? 20.346  -17.533 -7.101  1.00 12.53 ? 134  MET A N   1 
ATOM   965  C CA  . MET A 1 134 ? 21.189  -18.546 -7.721  1.00 12.80 ? 134  MET A CA  1 
ATOM   966  C C   . MET A 1 134 ? 20.756  -18.969 -9.118  1.00 14.01 ? 134  MET A C   1 
ATOM   967  O O   . MET A 1 134 ? 21.355  -19.870 -9.709  1.00 13.77 ? 134  MET A O   1 
ATOM   968  C CB  . MET A 1 134 ? 21.287  -19.775 -6.809  1.00 14.41 ? 134  MET A CB  1 
ATOM   969  C CG  . MET A 1 134 ? 21.894  -19.478 -5.433  1.00 15.80 ? 134  MET A CG  1 
ATOM   970  S SD  . MET A 1 134 ? 23.446  -18.540 -5.526  1.00 19.74 ? 134  MET A SD  1 
ATOM   971  C CE  . MET A 1 134 ? 24.550  -19.781 -6.072  1.00 15.63 ? 134  MET A CE  1 
ATOM   972  N N   . ASN A 1 135 ? 19.720  -18.326 -9.648  1.00 12.79 ? 135  ASN A N   1 
ATOM   973  C CA  . ASN A 1 135 ? 19.252  -18.650 -10.989 1.00 14.59 ? 135  ASN A CA  1 
ATOM   974  C C   . ASN A 1 135 ? 20.397  -18.305 -11.935 1.00 14.45 ? 135  ASN A C   1 
ATOM   975  O O   . ASN A 1 135 ? 20.822  -17.151 -12.010 1.00 13.82 ? 135  ASN A O   1 
ATOM   976  C CB  . ASN A 1 135 ? 18.020  -17.816 -11.345 1.00 17.19 ? 135  ASN A CB  1 
ATOM   977  C CG  . ASN A 1 135 ? 17.342  -18.292 -12.619 1.00 20.47 ? 135  ASN A CG  1 
ATOM   978  O OD1 . ASN A 1 135 ? 18.004  -18.659 -13.588 1.00 22.72 ? 135  ASN A OD1 1 
ATOM   979  N ND2 . ASN A 1 135 ? 16.014  -18.277 -12.625 1.00 22.40 ? 135  ASN A ND2 1 
ATOM   980  N N   . GLY A 1 136 ? 20.913  -19.305 -12.642 1.00 12.59 ? 136  GLY A N   1 
ATOM   981  C CA  . GLY A 1 136 ? 22.009  -19.056 -13.559 1.00 13.36 ? 136  GLY A CA  1 
ATOM   982  C C   . GLY A 1 136 ? 23.380  -19.346 -12.970 1.00 14.05 ? 136  GLY A C   1 
ATOM   983  O O   . GLY A 1 136 ? 24.374  -19.355 -13.691 1.00 16.95 ? 136  GLY A O   1 
ATOM   984  N N   . GLY A 1 137 ? 23.441  -19.573 -11.661 1.00 14.86 ? 137  GLY A N   1 
ATOM   985  C CA  . GLY A 1 137 ? 24.707  -19.876 -11.010 1.00 14.34 ? 137  GLY A CA  1 
ATOM   986  C C   . GLY A 1 137 ? 25.803  -18.842 -11.208 1.00 13.39 ? 137  GLY A C   1 
ATOM   987  O O   . GLY A 1 137 ? 26.950  -19.185 -11.487 1.00 14.31 ? 137  GLY A O   1 
ATOM   988  N N   . HIS A 1 138 ? 25.459  -17.571 -11.041 1.00 13.79 ? 138  HIS A N   1 
ATOM   989  C CA  . HIS A 1 138 ? 26.426  -16.496 -11.224 1.00 12.65 ? 138  HIS A CA  1 
ATOM   990  C C   . HIS A 1 138 ? 27.141  -16.104 -9.939  1.00 13.29 ? 138  HIS A C   1 
ATOM   991  O O   . HIS A 1 138 ? 27.929  -15.157 -9.918  1.00 14.31 ? 138  HIS A O   1 
ATOM   992  C CB  . HIS A 1 138 ? 25.722  -15.280 -11.821 1.00 12.51 ? 138  HIS A CB  1 
ATOM   993  C CG  . HIS A 1 138 ? 25.097  -15.549 -13.150 1.00 12.80 ? 138  HIS A CG  1 
ATOM   994  N ND1 . HIS A 1 138 ? 25.832  -15.927 -14.254 1.00 14.46 ? 138  HIS A ND1 1 
ATOM   995  C CD2 . HIS A 1 138 ? 23.803  -15.504 -13.558 1.00 12.18 ? 138  HIS A CD2 1 
ATOM   996  C CE1 . HIS A 1 138 ? 25.017  -16.103 -15.282 1.00 14.84 ? 138  HIS A CE1 1 
ATOM   997  N NE2 . HIS A 1 138 ? 23.788  -15.851 -14.885 1.00 14.26 ? 138  HIS A NE2 1 
ATOM   998  N N   . TYR A 1 139 ? 26.866  -16.845 -8.871  1.00 12.00 ? 139  TYR A N   1 
ATOM   999  C CA  . TYR A 1 139 ? 27.468  -16.596 -7.568  1.00 11.82 ? 139  TYR A CA  1 
ATOM   1000 C C   . TYR A 1 139 ? 27.631  -17.927 -6.851  1.00 12.96 ? 139  TYR A C   1 
ATOM   1001 O O   . TYR A 1 139 ? 27.207  -18.968 -7.349  1.00 14.49 ? 139  TYR A O   1 
ATOM   1002 C CB  . TYR A 1 139 ? 26.548  -15.721 -6.707  1.00 11.11 ? 139  TYR A CB  1 
ATOM   1003 C CG  . TYR A 1 139 ? 26.146  -14.403 -7.326  1.00 10.15 ? 139  TYR A CG  1 
ATOM   1004 C CD1 . TYR A 1 139 ? 26.972  -13.281 -7.232  1.00 11.03 ? 139  TYR A CD1 1 
ATOM   1005 C CD2 . TYR A 1 139 ? 24.937  -14.277 -8.010  1.00 10.50 ? 139  TYR A CD2 1 
ATOM   1006 C CE1 . TYR A 1 139 ? 26.602  -12.066 -7.807  1.00 9.55  ? 139  TYR A CE1 1 
ATOM   1007 C CE2 . TYR A 1 139 ? 24.558  -13.070 -8.590  1.00 12.72 ? 139  TYR A CE2 1 
ATOM   1008 C CZ  . TYR A 1 139 ? 25.393  -11.970 -8.488  1.00 11.66 ? 139  TYR A CZ  1 
ATOM   1009 O OH  . TYR A 1 139 ? 25.029  -10.783 -9.083  1.00 12.19 ? 139  TYR A OH  1 
ATOM   1010 N N   . THR A 1 140 ? 28.264  -17.875 -5.686  1.00 14.27 ? 140  THR A N   1 
ATOM   1011 C CA  . THR A 1 140 ? 28.425  -19.038 -4.823  1.00 14.16 ? 140  THR A CA  1 
ATOM   1012 C C   . THR A 1 140 ? 27.588  -18.627 -3.617  1.00 13.71 ? 140  THR A C   1 
ATOM   1013 O O   . THR A 1 140 ? 27.754  -17.519 -3.099  1.00 14.53 ? 140  THR A O   1 
ATOM   1014 C CB  . THR A 1 140 ? 29.888  -19.252 -4.382  1.00 15.07 ? 140  THR A CB  1 
ATOM   1015 O OG1 . THR A 1 140 ? 30.645  -19.782 -5.477  1.00 19.96 ? 140  THR A OG1 1 
ATOM   1016 C CG2 . THR A 1 140 ? 29.956  -20.230 -3.205  1.00 18.11 ? 140  THR A CG2 1 
ATOM   1017 N N   . TYR A 1 141 ? 26.682  -19.492 -3.177  1.00 12.96 ? 141  TYR A N   1 
ATOM   1018 C CA  . TYR A 1 141 ? 25.823  -19.148 -2.052  1.00 11.36 ? 141  TYR A CA  1 
ATOM   1019 C C   . TYR A 1 141 ? 26.451  -19.417 -0.693  1.00 12.70 ? 141  TYR A C   1 
ATOM   1020 O O   . TYR A 1 141 ? 27.291  -20.302 -0.535  1.00 13.34 ? 141  TYR A O   1 
ATOM   1021 C CB  . TYR A 1 141 ? 24.486  -19.884 -2.152  1.00 12.15 ? 141  TYR A CB  1 
ATOM   1022 C CG  . TYR A 1 141 ? 23.372  -19.193 -1.400  1.00 12.50 ? 141  TYR A CG  1 
ATOM   1023 C CD1 . TYR A 1 141 ? 22.845  -17.983 -1.856  1.00 11.09 ? 141  TYR A CD1 1 
ATOM   1024 C CD2 . TYR A 1 141 ? 22.855  -19.734 -0.223  1.00 11.19 ? 141  TYR A CD2 1 
ATOM   1025 C CE1 . TYR A 1 141 ? 21.827  -17.329 -1.161  1.00 11.43 ? 141  TYR A CE1 1 
ATOM   1026 C CE2 . TYR A 1 141 ? 21.841  -19.090 0.482   1.00 12.37 ? 141  TYR A CE2 1 
ATOM   1027 C CZ  . TYR A 1 141 ? 21.330  -17.888 0.008   1.00 11.08 ? 141  TYR A CZ  1 
ATOM   1028 O OH  . TYR A 1 141 ? 20.319  -17.254 0.703   1.00 12.08 ? 141  TYR A OH  1 
ATOM   1029 N N   . SER A 1 142 ? 26.024  -18.635 0.291   1.00 11.97 ? 142  SER A N   1 
ATOM   1030 C CA  . SER A 1 142 ? 26.526  -18.747 1.648   1.00 12.41 ? 142  SER A CA  1 
ATOM   1031 C C   . SER A 1 142 ? 25.383  -18.622 2.645   1.00 11.35 ? 142  SER A C   1 
ATOM   1032 O O   . SER A 1 142 ? 24.370  -17.980 2.364   1.00 11.47 ? 142  SER A O   1 
ATOM   1033 C CB  . SER A 1 142 ? 27.550  -17.640 1.910   1.00 13.67 ? 142  SER A CB  1 
ATOM   1034 O OG  . SER A 1 142 ? 27.804  -17.503 3.293   1.00 13.40 ? 142  SER A OG  1 
ATOM   1035 N N   . GLU A 1 143 ? 25.548  -19.243 3.808   1.00 10.61 ? 143  GLU A N   1 
ATOM   1036 C CA  . GLU A 1 143 ? 24.533  -19.160 4.843   1.00 10.70 ? 143  GLU A CA  1 
ATOM   1037 C C   . GLU A 1 143 ? 25.024  -18.320 6.018   1.00 10.81 ? 143  GLU A C   1 
ATOM   1038 O O   . GLU A 1 143 ? 24.392  -18.288 7.070   1.00 11.75 ? 143  GLU A O   1 
ATOM   1039 C CB  . GLU A 1 143 ? 24.122  -20.563 5.303   1.00 12.25 ? 143  GLU A CB  1 
ATOM   1040 C CG  . GLU A 1 143 ? 23.225  -21.267 4.289   1.00 13.06 ? 143  GLU A CG  1 
ATOM   1041 C CD  . GLU A 1 143 ? 22.787  -22.649 4.736   1.00 14.82 ? 143  GLU A CD  1 
ATOM   1042 O OE1 . GLU A 1 143 ? 22.965  -22.974 5.928   1.00 14.71 ? 143  GLU A OE1 1 
ATOM   1043 O OE2 . GLU A 1 143 ? 22.254  -23.403 3.894   1.00 13.21 ? 143  GLU A OE2 1 
ATOM   1044 N N   . ASN A 1 144 ? 26.155  -17.642 5.834   1.00 9.75  ? 144  ASN A N   1 
ATOM   1045 C CA  . ASN A 1 144 ? 26.695  -16.778 6.881   1.00 9.47  ? 144  ASN A CA  1 
ATOM   1046 C C   . ASN A 1 144 ? 25.735  -15.604 7.022   1.00 9.12  ? 144  ASN A C   1 
ATOM   1047 O O   . ASN A 1 144 ? 25.240  -15.087 6.019   1.00 8.45  ? 144  ASN A O   1 
ATOM   1048 C CB  . ASN A 1 144 ? 28.086  -16.282 6.494   1.00 11.27 ? 144  ASN A CB  1 
ATOM   1049 C CG  . ASN A 1 144 ? 29.132  -17.367 6.591   1.00 15.30 ? 144  ASN A CG  1 
ATOM   1050 O OD1 . ASN A 1 144 ? 30.104  -17.382 5.833   1.00 18.32 ? 144  ASN A OD1 1 
ATOM   1051 N ND2 . ASN A 1 144 ? 28.946  -18.280 7.539   1.00 14.60 ? 144  ASN A ND2 1 
ATOM   1052 N N   . ARG A 1 145 ? 25.468  -15.201 8.259   1.00 8.65  ? 145  ARG A N   1 
ATOM   1053 C CA  . ARG A 1 145 ? 24.543  -14.104 8.532   1.00 7.87  ? 145  ARG A CA  1 
ATOM   1054 C C   . ARG A 1 145 ? 24.947  -12.846 7.781   1.00 8.84  ? 145  ARG A C   1 
ATOM   1055 O O   . ARG A 1 145 ? 24.096  -12.070 7.350   1.00 6.75  ? 145  ARG A O   1 
ATOM   1056 C CB  . ARG A 1 145 ? 24.451  -13.875 10.042  1.00 9.15  ? 145  ARG A CB  1 
ATOM   1057 C CG  . ARG A 1 145 ? 23.747  -15.039 10.747  1.00 9.11  ? 145  ARG A CG  1 
ATOM   1058 C CD  . ARG A 1 145 ? 23.747  -14.906 12.259  1.00 13.14 ? 145  ARG A CD  1 
ATOM   1059 N NE  . ARG A 1 145 ? 22.914  -13.801 12.723  1.00 12.03 ? 145  ARG A NE  1 
ATOM   1060 C CZ  . ARG A 1 145 ? 21.585  -13.780 12.675  1.00 12.54 ? 145  ARG A CZ  1 
ATOM   1061 N NH1 . ARG A 1 145 ? 20.908  -14.813 12.184  1.00 11.59 ? 145  ARG A NH1 1 
ATOM   1062 N NH2 . ARG A 1 145 ? 20.931  -12.716 13.123  1.00 13.41 ? 145  ARG A NH2 1 
ATOM   1063 N N   . VAL A 1 146 ? 26.252  -12.655 7.638   1.00 8.59  ? 146  VAL A N   1 
ATOM   1064 C CA  . VAL A 1 146 ? 26.799  -11.546 6.866   1.00 9.09  ? 146  VAL A CA  1 
ATOM   1065 C C   . VAL A 1 146 ? 27.916  -12.156 6.026   1.00 9.69  ? 146  VAL A C   1 
ATOM   1066 O O   . VAL A 1 146 ? 28.755  -12.895 6.545   1.00 10.84 ? 146  VAL A O   1 
ATOM   1067 C CB  . VAL A 1 146 ? 27.395  -10.429 7.751   1.00 9.41  ? 146  VAL A CB  1 
ATOM   1068 C CG1 . VAL A 1 146 ? 28.083  -9.393  6.868   1.00 10.52 ? 146  VAL A CG1 1 
ATOM   1069 C CG2 . VAL A 1 146 ? 26.300  -9.767  8.566   1.00 9.23  ? 146  VAL A CG2 1 
ATOM   1070 N N   . GLU A 1 147 ? 27.912  -11.877 4.729   1.00 7.69  ? 147  GLU A N   1 
ATOM   1071 C CA  . GLU A 1 147 ? 28.941  -12.401 3.843   1.00 11.05 ? 147  GLU A CA  1 
ATOM   1072 C C   . GLU A 1 147 ? 29.638  -11.255 3.133   1.00 10.80 ? 147  GLU A C   1 
ATOM   1073 O O   . GLU A 1 147 ? 28.993  -10.425 2.497   1.00 10.72 ? 147  GLU A O   1 
ATOM   1074 C CB  . GLU A 1 147 ? 28.338  -13.346 2.798   1.00 10.53 ? 147  GLU A CB  1 
ATOM   1075 C CG  . GLU A 1 147 ? 29.389  -14.023 1.926   1.00 10.68 ? 147  GLU A CG  1 
ATOM   1076 C CD  . GLU A 1 147 ? 30.217  -15.034 2.703   1.00 13.54 ? 147  GLU A CD  1 
ATOM   1077 O OE1 . GLU A 1 147 ? 31.437  -15.118 2.466   1.00 17.60 ? 147  GLU A OE1 1 
ATOM   1078 O OE2 . GLU A 1 147 ? 29.643  -15.753 3.546   1.00 13.91 ? 147  GLU A OE2 1 
ATOM   1079 N N   . LYS A 1 148 ? 30.959  -11.205 3.250   1.00 10.66 ? 148  LYS A N   1 
ATOM   1080 C CA  . LYS A 1 148 ? 31.722  -10.160 2.590   1.00 10.46 ? 148  LYS A CA  1 
ATOM   1081 C C   . LYS A 1 148 ? 32.784  -10.797 1.709   1.00 12.50 ? 148  LYS A C   1 
ATOM   1082 O O   . LYS A 1 148 ? 33.713  -11.444 2.203   1.00 13.16 ? 148  LYS A O   1 
ATOM   1083 C CB  . LYS A 1 148 ? 32.384  -9.238  3.618   1.00 9.54  ? 148  LYS A CB  1 
ATOM   1084 C CG  . LYS A 1 148 ? 33.072  -8.028  2.996   1.00 10.16 ? 148  LYS A CG  1 
ATOM   1085 C CD  . LYS A 1 148 ? 33.776  -7.182  4.051   1.00 11.09 ? 148  LYS A CD  1 
ATOM   1086 C CE  . LYS A 1 148 ? 34.392  -5.926  3.442   1.00 12.28 ? 148  LYS A CE  1 
ATOM   1087 N NZ  . LYS A 1 148 ? 35.454  -6.225  2.440   1.00 12.95 ? 148  LYS A NZ  1 
ATOM   1088 N N   . ASP A 1 149 ? 32.623  -10.637 0.401   1.00 11.23 ? 149  ASP A N   1 
ATOM   1089 C CA  . ASP A 1 149 ? 33.571  -11.170 -0.566  1.00 13.08 ? 149  ASP A CA  1 
ATOM   1090 C C   . ASP A 1 149 ? 34.127  -9.963  -1.300  1.00 12.93 ? 149  ASP A C   1 
ATOM   1091 O O   . ASP A 1 149 ? 33.511  -9.450  -2.230  1.00 12.90 ? 149  ASP A O   1 
ATOM   1092 C CB  . ASP A 1 149 ? 32.866  -12.112 -1.548  1.00 13.91 ? 149  ASP A CB  1 
ATOM   1093 C CG  . ASP A 1 149 ? 33.830  -12.794 -2.505  1.00 16.81 ? 149  ASP A CG  1 
ATOM   1094 O OD1 . ASP A 1 149 ? 35.040  -12.476 -2.479  1.00 16.20 ? 149  ASP A OD1 1 
ATOM   1095 O OD2 . ASP A 1 149 ? 33.373  -13.651 -3.290  1.00 16.63 ? 149  ASP A OD2 1 
ATOM   1096 N N   . GLY A 1 150 ? 35.290  -9.495  -0.866  1.00 13.08 ? 150  GLY A N   1 
ATOM   1097 C CA  . GLY A 1 150 ? 35.869  -8.330  -1.499  1.00 13.82 ? 150  GLY A CA  1 
ATOM   1098 C C   . GLY A 1 150 ? 34.964  -7.129  -1.293  1.00 12.18 ? 150  GLY A C   1 
ATOM   1099 O O   . GLY A 1 150 ? 34.628  -6.783  -0.159  1.00 14.20 ? 150  GLY A O   1 
ATOM   1100 N N   . LEU A 1 151 ? 34.541  -6.509  -2.389  1.00 11.49 ? 151  LEU A N   1 
ATOM   1101 C CA  . LEU A 1 151 ? 33.690  -5.330  -2.311  1.00 11.01 ? 151  LEU A CA  1 
ATOM   1102 C C   . LEU A 1 151 ? 32.196  -5.612  -2.469  1.00 9.66  ? 151  LEU A C   1 
ATOM   1103 O O   . LEU A 1 151 ? 31.417  -4.713  -2.787  1.00 10.29 ? 151  LEU A O   1 
ATOM   1104 C CB  . LEU A 1 151 ? 34.161  -4.302  -3.344  1.00 11.49 ? 151  LEU A CB  1 
ATOM   1105 C CG  . LEU A 1 151 ? 35.567  -3.765  -3.044  1.00 13.00 ? 151  LEU A CG  1 
ATOM   1106 C CD1 . LEU A 1 151 ? 36.185  -3.159  -4.293  1.00 12.85 ? 151  LEU A CD1 1 
ATOM   1107 C CD2 . LEU A 1 151 ? 35.487  -2.738  -1.915  1.00 12.60 ? 151  LEU A CD2 1 
ATOM   1108 N N   . ILE A 1 152 ? 31.803  -6.864  -2.250  1.00 9.12  ? 152  ILE A N   1 
ATOM   1109 C CA  . ILE A 1 152 ? 30.399  -7.265  -2.326  1.00 7.85  ? 152  ILE A CA  1 
ATOM   1110 C C   . ILE A 1 152 ? 30.069  -7.778  -0.933  1.00 8.56  ? 152  ILE A C   1 
ATOM   1111 O O   . ILE A 1 152 ? 30.630  -8.775  -0.480  1.00 9.80  ? 152  ILE A O   1 
ATOM   1112 C CB  . ILE A 1 152 ? 30.175  -8.399  -3.362  1.00 8.00  ? 152  ILE A CB  1 
ATOM   1113 C CG1 . ILE A 1 152 ? 30.548  -7.911  -4.767  1.00 8.43  ? 152  ILE A CG1 1 
ATOM   1114 C CG2 . ILE A 1 152 ? 28.721  -8.870  -3.319  1.00 5.44  ? 152  ILE A CG2 1 
ATOM   1115 C CD1 . ILE A 1 152 ? 29.650  -6.798  -5.316  1.00 9.18  ? 152  ILE A CD1 1 
ATOM   1116 N N   . LEU A 1 153 ? 29.164  -7.080  -0.250  1.00 7.86  ? 153  LEU A N   1 
ATOM   1117 C CA  . LEU A 1 153 ? 28.782  -7.432  1.110   1.00 7.65  ? 153  LEU A CA  1 
ATOM   1118 C C   . LEU A 1 153 ? 27.283  -7.671  1.168   1.00 7.74  ? 153  LEU A C   1 
ATOM   1119 O O   . LEU A 1 153 ? 26.494  -6.787  0.852   1.00 7.29  ? 153  LEU A O   1 
ATOM   1120 C CB  . LEU A 1 153 ? 29.190  -6.290  2.046   1.00 8.75  ? 153  LEU A CB  1 
ATOM   1121 C CG  . LEU A 1 153 ? 29.135  -6.475  3.562   1.00 8.01  ? 153  LEU A CG  1 
ATOM   1122 C CD1 . LEU A 1 153 ? 29.949  -5.362  4.225   1.00 9.99  ? 153  LEU A CD1 1 
ATOM   1123 C CD2 . LEU A 1 153 ? 27.697  -6.471  4.043   1.00 9.28  ? 153  LEU A CD2 1 
ATOM   1124 N N   . THR A 1 154 ? 26.892  -8.874  1.573   1.00 7.83  ? 154  THR A N   1 
ATOM   1125 C CA  . THR A 1 154 ? 25.480  -9.217  1.638   1.00 7.20  ? 154  THR A CA  1 
ATOM   1126 C C   . THR A 1 154 ? 25.073  -9.750  3.008   1.00 5.38  ? 154  THR A C   1 
ATOM   1127 O O   . THR A 1 154 ? 25.919  -10.164 3.800   1.00 6.58  ? 154  THR A O   1 
ATOM   1128 C CB  . THR A 1 154 ? 25.137  -10.262 0.557   1.00 8.08  ? 154  THR A CB  1 
ATOM   1129 O OG1 . THR A 1 154 ? 26.065  -11.352 0.636   1.00 9.60  ? 154  THR A OG1 1 
ATOM   1130 C CG2 . THR A 1 154 ? 25.225  -9.638  -0.833  1.00 9.84  ? 154  THR A CG2 1 
ATOM   1131 N N   . SER A 1 155 ? 23.774  -9.717  3.287   1.00 5.85  ? 155  SER A N   1 
ATOM   1132 C CA  . SER A 1 155 ? 23.258  -10.209 4.556   1.00 7.08  ? 155  SER A CA  1 
ATOM   1133 C C   . SER A 1 155 ? 21.892  -10.865 4.348   1.00 6.78  ? 155  SER A C   1 
ATOM   1134 O O   . SER A 1 155 ? 21.285  -10.737 3.280   1.00 6.20  ? 155  SER A O   1 
ATOM   1135 C CB  . SER A 1 155 ? 23.192  -9.080  5.584   1.00 5.29  ? 155  SER A CB  1 
ATOM   1136 O OG  . SER A 1 155 ? 23.116  -9.606  6.898   1.00 6.78  ? 155  SER A OG  1 
ATOM   1137 N N   . ARG A 1 156 ? 21.398  -11.543 5.382   1.00 8.49  ? 156  ARG A N   1 
ATOM   1138 C CA  . ARG A 1 156 ? 20.167  -12.324 5.270   1.00 9.91  ? 156  ARG A CA  1 
ATOM   1139 C C   . ARG A 1 156 ? 18.768  -11.778 5.524   1.00 10.97 ? 156  ARG A C   1 
ATOM   1140 O O   . ARG A 1 156 ? 17.835  -12.171 4.827   1.00 11.18 ? 156  ARG A O   1 
ATOM   1141 C CB  . ARG A 1 156 ? 20.350  -13.598 6.094   1.00 12.43 ? 156  ARG A CB  1 
ATOM   1142 C CG  . ARG A 1 156 ? 21.588  -14.372 5.687   1.00 13.01 ? 156  ARG A CG  1 
ATOM   1143 C CD  . ARG A 1 156 ? 21.222  -15.543 4.799   1.00 22.30 ? 156  ARG A CD  1 
ATOM   1144 N NE  . ARG A 1 156 ? 20.961  -16.726 5.594   1.00 23.29 ? 156  ARG A NE  1 
ATOM   1145 C CZ  . ARG A 1 156 ? 20.519  -17.883 5.116   1.00 19.70 ? 156  ARG A CZ  1 
ATOM   1146 N NH1 . ARG A 1 156 ? 20.267  -18.040 3.820   1.00 18.32 ? 156  ARG A NH1 1 
ATOM   1147 N NH2 . ARG A 1 156 ? 20.347  -18.891 5.951   1.00 21.10 ? 156  ARG A NH2 1 
ATOM   1148 N N   . GLY A 1 157 ? 18.588  -10.908 6.511   1.00 9.14  ? 157  GLY A N   1 
ATOM   1149 C CA  . GLY A 1 157 ? 17.243  -10.415 6.751   1.00 10.08 ? 157  GLY A CA  1 
ATOM   1150 C C   . GLY A 1 157 ? 17.102  -9.377  7.842   1.00 9.42  ? 157  GLY A C   1 
ATOM   1151 O O   . GLY A 1 157 ? 18.099  -8.873  8.348   1.00 10.21 ? 157  GLY A O   1 
ATOM   1152 N N   . PRO A 1 158 ? 15.867  -9.038  8.233   1.00 8.99  ? 158  PRO A N   1 
ATOM   1153 C CA  . PRO A 1 158 ? 15.657  -8.040  9.283   1.00 9.88  ? 158  PRO A CA  1 
ATOM   1154 C C   . PRO A 1 158 ? 16.516  -8.317  10.512  1.00 9.62  ? 158  PRO A C   1 
ATOM   1155 O O   . PRO A 1 158 ? 17.133  -7.410  11.076  1.00 9.81  ? 158  PRO A O   1 
ATOM   1156 C CB  . PRO A 1 158 ? 14.165  -8.164  9.580   1.00 9.74  ? 158  PRO A CB  1 
ATOM   1157 C CG  . PRO A 1 158 ? 13.597  -8.550  8.245   1.00 9.14  ? 158  PRO A CG  1 
ATOM   1158 C CD  . PRO A 1 158 ? 14.580  -9.579  7.752   1.00 9.86  ? 158  PRO A CD  1 
ATOM   1159 N N   . GLY A 1 159 ? 16.556  -9.589  10.906  1.00 9.73  ? 159  GLY A N   1 
ATOM   1160 C CA  . GLY A 1 159 ? 17.312  -10.003 12.073  1.00 9.57  ? 159  GLY A CA  1 
ATOM   1161 C C   . GLY A 1 159 ? 18.823  -9.963  11.950  1.00 9.82  ? 159  GLY A C   1 
ATOM   1162 O O   . GLY A 1 159 ? 19.517  -10.205 12.938  1.00 11.45 ? 159  GLY A O   1 
ATOM   1163 N N   . THR A 1 160 ? 19.342  -9.688  10.756  1.00 7.47  ? 160  THR A N   1 
ATOM   1164 C CA  . THR A 1 160 ? 20.789  -9.602  10.582  1.00 7.75  ? 160  THR A CA  1 
ATOM   1165 C C   . THR A 1 160 ? 21.162  -8.169  10.226  1.00 6.34  ? 160  THR A C   1 
ATOM   1166 O O   . THR A 1 160 ? 22.315  -7.886  9.921   1.00 6.35  ? 160  THR A O   1 
ATOM   1167 C CB  . THR A 1 160 ? 21.320  -10.529 9.445   1.00 7.97  ? 160  THR A CB  1 
ATOM   1168 O OG1 . THR A 1 160 ? 20.810  -10.096 8.175   1.00 6.06  ? 160  THR A OG1 1 
ATOM   1169 C CG2 . THR A 1 160 ? 20.906  -11.977 9.693   1.00 9.34  ? 160  THR A CG2 1 
ATOM   1170 N N   . SER A 1 161 ? 20.179  -7.273  10.267  1.00 7.05  ? 161  SER A N   1 
ATOM   1171 C CA  . SER A 1 161 ? 20.407  -5.875  9.915   1.00 6.90  ? 161  SER A CA  1 
ATOM   1172 C C   . SER A 1 161 ? 21.488  -5.175  10.735  1.00 8.05  ? 161  SER A C   1 
ATOM   1173 O O   . SER A 1 161 ? 22.279  -4.408  10.179  1.00 7.15  ? 161  SER A O   1 
ATOM   1174 C CB  . SER A 1 161 ? 19.095  -5.091  10.002  1.00 7.63  ? 161  SER A CB  1 
ATOM   1175 O OG  . SER A 1 161 ? 18.191  -5.518  8.992   1.00 8.01  ? 161  SER A OG  1 
ATOM   1176 N N   . PHE A 1 162 ? 21.526  -5.416  12.042  1.00 6.88  ? 162  PHE A N   1 
ATOM   1177 C CA  . PHE A 1 162 ? 22.557  -4.791  12.869  1.00 8.02  ? 162  PHE A CA  1 
ATOM   1178 C C   . PHE A 1 162 ? 23.934  -5.316  12.482  1.00 8.27  ? 162  PHE A C   1 
ATOM   1179 O O   . PHE A 1 162 ? 24.875  -4.545  12.332  1.00 8.12  ? 162  PHE A O   1 
ATOM   1180 C CB  . PHE A 1 162 ? 22.319  -5.048  14.363  1.00 8.20  ? 162  PHE A CB  1 
ATOM   1181 C CG  . PHE A 1 162 ? 21.237  -4.202  14.962  1.00 9.49  ? 162  PHE A CG  1 
ATOM   1182 C CD1 . PHE A 1 162 ? 19.953  -4.704  15.126  1.00 10.43 ? 162  PHE A CD1 1 
ATOM   1183 C CD2 . PHE A 1 162 ? 21.496  -2.887  15.336  1.00 10.27 ? 162  PHE A CD2 1 
ATOM   1184 C CE1 . PHE A 1 162 ? 18.937  -3.911  15.665  1.00 10.93 ? 162  PHE A CE1 1 
ATOM   1185 C CE2 . PHE A 1 162 ? 20.489  -2.085  15.874  1.00 8.96  ? 162  PHE A CE2 1 
ATOM   1186 C CZ  . PHE A 1 162 ? 19.206  -2.596  16.034  1.00 9.27  ? 162  PHE A CZ  1 
ATOM   1187 N N   . GLU A 1 163 ? 24.050  -6.632  12.324  1.00 7.43  ? 163  GLU A N   1 
ATOM   1188 C CA  . GLU A 1 163 ? 25.319  -7.246  11.942  1.00 7.13  ? 163  GLU A CA  1 
ATOM   1189 C C   . GLU A 1 163 ? 25.764  -6.715  10.581  1.00 6.49  ? 163  GLU A C   1 
ATOM   1190 O O   . GLU A 1 163 ? 26.946  -6.455  10.356  1.00 7.81  ? 163  GLU A O   1 
ATOM   1191 C CB  . GLU A 1 163 ? 25.159  -8.768  11.900  1.00 7.91  ? 163  GLU A CB  1 
ATOM   1192 C CG  . GLU A 1 163 ? 24.855  -9.362  13.273  1.00 9.77  ? 163  GLU A CG  1 
ATOM   1193 C CD  . GLU A 1 163 ? 24.159  -10.711 13.206  1.00 14.03 ? 163  GLU A CD  1 
ATOM   1194 O OE1 . GLU A 1 163 ? 24.824  -11.725 12.910  1.00 15.80 ? 163  GLU A OE1 1 
ATOM   1195 O OE2 . GLU A 1 163 ? 22.934  -10.750 13.448  1.00 16.58 ? 163  GLU A OE2 1 
ATOM   1196 N N   . PHE A 1 164 ? 24.792  -6.556  9.686   1.00 5.91  ? 164  PHE A N   1 
ATOM   1197 C CA  . PHE A 1 164 ? 25.012  -6.043  8.337   1.00 6.14  ? 164  PHE A CA  1 
ATOM   1198 C C   . PHE A 1 164 ? 25.557  -4.614  8.436   1.00 5.86  ? 164  PHE A C   1 
ATOM   1199 O O   . PHE A 1 164 ? 26.588  -4.291  7.845   1.00 6.01  ? 164  PHE A O   1 
ATOM   1200 C CB  . PHE A 1 164 ? 23.673  -6.075  7.583   1.00 5.91  ? 164  PHE A CB  1 
ATOM   1201 C CG  . PHE A 1 164 ? 23.697  -5.423  6.221   1.00 6.91  ? 164  PHE A CG  1 
ATOM   1202 C CD1 . PHE A 1 164 ? 24.425  -5.973  5.170   1.00 4.99  ? 164  PHE A CD1 1 
ATOM   1203 C CD2 . PHE A 1 164 ? 22.902  -4.304  5.970   1.00 6.40  ? 164  PHE A CD2 1 
ATOM   1204 C CE1 . PHE A 1 164 ? 24.366  -5.417  3.890   1.00 7.83  ? 164  PHE A CE1 1 
ATOM   1205 C CE2 . PHE A 1 164 ? 22.837  -3.743  4.697   1.00 7.07  ? 164  PHE A CE2 1 
ATOM   1206 C CZ  . PHE A 1 164 ? 23.564  -4.303  3.655   1.00 7.77  ? 164  PHE A CZ  1 
ATOM   1207 N N   . ALA A 1 165 ? 24.878  -3.768  9.207   1.00 6.15  ? 165  ALA A N   1 
ATOM   1208 C CA  . ALA A 1 165 ? 25.311  -2.383  9.352   1.00 6.19  ? 165  ALA A CA  1 
ATOM   1209 C C   . ALA A 1 165 ? 26.686  -2.258  9.996   1.00 6.78  ? 165  ALA A C   1 
ATOM   1210 O O   . ALA A 1 165 ? 27.501  -1.444  9.565   1.00 7.57  ? 165  ALA A O   1 
ATOM   1211 C CB  . ALA A 1 165 ? 24.277  -1.585  10.152  1.00 5.99  ? 165  ALA A CB  1 
ATOM   1212 N N   . LEU A 1 166 ? 26.948  -3.057  11.027  1.00 7.34  ? 166  LEU A N   1 
ATOM   1213 C CA  . LEU A 1 166 ? 28.240  -3.000  11.696  1.00 8.25  ? 166  LEU A CA  1 
ATOM   1214 C C   . LEU A 1 166 ? 29.348  -3.501  10.777  1.00 8.90  ? 166  LEU A C   1 
ATOM   1215 O O   . LEU A 1 166 ? 30.488  -3.052  10.878  1.00 10.48 ? 166  LEU A O   1 
ATOM   1216 C CB  . LEU A 1 166 ? 28.202  -3.803  12.996  1.00 7.86  ? 166  LEU A CB  1 
ATOM   1217 C CG  . LEU A 1 166 ? 27.348  -3.134  14.081  1.00 9.84  ? 166  LEU A CG  1 
ATOM   1218 C CD1 . LEU A 1 166 ? 27.127  -4.093  15.232  1.00 8.51  ? 166  LEU A CD1 1 
ATOM   1219 C CD2 . LEU A 1 166 ? 28.037  -1.860  14.570  1.00 9.97  ? 166  LEU A CD2 1 
ATOM   1220 N N   . ALA A 1 167 ? 29.012  -4.427  9.879   1.00 7.05  ? 167  ALA A N   1 
ATOM   1221 C CA  . ALA A 1 167 ? 29.992  -4.945  8.930   1.00 6.95  ? 167  ALA A CA  1 
ATOM   1222 C C   . ALA A 1 167 ? 30.380  -3.830  7.966   1.00 7.73  ? 167  ALA A C   1 
ATOM   1223 O O   . ALA A 1 167 ? 31.541  -3.718  7.568   1.00 7.59  ? 167  ALA A O   1 
ATOM   1224 C CB  . ALA A 1 167 ? 29.416  -6.127  8.157   1.00 9.45  ? 167  ALA A CB  1 
ATOM   1225 N N   . ILE A 1 168 ? 29.399  -3.014  7.581   1.00 5.85  ? 168  ILE A N   1 
ATOM   1226 C CA  . ILE A 1 168 ? 29.658  -1.898  6.679   1.00 6.11  ? 168  ILE A CA  1 
ATOM   1227 C C   . ILE A 1 168 ? 30.538  -0.895  7.418   1.00 5.73  ? 168  ILE A C   1 
ATOM   1228 O O   . ILE A 1 168 ? 31.523  -0.395  6.872   1.00 5.99  ? 168  ILE A O   1 
ATOM   1229 C CB  . ILE A 1 168 ? 28.342  -1.197  6.239   1.00 5.65  ? 168  ILE A CB  1 
ATOM   1230 C CG1 . ILE A 1 168 ? 27.516  -2.136  5.359   1.00 5.51  ? 168  ILE A CG1 1 
ATOM   1231 C CG2 . ILE A 1 168 ? 28.661  0.072   5.457   1.00 7.55  ? 168  ILE A CG2 1 
ATOM   1232 C CD1 . ILE A 1 168 ? 26.057  -1.716  5.211   1.00 6.34  ? 168  ILE A CD1 1 
ATOM   1233 N N   . VAL A 1 169 ? 30.187  -0.620  8.670   1.00 7.24  ? 169  VAL A N   1 
ATOM   1234 C CA  . VAL A 1 169 ? 30.956  0.319   9.480   1.00 7.88  ? 169  VAL A CA  1 
ATOM   1235 C C   . VAL A 1 169 ? 32.404  -0.138  9.630   1.00 9.76  ? 169  VAL A C   1 
ATOM   1236 O O   . VAL A 1 169 ? 33.331  0.666   9.518   1.00 12.71 ? 169  VAL A O   1 
ATOM   1237 C CB  . VAL A 1 169 ? 30.327  0.501   10.875  1.00 7.76  ? 169  VAL A CB  1 
ATOM   1238 C CG1 . VAL A 1 169 ? 31.269  1.297   11.777  1.00 7.97  ? 169  VAL A CG1 1 
ATOM   1239 C CG2 . VAL A 1 169 ? 28.996  1.237   10.746  1.00 9.97  ? 169  VAL A CG2 1 
ATOM   1240 N N   . GLU A 1 170 ? 32.604  -1.428  9.880   1.00 9.86  ? 170  GLU A N   1 
ATOM   1241 C CA  . GLU A 1 170 ? 33.958  -1.945  10.025  1.00 10.68 ? 170  GLU A CA  1 
ATOM   1242 C C   . GLU A 1 170 ? 34.748  -1.848  8.721   1.00 9.89  ? 170  GLU A C   1 
ATOM   1243 O O   . GLU A 1 170 ? 35.926  -1.502  8.725   1.00 9.84  ? 170  GLU A O   1 
ATOM   1244 C CB  . GLU A 1 170 ? 33.940  -3.399  10.503  1.00 12.27 ? 170  GLU A CB  1 
ATOM   1245 C CG  . GLU A 1 170 ? 35.325  -4.029  10.521  1.00 19.05 ? 170  GLU A CG  1 
ATOM   1246 C CD  . GLU A 1 170 ? 35.348  -5.409  11.134  1.00 22.83 ? 170  GLU A CD  1 
ATOM   1247 O OE1 . GLU A 1 170 ? 36.400  -6.076  11.038  1.00 27.67 ? 170  GLU A OE1 1 
ATOM   1248 O OE2 . GLU A 1 170 ? 34.324  -5.825  11.717  1.00 27.38 ? 170  GLU A OE2 1 
ATOM   1249 N N   . ALA A 1 171 ? 34.095  -2.147  7.602   1.00 8.48  ? 171  ALA A N   1 
ATOM   1250 C CA  . ALA A 1 171 ? 34.759  -2.098  6.306   1.00 8.74  ? 171  ALA A CA  1 
ATOM   1251 C C   . ALA A 1 171 ? 35.197  -0.684  5.946   1.00 10.99 ? 171  ALA A C   1 
ATOM   1252 O O   . ALA A 1 171 ? 36.241  -0.490  5.325   1.00 12.19 ? 171  ALA A O   1 
ATOM   1253 C CB  . ALA A 1 171 ? 33.827  -2.644  5.223   1.00 8.74  ? 171  ALA A CB  1 
ATOM   1254 N N   . LEU A 1 172 ? 34.396  0.298   6.346   1.00 10.98 ? 172  LEU A N   1 
ATOM   1255 C CA  . LEU A 1 172 ? 34.675  1.697   6.048   1.00 12.43 ? 172  LEU A CA  1 
ATOM   1256 C C   . LEU A 1 172 ? 35.550  2.428   7.059   1.00 12.88 ? 172  LEU A C   1 
ATOM   1257 O O   . LEU A 1 172 ? 36.479  3.145   6.674   1.00 11.11 ? 172  LEU A O   1 
ATOM   1258 C CB  . LEU A 1 172 ? 33.361  2.468   5.893   1.00 12.85 ? 172  LEU A CB  1 
ATOM   1259 C CG  . LEU A 1 172 ? 32.754  2.632   4.497   1.00 15.06 ? 172  LEU A CG  1 
ATOM   1260 C CD1 . LEU A 1 172 ? 32.592  1.285   3.823   1.00 14.70 ? 172  LEU A CD1 1 
ATOM   1261 C CD2 . LEU A 1 172 ? 31.415  3.339   4.615   1.00 12.71 ? 172  LEU A CD2 1 
ATOM   1262 N N   . ASN A 1 173 ? 35.262  2.247   8.347   1.00 13.35 ? 173  ASN A N   1 
ATOM   1263 C CA  . ASN A 1 173 ? 36.015  2.948   9.387   1.00 13.49 ? 173  ASN A CA  1 
ATOM   1264 C C   . ASN A 1 173 ? 36.874  2.125   10.347  1.00 13.57 ? 173  ASN A C   1 
ATOM   1265 O O   . ASN A 1 173 ? 37.543  2.693   11.213  1.00 13.40 ? 173  ASN A O   1 
ATOM   1266 C CB  . ASN A 1 173 ? 35.064  3.831   10.199  1.00 16.47 ? 173  ASN A CB  1 
ATOM   1267 C CG  . ASN A 1 173 ? 34.346  4.854   9.339   1.00 18.11 ? 173  ASN A CG  1 
ATOM   1268 O OD1 . ASN A 1 173 ? 34.851  5.268   8.296   1.00 21.39 ? 173  ASN A OD1 1 
ATOM   1269 N ND2 . ASN A 1 173 ? 33.171  5.279   9.780   1.00 20.64 ? 173  ASN A ND2 1 
ATOM   1270 N N   . GLY A 1 174 ? 36.860  0.805   10.218  1.00 12.84 ? 174  GLY A N   1 
ATOM   1271 C CA  . GLY A 1 174 ? 37.681  -0.009  11.099  1.00 13.15 ? 174  GLY A CA  1 
ATOM   1272 C C   . GLY A 1 174 ? 36.951  -0.696  12.235  1.00 12.70 ? 174  GLY A C   1 
ATOM   1273 O O   . GLY A 1 174 ? 35.850  -0.304  12.618  1.00 12.10 ? 174  GLY A O   1 
ATOM   1274 N N   . LYS A 1 175 ? 37.588  -1.723  12.790  1.00 13.57 ? 175  LYS A N   1 
ATOM   1275 C CA  . LYS A 1 175 ? 37.008  -2.499  13.877  1.00 14.83 ? 175  LYS A CA  1 
ATOM   1276 C C   . LYS A 1 175 ? 36.746  -1.698  15.149  1.00 13.70 ? 175  LYS A C   1 
ATOM   1277 O O   . LYS A 1 175 ? 35.758  -1.944  15.843  1.00 9.93  ? 175  LYS A O   1 
ATOM   1278 C CB  . LYS A 1 175 ? 37.908  -3.695  14.196  1.00 17.42 ? 175  LYS A CB  1 
ATOM   1279 C CG  . LYS A 1 175 ? 38.192  -4.571  12.988  1.00 23.32 ? 175  LYS A CG  1 
ATOM   1280 C CD  . LYS A 1 175 ? 38.990  -5.816  13.349  1.00 27.77 ? 175  LYS A CD  1 
ATOM   1281 C CE  . LYS A 1 175 ? 38.172  -6.775  14.200  1.00 31.82 ? 175  LYS A CE  1 
ATOM   1282 N NZ  . LYS A 1 175 ? 38.912  -8.039  14.477  1.00 35.33 ? 175  LYS A NZ  1 
ATOM   1283 N N   . GLU A 1 176 ? 37.624  -0.748  15.462  1.00 15.21 ? 176  GLU A N   1 
ATOM   1284 C CA  . GLU A 1 176 ? 37.454  0.068   16.664  1.00 14.88 ? 176  GLU A CA  1 
ATOM   1285 C C   . GLU A 1 176 ? 36.180  0.906   16.609  1.00 14.49 ? 176  GLU A C   1 
ATOM   1286 O O   . GLU A 1 176 ? 35.391  0.910   17.553  1.00 13.14 ? 176  GLU A O   1 
ATOM   1287 C CB  . GLU A 1 176 ? 38.664  0.985   16.868  1.00 14.53 ? 176  GLU A CB  1 
ATOM   1288 C CG  . GLU A 1 176 ? 38.575  1.895   18.092  1.00 16.08 ? 176  GLU A CG  1 
ATOM   1289 C CD  . GLU A 1 176 ? 38.360  1.136   19.392  1.00 14.38 ? 176  GLU A CD  1 
ATOM   1290 O OE1 . GLU A 1 176 ? 38.805  -0.026  19.493  1.00 15.24 ? 176  GLU A OE1 1 
ATOM   1291 O OE2 . GLU A 1 176 ? 37.759  1.710   20.323  1.00 15.75 ? 176  GLU A OE2 1 
ATOM   1292 N N   . VAL A 1 177 ? 35.980  1.623   15.507  1.00 13.10 ? 177  VAL A N   1 
ATOM   1293 C CA  . VAL A 1 177 ? 34.782  2.441   15.369  1.00 12.54 ? 177  VAL A CA  1 
ATOM   1294 C C   . VAL A 1 177 ? 33.544  1.546   15.424  1.00 11.82 ? 177  VAL A C   1 
ATOM   1295 O O   . VAL A 1 177 ? 32.546  1.893   16.055  1.00 12.01 ? 177  VAL A O   1 
ATOM   1296 C CB  . VAL A 1 177 ? 34.788  3.232   14.039  1.00 13.49 ? 177  VAL A CB  1 
ATOM   1297 C CG1 . VAL A 1 177 ? 33.452  3.932   13.842  1.00 13.66 ? 177  VAL A CG1 1 
ATOM   1298 C CG2 . VAL A 1 177 ? 35.914  4.253   14.053  1.00 14.66 ? 177  VAL A CG2 1 
ATOM   1299 N N   . ALA A 1 178 ? 33.613  0.388   14.772  1.00 10.75 ? 178  ALA A N   1 
ATOM   1300 C CA  . ALA A 1 178 ? 32.487  -0.541  14.771  1.00 10.42 ? 178  ALA A CA  1 
ATOM   1301 C C   . ALA A 1 178 ? 32.176  -0.979  16.199  1.00 10.82 ? 178  ALA A C   1 
ATOM   1302 O O   . ALA A 1 178 ? 31.016  -1.017  16.607  1.00 9.93  ? 178  ALA A O   1 
ATOM   1303 C CB  . ALA A 1 178 ? 32.801  -1.760  13.904  1.00 10.41 ? 178  ALA A CB  1 
ATOM   1304 N N   . ALA A 1 179 ? 33.219  -1.300  16.961  1.00 8.42  ? 179  ALA A N   1 
ATOM   1305 C CA  . ALA A 1 179 ? 33.039  -1.732  18.342  1.00 9.55  ? 179  ALA A CA  1 
ATOM   1306 C C   . ALA A 1 179 ? 32.434  -0.629  19.201  1.00 10.50 ? 179  ALA A C   1 
ATOM   1307 O O   . ALA A 1 179 ? 31.564  -0.888  20.035  1.00 10.11 ? 179  ALA A O   1 
ATOM   1308 C CB  . ALA A 1 179 ? 34.371  -2.178  18.929  1.00 10.27 ? 179  ALA A CB  1 
ATOM   1309 N N   . GLN A 1 180 ? 32.893  0.605   18.999  1.00 10.42 ? 180  GLN A N   1 
ATOM   1310 C CA  . GLN A 1 180 ? 32.379  1.727   19.775  1.00 11.90 ? 180  GLN A CA  1 
ATOM   1311 C C   . GLN A 1 180 ? 30.907  1.981   19.449  1.00 12.40 ? 180  GLN A C   1 
ATOM   1312 O O   . GLN A 1 180 ? 30.120  2.339   20.326  1.00 14.71 ? 180  GLN A O   1 
ATOM   1313 C CB  . GLN A 1 180 ? 33.211  2.989   19.506  1.00 13.67 ? 180  GLN A CB  1 
ATOM   1314 C CG  . GLN A 1 180 ? 34.663  2.888   19.980  1.00 17.34 ? 180  GLN A CG  1 
ATOM   1315 C CD  . GLN A 1 180 ? 35.479  4.143   19.685  1.00 20.31 ? 180  GLN A CD  1 
ATOM   1316 O OE1 . GLN A 1 180 ? 36.662  4.229   20.037  1.00 21.62 ? 180  GLN A OE1 1 
ATOM   1317 N NE2 . GLN A 1 180 ? 34.852  5.118   19.036  1.00 18.52 ? 180  GLN A NE2 1 
ATOM   1318 N N   . VAL A 1 181 ? 30.535  1.784   18.188  1.00 10.72 ? 181  VAL A N   1 
ATOM   1319 C CA  . VAL A 1 181 ? 29.152  1.983   17.770  1.00 9.79  ? 181  VAL A CA  1 
ATOM   1320 C C   . VAL A 1 181 ? 28.267  0.863   18.302  1.00 8.83  ? 181  VAL A C   1 
ATOM   1321 O O   . VAL A 1 181 ? 27.132  1.097   18.710  1.00 9.37  ? 181  VAL A O   1 
ATOM   1322 C CB  . VAL A 1 181 ? 29.028  2.022   16.228  1.00 8.11  ? 181  VAL A CB  1 
ATOM   1323 C CG1 . VAL A 1 181 ? 27.563  1.996   15.820  1.00 7.59  ? 181  VAL A CG1 1 
ATOM   1324 C CG2 . VAL A 1 181 ? 29.688  3.285   15.690  1.00 9.67  ? 181  VAL A CG2 1 
ATOM   1325 N N   . LYS A 1 182 ? 28.797  -0.352  18.316  1.00 7.74  ? 182  LYS A N   1 
ATOM   1326 C CA  . LYS A 1 182 ? 28.029  -1.498  18.785  1.00 9.12  ? 182  LYS A CA  1 
ATOM   1327 C C   . LYS A 1 182 ? 27.709  -1.479  20.279  1.00 9.91  ? 182  LYS A C   1 
ATOM   1328 O O   . LYS A 1 182 ? 26.583  -1.765  20.679  1.00 9.99  ? 182  LYS A O   1 
ATOM   1329 C CB  . LYS A 1 182 ? 28.775  -2.794  18.449  1.00 8.56  ? 182  LYS A CB  1 
ATOM   1330 C CG  . LYS A 1 182 ? 28.061  -4.059  18.899  1.00 11.28 ? 182  LYS A CG  1 
ATOM   1331 C CD  . LYS A 1 182 ? 28.870  -5.304  18.554  1.00 12.99 ? 182  LYS A CD  1 
ATOM   1332 C CE  . LYS A 1 182 ? 28.146  -6.572  18.992  1.00 16.67 ? 182  LYS A CE  1 
ATOM   1333 N NZ  . LYS A 1 182 ? 28.877  -7.804  18.587  1.00 18.82 ? 182  LYS A NZ  1 
ATOM   1334 N N   . ALA A 1 183 ? 28.698  -1.132  21.096  1.00 12.41 ? 183  ALA A N   1 
ATOM   1335 C CA  . ALA A 1 183 ? 28.539  -1.129  22.551  1.00 13.46 ? 183  ALA A CA  1 
ATOM   1336 C C   . ALA A 1 183 ? 27.216  -0.597  23.123  1.00 14.82 ? 183  ALA A C   1 
ATOM   1337 O O   . ALA A 1 183 ? 26.554  -1.280  23.906  1.00 17.61 ? 183  ALA A O   1 
ATOM   1338 C CB  . ALA A 1 183 ? 29.723  -0.399  23.194  1.00 14.30 ? 183  ALA A CB  1 
ATOM   1339 N N   . PRO A 1 184 ? 26.809  0.626   22.742  1.00 13.05 ? 184  PRO A N   1 
ATOM   1340 C CA  . PRO A 1 184 ? 25.565  1.228   23.238  1.00 14.75 ? 184  PRO A CA  1 
ATOM   1341 C C   . PRO A 1 184 ? 24.256  0.627   22.721  1.00 13.41 ? 184  PRO A C   1 
ATOM   1342 O O   . PRO A 1 184 ? 23.176  0.975   23.198  1.00 13.81 ? 184  PRO A O   1 
ATOM   1343 C CB  . PRO A 1 184 ? 25.689  2.692   22.807  1.00 14.78 ? 184  PRO A CB  1 
ATOM   1344 C CG  . PRO A 1 184 ? 27.163  2.892   22.603  1.00 15.35 ? 184  PRO A CG  1 
ATOM   1345 C CD  . PRO A 1 184 ? 27.582  1.604   21.963  1.00 11.97 ? 184  PRO A CD  1 
ATOM   1346 N N   . LEU A 1 185 ? 24.345  -0.270  21.748  1.00 14.57 ? 185  LEU A N   1 
ATOM   1347 C CA  . LEU A 1 185 ? 23.147  -0.853  21.159  1.00 12.86 ? 185  LEU A CA  1 
ATOM   1348 C C   . LEU A 1 185 ? 22.432  -1.911  21.991  1.00 14.27 ? 185  LEU A C   1 
ATOM   1349 O O   . LEU A 1 185 ? 21.242  -2.150  21.795  1.00 12.02 ? 185  LEU A O   1 
ATOM   1350 C CB  . LEU A 1 185 ? 23.483  -1.434  19.785  1.00 13.22 ? 185  LEU A CB  1 
ATOM   1351 C CG  . LEU A 1 185 ? 24.036  -0.446  18.755  1.00 14.14 ? 185  LEU A CG  1 
ATOM   1352 C CD1 . LEU A 1 185 ? 24.288  -1.181  17.451  1.00 13.47 ? 185  LEU A CD1 1 
ATOM   1353 C CD2 . LEU A 1 185 ? 23.051  0.700   18.540  1.00 14.73 ? 185  LEU A CD2 1 
ATOM   1354 N N   . VAL A 1 186 ? 23.154  -2.540  22.914  1.00 13.83 ? 186  VAL A N   1 
ATOM   1355 C CA  . VAL A 1 186 ? 22.588  -3.587  23.762  1.00 14.25 ? 186  VAL A CA  1 
ATOM   1356 C C   . VAL A 1 186 ? 22.208  -4.811  22.924  1.00 14.90 ? 186  VAL A C   1 
ATOM   1357 O O   . VAL A 1 186 ? 21.115  -5.365  23.062  1.00 14.32 ? 186  VAL A O   1 
ATOM   1358 C CB  . VAL A 1 186 ? 21.329  -3.101  24.531  1.00 13.68 ? 186  VAL A CB  1 
ATOM   1359 C CG1 . VAL A 1 186 ? 21.005  -4.076  25.657  1.00 14.09 ? 186  VAL A CG1 1 
ATOM   1360 C CG2 . VAL A 1 186 ? 21.550  -1.701  25.088  1.00 12.43 ? 186  VAL A CG2 1 
ATOM   1361 N N   . LEU A 1 187 ? 23.112  -5.219  22.041  1.00 15.03 ? 187  LEU A N   1 
ATOM   1362 C CA  . LEU A 1 187 ? 22.885  -6.390  21.204  1.00 18.01 ? 187  LEU A CA  1 
ATOM   1363 C C   . LEU A 1 187 ? 23.312  -7.627  21.987  1.00 21.42 ? 187  LEU A C   1 
ATOM   1364 O O   . LEU A 1 187 ? 23.661  -7.529  23.162  1.00 23.14 ? 187  LEU A O   1 
ATOM   1365 C CB  . LEU A 1 187 ? 23.706  -6.291  19.919  1.00 15.91 ? 187  LEU A CB  1 
ATOM   1366 C CG  . LEU A 1 187 ? 23.202  -5.294  18.876  1.00 15.21 ? 187  LEU A CG  1 
ATOM   1367 C CD1 . LEU A 1 187 ? 24.304  -4.997  17.872  1.00 14.88 ? 187  LEU A CD1 1 
ATOM   1368 C CD2 . LEU A 1 187 ? 21.972  -5.865  18.184  1.00 14.84 ? 187  LEU A CD2 1 
ATOM   1369 N N   . LYS A 1 188 ? 23.282  -8.780  21.328  1.00 27.14 ? 188  LYS A N   1 
ATOM   1370 C CA  . LYS A 1 188 ? 23.676  -10.047 21.941  1.00 30.96 ? 188  LYS A CA  1 
ATOM   1371 C C   . LYS A 1 188 ? 24.934  -9.866  22.786  1.00 31.54 ? 188  LYS A C   1 
ATOM   1372 O O   . LYS A 1 188 ? 24.961  -10.221 23.964  1.00 34.12 ? 188  LYS A O   1 
ATOM   1373 C CB  . LYS A 1 188 ? 23.948  -11.091 20.853  1.00 32.37 ? 188  LYS A CB  1 
ATOM   1374 C CG  . LYS A 1 188 ? 22.793  -11.311 19.887  1.00 35.43 ? 188  LYS A CG  1 
ATOM   1375 C CD  . LYS A 1 188 ? 23.140  -12.310 18.785  1.00 36.30 ? 188  LYS A CD  1 
ATOM   1376 C CE  . LYS A 1 188 ? 24.275  -11.812 17.899  1.00 38.21 ? 188  LYS A CE  1 
ATOM   1377 N NZ  . LYS A 1 188 ? 24.566  -12.748 16.772  1.00 38.68 ? 188  LYS A NZ  1 
ATOM   1378 N N   . ALA B 1 2   ? -11.852 -9.090  16.129  1.00 33.37 ? 202  ALA B N   1 
ATOM   1379 C CA  . ALA B 1 2   ? -11.340 -7.893  15.472  1.00 32.34 ? 202  ALA B CA  1 
ATOM   1380 C C   . ALA B 1 2   ? -9.830  -7.781  15.653  1.00 31.48 ? 202  ALA B C   1 
ATOM   1381 O O   . ALA B 1 2   ? -9.236  -8.490  16.467  1.00 31.74 ? 202  ALA B O   1 
ATOM   1382 C CB  . ALA B 1 2   ? -12.027 -6.654  16.036  1.00 32.25 ? 202  ALA B CB  1 
ATOM   1383 N N   . SER B 1 3   ? -9.215  -6.887  14.887  1.00 29.56 ? 203  SER B N   1 
ATOM   1384 C CA  . SER B 1 3   ? -7.776  -6.680  14.961  1.00 28.91 ? 203  SER B CA  1 
ATOM   1385 C C   . SER B 1 3   ? -7.409  -5.949  16.242  1.00 27.15 ? 203  SER B C   1 
ATOM   1386 O O   . SER B 1 3   ? -8.168  -5.110  16.726  1.00 26.56 ? 203  SER B O   1 
ATOM   1387 C CB  . SER B 1 3   ? -7.293  -5.852  13.767  1.00 28.96 ? 203  SER B CB  1 
ATOM   1388 O OG  . SER B 1 3   ? -7.594  -6.486  12.538  1.00 31.29 ? 203  SER B OG  1 
ATOM   1389 N N   . LYS B 1 4   ? -6.250  -6.278  16.798  1.00 26.22 ? 204  LYS B N   1 
ATOM   1390 C CA  . LYS B 1 4   ? -5.783  -5.602  17.996  1.00 24.94 ? 204  LYS B CA  1 
ATOM   1391 C C   . LYS B 1 4   ? -5.207  -4.282  17.495  1.00 23.96 ? 204  LYS B C   1 
ATOM   1392 O O   . LYS B 1 4   ? -4.783  -4.189  16.340  1.00 22.72 ? 204  LYS B O   1 
ATOM   1393 C CB  . LYS B 1 4   ? -4.706  -6.435  18.694  1.00 26.33 ? 204  LYS B CB  1 
ATOM   1394 C CG  . LYS B 1 4   ? -5.116  -6.952  20.065  1.00 28.87 ? 204  LYS B CG  1 
ATOM   1395 C CD  . LYS B 1 4   ? -6.351  -7.830  19.995  1.00 31.27 ? 204  LYS B CD  1 
ATOM   1396 C CE  . LYS B 1 4   ? -6.828  -8.220  21.386  1.00 31.93 ? 204  LYS B CE  1 
ATOM   1397 N NZ  . LYS B 1 4   ? -5.776  -8.939  22.157  1.00 33.71 ? 204  LYS B NZ  1 
ATOM   1398 N N   . ARG B 1 5   ? -5.209  -3.257  18.340  1.00 22.58 ? 205  ARG B N   1 
ATOM   1399 C CA  . ARG B 1 5   ? -4.692  -1.960  17.927  1.00 22.60 ? 205  ARG B CA  1 
ATOM   1400 C C   . ARG B 1 5   ? -3.534  -1.459  18.773  1.00 20.76 ? 205  ARG B C   1 
ATOM   1401 O O   . ARG B 1 5   ? -3.492  -1.671  19.988  1.00 19.72 ? 205  ARG B O   1 
ATOM   1402 C CB  . ARG B 1 5   ? -5.807  -0.913  17.930  1.00 25.50 ? 205  ARG B CB  1 
ATOM   1403 C CG  . ARG B 1 5   ? -6.837  -1.092  16.824  1.00 29.74 ? 205  ARG B CG  1 
ATOM   1404 C CD  . ARG B 1 5   ? -7.639  0.180   16.622  1.00 33.50 ? 205  ARG B CD  1 
ATOM   1405 N NE  . ARG B 1 5   ? -8.493  0.491   17.763  1.00 37.56 ? 205  ARG B NE  1 
ATOM   1406 C CZ  . ARG B 1 5   ? -9.087  1.664   17.955  1.00 39.52 ? 205  ARG B CZ  1 
ATOM   1407 N NH1 . ARG B 1 5   ? -8.918  2.649   17.084  1.00 40.41 ? 205  ARG B NH1 1 
ATOM   1408 N NH2 . ARG B 1 5   ? -9.860  1.850   19.017  1.00 40.63 ? 205  ARG B NH2 1 
ATOM   1409 N N   . ALA B 1 6   ? -2.600  -0.785  18.116  1.00 19.19 ? 206  ALA B N   1 
ATOM   1410 C CA  . ALA B 1 6   ? -1.431  -0.241  18.789  1.00 16.73 ? 206  ALA B CA  1 
ATOM   1411 C C   . ALA B 1 6   ? -1.221  1.222   18.435  1.00 17.03 ? 206  ALA B C   1 
ATOM   1412 O O   . ALA B 1 6   ? -1.338  1.618   17.273  1.00 15.48 ? 206  ALA B O   1 
ATOM   1413 C CB  . ALA B 1 6   ? -0.188  -1.048  18.418  1.00 16.13 ? 206  ALA B CB  1 
ATOM   1414 N N   . LEU B 1 7   ? -0.922  2.018   19.453  1.00 14.56 ? 207  LEU B N   1 
ATOM   1415 C CA  . LEU B 1 7   ? -0.656  3.438   19.281  1.00 16.11 ? 207  LEU B CA  1 
ATOM   1416 C C   . LEU B 1 7   ? 0.826   3.678   19.556  1.00 15.85 ? 207  LEU B C   1 
ATOM   1417 O O   . LEU B 1 7   ? 1.290   3.477   20.675  1.00 16.01 ? 207  LEU B O   1 
ATOM   1418 C CB  . LEU B 1 7   ? -1.487  4.262   20.267  1.00 16.14 ? 207  LEU B CB  1 
ATOM   1419 C CG  . LEU B 1 7   ? -1.228  5.769   20.245  1.00 18.52 ? 207  LEU B CG  1 
ATOM   1420 C CD1 . LEU B 1 7   ? -1.707  6.338   18.920  1.00 17.95 ? 207  LEU B CD1 1 
ATOM   1421 C CD2 . LEU B 1 7   ? -1.947  6.443   21.407  1.00 19.82 ? 207  LEU B CD2 1 
ATOM   1422 N N   . VAL B 1 8   ? 1.569   4.100   18.540  1.00 14.64 ? 208  VAL B N   1 
ATOM   1423 C CA  . VAL B 1 8   ? 2.988   4.376   18.721  1.00 14.98 ? 208  VAL B CA  1 
ATOM   1424 C C   . VAL B 1 8   ? 3.153   5.887   18.671  1.00 15.26 ? 208  VAL B C   1 
ATOM   1425 O O   . VAL B 1 8   ? 2.878   6.511   17.648  1.00 15.08 ? 208  VAL B O   1 
ATOM   1426 C CB  . VAL B 1 8   ? 3.834   3.718   17.613  1.00 14.01 ? 208  VAL B CB  1 
ATOM   1427 C CG1 . VAL B 1 8   ? 5.318   4.002   17.842  1.00 14.96 ? 208  VAL B CG1 1 
ATOM   1428 C CG2 . VAL B 1 8   ? 3.583   2.223   17.605  1.00 11.80 ? 208  VAL B CG2 1 
ATOM   1429 N N   . ILE B 1 9   ? 3.581   6.480   19.781  1.00 15.57 ? 209  ILE B N   1 
ATOM   1430 C CA  . ILE B 1 9   ? 3.743   7.927   19.833  1.00 15.33 ? 209  ILE B CA  1 
ATOM   1431 C C   . ILE B 1 9   ? 5.118   8.354   19.350  1.00 16.90 ? 209  ILE B C   1 
ATOM   1432 O O   . ILE B 1 9   ? 6.136   8.057   19.977  1.00 16.43 ? 209  ILE B O   1 
ATOM   1433 C CB  . ILE B 1 9   ? 3.511   8.463   21.254  1.00 15.73 ? 209  ILE B CB  1 
ATOM   1434 C CG1 . ILE B 1 9   ? 2.181   7.930   21.791  1.00 15.71 ? 209  ILE B CG1 1 
ATOM   1435 C CG2 . ILE B 1 9   ? 3.482   9.985   21.233  1.00 15.01 ? 209  ILE B CG2 1 
ATOM   1436 C CD1 . ILE B 1 9   ? 1.876   8.358   23.216  1.00 13.99 ? 209  ILE B CD1 1 
ATOM   1437 N N   . LEU B 1 10  ? 5.132   9.064   18.228  1.00 15.81 ? 210  LEU B N   1 
ATOM   1438 C CA  . LEU B 1 10  ? 6.372   9.523   17.619  1.00 15.50 ? 210  LEU B CA  1 
ATOM   1439 C C   . LEU B 1 10  ? 6.676   10.982  17.917  1.00 17.04 ? 210  LEU B C   1 
ATOM   1440 O O   . LEU B 1 10  ? 6.015   11.889  17.408  1.00 16.69 ? 210  LEU B O   1 
ATOM   1441 C CB  . LEU B 1 10  ? 6.315   9.303   16.103  1.00 15.98 ? 210  LEU B CB  1 
ATOM   1442 C CG  . LEU B 1 10  ? 7.526   9.751   15.279  1.00 17.20 ? 210  LEU B CG  1 
ATOM   1443 C CD1 . LEU B 1 10  ? 8.790   9.103   15.820  1.00 15.80 ? 210  LEU B CD1 1 
ATOM   1444 C CD2 . LEU B 1 10  ? 7.315   9.378   13.814  1.00 17.21 ? 210  LEU B CD2 1 
ATOM   1445 N N   . ALA B 1 11  ? 7.691   11.199  18.743  1.00 17.12 ? 211  ALA B N   1 
ATOM   1446 C CA  . ALA B 1 11  ? 8.100   12.543  19.109  1.00 17.04 ? 211  ALA B CA  1 
ATOM   1447 C C   . ALA B 1 11  ? 9.404   12.885  18.409  1.00 17.60 ? 211  ALA B C   1 
ATOM   1448 O O   . ALA B 1 11  ? 10.198  12.002  18.083  1.00 17.26 ? 211  ALA B O   1 
ATOM   1449 C CB  . ALA B 1 11  ? 8.278   12.638  20.613  1.00 16.42 ? 211  ALA B CB  1 
ATOM   1450 N N   . LYS B 1 12  ? 9.619   14.170  18.167  1.00 17.34 ? 212  LYS B N   1 
ATOM   1451 C CA  . LYS B 1 12  ? 10.841  14.612  17.522  1.00 16.96 ? 212  LYS B CA  1 
ATOM   1452 C C   . LYS B 1 12  ? 12.023  14.126  18.361  1.00 16.02 ? 212  LYS B C   1 
ATOM   1453 O O   . LYS B 1 12  ? 12.027  14.274  19.584  1.00 16.21 ? 212  LYS B O   1 
ATOM   1454 C CB  . LYS B 1 12  ? 10.848  16.138  17.427  1.00 19.27 ? 212  LYS B CB  1 
ATOM   1455 C CG  . LYS B 1 12  ? 12.035  16.714  16.696  1.00 23.87 ? 212  LYS B CG  1 
ATOM   1456 C CD  . LYS B 1 12  ? 11.973  18.232  16.695  1.00 26.27 ? 212  LYS B CD  1 
ATOM   1457 C CE  . LYS B 1 12  ? 13.168  18.824  15.978  1.00 29.32 ? 212  LYS B CE  1 
ATOM   1458 N NZ  . LYS B 1 12  ? 14.455  18.412  16.606  1.00 31.43 ? 212  LYS B NZ  1 
ATOM   1459 N N   . GLY B 1 13  ? 13.014  13.528  17.707  1.00 13.46 ? 213  GLY B N   1 
ATOM   1460 C CA  . GLY B 1 13  ? 14.173  13.035  18.430  1.00 11.89 ? 213  GLY B CA  1 
ATOM   1461 C C   . GLY B 1 13  ? 14.044  11.582  18.853  1.00 11.82 ? 213  GLY B C   1 
ATOM   1462 O O   . GLY B 1 13  ? 14.912  11.053  19.544  1.00 11.10 ? 213  GLY B O   1 
ATOM   1463 N N   . ALA B 1 14  ? 12.957  10.936  18.448  1.00 11.53 ? 214  ALA B N   1 
ATOM   1464 C CA  . ALA B 1 14  ? 12.746  9.535   18.793  1.00 10.89 ? 214  ALA B CA  1 
ATOM   1465 C C   . ALA B 1 14  ? 13.803  8.688   18.102  1.00 11.29 ? 214  ALA B C   1 
ATOM   1466 O O   . ALA B 1 14  ? 14.314  9.065   17.049  1.00 11.30 ? 214  ALA B O   1 
ATOM   1467 C CB  . ALA B 1 14  ? 11.365  9.091   18.349  1.00 12.48 ? 214  ALA B CB  1 
ATOM   1468 N N   . GLU B 1 15  ? 14.135  7.546   18.695  1.00 11.12 ? 215  GLU B N   1 
ATOM   1469 C CA  . GLU B 1 15  ? 15.115  6.655   18.089  1.00 9.67  ? 215  GLU B CA  1 
ATOM   1470 C C   . GLU B 1 15  ? 14.354  5.948   16.971  1.00 9.48  ? 215  GLU B C   1 
ATOM   1471 O O   . GLU B 1 15  ? 13.412  5.201   17.230  1.00 9.45  ? 215  GLU B O   1 
ATOM   1472 C CB  . GLU B 1 15  ? 15.625  5.641   19.118  1.00 9.83  ? 215  GLU B CB  1 
ATOM   1473 C CG  . GLU B 1 15  ? 17.118  5.388   19.020  1.00 10.16 ? 215  GLU B CG  1 
ATOM   1474 C CD  . GLU B 1 15  ? 17.517  4.812   17.683  1.00 10.75 ? 215  GLU B CD  1 
ATOM   1475 O OE1 . GLU B 1 15  ? 18.638  5.107   17.218  1.00 11.84 ? 215  GLU B OE1 1 
ATOM   1476 O OE2 . GLU B 1 15  ? 16.712  4.055   17.103  1.00 12.19 ? 215  GLU B OE2 1 
ATOM   1477 N N   . GLU B 1 16  ? 14.751  6.194   15.725  1.00 10.02 ? 216  GLU B N   1 
ATOM   1478 C CA  . GLU B 1 16  ? 14.059  5.597   14.592  1.00 9.01  ? 216  GLU B CA  1 
ATOM   1479 C C   . GLU B 1 16  ? 14.054  4.076   14.533  1.00 9.23  ? 216  GLU B C   1 
ATOM   1480 O O   . GLU B 1 16  ? 13.091  3.487   14.046  1.00 8.95  ? 216  GLU B O   1 
ATOM   1481 C CB  . GLU B 1 16  ? 14.588  6.161   13.263  1.00 9.86  ? 216  GLU B CB  1 
ATOM   1482 C CG  . GLU B 1 16  ? 16.102  6.264   13.130  1.00 9.66  ? 216  GLU B CG  1 
ATOM   1483 C CD  . GLU B 1 16  ? 16.656  7.541   13.736  1.00 11.68 ? 216  GLU B CD  1 
ATOM   1484 O OE1 . GLU B 1 16  ? 16.707  7.642   14.979  1.00 11.40 ? 216  GLU B OE1 1 
ATOM   1485 O OE2 . GLU B 1 16  ? 17.033  8.447   12.960  1.00 9.41  ? 216  GLU B OE2 1 
ATOM   1486 N N   . MET B 1 17  ? 15.109  3.430   15.013  1.00 8.37  ? 217  MET B N   1 
ATOM   1487 C CA  . MET B 1 17  ? 15.128  1.970   14.980  1.00 7.32  ? 217  MET B CA  1 
ATOM   1488 C C   . MET B 1 17  ? 14.114  1.435   15.987  1.00 7.70  ? 217  MET B C   1 
ATOM   1489 O O   . MET B 1 17  ? 13.386  0.476   15.713  1.00 7.36  ? 217  MET B O   1 
ATOM   1490 C CB  . MET B 1 17  ? 16.525  1.437   15.314  1.00 7.13  ? 217  MET B CB  1 
ATOM   1491 C CG  . MET B 1 17  ? 17.597  1.859   14.322  1.00 6.31  ? 217  MET B CG  1 
ATOM   1492 S SD  . MET B 1 17  ? 19.180  1.038   14.615  1.00 9.20  ? 217  MET B SD  1 
ATOM   1493 C CE  . MET B 1 17  ? 19.774  1.972   16.045  1.00 7.87  ? 217  MET B CE  1 
ATOM   1494 N N   . GLU B 1 18  ? 14.058  2.075   17.147  1.00 7.34  ? 218  GLU B N   1 
ATOM   1495 C CA  . GLU B 1 18  ? 13.146  1.669   18.210  1.00 8.43  ? 218  GLU B CA  1 
ATOM   1496 C C   . GLU B 1 18  ? 11.690  1.973   17.880  1.00 8.69  ? 218  GLU B C   1 
ATOM   1497 O O   . GLU B 1 18  ? 10.776  1.491   18.548  1.00 10.92 ? 218  GLU B O   1 
ATOM   1498 C CB  . GLU B 1 18  ? 13.549  2.350   19.516  1.00 9.33  ? 218  GLU B CB  1 
ATOM   1499 C CG  . GLU B 1 18  ? 14.878  1.860   20.055  1.00 12.85 ? 218  GLU B CG  1 
ATOM   1500 C CD  . GLU B 1 18  ? 15.412  2.738   21.161  1.00 13.71 ? 218  GLU B CD  1 
ATOM   1501 O OE1 . GLU B 1 18  ? 14.607  3.468   21.772  1.00 13.05 ? 218  GLU B OE1 1 
ATOM   1502 O OE2 . GLU B 1 18  ? 16.631  2.692   21.429  1.00 14.48 ? 218  GLU B OE2 1 
ATOM   1503 N N   . THR B 1 19  ? 11.481  2.772   16.840  1.00 9.11  ? 219  THR B N   1 
ATOM   1504 C CA  . THR B 1 19  ? 10.139  3.128   16.404  1.00 10.40 ? 219  THR B CA  1 
ATOM   1505 C C   . THR B 1 19  ? 9.715   2.190   15.274  1.00 9.36  ? 219  THR B C   1 
ATOM   1506 O O   . THR B 1 19  ? 8.672   1.534   15.341  1.00 10.54 ? 219  THR B O   1 
ATOM   1507 C CB  . THR B 1 19  ? 10.099  4.587   15.888  1.00 9.13  ? 219  THR B CB  1 
ATOM   1508 O OG1 . THR B 1 19  ? 10.499  5.474   16.938  1.00 12.16 ? 219  THR B OG1 1 
ATOM   1509 C CG2 . THR B 1 19  ? 8.696   4.957   15.416  1.00 11.58 ? 219  THR B CG2 1 
ATOM   1510 N N   . VAL B 1 20  ? 10.550  2.112   14.245  1.00 10.65 ? 220  VAL B N   1 
ATOM   1511 C CA  . VAL B 1 20  ? 10.263  1.280   13.085  1.00 11.14 ? 220  VAL B CA  1 
ATOM   1512 C C   . VAL B 1 20  ? 10.212  -0.222  13.347  1.00 10.77 ? 220  VAL B C   1 
ATOM   1513 O O   . VAL B 1 20  ? 9.347   -0.911  12.813  1.00 10.60 ? 220  VAL B O   1 
ATOM   1514 C CB  . VAL B 1 20  ? 11.277  1.560   11.953  1.00 12.14 ? 220  VAL B CB  1 
ATOM   1515 C CG1 . VAL B 1 20  ? 11.011  0.646   10.767  1.00 14.31 ? 220  VAL B CG1 1 
ATOM   1516 C CG2 . VAL B 1 20  ? 11.170  3.022   11.521  1.00 12.71 ? 220  VAL B CG2 1 
ATOM   1517 N N   . ILE B 1 21  ? 11.126  -0.744  14.161  1.00 8.75  ? 221  ILE B N   1 
ATOM   1518 C CA  . ILE B 1 21  ? 11.116  -2.178  14.422  1.00 9.19  ? 221  ILE B CA  1 
ATOM   1519 C C   . ILE B 1 21  ? 9.801   -2.642  15.063  1.00 8.73  ? 221  ILE B C   1 
ATOM   1520 O O   . ILE B 1 21  ? 9.207   -3.617  14.607  1.00 9.84  ? 221  ILE B O   1 
ATOM   1521 C CB  . ILE B 1 21  ? 12.332  -2.610  15.281  1.00 10.19 ? 221  ILE B CB  1 
ATOM   1522 C CG1 . ILE B 1 21  ? 13.621  -2.430  14.466  1.00 9.45  ? 221  ILE B CG1 1 
ATOM   1523 C CG2 . ILE B 1 21  ? 12.188  -4.074  15.696  1.00 10.17 ? 221  ILE B CG2 1 
ATOM   1524 C CD1 . ILE B 1 21  ? 14.906  -2.731  15.232  1.00 12.10 ? 221  ILE B CD1 1 
ATOM   1525 N N   . PRO B 1 22  ? 9.328   -1.961  16.122  1.00 9.38  ? 222  PRO B N   1 
ATOM   1526 C CA  . PRO B 1 22  ? 8.068   -2.386  16.740  1.00 11.30 ? 222  PRO B CA  1 
ATOM   1527 C C   . PRO B 1 22  ? 6.875   -2.223  15.789  1.00 11.67 ? 222  PRO B C   1 
ATOM   1528 O O   . PRO B 1 22  ? 6.004   -3.087  15.725  1.00 12.29 ? 222  PRO B O   1 
ATOM   1529 C CB  . PRO B 1 22  ? 7.953   -1.479  17.962  1.00 12.09 ? 222  PRO B CB  1 
ATOM   1530 C CG  . PRO B 1 22  ? 9.390   -1.241  18.329  1.00 10.16 ? 222  PRO B CG  1 
ATOM   1531 C CD  . PRO B 1 22  ? 10.023  -0.985  16.984  1.00 8.65  ? 222  PRO B CD  1 
ATOM   1532 N N   . VAL B 1 23  ? 6.838   -1.112  15.059  1.00 12.43 ? 223  VAL B N   1 
ATOM   1533 C CA  . VAL B 1 23  ? 5.745   -0.860  14.116  1.00 12.29 ? 223  VAL B CA  1 
ATOM   1534 C C   . VAL B 1 23  ? 5.679   -1.959  13.059  1.00 12.18 ? 223  VAL B C   1 
ATOM   1535 O O   . VAL B 1 23  ? 4.619   -2.541  12.808  1.00 13.03 ? 223  VAL B O   1 
ATOM   1536 C CB  . VAL B 1 23  ? 5.914   0.507   13.399  1.00 12.69 ? 223  VAL B CB  1 
ATOM   1537 C CG1 . VAL B 1 23  ? 4.933   0.615   12.235  1.00 11.80 ? 223  VAL B CG1 1 
ATOM   1538 C CG2 . VAL B 1 23  ? 5.675   1.641   14.377  1.00 12.98 ? 223  VAL B CG2 1 
ATOM   1539 N N   . ASP B 1 24  ? 6.825   -2.236  12.447  1.00 11.48 ? 224  ASP B N   1 
ATOM   1540 C CA  . ASP B 1 24  ? 6.943   -3.246  11.404  1.00 11.45 ? 224  ASP B CA  1 
ATOM   1541 C C   . ASP B 1 24  ? 6.565   -4.631  11.932  1.00 11.96 ? 224  ASP B C   1 
ATOM   1542 O O   . ASP B 1 24  ? 5.716   -5.317  11.360  1.00 11.36 ? 224  ASP B O   1 
ATOM   1543 C CB  . ASP B 1 24  ? 8.385   -3.258  10.888  1.00 10.96 ? 224  ASP B CB  1 
ATOM   1544 C CG  . ASP B 1 24  ? 8.564   -4.085  9.634   1.00 12.34 ? 224  ASP B CG  1 
ATOM   1545 O OD1 . ASP B 1 24  ? 8.027   -5.209  9.558   1.00 12.57 ? 224  ASP B OD1 1 
ATOM   1546 O OD2 . ASP B 1 24  ? 9.272   -3.608  8.724   1.00 10.53 ? 224  ASP B OD2 1 
ATOM   1547 N N   . VAL B 1 25  ? 7.193   -5.040  13.030  1.00 11.42 ? 225  VAL B N   1 
ATOM   1548 C CA  . VAL B 1 25  ? 6.915   -6.351  13.604  1.00 11.87 ? 225  VAL B CA  1 
ATOM   1549 C C   . VAL B 1 25  ? 5.461   -6.502  14.052  1.00 11.45 ? 225  VAL B C   1 
ATOM   1550 O O   . VAL B 1 25  ? 4.867   -7.560  13.858  1.00 12.85 ? 225  VAL B O   1 
ATOM   1551 C CB  . VAL B 1 25  ? 7.870   -6.659  14.787  1.00 12.18 ? 225  VAL B CB  1 
ATOM   1552 C CG1 . VAL B 1 25  ? 7.476   -7.966  15.468  1.00 13.08 ? 225  VAL B CG1 1 
ATOM   1553 C CG2 . VAL B 1 25  ? 9.296   -6.762  14.271  1.00 11.64 ? 225  VAL B CG2 1 
ATOM   1554 N N   . MET B 1 26  ? 4.883   -5.457  14.640  1.00 12.05 ? 226  MET B N   1 
ATOM   1555 C CA  . MET B 1 26  ? 3.490   -5.542  15.069  1.00 12.92 ? 226  MET B CA  1 
ATOM   1556 C C   . MET B 1 26  ? 2.588   -5.680  13.845  1.00 15.27 ? 226  MET B C   1 
ATOM   1557 O O   . MET B 1 26  ? 1.652   -6.486  13.844  1.00 15.98 ? 226  MET B O   1 
ATOM   1558 C CB  . MET B 1 26  ? 3.082   -4.311  15.890  1.00 13.31 ? 226  MET B CB  1 
ATOM   1559 C CG  . MET B 1 26  ? 3.643   -4.302  17.312  1.00 12.74 ? 226  MET B CG  1 
ATOM   1560 S SD  . MET B 1 26  ? 2.958   -2.986  18.345  1.00 14.05 ? 226  MET B SD  1 
ATOM   1561 C CE  . MET B 1 26  ? 3.729   -1.568  17.607  1.00 11.23 ? 226  MET B CE  1 
ATOM   1562 N N   . ARG B 1 27  ? 2.877   -4.911  12.798  1.00 13.86 ? 227  ARG B N   1 
ATOM   1563 C CA  . ARG B 1 27  ? 2.072   -4.985  11.584  1.00 14.51 ? 227  ARG B CA  1 
ATOM   1564 C C   . ARG B 1 27  ? 2.174   -6.358  10.924  1.00 15.16 ? 227  ARG B C   1 
ATOM   1565 O O   . ARG B 1 27  ? 1.213   -6.822  10.311  1.00 16.15 ? 227  ARG B O   1 
ATOM   1566 C CB  . ARG B 1 27  ? 2.454   -3.867  10.603  1.00 14.73 ? 227  ARG B CB  1 
ATOM   1567 C CG  . ARG B 1 27  ? 1.764   -2.546  10.935  1.00 14.54 ? 227  ARG B CG  1 
ATOM   1568 C CD  . ARG B 1 27  ? 2.172   -1.379  10.046  1.00 15.16 ? 227  ARG B CD  1 
ATOM   1569 N NE  . ARG B 1 27  ? 1.441   -0.177  10.442  1.00 14.19 ? 227  ARG B NE  1 
ATOM   1570 C CZ  . ARG B 1 27  ? 1.803   1.070   10.150  1.00 13.78 ? 227  ARG B CZ  1 
ATOM   1571 N NH1 . ARG B 1 27  ? 2.900   1.308   9.446   1.00 13.22 ? 227  ARG B NH1 1 
ATOM   1572 N NH2 . ARG B 1 27  ? 1.065   2.082   10.580  1.00 15.35 ? 227  ARG B NH2 1 
ATOM   1573 N N   . ARG B 1 28  ? 3.326   -7.013  11.061  1.00 14.10 ? 228  ARG B N   1 
ATOM   1574 C CA  . ARG B 1 28  ? 3.513   -8.352  10.499  1.00 13.71 ? 228  ARG B CA  1 
ATOM   1575 C C   . ARG B 1 28  ? 2.652   -9.346  11.275  1.00 17.26 ? 228  ARG B C   1 
ATOM   1576 O O   . ARG B 1 28  ? 2.291   -10.410 10.762  1.00 18.14 ? 228  ARG B O   1 
ATOM   1577 C CB  . ARG B 1 28  ? 4.978   -8.791  10.601  1.00 13.63 ? 228  ARG B CB  1 
ATOM   1578 C CG  . ARG B 1 28  ? 5.918   -8.136  9.606   1.00 12.07 ? 228  ARG B CG  1 
ATOM   1579 C CD  . ARG B 1 28  ? 7.366   -8.503  9.920   1.00 14.13 ? 228  ARG B CD  1 
ATOM   1580 N NE  . ARG B 1 28  ? 8.307   -7.922  8.966   1.00 13.74 ? 228  ARG B NE  1 
ATOM   1581 C CZ  . ARG B 1 28  ? 9.089   -8.628  8.155   1.00 15.97 ? 228  ARG B CZ  1 
ATOM   1582 N NH1 . ARG B 1 28  ? 9.044   -9.955  8.171   1.00 14.12 ? 228  ARG B NH1 1 
ATOM   1583 N NH2 . ARG B 1 28  ? 9.925   -8.004  7.333   1.00 13.92 ? 228  ARG B NH2 1 
ATOM   1584 N N   . ALA B 1 29  ? 2.333   -8.991  12.515  1.00 17.21 ? 229  ALA B N   1 
ATOM   1585 C CA  . ALA B 1 29  ? 1.528   -9.843  13.383  1.00 18.39 ? 229  ALA B CA  1 
ATOM   1586 C C   . ALA B 1 29  ? 0.033   -9.628  13.176  1.00 19.12 ? 229  ALA B C   1 
ATOM   1587 O O   . ALA B 1 29  ? -0.785  -10.326 13.774  1.00 21.27 ? 229  ALA B O   1 
ATOM   1588 C CB  . ALA B 1 29  ? 1.894   -9.592  14.841  1.00 18.51 ? 229  ALA B CB  1 
ATOM   1589 N N   . GLY B 1 30  ? -0.320  -8.661  12.334  1.00 19.41 ? 230  GLY B N   1 
ATOM   1590 C CA  . GLY B 1 30  ? -1.725  -8.389  12.069  1.00 18.93 ? 230  GLY B CA  1 
ATOM   1591 C C   . GLY B 1 30  ? -2.322  -7.308  12.950  1.00 19.58 ? 230  GLY B C   1 
ATOM   1592 O O   . GLY B 1 30  ? -3.535  -7.083  12.939  1.00 18.54 ? 230  GLY B O   1 
ATOM   1593 N N   . ILE B 1 31  ? -1.469  -6.634  13.713  1.00 17.65 ? 231  ILE B N   1 
ATOM   1594 C CA  . ILE B 1 31  ? -1.905  -5.569  14.606  1.00 17.72 ? 231  ILE B CA  1 
ATOM   1595 C C   . ILE B 1 31  ? -2.076  -4.274  13.814  1.00 17.59 ? 231  ILE B C   1 
ATOM   1596 O O   . ILE B 1 31  ? -1.270  -3.970  12.934  1.00 16.67 ? 231  ILE B O   1 
ATOM   1597 C CB  . ILE B 1 31  ? -0.859  -5.337  15.730  1.00 16.31 ? 231  ILE B CB  1 
ATOM   1598 C CG1 . ILE B 1 31  ? -0.714  -6.606  16.576  1.00 16.66 ? 231  ILE B CG1 1 
ATOM   1599 C CG2 . ILE B 1 31  ? -1.264  -4.148  16.590  1.00 16.96 ? 231  ILE B CG2 1 
ATOM   1600 C CD1 . ILE B 1 31  ? 0.449   -6.566  17.566  1.00 16.50 ? 231  ILE B CD1 1 
ATOM   1601 N N   . LYS B 1 32  ? -3.136  -3.523  14.107  1.00 17.77 ? 232  LYS B N   1 
ATOM   1602 C CA  . LYS B 1 32  ? -3.362  -2.253  13.424  1.00 18.85 ? 232  LYS B CA  1 
ATOM   1603 C C   . LYS B 1 32  ? -2.614  -1.160  14.166  1.00 17.99 ? 232  LYS B C   1 
ATOM   1604 O O   . LYS B 1 32  ? -3.022  -0.726  15.244  1.00 17.77 ? 232  LYS B O   1 
ATOM   1605 C CB  . LYS B 1 32  ? -4.849  -1.907  13.373  1.00 21.23 ? 232  LYS B CB  1 
ATOM   1606 C CG  . LYS B 1 32  ? -5.631  -2.675  12.329  1.00 26.38 ? 232  LYS B CG  1 
ATOM   1607 C CD  . LYS B 1 32  ? -6.977  -2.012  12.067  1.00 29.93 ? 232  LYS B CD  1 
ATOM   1608 C CE  . LYS B 1 32  ? -6.802  -0.589  11.545  1.00 32.69 ? 232  LYS B CE  1 
ATOM   1609 N NZ  . LYS B 1 32  ? -8.103  0.068   11.232  1.00 35.02 ? 232  LYS B NZ  1 
ATOM   1610 N N   . VAL B 1 33  ? -1.515  -0.711  13.573  1.00 16.20 ? 233  VAL B N   1 
ATOM   1611 C CA  . VAL B 1 33  ? -0.684  0.307   14.183  1.00 16.80 ? 233  VAL B CA  1 
ATOM   1612 C C   . VAL B 1 33  ? -0.924  1.712   13.654  1.00 18.25 ? 233  VAL B C   1 
ATOM   1613 O O   . VAL B 1 33  ? -1.028  1.932   12.446  1.00 17.57 ? 233  VAL B O   1 
ATOM   1614 C CB  . VAL B 1 33  ? 0.805   -0.031  13.988  1.00 15.51 ? 233  VAL B CB  1 
ATOM   1615 C CG1 . VAL B 1 33  ? 1.673   0.981   14.726  1.00 16.09 ? 233  VAL B CG1 1 
ATOM   1616 C CG2 . VAL B 1 33  ? 1.080   -1.453  14.468  1.00 13.94 ? 233  VAL B CG2 1 
ATOM   1617 N N   . THR B 1 34  ? -1.008  2.662   14.576  1.00 19.24 ? 234  THR B N   1 
ATOM   1618 C CA  . THR B 1 34  ? -1.194  4.055   14.220  1.00 20.40 ? 234  THR B CA  1 
ATOM   1619 C C   . THR B 1 34  ? 0.023   4.822   14.715  1.00 20.45 ? 234  THR B C   1 
ATOM   1620 O O   . THR B 1 34  ? 0.250   4.931   15.921  1.00 21.37 ? 234  THR B O   1 
ATOM   1621 C CB  . THR B 1 34  ? -2.451  4.653   14.879  1.00 20.35 ? 234  THR B CB  1 
ATOM   1622 O OG1 . THR B 1 34  ? -3.600  3.889   14.498  1.00 21.27 ? 234  THR B OG1 1 
ATOM   1623 C CG2 . THR B 1 34  ? -2.641  6.096   14.443  1.00 20.88 ? 234  THR B CG2 1 
ATOM   1624 N N   . VAL B 1 35  ? 0.825   5.324   13.784  1.00 18.80 ? 235  VAL B N   1 
ATOM   1625 C CA  . VAL B 1 35  ? 1.997   6.098   14.155  1.00 18.20 ? 235  VAL B CA  1 
ATOM   1626 C C   . VAL B 1 35  ? 1.516   7.531   14.334  1.00 18.27 ? 235  VAL B C   1 
ATOM   1627 O O   . VAL B 1 35  ? 1.278   8.247   13.359  1.00 18.77 ? 235  VAL B O   1 
ATOM   1628 C CB  . VAL B 1 35  ? 3.082   6.036   13.063  1.00 17.32 ? 235  VAL B CB  1 
ATOM   1629 C CG1 . VAL B 1 35  ? 4.246   6.936   13.438  1.00 17.85 ? 235  VAL B CG1 1 
ATOM   1630 C CG2 . VAL B 1 35  ? 3.559   4.600   12.894  1.00 17.75 ? 235  VAL B CG2 1 
ATOM   1631 N N   . ALA B 1 36  ? 1.360   7.938   15.589  1.00 17.99 ? 236  ALA B N   1 
ATOM   1632 C CA  . ALA B 1 36  ? 0.874   9.275   15.908  1.00 17.81 ? 236  ALA B CA  1 
ATOM   1633 C C   . ALA B 1 36  ? 1.988   10.264  16.220  1.00 18.04 ? 236  ALA B C   1 
ATOM   1634 O O   . ALA B 1 36  ? 2.802   10.040  17.120  1.00 19.35 ? 236  ALA B O   1 
ATOM   1635 C CB  . ALA B 1 36  ? -0.103  9.200   17.079  1.00 18.24 ? 236  ALA B CB  1 
ATOM   1636 N N   . GLY B 1 37  ? 2.013   11.361  15.471  1.00 16.76 ? 237  GLY B N   1 
ATOM   1637 C CA  . GLY B 1 37  ? 3.021   12.381  15.683  1.00 18.12 ? 237  GLY B CA  1 
ATOM   1638 C C   . GLY B 1 37  ? 2.649   13.251  16.867  1.00 21.89 ? 237  GLY B C   1 
ATOM   1639 O O   . GLY B 1 37  ? 1.569   13.847  16.899  1.00 21.73 ? 237  GLY B O   1 
ATOM   1640 N N   . LEU B 1 38  ? 3.545   13.326  17.844  1.00 21.35 ? 238  LEU B N   1 
ATOM   1641 C CA  . LEU B 1 38  ? 3.301   14.119  19.039  1.00 23.28 ? 238  LEU B CA  1 
ATOM   1642 C C   . LEU B 1 38  ? 2.921   15.554  18.690  1.00 25.14 ? 238  LEU B C   1 
ATOM   1643 O O   . LEU B 1 38  ? 1.848   16.027  19.068  1.00 25.29 ? 238  LEU B O   1 
ATOM   1644 C CB  . LEU B 1 38  ? 4.544   14.126  19.931  1.00 21.18 ? 238  LEU B CB  1 
ATOM   1645 C CG  . LEU B 1 38  ? 4.406   14.847  21.274  1.00 20.74 ? 238  LEU B CG  1 
ATOM   1646 C CD1 . LEU B 1 38  ? 3.334   14.166  22.112  1.00 21.64 ? 238  LEU B CD1 1 
ATOM   1647 C CD2 . LEU B 1 38  ? 5.741   14.833  21.996  1.00 20.11 ? 238  LEU B CD2 1 
ATOM   1648 N N   . ALA B 1 39  ? 3.804   16.230  17.962  1.00 26.73 ? 239  ALA B N   1 
ATOM   1649 C CA  . ALA B 1 39  ? 3.593   17.620  17.568  1.00 29.01 ? 239  ALA B CA  1 
ATOM   1650 C C   . ALA B 1 39  ? 2.492   17.824  16.526  1.00 30.25 ? 239  ALA B C   1 
ATOM   1651 O O   . ALA B 1 39  ? 1.983   18.935  16.370  1.00 31.50 ? 239  ALA B O   1 
ATOM   1652 C CB  . ALA B 1 39  ? 4.904   18.214  17.059  1.00 29.01 ? 239  ALA B CB  1 
ATOM   1653 N N   . GLY B 1 40  ? 2.126   16.765  15.815  1.00 30.98 ? 240  GLY B N   1 
ATOM   1654 C CA  . GLY B 1 40  ? 1.087   16.898  14.808  1.00 31.73 ? 240  GLY B CA  1 
ATOM   1655 C C   . GLY B 1 40  ? 1.197   15.924  13.650  1.00 32.10 ? 240  GLY B C   1 
ATOM   1656 O O   . GLY B 1 40  ? 1.666   14.799  13.816  1.00 32.35 ? 240  GLY B O   1 
ATOM   1657 N N   . LYS B 1 41  ? 0.771   16.368  12.470  1.00 32.73 ? 241  LYS B N   1 
ATOM   1658 C CA  . LYS B 1 41  ? 0.792   15.539  11.266  1.00 32.62 ? 241  LYS B CA  1 
ATOM   1659 C C   . LYS B 1 41  ? 2.077   15.668  10.447  1.00 31.24 ? 241  LYS B C   1 
ATOM   1660 O O   . LYS B 1 41  ? 2.338   14.848  9.567   1.00 30.89 ? 241  LYS B O   1 
ATOM   1661 C CB  . LYS B 1 41  ? -0.403  15.895  10.376  1.00 34.82 ? 241  LYS B CB  1 
ATOM   1662 C CG  . LYS B 1 41  ? -1.748  15.862  11.086  1.00 36.91 ? 241  LYS B CG  1 
ATOM   1663 C CD  . LYS B 1 41  ? -2.864  16.364  10.177  1.00 38.69 ? 241  LYS B CD  1 
ATOM   1664 C CE  . LYS B 1 41  ? -4.204  16.376  10.897  1.00 39.93 ? 241  LYS B CE  1 
ATOM   1665 N NZ  . LYS B 1 41  ? -5.313  16.847  10.017  1.00 40.60 ? 241  LYS B NZ  1 
ATOM   1666 N N   . ASP B 1 42  ? 2.871   16.696  10.731  1.00 30.32 ? 242  ASP B N   1 
ATOM   1667 C CA  . ASP B 1 42  ? 4.118   16.932  10.006  1.00 29.19 ? 242  ASP B CA  1 
ATOM   1668 C C   . ASP B 1 42  ? 5.157   15.829  10.204  1.00 27.22 ? 242  ASP B C   1 
ATOM   1669 O O   . ASP B 1 42  ? 5.191   15.169  11.244  1.00 26.29 ? 242  ASP B O   1 
ATOM   1670 C CB  . ASP B 1 42  ? 4.724   18.273  10.430  1.00 32.12 ? 242  ASP B CB  1 
ATOM   1671 C CG  . ASP B 1 42  ? 3.919   19.462  9.938   1.00 34.13 ? 242  ASP B CG  1 
ATOM   1672 O OD1 . ASP B 1 42  ? 2.674   19.419  10.028  1.00 35.95 ? 242  ASP B OD1 1 
ATOM   1673 O OD2 . ASP B 1 42  ? 4.535   20.444  9.472   1.00 36.11 ? 242  ASP B OD2 1 
ATOM   1674 N N   . PRO B 1 43  ? 6.020   15.615  9.196   1.00 25.41 ? 243  PRO B N   1 
ATOM   1675 C CA  . PRO B 1 43  ? 7.064   14.588  9.274   1.00 22.97 ? 243  PRO B CA  1 
ATOM   1676 C C   . PRO B 1 43  ? 7.938   14.818  10.501  1.00 20.92 ? 243  PRO B C   1 
ATOM   1677 O O   . PRO B 1 43  ? 8.227   15.959  10.864  1.00 20.87 ? 243  PRO B O   1 
ATOM   1678 C CB  . PRO B 1 43  ? 7.834   14.782  7.972   1.00 22.26 ? 243  PRO B CB  1 
ATOM   1679 C CG  . PRO B 1 43  ? 6.773   15.257  7.030   1.00 24.40 ? 243  PRO B CG  1 
ATOM   1680 C CD  . PRO B 1 43  ? 6.024   16.264  7.873   1.00 24.24 ? 243  PRO B CD  1 
ATOM   1681 N N   . VAL B 1 44  ? 8.369   13.731  11.128  1.00 18.79 ? 244  VAL B N   1 
ATOM   1682 C CA  . VAL B 1 44  ? 9.187   13.824  12.327  1.00 16.80 ? 244  VAL B CA  1 
ATOM   1683 C C   . VAL B 1 44  ? 10.635  13.408  12.106  1.00 15.96 ? 244  VAL B C   1 
ATOM   1684 O O   . VAL B 1 44  ? 10.912  12.302  11.635  1.00 15.08 ? 244  VAL B O   1 
ATOM   1685 C CB  . VAL B 1 44  ? 8.602   12.948  13.453  1.00 16.85 ? 244  VAL B CB  1 
ATOM   1686 C CG1 . VAL B 1 44  ? 9.409   13.128  14.727  1.00 16.26 ? 244  VAL B CG1 1 
ATOM   1687 C CG2 . VAL B 1 44  ? 7.141   13.303  13.681  1.00 17.24 ? 244  VAL B CG2 1 
ATOM   1688 N N   . GLN B 1 45  ? 11.555  14.304  12.449  1.00 15.62 ? 245  GLN B N   1 
ATOM   1689 C CA  . GLN B 1 45  ? 12.976  14.020  12.321  1.00 13.90 ? 245  GLN B CA  1 
ATOM   1690 C C   . GLN B 1 45  ? 13.402  13.269  13.575  1.00 14.16 ? 245  GLN B C   1 
ATOM   1691 O O   . GLN B 1 45  ? 13.256  13.772  14.690  1.00 11.60 ? 245  GLN B O   1 
ATOM   1692 C CB  . GLN B 1 45  ? 13.784  15.308  12.203  1.00 15.81 ? 245  GLN B CB  1 
ATOM   1693 C CG  . GLN B 1 45  ? 15.263  15.059  11.993  1.00 16.30 ? 245  GLN B CG  1 
ATOM   1694 C CD  . GLN B 1 45  ? 16.072  16.331  12.023  1.00 17.49 ? 245  GLN B CD  1 
ATOM   1695 O OE1 . GLN B 1 45  ? 16.131  17.015  13.045  1.00 20.39 ? 245  GLN B OE1 1 
ATOM   1696 N NE2 . GLN B 1 45  ? 16.701  16.661  10.901  1.00 17.46 ? 245  GLN B NE2 1 
ATOM   1697 N N   . CYS B 1 46  ? 13.937  12.068  13.385  1.00 13.28 ? 246  CYS B N   1 
ATOM   1698 C CA  . CYS B 1 46  ? 14.359  11.236  14.503  1.00 13.33 ? 246  CYS B CA  1 
ATOM   1699 C C   . CYS B 1 46  ? 15.788  11.489  14.983  1.00 12.62 ? 246  CYS B C   1 
ATOM   1700 O O   . CYS B 1 46  ? 16.507  12.324  14.423  1.00 12.55 ? 246  CYS B O   1 
ATOM   1701 C CB  . CYS B 1 46  ? 14.147  9.761   14.139  1.00 11.94 ? 246  CYS B CB  1 
ATOM   1702 S SG  . CYS B 1 46  ? 12.393  9.346   13.880  1.00 13.23 ? 246  CYS B SG  1 
ATOM   1703 N N   . SER B 1 47  ? 16.189  10.766  16.028  1.00 12.40 ? 247  SER B N   1 
ATOM   1704 C CA  . SER B 1 47  ? 17.508  10.917  16.639  1.00 10.94 ? 247  SER B CA  1 
ATOM   1705 C C   . SER B 1 47  ? 18.687  10.932  15.673  1.00 11.52 ? 247  SER B C   1 
ATOM   1706 O O   . SER B 1 47  ? 19.634  11.694  15.863  1.00 10.60 ? 247  SER B O   1 
ATOM   1707 C CB  . SER B 1 47  ? 17.729  9.834   17.704  1.00 12.44 ? 247  SER B CB  1 
ATOM   1708 O OG  . SER B 1 47  ? 17.855  8.546   17.127  1.00 15.32 ? 247  SER B OG  1 
ATOM   1709 N N   . ARG B 1 48  ? 18.641  10.083  14.650  1.00 10.57 ? 248  ARG B N   1 
ATOM   1710 C CA  . ARG B 1 48  ? 19.712  10.036  13.665  1.00 10.07 ? 248  ARG B CA  1 
ATOM   1711 C C   . ARG B 1 48  ? 19.245  10.556  12.312  1.00 12.04 ? 248  ARG B C   1 
ATOM   1712 O O   . ARG B 1 48  ? 19.589  10.020  11.260  1.00 10.59 ? 248  ARG B O   1 
ATOM   1713 C CB  . ARG B 1 48  ? 20.274  8.615   13.541  1.00 11.41 ? 248  ARG B CB  1 
ATOM   1714 C CG  . ARG B 1 48  ? 21.353  8.312   14.572  1.00 12.06 ? 248  ARG B CG  1 
ATOM   1715 C CD  . ARG B 1 48  ? 20.798  8.297   15.990  1.00 11.34 ? 248  ARG B CD  1 
ATOM   1716 N NE  . ARG B 1 48  ? 21.865  8.176   16.981  1.00 13.66 ? 248  ARG B NE  1 
ATOM   1717 C CZ  . ARG B 1 48  ? 21.661  7.984   18.280  1.00 12.47 ? 248  ARG B CZ  1 
ATOM   1718 N NH1 . ARG B 1 48  ? 20.428  7.877   18.752  1.00 12.33 ? 248  ARG B NH1 1 
ATOM   1719 N NH2 . ARG B 1 48  ? 22.693  7.915   19.112  1.00 13.50 ? 248  ARG B NH2 1 
ATOM   1720 N N   . ASP B 1 49  ? 18.434  11.609  12.378  1.00 12.86 ? 249  ASP B N   1 
ATOM   1721 C CA  . ASP B 1 49  ? 17.896  12.315  11.222  1.00 13.57 ? 249  ASP B CA  1 
ATOM   1722 C C   . ASP B 1 49  ? 16.993  11.601  10.220  1.00 13.77 ? 249  ASP B C   1 
ATOM   1723 O O   . ASP B 1 49  ? 16.650  12.177  9.185   1.00 14.10 ? 249  ASP B O   1 
ATOM   1724 C CB  . ASP B 1 49  ? 19.042  13.018  10.488  1.00 14.08 ? 249  ASP B CB  1 
ATOM   1725 C CG  . ASP B 1 49  ? 19.737  14.049  11.365  1.00 15.75 ? 249  ASP B CG  1 
ATOM   1726 O OD1 . ASP B 1 49  ? 19.075  14.576  12.286  1.00 15.34 ? 249  ASP B OD1 1 
ATOM   1727 O OD2 . ASP B 1 49  ? 20.930  14.340  11.136  1.00 18.24 ? 249  ASP B OD2 1 
ATOM   1728 N N   . VAL B 1 50  ? 16.606  10.360  10.503  1.00 12.10 ? 250  VAL B N   1 
ATOM   1729 C CA  . VAL B 1 50  ? 15.692  9.661   9.606   1.00 11.65 ? 250  VAL B CA  1 
ATOM   1730 C C   . VAL B 1 50  ? 14.349  10.365  9.792   1.00 12.07 ? 250  VAL B C   1 
ATOM   1731 O O   . VAL B 1 50  ? 13.922  10.609  10.922  1.00 12.90 ? 250  VAL B O   1 
ATOM   1732 C CB  . VAL B 1 50  ? 15.535  8.164   9.977   1.00 10.57 ? 250  VAL B CB  1 
ATOM   1733 C CG1 . VAL B 1 50  ? 14.362  7.557   9.208   1.00 10.42 ? 250  VAL B CG1 1 
ATOM   1734 C CG2 . VAL B 1 50  ? 16.820  7.411   9.655   1.00 10.95 ? 250  VAL B CG2 1 
ATOM   1735 N N   . VAL B 1 51  ? 13.692  10.709  8.691   1.00 12.77 ? 251  VAL B N   1 
ATOM   1736 C CA  . VAL B 1 51  ? 12.409  11.399  8.775   1.00 13.32 ? 251  VAL B CA  1 
ATOM   1737 C C   . VAL B 1 51  ? 11.241  10.464  8.485   1.00 13.05 ? 251  VAL B C   1 
ATOM   1738 O O   . VAL B 1 51  ? 11.153  9.862   7.413   1.00 13.19 ? 251  VAL B O   1 
ATOM   1739 C CB  . VAL B 1 51  ? 12.369  12.606  7.811   1.00 13.39 ? 251  VAL B CB  1 
ATOM   1740 C CG1 . VAL B 1 51  ? 11.026  13.314  7.914   1.00 14.45 ? 251  VAL B CG1 1 
ATOM   1741 C CG2 . VAL B 1 51  ? 13.497  13.568  8.149   1.00 15.73 ? 251  VAL B CG2 1 
ATOM   1742 N N   . ILE B 1 52  ? 10.342  10.344  9.456   1.00 13.02 ? 252  ILE B N   1 
ATOM   1743 C CA  . ILE B 1 52  ? 9.186   9.469   9.324   1.00 13.27 ? 252  ILE B CA  1 
ATOM   1744 C C   . ILE B 1 52  ? 7.876   10.246  9.315   1.00 15.57 ? 252  ILE B C   1 
ATOM   1745 O O   . ILE B 1 52  ? 7.657   11.117  10.156  1.00 13.95 ? 252  ILE B O   1 
ATOM   1746 C CB  . ILE B 1 52  ? 9.127   8.457   10.484  1.00 13.03 ? 252  ILE B CB  1 
ATOM   1747 C CG1 . ILE B 1 52  ? 10.402  7.611   10.504  1.00 14.03 ? 252  ILE B CG1 1 
ATOM   1748 C CG2 . ILE B 1 52  ? 7.896   7.570   10.339  1.00 13.57 ? 252  ILE B CG2 1 
ATOM   1749 C CD1 . ILE B 1 52  ? 10.470  6.635   11.665  1.00 10.95 ? 252  ILE B CD1 1 
ATOM   1750 N N   . CYS B 1 53  ? 7.007   9.916   8.366   1.00 17.62 ? 253  CYS B N   1 
ATOM   1751 C CA  . CYS B 1 53  ? 5.710   10.571  8.255   1.00 19.49 ? 253  CYS B CA  1 
ATOM   1752 C C   . CYS B 1 53  ? 4.687   9.807   9.080   1.00 19.25 ? 253  CYS B C   1 
ATOM   1753 O O   . CYS B 1 53  ? 4.380   8.654   8.784   1.00 20.51 ? 253  CYS B O   1 
ATOM   1754 C CB  . CYS B 1 53  ? 5.257   10.609  6.797   1.00 20.71 ? 253  CYS B CB  1 
ATOM   1755 S SG  . CYS B 1 53  ? 6.359   11.520  5.722   1.00 26.31 ? 253  CYS B SG  1 
ATOM   1756 N N   . PRO B 1 54  ? 4.145   10.442  10.130  1.00 20.08 ? 254  PRO B N   1 
ATOM   1757 C CA  . PRO B 1 54  ? 3.151   9.785   10.983  1.00 21.76 ? 254  PRO B CA  1 
ATOM   1758 C C   . PRO B 1 54  ? 1.821   9.576   10.270  1.00 22.44 ? 254  PRO B C   1 
ATOM   1759 O O   . PRO B 1 54  ? 1.438   10.371  9.410   1.00 23.24 ? 254  PRO B O   1 
ATOM   1760 C CB  . PRO B 1 54  ? 3.033   10.741  12.165  1.00 21.85 ? 254  PRO B CB  1 
ATOM   1761 C CG  . PRO B 1 54  ? 3.249   12.078  11.525  1.00 23.28 ? 254  PRO B CG  1 
ATOM   1762 C CD  . PRO B 1 54  ? 4.419   11.812  10.598  1.00 20.98 ? 254  PRO B CD  1 
ATOM   1763 N N   . ASP B 1 55  ? 1.124   8.503   10.628  1.00 21.74 ? 255  ASP B N   1 
ATOM   1764 C CA  . ASP B 1 55  ? -0.167  8.199   10.023  1.00 24.07 ? 255  ASP B CA  1 
ATOM   1765 C C   . ASP B 1 55  ? -1.183  9.266   10.411  1.00 24.77 ? 255  ASP B C   1 
ATOM   1766 O O   . ASP B 1 55  ? -2.084  9.597   9.636   1.00 25.56 ? 255  ASP B O   1 
ATOM   1767 C CB  . ASP B 1 55  ? -0.669  6.832   10.489  1.00 23.52 ? 255  ASP B CB  1 
ATOM   1768 C CG  . ASP B 1 55  ? 0.310   5.719   10.188  1.00 23.37 ? 255  ASP B CG  1 
ATOM   1769 O OD1 . ASP B 1 55  ? 0.860   5.697   9.068   1.00 21.86 ? 255  ASP B OD1 1 
ATOM   1770 O OD2 . ASP B 1 55  ? 0.520   4.861   11.068  1.00 23.41 ? 255  ASP B OD2 1 
ATOM   1771 N N   . ALA B 1 56  ? -1.029  9.802   11.615  1.00 24.70 ? 256  ALA B N   1 
ATOM   1772 C CA  . ALA B 1 56  ? -1.933  10.826  12.112  1.00 24.88 ? 256  ALA B CA  1 
ATOM   1773 C C   . ALA B 1 56  ? -1.285  11.601  13.246  1.00 26.07 ? 256  ALA B C   1 
ATOM   1774 O O   . ALA B 1 56  ? -0.228  11.221  13.750  1.00 25.04 ? 256  ALA B O   1 
ATOM   1775 C CB  . ALA B 1 56  ? -3.221  10.182  12.600  1.00 25.49 ? 256  ALA B CB  1 
ATOM   1776 N N   . SER B 1 57  ? -1.917  12.701  13.634  1.00 25.58 ? 257  SER B N   1 
ATOM   1777 C CA  . SER B 1 57  ? -1.412  13.501  14.736  1.00 25.13 ? 257  SER B CA  1 
ATOM   1778 C C   . SER B 1 57  ? -1.905  12.790  15.987  1.00 24.70 ? 257  SER B C   1 
ATOM   1779 O O   . SER B 1 57  ? -2.883  12.044  15.932  1.00 24.39 ? 257  SER B O   1 
ATOM   1780 C CB  . SER B 1 57  ? -1.989  14.916  14.678  1.00 26.10 ? 257  SER B CB  1 
ATOM   1781 O OG  . SER B 1 57  ? -3.403  14.883  14.749  1.00 26.13 ? 257  SER B OG  1 
ATOM   1782 N N   . LEU B 1 58  ? -1.226  12.999  17.109  1.00 25.55 ? 258  LEU B N   1 
ATOM   1783 C CA  . LEU B 1 58  ? -1.644  12.363  18.348  1.00 26.53 ? 258  LEU B CA  1 
ATOM   1784 C C   . LEU B 1 58  ? -3.036  12.894  18.670  1.00 28.32 ? 258  LEU B C   1 
ATOM   1785 O O   . LEU B 1 58  ? -3.911  12.157  19.126  1.00 28.29 ? 258  LEU B O   1 
ATOM   1786 C CB  . LEU B 1 58  ? -0.671  12.707  19.480  1.00 26.11 ? 258  LEU B CB  1 
ATOM   1787 C CG  . LEU B 1 58  ? -0.932  12.030  20.829  1.00 24.92 ? 258  LEU B CG  1 
ATOM   1788 C CD1 . LEU B 1 58  ? -0.926  10.522  20.658  1.00 24.31 ? 258  LEU B CD1 1 
ATOM   1789 C CD2 . LEU B 1 58  ? 0.128   12.456  21.832  1.00 25.44 ? 258  LEU B CD2 1 
ATOM   1790 N N   . GLU B 1 59  ? -3.230  14.180  18.399  1.00 30.55 ? 259  GLU B N   1 
ATOM   1791 C CA  . GLU B 1 59  ? -4.499  14.853  18.643  1.00 32.77 ? 259  GLU B CA  1 
ATOM   1792 C C   . GLU B 1 59  ? -5.664  14.101  18.006  1.00 33.49 ? 259  GLU B C   1 
ATOM   1793 O O   . GLU B 1 59  ? -6.711  13.921  18.631  1.00 33.57 ? 259  GLU B O   1 
ATOM   1794 C CB  . GLU B 1 59  ? -4.430  16.281  18.095  1.00 34.77 ? 259  GLU B CB  1 
ATOM   1795 C CG  . GLU B 1 59  ? -5.649  17.136  18.389  1.00 37.98 ? 259  GLU B CG  1 
ATOM   1796 C CD  . GLU B 1 59  ? -5.450  18.577  17.962  1.00 40.20 ? 259  GLU B CD  1 
ATOM   1797 O OE1 . GLU B 1 59  ? -4.502  19.218  18.465  1.00 42.12 ? 259  GLU B OE1 1 
ATOM   1798 O OE2 . GLU B 1 59  ? -6.236  19.068  17.124  1.00 41.85 ? 259  GLU B OE2 1 
ATOM   1799 N N   . ASP B 1 60  ? -5.481  13.660  16.765  1.00 33.58 ? 260  ASP B N   1 
ATOM   1800 C CA  . ASP B 1 60  ? -6.528  12.928  16.061  1.00 33.85 ? 260  ASP B CA  1 
ATOM   1801 C C   . ASP B 1 60  ? -6.539  11.451  16.429  1.00 34.03 ? 260  ASP B C   1 
ATOM   1802 O O   . ASP B 1 60  ? -7.599  10.835  16.524  1.00 33.92 ? 260  ASP B O   1 
ATOM   1803 C CB  . ASP B 1 60  ? -6.360  13.068  14.544  1.00 34.29 ? 260  ASP B CB  1 
ATOM   1804 C CG  . ASP B 1 60  ? -6.599  14.483  14.059  1.00 35.12 ? 260  ASP B CG  1 
ATOM   1805 O OD1 . ASP B 1 60  ? -7.604  15.091  14.484  1.00 35.50 ? 260  ASP B OD1 1 
ATOM   1806 O OD2 . ASP B 1 60  ? -5.793  14.986  13.247  1.00 35.91 ? 260  ASP B OD2 1 
ATOM   1807 N N   . ALA B 1 61  ? -5.354  10.887  16.636  1.00 34.79 ? 261  ALA B N   1 
ATOM   1808 C CA  . ALA B 1 61  ? -5.223  9.476   16.981  1.00 35.72 ? 261  ALA B CA  1 
ATOM   1809 C C   . ALA B 1 61  ? -5.864  9.129   18.321  1.00 36.67 ? 261  ALA B C   1 
ATOM   1810 O O   . ALA B 1 61  ? -6.473  8.069   18.468  1.00 36.94 ? 261  ALA B O   1 
ATOM   1811 C CB  . ALA B 1 61  ? -3.748  9.081   16.991  1.00 36.05 ? 261  ALA B CB  1 
ATOM   1812 N N   . LYS B 1 62  ? -5.721  10.021  19.296  1.00 38.26 ? 262  LYS B N   1 
ATOM   1813 C CA  . LYS B 1 62  ? -6.284  9.801   20.626  1.00 40.43 ? 262  LYS B CA  1 
ATOM   1814 C C   . LYS B 1 62  ? -7.792  9.585   20.573  1.00 41.66 ? 262  LYS B C   1 
ATOM   1815 O O   . LYS B 1 62  ? -8.315  8.607   21.109  1.00 41.40 ? 262  LYS B O   1 
ATOM   1816 C CB  . LYS B 1 62  ? -5.982  10.999  21.531  1.00 40.75 ? 262  LYS B CB  1 
ATOM   1817 C CG  . LYS B 1 62  ? -6.609  10.903  22.916  1.00 41.56 ? 262  LYS B CG  1 
ATOM   1818 C CD  . LYS B 1 62  ? -6.379  12.168  23.736  1.00 42.51 ? 262  LYS B CD  1 
ATOM   1819 C CE  . LYS B 1 62  ? -4.898  12.417  23.989  1.00 43.15 ? 262  LYS B CE  1 
ATOM   1820 N NZ  . LYS B 1 62  ? -4.664  13.586  24.888  1.00 42.32 ? 262  LYS B NZ  1 
ATOM   1821 N N   . LYS B 1 63  ? -8.482  10.512  19.920  1.00 43.51 ? 263  LYS B N   1 
ATOM   1822 C CA  . LYS B 1 63  ? -9.932  10.461  19.795  1.00 44.78 ? 263  LYS B CA  1 
ATOM   1823 C C   . LYS B 1 63  ? -10.406 9.304   18.918  1.00 45.14 ? 263  LYS B C   1 
ATOM   1824 O O   . LYS B 1 63  ? -11.583 9.228   18.570  1.00 46.07 ? 263  LYS B O   1 
ATOM   1825 C CB  . LYS B 1 63  ? -10.435 11.789  19.222  1.00 45.30 ? 263  LYS B CB  1 
ATOM   1826 C CG  . LYS B 1 63  ? -9.926  13.008  19.981  1.00 46.47 ? 263  LYS B CG  1 
ATOM   1827 C CD  . LYS B 1 63  ? -10.213 14.306  19.237  1.00 47.92 ? 263  LYS B CD  1 
ATOM   1828 C CE  . LYS B 1 63  ? -9.599  15.500  19.960  1.00 48.76 ? 263  LYS B CE  1 
ATOM   1829 N NZ  . LYS B 1 63  ? -9.802  16.780  19.224  1.00 48.36 ? 263  LYS B NZ  1 
ATOM   1830 N N   . GLU B 1 64  ? -9.494  8.399   18.571  1.00 44.98 ? 264  GLU B N   1 
ATOM   1831 C CA  . GLU B 1 64  ? -9.841  7.261   17.724  1.00 44.78 ? 264  GLU B CA  1 
ATOM   1832 C C   . GLU B 1 64  ? -9.894  5.930   18.466  1.00 43.64 ? 264  GLU B C   1 
ATOM   1833 O O   . GLU B 1 64  ? -9.034  5.072   18.277  1.00 43.21 ? 264  GLU B O   1 
ATOM   1834 C CB  . GLU B 1 64  ? -8.853  7.153   16.558  1.00 46.09 ? 264  GLU B CB  1 
ATOM   1835 C CG  . GLU B 1 64  ? -8.888  8.332   15.598  1.00 48.13 ? 264  GLU B CG  1 
ATOM   1836 C CD  . GLU B 1 64  ? -10.222 8.471   14.888  1.00 49.52 ? 264  GLU B CD  1 
ATOM   1837 O OE1 . GLU B 1 64  ? -11.254 8.630   15.574  1.00 50.78 ? 264  GLU B OE1 1 
ATOM   1838 O OE2 . GLU B 1 64  ? -10.240 8.424   13.641  1.00 50.84 ? 264  GLU B OE2 1 
ATOM   1839 N N   . GLY B 1 65  ? -10.914 5.763   19.302  1.00 42.85 ? 265  GLY B N   1 
ATOM   1840 C CA  . GLY B 1 65  ? -11.071 4.530   20.054  1.00 39.66 ? 265  GLY B CA  1 
ATOM   1841 C C   . GLY B 1 65  ? -9.874  4.166   20.913  1.00 37.82 ? 265  GLY B C   1 
ATOM   1842 O O   . GLY B 1 65  ? -8.809  4.769   20.783  1.00 38.27 ? 265  GLY B O   1 
ATOM   1843 N N   . PRO B 1 66  ? -10.025 3.177   21.812  1.00 35.43 ? 266  PRO B N   1 
ATOM   1844 C CA  . PRO B 1 66  ? -8.960  2.713   22.711  1.00 33.33 ? 266  PRO B CA  1 
ATOM   1845 C C   . PRO B 1 66  ? -7.943  1.819   22.004  1.00 30.64 ? 266  PRO B C   1 
ATOM   1846 O O   . PRO B 1 66  ? -8.254  1.188   20.996  1.00 29.86 ? 266  PRO B O   1 
ATOM   1847 C CB  . PRO B 1 66  ? -9.726  1.938   23.789  1.00 33.94 ? 266  PRO B CB  1 
ATOM   1848 C CG  . PRO B 1 66  ? -11.142 2.458   23.681  1.00 35.49 ? 266  PRO B CG  1 
ATOM   1849 C CD  . PRO B 1 66  ? -11.317 2.595   22.204  1.00 35.01 ? 266  PRO B CD  1 
ATOM   1850 N N   . TYR B 1 67  ? -6.729  1.761   22.542  1.00 27.90 ? 267  TYR B N   1 
ATOM   1851 C CA  . TYR B 1 67  ? -5.684  0.930   21.960  1.00 25.12 ? 267  TYR B CA  1 
ATOM   1852 C C   . TYR B 1 67  ? -5.282  -0.182  22.920  1.00 23.35 ? 267  TYR B C   1 
ATOM   1853 O O   . TYR B 1 67  ? -5.249  0.014   24.136  1.00 21.63 ? 267  TYR B O   1 
ATOM   1854 C CB  . TYR B 1 67  ? -4.455  1.774   21.607  1.00 24.58 ? 267  TYR B CB  1 
ATOM   1855 C CG  . TYR B 1 67  ? -4.726  2.838   20.567  1.00 24.77 ? 267  TYR B CG  1 
ATOM   1856 C CD1 . TYR B 1 67  ? -5.234  4.085   20.931  1.00 24.38 ? 267  TYR B CD1 1 
ATOM   1857 C CD2 . TYR B 1 67  ? -4.501  2.588   19.214  1.00 25.51 ? 267  TYR B CD2 1 
ATOM   1858 C CE1 . TYR B 1 67  ? -5.516  5.056   19.972  1.00 26.02 ? 267  TYR B CE1 1 
ATOM   1859 C CE2 . TYR B 1 67  ? -4.782  3.551   18.246  1.00 26.80 ? 267  TYR B CE2 1 
ATOM   1860 C CZ  . TYR B 1 67  ? -5.284  4.782   18.632  1.00 25.69 ? 267  TYR B CZ  1 
ATOM   1861 O OH  . TYR B 1 67  ? -5.562  5.732   17.678  1.00 28.20 ? 267  TYR B OH  1 
ATOM   1862 N N   . ASP B 1 68  ? -4.989  -1.352  22.364  1.00 21.45 ? 268  ASP B N   1 
ATOM   1863 C CA  . ASP B 1 68  ? -4.580  -2.499  23.160  1.00 20.85 ? 268  ASP B CA  1 
ATOM   1864 C C   . ASP B 1 68  ? -3.193  -2.267  23.745  1.00 20.76 ? 268  ASP B C   1 
ATOM   1865 O O   . ASP B 1 68  ? -2.826  -2.874  24.750  1.00 20.63 ? 268  ASP B O   1 
ATOM   1866 C CB  . ASP B 1 68  ? -4.591  -3.760  22.297  1.00 20.00 ? 268  ASP B CB  1 
ATOM   1867 C CG  . ASP B 1 68  ? -5.986  -4.125  21.826  1.00 22.94 ? 268  ASP B CG  1 
ATOM   1868 O OD1 . ASP B 1 68  ? -6.818  -4.512  22.675  1.00 24.13 ? 268  ASP B OD1 1 
ATOM   1869 O OD2 . ASP B 1 68  ? -6.256  -4.015  20.611  1.00 21.85 ? 268  ASP B OD2 1 
ATOM   1870 N N   . VAL B 1 69  ? -2.425  -1.386  23.112  1.00 19.91 ? 269  VAL B N   1 
ATOM   1871 C CA  . VAL B 1 69  ? -1.087  -1.066  23.594  1.00 18.41 ? 269  VAL B CA  1 
ATOM   1872 C C   . VAL B 1 69  ? -0.631  0.307   23.127  1.00 17.94 ? 269  VAL B C   1 
ATOM   1873 O O   . VAL B 1 69  ? -0.904  0.720   21.999  1.00 17.48 ? 269  VAL B O   1 
ATOM   1874 C CB  . VAL B 1 69  ? -0.038  -2.120  23.138  1.00 18.30 ? 269  VAL B CB  1 
ATOM   1875 C CG1 . VAL B 1 69  ? 0.104   -2.108  21.621  1.00 19.61 ? 269  VAL B CG1 1 
ATOM   1876 C CG2 . VAL B 1 69  ? 1.310   -1.833  23.798  1.00 16.84 ? 269  VAL B CG2 1 
ATOM   1877 N N   . VAL B 1 70  ? 0.038   1.022   24.024  1.00 15.15 ? 270  VAL B N   1 
ATOM   1878 C CA  . VAL B 1 70  ? 0.583   2.336   23.724  1.00 16.60 ? 270  VAL B CA  1 
ATOM   1879 C C   . VAL B 1 70  ? 2.084   2.115   23.792  1.00 16.25 ? 270  VAL B C   1 
ATOM   1880 O O   . VAL B 1 70  ? 2.605   1.687   24.824  1.00 15.77 ? 270  VAL B O   1 
ATOM   1881 C CB  . VAL B 1 70  ? 0.168   3.385   24.773  1.00 15.71 ? 270  VAL B CB  1 
ATOM   1882 C CG1 . VAL B 1 70  ? 0.885   4.704   24.507  1.00 17.07 ? 270  VAL B CG1 1 
ATOM   1883 C CG2 . VAL B 1 70  ? -1.336  3.591   24.728  1.00 17.48 ? 270  VAL B CG2 1 
ATOM   1884 N N   . VAL B 1 71  ? 2.770   2.387   22.688  1.00 14.14 ? 271  VAL B N   1 
ATOM   1885 C CA  . VAL B 1 71  ? 4.210   2.186   22.617  1.00 14.73 ? 271  VAL B CA  1 
ATOM   1886 C C   . VAL B 1 71  ? 4.989   3.490   22.672  1.00 13.52 ? 271  VAL B C   1 
ATOM   1887 O O   . VAL B 1 71  ? 4.676   4.450   21.967  1.00 14.45 ? 271  VAL B O   1 
ATOM   1888 C CB  . VAL B 1 71  ? 4.588   1.426   21.328  1.00 13.67 ? 271  VAL B CB  1 
ATOM   1889 C CG1 . VAL B 1 71  ? 6.091   1.201   21.273  1.00 13.09 ? 271  VAL B CG1 1 
ATOM   1890 C CG2 . VAL B 1 71  ? 3.854   0.095   21.284  1.00 14.53 ? 271  VAL B CG2 1 
ATOM   1891 N N   . LEU B 1 72  ? 6.012   3.512   23.521  1.00 12.65 ? 272  LEU B N   1 
ATOM   1892 C CA  . LEU B 1 72  ? 6.850   4.687   23.681  1.00 13.03 ? 272  LEU B CA  1 
ATOM   1893 C C   . LEU B 1 72  ? 8.289   4.377   23.273  1.00 13.35 ? 272  LEU B C   1 
ATOM   1894 O O   . LEU B 1 72  ? 9.037   3.746   24.027  1.00 13.86 ? 272  LEU B O   1 
ATOM   1895 C CB  . LEU B 1 72  ? 6.825   5.159   25.137  1.00 13.66 ? 272  LEU B CB  1 
ATOM   1896 C CG  . LEU B 1 72  ? 5.475   5.446   25.802  1.00 13.09 ? 272  LEU B CG  1 
ATOM   1897 C CD1 . LEU B 1 72  ? 5.721   5.917   27.222  1.00 13.72 ? 272  LEU B CD1 1 
ATOM   1898 C CD2 . LEU B 1 72  ? 4.708   6.507   25.027  1.00 12.64 ? 272  LEU B CD2 1 
ATOM   1899 N N   . PRO B 1 73  ? 8.696   4.807   22.070  1.00 13.32 ? 273  PRO B N   1 
ATOM   1900 C CA  . PRO B 1 73  ? 10.066  4.545   21.630  1.00 12.85 ? 273  PRO B CA  1 
ATOM   1901 C C   . PRO B 1 73  ? 11.053  5.327   22.490  1.00 14.00 ? 273  PRO B C   1 
ATOM   1902 O O   . PRO B 1 73  ? 10.660  6.193   23.285  1.00 12.71 ? 273  PRO B O   1 
ATOM   1903 C CB  . PRO B 1 73  ? 10.074  5.040   20.182  1.00 14.33 ? 273  PRO B CB  1 
ATOM   1904 C CG  . PRO B 1 73  ? 8.643   4.908   19.758  1.00 15.50 ? 273  PRO B CG  1 
ATOM   1905 C CD  . PRO B 1 73  ? 7.906   5.405   20.978  1.00 13.60 ? 273  PRO B CD  1 
ATOM   1906 N N   . GLY B 1 74  ? 12.331  5.023   22.316  1.00 12.60 ? 274  GLY B N   1 
ATOM   1907 C CA  . GLY B 1 74  ? 13.369  5.711   23.058  1.00 12.41 ? 274  GLY B CA  1 
ATOM   1908 C C   . GLY B 1 74  ? 13.876  6.931   22.314  1.00 11.77 ? 274  GLY B C   1 
ATOM   1909 O O   . GLY B 1 74  ? 13.157  7.530   21.513  1.00 12.24 ? 274  GLY B O   1 
ATOM   1910 N N   . GLY B 1 75  ? 15.136  7.276   22.556  1.00 12.99 ? 275  GLY B N   1 
ATOM   1911 C CA  . GLY B 1 75  ? 15.723  8.450   21.942  1.00 14.33 ? 275  GLY B CA  1 
ATOM   1912 C C   . GLY B 1 75  ? 15.729  9.475   23.058  1.00 15.61 ? 275  GLY B C   1 
ATOM   1913 O O   . GLY B 1 75  ? 14.687  9.730   23.661  1.00 17.09 ? 275  GLY B O   1 
ATOM   1914 N N   . ASN B 1 76  ? 16.888  10.052  23.353  1.00 17.79 ? 276  ASN B N   1 
ATOM   1915 C CA  . ASN B 1 76  ? 16.971  11.019  24.439  1.00 17.90 ? 276  ASN B CA  1 
ATOM   1916 C C   . ASN B 1 76  ? 16.051  12.222  24.262  1.00 18.70 ? 276  ASN B C   1 
ATOM   1917 O O   . ASN B 1 76  ? 15.340  12.596  25.193  1.00 18.52 ? 276  ASN B O   1 
ATOM   1918 C CB  . ASN B 1 76  ? 18.419  11.469  24.641  1.00 20.54 ? 276  ASN B CB  1 
ATOM   1919 C CG  . ASN B 1 76  ? 19.298  10.354  25.186  1.00 22.49 ? 276  ASN B CG  1 
ATOM   1920 O OD1 . ASN B 1 76  ? 18.883  9.599   26.065  1.00 24.15 ? 276  ASN B OD1 1 
ATOM   1921 N ND2 . ASN B 1 76  ? 20.520  10.255  24.673  1.00 25.56 ? 276  ASN B ND2 1 
ATOM   1922 N N   . LEU B 1 77  ? 16.047  12.828  23.079  1.00 17.60 ? 277  LEU B N   1 
ATOM   1923 C CA  . LEU B 1 77  ? 15.167  13.971  22.853  1.00 18.20 ? 277  LEU B CA  1 
ATOM   1924 C C   . LEU B 1 77  ? 13.723  13.487  22.734  1.00 17.18 ? 277  LEU B C   1 
ATOM   1925 O O   . LEU B 1 77  ? 12.798  14.130  23.235  1.00 17.53 ? 277  LEU B O   1 
ATOM   1926 C CB  . LEU B 1 77  ? 15.567  14.732  21.584  1.00 17.94 ? 277  LEU B CB  1 
ATOM   1927 C CG  . LEU B 1 77  ? 14.704  15.956  21.241  1.00 18.53 ? 277  LEU B CG  1 
ATOM   1928 C CD1 . LEU B 1 77  ? 14.677  16.932  22.418  1.00 18.09 ? 277  LEU B CD1 1 
ATOM   1929 C CD2 . LEU B 1 77  ? 15.258  16.633  19.996  1.00 18.10 ? 277  LEU B CD2 1 
ATOM   1930 N N   . GLY B 1 78  ? 13.532  12.349  22.076  1.00 14.81 ? 278  GLY B N   1 
ATOM   1931 C CA  . GLY B 1 78  ? 12.194  11.809  21.921  1.00 12.99 ? 278  GLY B CA  1 
ATOM   1932 C C   . GLY B 1 78  ? 11.535  11.533  23.263  1.00 12.98 ? 278  GLY B C   1 
ATOM   1933 O O   . GLY B 1 78  ? 10.363  11.853  23.470  1.00 13.01 ? 278  GLY B O   1 
ATOM   1934 N N   . ALA B 1 79  ? 12.285  10.939  24.183  1.00 13.28 ? 279  ALA B N   1 
ATOM   1935 C CA  . ALA B 1 79  ? 11.749  10.631  25.503  1.00 13.88 ? 279  ALA B CA  1 
ATOM   1936 C C   . ALA B 1 79  ? 11.509  11.912  26.295  1.00 15.77 ? 279  ALA B C   1 
ATOM   1937 O O   . ALA B 1 79  ? 10.560  12.004  27.075  1.00 16.48 ? 279  ALA B O   1 
ATOM   1938 C CB  . ALA B 1 79  ? 12.703  9.715   26.257  1.00 13.82 ? 279  ALA B CB  1 
ATOM   1939 N N   . GLN B 1 80  ? 12.377  12.898  26.093  1.00 17.72 ? 280  GLN B N   1 
ATOM   1940 C CA  . GLN B 1 80  ? 12.250  14.178  26.777  1.00 19.13 ? 280  GLN B CA  1 
ATOM   1941 C C   . GLN B 1 80  ? 10.924  14.809  26.369  1.00 19.86 ? 280  GLN B C   1 
ATOM   1942 O O   . GLN B 1 80  ? 10.143  15.246  27.216  1.00 19.60 ? 280  GLN B O   1 
ATOM   1943 C CB  . GLN B 1 80  ? 13.407  15.104  26.386  1.00 21.95 ? 280  GLN B CB  1 
ATOM   1944 C CG  . GLN B 1 80  ? 13.456  16.422  27.150  1.00 25.65 ? 280  GLN B CG  1 
ATOM   1945 C CD  . GLN B 1 80  ? 13.479  17.633  26.232  1.00 29.82 ? 280  GLN B CD  1 
ATOM   1946 O OE1 . GLN B 1 80  ? 12.484  17.948  25.575  1.00 31.75 ? 280  GLN B OE1 1 
ATOM   1947 N NE2 . GLN B 1 80  ? 14.619  18.317  26.177  1.00 30.73 ? 280  GLN B NE2 1 
ATOM   1948 N N   . ASN B 1 81  ? 10.674  14.845  25.061  1.00 19.05 ? 281  ASN B N   1 
ATOM   1949 C CA  . ASN B 1 81  ? 9.445   15.416  24.530  1.00 19.66 ? 281  ASN B CA  1 
ATOM   1950 C C   . ASN B 1 81  ? 8.227   14.663  25.054  1.00 19.19 ? 281  ASN B C   1 
ATOM   1951 O O   . ASN B 1 81  ? 7.232   15.277  25.445  1.00 18.20 ? 281  ASN B O   1 
ATOM   1952 C CB  . ASN B 1 81  ? 9.473   15.391  22.997  1.00 19.65 ? 281  ASN B CB  1 
ATOM   1953 C CG  . ASN B 1 81  ? 10.382  16.462  22.415  1.00 20.68 ? 281  ASN B CG  1 
ATOM   1954 O OD1 . ASN B 1 81  ? 10.928  16.306  21.322  1.00 21.44 ? 281  ASN B OD1 1 
ATOM   1955 N ND2 . ASN B 1 81  ? 10.536  17.565  23.140  1.00 18.73 ? 281  ASN B ND2 1 
ATOM   1956 N N   . LEU B 1 82  ? 8.310   13.335  25.067  1.00 17.66 ? 282  LEU B N   1 
ATOM   1957 C CA  . LEU B 1 82  ? 7.212   12.513  25.567  1.00 18.03 ? 282  LEU B CA  1 
ATOM   1958 C C   . LEU B 1 82  ? 6.961   12.827  27.038  1.00 18.49 ? 282  LEU B C   1 
ATOM   1959 O O   . LEU B 1 82  ? 5.815   12.906  27.480  1.00 19.64 ? 282  LEU B O   1 
ATOM   1960 C CB  . LEU B 1 82  ? 7.539   11.020  25.426  1.00 16.06 ? 282  LEU B CB  1 
ATOM   1961 C CG  . LEU B 1 82  ? 7.557   10.390  24.033  1.00 16.27 ? 282  LEU B CG  1 
ATOM   1962 C CD1 . LEU B 1 82  ? 8.006   8.940   24.146  1.00 16.25 ? 282  LEU B CD1 1 
ATOM   1963 C CD2 . LEU B 1 82  ? 6.171   10.480  23.398  1.00 16.86 ? 282  LEU B CD2 1 
ATOM   1964 N N   . SER B 1 83  ? 8.043   13.015  27.787  1.00 19.73 ? 283  SER B N   1 
ATOM   1965 C CA  . SER B 1 83  ? 7.961   13.298  29.216  1.00 20.81 ? 283  SER B CA  1 
ATOM   1966 C C   . SER B 1 83  ? 7.365   14.662  29.562  1.00 22.08 ? 283  SER B C   1 
ATOM   1967 O O   . SER B 1 83  ? 6.771   14.828  30.628  1.00 22.09 ? 283  SER B O   1 
ATOM   1968 C CB  . SER B 1 83  ? 9.350   13.182  29.853  1.00 20.37 ? 283  SER B CB  1 
ATOM   1969 O OG  . SER B 1 83  ? 9.858   11.862  29.751  1.00 19.47 ? 283  SER B OG  1 
ATOM   1970 N N   . GLU B 1 84  ? 7.521   15.635  28.670  1.00 22.89 ? 284  GLU B N   1 
ATOM   1971 C CA  . GLU B 1 84  ? 7.003   16.979  28.921  1.00 24.27 ? 284  GLU B CA  1 
ATOM   1972 C C   . GLU B 1 84  ? 5.585   17.190  28.400  1.00 24.53 ? 284  GLU B C   1 
ATOM   1973 O O   . GLU B 1 84  ? 4.938   18.181  28.734  1.00 25.54 ? 284  GLU B O   1 
ATOM   1974 C CB  . GLU B 1 84  ? 7.916   18.030  28.284  1.00 24.93 ? 284  GLU B CB  1 
ATOM   1975 C CG  . GLU B 1 84  ? 9.386   17.894  28.633  1.00 26.41 ? 284  GLU B CG  1 
ATOM   1976 C CD  . GLU B 1 84  ? 10.232  18.968  27.977  1.00 27.78 ? 284  GLU B CD  1 
ATOM   1977 O OE1 . GLU B 1 84  ? 9.965   19.294  26.803  1.00 30.32 ? 284  GLU B OE1 1 
ATOM   1978 O OE2 . GLU B 1 84  ? 11.168  19.479  28.627  1.00 31.08 ? 284  GLU B OE2 1 
ATOM   1979 N N   . SER B 1 85  ? 5.105   16.258  27.582  1.00 24.55 ? 285  SER B N   1 
ATOM   1980 C CA  . SER B 1 85  ? 3.772   16.367  27.002  1.00 24.75 ? 285  SER B CA  1 
ATOM   1981 C C   . SER B 1 85  ? 2.626   16.058  27.955  1.00 24.75 ? 285  SER B C   1 
ATOM   1982 O O   . SER B 1 85  ? 2.568   14.985  28.551  1.00 24.35 ? 285  SER B O   1 
ATOM   1983 C CB  . SER B 1 85  ? 3.660   15.457  25.779  1.00 24.10 ? 285  SER B CB  1 
ATOM   1984 O OG  . SER B 1 85  ? 2.339   15.462  25.268  1.00 24.20 ? 285  SER B OG  1 
ATOM   1985 N N   . ALA B 1 86  ? 1.704   17.008  28.082  1.00 25.81 ? 286  ALA B N   1 
ATOM   1986 C CA  . ALA B 1 86  ? 0.545   16.830  28.944  1.00 25.43 ? 286  ALA B CA  1 
ATOM   1987 C C   . ALA B 1 86  ? -0.399  15.844  28.269  1.00 24.82 ? 286  ALA B C   1 
ATOM   1988 O O   . ALA B 1 86  ? -1.105  15.086  28.933  1.00 24.27 ? 286  ALA B O   1 
ATOM   1989 C CB  . ALA B 1 86  ? -0.158  18.167  29.163  1.00 25.98 ? 286  ALA B CB  1 
ATOM   1990 N N   . ALA B 1 87  ? -0.399  15.861  26.939  1.00 23.76 ? 287  ALA B N   1 
ATOM   1991 C CA  . ALA B 1 87  ? -1.245  14.973  26.154  1.00 23.19 ? 287  ALA B CA  1 
ATOM   1992 C C   . ALA B 1 87  ? -0.857  13.522  26.407  1.00 23.24 ? 287  ALA B C   1 
ATOM   1993 O O   . ALA B 1 87  ? -1.716  12.658  26.580  1.00 22.35 ? 287  ALA B O   1 
ATOM   1994 C CB  . ALA B 1 87  ? -1.109  15.303  24.675  1.00 23.31 ? 287  ALA B CB  1 
ATOM   1995 N N   . VAL B 1 88  ? 0.446   13.258  26.424  1.00 22.67 ? 288  VAL B N   1 
ATOM   1996 C CA  . VAL B 1 88  ? 0.932   11.909  26.669  1.00 22.50 ? 288  VAL B CA  1 
ATOM   1997 C C   . VAL B 1 88  ? 0.578   11.498  28.096  1.00 22.77 ? 288  VAL B C   1 
ATOM   1998 O O   . VAL B 1 88  ? 0.194   10.355  28.345  1.00 21.32 ? 288  VAL B O   1 
ATOM   1999 C CB  . VAL B 1 88  ? 2.464   11.821  26.476  1.00 21.78 ? 288  VAL B CB  1 
ATOM   2000 C CG1 . VAL B 1 88  ? 2.959   10.423  26.830  1.00 21.62 ? 288  VAL B CG1 1 
ATOM   2001 C CG2 . VAL B 1 88  ? 2.824   12.152  25.033  1.00 21.32 ? 288  VAL B CG2 1 
ATOM   2002 N N   . LYS B 1 89  ? 0.702   12.440  29.027  1.00 24.42 ? 289  LYS B N   1 
ATOM   2003 C CA  . LYS B 1 89  ? 0.394   12.174  30.428  1.00 25.70 ? 289  LYS B CA  1 
ATOM   2004 C C   . LYS B 1 89  ? -1.021  11.618  30.544  1.00 26.19 ? 289  LYS B C   1 
ATOM   2005 O O   . LYS B 1 89  ? -1.249  10.592  31.185  1.00 25.35 ? 289  LYS B O   1 
ATOM   2006 C CB  . LYS B 1 89  ? 0.509   13.463  31.250  1.00 26.25 ? 289  LYS B CB  1 
ATOM   2007 C CG  . LYS B 1 89  ? 0.359   13.266  32.756  1.00 27.72 ? 289  LYS B CG  1 
ATOM   2008 C CD  . LYS B 1 89  ? 0.348   14.603  33.496  1.00 28.09 ? 289  LYS B CD  1 
ATOM   2009 C CE  . LYS B 1 89  ? 1.640   15.390  33.290  1.00 30.64 ? 289  LYS B CE  1 
ATOM   2010 N NZ  . LYS B 1 89  ? 2.832   14.712  33.874  1.00 30.34 ? 289  LYS B NZ  1 
ATOM   2011 N N   . GLU B 1 90  ? -1.965  12.297  29.902  1.00 27.05 ? 290  GLU B N   1 
ATOM   2012 C CA  . GLU B 1 90  ? -3.362  11.884  29.934  1.00 27.26 ? 290  GLU B CA  1 
ATOM   2013 C C   . GLU B 1 90  ? -3.556  10.512  29.298  1.00 25.78 ? 290  GLU B C   1 
ATOM   2014 O O   . GLU B 1 90  ? -4.267  9.663   29.837  1.00 24.31 ? 290  GLU B O   1 
ATOM   2015 C CB  . GLU B 1 90  ? -4.229  12.909  29.203  1.00 30.23 ? 290  GLU B CB  1 
ATOM   2016 C CG  . GLU B 1 90  ? -5.718  12.655  29.344  1.00 34.11 ? 290  GLU B CG  1 
ATOM   2017 C CD  . GLU B 1 90  ? -6.558  13.640  28.558  1.00 37.58 ? 290  GLU B CD  1 
ATOM   2018 O OE1 . GLU B 1 90  ? -6.358  14.863  28.729  1.00 40.07 ? 290  GLU B OE1 1 
ATOM   2019 O OE2 . GLU B 1 90  ? -7.422  13.191  27.773  1.00 39.19 ? 290  GLU B OE2 1 
ATOM   2020 N N   . ILE B 1 91  ? -2.924  10.304  28.148  1.00 24.61 ? 291  ILE B N   1 
ATOM   2021 C CA  . ILE B 1 91  ? -3.025  9.040   27.427  1.00 23.75 ? 291  ILE B CA  1 
ATOM   2022 C C   . ILE B 1 91  ? -2.534  7.862   28.259  1.00 22.49 ? 291  ILE B C   1 
ATOM   2023 O O   . ILE B 1 91  ? -3.185  6.820   28.319  1.00 21.68 ? 291  ILE B O   1 
ATOM   2024 C CB  . ILE B 1 91  ? -2.218  9.093   26.110  1.00 24.00 ? 291  ILE B CB  1 
ATOM   2025 C CG1 . ILE B 1 91  ? -2.838  10.128  25.172  1.00 24.44 ? 291  ILE B CG1 1 
ATOM   2026 C CG2 . ILE B 1 91  ? -2.192  7.721   25.451  1.00 25.27 ? 291  ILE B CG2 1 
ATOM   2027 C CD1 . ILE B 1 91  ? -2.023  10.406  23.925  1.00 24.29 ? 291  ILE B CD1 1 
ATOM   2028 N N   . LEU B 1 92  ? -1.381  8.028   28.897  1.00 21.85 ? 292  LEU B N   1 
ATOM   2029 C CA  . LEU B 1 92  ? -0.817  6.964   29.715  1.00 21.34 ? 292  LEU B CA  1 
ATOM   2030 C C   . LEU B 1 92  ? -1.692  6.697   30.935  1.00 21.28 ? 292  LEU B C   1 
ATOM   2031 O O   . LEU B 1 92  ? -1.902  5.544   31.314  1.00 20.00 ? 292  LEU B O   1 
ATOM   2032 C CB  . LEU B 1 92  ? 0.608   7.326   30.141  1.00 20.81 ? 292  LEU B CB  1 
ATOM   2033 C CG  . LEU B 1 92  ? 1.610   7.454   28.986  1.00 20.49 ? 292  LEU B CG  1 
ATOM   2034 C CD1 . LEU B 1 92  ? 2.963   7.898   29.516  1.00 20.55 ? 292  LEU B CD1 1 
ATOM   2035 C CD2 . LEU B 1 92  ? 1.734   6.118   28.266  1.00 18.70 ? 292  LEU B CD2 1 
ATOM   2036 N N   . LYS B 1 93  ? -2.205  7.762   31.543  1.00 23.04 ? 293  LYS B N   1 
ATOM   2037 C CA  . LYS B 1 93  ? -3.074  7.618   32.705  1.00 25.07 ? 293  LYS B CA  1 
ATOM   2038 C C   . LYS B 1 93  ? -4.299  6.801   32.303  1.00 25.78 ? 293  LYS B C   1 
ATOM   2039 O O   . LYS B 1 93  ? -4.709  5.886   33.019  1.00 25.57 ? 293  LYS B O   1 
ATOM   2040 C CB  . LYS B 1 93  ? -3.516  8.990   33.222  1.00 25.90 ? 293  LYS B CB  1 
ATOM   2041 C CG  . LYS B 1 93  ? -2.415  9.806   33.881  1.00 27.42 ? 293  LYS B CG  1 
ATOM   2042 C CD  . LYS B 1 93  ? -1.939  9.153   35.167  1.00 30.53 ? 293  LYS B CD  1 
ATOM   2043 C CE  . LYS B 1 93  ? -0.910  10.015  35.887  1.00 31.46 ? 293  LYS B CE  1 
ATOM   2044 N NZ  . LYS B 1 93  ? -0.396  9.337   37.111  1.00 32.92 ? 293  LYS B NZ  1 
ATOM   2045 N N   . GLU B 1 94  ? -4.879  7.135   31.153  1.00 26.40 ? 294  GLU B N   1 
ATOM   2046 C CA  . GLU B 1 94  ? -6.050  6.417   30.659  1.00 26.74 ? 294  GLU B CA  1 
ATOM   2047 C C   . GLU B 1 94  ? -5.736  4.943   30.450  1.00 25.23 ? 294  GLU B C   1 
ATOM   2048 O O   . GLU B 1 94  ? -6.501  4.073   30.864  1.00 24.31 ? 294  GLU B O   1 
ATOM   2049 C CB  . GLU B 1 94  ? -6.533  6.993   29.325  1.00 28.32 ? 294  GLU B CB  1 
ATOM   2050 C CG  . GLU B 1 94  ? -7.178  8.358   29.388  1.00 31.37 ? 294  GLU B CG  1 
ATOM   2051 C CD  . GLU B 1 94  ? -7.883  8.709   28.088  1.00 32.67 ? 294  GLU B CD  1 
ATOM   2052 O OE1 . GLU B 1 94  ? -7.225  8.691   27.024  1.00 33.60 ? 294  GLU B OE1 1 
ATOM   2053 O OE2 . GLU B 1 94  ? -9.097  8.997   28.128  1.00 34.36 ? 294  GLU B OE2 1 
ATOM   2054 N N   . GLN B 1 95  ? -4.610  4.665   29.797  1.00 23.25 ? 295  GLN B N   1 
ATOM   2055 C CA  . GLN B 1 95  ? -4.225  3.286   29.526  1.00 22.45 ? 295  GLN B CA  1 
ATOM   2056 C C   . GLN B 1 95  ? -4.116  2.491   30.822  1.00 22.89 ? 295  GLN B C   1 
ATOM   2057 O O   . GLN B 1 95  ? -4.518  1.329   30.881  1.00 22.99 ? 295  GLN B O   1 
ATOM   2058 C CB  . GLN B 1 95  ? -2.900  3.234   28.759  1.00 21.68 ? 295  GLN B CB  1 
ATOM   2059 C CG  . GLN B 1 95  ? -2.590  1.859   28.182  1.00 20.67 ? 295  GLN B CG  1 
ATOM   2060 C CD  . GLN B 1 95  ? -3.514  1.473   27.035  1.00 21.89 ? 295  GLN B CD  1 
ATOM   2061 O OE1 . GLN B 1 95  ? -4.620  2.001   26.901  1.00 20.65 ? 295  GLN B OE1 1 
ATOM   2062 N NE2 . GLN B 1 95  ? -3.068  0.533   26.210  1.00 20.02 ? 295  GLN B NE2 1 
ATOM   2063 N N   . GLU B 1 96  ? -3.564  3.114   31.859  1.00 24.68 ? 296  GLU B N   1 
ATOM   2064 C CA  . GLU B 1 96  ? -3.446  2.453   33.154  1.00 27.74 ? 296  GLU B CA  1 
ATOM   2065 C C   . GLU B 1 96  ? -4.842  2.081   33.650  1.00 27.62 ? 296  GLU B C   1 
ATOM   2066 O O   . GLU B 1 96  ? -5.092  0.943   34.033  1.00 27.91 ? 296  GLU B O   1 
ATOM   2067 C CB  . GLU B 1 96  ? -2.800  3.378   34.188  1.00 28.77 ? 296  GLU B CB  1 
ATOM   2068 C CG  . GLU B 1 96  ? -1.288  3.364   34.239  1.00 31.11 ? 296  GLU B CG  1 
ATOM   2069 C CD  . GLU B 1 96  ? -0.764  4.045   35.495  1.00 31.86 ? 296  GLU B CD  1 
ATOM   2070 O OE1 . GLU B 1 96  ? -1.049  5.247   35.688  1.00 34.18 ? 296  GLU B OE1 1 
ATOM   2071 O OE2 . GLU B 1 96  ? -0.075  3.377   36.294  1.00 30.89 ? 296  GLU B OE2 1 
ATOM   2072 N N   . ASN B 1 97  ? -5.759  3.039   33.626  1.00 29.50 ? 297  ASN B N   1 
ATOM   2073 C CA  . ASN B 1 97  ? -7.125  2.779   34.088  1.00 31.08 ? 297  ASN B CA  1 
ATOM   2074 C C   . ASN B 1 97  ? -7.977  1.740   33.252  1.00 31.86 ? 297  ASN B C   1 
ATOM   2075 O O   . ASN B 1 97  ? -8.898  1.132   33.806  1.00 32.70 ? 297  ASN B O   1 
ATOM   2076 C CB  . ASN B 1 97  ? -7.866  4.131   34.236  1.00 31.85 ? 297  ASN B CB  1 
ATOM   2077 C CG  . ASN B 1 97  ? -7.285  5.068   35.322  1.00 33.25 ? 297  ASN B CG  1 
ATOM   2078 O OD1 . ASN B 1 97  ? -7.453  6.280   35.252  1.00 33.98 ? 297  ASN B OD1 1 
ATOM   2079 N ND2 . ASN B 1 97  ? -6.628  4.490   36.328  1.00 34.27 ? 297  ASN B ND2 1 
ATOM   2080 N N   . ARG B 1 98  ? -7.687  1.520   31.945  1.00 31.53 ? 298  ARG B N   1 
ATOM   2081 C CA  . ARG B 1 98  ? -8.441  0.576   31.069  1.00 31.96 ? 298  ARG B CA  1 
ATOM   2082 C C   . ARG B 1 98  ? -7.754  -0.755  31.108  1.00 30.73 ? 298  ARG B C   1 
ATOM   2083 O O   . ARG B 1 98  ? -8.116  -1.732  30.448  1.00 31.26 ? 298  ARG B O   1 
ATOM   2084 C CB  . ARG B 1 98  ? -8.450  1.052   29.609  1.00 32.86 ? 298  ARG B CB  1 
ATOM   2085 C CG  . ARG B 1 98  ? -8.602  2.546   29.462  1.00 35.24 ? 298  ARG B CG  1 
ATOM   2086 C CD  . ARG B 1 98  ? -9.088  2.874   28.076  1.00 37.88 ? 298  ARG B CD  1 
ATOM   2087 N NE  . ARG B 1 98  ? -9.220  4.312   27.884  1.00 39.93 ? 298  ARG B NE  1 
ATOM   2088 C CZ  . ARG B 1 98  ? -9.231  4.891   26.703  1.00 41.00 ? 298  ARG B CZ  1 
ATOM   2089 N NH1 . ARG B 1 98  ? -9.114  4.173   25.594  1.00 42.99 ? 298  ARG B NH1 1 
ATOM   2090 N NH2 . ARG B 1 98  ? -9.345  6.212   26.623  1.00 41.71 ? 298  ARG B NH2 1 
ATOM   2091 N N   . LYS B 1 99  ? -6.712  -0.739  31.950  1.00 29.45 ? 299  LYS B N   1 
ATOM   2092 C CA  . LYS B 1 99  ? -5.873  -1.879  32.176  1.00 27.89 ? 299  LYS B CA  1 
ATOM   2093 C C   . LYS B 1 99  ? -5.313  -2.277  30.832  1.00 26.85 ? 299  LYS B C   1 
ATOM   2094 O O   . LYS B 1 99  ? -5.356  -3.456  30.468  1.00 25.96 ? 299  LYS B O   1 
ATOM   2095 C CB  . LYS B 1 99  ? -6.655  -3.011  32.822  1.00 29.06 ? 299  LYS B CB  1 
ATOM   2096 C CG  . LYS B 1 99  ? -7.312  -2.618  34.144  1.00 30.84 ? 299  LYS B CG  1 
ATOM   2097 C CD  . LYS B 1 99  ? -6.281  -2.198  35.186  1.00 31.90 ? 299  LYS B CD  1 
ATOM   2098 C CE  . LYS B 1 99  ? -5.380  -3.363  35.582  1.00 33.23 ? 299  LYS B CE  1 
ATOM   2099 N NZ  . LYS B 1 99  ? -4.355  -2.960  36.591  1.00 31.50 ? 299  LYS B NZ  1 
ATOM   2100 N N   . GLY B 1 100 ? -4.804  -1.309  30.119  1.00 24.67 ? 300  GLY B N   1 
ATOM   2101 C CA  . GLY B 1 100 ? -4.229  -1.586  28.815  1.00 22.29 ? 300  GLY B CA  1 
ATOM   2102 C C   . GLY B 1 100 ? -2.720  -1.658  28.903  1.00 21.24 ? 300  GLY B C   1 
ATOM   2103 O O   . GLY B 1 100 ? -2.108  -1.006  29.750  1.00 21.58 ? 300  GLY B O   1 
ATOM   2104 N N   . LEU B 1 101 ? -2.117  -2.444  28.018  1.00 19.13 ? 301  LEU B N   1 
ATOM   2105 C CA  . LEU B 1 101 ? -0.669  -2.599  28.003  1.00 17.62 ? 301  LEU B CA  1 
ATOM   2106 C C   . LEU B 1 101 ? 0.046   -1.307  27.627  1.00 17.42 ? 301  LEU B C   1 
ATOM   2107 O O   . LEU B 1 101 ? -0.429  -0.534  26.790  1.00 17.52 ? 301  LEU B O   1 
ATOM   2108 C CB  . LEU B 1 101 ? -0.268  -3.710  27.022  1.00 17.56 ? 301  LEU B CB  1 
ATOM   2109 C CG  . LEU B 1 101 ? 1.218   -4.085  26.950  1.00 15.90 ? 301  LEU B CG  1 
ATOM   2110 C CD1 . LEU B 1 101 ? 1.686   -4.567  28.319  1.00 17.64 ? 301  LEU B CD1 1 
ATOM   2111 C CD2 . LEU B 1 101 ? 1.430   -5.176  25.905  1.00 18.43 ? 301  LEU B CD2 1 
ATOM   2112 N N   . ILE B 1 102 ? 1.179   -1.071  28.280  1.00 16.30 ? 302  ILE B N   1 
ATOM   2113 C CA  . ILE B 1 102 ? 2.014   0.091   28.006  1.00 16.14 ? 302  ILE B CA  1 
ATOM   2114 C C   . ILE B 1 102 ? 3.412   -0.469  27.802  1.00 14.89 ? 302  ILE B C   1 
ATOM   2115 O O   . ILE B 1 102 ? 3.938   -1.153  28.675  1.00 15.13 ? 302  ILE B O   1 
ATOM   2116 C CB  . ILE B 1 102 ? 2.049   1.093   29.182  1.00 16.67 ? 302  ILE B CB  1 
ATOM   2117 C CG1 . ILE B 1 102 ? 0.674   1.737   29.365  1.00 18.22 ? 302  ILE B CG1 1 
ATOM   2118 C CG2 . ILE B 1 102 ? 3.091   2.172   28.910  1.00 17.05 ? 302  ILE B CG2 1 
ATOM   2119 C CD1 . ILE B 1 102 ? 0.636   2.810   30.448  1.00 15.73 ? 302  ILE B CD1 1 
ATOM   2120 N N   . ALA B 1 103 ? 4.002   -0.192  26.645  1.00 13.14 ? 303  ALA B N   1 
ATOM   2121 C CA  . ALA B 1 103 ? 5.338   -0.689  26.327  1.00 13.02 ? 303  ALA B CA  1 
ATOM   2122 C C   . ALA B 1 103 ? 6.300   0.466   26.053  1.00 12.07 ? 303  ALA B C   1 
ATOM   2123 O O   . ALA B 1 103 ? 6.010   1.347   25.250  1.00 11.32 ? 303  ALA B O   1 
ATOM   2124 C CB  . ALA B 1 103 ? 5.265   -1.615  25.121  1.00 12.82 ? 303  ALA B CB  1 
ATOM   2125 N N   . ALA B 1 104 ? 7.449   0.457   26.724  1.00 11.59 ? 304  ALA B N   1 
ATOM   2126 C CA  . ALA B 1 104 ? 8.438   1.519   26.556  1.00 11.26 ? 304  ALA B CA  1 
ATOM   2127 C C   . ALA B 1 104 ? 9.835   0.917   26.457  1.00 10.67 ? 304  ALA B C   1 
ATOM   2128 O O   . ALA B 1 104 ? 10.163  -0.019  27.184  1.00 11.14 ? 304  ALA B O   1 
ATOM   2129 C CB  . ALA B 1 104 ? 8.363   2.489   27.730  1.00 11.82 ? 304  ALA B CB  1 
ATOM   2130 N N   . ILE B 1 105 ? 10.657  1.461   25.565  1.00 12.15 ? 305  ILE B N   1 
ATOM   2131 C CA  . ILE B 1 105 ? 12.000  0.928   25.368  1.00 11.26 ? 305  ILE B CA  1 
ATOM   2132 C C   . ILE B 1 105 ? 13.117  1.966   25.417  1.00 13.02 ? 305  ILE B C   1 
ATOM   2133 O O   . ILE B 1 105 ? 12.926  3.126   25.046  1.00 12.95 ? 305  ILE B O   1 
ATOM   2134 C CB  . ILE B 1 105 ? 12.065  0.152   24.017  1.00 10.72 ? 305  ILE B CB  1 
ATOM   2135 C CG1 . ILE B 1 105 ? 13.456  -0.444  23.796  1.00 9.39  ? 305  ILE B CG1 1 
ATOM   2136 C CG2 . ILE B 1 105 ? 11.695  1.077   22.864  1.00 10.02 ? 305  ILE B CG2 1 
ATOM   2137 C CD1 . ILE B 1 105 ? 13.523  -1.378  22.596  1.00 10.67 ? 305  ILE B CD1 1 
ATOM   2138 N N   . CYS B 1 106 ? 14.278  1.528   25.906  1.00 12.35 ? 306  CYS B N   1 
ATOM   2139 C CA  . CYS B 1 106 ? 15.481  2.350   26.005  1.00 14.24 ? 306  CYS B CA  1 
ATOM   2140 C C   . CYS B 1 106 ? 15.332  3.512   26.984  1.00 13.15 ? 306  CYS B C   1 
ATOM   2141 O O   . CYS B 1 106 ? 15.337  3.307   28.198  1.00 11.22 ? 306  CYS B O   1 
ATOM   2142 C CB  . CYS B 1 106 ? 15.864  2.865   24.614  1.00 15.39 ? 306  CYS B CB  1 
ATOM   2143 S SG  . CYS B 1 106 ? 17.614  3.257   24.424  1.00 19.24 ? 306  CYS B SG  1 
ATOM   2144 N N   . ALA B 1 107 ? 15.221  4.732   26.462  1.00 13.61 ? 307  ALA B N   1 
ATOM   2145 C CA  . ALA B 1 107 ? 15.048  5.908   27.311  1.00 13.90 ? 307  ALA B CA  1 
ATOM   2146 C C   . ALA B 1 107 ? 13.556  6.161   27.492  1.00 13.11 ? 307  ALA B C   1 
ATOM   2147 O O   . ALA B 1 107 ? 13.143  6.950   28.340  1.00 13.42 ? 307  ALA B O   1 
ATOM   2148 C CB  . ALA B 1 107 ? 15.711  7.131   26.676  1.00 14.78 ? 307  ALA B CB  1 
ATOM   2149 N N   . GLY B 1 108 ? 12.754  5.485   26.676  1.00 12.97 ? 308  GLY B N   1 
ATOM   2150 C CA  . GLY B 1 108 ? 11.313  5.636   26.743  1.00 11.96 ? 308  GLY B CA  1 
ATOM   2151 C C   . GLY B 1 108 ? 10.686  5.448   28.116  1.00 12.81 ? 308  GLY B C   1 
ATOM   2152 O O   . GLY B 1 108 ? 9.778   6.198   28.471  1.00 12.10 ? 308  GLY B O   1 
ATOM   2153 N N   . PRO B 1 109 ? 11.129  4.460   28.914  1.00 12.14 ? 309  PRO B N   1 
ATOM   2154 C CA  . PRO B 1 109 ? 10.531  4.267   30.239  1.00 12.16 ? 309  PRO B CA  1 
ATOM   2155 C C   . PRO B 1 109 ? 10.578  5.501   31.143  1.00 13.48 ? 309  PRO B C   1 
ATOM   2156 O O   . PRO B 1 109 ? 9.774   5.623   32.070  1.00 14.75 ? 309  PRO B O   1 
ATOM   2157 C CB  . PRO B 1 109 ? 11.330  3.095   30.812  1.00 11.84 ? 309  PRO B CB  1 
ATOM   2158 C CG  . PRO B 1 109 ? 11.671  2.299   29.588  1.00 11.35 ? 309  PRO B CG  1 
ATOM   2159 C CD  . PRO B 1 109 ? 12.088  3.382   28.612  1.00 12.81 ? 309  PRO B CD  1 
ATOM   2160 N N   . THR B 1 110 ? 11.505  6.418   30.878  1.00 13.77 ? 310  THR B N   1 
ATOM   2161 C CA  . THR B 1 110 ? 11.608  7.612   31.707  1.00 14.25 ? 310  THR B CA  1 
ATOM   2162 C C   . THR B 1 110 ? 10.358  8.479   31.588  1.00 15.34 ? 310  THR B C   1 
ATOM   2163 O O   . THR B 1 110 ? 10.091  9.310   32.457  1.00 16.11 ? 310  THR B O   1 
ATOM   2164 C CB  . THR B 1 110 ? 12.865  8.458   31.365  1.00 15.94 ? 310  THR B CB  1 
ATOM   2165 O OG1 . THR B 1 110 ? 12.835  8.850   29.988  1.00 16.90 ? 310  THR B OG1 1 
ATOM   2166 C CG2 . THR B 1 110 ? 14.131  7.658   31.641  1.00 16.36 ? 310  THR B CG2 1 
ATOM   2167 N N   . ALA B 1 111 ? 9.593   8.281   30.518  1.00 14.02 ? 311  ALA B N   1 
ATOM   2168 C CA  . ALA B 1 111 ? 8.357   9.033   30.322  1.00 16.17 ? 311  ALA B CA  1 
ATOM   2169 C C   . ALA B 1 111 ? 7.346   8.536   31.349  1.00 16.54 ? 311  ALA B C   1 
ATOM   2170 O O   . ALA B 1 111 ? 6.518   9.299   31.851  1.00 16.96 ? 311  ALA B O   1 
ATOM   2171 C CB  . ALA B 1 111 ? 7.819   8.821   28.908  1.00 15.44 ? 311  ALA B CB  1 
ATOM   2172 N N   . LEU B 1 112 ? 7.421   7.244   31.657  1.00 18.00 ? 312  LEU B N   1 
ATOM   2173 C CA  . LEU B 1 112 ? 6.528   6.641   32.637  1.00 17.36 ? 312  LEU B CA  1 
ATOM   2174 C C   . LEU B 1 112 ? 6.775   7.293   33.996  1.00 17.90 ? 312  LEU B C   1 
ATOM   2175 O O   . LEU B 1 112 ? 5.834   7.580   34.734  1.00 18.15 ? 312  LEU B O   1 
ATOM   2176 C CB  . LEU B 1 112 ? 6.775   5.132   32.723  1.00 16.62 ? 312  LEU B CB  1 
ATOM   2177 C CG  . LEU B 1 112 ? 6.611   4.346   31.417  1.00 16.83 ? 312  LEU B CG  1 
ATOM   2178 C CD1 . LEU B 1 112 ? 6.954   2.887   31.639  1.00 18.22 ? 312  LEU B CD1 1 
ATOM   2179 C CD2 . LEU B 1 112 ? 5.181   4.484   30.908  1.00 16.07 ? 312  LEU B CD2 1 
ATOM   2180 N N   . LEU B 1 113 ? 8.044   7.535   34.317  1.00 17.59 ? 313  LEU B N   1 
ATOM   2181 C CA  . LEU B 1 113 ? 8.402   8.164   35.584  1.00 18.66 ? 313  LEU B CA  1 
ATOM   2182 C C   . LEU B 1 113 ? 7.893   9.599   35.633  1.00 19.75 ? 313  LEU B C   1 
ATOM   2183 O O   . LEU B 1 113 ? 7.318   10.028  36.632  1.00 21.12 ? 313  LEU B O   1 
ATOM   2184 C CB  . LEU B 1 113 ? 9.922   8.161   35.775  1.00 16.57 ? 313  LEU B CB  1 
ATOM   2185 C CG  . LEU B 1 113 ? 10.453  9.014   36.934  1.00 16.71 ? 313  LEU B CG  1 
ATOM   2186 C CD1 . LEU B 1 113 ? 9.879   8.519   38.251  1.00 15.04 ? 313  LEU B CD1 1 
ATOM   2187 C CD2 . LEU B 1 113 ? 11.971  8.955   36.962  1.00 16.74 ? 313  LEU B CD2 1 
ATOM   2188 N N   . ALA B 1 114 ? 8.104   10.332  34.545  1.00 20.46 ? 314  ALA B N   1 
ATOM   2189 C CA  . ALA B 1 114 ? 7.684   11.728  34.456  1.00 21.13 ? 314  ALA B CA  1 
ATOM   2190 C C   . ALA B 1 114 ? 6.177   11.913  34.618  1.00 21.85 ? 314  ALA B C   1 
ATOM   2191 O O   . ALA B 1 114 ? 5.722   12.940  35.127  1.00 21.84 ? 314  ALA B O   1 
ATOM   2192 C CB  . ALA B 1 114 ? 8.141   12.323  33.125  1.00 20.93 ? 314  ALA B CB  1 
ATOM   2193 N N   . HIS B 1 115 ? 5.406   10.921  34.188  1.00 21.46 ? 315  HIS B N   1 
ATOM   2194 C CA  . HIS B 1 115 ? 3.954   10.994  34.284  1.00 21.96 ? 315  HIS B CA  1 
ATOM   2195 C C   . HIS B 1 115 ? 3.416   10.094  35.389  1.00 22.00 ? 315  HIS B C   1 
ATOM   2196 O O   . HIS B 1 115 ? 2.222   9.794   35.438  1.00 21.27 ? 315  HIS B O   1 
ATOM   2197 C CB  . HIS B 1 115 ? 3.337   10.621  32.936  1.00 21.69 ? 315  HIS B CB  1 
ATOM   2198 C CG  . HIS B 1 115 ? 3.708   11.567  31.835  1.00 21.66 ? 315  HIS B CG  1 
ATOM   2199 N ND1 . HIS B 1 115 ? 4.003   11.138  30.554  1.00 23.71 ? 315  HIS B ND1 1 
ATOM   2200 C CD2 . HIS B 1 115 ? 3.832   12.909  31.820  1.00 21.39 ? 315  HIS B CD2 1 
ATOM   2201 C CE1 . HIS B 1 115 ? 4.294   12.185  29.806  1.00 22.28 ? 315  HIS B CE1 1 
ATOM   2202 N NE2 . HIS B 1 115 ? 4.199   13.273  30.543  1.00 25.40 ? 315  HIS B NE2 1 
ATOM   2203 N N   . GLU B 1 116 ? 4.315   9.678   36.276  1.00 22.45 ? 316  GLU B N   1 
ATOM   2204 C CA  . GLU B 1 116 ? 3.978   8.820   37.406  1.00 23.72 ? 316  GLU B CA  1 
ATOM   2205 C C   . GLU B 1 116 ? 3.110   7.635   36.996  1.00 22.40 ? 316  GLU B C   1 
ATOM   2206 O O   . GLU B 1 116 ? 2.009   7.447   37.513  1.00 23.71 ? 316  GLU B O   1 
ATOM   2207 C CB  . GLU B 1 116 ? 3.275   9.642   38.487  1.00 24.75 ? 316  GLU B CB  1 
ATOM   2208 C CG  . GLU B 1 116 ? 4.030   10.910  38.856  1.00 28.15 ? 316  GLU B CG  1 
ATOM   2209 C CD  . GLU B 1 116 ? 3.532   11.536  40.140  1.00 30.46 ? 316  GLU B CD  1 
ATOM   2210 O OE1 . GLU B 1 116 ? 2.317   11.803  40.242  1.00 32.88 ? 316  GLU B OE1 1 
ATOM   2211 O OE2 . GLU B 1 116 ? 4.362   11.761  41.047  1.00 33.13 ? 316  GLU B OE2 1 
ATOM   2212 N N   . ILE B 1 117 ? 3.628   6.833   36.072  1.00 19.82 ? 317  ILE B N   1 
ATOM   2213 C CA  . ILE B 1 117 ? 2.917   5.666   35.566  1.00 19.32 ? 317  ILE B CA  1 
ATOM   2214 C C   . ILE B 1 117 ? 3.496   4.348   36.080  1.00 19.63 ? 317  ILE B C   1 
ATOM   2215 O O   . ILE B 1 117 ? 4.702   4.125   36.018  1.00 18.09 ? 317  ILE B O   1 
ATOM   2216 C CB  . ILE B 1 117 ? 2.956   5.634   34.018  1.00 19.07 ? 317  ILE B CB  1 
ATOM   2217 C CG1 . ILE B 1 117 ? 2.332   6.913   33.451  1.00 18.52 ? 317  ILE B CG1 1 
ATOM   2218 C CG2 . ILE B 1 117 ? 2.256   4.386   33.501  1.00 18.70 ? 317  ILE B CG2 1 
ATOM   2219 C CD1 . ILE B 1 117 ? 0.865   7.110   33.800  1.00 18.61 ? 317  ILE B CD1 1 
ATOM   2220 N N   . GLY B 1 118 ? 2.621   3.484   36.589  1.00 19.47 ? 318  GLY B N   1 
ATOM   2221 C CA  . GLY B 1 118 ? 3.034   2.179   37.078  1.00 20.29 ? 318  GLY B CA  1 
ATOM   2222 C C   . GLY B 1 118 ? 4.073   2.091   38.184  1.00 20.99 ? 318  GLY B C   1 
ATOM   2223 O O   . GLY B 1 118 ? 4.894   1.173   38.179  1.00 20.67 ? 318  GLY B O   1 
ATOM   2224 N N   . PHE B 1 119 ? 4.044   3.021   39.133  1.00 21.98 ? 319  PHE B N   1 
ATOM   2225 C CA  . PHE B 1 119 ? 5.001   2.990   40.237  1.00 22.64 ? 319  PHE B CA  1 
ATOM   2226 C C   . PHE B 1 119 ? 4.963   1.648   40.961  1.00 23.59 ? 319  PHE B C   1 
ATOM   2227 O O   . PHE B 1 119 ? 3.908   1.023   41.081  1.00 23.62 ? 319  PHE B O   1 
ATOM   2228 C CB  . PHE B 1 119 ? 4.711   4.117   41.235  1.00 23.11 ? 319  PHE B CB  1 
ATOM   2229 C CG  . PHE B 1 119 ? 5.241   5.461   40.815  1.00 23.35 ? 319  PHE B CG  1 
ATOM   2230 C CD1 . PHE B 1 119 ? 5.188   6.541   41.689  1.00 22.77 ? 319  PHE B CD1 1 
ATOM   2231 C CD2 . PHE B 1 119 ? 5.815   5.644   39.558  1.00 22.26 ? 319  PHE B CD2 1 
ATOM   2232 C CE1 . PHE B 1 119 ? 5.685   7.788   41.317  1.00 21.97 ? 319  PHE B CE1 1 
ATOM   2233 C CE2 . PHE B 1 119 ? 6.314   6.887   39.178  1.00 22.27 ? 319  PHE B CE2 1 
ATOM   2234 C CZ  . PHE B 1 119 ? 6.256   7.959   40.062  1.00 23.28 ? 319  PHE B CZ  1 
ATOM   2235 N N   . GLY B 1 120 ? 6.121   1.209   41.440  1.00 22.95 ? 320  GLY B N   1 
ATOM   2236 C CA  . GLY B 1 120 ? 6.200   -0.057  42.143  1.00 21.81 ? 320  GLY B CA  1 
ATOM   2237 C C   . GLY B 1 120 ? 6.430   -1.239  41.223  1.00 20.97 ? 320  GLY B C   1 
ATOM   2238 O O   . GLY B 1 120 ? 6.634   -2.358  41.687  1.00 22.32 ? 320  GLY B O   1 
ATOM   2239 N N   . SER B 1 121 ? 6.406   -0.998  39.914  1.00 19.95 ? 321  SER B N   1 
ATOM   2240 C CA  . SER B 1 121 ? 6.608   -2.065  38.941  1.00 17.97 ? 321  SER B CA  1 
ATOM   2241 C C   . SER B 1 121 ? 8.080   -2.359  38.681  1.00 17.37 ? 321  SER B C   1 
ATOM   2242 O O   . SER B 1 121 ? 8.945   -1.513  38.910  1.00 16.63 ? 321  SER B O   1 
ATOM   2243 C CB  . SER B 1 121 ? 5.946   -1.702  37.609  1.00 18.16 ? 321  SER B CB  1 
ATOM   2244 O OG  . SER B 1 121 ? 4.561   -1.468  37.769  1.00 19.33 ? 321  SER B OG  1 
ATOM   2245 N N   . LYS B 1 122 ? 8.346   -3.570  38.206  1.00 19.10 ? 322  LYS B N   1 
ATOM   2246 C CA  . LYS B 1 122 ? 9.696   -3.997  37.860  1.00 19.35 ? 322  LYS B CA  1 
ATOM   2247 C C   . LYS B 1 122 ? 9.910   -3.528  36.420  1.00 19.29 ? 322  LYS B C   1 
ATOM   2248 O O   . LYS B 1 122 ? 9.178   -3.934  35.516  1.00 18.76 ? 322  LYS B O   1 
ATOM   2249 C CB  . LYS B 1 122 ? 9.801   -5.522  37.944  1.00 23.20 ? 322  LYS B CB  1 
ATOM   2250 C CG  . LYS B 1 122 ? 11.171  -6.087  37.605  1.00 26.12 ? 322  LYS B CG  1 
ATOM   2251 C CD  . LYS B 1 122 ? 11.183  -7.609  37.739  1.00 30.05 ? 322  LYS B CD  1 
ATOM   2252 C CE  . LYS B 1 122 ? 12.523  -8.201  37.315  1.00 29.89 ? 322  LYS B CE  1 
ATOM   2253 N NZ  . LYS B 1 122 ? 12.506  -9.694  37.298  1.00 31.14 ? 322  LYS B NZ  1 
ATOM   2254 N N   . VAL B 1 123 ? 10.905  -2.671  36.211  1.00 16.19 ? 323  VAL B N   1 
ATOM   2255 C CA  . VAL B 1 123 ? 11.178  -2.132  34.881  1.00 15.38 ? 323  VAL B CA  1 
ATOM   2256 C C   . VAL B 1 123 ? 12.657  -2.154  34.516  1.00 13.86 ? 323  VAL B C   1 
ATOM   2257 O O   . VAL B 1 123 ? 13.521  -2.254  35.384  1.00 15.29 ? 323  VAL B O   1 
ATOM   2258 C CB  . VAL B 1 123 ? 10.720  -0.658  34.777  1.00 15.93 ? 323  VAL B CB  1 
ATOM   2259 C CG1 . VAL B 1 123 ? 9.254   -0.526  35.159  1.00 16.70 ? 323  VAL B CG1 1 
ATOM   2260 C CG2 . VAL B 1 123 ? 11.579  0.212   35.681  1.00 17.06 ? 323  VAL B CG2 1 
ATOM   2261 N N   . THR B 1 124 ? 12.936  -2.066  33.219  1.00 12.45 ? 324  THR B N   1 
ATOM   2262 C CA  . THR B 1 124 ? 14.309  -2.002  32.739  1.00 11.72 ? 324  THR B CA  1 
ATOM   2263 C C   . THR B 1 124 ? 14.369  -0.810  31.794  1.00 12.44 ? 324  THR B C   1 
ATOM   2264 O O   . THR B 1 124 ? 13.330  -0.299  31.369  1.00 10.12 ? 324  THR B O   1 
ATOM   2265 C CB  . THR B 1 124 ? 14.748  -3.271  31.978  1.00 11.65 ? 324  THR B CB  1 
ATOM   2266 O OG1 . THR B 1 124 ? 16.169  -3.226  31.780  1.00 12.93 ? 324  THR B OG1 1 
ATOM   2267 C CG2 . THR B 1 124 ? 14.065  -3.359  30.614  1.00 9.59  ? 324  THR B CG2 1 
ATOM   2268 N N   . THR B 1 125 ? 15.579  -0.365  31.487  1.00 12.55 ? 325  THR B N   1 
ATOM   2269 C CA  . THR B 1 125 ? 15.795  0.771   30.596  1.00 12.67 ? 325  THR B CA  1 
ATOM   2270 C C   . THR B 1 125 ? 17.176  0.600   29.983  1.00 11.78 ? 325  THR B C   1 
ATOM   2271 O O   . THR B 1 125 ? 17.859  -0.388  30.243  1.00 11.61 ? 325  THR B O   1 
ATOM   2272 C CB  . THR B 1 125 ? 15.833  2.102   31.365  1.00 12.08 ? 325  THR B CB  1 
ATOM   2273 O OG1 . THR B 1 125 ? 17.038  2.155   32.145  1.00 14.27 ? 325  THR B OG1 1 
ATOM   2274 C CG2 . THR B 1 125 ? 14.622  2.240   32.292  1.00 10.46 ? 325  THR B CG2 1 
ATOM   2275 N N   . HIS B 1 126 ? 17.593  1.562   29.171  1.00 11.11 ? 326  HIS B N   1 
ATOM   2276 C CA  . HIS B 1 126 ? 18.931  1.495   28.607  1.00 11.45 ? 326  HIS B CA  1 
ATOM   2277 C C   . HIS B 1 126 ? 19.821  1.753   29.821  1.00 12.02 ? 326  HIS B C   1 
ATOM   2278 O O   . HIS B 1 126 ? 19.415  2.458   30.741  1.00 9.22  ? 326  HIS B O   1 
ATOM   2279 C CB  . HIS B 1 126 ? 19.155  2.607   27.584  1.00 11.56 ? 326  HIS B CB  1 
ATOM   2280 C CG  . HIS B 1 126 ? 20.521  2.597   26.992  1.00 11.92 ? 326  HIS B CG  1 
ATOM   2281 N ND1 . HIS B 1 126 ? 20.844  1.846   25.873  1.00 14.14 ? 326  HIS B ND1 1 
ATOM   2282 C CD2 . HIS B 1 126 ? 21.678  3.168   27.395  1.00 10.59 ? 326  HIS B CD2 1 
ATOM   2283 C CE1 . HIS B 1 126 ? 22.134  1.958   25.627  1.00 8.86  ? 326  HIS B CE1 1 
ATOM   2284 N NE2 . HIS B 1 126 ? 22.666  2.758   26.542  1.00 14.16 ? 326  HIS B NE2 1 
ATOM   2285 N N   . PRO B 1 127 ? 21.029  1.175   29.854  1.00 13.14 ? 327  PRO B N   1 
ATOM   2286 C CA  . PRO B 1 127 ? 21.898  1.414   31.015  1.00 14.26 ? 327  PRO B CA  1 
ATOM   2287 C C   . PRO B 1 127 ? 22.081  2.894   31.361  1.00 14.72 ? 327  PRO B C   1 
ATOM   2288 O O   . PRO B 1 127 ? 22.083  3.273   32.533  1.00 16.22 ? 327  PRO B O   1 
ATOM   2289 C CB  . PRO B 1 127 ? 23.207  0.757   30.595  1.00 13.60 ? 327  PRO B CB  1 
ATOM   2290 C CG  . PRO B 1 127 ? 22.734  -0.424  29.811  1.00 13.03 ? 327  PRO B CG  1 
ATOM   2291 C CD  . PRO B 1 127 ? 21.619  0.164   28.957  1.00 13.12 ? 327  PRO B CD  1 
ATOM   2292 N N   . LEU B 1 128 ? 22.229  3.729   30.338  1.00 13.80 ? 328  LEU B N   1 
ATOM   2293 C CA  . LEU B 1 128 ? 22.433  5.157   30.543  1.00 14.84 ? 328  LEU B CA  1 
ATOM   2294 C C   . LEU B 1 128 ? 21.210  5.911   31.050  1.00 15.42 ? 328  LEU B C   1 
ATOM   2295 O O   . LEU B 1 128 ? 21.306  7.094   31.374  1.00 17.11 ? 328  LEU B O   1 
ATOM   2296 C CB  . LEU B 1 128 ? 22.926  5.805   29.248  1.00 14.14 ? 328  LEU B CB  1 
ATOM   2297 C CG  . LEU B 1 128 ? 24.307  5.338   28.788  1.00 15.09 ? 328  LEU B CG  1 
ATOM   2298 C CD1 . LEU B 1 128 ? 24.655  6.011   27.471  1.00 13.61 ? 328  LEU B CD1 1 
ATOM   2299 C CD2 . LEU B 1 128 ? 25.348  5.667   29.856  1.00 14.83 ? 328  LEU B CD2 1 
ATOM   2300 N N   . ALA B 1 129 ? 20.065  5.238   31.120  1.00 15.02 ? 329  ALA B N   1 
ATOM   2301 C CA  . ALA B 1 129 ? 18.845  5.888   31.594  1.00 14.55 ? 329  ALA B CA  1 
ATOM   2302 C C   . ALA B 1 129 ? 18.418  5.354   32.956  1.00 13.54 ? 329  ALA B C   1 
ATOM   2303 O O   . ALA B 1 129 ? 17.414  5.792   33.517  1.00 16.98 ? 329  ALA B O   1 
ATOM   2304 C CB  . ALA B 1 129 ? 17.715  5.692   30.582  1.00 15.31 ? 329  ALA B CB  1 
ATOM   2305 N N   . ARG B 1 130 ? 19.191  4.419   33.490  1.00 12.77 ? 330  ARG B N   1 
ATOM   2306 C CA  . ARG B 1 130 ? 18.874  3.815   34.778  1.00 13.42 ? 330  ARG B CA  1 
ATOM   2307 C C   . ARG B 1 130 ? 18.785  4.794   35.947  1.00 14.69 ? 330  ARG B C   1 
ATOM   2308 O O   . ARG B 1 130 ? 17.783  4.829   36.658  1.00 13.35 ? 330  ARG B O   1 
ATOM   2309 C CB  . ARG B 1 130 ? 19.892  2.723   35.108  1.00 13.39 ? 330  ARG B CB  1 
ATOM   2310 C CG  . ARG B 1 130 ? 19.659  2.070   36.456  1.00 14.30 ? 330  ARG B CG  1 
ATOM   2311 C CD  . ARG B 1 130 ? 20.527  0.841   36.642  1.00 12.30 ? 330  ARG B CD  1 
ATOM   2312 N NE  . ARG B 1 130 ? 20.189  0.156   37.884  1.00 13.71 ? 330  ARG B NE  1 
ATOM   2313 C CZ  . ARG B 1 130 ? 20.569  -1.079  38.190  1.00 12.03 ? 330  ARG B CZ  1 
ATOM   2314 N NH1 . ARG B 1 130 ? 21.316  -1.778  37.348  1.00 15.40 ? 330  ARG B NH1 1 
ATOM   2315 N NH2 . ARG B 1 130 ? 20.187  -1.621  39.337  1.00 11.93 ? 330  ARG B NH2 1 
ATOM   2316 N N   . ASP B 1 131 ? 19.833  5.586   36.157  1.00 15.80 ? 331  ASP B N   1 
ATOM   2317 C CA  . ASP B 1 131 ? 19.822  6.534   37.263  1.00 17.35 ? 331  ASP B CA  1 
ATOM   2318 C C   . ASP B 1 131 ? 18.634  7.485   37.201  1.00 17.48 ? 331  ASP B C   1 
ATOM   2319 O O   . ASP B 1 131 ? 18.010  7.774   38.221  1.00 17.15 ? 331  ASP B O   1 
ATOM   2320 C CB  . ASP B 1 131 ? 21.130  7.323   37.294  1.00 18.42 ? 331  ASP B CB  1 
ATOM   2321 C CG  . ASP B 1 131 ? 22.333  6.433   37.528  1.00 21.34 ? 331  ASP B CG  1 
ATOM   2322 O OD1 . ASP B 1 131 ? 22.139  5.218   37.740  1.00 21.01 ? 331  ASP B OD1 1 
ATOM   2323 O OD2 . ASP B 1 131 ? 23.471  6.943   37.500  1.00 21.06 ? 331  ASP B OD2 1 
ATOM   2324 N N   . LYS B 1 132 ? 18.316  7.963   36.002  1.00 18.05 ? 332  LYS B N   1 
ATOM   2325 C CA  . LYS B 1 132 ? 17.196  8.879   35.815  1.00 17.79 ? 332  LYS B CA  1 
ATOM   2326 C C   . LYS B 1 132 ? 15.882  8.188   36.173  1.00 17.47 ? 332  LYS B C   1 
ATOM   2327 O O   . LYS B 1 132 ? 15.053  8.733   36.905  1.00 18.00 ? 332  LYS B O   1 
ATOM   2328 C CB  . LYS B 1 132 ? 17.155  9.351   34.359  1.00 18.79 ? 332  LYS B CB  1 
ATOM   2329 C CG  . LYS B 1 132 ? 16.113  10.416  34.055  1.00 19.65 ? 332  LYS B CG  1 
ATOM   2330 C CD  . LYS B 1 132 ? 16.227  10.857  32.603  1.00 23.37 ? 332  LYS B CD  1 
ATOM   2331 C CE  . LYS B 1 132 ? 15.444  12.132  32.330  1.00 25.90 ? 332  LYS B CE  1 
ATOM   2332 N NZ  . LYS B 1 132 ? 13.989  11.960  32.540  1.00 30.52 ? 332  LYS B NZ  1 
ATOM   2333 N N   . MET B 1 133 ? 15.710  6.978   35.657  1.00 16.96 ? 333  MET B N   1 
ATOM   2334 C CA  . MET B 1 133 ? 14.512  6.183   35.894  1.00 16.17 ? 333  MET B CA  1 
ATOM   2335 C C   . MET B 1 133 ? 14.317  5.800   37.361  1.00 16.49 ? 333  MET B C   1 
ATOM   2336 O O   . MET B 1 133 ? 13.192  5.759   37.860  1.00 14.15 ? 333  MET B O   1 
ATOM   2337 C CB  . MET B 1 133 ? 14.576  4.905   35.059  1.00 15.02 ? 333  MET B CB  1 
ATOM   2338 C CG  . MET B 1 133 ? 13.331  4.050   35.136  1.00 14.93 ? 333  MET B CG  1 
ATOM   2339 S SD  . MET B 1 133 ? 11.964  4.822   34.269  1.00 14.20 ? 333  MET B SD  1 
ATOM   2340 C CE  . MET B 1 133 ? 10.752  3.507   34.340  1.00 12.41 ? 333  MET B CE  1 
ATOM   2341 N N   . MET B 1 134 ? 15.415  5.526   38.051  1.00 16.43 ? 334  MET B N   1 
ATOM   2342 C CA  . MET B 1 134 ? 15.342  5.102   39.442  1.00 17.53 ? 334  MET B CA  1 
ATOM   2343 C C   . MET B 1 134 ? 15.427  6.208   40.487  1.00 19.09 ? 334  MET B C   1 
ATOM   2344 O O   . MET B 1 134 ? 15.450  5.927   41.687  1.00 18.96 ? 334  MET B O   1 
ATOM   2345 C CB  . MET B 1 134 ? 16.418  4.046   39.703  1.00 16.56 ? 334  MET B CB  1 
ATOM   2346 C CG  . MET B 1 134 ? 16.246  2.788   38.861  1.00 15.92 ? 334  MET B CG  1 
ATOM   2347 S SD  . MET B 1 134 ? 14.634  1.986   39.092  1.00 16.43 ? 334  MET B SD  1 
ATOM   2348 C CE  . MET B 1 134 ? 14.823  1.338   40.752  1.00 15.74 ? 334  MET B CE  1 
ATOM   2349 N N   . ASN B 1 135 ? 15.474  7.458   40.041  1.00 20.95 ? 335  ASN B N   1 
ATOM   2350 C CA  . ASN B 1 135 ? 15.533  8.582   40.969  1.00 22.63 ? 335  ASN B CA  1 
ATOM   2351 C C   . ASN B 1 135 ? 14.214  8.628   41.735  1.00 23.63 ? 335  ASN B C   1 
ATOM   2352 O O   . ASN B 1 135 ? 13.147  8.739   41.133  1.00 23.49 ? 335  ASN B O   1 
ATOM   2353 C CB  . ASN B 1 135 ? 15.724  9.898   40.213  1.00 25.53 ? 335  ASN B CB  1 
ATOM   2354 C CG  . ASN B 1 135 ? 15.779  11.099  41.141  1.00 28.29 ? 335  ASN B CG  1 
ATOM   2355 O OD1 . ASN B 1 135 ? 15.597  12.239  40.714  1.00 31.60 ? 335  ASN B OD1 1 
ATOM   2356 N ND2 . ASN B 1 135 ? 16.040  10.847  42.418  1.00 29.06 ? 335  ASN B ND2 1 
ATOM   2357 N N   . GLY B 1 136 ? 14.288  8.537   43.058  1.00 24.26 ? 336  GLY B N   1 
ATOM   2358 C CA  . GLY B 1 136 ? 13.081  8.568   43.866  1.00 24.11 ? 336  GLY B CA  1 
ATOM   2359 C C   . GLY B 1 136 ? 12.610  7.173   44.236  1.00 24.00 ? 336  GLY B C   1 
ATOM   2360 O O   . GLY B 1 136 ? 11.632  7.014   44.970  1.00 24.34 ? 336  GLY B O   1 
ATOM   2361 N N   . GLY B 1 137 ? 13.308  6.166   43.723  1.00 23.12 ? 337  GLY B N   1 
ATOM   2362 C CA  . GLY B 1 137 ? 12.963  4.784   44.008  1.00 22.13 ? 337  GLY B CA  1 
ATOM   2363 C C   . GLY B 1 137 ? 11.500  4.451   43.778  1.00 22.82 ? 337  GLY B C   1 
ATOM   2364 O O   . GLY B 1 137 ? 10.854  3.836   44.620  1.00 23.81 ? 337  GLY B O   1 
ATOM   2365 N N   . HIS B 1 138 ? 10.969  4.846   42.629  1.00 22.20 ? 338  HIS B N   1 
ATOM   2366 C CA  . HIS B 1 138 ? 9.569   4.582   42.323  1.00 21.33 ? 338  HIS B CA  1 
ATOM   2367 C C   . HIS B 1 138 ? 9.344   3.289   41.551  1.00 20.87 ? 338  HIS B C   1 
ATOM   2368 O O   . HIS B 1 138 ? 8.216   2.979   41.166  1.00 21.22 ? 338  HIS B O   1 
ATOM   2369 C CB  . HIS B 1 138 ? 8.987   5.757   41.545  1.00 21.74 ? 338  HIS B CB  1 
ATOM   2370 C CG  . HIS B 1 138 ? 8.970   7.038   42.324  1.00 23.24 ? 338  HIS B CG  1 
ATOM   2371 N ND1 . HIS B 1 138 ? 8.292   7.172   43.510  1.00 24.06 ? 338  HIS B ND1 1 
ATOM   2372 C CD2 . HIS B 1 138 ? 9.556   8.234   42.082  1.00 22.09 ? 338  HIS B CD2 1 
ATOM   2373 C CE1 . HIS B 1 138 ? 8.457   8.400   43.975  1.00 23.76 ? 338  HIS B CE1 1 
ATOM   2374 N NE2 . HIS B 1 138 ? 9.222   9.063   43.123  1.00 24.51 ? 338  HIS B NE2 1 
ATOM   2375 N N   . TYR B 1 139 ? 10.418  2.536   41.334  1.00 18.56 ? 339  TYR B N   1 
ATOM   2376 C CA  . TYR B 1 139 ? 10.345  1.275   40.606  1.00 16.80 ? 339  TYR B CA  1 
ATOM   2377 C C   . TYR B 1 139 ? 11.375  0.295   41.159  1.00 17.75 ? 339  TYR B C   1 
ATOM   2378 O O   . TYR B 1 139 ? 12.172  0.640   42.031  1.00 18.70 ? 339  TYR B O   1 
ATOM   2379 C CB  . TYR B 1 139 ? 10.654  1.501   39.119  1.00 16.61 ? 339  TYR B CB  1 
ATOM   2380 C CG  . TYR B 1 139 ? 9.731   2.466   38.410  1.00 16.61 ? 339  TYR B CG  1 
ATOM   2381 C CD1 . TYR B 1 139 ? 8.445   2.083   38.037  1.00 17.64 ? 339  TYR B CD1 1 
ATOM   2382 C CD2 . TYR B 1 139 ? 10.147  3.761   38.103  1.00 16.34 ? 339  TYR B CD2 1 
ATOM   2383 C CE1 . TYR B 1 139 ? 7.595   2.964   37.374  1.00 16.37 ? 339  TYR B CE1 1 
ATOM   2384 C CE2 . TYR B 1 139 ? 9.305   4.653   37.441  1.00 15.69 ? 339  TYR B CE2 1 
ATOM   2385 C CZ  . TYR B 1 139 ? 8.032   4.245   37.079  1.00 15.78 ? 339  TYR B CZ  1 
ATOM   2386 O OH  . TYR B 1 139 ? 7.198   5.112   36.417  1.00 15.77 ? 339  TYR B OH  1 
ATOM   2387 N N   . THR B 1 140 ? 11.332  -0.929  40.647  1.00 19.02 ? 340  THR B N   1 
ATOM   2388 C CA  . THR B 1 140 ? 12.289  -1.972  40.998  1.00 20.23 ? 340  THR B CA  1 
ATOM   2389 C C   . THR B 1 140 ? 12.995  -2.194  39.668  1.00 19.08 ? 340  THR B C   1 
ATOM   2390 O O   . THR B 1 140 ? 12.343  -2.477  38.663  1.00 17.89 ? 340  THR B O   1 
ATOM   2391 C CB  . THR B 1 140 ? 11.599  -3.281  41.421  1.00 21.98 ? 340  THR B CB  1 
ATOM   2392 O OG1 . THR B 1 140 ? 10.998  -3.109  42.709  1.00 24.95 ? 340  THR B OG1 1 
ATOM   2393 C CG2 . THR B 1 140 ? 12.613  -4.426  41.475  1.00 22.21 ? 340  THR B CG2 1 
ATOM   2394 N N   . TYR B 1 141 ? 14.316  -2.056  39.643  1.00 18.48 ? 341  TYR B N   1 
ATOM   2395 C CA  . TYR B 1 141 ? 15.034  -2.217  38.385  1.00 17.20 ? 341  TYR B CA  1 
ATOM   2396 C C   . TYR B 1 141 ? 15.265  -3.665  37.988  1.00 17.21 ? 341  TYR B C   1 
ATOM   2397 O O   . TYR B 1 141 ? 15.376  -4.553  38.839  1.00 16.68 ? 341  TYR B O   1 
ATOM   2398 C CB  . TYR B 1 141 ? 16.380  -1.493  38.436  1.00 15.45 ? 341  TYR B CB  1 
ATOM   2399 C CG  . TYR B 1 141 ? 16.921  -1.139  37.067  1.00 15.24 ? 341  TYR B CG  1 
ATOM   2400 C CD1 . TYR B 1 141 ? 16.357  -0.102  36.324  1.00 14.25 ? 341  TYR B CD1 1 
ATOM   2401 C CD2 . TYR B 1 141 ? 17.983  -1.849  36.509  1.00 14.58 ? 341  TYR B CD2 1 
ATOM   2402 C CE1 . TYR B 1 141 ? 16.838  0.221   35.057  1.00 13.52 ? 341  TYR B CE1 1 
ATOM   2403 C CE2 . TYR B 1 141 ? 18.475  -1.535  35.240  1.00 14.85 ? 341  TYR B CE2 1 
ATOM   2404 C CZ  . TYR B 1 141 ? 17.897  -0.497  34.522  1.00 16.01 ? 341  TYR B CZ  1 
ATOM   2405 O OH  . TYR B 1 141 ? 18.381  -0.166  33.276  1.00 14.71 ? 341  TYR B OH  1 
ATOM   2406 N N   . SER B 1 142 ? 15.348  -3.890  36.681  1.00 15.75 ? 342  SER B N   1 
ATOM   2407 C CA  . SER B 1 142 ? 15.584  -5.217  36.132  1.00 15.58 ? 342  SER B CA  1 
ATOM   2408 C C   . SER B 1 142 ? 16.692  -5.148  35.088  1.00 15.61 ? 342  SER B C   1 
ATOM   2409 O O   . SER B 1 142 ? 16.819  -4.153  34.370  1.00 15.82 ? 342  SER B O   1 
ATOM   2410 C CB  . SER B 1 142 ? 14.309  -5.766  35.488  1.00 14.99 ? 342  SER B CB  1 
ATOM   2411 O OG  . SER B 1 142 ? 14.575  -6.981  34.811  1.00 16.49 ? 342  SER B OG  1 
ATOM   2412 N N   . GLU B 1 143 ? 17.482  -6.214  35.008  1.00 15.86 ? 343  GLU B N   1 
ATOM   2413 C CA  . GLU B 1 143 ? 18.587  -6.300  34.062  1.00 18.44 ? 343  GLU B CA  1 
ATOM   2414 C C   . GLU B 1 143 ? 18.153  -7.067  32.813  1.00 16.77 ? 343  GLU B C   1 
ATOM   2415 O O   . GLU B 1 143 ? 18.890  -7.140  31.832  1.00 16.77 ? 343  GLU B O   1 
ATOM   2416 C CB  . GLU B 1 143 ? 19.774  -7.019  34.712  1.00 22.14 ? 343  GLU B CB  1 
ATOM   2417 C CG  . GLU B 1 143 ? 21.123  -6.370  34.466  1.00 27.60 ? 343  GLU B CG  1 
ATOM   2418 C CD  . GLU B 1 143 ? 21.275  -5.052  35.198  1.00 28.98 ? 343  GLU B CD  1 
ATOM   2419 O OE1 . GLU B 1 143 ? 20.498  -4.121  34.908  1.00 32.98 ? 343  GLU B OE1 1 
ATOM   2420 O OE2 . GLU B 1 143 ? 22.168  -4.947  36.066  1.00 29.55 ? 343  GLU B OE2 1 
ATOM   2421 N N   . ASN B 1 144 ? 16.958  -7.644  32.856  1.00 15.94 ? 344  ASN B N   1 
ATOM   2422 C CA  . ASN B 1 144 ? 16.444  -8.405  31.722  1.00 15.21 ? 344  ASN B CA  1 
ATOM   2423 C C   . ASN B 1 144 ? 16.349  -7.540  30.469  1.00 14.17 ? 344  ASN B C   1 
ATOM   2424 O O   . ASN B 1 144 ? 15.990  -6.364  30.540  1.00 13.75 ? 344  ASN B O   1 
ATOM   2425 C CB  . ASN B 1 144 ? 15.068  -8.982  32.060  1.00 17.16 ? 344  ASN B CB  1 
ATOM   2426 C CG  . ASN B 1 144 ? 15.140  -10.094 33.093  1.00 19.69 ? 344  ASN B CG  1 
ATOM   2427 O OD1 . ASN B 1 144 ? 14.158  -10.379 33.780  1.00 22.04 ? 344  ASN B OD1 1 
ATOM   2428 N ND2 . ASN B 1 144 ? 16.300  -10.737 33.197  1.00 18.71 ? 344  ASN B ND2 1 
ATOM   2429 N N   . ARG B 1 145 ? 16.678  -8.127  29.325  1.00 15.10 ? 345  ARG B N   1 
ATOM   2430 C CA  . ARG B 1 145 ? 16.630  -7.414  28.054  1.00 14.62 ? 345  ARG B CA  1 
ATOM   2431 C C   . ARG B 1 145 ? 15.206  -6.933  27.804  1.00 15.53 ? 345  ARG B C   1 
ATOM   2432 O O   . ARG B 1 145 ? 14.984  -5.877  27.213  1.00 14.84 ? 345  ARG B O   1 
ATOM   2433 C CB  . ARG B 1 145 ? 17.132  -8.331  26.941  1.00 14.69 ? 345  ARG B CB  1 
ATOM   2434 C CG  . ARG B 1 145 ? 18.603  -8.701  27.133  1.00 13.78 ? 345  ARG B CG  1 
ATOM   2435 C CD  . ARG B 1 145 ? 19.053  -9.779  26.173  1.00 14.15 ? 345  ARG B CD  1 
ATOM   2436 N NE  . ARG B 1 145 ? 18.919  -9.358  24.784  1.00 14.93 ? 345  ARG B NE  1 
ATOM   2437 C CZ  . ARG B 1 145 ? 19.690  -8.451  24.193  1.00 16.40 ? 345  ARG B CZ  1 
ATOM   2438 N NH1 . ARG B 1 145 ? 20.666  -7.856  24.868  1.00 14.93 ? 345  ARG B NH1 1 
ATOM   2439 N NH2 . ARG B 1 145 ? 19.481  -8.137  22.922  1.00 17.05 ? 345  ARG B NH2 1 
ATOM   2440 N N   . VAL B 1 146 ? 14.243  -7.724  28.260  1.00 15.16 ? 346  VAL B N   1 
ATOM   2441 C CA  . VAL B 1 146 ? 12.839  -7.359  28.163  1.00 14.90 ? 346  VAL B CA  1 
ATOM   2442 C C   . VAL B 1 146 ? 12.228  -7.691  29.513  1.00 15.30 ? 346  VAL B C   1 
ATOM   2443 O O   . VAL B 1 146 ? 12.456  -8.776  30.052  1.00 14.73 ? 346  VAL B O   1 
ATOM   2444 C CB  . VAL B 1 146 ? 12.078  -8.156  27.087  1.00 14.11 ? 346  VAL B CB  1 
ATOM   2445 C CG1 . VAL B 1 146 ? 10.600  -7.780  27.132  1.00 15.20 ? 346  VAL B CG1 1 
ATOM   2446 C CG2 . VAL B 1 146 ? 12.649  -7.866  25.715  1.00 13.42 ? 346  VAL B CG2 1 
ATOM   2447 N N   . GLU B 1 147 ? 11.468  -6.755  30.068  1.00 15.58 ? 347  GLU B N   1 
ATOM   2448 C CA  . GLU B 1 147 ? 10.827  -6.979  31.355  1.00 17.80 ? 347  GLU B CA  1 
ATOM   2449 C C   . GLU B 1 147 ? 9.339   -6.675  31.268  1.00 18.37 ? 347  GLU B C   1 
ATOM   2450 O O   . GLU B 1 147 ? 8.937   -5.611  30.797  1.00 17.39 ? 347  GLU B O   1 
ATOM   2451 C CB  . GLU B 1 147 ? 11.462  -6.103  32.436  1.00 19.08 ? 347  GLU B CB  1 
ATOM   2452 C CG  . GLU B 1 147 ? 10.909  -6.373  33.829  1.00 20.50 ? 347  GLU B CG  1 
ATOM   2453 C CD  . GLU B 1 147 ? 11.225  -7.777  34.313  1.00 23.75 ? 347  GLU B CD  1 
ATOM   2454 O OE1 . GLU B 1 147 ? 10.385  -8.362  35.026  1.00 28.57 ? 347  GLU B OE1 1 
ATOM   2455 O OE2 . GLU B 1 147 ? 12.317  -8.294  33.993  1.00 23.92 ? 347  GLU B OE2 1 
ATOM   2456 N N   . LYS B 1 148 ? 8.523   -7.624  31.717  1.00 20.12 ? 348  LYS B N   1 
ATOM   2457 C CA  . LYS B 1 148 ? 7.078   -7.456  31.702  1.00 20.78 ? 348  LYS B CA  1 
ATOM   2458 C C   . LYS B 1 148 ? 6.515   -7.714  33.093  1.00 21.18 ? 348  LYS B C   1 
ATOM   2459 O O   . LYS B 1 148 ? 6.548   -8.838  33.593  1.00 22.75 ? 348  LYS B O   1 
ATOM   2460 C CB  . LYS B 1 148 ? 6.438   -8.416  30.696  1.00 21.37 ? 348  LYS B CB  1 
ATOM   2461 C CG  . LYS B 1 148 ? 4.938   -8.218  30.509  1.00 22.04 ? 348  LYS B CG  1 
ATOM   2462 C CD  . LYS B 1 148 ? 4.371   -9.208  29.504  1.00 22.49 ? 348  LYS B CD  1 
ATOM   2463 C CE  . LYS B 1 148 ? 2.876   -9.001  29.298  1.00 23.64 ? 348  LYS B CE  1 
ATOM   2464 N NZ  . LYS B 1 148 ? 2.119   -9.164  30.570  1.00 24.18 ? 348  LYS B NZ  1 
ATOM   2465 N N   . ASP B 1 149 ? 6.015   -6.658  33.719  1.00 21.13 ? 349  ASP B N   1 
ATOM   2466 C CA  . ASP B 1 149 ? 5.427   -6.758  35.045  1.00 21.15 ? 349  ASP B CA  1 
ATOM   2467 C C   . ASP B 1 149 ? 4.009   -6.213  34.941  1.00 20.19 ? 349  ASP B C   1 
ATOM   2468 O O   . ASP B 1 149 ? 3.792   -5.002  34.954  1.00 20.48 ? 349  ASP B O   1 
ATOM   2469 C CB  . ASP B 1 149 ? 6.250   -5.949  36.052  1.00 20.94 ? 349  ASP B CB  1 
ATOM   2470 C CG  . ASP B 1 149 ? 5.774   -6.141  37.479  1.00 21.99 ? 349  ASP B CG  1 
ATOM   2471 O OD1 . ASP B 1 149 ? 5.094   -7.155  37.746  1.00 22.46 ? 349  ASP B OD1 1 
ATOM   2472 O OD2 . ASP B 1 149 ? 6.089   -5.288  38.333  1.00 21.27 ? 349  ASP B OD2 1 
ATOM   2473 N N   . GLY B 1 150 ? 3.044   -7.120  34.823  1.00 20.49 ? 350  GLY B N   1 
ATOM   2474 C CA  . GLY B 1 150 ? 1.664   -6.701  34.689  1.00 21.12 ? 350  GLY B CA  1 
ATOM   2475 C C   . GLY B 1 150 ? 1.488   -6.077  33.318  1.00 19.93 ? 350  GLY B C   1 
ATOM   2476 O O   . GLY B 1 150 ? 1.909   -6.653  32.316  1.00 20.28 ? 350  GLY B O   1 
ATOM   2477 N N   . LEU B 1 151 ? 0.887   -4.894  33.273  1.00 20.47 ? 351  LEU B N   1 
ATOM   2478 C CA  . LEU B 1 151 ? 0.665   -4.201  32.008  1.00 20.76 ? 351  LEU B CA  1 
ATOM   2479 C C   . LEU B 1 151 ? 1.767   -3.185  31.730  1.00 19.51 ? 351  LEU B C   1 
ATOM   2480 O O   . LEU B 1 151 ? 1.552   -2.193  31.031  1.00 17.02 ? 351  LEU B O   1 
ATOM   2481 C CB  . LEU B 1 151 ? -0.695  -3.494  32.017  1.00 21.51 ? 351  LEU B CB  1 
ATOM   2482 C CG  . LEU B 1 151 ? -1.955  -4.367  32.048  1.00 23.78 ? 351  LEU B CG  1 
ATOM   2483 C CD1 . LEU B 1 151 ? -1.925  -5.348  30.883  1.00 23.33 ? 351  LEU B CD1 1 
ATOM   2484 C CD2 . LEU B 1 151 ? -2.047  -5.108  33.375  1.00 25.29 ? 351  LEU B CD2 1 
ATOM   2485 N N   . ILE B 1 152 ? 2.943   -3.429  32.295  1.00 18.34 ? 352  ILE B N   1 
ATOM   2486 C CA  . ILE B 1 152 ? 4.080   -2.543  32.092  1.00 17.65 ? 352  ILE B CA  1 
ATOM   2487 C C   . ILE B 1 152 ? 5.184   -3.371  31.455  1.00 16.69 ? 352  ILE B C   1 
ATOM   2488 O O   . ILE B 1 152 ? 5.771   -4.234  32.101  1.00 15.27 ? 352  ILE B O   1 
ATOM   2489 C CB  . ILE B 1 152 ? 4.586   -1.958  33.426  1.00 18.18 ? 352  ILE B CB  1 
ATOM   2490 C CG1 . ILE B 1 152 ? 3.464   -1.180  34.116  1.00 18.83 ? 352  ILE B CG1 1 
ATOM   2491 C CG2 . ILE B 1 152 ? 5.776   -1.042  33.172  1.00 15.49 ? 352  ILE B CG2 1 
ATOM   2492 C CD1 . ILE B 1 152 ? 3.011   0.055   33.361  1.00 18.39 ? 352  ILE B CD1 1 
ATOM   2493 N N   . LEU B 1 153 ? 5.448   -3.112  30.179  1.00 14.95 ? 353  LEU B N   1 
ATOM   2494 C CA  . LEU B 1 153 ? 6.465   -3.844  29.435  1.00 14.61 ? 353  LEU B CA  1 
ATOM   2495 C C   . LEU B 1 153 ? 7.593   -2.895  29.036  1.00 12.86 ? 353  LEU B C   1 
ATOM   2496 O O   . LEU B 1 153 ? 7.363   -1.882  28.376  1.00 12.53 ? 353  LEU B O   1 
ATOM   2497 C CB  . LEU B 1 153 ? 5.824   -4.481  28.193  1.00 15.33 ? 353  LEU B CB  1 
ATOM   2498 C CG  . LEU B 1 153 ? 6.604   -5.500  27.356  1.00 17.32 ? 353  LEU B CG  1 
ATOM   2499 C CD1 . LEU B 1 153 ? 5.662   -6.191  26.378  1.00 20.08 ? 353  LEU B CD1 1 
ATOM   2500 C CD2 . LEU B 1 153 ? 7.722   -4.808  26.609  1.00 15.71 ? 353  LEU B CD2 1 
ATOM   2501 N N   . THR B 1 154 ? 8.813   -3.223  29.448  1.00 10.36 ? 354  THR B N   1 
ATOM   2502 C CA  . THR B 1 154 ? 9.963   -2.384  29.133  1.00 11.51 ? 354  THR B CA  1 
ATOM   2503 C C   . THR B 1 154 ? 11.108  -3.151  28.483  1.00 10.27 ? 354  THR B C   1 
ATOM   2504 O O   . THR B 1 154 ? 11.200  -4.374  28.591  1.00 11.19 ? 354  THR B O   1 
ATOM   2505 C CB  . THR B 1 154 ? 10.488  -1.679  30.401  1.00 12.53 ? 354  THR B CB  1 
ATOM   2506 O OG1 . THR B 1 154 ? 10.730  -2.650  31.428  1.00 11.35 ? 354  THR B OG1 1 
ATOM   2507 C CG2 . THR B 1 154 ? 9.471   -0.668  30.901  1.00 11.57 ? 354  THR B CG2 1 
ATOM   2508 N N   . SER B 1 155 ? 11.979  -2.423  27.791  1.00 9.06  ? 355  SER B N   1 
ATOM   2509 C CA  . SER B 1 155 ? 13.120  -3.038  27.135  1.00 10.86 ? 355  SER B CA  1 
ATOM   2510 C C   . SER B 1 155 ? 14.317  -2.094  27.192  1.00 9.49  ? 355  SER B C   1 
ATOM   2511 O O   . SER B 1 155 ? 14.168  -0.913  27.512  1.00 9.93  ? 355  SER B O   1 
ATOM   2512 C CB  . SER B 1 155 ? 12.777  -3.413  25.696  1.00 9.50  ? 355  SER B CB  1 
ATOM   2513 O OG  . SER B 1 155 ? 13.634  -4.447  25.245  1.00 9.42  ? 355  SER B OG  1 
ATOM   2514 N N   . ARG B 1 156 ? 15.494  -2.610  26.843  1.00 11.99 ? 356  ARG B N   1 
ATOM   2515 C CA  . ARG B 1 156 ? 16.744  -1.861  26.970  1.00 12.14 ? 356  ARG B CA  1 
ATOM   2516 C C   . ARG B 1 156 ? 17.324  -0.952  25.886  1.00 12.04 ? 356  ARG B C   1 
ATOM   2517 O O   . ARG B 1 156 ? 17.911  0.081   26.208  1.00 14.40 ? 356  ARG B O   1 
ATOM   2518 C CB  . ARG B 1 156 ? 17.827  -2.847  27.410  1.00 13.24 ? 356  ARG B CB  1 
ATOM   2519 C CG  . ARG B 1 156 ? 17.429  -3.645  28.648  1.00 15.84 ? 356  ARG B CG  1 
ATOM   2520 C CD  . ARG B 1 156 ? 18.118  -3.121  29.888  1.00 21.89 ? 356  ARG B CD  1 
ATOM   2521 N NE  . ARG B 1 156 ? 19.459  -3.664  30.039  1.00 24.16 ? 356  ARG B NE  1 
ATOM   2522 C CZ  . ARG B 1 156 ? 20.321  -3.281  30.974  1.00 22.31 ? 356  ARG B CZ  1 
ATOM   2523 N NH1 . ARG B 1 156 ? 19.988  -2.340  31.848  1.00 21.24 ? 356  ARG B NH1 1 
ATOM   2524 N NH2 . ARG B 1 156 ? 21.513  -3.851  31.041  1.00 25.98 ? 356  ARG B NH2 1 
ATOM   2525 N N   . GLY B 1 157 ? 17.200  -1.318  24.619  1.00 10.78 ? 357  GLY B N   1 
ATOM   2526 C CA  . GLY B 1 157 ? 17.774  -0.467  23.593  1.00 9.97  ? 357  GLY B CA  1 
ATOM   2527 C C   . GLY B 1 157 ? 17.553  -0.951  22.182  1.00 9.99  ? 357  GLY B C   1 
ATOM   2528 O O   . GLY B 1 157 ? 16.789  -1.890  21.959  1.00 9.61  ? 357  GLY B O   1 
ATOM   2529 N N   . PRO B 1 158 ? 18.217  -0.331  21.190  1.00 10.48 ? 358  PRO B N   1 
ATOM   2530 C CA  . PRO B 1 158 ? 18.050  -0.746  19.800  1.00 10.98 ? 358  PRO B CA  1 
ATOM   2531 C C   . PRO B 1 158 ? 18.226  -2.244  19.610  1.00 11.13 ? 358  PRO B C   1 
ATOM   2532 O O   . PRO B 1 158 ? 17.463  -2.876  18.883  1.00 11.93 ? 358  PRO B O   1 
ATOM   2533 C CB  . PRO B 1 158 ? 19.120  0.057   19.071  1.00 11.15 ? 358  PRO B CB  1 
ATOM   2534 C CG  . PRO B 1 158 ? 19.169  1.322   19.865  1.00 11.49 ? 358  PRO B CG  1 
ATOM   2535 C CD  . PRO B 1 158 ? 19.151  0.808   21.288  1.00 9.90  ? 358  PRO B CD  1 
ATOM   2536 N N   . GLY B 1 159 ? 19.232  -2.797  20.287  1.00 11.21 ? 359  GLY B N   1 
ATOM   2537 C CA  . GLY B 1 159 ? 19.533  -4.214  20.191  1.00 11.86 ? 359  GLY B CA  1 
ATOM   2538 C C   . GLY B 1 159 ? 18.528  -5.167  20.809  1.00 11.87 ? 359  GLY B C   1 
ATOM   2539 O O   . GLY B 1 159 ? 18.653  -6.379  20.641  1.00 13.02 ? 359  GLY B O   1 
ATOM   2540 N N   . THR B 1 160 ? 17.545  -4.644  21.537  1.00 10.21 ? 360  THR B N   1 
ATOM   2541 C CA  . THR B 1 160 ? 16.525  -5.500  22.135  1.00 9.47  ? 360  THR B CA  1 
ATOM   2542 C C   . THR B 1 160 ? 15.168  -5.175  21.513  1.00 8.84  ? 360  THR B C   1 
ATOM   2543 O O   . THR B 1 160 ? 14.131  -5.626  21.995  1.00 8.04  ? 360  THR B O   1 
ATOM   2544 C CB  . THR B 1 160 ? 16.427  -5.315  23.676  1.00 9.29  ? 360  THR B CB  1 
ATOM   2545 O OG1 . THR B 1 160 ? 15.939  -4.003  23.986  1.00 8.20  ? 360  THR B OG1 1 
ATOM   2546 C CG2 . THR B 1 160 ? 17.790  -5.510  24.323  1.00 10.39 ? 360  THR B CG2 1 
ATOM   2547 N N   . SER B 1 161 ? 15.187  -4.396  20.434  1.00 8.87  ? 361  SER B N   1 
ATOM   2548 C CA  . SER B 1 161 ? 13.955  -3.991  19.758  1.00 10.67 ? 361  SER B CA  1 
ATOM   2549 C C   . SER B 1 161 ? 13.103  -5.132  19.215  1.00 10.57 ? 361  SER B C   1 
ATOM   2550 O O   . SER B 1 161 ? 11.877  -5.095  19.331  1.00 10.10 ? 361  SER B O   1 
ATOM   2551 C CB  . SER B 1 161 ? 14.265  -3.010  18.625  1.00 10.79 ? 361  SER B CB  1 
ATOM   2552 O OG  . SER B 1 161 ? 14.685  -1.761  19.145  1.00 13.53 ? 361  SER B OG  1 
ATOM   2553 N N   . PHE B 1 162 ? 13.728  -6.131  18.602  1.00 9.34  ? 362  PHE B N   1 
ATOM   2554 C CA  . PHE B 1 162 ? 12.952  -7.251  18.084  1.00 10.74 ? 362  PHE B CA  1 
ATOM   2555 C C   . PHE B 1 162 ? 12.346  -8.041  19.241  1.00 11.63 ? 362  PHE B C   1 
ATOM   2556 O O   . PHE B 1 162 ? 11.179  -8.427  19.188  1.00 10.26 ? 362  PHE B O   1 
ATOM   2557 C CB  . PHE B 1 162 ? 13.812  -8.177  17.224  1.00 11.23 ? 362  PHE B CB  1 
ATOM   2558 C CG  . PHE B 1 162 ? 14.131  -7.622  15.868  1.00 10.22 ? 362  PHE B CG  1 
ATOM   2559 C CD1 . PHE B 1 162 ? 15.333  -6.968  15.634  1.00 12.08 ? 362  PHE B CD1 1 
ATOM   2560 C CD2 . PHE B 1 162 ? 13.230  -7.764  14.819  1.00 11.79 ? 362  PHE B CD2 1 
ATOM   2561 C CE1 . PHE B 1 162 ? 15.631  -6.453  14.376  1.00 13.51 ? 362  PHE B CE1 1 
ATOM   2562 C CE2 . PHE B 1 162 ? 13.517  -7.253  13.558  1.00 12.66 ? 362  PHE B CE2 1 
ATOM   2563 C CZ  . PHE B 1 162 ? 14.722  -6.602  13.334  1.00 11.82 ? 362  PHE B CZ  1 
ATOM   2564 N N   . GLU B 1 163 ? 13.139  -8.276  20.285  1.00 12.63 ? 363  GLU B N   1 
ATOM   2565 C CA  . GLU B 1 163 ? 12.660  -9.007  21.458  1.00 13.21 ? 363  GLU B CA  1 
ATOM   2566 C C   . GLU B 1 163 ? 11.490  -8.247  22.068  1.00 13.46 ? 363  GLU B C   1 
ATOM   2567 O O   . GLU B 1 163 ? 10.478  -8.834  22.446  1.00 13.12 ? 363  GLU B O   1 
ATOM   2568 C CB  . GLU B 1 163 ? 13.786  -9.153  22.488  1.00 15.43 ? 363  GLU B CB  1 
ATOM   2569 C CG  . GLU B 1 163 ? 14.938  -10.009 22.000  1.00 16.61 ? 363  GLU B CG  1 
ATOM   2570 C CD  . GLU B 1 163 ? 16.228  -9.744  22.749  1.00 19.21 ? 363  GLU B CD  1 
ATOM   2571 O OE1 . GLU B 1 163 ? 16.344  -10.156 23.925  1.00 18.85 ? 363  GLU B OE1 1 
ATOM   2572 O OE2 . GLU B 1 163 ? 17.127  -9.112  22.156  1.00 19.86 ? 363  GLU B OE2 1 
ATOM   2573 N N   . PHE B 1 164 ? 11.646  -6.929  22.142  1.00 11.60 ? 364  PHE B N   1 
ATOM   2574 C CA  . PHE B 1 164 ? 10.641  -6.021  22.682  1.00 11.29 ? 364  PHE B CA  1 
ATOM   2575 C C   . PHE B 1 164 ? 9.351   -6.112  21.864  1.00 11.92 ? 364  PHE B C   1 
ATOM   2576 O O   . PHE B 1 164 ? 8.253   -6.228  22.415  1.00 12.02 ? 364  PHE B O   1 
ATOM   2577 C CB  . PHE B 1 164 ? 11.214  -4.602  22.637  1.00 10.46 ? 364  PHE B CB  1 
ATOM   2578 C CG  . PHE B 1 164 ? 10.246  -3.518  23.011  1.00 10.44 ? 364  PHE B CG  1 
ATOM   2579 C CD1 . PHE B 1 164 ? 9.755   -3.411  24.309  1.00 9.63  ? 364  PHE B CD1 1 
ATOM   2580 C CD2 . PHE B 1 164 ? 9.882   -2.553  22.074  1.00 11.70 ? 364  PHE B CD2 1 
ATOM   2581 C CE1 . PHE B 1 164 ? 8.938   -2.341  24.677  1.00 10.55 ? 364  PHE B CE1 1 
ATOM   2582 C CE2 . PHE B 1 164 ? 9.066   -1.480  22.429  1.00 9.56  ? 364  PHE B CE2 1 
ATOM   2583 C CZ  . PHE B 1 164 ? 8.589   -1.376  23.735  1.00 10.80 ? 364  PHE B CZ  1 
ATOM   2584 N N   . ALA B 1 165 ? 9.494   -6.069  20.545  1.00 12.03 ? 365  ALA B N   1 
ATOM   2585 C CA  . ALA B 1 165 ? 8.345   -6.141  19.653  1.00 12.08 ? 365  ALA B CA  1 
ATOM   2586 C C   . ALA B 1 165 ? 7.647   -7.495  19.718  1.00 12.60 ? 365  ALA B C   1 
ATOM   2587 O O   . ALA B 1 165 ? 6.421   -7.557  19.791  1.00 13.44 ? 365  ALA B O   1 
ATOM   2588 C CB  . ALA B 1 165 ? 8.779   -5.846  18.225  1.00 12.89 ? 365  ALA B CB  1 
ATOM   2589 N N   . LEU B 1 166 ? 8.420   -8.577  19.690  1.00 12.89 ? 366  LEU B N   1 
ATOM   2590 C CA  . LEU B 1 166 ? 7.829   -9.910  19.742  1.00 12.91 ? 366  LEU B CA  1 
ATOM   2591 C C   . LEU B 1 166 ? 7.132   -10.149 21.073  1.00 14.28 ? 366  LEU B C   1 
ATOM   2592 O O   . LEU B 1 166 ? 6.168   -10.913 21.145  1.00 14.75 ? 366  LEU B O   1 
ATOM   2593 C CB  . LEU B 1 166 ? 8.895   -10.987 19.496  1.00 12.94 ? 366  LEU B CB  1 
ATOM   2594 C CG  . LEU B 1 166 ? 9.449   -11.038 18.067  1.00 14.43 ? 366  LEU B CG  1 
ATOM   2595 C CD1 . LEU B 1 166 ? 10.610  -12.013 17.987  1.00 16.45 ? 366  LEU B CD1 1 
ATOM   2596 C CD2 . LEU B 1 166 ? 8.343   -11.444 17.100  1.00 16.16 ? 366  LEU B CD2 1 
ATOM   2597 N N   . ALA B 1 167 ? 7.617   -9.497  22.126  1.00 13.88 ? 367  ALA B N   1 
ATOM   2598 C CA  . ALA B 1 167 ? 7.003   -9.638  23.440  1.00 15.03 ? 367  ALA B CA  1 
ATOM   2599 C C   . ALA B 1 167 ? 5.632   -8.967  23.399  1.00 14.99 ? 367  ALA B C   1 
ATOM   2600 O O   . ALA B 1 167 ? 4.673   -9.457  23.999  1.00 17.12 ? 367  ALA B O   1 
ATOM   2601 C CB  . ALA B 1 167 ? 7.880   -8.996  24.510  1.00 15.19 ? 367  ALA B CB  1 
ATOM   2602 N N   . ILE B 1 168 ? 5.547   -7.846  22.686  1.00 14.36 ? 368  ILE B N   1 
ATOM   2603 C CA  . ILE B 1 168 ? 4.287   -7.118  22.545  1.00 16.26 ? 368  ILE B CA  1 
ATOM   2604 C C   . ILE B 1 168 ? 3.323   -7.984  21.747  1.00 16.68 ? 368  ILE B C   1 
ATOM   2605 O O   . ILE B 1 168 ? 2.153   -8.119  22.103  1.00 16.33 ? 368  ILE B O   1 
ATOM   2606 C CB  . ILE B 1 168 ? 4.469   -5.780  21.783  1.00 15.99 ? 368  ILE B CB  1 
ATOM   2607 C CG1 . ILE B 1 168 ? 5.344   -4.825  22.593  1.00 17.21 ? 368  ILE B CG1 1 
ATOM   2608 C CG2 . ILE B 1 168 ? 3.107   -5.132  21.525  1.00 14.24 ? 368  ILE B CG2 1 
ATOM   2609 C CD1 . ILE B 1 168 ? 5.628   -3.512  21.878  1.00 17.57 ? 368  ILE B CD1 1 
ATOM   2610 N N   . VAL B 1 169 ? 3.822   -8.569  20.663  1.00 16.83 ? 369  VAL B N   1 
ATOM   2611 C CA  . VAL B 1 169 ? 2.993   -9.423  19.825  1.00 19.42 ? 369  VAL B CA  1 
ATOM   2612 C C   . VAL B 1 169 ? 2.436   -10.583 20.637  1.00 20.56 ? 369  VAL B C   1 
ATOM   2613 O O   . VAL B 1 169 ? 1.239   -10.866 20.587  1.00 21.39 ? 369  VAL B O   1 
ATOM   2614 C CB  . VAL B 1 169 ? 3.790   -9.987  18.634  1.00 19.14 ? 369  VAL B CB  1 
ATOM   2615 C CG1 . VAL B 1 169 ? 2.950   -11.013 17.890  1.00 19.40 ? 369  VAL B CG1 1 
ATOM   2616 C CG2 . VAL B 1 169 ? 4.188   -8.856  17.697  1.00 18.97 ? 369  VAL B CG2 1 
ATOM   2617 N N   . GLU B 1 170 ? 3.306   -11.246 21.388  1.00 21.34 ? 370  GLU B N   1 
ATOM   2618 C CA  . GLU B 1 170 ? 2.889   -12.376 22.206  1.00 23.12 ? 370  GLU B CA  1 
ATOM   2619 C C   . GLU B 1 170 ? 1.845   -11.972 23.241  1.00 22.81 ? 370  GLU B C   1 
ATOM   2620 O O   . GLU B 1 170 ? 0.906   -12.720 23.503  1.00 23.67 ? 370  GLU B O   1 
ATOM   2621 C CB  . GLU B 1 170 ? 4.098   -13.000 22.905  1.00 25.12 ? 370  GLU B CB  1 
ATOM   2622 C CG  . GLU B 1 170 ? 3.742   -14.154 23.829  1.00 28.31 ? 370  GLU B CG  1 
ATOM   2623 C CD  . GLU B 1 170 ? 4.964   -14.887 24.338  1.00 30.46 ? 370  GLU B CD  1 
ATOM   2624 O OE1 . GLU B 1 170 ? 4.808   -15.785 25.190  1.00 32.28 ? 370  GLU B OE1 1 
ATOM   2625 O OE2 . GLU B 1 170 ? 6.083   -14.568 23.882  1.00 34.47 ? 370  GLU B OE2 1 
ATOM   2626 N N   . ALA B 1 171 ? 2.006   -10.789 23.825  1.00 22.42 ? 371  ALA B N   1 
ATOM   2627 C CA  . ALA B 1 171 ? 1.064   -10.308 24.830  1.00 23.97 ? 371  ALA B CA  1 
ATOM   2628 C C   . ALA B 1 171 ? -0.291  -9.939  24.226  1.00 25.02 ? 371  ALA B C   1 
ATOM   2629 O O   . ALA B 1 171 ? -1.310  -9.968  24.914  1.00 26.27 ? 371  ALA B O   1 
ATOM   2630 C CB  . ALA B 1 171 ? 1.651   -9.103  25.568  1.00 22.35 ? 371  ALA B CB  1 
ATOM   2631 N N   . LEU B 1 172 ? -0.306  -9.592  22.942  1.00 25.45 ? 372  LEU B N   1 
ATOM   2632 C CA  . LEU B 1 172 ? -1.553  -9.213  22.282  1.00 25.67 ? 372  LEU B CA  1 
ATOM   2633 C C   . LEU B 1 172 ? -2.180  -10.301 21.419  1.00 26.09 ? 372  LEU B C   1 
ATOM   2634 O O   . LEU B 1 172 ? -3.405  -10.428 21.375  1.00 26.91 ? 372  LEU B O   1 
ATOM   2635 C CB  . LEU B 1 172 ? -1.344  -7.965  21.417  1.00 25.62 ? 372  LEU B CB  1 
ATOM   2636 C CG  . LEU B 1 172 ? -1.572  -6.591  22.051  1.00 25.18 ? 372  LEU B CG  1 
ATOM   2637 C CD1 . LEU B 1 172 ? -0.686  -6.418  23.267  1.00 24.28 ? 372  LEU B CD1 1 
ATOM   2638 C CD2 . LEU B 1 172 ? -1.289  -5.513  21.020  1.00 23.74 ? 372  LEU B CD2 1 
ATOM   2639 N N   . ASN B 1 173 ? -1.347  -11.085 20.741  1.00 25.92 ? 373  ASN B N   1 
ATOM   2640 C CA  . ASN B 1 173 ? -1.844  -12.128 19.851  1.00 26.53 ? 373  ASN B CA  1 
ATOM   2641 C C   . ASN B 1 173 ? -1.496  -13.567 20.220  1.00 25.43 ? 373  ASN B C   1 
ATOM   2642 O O   . ASN B 1 173 ? -1.954  -14.500 19.563  1.00 25.76 ? 373  ASN B O   1 
ATOM   2643 C CB  . ASN B 1 173 ? -1.374  -11.837 18.423  1.00 27.33 ? 373  ASN B CB  1 
ATOM   2644 C CG  . ASN B 1 173 ? -2.087  -10.646 17.805  1.00 29.99 ? 373  ASN B CG  1 
ATOM   2645 O OD1 . ASN B 1 173 ? -2.732  -9.859  18.502  1.00 30.53 ? 373  ASN B OD1 1 
ATOM   2646 N ND2 . ASN B 1 173 ? -1.968  -10.505 16.490  1.00 31.41 ? 373  ASN B ND2 1 
ATOM   2647 N N   . GLY B 1 174 ? -0.685  -13.757 21.254  1.00 25.64 ? 374  GLY B N   1 
ATOM   2648 C CA  . GLY B 1 174 ? -0.336  -15.110 21.654  1.00 25.41 ? 374  GLY B CA  1 
ATOM   2649 C C   . GLY B 1 174 ? 1.015   -15.614 21.181  1.00 26.12 ? 374  GLY B C   1 
ATOM   2650 O O   . GLY B 1 174 ? 1.624   -15.054 20.270  1.00 25.18 ? 374  GLY B O   1 
ATOM   2651 N N   . LYS B 1 175 ? 1.475   -16.693 21.805  1.00 26.18 ? 375  LYS B N   1 
ATOM   2652 C CA  . LYS B 1 175 ? 2.766   -17.294 21.484  1.00 27.85 ? 375  LYS B CA  1 
ATOM   2653 C C   . LYS B 1 175 ? 2.856   -17.814 20.053  1.00 27.83 ? 375  LYS B C   1 
ATOM   2654 O O   . LYS B 1 175 ? 3.912   -17.749 19.428  1.00 27.41 ? 375  LYS B O   1 
ATOM   2655 C CB  . LYS B 1 175 ? 3.059   -18.443 22.453  1.00 29.58 ? 375  LYS B CB  1 
ATOM   2656 C CG  . LYS B 1 175 ? 2.850   -18.090 23.919  1.00 32.15 ? 375  LYS B CG  1 
ATOM   2657 C CD  . LYS B 1 175 ? 3.063   -19.299 24.825  1.00 35.19 ? 375  LYS B CD  1 
ATOM   2658 C CE  . LYS B 1 175 ? 4.535   -19.660 24.953  1.00 36.40 ? 375  LYS B CE  1 
ATOM   2659 N NZ  . LYS B 1 175 ? 5.302   -18.591 25.655  1.00 37.82 ? 375  LYS B NZ  1 
ATOM   2660 N N   . GLU B 1 176 ? 1.749   -18.337 19.532  1.00 28.16 ? 376  GLU B N   1 
ATOM   2661 C CA  . GLU B 1 176 ? 1.747   -18.873 18.178  1.00 27.94 ? 376  GLU B CA  1 
ATOM   2662 C C   . GLU B 1 176 ? 1.987   -17.788 17.133  1.00 26.00 ? 376  GLU B C   1 
ATOM   2663 O O   . GLU B 1 176 ? 2.839   -17.939 16.258  1.00 26.36 ? 376  GLU B O   1 
ATOM   2664 C CB  . GLU B 1 176 ? 0.426   -19.588 17.891  1.00 30.74 ? 376  GLU B CB  1 
ATOM   2665 C CG  . GLU B 1 176 ? 0.457   -20.437 16.634  1.00 34.90 ? 376  GLU B CG  1 
ATOM   2666 C CD  . GLU B 1 176 ? -0.848  -21.168 16.391  1.00 37.08 ? 376  GLU B CD  1 
ATOM   2667 O OE1 . GLU B 1 176 ? -1.862  -20.499 16.098  1.00 39.43 ? 376  GLU B OE1 1 
ATOM   2668 O OE2 . GLU B 1 176 ? -0.859  -22.413 16.500  1.00 39.64 ? 376  GLU B OE2 1 
ATOM   2669 N N   . VAL B 1 177 ? 1.233   -16.698 17.219  1.00 23.80 ? 377  VAL B N   1 
ATOM   2670 C CA  . VAL B 1 177 ? 1.389   -15.597 16.276  1.00 21.33 ? 377  VAL B CA  1 
ATOM   2671 C C   . VAL B 1 177 ? 2.803   -15.026 16.382  1.00 21.26 ? 377  VAL B C   1 
ATOM   2672 O O   . VAL B 1 177 ? 3.426   -14.693 15.375  1.00 20.54 ? 377  VAL B O   1 
ATOM   2673 C CB  . VAL B 1 177 ? 0.368   -14.470 16.556  1.00 21.59 ? 377  VAL B CB  1 
ATOM   2674 C CG1 . VAL B 1 177 ? 0.633   -13.283 15.638  1.00 20.20 ? 377  VAL B CG1 1 
ATOM   2675 C CG2 . VAL B 1 177 ? -1.050  -14.990 16.343  1.00 20.89 ? 377  VAL B CG2 1 
ATOM   2676 N N   . ALA B 1 178 ? 3.305   -14.923 17.605  1.00 20.61 ? 378  ALA B N   1 
ATOM   2677 C CA  . ALA B 1 178 ? 4.646   -14.395 17.830  1.00 19.90 ? 378  ALA B CA  1 
ATOM   2678 C C   . ALA B 1 178 ? 5.696   -15.260 17.135  1.00 20.47 ? 378  ALA B C   1 
ATOM   2679 O O   . ALA B 1 178 ? 6.604   -14.746 16.481  1.00 19.90 ? 378  ALA B O   1 
ATOM   2680 C CB  . ALA B 1 178 ? 4.933   -14.322 19.324  1.00 21.22 ? 378  ALA B CB  1 
ATOM   2681 N N   . ALA B 1 179 ? 5.566   -16.575 17.276  1.00 19.79 ? 379  ALA B N   1 
ATOM   2682 C CA  . ALA B 1 179 ? 6.509   -17.506 16.666  1.00 20.54 ? 379  ALA B CA  1 
ATOM   2683 C C   . ALA B 1 179 ? 6.457   -17.439 15.142  1.00 20.14 ? 379  ALA B C   1 
ATOM   2684 O O   . ALA B 1 179 ? 7.483   -17.540 14.471  1.00 19.19 ? 379  ALA B O   1 
ATOM   2685 C CB  . ALA B 1 179 ? 6.219   -18.929 17.140  1.00 20.74 ? 379  ALA B CB  1 
ATOM   2686 N N   . GLN B 1 180 ? 5.256   -17.269 14.601  1.00 20.06 ? 380  GLN B N   1 
ATOM   2687 C CA  . GLN B 1 180 ? 5.072   -17.189 13.159  1.00 21.79 ? 380  GLN B CA  1 
ATOM   2688 C C   . GLN B 1 180 ? 5.748   -15.943 12.596  1.00 20.60 ? 380  GLN B C   1 
ATOM   2689 O O   . GLN B 1 180 ? 6.396   -15.993 11.550  1.00 19.48 ? 380  GLN B O   1 
ATOM   2690 C CB  . GLN B 1 180 ? 3.577   -17.171 12.829  1.00 24.76 ? 380  GLN B CB  1 
ATOM   2691 C CG  . GLN B 1 180 ? 2.846   -18.425 13.292  1.00 29.33 ? 380  GLN B CG  1 
ATOM   2692 C CD  . GLN B 1 180 ? 1.334   -18.287 13.253  1.00 31.84 ? 380  GLN B CD  1 
ATOM   2693 O OE1 . GLN B 1 180 ? 0.609   -19.223 13.594  1.00 36.20 ? 380  GLN B OE1 1 
ATOM   2694 N NE2 . GLN B 1 180 ? 0.850   -17.118 12.842  1.00 33.27 ? 380  GLN B NE2 1 
ATOM   2695 N N   . VAL B 1 181 ? 5.593   -14.825 13.298  1.00 19.24 ? 381  VAL B N   1 
ATOM   2696 C CA  . VAL B 1 181 ? 6.190   -13.571 12.867  1.00 17.47 ? 381  VAL B CA  1 
ATOM   2697 C C   . VAL B 1 181 ? 7.708   -13.608 13.022  1.00 17.43 ? 381  VAL B C   1 
ATOM   2698 O O   . VAL B 1 181 ? 8.437   -13.046 12.208  1.00 16.30 ? 381  VAL B O   1 
ATOM   2699 C CB  . VAL B 1 181 ? 5.630   -12.378 13.682  1.00 17.82 ? 381  VAL B CB  1 
ATOM   2700 C CG1 . VAL B 1 181 ? 6.388   -11.097 13.333  1.00 16.76 ? 381  VAL B CG1 1 
ATOM   2701 C CG2 . VAL B 1 181 ? 4.145   -12.200 13.384  1.00 17.13 ? 381  VAL B CG2 1 
ATOM   2702 N N   . LYS B 1 182 ? 8.183   -14.286 14.057  1.00 16.29 ? 382  LYS B N   1 
ATOM   2703 C CA  . LYS B 1 182 ? 9.617   -14.365 14.310  1.00 16.86 ? 382  LYS B CA  1 
ATOM   2704 C C   . LYS B 1 182 ? 10.412  -15.154 13.273  1.00 17.48 ? 382  LYS B C   1 
ATOM   2705 O O   . LYS B 1 182 ? 11.482  -14.723 12.845  1.00 16.92 ? 382  LYS B O   1 
ATOM   2706 C CB  . LYS B 1 182 ? 9.872   -14.969 15.692  1.00 17.42 ? 382  LYS B CB  1 
ATOM   2707 C CG  . LYS B 1 182 ? 11.344  -15.058 16.057  1.00 18.27 ? 382  LYS B CG  1 
ATOM   2708 C CD  . LYS B 1 182 ? 11.553  -15.663 17.432  1.00 18.84 ? 382  LYS B CD  1 
ATOM   2709 C CE  . LYS B 1 182 ? 13.032  -15.675 17.797  1.00 19.79 ? 382  LYS B CE  1 
ATOM   2710 N NZ  . LYS B 1 182 ? 13.272  -16.265 19.139  1.00 21.00 ? 382  LYS B NZ  1 
ATOM   2711 N N   . ALA B 1 183 ? 9.884   -16.308 12.872  1.00 17.99 ? 383  ALA B N   1 
ATOM   2712 C CA  . ALA B 1 183 ? 10.560  -17.187 11.921  1.00 18.70 ? 383  ALA B CA  1 
ATOM   2713 C C   . ALA B 1 183 ? 11.193  -16.551 10.677  1.00 17.16 ? 383  ALA B C   1 
ATOM   2714 O O   . ALA B 1 183 ? 12.356  -16.814 10.370  1.00 18.37 ? 383  ALA B O   1 
ATOM   2715 C CB  . ALA B 1 183 ? 9.608   -18.315 11.501  1.00 19.26 ? 383  ALA B CB  1 
ATOM   2716 N N   . PRO B 1 184 ? 10.445  -15.712 9.943   1.00 16.52 ? 384  PRO B N   1 
ATOM   2717 C CA  . PRO B 1 184 ? 10.999  -15.080 8.737   1.00 16.71 ? 384  PRO B CA  1 
ATOM   2718 C C   . PRO B 1 184 ? 12.020  -13.955 8.943   1.00 15.64 ? 384  PRO B C   1 
ATOM   2719 O O   . PRO B 1 184 ? 12.623  -13.480 7.982   1.00 15.06 ? 384  PRO B O   1 
ATOM   2720 C CB  . PRO B 1 184 ? 9.752   -14.566 8.013   1.00 16.70 ? 384  PRO B CB  1 
ATOM   2721 C CG  . PRO B 1 184 ? 8.642   -15.435 8.546   1.00 18.80 ? 384  PRO B CG  1 
ATOM   2722 C CD  . PRO B 1 184 ? 8.988   -15.515 10.002  1.00 16.54 ? 384  PRO B CD  1 
ATOM   2723 N N   . LEU B 1 185 ? 12.219  -13.530 10.184  1.00 15.60 ? 385  LEU B N   1 
ATOM   2724 C CA  . LEU B 1 185 ? 13.145  -12.432 10.464  1.00 13.49 ? 385  LEU B CA  1 
ATOM   2725 C C   . LEU B 1 185 ? 14.633  -12.785 10.437  1.00 13.03 ? 385  LEU B C   1 
ATOM   2726 O O   . LEU B 1 185 ? 15.479  -11.906 10.284  1.00 11.93 ? 385  LEU B O   1 
ATOM   2727 C CB  . LEU B 1 185 ? 12.799  -11.806 11.815  1.00 14.03 ? 385  LEU B CB  1 
ATOM   2728 C CG  . LEU B 1 185 ? 11.370  -11.277 11.958  1.00 14.05 ? 385  LEU B CG  1 
ATOM   2729 C CD1 . LEU B 1 185 ? 11.139  -10.795 13.385  1.00 15.23 ? 385  LEU B CD1 1 
ATOM   2730 C CD2 . LEU B 1 185 ? 11.138  -10.155 10.953  1.00 16.86 ? 385  LEU B CD2 1 
ATOM   2731 N N   . VAL B 1 186 ? 14.950  -14.066 10.579  1.00 11.96 ? 386  VAL B N   1 
ATOM   2732 C CA  . VAL B 1 186 ? 16.336  -14.533 10.594  1.00 12.61 ? 386  VAL B CA  1 
ATOM   2733 C C   . VAL B 1 186 ? 17.093  -13.963 11.795  1.00 13.44 ? 386  VAL B C   1 
ATOM   2734 O O   . VAL B 1 186 ? 18.226  -13.492 11.670  1.00 13.74 ? 386  VAL B O   1 
ATOM   2735 C CB  . VAL B 1 186 ? 17.107  -14.158 9.297   1.00 11.89 ? 386  VAL B CB  1 
ATOM   2736 C CG1 . VAL B 1 186 ? 18.378  -15.003 9.193   1.00 13.40 ? 386  VAL B CG1 1 
ATOM   2737 C CG2 . VAL B 1 186 ? 16.233  -14.372 8.075   1.00 10.85 ? 386  VAL B CG2 1 
ATOM   2738 N N   . LEU B 1 187 ? 16.454  -14.002 12.959  1.00 15.77 ? 387  LEU B N   1 
ATOM   2739 C CA  . LEU B 1 187 ? 17.070  -13.521 14.193  1.00 17.52 ? 387  LEU B CA  1 
ATOM   2740 C C   . LEU B 1 187 ? 18.024  -14.590 14.720  1.00 20.81 ? 387  LEU B C   1 
ATOM   2741 O O   . LEU B 1 187 ? 17.993  -15.735 14.269  1.00 21.61 ? 387  LEU B O   1 
ATOM   2742 C CB  . LEU B 1 187 ? 15.998  -13.238 15.249  1.00 16.26 ? 387  LEU B CB  1 
ATOM   2743 C CG  . LEU B 1 187 ? 15.158  -11.973 15.075  1.00 16.11 ? 387  LEU B CG  1 
ATOM   2744 C CD1 . LEU B 1 187 ? 13.922  -12.047 15.958  1.00 15.96 ? 387  LEU B CD1 1 
ATOM   2745 C CD2 . LEU B 1 187 ? 16.005  -10.755 15.423  1.00 16.56 ? 387  LEU B CD2 1 
ATOM   2746 N N   . LYS B 1 188 ? 18.866  -14.202 15.673  1.00 25.01 ? 388  LYS B N   1 
ATOM   2747 C CA  . LYS B 1 188 ? 19.831  -15.104 16.297  1.00 28.74 ? 388  LYS B CA  1 
ATOM   2748 C C   . LYS B 1 188 ? 19.160  -16.409 16.719  1.00 29.07 ? 388  LYS B C   1 
ATOM   2749 O O   . LYS B 1 188 ? 19.654  -17.485 16.325  1.00 29.94 ? 388  LYS B O   1 
ATOM   2750 C CB  . LYS B 1 188 ? 20.445  -14.428 17.526  1.00 31.34 ? 388  LYS B CB  1 
ATOM   2751 C CG  . LYS B 1 188 ? 19.400  -13.941 18.528  1.00 34.72 ? 388  LYS B CG  1 
ATOM   2752 C CD  . LYS B 1 188 ? 20.020  -13.330 19.778  1.00 37.55 ? 388  LYS B CD  1 
ATOM   2753 C CE  . LYS B 1 188 ? 18.937  -12.900 20.766  1.00 38.40 ? 388  LYS B CE  1 
ATOM   2754 N NZ  . LYS B 1 188 ? 19.495  -12.409 22.060  1.00 40.03 ? 388  LYS B NZ  1 
HETATM 2755 O O   . HOH C 2 .   ? 21.729  -8.224  13.450  1.00 9.00  ? 4001 HOH A O   1 
HETATM 2756 O O   . HOH C 2 .   ? 14.794  -2.315  -1.331  1.00 7.97  ? 4002 HOH A O   1 
HETATM 2757 O O   . HOH C 2 .   ? 28.570  -11.152 -0.488  1.00 9.38  ? 4003 HOH A O   1 
HETATM 2758 O O   . HOH C 2 .   ? 27.970  4.907   -8.796  1.00 14.81 ? 4005 HOH A O   1 
HETATM 2759 O O   . HOH C 2 .   ? 22.886  -16.486 -10.411 1.00 14.55 ? 4006 HOH A O   1 
HETATM 2760 O O   . HOH C 2 .   ? 14.576  -19.435 -2.254  1.00 13.65 ? 4007 HOH A O   1 
HETATM 2761 O O   . HOH C 2 .   ? 14.959  0.320   -1.375  1.00 13.67 ? 4008 HOH A O   1 
HETATM 2762 O O   . HOH C 2 .   ? 25.937  3.506   18.966  1.00 16.66 ? 4010 HOH A O   1 
HETATM 2763 O O   . HOH C 2 .   ? 33.384  -5.717  7.294   1.00 13.16 ? 4011 HOH A O   1 
HETATM 2764 O O   . HOH C 2 .   ? 24.231  11.510  7.516   1.00 12.48 ? 4012 HOH A O   1 
HETATM 2765 O O   . HOH C 2 .   ? 28.782  -7.586  11.825  1.00 15.03 ? 4014 HOH A O   1 
HETATM 2766 O O   . HOH C 2 .   ? 17.325  10.920  6.856   1.00 10.87 ? 4015 HOH A O   1 
HETATM 2767 O O   . HOH C 2 .   ? 27.083  2.682   -16.051 1.00 28.78 ? 4017 HOH A O   1 
HETATM 2768 O O   . HOH C 2 .   ? 29.678  5.967   -5.530  1.00 18.81 ? 4018 HOH A O   1 
HETATM 2769 O O   . HOH C 2 .   ? 37.448  -2.089  -11.728 1.00 16.01 ? 4019 HOH A O   1 
HETATM 2770 O O   . HOH C 2 .   ? 33.383  3.947   -12.202 1.00 13.17 ? 4020 HOH A O   1 
HETATM 2771 O O   . HOH C 2 .   ? 25.742  -4.187  21.964  1.00 16.32 ? 4021 HOH A O   1 
HETATM 2772 O O   . HOH C 2 .   ? 11.117  8.906   -3.297  1.00 18.73 ? 4024 HOH A O   1 
HETATM 2773 O O   . HOH C 2 .   ? 12.234  0.645   -11.173 1.00 15.45 ? 4025 HOH A O   1 
HETATM 2774 O O   . HOH C 2 .   ? 7.788   -5.029  -0.328  1.00 18.16 ? 4026 HOH A O   1 
HETATM 2775 O O   . HOH C 2 .   ? 13.702  -8.607  1.566   1.00 22.47 ? 4027 HOH A O   1 
HETATM 2776 O O   . HOH C 2 .   ? 28.102  -13.529 9.899   1.00 17.07 ? 4028 HOH A O   1 
HETATM 2777 O O   . HOH C 2 .   ? 14.721  9.611   6.219   1.00 14.39 ? 4029 HOH A O   1 
HETATM 2778 O O   . HOH C 2 .   ? 33.604  -10.018 -4.848  1.00 13.41 ? 4030 HOH A O   1 
HETATM 2779 O O   . HOH C 2 .   ? 27.859  -21.051 4.391   1.00 18.71 ? 4031 HOH A O   1 
HETATM 2780 O O   . HOH C 2 .   ? 34.431  1.470   -0.811  1.00 19.69 ? 4034 HOH A O   1 
HETATM 2781 O O   . HOH C 2 .   ? 6.178   0.226   -6.776  1.00 17.54 ? 4036 HOH A O   1 
HETATM 2782 O O   . HOH C 2 .   ? 19.090  -6.829  13.163  1.00 16.87 ? 4037 HOH A O   1 
HETATM 2783 O O   . HOH C 2 .   ? 12.209  -8.917  5.392   1.00 24.64 ? 4038 HOH A O   1 
HETATM 2784 O O   . HOH C 2 .   ? 31.399  -3.406  21.317  1.00 17.98 ? 4040 HOH A O   1 
HETATM 2785 O O   . HOH C 2 .   ? 38.382  -0.515  -2.589  1.00 15.00 ? 4041 HOH A O   1 
HETATM 2786 O O   . HOH C 2 .   ? 26.396  11.042  1.902   1.00 16.79 ? 4042 HOH A O   1 
HETATM 2787 O O   . HOH C 2 .   ? 27.092  -16.557 10.388  1.00 14.90 ? 4043 HOH A O   1 
HETATM 2788 O O   . HOH C 2 .   ? 34.397  -7.484  -5.378  1.00 21.85 ? 4044 HOH A O   1 
HETATM 2789 O O   . HOH C 2 .   ? 21.181  -17.337 10.819  1.00 18.31 ? 4047 HOH A O   1 
HETATM 2790 O O   . HOH C 2 .   ? 16.379  -14.901 -10.755 1.00 20.14 ? 4048 HOH A O   1 
HETATM 2791 O O   . HOH C 2 .   ? 8.504   -7.496  1.604   1.00 19.95 ? 4050 HOH A O   1 
HETATM 2792 O O   . HOH C 2 .   ? 11.501  6.007   -4.132  1.00 14.99 ? 4051 HOH A O   1 
HETATM 2793 O O   . HOH C 2 .   ? 35.643  -2.889  1.892   1.00 21.97 ? 4052 HOH A O   1 
HETATM 2794 O O   . HOH C 2 .   ? 31.545  -3.462  -5.478  1.00 14.04 ? 4054 HOH A O   1 
HETATM 2795 O O   . HOH C 2 .   ? 14.159  -8.469  -6.949  1.00 18.64 ? 4055 HOH A O   1 
HETATM 2796 O O   . HOH C 2 .   ? 37.517  -2.414  3.869   1.00 15.63 ? 4058 HOH A O   1 
HETATM 2797 O O   . HOH C 2 .   ? 31.854  -5.017  12.770  1.00 18.22 ? 4059 HOH A O   1 
HETATM 2798 O O   . HOH C 2 .   ? 13.887  -17.182 -4.512  1.00 18.80 ? 4061 HOH A O   1 
HETATM 2799 O O   . HOH C 2 .   ? 37.385  3.350   -4.584  1.00 17.08 ? 4062 HOH A O   1 
HETATM 2800 O O   . HOH C 2 .   ? 29.628  -9.236  -12.763 1.00 18.34 ? 4063 HOH A O   1 
HETATM 2801 O O   . HOH C 2 .   ? 33.039  8.485   8.383   1.00 18.28 ? 4065 HOH A O   1 
HETATM 2802 O O   . HOH C 2 .   ? 21.429  -22.132 1.479   1.00 23.64 ? 4067 HOH A O   1 
HETATM 2803 O O   . HOH C 2 .   ? 26.849  -22.404 -3.489  1.00 24.45 ? 4068 HOH A O   1 
HETATM 2804 O O   . HOH C 2 .   ? 14.211  -16.689 -10.677 1.00 22.85 ? 4071 HOH A O   1 
HETATM 2805 O O   . HOH C 2 .   ? 21.868  -18.288 8.406   1.00 20.76 ? 4073 HOH A O   1 
HETATM 2806 O O   . HOH C 2 .   ? 31.924  -8.113  -11.984 1.00 22.77 ? 4077 HOH A O   1 
HETATM 2807 O O   . HOH C 2 .   ? 15.005  13.300  5.194   1.00 14.54 ? 4078 HOH A O   1 
HETATM 2808 O O   . HOH C 2 .   ? 30.858  3.378   22.638  1.00 20.12 ? 4079 HOH A O   1 
HETATM 2809 O O   . HOH C 2 .   ? 6.063   5.117   -2.274  1.00 18.01 ? 4080 HOH A O   1 
HETATM 2810 O O   . HOH C 2 .   ? 22.031  3.450   22.101  1.00 21.08 ? 4083 HOH A O   1 
HETATM 2811 O O   . HOH C 2 .   ? 38.375  1.985   13.739  1.00 23.40 ? 4085 HOH A O   1 
HETATM 2812 O O   . HOH C 2 .   ? 15.538  10.141  -8.527  1.00 25.95 ? 4087 HOH A O   1 
HETATM 2813 O O   . HOH C 2 .   ? 19.094  18.171  -2.911  1.00 24.00 ? 4089 HOH A O   1 
HETATM 2814 O O   . HOH C 2 .   ? 20.745  -11.155 -14.765 1.00 20.25 ? 4091 HOH A O   1 
HETATM 2815 O O   . HOH C 2 .   ? 23.104  17.352  -5.843  1.00 20.95 ? 4095 HOH A O   1 
HETATM 2816 O O   . HOH C 2 .   ? 33.414  -14.218 1.086   1.00 20.62 ? 4097 HOH A O   1 
HETATM 2817 O O   . HOH C 2 .   ? 11.991  -9.109  -5.259  1.00 21.66 ? 4098 HOH A O   1 
HETATM 2818 O O   . HOH C 2 .   ? 27.067  10.882  10.592  1.00 19.86 ? 4099 HOH A O   1 
HETATM 2819 O O   . HOH C 2 .   ? 19.842  -15.534 -13.983 1.00 21.53 ? 4101 HOH A O   1 
HETATM 2820 O O   . HOH C 2 .   ? 37.631  1.289   3.690   1.00 30.05 ? 4102 HOH A O   1 
HETATM 2821 O O   . HOH C 2 .   ? 26.499  -21.488 -8.092  1.00 27.43 ? 4103 HOH A O   1 
HETATM 2822 O O   . HOH C 2 .   ? 16.630  16.699  3.060   1.00 19.25 ? 4107 HOH A O   1 
HETATM 2823 O O   . HOH C 2 .   ? 3.449   -7.875  6.933   1.00 29.40 ? 4109 HOH A O   1 
HETATM 2824 O O   . HOH C 2 .   ? 27.682  9.159   -7.719  1.00 28.04 ? 4110 HOH A O   1 
HETATM 2825 O O   . HOH C 2 .   ? 16.702  -9.869  -9.755  1.00 21.76 ? 4111 HOH A O   1 
HETATM 2826 O O   . HOH C 2 .   ? 37.552  0.029   -14.060 1.00 40.75 ? 4112 HOH A O   1 
HETATM 2827 O O   . HOH C 2 .   ? 38.777  4.157   -7.560  1.00 19.05 ? 4115 HOH A O   1 
HETATM 2828 O O   . HOH C 2 .   ? 4.493   0.290   -0.772  1.00 34.55 ? 4117 HOH A O   1 
HETATM 2829 O O   . HOH C 2 .   ? 14.475  2.119   -15.299 1.00 21.62 ? 4119 HOH A O   1 
HETATM 2830 O O   . HOH C 2 .   ? 28.648  -15.930 -14.420 1.00 19.96 ? 4121 HOH A O   1 
HETATM 2831 O O   . HOH C 2 .   ? 18.159  -21.400 -8.692  1.00 40.27 ? 4122 HOH A O   1 
HETATM 2832 O O   . HOH C 2 .   ? 17.853  -23.475 -3.451  1.00 21.77 ? 4126 HOH A O   1 
HETATM 2833 O O   . HOH C 2 .   ? 35.211  -4.168  -7.802  1.00 32.38 ? 4130 HOH A O   1 
HETATM 2834 O O   . HOH C 2 .   ? 27.196  -12.166 12.055  1.00 23.53 ? 4131 HOH A O   1 
HETATM 2835 O O   . HOH C 2 .   ? 28.928  16.686  -1.608  1.00 40.34 ? 4133 HOH A O   1 
HETATM 2836 O O   . HOH C 2 .   ? 21.702  4.522   -17.609 1.00 25.98 ? 4134 HOH A O   1 
HETATM 2837 O O   . HOH C 2 .   ? 14.806  4.557   -11.700 1.00 22.78 ? 4135 HOH A O   1 
HETATM 2838 O O   . HOH C 2 .   ? 22.142  13.310  4.135   1.00 26.73 ? 4136 HOH A O   1 
HETATM 2839 O O   . HOH C 2 .   ? 24.910  13.058  -0.746  1.00 19.85 ? 4137 HOH A O   1 
HETATM 2840 O O   . HOH C 2 .   ? 9.694   -13.372 0.443   1.00 28.62 ? 4141 HOH A O   1 
HETATM 2841 O O   . HOH C 2 .   ? 17.014  -4.653  -14.943 1.00 30.58 ? 4142 HOH A O   1 
HETATM 2842 O O   . HOH C 2 .   ? 34.733  -4.607  16.097  1.00 23.14 ? 4143 HOH A O   1 
HETATM 2843 O O   . HOH C 2 .   ? 33.229  -10.631 -11.521 1.00 28.78 ? 4144 HOH A O   1 
HETATM 2844 O O   . HOH C 2 .   ? 40.941  -1.465  18.430  1.00 17.82 ? 4145 HOH A O   1 
HETATM 2845 O O   . HOH C 2 .   ? 27.955  -21.693 -10.352 1.00 34.90 ? 4146 HOH A O   1 
HETATM 2846 O O   . HOH C 2 .   ? 24.749  -23.075 8.045   1.00 30.83 ? 4150 HOH A O   1 
HETATM 2847 O O   . HOH C 2 .   ? 18.531  -8.456  -15.778 1.00 33.85 ? 4151 HOH A O   1 
HETATM 2848 O O   . HOH C 2 .   ? 7.945   8.509   -3.614  1.00 22.64 ? 4152 HOH A O   1 
HETATM 2849 O O   . HOH C 2 .   ? 25.313  -6.008  -17.496 1.00 29.19 ? 4153 HOH A O   1 
HETATM 2850 O O   . HOH C 2 .   ? 4.796   9.791   -1.447  1.00 32.42 ? 4154 HOH A O   1 
HETATM 2851 O O   . HOH C 2 .   ? 30.984  -7.671  20.368  1.00 28.42 ? 4160 HOH A O   1 
HETATM 2852 O O   . HOH C 2 .   ? 31.393  -20.019 4.992   1.00 32.97 ? 4162 HOH A O   1 
HETATM 2853 O O   . HOH C 2 .   ? 31.390  -18.178 -7.505  1.00 32.56 ? 4164 HOH A O   1 
HETATM 2854 O O   . HOH C 2 .   ? 11.006  -18.817 -2.018  1.00 28.74 ? 4165 HOH A O   1 
HETATM 2855 O O   . HOH C 2 .   ? 6.335   -9.626  -10.095 1.00 33.68 ? 4166 HOH A O   1 
HETATM 2856 O O   . HOH C 2 .   ? 32.256  11.999  11.415  1.00 40.45 ? 4167 HOH A O   1 
HETATM 2857 O O   . HOH C 2 .   ? 1.438   4.021   4.632   1.00 25.71 ? 4169 HOH A O   1 
HETATM 2858 O O   . HOH C 2 .   ? 27.291  6.849   -10.615 1.00 36.07 ? 4171 HOH A O   1 
HETATM 2859 O O   . HOH C 2 .   ? 17.066  18.230  -8.758  1.00 22.68 ? 4174 HOH A O   1 
HETATM 2860 O O   . HOH C 2 .   ? 36.667  -10.239 1.564   1.00 23.93 ? 4175 HOH A O   1 
HETATM 2861 O O   . HOH C 2 .   ? 36.305  7.237   -7.574  1.00 42.97 ? 4176 HOH A O   1 
HETATM 2862 O O   . HOH C 2 .   ? 4.996   -10.563 6.693   1.00 29.01 ? 4177 HOH A O   1 
HETATM 2863 O O   . HOH C 2 .   ? 27.347  8.499   17.474  1.00 27.01 ? 4179 HOH A O   1 
HETATM 2864 O O   . HOH C 2 .   ? 8.138   -10.649 3.776   1.00 25.59 ? 4180 HOH A O   1 
HETATM 2865 O O   . HOH C 2 .   ? 35.706  6.731   16.882  1.00 32.25 ? 4181 HOH A O   1 
HETATM 2866 O O   . HOH C 2 .   ? 34.682  -12.506 4.732   1.00 34.25 ? 4182 HOH A O   1 
HETATM 2867 O O   . HOH C 2 .   ? 10.118  13.261  1.351   1.00 24.86 ? 4183 HOH A O   1 
HETATM 2868 O O   . HOH C 2 .   ? 15.985  4.434   -14.267 1.00 25.15 ? 4185 HOH A O   1 
HETATM 2869 O O   . HOH C 2 .   ? 11.930  -7.676  -11.857 1.00 35.25 ? 4190 HOH A O   1 
HETATM 2870 O O   . HOH C 2 .   ? 6.185   15.688  -0.723  1.00 34.00 ? 4194 HOH A O   1 
HETATM 2871 O O   . HOH C 2 .   ? 13.680  -8.878  -9.578  1.00 26.38 ? 4195 HOH A O   1 
HETATM 2872 O O   . HOH C 2 .   ? 14.602  -12.772 -11.092 1.00 37.52 ? 4196 HOH A O   1 
HETATM 2873 O O   . HOH C 2 .   ? 25.077  9.512   -16.445 1.00 38.60 ? 4197 HOH A O   1 
HETATM 2874 O O   . HOH C 2 .   ? 33.575  -7.419  -8.461  1.00 41.79 ? 4198 HOH A O   1 
HETATM 2875 O O   . HOH C 2 .   ? 15.604  6.944   -10.276 1.00 30.81 ? 4199 HOH A O   1 
HETATM 2876 O O   . HOH C 2 .   ? 9.413   10.616  -5.201  1.00 27.40 ? 4201 HOH A O   1 
HETATM 2877 O O   . HOH C 2 .   ? 33.154  -3.525  -15.612 1.00 29.31 ? 4206 HOH A O   1 
HETATM 2878 O O   . HOH C 2 .   ? 31.264  6.846   16.502  1.00 45.30 ? 4208 HOH A O   1 
HETATM 2879 O O   . HOH C 2 .   ? 25.330  -2.993  25.256  1.00 37.73 ? 4210 HOH A O   1 
HETATM 2880 O O   . HOH C 2 .   ? 29.988  -16.024 -12.178 1.00 38.24 ? 4211 HOH A O   1 
HETATM 2881 O O   . HOH C 2 .   ? -0.612  -0.171  1.808   1.00 28.75 ? 4212 HOH A O   1 
HETATM 2882 O O   . HOH C 2 .   ? 21.998  -5.945  -16.716 1.00 39.66 ? 4214 HOH A O   1 
HETATM 2883 O O   . HOH C 2 .   ? 4.490   -6.117  2.307   1.00 33.36 ? 4215 HOH A O   1 
HETATM 2884 O O   . HOH C 2 .   ? 28.725  -22.387 -0.324  1.00 26.60 ? 4216 HOH A O   1 
HETATM 2885 O O   . HOH C 2 .   ? 20.207  8.608   -10.977 1.00 27.45 ? 4217 HOH A O   1 
HETATM 2886 O O   . HOH C 2 .   ? 32.179  -13.238 5.000   1.00 30.36 ? 4221 HOH A O   1 
HETATM 2887 O O   . HOH C 2 .   ? 37.277  -13.429 -1.009  1.00 40.12 ? 4224 HOH A O   1 
HETATM 2888 O O   . HOH C 2 .   ? 26.132  -9.431  19.159  1.00 34.05 ? 4227 HOH A O   1 
HETATM 2889 O O   . HOH C 2 .   ? 30.650  -2.792  -13.901 1.00 29.79 ? 4228 HOH A O   1 
HETATM 2890 O O   . HOH C 2 .   ? 30.100  -5.270  -13.512 1.00 37.75 ? 4229 HOH A O   1 
HETATM 2891 O O   . HOH C 2 .   ? 33.675  11.108  -1.682  1.00 43.08 ? 4232 HOH A O   1 
HETATM 2892 O O   . HOH C 2 .   ? 21.889  -13.463 -15.663 1.00 40.71 ? 4233 HOH A O   1 
HETATM 2893 O O   . HOH C 2 .   ? 26.668  15.651  0.142   1.00 38.25 ? 4236 HOH A O   1 
HETATM 2894 O O   . HOH C 2 .   ? 28.526  17.049  -9.935  1.00 37.32 ? 4238 HOH A O   1 
HETATM 2895 O O   . HOH C 2 .   ? 32.904  -20.879 -0.282  1.00 29.83 ? 4242 HOH A O   1 
HETATM 2896 O O   . HOH C 2 .   ? 34.191  10.262  1.216   1.00 47.30 ? 4243 HOH A O   1 
HETATM 2897 O O   . HOH C 2 .   ? 33.686  -4.139  -12.377 1.00 29.40 ? 4244 HOH A O   1 
HETATM 2898 O O   . HOH C 2 .   ? 22.030  12.834  -11.462 1.00 26.66 ? 4248 HOH A O   1 
HETATM 2899 O O   . HOH C 2 .   ? 38.623  -7.350  -7.665  1.00 34.08 ? 4249 HOH A O   1 
HETATM 2900 O O   . HOH C 2 .   ? 33.873  7.960   12.598  1.00 42.12 ? 4252 HOH A O   1 
HETATM 2901 O O   . HOH C 2 .   ? 8.196   -3.347  -9.522  1.00 31.38 ? 4253 HOH A O   1 
HETATM 2902 O O   . HOH C 2 .   ? 33.537  15.354  6.883   1.00 44.04 ? 4254 HOH A O   1 
HETATM 2903 O O   . HOH C 2 .   ? 11.574  -20.483 -4.562  1.00 38.95 ? 4255 HOH A O   1 
HETATM 2904 O O   . HOH C 2 .   ? 13.007  -20.275 2.099   1.00 29.07 ? 4256 HOH A O   1 
HETATM 2905 O O   . HOH C 2 .   ? 31.275  7.755   -13.016 1.00 40.14 ? 4261 HOH A O   1 
HETATM 2906 O O   . HOH C 2 .   ? 8.338   15.151  -7.120  1.00 39.68 ? 4262 HOH A O   1 
HETATM 2907 O O   . HOH C 2 .   ? 18.061  13.811  -16.210 1.00 52.18 ? 4263 HOH A O   1 
HETATM 2908 O O   . HOH C 2 .   ? 1.831   5.287   -1.476  1.00 29.42 ? 4266 HOH A O   1 
HETATM 2909 O O   . HOH C 2 .   ? 36.851  7.781   1.266   1.00 27.82 ? 4267 HOH A O   1 
HETATM 2910 O O   . HOH C 2 .   ? 5.304   11.353  -5.051  1.00 47.78 ? 4268 HOH A O   1 
HETATM 2911 O O   . HOH C 2 .   ? 11.842  -10.583 0.883   1.00 43.82 ? 4273 HOH A O   1 
HETATM 2912 O O   . HOH C 2 .   ? 26.686  13.603  2.047   1.00 26.10 ? 4274 HOH A O   1 
HETATM 2913 O O   . HOH C 2 .   ? 33.202  -16.786 3.744   1.00 41.29 ? 4279 HOH A O   1 
HETATM 2914 O O   . HOH C 2 .   ? 36.582  13.270  9.295   1.00 50.23 ? 4280 HOH A O   1 
HETATM 2915 O O   . HOH C 2 .   ? 21.697  2.032   -16.855 1.00 32.09 ? 4281 HOH A O   1 
HETATM 2916 O O   . HOH C 2 .   ? 32.443  -5.000  17.253  1.00 20.26 ? 4286 HOH A O   1 
HETATM 2917 O O   . HOH C 2 .   ? 10.054  -8.538  3.179   1.00 26.87 ? 4287 HOH A O   1 
HETATM 2918 O O   . HOH C 2 .   ? 36.116  -5.480  7.240   1.00 19.73 ? 4288 HOH A O   1 
HETATM 2919 O O   . HOH C 2 .   ? 23.281  13.761  6.416   1.00 25.47 ? 4289 HOH A O   1 
HETATM 2920 O O   . HOH C 2 .   ? 10.240  3.206   -6.455  1.00 16.34 ? 4290 HOH A O   1 
HETATM 2921 O O   . HOH C 2 .   ? 18.511  -7.496  16.538  1.00 21.36 ? 4291 HOH A O   1 
HETATM 2922 O O   . HOH C 2 .   ? 24.803  12.381  10.174  1.00 28.51 ? 4292 HOH A O   1 
HETATM 2923 O O   . HOH C 2 .   ? 5.108   -3.962  -0.541  1.00 25.73 ? 4293 HOH A O   1 
HETATM 2924 O O   . HOH C 2 .   ? 35.723  -0.014  0.966   1.00 24.80 ? 4294 HOH A O   1 
HETATM 2925 O O   . HOH C 2 .   ? 29.770  -10.144 -15.366 1.00 22.47 ? 4295 HOH A O   1 
HETATM 2926 O O   . HOH C 2 .   ? 37.607  -4.922  4.683   1.00 22.35 ? 4298 HOH A O   1 
HETATM 2927 O O   . HOH C 2 .   ? 32.599  -5.287  20.081  1.00 26.65 ? 4300 HOH A O   1 
HETATM 2928 O O   . HOH C 2 .   ? 36.184  4.087   -12.467 1.00 20.77 ? 4301 HOH A O   1 
HETATM 2929 O O   . HOH C 2 .   ? 27.647  5.516   19.587  1.00 25.15 ? 4302 HOH A O   1 
HETATM 2930 O O   . HOH C 2 .   ? 14.660  15.717  4.542   1.00 28.35 ? 4303 HOH A O   1 
HETATM 2931 O O   . HOH C 2 .   ? 17.362  8.741   -10.768 1.00 23.10 ? 4304 HOH A O   1 
HETATM 2932 O O   . HOH C 2 .   ? 30.698  5.380   -8.550  1.00 28.44 ? 4305 HOH A O   1 
HETATM 2933 O O   . HOH C 2 .   ? 20.239  -23.008 -4.692  1.00 27.99 ? 4306 HOH A O   1 
HETATM 2934 O O   . HOH C 2 .   ? 17.760  -1.546  -16.508 1.00 33.52 ? 4308 HOH A O   1 
HETATM 2935 O O   . HOH C 2 .   ? -1.014  -3.059  8.724   1.00 30.60 ? 4310 HOH A O   1 
HETATM 2936 O O   . HOH C 2 .   ? 27.171  6.830   -6.844  1.00 24.42 ? 4311 HOH A O   1 
HETATM 2937 O O   . HOH C 2 .   ? 33.071  -5.413  -6.743  1.00 23.76 ? 4313 HOH A O   1 
HETATM 2938 O O   . HOH C 2 .   ? 36.272  -4.293  -10.789 1.00 31.56 ? 4315 HOH A O   1 
HETATM 2939 O O   . HOH C 2 .   ? 22.022  7.048   -18.776 1.00 53.16 ? 4317 HOH A O   1 
HETATM 2940 O O   . HOH C 2 .   ? 36.146  7.134   11.566  1.00 37.64 ? 4319 HOH A O   1 
HETATM 2941 O O   . HOH C 2 .   ? 10.899  -17.486 5.796   1.00 28.81 ? 4320 HOH A O   1 
HETATM 2942 O O   . HOH C 2 .   ? 36.047  3.430   2.013   1.00 31.35 ? 4321 HOH A O   1 
HETATM 2943 O O   . HOH C 2 .   ? 23.058  9.896   -14.274 1.00 30.48 ? 4322 HOH A O   1 
HETATM 2944 O O   . HOH C 2 .   ? 8.028   5.929   -4.131  1.00 28.27 ? 4323 HOH A O   1 
HETATM 2945 O O   . HOH C 2 .   ? 11.820  -12.637 2.412   1.00 29.89 ? 4324 HOH A O   1 
HETATM 2946 O O   . HOH C 2 .   ? 30.892  -4.778  15.338  1.00 32.36 ? 4325 HOH A O   1 
HETATM 2947 O O   . HOH C 2 .   ? 30.751  -23.576 -1.554  1.00 58.77 ? 4327 HOH A O   1 
HETATM 2948 O O   . HOH C 2 .   ? 25.275  18.698  -6.680  1.00 24.82 ? 4329 HOH A O   1 
HETATM 2949 O O   . HOH C 2 .   ? 14.042  12.053  -9.862  1.00 33.21 ? 4332 HOH A O   1 
HETATM 2950 O O   . HOH C 2 .   ? 25.086  -2.276  27.713  1.00 34.81 ? 4333 HOH A O   1 
HETATM 2951 O O   . HOH C 2 .   ? 35.944  3.242   -2.318  1.00 35.90 ? 4334 HOH A O   1 
HETATM 2952 O O   . HOH C 2 .   ? 29.518  3.052   25.074  1.00 32.50 ? 4335 HOH A O   1 
HETATM 2953 O O   . HOH C 2 .   ? -1.364  1.147   7.065   1.00 24.25 ? 4336 HOH A O   1 
HETATM 2954 O O   . HOH C 2 .   ? 11.644  -18.060 -5.959  1.00 37.20 ? 4337 HOH A O   1 
HETATM 2955 O O   . HOH C 2 .   ? 29.683  12.936  11.163  1.00 36.72 ? 4338 HOH A O   1 
HETATM 2956 O O   . HOH C 2 .   ? 22.967  -9.120  16.423  1.00 36.76 ? 4339 HOH A O   1 
HETATM 2957 O O   . HOH C 2 .   ? 10.569  -10.179 -7.625  1.00 37.24 ? 4340 HOH A O   1 
HETATM 2958 O O   . HOH C 2 .   ? 29.739  -18.286 -9.570  1.00 30.23 ? 4341 HOH A O   1 
HETATM 2959 O O   . HOH C 2 .   ? 8.172   -17.109 5.464   1.00 28.91 ? 4343 HOH A O   1 
HETATM 2960 O O   . HOH C 2 .   ? 7.124   2.304   -7.959  1.00 33.74 ? 4345 HOH A O   1 
HETATM 2961 O O   . HOH C 2 .   ? 0.996   -3.332  7.120   1.00 27.17 ? 4347 HOH A O   1 
HETATM 2962 O O   . HOH C 2 .   ? 35.969  -14.191 -5.650  1.00 38.64 ? 4350 HOH A O   1 
HETATM 2963 O O   . HOH C 2 .   ? 28.522  -22.860 -5.414  1.00 33.23 ? 4352 HOH A O   1 
HETATM 2964 O O   . HOH C 2 .   ? 30.404  -11.473 9.330   1.00 31.97 ? 4354 HOH A O   1 
HETATM 2965 O O   . HOH C 2 .   ? 34.591  7.691   -9.457  1.00 27.34 ? 4355 HOH A O   1 
HETATM 2966 O O   . HOH C 2 .   ? 19.799  -9.359  15.462  1.00 37.46 ? 4357 HOH A O   1 
HETATM 2967 O O   . HOH C 2 .   ? 18.712  14.756  6.802   1.00 39.64 ? 4358 HOH A O   1 
HETATM 2968 O O   . HOH C 2 .   ? 17.201  -11.173 -12.437 1.00 28.11 ? 4359 HOH A O   1 
HETATM 2969 O O   . HOH C 2 .   ? 26.496  18.541  -8.886  1.00 35.09 ? 4365 HOH A O   1 
HETATM 2970 O O   . HOH C 2 .   ? 20.814  10.874  -12.590 1.00 29.69 ? 4367 HOH A O   1 
HETATM 2971 O O   . HOH C 2 .   ? 32.425  -8.219  7.169   1.00 37.50 ? 4370 HOH A O   1 
HETATM 2972 O O   . HOH C 2 .   ? 25.070  -19.472 10.031  1.00 44.29 ? 4373 HOH A O   1 
HETATM 2973 O O   . HOH C 2 .   ? 12.143  -19.710 4.507   1.00 35.36 ? 4374 HOH A O   1 
HETATM 2974 O O   . HOH C 2 .   ? 29.423  -22.147 2.198   1.00 28.75 ? 4375 HOH A O   1 
HETATM 2975 O O   . HOH C 2 .   ? 32.938  -7.827  9.594   1.00 32.66 ? 4376 HOH A O   1 
HETATM 2976 O O   . HOH C 2 .   ? 17.294  -14.190 -13.165 1.00 36.05 ? 4377 HOH A O   1 
HETATM 2977 O O   . HOH C 2 .   ? 17.379  6.043   -15.980 1.00 38.02 ? 4378 HOH A O   1 
HETATM 2978 O O   . HOH C 2 .   ? 27.894  -8.053  14.736  1.00 34.33 ? 4379 HOH A O   1 
HETATM 2979 O O   . HOH C 2 .   ? 33.708  7.325   15.278  1.00 40.50 ? 4380 HOH A O   1 
HETATM 2980 O O   . HOH C 2 .   ? 29.297  -14.415 -16.609 1.00 31.76 ? 4381 HOH A O   1 
HETATM 2981 O O   . HOH C 2 .   ? 12.367  3.261   -11.207 1.00 32.19 ? 4382 HOH A O   1 
HETATM 2982 O O   . HOH C 2 .   ? 28.278  9.404   -10.527 1.00 31.47 ? 4383 HOH A O   1 
HETATM 2983 O O   . HOH C 2 .   ? 2.080   5.690   1.309   1.00 40.47 ? 4384 HOH A O   1 
HETATM 2984 O O   . HOH C 2 .   ? 10.341  2.327   -9.010  1.00 39.99 ? 4385 HOH A O   1 
HETATM 2985 O O   . HOH C 2 .   ? 24.635  15.217  2.780   1.00 42.46 ? 4386 HOH A O   1 
HETATM 2986 O O   . HOH C 2 .   ? 25.318  -14.376 -18.455 1.00 45.61 ? 4387 HOH A O   1 
HETATM 2987 O O   . HOH C 2 .   ? 12.797  15.134  -12.171 1.00 41.62 ? 4392 HOH A O   1 
HETATM 2988 O O   . HOH C 2 .   ? 3.299   -1.417  1.143   1.00 43.29 ? 4397 HOH A O   1 
HETATM 2989 O O   . HOH C 2 .   ? 28.159  0.959   25.924  1.00 41.27 ? 4400 HOH A O   1 
HETATM 2990 O O   . HOH C 2 .   ? 0.682   6.229   3.403   1.00 30.14 ? 4401 HOH A O   1 
HETATM 2991 O O   . HOH C 2 .   ? 5.255   -1.483  -8.550  1.00 33.34 ? 4403 HOH A O   1 
HETATM 2992 O O   . HOH C 2 .   ? 20.119  -0.017  -18.758 1.00 28.74 ? 4404 HOH A O   1 
HETATM 2993 O O   . HOH C 2 .   ? 33.886  -19.703 -6.445  1.00 35.99 ? 4405 HOH A O   1 
HETATM 2994 O O   . HOH C 2 .   ? 31.281  -7.366  11.438  1.00 28.48 ? 4406 HOH A O   1 
HETATM 2995 O O   . HOH C 2 .   ? 29.118  -4.458  22.377  1.00 31.16 ? 4407 HOH A O   1 
HETATM 2996 O O   . HOH C 2 .   ? 3.289   -0.402  -5.484  1.00 36.97 ? 4410 HOH A O   1 
HETATM 2997 O O   . HOH C 2 .   ? 27.183  10.787  14.607  1.00 35.90 ? 4414 HOH A O   1 
HETATM 2998 O O   . HOH C 2 .   ? 22.887  5.271   23.839  1.00 41.33 ? 4415 HOH A O   1 
HETATM 2999 O O   . HOH C 2 .   ? 34.788  -6.641  14.335  1.00 41.18 ? 4416 HOH A O   1 
HETATM 3000 O O   . HOH C 2 .   ? 14.533  -7.380  -13.315 1.00 41.47 ? 4417 HOH A O   1 
HETATM 3001 O O   . HOH C 2 .   ? 33.236  -21.574 -4.562  1.00 35.96 ? 4418 HOH A O   1 
HETATM 3002 O O   . HOH C 2 .   ? 32.481  6.314   -11.518 1.00 40.44 ? 4419 HOH A O   1 
HETATM 3003 O O   . HOH C 2 .   ? 25.294  -4.241  -19.546 1.00 43.83 ? 4421 HOH A O   1 
HETATM 3004 O O   . HOH C 2 .   ? 29.176  12.295  -8.408  1.00 40.71 ? 4423 HOH A O   1 
HETATM 3005 O O   . HOH C 2 .   ? 32.454  -15.352 -12.748 1.00 37.99 ? 4425 HOH A O   1 
HETATM 3006 O O   . HOH C 2 .   ? 29.034  -10.099 11.578  1.00 40.51 ? 4427 HOH A O   1 
HETATM 3007 O O   . HOH C 2 .   ? 26.860  -24.205 6.790   1.00 33.85 ? 4428 HOH A O   1 
HETATM 3008 O O   . HOH C 2 .   ? 38.685  5.993   -8.534  1.00 42.53 ? 4439 HOH A O   1 
HETATM 3009 O O   . HOH C 2 .   ? 14.555  -4.901  -16.163 1.00 32.01 ? 4443 HOH A O   1 
HETATM 3010 O O   . HOH C 2 .   ? 36.767  -5.551  17.687  1.00 45.71 ? 4444 HOH A O   1 
HETATM 3011 O O   . HOH C 2 .   ? 34.594  -9.386  -8.837  1.00 46.12 ? 4445 HOH A O   1 
HETATM 3012 O O   . HOH C 2 .   ? 8.308   -19.609 -0.307  1.00 44.66 ? 4446 HOH A O   1 
HETATM 3013 O O   . HOH C 2 .   ? 33.314  11.095  13.174  1.00 46.17 ? 4447 HOH A O   1 
HETATM 3014 O O   . HOH C 2 .   ? 3.960   -11.163 4.287   1.00 51.64 ? 4449 HOH A O   1 
HETATM 3015 O O   . HOH C 2 .   ? 2.839   -7.748  4.071   1.00 50.76 ? 4450 HOH A O   1 
HETATM 3016 O O   . HOH C 2 .   ? 35.492  -15.457 1.076   1.00 53.19 ? 4460 HOH A O   1 
HETATM 3017 O O   . HOH C 2 .   ? 37.221  -10.990 -3.684  1.00 45.70 ? 4461 HOH A O   1 
HETATM 3018 O O   . HOH C 2 .   ? 23.708  -13.071 -17.361 1.00 47.54 ? 4462 HOH A O   1 
HETATM 3019 O O   . HOH C 2 .   ? 21.212  5.998   25.430  1.00 41.76 ? 4467 HOH A O   1 
HETATM 3020 O O   . HOH C 2 .   ? 31.345  9.791   -13.633 1.00 32.66 ? 4468 HOH A O   1 
HETATM 3021 O O   . HOH C 2 .   ? 7.604   -14.906 5.285   1.00 39.50 ? 4469 HOH A O   1 
HETATM 3022 O O   . HOH C 2 .   ? 27.465  4.394   26.111  1.00 27.29 ? 4471 HOH A O   1 
HETATM 3023 O O   . HOH C 2 .   ? 36.980  -8.170  3.499   1.00 41.31 ? 4474 HOH A O   1 
HETATM 3024 O O   . HOH C 2 .   ? 39.223  -6.898  3.735   1.00 34.64 ? 4475 HOH A O   1 
HETATM 3025 O O   . HOH C 2 .   ? 27.462  6.649   21.908  1.00 29.62 ? 4476 HOH A O   1 
HETATM 3026 O O   . HOH C 2 .   ? 22.139  -9.316  18.499  1.00 41.07 ? 4479 HOH A O   1 
HETATM 3027 O O   . HOH C 2 .   ? 25.742  -8.077  16.585  1.00 46.08 ? 4480 HOH A O   1 
HETATM 3028 O O   . HOH C 2 .   ? 26.130  12.547  -11.907 1.00 47.28 ? 4482 HOH A O   1 
HETATM 3029 O O   . HOH D 2 .   ? 10.632  8.658   21.986  1.00 12.86 ? 4004 HOH B O   1 
HETATM 3030 O O   . HOH D 2 .   ? 20.179  8.220   33.911  1.00 12.82 ? 4009 HOH B O   1 
HETATM 3031 O O   . HOH D 2 .   ? 8.511   -3.460  32.758  1.00 15.16 ? 4013 HOH B O   1 
HETATM 3032 O O   . HOH D 2 .   ? 16.680  14.855  8.544   1.00 14.92 ? 4016 HOH B O   1 
HETATM 3033 O O   . HOH D 2 .   ? 8.583   8.988   20.147  1.00 15.84 ? 4022 HOH B O   1 
HETATM 3034 O O   . HOH D 2 .   ? 24.437  9.471   16.611  1.00 20.66 ? 4023 HOH B O   1 
HETATM 3035 O O   . HOH D 2 .   ? 5.277   6.177   8.882   1.00 14.17 ? 4032 HOH B O   1 
HETATM 3036 O O   . HOH D 2 .   ? 14.861  11.387  37.448  1.00 20.56 ? 4033 HOH B O   1 
HETATM 3037 O O   . HOH D 2 .   ? 17.496  -11.196 29.546  1.00 24.00 ? 4035 HOH B O   1 
HETATM 3038 O O   . HOH D 2 .   ? 23.379  1.795   34.428  1.00 19.90 ? 4039 HOH B O   1 
HETATM 3039 O O   . HOH D 2 .   ? 7.787   -11.848 9.884   1.00 18.12 ? 4045 HOH B O   1 
HETATM 3040 O O   . HOH D 2 .   ? -0.282  -0.190  31.870  1.00 21.93 ? 4046 HOH B O   1 
HETATM 3041 O O   . HOH D 2 .   ? -4.557  -8.101  15.692  1.00 19.56 ? 4049 HOH B O   1 
HETATM 3042 O O   . HOH D 2 .   ? 3.003   4.159   8.856   1.00 18.10 ? 4053 HOH B O   1 
HETATM 3043 O O   . HOH D 2 .   ? -1.467  -5.034  10.390  1.00 23.26 ? 4056 HOH B O   1 
HETATM 3044 O O   . HOH D 2 .   ? 14.069  -15.482 13.233  1.00 20.01 ? 4057 HOH B O   1 
HETATM 3045 O O   . HOH D 2 .   ? 11.340  -11.344 6.676   1.00 21.97 ? 4060 HOH B O   1 
HETATM 3046 O O   . HOH D 2 .   ? 17.226  12.007  20.608  1.00 19.89 ? 4064 HOH B O   1 
HETATM 3047 O O   . HOH D 2 .   ? 16.136  -7.900  19.883  1.00 14.26 ? 4066 HOH B O   1 
HETATM 3048 O O   . HOH D 2 .   ? 12.110  6.040   40.518  1.00 21.06 ? 4069 HOH B O   1 
HETATM 3049 O O   . HOH D 2 .   ? 19.193  17.294  12.943  1.00 15.59 ? 4070 HOH B O   1 
HETATM 3050 O O   . HOH D 2 .   ? 10.878  -11.420 23.146  1.00 19.34 ? 4072 HOH B O   1 
HETATM 3051 O O   . HOH D 2 .   ? -1.309  -1.011  10.653  1.00 20.76 ? 4074 HOH B O   1 
HETATM 3052 O O   . HOH D 2 .   ? 15.440  11.944  27.700  1.00 23.07 ? 4075 HOH B O   1 
HETATM 3053 O O   . HOH D 2 .   ? 18.619  6.628   40.828  1.00 36.24 ? 4076 HOH B O   1 
HETATM 3054 O O   . HOH D 2 .   ? 16.815  -5.738  17.984  1.00 17.24 ? 4081 HOH B O   1 
HETATM 3055 O O   . HOH D 2 .   ? 23.509  3.058   37.032  1.00 19.74 ? 4082 HOH B O   1 
HETATM 3056 O O   . HOH D 2 .   ? 19.209  8.341   21.632  1.00 24.80 ? 4084 HOH B O   1 
HETATM 3057 O O   . HOH D 2 .   ? 6.242   15.096  16.648  1.00 24.74 ? 4086 HOH B O   1 
HETATM 3058 O O   . HOH D 2 .   ? 9.564   -1.115  43.752  1.00 28.21 ? 4088 HOH B O   1 
HETATM 3059 O O   . HOH D 2 .   ? 22.142  5.638   34.308  1.00 17.59 ? 4090 HOH B O   1 
HETATM 3060 O O   . HOH D 2 .   ? 7.402   -13.562 21.808  1.00 23.24 ? 4092 HOH B O   1 
HETATM 3061 O O   . HOH D 2 .   ? 14.625  -10.534 28.432  1.00 24.41 ? 4093 HOH B O   1 
HETATM 3062 O O   . HOH D 2 .   ? 2.047   17.471  23.531  1.00 27.97 ? 4094 HOH B O   1 
HETATM 3063 O O   . HOH D 2 .   ? 11.632  11.149  33.335  1.00 28.67 ? 4096 HOH B O   1 
HETATM 3064 O O   . HOH D 2 .   ? 22.323  -1.734  33.747  1.00 25.92 ? 4100 HOH B O   1 
HETATM 3065 O O   . HOH D 2 .   ? -1.135  -16.873 19.002  1.00 25.48 ? 4104 HOH B O   1 
HETATM 3066 O O   . HOH D 2 .   ? 21.061  14.867  8.081   1.00 31.45 ? 4105 HOH B O   1 
HETATM 3067 O O   . HOH D 2 .   ? 19.288  4.374   21.639  1.00 24.35 ? 4106 HOH B O   1 
HETATM 3068 O O   . HOH D 2 .   ? 9.520   -19.050 15.289  1.00 26.59 ? 4108 HOH B O   1 
HETATM 3069 O O   . HOH D 2 .   ? 21.539  17.104  11.287  1.00 24.38 ? 4113 HOH B O   1 
HETATM 3070 O O   . HOH D 2 .   ? 24.809  -3.166  36.419  1.00 29.63 ? 4114 HOH B O   1 
HETATM 3071 O O   . HOH D 2 .   ? 7.709   16.219  19.409  1.00 20.29 ? 4116 HOH B O   1 
HETATM 3072 O O   . HOH D 2 .   ? 2.767   -3.459  36.935  1.00 25.65 ? 4118 HOH B O   1 
HETATM 3073 O O   . HOH D 2 .   ? 22.346  7.414   22.035  1.00 23.19 ? 4120 HOH B O   1 
HETATM 3074 O O   . HOH D 2 .   ? 15.978  4.079   43.519  1.00 36.44 ? 4123 HOH B O   1 
HETATM 3075 O O   . HOH D 2 .   ? 14.964  16.021  15.395  1.00 23.03 ? 4124 HOH B O   1 
HETATM 3076 O O   . HOH D 2 .   ? 19.373  14.397  15.089  1.00 28.41 ? 4125 HOH B O   1 
HETATM 3077 O O   . HOH D 2 .   ? 8.000   11.953  38.365  1.00 29.00 ? 4127 HOH B O   1 
HETATM 3078 O O   . HOH D 2 .   ? -4.485  1.449   15.032  1.00 25.59 ? 4128 HOH B O   1 
HETATM 3079 O O   . HOH D 2 .   ? 13.099  11.688  29.339  1.00 24.43 ? 4129 HOH B O   1 
HETATM 3080 O O   . HOH D 2 .   ? 2.488   20.018  27.112  1.00 31.27 ? 4132 HOH B O   1 
HETATM 3081 O O   . HOH D 2 .   ? 17.342  -8.259  36.891  1.00 30.15 ? 4138 HOH B O   1 
HETATM 3082 O O   . HOH D 2 .   ? 6.687   17.792  24.802  1.00 23.67 ? 4139 HOH B O   1 
HETATM 3083 O O   . HOH D 2 .   ? -0.330  -17.976 23.932  1.00 30.45 ? 4140 HOH B O   1 
HETATM 3084 O O   . HOH D 2 .   ? 0.352   -2.950  35.503  1.00 22.97 ? 4147 HOH B O   1 
HETATM 3085 O O   . HOH D 2 .   ? 20.784  12.534  18.235  1.00 23.67 ? 4148 HOH B O   1 
HETATM 3086 O O   . HOH D 2 .   ? 4.599   15.207  13.921  1.00 32.90 ? 4149 HOH B O   1 
HETATM 3087 O O   . HOH D 2 .   ? 23.700  8.466   32.092  1.00 33.71 ? 4155 HOH B O   1 
HETATM 3088 O O   . HOH D 2 .   ? 8.126   -8.944  36.241  1.00 35.76 ? 4156 HOH B O   1 
HETATM 3089 O O   . HOH D 2 .   ? 21.837  -7.784  27.457  1.00 33.93 ? 4157 HOH B O   1 
HETATM 3090 O O   . HOH D 2 .   ? -3.754  -4.373  26.741  1.00 30.27 ? 4158 HOH B O   1 
HETATM 3091 O O   . HOH D 2 .   ? 0.526   18.653  25.718  1.00 35.08 ? 4159 HOH B O   1 
HETATM 3092 O O   . HOH D 2 .   ? -4.326  17.397  14.852  1.00 34.59 ? 4161 HOH B O   1 
HETATM 3093 O O   . HOH D 2 .   ? -0.542  18.692  12.033  1.00 39.07 ? 4163 HOH B O   1 
HETATM 3094 O O   . HOH D 2 .   ? 1.882   -0.241  39.780  1.00 36.36 ? 4168 HOH B O   1 
HETATM 3095 O O   . HOH D 2 .   ? -5.077  -6.844  24.318  1.00 34.29 ? 4170 HOH B O   1 
HETATM 3096 O O   . HOH D 2 .   ? -5.908  3.333   24.684  1.00 27.72 ? 4172 HOH B O   1 
HETATM 3097 O O   . HOH D 2 .   ? 2.189   4.967   39.547  1.00 28.06 ? 4173 HOH B O   1 
HETATM 3098 O O   . HOH D 2 .   ? -9.128  -6.242  22.215  1.00 36.29 ? 4178 HOH B O   1 
HETATM 3099 O O   . HOH D 2 .   ? 16.539  8.557   44.619  1.00 24.07 ? 4184 HOH B O   1 
HETATM 3100 O O   . HOH D 2 .   ? 3.702   0.850   43.836  1.00 23.95 ? 4186 HOH B O   1 
HETATM 3101 O O   . HOH D 2 .   ? -3.963  13.499  11.809  1.00 37.75 ? 4187 HOH B O   1 
HETATM 3102 O O   . HOH D 2 .   ? 4.853   -11.005 26.325  1.00 27.89 ? 4188 HOH B O   1 
HETATM 3103 O O   . HOH D 2 .   ? 16.799  14.480  16.383  1.00 31.11 ? 4189 HOH B O   1 
HETATM 3104 O O   . HOH D 2 .   ? -8.034  -2.159  23.899  1.00 43.90 ? 4191 HOH B O   1 
HETATM 3105 O O   . HOH D 2 .   ? -11.484 6.740   28.549  1.00 33.23 ? 4192 HOH B O   1 
HETATM 3106 O O   . HOH D 2 .   ? -1.044  -10.846 27.716  1.00 30.37 ? 4193 HOH B O   1 
HETATM 3107 O O   . HOH D 2 .   ? -11.221 -10.056 18.529  1.00 31.43 ? 4200 HOH B O   1 
HETATM 3108 O O   . HOH D 2 .   ? 8.723   19.258  24.346  1.00 35.70 ? 4202 HOH B O   1 
HETATM 3109 O O   . HOH D 2 .   ? 11.867  11.386  40.304  1.00 39.70 ? 4203 HOH B O   1 
HETATM 3110 O O   . HOH D 2 .   ? 20.073  -8.489  19.010  1.00 42.52 ? 4204 HOH B O   1 
HETATM 3111 O O   . HOH D 2 .   ? 8.253   -4.589  42.317  1.00 33.91 ? 4205 HOH B O   1 
HETATM 3112 O O   . HOH D 2 .   ? -5.192  6.049   26.507  1.00 26.82 ? 4207 HOH B O   1 
HETATM 3113 O O   . HOH D 2 .   ? -0.610  -7.742  8.047   1.00 38.66 ? 4209 HOH B O   1 
HETATM 3114 O O   . HOH D 2 .   ? -4.096  2.382   11.120  1.00 41.48 ? 4213 HOH B O   1 
HETATM 3115 O O   . HOH D 2 .   ? -0.626  16.150  17.912  1.00 28.05 ? 4218 HOH B O   1 
HETATM 3116 O O   . HOH D 2 .   ? -14.257 -10.454 15.491  1.00 42.58 ? 4219 HOH B O   1 
HETATM 3117 O O   . HOH D 2 .   ? 12.439  -19.386 18.096  1.00 38.47 ? 4220 HOH B O   1 
HETATM 3118 O O   . HOH D 2 .   ? -2.782  16.049  31.082  1.00 38.83 ? 4222 HOH B O   1 
HETATM 3119 O O   . HOH D 2 .   ? 3.548   17.879  13.153  1.00 41.91 ? 4223 HOH B O   1 
HETATM 3120 O O   . HOH D 2 .   ? -0.460  -19.718 20.961  1.00 37.61 ? 4225 HOH B O   1 
HETATM 3121 O O   . HOH D 2 .   ? 14.840  -11.288 25.694  1.00 26.65 ? 4226 HOH B O   1 
HETATM 3122 O O   . HOH D 2 .   ? -9.512  -5.605  19.016  1.00 32.37 ? 4230 HOH B O   1 
HETATM 3123 O O   . HOH D 2 .   ? -7.334  6.703   22.975  1.00 39.22 ? 4231 HOH B O   1 
HETATM 3124 O O   . HOH D 2 .   ? -4.115  -14.006 18.015  1.00 33.46 ? 4234 HOH B O   1 
HETATM 3125 O O   . HOH D 2 .   ? 2.185   7.233   7.197   1.00 35.07 ? 4235 HOH B O   1 
HETATM 3126 O O   . HOH D 2 .   ? -8.353  -10.466 17.934  1.00 54.49 ? 4237 HOH B O   1 
HETATM 3127 O O   . HOH D 2 .   ? 6.179   -17.834 9.452   1.00 23.63 ? 4239 HOH B O   1 
HETATM 3128 O O   . HOH D 2 .   ? -8.285  -2.410  20.051  1.00 45.07 ? 4240 HOH B O   1 
HETATM 3129 O O   . HOH D 2 .   ? 13.665  13.110  35.304  1.00 39.31 ? 4241 HOH B O   1 
HETATM 3130 O O   . HOH D 2 .   ? 0.520   16.265  21.555  1.00 32.47 ? 4245 HOH B O   1 
HETATM 3131 O O   . HOH D 2 .   ? -0.217  0.972   37.237  1.00 43.06 ? 4246 HOH B O   1 
HETATM 3132 O O   . HOH D 2 .   ? 22.062  8.450   26.809  1.00 40.21 ? 4247 HOH B O   1 
HETATM 3133 O O   . HOH D 2 .   ? 12.846  -12.055 29.846  1.00 32.68 ? 4250 HOH B O   1 
HETATM 3134 O O   . HOH D 2 .   ? 25.799  5.891   38.608  1.00 42.70 ? 4251 HOH B O   1 
HETATM 3135 O O   . HOH D 2 .   ? 6.529   17.153  13.056  1.00 44.22 ? 4257 HOH B O   1 
HETATM 3136 O O   . HOH D 2 .   ? 11.152  -14.806 20.966  1.00 42.94 ? 4258 HOH B O   1 
HETATM 3137 O O   . HOH D 2 .   ? 5.936   20.660  29.535  1.00 49.35 ? 4259 HOH B O   1 
HETATM 3138 O O   . HOH D 2 .   ? -1.858  9.016   6.675   1.00 38.03 ? 4260 HOH B O   1 
HETATM 3139 O O   . HOH D 2 .   ? -3.650  -9.130  25.947  1.00 38.07 ? 4264 HOH B O   1 
HETATM 3140 O O   . HOH D 2 .   ? 17.445  -17.535 12.188  1.00 36.49 ? 4265 HOH B O   1 
HETATM 3141 O O   . HOH D 2 .   ? 14.067  11.453  44.111  1.00 38.90 ? 4269 HOH B O   1 
HETATM 3142 O O   . HOH D 2 .   ? 0.140   3.097   39.294  1.00 45.96 ? 4270 HOH B O   1 
HETATM 3143 O O   . HOH D 2 .   ? 10.686  -18.357 8.278   1.00 37.42 ? 4271 HOH B O   1 
HETATM 3144 O O   . HOH D 2 .   ? 7.621   15.368  35.302  1.00 42.31 ? 4272 HOH B O   1 
HETATM 3145 O O   . HOH D 2 .   ? 9.477   -10.293 31.873  1.00 59.88 ? 4275 HOH B O   1 
HETATM 3146 O O   . HOH D 2 .   ? 24.171  10.915  18.638  1.00 36.87 ? 4276 HOH B O   1 
HETATM 3147 O O   . HOH D 2 .   ? -0.383  3.668   7.477   1.00 38.63 ? 4277 HOH B O   1 
HETATM 3148 O O   . HOH D 2 .   ? 16.414  -4.173  41.352  1.00 38.31 ? 4278 HOH B O   1 
HETATM 3149 O O   . HOH D 2 .   ? 14.197  -17.400 8.312   1.00 40.94 ? 4282 HOH B O   1 
HETATM 3150 O O   . HOH D 2 .   ? -7.639  9.624   12.990  1.00 41.21 ? 4283 HOH B O   1 
HETATM 3151 O O   . HOH D 2 .   ? 16.821  5.872   23.997  1.00 24.86 ? 4284 HOH B O   1 
HETATM 3152 O O   . HOH D 2 .   ? 8.922   1.453   43.995  1.00 17.58 ? 4285 HOH B O   1 
HETATM 3153 O O   . HOH D 2 .   ? 12.236  18.941  20.301  1.00 20.73 ? 4296 HOH B O   1 
HETATM 3154 O O   . HOH D 2 .   ? 25.813  2.257   27.464  1.00 27.60 ? 4297 HOH B O   1 
HETATM 3155 O O   . HOH D 2 .   ? 18.087  14.159  18.936  1.00 23.97 ? 4299 HOH B O   1 
HETATM 3156 O O   . HOH D 2 .   ? 8.886   -13.184 23.787  1.00 26.42 ? 4307 HOH B O   1 
HETATM 3157 O O   . HOH D 2 .   ? 9.759   -18.957 18.212  1.00 27.30 ? 4309 HOH B O   1 
HETATM 3158 O O   . HOH D 2 .   ? -0.644  -8.252  28.770  1.00 25.96 ? 4312 HOH B O   1 
HETATM 3159 O O   . HOH D 2 .   ? -0.762  -0.374  34.552  1.00 23.13 ? 4314 HOH B O   1 
HETATM 3160 O O   . HOH D 2 .   ? 12.351  2.640   46.095  1.00 62.45 ? 4316 HOH B O   1 
HETATM 3161 O O   . HOH D 2 .   ? -3.018  0.676   9.525   1.00 25.80 ? 4318 HOH B O   1 
HETATM 3162 O O   . HOH D 2 .   ? 19.250  9.870   31.504  1.00 29.32 ? 4326 HOH B O   1 
HETATM 3163 O O   . HOH D 2 .   ? 11.993  -18.453 14.706  1.00 26.66 ? 4328 HOH B O   1 
HETATM 3164 O O   . HOH D 2 .   ? 10.317  16.599  13.673  1.00 29.34 ? 4330 HOH B O   1 
HETATM 3165 O O   . HOH D 2 .   ? 17.152  3.958   45.815  1.00 36.92 ? 4331 HOH B O   1 
HETATM 3166 O O   . HOH D 2 .   ? 9.940   -12.871 4.627   1.00 30.04 ? 4342 HOH B O   1 
HETATM 3167 O O   . HOH D 2 .   ? 8.803   -14.653 19.916  1.00 28.70 ? 4344 HOH B O   1 
HETATM 3168 O O   . HOH D 2 .   ? 25.458  3.031   33.052  1.00 33.89 ? 4346 HOH B O   1 
HETATM 3169 O O   . HOH D 2 .   ? 14.986  16.599  7.359   1.00 29.06 ? 4348 HOH B O   1 
HETATM 3170 O O   . HOH D 2 .   ? 24.432  -3.180  31.532  1.00 46.01 ? 4349 HOH B O   1 
HETATM 3171 O O   . HOH D 2 .   ? 16.942  -10.632 19.185  1.00 33.69 ? 4351 HOH B O   1 
HETATM 3172 O O   . HOH D 2 .   ? -5.276  -6.439  30.146  1.00 43.61 ? 4353 HOH B O   1 
HETATM 3173 O O   . HOH D 2 .   ? 3.201   13.418  7.274   1.00 42.84 ? 4356 HOH B O   1 
HETATM 3174 O O   . HOH D 2 .   ? 15.551  6.607   46.178  1.00 35.74 ? 4360 HOH B O   1 
HETATM 3175 O O   . HOH D 2 .   ? 20.660  11.028  20.379  1.00 30.82 ? 4361 HOH B O   1 
HETATM 3176 O O   . HOH D 2 .   ? 23.810  -0.773  35.589  1.00 30.21 ? 4362 HOH B O   1 
HETATM 3177 O O   . HOH D 2 .   ? 11.089  12.898  35.658  1.00 34.09 ? 4363 HOH B O   1 
HETATM 3178 O O   . HOH D 2 .   ? -10.060 -3.334  15.315  1.00 31.16 ? 4364 HOH B O   1 
HETATM 3179 O O   . HOH D 2 .   ? 2.986   -11.039 8.202   1.00 31.33 ? 4366 HOH B O   1 
HETATM 3180 O O   . HOH D 2 .   ? -6.375  -3.694  26.849  1.00 35.98 ? 4368 HOH B O   1 
HETATM 3181 O O   . HOH D 2 .   ? 5.749   -13.238 8.522   1.00 32.34 ? 4369 HOH B O   1 
HETATM 3182 O O   . HOH D 2 .   ? 18.566  6.766   45.295  1.00 40.56 ? 4371 HOH B O   1 
HETATM 3183 O O   . HOH D 2 .   ? 2.332   9.440   42.111  1.00 51.09 ? 4372 HOH B O   1 
HETATM 3184 O O   . HOH D 2 .   ? 1.871   -4.385  39.389  1.00 30.01 ? 4388 HOH B O   1 
HETATM 3185 O O   . HOH D 2 .   ? 22.357  -16.912 15.463  1.00 39.60 ? 4389 HOH B O   1 
HETATM 3186 O O   . HOH D 2 .   ? 19.512  -11.760 16.306  1.00 46.70 ? 4390 HOH B O   1 
HETATM 3187 O O   . HOH D 2 .   ? 27.645  8.337   38.503  1.00 59.11 ? 4391 HOH B O   1 
HETATM 3188 O O   . HOH D 2 .   ? -2.955  -6.641  27.615  1.00 38.81 ? 4393 HOH B O   1 
HETATM 3189 O O   . HOH D 2 .   ? 10.401  20.665  15.707  1.00 31.21 ? 4394 HOH B O   1 
HETATM 3190 O O   . HOH D 2 .   ? 21.612  -10.112 28.832  1.00 31.90 ? 4395 HOH B O   1 
HETATM 3191 O O   . HOH D 2 .   ? -0.113  12.919  9.591   1.00 41.19 ? 4396 HOH B O   1 
HETATM 3192 O O   . HOH D 2 .   ? 2.510   -11.947 27.544  1.00 34.07 ? 4398 HOH B O   1 
HETATM 3193 O O   . HOH D 2 .   ? 14.948  2.007   44.831  1.00 37.20 ? 4399 HOH B O   1 
HETATM 3194 O O   . HOH D 2 .   ? 26.051  0.623   33.760  1.00 35.67 ? 4402 HOH B O   1 
HETATM 3195 O O   . HOH D 2 .   ? -4.673  7.586   36.894  1.00 40.36 ? 4408 HOH B O   1 
HETATM 3196 O O   . HOH D 2 .   ? 15.852  -6.345  43.103  1.00 34.23 ? 4409 HOH B O   1 
HETATM 3197 O O   . HOH D 2 .   ? -4.556  -15.618 21.589  1.00 29.05 ? 4411 HOH B O   1 
HETATM 3198 O O   . HOH D 2 .   ? 20.792  -4.788  39.180  1.00 42.53 ? 4412 HOH B O   1 
HETATM 3199 O O   . HOH D 2 .   ? 18.180  11.998  37.456  1.00 39.08 ? 4413 HOH B O   1 
HETATM 3200 O O   . HOH D 2 .   ? -6.350  -16.253 18.498  1.00 45.74 ? 4420 HOH B O   1 
HETATM 3201 O O   . HOH D 2 .   ? -2.458  -13.042 24.220  1.00 41.97 ? 4422 HOH B O   1 
HETATM 3202 O O   . HOH D 2 .   ? 13.065  -12.612 24.313  1.00 40.69 ? 4424 HOH B O   1 
HETATM 3203 O O   . HOH D 2 .   ? 24.759  16.563  11.904  1.00 34.99 ? 4426 HOH B O   1 
HETATM 3204 O O   . HOH D 2 .   ? 10.802  -11.767 27.915  1.00 35.77 ? 4429 HOH B O   1 
HETATM 3205 O O   . HOH D 2 .   ? 8.516   -17.117 19.608  1.00 34.80 ? 4434 HOH B O   1 
HETATM 3206 O O   . HOH D 2 .   ? 6.159   -17.906 20.455  1.00 43.77 ? 4435 HOH B O   1 
HETATM 3207 O O   . HOH D 2 .   ? 6.320   -20.746 20.683  1.00 45.29 ? 4436 HOH B O   1 
HETATM 3208 O O   . HOH D 2 .   ? 8.978   11.560  40.862  1.00 44.30 ? 4440 HOH B O   1 
HETATM 3209 O O   . HOH D 2 .   ? -7.110  1.822   14.745  1.00 50.28 ? 4441 HOH B O   1 
HETATM 3210 O O   . HOH D 2 .   ? 12.099  12.912  31.661  1.00 35.30 ? 4442 HOH B O   1 
HETATM 3211 O O   . HOH D 2 .   ? -11.118 -4.735  23.532  1.00 50.01 ? 4451 HOH B O   1 
HETATM 3212 O O   . HOH D 2 .   ? -1.474  19.379  16.315  1.00 45.25 ? 4456 HOH B O   1 
HETATM 3213 O O   . HOH D 2 .   ? -2.343  16.170  21.607  1.00 40.74 ? 4457 HOH B O   1 
HETATM 3214 O O   . HOH D 2 .   ? -3.760  17.783  21.252  1.00 40.96 ? 4458 HOH B O   1 
HETATM 3215 O O   . HOH D 2 .   ? -0.677  17.682  32.726  1.00 40.77 ? 4459 HOH B O   1 
HETATM 3216 O O   . HOH D 2 .   ? -3.679  -13.400 15.602  1.00 40.26 ? 4463 HOH B O   1 
HETATM 3217 O O   . HOH D 2 .   ? -3.012  -11.927 13.633  1.00 43.20 ? 4464 HOH B O   1 
HETATM 3218 O O   . HOH D 2 .   ? -5.863  -12.751 20.560  1.00 46.77 ? 4465 HOH B O   1 
HETATM 3219 O O   . HOH D 2 .   ? 0.845   8.689   5.902   1.00 38.36 ? 4466 HOH B O   1 
HETATM 3220 O O   . HOH D 2 .   ? 2.713   13.295  36.384  1.00 50.80 ? 4470 HOH B O   1 
HETATM 3221 O O   . HOH D 2 .   ? 26.421  2.211   30.119  1.00 37.37 ? 4472 HOH B O   1 
HETATM 3222 O O   . HOH D 2 .   ? 26.695  -0.097  29.623  1.00 48.17 ? 4473 HOH B O   1 
HETATM 3223 O O   . HOH D 2 .   ? 19.252  12.206  31.277  1.00 50.46 ? 4478 HOH B O   1 
HETATM 3224 O O   . HOH D 2 .   ? 12.046  21.774  18.132  1.00 32.10 ? 4481 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   2   ALA ALA A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   LYS 4   4   4   LYS LYS A . n 
A 1 5   ARG 5   5   5   ARG ARG A . n 
A 1 6   ALA 6   6   6   ALA ALA A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  LYS 12  12  12  LYS LYS A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  ALA 14  14  14  ALA ALA A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  MET 17  17  17  MET MET A . n 
A 1 18  GLU 18  18  18  GLU GLU A . n 
A 1 19  THR 19  19  19  THR THR A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  ILE 21  21  21  ILE ILE A . n 
A 1 22  PRO 22  22  22  PRO PRO A . n 
A 1 23  VAL 23  23  23  VAL VAL A . n 
A 1 24  ASP 24  24  24  ASP ASP A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  MET 26  26  26  MET MET A . n 
A 1 27  ARG 27  27  27  ARG ARG A . n 
A 1 28  ARG 28  28  28  ARG ARG A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  THR 34  34  34  THR THR A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  GLN 45  45  45  GLN GLN A . n 
A 1 46  CYS 46  46  46  CYS CYS A . n 
A 1 47  SER 47  47  47  SER SER A . n 
A 1 48  ARG 48  48  48  ARG ARG A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  CYS 53  53  53  CYS CYS A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  ASP 55  55  55  ASP ASP A . n 
A 1 56  ALA 56  56  56  ALA ALA A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  PRO 66  66  66  PRO PRO A . n 
A 1 67  TYR 67  67  67  TYR TYR A . n 
A 1 68  ASP 68  68  68  ASP ASP A . n 
A 1 69  VAL 69  69  69  VAL VAL A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  PRO 73  73  73  PRO PRO A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  ASN 76  76  76  ASN ASN A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  GLN 80  80  80  GLN GLN A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  ASN 97  97  97  ASN ASN A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 ILE 102 102 102 ILE ILE A . n 
A 1 103 ALA 103 103 103 ALA ALA A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 CYS 106 106 106 CYS CYS A . n 
A 1 107 ALA 107 107 107 ALA ALA A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 PRO 109 109 109 PRO PRO A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 HIS 115 115 115 HIS HIS A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 ILE 117 117 117 ILE ILE A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 PHE 119 119 119 PHE PHE A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 LYS 122 122 122 LYS LYS A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 THR 125 125 125 THR THR A . n 
A 1 126 HIS 126 126 126 HIS HIS A . n 
A 1 127 PRO 127 127 127 PRO PRO A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 ARG 130 130 130 ARG ARG A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 LYS 132 132 132 LYS LYS A . n 
A 1 133 MET 133 133 133 MET MET A . n 
A 1 134 MET 134 134 134 MET MET A . n 
A 1 135 ASN 135 135 135 ASN ASN A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 GLY 137 137 137 GLY GLY A . n 
A 1 138 HIS 138 138 138 HIS HIS A . n 
A 1 139 TYR 139 139 139 TYR TYR A . n 
A 1 140 THR 140 140 140 THR THR A . n 
A 1 141 TYR 141 141 141 TYR TYR A . n 
A 1 142 SER 142 142 142 SER SER A . n 
A 1 143 GLU 143 143 143 GLU GLU A . n 
A 1 144 ASN 144 144 144 ASN ASN A . n 
A 1 145 ARG 145 145 145 ARG ARG A . n 
A 1 146 VAL 146 146 146 VAL VAL A . n 
A 1 147 GLU 147 147 147 GLU GLU A . n 
A 1 148 LYS 148 148 148 LYS LYS A . n 
A 1 149 ASP 149 149 149 ASP ASP A . n 
A 1 150 GLY 150 150 150 GLY GLY A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 THR 154 154 154 THR THR A . n 
A 1 155 SER 155 155 155 SER SER A . n 
A 1 156 ARG 156 156 156 ARG ARG A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 PRO 158 158 158 PRO PRO A . n 
A 1 159 GLY 159 159 159 GLY GLY A . n 
A 1 160 THR 160 160 160 THR THR A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 PHE 162 162 162 PHE PHE A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 PHE 164 164 164 PHE PHE A . n 
A 1 165 ALA 165 165 165 ALA ALA A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 ILE 168 168 168 ILE ILE A . n 
A 1 169 VAL 169 169 169 VAL VAL A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 ASN 173 173 173 ASN ASN A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 LYS 175 175 175 LYS LYS A . n 
A 1 176 GLU 176 176 176 GLU GLU A . n 
A 1 177 VAL 177 177 177 VAL VAL A . n 
A 1 178 ALA 178 178 178 ALA ALA A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 GLN 180 180 180 GLN GLN A . n 
A 1 181 VAL 181 181 181 VAL VAL A . n 
A 1 182 LYS 182 182 182 LYS LYS A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 PRO 184 184 184 PRO PRO A . n 
A 1 185 LEU 185 185 185 LEU LEU A . n 
A 1 186 VAL 186 186 186 VAL VAL A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 LYS 188 188 188 LYS LYS A . n 
A 1 189 ASP 189 189 ?   ?   ?   A . n 
A 1 190 LEU 190 190 ?   ?   ?   A . n 
A 1 191 GLU 191 191 ?   ?   ?   A . n 
A 1 192 HIS 192 192 ?   ?   ?   A . n 
A 1 193 HIS 193 193 ?   ?   ?   A . n 
A 1 194 HIS 194 194 ?   ?   ?   A . n 
A 1 195 HIS 195 195 ?   ?   ?   A . n 
A 1 196 HIS 196 196 ?   ?   ?   A . n 
A 1 197 HIS 197 197 ?   ?   ?   A . n 
B 1 1   MET 1   201 ?   ?   ?   B . n 
B 1 2   ALA 2   202 202 ALA ALA B . n 
B 1 3   SER 3   203 203 SER SER B . n 
B 1 4   LYS 4   204 204 LYS LYS B . n 
B 1 5   ARG 5   205 205 ARG ARG B . n 
B 1 6   ALA 6   206 206 ALA ALA B . n 
B 1 7   LEU 7   207 207 LEU LEU B . n 
B 1 8   VAL 8   208 208 VAL VAL B . n 
B 1 9   ILE 9   209 209 ILE ILE B . n 
B 1 10  LEU 10  210 210 LEU LEU B . n 
B 1 11  ALA 11  211 211 ALA ALA B . n 
B 1 12  LYS 12  212 212 LYS LYS B . n 
B 1 13  GLY 13  213 213 GLY GLY B . n 
B 1 14  ALA 14  214 214 ALA ALA B . n 
B 1 15  GLU 15  215 215 GLU GLU B . n 
B 1 16  GLU 16  216 216 GLU GLU B . n 
B 1 17  MET 17  217 217 MET MET B . n 
B 1 18  GLU 18  218 218 GLU GLU B . n 
B 1 19  THR 19  219 219 THR THR B . n 
B 1 20  VAL 20  220 220 VAL VAL B . n 
B 1 21  ILE 21  221 221 ILE ILE B . n 
B 1 22  PRO 22  222 222 PRO PRO B . n 
B 1 23  VAL 23  223 223 VAL VAL B . n 
B 1 24  ASP 24  224 224 ASP ASP B . n 
B 1 25  VAL 25  225 225 VAL VAL B . n 
B 1 26  MET 26  226 226 MET MET B . n 
B 1 27  ARG 27  227 227 ARG ARG B . n 
B 1 28  ARG 28  228 228 ARG ARG B . n 
B 1 29  ALA 29  229 229 ALA ALA B . n 
B 1 30  GLY 30  230 230 GLY GLY B . n 
B 1 31  ILE 31  231 231 ILE ILE B . n 
B 1 32  LYS 32  232 232 LYS LYS B . n 
B 1 33  VAL 33  233 233 VAL VAL B . n 
B 1 34  THR 34  234 234 THR THR B . n 
B 1 35  VAL 35  235 235 VAL VAL B . n 
B 1 36  ALA 36  236 236 ALA ALA B . n 
B 1 37  GLY 37  237 237 GLY GLY B . n 
B 1 38  LEU 38  238 238 LEU LEU B . n 
B 1 39  ALA 39  239 239 ALA ALA B . n 
B 1 40  GLY 40  240 240 GLY GLY B . n 
B 1 41  LYS 41  241 241 LYS LYS B . n 
B 1 42  ASP 42  242 242 ASP ASP B . n 
B 1 43  PRO 43  243 243 PRO PRO B . n 
B 1 44  VAL 44  244 244 VAL VAL B . n 
B 1 45  GLN 45  245 245 GLN GLN B . n 
B 1 46  CYS 46  246 246 CYS CYS B . n 
B 1 47  SER 47  247 247 SER SER B . n 
B 1 48  ARG 48  248 248 ARG ARG B . n 
B 1 49  ASP 49  249 249 ASP ASP B . n 
B 1 50  VAL 50  250 250 VAL VAL B . n 
B 1 51  VAL 51  251 251 VAL VAL B . n 
B 1 52  ILE 52  252 252 ILE ILE B . n 
B 1 53  CYS 53  253 253 CYS CYS B . n 
B 1 54  PRO 54  254 254 PRO PRO B . n 
B 1 55  ASP 55  255 255 ASP ASP B . n 
B 1 56  ALA 56  256 256 ALA ALA B . n 
B 1 57  SER 57  257 257 SER SER B . n 
B 1 58  LEU 58  258 258 LEU LEU B . n 
B 1 59  GLU 59  259 259 GLU GLU B . n 
B 1 60  ASP 60  260 260 ASP ASP B . n 
B 1 61  ALA 61  261 261 ALA ALA B . n 
B 1 62  LYS 62  262 262 LYS LYS B . n 
B 1 63  LYS 63  263 263 LYS LYS B . n 
B 1 64  GLU 64  264 264 GLU GLU B . n 
B 1 65  GLY 65  265 265 GLY GLY B . n 
B 1 66  PRO 66  266 266 PRO PRO B . n 
B 1 67  TYR 67  267 267 TYR TYR B . n 
B 1 68  ASP 68  268 268 ASP ASP B . n 
B 1 69  VAL 69  269 269 VAL VAL B . n 
B 1 70  VAL 70  270 270 VAL VAL B . n 
B 1 71  VAL 71  271 271 VAL VAL B . n 
B 1 72  LEU 72  272 272 LEU LEU B . n 
B 1 73  PRO 73  273 273 PRO PRO B . n 
B 1 74  GLY 74  274 274 GLY GLY B . n 
B 1 75  GLY 75  275 275 GLY GLY B . n 
B 1 76  ASN 76  276 276 ASN ASN B . n 
B 1 77  LEU 77  277 277 LEU LEU B . n 
B 1 78  GLY 78  278 278 GLY GLY B . n 
B 1 79  ALA 79  279 279 ALA ALA B . n 
B 1 80  GLN 80  280 280 GLN GLN B . n 
B 1 81  ASN 81  281 281 ASN ASN B . n 
B 1 82  LEU 82  282 282 LEU LEU B . n 
B 1 83  SER 83  283 283 SER SER B . n 
B 1 84  GLU 84  284 284 GLU GLU B . n 
B 1 85  SER 85  285 285 SER SER B . n 
B 1 86  ALA 86  286 286 ALA ALA B . n 
B 1 87  ALA 87  287 287 ALA ALA B . n 
B 1 88  VAL 88  288 288 VAL VAL B . n 
B 1 89  LYS 89  289 289 LYS LYS B . n 
B 1 90  GLU 90  290 290 GLU GLU B . n 
B 1 91  ILE 91  291 291 ILE ILE B . n 
B 1 92  LEU 92  292 292 LEU LEU B . n 
B 1 93  LYS 93  293 293 LYS LYS B . n 
B 1 94  GLU 94  294 294 GLU GLU B . n 
B 1 95  GLN 95  295 295 GLN GLN B . n 
B 1 96  GLU 96  296 296 GLU GLU B . n 
B 1 97  ASN 97  297 297 ASN ASN B . n 
B 1 98  ARG 98  298 298 ARG ARG B . n 
B 1 99  LYS 99  299 299 LYS LYS B . n 
B 1 100 GLY 100 300 300 GLY GLY B . n 
B 1 101 LEU 101 301 301 LEU LEU B . n 
B 1 102 ILE 102 302 302 ILE ILE B . n 
B 1 103 ALA 103 303 303 ALA ALA B . n 
B 1 104 ALA 104 304 304 ALA ALA B . n 
B 1 105 ILE 105 305 305 ILE ILE B . n 
B 1 106 CYS 106 306 306 CYS CYS B . n 
B 1 107 ALA 107 307 307 ALA ALA B . n 
B 1 108 GLY 108 308 308 GLY GLY B . n 
B 1 109 PRO 109 309 309 PRO PRO B . n 
B 1 110 THR 110 310 310 THR THR B . n 
B 1 111 ALA 111 311 311 ALA ALA B . n 
B 1 112 LEU 112 312 312 LEU LEU B . n 
B 1 113 LEU 113 313 313 LEU LEU B . n 
B 1 114 ALA 114 314 314 ALA ALA B . n 
B 1 115 HIS 115 315 315 HIS HIS B . n 
B 1 116 GLU 116 316 316 GLU GLU B . n 
B 1 117 ILE 117 317 317 ILE ILE B . n 
B 1 118 GLY 118 318 318 GLY GLY B . n 
B 1 119 PHE 119 319 319 PHE PHE B . n 
B 1 120 GLY 120 320 320 GLY GLY B . n 
B 1 121 SER 121 321 321 SER SER B . n 
B 1 122 LYS 122 322 322 LYS LYS B . n 
B 1 123 VAL 123 323 323 VAL VAL B . n 
B 1 124 THR 124 324 324 THR THR B . n 
B 1 125 THR 125 325 325 THR THR B . n 
B 1 126 HIS 126 326 326 HIS HIS B . n 
B 1 127 PRO 127 327 327 PRO PRO B . n 
B 1 128 LEU 128 328 328 LEU LEU B . n 
B 1 129 ALA 129 329 329 ALA ALA B . n 
B 1 130 ARG 130 330 330 ARG ARG B . n 
B 1 131 ASP 131 331 331 ASP ASP B . n 
B 1 132 LYS 132 332 332 LYS LYS B . n 
B 1 133 MET 133 333 333 MET MET B . n 
B 1 134 MET 134 334 334 MET MET B . n 
B 1 135 ASN 135 335 335 ASN ASN B . n 
B 1 136 GLY 136 336 336 GLY GLY B . n 
B 1 137 GLY 137 337 337 GLY GLY B . n 
B 1 138 HIS 138 338 338 HIS HIS B . n 
B 1 139 TYR 139 339 339 TYR TYR B . n 
B 1 140 THR 140 340 340 THR THR B . n 
B 1 141 TYR 141 341 341 TYR TYR B . n 
B 1 142 SER 142 342 342 SER SER B . n 
B 1 143 GLU 143 343 343 GLU GLU B . n 
B 1 144 ASN 144 344 344 ASN ASN B . n 
B 1 145 ARG 145 345 345 ARG ARG B . n 
B 1 146 VAL 146 346 346 VAL VAL B . n 
B 1 147 GLU 147 347 347 GLU GLU B . n 
B 1 148 LYS 148 348 348 LYS LYS B . n 
B 1 149 ASP 149 349 349 ASP ASP B . n 
B 1 150 GLY 150 350 350 GLY GLY B . n 
B 1 151 LEU 151 351 351 LEU LEU B . n 
B 1 152 ILE 152 352 352 ILE ILE B . n 
B 1 153 LEU 153 353 353 LEU LEU B . n 
B 1 154 THR 154 354 354 THR THR B . n 
B 1 155 SER 155 355 355 SER SER B . n 
B 1 156 ARG 156 356 356 ARG ARG B . n 
B 1 157 GLY 157 357 357 GLY GLY B . n 
B 1 158 PRO 158 358 358 PRO PRO B . n 
B 1 159 GLY 159 359 359 GLY GLY B . n 
B 1 160 THR 160 360 360 THR THR B . n 
B 1 161 SER 161 361 361 SER SER B . n 
B 1 162 PHE 162 362 362 PHE PHE B . n 
B 1 163 GLU 163 363 363 GLU GLU B . n 
B 1 164 PHE 164 364 364 PHE PHE B . n 
B 1 165 ALA 165 365 365 ALA ALA B . n 
B 1 166 LEU 166 366 366 LEU LEU B . n 
B 1 167 ALA 167 367 367 ALA ALA B . n 
B 1 168 ILE 168 368 368 ILE ILE B . n 
B 1 169 VAL 169 369 369 VAL VAL B . n 
B 1 170 GLU 170 370 370 GLU GLU B . n 
B 1 171 ALA 171 371 371 ALA ALA B . n 
B 1 172 LEU 172 372 372 LEU LEU B . n 
B 1 173 ASN 173 373 373 ASN ASN B . n 
B 1 174 GLY 174 374 374 GLY GLY B . n 
B 1 175 LYS 175 375 375 LYS LYS B . n 
B 1 176 GLU 176 376 376 GLU GLU B . n 
B 1 177 VAL 177 377 377 VAL VAL B . n 
B 1 178 ALA 178 378 378 ALA ALA B . n 
B 1 179 ALA 179 379 379 ALA ALA B . n 
B 1 180 GLN 180 380 380 GLN GLN B . n 
B 1 181 VAL 181 381 381 VAL VAL B . n 
B 1 182 LYS 182 382 382 LYS LYS B . n 
B 1 183 ALA 183 383 383 ALA ALA B . n 
B 1 184 PRO 184 384 384 PRO PRO B . n 
B 1 185 LEU 185 385 385 LEU LEU B . n 
B 1 186 VAL 186 386 386 VAL VAL B . n 
B 1 187 LEU 187 387 387 LEU LEU B . n 
B 1 188 LYS 188 388 388 LYS LYS B . n 
B 1 189 ASP 189 389 ?   ?   ?   B . n 
B 1 190 LEU 190 390 ?   ?   ?   B . n 
B 1 191 GLU 191 391 ?   ?   ?   B . n 
B 1 192 HIS 192 392 ?   ?   ?   B . n 
B 1 193 HIS 193 393 ?   ?   ?   B . n 
B 1 194 HIS 194 394 ?   ?   ?   B . n 
B 1 195 HIS 195 395 ?   ?   ?   B . n 
B 1 196 HIS 196 396 ?   ?   ?   B . n 
B 1 197 HIS 197 397 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1   4001 4001 HOH HOH A . 
C 2 HOH 2   4002 4002 HOH HOH A . 
C 2 HOH 3   4003 4003 HOH HOH A . 
C 2 HOH 4   4005 4005 HOH HOH A . 
C 2 HOH 5   4006 4006 HOH HOH A . 
C 2 HOH 6   4007 4007 HOH HOH A . 
C 2 HOH 7   4008 4008 HOH HOH A . 
C 2 HOH 8   4010 4010 HOH HOH A . 
C 2 HOH 9   4011 4011 HOH HOH A . 
C 2 HOH 10  4012 4012 HOH HOH A . 
C 2 HOH 11  4014 4014 HOH HOH A . 
C 2 HOH 12  4015 4015 HOH HOH A . 
C 2 HOH 13  4017 4017 HOH HOH A . 
C 2 HOH 14  4018 4018 HOH HOH A . 
C 2 HOH 15  4019 4019 HOH HOH A . 
C 2 HOH 16  4020 4020 HOH HOH A . 
C 2 HOH 17  4021 4021 HOH HOH A . 
C 2 HOH 18  4024 4024 HOH HOH A . 
C 2 HOH 19  4025 4025 HOH HOH A . 
C 2 HOH 20  4026 4026 HOH HOH A . 
C 2 HOH 21  4027 4027 HOH HOH A . 
C 2 HOH 22  4028 4028 HOH HOH A . 
C 2 HOH 23  4029 4029 HOH HOH A . 
C 2 HOH 24  4030 4030 HOH HOH A . 
C 2 HOH 25  4031 4031 HOH HOH A . 
C 2 HOH 26  4034 4034 HOH HOH A . 
C 2 HOH 27  4036 4036 HOH HOH A . 
C 2 HOH 28  4037 4037 HOH HOH A . 
C 2 HOH 29  4038 4038 HOH HOH A . 
C 2 HOH 30  4040 4040 HOH HOH A . 
C 2 HOH 31  4041 4041 HOH HOH A . 
C 2 HOH 32  4042 4042 HOH HOH A . 
C 2 HOH 33  4043 4043 HOH HOH A . 
C 2 HOH 34  4044 4044 HOH HOH A . 
C 2 HOH 35  4047 4047 HOH HOH A . 
C 2 HOH 36  4048 4048 HOH HOH A . 
C 2 HOH 37  4050 4050 HOH HOH A . 
C 2 HOH 38  4051 4051 HOH HOH A . 
C 2 HOH 39  4052 4052 HOH HOH A . 
C 2 HOH 40  4054 4054 HOH HOH A . 
C 2 HOH 41  4055 4055 HOH HOH A . 
C 2 HOH 42  4058 4058 HOH HOH A . 
C 2 HOH 43  4059 4059 HOH HOH A . 
C 2 HOH 44  4061 4061 HOH HOH A . 
C 2 HOH 45  4062 4062 HOH HOH A . 
C 2 HOH 46  4063 4063 HOH HOH A . 
C 2 HOH 47  4065 4065 HOH HOH A . 
C 2 HOH 48  4067 4067 HOH HOH A . 
C 2 HOH 49  4068 4068 HOH HOH A . 
C 2 HOH 50  4071 4071 HOH HOH A . 
C 2 HOH 51  4073 4073 HOH HOH A . 
C 2 HOH 52  4077 4077 HOH HOH A . 
C 2 HOH 53  4078 4078 HOH HOH A . 
C 2 HOH 54  4079 4079 HOH HOH A . 
C 2 HOH 55  4080 4080 HOH HOH A . 
C 2 HOH 56  4083 4083 HOH HOH A . 
C 2 HOH 57  4085 4085 HOH HOH A . 
C 2 HOH 58  4087 4087 HOH HOH A . 
C 2 HOH 59  4089 4089 HOH HOH A . 
C 2 HOH 60  4091 4091 HOH HOH A . 
C 2 HOH 61  4095 4095 HOH HOH A . 
C 2 HOH 62  4097 4097 HOH HOH A . 
C 2 HOH 63  4098 4098 HOH HOH A . 
C 2 HOH 64  4099 4099 HOH HOH A . 
C 2 HOH 65  4101 4101 HOH HOH A . 
C 2 HOH 66  4102 4102 HOH HOH A . 
C 2 HOH 67  4103 4103 HOH HOH A . 
C 2 HOH 68  4107 4107 HOH HOH A . 
C 2 HOH 69  4109 4109 HOH HOH A . 
C 2 HOH 70  4110 4110 HOH HOH A . 
C 2 HOH 71  4111 4111 HOH HOH A . 
C 2 HOH 72  4112 4112 HOH HOH A . 
C 2 HOH 73  4115 4115 HOH HOH A . 
C 2 HOH 74  4117 4117 HOH HOH A . 
C 2 HOH 75  4119 4119 HOH HOH A . 
C 2 HOH 76  4121 4121 HOH HOH A . 
C 2 HOH 77  4122 4122 HOH HOH A . 
C 2 HOH 78  4126 4126 HOH HOH A . 
C 2 HOH 79  4130 4130 HOH HOH A . 
C 2 HOH 80  4131 4131 HOH HOH A . 
C 2 HOH 81  4133 4133 HOH HOH A . 
C 2 HOH 82  4134 4134 HOH HOH A . 
C 2 HOH 83  4135 4135 HOH HOH A . 
C 2 HOH 84  4136 4136 HOH HOH A . 
C 2 HOH 85  4137 4137 HOH HOH A . 
C 2 HOH 86  4141 4141 HOH HOH A . 
C 2 HOH 87  4142 4142 HOH HOH A . 
C 2 HOH 88  4143 4143 HOH HOH A . 
C 2 HOH 89  4144 4144 HOH HOH A . 
C 2 HOH 90  4145 4145 HOH HOH A . 
C 2 HOH 91  4146 4146 HOH HOH A . 
C 2 HOH 92  4150 4150 HOH HOH A . 
C 2 HOH 93  4151 4151 HOH HOH A . 
C 2 HOH 94  4152 4152 HOH HOH A . 
C 2 HOH 95  4153 4153 HOH HOH A . 
C 2 HOH 96  4154 4154 HOH HOH A . 
C 2 HOH 97  4160 4160 HOH HOH A . 
C 2 HOH 98  4162 4162 HOH HOH A . 
C 2 HOH 99  4164 4164 HOH HOH A . 
C 2 HOH 100 4165 4165 HOH HOH A . 
C 2 HOH 101 4166 4166 HOH HOH A . 
C 2 HOH 102 4167 4167 HOH HOH A . 
C 2 HOH 103 4169 4169 HOH HOH A . 
C 2 HOH 104 4171 4171 HOH HOH A . 
C 2 HOH 105 4174 4174 HOH HOH A . 
C 2 HOH 106 4175 4175 HOH HOH A . 
C 2 HOH 107 4176 4176 HOH HOH A . 
C 2 HOH 108 4177 4177 HOH HOH A . 
C 2 HOH 109 4179 4179 HOH HOH A . 
C 2 HOH 110 4180 4180 HOH HOH A . 
C 2 HOH 111 4181 4181 HOH HOH A . 
C 2 HOH 112 4182 4182 HOH HOH A . 
C 2 HOH 113 4183 4183 HOH HOH A . 
C 2 HOH 114 4185 4185 HOH HOH A . 
C 2 HOH 115 4190 4190 HOH HOH A . 
C 2 HOH 116 4194 4194 HOH HOH A . 
C 2 HOH 117 4195 4195 HOH HOH A . 
C 2 HOH 118 4196 4196 HOH HOH A . 
C 2 HOH 119 4197 4197 HOH HOH A . 
C 2 HOH 120 4198 4198 HOH HOH A . 
C 2 HOH 121 4199 4199 HOH HOH A . 
C 2 HOH 122 4201 4201 HOH HOH A . 
C 2 HOH 123 4206 4206 HOH HOH A . 
C 2 HOH 124 4208 4208 HOH HOH A . 
C 2 HOH 125 4210 4210 HOH HOH A . 
C 2 HOH 126 4211 4211 HOH HOH A . 
C 2 HOH 127 4212 4212 HOH HOH A . 
C 2 HOH 128 4214 4214 HOH HOH A . 
C 2 HOH 129 4215 4215 HOH HOH A . 
C 2 HOH 130 4216 4216 HOH HOH A . 
C 2 HOH 131 4217 4217 HOH HOH A . 
C 2 HOH 132 4221 4221 HOH HOH A . 
C 2 HOH 133 4224 4224 HOH HOH A . 
C 2 HOH 134 4227 4227 HOH HOH A . 
C 2 HOH 135 4228 4228 HOH HOH A . 
C 2 HOH 136 4229 4229 HOH HOH A . 
C 2 HOH 137 4232 4232 HOH HOH A . 
C 2 HOH 138 4233 4233 HOH HOH A . 
C 2 HOH 139 4236 4236 HOH HOH A . 
C 2 HOH 140 4238 4238 HOH HOH A . 
C 2 HOH 141 4242 4242 HOH HOH A . 
C 2 HOH 142 4243 4243 HOH HOH A . 
C 2 HOH 143 4244 4244 HOH HOH A . 
C 2 HOH 144 4248 4248 HOH HOH A . 
C 2 HOH 145 4249 4249 HOH HOH A . 
C 2 HOH 146 4252 4252 HOH HOH A . 
C 2 HOH 147 4253 4253 HOH HOH A . 
C 2 HOH 148 4254 4254 HOH HOH A . 
C 2 HOH 149 4255 4255 HOH HOH A . 
C 2 HOH 150 4256 4256 HOH HOH A . 
C 2 HOH 151 4261 4261 HOH HOH A . 
C 2 HOH 152 4262 4262 HOH HOH A . 
C 2 HOH 153 4263 4263 HOH HOH A . 
C 2 HOH 154 4266 4266 HOH HOH A . 
C 2 HOH 155 4267 4267 HOH HOH A . 
C 2 HOH 156 4268 4268 HOH HOH A . 
C 2 HOH 157 4273 4273 HOH HOH A . 
C 2 HOH 158 4274 4274 HOH HOH A . 
C 2 HOH 159 4279 4279 HOH HOH A . 
C 2 HOH 160 4280 4280 HOH HOH A . 
C 2 HOH 161 4281 4281 HOH HOH A . 
C 2 HOH 162 4286 4286 HOH HOH A . 
C 2 HOH 163 4287 4287 HOH HOH A . 
C 2 HOH 164 4288 4288 HOH HOH A . 
C 2 HOH 165 4289 4289 HOH HOH A . 
C 2 HOH 166 4290 4290 HOH HOH A . 
C 2 HOH 167 4291 4291 HOH HOH A . 
C 2 HOH 168 4292 4292 HOH HOH A . 
C 2 HOH 169 4293 4293 HOH HOH A . 
C 2 HOH 170 4294 4294 HOH HOH A . 
C 2 HOH 171 4295 4295 HOH HOH A . 
C 2 HOH 172 4298 4298 HOH HOH A . 
C 2 HOH 173 4300 4300 HOH HOH A . 
C 2 HOH 174 4301 4301 HOH HOH A . 
C 2 HOH 175 4302 4302 HOH HOH A . 
C 2 HOH 176 4303 4303 HOH HOH A . 
C 2 HOH 177 4304 4304 HOH HOH A . 
C 2 HOH 178 4305 4305 HOH HOH A . 
C 2 HOH 179 4306 4306 HOH HOH A . 
C 2 HOH 180 4308 4308 HOH HOH A . 
C 2 HOH 181 4310 4310 HOH HOH A . 
C 2 HOH 182 4311 4311 HOH HOH A . 
C 2 HOH 183 4313 4313 HOH HOH A . 
C 2 HOH 184 4315 4315 HOH HOH A . 
C 2 HOH 185 4317 4317 HOH HOH A . 
C 2 HOH 186 4319 4319 HOH HOH A . 
C 2 HOH 187 4320 4320 HOH HOH A . 
C 2 HOH 188 4321 4321 HOH HOH A . 
C 2 HOH 189 4322 4322 HOH HOH A . 
C 2 HOH 190 4323 4323 HOH HOH A . 
C 2 HOH 191 4324 4324 HOH HOH A . 
C 2 HOH 192 4325 4325 HOH HOH A . 
C 2 HOH 193 4327 4327 HOH HOH A . 
C 2 HOH 194 4329 4329 HOH HOH A . 
C 2 HOH 195 4332 4332 HOH HOH A . 
C 2 HOH 196 4333 4333 HOH HOH A . 
C 2 HOH 197 4334 4334 HOH HOH A . 
C 2 HOH 198 4335 4335 HOH HOH A . 
C 2 HOH 199 4336 4336 HOH HOH A . 
C 2 HOH 200 4337 4337 HOH HOH A . 
C 2 HOH 201 4338 4338 HOH HOH A . 
C 2 HOH 202 4339 4339 HOH HOH A . 
C 2 HOH 203 4340 4340 HOH HOH A . 
C 2 HOH 204 4341 4341 HOH HOH A . 
C 2 HOH 205 4343 4343 HOH HOH A . 
C 2 HOH 206 4345 4345 HOH HOH A . 
C 2 HOH 207 4347 4347 HOH HOH A . 
C 2 HOH 208 4350 4350 HOH HOH A . 
C 2 HOH 209 4352 4352 HOH HOH A . 
C 2 HOH 210 4354 4354 HOH HOH A . 
C 2 HOH 211 4355 4355 HOH HOH A . 
C 2 HOH 212 4357 4357 HOH HOH A . 
C 2 HOH 213 4358 4358 HOH HOH A . 
C 2 HOH 214 4359 4359 HOH HOH A . 
C 2 HOH 215 4365 4365 HOH HOH A . 
C 2 HOH 216 4367 4367 HOH HOH A . 
C 2 HOH 217 4370 4370 HOH HOH A . 
C 2 HOH 218 4373 4373 HOH HOH A . 
C 2 HOH 219 4374 4374 HOH HOH A . 
C 2 HOH 220 4375 4375 HOH HOH A . 
C 2 HOH 221 4376 4376 HOH HOH A . 
C 2 HOH 222 4377 4377 HOH HOH A . 
C 2 HOH 223 4378 4378 HOH HOH A . 
C 2 HOH 224 4379 4379 HOH HOH A . 
C 2 HOH 225 4380 4380 HOH HOH A . 
C 2 HOH 226 4381 4381 HOH HOH A . 
C 2 HOH 227 4382 4382 HOH HOH A . 
C 2 HOH 228 4383 4383 HOH HOH A . 
C 2 HOH 229 4384 4384 HOH HOH A . 
C 2 HOH 230 4385 4385 HOH HOH A . 
C 2 HOH 231 4386 4386 HOH HOH A . 
C 2 HOH 232 4387 4387 HOH HOH A . 
C 2 HOH 233 4392 4392 HOH HOH A . 
C 2 HOH 234 4397 4397 HOH HOH A . 
C 2 HOH 235 4400 4400 HOH HOH A . 
C 2 HOH 236 4401 4401 HOH HOH A . 
C 2 HOH 237 4403 4403 HOH HOH A . 
C 2 HOH 238 4404 4404 HOH HOH A . 
C 2 HOH 239 4405 4405 HOH HOH A . 
C 2 HOH 240 4406 4406 HOH HOH A . 
C 2 HOH 241 4407 4407 HOH HOH A . 
C 2 HOH 242 4410 4410 HOH HOH A . 
C 2 HOH 243 4414 4414 HOH HOH A . 
C 2 HOH 244 4415 4415 HOH HOH A . 
C 2 HOH 245 4416 4416 HOH HOH A . 
C 2 HOH 246 4417 4417 HOH HOH A . 
C 2 HOH 247 4418 4418 HOH HOH A . 
C 2 HOH 248 4419 4419 HOH HOH A . 
C 2 HOH 249 4421 4421 HOH HOH A . 
C 2 HOH 250 4423 4423 HOH HOH A . 
C 2 HOH 251 4425 4425 HOH HOH A . 
C 2 HOH 252 4427 4427 HOH HOH A . 
C 2 HOH 253 4428 4428 HOH HOH A . 
C 2 HOH 254 4439 4439 HOH HOH A . 
C 2 HOH 255 4443 4443 HOH HOH A . 
C 2 HOH 256 4444 4444 HOH HOH A . 
C 2 HOH 257 4445 4445 HOH HOH A . 
C 2 HOH 258 4446 4446 HOH HOH A . 
C 2 HOH 259 4447 4447 HOH HOH A . 
C 2 HOH 260 4449 4449 HOH HOH A . 
C 2 HOH 261 4450 4450 HOH HOH A . 
C 2 HOH 262 4460 4460 HOH HOH A . 
C 2 HOH 263 4461 4461 HOH HOH A . 
C 2 HOH 264 4462 4462 HOH HOH A . 
C 2 HOH 265 4467 4467 HOH HOH A . 
C 2 HOH 266 4468 4468 HOH HOH A . 
C 2 HOH 267 4469 4469 HOH HOH A . 
C 2 HOH 268 4471 4471 HOH HOH A . 
C 2 HOH 269 4474 4474 HOH HOH A . 
C 2 HOH 270 4475 4475 HOH HOH A . 
C 2 HOH 271 4476 4476 HOH HOH A . 
C 2 HOH 272 4479 4479 HOH HOH A . 
C 2 HOH 273 4480 4480 HOH HOH A . 
C 2 HOH 274 4482 4482 HOH HOH A . 
D 2 HOH 1   4004 4004 HOH HOH B . 
D 2 HOH 2   4009 4009 HOH HOH B . 
D 2 HOH 3   4013 4013 HOH HOH B . 
D 2 HOH 4   4016 4016 HOH HOH B . 
D 2 HOH 5   4022 4022 HOH HOH B . 
D 2 HOH 6   4023 4023 HOH HOH B . 
D 2 HOH 7   4032 4032 HOH HOH B . 
D 2 HOH 8   4033 4033 HOH HOH B . 
D 2 HOH 9   4035 4035 HOH HOH B . 
D 2 HOH 10  4039 4039 HOH HOH B . 
D 2 HOH 11  4045 4045 HOH HOH B . 
D 2 HOH 12  4046 4046 HOH HOH B . 
D 2 HOH 13  4049 4049 HOH HOH B . 
D 2 HOH 14  4053 4053 HOH HOH B . 
D 2 HOH 15  4056 4056 HOH HOH B . 
D 2 HOH 16  4057 4057 HOH HOH B . 
D 2 HOH 17  4060 4060 HOH HOH B . 
D 2 HOH 18  4064 4064 HOH HOH B . 
D 2 HOH 19  4066 4066 HOH HOH B . 
D 2 HOH 20  4069 4069 HOH HOH B . 
D 2 HOH 21  4070 4070 HOH HOH B . 
D 2 HOH 22  4072 4072 HOH HOH B . 
D 2 HOH 23  4074 4074 HOH HOH B . 
D 2 HOH 24  4075 4075 HOH HOH B . 
D 2 HOH 25  4076 4076 HOH HOH B . 
D 2 HOH 26  4081 4081 HOH HOH B . 
D 2 HOH 27  4082 4082 HOH HOH B . 
D 2 HOH 28  4084 4084 HOH HOH B . 
D 2 HOH 29  4086 4086 HOH HOH B . 
D 2 HOH 30  4088 4088 HOH HOH B . 
D 2 HOH 31  4090 4090 HOH HOH B . 
D 2 HOH 32  4092 4092 HOH HOH B . 
D 2 HOH 33  4093 4093 HOH HOH B . 
D 2 HOH 34  4094 4094 HOH HOH B . 
D 2 HOH 35  4096 4096 HOH HOH B . 
D 2 HOH 36  4100 4100 HOH HOH B . 
D 2 HOH 37  4104 4104 HOH HOH B . 
D 2 HOH 38  4105 4105 HOH HOH B . 
D 2 HOH 39  4106 4106 HOH HOH B . 
D 2 HOH 40  4108 4108 HOH HOH B . 
D 2 HOH 41  4113 4113 HOH HOH B . 
D 2 HOH 42  4114 4114 HOH HOH B . 
D 2 HOH 43  4116 4116 HOH HOH B . 
D 2 HOH 44  4118 4118 HOH HOH B . 
D 2 HOH 45  4120 4120 HOH HOH B . 
D 2 HOH 46  4123 4123 HOH HOH B . 
D 2 HOH 47  4124 4124 HOH HOH B . 
D 2 HOH 48  4125 4125 HOH HOH B . 
D 2 HOH 49  4127 4127 HOH HOH B . 
D 2 HOH 50  4128 4128 HOH HOH B . 
D 2 HOH 51  4129 4129 HOH HOH B . 
D 2 HOH 52  4132 4132 HOH HOH B . 
D 2 HOH 53  4138 4138 HOH HOH B . 
D 2 HOH 54  4139 4139 HOH HOH B . 
D 2 HOH 55  4140 4140 HOH HOH B . 
D 2 HOH 56  4147 4147 HOH HOH B . 
D 2 HOH 57  4148 4148 HOH HOH B . 
D 2 HOH 58  4149 4149 HOH HOH B . 
D 2 HOH 59  4155 4155 HOH HOH B . 
D 2 HOH 60  4156 4156 HOH HOH B . 
D 2 HOH 61  4157 4157 HOH HOH B . 
D 2 HOH 62  4158 4158 HOH HOH B . 
D 2 HOH 63  4159 4159 HOH HOH B . 
D 2 HOH 64  4161 4161 HOH HOH B . 
D 2 HOH 65  4163 4163 HOH HOH B . 
D 2 HOH 66  4168 4168 HOH HOH B . 
D 2 HOH 67  4170 4170 HOH HOH B . 
D 2 HOH 68  4172 4172 HOH HOH B . 
D 2 HOH 69  4173 4173 HOH HOH B . 
D 2 HOH 70  4178 4178 HOH HOH B . 
D 2 HOH 71  4184 4184 HOH HOH B . 
D 2 HOH 72  4186 4186 HOH HOH B . 
D 2 HOH 73  4187 4187 HOH HOH B . 
D 2 HOH 74  4188 4188 HOH HOH B . 
D 2 HOH 75  4189 4189 HOH HOH B . 
D 2 HOH 76  4191 4191 HOH HOH B . 
D 2 HOH 77  4192 4192 HOH HOH B . 
D 2 HOH 78  4193 4193 HOH HOH B . 
D 2 HOH 79  4200 4200 HOH HOH B . 
D 2 HOH 80  4202 4202 HOH HOH B . 
D 2 HOH 81  4203 4203 HOH HOH B . 
D 2 HOH 82  4204 4204 HOH HOH B . 
D 2 HOH 83  4205 4205 HOH HOH B . 
D 2 HOH 84  4207 4207 HOH HOH B . 
D 2 HOH 85  4209 4209 HOH HOH B . 
D 2 HOH 86  4213 4213 HOH HOH B . 
D 2 HOH 87  4218 4218 HOH HOH B . 
D 2 HOH 88  4219 4219 HOH HOH B . 
D 2 HOH 89  4220 4220 HOH HOH B . 
D 2 HOH 90  4222 4222 HOH HOH B . 
D 2 HOH 91  4223 4223 HOH HOH B . 
D 2 HOH 92  4225 4225 HOH HOH B . 
D 2 HOH 93  4226 4226 HOH HOH B . 
D 2 HOH 94  4230 4230 HOH HOH B . 
D 2 HOH 95  4231 4231 HOH HOH B . 
D 2 HOH 96  4234 4234 HOH HOH B . 
D 2 HOH 97  4235 4235 HOH HOH B . 
D 2 HOH 98  4237 4237 HOH HOH B . 
D 2 HOH 99  4239 4239 HOH HOH B . 
D 2 HOH 100 4240 4240 HOH HOH B . 
D 2 HOH 101 4241 4241 HOH HOH B . 
D 2 HOH 102 4245 4245 HOH HOH B . 
D 2 HOH 103 4246 4246 HOH HOH B . 
D 2 HOH 104 4247 4247 HOH HOH B . 
D 2 HOH 105 4250 4250 HOH HOH B . 
D 2 HOH 106 4251 4251 HOH HOH B . 
D 2 HOH 107 4257 4257 HOH HOH B . 
D 2 HOH 108 4258 4258 HOH HOH B . 
D 2 HOH 109 4259 4259 HOH HOH B . 
D 2 HOH 110 4260 4260 HOH HOH B . 
D 2 HOH 111 4264 4264 HOH HOH B . 
D 2 HOH 112 4265 4265 HOH HOH B . 
D 2 HOH 113 4269 4269 HOH HOH B . 
D 2 HOH 114 4270 4270 HOH HOH B . 
D 2 HOH 115 4271 4271 HOH HOH B . 
D 2 HOH 116 4272 4272 HOH HOH B . 
D 2 HOH 117 4275 4275 HOH HOH B . 
D 2 HOH 118 4276 4276 HOH HOH B . 
D 2 HOH 119 4277 4277 HOH HOH B . 
D 2 HOH 120 4278 4278 HOH HOH B . 
D 2 HOH 121 4282 4282 HOH HOH B . 
D 2 HOH 122 4283 4283 HOH HOH B . 
D 2 HOH 123 4284 4284 HOH HOH B . 
D 2 HOH 124 4285 4285 HOH HOH B . 
D 2 HOH 125 4296 4296 HOH HOH B . 
D 2 HOH 126 4297 4297 HOH HOH B . 
D 2 HOH 127 4299 4299 HOH HOH B . 
D 2 HOH 128 4307 4307 HOH HOH B . 
D 2 HOH 129 4309 4309 HOH HOH B . 
D 2 HOH 130 4312 4312 HOH HOH B . 
D 2 HOH 131 4314 4314 HOH HOH B . 
D 2 HOH 132 4316 4316 HOH HOH B . 
D 2 HOH 133 4318 4318 HOH HOH B . 
D 2 HOH 134 4326 4326 HOH HOH B . 
D 2 HOH 135 4328 4328 HOH HOH B . 
D 2 HOH 136 4330 4330 HOH HOH B . 
D 2 HOH 137 4331 4331 HOH HOH B . 
D 2 HOH 138 4342 4342 HOH HOH B . 
D 2 HOH 139 4344 4344 HOH HOH B . 
D 2 HOH 140 4346 4346 HOH HOH B . 
D 2 HOH 141 4348 4348 HOH HOH B . 
D 2 HOH 142 4349 4349 HOH HOH B . 
D 2 HOH 143 4351 4351 HOH HOH B . 
D 2 HOH 144 4353 4353 HOH HOH B . 
D 2 HOH 145 4356 4356 HOH HOH B . 
D 2 HOH 146 4360 4360 HOH HOH B . 
D 2 HOH 147 4361 4361 HOH HOH B . 
D 2 HOH 148 4362 4362 HOH HOH B . 
D 2 HOH 149 4363 4363 HOH HOH B . 
D 2 HOH 150 4364 4364 HOH HOH B . 
D 2 HOH 151 4366 4366 HOH HOH B . 
D 2 HOH 152 4368 4368 HOH HOH B . 
D 2 HOH 153 4369 4369 HOH HOH B . 
D 2 HOH 154 4371 4371 HOH HOH B . 
D 2 HOH 155 4372 4372 HOH HOH B . 
D 2 HOH 156 4388 4388 HOH HOH B . 
D 2 HOH 157 4389 4389 HOH HOH B . 
D 2 HOH 158 4390 4390 HOH HOH B . 
D 2 HOH 159 4391 4391 HOH HOH B . 
D 2 HOH 160 4393 4393 HOH HOH B . 
D 2 HOH 161 4394 4394 HOH HOH B . 
D 2 HOH 162 4395 4395 HOH HOH B . 
D 2 HOH 163 4396 4396 HOH HOH B . 
D 2 HOH 164 4398 4398 HOH HOH B . 
D 2 HOH 165 4399 4399 HOH HOH B . 
D 2 HOH 166 4402 4402 HOH HOH B . 
D 2 HOH 167 4408 4408 HOH HOH B . 
D 2 HOH 168 4409 4409 HOH HOH B . 
D 2 HOH 169 4411 4411 HOH HOH B . 
D 2 HOH 170 4412 4412 HOH HOH B . 
D 2 HOH 171 4413 4413 HOH HOH B . 
D 2 HOH 172 4420 4420 HOH HOH B . 
D 2 HOH 173 4422 4422 HOH HOH B . 
D 2 HOH 174 4424 4424 HOH HOH B . 
D 2 HOH 175 4426 4426 HOH HOH B . 
D 2 HOH 176 4429 4429 HOH HOH B . 
D 2 HOH 177 4434 4434 HOH HOH B . 
D 2 HOH 178 4435 4435 HOH HOH B . 
D 2 HOH 179 4436 4436 HOH HOH B . 
D 2 HOH 180 4440 4440 HOH HOH B . 
D 2 HOH 181 4441 4441 HOH HOH B . 
D 2 HOH 182 4442 4442 HOH HOH B . 
D 2 HOH 183 4451 4451 HOH HOH B . 
D 2 HOH 184 4456 4456 HOH HOH B . 
D 2 HOH 185 4457 4457 HOH HOH B . 
D 2 HOH 186 4458 4458 HOH HOH B . 
D 2 HOH 187 4459 4459 HOH HOH B . 
D 2 HOH 188 4463 4463 HOH HOH B . 
D 2 HOH 189 4464 4464 HOH HOH B . 
D 2 HOH 190 4465 4465 HOH HOH B . 
D 2 HOH 191 4466 4466 HOH HOH B . 
D 2 HOH 192 4470 4470 HOH HOH B . 
D 2 HOH 193 4472 4472 HOH HOH B . 
D 2 HOH 194 4473 4473 HOH HOH B . 
D 2 HOH 195 4478 4478 HOH HOH B . 
D 2 HOH 196 4481 4481 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2660  ? 
1 MORE         -19   ? 
1 'SSA (A^2)'  14600 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-06-24 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
COMO      phasing          .   ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 4115 ? ? O A HOH 4439 ? ? 2.08 
2 1 O A HOH 4261 ? ? O A HOH 4468 ? ? 2.13 
3 1 O B HOH 4457 ? ? O B HOH 4458 ? ? 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 106 ? ? 66.25   -106.19 
2 1 LYS B 263 ? ? -68.06  10.22   
3 1 GLU B 264 ? ? -107.30 71.19   
4 1 CYS B 306 ? ? 65.42   -107.22 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ASP 189 ? A ASP 189 
3  1 Y 1 A LEU 190 ? A LEU 190 
4  1 Y 1 A GLU 191 ? A GLU 191 
5  1 Y 1 A HIS 192 ? A HIS 192 
6  1 Y 1 A HIS 193 ? A HIS 193 
7  1 Y 1 A HIS 194 ? A HIS 194 
8  1 Y 1 A HIS 195 ? A HIS 195 
9  1 Y 1 A HIS 196 ? A HIS 196 
10 1 Y 1 A HIS 197 ? A HIS 197 
11 1 Y 1 B MET 201 ? B MET 1   
12 1 Y 1 B ASP 389 ? B ASP 189 
13 1 Y 1 B LEU 390 ? B LEU 190 
14 1 Y 1 B GLU 391 ? B GLU 191 
15 1 Y 1 B HIS 392 ? B HIS 192 
16 1 Y 1 B HIS 393 ? B HIS 193 
17 1 Y 1 B HIS 394 ? B HIS 194 
18 1 Y 1 B HIS 395 ? B HIS 195 
19 1 Y 1 B HIS 396 ? B HIS 196 
20 1 Y 1 B HIS 397 ? B HIS 197 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#