data_1PIH
# 
_entry.id   1PIH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1PIH         
WWPDB D_1000175695 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1PIJ 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   'representative structure' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1PIH 
_pdbx_database_status.recvd_initial_deposition_date   1994-08-03 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Banci, L.'       1 
'Bertini, I.'     2 
'Eltis, L.D.'     3 
'Felli, I.'       4 
'Kastrau, D.H.W.' 5 
'Luchinat, C.'    6 
'Piccioli, M.'    7 
'Pierattelli, R.' 8 
'Smith, M.'       9 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;The three-dimensional structure in solution of the paramagnetic high-potential iron-sulfur protein I from Ectothiorhodospira halophila through nuclear magnetic resonance.
;
Eur.J.Biochem. 225 715 725 1994 EJBCAI IX 0014-2956 0262 ? 7957187 10.1111/j.1432-1033.1994.00715.x 
1       
;Sequence Specific Assignment of the 1H and 15N Nuclear Magnetic Resonance Spectra of the Reduced Recombinant High Potential Iron Sulfur Protein (Hipip) I from Ectothiorhodospira Halophila
;
Eur.J.Biochem. 225 703 ?   1994 EJBCAI IX 0014-2956 0262 ? ?       ?                                
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Banci, L.'       1  
primary 'Bertini, I.'     2  
primary 'Eltis, L.D.'     3  
primary 'Felli, I.C.'     4  
primary 'Kastrau, D.H.'   5  
primary 'Luchinat, C.'    6  
primary 'Piccioli, M.'    7  
primary 'Pierattelli, R.' 8  
primary 'Smith, M.'       9  
1       'Bertini, I.'     10 
1       'Felli, I.'       11 
1       'Kastrau, D.H.W.' 12 
1       'Luchinat, C.'    13 
1       'Piccioli, M.'    14 
1       'Viezzoli, M.S.'  15 
# 
_cell.entry_id           1PIH 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1PIH 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'HIGH POTENTIAL IRON SULFUR PROTEIN' 8003.524 1 ? ? ? ? 
2 non-polymer syn 'IRON/SULFUR CLUSTER'                351.640  1 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       ASEPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS 
_entity_poly.pdbx_seq_one_letter_code_can   ASEPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  SER n 
1 3  GLU n 
1 4  PRO n 
1 5  ARG n 
1 6  ALA n 
1 7  GLU n 
1 8  ASP n 
1 9  GLY n 
1 10 HIS n 
1 11 ALA n 
1 12 HIS n 
1 13 ASP n 
1 14 TYR n 
1 15 VAL n 
1 16 ASN n 
1 17 GLU n 
1 18 ALA n 
1 19 ALA n 
1 20 ASP n 
1 21 ALA n 
1 22 SER n 
1 23 GLY n 
1 24 HIS n 
1 25 PRO n 
1 26 ARG n 
1 27 TYR n 
1 28 GLN n 
1 29 GLU n 
1 30 GLY n 
1 31 GLN n 
1 32 LEU n 
1 33 CYS n 
1 34 GLU n 
1 35 ASN n 
1 36 CYS n 
1 37 ALA n 
1 38 PHE n 
1 39 TRP n 
1 40 GLY n 
1 41 GLU n 
1 42 ALA n 
1 43 VAL n 
1 44 GLN n 
1 45 ASP n 
1 46 GLY n 
1 47 TRP n 
1 48 GLY n 
1 49 ARG n 
1 50 CYS n 
1 51 THR n 
1 52 HIS n 
1 53 PRO n 
1 54 ASP n 
1 55 PHE n 
1 56 ASP n 
1 57 GLU n 
1 58 VAL n 
1 59 LEU n 
1 60 VAL n 
1 61 LYS n 
1 62 ALA n 
1 63 GLU n 
1 64 GLY n 
1 65 TRP n 
1 66 CYS n 
1 67 SER n 
1 68 VAL n 
1 69 TYR n 
1 70 ALA n 
1 71 PRO n 
1 72 ALA n 
1 73 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Halorhodospira 
_entity_src_gen.pdbx_gene_src_gene                 POTENTIAL 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Halorhodospira halophila' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1053 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HIP1_ECTHA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04168 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   EPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1PIH 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 73 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04168 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  71 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       3 
_struct_ref_seq.pdbx_auth_seq_align_end       73 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE               ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE              ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE            ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'       ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE              ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE             ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'       ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE               ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE             ? 'C6 H10 N3 O2 1' 156.162 
LEU 'L-peptide linking' y LEUCINE               ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE         ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE               ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                ? 'C3 H7 N O3'     105.093 
SF4 non-polymer         . 'IRON/SULFUR CLUSTER' ? 'Fe4 S4'         351.640 
THR 'L-peptide linking' y THREONINE             ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN            ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE              ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_ensemble.entry_id                             1PIH 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    15 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement DIANA ? GUNTERT,BRAUN,WUTHRICH                             1 
refinement AMBER ? PEARLMAN,CASE,CALDWELL,SIEBEL,SINGH,WEINER,KOLLMAN 2 
# 
_exptl.entry_id          1PIH 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1PIH 
_struct.title                     
'THE THREE DIMENSIONAL STRUCTURE OF THE PARAMAGNETIC PROTEIN HIPIP I FROM E.HALOPHILA THROUGH NUCLEAR MAGNETIC RESONANCE' 
_struct.pdbx_descriptor           
'HIGH POTENTIAL IRON SULFUR PROTEIN INSERTION MUTANT WITH ALA 1 AND SER 2 (INS(A1,S2)) (NMR, 15 STRUCTURES)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1PIH 
_struct_keywords.pdbx_keywords   'ELECTRON TRANSFER(IRON-SULFUR PROTEIN)' 
_struct_keywords.text            'ELECTRON TRANSFER(IRON-SULFUR PROTEIN)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A Y N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 17 ? HIS A 24 ? GLU A 17 HIS A 24 5 ? 8 
HELX_P HELX_P2 2 LEU A 32 ? ASN A 35 ? LEU A 32 ASN A 35 5 ? 4 
HELX_P HELX_P3 3 HIS A 52 ? GLU A 57 ? HIS A 52 GLU A 57 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A CYS 33 SG ? ? ? 1_555 B SF4 . FE1 ? ? A CYS 33 A SF4 74 1_555 ? ? ? ? ? ? ? 2.059 ? 
metalc2 metalc ? ? A CYS 36 SG ? ? ? 1_555 B SF4 . FE2 ? ? A CYS 36 A SF4 74 1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc3 metalc ? ? A CYS 50 SG ? ? ? 1_555 B SF4 . FE3 ? ? A CYS 50 A SF4 74 1_555 ? ? ? ? ? ? ? 2.023 ? 
metalc4 metalc ? ? A CYS 66 SG ? ? ? 1_555 B SF4 . FE4 ? ? A CYS 66 A SF4 74 1_555 ? ? ? ? ? ? ? 2.027 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP A 39 ? GLN A 44 ? TRP A 39 GLN A 44 
A 2 TRP A 47 ? CYS A 50 ? TRP A 47 CYS A 50 
A 3 VAL A 60 ? LYS A 61 ? VAL A 60 LYS A 61 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 43 ? N VAL A 43 O TRP A 47 ? O TRP A 47 
A 2 3 N GLY A 48 ? N GLY A 48 O VAL A 60 ? O VAL A 60 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE SF4 A 74' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 CYS A 33 ? CYS A 33 . ? 1_555 ? 
2 AC1 6 CYS A 36 ? CYS A 36 . ? 1_555 ? 
3 AC1 6 CYS A 50 ? CYS A 50 . ? 1_555 ? 
4 AC1 6 CYS A 66 ? CYS A 66 . ? 1_555 ? 
5 AC1 6 VAL A 68 ? VAL A 68 . ? 1_555 ? 
6 AC1 6 TYR A 69 ? TYR A 69 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1PIH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1PIH 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 'GLN      44  - ASP      45  MODEL   5    OMEGA = 148.94 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 
2 'ARG      49  - CYS      50  MODEL   8    OMEGA = 141.06 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 
3 'SER       2  - GLU       3  MODEL   9    OMEGA = 211.11 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 
4 'PRO      71  - ALA      72  MODEL  11    OMEGA = 142.48 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 1  ? 17.231  -0.385  2.219   1.00 0.00 ? 1  ALA A N   1  
ATOM   2    C  CA  . ALA A 1 1  ? 17.823  -0.469  0.887   1.00 0.00 ? 1  ALA A CA  1  
ATOM   3    C  C   . ALA A 1 1  ? 16.713  -0.455  -0.144  1.00 0.00 ? 1  ALA A C   1  
ATOM   4    O  O   . ALA A 1 1  ? 15.614  -0.019  0.204   1.00 0.00 ? 1  ALA A O   1  
ATOM   5    C  CB  . ALA A 1 1  ? 18.576  -1.795  0.790   1.00 0.00 ? 1  ALA A CB  1  
ATOM   6    N  N   . SER A 1 2  ? 16.954  -0.976  -1.343  1.00 0.00 ? 2  SER A N   1  
ATOM   7    C  CA  . SER A 1 2  ? 15.917  -1.360  -2.279  1.00 0.00 ? 2  SER A CA  1  
ATOM   8    C  C   . SER A 1 2  ? 15.273  -2.650  -1.760  1.00 0.00 ? 2  SER A C   1  
ATOM   9    O  O   . SER A 1 2  ? 15.492  -3.732  -2.307  1.00 0.00 ? 2  SER A O   1  
ATOM   10   C  CB  . SER A 1 2  ? 16.575  -1.533  -3.655  1.00 0.00 ? 2  SER A CB  1  
ATOM   11   O  OG  . SER A 1 2  ? 17.938  -1.907  -3.488  1.00 0.00 ? 2  SER A OG  1  
ATOM   12   N  N   . GLU A 1 3  ? 14.504  -2.529  -0.674  1.00 0.00 ? 3  GLU A N   1  
ATOM   13   C  CA  . GLU A 1 3  ? 13.774  -3.643  -0.087  1.00 0.00 ? 3  GLU A CA  1  
ATOM   14   C  C   . GLU A 1 3  ? 12.929  -4.357  -1.158  1.00 0.00 ? 3  GLU A C   1  
ATOM   15   O  O   . GLU A 1 3  ? 12.524  -3.736  -2.143  1.00 0.00 ? 3  GLU A O   1  
ATOM   16   C  CB  . GLU A 1 3  ? 12.909  -3.140  1.083   1.00 0.00 ? 3  GLU A CB  1  
ATOM   17   C  CG  . GLU A 1 3  ? 13.678  -3.119  2.413   1.00 0.00 ? 3  GLU A CG  1  
ATOM   18   C  CD  . GLU A 1 3  ? 14.867  -2.182  2.405   1.00 0.00 ? 3  GLU A CD  1  
ATOM   19   O  OE1 . GLU A 1 3  ? 14.670  -0.943  2.461   1.00 0.00 ? 3  GLU A OE1 1  
ATOM   20   O  OE2 . GLU A 1 3  ? 16.025  -2.636  2.302   1.00 0.00 ? 3  GLU A OE2 1  
ATOM   21   N  N   . PRO A 1 4  ? 12.670  -5.662  -0.994  1.00 0.00 ? 4  PRO A N   1  
ATOM   22   C  CA  . PRO A 1 4  ? 11.919  -6.437  -1.968  1.00 0.00 ? 4  PRO A CA  1  
ATOM   23   C  C   . PRO A 1 4  ? 10.494  -5.895  -2.101  1.00 0.00 ? 4  PRO A C   1  
ATOM   24   O  O   . PRO A 1 4  ? 9.884   -5.482  -1.117  1.00 0.00 ? 4  PRO A O   1  
ATOM   25   C  CB  . PRO A 1 4  ? 11.944  -7.882  -1.459  1.00 0.00 ? 4  PRO A CB  1  
ATOM   26   C  CG  . PRO A 1 4  ? 12.185  -7.735  0.043   1.00 0.00 ? 4  PRO A CG  1  
ATOM   27   C  CD  . PRO A 1 4  ? 13.055  -6.483  0.142   1.00 0.00 ? 4  PRO A CD  1  
ATOM   28   N  N   . ARG A 1 5  ? 9.972   -5.892  -3.330  1.00 0.00 ? 5  ARG A N   1  
ATOM   29   C  CA  . ARG A 1 5  ? 8.620   -5.486  -3.653  1.00 0.00 ? 5  ARG A CA  1  
ATOM   30   C  C   . ARG A 1 5  ? 7.609   -6.342  -2.878  1.00 0.00 ? 5  ARG A C   1  
ATOM   31   O  O   . ARG A 1 5  ? 7.679   -7.569  -2.926  1.00 0.00 ? 5  ARG A O   1  
ATOM   32   C  CB  . ARG A 1 5  ? 8.482   -5.664  -5.165  1.00 0.00 ? 5  ARG A CB  1  
ATOM   33   C  CG  . ARG A 1 5  ? 9.351   -4.662  -5.889  1.00 0.00 ? 5  ARG A CG  1  
ATOM   34   C  CD  . ARG A 1 5  ? 9.480   -5.167  -7.321  1.00 0.00 ? 5  ARG A CD  1  
ATOM   35   N  NE  . ARG A 1 5  ? 10.646  -4.522  -7.875  1.00 0.00 ? 5  ARG A NE  1  
ATOM   36   C  CZ  . ARG A 1 5  ? 10.631  -3.564  -8.813  1.00 0.00 ? 5  ARG A CZ  1  
ATOM   37   N  NH1 . ARG A 1 5  ? 9.690   -3.569  -9.757  1.00 0.00 ? 5  ARG A NH1 1  
ATOM   38   N  NH2 . ARG A 1 5  ? 11.540  -2.593  -8.790  1.00 0.00 ? 5  ARG A NH2 1  
ATOM   39   N  N   . ALA A 1 6  ? 6.701   -5.688  -2.153  1.00 0.00 ? 6  ALA A N   1  
ATOM   40   C  CA  . ALA A 1 6  ? 5.758   -6.308  -1.237  1.00 0.00 ? 6  ALA A CA  1  
ATOM   41   C  C   . ALA A 1 6  ? 4.864   -7.334  -1.926  1.00 0.00 ? 6  ALA A C   1  
ATOM   42   O  O   . ALA A 1 6  ? 4.427   -7.140  -3.061  1.00 0.00 ? 6  ALA A O   1  
ATOM   43   C  CB  . ALA A 1 6  ? 4.910   -5.217  -0.578  1.00 0.00 ? 6  ALA A CB  1  
ATOM   44   N  N   . GLU A 1 7  ? 4.570   -8.414  -1.207  1.00 0.00 ? 7  GLU A N   1  
ATOM   45   C  CA  . GLU A 1 7  ? 3.708   -9.482  -1.654  1.00 0.00 ? 7  GLU A CA  1  
ATOM   46   C  C   . GLU A 1 7  ? 2.271   -9.011  -1.545  1.00 0.00 ? 7  GLU A C   1  
ATOM   47   O  O   . GLU A 1 7  ? 1.901   -8.367  -0.563  1.00 0.00 ? 7  GLU A O   1  
ATOM   48   C  CB  . GLU A 1 7  ? 3.868   -10.730 -0.785  1.00 0.00 ? 7  GLU A CB  1  
ATOM   49   C  CG  . GLU A 1 7  ? 5.320   -11.003 -0.394  1.00 0.00 ? 7  GLU A CG  1  
ATOM   50   C  CD  . GLU A 1 7  ? 5.657   -10.371 0.952   1.00 0.00 ? 7  GLU A CD  1  
ATOM   51   O  OE1 . GLU A 1 7  ? 5.892   -9.146  0.977   1.00 0.00 ? 7  GLU A OE1 1  
ATOM   52   O  OE2 . GLU A 1 7  ? 5.564   -11.044 1.999   1.00 0.00 ? 7  GLU A OE2 1  
ATOM   53   N  N   . ASP A 1 8  ? 1.445   -9.416  -2.499  1.00 0.00 ? 8  ASP A N   1  
ATOM   54   C  CA  . ASP A 1 8  ? 0.014   -9.303  -2.369  1.00 0.00 ? 8  ASP A CA  1  
ATOM   55   C  C   . ASP A 1 8  ? -0.384  -10.164 -1.170  1.00 0.00 ? 8  ASP A C   1  
ATOM   56   O  O   . ASP A 1 8  ? -0.118  -11.364 -1.146  1.00 0.00 ? 8  ASP A O   1  
ATOM   57   C  CB  . ASP A 1 8  ? -0.625  -9.748  -3.683  1.00 0.00 ? 8  ASP A CB  1  
ATOM   58   C  CG  . ASP A 1 8  ? -0.405  -8.694  -4.755  1.00 0.00 ? 8  ASP A CG  1  
ATOM   59   O  OD1 . ASP A 1 8  ? -1.201  -7.733  -4.790  1.00 0.00 ? 8  ASP A OD1 1  
ATOM   60   O  OD2 . ASP A 1 8  ? 0.613   -8.810  -5.473  1.00 0.00 ? 8  ASP A OD2 1  
ATOM   61   N  N   . GLY A 1 9  ? -0.933  -9.529  -0.137  1.00 0.00 ? 9  GLY A N   1  
ATOM   62   C  CA  . GLY A 1 9  ? -1.264  -10.161 1.124   1.00 0.00 ? 9  GLY A CA  1  
ATOM   63   C  C   . GLY A 1 9  ? -0.082  -10.255 2.093   1.00 0.00 ? 9  GLY A C   1  
ATOM   64   O  O   . GLY A 1 9  ? -0.183  -11.002 3.063   1.00 0.00 ? 9  GLY A O   1  
ATOM   65   N  N   . HIS A 1 10 ? 1.011   -9.496  1.891   1.00 0.00 ? 10 HIS A N   1  
ATOM   66   C  CA  . HIS A 1 10 ? 2.122   -9.436  2.841   1.00 0.00 ? 10 HIS A CA  1  
ATOM   67   C  C   . HIS A 1 10 ? 1.636   -9.279  4.285   1.00 0.00 ? 10 HIS A C   1  
ATOM   68   O  O   . HIS A 1 10 ? 1.973   -10.069 5.162   1.00 0.00 ? 10 HIS A O   1  
ATOM   69   C  CB  . HIS A 1 10 ? 3.039   -8.255  2.498   1.00 0.00 ? 10 HIS A CB  1  
ATOM   70   C  CG  . HIS A 1 10 ? 4.152   -8.090  3.505   1.00 0.00 ? 10 HIS A CG  1  
ATOM   71   N  ND1 . HIS A 1 10 ? 5.241   -8.930  3.654   1.00 0.00 ? 10 HIS A ND1 1  
ATOM   72   C  CD2 . HIS A 1 10 ? 4.149   -7.209  4.552   1.00 0.00 ? 10 HIS A CD2 1  
ATOM   73   C  CE1 . HIS A 1 10 ? 5.898   -8.556  4.767   1.00 0.00 ? 10 HIS A CE1 1  
ATOM   74   N  NE2 . HIS A 1 10 ? 5.239   -7.527  5.331   1.00 0.00 ? 10 HIS A NE2 1  
ATOM   75   N  N   . ALA A 1 11 ? 0.885   -8.204  4.526   1.00 0.00 ? 11 ALA A N   1  
ATOM   76   C  CA  . ALA A 1 11 ? 0.247   -7.913  5.801   1.00 0.00 ? 11 ALA A CA  1  
ATOM   77   C  C   . ALA A 1 11 ? -0.945  -7.001  5.522   1.00 0.00 ? 11 ALA A C   1  
ATOM   78   O  O   . ALA A 1 11 ? -1.024  -6.400  4.451   1.00 0.00 ? 11 ALA A O   1  
ATOM   79   C  CB  . ALA A 1 11 ? 1.250   -7.273  6.782   1.00 0.00 ? 11 ALA A CB  1  
ATOM   80   N  N   . HIS A 1 12 ? -1.870  -6.913  6.484   1.00 0.00 ? 12 HIS A N   1  
ATOM   81   C  CA  . HIS A 1 12 ? -2.996  -5.981  6.486   1.00 0.00 ? 12 HIS A CA  1  
ATOM   82   C  C   . HIS A 1 12 ? -3.721  -5.909  5.141   1.00 0.00 ? 12 HIS A C   1  
ATOM   83   O  O   . HIS A 1 12 ? -3.993  -4.822  4.631   1.00 0.00 ? 12 HIS A O   1  
ATOM   84   C  CB  . HIS A 1 12 ? -2.516  -4.591  6.893   1.00 0.00 ? 12 HIS A CB  1  
ATOM   85   C  CG  . HIS A 1 12 ? -1.625  -4.571  8.104   1.00 0.00 ? 12 HIS A CG  1  
ATOM   86   N  ND1 . HIS A 1 12 ? -2.043  -4.281  9.388   1.00 0.00 ? 12 HIS A ND1 1  
ATOM   87   C  CD2 . HIS A 1 12 ? -0.260  -4.495  8.066   1.00 0.00 ? 12 HIS A CD2 1  
ATOM   88   C  CE1 . HIS A 1 12 ? -0.945  -3.982  10.105  1.00 0.00 ? 12 HIS A CE1 1  
ATOM   89   N  NE2 . HIS A 1 12 ? 0.139   -4.117  9.325   1.00 0.00 ? 12 HIS A NE2 1  
ATOM   90   N  N   . ASP A 1 13 ? -4.021  -7.076  4.574   1.00 0.00 ? 13 ASP A N   1  
ATOM   91   C  CA  . ASP A 1 13 ? -4.819  -7.204  3.364   1.00 0.00 ? 13 ASP A CA  1  
ATOM   92   C  C   . ASP A 1 13 ? -4.215  -6.413  2.195   1.00 0.00 ? 13 ASP A C   1  
ATOM   93   O  O   . ASP A 1 13 ? -4.948  -5.983  1.305   1.00 0.00 ? 13 ASP A O   1  
ATOM   94   C  CB  . ASP A 1 13 ? -6.279  -6.787  3.616   1.00 0.00 ? 13 ASP A CB  1  
ATOM   95   C  CG  . ASP A 1 13 ? -6.790  -7.066  5.021   1.00 0.00 ? 13 ASP A CG  1  
ATOM   96   O  OD1 . ASP A 1 13 ? -6.660  -8.216  5.481   1.00 0.00 ? 13 ASP A OD1 1  
ATOM   97   O  OD2 . ASP A 1 13 ? -7.335  -6.099  5.607   1.00 0.00 ? 13 ASP A OD2 1  
ATOM   98   N  N   . TYR A 1 14 ? -2.895  -6.182  2.209   1.00 0.00 ? 14 TYR A N   1  
ATOM   99   C  CA  . TYR A 1 14 ? -2.262  -5.352  1.198   1.00 0.00 ? 14 TYR A CA  1  
ATOM   100  C  C   . TYR A 1 14 ? -2.428  -5.954  -0.192  1.00 0.00 ? 14 TYR A C   1  
ATOM   101  O  O   . TYR A 1 14 ? -2.328  -7.168  -0.354  1.00 0.00 ? 14 TYR A O   1  
ATOM   102  C  CB  . TYR A 1 14 ? -0.791  -5.105  1.543   1.00 0.00 ? 14 TYR A CB  1  
ATOM   103  C  CG  . TYR A 1 14 ? 0.054   -4.532  0.419   1.00 0.00 ? 14 TYR A CG  1  
ATOM   104  C  CD1 . TYR A 1 14 ? 0.630   -5.400  -0.524  1.00 0.00 ? 14 TYR A CD1 1  
ATOM   105  C  CD2 . TYR A 1 14 ? 0.242   -3.144  0.289   1.00 0.00 ? 14 TYR A CD2 1  
ATOM   106  C  CE1 . TYR A 1 14 ? 1.423   -4.893  -1.564  1.00 0.00 ? 14 TYR A CE1 1  
ATOM   107  C  CE2 . TYR A 1 14 ? 1.018   -2.633  -0.762  1.00 0.00 ? 14 TYR A CE2 1  
ATOM   108  C  CZ  . TYR A 1 14 ? 1.624   -3.507  -1.675  1.00 0.00 ? 14 TYR A CZ  1  
ATOM   109  O  OH  . TYR A 1 14 ? 2.463   -3.009  -2.623  1.00 0.00 ? 14 TYR A OH  1  
ATOM   110  N  N   . VAL A 1 15 ? -2.627  -5.095  -1.191  1.00 0.00 ? 15 VAL A N   1  
ATOM   111  C  CA  . VAL A 1 15 ? -2.656  -5.462  -2.598  1.00 0.00 ? 15 VAL A CA  1  
ATOM   112  C  C   . VAL A 1 15 ? -1.686  -4.550  -3.343  1.00 0.00 ? 15 VAL A C   1  
ATOM   113  O  O   . VAL A 1 15 ? -1.525  -3.386  -2.970  1.00 0.00 ? 15 VAL A O   1  
ATOM   114  C  CB  . VAL A 1 15 ? -4.085  -5.348  -3.155  1.00 0.00 ? 15 VAL A CB  1  
ATOM   115  C  CG1 . VAL A 1 15 ? -4.995  -6.390  -2.491  1.00 0.00 ? 15 VAL A CG1 1  
ATOM   116  C  CG2 . VAL A 1 15 ? -4.680  -3.949  -2.938  1.00 0.00 ? 15 VAL A CG2 1  
ATOM   117  N  N   . ASN A 1 16 ? -1.037  -5.080  -4.383  1.00 0.00 ? 16 ASN A N   1  
ATOM   118  C  CA  . ASN A 1 16 ? -0.122  -4.352  -5.231  1.00 0.00 ? 16 ASN A CA  1  
ATOM   119  C  C   . ASN A 1 16 ? -0.844  -3.383  -6.161  1.00 0.00 ? 16 ASN A C   1  
ATOM   120  O  O   . ASN A 1 16 ? -0.255  -2.381  -6.563  1.00 0.00 ? 16 ASN A O   1  
ATOM   121  C  CB  . ASN A 1 16 ? 0.819   -5.283  -6.002  1.00 0.00 ? 16 ASN A CB  1  
ATOM   122  C  CG  . ASN A 1 16 ? 2.058   -5.578  -5.172  1.00 0.00 ? 16 ASN A CG  1  
ATOM   123  O  OD1 . ASN A 1 16 ? 2.746   -4.666  -4.730  1.00 0.00 ? 16 ASN A OD1 1  
ATOM   124  N  ND2 . ASN A 1 16 ? 2.354   -6.837  -4.926  1.00 0.00 ? 16 ASN A ND2 1  
ATOM   125  N  N   . GLU A 1 17 ? -2.102  -3.677  -6.504  1.00 0.00 ? 17 GLU A N   1  
ATOM   126  C  CA  . GLU A 1 17 ? -2.983  -2.788  -7.224  1.00 0.00 ? 17 GLU A CA  1  
ATOM   127  C  C   . GLU A 1 17 ? -4.138  -2.458  -6.296  1.00 0.00 ? 17 GLU A C   1  
ATOM   128  O  O   . GLU A 1 17 ? -4.901  -3.352  -5.940  1.00 0.00 ? 17 GLU A O   1  
ATOM   129  C  CB  . GLU A 1 17 ? -3.503  -3.497  -8.473  1.00 0.00 ? 17 GLU A CB  1  
ATOM   130  C  CG  . GLU A 1 17 ? -4.183  -2.496  -9.404  1.00 0.00 ? 17 GLU A CG  1  
ATOM   131  C  CD  . GLU A 1 17 ? -4.603  -3.116  -10.733 1.00 0.00 ? 17 GLU A CD  1  
ATOM   132  O  OE1 . GLU A 1 17 ? -3.857  -3.996  -11.216 1.00 0.00 ? 17 GLU A OE1 1  
ATOM   133  O  OE2 . GLU A 1 17 ? -5.651  -2.680  -11.254 1.00 0.00 ? 17 GLU A OE2 1  
ATOM   134  N  N   . ALA A 1 18 ? -4.276  -1.187  -5.930  1.00 0.00 ? 18 ALA A N   1  
ATOM   135  C  CA  . ALA A 1 18 ? -5.372  -0.681  -5.116  1.00 0.00 ? 18 ALA A CA  1  
ATOM   136  C  C   . ALA A 1 18 ? -6.707  -1.283  -5.559  1.00 0.00 ? 18 ALA A C   1  
ATOM   137  O  O   . ALA A 1 18 ? -7.454  -1.821  -4.742  1.00 0.00 ? 18 ALA A O   1  
ATOM   138  C  CB  . ALA A 1 18 ? -5.396  0.848   -5.198  1.00 0.00 ? 18 ALA A CB  1  
ATOM   139  N  N   . ALA A 1 19 ? -6.966  -1.243  -6.869  1.00 0.00 ? 19 ALA A N   1  
ATOM   140  C  CA  . ALA A 1 19 ? -8.175  -1.780  -7.472  1.00 0.00 ? 19 ALA A CA  1  
ATOM   141  C  C   . ALA A 1 19 ? -8.484  -3.208  -7.022  1.00 0.00 ? 19 ALA A C   1  
ATOM   142  O  O   . ALA A 1 19 ? -9.658  -3.522  -6.810  1.00 0.00 ? 19 ALA A O   1  
ATOM   143  C  CB  . ALA A 1 19 ? -8.082  -1.711  -8.995  1.00 0.00 ? 19 ALA A CB  1  
ATOM   144  N  N   . ASP A 1 20 ? -7.471  -4.075  -6.851  1.00 0.00 ? 20 ASP A N   1  
ATOM   145  C  CA  . ASP A 1 20 ? -7.718  -5.433  -6.360  1.00 0.00 ? 20 ASP A CA  1  
ATOM   146  C  C   . ASP A 1 20 ? -8.603  -5.425  -5.109  1.00 0.00 ? 20 ASP A C   1  
ATOM   147  O  O   . ASP A 1 20 ? -9.531  -6.221  -4.963  1.00 0.00 ? 20 ASP A O   1  
ATOM   148  C  CB  . ASP A 1 20 ? -6.411  -6.152  -6.043  1.00 0.00 ? 20 ASP A CB  1  
ATOM   149  C  CG  . ASP A 1 20 ? -6.668  -7.637  -5.819  1.00 0.00 ? 20 ASP A CG  1  
ATOM   150  O  OD1 . ASP A 1 20 ? -6.740  -8.357  -6.837  1.00 0.00 ? 20 ASP A OD1 1  
ATOM   151  O  OD2 . ASP A 1 20 ? -6.812  -8.020  -4.639  1.00 0.00 ? 20 ASP A OD2 1  
ATOM   152  N  N   . ALA A 1 21 ? -8.361  -4.451  -4.226  1.00 0.00 ? 21 ALA A N   1  
ATOM   153  C  CA  . ALA A 1 21 ? -9.048  -4.350  -2.951  1.00 0.00 ? 21 ALA A CA  1  
ATOM   154  C  C   . ALA A 1 21 ? -10.504 -3.898  -3.087  1.00 0.00 ? 21 ALA A C   1  
ATOM   155  O  O   . ALA A 1 21 ? -11.148 -3.693  -2.062  1.00 0.00 ? 21 ALA A O   1  
ATOM   156  C  CB  . ALA A 1 21 ? -8.267  -3.449  -1.988  1.00 0.00 ? 21 ALA A CB  1  
ATOM   157  N  N   . SER A 1 22 ? -11.079 -3.813  -4.294  1.00 0.00 ? 22 SER A N   1  
ATOM   158  C  CA  . SER A 1 22 ? -12.501 -3.574  -4.484  1.00 0.00 ? 22 SER A CA  1  
ATOM   159  C  C   . SER A 1 22 ? -13.406 -4.491  -3.663  1.00 0.00 ? 22 SER A C   1  
ATOM   160  O  O   . SER A 1 22 ? -14.501 -4.117  -3.251  1.00 0.00 ? 22 SER A O   1  
ATOM   161  C  CB  . SER A 1 22 ? -12.820 -3.666  -5.975  1.00 0.00 ? 22 SER A CB  1  
ATOM   162  O  OG  . SER A 1 22 ? -12.226 -2.593  -6.674  1.00 0.00 ? 22 SER A OG  1  
ATOM   163  N  N   . GLY A 1 23 ? -12.919 -5.698  -3.429  1.00 0.00 ? 23 GLY A N   1  
ATOM   164  C  CA  . GLY A 1 23 ? -13.583 -6.718  -2.628  1.00 0.00 ? 23 GLY A CA  1  
ATOM   165  C  C   . GLY A 1 23 ? -13.583 -6.394  -1.128  1.00 0.00 ? 23 GLY A C   1  
ATOM   166  O  O   . GLY A 1 23 ? -14.413 -6.907  -0.381  1.00 0.00 ? 23 GLY A O   1  
ATOM   167  N  N   . HIS A 1 24 ? -12.627 -5.586  -0.664  1.00 0.00 ? 24 HIS A N   1  
ATOM   168  C  CA  . HIS A 1 24 ? -12.379 -5.326  0.744   1.00 0.00 ? 24 HIS A CA  1  
ATOM   169  C  C   . HIS A 1 24 ? -13.378 -4.291  1.282   1.00 0.00 ? 24 HIS A C   1  
ATOM   170  O  O   . HIS A 1 24 ? -13.326 -3.153  0.833   1.00 0.00 ? 24 HIS A O   1  
ATOM   171  C  CB  . HIS A 1 24 ? -10.950 -4.780  0.875   1.00 0.00 ? 24 HIS A CB  1  
ATOM   172  C  CG  . HIS A 1 24 ? -10.446 -4.777  2.293   1.00 0.00 ? 24 HIS A CG  1  
ATOM   173  N  ND1 . HIS A 1 24 ? -10.796 -3.852  3.251   1.00 0.00 ? 24 HIS A ND1 1  
ATOM   174  C  CD2 . HIS A 1 24 ? -9.560  -5.654  2.853   1.00 0.00 ? 24 HIS A CD2 1  
ATOM   175  C  CE1 . HIS A 1 24 ? -10.141 -4.160  4.388   1.00 0.00 ? 24 HIS A CE1 1  
ATOM   176  N  NE2 . HIS A 1 24 ? -9.381  -5.251  4.164   1.00 0.00 ? 24 HIS A NE2 1  
ATOM   177  N  N   . PRO A 1 25 ? -14.209 -4.598  2.294   1.00 0.00 ? 25 PRO A N   1  
ATOM   178  C  CA  . PRO A 1 25 ? -15.139 -3.637  2.884   1.00 0.00 ? 25 PRO A CA  1  
ATOM   179  C  C   . PRO A 1 25 ? -14.510 -2.270  3.192   1.00 0.00 ? 25 PRO A C   1  
ATOM   180  O  O   . PRO A 1 25 ? -15.052 -1.235  2.822   1.00 0.00 ? 25 PRO A O   1  
ATOM   181  C  CB  . PRO A 1 25 ? -15.687 -4.319  4.141   1.00 0.00 ? 25 PRO A CB  1  
ATOM   182  C  CG  . PRO A 1 25 ? -15.638 -5.798  3.763   1.00 0.00 ? 25 PRO A CG  1  
ATOM   183  C  CD  . PRO A 1 25 ? -14.367 -5.902  2.918   1.00 0.00 ? 25 PRO A CD  1  
ATOM   184  N  N   . ARG A 1 26 ? -13.352 -2.258  3.866   1.00 0.00 ? 26 ARG A N   1  
ATOM   185  C  CA  . ARG A 1 26 ? -12.675 -1.008  4.213   1.00 0.00 ? 26 ARG A CA  1  
ATOM   186  C  C   . ARG A 1 26 ? -12.200 -0.210  2.988   1.00 0.00 ? 26 ARG A C   1  
ATOM   187  O  O   . ARG A 1 26 ? -11.827 0.943   3.172   1.00 0.00 ? 26 ARG A O   1  
ATOM   188  C  CB  . ARG A 1 26 ? -11.487 -1.272  5.162   1.00 0.00 ? 26 ARG A CB  1  
ATOM   189  C  CG  . ARG A 1 26 ? -10.992 -0.064  5.974   1.00 0.00 ? 26 ARG A CG  1  
ATOM   190  C  CD  . ARG A 1 26 ? -9.641  0.453   5.450   1.00 0.00 ? 26 ARG A CD  1  
ATOM   191  N  NE  . ARG A 1 26 ? -9.271  1.811   5.896   1.00 0.00 ? 26 ARG A NE  1  
ATOM   192  C  CZ  . ARG A 1 26 ? -9.614  2.958   5.275   1.00 0.00 ? 26 ARG A CZ  1  
ATOM   193  N  NH1 . ARG A 1 26 ? -10.558 2.958   4.331   1.00 0.00 ? 26 ARG A NH1 1  
ATOM   194  N  NH2 . ARG A 1 26 ? -8.998  4.099   5.586   1.00 0.00 ? 26 ARG A NH2 1  
ATOM   195  N  N   . TYR A 1 27 ? -12.124 -0.784  1.782   1.00 0.00 ? 27 TYR A N   1  
ATOM   196  C  CA  . TYR A 1 27 ? -11.635 -0.060  0.613   1.00 0.00 ? 27 TYR A CA  1  
ATOM   197  C  C   . TYR A 1 27 ? -12.666 0.954   0.108   1.00 0.00 ? 27 TYR A C   1  
ATOM   198  O  O   . TYR A 1 27 ? -13.874 0.742   0.181   1.00 0.00 ? 27 TYR A O   1  
ATOM   199  C  CB  . TYR A 1 27 ? -11.209 -1.045  -0.485  1.00 0.00 ? 27 TYR A CB  1  
ATOM   200  C  CG  . TYR A 1 27 ? -10.676 -0.402  -1.755  1.00 0.00 ? 27 TYR A CG  1  
ATOM   201  C  CD1 . TYR A 1 27 ? -9.350  0.053   -1.789  1.00 0.00 ? 27 TYR A CD1 1  
ATOM   202  C  CD2 . TYR A 1 27 ? -11.467 -0.309  -2.916  1.00 0.00 ? 27 TYR A CD2 1  
ATOM   203  C  CE1 . TYR A 1 27 ? -8.798  0.561   -2.972  1.00 0.00 ? 27 TYR A CE1 1  
ATOM   204  C  CE2 . TYR A 1 27 ? -10.900 0.156   -4.120  1.00 0.00 ? 27 TYR A CE2 1  
ATOM   205  C  CZ  . TYR A 1 27 ? -9.557  0.575   -4.151  1.00 0.00 ? 27 TYR A CZ  1  
ATOM   206  O  OH  . TYR A 1 27 ? -8.968  0.988   -5.308  1.00 0.00 ? 27 TYR A OH  1  
ATOM   207  N  N   . GLN A 1 28 ? -12.150 2.071   -0.402  1.00 0.00 ? 28 GLN A N   1  
ATOM   208  C  CA  . GLN A 1 28 ? -12.815 3.072   -1.205  1.00 0.00 ? 28 GLN A CA  1  
ATOM   209  C  C   . GLN A 1 28 ? -11.853 3.332   -2.359  1.00 0.00 ? 28 GLN A C   1  
ATOM   210  O  O   . GLN A 1 28 ? -10.640 3.214   -2.156  1.00 0.00 ? 28 GLN A O   1  
ATOM   211  C  CB  . GLN A 1 28 ? -12.993 4.389   -0.442  1.00 0.00 ? 28 GLN A CB  1  
ATOM   212  C  CG  . GLN A 1 28 ? -13.888 4.323   0.797   1.00 0.00 ? 28 GLN A CG  1  
ATOM   213  C  CD  . GLN A 1 28 ? -13.210 3.614   1.963   1.00 0.00 ? 28 GLN A CD  1  
ATOM   214  O  OE1 . GLN A 1 28 ? -12.084 3.939   2.344   1.00 0.00 ? 28 GLN A OE1 1  
ATOM   215  N  NE2 . GLN A 1 28 ? -13.869 2.612   2.529   1.00 0.00 ? 28 GLN A NE2 1  
ATOM   216  N  N   . GLU A 1 29 ? -12.382 3.698   -3.525  1.00 0.00 ? 29 GLU A N   1  
ATOM   217  C  CA  . GLU A 1 29 ? -11.582 3.983   -4.696  1.00 0.00 ? 29 GLU A CA  1  
ATOM   218  C  C   . GLU A 1 29 ? -10.729 5.231   -4.500  1.00 0.00 ? 29 GLU A C   1  
ATOM   219  O  O   . GLU A 1 29 ? -10.919 6.006   -3.562  1.00 0.00 ? 29 GLU A O   1  
ATOM   220  C  CB  . GLU A 1 29 ? -12.480 4.115   -5.944  1.00 0.00 ? 29 GLU A CB  1  
ATOM   221  C  CG  . GLU A 1 29 ? -12.387 2.858   -6.818  1.00 0.00 ? 29 GLU A CG  1  
ATOM   222  C  CD  . GLU A 1 29 ? -10.947 2.576   -7.232  1.00 0.00 ? 29 GLU A CD  1  
ATOM   223  O  OE1 . GLU A 1 29 ? -10.178 3.559   -7.332  1.00 0.00 ? 29 GLU A OE1 1  
ATOM   224  O  OE2 . GLU A 1 29 ? -10.606 1.377   -7.321  1.00 0.00 ? 29 GLU A OE2 1  
ATOM   225  N  N   . GLY A 1 30 ? -9.748  5.390   -5.383  1.00 0.00 ? 30 GLY A N   1  
ATOM   226  C  CA  . GLY A 1 30 ? -8.834  6.520   -5.422  1.00 0.00 ? 30 GLY A CA  1  
ATOM   227  C  C   . GLY A 1 30 ? -7.704  6.377   -4.406  1.00 0.00 ? 30 GLY A C   1  
ATOM   228  O  O   . GLY A 1 30 ? -6.628  6.941   -4.592  1.00 0.00 ? 30 GLY A O   1  
ATOM   229  N  N   . GLN A 1 31 ? -7.940  5.637   -3.321  1.00 0.00 ? 31 GLN A N   1  
ATOM   230  C  CA  . GLN A 1 31 ? -6.954  5.437   -2.278  1.00 0.00 ? 31 GLN A CA  1  
ATOM   231  C  C   . GLN A 1 31 ? -5.825  4.551   -2.811  1.00 0.00 ? 31 GLN A C   1  
ATOM   232  O  O   . GLN A 1 31 ? -6.042  3.368   -3.061  1.00 0.00 ? 31 GLN A O   1  
ATOM   233  C  CB  . GLN A 1 31 ? -7.639  4.794   -1.069  1.00 0.00 ? 31 GLN A CB  1  
ATOM   234  C  CG  . GLN A 1 31 ? -8.628  5.744   -0.379  1.00 0.00 ? 31 GLN A CG  1  
ATOM   235  C  CD  . GLN A 1 31 ? -9.344  5.056   0.779   1.00 0.00 ? 31 GLN A CD  1  
ATOM   236  O  OE1 . GLN A 1 31 ? -9.432  5.561   1.895   1.00 0.00 ? 31 GLN A OE1 1  
ATOM   237  N  NE2 . GLN A 1 31 ? -9.901  3.885   0.508   1.00 0.00 ? 31 GLN A NE2 1  
ATOM   238  N  N   . LEU A 1 32 ? -4.629  5.122   -2.967  1.00 0.00 ? 32 LEU A N   1  
ATOM   239  C  CA  . LEU A 1 32 ? -3.407  4.437   -3.371  1.00 0.00 ? 32 LEU A CA  1  
ATOM   240  C  C   . LEU A 1 32 ? -2.377  4.702   -2.273  1.00 0.00 ? 32 LEU A C   1  
ATOM   241  O  O   . LEU A 1 32 ? -2.404  5.782   -1.686  1.00 0.00 ? 32 LEU A O   1  
ATOM   242  C  CB  . LEU A 1 32 ? -2.882  5.039   -4.687  1.00 0.00 ? 32 LEU A CB  1  
ATOM   243  C  CG  . LEU A 1 32 ? -3.274  4.318   -5.985  1.00 0.00 ? 32 LEU A CG  1  
ATOM   244  C  CD1 . LEU A 1 32 ? -4.759  4.339   -6.330  1.00 0.00 ? 32 LEU A CD1 1  
ATOM   245  C  CD2 . LEU A 1 32 ? -2.536  4.999   -7.146  1.00 0.00 ? 32 LEU A CD2 1  
ATOM   246  N  N   . CYS A 1 33 ? -1.450  3.771   -2.026  1.00 0.00 ? 33 CYS A N   1  
ATOM   247  C  CA  . CYS A 1 33 ? -0.317  3.953   -1.123  1.00 0.00 ? 33 CYS A CA  1  
ATOM   248  C  C   . CYS A 1 33 ? 0.307   5.342   -1.300  1.00 0.00 ? 33 CYS A C   1  
ATOM   249  O  O   . CYS A 1 33 ? 0.539   6.049   -0.325  1.00 0.00 ? 33 CYS A O   1  
ATOM   250  C  CB  . CYS A 1 33 ? 0.714   2.873   -1.356  1.00 0.00 ? 33 CYS A CB  1  
ATOM   251  S  SG  . CYS A 1 33 ? 0.398   1.342   -0.420  1.00 0.00 ? 33 CYS A SG  1  
ATOM   252  N  N   . GLU A 1 34 ? 0.549   5.779   -2.539  1.00 0.00 ? 34 GLU A N   1  
ATOM   253  C  CA  . GLU A 1 34 ? 1.163   7.083   -2.763  1.00 0.00 ? 34 GLU A CA  1  
ATOM   254  C  C   . GLU A 1 34 ? 0.400   8.258   -2.124  1.00 0.00 ? 34 GLU A C   1  
ATOM   255  O  O   . GLU A 1 34 ? 1.011   9.279   -1.812  1.00 0.00 ? 34 GLU A O   1  
ATOM   256  C  CB  . GLU A 1 34 ? 1.445   7.296   -4.251  1.00 0.00 ? 34 GLU A CB  1  
ATOM   257  C  CG  . GLU A 1 34 ? 0.207   7.629   -5.095  1.00 0.00 ? 34 GLU A CG  1  
ATOM   258  C  CD  . GLU A 1 34 ? 0.566   7.910   -6.550  1.00 0.00 ? 34 GLU A CD  1  
ATOM   259  O  OE1 . GLU A 1 34 ? 1.666   7.487   -6.968  1.00 0.00 ? 34 GLU A OE1 1  
ATOM   260  O  OE2 . GLU A 1 34 ? -0.271  8.557   -7.214  1.00 0.00 ? 34 GLU A OE2 1  
ATOM   261  N  N   . ASN A 1 35 ? -0.921  8.125   -1.934  1.00 0.00 ? 35 ASN A N   1  
ATOM   262  C  CA  . ASN A 1 35 ? -1.775  9.124   -1.291  1.00 0.00 ? 35 ASN A CA  1  
ATOM   263  C  C   . ASN A 1 35 ? -2.252  8.667   0.092   1.00 0.00 ? 35 ASN A C   1  
ATOM   264  O  O   . ASN A 1 35 ? -3.268  9.154   0.592   1.00 0.00 ? 35 ASN A O   1  
ATOM   265  C  CB  . ASN A 1 35 ? -2.936  9.517   -2.220  1.00 0.00 ? 35 ASN A CB  1  
ATOM   266  C  CG  . ASN A 1 35 ? -3.960  8.423   -2.488  1.00 0.00 ? 35 ASN A CG  1  
ATOM   267  O  OD1 . ASN A 1 35 ? -4.471  7.762   -1.591  1.00 0.00 ? 35 ASN A OD1 1  
ATOM   268  N  ND2 . ASN A 1 35 ? -4.315  8.250   -3.752  1.00 0.00 ? 35 ASN A ND2 1  
ATOM   269  N  N   . CYS A 1 36 ? -1.514  7.754   0.724   1.00 0.00 ? 36 CYS A N   1  
ATOM   270  C  CA  . CYS A 1 36 ? -1.747  7.299   2.083   1.00 0.00 ? 36 CYS A CA  1  
ATOM   271  C  C   . CYS A 1 36 ? -1.032  8.241   3.051   1.00 0.00 ? 36 CYS A C   1  
ATOM   272  O  O   . CYS A 1 36 ? 0.103   8.649   2.808   1.00 0.00 ? 36 CYS A O   1  
ATOM   273  C  CB  . CYS A 1 36 ? -1.196  5.905   2.170   1.00 0.00 ? 36 CYS A CB  1  
ATOM   274  S  SG  . CYS A 1 36 ? -1.502  5.087   3.732   1.00 0.00 ? 36 CYS A SG  1  
ATOM   275  N  N   . ALA A 1 37 ? -1.666  8.584   4.171   1.00 0.00 ? 37 ALA A N   1  
ATOM   276  C  CA  . ALA A 1 37 ? -1.052  9.430   5.186   1.00 0.00 ? 37 ALA A CA  1  
ATOM   277  C  C   . ALA A 1 37 ? 0.218   8.801   5.757   1.00 0.00 ? 37 ALA A C   1  
ATOM   278  O  O   . ALA A 1 37 ? 1.090   9.521   6.238   1.00 0.00 ? 37 ALA A O   1  
ATOM   279  C  CB  . ALA A 1 37 ? -2.060  9.729   6.293   1.00 0.00 ? 37 ALA A CB  1  
ATOM   280  N  N   . PHE A 1 38 ? 0.333   7.469   5.705   1.00 0.00 ? 38 PHE A N   1  
ATOM   281  C  CA  . PHE A 1 38 ? 1.531   6.770   6.138   1.00 0.00 ? 38 PHE A CA  1  
ATOM   282  C  C   . PHE A 1 38 ? 2.520   6.563   4.992   1.00 0.00 ? 38 PHE A C   1  
ATOM   283  O  O   . PHE A 1 38 ? 3.515   5.874   5.195   1.00 0.00 ? 38 PHE A O   1  
ATOM   284  C  CB  . PHE A 1 38 ? 1.160   5.435   6.797   1.00 0.00 ? 38 PHE A CB  1  
ATOM   285  C  CG  . PHE A 1 38 ? 0.221   5.564   7.982   1.00 0.00 ? 38 PHE A CG  1  
ATOM   286  C  CD1 . PHE A 1 38 ? 0.560   6.409   9.056   1.00 0.00 ? 38 PHE A CD1 1  
ATOM   287  C  CD2 . PHE A 1 38 ? -1.024  4.904   7.979   1.00 0.00 ? 38 PHE A CD2 1  
ATOM   288  C  CE1 . PHE A 1 38 ? -0.360  6.636   10.094  1.00 0.00 ? 38 PHE A CE1 1  
ATOM   289  C  CE2 . PHE A 1 38 ? -1.933  5.114   9.031   1.00 0.00 ? 38 PHE A CE2 1  
ATOM   290  C  CZ  . PHE A 1 38 ? -1.608  5.988   10.081  1.00 0.00 ? 38 PHE A CZ  1  
ATOM   291  N  N   . TRP A 1 39 ? 2.311   7.148   3.812   1.00 0.00 ? 39 TRP A N   1  
ATOM   292  C  CA  . TRP A 1 39 ? 3.304   7.067   2.752   1.00 0.00 ? 39 TRP A CA  1  
ATOM   293  C  C   . TRP A 1 39 ? 4.645   7.615   3.248   1.00 0.00 ? 39 TRP A C   1  
ATOM   294  O  O   . TRP A 1 39 ? 4.681   8.630   3.939   1.00 0.00 ? 39 TRP A O   1  
ATOM   295  C  CB  . TRP A 1 39 ? 2.827   7.862   1.538   1.00 0.00 ? 39 TRP A CB  1  
ATOM   296  C  CG  . TRP A 1 39 ? 3.726   7.800   0.343   1.00 0.00 ? 39 TRP A CG  1  
ATOM   297  C  CD1 . TRP A 1 39 ? 4.364   8.852   -0.213  1.00 0.00 ? 39 TRP A CD1 1  
ATOM   298  C  CD2 . TRP A 1 39 ? 4.067   6.642   -0.478  1.00 0.00 ? 39 TRP A CD2 1  
ATOM   299  N  NE1 . TRP A 1 39 ? 5.051   8.436   -1.334  1.00 0.00 ? 39 TRP A NE1 1  
ATOM   300  C  CE2 . TRP A 1 39 ? 4.889   7.085   -1.554  1.00 0.00 ? 39 TRP A CE2 1  
ATOM   301  C  CE3 . TRP A 1 39 ? 3.736   5.270   -0.449  1.00 0.00 ? 39 TRP A CE3 1  
ATOM   302  C  CZ2 . TRP A 1 39 ? 5.339   6.219   -2.559  1.00 0.00 ? 39 TRP A CZ2 1  
ATOM   303  C  CZ3 . TRP A 1 39 ? 4.193   4.393   -1.450  1.00 0.00 ? 39 TRP A CZ3 1  
ATOM   304  C  CH2 . TRP A 1 39 ? 4.973   4.868   -2.513  1.00 0.00 ? 39 TRP A CH2 1  
ATOM   305  N  N   . GLY A 1 40 ? 5.746   6.943   2.903   1.00 0.00 ? 40 GLY A N   1  
ATOM   306  C  CA  . GLY A 1 40 ? 7.081   7.448   3.159   1.00 0.00 ? 40 GLY A CA  1  
ATOM   307  C  C   . GLY A 1 40 ? 7.485   8.359   2.008   1.00 0.00 ? 40 GLY A C   1  
ATOM   308  O  O   . GLY A 1 40 ? 7.313   9.573   2.078   1.00 0.00 ? 40 GLY A O   1  
ATOM   309  N  N   . GLU A 1 41 ? 8.017   7.761   0.941   1.00 0.00 ? 41 GLU A N   1  
ATOM   310  C  CA  . GLU A 1 41 ? 8.433   8.451   -0.265  1.00 0.00 ? 41 GLU A CA  1  
ATOM   311  C  C   . GLU A 1 41 ? 8.590   7.384   -1.343  1.00 0.00 ? 41 GLU A C   1  
ATOM   312  O  O   . GLU A 1 41 ? 8.745   6.201   -1.020  1.00 0.00 ? 41 GLU A O   1  
ATOM   313  C  CB  . GLU A 1 41 ? 9.746   9.211   -0.029  1.00 0.00 ? 41 GLU A CB  1  
ATOM   314  C  CG  . GLU A 1 41 ? 10.071  10.215  -1.145  1.00 0.00 ? 41 GLU A CG  1  
ATOM   315  C  CD  . GLU A 1 41 ? 11.266  11.091  -0.786  1.00 0.00 ? 41 GLU A CD  1  
ATOM   316  O  OE1 . GLU A 1 41 ? 12.151  10.582  -0.066  1.00 0.00 ? 41 GLU A OE1 1  
ATOM   317  O  OE2 . GLU A 1 41 ? 11.270  12.254  -1.243  1.00 0.00 ? 41 GLU A OE2 1  
ATOM   318  N  N   . ALA A 1 42 ? 8.543   7.805   -2.608  1.00 0.00 ? 42 ALA A N   1  
ATOM   319  C  CA  . ALA A 1 42 ? 8.782   6.920   -3.734  1.00 0.00 ? 42 ALA A CA  1  
ATOM   320  C  C   . ALA A 1 42 ? 10.277  6.658   -3.857  1.00 0.00 ? 42 ALA A C   1  
ATOM   321  O  O   . ALA A 1 42 ? 11.088  7.569   -3.717  1.00 0.00 ? 42 ALA A O   1  
ATOM   322  C  CB  . ALA A 1 42 ? 8.207   7.491   -5.029  1.00 0.00 ? 42 ALA A CB  1  
ATOM   323  N  N   . VAL A 1 43 ? 10.626  5.397   -4.093  1.00 0.00 ? 43 VAL A N   1  
ATOM   324  C  CA  . VAL A 1 43 ? 11.989  4.904   -4.086  1.00 0.00 ? 43 VAL A CA  1  
ATOM   325  C  C   . VAL A 1 43 ? 12.413  4.641   -5.528  1.00 0.00 ? 43 VAL A C   1  
ATOM   326  O  O   . VAL A 1 43 ? 13.496  5.054   -5.938  1.00 0.00 ? 43 VAL A O   1  
ATOM   327  C  CB  . VAL A 1 43 ? 12.043  3.638   -3.216  1.00 0.00 ? 43 VAL A CB  1  
ATOM   328  C  CG1 . VAL A 1 43 ? 13.441  3.004   -3.209  1.00 0.00 ? 43 VAL A CG1 1  
ATOM   329  C  CG2 . VAL A 1 43 ? 11.612  3.926   -1.767  1.00 0.00 ? 43 VAL A CG2 1  
ATOM   330  N  N   . GLN A 1 44 ? 11.571  3.936   -6.294  1.00 0.00 ? 44 GLN A N   1  
ATOM   331  C  CA  . GLN A 1 44 ? 11.878  3.556   -7.662  1.00 0.00 ? 44 GLN A CA  1  
ATOM   332  C  C   . GLN A 1 44 ? 10.616  3.410   -8.521  1.00 0.00 ? 44 GLN A C   1  
ATOM   333  O  O   . GLN A 1 44 ? 9.722   4.248   -8.421  1.00 0.00 ? 44 GLN A O   1  
ATOM   334  C  CB  . GLN A 1 44 ? 12.822  2.354   -7.646  1.00 0.00 ? 44 GLN A CB  1  
ATOM   335  C  CG  . GLN A 1 44 ? 12.279  1.138   -6.894  1.00 0.00 ? 44 GLN A CG  1  
ATOM   336  C  CD  . GLN A 1 44 ? 13.302  0.010   -6.944  1.00 0.00 ? 44 GLN A CD  1  
ATOM   337  O  OE1 . GLN A 1 44 ? 13.943  -0.316  -5.950  1.00 0.00 ? 44 GLN A OE1 1  
ATOM   338  N  NE2 . GLN A 1 44 ? 13.481  -0.578  -8.122  1.00 0.00 ? 44 GLN A NE2 1  
ATOM   339  N  N   . ASP A 1 45 ? 10.550  2.385   -9.381  1.00 0.00 ? 45 ASP A N   1  
ATOM   340  C  CA  . ASP A 1 45 ? 9.640   2.219   -10.512 1.00 0.00 ? 45 ASP A CA  1  
ATOM   341  C  C   . ASP A 1 45 ? 8.187   1.988   -10.083 1.00 0.00 ? 45 ASP A C   1  
ATOM   342  O  O   . ASP A 1 45 ? 7.599   0.929   -10.295 1.00 0.00 ? 45 ASP A O   1  
ATOM   343  C  CB  . ASP A 1 45 ? 10.176  1.097   -11.422 1.00 0.00 ? 45 ASP A CB  1  
ATOM   344  C  CG  . ASP A 1 45 ? 10.518  -0.182  -10.669 1.00 0.00 ? 45 ASP A CG  1  
ATOM   345  O  OD1 . ASP A 1 45 ? 11.451  -0.136  -9.831  1.00 0.00 ? 45 ASP A OD1 1  
ATOM   346  O  OD2 . ASP A 1 45 ? 9.877   -1.227  -10.901 1.00 0.00 ? 45 ASP A OD2 1  
ATOM   347  N  N   . GLY A 1 46 ? 7.599   3.019   -9.487  1.00 0.00 ? 46 GLY A N   1  
ATOM   348  C  CA  . GLY A 1 46 ? 6.261   2.987   -8.927  1.00 0.00 ? 46 GLY A CA  1  
ATOM   349  C  C   . GLY A 1 46 ? 6.239   2.164   -7.643  1.00 0.00 ? 46 GLY A C   1  
ATOM   350  O  O   . GLY A 1 46 ? 5.240   1.521   -7.343  1.00 0.00 ? 46 GLY A O   1  
ATOM   351  N  N   . TRP A 1 47 ? 7.329   2.188   -6.872  1.00 0.00 ? 47 TRP A N   1  
ATOM   352  C  CA  . TRP A 1 47 ? 7.454   1.590   -5.567  1.00 0.00 ? 47 TRP A CA  1  
ATOM   353  C  C   . TRP A 1 47 ? 8.060   2.611   -4.620  1.00 0.00 ? 47 TRP A C   1  
ATOM   354  O  O   . TRP A 1 47 ? 8.943   3.373   -5.023  1.00 0.00 ? 47 TRP A O   1  
ATOM   355  C  CB  . TRP A 1 47 ? 8.375   0.381   -5.646  1.00 0.00 ? 47 TRP A CB  1  
ATOM   356  C  CG  . TRP A 1 47 ? 7.924   -0.721  -6.540  1.00 0.00 ? 47 TRP A CG  1  
ATOM   357  C  CD1 . TRP A 1 47 ? 8.197   -0.842  -7.854  1.00 0.00 ? 47 TRP A CD1 1  
ATOM   358  C  CD2 . TRP A 1 47 ? 7.084   -1.853  -6.200  1.00 0.00 ? 47 TRP A CD2 1  
ATOM   359  N  NE1 . TRP A 1 47 ? 7.524   -1.933  -8.363  1.00 0.00 ? 47 TRP A NE1 1  
ATOM   360  C  CE2 . TRP A 1 47 ? 6.815   -2.595  -7.385  1.00 0.00 ? 47 TRP A CE2 1  
ATOM   361  C  CE3 . TRP A 1 47 ? 6.559   -2.349  -4.993  1.00 0.00 ? 47 TRP A CE3 1  
ATOM   362  C  CZ2 . TRP A 1 47 ? 6.003   -3.738  -7.381  1.00 0.00 ? 47 TRP A CZ2 1  
ATOM   363  C  CZ3 . TRP A 1 47 ? 5.690   -3.455  -4.987  1.00 0.00 ? 47 TRP A CZ3 1  
ATOM   364  C  CH2 . TRP A 1 47 ? 5.375   -4.118  -6.186  1.00 0.00 ? 47 TRP A CH2 1  
ATOM   365  N  N   . GLY A 1 48 ? 7.604   2.600   -3.369  1.00 0.00 ? 48 GLY A N   1  
ATOM   366  C  CA  . GLY A 1 48 ? 8.066   3.488   -2.330  1.00 0.00 ? 48 GLY A CA  1  
ATOM   367  C  C   . GLY A 1 48 ? 7.899   2.868   -0.953  1.00 0.00 ? 48 GLY A C   1  
ATOM   368  O  O   . GLY A 1 48 ? 7.426   1.739   -0.808  1.00 0.00 ? 48 GLY A O   1  
ATOM   369  N  N   . ARG A 1 49 ? 8.340   3.607   0.060   1.00 0.00 ? 49 ARG A N   1  
ATOM   370  C  CA  . ARG A 1 49 ? 8.264   3.187   1.441   1.00 0.00 ? 49 ARG A CA  1  
ATOM   371  C  C   . ARG A 1 49 ? 6.940   3.590   2.090   1.00 0.00 ? 49 ARG A C   1  
ATOM   372  O  O   . ARG A 1 49 ? 6.283   4.527   1.633   1.00 0.00 ? 49 ARG A O   1  
ATOM   373  C  CB  . ARG A 1 49 ? 9.434   3.852   2.143   1.00 0.00 ? 49 ARG A CB  1  
ATOM   374  C  CG  . ARG A 1 49 ? 10.725  3.479   1.424   1.00 0.00 ? 49 ARG A CG  1  
ATOM   375  C  CD  . ARG A 1 49 ? 11.874  3.628   2.391   1.00 0.00 ? 49 ARG A CD  1  
ATOM   376  N  NE  . ARG A 1 49 ? 11.973  2.436   3.256   1.00 0.00 ? 49 ARG A NE  1  
ATOM   377  C  CZ  . ARG A 1 49 ? 12.694  1.338   2.977   1.00 0.00 ? 49 ARG A CZ  1  
ATOM   378  N  NH1 . ARG A 1 49 ? 13.328  1.223   1.807   1.00 0.00 ? 49 ARG A NH1 1  
ATOM   379  N  NH2 . ARG A 1 49 ? 12.815  0.337   3.843   1.00 0.00 ? 49 ARG A NH2 1  
ATOM   380  N  N   . CYS A 1 50 ? 6.588   2.902   3.180   1.00 0.00 ? 50 CYS A N   1  
ATOM   381  C  CA  . CYS A 1 50 ? 5.386   3.116   3.971   1.00 0.00 ? 50 CYS A CA  1  
ATOM   382  C  C   . CYS A 1 50 ? 5.788   3.137   5.448   1.00 0.00 ? 50 CYS A C   1  
ATOM   383  O  O   . CYS A 1 50 ? 6.385   2.187   5.951   1.00 0.00 ? 50 CYS A O   1  
ATOM   384  C  CB  . CYS A 1 50 ? 4.390   2.031   3.646   1.00 0.00 ? 50 CYS A CB  1  
ATOM   385  S  SG  . CYS A 1 50 ? 3.085   1.980   4.885   1.00 0.00 ? 50 CYS A SG  1  
ATOM   386  N  N   . THR A 1 51 ? 5.511   4.244   6.139   1.00 0.00 ? 51 THR A N   1  
ATOM   387  C  CA  . THR A 1 51 ? 5.937   4.501   7.507   1.00 0.00 ? 51 THR A CA  1  
ATOM   388  C  C   . THR A 1 51 ? 5.108   3.682   8.501   1.00 0.00 ? 51 THR A C   1  
ATOM   389  O  O   . THR A 1 51 ? 4.323   4.213   9.286   1.00 0.00 ? 51 THR A O   1  
ATOM   390  C  CB  . THR A 1 51 ? 5.908   6.011   7.808   1.00 0.00 ? 51 THR A CB  1  
ATOM   391  O  OG1 . THR A 1 51 ? 4.634   6.574   7.579   1.00 0.00 ? 51 THR A OG1 1  
ATOM   392  C  CG2 . THR A 1 51 ? 6.926   6.756   6.942   1.00 0.00 ? 51 THR A CG2 1  
ATOM   393  N  N   . HIS A 1 52 ? 5.296   2.366   8.482   1.00 0.00 ? 52 HIS A N   1  
ATOM   394  C  CA  . HIS A 1 52 ? 4.830   1.435   9.495   1.00 0.00 ? 52 HIS A CA  1  
ATOM   395  C  C   . HIS A 1 52 ? 5.889   0.337   9.558   1.00 0.00 ? 52 HIS A C   1  
ATOM   396  O  O   . HIS A 1 52 ? 6.287   -0.137  8.496   1.00 0.00 ? 52 HIS A O   1  
ATOM   397  C  CB  . HIS A 1 52 ? 3.468   0.853   9.088   1.00 0.00 ? 52 HIS A CB  1  
ATOM   398  C  CG  . HIS A 1 52 ? 2.285   1.535   9.725   1.00 0.00 ? 52 HIS A CG  1  
ATOM   399  N  ND1 . HIS A 1 52 ? 2.014   2.889   9.702   1.00 0.00 ? 52 HIS A ND1 1  
ATOM   400  C  CD2 . HIS A 1 52 ? 1.292   0.911   10.426  1.00 0.00 ? 52 HIS A CD2 1  
ATOM   401  C  CE1 . HIS A 1 52 ? 0.861   3.083   10.367  1.00 0.00 ? 52 HIS A CE1 1  
ATOM   402  N  NE2 . HIS A 1 52 ? 0.402   1.896   10.810  1.00 0.00 ? 52 HIS A NE2 1  
ATOM   403  N  N   . PRO A 1 53 ? 6.377   -0.061  10.744  1.00 0.00 ? 53 PRO A N   1  
ATOM   404  C  CA  . PRO A 1 53 ? 7.385   -1.106  10.848  1.00 0.00 ? 53 PRO A CA  1  
ATOM   405  C  C   . PRO A 1 53 ? 6.848   -2.396  10.232  1.00 0.00 ? 53 PRO A C   1  
ATOM   406  O  O   . PRO A 1 53 ? 7.527   -3.030  9.431   1.00 0.00 ? 53 PRO A O   1  
ATOM   407  C  CB  . PRO A 1 53 ? 7.699   -1.237  12.341  1.00 0.00 ? 53 PRO A CB  1  
ATOM   408  C  CG  . PRO A 1 53 ? 6.445   -0.698  13.033  1.00 0.00 ? 53 PRO A CG  1  
ATOM   409  C  CD  . PRO A 1 53 ? 5.931   0.365   12.060  1.00 0.00 ? 53 PRO A CD  1  
ATOM   410  N  N   . ASP A 1 54 ? 5.593   -2.727  10.539  1.00 0.00 ? 54 ASP A N   1  
ATOM   411  C  CA  . ASP A 1 54 ? 4.775   -3.776  9.940   1.00 0.00 ? 54 ASP A CA  1  
ATOM   412  C  C   . ASP A 1 54 ? 4.372   -3.426  8.502   1.00 0.00 ? 54 ASP A C   1  
ATOM   413  O  O   . ASP A 1 54 ? 3.197   -3.551  8.146   1.00 0.00 ? 54 ASP A O   1  
ATOM   414  C  CB  . ASP A 1 54 ? 3.517   -3.953  10.814  1.00 0.00 ? 54 ASP A CB  1  
ATOM   415  C  CG  . ASP A 1 54 ? 2.775   -2.629  11.032  1.00 0.00 ? 54 ASP A CG  1  
ATOM   416  O  OD1 . ASP A 1 54 ? 3.413   -1.657  11.499  1.00 0.00 ? 54 ASP A OD1 1  
ATOM   417  O  OD2 . ASP A 1 54 ? 1.570   -2.588  10.717  1.00 0.00 ? 54 ASP A OD2 1  
ATOM   418  N  N   . PHE A 1 55 ? 5.334   -2.980  7.690   1.00 0.00 ? 55 PHE A N   1  
ATOM   419  C  CA  . PHE A 1 55 ? 5.154   -2.642  6.288   1.00 0.00 ? 55 PHE A CA  1  
ATOM   420  C  C   . PHE A 1 55 ? 6.507   -2.340  5.631   1.00 0.00 ? 55 PHE A C   1  
ATOM   421  O  O   . PHE A 1 55 ? 6.856   -2.985  4.645   1.00 0.00 ? 55 PHE A O   1  
ATOM   422  C  CB  . PHE A 1 55 ? 4.128   -1.500  6.102   1.00 0.00 ? 55 PHE A CB  1  
ATOM   423  C  CG  . PHE A 1 55 ? 2.794   -1.967  5.543   1.00 0.00 ? 55 PHE A CG  1  
ATOM   424  C  CD1 . PHE A 1 55 ? 2.814   -2.713  4.348   1.00 0.00 ? 55 PHE A CD1 1  
ATOM   425  C  CD2 . PHE A 1 55 ? 1.568   -1.770  6.225   1.00 0.00 ? 55 PHE A CD2 1  
ATOM   426  C  CE1 . PHE A 1 55 ? 1.676   -3.422  3.938   1.00 0.00 ? 55 PHE A CE1 1  
ATOM   427  C  CE2 . PHE A 1 55 ? 0.416   -2.411  5.752   1.00 0.00 ? 55 PHE A CE2 1  
ATOM   428  C  CZ  . PHE A 1 55 ? 0.492   -3.310  4.678   1.00 0.00 ? 55 PHE A CZ  1  
ATOM   429  N  N   . ASP A 1 56 ? 7.276   -1.394  6.186   1.00 0.00 ? 56 ASP A N   1  
ATOM   430  C  CA  . ASP A 1 56 ? 8.519   -0.878  5.602   1.00 0.00 ? 56 ASP A CA  1  
ATOM   431  C  C   . ASP A 1 56 ? 9.552   -1.972  5.295   1.00 0.00 ? 56 ASP A C   1  
ATOM   432  O  O   . ASP A 1 56 ? 10.353  -1.819  4.373   1.00 0.00 ? 56 ASP A O   1  
ATOM   433  C  CB  . ASP A 1 56 ? 9.123   0.197   6.514   1.00 0.00 ? 56 ASP A CB  1  
ATOM   434  C  CG  . ASP A 1 56 ? 10.288  0.897   5.829   1.00 0.00 ? 56 ASP A CG  1  
ATOM   435  O  OD1 . ASP A 1 56 ? 10.042  1.783   4.983   1.00 0.00 ? 56 ASP A OD1 1  
ATOM   436  O  OD2 . ASP A 1 56 ? 11.445  0.526   6.118   1.00 0.00 ? 56 ASP A OD2 1  
ATOM   437  N  N   . GLU A 1 57 ? 9.513   -3.080  6.052   1.00 0.00 ? 57 GLU A N   1  
ATOM   438  C  CA  . GLU A 1 57 ? 10.214  -4.330  5.748   1.00 0.00 ? 57 GLU A CA  1  
ATOM   439  C  C   . GLU A 1 57 ? 10.253  -4.617  4.244   1.00 0.00 ? 57 GLU A C   1  
ATOM   440  O  O   . GLU A 1 57 ? 11.285  -5.033  3.719   1.00 0.00 ? 57 GLU A O   1  
ATOM   441  C  CB  . GLU A 1 57 ? 9.574   -5.543  6.464   1.00 0.00 ? 57 GLU A CB  1  
ATOM   442  C  CG  . GLU A 1 57 ? 8.226   -5.277  7.155   1.00 0.00 ? 57 GLU A CG  1  
ATOM   443  C  CD  . GLU A 1 57 ? 7.365   -6.517  7.324   1.00 0.00 ? 57 GLU A CD  1  
ATOM   444  O  OE1 . GLU A 1 57 ? 7.871   -7.639  7.118   1.00 0.00 ? 57 GLU A OE1 1  
ATOM   445  O  OE2 . GLU A 1 57 ? 6.143   -6.330  7.519   1.00 0.00 ? 57 GLU A OE2 1  
ATOM   446  N  N   . VAL A 1 58 ? 9.111   -4.448  3.573   1.00 0.00 ? 58 VAL A N   1  
ATOM   447  C  CA  . VAL A 1 58 ? 8.974   -4.663  2.146   1.00 0.00 ? 58 VAL A CA  1  
ATOM   448  C  C   . VAL A 1 58 ? 8.614   -3.338  1.476   1.00 0.00 ? 58 VAL A C   1  
ATOM   449  O  O   . VAL A 1 58 ? 7.999   -2.461  2.078   1.00 0.00 ? 58 VAL A O   1  
ATOM   450  C  CB  . VAL A 1 58 ? 7.944   -5.767  1.871   1.00 0.00 ? 58 VAL A CB  1  
ATOM   451  C  CG1 . VAL A 1 58 ? 8.469   -7.118  2.372   1.00 0.00 ? 58 VAL A CG1 1  
ATOM   452  C  CG2 . VAL A 1 58 ? 6.579   -5.488  2.513   1.00 0.00 ? 58 VAL A CG2 1  
ATOM   453  N  N   . LEU A 1 59 ? 9.019   -3.171  0.219   1.00 0.00 ? 59 LEU A N   1  
ATOM   454  C  CA  . LEU A 1 59 ? 8.784   -1.956  -0.521  1.00 0.00 ? 59 LEU A CA  1  
ATOM   455  C  C   . LEU A 1 59 ? 7.372   -2.018  -1.087  1.00 0.00 ? 59 LEU A C   1  
ATOM   456  O  O   . LEU A 1 59 ? 7.063   -2.956  -1.820  1.00 0.00 ? 59 LEU A O   1  
ATOM   457  C  CB  . LEU A 1 59 ? 9.840   -1.892  -1.623  1.00 0.00 ? 59 LEU A CB  1  
ATOM   458  C  CG  . LEU A 1 59 ? 10.052  -0.458  -2.085  1.00 0.00 ? 59 LEU A CG  1  
ATOM   459  C  CD1 . LEU A 1 59 ? 10.704  0.349   -0.957  1.00 0.00 ? 59 LEU A CD1 1  
ATOM   460  C  CD2 . LEU A 1 59 ? 10.985  -0.455  -3.292  1.00 0.00 ? 59 LEU A CD2 1  
ATOM   461  N  N   . VAL A 1 60 ? 6.504   -1.065  -0.757  1.00 0.00 ? 60 VAL A N   1  
ATOM   462  C  CA  . VAL A 1 60 ? 5.128   -1.118  -1.221  1.00 0.00 ? 60 VAL A CA  1  
ATOM   463  C  C   . VAL A 1 60 ? 5.030   -0.427  -2.576  1.00 0.00 ? 60 VAL A C   1  
ATOM   464  O  O   . VAL A 1 60 ? 5.746   0.537   -2.857  1.00 0.00 ? 60 VAL A O   1  
ATOM   465  C  CB  . VAL A 1 60 ? 4.160   -0.541  -0.180  1.00 0.00 ? 60 VAL A CB  1  
ATOM   466  C  CG1 . VAL A 1 60 ? 4.092   -1.459  1.047   1.00 0.00 ? 60 VAL A CG1 1  
ATOM   467  C  CG2 . VAL A 1 60 ? 4.525   0.880   0.249   1.00 0.00 ? 60 VAL A CG2 1  
ATOM   468  N  N   . LYS A 1 61 ? 4.178   -0.947  -3.453  1.00 0.00 ? 61 LYS A N   1  
ATOM   469  C  CA  . LYS A 1 61 ? 3.910   -0.319  -4.725  1.00 0.00 ? 61 LYS A CA  1  
ATOM   470  C  C   . LYS A 1 61 ? 3.192   0.994   -4.453  1.00 0.00 ? 61 LYS A C   1  
ATOM   471  O  O   . LYS A 1 61 ? 2.282   1.034   -3.634  1.00 0.00 ? 61 LYS A O   1  
ATOM   472  C  CB  . LYS A 1 61 ? 3.042   -1.259  -5.569  1.00 0.00 ? 61 LYS A CB  1  
ATOM   473  C  CG  . LYS A 1 61 ? 3.148   -0.868  -7.039  1.00 0.00 ? 61 LYS A CG  1  
ATOM   474  C  CD  . LYS A 1 61 ? 2.904   -2.029  -8.001  1.00 0.00 ? 61 LYS A CD  1  
ATOM   475  C  CE  . LYS A 1 61 ? 3.531   -1.692  -9.368  1.00 0.00 ? 61 LYS A CE  1  
ATOM   476  N  NZ  . LYS A 1 61 ? 3.217   -0.327  -9.854  1.00 0.00 ? 61 LYS A NZ  1  
ATOM   477  N  N   . ALA A 1 62 ? 3.578   2.053   -5.155  1.00 0.00 ? 62 ALA A N   1  
ATOM   478  C  CA  . ALA A 1 62 ? 2.893   3.334   -5.083  1.00 0.00 ? 62 ALA A CA  1  
ATOM   479  C  C   . ALA A 1 62 ? 1.396   3.185   -5.358  1.00 0.00 ? 62 ALA A C   1  
ATOM   480  O  O   . ALA A 1 62 ? 0.590   3.796   -4.655  1.00 0.00 ? 62 ALA A O   1  
ATOM   481  C  CB  . ALA A 1 62 ? 3.565   4.306   -6.041  1.00 0.00 ? 62 ALA A CB  1  
ATOM   482  N  N   . GLU A 1 63 ? 1.016   2.353   -6.339  1.00 0.00 ? 63 GLU A N   1  
ATOM   483  C  CA  . GLU A 1 63 ? -0.390  2.067   -6.589  1.00 0.00 ? 63 GLU A CA  1  
ATOM   484  C  C   . GLU A 1 63 ? -0.963  0.947   -5.721  1.00 0.00 ? 63 GLU A C   1  
ATOM   485  O  O   . GLU A 1 63 ? -2.086  0.509   -5.976  1.00 0.00 ? 63 GLU A O   1  
ATOM   486  C  CB  . GLU A 1 63 ? -0.660  1.742   -8.057  1.00 0.00 ? 63 GLU A CB  1  
ATOM   487  C  CG  . GLU A 1 63 ? 0.113   2.633   -9.028  1.00 0.00 ? 63 GLU A CG  1  
ATOM   488  C  CD  . GLU A 1 63 ? 1.357   1.889   -9.483  1.00 0.00 ? 63 GLU A CD  1  
ATOM   489  O  OE1 . GLU A 1 63 ? 2.334   1.830   -8.699  1.00 0.00 ? 63 GLU A OE1 1  
ATOM   490  O  OE2 . GLU A 1 63 ? 1.306   1.210   -10.532 1.00 0.00 ? 63 GLU A OE2 1  
ATOM   491  N  N   . GLY A 1 64 ? -0.218  0.453   -4.732  1.00 0.00 ? 64 GLY A N   1  
ATOM   492  C  CA  . GLY A 1 64 ? -0.734  -0.539  -3.812  1.00 0.00 ? 64 GLY A CA  1  
ATOM   493  C  C   . GLY A 1 64 ? -1.770  0.081   -2.882  1.00 0.00 ? 64 GLY A C   1  
ATOM   494  O  O   . GLY A 1 64 ? -2.111  1.258   -3.003  1.00 0.00 ? 64 GLY A O   1  
ATOM   495  N  N   . TRP A 1 65 ? -2.279  -0.719  -1.950  1.00 0.00 ? 65 TRP A N   1  
ATOM   496  C  CA  . TRP A 1 65 ? -3.154  -0.253  -0.888  1.00 0.00 ? 65 TRP A CA  1  
ATOM   497  C  C   . TRP A 1 65 ? -3.113  -1.299  0.216   1.00 0.00 ? 65 TRP A C   1  
ATOM   498  O  O   . TRP A 1 65 ? -2.836  -2.461  -0.083  1.00 0.00 ? 65 TRP A O   1  
ATOM   499  C  CB  . TRP A 1 65 ? -4.579  -0.098  -1.428  1.00 0.00 ? 65 TRP A CB  1  
ATOM   500  C  CG  . TRP A 1 65 ? -5.618  0.326   -0.440  1.00 0.00 ? 65 TRP A CG  1  
ATOM   501  C  CD1 . TRP A 1 65 ? -6.022  1.597   -0.226  1.00 0.00 ? 65 TRP A CD1 1  
ATOM   502  C  CD2 . TRP A 1 65 ? -6.420  -0.507  0.449   1.00 0.00 ? 65 TRP A CD2 1  
ATOM   503  N  NE1 . TRP A 1 65 ? -7.061  1.608   0.681   1.00 0.00 ? 65 TRP A NE1 1  
ATOM   504  C  CE2 . TRP A 1 65 ? -7.333  0.337   1.144   1.00 0.00 ? 65 TRP A CE2 1  
ATOM   505  C  CE3 . TRP A 1 65 ? -6.497  -1.894  0.713   1.00 0.00 ? 65 TRP A CE3 1  
ATOM   506  C  CZ2 . TRP A 1 65 ? -8.297  -0.173  2.020   1.00 0.00 ? 65 TRP A CZ2 1  
ATOM   507  C  CZ3 . TRP A 1 65 ? -7.420  -2.407  1.643   1.00 0.00 ? 65 TRP A CZ3 1  
ATOM   508  C  CH2 . TRP A 1 65 ? -8.320  -1.547  2.293   1.00 0.00 ? 65 TRP A CH2 1  
ATOM   509  N  N   . CYS A 1 66 ? -3.408  -0.903  1.459   1.00 0.00 ? 66 CYS A N   1  
ATOM   510  C  CA  . CYS A 1 66 ? -3.554  -1.806  2.589   1.00 0.00 ? 66 CYS A CA  1  
ATOM   511  C  C   . CYS A 1 66 ? -4.669  -1.332  3.521   1.00 0.00 ? 66 CYS A C   1  
ATOM   512  O  O   . CYS A 1 66 ? -5.140  -0.199  3.422   1.00 0.00 ? 66 CYS A O   1  
ATOM   513  C  CB  . CYS A 1 66 ? -2.251  -1.933  3.331   1.00 0.00 ? 66 CYS A CB  1  
ATOM   514  S  SG  . CYS A 1 66 ? -2.042  -0.571  4.498   1.00 0.00 ? 66 CYS A SG  1  
ATOM   515  N  N   . SER A 1 67 ? -5.095  -2.190  4.453   1.00 0.00 ? 67 SER A N   1  
ATOM   516  C  CA  . SER A 1 67 ? -6.162  -1.834  5.371   1.00 0.00 ? 67 SER A CA  1  
ATOM   517  C  C   . SER A 1 67 ? -5.723  -0.836  6.447   1.00 0.00 ? 67 SER A C   1  
ATOM   518  O  O   . SER A 1 67 ? -6.580  -0.124  6.971   1.00 0.00 ? 67 SER A O   1  
ATOM   519  C  CB  . SER A 1 67 ? -6.850  -3.085  5.914   1.00 0.00 ? 67 SER A CB  1  
ATOM   520  O  OG  . SER A 1 67 ? -5.967  -4.007  6.514   1.00 0.00 ? 67 SER A OG  1  
ATOM   521  N  N   . VAL A 1 68 ? -4.419  -0.721  6.748   1.00 0.00 ? 68 VAL A N   1  
ATOM   522  C  CA  . VAL A 1 68 ? -3.944  0.356   7.627   1.00 0.00 ? 68 VAL A CA  1  
ATOM   523  C  C   . VAL A 1 68 ? -4.008  1.734   6.953   1.00 0.00 ? 68 VAL A C   1  
ATOM   524  O  O   . VAL A 1 68 ? -3.739  2.731   7.620   1.00 0.00 ? 68 VAL A O   1  
ATOM   525  C  CB  . VAL A 1 68 ? -2.628  0.089   8.394   1.00 0.00 ? 68 VAL A CB  1  
ATOM   526  C  CG1 . VAL A 1 68 ? -2.531  -1.378  8.745   1.00 0.00 ? 68 VAL A CG1 1  
ATOM   527  C  CG2 . VAL A 1 68 ? -1.276  0.501   7.807   1.00 0.00 ? 68 VAL A CG2 1  
ATOM   528  N  N   . TYR A 1 69 ? -4.363  1.812   5.657   1.00 0.00 ? 69 TYR A N   1  
ATOM   529  C  CA  . TYR A 1 69 ? -4.537  3.076   4.949   1.00 0.00 ? 69 TYR A CA  1  
ATOM   530  C  C   . TYR A 1 69 ? -5.352  4.079   5.774   1.00 0.00 ? 69 TYR A C   1  
ATOM   531  O  O   . TYR A 1 69 ? -6.445  3.762   6.255   1.00 0.00 ? 69 TYR A O   1  
ATOM   532  C  CB  . TYR A 1 69 ? -5.200  2.848   3.577   1.00 0.00 ? 69 TYR A CB  1  
ATOM   533  C  CG  . TYR A 1 69 ? -5.403  4.106   2.744   1.00 0.00 ? 69 TYR A CG  1  
ATOM   534  C  CD1 . TYR A 1 69 ? -6.471  4.975   3.027   1.00 0.00 ? 69 TYR A CD1 1  
ATOM   535  C  CD2 . TYR A 1 69 ? -4.512  4.435   1.705   1.00 0.00 ? 69 TYR A CD2 1  
ATOM   536  C  CE1 . TYR A 1 69 ? -6.550  6.226   2.397   1.00 0.00 ? 69 TYR A CE1 1  
ATOM   537  C  CE2 . TYR A 1 69 ? -4.628  5.664   1.034   1.00 0.00 ? 69 TYR A CE2 1  
ATOM   538  C  CZ  . TYR A 1 69 ? -5.615  6.583   1.414   1.00 0.00 ? 69 TYR A CZ  1  
ATOM   539  O  OH  . TYR A 1 69 ? -5.731  7.790   0.795   1.00 0.00 ? 69 TYR A OH  1  
ATOM   540  N  N   . ALA A 1 70 ? -4.849  5.312   5.864   1.00 0.00 ? 70 ALA A N   1  
ATOM   541  C  CA  . ALA A 1 70 ? -5.575  6.478   6.341   1.00 0.00 ? 70 ALA A CA  1  
ATOM   542  C  C   . ALA A 1 70 ? -5.355  7.570   5.293   1.00 0.00 ? 70 ALA A C   1  
ATOM   543  O  O   . ALA A 1 70 ? -4.249  7.651   4.761   1.00 0.00 ? 70 ALA A O   1  
ATOM   544  C  CB  . ALA A 1 70 ? -5.032  6.901   7.708   1.00 0.00 ? 70 ALA A CB  1  
ATOM   545  N  N   . PRO A 1 71 ? -6.374  8.368   4.944   1.00 0.00 ? 71 PRO A N   1  
ATOM   546  C  CA  . PRO A 1 71 ? -6.238  9.388   3.921   1.00 0.00 ? 71 PRO A CA  1  
ATOM   547  C  C   . PRO A 1 71 ? -5.395  10.547  4.428   1.00 0.00 ? 71 PRO A C   1  
ATOM   548  O  O   . PRO A 1 71 ? -5.367  10.835  5.623   1.00 0.00 ? 71 PRO A O   1  
ATOM   549  C  CB  . PRO A 1 71 ? -7.664  9.825   3.581   1.00 0.00 ? 71 PRO A CB  1  
ATOM   550  C  CG  . PRO A 1 71 ? -8.407  9.595   4.898   1.00 0.00 ? 71 PRO A CG  1  
ATOM   551  C  CD  . PRO A 1 71 ? -7.726  8.352   5.477   1.00 0.00 ? 71 PRO A CD  1  
ATOM   552  N  N   . ALA A 1 72 ? -4.712  11.212  3.496   1.00 0.00 ? 72 ALA A N   1  
ATOM   553  C  CA  . ALA A 1 72 ? -3.881  12.370  3.773   1.00 0.00 ? 72 ALA A CA  1  
ATOM   554  C  C   . ALA A 1 72 ? -4.653  13.658  3.484   1.00 0.00 ? 72 ALA A C   1  
ATOM   555  O  O   . ALA A 1 72 ? -4.100  14.642  2.995   1.00 0.00 ? 72 ALA A O   1  
ATOM   556  C  CB  . ALA A 1 72 ? -2.624  12.274  2.918   1.00 0.00 ? 72 ALA A CB  1  
ATOM   557  N  N   . SER A 1 73 ? -5.953  13.624  3.751   1.00 0.00 ? 73 SER A N   1  
ATOM   558  C  CA  . SER A 1 73 ? -6.935  14.680  3.607   1.00 0.00 ? 73 SER A CA  1  
ATOM   559  C  C   . SER A 1 73 ? -8.175  14.184  4.350   1.00 0.00 ? 73 SER A C   1  
ATOM   560  O  O   . SER A 1 73 ? -8.156  12.986  4.722   1.00 0.00 ? 73 SER A O   1  
ATOM   561  C  CB  . SER A 1 73 ? -7.279  14.918  2.133   1.00 0.00 ? 73 SER A CB  1  
ATOM   562  O  OG  . SER A 1 73 ? -6.204  15.514  1.431   1.00 0.00 ? 73 SER A OG  1  
ATOM   563  O  OXT . SER A 1 73 ? -9.114  14.990  4.504   1.00 0.00 ? 73 SER A OXT 1  
HETATM 564  FE FE1 . SF4 B 2 .  ? 0.223   1.731   1.594   1.00 0.00 ? 74 SF4 A FE1 1  
HETATM 565  FE FE2 . SF4 B 2 .  ? -0.634  3.293   3.353   1.00 0.00 ? 74 SF4 A FE2 1  
HETATM 566  FE FE3 . SF4 B 2 .  ? 1.364   1.932   3.822   1.00 0.00 ? 74 SF4 A FE3 1  
HETATM 567  FE FE4 . SF4 B 2 .  ? -0.858  0.844   3.658   1.00 0.00 ? 74 SF4 A FE4 1  
HETATM 568  S  S1  . SF4 B 2 .  ? -0.267  2.265   5.169   1.00 0.00 ? 74 SF4 A S1  1  
HETATM 569  S  S2  . SF4 B 2 .  ? 0.954   0.081   2.790   1.00 0.00 ? 74 SF4 A S2  1  
HETATM 570  S  S3  . SF4 B 2 .  ? -1.857  1.982   2.146   1.00 0.00 ? 74 SF4 A S3  1  
HETATM 571  S  S4  . SF4 B 2 .  ? 1.262   3.485   2.328   1.00 0.00 ? 74 SF4 A S4  1  
ATOM   572  N  N   . ALA A 1 1  ? 17.207  1.785   -5.357  1.00 0.00 ? 1  ALA A N   2  
ATOM   573  C  CA  . ALA A 1 1  ? 17.386  1.076   -4.098  1.00 0.00 ? 1  ALA A CA  2  
ATOM   574  C  C   . ALA A 1 1  ? 17.117  -0.377  -4.425  1.00 0.00 ? 1  ALA A C   2  
ATOM   575  O  O   . ALA A 1 1  ? 16.722  -0.644  -5.556  1.00 0.00 ? 1  ALA A O   2  
ATOM   576  C  CB  . ALA A 1 1  ? 16.357  1.546   -3.064  1.00 0.00 ? 1  ALA A CB  2  
ATOM   577  N  N   . SER A 1 2  ? 17.209  -1.275  -3.445  1.00 0.00 ? 2  SER A N   2  
ATOM   578  C  CA  . SER A 1 2  ? 16.905  -2.688  -3.644  1.00 0.00 ? 2  SER A CA  2  
ATOM   579  C  C   . SER A 1 2  ? 16.031  -3.221  -2.510  1.00 0.00 ? 2  SER A C   2  
ATOM   580  O  O   . SER A 1 2  ? 16.114  -4.393  -2.151  1.00 0.00 ? 2  SER A O   2  
ATOM   581  C  CB  . SER A 1 2  ? 18.203  -3.478  -3.819  1.00 0.00 ? 2  SER A CB  2  
ATOM   582  O  OG  . SER A 1 2  ? 19.010  -2.838  -4.791  1.00 0.00 ? 2  SER A OG  2  
ATOM   583  N  N   . GLU A 1 3  ? 15.180  -2.357  -1.958  1.00 0.00 ? 3  GLU A N   2  
ATOM   584  C  CA  . GLU A 1 3  ? 14.203  -2.737  -0.960  1.00 0.00 ? 3  GLU A CA  2  
ATOM   585  C  C   . GLU A 1 3  ? 13.195  -3.710  -1.604  1.00 0.00 ? 3  GLU A C   2  
ATOM   586  O  O   . GLU A 1 3  ? 12.734  -3.448  -2.718  1.00 0.00 ? 3  GLU A O   2  
ATOM   587  C  CB  . GLU A 1 3  ? 13.519  -1.467  -0.445  1.00 0.00 ? 3  GLU A CB  2  
ATOM   588  C  CG  . GLU A 1 3  ? 14.494  -0.344  -0.051  1.00 0.00 ? 3  GLU A CG  2  
ATOM   589  C  CD  . GLU A 1 3  ? 14.634  0.712   -1.139  1.00 0.00 ? 3  GLU A CD  2  
ATOM   590  O  OE1 . GLU A 1 3  ? 15.018  0.336   -2.272  1.00 0.00 ? 3  GLU A OE1 2  
ATOM   591  O  OE2 . GLU A 1 3  ? 14.366  1.897   -0.835  1.00 0.00 ? 3  GLU A OE2 2  
ATOM   592  N  N   . PRO A 1 4  ? 12.871  -4.844  -0.966  1.00 0.00 ? 4  PRO A N   2  
ATOM   593  C  CA  . PRO A 1 4  ? 12.067  -5.885  -1.587  1.00 0.00 ? 4  PRO A CA  2  
ATOM   594  C  C   . PRO A 1 4  ? 10.622  -5.422  -1.781  1.00 0.00 ? 4  PRO A C   2  
ATOM   595  O  O   . PRO A 1 4  ? 9.995   -4.923  -0.850  1.00 0.00 ? 4  PRO A O   2  
ATOM   596  C  CB  . PRO A 1 4  ? 12.163  -7.095  -0.657  1.00 0.00 ? 4  PRO A CB  2  
ATOM   597  C  CG  . PRO A 1 4  ? 12.480  -6.479  0.707   1.00 0.00 ? 4  PRO A CG  2  
ATOM   598  C  CD  . PRO A 1 4  ? 13.307  -5.243  0.360   1.00 0.00 ? 4  PRO A CD  2  
ATOM   599  N  N   . ARG A 1 5  ? 10.097  -5.593  -2.996  1.00 0.00 ? 5  ARG A N   2  
ATOM   600  C  CA  . ARG A 1 5  ? 8.735   -5.255  -3.358  1.00 0.00 ? 5  ARG A CA  2  
ATOM   601  C  C   . ARG A 1 5  ? 7.747   -6.120  -2.568  1.00 0.00 ? 5  ARG A C   2  
ATOM   602  O  O   . ARG A 1 5  ? 7.854   -7.344  -2.581  1.00 0.00 ? 5  ARG A O   2  
ATOM   603  C  CB  . ARG A 1 5  ? 8.629   -5.481  -4.868  1.00 0.00 ? 5  ARG A CB  2  
ATOM   604  C  CG  . ARG A 1 5  ? 9.479   -4.472  -5.605  1.00 0.00 ? 5  ARG A CG  2  
ATOM   605  C  CD  . ARG A 1 5  ? 9.675   -5.035  -7.007  1.00 0.00 ? 5  ARG A CD  2  
ATOM   606  N  NE  . ARG A 1 5  ? 10.805  -4.335  -7.568  1.00 0.00 ? 5  ARG A NE  2  
ATOM   607  C  CZ  . ARG A 1 5  ? 10.743  -3.450  -8.574  1.00 0.00 ? 5  ARG A CZ  2  
ATOM   608  N  NH1 . ARG A 1 5  ? 9.829   -3.608  -9.534  1.00 0.00 ? 5  ARG A NH1 2  
ATOM   609  N  NH2 . ARG A 1 5  ? 11.569  -2.407  -8.607  1.00 0.00 ? 5  ARG A NH2 2  
ATOM   610  N  N   . ALA A 1 6  ? 6.812   -5.475  -1.867  1.00 0.00 ? 6  ALA A N   2  
ATOM   611  C  CA  . ALA A 1 6  ? 5.880   -6.107  -0.952  1.00 0.00 ? 6  ALA A CA  2  
ATOM   612  C  C   . ALA A 1 6  ? 4.998   -7.140  -1.650  1.00 0.00 ? 6  ALA A C   2  
ATOM   613  O  O   . ALA A 1 6  ? 4.563   -6.951  -2.788  1.00 0.00 ? 6  ALA A O   2  
ATOM   614  C  CB  . ALA A 1 6  ? 5.017   -5.034  -0.284  1.00 0.00 ? 6  ALA A CB  2  
ATOM   615  N  N   . GLU A 1 7  ? 4.719   -8.230  -0.942  1.00 0.00 ? 7  GLU A N   2  
ATOM   616  C  CA  . GLU A 1 7  ? 3.926   -9.337  -1.423  1.00 0.00 ? 7  GLU A CA  2  
ATOM   617  C  C   . GLU A 1 7  ? 2.462   -8.936  -1.396  1.00 0.00 ? 7  GLU A C   2  
ATOM   618  O  O   . GLU A 1 7  ? 2.023   -8.267  -0.462  1.00 0.00 ? 7  GLU A O   2  
ATOM   619  C  CB  . GLU A 1 7  ? 4.112   -10.565 -0.531  1.00 0.00 ? 7  GLU A CB  2  
ATOM   620  C  CG  . GLU A 1 7  ? 5.564   -10.764 -0.087  1.00 0.00 ? 7  GLU A CG  2  
ATOM   621  C  CD  . GLU A 1 7  ? 5.822   -10.134 1.280   1.00 0.00 ? 7  GLU A CD  2  
ATOM   622  O  OE1 . GLU A 1 7  ? 5.963   -8.892  1.332   1.00 0.00 ? 7  GLU A OE1 2  
ATOM   623  O  OE2 . GLU A 1 7  ? 5.789   -10.851 2.297   1.00 0.00 ? 7  GLU A OE2 2  
ATOM   624  N  N   . ASP A 1 8  ? 1.687   -9.423  -2.358  1.00 0.00 ? 8  ASP A N   2  
ATOM   625  C  CA  . ASP A 1 8  ? 0.247   -9.388  -2.252  1.00 0.00 ? 8  ASP A CA  2  
ATOM   626  C  C   . ASP A 1 8  ? -0.121  -10.237 -1.038  1.00 0.00 ? 8  ASP A C   2  
ATOM   627  O  O   . ASP A 1 8  ? 0.280   -11.395 -0.938  1.00 0.00 ? 8  ASP A O   2  
ATOM   628  C  CB  . ASP A 1 8  ? -0.355  -9.909  -3.556  1.00 0.00 ? 8  ASP A CB  2  
ATOM   629  C  CG  . ASP A 1 8  ? -0.219  -8.862  -4.646  1.00 0.00 ? 8  ASP A CG  2  
ATOM   630  O  OD1 . ASP A 1 8  ? -1.083  -7.960  -4.692  1.00 0.00 ? 8  ASP A OD1 2  
ATOM   631  O  OD2 . ASP A 1 8  ? 0.805   -8.913  -5.361  1.00 0.00 ? 8  ASP A OD2 2  
ATOM   632  N  N   . GLY A 1 9  ? -0.799  -9.626  -0.067  1.00 0.00 ? 9  GLY A N   2  
ATOM   633  C  CA  . GLY A 1 9  ? -1.087  -10.241 1.213   1.00 0.00 ? 9  GLY A CA  2  
ATOM   634  C  C   . GLY A 1 9  ? 0.114   -10.265 2.161   1.00 0.00 ? 9  GLY A C   2  
ATOM   635  O  O   . GLY A 1 9  ? 0.089   -11.042 3.112   1.00 0.00 ? 9  GLY A O   2  
ATOM   636  N  N   . HIS A 1 10 ? 1.132   -9.404  1.964   1.00 0.00 ? 10 HIS A N   2  
ATOM   637  C  CA  . HIS A 1 10 ? 2.210   -9.187  2.931   1.00 0.00 ? 10 HIS A CA  2  
ATOM   638  C  C   . HIS A 1 10 ? 1.676   -9.143  4.364   1.00 0.00 ? 10 HIS A C   2  
ATOM   639  O  O   . HIS A 1 10 ? 2.115   -9.886  5.237   1.00 0.00 ? 10 HIS A O   2  
ATOM   640  C  CB  . HIS A 1 10 ? 2.909   -7.854  2.617   1.00 0.00 ? 10 HIS A CB  2  
ATOM   641  C  CG  . HIS A 1 10 ? 3.970   -7.488  3.624   1.00 0.00 ? 10 HIS A CG  2  
ATOM   642  N  ND1 . HIS A 1 10 ? 5.244   -8.023  3.677   1.00 0.00 ? 10 HIS A ND1 2  
ATOM   643  C  CD2 . HIS A 1 10 ? 3.831   -6.614  4.667   1.00 0.00 ? 10 HIS A CD2 2  
ATOM   644  C  CE1 . HIS A 1 10 ? 5.867   -7.485  4.740   1.00 0.00 ? 10 HIS A CE1 2  
ATOM   645  N  NE2 . HIS A 1 10 ? 5.028   -6.627  5.351   1.00 0.00 ? 10 HIS A NE2 2  
ATOM   646  N  N   . ALA A 1 11 ? 0.736   -8.227  4.589   1.00 0.00 ? 11 ALA A N   2  
ATOM   647  C  CA  . ALA A 1 11 ? -0.010  -8.065  5.825   1.00 0.00 ? 11 ALA A CA  2  
ATOM   648  C  C   . ALA A 1 11 ? -1.189  -7.150  5.516   1.00 0.00 ? 11 ALA A C   2  
ATOM   649  O  O   . ALA A 1 11 ? -1.258  -6.601  4.416   1.00 0.00 ? 11 ALA A O   2  
ATOM   650  C  CB  . ALA A 1 11 ? 0.882   -7.460  6.917   1.00 0.00 ? 11 ALA A CB  2  
ATOM   651  N  N   . HIS A 1 12 ? -2.102  -6.981  6.481   1.00 0.00 ? 12 HIS A N   2  
ATOM   652  C  CA  . HIS A 1 12 ? -3.193  -6.010  6.425   1.00 0.00 ? 12 HIS A CA  2  
ATOM   653  C  C   . HIS A 1 12 ? -3.893  -5.985  5.067   1.00 0.00 ? 12 HIS A C   2  
ATOM   654  O  O   . HIS A 1 12 ? -4.115  -4.918  4.498   1.00 0.00 ? 12 HIS A O   2  
ATOM   655  C  CB  . HIS A 1 12 ? -2.653  -4.623  6.769   1.00 0.00 ? 12 HIS A CB  2  
ATOM   656  C  CG  . HIS A 1 12 ? -2.220  -4.484  8.198   1.00 0.00 ? 12 HIS A CG  2  
ATOM   657  N  ND1 . HIS A 1 12 ? -3.052  -4.134  9.244   1.00 0.00 ? 12 HIS A ND1 2  
ATOM   658  C  CD2 . HIS A 1 12 ? -0.930  -4.490  8.651   1.00 0.00 ? 12 HIS A CD2 2  
ATOM   659  C  CE1 . HIS A 1 12 ? -2.275  -3.921  10.322  1.00 0.00 ? 12 HIS A CE1 2  
ATOM   660  N  NE2 . HIS A 1 12 ? -0.991  -4.144  9.986   1.00 0.00 ? 12 HIS A NE2 2  
ATOM   661  N  N   . ASP A 1 13 ? -4.232  -7.166  4.550   1.00 0.00 ? 13 ASP A N   2  
ATOM   662  C  CA  . ASP A 1 13 ? -5.034  -7.297  3.344   1.00 0.00 ? 13 ASP A CA  2  
ATOM   663  C  C   . ASP A 1 13 ? -4.380  -6.578  2.151   1.00 0.00 ? 13 ASP A C   2  
ATOM   664  O  O   . ASP A 1 13 ? -5.082  -6.214  1.208   1.00 0.00 ? 13 ASP A O   2  
ATOM   665  C  CB  . ASP A 1 13 ? -6.490  -6.822  3.557   1.00 0.00 ? 13 ASP A CB  2  
ATOM   666  C  CG  . ASP A 1 13 ? -7.087  -6.971  4.956   1.00 0.00 ? 13 ASP A CG  2  
ATOM   667  O  OD1 . ASP A 1 13 ? -6.543  -6.389  5.920   1.00 0.00 ? 13 ASP A OD1 2  
ATOM   668  O  OD2 . ASP A 1 13 ? -8.200  -7.534  5.017   1.00 0.00 ? 13 ASP A OD2 2  
ATOM   669  N  N   . TYR A 1 14 ? -3.062  -6.329  2.197   1.00 0.00 ? 14 TYR A N   2  
ATOM   670  C  CA  . TYR A 1 14 ? -2.409  -5.510  1.190   1.00 0.00 ? 14 TYR A CA  2  
ATOM   671  C  C   . TYR A 1 14 ? -2.516  -6.142  -0.189  1.00 0.00 ? 14 TYR A C   2  
ATOM   672  O  O   . TYR A 1 14 ? -2.359  -7.353  -0.331  1.00 0.00 ? 14 TYR A O   2  
ATOM   673  C  CB  . TYR A 1 14 ? -0.953  -5.208  1.570   1.00 0.00 ? 14 TYR A CB  2  
ATOM   674  C  CG  . TYR A 1 14 ? -0.090  -4.622  0.459   1.00 0.00 ? 14 TYR A CG  2  
ATOM   675  C  CD1 . TYR A 1 14 ? 0.550   -5.482  -0.448  1.00 0.00 ? 14 TYR A CD1 2  
ATOM   676  C  CD2 . TYR A 1 14 ? 0.085   -3.231  0.326   1.00 0.00 ? 14 TYR A CD2 2  
ATOM   677  C  CE1 . TYR A 1 14 ? 1.408   -4.969  -1.434  1.00 0.00 ? 14 TYR A CE1 2  
ATOM   678  C  CE2 . TYR A 1 14 ? 0.915   -2.715  -0.682  1.00 0.00 ? 14 TYR A CE2 2  
ATOM   679  C  CZ  . TYR A 1 14 ? 1.602   -3.582  -1.541  1.00 0.00 ? 14 TYR A CZ  2  
ATOM   680  O  OH  . TYR A 1 14 ? 2.495   -3.075  -2.436  1.00 0.00 ? 14 TYR A OH  2  
ATOM   681  N  N   . VAL A 1 15 ? -2.735  -5.303  -1.199  1.00 0.00 ? 15 VAL A N   2  
ATOM   682  C  CA  . VAL A 1 15 ? -2.732  -5.692  -2.599  1.00 0.00 ? 15 VAL A CA  2  
ATOM   683  C  C   . VAL A 1 15 ? -1.766  -4.764  -3.324  1.00 0.00 ? 15 VAL A C   2  
ATOM   684  O  O   . VAL A 1 15 ? -1.667  -3.584  -2.977  1.00 0.00 ? 15 VAL A O   2  
ATOM   685  C  CB  . VAL A 1 15 ? -4.159  -5.616  -3.176  1.00 0.00 ? 15 VAL A CB  2  
ATOM   686  C  CG1 . VAL A 1 15 ? -5.029  -6.713  -2.547  1.00 0.00 ? 15 VAL A CG1 2  
ATOM   687  C  CG2 . VAL A 1 15 ? -4.805  -4.247  -2.916  1.00 0.00 ? 15 VAL A CG2 2  
ATOM   688  N  N   . ASN A 1 16 ? -1.038  -5.294  -4.311  1.00 0.00 ? 16 ASN A N   2  
ATOM   689  C  CA  . ASN A 1 16 ? -0.130  -4.536  -5.137  1.00 0.00 ? 16 ASN A CA  2  
ATOM   690  C  C   . ASN A 1 16 ? -0.877  -3.615  -6.098  1.00 0.00 ? 16 ASN A C   2  
ATOM   691  O  O   . ASN A 1 16 ? -0.332  -2.586  -6.494  1.00 0.00 ? 16 ASN A O   2  
ATOM   692  C  CB  . ASN A 1 16 ? 0.883   -5.432  -5.858  1.00 0.00 ? 16 ASN A CB  2  
ATOM   693  C  CG  . ASN A 1 16 ? 2.104   -5.650  -4.978  1.00 0.00 ? 16 ASN A CG  2  
ATOM   694  O  OD1 . ASN A 1 16 ? 2.752   -4.694  -4.567  1.00 0.00 ? 16 ASN A OD1 2  
ATOM   695  N  ND2 . ASN A 1 16 ? 2.430   -6.885  -4.656  1.00 0.00 ? 16 ASN A ND2 2  
ATOM   696  N  N   . GLU A 1 17 ? -2.110  -3.978  -6.467  1.00 0.00 ? 17 GLU A N   2  
ATOM   697  C  CA  . GLU A 1 17 ? -3.031  -3.128  -7.185  1.00 0.00 ? 17 GLU A CA  2  
ATOM   698  C  C   . GLU A 1 17 ? -4.177  -2.799  -6.242  1.00 0.00 ? 17 GLU A C   2  
ATOM   699  O  O   . GLU A 1 17 ? -4.978  -3.669  -5.918  1.00 0.00 ? 17 GLU A O   2  
ATOM   700  C  CB  . GLU A 1 17 ? -3.552  -3.868  -8.415  1.00 0.00 ? 17 GLU A CB  2  
ATOM   701  C  CG  . GLU A 1 17 ? -4.285  -2.902  -9.339  1.00 0.00 ? 17 GLU A CG  2  
ATOM   702  C  CD  . GLU A 1 17 ? -4.666  -3.563  -10.655 1.00 0.00 ? 17 GLU A CD  2  
ATOM   703  O  OE1 . GLU A 1 17 ? -3.733  -3.809  -11.450 1.00 0.00 ? 17 GLU A OE1 2  
ATOM   704  O  OE2 . GLU A 1 17 ? -5.877  -3.806  -10.844 1.00 0.00 ? 17 GLU A OE2 2  
ATOM   705  N  N   . ALA A 1 18 ? -4.265  -1.539  -5.829  1.00 0.00 ? 18 ALA A N   2  
ATOM   706  C  CA  . ALA A 1 18 ? -5.330  -1.010  -4.990  1.00 0.00 ? 18 ALA A CA  2  
ATOM   707  C  C   . ALA A 1 18 ? -6.699  -1.487  -5.478  1.00 0.00 ? 18 ALA A C   2  
ATOM   708  O  O   . ALA A 1 18 ? -7.535  -1.915  -4.686  1.00 0.00 ? 18 ALA A O   2  
ATOM   709  C  CB  . ALA A 1 18 ? -5.248  0.519   -4.993  1.00 0.00 ? 18 ALA A CB  2  
ATOM   710  N  N   . ALA A 1 19 ? -6.908  -1.436  -6.796  1.00 0.00 ? 19 ALA A N   2  
ATOM   711  C  CA  . ALA A 1 19 ? -8.146  -1.867  -7.422  1.00 0.00 ? 19 ALA A CA  2  
ATOM   712  C  C   . ALA A 1 19 ? -8.526  -3.302  -7.049  1.00 0.00 ? 19 ALA A C   2  
ATOM   713  O  O   . ALA A 1 19 ? -9.719  -3.563  -6.885  1.00 0.00 ? 19 ALA A O   2  
ATOM   714  C  CB  . ALA A 1 19 ? -8.062  -1.712  -8.937  1.00 0.00 ? 19 ALA A CB  2  
ATOM   715  N  N   . ASP A 1 20 ? -7.555  -4.217  -6.882  1.00 0.00 ? 20 ASP A N   2  
ATOM   716  C  CA  . ASP A 1 20 ? -7.866  -5.565  -6.400  1.00 0.00 ? 20 ASP A CA  2  
ATOM   717  C  C   . ASP A 1 20 ? -8.770  -5.507  -5.165  1.00 0.00 ? 20 ASP A C   2  
ATOM   718  O  O   . ASP A 1 20 ? -9.783  -6.200  -5.058  1.00 0.00 ? 20 ASP A O   2  
ATOM   719  C  CB  . ASP A 1 20 ? -6.595  -6.336  -6.047  1.00 0.00 ? 20 ASP A CB  2  
ATOM   720  C  CG  . ASP A 1 20 ? -6.920  -7.804  -5.812  1.00 0.00 ? 20 ASP A CG  2  
ATOM   721  O  OD1 . ASP A 1 20 ? -6.902  -8.557  -6.811  1.00 0.00 ? 20 ASP A OD1 2  
ATOM   722  O  OD2 . ASP A 1 20 ? -7.203  -8.146  -4.645  1.00 0.00 ? 20 ASP A OD2 2  
ATOM   723  N  N   . ALA A 1 21 ? -8.432  -4.594  -4.251  1.00 0.00 ? 21 ALA A N   2  
ATOM   724  C  CA  . ALA A 1 21 ? -9.116  -4.469  -2.977  1.00 0.00 ? 21 ALA A CA  2  
ATOM   725  C  C   . ALA A 1 21 ? -10.476 -3.782  -3.109  1.00 0.00 ? 21 ALA A C   2  
ATOM   726  O  O   . ALA A 1 21 ? -11.132 -3.590  -2.092  1.00 0.00 ? 21 ALA A O   2  
ATOM   727  C  CB  . ALA A 1 21 ? -8.221  -3.775  -1.945  1.00 0.00 ? 21 ALA A CB  2  
ATOM   728  N  N   . SER A 1 22 ? -10.967 -3.484  -4.319  1.00 0.00 ? 22 SER A N   2  
ATOM   729  C  CA  . SER A 1 22 ? -12.335 -3.002  -4.514  1.00 0.00 ? 22 SER A CA  2  
ATOM   730  C  C   . SER A 1 22 ? -13.377 -3.948  -3.913  1.00 0.00 ? 22 SER A C   2  
ATOM   731  O  O   . SER A 1 22 ? -14.432 -3.545  -3.430  1.00 0.00 ? 22 SER A O   2  
ATOM   732  C  CB  . SER A 1 22 ? -12.574 -2.683  -5.995  1.00 0.00 ? 22 SER A CB  2  
ATOM   733  O  OG  . SER A 1 22 ? -13.825 -2.056  -6.193  1.00 0.00 ? 22 SER A OG  2  
ATOM   734  N  N   . GLY A 1 23 ? -13.017 -5.223  -3.868  1.00 0.00 ? 23 GLY A N   2  
ATOM   735  C  CA  . GLY A 1 23 ? -13.793 -6.277  -3.232  1.00 0.00 ? 23 GLY A CA  2  
ATOM   736  C  C   . GLY A 1 23 ? -13.916 -6.122  -1.708  1.00 0.00 ? 23 GLY A C   2  
ATOM   737  O  O   . GLY A 1 23 ? -14.720 -6.819  -1.094  1.00 0.00 ? 23 GLY A O   2  
ATOM   738  N  N   . HIS A 1 24 ? -13.106 -5.261  -1.080  1.00 0.00 ? 24 HIS A N   2  
ATOM   739  C  CA  . HIS A 1 24 ? -12.964 -5.120  0.359   1.00 0.00 ? 24 HIS A CA  2  
ATOM   740  C  C   . HIS A 1 24 ? -13.771 -3.926  0.890   1.00 0.00 ? 24 HIS A C   2  
ATOM   741  O  O   . HIS A 1 24 ? -13.308 -2.796  0.758   1.00 0.00 ? 24 HIS A O   2  
ATOM   742  C  CB  . HIS A 1 24 ? -11.469 -4.886  0.645   1.00 0.00 ? 24 HIS A CB  2  
ATOM   743  C  CG  . HIS A 1 24 ? -11.037 -5.200  2.053   1.00 0.00 ? 24 HIS A CG  2  
ATOM   744  N  ND1 . HIS A 1 24 ? -11.658 -4.782  3.215   1.00 0.00 ? 24 HIS A ND1 2  
ATOM   745  C  CD2 . HIS A 1 24 ? -9.914  -5.895  2.401   1.00 0.00 ? 24 HIS A CD2 2  
ATOM   746  C  CE1 . HIS A 1 24 ? -10.921 -5.207  4.253   1.00 0.00 ? 24 HIS A CE1 2  
ATOM   747  N  NE2 . HIS A 1 24 ? -9.887  -5.925  3.781   1.00 0.00 ? 24 HIS A NE2 2  
ATOM   748  N  N   . PRO A 1 25 ? -14.888 -4.114  1.612   1.00 0.00 ? 25 PRO A N   2  
ATOM   749  C  CA  . PRO A 1 25 ? -15.443 -3.047  2.438   1.00 0.00 ? 25 PRO A CA  2  
ATOM   750  C  C   . PRO A 1 25 ? -14.342 -2.551  3.387   1.00 0.00 ? 25 PRO A C   2  
ATOM   751  O  O   . PRO A 1 25 ? -13.814 -3.371  4.134   1.00 0.00 ? 25 PRO A O   2  
ATOM   752  C  CB  . PRO A 1 25 ? -16.615 -3.678  3.204   1.00 0.00 ? 25 PRO A CB  2  
ATOM   753  C  CG  . PRO A 1 25 ? -16.963 -4.925  2.388   1.00 0.00 ? 25 PRO A CG  2  
ATOM   754  C  CD  . PRO A 1 25 ? -15.613 -5.354  1.818   1.00 0.00 ? 25 PRO A CD  2  
ATOM   755  N  N   . ARG A 1 26 ? -13.938 -1.276  3.280   1.00 0.00 ? 26 ARG A N   2  
ATOM   756  C  CA  . ARG A 1 26 ? -12.776 -0.614  3.904   1.00 0.00 ? 26 ARG A CA  2  
ATOM   757  C  C   . ARG A 1 26 ? -11.963 0.074   2.808   1.00 0.00 ? 26 ARG A C   2  
ATOM   758  O  O   . ARG A 1 26 ? -11.469 1.187   3.000   1.00 0.00 ? 26 ARG A O   2  
ATOM   759  C  CB  . ARG A 1 26 ? -11.870 -1.567  4.706   1.00 0.00 ? 26 ARG A CB  2  
ATOM   760  C  CG  . ARG A 1 26 ? -10.592 -0.984  5.313   1.00 0.00 ? 26 ARG A CG  2  
ATOM   761  C  CD  . ARG A 1 26 ? -10.801 0.239   6.206   1.00 0.00 ? 26 ARG A CD  2  
ATOM   762  N  NE  . ARG A 1 26 ? -9.515  0.646   6.796   1.00 0.00 ? 26 ARG A NE  2  
ATOM   763  C  CZ  . ARG A 1 26 ? -8.786  1.740   6.518   1.00 0.00 ? 26 ARG A CZ  2  
ATOM   764  N  NH1 . ARG A 1 26 ? -9.154  2.627   5.587   1.00 0.00 ? 26 ARG A NH1 2  
ATOM   765  N  NH2 . ARG A 1 26 ? -7.652  1.933   7.185   1.00 0.00 ? 26 ARG A NH2 2  
ATOM   766  N  N   . TYR A 1 27 ? -11.806 -0.607  1.667   1.00 0.00 ? 27 TYR A N   2  
ATOM   767  C  CA  . TYR A 1 27 ? -11.252 0.004   0.477   1.00 0.00 ? 27 TYR A CA  2  
ATOM   768  C  C   . TYR A 1 27 ? -12.214 1.063   -0.039  1.00 0.00 ? 27 TYR A C   2  
ATOM   769  O  O   . TYR A 1 27 ? -13.420 0.994   0.201   1.00 0.00 ? 27 TYR A O   2  
ATOM   770  C  CB  . TYR A 1 27 ? -10.954 -1.057  -0.592  1.00 0.00 ? 27 TYR A CB  2  
ATOM   771  C  CG  . TYR A 1 27 ? -10.237 -0.496  -1.805  1.00 0.00 ? 27 TYR A CG  2  
ATOM   772  C  CD1 . TYR A 1 27 ? -8.864  -0.234  -1.709  1.00 0.00 ? 27 TYR A CD1 2  
ATOM   773  C  CD2 . TYR A 1 27 ? -10.948 -0.024  -2.922  1.00 0.00 ? 27 TYR A CD2 2  
ATOM   774  C  CE1 . TYR A 1 27 ? -8.252  0.674   -2.585  1.00 0.00 ? 27 TYR A CE1 2  
ATOM   775  C  CE2 . TYR A 1 27 ? -10.287 0.740   -3.899  1.00 0.00 ? 27 TYR A CE2 2  
ATOM   776  C  CZ  . TYR A 1 27 ? -8.972  1.186   -3.676  1.00 0.00 ? 27 TYR A CZ  2  
ATOM   777  O  OH  . TYR A 1 27 ? -8.437  2.189   -4.434  1.00 0.00 ? 27 TYR A OH  2  
ATOM   778  N  N   . GLN A 1 28 ? -11.649 2.042   -0.743  1.00 0.00 ? 28 GLN A N   2  
ATOM   779  C  CA  . GLN A 1 28 ? -12.413 3.000   -1.522  1.00 0.00 ? 28 GLN A CA  2  
ATOM   780  C  C   . GLN A 1 28 ? -11.574 3.522   -2.685  1.00 0.00 ? 28 GLN A C   2  
ATOM   781  O  O   . GLN A 1 28 ? -10.389 3.828   -2.535  1.00 0.00 ? 28 GLN A O   2  
ATOM   782  C  CB  . GLN A 1 28 ? -12.939 4.131   -0.635  1.00 0.00 ? 28 GLN A CB  2  
ATOM   783  C  CG  . GLN A 1 28 ? -14.173 4.824   -1.237  1.00 0.00 ? 28 GLN A CG  2  
ATOM   784  C  CD  . GLN A 1 28 ? -13.912 6.273   -1.632  1.00 0.00 ? 28 GLN A CD  2  
ATOM   785  O  OE1 . GLN A 1 28 ? -14.244 7.188   -0.887  1.00 0.00 ? 28 GLN A OE1 2  
ATOM   786  N  NE2 . GLN A 1 28 ? -13.326 6.513   -2.801  1.00 0.00 ? 28 GLN A NE2 2  
ATOM   787  N  N   . GLU A 1 29 ? -12.217 3.596   -3.842  1.00 0.00 ? 29 GLU A N   2  
ATOM   788  C  CA  . GLU A 1 29 ? -11.628 3.857   -5.142  1.00 0.00 ? 29 GLU A CA  2  
ATOM   789  C  C   . GLU A 1 29 ? -10.941 5.214   -5.142  1.00 0.00 ? 29 GLU A C   2  
ATOM   790  O  O   . GLU A 1 29 ? -11.603 6.237   -4.977  1.00 0.00 ? 29 GLU A O   2  
ATOM   791  C  CB  . GLU A 1 29 ? -12.720 3.763   -6.219  1.00 0.00 ? 29 GLU A CB  2  
ATOM   792  C  CG  . GLU A 1 29 ? -13.185 2.317   -6.487  1.00 0.00 ? 29 GLU A CG  2  
ATOM   793  C  CD  . GLU A 1 29 ? -13.815 1.611   -5.289  1.00 0.00 ? 29 GLU A CD  2  
ATOM   794  O  OE1 . GLU A 1 29 ? -14.450 2.321   -4.475  1.00 0.00 ? 29 GLU A OE1 2  
ATOM   795  O  OE2 . GLU A 1 29 ? -13.610 0.383   -5.185  1.00 0.00 ? 29 GLU A OE2 2  
ATOM   796  N  N   . GLY A 1 30 ? -9.618  5.209   -5.307  1.00 0.00 ? 30 GLY A N   2  
ATOM   797  C  CA  . GLY A 1 30 ? -8.786  6.402   -5.271  1.00 0.00 ? 30 GLY A CA  2  
ATOM   798  C  C   . GLY A 1 30 ? -7.730  6.276   -4.178  1.00 0.00 ? 30 GLY A C   2  
ATOM   799  O  O   . GLY A 1 30 ? -6.630  6.809   -4.320  1.00 0.00 ? 30 GLY A O   2  
ATOM   800  N  N   . GLN A 1 31 ? -8.041  5.558   -3.094  1.00 0.00 ? 31 GLN A N   2  
ATOM   801  C  CA  . GLN A 1 31 ? -7.059  5.303   -2.060  1.00 0.00 ? 31 GLN A CA  2  
ATOM   802  C  C   . GLN A 1 31 ? -5.977  4.399   -2.652  1.00 0.00 ? 31 GLN A C   2  
ATOM   803  O  O   . GLN A 1 31 ? -6.268  3.267   -3.041  1.00 0.00 ? 31 GLN A O   2  
ATOM   804  C  CB  . GLN A 1 31 ? -7.754  4.651   -0.860  1.00 0.00 ? 31 GLN A CB  2  
ATOM   805  C  CG  . GLN A 1 31 ? -8.839  5.550   -0.237  1.00 0.00 ? 31 GLN A CG  2  
ATOM   806  C  CD  . GLN A 1 31 ? -9.504  4.932   0.995   1.00 0.00 ? 31 GLN A CD  2  
ATOM   807  O  OE1 . GLN A 1 31 ? -9.868  5.633   1.934   1.00 0.00 ? 31 GLN A OE1 2  
ATOM   808  N  NE2 . GLN A 1 31 ? -9.685  3.613   1.019   1.00 0.00 ? 31 GLN A NE2 2  
ATOM   809  N  N   . LEU A 1 32 ? -4.754  4.923   -2.740  1.00 0.00 ? 32 LEU A N   2  
ATOM   810  C  CA  . LEU A 1 32 ? -3.545  4.253   -3.193  1.00 0.00 ? 32 LEU A CA  2  
ATOM   811  C  C   . LEU A 1 32 ? -2.489  4.557   -2.129  1.00 0.00 ? 32 LEU A C   2  
ATOM   812  O  O   . LEU A 1 32 ? -2.532  5.631   -1.525  1.00 0.00 ? 32 LEU A O   2  
ATOM   813  C  CB  . LEU A 1 32 ? -3.065  4.846   -4.532  1.00 0.00 ? 32 LEU A CB  2  
ATOM   814  C  CG  . LEU A 1 32 ? -3.392  4.074   -5.815  1.00 0.00 ? 32 LEU A CG  2  
ATOM   815  C  CD1 . LEU A 1 32 ? -4.867  4.064   -6.195  1.00 0.00 ? 32 LEU A CD1 2  
ATOM   816  C  CD2 . LEU A 1 32 ? -2.641  4.754   -6.973  1.00 0.00 ? 32 LEU A CD2 2  
ATOM   817  N  N   . CYS A 1 33 ? -1.534  3.647   -1.927  1.00 0.00 ? 33 CYS A N   2  
ATOM   818  C  CA  . CYS A 1 33 ? -0.383  3.826   -1.055  1.00 0.00 ? 33 CYS A CA  2  
ATOM   819  C  C   . CYS A 1 33 ? 0.241   5.213   -1.230  1.00 0.00 ? 33 CYS A C   2  
ATOM   820  O  O   . CYS A 1 33 ? 0.500   5.906   -0.251  1.00 0.00 ? 33 CYS A O   2  
ATOM   821  C  CB  . CYS A 1 33 ? 0.633   2.747   -1.337  1.00 0.00 ? 33 CYS A CB  2  
ATOM   822  S  SG  . CYS A 1 33 ? 0.290   1.206   -0.438  1.00 0.00 ? 33 CYS A SG  2  
ATOM   823  N  N   . GLU A 1 34 ? 0.471   5.662   -2.466  1.00 0.00 ? 34 GLU A N   2  
ATOM   824  C  CA  . GLU A 1 34 ? 1.096   6.965   -2.655  1.00 0.00 ? 34 GLU A CA  2  
ATOM   825  C  C   . GLU A 1 34 ? 0.324   8.138   -2.023  1.00 0.00 ? 34 GLU A C   2  
ATOM   826  O  O   . GLU A 1 34 ? 0.940   9.157   -1.710  1.00 0.00 ? 34 GLU A O   2  
ATOM   827  C  CB  . GLU A 1 34 ? 1.504   7.166   -4.114  1.00 0.00 ? 34 GLU A CB  2  
ATOM   828  C  CG  . GLU A 1 34 ? 0.370   7.108   -5.145  1.00 0.00 ? 34 GLU A CG  2  
ATOM   829  C  CD  . GLU A 1 34 ? -0.634  8.249   -5.016  1.00 0.00 ? 34 GLU A CD  2  
ATOM   830  O  OE1 . GLU A 1 34 ? -0.184  9.407   -5.133  1.00 0.00 ? 34 GLU A OE1 2  
ATOM   831  O  OE2 . GLU A 1 34 ? -1.829  7.950   -4.806  1.00 0.00 ? 34 GLU A OE2 2  
ATOM   832  N  N   . ASN A 1 35 ? -0.986  7.990   -1.775  1.00 0.00 ? 35 ASN A N   2  
ATOM   833  C  CA  . ASN A 1 35 ? -1.813  8.984   -1.092  1.00 0.00 ? 35 ASN A CA  2  
ATOM   834  C  C   . ASN A 1 35 ? -2.239  8.525   0.310   1.00 0.00 ? 35 ASN A C   2  
ATOM   835  O  O   . ASN A 1 35 ? -3.251  8.988   0.841   1.00 0.00 ? 35 ASN A O   2  
ATOM   836  C  CB  . ASN A 1 35 ? -2.993  9.395   -1.985  1.00 0.00 ? 35 ASN A CB  2  
ATOM   837  C  CG  . ASN A 1 35 ? -4.035  8.319   -2.234  1.00 0.00 ? 35 ASN A CG  2  
ATOM   838  O  OD1 . ASN A 1 35 ? -4.787  7.925   -1.351  1.00 0.00 ? 35 ASN A OD1 2  
ATOM   839  N  ND2 . ASN A 1 35 ? -4.157  7.894   -3.476  1.00 0.00 ? 35 ASN A ND2 2  
ATOM   840  N  N   . CYS A 1 36 ? -1.443  7.646   0.926   1.00 0.00 ? 36 CYS A N   2  
ATOM   841  C  CA  . CYS A 1 36 ? -1.615  7.156   2.286   1.00 0.00 ? 36 CYS A CA  2  
ATOM   842  C  C   . CYS A 1 36 ? -0.720  7.962   3.230   1.00 0.00 ? 36 CYS A C   2  
ATOM   843  O  O   . CYS A 1 36 ? 0.444   8.221   2.932   1.00 0.00 ? 36 CYS A O   2  
ATOM   844  C  CB  . CYS A 1 36 ? -1.198  5.717   2.281   1.00 0.00 ? 36 CYS A CB  2  
ATOM   845  S  SG  . CYS A 1 36 ? -1.405  4.887   3.852   1.00 0.00 ? 36 CYS A SG  2  
ATOM   846  N  N   . ALA A 1 37 ? -1.233  8.357   4.395   1.00 0.00 ? 37 ALA A N   2  
ATOM   847  C  CA  . ALA A 1 37 ? -0.491  9.169   5.349   1.00 0.00 ? 37 ALA A CA  2  
ATOM   848  C  C   . ALA A 1 37 ? 0.750   8.460   5.901   1.00 0.00 ? 37 ALA A C   2  
ATOM   849  O  O   . ALA A 1 37 ? 1.662   9.125   6.387   1.00 0.00 ? 37 ALA A O   2  
ATOM   850  C  CB  . ALA A 1 37 ? -1.427  9.619   6.470   1.00 0.00 ? 37 ALA A CB  2  
ATOM   851  N  N   . PHE A 1 38 ? 0.806   7.125   5.829   1.00 0.00 ? 38 PHE A N   2  
ATOM   852  C  CA  . PHE A 1 38 ? 1.989   6.371   6.237   1.00 0.00 ? 38 PHE A CA  2  
ATOM   853  C  C   . PHE A 1 38 ? 3.072   6.367   5.154   1.00 0.00 ? 38 PHE A C   2  
ATOM   854  O  O   . PHE A 1 38 ? 4.179   5.887   5.416   1.00 0.00 ? 38 PHE A O   2  
ATOM   855  C  CB  . PHE A 1 38 ? 1.598   4.940   6.615   1.00 0.00 ? 38 PHE A CB  2  
ATOM   856  C  CG  . PHE A 1 38 ? 0.756   4.848   7.871   1.00 0.00 ? 38 PHE A CG  2  
ATOM   857  C  CD1 . PHE A 1 38 ? 1.380   4.904   9.131   1.00 0.00 ? 38 PHE A CD1 2  
ATOM   858  C  CD2 . PHE A 1 38 ? -0.647  4.756   7.788   1.00 0.00 ? 38 PHE A CD2 2  
ATOM   859  C  CE1 . PHE A 1 38 ? 0.605   4.881   10.303  1.00 0.00 ? 38 PHE A CE1 2  
ATOM   860  C  CE2 . PHE A 1 38 ? -1.422  4.734   8.960   1.00 0.00 ? 38 PHE A CE2 2  
ATOM   861  C  CZ  . PHE A 1 38 ? -0.797  4.798   10.219  1.00 0.00 ? 38 PHE A CZ  2  
ATOM   862  N  N   . TRP A 1 39 ? 2.777   6.864   3.950   1.00 0.00 ? 39 TRP A N   2  
ATOM   863  C  CA  . TRP A 1 39 ? 3.726   6.877   2.852   1.00 0.00 ? 39 TRP A CA  2  
ATOM   864  C  C   . TRP A 1 39 ? 4.998   7.645   3.219   1.00 0.00 ? 39 TRP A C   2  
ATOM   865  O  O   . TRP A 1 39 ? 4.945   8.692   3.862   1.00 0.00 ? 39 TRP A O   2  
ATOM   866  C  CB  . TRP A 1 39 ? 3.064   7.499   1.622   1.00 0.00 ? 39 TRP A CB  2  
ATOM   867  C  CG  . TRP A 1 39 ? 3.891   7.505   0.378   1.00 0.00 ? 39 TRP A CG  2  
ATOM   868  C  CD1 . TRP A 1 39 ? 4.560   8.572   -0.113  1.00 0.00 ? 39 TRP A CD1 2  
ATOM   869  C  CD2 . TRP A 1 39 ? 4.117   6.417   -0.567  1.00 0.00 ? 39 TRP A CD2 2  
ATOM   870  N  NE1 . TRP A 1 39 ? 5.161   8.228   -1.304  1.00 0.00 ? 39 TRP A NE1 2  
ATOM   871  C  CE2 . TRP A 1 39 ? 4.885   6.928   -1.651  1.00 0.00 ? 39 TRP A CE2 2  
ATOM   872  C  CE3 . TRP A 1 39 ? 3.718   5.066   -0.652  1.00 0.00 ? 39 TRP A CE3 2  
ATOM   873  C  CZ2 . TRP A 1 39 ? 5.223   6.155   -2.765  1.00 0.00 ? 39 TRP A CZ2 2  
ATOM   874  C  CZ3 . TRP A 1 39 ? 4.083   4.275   -1.758  1.00 0.00 ? 39 TRP A CZ3 2  
ATOM   875  C  CH2 . TRP A 1 39 ? 4.857   4.807   -2.797  1.00 0.00 ? 39 TRP A CH2 2  
ATOM   876  N  N   . GLY A 1 40 ? 6.141   7.128   2.772   1.00 0.00 ? 40 GLY A N   2  
ATOM   877  C  CA  . GLY A 1 40 ? 7.438   7.767   2.881   1.00 0.00 ? 40 GLY A CA  2  
ATOM   878  C  C   . GLY A 1 40 ? 7.673   8.658   1.666   1.00 0.00 ? 40 GLY A C   2  
ATOM   879  O  O   . GLY A 1 40 ? 7.714   9.881   1.776   1.00 0.00 ? 40 GLY A O   2  
ATOM   880  N  N   . GLU A 1 41 ? 7.848   8.026   0.504   1.00 0.00 ? 41 GLU A N   2  
ATOM   881  C  CA  . GLU A 1 41 ? 8.311   8.643   -0.731  1.00 0.00 ? 41 GLU A CA  2  
ATOM   882  C  C   . GLU A 1 41 ? 8.224   7.573   -1.820  1.00 0.00 ? 41 GLU A C   2  
ATOM   883  O  O   . GLU A 1 41 ? 8.252   6.382   -1.495  1.00 0.00 ? 41 GLU A O   2  
ATOM   884  C  CB  . GLU A 1 41 ? 9.758   9.135   -0.569  1.00 0.00 ? 41 GLU A CB  2  
ATOM   885  C  CG  . GLU A 1 41 ? 10.667  7.944   -0.266  1.00 0.00 ? 41 GLU A CG  2  
ATOM   886  C  CD  . GLU A 1 41 ? 12.076  8.348   0.136   1.00 0.00 ? 41 GLU A CD  2  
ATOM   887  O  OE1 . GLU A 1 41 ? 12.683  9.150   -0.600  1.00 0.00 ? 41 GLU A OE1 2  
ATOM   888  O  OE2 . GLU A 1 41 ? 12.551  7.795   1.155   1.00 0.00 ? 41 GLU A OE2 2  
ATOM   889  N  N   . ALA A 1 42 ? 8.144   7.983   -3.091  1.00 0.00 ? 42 ALA A N   2  
ATOM   890  C  CA  . ALA A 1 42 ? 8.338   7.069   -4.208  1.00 0.00 ? 42 ALA A CA  2  
ATOM   891  C  C   . ALA A 1 42 ? 9.832   6.918   -4.441  1.00 0.00 ? 42 ALA A C   2  
ATOM   892  O  O   . ALA A 1 42 ? 10.548  7.915   -4.501  1.00 0.00 ? 42 ALA A O   2  
ATOM   893  C  CB  . ALA A 1 42 ? 7.634   7.556   -5.474  1.00 0.00 ? 42 ALA A CB  2  
ATOM   894  N  N   . VAL A 1 43 ? 10.295  5.675   -4.552  1.00 0.00 ? 43 VAL A N   2  
ATOM   895  C  CA  . VAL A 1 43 ? 11.706  5.369   -4.679  1.00 0.00 ? 43 VAL A CA  2  
ATOM   896  C  C   . VAL A 1 43 ? 12.048  5.177   -6.151  1.00 0.00 ? 43 VAL A C   2  
ATOM   897  O  O   . VAL A 1 43 ? 13.040  5.722   -6.631  1.00 0.00 ? 43 VAL A O   2  
ATOM   898  C  CB  . VAL A 1 43 ? 12.027  4.124   -3.843  1.00 0.00 ? 43 VAL A CB  2  
ATOM   899  C  CG1 . VAL A 1 43 ? 13.500  3.726   -3.974  1.00 0.00 ? 43 VAL A CG1 2  
ATOM   900  C  CG2 . VAL A 1 43 ? 11.750  4.374   -2.358  1.00 0.00 ? 43 VAL A CG2 2  
ATOM   901  N  N   . GLN A 1 44 ? 11.261  4.359   -6.858  1.00 0.00 ? 44 GLN A N   2  
ATOM   902  C  CA  . GLN A 1 44 ? 11.582  3.950   -8.214  1.00 0.00 ? 44 GLN A CA  2  
ATOM   903  C  C   . GLN A 1 44 ? 10.331  3.627   -9.035  1.00 0.00 ? 44 GLN A C   2  
ATOM   904  O  O   . GLN A 1 44 ? 9.429   4.460   -9.113  1.00 0.00 ? 44 GLN A O   2  
ATOM   905  C  CB  . GLN A 1 44 ? 12.649  2.855   -8.159  1.00 0.00 ? 44 GLN A CB  2  
ATOM   906  C  CG  . GLN A 1 44 ? 12.308  1.688   -7.228  1.00 0.00 ? 44 GLN A CG  2  
ATOM   907  C  CD  . GLN A 1 44 ? 13.449  0.681   -7.230  1.00 0.00 ? 44 GLN A CD  2  
ATOM   908  O  OE1 . GLN A 1 44 ? 14.294  0.683   -6.330  1.00 0.00 ? 44 GLN A OE1 2  
ATOM   909  N  NE2 . GLN A 1 44 ? 13.502  -0.157  -8.259  1.00 0.00 ? 44 GLN A NE2 2  
ATOM   910  N  N   . ASP A 1 45 ? 10.279  2.456   -9.680  1.00 0.00 ? 45 ASP A N   2  
ATOM   911  C  CA  . ASP A 1 45 ? 9.370   2.106   -10.767 1.00 0.00 ? 45 ASP A CA  2  
ATOM   912  C  C   . ASP A 1 45 ? 7.941   1.843   -10.279 1.00 0.00 ? 45 ASP A C   2  
ATOM   913  O  O   . ASP A 1 45 ? 7.400   0.747   -10.398 1.00 0.00 ? 45 ASP A O   2  
ATOM   914  C  CB  . ASP A 1 45 ? 9.972   0.932   -11.557 1.00 0.00 ? 45 ASP A CB  2  
ATOM   915  C  CG  . ASP A 1 45 ? 10.405  -0.239  -10.685 1.00 0.00 ? 45 ASP A CG  2  
ATOM   916  O  OD1 . ASP A 1 45 ? 11.315  -0.047  -9.842  1.00 0.00 ? 45 ASP A OD1 2  
ATOM   917  O  OD2 . ASP A 1 45 ? 9.856   -1.350  -10.835 1.00 0.00 ? 45 ASP A OD2 2  
ATOM   918  N  N   . GLY A 1 46 ? 7.319   2.887   -9.737  1.00 0.00 ? 46 GLY A N   2  
ATOM   919  C  CA  . GLY A 1 46 ? 5.987   2.836   -9.160  1.00 0.00 ? 46 GLY A CA  2  
ATOM   920  C  C   . GLY A 1 46 ? 5.998   2.093   -7.827  1.00 0.00 ? 46 GLY A C   2  
ATOM   921  O  O   . GLY A 1 46 ? 4.990   1.515   -7.439  1.00 0.00 ? 46 GLY A O   2  
ATOM   922  N  N   . TRP A 1 47 ? 7.124   2.115   -7.111  1.00 0.00 ? 47 TRP A N   2  
ATOM   923  C  CA  . TRP A 1 47 ? 7.288   1.586   -5.781  1.00 0.00 ? 47 TRP A CA  2  
ATOM   924  C  C   . TRP A 1 47 ? 7.867   2.664   -4.884  1.00 0.00 ? 47 TRP A C   2  
ATOM   925  O  O   . TRP A 1 47 ? 8.707   3.462   -5.320  1.00 0.00 ? 47 TRP A O   2  
ATOM   926  C  CB  . TRP A 1 47 ? 8.244   0.405   -5.803  1.00 0.00 ? 47 TRP A CB  2  
ATOM   927  C  CG  . TRP A 1 47 ? 7.817   -0.758  -6.625  1.00 0.00 ? 47 TRP A CG  2  
ATOM   928  C  CD1 . TRP A 1 47 ? 8.083   -0.947  -7.932  1.00 0.00 ? 47 TRP A CD1 2  
ATOM   929  C  CD2 . TRP A 1 47 ? 7.019   -1.895  -6.208  1.00 0.00 ? 47 TRP A CD2 2  
ATOM   930  N  NE1 . TRP A 1 47 ? 7.445   -2.089  -8.367  1.00 0.00 ? 47 TRP A NE1 2  
ATOM   931  C  CE2 . TRP A 1 47 ? 6.773   -2.718  -7.342  1.00 0.00 ? 47 TRP A CE2 2  
ATOM   932  C  CE3 . TRP A 1 47 ? 6.515   -2.333  -4.970  1.00 0.00 ? 47 TRP A CE3 2  
ATOM   933  C  CZ2 . TRP A 1 47 ? 6.007   -3.885  -7.261  1.00 0.00 ? 47 TRP A CZ2 2  
ATOM   934  C  CZ3 . TRP A 1 47 ? 5.687   -3.465  -4.889  1.00 0.00 ? 47 TRP A CZ3 2  
ATOM   935  C  CH2 . TRP A 1 47 ? 5.392   -4.208  -6.045  1.00 0.00 ? 47 TRP A CH2 2  
ATOM   936  N  N   . GLY A 1 48 ? 7.440   2.651   -3.626  1.00 0.00 ? 48 GLY A N   2  
ATOM   937  C  CA  . GLY A 1 48 ? 7.917   3.563   -2.625  1.00 0.00 ? 48 GLY A CA  2  
ATOM   938  C  C   . GLY A 1 48 ? 7.802   2.991   -1.222  1.00 0.00 ? 48 GLY A C   2  
ATOM   939  O  O   . GLY A 1 48 ? 7.387   1.852   -1.010  1.00 0.00 ? 48 GLY A O   2  
ATOM   940  N  N   . ARG A 1 49 ? 8.258   3.793   -0.268  1.00 0.00 ? 49 ARG A N   2  
ATOM   941  C  CA  . ARG A 1 49 ? 8.395   3.392   1.120   1.00 0.00 ? 49 ARG A CA  2  
ATOM   942  C  C   . ARG A 1 49 ? 7.088   3.702   1.843   1.00 0.00 ? 49 ARG A C   2  
ATOM   943  O  O   . ARG A 1 49 ? 6.431   4.688   1.515   1.00 0.00 ? 49 ARG A O   2  
ATOM   944  C  CB  . ARG A 1 49 ? 9.605   4.126   1.718   1.00 0.00 ? 49 ARG A CB  2  
ATOM   945  C  CG  . ARG A 1 49 ? 10.899  3.593   1.100   1.00 0.00 ? 49 ARG A CG  2  
ATOM   946  C  CD  . ARG A 1 49 ? 12.109  4.490   1.370   1.00 0.00 ? 49 ARG A CD  2  
ATOM   947  N  NE  . ARG A 1 49 ? 13.296  4.046   0.608   1.00 0.00 ? 49 ARG A NE  2  
ATOM   948  C  CZ  . ARG A 1 49 ? 14.381  4.795   0.353   1.00 0.00 ? 49 ARG A CZ  2  
ATOM   949  N  NH1 . ARG A 1 49 ? 14.468  6.071   0.737   1.00 0.00 ? 49 ARG A NH1 2  
ATOM   950  N  NH2 . ARG A 1 49 ? 15.399  4.238   -0.307  1.00 0.00 ? 49 ARG A NH2 2  
ATOM   951  N  N   . CYS A 1 50 ? 6.725   2.861   2.812   1.00 0.00 ? 50 CYS A N   2  
ATOM   952  C  CA  . CYS A 1 50 ? 5.575   3.023   3.687   1.00 0.00 ? 50 CYS A CA  2  
ATOM   953  C  C   . CYS A 1 50 ? 6.054   2.714   5.100   1.00 0.00 ? 50 CYS A C   2  
ATOM   954  O  O   . CYS A 1 50 ? 6.741   1.717   5.310   1.00 0.00 ? 50 CYS A O   2  
ATOM   955  C  CB  . CYS A 1 50 ? 4.450   2.125   3.240   1.00 0.00 ? 50 CYS A CB  2  
ATOM   956  S  SG  . CYS A 1 50 ? 3.259   1.918   4.580   1.00 0.00 ? 50 CYS A SG  2  
ATOM   957  N  N   . THR A 1 51 ? 5.777   3.620   6.037   1.00 0.00 ? 51 THR A N   2  
ATOM   958  C  CA  . THR A 1 51 ? 6.383   3.607   7.357   1.00 0.00 ? 51 THR A CA  2  
ATOM   959  C  C   . THR A 1 51 ? 5.532   2.817   8.352   1.00 0.00 ? 51 THR A C   2  
ATOM   960  O  O   . THR A 1 51 ? 4.324   2.662   8.176   1.00 0.00 ? 51 THR A O   2  
ATOM   961  C  CB  . THR A 1 51 ? 6.613   5.051   7.831   1.00 0.00 ? 51 THR A CB  2  
ATOM   962  O  OG1 . THR A 1 51 ? 5.397   5.771   7.902   1.00 0.00 ? 51 THR A OG1 2  
ATOM   963  C  CG2 . THR A 1 51 ? 7.574   5.795   6.896   1.00 0.00 ? 51 THR A CG2 2  
ATOM   964  N  N   . HIS A 1 52 ? 6.186   2.362   9.422   1.00 0.00 ? 52 HIS A N   2  
ATOM   965  C  CA  . HIS A 1 52 ? 5.712   1.606   10.571  1.00 0.00 ? 52 HIS A CA  2  
ATOM   966  C  C   . HIS A 1 52 ? 5.951   0.100   10.353  1.00 0.00 ? 52 HIS A C   2  
ATOM   967  O  O   . HIS A 1 52 ? 5.694   -0.412  9.261   1.00 0.00 ? 52 HIS A O   2  
ATOM   968  C  CB  . HIS A 1 52 ? 4.289   1.998   11.034  1.00 0.00 ? 52 HIS A CB  2  
ATOM   969  C  CG  . HIS A 1 52 ? 3.236   0.931   10.855  1.00 0.00 ? 52 HIS A CG  2  
ATOM   970  N  ND1 . HIS A 1 52 ? 2.655   0.222   11.890  1.00 0.00 ? 52 HIS A ND1 2  
ATOM   971  C  CD2 . HIS A 1 52 ? 2.869   0.339   9.676   1.00 0.00 ? 52 HIS A CD2 2  
ATOM   972  C  CE1 . HIS A 1 52 ? 1.957   -0.789  11.350  1.00 0.00 ? 52 HIS A CE1 2  
ATOM   973  N  NE2 . HIS A 1 52 ? 2.089   -0.746  10.012  1.00 0.00 ? 52 HIS A NE2 2  
ATOM   974  N  N   . PRO A 1 53 ? 6.431   -0.629  11.375  1.00 0.00 ? 53 PRO A N   2  
ATOM   975  C  CA  . PRO A 1 53 ? 6.712   -2.054  11.262  1.00 0.00 ? 53 PRO A CA  2  
ATOM   976  C  C   . PRO A 1 53 ? 5.440   -2.810  10.887  1.00 0.00 ? 53 PRO A C   2  
ATOM   977  O  O   . PRO A 1 53 ? 4.365   -2.463  11.374  1.00 0.00 ? 53 PRO A O   2  
ATOM   978  C  CB  . PRO A 1 53 ? 7.266   -2.480  12.626  1.00 0.00 ? 53 PRO A CB  2  
ATOM   979  C  CG  . PRO A 1 53 ? 6.696   -1.438  13.588  1.00 0.00 ? 53 PRO A CG  2  
ATOM   980  C  CD  . PRO A 1 53 ? 6.669   -0.170  12.734  1.00 0.00 ? 53 PRO A CD  2  
ATOM   981  N  N   . ASP A 1 54 ? 5.584   -3.797  9.997   1.00 0.00 ? 54 ASP A N   2  
ATOM   982  C  CA  . ASP A 1 54 ? 4.537   -4.533  9.292   1.00 0.00 ? 54 ASP A CA  2  
ATOM   983  C  C   . ASP A 1 54 ? 4.322   -3.973  7.881   1.00 0.00 ? 54 ASP A C   2  
ATOM   984  O  O   . ASP A 1 54 ? 3.756   -4.668  7.033   1.00 0.00 ? 54 ASP A O   2  
ATOM   985  C  CB  . ASP A 1 54 ? 3.272   -4.879  10.106  1.00 0.00 ? 54 ASP A CB  2  
ATOM   986  C  CG  . ASP A 1 54 ? 2.137   -3.869  10.098  1.00 0.00 ? 54 ASP A CG  2  
ATOM   987  O  OD1 . ASP A 1 54 ? 1.922   -3.159  9.093   1.00 0.00 ? 54 ASP A OD1 2  
ATOM   988  O  OD2 . ASP A 1 54 ? 1.376   -3.851  11.092  1.00 0.00 ? 54 ASP A OD2 2  
ATOM   989  N  N   . PHE A 1 55 ? 4.875   -2.778  7.601   1.00 0.00 ? 55 PHE A N   2  
ATOM   990  C  CA  . PHE A 1 55 ? 5.148   -2.323  6.244   1.00 0.00 ? 55 PHE A CA  2  
ATOM   991  C  C   . PHE A 1 55 ? 6.596   -1.864  6.037   1.00 0.00 ? 55 PHE A C   2  
ATOM   992  O  O   . PHE A 1 55 ? 7.164   -2.199  5.001   1.00 0.00 ? 55 PHE A O   2  
ATOM   993  C  CB  . PHE A 1 55 ? 4.115   -1.283  5.787   1.00 0.00 ? 55 PHE A CB  2  
ATOM   994  C  CG  . PHE A 1 55 ? 2.839   -1.946  5.302   1.00 0.00 ? 55 PHE A CG  2  
ATOM   995  C  CD1 . PHE A 1 55 ? 2.914   -2.760  4.156   1.00 0.00 ? 55 PHE A CD1 2  
ATOM   996  C  CD2 . PHE A 1 55 ? 1.654   -1.925  6.068   1.00 0.00 ? 55 PHE A CD2 2  
ATOM   997  C  CE1 . PHE A 1 55 ? 1.855   -3.616  3.816   1.00 0.00 ? 55 PHE A CE1 2  
ATOM   998  C  CE2 . PHE A 1 55 ? 0.617   -2.811  5.744   1.00 0.00 ? 55 PHE A CE2 2  
ATOM   999  C  CZ  . PHE A 1 55 ? 0.727   -3.677  4.647   1.00 0.00 ? 55 PHE A CZ  2  
ATOM   1000 N  N   . ASP A 1 56 ? 7.196   -1.137  6.993   1.00 0.00 ? 56 ASP A N   2  
ATOM   1001 C  CA  . ASP A 1 56 ? 8.573   -0.624  6.936   1.00 0.00 ? 56 ASP A CA  2  
ATOM   1002 C  C   . ASP A 1 56 ? 9.543   -1.600  6.262   1.00 0.00 ? 56 ASP A C   2  
ATOM   1003 O  O   . ASP A 1 56 ? 10.369  -1.214  5.439   1.00 0.00 ? 56 ASP A O   2  
ATOM   1004 C  CB  . ASP A 1 56 ? 9.087   -0.299  8.356   1.00 0.00 ? 56 ASP A CB  2  
ATOM   1005 C  CG  . ASP A 1 56 ? 9.272   1.191   8.610   1.00 0.00 ? 56 ASP A CG  2  
ATOM   1006 O  OD1 . ASP A 1 56 ? 9.973   1.840   7.807   1.00 0.00 ? 56 ASP A OD1 2  
ATOM   1007 O  OD2 . ASP A 1 56 ? 8.709   1.666   9.621   1.00 0.00 ? 56 ASP A OD2 2  
ATOM   1008 N  N   . GLU A 1 57 ? 9.458   -2.877  6.640   1.00 0.00 ? 57 GLU A N   2  
ATOM   1009 C  CA  . GLU A 1 57 ? 10.361  -3.917  6.186   1.00 0.00 ? 57 GLU A CA  2  
ATOM   1010 C  C   . GLU A 1 57 ? 10.352  -4.176  4.665   1.00 0.00 ? 57 GLU A C   2  
ATOM   1011 O  O   . GLU A 1 57 ? 11.275  -4.825  4.170   1.00 0.00 ? 57 GLU A O   2  
ATOM   1012 C  CB  . GLU A 1 57 ? 10.161  -5.174  7.035   1.00 0.00 ? 57 GLU A CB  2  
ATOM   1013 C  CG  . GLU A 1 57 ? 8.794   -5.808  6.814   1.00 0.00 ? 57 GLU A CG  2  
ATOM   1014 C  CD  . GLU A 1 57 ? 7.606   -5.174  7.526   1.00 0.00 ? 57 GLU A CD  2  
ATOM   1015 O  OE1 . GLU A 1 57 ? 7.781   -4.219  8.321   1.00 0.00 ? 57 GLU A OE1 2  
ATOM   1016 O  OE2 . GLU A 1 57 ? 6.502   -5.669  7.228   1.00 0.00 ? 57 GLU A OE2 2  
ATOM   1017 N  N   . VAL A 1 58 ? 9.335   -3.721  3.924   1.00 0.00 ? 58 VAL A N   2  
ATOM   1018 C  CA  . VAL A 1 58 ? 9.199   -3.953  2.486   1.00 0.00 ? 58 VAL A CA  2  
ATOM   1019 C  C   . VAL A 1 58 ? 8.872   -2.646  1.761   1.00 0.00 ? 58 VAL A C   2  
ATOM   1020 O  O   . VAL A 1 58 ? 8.371   -1.698  2.360   1.00 0.00 ? 58 VAL A O   2  
ATOM   1021 C  CB  . VAL A 1 58 ? 8.127   -5.023  2.208   1.00 0.00 ? 58 VAL A CB  2  
ATOM   1022 C  CG1 . VAL A 1 58 ? 8.608   -6.416  2.633   1.00 0.00 ? 58 VAL A CG1 2  
ATOM   1023 C  CG2 . VAL A 1 58 ? 6.790   -4.701  2.891   1.00 0.00 ? 58 VAL A CG2 2  
ATOM   1024 N  N   . LEU A 1 59 ? 9.148   -2.586  0.455   1.00 0.00 ? 59 LEU A N   2  
ATOM   1025 C  CA  . LEU A 1 59 ? 8.819   -1.453  -0.381  1.00 0.00 ? 59 LEU A CA  2  
ATOM   1026 C  C   . LEU A 1 59 ? 7.447   -1.715  -0.979  1.00 0.00 ? 59 LEU A C   2  
ATOM   1027 O  O   . LEU A 1 59 ? 7.251   -2.746  -1.616  1.00 0.00 ? 59 LEU A O   2  
ATOM   1028 C  CB  . LEU A 1 59 ? 9.893   -1.364  -1.464  1.00 0.00 ? 59 LEU A CB  2  
ATOM   1029 C  CG  . LEU A 1 59 ? 9.903   -0.012  -2.178  1.00 0.00 ? 59 LEU A CG  2  
ATOM   1030 C  CD1 . LEU A 1 59 ? 10.454  1.100   -1.283  1.00 0.00 ? 59 LEU A CD1 2  
ATOM   1031 C  CD2 . LEU A 1 59 ? 10.810  -0.094  -3.402  1.00 0.00 ? 59 LEU A CD2 2  
ATOM   1032 N  N   . VAL A 1 60 ? 6.486   -0.820  -0.771  1.00 0.00 ? 60 VAL A N   2  
ATOM   1033 C  CA  . VAL A 1 60 ? 5.129   -1.047  -1.231  1.00 0.00 ? 60 VAL A CA  2  
ATOM   1034 C  C   . VAL A 1 60 ? 4.954   -0.384  -2.591  1.00 0.00 ? 60 VAL A C   2  
ATOM   1035 O  O   . VAL A 1 60 ? 5.619   0.602   -2.911  1.00 0.00 ? 60 VAL A O   2  
ATOM   1036 C  CB  . VAL A 1 60 ? 4.111   -0.581  -0.183  1.00 0.00 ? 60 VAL A CB  2  
ATOM   1037 C  CG1 . VAL A 1 60 ? 4.292   -1.359  1.126   1.00 0.00 ? 60 VAL A CG1 2  
ATOM   1038 C  CG2 . VAL A 1 60 ? 4.192   0.918   0.088   1.00 0.00 ? 60 VAL A CG2 2  
ATOM   1039 N  N   . LYS A 1 61 ? 4.101   -0.955  -3.434  1.00 0.00 ? 61 LYS A N   2  
ATOM   1040 C  CA  . LYS A 1 61 ? 3.813   -0.356  -4.718  1.00 0.00 ? 61 LYS A CA  2  
ATOM   1041 C  C   . LYS A 1 61 ? 3.061   0.941   -4.464  1.00 0.00 ? 61 LYS A C   2  
ATOM   1042 O  O   . LYS A 1 61 ? 2.162   0.965   -3.633  1.00 0.00 ? 61 LYS A O   2  
ATOM   1043 C  CB  . LYS A 1 61 ? 2.976   -1.341  -5.540  1.00 0.00 ? 61 LYS A CB  2  
ATOM   1044 C  CG  . LYS A 1 61 ? 3.086   -0.995  -7.021  1.00 0.00 ? 61 LYS A CG  2  
ATOM   1045 C  CD  . LYS A 1 61 ? 2.891   -2.199  -7.940  1.00 0.00 ? 61 LYS A CD  2  
ATOM   1046 C  CE  . LYS A 1 61 ? 3.510   -1.882  -9.313  1.00 0.00 ? 61 LYS A CE  2  
ATOM   1047 N  NZ  . LYS A 1 61 ? 3.128   -0.552  -9.850  1.00 0.00 ? 61 LYS A NZ  2  
ATOM   1048 N  N   . ALA A 1 62 ? 3.404   2.005   -5.182  1.00 0.00 ? 62 ALA A N   2  
ATOM   1049 C  CA  . ALA A 1 62 ? 2.653   3.254   -5.126  1.00 0.00 ? 62 ALA A CA  2  
ATOM   1050 C  C   . ALA A 1 62 ? 1.170   3.011   -5.392  1.00 0.00 ? 62 ALA A C   2  
ATOM   1051 O  O   . ALA A 1 62 ? 0.331   3.573   -4.687  1.00 0.00 ? 62 ALA A O   2  
ATOM   1052 C  CB  . ALA A 1 62 ? 3.236   4.255   -6.111  1.00 0.00 ? 62 ALA A CB  2  
ATOM   1053 N  N   . GLU A 1 63 ? 0.843   2.161   -6.376  1.00 0.00 ? 63 GLU A N   2  
ATOM   1054 C  CA  . GLU A 1 63 ? -0.545  1.805   -6.621  1.00 0.00 ? 63 GLU A CA  2  
ATOM   1055 C  C   . GLU A 1 63 ? -1.084  0.720   -5.694  1.00 0.00 ? 63 GLU A C   2  
ATOM   1056 O  O   . GLU A 1 63 ? -2.198  0.256   -5.925  1.00 0.00 ? 63 GLU A O   2  
ATOM   1057 C  CB  . GLU A 1 63 ? -0.790  1.394   -8.071  1.00 0.00 ? 63 GLU A CB  2  
ATOM   1058 C  CG  . GLU A 1 63 ? -0.085  2.302   -9.076  1.00 0.00 ? 63 GLU A CG  2  
ATOM   1059 C  CD  . GLU A 1 63 ? 1.190   1.611   -9.531  1.00 0.00 ? 63 GLU A CD  2  
ATOM   1060 O  OE1 . GLU A 1 63 ? 2.175   1.624   -8.756  1.00 0.00 ? 63 GLU A OE1 2  
ATOM   1061 O  OE2 . GLU A 1 63 ? 1.163   0.903   -10.561 1.00 0.00 ? 63 GLU A OE2 2  
ATOM   1062 N  N   . GLY A 1 64 ? -0.329  0.281   -4.688  1.00 0.00 ? 64 GLY A N   2  
ATOM   1063 C  CA  . GLY A 1 64 ? -0.821  -0.695  -3.737  1.00 0.00 ? 64 GLY A CA  2  
ATOM   1064 C  C   . GLY A 1 64 ? -1.826  -0.058  -2.784  1.00 0.00 ? 64 GLY A C   2  
ATOM   1065 O  O   . GLY A 1 64 ? -2.162  1.119   -2.913  1.00 0.00 ? 64 GLY A O   2  
ATOM   1066 N  N   . TRP A 1 65 ? -2.311  -0.843  -1.824  1.00 0.00 ? 65 TRP A N   2  
ATOM   1067 C  CA  . TRP A 1 65 ? -3.124  -0.361  -0.716  1.00 0.00 ? 65 TRP A CA  2  
ATOM   1068 C  C   . TRP A 1 65 ? -3.115  -1.446  0.352   1.00 0.00 ? 65 TRP A C   2  
ATOM   1069 O  O   . TRP A 1 65 ? -2.936  -2.612  0.000   1.00 0.00 ? 65 TRP A O   2  
ATOM   1070 C  CB  . TRP A 1 65 ? -4.550  -0.085  -1.200  1.00 0.00 ? 65 TRP A CB  2  
ATOM   1071 C  CG  . TRP A 1 65 ? -5.548  0.307   -0.154  1.00 0.00 ? 65 TRP A CG  2  
ATOM   1072 C  CD1 . TRP A 1 65 ? -5.947  1.569   0.118   1.00 0.00 ? 65 TRP A CD1 2  
ATOM   1073 C  CD2 . TRP A 1 65 ? -6.357  -0.561  0.693   1.00 0.00 ? 65 TRP A CD2 2  
ATOM   1074 N  NE1 . TRP A 1 65 ? -6.997  1.540   1.013   1.00 0.00 ? 65 TRP A NE1 2  
ATOM   1075 C  CE2 . TRP A 1 65 ? -7.310  0.245   1.383   1.00 0.00 ? 65 TRP A CE2 2  
ATOM   1076 C  CE3 . TRP A 1 65 ? -6.441  -1.960  0.881   1.00 0.00 ? 65 TRP A CE3 2  
ATOM   1077 C  CZ2 . TRP A 1 65 ? -8.324  -0.313  2.175   1.00 0.00 ? 65 TRP A CZ2 2  
ATOM   1078 C  CZ3 . TRP A 1 65 ? -7.415  -2.523  1.724   1.00 0.00 ? 65 TRP A CZ3 2  
ATOM   1079 C  CH2 . TRP A 1 65 ? -8.380  -1.708  2.336   1.00 0.00 ? 65 TRP A CH2 2  
ATOM   1080 N  N   . CYS A 1 66 ? -3.330  -1.068  1.620   1.00 0.00 ? 66 CYS A N   2  
ATOM   1081 C  CA  . CYS A 1 66 ? -3.486  -1.962  2.760   1.00 0.00 ? 66 CYS A CA  2  
ATOM   1082 C  C   . CYS A 1 66 ? -4.593  -1.441  3.690   1.00 0.00 ? 66 CYS A C   2  
ATOM   1083 O  O   . CYS A 1 66 ? -4.964  -0.268  3.642   1.00 0.00 ? 66 CYS A O   2  
ATOM   1084 C  CB  . CYS A 1 66 ? -2.177  -2.126  3.498   1.00 0.00 ? 66 CYS A CB  2  
ATOM   1085 S  SG  . CYS A 1 66 ? -1.844  -0.752  4.596   1.00 0.00 ? 66 CYS A SG  2  
ATOM   1086 N  N   . SER A 1 67 ? -5.125  -2.302  4.560   1.00 0.00 ? 67 SER A N   2  
ATOM   1087 C  CA  . SER A 1 67 ? -6.214  -1.964  5.470   1.00 0.00 ? 67 SER A CA  2  
ATOM   1088 C  C   . SER A 1 67 ? -5.782  -1.009  6.590   1.00 0.00 ? 67 SER A C   2  
ATOM   1089 O  O   . SER A 1 67 ? -6.633  -0.471  7.304   1.00 0.00 ? 67 SER A O   2  
ATOM   1090 C  CB  . SER A 1 67 ? -6.830  -3.252  6.023   1.00 0.00 ? 67 SER A CB  2  
ATOM   1091 O  OG  . SER A 1 67 ? -5.890  -3.992  6.777   1.00 0.00 ? 67 SER A OG  2  
ATOM   1092 N  N   . VAL A 1 68 ? -4.477  -0.768  6.736   1.00 0.00 ? 68 VAL A N   2  
ATOM   1093 C  CA  . VAL A 1 68 ? -3.926  0.284   7.582   1.00 0.00 ? 68 VAL A CA  2  
ATOM   1094 C  C   . VAL A 1 68 ? -4.348  1.654   7.027   1.00 0.00 ? 68 VAL A C   2  
ATOM   1095 O  O   . VAL A 1 68 ? -4.610  2.558   7.815   1.00 0.00 ? 68 VAL A O   2  
ATOM   1096 C  CB  . VAL A 1 68 ? -2.390  0.173   7.663   1.00 0.00 ? 68 VAL A CB  2  
ATOM   1097 C  CG1 . VAL A 1 68 ? -1.755  0.981   8.784   1.00 0.00 ? 68 VAL A CG1 2  
ATOM   1098 C  CG2 . VAL A 1 68 ? -1.888  -1.254  7.893   1.00 0.00 ? 68 VAL A CG2 2  
ATOM   1099 N  N   . TYR A 1 69 ? -4.436  1.788   5.690   1.00 0.00 ? 69 TYR A N   2  
ATOM   1100 C  CA  . TYR A 1 69 ? -4.620  3.042   4.950   1.00 0.00 ? 69 TYR A CA  2  
ATOM   1101 C  C   . TYR A 1 69 ? -5.343  4.138   5.738   1.00 0.00 ? 69 TYR A C   2  
ATOM   1102 O  O   . TYR A 1 69 ? -6.544  4.017   6.008   1.00 0.00 ? 69 TYR A O   2  
ATOM   1103 C  CB  . TYR A 1 69 ? -5.339  2.783   3.616   1.00 0.00 ? 69 TYR A CB  2  
ATOM   1104 C  CG  . TYR A 1 69 ? -5.581  4.038   2.795   1.00 0.00 ? 69 TYR A CG  2  
ATOM   1105 C  CD1 . TYR A 1 69 ? -6.719  4.832   3.038   1.00 0.00 ? 69 TYR A CD1 2  
ATOM   1106 C  CD2 . TYR A 1 69 ? -4.613  4.484   1.876   1.00 0.00 ? 69 TYR A CD2 2  
ATOM   1107 C  CE1 . TYR A 1 69 ? -6.808  6.118   2.490   1.00 0.00 ? 69 TYR A CE1 2  
ATOM   1108 C  CE2 . TYR A 1 69 ? -4.757  5.735   1.249   1.00 0.00 ? 69 TYR A CE2 2  
ATOM   1109 C  CZ  . TYR A 1 69 ? -5.834  6.568   1.589   1.00 0.00 ? 69 TYR A CZ  2  
ATOM   1110 O  OH  . TYR A 1 69 ? -5.983  7.794   1.020   1.00 0.00 ? 69 TYR A OH  2  
ATOM   1111 N  N   . ALA A 1 70 ? -4.629  5.216   6.058   1.00 0.00 ? 70 ALA A N   2  
ATOM   1112 C  CA  . ALA A 1 70 ? -5.192  6.454   6.574   1.00 0.00 ? 70 ALA A CA  2  
ATOM   1113 C  C   . ALA A 1 70 ? -4.958  7.505   5.489   1.00 0.00 ? 70 ALA A C   2  
ATOM   1114 O  O   . ALA A 1 70 ? -3.853  7.545   4.953   1.00 0.00 ? 70 ALA A O   2  
ATOM   1115 C  CB  . ALA A 1 70 ? -4.476  6.840   7.871   1.00 0.00 ? 70 ALA A CB  2  
ATOM   1116 N  N   . PRO A 1 71 ? -5.956  8.318   5.119   1.00 0.00 ? 71 PRO A N   2  
ATOM   1117 C  CA  . PRO A 1 71 ? -5.791  9.293   4.060   1.00 0.00 ? 71 PRO A CA  2  
ATOM   1118 C  C   . PRO A 1 71 ? -4.868  10.418  4.497   1.00 0.00 ? 71 PRO A C   2  
ATOM   1119 O  O   . PRO A 1 71 ? -4.788  10.751  5.678   1.00 0.00 ? 71 PRO A O   2  
ATOM   1120 C  CB  . PRO A 1 71 ? -7.200  9.792   3.737   1.00 0.00 ? 71 PRO A CB  2  
ATOM   1121 C  CG  . PRO A 1 71 ? -7.930  9.635   5.071   1.00 0.00 ? 71 PRO A CG  2  
ATOM   1122 C  CD  . PRO A 1 71 ? -7.297  8.378   5.676   1.00 0.00 ? 71 PRO A CD  2  
ATOM   1123 N  N   . ALA A 1 72 ? -4.170  10.998  3.518   1.00 0.00 ? 72 ALA A N   2  
ATOM   1124 C  CA  . ALA A 1 72 ? -3.283  12.130  3.721   1.00 0.00 ? 72 ALA A CA  2  
ATOM   1125 C  C   . ALA A 1 72 ? -3.988  13.433  3.340   1.00 0.00 ? 72 ALA A C   2  
ATOM   1126 O  O   . ALA A 1 72 ? -3.385  14.350  2.785   1.00 0.00 ? 72 ALA A O   2  
ATOM   1127 C  CB  . ALA A 1 72 ? -2.028  11.910  2.886   1.00 0.00 ? 72 ALA A CB  2  
ATOM   1128 N  N   . SER A 1 73 ? -5.287  13.487  3.611   1.00 0.00 ? 73 SER A N   2  
ATOM   1129 C  CA  . SER A 1 73 ? -6.207  14.589  3.414   1.00 0.00 ? 73 SER A CA  2  
ATOM   1130 C  C   . SER A 1 73 ? -7.466  14.213  4.194   1.00 0.00 ? 73 SER A C   2  
ATOM   1131 O  O   . SER A 1 73 ? -7.498  13.055  4.671   1.00 0.00 ? 73 SER A O   2  
ATOM   1132 C  CB  . SER A 1 73 ? -6.549  14.771  1.931   1.00 0.00 ? 73 SER A CB  2  
ATOM   1133 O  OG  . SER A 1 73 ? -5.447  15.275  1.198   1.00 0.00 ? 73 SER A OG  2  
ATOM   1134 O  OXT . SER A 1 73 ? -8.371  15.070  4.273   1.00 0.00 ? 73 SER A OXT 2  
HETATM 1135 FE FE1 . SF4 B 2 .  ? 0.193   1.573   1.565   1.00 0.00 ? 74 SF4 A FE1 2  
HETATM 1136 FE FE2 . SF4 B 2 .  ? -0.568  3.105   3.391   1.00 0.00 ? 74 SF4 A FE2 2  
HETATM 1137 FE FE3 . SF4 B 2 .  ? 1.470   1.779   3.692   1.00 0.00 ? 74 SF4 A FE3 2  
HETATM 1138 FE FE4 . SF4 B 2 .  ? -0.740  0.659   3.672   1.00 0.00 ? 74 SF4 A FE4 2  
HETATM 1139 S  S1  . SF4 B 2 .  ? -0.072  2.053   5.158   1.00 0.00 ? 74 SF4 A S1  2  
HETATM 1140 S  S2  . SF4 B 2 .  ? 1.021   -0.075  2.686   1.00 0.00 ? 74 SF4 A S2  2  
HETATM 1141 S  S3  . SF4 B 2 .  ? -1.862  1.813   2.246   1.00 0.00 ? 74 SF4 A S3  2  
HETATM 1142 S  S4  . SF4 B 2 .  ? 1.235   3.329   2.231   1.00 0.00 ? 74 SF4 A S4  2  
ATOM   1143 N  N   . ALA A 1 1  ? 17.973  -1.265  -6.008  1.00 0.00 ? 1  ALA A N   3  
ATOM   1144 C  CA  . ALA A 1 1  ? 17.177  -0.279  -5.280  1.00 0.00 ? 1  ALA A CA  3  
ATOM   1145 C  C   . ALA A 1 1  ? 17.237  -0.656  -3.813  1.00 0.00 ? 1  ALA A C   3  
ATOM   1146 O  O   . ALA A 1 1  ? 17.644  -1.761  -3.472  1.00 0.00 ? 1  ALA A O   3  
ATOM   1147 C  CB  . ALA A 1 1  ? 15.710  -0.163  -5.706  1.00 0.00 ? 1  ALA A CB  3  
ATOM   1148 N  N   . SER A 1 2  ? 16.551  0.159   -3.017  1.00 0.00 ? 2  SER A N   3  
ATOM   1149 C  CA  . SER A 1 2  ? 16.197  -0.158  -1.649  1.00 0.00 ? 2  SER A CA  3  
ATOM   1150 C  C   . SER A 1 2  ? 15.379  -1.473  -1.601  1.00 0.00 ? 2  SER A C   3  
ATOM   1151 O  O   . SER A 1 2  ? 15.438  -2.276  -2.547  1.00 0.00 ? 2  SER A O   3  
ATOM   1152 C  CB  . SER A 1 2  ? 15.428  1.059   -1.104  1.00 0.00 ? 2  SER A CB  3  
ATOM   1153 O  OG  . SER A 1 2  ? 15.797  2.232   -1.816  1.00 0.00 ? 2  SER A OG  3  
ATOM   1154 N  N   . GLU A 1 3  ? 14.618  -1.665  -0.520  1.00 0.00 ? 3  GLU A N   3  
ATOM   1155 C  CA  . GLU A 1 3  ? 13.958  -2.884  -0.059  1.00 0.00 ? 3  GLU A CA  3  
ATOM   1156 C  C   . GLU A 1 3  ? 13.212  -3.671  -1.158  1.00 0.00 ? 3  GLU A C   3  
ATOM   1157 O  O   . GLU A 1 3  ? 12.799  -3.096  -2.169  1.00 0.00 ? 3  GLU A O   3  
ATOM   1158 C  CB  . GLU A 1 3  ? 13.023  -2.498  1.107   1.00 0.00 ? 3  GLU A CB  3  
ATOM   1159 C  CG  . GLU A 1 3  ? 13.748  -1.771  2.256   1.00 0.00 ? 3  GLU A CG  3  
ATOM   1160 C  CD  . GLU A 1 3  ? 13.623  -0.252  2.194   1.00 0.00 ? 3  GLU A CD  3  
ATOM   1161 O  OE1 . GLU A 1 3  ? 13.731  0.291   1.075   1.00 0.00 ? 3  GLU A OE1 3  
ATOM   1162 O  OE2 . GLU A 1 3  ? 13.428  0.366   3.260   1.00 0.00 ? 3  GLU A OE2 3  
ATOM   1163 N  N   . PRO A 1 4  ? 13.037  -4.997  -0.987  1.00 0.00 ? 4  PRO A N   3  
ATOM   1164 C  CA  . PRO A 1 4  ? 12.320  -5.833  -1.942  1.00 0.00 ? 4  PRO A CA  3  
ATOM   1165 C  C   . PRO A 1 4  ? 10.845  -5.438  -2.026  1.00 0.00 ? 4  PRO A C   3  
ATOM   1166 O  O   . PRO A 1 4  ? 10.260  -5.000  -1.040  1.00 0.00 ? 4  PRO A O   3  
ATOM   1167 C  CB  . PRO A 1 4  ? 12.476  -7.275  -1.441  1.00 0.00 ? 4  PRO A CB  3  
ATOM   1168 C  CG  . PRO A 1 4  ? 12.731  -7.110  0.054   1.00 0.00 ? 4  PRO A CG  3  
ATOM   1169 C  CD  . PRO A 1 4  ? 13.514  -5.801  0.129   1.00 0.00 ? 4  PRO A CD  3  
ATOM   1170 N  N   . ARG A 1 5  ? 10.247  -5.596  -3.209  1.00 0.00 ? 5  ARG A N   3  
ATOM   1171 C  CA  . ARG A 1 5  ? 8.860   -5.273  -3.477  1.00 0.00 ? 5  ARG A CA  3  
ATOM   1172 C  C   . ARG A 1 5  ? 7.922   -6.134  -2.620  1.00 0.00 ? 5  ARG A C   3  
ATOM   1173 O  O   . ARG A 1 5  ? 8.112   -7.345  -2.524  1.00 0.00 ? 5  ARG A O   3  
ATOM   1174 C  CB  . ARG A 1 5  ? 8.648   -5.534  -4.971  1.00 0.00 ? 5  ARG A CB  3  
ATOM   1175 C  CG  . ARG A 1 5  ? 9.459   -4.566  -5.800  1.00 0.00 ? 5  ARG A CG  3  
ATOM   1176 C  CD  . ARG A 1 5  ? 9.536   -5.162  -7.201  1.00 0.00 ? 5  ARG A CD  3  
ATOM   1177 N  NE  . ARG A 1 5  ? 10.665  -4.534  -7.843  1.00 0.00 ? 5  ARG A NE  3  
ATOM   1178 C  CZ  . ARG A 1 5  ? 10.601  -3.667  -8.863  1.00 0.00 ? 5  ARG A CZ  3  
ATOM   1179 N  NH1 . ARG A 1 5  ? 9.627   -3.753  -9.768  1.00 0.00 ? 5  ARG A NH1 3  
ATOM   1180 N  NH2 . ARG A 1 5  ? 11.504  -2.697  -8.960  1.00 0.00 ? 5  ARG A NH2 3  
ATOM   1181 N  N   . ALA A 1 6  ? 6.928   -5.499  -1.995  1.00 0.00 ? 6  ALA A N   3  
ATOM   1182 C  CA  . ALA A 1 6  ? 6.014   -6.112  -1.047  1.00 0.00 ? 6  ALA A CA  3  
ATOM   1183 C  C   . ALA A 1 6  ? 5.153   -7.196  -1.692  1.00 0.00 ? 6  ALA A C   3  
ATOM   1184 O  O   . ALA A 1 6  ? 4.740   -7.087  -2.849  1.00 0.00 ? 6  ALA A O   3  
ATOM   1185 C  CB  . ALA A 1 6  ? 5.130   -5.027  -0.427  1.00 0.00 ? 6  ALA A CB  3  
ATOM   1186 N  N   . GLU A 1 7  ? 4.859   -8.230  -0.910  1.00 0.00 ? 7  GLU A N   3  
ATOM   1187 C  CA  . GLU A 1 7  ? 4.033   -9.348  -1.298  1.00 0.00 ? 7  GLU A CA  3  
ATOM   1188 C  C   . GLU A 1 7  ? 2.587   -8.894  -1.287  1.00 0.00 ? 7  GLU A C   3  
ATOM   1189 O  O   . GLU A 1 7  ? 2.174   -8.187  -0.369  1.00 0.00 ? 7  GLU A O   3  
ATOM   1190 C  CB  . GLU A 1 7  ? 4.171   -10.506 -0.310  1.00 0.00 ? 7  GLU A CB  3  
ATOM   1191 C  CG  . GLU A 1 7  ? 5.608   -10.710 0.172   1.00 0.00 ? 7  GLU A CG  3  
ATOM   1192 C  CD  . GLU A 1 7  ? 5.876   -9.943  1.464   1.00 0.00 ? 7  GLU A CD  3  
ATOM   1193 O  OE1 . GLU A 1 7  ? 6.096   -8.718  1.391   1.00 0.00 ? 7  GLU A OE1 3  
ATOM   1194 O  OE2 . GLU A 1 7  ? 5.751   -10.508 2.568   1.00 0.00 ? 7  GLU A OE2 3  
ATOM   1195 N  N   . ASP A 1 8  ? 1.800   -9.382  -2.237  1.00 0.00 ? 8  ASP A N   3  
ATOM   1196 C  CA  . ASP A 1 8  ? 0.362   -9.293  -2.142  1.00 0.00 ? 8  ASP A CA  3  
ATOM   1197 C  C   . ASP A 1 8  ? -0.037  -10.092 -0.904  1.00 0.00 ? 8  ASP A C   3  
ATOM   1198 O  O   . ASP A 1 8  ? 0.316   -11.263 -0.774  1.00 0.00 ? 8  ASP A O   3  
ATOM   1199 C  CB  . ASP A 1 8  ? -0.257  -9.826  -3.432  1.00 0.00 ? 8  ASP A CB  3  
ATOM   1200 C  CG  . ASP A 1 8  ? -0.147  -8.783  -4.530  1.00 0.00 ? 8  ASP A CG  3  
ATOM   1201 O  OD1 . ASP A 1 8  ? -0.983  -7.856  -4.526  1.00 0.00 ? 8  ASP A OD1 3  
ATOM   1202 O  OD2 . ASP A 1 8  ? 0.834   -8.865  -5.302  1.00 0.00 ? 8  ASP A OD2 3  
ATOM   1203 N  N   . GLY A 1 9  ? -0.679  -9.426  0.050   1.00 0.00 ? 9  GLY A N   3  
ATOM   1204 C  CA  . GLY A 1 9  ? -0.983  -9.983  1.349   1.00 0.00 ? 9  GLY A CA  3  
ATOM   1205 C  C   . GLY A 1 9  ? 0.236   -10.069 2.274   1.00 0.00 ? 9  GLY A C   3  
ATOM   1206 O  O   . GLY A 1 9  ? 0.211   -10.887 3.190   1.00 0.00 ? 9  GLY A O   3  
ATOM   1207 N  N   . HIS A 1 10 ? 1.264   -9.216  2.106   1.00 0.00 ? 10 HIS A N   3  
ATOM   1208 C  CA  . HIS A 1 10 ? 2.329   -9.047  3.100   1.00 0.00 ? 10 HIS A CA  3  
ATOM   1209 C  C   . HIS A 1 10 ? 1.748   -8.996  4.514   1.00 0.00 ? 10 HIS A C   3  
ATOM   1210 O  O   . HIS A 1 10 ? 2.146   -9.755  5.393   1.00 0.00 ? 10 HIS A O   3  
ATOM   1211 C  CB  . HIS A 1 10 ? 3.107   -7.748  2.841   1.00 0.00 ? 10 HIS A CB  3  
ATOM   1212 C  CG  . HIS A 1 10 ? 4.192   -7.489  3.865   1.00 0.00 ? 10 HIS A CG  3  
ATOM   1213 N  ND1 . HIS A 1 10 ? 5.373   -8.200  3.975   1.00 0.00 ? 10 HIS A ND1 3  
ATOM   1214 C  CD2 . HIS A 1 10 ? 4.163   -6.558  4.872   1.00 0.00 ? 10 HIS A CD2 3  
ATOM   1215 C  CE1 . HIS A 1 10 ? 6.058   -7.695  5.016   1.00 0.00 ? 10 HIS A CE1 3  
ATOM   1216 N  NE2 . HIS A 1 10 ? 5.346   -6.700  5.577   1.00 0.00 ? 10 HIS A NE2 3  
ATOM   1217 N  N   . ALA A 1 11 ? 0.818   -8.062  4.716   1.00 0.00 ? 11 ALA A N   3  
ATOM   1218 C  CA  . ALA A 1 11 ? 0.051   -7.910  5.939   1.00 0.00 ? 11 ALA A CA  3  
ATOM   1219 C  C   . ALA A 1 11 ? -1.135  -6.989  5.651   1.00 0.00 ? 11 ALA A C   3  
ATOM   1220 O  O   . ALA A 1 11 ? -1.196  -6.373  4.586   1.00 0.00 ? 11 ALA A O   3  
ATOM   1221 C  CB  . ALA A 1 11 ? 0.945   -7.347  7.049   1.00 0.00 ? 11 ALA A CB  3  
ATOM   1222 N  N   . HIS A 1 12 ? -2.070  -6.898  6.607   1.00 0.00 ? 12 HIS A N   3  
ATOM   1223 C  CA  . HIS A 1 12 ? -3.200  -5.967  6.607   1.00 0.00 ? 12 HIS A CA  3  
ATOM   1224 C  C   . HIS A 1 12 ? -3.946  -5.916  5.266   1.00 0.00 ? 12 HIS A C   3  
ATOM   1225 O  O   . HIS A 1 12 ? -4.354  -4.838  4.829   1.00 0.00 ? 12 HIS A O   3  
ATOM   1226 C  CB  . HIS A 1 12 ? -2.717  -4.563  6.978   1.00 0.00 ? 12 HIS A CB  3  
ATOM   1227 C  CG  . HIS A 1 12 ? -1.888  -4.448  8.231   1.00 0.00 ? 12 HIS A CG  3  
ATOM   1228 N  ND1 . HIS A 1 12 ? -2.357  -4.007  9.457   1.00 0.00 ? 12 HIS A ND1 3  
ATOM   1229 C  CD2 . HIS A 1 12 ? -0.522  -4.385  8.257   1.00 0.00 ? 12 HIS A CD2 3  
ATOM   1230 C  CE1 . HIS A 1 12 ? -1.291  -3.651  10.198  1.00 0.00 ? 12 HIS A CE1 3  
ATOM   1231 N  NE2 . HIS A 1 12 ? -0.178  -3.863  9.482   1.00 0.00 ? 12 HIS A NE2 3  
ATOM   1232 N  N   . ASP A 1 13 ? -4.140  -7.076  4.639   1.00 0.00 ? 13 ASP A N   3  
ATOM   1233 C  CA  . ASP A 1 13 ? -4.867  -7.228  3.385   1.00 0.00 ? 13 ASP A CA  3  
ATOM   1234 C  C   . ASP A 1 13 ? -4.262  -6.366  2.268   1.00 0.00 ? 13 ASP A C   3  
ATOM   1235 O  O   . ASP A 1 13 ? -4.987  -5.898  1.390   1.00 0.00 ? 13 ASP A O   3  
ATOM   1236 C  CB  . ASP A 1 13 ? -6.370  -6.950  3.558   1.00 0.00 ? 13 ASP A CB  3  
ATOM   1237 C  CG  . ASP A 1 13 ? -6.952  -7.377  4.895   1.00 0.00 ? 13 ASP A CG  3  
ATOM   1238 O  OD1 . ASP A 1 13 ? -6.562  -8.448  5.403   1.00 0.00 ? 13 ASP A OD1 3  
ATOM   1239 O  OD2 . ASP A 1 13 ? -7.810  -6.598  5.371   1.00 0.00 ? 13 ASP A OD2 3  
ATOM   1240 N  N   . TYR A 1 14 ? -2.946  -6.129  2.306   1.00 0.00 ? 14 TYR A N   3  
ATOM   1241 C  CA  . TYR A 1 14 ? -2.294  -5.315  1.295   1.00 0.00 ? 14 TYR A CA  3  
ATOM   1242 C  C   . TYR A 1 14 ? -2.411  -5.958  -0.087  1.00 0.00 ? 14 TYR A C   3  
ATOM   1243 O  O   . TYR A 1 14 ? -2.241  -7.167  -0.218  1.00 0.00 ? 14 TYR A O   3  
ATOM   1244 C  CB  . TYR A 1 14 ? -0.833  -5.056  1.670   1.00 0.00 ? 14 TYR A CB  3  
ATOM   1245 C  CG  . TYR A 1 14 ? 0.016   -4.484  0.548   1.00 0.00 ? 14 TYR A CG  3  
ATOM   1246 C  CD1 . TYR A 1 14 ? 0.000   -3.108  0.266   1.00 0.00 ? 14 TYR A CD1 3  
ATOM   1247 C  CD2 . TYR A 1 14 ? 0.734   -5.351  -0.289  1.00 0.00 ? 14 TYR A CD2 3  
ATOM   1248 C  CE1 . TYR A 1 14 ? 0.735   -2.603  -0.815  1.00 0.00 ? 14 TYR A CE1 3  
ATOM   1249 C  CE2 . TYR A 1 14 ? 1.535   -4.839  -1.324  1.00 0.00 ? 14 TYR A CE2 3  
ATOM   1250 C  CZ  . TYR A 1 14 ? 1.560   -3.453  -1.564  1.00 0.00 ? 14 TYR A CZ  3  
ATOM   1251 O  OH  . TYR A 1 14 ? 2.419   -2.930  -2.483  1.00 0.00 ? 14 TYR A OH  3  
ATOM   1252 N  N   . VAL A 1 15 ? -2.652  -5.138  -1.109  1.00 0.00 ? 15 VAL A N   3  
ATOM   1253 C  CA  . VAL A 1 15 ? -2.651  -5.528  -2.511  1.00 0.00 ? 15 VAL A CA  3  
ATOM   1254 C  C   . VAL A 1 15 ? -1.671  -4.622  -3.247  1.00 0.00 ? 15 VAL A C   3  
ATOM   1255 O  O   . VAL A 1 15 ? -1.582  -3.429  -2.943  1.00 0.00 ? 15 VAL A O   3  
ATOM   1256 C  CB  . VAL A 1 15 ? -4.071  -5.428  -3.100  1.00 0.00 ? 15 VAL A CB  3  
ATOM   1257 C  CG1 . VAL A 1 15 ? -4.950  -6.540  -2.518  1.00 0.00 ? 15 VAL A CG1 3  
ATOM   1258 C  CG2 . VAL A 1 15 ? -4.720  -4.066  -2.805  1.00 0.00 ? 15 VAL A CG2 3  
ATOM   1259 N  N   . ASN A 1 16 ? -0.923  -5.182  -4.202  1.00 0.00 ? 16 ASN A N   3  
ATOM   1260 C  CA  . ASN A 1 16 ? 0.015   -4.451  -5.024  1.00 0.00 ? 16 ASN A CA  3  
ATOM   1261 C  C   . ASN A 1 16 ? -0.684  -3.493  -5.983  1.00 0.00 ? 16 ASN A C   3  
ATOM   1262 O  O   . ASN A 1 16 ? -0.077  -2.511  -6.410  1.00 0.00 ? 16 ASN A O   3  
ATOM   1263 C  CB  . ASN A 1 16 ? 1.002   -5.375  -5.747  1.00 0.00 ? 16 ASN A CB  3  
ATOM   1264 C  CG  . ASN A 1 16 ? 2.218   -5.642  -4.874  1.00 0.00 ? 16 ASN A CG  3  
ATOM   1265 O  OD1 . ASN A 1 16 ? 2.890   -4.713  -4.438  1.00 0.00 ? 16 ASN A OD1 3  
ATOM   1266 N  ND2 . ASN A 1 16 ? 2.523   -6.892  -4.595  1.00 0.00 ? 16 ASN A ND2 3  
ATOM   1267 N  N   . GLU A 1 17 ? -1.946  -3.772  -6.324  1.00 0.00 ? 17 GLU A N   3  
ATOM   1268 C  CA  . GLU A 1 17 ? -2.824  -2.889  -7.057  1.00 0.00 ? 17 GLU A CA  3  
ATOM   1269 C  C   . GLU A 1 17 ? -4.008  -2.555  -6.164  1.00 0.00 ? 17 GLU A C   3  
ATOM   1270 O  O   . GLU A 1 17 ? -4.700  -3.453  -5.701  1.00 0.00 ? 17 GLU A O   3  
ATOM   1271 C  CB  . GLU A 1 17 ? -3.291  -3.600  -8.328  1.00 0.00 ? 17 GLU A CB  3  
ATOM   1272 C  CG  . GLU A 1 17 ? -3.765  -2.574  -9.353  1.00 0.00 ? 17 GLU A CG  3  
ATOM   1273 C  CD  . GLU A 1 17 ? -5.217  -2.224  -9.165  1.00 0.00 ? 17 GLU A CD  3  
ATOM   1274 O  OE1 . GLU A 1 17 ? -6.015  -3.176  -9.080  1.00 0.00 ? 17 GLU A OE1 3  
ATOM   1275 O  OE2 . GLU A 1 17 ? -5.490  -1.013  -9.019  1.00 0.00 ? 17 GLU A OE2 3  
ATOM   1276 N  N   . ALA A 1 18 ? -4.227  -1.267  -5.920  1.00 0.00 ? 18 ALA A N   3  
ATOM   1277 C  CA  . ALA A 1 18 ? -5.303  -0.780  -5.080  1.00 0.00 ? 18 ALA A CA  3  
ATOM   1278 C  C   . ALA A 1 18 ? -6.644  -1.368  -5.500  1.00 0.00 ? 18 ALA A C   3  
ATOM   1279 O  O   . ALA A 1 18 ? -7.406  -1.854  -4.662  1.00 0.00 ? 18 ALA A O   3  
ATOM   1280 C  CB  . ALA A 1 18 ? -5.339  0.748   -5.136  1.00 0.00 ? 18 ALA A CB  3  
ATOM   1281 N  N   . ALA A 1 19 ? -6.950  -1.311  -6.797  1.00 0.00 ? 19 ALA A N   3  
ATOM   1282 C  CA  . ALA A 1 19 ? -8.260  -1.733  -7.271  1.00 0.00 ? 19 ALA A CA  3  
ATOM   1283 C  C   . ALA A 1 19 ? -8.498  -3.235  -7.097  1.00 0.00 ? 19 ALA A C   3  
ATOM   1284 O  O   . ALA A 1 19 ? -9.662  -3.621  -6.967  1.00 0.00 ? 19 ALA A O   3  
ATOM   1285 C  CB  . ALA A 1 19 ? -8.552  -1.256  -8.693  1.00 0.00 ? 19 ALA A CB  3  
ATOM   1286 N  N   . ASP A 1 20 ? -7.450  -4.072  -7.006  1.00 0.00 ? 20 ASP A N   3  
ATOM   1287 C  CA  . ASP A 1 20 ? -7.606  -5.465  -6.576  1.00 0.00 ? 20 ASP A CA  3  
ATOM   1288 C  C   . ASP A 1 20 ? -8.532  -5.550  -5.359  1.00 0.00 ? 20 ASP A C   3  
ATOM   1289 O  O   . ASP A 1 20 ? -9.459  -6.357  -5.295  1.00 0.00 ? 20 ASP A O   3  
ATOM   1290 C  CB  . ASP A 1 20 ? -6.267  -6.098  -6.198  1.00 0.00 ? 20 ASP A CB  3  
ATOM   1291 C  CG  . ASP A 1 20 ? -6.426  -7.604  -6.035  1.00 0.00 ? 20 ASP A CG  3  
ATOM   1292 O  OD1 . ASP A 1 20 ? -6.313  -8.301  -7.066  1.00 0.00 ? 20 ASP A OD1 3  
ATOM   1293 O  OD2 . ASP A 1 20 ? -6.683  -8.029  -4.888  1.00 0.00 ? 20 ASP A OD2 3  
ATOM   1294 N  N   . ALA A 1 21 ? -8.313  -4.637  -4.409  1.00 0.00 ? 21 ALA A N   3  
ATOM   1295 C  CA  . ALA A 1 21 ? -9.029  -4.635  -3.144  1.00 0.00 ? 21 ALA A CA  3  
ATOM   1296 C  C   . ALA A 1 21 ? -10.427 -4.029  -3.260  1.00 0.00 ? 21 ALA A C   3  
ATOM   1297 O  O   . ALA A 1 21 ? -11.087 -3.858  -2.240  1.00 0.00 ? 21 ALA A O   3  
ATOM   1298 C  CB  . ALA A 1 21 ? -8.200  -3.936  -2.062  1.00 0.00 ? 21 ALA A CB  3  
ATOM   1299 N  N   . SER A 1 22 ? -10.944 -3.759  -4.465  1.00 0.00 ? 22 SER A N   3  
ATOM   1300 C  CA  . SER A 1 22 ? -12.258 -3.144  -4.631  1.00 0.00 ? 22 SER A CA  3  
ATOM   1301 C  C   . SER A 1 22 ? -13.433 -4.047  -4.246  1.00 0.00 ? 22 SER A C   3  
ATOM   1302 O  O   . SER A 1 22 ? -14.581 -3.611  -4.311  1.00 0.00 ? 22 SER A O   3  
ATOM   1303 C  CB  . SER A 1 22 ? -12.412 -2.578  -6.049  1.00 0.00 ? 22 SER A CB  3  
ATOM   1304 O  OG  . SER A 1 22 ? -13.586 -1.792  -6.137  1.00 0.00 ? 22 SER A OG  3  
ATOM   1305 N  N   . GLY A 1 23 ? -13.154 -5.279  -3.829  1.00 0.00 ? 23 GLY A N   3  
ATOM   1306 C  CA  . GLY A 1 23 ? -14.123 -6.180  -3.214  1.00 0.00 ? 23 GLY A CA  3  
ATOM   1307 C  C   . GLY A 1 23 ? -14.145 -6.037  -1.688  1.00 0.00 ? 23 GLY A C   3  
ATOM   1308 O  O   . GLY A 1 23 ? -15.057 -6.532  -1.030  1.00 0.00 ? 23 GLY A O   3  
ATOM   1309 N  N   . HIS A 1 24 ? -13.128 -5.397  -1.106  1.00 0.00 ? 24 HIS A N   3  
ATOM   1310 C  CA  . HIS A 1 24 ? -12.919 -5.322  0.329   1.00 0.00 ? 24 HIS A CA  3  
ATOM   1311 C  C   . HIS A 1 24 ? -13.806 -4.221  0.923   1.00 0.00 ? 24 HIS A C   3  
ATOM   1312 O  O   . HIS A 1 24 ? -13.517 -3.051  0.683   1.00 0.00 ? 24 HIS A O   3  
ATOM   1313 C  CB  . HIS A 1 24 ? -11.436 -4.991  0.571   1.00 0.00 ? 24 HIS A CB  3  
ATOM   1314 C  CG  . HIS A 1 24 ? -10.919 -5.249  1.965   1.00 0.00 ? 24 HIS A CG  3  
ATOM   1315 N  ND1 . HIS A 1 24 ? -11.557 -4.948  3.157   1.00 0.00 ? 24 HIS A ND1 3  
ATOM   1316 C  CD2 . HIS A 1 24 ? -9.663  -5.703  2.266   1.00 0.00 ? 24 HIS A CD2 3  
ATOM   1317 C  CE1 . HIS A 1 24 ? -10.700 -5.204  4.160   1.00 0.00 ? 24 HIS A CE1 3  
ATOM   1318 N  NE2 . HIS A 1 24 ? -9.555  -5.677  3.642   1.00 0.00 ? 24 HIS A NE2 3  
ATOM   1319 N  N   . PRO A 1 25 ? -14.804 -4.513  1.773   1.00 0.00 ? 25 PRO A N   3  
ATOM   1320 C  CA  . PRO A 1 25 ? -15.418 -3.460  2.569   1.00 0.00 ? 25 PRO A CA  3  
ATOM   1321 C  C   . PRO A 1 25 ? -14.323 -2.881  3.473   1.00 0.00 ? 25 PRO A C   3  
ATOM   1322 O  O   . PRO A 1 25 ? -13.708 -3.644  4.216   1.00 0.00 ? 25 PRO A O   3  
ATOM   1323 C  CB  . PRO A 1 25 ? -16.542 -4.139  3.356   1.00 0.00 ? 25 PRO A CB  3  
ATOM   1324 C  CG  . PRO A 1 25 ? -16.079 -5.593  3.469   1.00 0.00 ? 25 PRO A CG  3  
ATOM   1325 C  CD  . PRO A 1 25 ? -15.294 -5.824  2.177   1.00 0.00 ? 25 PRO A CD  3  
ATOM   1326 N  N   . ARG A 1 26 ? -14.018 -1.586  3.315   1.00 0.00 ? 26 ARG A N   3  
ATOM   1327 C  CA  . ARG A 1 26 ? -12.881 -0.826  3.856   1.00 0.00 ? 26 ARG A CA  3  
ATOM   1328 C  C   . ARG A 1 26 ? -12.143 -0.155  2.699   1.00 0.00 ? 26 ARG A C   3  
ATOM   1329 O  O   . ARG A 1 26 ? -11.665 0.974   2.845   1.00 0.00 ? 26 ARG A O   3  
ATOM   1330 C  CB  . ARG A 1 26 ? -11.896 -1.660  4.699   1.00 0.00 ? 26 ARG A CB  3  
ATOM   1331 C  CG  . ARG A 1 26 ? -10.617 -0.947  5.153   1.00 0.00 ? 26 ARG A CG  3  
ATOM   1332 C  CD  . ARG A 1 26 ? -10.824 0.373   5.901   1.00 0.00 ? 26 ARG A CD  3  
ATOM   1333 N  NE  . ARG A 1 26 ? -9.554  1.114   5.970   1.00 0.00 ? 26 ARG A NE  3  
ATOM   1334 C  CZ  . ARG A 1 26 ? -9.215  2.190   5.243   1.00 0.00 ? 26 ARG A CZ  3  
ATOM   1335 N  NH1 . ARG A 1 26 ? -9.928  2.572   4.174   1.00 0.00 ? 26 ARG A NH1 3  
ATOM   1336 N  NH2 . ARG A 1 26 ? -8.137  2.892   5.592   1.00 0.00 ? 26 ARG A NH2 3  
ATOM   1337 N  N   . TYR A 1 27 ? -12.037 -0.844  1.557   1.00 0.00 ? 27 TYR A N   3  
ATOM   1338 C  CA  . TYR A 1 27 ? -11.582 -0.199  0.340   1.00 0.00 ? 27 TYR A CA  3  
ATOM   1339 C  C   . TYR A 1 27 ? -12.609 0.853   -0.060  1.00 0.00 ? 27 TYR A C   3  
ATOM   1340 O  O   . TYR A 1 27 ? -13.798 0.747   0.238   1.00 0.00 ? 27 TYR A O   3  
ATOM   1341 C  CB  . TYR A 1 27 ? -11.251 -1.196  -0.781  1.00 0.00 ? 27 TYR A CB  3  
ATOM   1342 C  CG  . TYR A 1 27 ? -10.538 -0.544  -1.959  1.00 0.00 ? 27 TYR A CG  3  
ATOM   1343 C  CD1 . TYR A 1 27 ? -9.151  -0.340  -1.880  1.00 0.00 ? 27 TYR A CD1 3  
ATOM   1344 C  CD2 . TYR A 1 27 ? -11.254 0.048   -3.015  1.00 0.00 ? 27 TYR A CD2 3  
ATOM   1345 C  CE1 . TYR A 1 27 ? -8.527  0.633   -2.679  1.00 0.00 ? 27 TYR A CE1 3  
ATOM   1346 C  CE2 . TYR A 1 27 ? -10.597 0.919   -3.905  1.00 0.00 ? 27 TYR A CE2 3  
ATOM   1347 C  CZ  . TYR A 1 27 ? -9.262  1.300   -3.670  1.00 0.00 ? 27 TYR A CZ  3  
ATOM   1348 O  OH  . TYR A 1 27 ? -8.705  2.360   -4.333  1.00 0.00 ? 27 TYR A OH  3  
ATOM   1349 N  N   . GLN A 1 28 ? -12.085 1.902   -0.675  1.00 0.00 ? 28 GLN A N   3  
ATOM   1350 C  CA  . GLN A 1 28 ? -12.776 3.096   -1.116  1.00 0.00 ? 28 GLN A CA  3  
ATOM   1351 C  C   . GLN A 1 28 ? -11.927 3.638   -2.257  1.00 0.00 ? 28 GLN A C   3  
ATOM   1352 O  O   . GLN A 1 28 ? -10.697 3.683   -2.143  1.00 0.00 ? 28 GLN A O   3  
ATOM   1353 C  CB  . GLN A 1 28 ? -12.926 4.079   0.055   1.00 0.00 ? 28 GLN A CB  3  
ATOM   1354 C  CG  . GLN A 1 28 ? -13.799 5.308   -0.235  1.00 0.00 ? 28 GLN A CG  3  
ATOM   1355 C  CD  . GLN A 1 28 ? -13.056 6.338   -1.076  1.00 0.00 ? 28 GLN A CD  3  
ATOM   1356 O  OE1 . GLN A 1 28 ? -12.053 6.891   -0.638  1.00 0.00 ? 28 GLN A OE1 3  
ATOM   1357 N  NE2 . GLN A 1 28 ? -13.510 6.561   -2.299  1.00 0.00 ? 28 GLN A NE2 3  
ATOM   1358 N  N   . GLU A 1 29 ? -12.603 3.958   -3.354  1.00 0.00 ? 29 GLU A N   3  
ATOM   1359 C  CA  . GLU A 1 29 ? -12.047 4.266   -4.652  1.00 0.00 ? 29 GLU A CA  3  
ATOM   1360 C  C   . GLU A 1 29 ? -11.149 5.502   -4.626  1.00 0.00 ? 29 GLU A C   3  
ATOM   1361 O  O   . GLU A 1 29 ? -11.540 6.582   -4.183  1.00 0.00 ? 29 GLU A O   3  
ATOM   1362 C  CB  . GLU A 1 29 ? -13.121 4.246   -5.744  1.00 0.00 ? 29 GLU A CB  3  
ATOM   1363 C  CG  . GLU A 1 29 ? -14.256 5.225   -5.472  1.00 0.00 ? 29 GLU A CG  3  
ATOM   1364 C  CD  . GLU A 1 29 ? -15.359 4.662   -4.583  1.00 0.00 ? 29 GLU A CD  3  
ATOM   1365 O  OE1 . GLU A 1 29 ? -15.165 4.732   -3.347  1.00 0.00 ? 29 GLU A OE1 3  
ATOM   1366 O  OE2 . GLU A 1 29 ? -16.348 4.152   -5.145  1.00 0.00 ? 29 GLU A OE2 3  
ATOM   1367 N  N   . GLY A 1 30 ? -9.914  5.323   -5.094  1.00 0.00 ? 30 GLY A N   3  
ATOM   1368 C  CA  . GLY A 1 30 ? -8.943  6.392   -5.198  1.00 0.00 ? 30 GLY A CA  3  
ATOM   1369 C  C   . GLY A 1 30 ? -7.863  6.265   -4.133  1.00 0.00 ? 30 GLY A C   3  
ATOM   1370 O  O   . GLY A 1 30 ? -6.755  6.741   -4.355  1.00 0.00 ? 30 GLY A O   3  
ATOM   1371 N  N   . GLN A 1 31 ? -8.143  5.614   -2.995  1.00 0.00 ? 31 GLN A N   3  
ATOM   1372 C  CA  . GLN A 1 31 ? -7.099  5.357   -2.018  1.00 0.00 ? 31 GLN A CA  3  
ATOM   1373 C  C   . GLN A 1 31 ? -6.010  4.505   -2.689  1.00 0.00 ? 31 GLN A C   3  
ATOM   1374 O  O   . GLN A 1 31 ? -6.310  3.396   -3.139  1.00 0.00 ? 31 GLN A O   3  
ATOM   1375 C  CB  . GLN A 1 31 ? -7.680  4.592   -0.823  1.00 0.00 ? 31 GLN A CB  3  
ATOM   1376 C  CG  . GLN A 1 31 ? -8.689  5.319   0.078   1.00 0.00 ? 31 GLN A CG  3  
ATOM   1377 C  CD  . GLN A 1 31 ? -9.218  4.332   1.123   1.00 0.00 ? 31 GLN A CD  3  
ATOM   1378 O  OE1 . GLN A 1 31 ? -9.090  4.479   2.340   1.00 0.00 ? 31 GLN A OE1 3  
ATOM   1379 N  NE2 . GLN A 1 31 ? -9.795  3.248   0.626   1.00 0.00 ? 31 GLN A NE2 3  
ATOM   1380 N  N   . LEU A 1 32 ? -4.780  5.033   -2.751  1.00 0.00 ? 32 LEU A N   3  
ATOM   1381 C  CA  . LEU A 1 32 ? -3.566  4.380   -3.230  1.00 0.00 ? 32 LEU A CA  3  
ATOM   1382 C  C   . LEU A 1 32 ? -2.480  4.623   -2.177  1.00 0.00 ? 32 LEU A C   3  
ATOM   1383 O  O   . LEU A 1 32 ? -2.513  5.650   -1.500  1.00 0.00 ? 32 LEU A O   3  
ATOM   1384 C  CB  . LEU A 1 32 ? -3.101  5.029   -4.548  1.00 0.00 ? 32 LEU A CB  3  
ATOM   1385 C  CG  . LEU A 1 32 ? -3.342  4.210   -5.819  1.00 0.00 ? 32 LEU A CG  3  
ATOM   1386 C  CD1 . LEU A 1 32 ? -4.804  4.114   -6.237  1.00 0.00 ? 32 LEU A CD1 3  
ATOM   1387 C  CD2 . LEU A 1 32 ? -2.612  4.898   -6.978  1.00 0.00 ? 32 LEU A CD2 3  
ATOM   1388 N  N   . CYS A 1 33 ? -1.489  3.738   -2.075  1.00 0.00 ? 33 CYS A N   3  
ATOM   1389 C  CA  . CYS A 1 33 ? -0.322  3.927   -1.220  1.00 0.00 ? 33 CYS A CA  3  
ATOM   1390 C  C   . CYS A 1 33 ? 0.295   5.320   -1.419  1.00 0.00 ? 33 CYS A C   3  
ATOM   1391 O  O   . CYS A 1 33 ? 0.456   6.061   -0.456  1.00 0.00 ? 33 CYS A O   3  
ATOM   1392 C  CB  . CYS A 1 33 ? 0.668   2.817   -1.454  1.00 0.00 ? 33 CYS A CB  3  
ATOM   1393 S  SG  . CYS A 1 33 ? 0.114   1.274   -0.665  1.00 0.00 ? 33 CYS A SG  3  
ATOM   1394 N  N   . GLU A 1 34 ? 0.552   5.766   -2.653  1.00 0.00 ? 34 GLU A N   3  
ATOM   1395 C  CA  . GLU A 1 34 ? 1.051   7.134   -2.840  1.00 0.00 ? 34 GLU A CA  3  
ATOM   1396 C  C   . GLU A 1 34 ? -0.045  8.217   -2.706  1.00 0.00 ? 34 GLU A C   3  
ATOM   1397 O  O   . GLU A 1 34 ? 0.046   9.288   -3.301  1.00 0.00 ? 34 GLU A O   3  
ATOM   1398 C  CB  . GLU A 1 34 ? 1.942   7.221   -4.084  1.00 0.00 ? 34 GLU A CB  3  
ATOM   1399 C  CG  . GLU A 1 34 ? 2.753   8.529   -4.175  1.00 0.00 ? 34 GLU A CG  3  
ATOM   1400 C  CD  . GLU A 1 34 ? 4.177   8.313   -4.677  1.00 0.00 ? 34 GLU A CD  3  
ATOM   1401 O  OE1 . GLU A 1 34 ? 4.316   7.649   -5.725  1.00 0.00 ? 34 GLU A OE1 3  
ATOM   1402 O  OE2 . GLU A 1 34 ? 5.104   8.798   -3.986  1.00 0.00 ? 34 GLU A OE2 3  
ATOM   1403 N  N   . ASN A 1 35 ? -1.067  7.986   -1.871  1.00 0.00 ? 35 ASN A N   3  
ATOM   1404 C  CA  . ASN A 1 35 ? -1.872  9.026   -1.239  1.00 0.00 ? 35 ASN A CA  3  
ATOM   1405 C  C   . ASN A 1 35 ? -2.255  8.619   0.194   1.00 0.00 ? 35 ASN A C   3  
ATOM   1406 O  O   . ASN A 1 35 ? -3.298  9.025   0.707   1.00 0.00 ? 35 ASN A O   3  
ATOM   1407 C  CB  . ASN A 1 35 ? -3.074  9.393   -2.122  1.00 0.00 ? 35 ASN A CB  3  
ATOM   1408 C  CG  . ASN A 1 35 ? -4.087  8.284   -2.342  1.00 0.00 ? 35 ASN A CG  3  
ATOM   1409 O  OD1 . ASN A 1 35 ? -4.576  7.641   -1.422  1.00 0.00 ? 35 ASN A OD1 3  
ATOM   1410 N  ND2 . ASN A 1 35 ? -4.463  8.074   -3.593  1.00 0.00 ? 35 ASN A ND2 3  
ATOM   1411 N  N   . CYS A 1 36 ? -1.386  7.833   0.840   1.00 0.00 ? 36 CYS A N   3  
ATOM   1412 C  CA  . CYS A 1 36 ? -1.572  7.257   2.163   1.00 0.00 ? 36 CYS A CA  3  
ATOM   1413 C  C   . CYS A 1 36 ? -0.764  8.036   3.205   1.00 0.00 ? 36 CYS A C   3  
ATOM   1414 O  O   . CYS A 1 36 ? 0.387   8.395   2.966   1.00 0.00 ? 36 CYS A O   3  
ATOM   1415 C  CB  . CYS A 1 36 ? -1.087  5.839   2.070   1.00 0.00 ? 36 CYS A CB  3  
ATOM   1416 S  SG  . CYS A 1 36 ? -1.309  4.949   3.592   1.00 0.00 ? 36 CYS A SG  3  
ATOM   1417 N  N   . ALA A 1 37 ? -1.331  8.292   4.385   1.00 0.00 ? 37 ALA A N   3  
ATOM   1418 C  CA  . ALA A 1 37 ? -0.629  9.026   5.435   1.00 0.00 ? 37 ALA A CA  3  
ATOM   1419 C  C   . ALA A 1 37 ? 0.541   8.226   6.020   1.00 0.00 ? 37 ALA A C   3  
ATOM   1420 O  O   . ALA A 1 37 ? 1.431   8.797   6.643   1.00 0.00 ? 37 ALA A O   3  
ATOM   1421 C  CB  . ALA A 1 37 ? -1.616  9.440   6.522   1.00 0.00 ? 37 ALA A CB  3  
ATOM   1422 N  N   . PHE A 1 38 ? 0.545   6.906   5.826   1.00 0.00 ? 38 PHE A N   3  
ATOM   1423 C  CA  . PHE A 1 38 ? 1.662   6.038   6.174   1.00 0.00 ? 38 PHE A CA  3  
ATOM   1424 C  C   . PHE A 1 38 ? 2.711   5.989   5.056   1.00 0.00 ? 38 PHE A C   3  
ATOM   1425 O  O   . PHE A 1 38 ? 3.717   5.296   5.218   1.00 0.00 ? 38 PHE A O   3  
ATOM   1426 C  CB  . PHE A 1 38 ? 1.137   4.632   6.499   1.00 0.00 ? 38 PHE A CB  3  
ATOM   1427 C  CG  . PHE A 1 38 ? 0.763   4.350   7.944   1.00 0.00 ? 38 PHE A CG  3  
ATOM   1428 C  CD1 . PHE A 1 38 ? 0.205   5.351   8.760   1.00 0.00 ? 38 PHE A CD1 3  
ATOM   1429 C  CD2 . PHE A 1 38 ? 0.893   3.038   8.439   1.00 0.00 ? 38 PHE A CD2 3  
ATOM   1430 C  CE1 . PHE A 1 38 ? -0.139  5.062   10.093  1.00 0.00 ? 38 PHE A CE1 3  
ATOM   1431 C  CE2 . PHE A 1 38 ? 0.542   2.748   9.769   1.00 0.00 ? 38 PHE A CE2 3  
ATOM   1432 C  CZ  . PHE A 1 38 ? 0.042   3.765   10.602  1.00 0.00 ? 38 PHE A CZ  3  
ATOM   1433 N  N   . TRP A 1 39 ? 2.513   6.697   3.939   1.00 0.00 ? 39 TRP A N   3  
ATOM   1434 C  CA  . TRP A 1 39 ? 3.504   6.734   2.876   1.00 0.00 ? 39 TRP A CA  3  
ATOM   1435 C  C   . TRP A 1 39 ? 4.780   7.435   3.344   1.00 0.00 ? 39 TRP A C   3  
ATOM   1436 O  O   . TRP A 1 39 ? 4.736   8.346   4.169   1.00 0.00 ? 39 TRP A O   3  
ATOM   1437 C  CB  . TRP A 1 39 ? 2.923   7.436   1.646   1.00 0.00 ? 39 TRP A CB  3  
ATOM   1438 C  CG  . TRP A 1 39 ? 3.710   7.323   0.377   1.00 0.00 ? 39 TRP A CG  3  
ATOM   1439 C  CD1 . TRP A 1 39 ? 4.154   8.361   -0.371  1.00 0.00 ? 39 TRP A CD1 3  
ATOM   1440 C  CD2 . TRP A 1 39 ? 4.075   6.116   -0.361  1.00 0.00 ? 39 TRP A CD2 3  
ATOM   1441 N  NE1 . TRP A 1 39 ? 4.741   7.880   -1.520  1.00 0.00 ? 39 TRP A NE1 3  
ATOM   1442 C  CE2 . TRP A 1 39 ? 4.715   6.507   -1.572  1.00 0.00 ? 39 TRP A CE2 3  
ATOM   1443 C  CE3 . TRP A 1 39 ? 3.914   4.731   -0.145  1.00 0.00 ? 39 TRP A CE3 3  
ATOM   1444 C  CZ2 . TRP A 1 39 ? 5.146   5.581   -2.529  1.00 0.00 ? 39 TRP A CZ2 3  
ATOM   1445 C  CZ3 . TRP A 1 39 ? 4.388   3.790   -1.076  1.00 0.00 ? 39 TRP A CZ3 3  
ATOM   1446 C  CH2 . TRP A 1 39 ? 4.959   4.213   -2.287  1.00 0.00 ? 39 TRP A CH2 3  
ATOM   1447 N  N   . GLY A 1 40 ? 5.913   7.006   2.796   1.00 0.00 ? 40 GLY A N   3  
ATOM   1448 C  CA  . GLY A 1 40 ? 7.180   7.707   2.853   1.00 0.00 ? 40 GLY A CA  3  
ATOM   1449 C  C   . GLY A 1 40 ? 7.281   8.570   1.600   1.00 0.00 ? 40 GLY A C   3  
ATOM   1450 O  O   . GLY A 1 40 ? 6.677   9.638   1.532   1.00 0.00 ? 40 GLY A O   3  
ATOM   1451 N  N   . GLU A 1 41 ? 8.013   8.070   0.603   1.00 0.00 ? 41 GLU A N   3  
ATOM   1452 C  CA  . GLU A 1 41 ? 8.180   8.667   -0.710  1.00 0.00 ? 41 GLU A CA  3  
ATOM   1453 C  C   . GLU A 1 41 ? 8.359   7.522   -1.703  1.00 0.00 ? 41 GLU A C   3  
ATOM   1454 O  O   . GLU A 1 41 ? 8.747   6.413   -1.310  1.00 0.00 ? 41 GLU A O   3  
ATOM   1455 C  CB  . GLU A 1 41 ? 9.432   9.561   -0.741  1.00 0.00 ? 41 GLU A CB  3  
ATOM   1456 C  CG  . GLU A 1 41 ? 9.247   10.891  -0.002  1.00 0.00 ? 41 GLU A CG  3  
ATOM   1457 C  CD  . GLU A 1 41 ? 10.502  11.748  -0.105  1.00 0.00 ? 41 GLU A CD  3  
ATOM   1458 O  OE1 . GLU A 1 41 ? 11.515  11.336  0.501   1.00 0.00 ? 41 GLU A OE1 3  
ATOM   1459 O  OE2 . GLU A 1 41 ? 10.430  12.789  -0.793  1.00 0.00 ? 41 GLU A OE2 3  
ATOM   1460 N  N   . ALA A 1 42 ? 8.117   7.804   -2.986  1.00 0.00 ? 42 ALA A N   3  
ATOM   1461 C  CA  . ALA A 1 42 ? 8.522   6.921   -4.063  1.00 0.00 ? 42 ALA A CA  3  
ATOM   1462 C  C   . ALA A 1 42 ? 10.036  6.727   -4.061  1.00 0.00 ? 42 ALA A C   3  
ATOM   1463 O  O   . ALA A 1 42 ? 10.794  7.625   -3.699  1.00 0.00 ? 42 ALA A O   3  
ATOM   1464 C  CB  . ALA A 1 42 ? 8.024   7.430   -5.416  1.00 0.00 ? 42 ALA A CB  3  
ATOM   1465 N  N   . VAL A 1 43 ? 10.456  5.527   -4.456  1.00 0.00 ? 43 VAL A N   3  
ATOM   1466 C  CA  . VAL A 1 43 ? 11.838  5.084   -4.487  1.00 0.00 ? 43 VAL A CA  3  
ATOM   1467 C  C   . VAL A 1 43 ? 12.208  4.744   -5.931  1.00 0.00 ? 43 VAL A C   3  
ATOM   1468 O  O   . VAL A 1 43 ? 13.226  5.213   -6.434  1.00 0.00 ? 43 VAL A O   3  
ATOM   1469 C  CB  . VAL A 1 43 ? 11.987  3.863   -3.564  1.00 0.00 ? 43 VAL A CB  3  
ATOM   1470 C  CG1 . VAL A 1 43 ? 13.374  3.219   -3.693  1.00 0.00 ? 43 VAL A CG1 3  
ATOM   1471 C  CG2 . VAL A 1 43 ? 11.767  4.223   -2.086  1.00 0.00 ? 43 VAL A CG2 3  
ATOM   1472 N  N   . GLN A 1 44 ? 11.407  3.893   -6.581  1.00 0.00 ? 44 GLN A N   3  
ATOM   1473 C  CA  . GLN A 1 44 ? 11.671  3.404   -7.924  1.00 0.00 ? 44 GLN A CA  3  
ATOM   1474 C  C   . GLN A 1 44 ? 10.366  3.154   -8.690  1.00 0.00 ? 44 GLN A C   3  
ATOM   1475 O  O   . GLN A 1 44 ? 9.371   3.816   -8.408  1.00 0.00 ? 44 GLN A O   3  
ATOM   1476 C  CB  . GLN A 1 44 ? 12.647  2.226   -7.856  1.00 0.00 ? 44 GLN A CB  3  
ATOM   1477 C  CG  . GLN A 1 44 ? 12.106  0.995   -7.124  1.00 0.00 ? 44 GLN A CG  3  
ATOM   1478 C  CD  . GLN A 1 44 ? 13.132  -0.135  -7.157  1.00 0.00 ? 44 GLN A CD  3  
ATOM   1479 O  OE1 . GLN A 1 44 ? 13.690  -0.540  -6.139  1.00 0.00 ? 44 GLN A OE1 3  
ATOM   1480 N  NE2 . GLN A 1 44 ? 13.402  -0.656  -8.348  1.00 0.00 ? 44 GLN A NE2 3  
ATOM   1481 N  N   . ASP A 1 45 ? 10.381  2.229   -9.659  1.00 0.00 ? 45 ASP A N   3  
ATOM   1482 C  CA  . ASP A 1 45 ? 9.435   1.994   -10.751 1.00 0.00 ? 45 ASP A CA  3  
ATOM   1483 C  C   . ASP A 1 45 ? 7.990   1.759   -10.296 1.00 0.00 ? 45 ASP A C   3  
ATOM   1484 O  O   . ASP A 1 45 ? 7.425   0.676   -10.436 1.00 0.00 ? 45 ASP A O   3  
ATOM   1485 C  CB  . ASP A 1 45 ? 9.981   0.855   -11.634 1.00 0.00 ? 45 ASP A CB  3  
ATOM   1486 C  CG  . ASP A 1 45 ? 10.404  -0.377  -10.847 1.00 0.00 ? 45 ASP A CG  3  
ATOM   1487 O  OD1 . ASP A 1 45 ? 11.395  -0.273  -10.082 1.00 0.00 ? 45 ASP A OD1 3  
ATOM   1488 O  OD2 . ASP A 1 45 ? 9.775   -1.447  -10.979 1.00 0.00 ? 45 ASP A OD2 3  
ATOM   1489 N  N   . GLY A 1 46 ? 7.382   2.818   -9.771  1.00 0.00 ? 46 GLY A N   3  
ATOM   1490 C  CA  . GLY A 1 46 ? 6.066   2.796   -9.165  1.00 0.00 ? 46 GLY A CA  3  
ATOM   1491 C  C   . GLY A 1 46 ? 6.103   2.059   -7.830  1.00 0.00 ? 46 GLY A C   3  
ATOM   1492 O  O   . GLY A 1 46 ? 5.113   1.453   -7.441  1.00 0.00 ? 46 GLY A O   3  
ATOM   1493 N  N   . TRP A 1 47 ? 7.232   2.106   -7.118  1.00 0.00 ? 47 TRP A N   3  
ATOM   1494 C  CA  . TRP A 1 47 ? 7.403   1.574   -5.788  1.00 0.00 ? 47 TRP A CA  3  
ATOM   1495 C  C   . TRP A 1 47 ? 8.011   2.643   -4.907  1.00 0.00 ? 47 TRP A C   3  
ATOM   1496 O  O   . TRP A 1 47 ? 8.849   3.424   -5.362  1.00 0.00 ? 47 TRP A O   3  
ATOM   1497 C  CB  . TRP A 1 47 ? 8.353   0.388   -5.817  1.00 0.00 ? 47 TRP A CB  3  
ATOM   1498 C  CG  . TRP A 1 47 ? 7.914   -0.767  -6.642  1.00 0.00 ? 47 TRP A CG  3  
ATOM   1499 C  CD1 . TRP A 1 47 ? 8.169   -0.951  -7.952  1.00 0.00 ? 47 TRP A CD1 3  
ATOM   1500 C  CD2 . TRP A 1 47 ? 7.099   -1.892  -6.228  1.00 0.00 ? 47 TRP A CD2 3  
ATOM   1501 N  NE1 . TRP A 1 47 ? 7.507   -2.077  -8.392  1.00 0.00 ? 47 TRP A NE1 3  
ATOM   1502 C  CE2 . TRP A 1 47 ? 6.832   -2.703  -7.366  1.00 0.00 ? 47 TRP A CE2 3  
ATOM   1503 C  CE3 . TRP A 1 47 ? 6.602   -2.335  -4.989  1.00 0.00 ? 47 TRP A CE3 3  
ATOM   1504 C  CZ2 . TRP A 1 47 ? 6.049   -3.862  -7.288  1.00 0.00 ? 47 TRP A CZ2 3  
ATOM   1505 C  CZ3 . TRP A 1 47 ? 5.757   -3.454  -4.911  1.00 0.00 ? 47 TRP A CZ3 3  
ATOM   1506 C  CH2 . TRP A 1 47 ? 5.440   -4.183  -6.070  1.00 0.00 ? 47 TRP A CH2 3  
ATOM   1507 N  N   . GLY A 1 48 ? 7.625   2.634   -3.638  1.00 0.00 ? 48 GLY A N   3  
ATOM   1508 C  CA  . GLY A 1 48 ? 8.106   3.561   -2.651  1.00 0.00 ? 48 GLY A CA  3  
ATOM   1509 C  C   . GLY A 1 48 ? 7.971   2.970   -1.270  1.00 0.00 ? 48 GLY A C   3  
ATOM   1510 O  O   . GLY A 1 48 ? 7.425   1.882   -1.092  1.00 0.00 ? 48 GLY A O   3  
ATOM   1511 N  N   . ARG A 1 49 ? 8.503   3.674   -0.283  1.00 0.00 ? 49 ARG A N   3  
ATOM   1512 C  CA  . ARG A 1 49 ? 8.351   3.218   1.073   1.00 0.00 ? 49 ARG A CA  3  
ATOM   1513 C  C   . ARG A 1 49 ? 6.958   3.555   1.585   1.00 0.00 ? 49 ARG A C   3  
ATOM   1514 O  O   . ARG A 1 49 ? 6.532   4.703   1.513   1.00 0.00 ? 49 ARG A O   3  
ATOM   1515 C  CB  . ARG A 1 49 ? 9.417   3.886   1.906   1.00 0.00 ? 49 ARG A CB  3  
ATOM   1516 C  CG  . ARG A 1 49 ? 10.783  3.411   1.425   1.00 0.00 ? 49 ARG A CG  3  
ATOM   1517 C  CD  . ARG A 1 49 ? 11.844  3.814   2.432   1.00 0.00 ? 49 ARG A CD  3  
ATOM   1518 N  NE  . ARG A 1 49 ? 12.134  2.701   3.357   1.00 0.00 ? 49 ARG A NE  3  
ATOM   1519 C  CZ  . ARG A 1 49 ? 11.517  2.376   4.505   1.00 0.00 ? 49 ARG A CZ  3  
ATOM   1520 N  NH1 . ARG A 1 49 ? 10.639  3.177   5.109   1.00 0.00 ? 49 ARG A NH1 3  
ATOM   1521 N  NH2 . ARG A 1 49 ? 11.781  1.204   5.069   1.00 0.00 ? 49 ARG A NH2 3  
ATOM   1522 N  N   . CYS A 1 50 ? 6.304   2.549   2.152   1.00 0.00 ? 50 CYS A N   3  
ATOM   1523 C  CA  . CYS A 1 50 ? 5.314   2.705   3.203   1.00 0.00 ? 50 CYS A CA  3  
ATOM   1524 C  C   . CYS A 1 50 ? 6.117   2.675   4.512   1.00 0.00 ? 50 CYS A C   3  
ATOM   1525 O  O   . CYS A 1 50 ? 7.292   2.293   4.493   1.00 0.00 ? 50 CYS A O   3  
ATOM   1526 C  CB  . CYS A 1 50 ? 4.321   1.577   3.066   1.00 0.00 ? 50 CYS A CB  3  
ATOM   1527 S  SG  . CYS A 1 50 ? 3.104   1.571   4.395   1.00 0.00 ? 50 CYS A SG  3  
ATOM   1528 N  N   . THR A 1 51 ? 5.554   3.158   5.620   1.00 0.00 ? 51 THR A N   3  
ATOM   1529 C  CA  . THR A 1 51 ? 6.247   3.204   6.903   1.00 0.00 ? 51 THR A CA  3  
ATOM   1530 C  C   . THR A 1 51 ? 5.451   2.471   7.979   1.00 0.00 ? 51 THR A C   3  
ATOM   1531 O  O   . THR A 1 51 ? 4.243   2.274   7.826   1.00 0.00 ? 51 THR A O   3  
ATOM   1532 C  CB  . THR A 1 51 ? 6.477   4.665   7.320   1.00 0.00 ? 51 THR A CB  3  
ATOM   1533 O  OG1 . THR A 1 51 ? 5.238   5.326   7.491   1.00 0.00 ? 51 THR A OG1 3  
ATOM   1534 C  CG2 . THR A 1 51 ? 7.312   5.428   6.287   1.00 0.00 ? 51 THR A CG2 3  
ATOM   1535 N  N   . HIS A 1 52 ? 6.110   2.204   9.114   1.00 0.00 ? 52 HIS A N   3  
ATOM   1536 C  CA  . HIS A 1 52 ? 5.621   1.631   10.369  1.00 0.00 ? 52 HIS A CA  3  
ATOM   1537 C  C   . HIS A 1 52 ? 5.908   0.126   10.366  1.00 0.00 ? 52 HIS A C   3  
ATOM   1538 O  O   . HIS A 1 52 ? 5.387   -0.557  9.489   1.00 0.00 ? 52 HIS A O   3  
ATOM   1539 C  CB  . HIS A 1 52 ? 4.138   1.920   10.666  1.00 0.00 ? 52 HIS A CB  3  
ATOM   1540 C  CG  . HIS A 1 52 ? 3.787   3.391   10.684  1.00 0.00 ? 52 HIS A CG  3  
ATOM   1541 N  ND1 . HIS A 1 52 ? 3.521   4.166   9.574   1.00 0.00 ? 52 HIS A ND1 3  
ATOM   1542 C  CD2 . HIS A 1 52 ? 3.718   4.200   11.786  1.00 0.00 ? 52 HIS A CD2 3  
ATOM   1543 C  CE1 . HIS A 1 52 ? 3.303   5.425   9.984   1.00 0.00 ? 52 HIS A CE1 3  
ATOM   1544 N  NE2 . HIS A 1 52 ? 3.410   5.468   11.327  1.00 0.00 ? 52 HIS A NE2 3  
ATOM   1545 N  N   . PRO A 1 53 ? 6.730   -0.400  11.294  1.00 0.00 ? 53 PRO A N   3  
ATOM   1546 C  CA  . PRO A 1 53 ? 7.062   -1.817  11.376  1.00 0.00 ? 53 PRO A CA  3  
ATOM   1547 C  C   . PRO A 1 53 ? 5.846   -2.735  11.216  1.00 0.00 ? 53 PRO A C   3  
ATOM   1548 O  O   . PRO A 1 53 ? 4.835   -2.522  11.881  1.00 0.00 ? 53 PRO A O   3  
ATOM   1549 C  CB  . PRO A 1 53 ? 7.732   -2.000  12.738  1.00 0.00 ? 53 PRO A CB  3  
ATOM   1550 C  CG  . PRO A 1 53 ? 8.443   -0.662  12.933  1.00 0.00 ? 53 PRO A CG  3  
ATOM   1551 C  CD  . PRO A 1 53 ? 7.467   0.338   12.309  1.00 0.00 ? 53 PRO A CD  3  
ATOM   1552 N  N   . ASP A 1 54 ? 5.983   -3.718  10.321  1.00 0.00 ? 54 ASP A N   3  
ATOM   1553 C  CA  . ASP A 1 54 ? 4.976   -4.595  9.721   1.00 0.00 ? 54 ASP A CA  3  
ATOM   1554 C  C   . ASP A 1 54 ? 4.598   -4.103  8.313   1.00 0.00 ? 54 ASP A C   3  
ATOM   1555 O  O   . ASP A 1 54 ? 4.130   -4.884  7.481   1.00 0.00 ? 54 ASP A O   3  
ATOM   1556 C  CB  . ASP A 1 54 ? 3.812   -4.985  10.653  1.00 0.00 ? 54 ASP A CB  3  
ATOM   1557 C  CG  . ASP A 1 54 ? 2.596   -4.069  10.657  1.00 0.00 ? 54 ASP A CG  3  
ATOM   1558 O  OD1 . ASP A 1 54 ? 2.409   -3.240  9.742   1.00 0.00 ? 54 ASP A OD1 3  
ATOM   1559 O  OD2 . ASP A 1 54 ? 1.687   -4.321  11.476  1.00 0.00 ? 54 ASP A OD2 3  
ATOM   1560 N  N   . PHE A 1 55 ? 4.873   -2.822  8.040   1.00 0.00 ? 55 PHE A N   3  
ATOM   1561 C  CA  . PHE A 1 55 ? 4.705   -2.137  6.769   1.00 0.00 ? 55 PHE A CA  3  
ATOM   1562 C  C   . PHE A 1 55 ? 5.961   -1.348  6.365   1.00 0.00 ? 55 PHE A C   3  
ATOM   1563 O  O   . PHE A 1 55 ? 5.883   -0.533  5.450   1.00 0.00 ? 55 PHE A O   3  
ATOM   1564 C  CB  . PHE A 1 55 ? 3.479   -1.197  6.878   1.00 0.00 ? 55 PHE A CB  3  
ATOM   1565 C  CG  . PHE A 1 55 ? 2.248   -1.689  6.150   1.00 0.00 ? 55 PHE A CG  3  
ATOM   1566 C  CD1 . PHE A 1 55 ? 2.394   -2.215  4.854   1.00 0.00 ? 55 PHE A CD1 3  
ATOM   1567 C  CD2 . PHE A 1 55 ? 0.965   -1.628  6.738   1.00 0.00 ? 55 PHE A CD2 3  
ATOM   1568 C  CE1 . PHE A 1 55 ? 1.360   -2.970  4.286   1.00 0.00 ? 55 PHE A CE1 3  
ATOM   1569 C  CE2 . PHE A 1 55 ? -0.099  -2.277  6.100   1.00 0.00 ? 55 PHE A CE2 3  
ATOM   1570 C  CZ  . PHE A 1 55 ? 0.132   -3.057  4.954   1.00 0.00 ? 55 PHE A CZ  3  
ATOM   1571 N  N   . ASP A 1 56 ? 7.112   -1.576  7.007   1.00 0.00 ? 56 ASP A N   3  
ATOM   1572 C  CA  . ASP A 1 56 ? 8.338   -0.804  6.759   1.00 0.00 ? 56 ASP A CA  3  
ATOM   1573 C  C   . ASP A 1 56 ? 9.396   -1.665  6.059   1.00 0.00 ? 56 ASP A C   3  
ATOM   1574 O  O   . ASP A 1 56 ? 10.164  -1.181  5.232   1.00 0.00 ? 56 ASP A O   3  
ATOM   1575 C  CB  . ASP A 1 56 ? 8.864   -0.227  8.086   1.00 0.00 ? 56 ASP A CB  3  
ATOM   1576 C  CG  . ASP A 1 56 ? 9.299   1.224   7.948   1.00 0.00 ? 56 ASP A CG  3  
ATOM   1577 O  OD1 . ASP A 1 56 ? 10.139  1.499   7.064   1.00 0.00 ? 56 ASP A OD1 3  
ATOM   1578 O  OD2 . ASP A 1 56 ? 8.758   2.059   8.707   1.00 0.00 ? 56 ASP A OD2 3  
ATOM   1579 N  N   . GLU A 1 57 ? 9.432   -2.953  6.416   1.00 0.00 ? 57 GLU A N   3  
ATOM   1580 C  CA  . GLU A 1 57 ? 10.375  -3.969  5.958   1.00 0.00 ? 57 GLU A CA  3  
ATOM   1581 C  C   . GLU A 1 57 ? 10.540  -3.993  4.436   1.00 0.00 ? 57 GLU A C   3  
ATOM   1582 O  O   . GLU A 1 57 ? 11.648  -4.143  3.928   1.00 0.00 ? 57 GLU A O   3  
ATOM   1583 C  CB  . GLU A 1 57 ? 9.930   -5.379  6.400   1.00 0.00 ? 57 GLU A CB  3  
ATOM   1584 C  CG  . GLU A 1 57 ? 9.347   -5.497  7.816   1.00 0.00 ? 57 GLU A CG  3  
ATOM   1585 C  CD  . GLU A 1 57 ? 7.894   -5.047  7.850   1.00 0.00 ? 57 GLU A CD  3  
ATOM   1586 O  OE1 . GLU A 1 57 ? 7.029   -5.796  7.344   1.00 0.00 ? 57 GLU A OE1 3  
ATOM   1587 O  OE2 . GLU A 1 57 ? 7.696   -3.895  8.296   1.00 0.00 ? 57 GLU A OE2 3  
ATOM   1588 N  N   . VAL A 1 58 ? 9.411   -3.961  3.724   1.00 0.00 ? 58 VAL A N   3  
ATOM   1589 C  CA  . VAL A 1 58 ? 9.326   -4.183  2.289   1.00 0.00 ? 58 VAL A CA  3  
ATOM   1590 C  C   . VAL A 1 58 ? 8.941   -2.885  1.588   1.00 0.00 ? 58 VAL A C   3  
ATOM   1591 O  O   . VAL A 1 58 ? 8.293   -2.022  2.177   1.00 0.00 ? 58 VAL A O   3  
ATOM   1592 C  CB  . VAL A 1 58 ? 8.317   -5.301  1.980   1.00 0.00 ? 58 VAL A CB  3  
ATOM   1593 C  CG1 . VAL A 1 58 ? 8.881   -6.664  2.395   1.00 0.00 ? 58 VAL A CG1 3  
ATOM   1594 C  CG2 . VAL A 1 58 ? 6.953   -5.078  2.654   1.00 0.00 ? 58 VAL A CG2 3  
ATOM   1595 N  N   . LEU A 1 59 ? 9.331   -2.750  0.320   1.00 0.00 ? 59 LEU A N   3  
ATOM   1596 C  CA  . LEU A 1 59 ? 9.022   -1.591  -0.481  1.00 0.00 ? 59 LEU A CA  3  
ATOM   1597 C  C   . LEU A 1 59 ? 7.637   -1.783  -1.079  1.00 0.00 ? 59 LEU A C   3  
ATOM   1598 O  O   . LEU A 1 59 ? 7.358   -2.819  -1.675  1.00 0.00 ? 59 LEU A O   3  
ATOM   1599 C  CB  . LEU A 1 59 ? 10.095  -1.468  -1.561  1.00 0.00 ? 59 LEU A CB  3  
ATOM   1600 C  CG  . LEU A 1 59 ? 10.058  -0.114  -2.259  1.00 0.00 ? 59 LEU A CG  3  
ATOM   1601 C  CD1 . LEU A 1 59 ? 10.511  1.007   -1.330  1.00 0.00 ? 59 LEU A CD1 3  
ATOM   1602 C  CD2 . LEU A 1 59 ? 11.034  -0.144  -3.430  1.00 0.00 ? 59 LEU A CD2 3  
ATOM   1603 N  N   . VAL A 1 60 ? 6.755   -0.807  -0.909  1.00 0.00 ? 60 VAL A N   3  
ATOM   1604 C  CA  . VAL A 1 60 ? 5.351   -0.941  -1.239  1.00 0.00 ? 60 VAL A CA  3  
ATOM   1605 C  C   . VAL A 1 60 ? 5.098   -0.314  -2.608  1.00 0.00 ? 60 VAL A C   3  
ATOM   1606 O  O   . VAL A 1 60 ? 5.718   0.684   -2.966  1.00 0.00 ? 60 VAL A O   3  
ATOM   1607 C  CB  . VAL A 1 60 ? 4.551   -0.315  -0.089  1.00 0.00 ? 60 VAL A CB  3  
ATOM   1608 C  CG1 . VAL A 1 60 ? 3.143   0.071   -0.516  1.00 0.00 ? 60 VAL A CG1 3  
ATOM   1609 C  CG2 . VAL A 1 60 ? 4.467   -1.330  1.062   1.00 0.00 ? 60 VAL A CG2 3  
ATOM   1610 N  N   . LYS A 1 61 ? 4.233   -0.924  -3.418  1.00 0.00 ? 61 LYS A N   3  
ATOM   1611 C  CA  . LYS A 1 61 ? 3.912   -0.362  -4.715  1.00 0.00 ? 61 LYS A CA  3  
ATOM   1612 C  C   . LYS A 1 61 ? 3.140   0.925   -4.493  1.00 0.00 ? 61 LYS A C   3  
ATOM   1613 O  O   . LYS A 1 61 ? 2.201   0.943   -3.705  1.00 0.00 ? 61 LYS A O   3  
ATOM   1614 C  CB  . LYS A 1 61 ? 3.063   -1.354  -5.518  1.00 0.00 ? 61 LYS A CB  3  
ATOM   1615 C  CG  . LYS A 1 61 ? 3.153   -0.992  -6.999  1.00 0.00 ? 61 LYS A CG  3  
ATOM   1616 C  CD  . LYS A 1 61 ? 2.956   -2.171  -7.948  1.00 0.00 ? 61 LYS A CD  3  
ATOM   1617 C  CE  . LYS A 1 61 ? 3.596   -1.826  -9.306  1.00 0.00 ? 61 LYS A CE  3  
ATOM   1618 N  NZ  . LYS A 1 61 ? 3.248   -0.473  -9.812  1.00 0.00 ? 61 LYS A NZ  3  
ATOM   1619 N  N   . ALA A 1 62 ? 3.506   1.985   -5.204  1.00 0.00 ? 62 ALA A N   3  
ATOM   1620 C  CA  . ALA A 1 62 ? 2.817   3.259   -5.084  1.00 0.00 ? 62 ALA A CA  3  
ATOM   1621 C  C   . ALA A 1 62 ? 1.328   3.135   -5.416  1.00 0.00 ? 62 ALA A C   3  
ATOM   1622 O  O   . ALA A 1 62 ? 0.512   3.805   -4.782  1.00 0.00 ? 62 ALA A O   3  
ATOM   1623 C  CB  . ALA A 1 62 ? 3.511   4.307   -5.946  1.00 0.00 ? 62 ALA A CB  3  
ATOM   1624 N  N   . GLU A 1 63 ? 0.965   2.273   -6.378  1.00 0.00 ? 63 GLU A N   3  
ATOM   1625 C  CA  . GLU A 1 63 ? -0.439  1.996   -6.651  1.00 0.00 ? 63 GLU A CA  3  
ATOM   1626 C  C   . GLU A 1 63 ? -1.053  0.925   -5.754  1.00 0.00 ? 63 GLU A C   3  
ATOM   1627 O  O   . GLU A 1 63 ? -2.197  0.549   -5.994  1.00 0.00 ? 63 GLU A O   3  
ATOM   1628 C  CB  . GLU A 1 63 ? -0.680  1.598   -8.104  1.00 0.00 ? 63 GLU A CB  3  
ATOM   1629 C  CG  . GLU A 1 63 ? 0.084   2.468   -9.095  1.00 0.00 ? 63 GLU A CG  3  
ATOM   1630 C  CD  . GLU A 1 63 ? 1.338   1.717   -9.515  1.00 0.00 ? 63 GLU A CD  3  
ATOM   1631 O  OE1 . GLU A 1 63 ? 2.304   1.686   -8.717  1.00 0.00 ? 63 GLU A OE1 3  
ATOM   1632 O  OE2 . GLU A 1 63 ? 1.303   1.011   -10.545 1.00 0.00 ? 63 GLU A OE2 3  
ATOM   1633 N  N   . GLY A 1 64 ? -0.325  0.395   -4.773  1.00 0.00 ? 64 GLY A N   3  
ATOM   1634 C  CA  . GLY A 1 64 ? -0.888  -0.584  -3.866  1.00 0.00 ? 64 GLY A CA  3  
ATOM   1635 C  C   . GLY A 1 64 ? -1.922  0.049   -2.942  1.00 0.00 ? 64 GLY A C   3  
ATOM   1636 O  O   . GLY A 1 64 ? -2.243  1.234   -3.054  1.00 0.00 ? 64 GLY A O   3  
ATOM   1637 N  N   . TRP A 1 65 ? -2.448  -0.754  -2.018  1.00 0.00 ? 65 TRP A N   3  
ATOM   1638 C  CA  . TRP A 1 65 ? -3.312  -0.291  -0.946  1.00 0.00 ? 65 TRP A CA  3  
ATOM   1639 C  C   . TRP A 1 65 ? -3.269  -1.331  0.158   1.00 0.00 ? 65 TRP A C   3  
ATOM   1640 O  O   . TRP A 1 65 ? -3.006  -2.496  -0.135  1.00 0.00 ? 65 TRP A O   3  
ATOM   1641 C  CB  . TRP A 1 65 ? -4.745  -0.157  -1.456  1.00 0.00 ? 65 TRP A CB  3  
ATOM   1642 C  CG  . TRP A 1 65 ? -5.778  0.203   -0.437  1.00 0.00 ? 65 TRP A CG  3  
ATOM   1643 C  CD1 . TRP A 1 65 ? -6.188  1.457   -0.155  1.00 0.00 ? 65 TRP A CD1 3  
ATOM   1644 C  CD2 . TRP A 1 65 ? -6.578  -0.681  0.405   1.00 0.00 ? 65 TRP A CD2 3  
ATOM   1645 N  NE1 . TRP A 1 65 ? -7.249  1.408   0.726   1.00 0.00 ? 65 TRP A NE1 3  
ATOM   1646 C  CE2 . TRP A 1 65 ? -7.541  0.111   1.097   1.00 0.00 ? 65 TRP A CE2 3  
ATOM   1647 C  CE3 . TRP A 1 65 ? -6.623  -2.077  0.621   1.00 0.00 ? 65 TRP A CE3 3  
ATOM   1648 C  CZ2 . TRP A 1 65 ? -8.532  -0.458  1.910   1.00 0.00 ? 65 TRP A CZ2 3  
ATOM   1649 C  CZ3 . TRP A 1 65 ? -7.562  -2.648  1.501   1.00 0.00 ? 65 TRP A CZ3 3  
ATOM   1650 C  CH2 . TRP A 1 65 ? -8.552  -1.850  2.096   1.00 0.00 ? 65 TRP A CH2 3  
ATOM   1651 N  N   . CYS A 1 66 ? -3.576  -0.927  1.394   1.00 0.00 ? 66 CYS A N   3  
ATOM   1652 C  CA  . CYS A 1 66 ? -3.802  -1.832  2.506   1.00 0.00 ? 66 CYS A CA  3  
ATOM   1653 C  C   . CYS A 1 66 ? -4.933  -1.320  3.399   1.00 0.00 ? 66 CYS A C   3  
ATOM   1654 O  O   . CYS A 1 66 ? -5.426  -0.203  3.227   1.00 0.00 ? 66 CYS A O   3  
ATOM   1655 C  CB  . CYS A 1 66 ? -2.537  -2.023  3.292   1.00 0.00 ? 66 CYS A CB  3  
ATOM   1656 S  SG  . CYS A 1 66 ? -2.271  -0.610  4.378   1.00 0.00 ? 66 CYS A SG  3  
ATOM   1657 N  N   . SER A 1 67 ? -5.360  -2.149  4.357   1.00 0.00 ? 67 SER A N   3  
ATOM   1658 C  CA  . SER A 1 67 ? -6.511  -1.835  5.188   1.00 0.00 ? 67 SER A CA  3  
ATOM   1659 C  C   . SER A 1 67 ? -6.242  -0.710  6.196   1.00 0.00 ? 67 SER A C   3  
ATOM   1660 O  O   . SER A 1 67 ? -7.188  -0.002  6.553   1.00 0.00 ? 67 SER A O   3  
ATOM   1661 C  CB  . SER A 1 67 ? -7.033  -3.103  5.865   1.00 0.00 ? 67 SER A CB  3  
ATOM   1662 O  OG  . SER A 1 67 ? -6.032  -3.673  6.676   1.00 0.00 ? 67 SER A OG  3  
ATOM   1663 N  N   . VAL A 1 68 ? -4.999  -0.533  6.676   1.00 0.00 ? 68 VAL A N   3  
ATOM   1664 C  CA  . VAL A 1 68 ? -4.724  0.534   7.639   1.00 0.00 ? 68 VAL A CA  3  
ATOM   1665 C  C   . VAL A 1 68 ? -4.895  1.874   6.917   1.00 0.00 ? 68 VAL A C   3  
ATOM   1666 O  O   . VAL A 1 68 ? -5.895  2.579   7.096   1.00 0.00 ? 68 VAL A O   3  
ATOM   1667 C  CB  . VAL A 1 68 ? -3.406  0.364   8.441   1.00 0.00 ? 68 VAL A CB  3  
ATOM   1668 C  CG1 . VAL A 1 68 ? -3.319  -1.071  8.941   1.00 0.00 ? 68 VAL A CG1 3  
ATOM   1669 C  CG2 . VAL A 1 68 ? -2.049  0.686   7.800   1.00 0.00 ? 68 VAL A CG2 3  
ATOM   1670 N  N   . TYR A 1 69 ? -3.959  2.160   6.014   1.00 0.00 ? 69 TYR A N   3  
ATOM   1671 C  CA  . TYR A 1 69 ? -3.917  3.335   5.168   1.00 0.00 ? 69 TYR A CA  3  
ATOM   1672 C  C   . TYR A 1 69 ? -3.888  4.638   5.983   1.00 0.00 ? 69 TYR A C   3  
ATOM   1673 O  O   . TYR A 1 69 ? -2.817  5.163   6.272   1.00 0.00 ? 69 TYR A O   3  
ATOM   1674 C  CB  . TYR A 1 69 ? -4.995  3.236   4.070   1.00 0.00 ? 69 TYR A CB  3  
ATOM   1675 C  CG  . TYR A 1 69 ? -5.229  4.475   3.226   1.00 0.00 ? 69 TYR A CG  3  
ATOM   1676 C  CD1 . TYR A 1 69 ? -4.456  4.706   2.075   1.00 0.00 ? 69 TYR A CD1 3  
ATOM   1677 C  CD2 . TYR A 1 69 ? -6.299  5.340   3.520   1.00 0.00 ? 69 TYR A CD2 3  
ATOM   1678 C  CE1 . TYR A 1 69 ? -4.688  5.841   1.283   1.00 0.00 ? 69 TYR A CE1 3  
ATOM   1679 C  CE2 . TYR A 1 69 ? -6.559  6.447   2.702   1.00 0.00 ? 69 TYR A CE2 3  
ATOM   1680 C  CZ  . TYR A 1 69 ? -5.717  6.732   1.619   1.00 0.00 ? 69 TYR A CZ  3  
ATOM   1681 O  OH  . TYR A 1 69 ? -5.935  7.857   0.888   1.00 0.00 ? 69 TYR A OH  3  
ATOM   1682 N  N   . ALA A 1 70 ? -5.066  5.132   6.373   1.00 0.00 ? 70 ALA A N   3  
ATOM   1683 C  CA  . ALA A 1 70 ? -5.324  6.500   6.826   1.00 0.00 ? 70 ALA A CA  3  
ATOM   1684 C  C   . ALA A 1 70 ? -5.037  7.525   5.707   1.00 0.00 ? 70 ALA A C   3  
ATOM   1685 O  O   . ALA A 1 70 ? -3.947  7.528   5.141   1.00 0.00 ? 70 ALA A O   3  
ATOM   1686 C  CB  . ALA A 1 70 ? -4.556  6.823   8.115   1.00 0.00 ? 70 ALA A CB  3  
ATOM   1687 N  N   . PRO A 1 71 ? -6.002  8.389   5.344   1.00 0.00 ? 71 PRO A N   3  
ATOM   1688 C  CA  . PRO A 1 71 ? -5.819  9.341   4.260   1.00 0.00 ? 71 PRO A CA  3  
ATOM   1689 C  C   . PRO A 1 71 ? -4.851  10.442  4.654   1.00 0.00 ? 71 PRO A C   3  
ATOM   1690 O  O   . PRO A 1 71 ? -4.818  10.878  5.804   1.00 0.00 ? 71 PRO A O   3  
ATOM   1691 C  CB  . PRO A 1 71 ? -7.203  9.914   3.962   1.00 0.00 ? 71 PRO A CB  3  
ATOM   1692 C  CG  . PRO A 1 71 ? -7.924  9.791   5.304   1.00 0.00 ? 71 PRO A CG  3  
ATOM   1693 C  CD  . PRO A 1 71 ? -7.331  8.522   5.919   1.00 0.00 ? 71 PRO A CD  3  
ATOM   1694 N  N   . ALA A 1 72 ? -4.091  10.928  3.671   1.00 0.00 ? 72 ALA A N   3  
ATOM   1695 C  CA  . ALA A 1 72 ? -3.180  12.043  3.850   1.00 0.00 ? 72 ALA A CA  3  
ATOM   1696 C  C   . ALA A 1 72 ? -3.898  13.345  3.507   1.00 0.00 ? 72 ALA A C   3  
ATOM   1697 O  O   . ALA A 1 72 ? -3.407  14.172  2.740   1.00 0.00 ? 72 ALA A O   3  
ATOM   1698 C  CB  . ALA A 1 72 ? -1.952  11.822  2.982   1.00 0.00 ? 72 ALA A CB  3  
ATOM   1699 N  N   . SER A 1 73 ? -5.088  13.491  4.075   1.00 0.00 ? 73 SER A N   3  
ATOM   1700 C  CA  . SER A 1 73 ? -6.013  14.575  3.824   1.00 0.00 ? 73 SER A CA  3  
ATOM   1701 C  C   . SER A 1 73 ? -7.144  14.446  4.838   1.00 0.00 ? 73 SER A C   3  
ATOM   1702 O  O   . SER A 1 73 ? -7.360  15.405  5.606   1.00 0.00 ? 73 SER A O   3  
ATOM   1703 C  CB  . SER A 1 73 ? -6.571  14.464  2.399   1.00 0.00 ? 73 SER A CB  3  
ATOM   1704 O  OG  . SER A 1 73 ? -7.155  13.187  2.229   1.00 0.00 ? 73 SER A OG  3  
ATOM   1705 O  OXT . SER A 1 73 ? -7.776  13.365  4.795   1.00 0.00 ? 73 SER A OXT 3  
HETATM 1706 FE FE1 . SF4 B 2 .  ? 0.037   1.550   1.345   1.00 0.00 ? 74 SF4 A FE1 3  
HETATM 1707 FE FE2 . SF4 B 2 .  ? -0.603  3.119   3.154   1.00 0.00 ? 74 SF4 A FE2 3  
HETATM 1708 FE FE3 . SF4 B 2 .  ? 1.310   1.617   3.486   1.00 0.00 ? 74 SF4 A FE3 3  
HETATM 1709 FE FE4 . SF4 B 2 .  ? -0.995  0.687   3.450   1.00 0.00 ? 74 SF4 A FE4 3  
HETATM 1710 S  S1  . SF4 B 2 .  ? -0.219  2.011   4.937   1.00 0.00 ? 74 SF4 A S1  3  
HETATM 1711 S  S2  . SF4 B 2 .  ? 0.708   -0.192  2.452   1.00 0.00 ? 74 SF4 A S2  3  
HETATM 1712 S  S3  . SF4 B 2 .  ? -1.990  1.929   2.004   1.00 0.00 ? 74 SF4 A S3  3  
HETATM 1713 S  S4  . SF4 B 2 .  ? 1.224   3.204   2.044   1.00 0.00 ? 74 SF4 A S4  3  
ATOM   1714 N  N   . ALA A 1 1  ? 16.810  1.970   -3.003  1.00 0.00 ? 1  ALA A N   4  
ATOM   1715 C  CA  . ALA A 1 1  ? 17.766  0.912   -2.729  1.00 0.00 ? 1  ALA A CA  4  
ATOM   1716 C  C   . ALA A 1 1  ? 17.229  -0.315  -3.443  1.00 0.00 ? 1  ALA A C   4  
ATOM   1717 O  O   . ALA A 1 1  ? 16.346  -0.121  -4.286  1.00 0.00 ? 1  ALA A O   4  
ATOM   1718 C  CB  . ALA A 1 1  ? 17.791  0.641   -1.221  1.00 0.00 ? 1  ALA A CB  4  
ATOM   1719 N  N   . SER A 1 2  ? 17.685  -1.507  -3.089  1.00 0.00 ? 2  SER A N   4  
ATOM   1720 C  CA  . SER A 1 2  ? 17.116  -2.766  -3.521  1.00 0.00 ? 2  SER A CA  4  
ATOM   1721 C  C   . SER A 1 2  ? 16.109  -3.261  -2.477  1.00 0.00 ? 2  SER A C   4  
ATOM   1722 O  O   . SER A 1 2  ? 16.033  -4.460  -2.212  1.00 0.00 ? 2  SER A O   4  
ATOM   1723 C  CB  . SER A 1 2  ? 18.301  -3.725  -3.706  1.00 0.00 ? 2  SER A CB  4  
ATOM   1724 O  OG  . SER A 1 2  ? 19.255  -3.483  -2.680  1.00 0.00 ? 2  SER A OG  4  
ATOM   1725 N  N   . GLU A 1 3  ? 15.331  -2.353  -1.871  1.00 0.00 ? 3  GLU A N   4  
ATOM   1726 C  CA  . GLU A 1 3  ? 14.334  -2.747  -0.887  1.00 0.00 ? 3  GLU A CA  4  
ATOM   1727 C  C   . GLU A 1 3  ? 13.325  -3.702  -1.557  1.00 0.00 ? 3  GLU A C   4  
ATOM   1728 O  O   . GLU A 1 3  ? 12.838  -3.392  -2.647  1.00 0.00 ? 3  GLU A O   4  
ATOM   1729 C  CB  . GLU A 1 3  ? 13.646  -1.502  -0.314  1.00 0.00 ? 3  GLU A CB  4  
ATOM   1730 C  CG  . GLU A 1 3  ? 14.612  -0.474  0.300   1.00 0.00 ? 3  GLU A CG  4  
ATOM   1731 C  CD  . GLU A 1 3  ? 14.718  0.784   -0.548  1.00 0.00 ? 3  GLU A CD  4  
ATOM   1732 O  OE1 . GLU A 1 3  ? 15.080  0.639   -1.738  1.00 0.00 ? 3  GLU A OE1 4  
ATOM   1733 O  OE2 . GLU A 1 3  ? 14.499  1.894   -0.012  1.00 0.00 ? 3  GLU A OE2 4  
ATOM   1734 N  N   . PRO A 1 4  ? 13.036  -4.873  -0.968  1.00 0.00 ? 4  PRO A N   4  
ATOM   1735 C  CA  . PRO A 1 4  ? 12.276  -5.916  -1.638  1.00 0.00 ? 4  PRO A CA  4  
ATOM   1736 C  C   . PRO A 1 4  ? 10.815  -5.507  -1.794  1.00 0.00 ? 4  PRO A C   4  
ATOM   1737 O  O   . PRO A 1 4  ? 10.171  -5.101  -0.830  1.00 0.00 ? 4  PRO A O   4  
ATOM   1738 C  CB  . PRO A 1 4  ? 12.428  -7.170  -0.774  1.00 0.00 ? 4  PRO A CB  4  
ATOM   1739 C  CG  . PRO A 1 4  ? 12.719  -6.611  0.620   1.00 0.00 ? 4  PRO A CG  4  
ATOM   1740 C  CD  . PRO A 1 4  ? 13.489  -5.322  0.338   1.00 0.00 ? 4  PRO A CD  4  
ATOM   1741 N  N   . ARG A 1 5  ? 10.294  -5.610  -3.017  1.00 0.00 ? 5  ARG A N   4  
ATOM   1742 C  CA  . ARG A 1 5  ? 8.928   -5.270  -3.363  1.00 0.00 ? 5  ARG A CA  4  
ATOM   1743 C  C   . ARG A 1 5  ? 7.929   -6.149  -2.600  1.00 0.00 ? 5  ARG A C   4  
ATOM   1744 O  O   . ARG A 1 5  ? 8.067   -7.372  -2.583  1.00 0.00 ? 5  ARG A O   4  
ATOM   1745 C  CB  . ARG A 1 5  ? 8.827   -5.460  -4.875  1.00 0.00 ? 5  ARG A CB  4  
ATOM   1746 C  CG  . ARG A 1 5  ? 9.656   -4.416  -5.588  1.00 0.00 ? 5  ARG A CG  4  
ATOM   1747 C  CD  . ARG A 1 5  ? 9.838   -4.931  -7.009  1.00 0.00 ? 5  ARG A CD  4  
ATOM   1748 N  NE  . ARG A 1 5  ? 10.960  -4.213  -7.563  1.00 0.00 ? 5  ARG A NE  4  
ATOM   1749 C  CZ  . ARG A 1 5  ? 10.921  -3.385  -8.616  1.00 0.00 ? 5  ARG A CZ  4  
ATOM   1750 N  NH1 . ARG A 1 5  ? 9.967   -3.541  -9.535  1.00 0.00 ? 5  ARG A NH1 4  
ATOM   1751 N  NH2 . ARG A 1 5  ? 11.810  -2.402  -8.733  1.00 0.00 ? 5  ARG A NH2 4  
ATOM   1752 N  N   . ALA A 1 6  ? 6.944   -5.514  -1.961  1.00 0.00 ? 6  ALA A N   4  
ATOM   1753 C  CA  . ALA A 1 6  ? 5.986   -6.139  -1.066  1.00 0.00 ? 6  ALA A CA  4  
ATOM   1754 C  C   . ALA A 1 6  ? 5.130   -7.190  -1.770  1.00 0.00 ? 6  ALA A C   4  
ATOM   1755 O  O   . ALA A 1 6  ? 4.727   -7.025  -2.922  1.00 0.00 ? 6  ALA A O   4  
ATOM   1756 C  CB  . ALA A 1 6  ? 5.095   -5.058  -0.452  1.00 0.00 ? 6  ALA A CB  4  
ATOM   1757 N  N   . GLU A 1 7  ? 4.827   -8.262  -1.044  1.00 0.00 ? 7  GLU A N   4  
ATOM   1758 C  CA  . GLU A 1 7  ? 4.039   -9.375  -1.519  1.00 0.00 ? 7  GLU A CA  4  
ATOM   1759 C  C   . GLU A 1 7  ? 2.576   -8.978  -1.492  1.00 0.00 ? 7  GLU A C   4  
ATOM   1760 O  O   . GLU A 1 7  ? 2.135   -8.322  -0.548  1.00 0.00 ? 7  GLU A O   4  
ATOM   1761 C  CB  . GLU A 1 7  ? 4.224   -10.595 -0.616  1.00 0.00 ? 7  GLU A CB  4  
ATOM   1762 C  CG  . GLU A 1 7  ? 5.673   -10.779 -0.154  1.00 0.00 ? 7  GLU A CG  4  
ATOM   1763 C  CD  . GLU A 1 7  ? 5.908   -10.153 1.220   1.00 0.00 ? 7  GLU A CD  4  
ATOM   1764 O  OE1 . GLU A 1 7  ? 5.951   -8.906  1.294   1.00 0.00 ? 7  GLU A OE1 4  
ATOM   1765 O  OE2 . GLU A 1 7  ? 5.964   -10.890 2.221   1.00 0.00 ? 7  GLU A OE2 4  
ATOM   1766 N  N   . ASP A 1 8  ? 1.802   -9.452  -2.459  1.00 0.00 ? 8  ASP A N   4  
ATOM   1767 C  CA  . ASP A 1 8  ? 0.363   -9.395  -2.360  1.00 0.00 ? 8  ASP A CA  4  
ATOM   1768 C  C   . ASP A 1 8  ? -0.028  -10.261 -1.167  1.00 0.00 ? 8  ASP A C   4  
ATOM   1769 O  O   . ASP A 1 8  ? 0.363   -11.424 -1.082  1.00 0.00 ? 8  ASP A O   4  
ATOM   1770 C  CB  . ASP A 1 8  ? -0.247  -9.871  -3.676  1.00 0.00 ? 8  ASP A CB  4  
ATOM   1771 C  CG  . ASP A 1 8  ? -0.120  -8.782  -4.724  1.00 0.00 ? 8  ASP A CG  4  
ATOM   1772 O  OD1 . ASP A 1 8  ? -0.958  -7.856  -4.695  1.00 0.00 ? 8  ASP A OD1 4  
ATOM   1773 O  OD2 . ASP A 1 8  ? 0.877   -8.824  -5.477  1.00 0.00 ? 8  ASP A OD2 4  
ATOM   1774 N  N   . GLY A 1 9  ? -0.716  -9.664  -0.198  1.00 0.00 ? 9  GLY A N   4  
ATOM   1775 C  CA  . GLY A 1 9  ? -1.019  -10.293 1.070   1.00 0.00 ? 9  GLY A CA  4  
ATOM   1776 C  C   . GLY A 1 9  ? 0.185   -10.350 2.015   1.00 0.00 ? 9  GLY A C   4  
ATOM   1777 O  O   . GLY A 1 9  ? 0.163   -11.165 2.934   1.00 0.00 ? 9  GLY A O   4  
ATOM   1778 N  N   . HIS A 1 10 ? 1.195   -9.475  1.853   1.00 0.00 ? 10 HIS A N   4  
ATOM   1779 C  CA  . HIS A 1 10 ? 2.259   -9.271  2.840   1.00 0.00 ? 10 HIS A CA  4  
ATOM   1780 C  C   . HIS A 1 10 ? 1.705   -9.294  4.265   1.00 0.00 ? 10 HIS A C   4  
ATOM   1781 O  O   . HIS A 1 10 ? 2.148   -10.065 5.111   1.00 0.00 ? 10 HIS A O   4  
ATOM   1782 C  CB  . HIS A 1 10 ? 2.938   -7.916  2.584   1.00 0.00 ? 10 HIS A CB  4  
ATOM   1783 C  CG  . HIS A 1 10 ? 3.986   -7.569  3.613   1.00 0.00 ? 10 HIS A CG  4  
ATOM   1784 N  ND1 . HIS A 1 10 ? 5.265   -8.087  3.667   1.00 0.00 ? 10 HIS A ND1 4  
ATOM   1785 C  CD2 . HIS A 1 10 ? 3.821   -6.734  4.684   1.00 0.00 ? 10 HIS A CD2 4  
ATOM   1786 C  CE1 . HIS A 1 10 ? 5.866   -7.579  4.759   1.00 0.00 ? 10 HIS A CE1 4  
ATOM   1787 N  NE2 . HIS A 1 10 ? 5.008   -6.752  5.390   1.00 0.00 ? 10 HIS A NE2 4  
ATOM   1788 N  N   . ALA A 1 11 ? 0.739   -8.408  4.514   1.00 0.00 ? 11 ALA A N   4  
ATOM   1789 C  CA  . ALA A 1 11 ? -0.026  -8.314  5.746   1.00 0.00 ? 11 ALA A CA  4  
ATOM   1790 C  C   . ALA A 1 11 ? -1.199  -7.371  5.481   1.00 0.00 ? 11 ALA A C   4  
ATOM   1791 O  O   . ALA A 1 11 ? -1.279  -6.806  4.391   1.00 0.00 ? 11 ALA A O   4  
ATOM   1792 C  CB  . ALA A 1 11 ? 0.860   -7.802  6.890   1.00 0.00 ? 11 ALA A CB  4  
ATOM   1793 N  N   . HIS A 1 12 ? -2.091  -7.205  6.467   1.00 0.00 ? 12 HIS A N   4  
ATOM   1794 C  CA  . HIS A 1 12 ? -3.228  -6.277  6.456   1.00 0.00 ? 12 HIS A CA  4  
ATOM   1795 C  C   . HIS A 1 12 ? -3.887  -6.161  5.081   1.00 0.00 ? 12 HIS A C   4  
ATOM   1796 O  O   . HIS A 1 12 ? -4.108  -5.058  4.580   1.00 0.00 ? 12 HIS A O   4  
ATOM   1797 C  CB  . HIS A 1 12 ? -2.807  -4.892  6.951   1.00 0.00 ? 12 HIS A CB  4  
ATOM   1798 C  CG  . HIS A 1 12 ? -2.411  -4.829  8.400   1.00 0.00 ? 12 HIS A CG  4  
ATOM   1799 N  ND1 . HIS A 1 12 ? -3.067  -4.097  9.373   1.00 0.00 ? 12 HIS A ND1 4  
ATOM   1800 C  CD2 . HIS A 1 12 ? -1.228  -5.267  8.925   1.00 0.00 ? 12 HIS A CD2 4  
ATOM   1801 C  CE1 . HIS A 1 12 ? -2.285  -4.085  10.468  1.00 0.00 ? 12 HIS A CE1 4  
ATOM   1802 N  NE2 . HIS A 1 12 ? -1.189  -4.827  10.229  1.00 0.00 ? 12 HIS A NE2 4  
ATOM   1803 N  N   . ASP A 1 13 ? -4.200  -7.308  4.480   1.00 0.00 ? 13 ASP A N   4  
ATOM   1804 C  CA  . ASP A 1 13 ? -4.974  -7.387  3.251   1.00 0.00 ? 13 ASP A CA  4  
ATOM   1805 C  C   . ASP A 1 13 ? -4.324  -6.593  2.108   1.00 0.00 ? 13 ASP A C   4  
ATOM   1806 O  O   . ASP A 1 13 ? -5.025  -6.160  1.195   1.00 0.00 ? 13 ASP A O   4  
ATOM   1807 C  CB  . ASP A 1 13 ? -6.414  -6.910  3.497   1.00 0.00 ? 13 ASP A CB  4  
ATOM   1808 C  CG  . ASP A 1 13 ? -6.960  -7.261  4.872   1.00 0.00 ? 13 ASP A CG  4  
ATOM   1809 O  OD1 . ASP A 1 13 ? -6.836  -8.428  5.286   1.00 0.00 ? 13 ASP A OD1 4  
ATOM   1810 O  OD2 . ASP A 1 13 ? -7.525  -6.318  5.476   1.00 0.00 ? 13 ASP A OD2 4  
ATOM   1811 N  N   . TYR A 1 14 ? -3.007  -6.360  2.171   1.00 0.00 ? 14 TYR A N   4  
ATOM   1812 C  CA  . TYR A 1 14 ? -2.337  -5.521  1.196   1.00 0.00 ? 14 TYR A CA  4  
ATOM   1813 C  C   . TYR A 1 14 ? -2.425  -6.129  -0.195  1.00 0.00 ? 14 TYR A C   4  
ATOM   1814 O  O   . TYR A 1 14 ? -2.196  -7.326  -0.362  1.00 0.00 ? 14 TYR A O   4  
ATOM   1815 C  CB  . TYR A 1 14 ? -0.886  -5.250  1.594   1.00 0.00 ? 14 TYR A CB  4  
ATOM   1816 C  CG  . TYR A 1 14 ? -0.033  -4.626  0.498   1.00 0.00 ? 14 TYR A CG  4  
ATOM   1817 C  CD1 . TYR A 1 14 ? -0.035  -3.239  0.272   1.00 0.00 ? 14 TYR A CD1 4  
ATOM   1818 C  CD2 . TYR A 1 14 ? 0.718   -5.458  -0.348  1.00 0.00 ? 14 TYR A CD2 4  
ATOM   1819 C  CE1 . TYR A 1 14 ? 0.770   -2.686  -0.735  1.00 0.00 ? 14 TYR A CE1 4  
ATOM   1820 C  CE2 . TYR A 1 14 ? 1.553   -4.904  -1.334  1.00 0.00 ? 14 TYR A CE2 4  
ATOM   1821 C  CZ  . TYR A 1 14 ? 1.606   -3.510  -1.501  1.00 0.00 ? 14 TYR A CZ  4  
ATOM   1822 O  OH  . TYR A 1 14 ? 2.492   -2.955  -2.376  1.00 0.00 ? 14 TYR A OH  4  
ATOM   1823 N  N   . VAL A 1 15 ? -2.704  -5.283  -1.181  1.00 0.00 ? 15 VAL A N   4  
ATOM   1824 C  CA  . VAL A 1 15 ? -2.696  -5.638  -2.589  1.00 0.00 ? 15 VAL A CA  4  
ATOM   1825 C  C   . VAL A 1 15 ? -1.739  -4.684  -3.292  1.00 0.00 ? 15 VAL A C   4  
ATOM   1826 O  O   . VAL A 1 15 ? -1.676  -3.502  -2.945  1.00 0.00 ? 15 VAL A O   4  
ATOM   1827 C  CB  . VAL A 1 15 ? -4.122  -5.565  -3.161  1.00 0.00 ? 15 VAL A CB  4  
ATOM   1828 C  CG1 . VAL A 1 15 ? -4.969  -6.695  -2.561  1.00 0.00 ? 15 VAL A CG1 4  
ATOM   1829 C  CG2 . VAL A 1 15 ? -4.793  -4.217  -2.863  1.00 0.00 ? 15 VAL A CG2 4  
ATOM   1830 N  N   . ASN A 1 16 ? -0.979  -5.197  -4.263  1.00 0.00 ? 16 ASN A N   4  
ATOM   1831 C  CA  . ASN A 1 16 ? -0.065  -4.418  -5.066  1.00 0.00 ? 16 ASN A CA  4  
ATOM   1832 C  C   . ASN A 1 16 ? -0.806  -3.469  -6.009  1.00 0.00 ? 16 ASN A C   4  
ATOM   1833 O  O   . ASN A 1 16 ? -0.239  -2.457  -6.414  1.00 0.00 ? 16 ASN A O   4  
ATOM   1834 C  CB  . ASN A 1 16 ? 0.955   -5.296  -5.799  1.00 0.00 ? 16 ASN A CB  4  
ATOM   1835 C  CG  . ASN A 1 16 ? 2.162   -5.566  -4.910  1.00 0.00 ? 16 ASN A CG  4  
ATOM   1836 O  OD1 . ASN A 1 16 ? 2.822   -4.638  -4.457  1.00 0.00 ? 16 ASN A OD1 4  
ATOM   1837 N  ND2 . ASN A 1 16 ? 2.470   -6.818  -4.638  1.00 0.00 ? 16 ASN A ND2 4  
ATOM   1838 N  N   . GLU A 1 17 ? -2.062  -3.785  -6.349  1.00 0.00 ? 17 GLU A N   4  
ATOM   1839 C  CA  . GLU A 1 17 ? -2.963  -2.914  -7.074  1.00 0.00 ? 17 GLU A CA  4  
ATOM   1840 C  C   . GLU A 1 17 ? -4.129  -2.576  -6.155  1.00 0.00 ? 17 GLU A C   4  
ATOM   1841 O  O   . GLU A 1 17 ? -4.914  -3.455  -5.815  1.00 0.00 ? 17 GLU A O   4  
ATOM   1842 C  CB  . GLU A 1 17 ? -3.476  -3.645  -8.314  1.00 0.00 ? 17 GLU A CB  4  
ATOM   1843 C  CG  . GLU A 1 17 ? -4.220  -2.683  -9.234  1.00 0.00 ? 17 GLU A CG  4  
ATOM   1844 C  CD  . GLU A 1 17 ? -4.602  -3.355  -10.546 1.00 0.00 ? 17 GLU A CD  4  
ATOM   1845 O  OE1 . GLU A 1 17 ? -3.759  -3.317  -11.466 1.00 0.00 ? 17 GLU A OE1 4  
ATOM   1846 O  OE2 . GLU A 1 17 ? -5.725  -3.900  -10.598 1.00 0.00 ? 17 GLU A OE2 4  
ATOM   1847 N  N   . ALA A 1 18 ? -4.259  -1.302  -5.791  1.00 0.00 ? 18 ALA A N   4  
ATOM   1848 C  CA  . ALA A 1 18 ? -5.363  -0.771  -5.005  1.00 0.00 ? 18 ALA A CA  4  
ATOM   1849 C  C   . ALA A 1 18 ? -6.701  -1.333  -5.490  1.00 0.00 ? 18 ALA A C   4  
ATOM   1850 O  O   . ALA A 1 18 ? -7.495  -1.834  -4.697  1.00 0.00 ? 18 ALA A O   4  
ATOM   1851 C  CB  . ALA A 1 18 ? -5.348  0.758   -5.083  1.00 0.00 ? 18 ALA A CB  4  
ATOM   1852 N  N   . ALA A 1 19 ? -6.918  -1.291  -6.807  1.00 0.00 ? 19 ALA A N   4  
ATOM   1853 C  CA  . ALA A 1 19 ? -8.136  -1.782  -7.432  1.00 0.00 ? 19 ALA A CA  4  
ATOM   1854 C  C   . ALA A 1 19 ? -8.478  -3.218  -7.027  1.00 0.00 ? 19 ALA A C   4  
ATOM   1855 O  O   . ALA A 1 19 ? -9.663  -3.518  -6.873  1.00 0.00 ? 19 ALA A O   4  
ATOM   1856 C  CB  . ALA A 1 19 ? -8.043  -1.664  -8.950  1.00 0.00 ? 19 ALA A CB  4  
ATOM   1857 N  N   . ASP A 1 20 ? -7.489  -4.102  -6.818  1.00 0.00 ? 20 ASP A N   4  
ATOM   1858 C  CA  . ASP A 1 20 ? -7.785  -5.451  -6.328  1.00 0.00 ? 20 ASP A CA  4  
ATOM   1859 C  C   . ASP A 1 20 ? -8.668  -5.394  -5.073  1.00 0.00 ? 20 ASP A C   4  
ATOM   1860 O  O   . ASP A 1 20 ? -9.641  -6.134  -4.916  1.00 0.00 ? 20 ASP A O   4  
ATOM   1861 C  CB  . ASP A 1 20 ? -6.491  -6.208  -6.023  1.00 0.00 ? 20 ASP A CB  4  
ATOM   1862 C  CG  . ASP A 1 20 ? -6.718  -7.699  -5.777  1.00 0.00 ? 20 ASP A CG  4  
ATOM   1863 O  OD1 . ASP A 1 20 ? -7.740  -8.227  -6.262  1.00 0.00 ? 20 ASP A OD1 4  
ATOM   1864 O  OD2 . ASP A 1 20 ? -5.847  -8.296  -5.112  1.00 0.00 ? 20 ASP A OD2 4  
ATOM   1865 N  N   . ALA A 1 21 ? -8.371  -4.439  -4.188  1.00 0.00 ? 21 ALA A N   4  
ATOM   1866 C  CA  . ALA A 1 21 ? -9.083  -4.279  -2.927  1.00 0.00 ? 21 ALA A CA  4  
ATOM   1867 C  C   . ALA A 1 21 ? -10.455 -3.622  -3.100  1.00 0.00 ? 21 ALA A C   4  
ATOM   1868 O  O   . ALA A 1 21 ? -11.124 -3.394  -2.094  1.00 0.00 ? 21 ALA A O   4  
ATOM   1869 C  CB  . ALA A 1 21 ? -8.221  -3.526  -1.907  1.00 0.00 ? 21 ALA A CB  4  
ATOM   1870 N  N   . SER A 1 22 ? -10.932 -3.385  -4.329  1.00 0.00 ? 22 SER A N   4  
ATOM   1871 C  CA  . SER A 1 22 ? -12.289 -2.894  -4.580  1.00 0.00 ? 22 SER A CA  4  
ATOM   1872 C  C   . SER A 1 22 ? -13.356 -3.743  -3.888  1.00 0.00 ? 22 SER A C   4  
ATOM   1873 O  O   . SER A 1 22 ? -14.376 -3.256  -3.403  1.00 0.00 ? 22 SER A O   4  
ATOM   1874 C  CB  . SER A 1 22 ? -12.519 -2.710  -6.087  1.00 0.00 ? 22 SER A CB  4  
ATOM   1875 O  OG  . SER A 1 22 ? -13.715 -2.004  -6.344  1.00 0.00 ? 22 SER A OG  4  
ATOM   1876 N  N   . GLY A 1 23 ? -13.058 -5.030  -3.786  1.00 0.00 ? 23 GLY A N   4  
ATOM   1877 C  CA  . GLY A 1 23 ? -13.885 -6.022  -3.114  1.00 0.00 ? 23 GLY A CA  4  
ATOM   1878 C  C   . GLY A 1 23 ? -13.934 -5.857  -1.589  1.00 0.00 ? 23 GLY A C   4  
ATOM   1879 O  O   . GLY A 1 23 ? -14.838 -6.391  -0.949  1.00 0.00 ? 23 GLY A O   4  
ATOM   1880 N  N   . HIS A 1 24 ? -12.953 -5.186  -0.976  1.00 0.00 ? 24 HIS A N   4  
ATOM   1881 C  CA  . HIS A 1 24 ? -12.773 -5.175  0.469   1.00 0.00 ? 24 HIS A CA  4  
ATOM   1882 C  C   . HIS A 1 24 ? -13.728 -4.183  1.143   1.00 0.00 ? 24 HIS A C   4  
ATOM   1883 O  O   . HIS A 1 24 ? -13.514 -2.978  1.014   1.00 0.00 ? 24 HIS A O   4  
ATOM   1884 C  CB  . HIS A 1 24 ? -11.321 -4.780  0.788   1.00 0.00 ? 24 HIS A CB  4  
ATOM   1885 C  CG  . HIS A 1 24 ? -10.855 -5.086  2.195   1.00 0.00 ? 24 HIS A CG  4  
ATOM   1886 N  ND1 . HIS A 1 24 ? -11.574 -4.973  3.378   1.00 0.00 ? 24 HIS A ND1 4  
ATOM   1887 C  CD2 . HIS A 1 24 ? -9.585  -5.483  2.517   1.00 0.00 ? 24 HIS A CD2 4  
ATOM   1888 C  CE1 . HIS A 1 24 ? -10.749 -5.291  4.392   1.00 0.00 ? 24 HIS A CE1 4  
ATOM   1889 N  NE2 . HIS A 1 24 ? -9.541  -5.603  3.894   1.00 0.00 ? 24 HIS A NE2 4  
ATOM   1890 N  N   . PRO A 1 25 ? -14.690 -4.619  1.975   1.00 0.00 ? 25 PRO A N   4  
ATOM   1891 C  CA  . PRO A 1 25 ? -15.376 -3.690  2.856   1.00 0.00 ? 25 PRO A CA  4  
ATOM   1892 C  C   . PRO A 1 25 ? -14.328 -3.120  3.820   1.00 0.00 ? 25 PRO A C   4  
ATOM   1893 O  O   . PRO A 1 25 ? -13.790 -3.872  4.631   1.00 0.00 ? 25 PRO A O   4  
ATOM   1894 C  CB  . PRO A 1 25 ? -16.465 -4.504  3.559   1.00 0.00 ? 25 PRO A CB  4  
ATOM   1895 C  CG  . PRO A 1 25 ? -15.931 -5.937  3.535   1.00 0.00 ? 25 PRO A CG  4  
ATOM   1896 C  CD  . PRO A 1 25 ? -15.064 -5.995  2.274   1.00 0.00 ? 25 PRO A CD  4  
ATOM   1897 N  N   . ARG A 1 26 ? -13.970 -1.847  3.618   1.00 0.00 ? 26 ARG A N   4  
ATOM   1898 C  CA  . ARG A 1 26 ? -12.952 -0.998  4.252   1.00 0.00 ? 26 ARG A CA  4  
ATOM   1899 C  C   . ARG A 1 26 ? -12.339 -0.093  3.187   1.00 0.00 ? 26 ARG A C   4  
ATOM   1900 O  O   . ARG A 1 26 ? -11.974 1.041   3.499   1.00 0.00 ? 26 ARG A O   4  
ATOM   1901 C  CB  . ARG A 1 26 ? -11.794 -1.712  4.992   1.00 0.00 ? 26 ARG A CB  4  
ATOM   1902 C  CG  . ARG A 1 26 ? -11.760 -1.356  6.480   1.00 0.00 ? 26 ARG A CG  4  
ATOM   1903 C  CD  . ARG A 1 26 ? -11.302 0.094   6.712   1.00 0.00 ? 26 ARG A CD  4  
ATOM   1904 N  NE  . ARG A 1 26 ? -9.864  0.283   6.433   1.00 0.00 ? 26 ARG A NE  4  
ATOM   1905 C  CZ  . ARG A 1 26 ? -9.303  1.348   5.833   1.00 0.00 ? 26 ARG A CZ  4  
ATOM   1906 N  NH1 . ARG A 1 26 ? -9.995  2.127   4.993   1.00 0.00 ? 26 ARG A NH1 4  
ATOM   1907 N  NH2 . ARG A 1 26 ? -8.025  1.618   6.104   1.00 0.00 ? 26 ARG A NH2 4  
ATOM   1908 N  N   . TYR A 1 27 ? -12.188 -0.617  1.966   1.00 0.00 ? 27 TYR A N   4  
ATOM   1909 C  CA  . TYR A 1 27 ? -11.618 0.093   0.837   1.00 0.00 ? 27 TYR A CA  4  
ATOM   1910 C  C   . TYR A 1 27 ? -12.628 1.074   0.242   1.00 0.00 ? 27 TYR A C   4  
ATOM   1911 O  O   . TYR A 1 27 ? -13.839 0.867   0.304   1.00 0.00 ? 27 TYR A O   4  
ATOM   1912 C  CB  . TYR A 1 27 ? -11.164 -0.931  -0.208  1.00 0.00 ? 27 TYR A CB  4  
ATOM   1913 C  CG  . TYR A 1 27 ? -10.625 -0.337  -1.491  1.00 0.00 ? 27 TYR A CG  4  
ATOM   1914 C  CD1 . TYR A 1 27 ? -11.502 -0.073  -2.554  1.00 0.00 ? 27 TYR A CD1 4  
ATOM   1915 C  CD2 . TYR A 1 27 ? -9.254  -0.093  -1.652  1.00 0.00 ? 27 TYR A CD2 4  
ATOM   1916 C  CE1 . TYR A 1 27 ? -10.995 0.353   -3.789  1.00 0.00 ? 27 TYR A CE1 4  
ATOM   1917 C  CE2 . TYR A 1 27 ? -8.757  0.413   -2.863  1.00 0.00 ? 27 TYR A CE2 4  
ATOM   1918 C  CZ  . TYR A 1 27 ? -9.623  0.596   -3.954  1.00 0.00 ? 27 TYR A CZ  4  
ATOM   1919 O  OH  . TYR A 1 27 ? -9.131  1.027   -5.153  1.00 0.00 ? 27 TYR A OH  4  
ATOM   1920 N  N   . GLN A 1 28 ? -12.091 2.143   -0.343  1.00 0.00 ? 28 GLN A N   4  
ATOM   1921 C  CA  . GLN A 1 28 ? -12.743 3.094   -1.215  1.00 0.00 ? 28 GLN A CA  4  
ATOM   1922 C  C   . GLN A 1 28 ? -11.751 3.362   -2.348  1.00 0.00 ? 28 GLN A C   4  
ATOM   1923 O  O   . GLN A 1 28 ? -10.543 3.347   -2.094  1.00 0.00 ? 28 GLN A O   4  
ATOM   1924 C  CB  . GLN A 1 28 ? -13.014 4.409   -0.476  1.00 0.00 ? 28 GLN A CB  4  
ATOM   1925 C  CG  . GLN A 1 28 ? -13.960 4.293   0.727   1.00 0.00 ? 28 GLN A CG  4  
ATOM   1926 C  CD  . GLN A 1 28 ? -13.297 3.654   1.946   1.00 0.00 ? 28 GLN A CD  4  
ATOM   1927 O  OE1 . GLN A 1 28 ? -12.153 3.951   2.277   1.00 0.00 ? 28 GLN A OE1 4  
ATOM   1928 N  NE2 . GLN A 1 28 ? -13.979 2.733   2.614   1.00 0.00 ? 28 GLN A NE2 4  
ATOM   1929 N  N   . GLU A 1 29 ? -12.251 3.604   -3.563  1.00 0.00 ? 29 GLU A N   4  
ATOM   1930 C  CA  . GLU A 1 29 ? -11.442 3.853   -4.739  1.00 0.00 ? 29 GLU A CA  4  
ATOM   1931 C  C   . GLU A 1 29 ? -10.619 5.126   -4.581  1.00 0.00 ? 29 GLU A C   4  
ATOM   1932 O  O   . GLU A 1 29 ? -10.917 5.995   -3.761  1.00 0.00 ? 29 GLU A O   4  
ATOM   1933 C  CB  . GLU A 1 29 ? -12.335 3.954   -5.988  1.00 0.00 ? 29 GLU A CB  4  
ATOM   1934 C  CG  . GLU A 1 29 ? -13.129 2.674   -6.303  1.00 0.00 ? 29 GLU A CG  4  
ATOM   1935 C  CD  . GLU A 1 29 ? -12.266 1.509   -6.776  1.00 0.00 ? 29 GLU A CD  4  
ATOM   1936 O  OE1 . GLU A 1 29 ? -11.030 1.687   -6.861  1.00 0.00 ? 29 GLU A OE1 4  
ATOM   1937 O  OE2 . GLU A 1 29 ? -12.853 0.423   -6.970  1.00 0.00 ? 29 GLU A OE2 4  
ATOM   1938 N  N   . GLY A 1 30 ? -9.552  5.216   -5.371  1.00 0.00 ? 30 GLY A N   4  
ATOM   1939 C  CA  . GLY A 1 30 ? -8.668  6.372   -5.427  1.00 0.00 ? 30 GLY A CA  4  
ATOM   1940 C  C   . GLY A 1 30 ? -7.601  6.323   -4.336  1.00 0.00 ? 30 GLY A C   4  
ATOM   1941 O  O   . GLY A 1 30 ? -6.517  6.884   -4.500  1.00 0.00 ? 30 GLY A O   4  
ATOM   1942 N  N   . GLN A 1 31 ? -7.891  5.650   -3.222  1.00 0.00 ? 31 GLN A N   4  
ATOM   1943 C  CA  . GLN A 1 31 ? -6.920  5.450   -2.166  1.00 0.00 ? 31 GLN A CA  4  
ATOM   1944 C  C   . GLN A 1 31 ? -5.807  4.535   -2.679  1.00 0.00 ? 31 GLN A C   4  
ATOM   1945 O  O   . GLN A 1 31 ? -6.049  3.358   -2.938  1.00 0.00 ? 31 GLN A O   4  
ATOM   1946 C  CB  . GLN A 1 31 ? -7.630  4.856   -0.954  1.00 0.00 ? 31 GLN A CB  4  
ATOM   1947 C  CG  . GLN A 1 31 ? -8.593  5.874   -0.327  1.00 0.00 ? 31 GLN A CG  4  
ATOM   1948 C  CD  . GLN A 1 31 ? -9.360  5.260   0.833   1.00 0.00 ? 31 GLN A CD  4  
ATOM   1949 O  OE1 . GLN A 1 31 ? -9.468  5.829   1.913   1.00 0.00 ? 31 GLN A OE1 4  
ATOM   1950 N  NE2 . GLN A 1 31 ? -9.931  4.088   0.597   1.00 0.00 ? 31 GLN A NE2 4  
ATOM   1951 N  N   . LEU A 1 32 ? -4.605  5.087   -2.829  1.00 0.00 ? 32 LEU A N   4  
ATOM   1952 C  CA  . LEU A 1 32 ? -3.395  4.397   -3.252  1.00 0.00 ? 32 LEU A CA  4  
ATOM   1953 C  C   . LEU A 1 32 ? -2.358  4.658   -2.164  1.00 0.00 ? 32 LEU A C   4  
ATOM   1954 O  O   . LEU A 1 32 ? -2.364  5.741   -1.581  1.00 0.00 ? 32 LEU A O   4  
ATOM   1955 C  CB  . LEU A 1 32 ? -2.878  5.005   -4.568  1.00 0.00 ? 32 LEU A CB  4  
ATOM   1956 C  CG  . LEU A 1 32 ? -3.253  4.271   -5.862  1.00 0.00 ? 32 LEU A CG  4  
ATOM   1957 C  CD1 . LEU A 1 32 ? -4.732  4.286   -6.227  1.00 0.00 ? 32 LEU A CD1 4  
ATOM   1958 C  CD2 . LEU A 1 32 ? -2.499  4.940   -7.021  1.00 0.00 ? 32 LEU A CD2 4  
ATOM   1959 N  N   . CYS A 1 33 ? -1.446  3.717   -1.922  1.00 0.00 ? 33 CYS A N   4  
ATOM   1960 C  CA  . CYS A 1 33 ? -0.305  3.883   -1.028  1.00 0.00 ? 33 CYS A CA  4  
ATOM   1961 C  C   . CYS A 1 33 ? 0.359   5.255   -1.196  1.00 0.00 ? 33 CYS A C   4  
ATOM   1962 O  O   . CYS A 1 33 ? 0.628   5.939   -0.213  1.00 0.00 ? 33 CYS A O   4  
ATOM   1963 C  CB  . CYS A 1 33 ? 0.675   2.765   -1.270  1.00 0.00 ? 33 CYS A CB  4  
ATOM   1964 S  SG  . CYS A 1 33 ? 0.166   1.245   -0.410  1.00 0.00 ? 33 CYS A SG  4  
ATOM   1965 N  N   . GLU A 1 34 ? 0.597   5.709   -2.429  1.00 0.00 ? 34 GLU A N   4  
ATOM   1966 C  CA  . GLU A 1 34 ? 1.223   7.012   -2.631  1.00 0.00 ? 34 GLU A CA  4  
ATOM   1967 C  C   . GLU A 1 34 ? 0.474   8.177   -1.958  1.00 0.00 ? 34 GLU A C   4  
ATOM   1968 O  O   . GLU A 1 34 ? 1.090   9.188   -1.630  1.00 0.00 ? 34 GLU A O   4  
ATOM   1969 C  CB  . GLU A 1 34 ? 1.484   7.257   -4.116  1.00 0.00 ? 34 GLU A CB  4  
ATOM   1970 C  CG  . GLU A 1 34 ? 0.231   7.620   -4.921  1.00 0.00 ? 34 GLU A CG  4  
ATOM   1971 C  CD  . GLU A 1 34 ? 0.524   7.778   -6.409  1.00 0.00 ? 34 GLU A CD  4  
ATOM   1972 O  OE1 . GLU A 1 34 ? 1.715   7.959   -6.745  1.00 0.00 ? 34 GLU A OE1 4  
ATOM   1973 O  OE2 . GLU A 1 34 ? -0.456  7.731   -7.181  1.00 0.00 ? 34 GLU A OE2 4  
ATOM   1974 N  N   . ASN A 1 35 ? -0.844  8.043   -1.754  1.00 0.00 ? 35 ASN A N   4  
ATOM   1975 C  CA  . ASN A 1 35 ? -1.693  9.018   -1.072  1.00 0.00 ? 35 ASN A CA  4  
ATOM   1976 C  C   . ASN A 1 35 ? -2.150  8.520   0.307   1.00 0.00 ? 35 ASN A C   4  
ATOM   1977 O  O   . ASN A 1 35 ? -3.192  8.949   0.805   1.00 0.00 ? 35 ASN A O   4  
ATOM   1978 C  CB  . ASN A 1 35 ? -2.861  9.442   -1.982  1.00 0.00 ? 35 ASN A CB  4  
ATOM   1979 C  CG  . ASN A 1 35 ? -3.889  8.361   -2.293  1.00 0.00 ? 35 ASN A CG  4  
ATOM   1980 O  OD1 . ASN A 1 35 ? -4.436  7.704   -1.414  1.00 0.00 ? 35 ASN A OD1 4  
ATOM   1981 N  ND2 . ASN A 1 35 ? -4.208  8.206   -3.570  1.00 0.00 ? 35 ASN A ND2 4  
ATOM   1982 N  N   . CYS A 1 36 ? -1.360  7.647   0.939   1.00 0.00 ? 36 CYS A N   4  
ATOM   1983 C  CA  . CYS A 1 36 ? -1.569  7.157   2.295   1.00 0.00 ? 36 CYS A CA  4  
ATOM   1984 C  C   . CYS A 1 36 ? -0.749  8.004   3.272   1.00 0.00 ? 36 CYS A C   4  
ATOM   1985 O  O   . CYS A 1 36 ? 0.393   8.365   2.992   1.00 0.00 ? 36 CYS A O   4  
ATOM   1986 C  CB  . CYS A 1 36 ? -1.110  5.728   2.323   1.00 0.00 ? 36 CYS A CB  4  
ATOM   1987 S  SG  . CYS A 1 36 ? -1.336  4.906   3.900   1.00 0.00 ? 36 CYS A SG  4  
ATOM   1988 N  N   . ALA A 1 37 ? -1.311  8.325   4.436   1.00 0.00 ? 37 ALA A N   4  
ATOM   1989 C  CA  . ALA A 1 37 ? -0.651  9.156   5.433   1.00 0.00 ? 37 ALA A CA  4  
ATOM   1990 C  C   . ALA A 1 37 ? 0.645   8.530   5.955   1.00 0.00 ? 37 ALA A C   4  
ATOM   1991 O  O   . ALA A 1 37 ? 1.525   9.251   6.415   1.00 0.00 ? 37 ALA A O   4  
ATOM   1992 C  CB  . ALA A 1 37 ? -1.620  9.454   6.576   1.00 0.00 ? 37 ALA A CB  4  
ATOM   1993 N  N   . PHE A 1 38 ? 0.777   7.200   5.887   1.00 0.00 ? 38 PHE A N   4  
ATOM   1994 C  CA  . PHE A 1 38 ? 2.007   6.524   6.284   1.00 0.00 ? 38 PHE A CA  4  
ATOM   1995 C  C   . PHE A 1 38 ? 3.064   6.539   5.176   1.00 0.00 ? 38 PHE A C   4  
ATOM   1996 O  O   . PHE A 1 38 ? 4.163   6.031   5.400   1.00 0.00 ? 38 PHE A O   4  
ATOM   1997 C  CB  . PHE A 1 38 ? 1.706   5.085   6.723   1.00 0.00 ? 38 PHE A CB  4  
ATOM   1998 C  CG  . PHE A 1 38 ? 0.899   4.974   8.004   1.00 0.00 ? 38 PHE A CG  4  
ATOM   1999 C  CD1 . PHE A 1 38 ? 1.434   5.458   9.214   1.00 0.00 ? 38 PHE A CD1 4  
ATOM   2000 C  CD2 . PHE A 1 38 ? -0.375  4.375   7.998   1.00 0.00 ? 38 PHE A CD2 4  
ATOM   2001 C  CE1 . PHE A 1 38 ? 0.696   5.358   10.404  1.00 0.00 ? 38 PHE A CE1 4  
ATOM   2002 C  CE2 . PHE A 1 38 ? -1.110  4.270   9.191   1.00 0.00 ? 38 PHE A CE2 4  
ATOM   2003 C  CZ  . PHE A 1 38 ? -0.576  4.764   10.395  1.00 0.00 ? 38 PHE A CZ  4  
ATOM   2004 N  N   . TRP A 1 39 ? 2.763   7.085   3.993   1.00 0.00 ? 39 TRP A N   4  
ATOM   2005 C  CA  . TRP A 1 39 ? 3.707   7.078   2.890   1.00 0.00 ? 39 TRP A CA  4  
ATOM   2006 C  C   . TRP A 1 39 ? 4.983   7.853   3.231   1.00 0.00 ? 39 TRP A C   4  
ATOM   2007 O  O   . TRP A 1 39 ? 4.932   8.921   3.840   1.00 0.00 ? 39 TRP A O   4  
ATOM   2008 C  CB  . TRP A 1 39 ? 3.055   7.653   1.635   1.00 0.00 ? 39 TRP A CB  4  
ATOM   2009 C  CG  . TRP A 1 39 ? 3.896   7.535   0.404   1.00 0.00 ? 39 TRP A CG  4  
ATOM   2010 C  CD1 . TRP A 1 39 ? 4.583   8.540   -0.181  1.00 0.00 ? 39 TRP A CD1 4  
ATOM   2011 C  CD2 . TRP A 1 39 ? 4.181   6.341   -0.382  1.00 0.00 ? 39 TRP A CD2 4  
ATOM   2012 N  NE1 . TRP A 1 39 ? 5.254   8.058   -1.285  1.00 0.00 ? 39 TRP A NE1 4  
ATOM   2013 C  CE2 . TRP A 1 39 ? 5.001   6.718   -1.484  1.00 0.00 ? 39 TRP A CE2 4  
ATOM   2014 C  CE3 . TRP A 1 39 ? 3.827   4.978   -0.287  1.00 0.00 ? 39 TRP A CE3 4  
ATOM   2015 C  CZ2 . TRP A 1 39 ? 5.400   5.807   -2.468  1.00 0.00 ? 39 TRP A CZ2 4  
ATOM   2016 C  CZ3 . TRP A 1 39 ? 4.288   4.040   -1.229  1.00 0.00 ? 39 TRP A CZ3 4  
ATOM   2017 C  CH2 . TRP A 1 39 ? 5.049   4.457   -2.332  1.00 0.00 ? 39 TRP A CH2 4  
ATOM   2018 N  N   . GLY A 1 40 ? 6.121   7.317   2.795   1.00 0.00 ? 40 GLY A N   4  
ATOM   2019 C  CA  . GLY A 1 40 ? 7.429   7.938   2.887   1.00 0.00 ? 40 GLY A CA  4  
ATOM   2020 C  C   . GLY A 1 40 ? 7.689   8.780   1.643   1.00 0.00 ? 40 GLY A C   4  
ATOM   2021 O  O   . GLY A 1 40 ? 7.706   10.008  1.702   1.00 0.00 ? 40 GLY A O   4  
ATOM   2022 N  N   . GLU A 1 41 ? 7.918   8.105   0.515   1.00 0.00 ? 41 GLU A N   4  
ATOM   2023 C  CA  . GLU A 1 41 ? 8.442   8.680   -0.715  1.00 0.00 ? 41 GLU A CA  4  
ATOM   2024 C  C   . GLU A 1 41 ? 8.417   7.583   -1.779  1.00 0.00 ? 41 GLU A C   4  
ATOM   2025 O  O   . GLU A 1 41 ? 8.426   6.403   -1.424  1.00 0.00 ? 41 GLU A O   4  
ATOM   2026 C  CB  . GLU A 1 41 ? 9.875   9.190   -0.495  1.00 0.00 ? 41 GLU A CB  4  
ATOM   2027 C  CG  . GLU A 1 41 ? 10.765  8.033   -0.039  1.00 0.00 ? 41 GLU A CG  4  
ATOM   2028 C  CD  . GLU A 1 41 ? 12.163  8.473   0.364   1.00 0.00 ? 41 GLU A CD  4  
ATOM   2029 O  OE1 . GLU A 1 41 ? 12.741  9.309   -0.357  1.00 0.00 ? 41 GLU A OE1 4  
ATOM   2030 O  OE2 . GLU A 1 41 ? 12.652  7.918   1.373   1.00 0.00 ? 41 GLU A OE2 4  
ATOM   2031 N  N   . ALA A 1 42 ? 8.404   7.961   -3.061  1.00 0.00 ? 42 ALA A N   4  
ATOM   2032 C  CA  . ALA A 1 42 ? 8.593   7.025   -4.163  1.00 0.00 ? 42 ALA A CA  4  
ATOM   2033 C  C   . ALA A 1 42 ? 10.089  6.829   -4.403  1.00 0.00 ? 42 ALA A C   4  
ATOM   2034 O  O   . ALA A 1 42 ? 10.839  7.801   -4.432  1.00 0.00 ? 42 ALA A O   4  
ATOM   2035 C  CB  . ALA A 1 42 ? 7.867   7.504   -5.419  1.00 0.00 ? 42 ALA A CB  4  
ATOM   2036 N  N   . VAL A 1 43 ? 10.513  5.573   -4.548  1.00 0.00 ? 43 VAL A N   4  
ATOM   2037 C  CA  . VAL A 1 43 ? 11.910  5.182   -4.675  1.00 0.00 ? 43 VAL A CA  4  
ATOM   2038 C  C   . VAL A 1 43 ? 12.199  4.744   -6.111  1.00 0.00 ? 43 VAL A C   4  
ATOM   2039 O  O   . VAL A 1 43 ? 13.207  5.146   -6.688  1.00 0.00 ? 43 VAL A O   4  
ATOM   2040 C  CB  . VAL A 1 43 ? 12.216  4.041   -3.687  1.00 0.00 ? 43 VAL A CB  4  
ATOM   2041 C  CG1 . VAL A 1 43 ? 13.693  3.626   -3.755  1.00 0.00 ? 43 VAL A CG1 4  
ATOM   2042 C  CG2 . VAL A 1 43 ? 11.915  4.411   -2.230  1.00 0.00 ? 43 VAL A CG2 4  
ATOM   2043 N  N   . GLN A 1 44 ? 11.356  3.865   -6.664  1.00 0.00 ? 44 GLN A N   4  
ATOM   2044 C  CA  . GLN A 1 44 ? 11.568  3.227   -7.955  1.00 0.00 ? 44 GLN A CA  4  
ATOM   2045 C  C   . GLN A 1 44 ? 10.223  2.997   -8.657  1.00 0.00 ? 44 GLN A C   4  
ATOM   2046 O  O   . GLN A 1 44 ? 9.254   3.667   -8.311  1.00 0.00 ? 44 GLN A O   4  
ATOM   2047 C  CB  . GLN A 1 44 ? 12.483  2.004   -7.771  1.00 0.00 ? 44 GLN A CB  4  
ATOM   2048 C  CG  . GLN A 1 44 ? 11.916  0.926   -6.845  1.00 0.00 ? 44 GLN A CG  4  
ATOM   2049 C  CD  . GLN A 1 44 ? 13.002  -0.019  -6.329  1.00 0.00 ? 44 GLN A CD  4  
ATOM   2050 O  OE1 . GLN A 1 44 ? 13.165  -1.129  -6.828  1.00 0.00 ? 44 GLN A OE1 4  
ATOM   2051 N  NE2 . GLN A 1 44 ? 13.752  0.411   -5.316  1.00 0.00 ? 44 GLN A NE2 4  
ATOM   2052 N  N   . ASP A 1 45 ? 10.169  2.101   -9.652  1.00 0.00 ? 45 ASP A N   4  
ATOM   2053 C  CA  . ASP A 1 45 ? 9.161   1.941   -10.707 1.00 0.00 ? 45 ASP A CA  4  
ATOM   2054 C  C   . ASP A 1 45 ? 7.731   1.748   -10.189 1.00 0.00 ? 45 ASP A C   4  
ATOM   2055 O  O   . ASP A 1 45 ? 7.126   0.681   -10.285 1.00 0.00 ? 45 ASP A O   4  
ATOM   2056 C  CB  . ASP A 1 45 ? 9.594   0.813   -11.660 1.00 0.00 ? 45 ASP A CB  4  
ATOM   2057 C  CG  . ASP A 1 45 ? 9.997   -0.455  -10.925 1.00 0.00 ? 45 ASP A CG  4  
ATOM   2058 O  OD1 . ASP A 1 45 ? 11.013  -0.377  -10.196 1.00 0.00 ? 45 ASP A OD1 4  
ATOM   2059 O  OD2 . ASP A 1 45 ? 9.315   -1.493  -11.058 1.00 0.00 ? 45 ASP A OD2 4  
ATOM   2060 N  N   . GLY A 1 46 ? 7.182   2.831   -9.653  1.00 0.00 ? 46 GLY A N   4  
ATOM   2061 C  CA  . GLY A 1 46 ? 5.908   2.844   -8.967  1.00 0.00 ? 46 GLY A CA  4  
ATOM   2062 C  C   . GLY A 1 46 ? 6.015   2.081   -7.650  1.00 0.00 ? 46 GLY A C   4  
ATOM   2063 O  O   . GLY A 1 46 ? 5.055   1.446   -7.234  1.00 0.00 ? 46 GLY A O   4  
ATOM   2064 N  N   . TRP A 1 47 ? 7.166   2.139   -6.979  1.00 0.00 ? 47 TRP A N   4  
ATOM   2065 C  CA  . TRP A 1 47 ? 7.391   1.593   -5.666  1.00 0.00 ? 47 TRP A CA  4  
ATOM   2066 C  C   . TRP A 1 47 ? 8.019   2.651   -4.788  1.00 0.00 ? 47 TRP A C   4  
ATOM   2067 O  O   . TRP A 1 47 ? 8.846   3.443   -5.249  1.00 0.00 ? 47 TRP A O   4  
ATOM   2068 C  CB  . TRP A 1 47 ? 8.361   0.428   -5.736  1.00 0.00 ? 47 TRP A CB  4  
ATOM   2069 C  CG  . TRP A 1 47 ? 7.924   -0.732  -6.552  1.00 0.00 ? 47 TRP A CG  4  
ATOM   2070 C  CD1 . TRP A 1 47 ? 8.153   -0.912  -7.867  1.00 0.00 ? 47 TRP A CD1 4  
ATOM   2071 C  CD2 . TRP A 1 47 ? 7.148   -1.873  -6.114  1.00 0.00 ? 47 TRP A CD2 4  
ATOM   2072 N  NE1 . TRP A 1 47 ? 7.514   -2.058  -8.289  1.00 0.00 ? 47 TRP A NE1 4  
ATOM   2073 C  CE2 . TRP A 1 47 ? 6.879   -2.696  -7.244  1.00 0.00 ? 47 TRP A CE2 4  
ATOM   2074 C  CE3 . TRP A 1 47 ? 6.675   -2.306  -4.862  1.00 0.00 ? 47 TRP A CE3 4  
ATOM   2075 C  CZ2 . TRP A 1 47 ? 6.118   -3.867  -7.141  1.00 0.00 ? 47 TRP A CZ2 4  
ATOM   2076 C  CZ3 . TRP A 1 47 ? 5.858   -3.445  -4.759  1.00 0.00 ? 47 TRP A CZ3 4  
ATOM   2077 C  CH2 . TRP A 1 47 ? 5.534   -4.186  -5.907  1.00 0.00 ? 47 TRP A CH2 4  
ATOM   2078 N  N   . GLY A 1 48 ? 7.672   2.614   -3.510  1.00 0.00 ? 48 GLY A N   4  
ATOM   2079 C  CA  . GLY A 1 48 ? 8.213   3.512   -2.535  1.00 0.00 ? 48 GLY A CA  4  
ATOM   2080 C  C   . GLY A 1 48 ? 8.026   2.999   -1.122  1.00 0.00 ? 48 GLY A C   4  
ATOM   2081 O  O   . GLY A 1 48 ? 7.648   1.852   -0.890  1.00 0.00 ? 48 GLY A O   4  
ATOM   2082 N  N   . ARG A 1 49 ? 8.369   3.860   -0.176  1.00 0.00 ? 49 ARG A N   4  
ATOM   2083 C  CA  . ARG A 1 49 ? 8.443   3.520   1.227   1.00 0.00 ? 49 ARG A CA  4  
ATOM   2084 C  C   . ARG A 1 49 ? 7.107   3.851   1.877   1.00 0.00 ? 49 ARG A C   4  
ATOM   2085 O  O   . ARG A 1 49 ? 6.512   4.884   1.576   1.00 0.00 ? 49 ARG A O   4  
ATOM   2086 C  CB  . ARG A 1 49 ? 9.612   4.293   1.844   1.00 0.00 ? 49 ARG A CB  4  
ATOM   2087 C  CG  . ARG A 1 49 ? 10.937  3.724   1.339   1.00 0.00 ? 49 ARG A CG  4  
ATOM   2088 C  CD  . ARG A 1 49 ? 12.117  4.649   1.635   1.00 0.00 ? 49 ARG A CD  4  
ATOM   2089 N  NE  . ARG A 1 49 ? 13.376  4.134   1.065   1.00 0.00 ? 49 ARG A NE  4  
ATOM   2090 C  CZ  . ARG A 1 49 ? 14.507  4.840   0.930   1.00 0.00 ? 49 ARG A CZ  4  
ATOM   2091 N  NH1 . ARG A 1 49 ? 14.567  6.142   1.217   1.00 0.00 ? 49 ARG A NH1 4  
ATOM   2092 N  NH2 . ARG A 1 49 ? 15.597  4.207   0.494   1.00 0.00 ? 49 ARG A NH2 4  
ATOM   2093 N  N   . CYS A 1 50 ? 6.665   2.968   2.768   1.00 0.00 ? 50 CYS A N   4  
ATOM   2094 C  CA  . CYS A 1 50 ? 5.499   3.109   3.626   1.00 0.00 ? 50 CYS A CA  4  
ATOM   2095 C  C   . CYS A 1 50 ? 6.045   3.067   5.052   1.00 0.00 ? 50 CYS A C   4  
ATOM   2096 O  O   . CYS A 1 50 ? 6.405   2.007   5.563   1.00 0.00 ? 50 CYS A O   4  
ATOM   2097 C  CB  . CYS A 1 50 ? 4.519   2.004   3.318   1.00 0.00 ? 50 CYS A CB  4  
ATOM   2098 S  SG  . CYS A 1 50 ? 3.285   1.861   4.631   1.00 0.00 ? 50 CYS A SG  4  
ATOM   2099 N  N   . THR A 1 51 ? 6.218   4.239   5.661   1.00 0.00 ? 51 THR A N   4  
ATOM   2100 C  CA  . THR A 1 51 ? 6.897   4.391   6.938   1.00 0.00 ? 51 THR A CA  4  
ATOM   2101 C  C   . THR A 1 51 ? 5.972   3.954   8.075   1.00 0.00 ? 51 THR A C   4  
ATOM   2102 O  O   . THR A 1 51 ? 5.472   4.784   8.836   1.00 0.00 ? 51 THR A O   4  
ATOM   2103 C  CB  . THR A 1 51 ? 7.395   5.841   7.078   1.00 0.00 ? 51 THR A CB  4  
ATOM   2104 O  OG1 . THR A 1 51 ? 6.493   6.768   6.507   1.00 0.00 ? 51 THR A OG1 4  
ATOM   2105 C  CG2 . THR A 1 51 ? 8.720   6.020   6.335   1.00 0.00 ? 51 THR A CG2 4  
ATOM   2106 N  N   . HIS A 1 52 ? 5.735   2.646   8.190   1.00 0.00 ? 52 HIS A N   4  
ATOM   2107 C  CA  . HIS A 1 52 ? 4.920   2.069   9.244   1.00 0.00 ? 52 HIS A CA  4  
ATOM   2108 C  C   . HIS A 1 52 ? 5.210   0.562   9.372   1.00 0.00 ? 52 HIS A C   4  
ATOM   2109 O  O   . HIS A 1 52 ? 5.020   -0.164  8.394   1.00 0.00 ? 52 HIS A O   4  
ATOM   2110 C  CB  . HIS A 1 52 ? 3.446   2.344   8.908   1.00 0.00 ? 52 HIS A CB  4  
ATOM   2111 C  CG  . HIS A 1 52 ? 2.487   1.648   9.830   1.00 0.00 ? 52 HIS A CG  4  
ATOM   2112 N  ND1 . HIS A 1 52 ? 2.345   1.880   11.185  1.00 0.00 ? 52 HIS A ND1 4  
ATOM   2113 C  CD2 . HIS A 1 52 ? 1.818   0.501   9.523   1.00 0.00 ? 52 HIS A CD2 4  
ATOM   2114 C  CE1 . HIS A 1 52 ? 1.623   0.865   11.696  1.00 0.00 ? 52 HIS A CE1 4  
ATOM   2115 N  NE2 . HIS A 1 52 ? 1.297   0.018   10.703  1.00 0.00 ? 52 HIS A NE2 4  
ATOM   2116 N  N   . PRO A 1 53 ? 5.609   0.062   10.555  1.00 0.00 ? 53 PRO A N   4  
ATOM   2117 C  CA  . PRO A 1 53 ? 5.901   -1.352  10.734  1.00 0.00 ? 53 PRO A CA  4  
ATOM   2118 C  C   . PRO A 1 53 ? 4.592   -2.130  10.639  1.00 0.00 ? 53 PRO A C   4  
ATOM   2119 O  O   . PRO A 1 53 ? 3.590   -1.699  11.210  1.00 0.00 ? 53 PRO A O   4  
ATOM   2120 C  CB  . PRO A 1 53 ? 6.571   -1.474  12.104  1.00 0.00 ? 53 PRO A CB  4  
ATOM   2121 C  CG  . PRO A 1 53 ? 6.002   -0.286  12.877  1.00 0.00 ? 53 PRO A CG  4  
ATOM   2122 C  CD  . PRO A 1 53 ? 5.849   0.786   11.795  1.00 0.00 ? 53 PRO A CD  4  
ATOM   2123 N  N   . ASP A 1 54 ? 4.615   -3.214  9.855   1.00 0.00 ? 54 ASP A N   4  
ATOM   2124 C  CA  . ASP A 1 54 ? 3.511   -3.876  9.158   1.00 0.00 ? 54 ASP A CA  4  
ATOM   2125 C  C   . ASP A 1 54 ? 3.892   -3.865  7.680   1.00 0.00 ? 54 ASP A C   4  
ATOM   2126 O  O   . ASP A 1 54 ? 3.608   -4.818  6.953   1.00 0.00 ? 54 ASP A O   4  
ATOM   2127 C  CB  . ASP A 1 54 ? 2.143   -3.172  9.253   1.00 0.00 ? 54 ASP A CB  4  
ATOM   2128 C  CG  . ASP A 1 54 ? 1.334   -3.417  10.513  1.00 0.00 ? 54 ASP A CG  4  
ATOM   2129 O  OD1 . ASP A 1 54 ? 1.289   -4.572  10.987  1.00 0.00 ? 54 ASP A OD1 4  
ATOM   2130 O  OD2 . ASP A 1 54 ? 0.551   -2.504  10.863  1.00 0.00 ? 54 ASP A OD2 4  
ATOM   2131 N  N   . PHE A 1 55 ? 4.466   -2.736  7.244   1.00 0.00 ? 55 PHE A N   4  
ATOM   2132 C  CA  . PHE A 1 55 ? 4.816   -2.455  5.869   1.00 0.00 ? 55 PHE A CA  4  
ATOM   2133 C  C   . PHE A 1 55 ? 6.290   -2.103  5.684   1.00 0.00 ? 55 PHE A C   4  
ATOM   2134 O  O   . PHE A 1 55 ? 6.890   -2.602  4.735   1.00 0.00 ? 55 PHE A O   4  
ATOM   2135 C  CB  . PHE A 1 55 ? 3.873   -1.368  5.346   1.00 0.00 ? 55 PHE A CB  4  
ATOM   2136 C  CG  . PHE A 1 55 ? 2.527   -1.963  4.993   1.00 0.00 ? 55 PHE A CG  4  
ATOM   2137 C  CD1 . PHE A 1 55 ? 2.502   -2.850  3.899   1.00 0.00 ? 55 PHE A CD1 4  
ATOM   2138 C  CD2 . PHE A 1 55 ? 1.458   -1.959  5.914   1.00 0.00 ? 55 PHE A CD2 4  
ATOM   2139 C  CE1 . PHE A 1 55 ? 1.498   -3.819  3.790   1.00 0.00 ? 55 PHE A CE1 4  
ATOM   2140 C  CE2 . PHE A 1 55 ? 0.507   -2.992  5.849   1.00 0.00 ? 55 PHE A CE2 4  
ATOM   2141 C  CZ  . PHE A 1 55 ? 0.522   -3.913  4.791   1.00 0.00 ? 55 PHE A CZ  4  
ATOM   2142 N  N   . ASP A 1 56 ? 6.880   -1.260  6.542   1.00 0.00 ? 56 ASP A N   4  
ATOM   2143 C  CA  . ASP A 1 56 ? 8.247   -0.770  6.335   1.00 0.00 ? 56 ASP A CA  4  
ATOM   2144 C  C   . ASP A 1 56 ? 9.302   -1.876  6.183   1.00 0.00 ? 56 ASP A C   4  
ATOM   2145 O  O   . ASP A 1 56 ? 10.358  -1.618  5.603   1.00 0.00 ? 56 ASP A O   4  
ATOM   2146 C  CB  . ASP A 1 56 ? 8.660   0.311   7.350   1.00 0.00 ? 56 ASP A CB  4  
ATOM   2147 C  CG  . ASP A 1 56 ? 8.778   -0.148  8.794   1.00 0.00 ? 56 ASP A CG  4  
ATOM   2148 O  OD1 . ASP A 1 56 ? 9.390   -1.210  9.027   1.00 0.00 ? 56 ASP A OD1 4  
ATOM   2149 O  OD2 . ASP A 1 56 ? 8.275   0.610   9.652   1.00 0.00 ? 56 ASP A OD2 4  
ATOM   2150 N  N   . GLU A 1 57 ? 9.013   -3.110  6.608   1.00 0.00 ? 57 GLU A N   4  
ATOM   2151 C  CA  . GLU A 1 57 ? 9.859   -4.263  6.299   1.00 0.00 ? 57 GLU A CA  4  
ATOM   2152 C  C   . GLU A 1 57 ? 10.178  -4.386  4.799   1.00 0.00 ? 57 GLU A C   4  
ATOM   2153 O  O   . GLU A 1 57 ? 11.247  -4.879  4.438   1.00 0.00 ? 57 GLU A O   4  
ATOM   2154 C  CB  . GLU A 1 57 ? 9.214   -5.579  6.763   1.00 0.00 ? 57 GLU A CB  4  
ATOM   2155 C  CG  . GLU A 1 57 ? 8.533   -5.520  8.137   1.00 0.00 ? 57 GLU A CG  4  
ATOM   2156 C  CD  . GLU A 1 57 ? 7.093   -5.053  8.010   1.00 0.00 ? 57 GLU A CD  4  
ATOM   2157 O  OE1 . GLU A 1 57 ? 6.288   -5.839  7.463   1.00 0.00 ? 57 GLU A OE1 4  
ATOM   2158 O  OE2 . GLU A 1 57 ? 6.834   -3.894  8.399   1.00 0.00 ? 57 GLU A OE2 4  
ATOM   2159 N  N   . VAL A 1 58 ? 9.228   -4.023  3.929   1.00 0.00 ? 58 VAL A N   4  
ATOM   2160 C  CA  . VAL A 1 58 ? 9.289   -4.216  2.484   1.00 0.00 ? 58 VAL A CA  4  
ATOM   2161 C  C   . VAL A 1 58 ? 8.995   -2.891  1.772   1.00 0.00 ? 58 VAL A C   4  
ATOM   2162 O  O   . VAL A 1 58 ? 8.467   -1.960  2.374   1.00 0.00 ? 58 VAL A O   4  
ATOM   2163 C  CB  . VAL A 1 58 ? 8.287   -5.310  2.061   1.00 0.00 ? 58 VAL A CB  4  
ATOM   2164 C  CG1 . VAL A 1 58 ? 8.753   -6.694  2.530   1.00 0.00 ? 58 VAL A CG1 4  
ATOM   2165 C  CG2 . VAL A 1 58 ? 6.873   -5.041  2.597   1.00 0.00 ? 58 VAL A CG2 4  
ATOM   2166 N  N   . LEU A 1 59 ? 9.331   -2.792  0.483   1.00 0.00 ? 59 LEU A N   4  
ATOM   2167 C  CA  . LEU A 1 59 ? 9.027   -1.629  -0.318  1.00 0.00 ? 59 LEU A CA  4  
ATOM   2168 C  C   . LEU A 1 59 ? 7.629   -1.791  -0.901  1.00 0.00 ? 59 LEU A C   4  
ATOM   2169 O  O   . LEU A 1 59 ? 7.306   -2.826  -1.475  1.00 0.00 ? 59 LEU A O   4  
ATOM   2170 C  CB  . LEU A 1 59 ? 10.081  -1.505  -1.411  1.00 0.00 ? 59 LEU A CB  4  
ATOM   2171 C  CG  . LEU A 1 59 ? 10.102  -0.099  -2.012  1.00 0.00 ? 59 LEU A CG  4  
ATOM   2172 C  CD1 . LEU A 1 59 ? 10.646  0.957   -1.041  1.00 0.00 ? 59 LEU A CD1 4  
ATOM   2173 C  CD2 . LEU A 1 59 ? 11.002  -0.111  -3.242  1.00 0.00 ? 59 LEU A CD2 4  
ATOM   2174 N  N   . VAL A 1 60 ? 6.793   -0.775  -0.741  1.00 0.00 ? 60 VAL A N   4  
ATOM   2175 C  CA  . VAL A 1 60 ? 5.374   -0.841  -1.019  1.00 0.00 ? 60 VAL A CA  4  
ATOM   2176 C  C   . VAL A 1 60 ? 5.115   -0.245  -2.398  1.00 0.00 ? 60 VAL A C   4  
ATOM   2177 O  O   . VAL A 1 60 ? 5.684   0.789   -2.749  1.00 0.00 ? 60 VAL A O   4  
ATOM   2178 C  CB  . VAL A 1 60 ? 4.666   -0.103  0.123   1.00 0.00 ? 60 VAL A CB  4  
ATOM   2179 C  CG1 . VAL A 1 60 ? 3.203   0.180   -0.183  1.00 0.00 ? 60 VAL A CG1 4  
ATOM   2180 C  CG2 . VAL A 1 60 ? 4.741   -0.972  1.385   1.00 0.00 ? 60 VAL A CG2 4  
ATOM   2181 N  N   . LYS A 1 61 ? 4.290   -0.904  -3.214  1.00 0.00 ? 61 LYS A N   4  
ATOM   2182 C  CA  . LYS A 1 61 ? 3.938   -0.357  -4.510  1.00 0.00 ? 61 LYS A CA  4  
ATOM   2183 C  C   . LYS A 1 61 ? 3.146   0.920   -4.291  1.00 0.00 ? 61 LYS A C   4  
ATOM   2184 O  O   . LYS A 1 61 ? 2.190   0.920   -3.526  1.00 0.00 ? 61 LYS A O   4  
ATOM   2185 C  CB  . LYS A 1 61 ? 3.109   -1.375  -5.303  1.00 0.00 ? 61 LYS A CB  4  
ATOM   2186 C  CG  . LYS A 1 61 ? 3.176   -1.022  -6.787  1.00 0.00 ? 61 LYS A CG  4  
ATOM   2187 C  CD  . LYS A 1 61 ? 2.976   -2.208  -7.731  1.00 0.00 ? 61 LYS A CD  4  
ATOM   2188 C  CE  . LYS A 1 61 ? 3.607   -1.878  -9.098  1.00 0.00 ? 61 LYS A CE  4  
ATOM   2189 N  NZ  . LYS A 1 61 ? 3.275   -0.527  -9.613  1.00 0.00 ? 61 LYS A NZ  4  
ATOM   2190 N  N   . ALA A 1 62 ? 3.523   1.990   -4.980  1.00 0.00 ? 62 ALA A N   4  
ATOM   2191 C  CA  . ALA A 1 62 ? 2.817   3.258   -4.930  1.00 0.00 ? 62 ALA A CA  4  
ATOM   2192 C  C   . ALA A 1 62 ? 1.329   3.086   -5.229  1.00 0.00 ? 62 ALA A C   4  
ATOM   2193 O  O   . ALA A 1 62 ? 0.505   3.720   -4.566  1.00 0.00 ? 62 ALA A O   4  
ATOM   2194 C  CB  . ALA A 1 62 ? 3.486   4.229   -5.892  1.00 0.00 ? 62 ALA A CB  4  
ATOM   2195 N  N   . GLU A 1 63 ? 0.975   2.225   -6.195  1.00 0.00 ? 63 GLU A N   4  
ATOM   2196 C  CA  . GLU A 1 63 ? -0.425  1.946   -6.476  1.00 0.00 ? 63 GLU A CA  4  
ATOM   2197 C  C   . GLU A 1 63 ? -1.052  0.883   -5.576  1.00 0.00 ? 63 GLU A C   4  
ATOM   2198 O  O   . GLU A 1 63 ? -2.203  0.523   -5.809  1.00 0.00 ? 63 GLU A O   4  
ATOM   2199 C  CB  . GLU A 1 63 ? -0.657  1.547   -7.931  1.00 0.00 ? 63 GLU A CB  4  
ATOM   2200 C  CG  . GLU A 1 63 ? 0.116   2.416   -8.919  1.00 0.00 ? 63 GLU A CG  4  
ATOM   2201 C  CD  . GLU A 1 63 ? 1.374   1.668   -9.328  1.00 0.00 ? 63 GLU A CD  4  
ATOM   2202 O  OE1 . GLU A 1 63 ? 2.331   1.631   -8.519  1.00 0.00 ? 63 GLU A OE1 4  
ATOM   2203 O  OE2 . GLU A 1 63 ? 1.354   0.973   -10.367 1.00 0.00 ? 63 GLU A OE2 4  
ATOM   2204 N  N   . GLY A 1 64 ? -0.323  0.337   -4.601  1.00 0.00 ? 64 GLY A N   4  
ATOM   2205 C  CA  . GLY A 1 64 ? -0.888  -0.648  -3.702  1.00 0.00 ? 64 GLY A CA  4  
ATOM   2206 C  C   . GLY A 1 64 ? -1.896  -0.014  -2.747  1.00 0.00 ? 64 GLY A C   4  
ATOM   2207 O  O   . GLY A 1 64 ? -2.189  1.179   -2.829  1.00 0.00 ? 64 GLY A O   4  
ATOM   2208 N  N   . TRP A 1 65 ? -2.430  -0.826  -1.836  1.00 0.00 ? 65 TRP A N   4  
ATOM   2209 C  CA  . TRP A 1 65 ? -3.273  -0.373  -0.740  1.00 0.00 ? 65 TRP A CA  4  
ATOM   2210 C  C   . TRP A 1 65 ? -3.274  -1.475  0.311   1.00 0.00 ? 65 TRP A C   4  
ATOM   2211 O  O   . TRP A 1 65 ? -3.150  -2.642  -0.062  1.00 0.00 ? 65 TRP A O   4  
ATOM   2212 C  CB  . TRP A 1 65 ? -4.693  -0.111  -1.254  1.00 0.00 ? 65 TRP A CB  4  
ATOM   2213 C  CG  . TRP A 1 65 ? -5.693  0.350   -0.239  1.00 0.00 ? 65 TRP A CG  4  
ATOM   2214 C  CD1 . TRP A 1 65 ? -6.066  1.632   -0.031  1.00 0.00 ? 65 TRP A CD1 4  
ATOM   2215 C  CD2 . TRP A 1 65 ? -6.510  -0.455  0.662   1.00 0.00 ? 65 TRP A CD2 4  
ATOM   2216 N  NE1 . TRP A 1 65 ? -7.086  1.675   0.896   1.00 0.00 ? 65 TRP A NE1 4  
ATOM   2217 C  CE2 . TRP A 1 65 ? -7.397  0.414   1.364   1.00 0.00 ? 65 TRP A CE2 4  
ATOM   2218 C  CE3 . TRP A 1 65 ? -6.631  -1.840  0.910   1.00 0.00 ? 65 TRP A CE3 4  
ATOM   2219 C  CZ2 . TRP A 1 65 ? -8.365  -0.071  2.259   1.00 0.00 ? 65 TRP A CZ2 4  
ATOM   2220 C  CZ3 . TRP A 1 65 ? -7.578  -2.334  1.824   1.00 0.00 ? 65 TRP A CZ3 4  
ATOM   2221 C  CH2 . TRP A 1 65 ? -8.455  -1.456  2.482   1.00 0.00 ? 65 TRP A CH2 4  
ATOM   2222 N  N   . CYS A 1 66 ? -3.425  -1.112  1.592   1.00 0.00 ? 66 CYS A N   4  
ATOM   2223 C  CA  . CYS A 1 66 ? -3.562  -2.031  2.715   1.00 0.00 ? 66 CYS A CA  4  
ATOM   2224 C  C   . CYS A 1 66 ? -4.700  -1.567  3.631   1.00 0.00 ? 66 CYS A C   4  
ATOM   2225 O  O   . CYS A 1 66 ? -5.127  -0.415  3.565   1.00 0.00 ? 66 CYS A O   4  
ATOM   2226 C  CB  . CYS A 1 66 ? -2.252  -2.167  3.458   1.00 0.00 ? 66 CYS A CB  4  
ATOM   2227 S  SG  . CYS A 1 66 ? -1.959  -0.799  4.600   1.00 0.00 ? 66 CYS A SG  4  
ATOM   2228 N  N   . SER A 1 67 ? -5.218  -2.437  4.504   1.00 0.00 ? 67 SER A N   4  
ATOM   2229 C  CA  . SER A 1 67 ? -6.311  -2.063  5.399   1.00 0.00 ? 67 SER A CA  4  
ATOM   2230 C  C   . SER A 1 67 ? -5.865  -1.111  6.516   1.00 0.00 ? 67 SER A C   4  
ATOM   2231 O  O   . SER A 1 67 ? -6.713  -0.462  7.133   1.00 0.00 ? 67 SER A O   4  
ATOM   2232 C  CB  . SER A 1 67 ? -7.036  -3.308  5.909   1.00 0.00 ? 67 SER A CB  4  
ATOM   2233 O  OG  . SER A 1 67 ? -6.154  -4.266  6.451   1.00 0.00 ? 67 SER A OG  4  
ATOM   2234 N  N   . VAL A 1 68 ? -4.553  -0.974  6.729   1.00 0.00 ? 68 VAL A N   4  
ATOM   2235 C  CA  . VAL A 1 68 ? -3.927  0.075   7.532   1.00 0.00 ? 68 VAL A CA  4  
ATOM   2236 C  C   . VAL A 1 68 ? -3.682  1.362   6.704   1.00 0.00 ? 68 VAL A C   4  
ATOM   2237 O  O   . VAL A 1 68 ? -3.115  2.324   7.214   1.00 0.00 ? 68 VAL A O   4  
ATOM   2238 C  CB  . VAL A 1 68 ? -2.783  -0.519  8.391   1.00 0.00 ? 68 VAL A CB  4  
ATOM   2239 C  CG1 . VAL A 1 68 ? -1.816  -1.498  7.741   1.00 0.00 ? 68 VAL A CG1 4  
ATOM   2240 C  CG2 . VAL A 1 68 ? -1.924  0.539   9.062   1.00 0.00 ? 68 VAL A CG2 4  
ATOM   2241 N  N   . TYR A 1 69 ? -4.224  1.460   5.480   1.00 0.00 ? 69 TYR A N   4  
ATOM   2242 C  CA  . TYR A 1 69 ? -4.355  2.737   4.778   1.00 0.00 ? 69 TYR A CA  4  
ATOM   2243 C  C   . TYR A 1 69 ? -5.068  3.757   5.665   1.00 0.00 ? 69 TYR A C   4  
ATOM   2244 O  O   . TYR A 1 69 ? -6.193  3.502   6.103   1.00 0.00 ? 69 TYR A O   4  
ATOM   2245 C  CB  . TYR A 1 69 ? -5.140  2.576   3.463   1.00 0.00 ? 69 TYR A CB  4  
ATOM   2246 C  CG  . TYR A 1 69 ? -5.352  3.877   2.704   1.00 0.00 ? 69 TYR A CG  4  
ATOM   2247 C  CD1 . TYR A 1 69 ? -6.415  4.732   3.051   1.00 0.00 ? 69 TYR A CD1 4  
ATOM   2248 C  CD2 . TYR A 1 69 ? -4.440  4.281   1.712   1.00 0.00 ? 69 TYR A CD2 4  
ATOM   2249 C  CE1 . TYR A 1 69 ? -6.481  6.024   2.510   1.00 0.00 ? 69 TYR A CE1 4  
ATOM   2250 C  CE2 . TYR A 1 69 ? -4.537  5.561   1.139   1.00 0.00 ? 69 TYR A CE2 4  
ATOM   2251 C  CZ  . TYR A 1 69 ? -5.536  6.447   1.562   1.00 0.00 ? 69 TYR A CZ  4  
ATOM   2252 O  OH  . TYR A 1 69 ? -5.642  7.691   1.017   1.00 0.00 ? 69 TYR A OH  4  
ATOM   2253 N  N   . ALA A 1 70 ? -4.461  4.926   5.870   1.00 0.00 ? 70 ALA A N   4  
ATOM   2254 C  CA  . ALA A 1 70 ? -5.089  6.082   6.489   1.00 0.00 ? 70 ALA A CA  4  
ATOM   2255 C  C   . ALA A 1 70 ? -4.977  7.227   5.483   1.00 0.00 ? 70 ALA A C   4  
ATOM   2256 O  O   . ALA A 1 70 ? -3.907  7.387   4.902   1.00 0.00 ? 70 ALA A O   4  
ATOM   2257 C  CB  . ALA A 1 70 ? -4.362  6.417   7.794   1.00 0.00 ? 70 ALA A CB  4  
ATOM   2258 N  N   . PRO A 1 71 ? -6.043  8.000   5.225   1.00 0.00 ? 71 PRO A N   4  
ATOM   2259 C  CA  . PRO A 1 71 ? -5.989  9.070   4.248   1.00 0.00 ? 71 PRO A CA  4  
ATOM   2260 C  C   . PRO A 1 71 ? -5.108  10.207  4.740   1.00 0.00 ? 71 PRO A C   4  
ATOM   2261 O  O   . PRO A 1 71 ? -5.019  10.468  5.938   1.00 0.00 ? 71 PRO A O   4  
ATOM   2262 C  CB  . PRO A 1 71 ? -7.436  9.514   4.030   1.00 0.00 ? 71 PRO A CB  4  
ATOM   2263 C  CG  . PRO A 1 71 ? -8.097  9.184   5.369   1.00 0.00 ? 71 PRO A CG  4  
ATOM   2264 C  CD  . PRO A 1 71 ? -7.362  7.923   5.831   1.00 0.00 ? 71 PRO A CD  4  
ATOM   2265 N  N   . ALA A 1 72 ? -4.460  10.882  3.790   1.00 0.00 ? 72 ALA A N   4  
ATOM   2266 C  CA  . ALA A 1 72 ? -3.606  12.027  4.050   1.00 0.00 ? 72 ALA A CA  4  
ATOM   2267 C  C   . ALA A 1 72 ? -4.367  13.326  3.780   1.00 0.00 ? 72 ALA A C   4  
ATOM   2268 O  O   . ALA A 1 72 ? -3.814  14.299  3.271   1.00 0.00 ? 72 ALA A O   4  
ATOM   2269 C  CB  . ALA A 1 72 ? -2.370  11.913  3.169   1.00 0.00 ? 72 ALA A CB  4  
ATOM   2270 N  N   . SER A 1 73 ? -5.658  13.312  4.088   1.00 0.00 ? 73 SER A N   4  
ATOM   2271 C  CA  . SER A 1 73 ? -6.633  14.379  3.960   1.00 0.00 ? 73 SER A CA  4  
ATOM   2272 C  C   . SER A 1 73 ? -7.859  13.899  4.737   1.00 0.00 ? 73 SER A C   4  
ATOM   2273 O  O   . SER A 1 73 ? -7.827  12.717  5.154   1.00 0.00 ? 73 SER A O   4  
ATOM   2274 C  CB  . SER A 1 73 ? -7.009  14.610  2.493   1.00 0.00 ? 73 SER A CB  4  
ATOM   2275 O  OG  . SER A 1 73 ? -5.945  15.197  1.764   1.00 0.00 ? 73 SER A OG  4  
ATOM   2276 O  OXT . SER A 1 73 ? -8.805  14.704  4.870   1.00 0.00 ? 73 SER A OXT 4  
HETATM 2277 FE FE1 . SF4 B 2 .  ? 0.152   1.567   1.602   1.00 0.00 ? 74 SF4 A FE1 4  
HETATM 2278 FE FE2 . SF4 B 2 .  ? -0.546  3.092   3.448   1.00 0.00 ? 74 SF4 A FE2 4  
HETATM 2279 FE FE3 . SF4 B 2 .  ? 1.473   1.737   3.720   1.00 0.00 ? 74 SF4 A FE3 4  
HETATM 2280 FE FE4 . SF4 B 2 .  ? -0.778  0.630   3.712   1.00 0.00 ? 74 SF4 A FE4 4  
HETATM 2281 S  S1  . SF4 B 2 .  ? -0.051  2.005   5.208   1.00 0.00 ? 74 SF4 A S1  4  
HETATM 2282 S  S2  . SF4 B 2 .  ? 0.977   -0.109  2.692   1.00 0.00 ? 74 SF4 A S2  4  
HETATM 2283 S  S3  . SF4 B 2 .  ? -1.871  1.823   2.308   1.00 0.00 ? 74 SF4 A S3  4  
HETATM 2284 S  S4  . SF4 B 2 .  ? 1.247   3.294   2.273   1.00 0.00 ? 74 SF4 A S4  4  
ATOM   2285 N  N   . ALA A 1 1  ? 16.395  1.241   2.413   1.00 0.00 ? 1  ALA A N   5  
ATOM   2286 C  CA  . ALA A 1 1  ? 17.148  0.446   1.456   1.00 0.00 ? 1  ALA A CA  5  
ATOM   2287 C  C   . ALA A 1 1  ? 16.286  0.247   0.212   1.00 0.00 ? 1  ALA A C   5  
ATOM   2288 O  O   . ALA A 1 1  ? 15.140  0.693   0.190   1.00 0.00 ? 1  ALA A O   5  
ATOM   2289 C  CB  . ALA A 1 1  ? 17.639  -0.866  2.075   1.00 0.00 ? 1  ALA A CB  5  
ATOM   2290 N  N   . SER A 1 2  ? 16.800  -0.462  -0.793  1.00 0.00 ? 2  SER A N   5  
ATOM   2291 C  CA  . SER A 1 2  ? 15.997  -0.952  -1.903  1.00 0.00 ? 2  SER A CA  5  
ATOM   2292 C  C   . SER A 1 2  ? 15.294  -2.245  -1.482  1.00 0.00 ? 2  SER A C   5  
ATOM   2293 O  O   . SER A 1 2  ? 15.608  -3.311  -2.008  1.00 0.00 ? 2  SER A O   5  
ATOM   2294 C  CB  . SER A 1 2  ? 16.911  -1.177  -3.116  1.00 0.00 ? 2  SER A CB  5  
ATOM   2295 O  OG  . SER A 1 2  ? 17.708  -0.028  -3.333  1.00 0.00 ? 2  SER A OG  5  
ATOM   2296 N  N   . GLU A 1 3  ? 14.387  -2.161  -0.504  1.00 0.00 ? 3  GLU A N   5  
ATOM   2297 C  CA  . GLU A 1 3  ? 13.745  -3.339  0.066   1.00 0.00 ? 3  GLU A CA  5  
ATOM   2298 C  C   . GLU A 1 3  ? 12.999  -4.145  -1.015  1.00 0.00 ? 3  GLU A C   5  
ATOM   2299 O  O   . GLU A 1 3  ? 12.575  -3.580  -2.025  1.00 0.00 ? 3  GLU A O   5  
ATOM   2300 C  CB  . GLU A 1 3  ? 12.824  -2.994  1.261   1.00 0.00 ? 3  GLU A CB  5  
ATOM   2301 C  CG  . GLU A 1 3  ? 12.588  -1.512  1.601   1.00 0.00 ? 3  GLU A CG  5  
ATOM   2302 C  CD  . GLU A 1 3  ? 13.767  -0.859  2.299   1.00 0.00 ? 3  GLU A CD  5  
ATOM   2303 O  OE1 . GLU A 1 3  ? 14.928  -1.291  2.175   1.00 0.00 ? 3  GLU A OE1 5  
ATOM   2304 O  OE2 . GLU A 1 3  ? 13.680  0.263   2.842   1.00 0.00 ? 3  GLU A OE2 5  
ATOM   2305 N  N   . PRO A 1 4  ? 12.830  -5.464  -0.819  1.00 0.00 ? 4  PRO A N   5  
ATOM   2306 C  CA  . PRO A 1 4  ? 12.102  -6.305  -1.752  1.00 0.00 ? 4  PRO A CA  5  
ATOM   2307 C  C   . PRO A 1 4  ? 10.662  -5.808  -1.905  1.00 0.00 ? 4  PRO A C   5  
ATOM   2308 O  O   . PRO A 1 4  ? 10.071  -5.285  -0.961  1.00 0.00 ? 4  PRO A O   5  
ATOM   2309 C  CB  . PRO A 1 4  ? 12.192  -7.732  -1.201  1.00 0.00 ? 4  PRO A CB  5  
ATOM   2310 C  CG  . PRO A 1 4  ? 12.505  -7.543  0.283   1.00 0.00 ? 4  PRO A CG  5  
ATOM   2311 C  CD  . PRO A 1 4  ? 13.285  -6.229  0.328   1.00 0.00 ? 4  PRO A CD  5  
ATOM   2312 N  N   . ARG A 1 5  ? 10.122  -5.937  -3.117  1.00 0.00 ? 5  ARG A N   5  
ATOM   2313 C  CA  . ARG A 1 5  ? 8.812   -5.418  -3.477  1.00 0.00 ? 5  ARG A CA  5  
ATOM   2314 C  C   . ARG A 1 5  ? 7.751   -6.279  -2.783  1.00 0.00 ? 5  ARG A C   5  
ATOM   2315 O  O   . ARG A 1 5  ? 7.792   -7.504  -2.880  1.00 0.00 ? 5  ARG A O   5  
ATOM   2316 C  CB  . ARG A 1 5  ? 8.689   -5.385  -5.011  1.00 0.00 ? 5  ARG A CB  5  
ATOM   2317 C  CG  . ARG A 1 5  ? 9.814   -4.550  -5.638  1.00 0.00 ? 5  ARG A CG  5  
ATOM   2318 C  CD  . ARG A 1 5  ? 9.887   -4.827  -7.138  1.00 0.00 ? 5  ARG A CD  5  
ATOM   2319 N  NE  . ARG A 1 5  ? 8.951   -4.027  -7.909  1.00 0.00 ? 5  ARG A NE  5  
ATOM   2320 C  CZ  . ARG A 1 5  ? 9.202   -3.455  -9.098  1.00 0.00 ? 5  ARG A CZ  5  
ATOM   2321 N  NH1 . ARG A 1 5  ? 10.333  -2.789  -9.330  1.00 0.00 ? 5  ARG A NH1 5  
ATOM   2322 N  NH2 . ARG A 1 5  ? 8.297   -3.518  -10.077 1.00 0.00 ? 5  ARG A NH2 5  
ATOM   2323 N  N   . ALA A 1 6  ? 6.862   -5.630  -2.029  1.00 0.00 ? 6  ALA A N   5  
ATOM   2324 C  CA  . ALA A 1 6  ? 5.955   -6.246  -1.073  1.00 0.00 ? 6  ALA A CA  5  
ATOM   2325 C  C   . ALA A 1 6  ? 5.104   -7.354  -1.684  1.00 0.00 ? 6  ALA A C   5  
ATOM   2326 O  O   . ALA A 1 6  ? 4.681   -7.276  -2.838  1.00 0.00 ? 6  ALA A O   5  
ATOM   2327 C  CB  . ALA A 1 6  ? 5.061   -5.162  -0.466  1.00 0.00 ? 6  ALA A CB  5  
ATOM   2328 N  N   . GLU A 1 7  ? 4.833   -8.377  -0.877  1.00 0.00 ? 7  GLU A N   5  
ATOM   2329 C  CA  . GLU A 1 7  ? 4.036   -9.519  -1.254  1.00 0.00 ? 7  GLU A CA  5  
ATOM   2330 C  C   . GLU A 1 7  ? 2.576   -9.109  -1.247  1.00 0.00 ? 7  GLU A C   5  
ATOM   2331 O  O   . GLU A 1 7  ? 2.128   -8.407  -0.338  1.00 0.00 ? 7  GLU A O   5  
ATOM   2332 C  CB  . GLU A 1 7  ? 4.216   -10.675 -0.270  1.00 0.00 ? 7  GLU A CB  5  
ATOM   2333 C  CG  . GLU A 1 7  ? 5.660   -10.843 0.201   1.00 0.00 ? 7  GLU A CG  5  
ATOM   2334 C  CD  . GLU A 1 7  ? 5.908   -10.090 1.504   1.00 0.00 ? 7  GLU A CD  5  
ATOM   2335 O  OE1 . GLU A 1 7  ? 6.028   -8.850  1.457   1.00 0.00 ? 7  GLU A OE1 5  
ATOM   2336 O  OE2 . GLU A 1 7  ? 5.878   -10.693 2.594   1.00 0.00 ? 7  GLU A OE2 5  
ATOM   2337 N  N   . ASP A 1 8  ? 1.814   -9.631  -2.199  1.00 0.00 ? 8  ASP A N   5  
ATOM   2338 C  CA  . ASP A 1 8  ? 0.375   -9.591  -2.129  1.00 0.00 ? 8  ASP A CA  5  
ATOM   2339 C  C   . ASP A 1 8  ? -0.019  -10.411 -0.903  1.00 0.00 ? 8  ASP A C   5  
ATOM   2340 O  O   . ASP A 1 8  ? 0.306   -11.593 -0.812  1.00 0.00 ? 8  ASP A O   5  
ATOM   2341 C  CB  . ASP A 1 8  ? -0.192  -10.141 -3.437  1.00 0.00 ? 8  ASP A CB  5  
ATOM   2342 C  CG  . ASP A 1 8  ? -0.066  -9.102  -4.538  1.00 0.00 ? 8  ASP A CG  5  
ATOM   2343 O  OD1 . ASP A 1 8  ? -0.960  -8.233  -4.605  1.00 0.00 ? 8  ASP A OD1 5  
ATOM   2344 O  OD2 . ASP A 1 8  ? 0.963   -9.135  -5.248  1.00 0.00 ? 8  ASP A OD2 5  
ATOM   2345 N  N   . GLY A 1 9  ? -0.628  -9.757  0.082   1.00 0.00 ? 9  GLY A N   5  
ATOM   2346 C  CA  . GLY A 1 9  ? -0.924  -10.345 1.373   1.00 0.00 ? 9  GLY A CA  5  
ATOM   2347 C  C   . GLY A 1 9  ? 0.291   -10.401 2.304   1.00 0.00 ? 9  GLY A C   5  
ATOM   2348 O  O   . GLY A 1 9  ? 0.284   -11.215 3.222   1.00 0.00 ? 9  GLY A O   5  
ATOM   2349 N  N   . HIS A 1 10 ? 1.296   -9.521  2.133   1.00 0.00 ? 10 HIS A N   5  
ATOM   2350 C  CA  . HIS A 1 10 ? 2.355   -9.304  3.126   1.00 0.00 ? 10 HIS A CA  5  
ATOM   2351 C  C   . HIS A 1 10 ? 1.773   -9.275  4.542   1.00 0.00 ? 10 HIS A C   5  
ATOM   2352 O  O   . HIS A 1 10 ? 2.214   -9.995  5.433   1.00 0.00 ? 10 HIS A O   5  
ATOM   2353 C  CB  . HIS A 1 10 ? 3.057   -7.968  2.845   1.00 0.00 ? 10 HIS A CB  5  
ATOM   2354 C  CG  . HIS A 1 10 ? 4.124   -7.621  3.858   1.00 0.00 ? 10 HIS A CG  5  
ATOM   2355 N  ND1 . HIS A 1 10 ? 5.393   -8.164  3.911   1.00 0.00 ? 10 HIS A ND1 5  
ATOM   2356 C  CD2 . HIS A 1 10 ? 4.008   -6.718  4.881   1.00 0.00 ? 10 HIS A CD2 5  
ATOM   2357 C  CE1 . HIS A 1 10 ? 6.039   -7.598  4.947   1.00 0.00 ? 10 HIS A CE1 5  
ATOM   2358 N  NE2 . HIS A 1 10 ? 5.219   -6.716  5.551   1.00 0.00 ? 10 HIS A NE2 5  
ATOM   2359 N  N   . ALA A 1 11 ? 0.777   -8.411  4.721   1.00 0.00 ? 11 ALA A N   5  
ATOM   2360 C  CA  . ALA A 1 11 ? -0.077  -8.346  5.894   1.00 0.00 ? 11 ALA A CA  5  
ATOM   2361 C  C   . ALA A 1 11 ? -1.273  -7.474  5.539   1.00 0.00 ? 11 ALA A C   5  
ATOM   2362 O  O   . ALA A 1 11 ? -1.336  -6.946  4.428   1.00 0.00 ? 11 ALA A O   5  
ATOM   2363 C  CB  . ALA A 1 11 ? 0.681   -7.760  7.094   1.00 0.00 ? 11 ALA A CB  5  
ATOM   2364 N  N   . HIS A 1 12 ? -2.190  -7.325  6.501   1.00 0.00 ? 12 HIS A N   5  
ATOM   2365 C  CA  . HIS A 1 12 ? -3.256  -6.327  6.523   1.00 0.00 ? 12 HIS A CA  5  
ATOM   2366 C  C   . HIS A 1 12 ? -3.887  -6.118  5.147   1.00 0.00 ? 12 HIS A C   5  
ATOM   2367 O  O   . HIS A 1 12 ? -4.054  -4.990  4.685   1.00 0.00 ? 12 HIS A O   5  
ATOM   2368 C  CB  . HIS A 1 12 ? -2.713  -5.022  7.110   1.00 0.00 ? 12 HIS A CB  5  
ATOM   2369 C  CG  . HIS A 1 12 ? -2.034  -5.174  8.452   1.00 0.00 ? 12 HIS A CG  5  
ATOM   2370 N  ND1 . HIS A 1 12 ? -1.002  -4.394  8.932   1.00 0.00 ? 12 HIS A ND1 5  
ATOM   2371 C  CD2 . HIS A 1 12 ? -2.410  -6.021  9.461   1.00 0.00 ? 12 HIS A CD2 5  
ATOM   2372 C  CE1 . HIS A 1 12 ? -0.796  -4.712  10.216  1.00 0.00 ? 12 HIS A CE1 5  
ATOM   2373 N  NE2 . HIS A 1 12 ? -1.622  -5.718  10.558  1.00 0.00 ? 12 HIS A NE2 5  
ATOM   2374 N  N   . ASP A 1 13 ? -4.220  -7.238  4.507   1.00 0.00 ? 13 ASP A N   5  
ATOM   2375 C  CA  . ASP A 1 13 ? -5.001  -7.299  3.282   1.00 0.00 ? 13 ASP A CA  5  
ATOM   2376 C  C   . ASP A 1 13 ? -4.356  -6.514  2.134   1.00 0.00 ? 13 ASP A C   5  
ATOM   2377 O  O   . ASP A 1 13 ? -5.056  -6.137  1.195   1.00 0.00 ? 13 ASP A O   5  
ATOM   2378 C  CB  . ASP A 1 13 ? -6.443  -6.827  3.524   1.00 0.00 ? 13 ASP A CB  5  
ATOM   2379 C  CG  . ASP A 1 13 ? -6.996  -7.138  4.903   1.00 0.00 ? 13 ASP A CG  5  
ATOM   2380 O  OD1 . ASP A 1 13 ? -6.827  -8.279  5.373   1.00 0.00 ? 13 ASP A OD1 5  
ATOM   2381 O  OD2 . ASP A 1 13 ? -7.610  -6.194  5.456   1.00 0.00 ? 13 ASP A OD2 5  
ATOM   2382 N  N   . TYR A 1 14 ? -3.048  -6.248  2.202   1.00 0.00 ? 14 TYR A N   5  
ATOM   2383 C  CA  . TYR A 1 14 ? -2.381  -5.504  1.151   1.00 0.00 ? 14 TYR A CA  5  
ATOM   2384 C  C   . TYR A 1 14 ? -2.447  -6.277  -0.157  1.00 0.00 ? 14 TYR A C   5  
ATOM   2385 O  O   . TYR A 1 14 ? -2.151  -7.469  -0.189  1.00 0.00 ? 14 TYR A O   5  
ATOM   2386 C  CB  . TYR A 1 14 ? -0.935  -5.177  1.534   1.00 0.00 ? 14 TYR A CB  5  
ATOM   2387 C  CG  . TYR A 1 14 ? -0.079  -4.616  0.409   1.00 0.00 ? 14 TYR A CG  5  
ATOM   2388 C  CD1 . TYR A 1 14 ? -0.008  -3.231  0.177   1.00 0.00 ? 14 TYR A CD1 5  
ATOM   2389 C  CD2 . TYR A 1 14 ? 0.658   -5.491  -0.410  1.00 0.00 ? 14 TYR A CD2 5  
ATOM   2390 C  CE1 . TYR A 1 14 ? 0.795   -2.729  -0.861  1.00 0.00 ? 14 TYR A CE1 5  
ATOM   2391 C  CE2 . TYR A 1 14 ? 1.514   -4.985  -1.401  1.00 0.00 ? 14 TYR A CE2 5  
ATOM   2392 C  CZ  . TYR A 1 14 ? 1.606   -3.598  -1.610  1.00 0.00 ? 14 TYR A CZ  5  
ATOM   2393 O  OH  . TYR A 1 14 ? 2.506   -3.095  -2.504  1.00 0.00 ? 14 TYR A OH  5  
ATOM   2394 N  N   . VAL A 1 15 ? -2.794  -5.573  -1.228  1.00 0.00 ? 15 VAL A N   5  
ATOM   2395 C  CA  . VAL A 1 15 ? -2.681  -6.049  -2.594  1.00 0.00 ? 15 VAL A CA  5  
ATOM   2396 C  C   . VAL A 1 15 ? -1.780  -5.061  -3.315  1.00 0.00 ? 15 VAL A C   5  
ATOM   2397 O  O   . VAL A 1 15 ? -1.796  -3.866  -3.007  1.00 0.00 ? 15 VAL A O   5  
ATOM   2398 C  CB  . VAL A 1 15 ? -4.061  -6.148  -3.263  1.00 0.00 ? 15 VAL A CB  5  
ATOM   2399 C  CG1 . VAL A 1 15 ? -4.713  -7.490  -2.915  1.00 0.00 ? 15 VAL A CG1 5  
ATOM   2400 C  CG2 . VAL A 1 15 ? -4.993  -5.010  -2.836  1.00 0.00 ? 15 VAL A CG2 5  
ATOM   2401 N  N   . ASN A 1 16 ? -0.958  -5.566  -4.232  1.00 0.00 ? 16 ASN A N   5  
ATOM   2402 C  CA  . ASN A 1 16 ? 0.019   -4.763  -4.920  1.00 0.00 ? 16 ASN A CA  5  
ATOM   2403 C  C   . ASN A 1 16 ? -0.640  -3.641  -5.703  1.00 0.00 ? 16 ASN A C   5  
ATOM   2404 O  O   . ASN A 1 16 ? -0.110  -2.536  -5.718  1.00 0.00 ? 16 ASN A O   5  
ATOM   2405 C  CB  . ASN A 1 16 ? 0.987   -5.610  -5.753  1.00 0.00 ? 16 ASN A CB  5  
ATOM   2406 C  CG  . ASN A 1 16 ? 2.262   -5.849  -4.960  1.00 0.00 ? 16 ASN A CG  5  
ATOM   2407 O  OD1 . ASN A 1 16 ? 2.898   -4.902  -4.506  1.00 0.00 ? 16 ASN A OD1 5  
ATOM   2408 N  ND2 . ASN A 1 16 ? 2.641   -7.095  -4.750  1.00 0.00 ? 16 ASN A ND2 5  
ATOM   2409 N  N   . GLU A 1 17 ? -1.796  -3.899  -6.318  1.00 0.00 ? 17 GLU A N   5  
ATOM   2410 C  CA  . GLU A 1 17 ? -2.627  -2.874  -6.886  1.00 0.00 ? 17 GLU A CA  5  
ATOM   2411 C  C   . GLU A 1 17 ? -3.818  -2.639  -5.969  1.00 0.00 ? 17 GLU A C   5  
ATOM   2412 O  O   . GLU A 1 17 ? -4.476  -3.577  -5.526  1.00 0.00 ? 17 GLU A O   5  
ATOM   2413 C  CB  . GLU A 1 17 ? -3.108  -3.374  -8.240  1.00 0.00 ? 17 GLU A CB  5  
ATOM   2414 C  CG  . GLU A 1 17 ? -2.947  -2.308  -9.309  1.00 0.00 ? 17 GLU A CG  5  
ATOM   2415 C  CD  . GLU A 1 17 ? -1.514  -2.212  -9.831  1.00 0.00 ? 17 GLU A CD  5  
ATOM   2416 O  OE1 . GLU A 1 17 ? -0.648  -1.722  -9.074  1.00 0.00 ? 17 GLU A OE1 5  
ATOM   2417 O  OE2 . GLU A 1 17 ? -1.280  -2.635  -10.981 1.00 0.00 ? 17 GLU A OE2 5  
ATOM   2418 N  N   . ALA A 1 18 ? -4.138  -1.370  -5.746  1.00 0.00 ? 18 ALA A N   5  
ATOM   2419 C  CA  . ALA A 1 18 ? -5.339  -0.957  -5.049  1.00 0.00 ? 18 ALA A CA  5  
ATOM   2420 C  C   . ALA A 1 18 ? -6.587  -1.416  -5.797  1.00 0.00 ? 18 ALA A C   5  
ATOM   2421 O  O   . ALA A 1 18 ? -7.616  -1.642  -5.167  1.00 0.00 ? 18 ALA A O   5  
ATOM   2422 C  CB  . ALA A 1 18 ? -5.334  0.562   -4.876  1.00 0.00 ? 18 ALA A CB  5  
ATOM   2423 N  N   . ALA A 1 19 ? -6.514  -1.565  -7.125  1.00 0.00 ? 19 ALA A N   5  
ATOM   2424 C  CA  . ALA A 1 19 ? -7.662  -2.004  -7.910  1.00 0.00 ? 19 ALA A CA  5  
ATOM   2425 C  C   . ALA A 1 19 ? -8.310  -3.256  -7.317  1.00 0.00 ? 19 ALA A C   5  
ATOM   2426 O  O   . ALA A 1 19 ? -9.508  -3.267  -7.029  1.00 0.00 ? 19 ALA A O   5  
ATOM   2427 C  CB  . ALA A 1 19 ? -7.247  -2.219  -9.368  1.00 0.00 ? 19 ALA A CB  5  
ATOM   2428 N  N   . ASP A 1 20 ? -7.513  -4.297  -7.079  1.00 0.00 ? 20 ASP A N   5  
ATOM   2429 C  CA  . ASP A 1 20 ? -7.938  -5.548  -6.501  1.00 0.00 ? 20 ASP A CA  5  
ATOM   2430 C  C   . ASP A 1 20 ? -8.627  -5.343  -5.152  1.00 0.00 ? 20 ASP A C   5  
ATOM   2431 O  O   . ASP A 1 20 ? -9.546  -6.082  -4.793  1.00 0.00 ? 20 ASP A O   5  
ATOM   2432 C  CB  . ASP A 1 20 ? -6.677  -6.400  -6.372  1.00 0.00 ? 20 ASP A CB  5  
ATOM   2433 C  CG  . ASP A 1 20 ? -6.056  -6.697  -7.729  1.00 0.00 ? 20 ASP A CG  5  
ATOM   2434 O  OD1 . ASP A 1 20 ? -5.544  -5.720  -8.318  1.00 0.00 ? 20 ASP A OD1 5  
ATOM   2435 O  OD2 . ASP A 1 20 ? -6.138  -7.867  -8.158  1.00 0.00 ? 20 ASP A OD2 5  
ATOM   2436 N  N   . ALA A 1 21 ? -8.225  -4.308  -4.409  1.00 0.00 ? 21 ALA A N   5  
ATOM   2437 C  CA  . ALA A 1 21 ? -8.815  -4.026  -3.110  1.00 0.00 ? 21 ALA A CA  5  
ATOM   2438 C  C   . ALA A 1 21 ? -10.258 -3.539  -3.232  1.00 0.00 ? 21 ALA A C   5  
ATOM   2439 O  O   . ALA A 1 21 ? -10.939 -3.472  -2.213  1.00 0.00 ? 21 ALA A O   5  
ATOM   2440 C  CB  . ALA A 1 21 ? -7.972  -3.041  -2.299  1.00 0.00 ? 21 ALA A CB  5  
ATOM   2441 N  N   . SER A 1 22 ? -10.761 -3.253  -4.439  1.00 0.00 ? 22 SER A N   5  
ATOM   2442 C  CA  . SER A 1 22 ? -12.162 -2.897  -4.661  1.00 0.00 ? 22 SER A CA  5  
ATOM   2443 C  C   . SER A 1 22 ? -13.143 -3.895  -4.046  1.00 0.00 ? 22 SER A C   5  
ATOM   2444 O  O   . SER A 1 22 ? -14.217 -3.548  -3.560  1.00 0.00 ? 22 SER A O   5  
ATOM   2445 C  CB  . SER A 1 22 ? -12.404 -2.648  -6.156  1.00 0.00 ? 22 SER A CB  5  
ATOM   2446 O  OG  . SER A 1 22 ? -13.696 -2.124  -6.384  1.00 0.00 ? 22 SER A OG  5  
ATOM   2447 N  N   . GLY A 1 23 ? -12.718 -5.148  -4.010  1.00 0.00 ? 23 GLY A N   5  
ATOM   2448 C  CA  . GLY A 1 23 ? -13.455 -6.242  -3.390  1.00 0.00 ? 23 GLY A CA  5  
ATOM   2449 C  C   . GLY A 1 23 ? -13.647 -6.060  -1.878  1.00 0.00 ? 23 GLY A C   5  
ATOM   2450 O  O   . GLY A 1 23 ? -14.554 -6.648  -1.291  1.00 0.00 ? 23 GLY A O   5  
ATOM   2451 N  N   . HIS A 1 24 ? -12.771 -5.292  -1.223  1.00 0.00 ? 24 HIS A N   5  
ATOM   2452 C  CA  . HIS A 1 24 ? -12.698 -5.166  0.222   1.00 0.00 ? 24 HIS A CA  5  
ATOM   2453 C  C   . HIS A 1 24 ? -13.623 -4.047  0.720   1.00 0.00 ? 24 HIS A C   5  
ATOM   2454 O  O   . HIS A 1 24 ? -13.244 -2.884  0.616   1.00 0.00 ? 24 HIS A O   5  
ATOM   2455 C  CB  . HIS A 1 24 ? -11.240 -4.834  0.589   1.00 0.00 ? 24 HIS A CB  5  
ATOM   2456 C  CG  . HIS A 1 24 ? -10.832 -5.145  2.011   1.00 0.00 ? 24 HIS A CG  5  
ATOM   2457 N  ND1 . HIS A 1 24 ? -11.602 -5.002  3.154   1.00 0.00 ? 24 HIS A ND1 5  
ATOM   2458 C  CD2 . HIS A 1 24 ? -9.568  -5.493  2.400   1.00 0.00 ? 24 HIS A CD2 5  
ATOM   2459 C  CE1 . HIS A 1 24 ? -10.812 -5.238  4.216   1.00 0.00 ? 24 HIS A CE1 5  
ATOM   2460 N  NE2 . HIS A 1 24 ? -9.576  -5.547  3.782   1.00 0.00 ? 24 HIS A NE2 5  
ATOM   2461 N  N   . PRO A 1 25 ? -14.763 -4.319  1.377   1.00 0.00 ? 25 PRO A N   5  
ATOM   2462 C  CA  . PRO A 1 25 ? -15.402 -3.279  2.173   1.00 0.00 ? 25 PRO A CA  5  
ATOM   2463 C  C   . PRO A 1 25 ? -14.381 -2.830  3.228   1.00 0.00 ? 25 PRO A C   5  
ATOM   2464 O  O   . PRO A 1 25 ? -13.867 -3.687  3.946   1.00 0.00 ? 25 PRO A O   5  
ATOM   2465 C  CB  . PRO A 1 25 ? -16.644 -3.927  2.787   1.00 0.00 ? 25 PRO A CB  5  
ATOM   2466 C  CG  . PRO A 1 25 ? -16.289 -5.414  2.835   1.00 0.00 ? 25 PRO A CG  5  
ATOM   2467 C  CD  . PRO A 1 25 ? -15.399 -5.610  1.606   1.00 0.00 ? 25 PRO A CD  5  
ATOM   2468 N  N   . ARG A 1 26 ? -14.016 -1.538  3.225   1.00 0.00 ? 26 ARG A N   5  
ATOM   2469 C  CA  . ARG A 1 26 ? -12.896 -0.888  3.925   1.00 0.00 ? 26 ARG A CA  5  
ATOM   2470 C  C   . ARG A 1 26 ? -12.080 -0.087  2.914   1.00 0.00 ? 26 ARG A C   5  
ATOM   2471 O  O   . ARG A 1 26 ? -11.565 0.990   3.242   1.00 0.00 ? 26 ARG A O   5  
ATOM   2472 C  CB  . ARG A 1 26 ? -11.954 -1.873  4.637   1.00 0.00 ? 26 ARG A CB  5  
ATOM   2473 C  CG  . ARG A 1 26 ? -10.705 -1.275  5.278   1.00 0.00 ? 26 ARG A CG  5  
ATOM   2474 C  CD  . ARG A 1 26 ? -10.987 -0.177  6.300   1.00 0.00 ? 26 ARG A CD  5  
ATOM   2475 N  NE  . ARG A 1 26 ? -9.714  0.425   6.700   1.00 0.00 ? 26 ARG A NE  5  
ATOM   2476 C  CZ  . ARG A 1 26 ? -9.078  1.413   6.050   1.00 0.00 ? 26 ARG A CZ  5  
ATOM   2477 N  NH1 . ARG A 1 26 ? -9.613  1.997   4.966   1.00 0.00 ? 26 ARG A NH1 5  
ATOM   2478 N  NH2 . ARG A 1 26 ? -7.886  1.779   6.509   1.00 0.00 ? 26 ARG A NH2 5  
ATOM   2479 N  N   . TYR A 1 27 ? -11.922 -0.652  1.712   1.00 0.00 ? 27 TYR A N   5  
ATOM   2480 C  CA  . TYR A 1 27 ? -11.368 0.041   0.570   1.00 0.00 ? 27 TYR A CA  5  
ATOM   2481 C  C   . TYR A 1 27 ? -12.354 1.089   0.078   1.00 0.00 ? 27 TYR A C   5  
ATOM   2482 O  O   . TYR A 1 27 ? -13.547 1.047   0.377   1.00 0.00 ? 27 TYR A O   5  
ATOM   2483 C  CB  . TYR A 1 27 ? -10.980 -0.956  -0.534  1.00 0.00 ? 27 TYR A CB  5  
ATOM   2484 C  CG  . TYR A 1 27 ? -10.255 -0.323  -1.706  1.00 0.00 ? 27 TYR A CG  5  
ATOM   2485 C  CD1 . TYR A 1 27 ? -8.917  0.045   -1.540  1.00 0.00 ? 27 TYR A CD1 5  
ATOM   2486 C  CD2 . TYR A 1 27 ? -10.932 0.064   -2.875  1.00 0.00 ? 27 TYR A CD2 5  
ATOM   2487 C  CE1 . TYR A 1 27 ? -8.299  0.930   -2.433  1.00 0.00 ? 27 TYR A CE1 5  
ATOM   2488 C  CE2 . TYR A 1 27 ? -10.265 0.833   -3.845  1.00 0.00 ? 27 TYR A CE2 5  
ATOM   2489 C  CZ  . TYR A 1 27 ? -8.988  1.362   -3.575  1.00 0.00 ? 27 TYR A CZ  5  
ATOM   2490 O  OH  . TYR A 1 27 ? -8.461  2.367   -4.339  1.00 0.00 ? 27 TYR A OH  5  
ATOM   2491 N  N   . GLN A 1 28 ? -11.801 2.039   -0.669  1.00 0.00 ? 28 GLN A N   5  
ATOM   2492 C  CA  . GLN A 1 28 ? -12.541 3.020   -1.441  1.00 0.00 ? 28 GLN A CA  5  
ATOM   2493 C  C   . GLN A 1 28 ? -11.673 3.510   -2.595  1.00 0.00 ? 28 GLN A C   5  
ATOM   2494 O  O   . GLN A 1 28 ? -10.507 3.866   -2.404  1.00 0.00 ? 28 GLN A O   5  
ATOM   2495 C  CB  . GLN A 1 28 ? -13.006 4.178   -0.555  1.00 0.00 ? 28 GLN A CB  5  
ATOM   2496 C  CG  . GLN A 1 28 ? -13.905 5.146   -1.335  1.00 0.00 ? 28 GLN A CG  5  
ATOM   2497 C  CD  . GLN A 1 28 ? -14.438 6.258   -0.439  1.00 0.00 ? 28 GLN A CD  5  
ATOM   2498 O  OE1 . GLN A 1 28 ? -14.130 7.428   -0.632  1.00 0.00 ? 28 GLN A OE1 5  
ATOM   2499 N  NE2 . GLN A 1 28 ? -15.242 5.902   0.558   1.00 0.00 ? 28 GLN A NE2 5  
ATOM   2500 N  N   . GLU A 1 29 ? -12.276 3.508   -3.779  1.00 0.00 ? 29 GLU A N   5  
ATOM   2501 C  CA  . GLU A 1 29 ? -11.688 3.833   -5.061  1.00 0.00 ? 29 GLU A CA  5  
ATOM   2502 C  C   . GLU A 1 29 ? -11.077 5.224   -5.015  1.00 0.00 ? 29 GLU A C   5  
ATOM   2503 O  O   . GLU A 1 29 ? -11.786 6.219   -4.880  1.00 0.00 ? 29 GLU A O   5  
ATOM   2504 C  CB  . GLU A 1 29 ? -12.757 3.711   -6.157  1.00 0.00 ? 29 GLU A CB  5  
ATOM   2505 C  CG  . GLU A 1 29 ? -13.148 2.253   -6.469  1.00 0.00 ? 29 GLU A CG  5  
ATOM   2506 C  CD  . GLU A 1 29 ? -13.782 1.491   -5.308  1.00 0.00 ? 29 GLU A CD  5  
ATOM   2507 O  OE1 . GLU A 1 29 ? -14.442 2.153   -4.474  1.00 0.00 ? 29 GLU A OE1 5  
ATOM   2508 O  OE2 . GLU A 1 29 ? -13.563 0.261   -5.257  1.00 0.00 ? 29 GLU A OE2 5  
ATOM   2509 N  N   . GLY A 1 30 ? -9.750  5.271   -5.114  1.00 0.00 ? 30 GLY A N   5  
ATOM   2510 C  CA  . GLY A 1 30 ? -8.979  6.495   -5.022  1.00 0.00 ? 30 GLY A CA  5  
ATOM   2511 C  C   . GLY A 1 30 ? -7.900  6.343   -3.963  1.00 0.00 ? 30 GLY A C   5  
ATOM   2512 O  O   . GLY A 1 30 ? -6.814  6.893   -4.123  1.00 0.00 ? 30 GLY A O   5  
ATOM   2513 N  N   . GLN A 1 31 ? -8.166  5.593   -2.887  1.00 0.00 ? 31 GLN A N   5  
ATOM   2514 C  CA  . GLN A 1 31 ? -7.157  5.384   -1.867  1.00 0.00 ? 31 GLN A CA  5  
ATOM   2515 C  C   . GLN A 1 31 ? -6.028  4.539   -2.471  1.00 0.00 ? 31 GLN A C   5  
ATOM   2516 O  O   . GLN A 1 31 ? -6.286  3.417   -2.908  1.00 0.00 ? 31 GLN A O   5  
ATOM   2517 C  CB  . GLN A 1 31 ? -7.791  4.695   -0.656  1.00 0.00 ? 31 GLN A CB  5  
ATOM   2518 C  CG  . GLN A 1 31 ? -8.851  5.559   0.052   1.00 0.00 ? 31 GLN A CG  5  
ATOM   2519 C  CD  . GLN A 1 31 ? -9.459  4.838   1.257   1.00 0.00 ? 31 GLN A CD  5  
ATOM   2520 O  OE1 . GLN A 1 31 ? -9.596  5.387   2.343   1.00 0.00 ? 31 GLN A OE1 5  
ATOM   2521 N  NE2 . GLN A 1 31 ? -9.838  3.580   1.071   1.00 0.00 ? 31 GLN A NE2 5  
ATOM   2522 N  N   . LEU A 1 32 ? -4.812  5.090   -2.516  1.00 0.00 ? 32 LEU A N   5  
ATOM   2523 C  CA  . LEU A 1 32 ? -3.587  4.451   -2.988  1.00 0.00 ? 32 LEU A CA  5  
ATOM   2524 C  C   . LEU A 1 32 ? -2.511  4.715   -1.929  1.00 0.00 ? 32 LEU A C   5  
ATOM   2525 O  O   . LEU A 1 32 ? -2.572  5.741   -1.255  1.00 0.00 ? 32 LEU A O   5  
ATOM   2526 C  CB  . LEU A 1 32 ? -3.140  5.090   -4.318  1.00 0.00 ? 32 LEU A CB  5  
ATOM   2527 C  CG  . LEU A 1 32 ? -3.468  4.301   -5.592  1.00 0.00 ? 32 LEU A CG  5  
ATOM   2528 C  CD1 . LEU A 1 32 ? -4.945  4.213   -5.955  1.00 0.00 ? 32 LEU A CD1 5  
ATOM   2529 C  CD2 . LEU A 1 32 ? -2.780  4.985   -6.780  1.00 0.00 ? 32 LEU A CD2 5  
ATOM   2530 N  N   . CYS A 1 33 ? -1.507  3.844   -1.804  1.00 0.00 ? 33 CYS A N   5  
ATOM   2531 C  CA  . CYS A 1 33 ? -0.375  4.038   -0.903  1.00 0.00 ? 33 CYS A CA  5  
ATOM   2532 C  C   . CYS A 1 33 ? 0.233   5.434   -1.072  1.00 0.00 ? 33 CYS A C   5  
ATOM   2533 O  O   . CYS A 1 33 ? 0.387   6.153   -0.092  1.00 0.00 ? 33 CYS A O   5  
ATOM   2534 C  CB  . CYS A 1 33 ? 0.647   2.948   -1.103  1.00 0.00 ? 33 CYS A CB  5  
ATOM   2535 S  SG  . CYS A 1 33 ? 0.157   1.413   -0.262  1.00 0.00 ? 33 CYS A SG  5  
ATOM   2536 N  N   . GLU A 1 34 ? 0.496   5.900   -2.298  1.00 0.00 ? 34 GLU A N   5  
ATOM   2537 C  CA  . GLU A 1 34 ? 1.007   7.267   -2.466  1.00 0.00 ? 34 GLU A CA  5  
ATOM   2538 C  C   . GLU A 1 34 ? -0.069  8.366   -2.274  1.00 0.00 ? 34 GLU A C   5  
ATOM   2539 O  O   . GLU A 1 34 ? 0.093   9.493   -2.736  1.00 0.00 ? 34 GLU A O   5  
ATOM   2540 C  CB  . GLU A 1 34 ? 1.867   7.371   -3.732  1.00 0.00 ? 34 GLU A CB  5  
ATOM   2541 C  CG  . GLU A 1 34 ? 2.696   8.666   -3.828  1.00 0.00 ? 34 GLU A CG  5  
ATOM   2542 C  CD  . GLU A 1 34 ? 4.068   8.449   -4.462  1.00 0.00 ? 34 GLU A CD  5  
ATOM   2543 O  OE1 . GLU A 1 34 ? 4.113   7.765   -5.507  1.00 0.00 ? 34 GLU A OE1 5  
ATOM   2544 O  OE2 . GLU A 1 34 ? 5.056   8.952   -3.874  1.00 0.00 ? 34 GLU A OE2 5  
ATOM   2545 N  N   . ASN A 1 35 ? -1.150  8.082   -1.535  1.00 0.00 ? 35 ASN A N   5  
ATOM   2546 C  CA  . ASN A 1 35 ? -1.985  9.078   -0.870  1.00 0.00 ? 35 ASN A CA  5  
ATOM   2547 C  C   . ASN A 1 35 ? -2.394  8.605   0.534   1.00 0.00 ? 35 ASN A C   5  
ATOM   2548 O  O   . ASN A 1 35 ? -3.435  9.012   1.054   1.00 0.00 ? 35 ASN A O   5  
ATOM   2549 C  CB  . ASN A 1 35 ? -3.178  9.467   -1.752  1.00 0.00 ? 35 ASN A CB  5  
ATOM   2550 C  CG  . ASN A 1 35 ? -4.174  8.354   -2.024  1.00 0.00 ? 35 ASN A CG  5  
ATOM   2551 O  OD1 . ASN A 1 35 ? -4.689  7.693   -1.129  1.00 0.00 ? 35 ASN A OD1 5  
ATOM   2552 N  ND2 . ASN A 1 35 ? -4.503  8.167   -3.293  1.00 0.00 ? 35 ASN A ND2 5  
ATOM   2553 N  N   . CYS A 1 36 ? -1.555  7.769   1.154   1.00 0.00 ? 36 CYS A N   5  
ATOM   2554 C  CA  . CYS A 1 36 ? -1.694  7.277   2.515   1.00 0.00 ? 36 CYS A CA  5  
ATOM   2555 C  C   . CYS A 1 36 ? -0.842  8.155   3.432   1.00 0.00 ? 36 CYS A C   5  
ATOM   2556 O  O   . CYS A 1 36 ? 0.301   8.476   3.113   1.00 0.00 ? 36 CYS A O   5  
ATOM   2557 C  CB  . CYS A 1 36 ? -1.204  5.857   2.524   1.00 0.00 ? 36 CYS A CB  5  
ATOM   2558 S  SG  . CYS A 1 36 ? -1.343  5.034   4.113   1.00 0.00 ? 36 CYS A SG  5  
ATOM   2559 N  N   . ALA A 1 37 ? -1.376  8.552   4.585   1.00 0.00 ? 37 ALA A N   5  
ATOM   2560 C  CA  . ALA A 1 37 ? -0.669  9.409   5.528   1.00 0.00 ? 37 ALA A CA  5  
ATOM   2561 C  C   . ALA A 1 37 ? 0.615   8.760   6.050   1.00 0.00 ? 37 ALA A C   5  
ATOM   2562 O  O   . ALA A 1 37 ? 1.510   9.467   6.507   1.00 0.00 ? 37 ALA A O   5  
ATOM   2563 C  CB  . ALA A 1 37 ? -1.603  9.786   6.677   1.00 0.00 ? 37 ALA A CB  5  
ATOM   2564 N  N   . PHE A 1 38 ? 0.715   7.428   5.991   1.00 0.00 ? 38 PHE A N   5  
ATOM   2565 C  CA  . PHE A 1 38 ? 1.918   6.714   6.394   1.00 0.00 ? 38 PHE A CA  5  
ATOM   2566 C  C   . PHE A 1 38 ? 2.913   6.550   5.245   1.00 0.00 ? 38 PHE A C   5  
ATOM   2567 O  O   . PHE A 1 38 ? 3.946   5.908   5.441   1.00 0.00 ? 38 PHE A O   5  
ATOM   2568 C  CB  . PHE A 1 38 ? 1.541   5.349   6.975   1.00 0.00 ? 38 PHE A CB  5  
ATOM   2569 C  CG  . PHE A 1 38 ? 0.602   5.393   8.170   1.00 0.00 ? 38 PHE A CG  5  
ATOM   2570 C  CD1 . PHE A 1 38 ? 0.920   6.187   9.288   1.00 0.00 ? 38 PHE A CD1 5  
ATOM   2571 C  CD2 . PHE A 1 38 ? -0.569  4.612   8.181   1.00 0.00 ? 38 PHE A CD2 5  
ATOM   2572 C  CE1 . PHE A 1 38 ? 0.061   6.219   10.400  1.00 0.00 ? 38 PHE A CE1 5  
ATOM   2573 C  CE2 . PHE A 1 38 ? -1.422  4.637   9.298   1.00 0.00 ? 38 PHE A CE2 5  
ATOM   2574 C  CZ  . PHE A 1 38 ? -1.113  5.445   10.404  1.00 0.00 ? 38 PHE A CZ  5  
ATOM   2575 N  N   . TRP A 1 39 ? 2.633   7.100   4.061   1.00 0.00 ? 39 TRP A N   5  
ATOM   2576 C  CA  . TRP A 1 39 ? 3.559   7.013   2.947   1.00 0.00 ? 39 TRP A CA  5  
ATOM   2577 C  C   . TRP A 1 39 ? 4.900   7.652   3.302   1.00 0.00 ? 39 TRP A C   5  
ATOM   2578 O  O   . TRP A 1 39 ? 4.941   8.712   3.926   1.00 0.00 ? 39 TRP A O   5  
ATOM   2579 C  CB  . TRP A 1 39 ? 2.958   7.696   1.718   1.00 0.00 ? 39 TRP A CB  5  
ATOM   2580 C  CG  . TRP A 1 39 ? 3.762   7.556   0.463   1.00 0.00 ? 39 TRP A CG  5  
ATOM   2581 C  CD1 . TRP A 1 39 ? 4.306   8.571   -0.247  1.00 0.00 ? 39 TRP A CD1 5  
ATOM   2582 C  CD2 . TRP A 1 39 ? 4.081   6.336   -0.270  1.00 0.00 ? 39 TRP A CD2 5  
ATOM   2583 N  NE1 . TRP A 1 39 ? 4.904   8.067   -1.381  1.00 0.00 ? 39 TRP A NE1 5  
ATOM   2584 C  CE2 . TRP A 1 39 ? 4.792   6.698   -1.451  1.00 0.00 ? 39 TRP A CE2 5  
ATOM   2585 C  CE3 . TRP A 1 39 ? 3.815   4.963   -0.079  1.00 0.00 ? 39 TRP A CE3 5  
ATOM   2586 C  CZ2 . TRP A 1 39 ? 5.191   5.756   -2.405  1.00 0.00 ? 39 TRP A CZ2 5  
ATOM   2587 C  CZ3 . TRP A 1 39 ? 4.240   4.005   -1.016  1.00 0.00 ? 39 TRP A CZ3 5  
ATOM   2588 C  CH2 . TRP A 1 39 ? 4.896   4.402   -2.191  1.00 0.00 ? 39 TRP A CH2 5  
ATOM   2589 N  N   . GLY A 1 40 ? 5.988   7.009   2.878   1.00 0.00 ? 40 GLY A N   5  
ATOM   2590 C  CA  . GLY A 1 40 ? 7.316   7.587   2.891   1.00 0.00 ? 40 GLY A CA  5  
ATOM   2591 C  C   . GLY A 1 40 ? 7.487   8.414   1.621   1.00 0.00 ? 40 GLY A C   5  
ATOM   2592 O  O   . GLY A 1 40 ? 6.907   9.489   1.496   1.00 0.00 ? 40 GLY A O   5  
ATOM   2593 N  N   . GLU A 1 41 ? 8.266   7.887   0.673   1.00 0.00 ? 41 GLU A N   5  
ATOM   2594 C  CA  . GLU A 1 41 ? 8.540   8.500   -0.615  1.00 0.00 ? 41 GLU A CA  5  
ATOM   2595 C  C   . GLU A 1 41 ? 8.689   7.385   -1.641  1.00 0.00 ? 41 GLU A C   5  
ATOM   2596 O  O   . GLU A 1 41 ? 9.033   6.254   -1.283  1.00 0.00 ? 41 GLU A O   5  
ATOM   2597 C  CB  . GLU A 1 41 ? 9.842   9.309   -0.553  1.00 0.00 ? 41 GLU A CB  5  
ATOM   2598 C  CG  . GLU A 1 41 ? 9.697   10.576  0.295   1.00 0.00 ? 41 GLU A CG  5  
ATOM   2599 C  CD  . GLU A 1 41 ? 10.994  11.376  0.323   1.00 0.00 ? 41 GLU A CD  5  
ATOM   2600 O  OE1 . GLU A 1 41 ? 12.004  10.791  0.770   1.00 0.00 ? 41 GLU A OE1 5  
ATOM   2601 O  OE2 . GLU A 1 41 ? 10.953  12.547  -0.107  1.00 0.00 ? 41 GLU A OE2 5  
ATOM   2602 N  N   . ALA A 1 42 ? 8.456   7.725   -2.912  1.00 0.00 ? 42 ALA A N   5  
ATOM   2603 C  CA  . ALA A 1 42 ? 8.729   6.837   -4.026  1.00 0.00 ? 42 ALA A CA  5  
ATOM   2604 C  C   . ALA A 1 42 ? 10.226  6.552   -4.131  1.00 0.00 ? 42 ALA A C   5  
ATOM   2605 O  O   . ALA A 1 42 ? 11.053  7.403   -3.813  1.00 0.00 ? 42 ALA A O   5  
ATOM   2606 C  CB  . ALA A 1 42 ? 8.165   7.416   -5.326  1.00 0.00 ? 42 ALA A CB  5  
ATOM   2607 N  N   . VAL A 1 43 ? 10.558  5.333   -4.560  1.00 0.00 ? 43 VAL A N   5  
ATOM   2608 C  CA  . VAL A 1 43 ? 11.916  4.822   -4.643  1.00 0.00 ? 43 VAL A CA  5  
ATOM   2609 C  C   . VAL A 1 43 ? 12.237  4.477   -6.102  1.00 0.00 ? 43 VAL A C   5  
ATOM   2610 O  O   . VAL A 1 43 ? 13.235  4.942   -6.645  1.00 0.00 ? 43 VAL A O   5  
ATOM   2611 C  CB  . VAL A 1 43 ? 12.055  3.600   -3.716  1.00 0.00 ? 43 VAL A CB  5  
ATOM   2612 C  CG1 . VAL A 1 43 ? 13.452  2.973   -3.828  1.00 0.00 ? 43 VAL A CG1 5  
ATOM   2613 C  CG2 . VAL A 1 43 ? 11.811  3.938   -2.235  1.00 0.00 ? 43 VAL A CG2 5  
ATOM   2614 N  N   . GLN A 1 44 ? 11.409  3.636   -6.728  1.00 0.00 ? 44 GLN A N   5  
ATOM   2615 C  CA  . GLN A 1 44 ? 11.598  3.152   -8.086  1.00 0.00 ? 44 GLN A CA  5  
ATOM   2616 C  C   . GLN A 1 44 ? 10.248  2.779   -8.684  1.00 0.00 ? 44 GLN A C   5  
ATOM   2617 O  O   . GLN A 1 44 ? 9.359   2.411   -7.930  1.00 0.00 ? 44 GLN A O   5  
ATOM   2618 C  CB  . GLN A 1 44 ? 12.516  1.925   -8.067  1.00 0.00 ? 44 GLN A CB  5  
ATOM   2619 C  CG  . GLN A 1 44 ? 11.987  0.798   -7.166  1.00 0.00 ? 44 GLN A CG  5  
ATOM   2620 C  CD  . GLN A 1 44 ? 12.701  -0.531  -7.391  1.00 0.00 ? 44 GLN A CD  5  
ATOM   2621 O  OE1 . GLN A 1 44 ? 12.065  -1.549  -7.666  1.00 0.00 ? 44 GLN A OE1 5  
ATOM   2622 N  NE2 . GLN A 1 44 ? 14.025  -0.542  -7.282  1.00 0.00 ? 44 GLN A NE2 5  
ATOM   2623 N  N   . ASP A 1 45 ? 10.130  2.794   -10.014 1.00 0.00 ? 45 ASP A N   5  
ATOM   2624 C  CA  . ASP A 1 45 ? 9.244   1.915   -10.786 1.00 0.00 ? 45 ASP A CA  5  
ATOM   2625 C  C   . ASP A 1 45 ? 7.782   1.827   -10.289 1.00 0.00 ? 45 ASP A C   5  
ATOM   2626 O  O   . ASP A 1 45 ? 7.137   0.786   -10.406 1.00 0.00 ? 45 ASP A O   5  
ATOM   2627 C  CB  . ASP A 1 45 ? 9.947   0.546   -10.847 1.00 0.00 ? 45 ASP A CB  5  
ATOM   2628 C  CG  . ASP A 1 45 ? 9.327   -0.444  -11.821 1.00 0.00 ? 45 ASP A CG  5  
ATOM   2629 O  OD1 . ASP A 1 45 ? 8.854   0.000   -12.885 1.00 0.00 ? 45 ASP A OD1 5  
ATOM   2630 O  OD2 . ASP A 1 45 ? 9.398   -1.651  -11.491 1.00 0.00 ? 45 ASP A OD2 5  
ATOM   2631 N  N   . GLY A 1 46 ? 7.244   2.908   -9.711  1.00 0.00 ? 46 GLY A N   5  
ATOM   2632 C  CA  . GLY A 1 46 ? 5.892   2.928   -9.151  1.00 0.00 ? 46 GLY A CA  5  
ATOM   2633 C  C   . GLY A 1 46 ? 5.800   2.232   -7.785  1.00 0.00 ? 46 GLY A C   5  
ATOM   2634 O  O   . GLY A 1 46 ? 4.780   1.643   -7.439  1.00 0.00 ? 46 GLY A O   5  
ATOM   2635 N  N   . TRP A 1 47 ? 6.860   2.316   -6.984  1.00 0.00 ? 47 TRP A N   5  
ATOM   2636 C  CA  . TRP A 1 47 ? 6.976   1.829   -5.630  1.00 0.00 ? 47 TRP A CA  5  
ATOM   2637 C  C   . TRP A 1 47 ? 7.621   2.897   -4.785  1.00 0.00 ? 47 TRP A C   5  
ATOM   2638 O  O   . TRP A 1 47 ? 8.342   3.761   -5.288  1.00 0.00 ? 47 TRP A O   5  
ATOM   2639 C  CB  . TRP A 1 47 ? 7.904   0.621   -5.580  1.00 0.00 ? 47 TRP A CB  5  
ATOM   2640 C  CG  . TRP A 1 47 ? 7.469   -0.520  -6.409  1.00 0.00 ? 47 TRP A CG  5  
ATOM   2641 C  CD1 . TRP A 1 47 ? 7.625   -0.601  -7.740  1.00 0.00 ? 47 TRP A CD1 5  
ATOM   2642 C  CD2 . TRP A 1 47 ? 6.783   -1.730  -6.003  1.00 0.00 ? 47 TRP A CD2 5  
ATOM   2643 N  NE1 . TRP A 1 47 ? 6.964   -1.709  -8.206  1.00 0.00 ? 47 TRP A NE1 5  
ATOM   2644 C  CE2 . TRP A 1 47 ? 6.448   -2.454  -7.178  1.00 0.00 ? 47 TRP A CE2 5  
ATOM   2645 C  CE3 . TRP A 1 47 ? 6.448   -2.311  -4.767  1.00 0.00 ? 47 TRP A CE3 5  
ATOM   2646 C  CZ2 . TRP A 1 47 ? 5.829   -3.702  -7.134  1.00 0.00 ? 47 TRP A CZ2 5  
ATOM   2647 C  CZ3 . TRP A 1 47 ? 5.714   -3.506  -4.713  1.00 0.00 ? 47 TRP A CZ3 5  
ATOM   2648 C  CH2 . TRP A 1 47 ? 5.435   -4.213  -5.894  1.00 0.00 ? 47 TRP A CH2 5  
ATOM   2649 N  N   . GLY A 1 48 ? 7.426   2.766   -3.481  1.00 0.00 ? 48 GLY A N   5  
ATOM   2650 C  CA  . GLY A 1 48 ? 8.019   3.632   -2.508  1.00 0.00 ? 48 GLY A CA  5  
ATOM   2651 C  C   . GLY A 1 48 ? 7.965   2.992   -1.145  1.00 0.00 ? 48 GLY A C   5  
ATOM   2652 O  O   . GLY A 1 48 ? 7.423   1.901   -0.963  1.00 0.00 ? 48 GLY A O   5  
ATOM   2653 N  N   . ARG A 1 49 ? 8.567   3.669   -0.182  1.00 0.00 ? 49 ARG A N   5  
ATOM   2654 C  CA  . ARG A 1 49 ? 8.493   3.234   1.187   1.00 0.00 ? 49 ARG A CA  5  
ATOM   2655 C  C   . ARG A 1 49 ? 7.152   3.631   1.801   1.00 0.00 ? 49 ARG A C   5  
ATOM   2656 O  O   . ARG A 1 49 ? 6.654   4.724   1.545   1.00 0.00 ? 49 ARG A O   5  
ATOM   2657 C  CB  . ARG A 1 49 ? 9.658   3.880   1.906   1.00 0.00 ? 49 ARG A CB  5  
ATOM   2658 C  CG  . ARG A 1 49 ? 10.957  3.321   1.330   1.00 0.00 ? 49 ARG A CG  5  
ATOM   2659 C  CD  . ARG A 1 49 ? 12.116  3.719   2.224   1.00 0.00 ? 49 ARG A CD  5  
ATOM   2660 N  NE  . ARG A 1 49 ? 12.462  2.609   3.135   1.00 0.00 ? 49 ARG A NE  5  
ATOM   2661 C  CZ  . ARG A 1 49 ? 11.902  2.296   4.314   1.00 0.00 ? 49 ARG A CZ  5  
ATOM   2662 N  NH1 . ARG A 1 49 ? 11.125  3.167   4.961   1.00 0.00 ? 49 ARG A NH1 5  
ATOM   2663 N  NH2 . ARG A 1 49 ? 12.142  1.085   4.812   1.00 0.00 ? 49 ARG A NH2 5  
ATOM   2664 N  N   . CYS A 1 50 ? 6.608   2.744   2.634   1.00 0.00 ? 50 CYS A N   5  
ATOM   2665 C  CA  . CYS A 1 50 ? 5.479   2.990   3.516   1.00 0.00 ? 50 CYS A CA  5  
ATOM   2666 C  C   . CYS A 1 50 ? 6.073   3.060   4.923   1.00 0.00 ? 50 CYS A C   5  
ATOM   2667 O  O   . CYS A 1 50 ? 6.521   2.049   5.460   1.00 0.00 ? 50 CYS A O   5  
ATOM   2668 C  CB  . CYS A 1 50 ? 4.491   1.862   3.369   1.00 0.00 ? 50 CYS A CB  5  
ATOM   2669 S  SG  . CYS A 1 50 ? 3.309   1.886   4.733   1.00 0.00 ? 50 CYS A SG  5  
ATOM   2670 N  N   . THR A 1 51 ? 6.165   4.259   5.499   1.00 0.00 ? 51 THR A N   5  
ATOM   2671 C  CA  . THR A 1 51 ? 6.809   4.459   6.786   1.00 0.00 ? 51 THR A CA  5  
ATOM   2672 C  C   . THR A 1 51 ? 5.886   3.985   7.911   1.00 0.00 ? 51 THR A C   5  
ATOM   2673 O  O   . THR A 1 51 ? 5.345   4.790   8.668   1.00 0.00 ? 51 THR A O   5  
ATOM   2674 C  CB  . THR A 1 51 ? 7.250   5.925   6.922   1.00 0.00 ? 51 THR A CB  5  
ATOM   2675 O  OG1 . THR A 1 51 ? 6.327   6.801   6.305   1.00 0.00 ? 51 THR A OG1 5  
ATOM   2676 C  CG2 . THR A 1 51 ? 8.593   6.130   6.219   1.00 0.00 ? 51 THR A CG2 5  
ATOM   2677 N  N   . HIS A 1 52 ? 5.709   2.667   8.020   1.00 0.00 ? 52 HIS A N   5  
ATOM   2678 C  CA  . HIS A 1 52 ? 4.909   2.044   9.058   1.00 0.00 ? 52 HIS A CA  5  
ATOM   2679 C  C   . HIS A 1 52 ? 5.394   0.609   9.290   1.00 0.00 ? 52 HIS A C   5  
ATOM   2680 O  O   . HIS A 1 52 ? 5.236   -0.219  8.396   1.00 0.00 ? 52 HIS A O   5  
ATOM   2681 C  CB  . HIS A 1 52 ? 3.438   2.055   8.629   1.00 0.00 ? 52 HIS A CB  5  
ATOM   2682 C  CG  . HIS A 1 52 ? 2.498   1.730   9.759   1.00 0.00 ? 52 HIS A CG  5  
ATOM   2683 N  ND1 . HIS A 1 52 ? 2.325   0.488   10.328  1.00 0.00 ? 52 HIS A ND1 5  
ATOM   2684 C  CD2 . HIS A 1 52 ? 1.654   2.605   10.386  1.00 0.00 ? 52 HIS A CD2 5  
ATOM   2685 C  CE1 . HIS A 1 52 ? 1.375   0.592   11.269  1.00 0.00 ? 52 HIS A CE1 5  
ATOM   2686 N  NE2 . HIS A 1 52 ? 0.956   1.873   11.326  1.00 0.00 ? 52 HIS A NE2 5  
ATOM   2687 N  N   . PRO A 1 53 ? 5.962   0.279   10.463  1.00 0.00 ? 53 PRO A N   5  
ATOM   2688 C  CA  . PRO A 1 53 ? 6.254   -1.099  10.831  1.00 0.00 ? 53 PRO A CA  5  
ATOM   2689 C  C   . PRO A 1 53 ? 4.996   -1.962  10.691  1.00 0.00 ? 53 PRO A C   5  
ATOM   2690 O  O   . PRO A 1 53 ? 3.967   -1.605  11.271  1.00 0.00 ? 53 PRO A O   5  
ATOM   2691 C  CB  . PRO A 1 53 ? 6.744   -1.048  12.282  1.00 0.00 ? 53 PRO A CB  5  
ATOM   2692 C  CG  . PRO A 1 53 ? 7.304   0.368   12.410  1.00 0.00 ? 53 PRO A CG  5  
ATOM   2693 C  CD  . PRO A 1 53 ? 6.367   1.186   11.522  1.00 0.00 ? 53 PRO A CD  5  
ATOM   2694 N  N   . ASP A 1 54 ? 5.107   -3.041  9.906   1.00 0.00 ? 54 ASP A N   5  
ATOM   2695 C  CA  . ASP A 1 54 ? 4.077   -3.927  9.356   1.00 0.00 ? 54 ASP A CA  5  
ATOM   2696 C  C   . ASP A 1 54 ? 4.169   -3.905  7.830   1.00 0.00 ? 54 ASP A C   5  
ATOM   2697 O  O   . ASP A 1 54 ? 3.821   -4.892  7.182   1.00 0.00 ? 54 ASP A O   5  
ATOM   2698 C  CB  . ASP A 1 54 ? 2.628   -3.677  9.819   1.00 0.00 ? 54 ASP A CB  5  
ATOM   2699 C  CG  . ASP A 1 54 ? 1.954   -2.495  9.131   1.00 0.00 ? 54 ASP A CG  5  
ATOM   2700 O  OD1 . ASP A 1 54 ? 2.654   -1.520  8.795   1.00 0.00 ? 54 ASP A OD1 5  
ATOM   2701 O  OD2 . ASP A 1 54 ? 0.714   -2.543  9.001   1.00 0.00 ? 54 ASP A OD2 5  
ATOM   2702 N  N   . PHE A 1 55 ? 4.626   -2.779  7.275   1.00 0.00 ? 55 PHE A N   5  
ATOM   2703 C  CA  . PHE A 1 55 ? 4.848   -2.568  5.858   1.00 0.00 ? 55 PHE A CA  5  
ATOM   2704 C  C   . PHE A 1 55 ? 6.285   -2.135  5.551   1.00 0.00 ? 55 PHE A C   5  
ATOM   2705 O  O   . PHE A 1 55 ? 6.860   -2.635  4.587   1.00 0.00 ? 55 PHE A O   5  
ATOM   2706 C  CB  . PHE A 1 55 ? 3.786   -1.587  5.344   1.00 0.00 ? 55 PHE A CB  5  
ATOM   2707 C  CG  . PHE A 1 55 ? 2.485   -2.302  5.036   1.00 0.00 ? 55 PHE A CG  5  
ATOM   2708 C  CD1 . PHE A 1 55 ? 2.483   -3.229  3.977   1.00 0.00 ? 55 PHE A CD1 5  
ATOM   2709 C  CD2 . PHE A 1 55 ? 1.355   -2.201  5.878   1.00 0.00 ? 55 PHE A CD2 5  
ATOM   2710 C  CE1 . PHE A 1 55 ? 1.422   -4.131  3.828   1.00 0.00 ? 55 PHE A CE1 5  
ATOM   2711 C  CE2 . PHE A 1 55 ? 0.284   -3.084  5.701   1.00 0.00 ? 55 PHE A CE2 5  
ATOM   2712 C  CZ  . PHE A 1 55 ? 0.332   -4.073  4.709   1.00 0.00 ? 55 PHE A CZ  5  
ATOM   2713 N  N   . ASP A 1 56 ? 6.864   -1.235  6.353   1.00 0.00 ? 56 ASP A N   5  
ATOM   2714 C  CA  . ASP A 1 56 ? 8.190   -0.641  6.157   1.00 0.00 ? 56 ASP A CA  5  
ATOM   2715 C  C   . ASP A 1 56 ? 9.259   -1.667  5.764   1.00 0.00 ? 56 ASP A C   5  
ATOM   2716 O  O   . ASP A 1 56 ? 10.114  -1.375  4.925   1.00 0.00 ? 56 ASP A O   5  
ATOM   2717 C  CB  . ASP A 1 56 ? 8.606   0.128   7.420   1.00 0.00 ? 56 ASP A CB  5  
ATOM   2718 C  CG  . ASP A 1 56 ? 9.827   0.995   7.160   1.00 0.00 ? 56 ASP A CG  5  
ATOM   2719 O  OD1 . ASP A 1 56 ? 10.948  0.446   7.108   1.00 0.00 ? 56 ASP A OD1 5  
ATOM   2720 O  OD2 . ASP A 1 56 ? 9.651   2.214   6.951   1.00 0.00 ? 56 ASP A OD2 5  
ATOM   2721 N  N   . GLU A 1 57 ? 9.194   -2.868  6.351   1.00 0.00 ? 57 GLU A N   5  
ATOM   2722 C  CA  . GLU A 1 57 ? 10.071  -3.994  6.029   1.00 0.00 ? 57 GLU A CA  5  
ATOM   2723 C  C   . GLU A 1 57 ? 10.291  -4.167  4.519   1.00 0.00 ? 57 GLU A C   5  
ATOM   2724 O  O   . GLU A 1 57 ? 11.393  -4.503  4.089   1.00 0.00 ? 57 GLU A O   5  
ATOM   2725 C  CB  . GLU A 1 57 ? 9.518   -5.322  6.576   1.00 0.00 ? 57 GLU A CB  5  
ATOM   2726 C  CG  . GLU A 1 57 ? 8.915   -5.262  7.984   1.00 0.00 ? 57 GLU A CG  5  
ATOM   2727 C  CD  . GLU A 1 57 ? 7.473   -4.789  7.938   1.00 0.00 ? 57 GLU A CD  5  
ATOM   2728 O  OE1 . GLU A 1 57 ? 6.628   -5.569  7.443   1.00 0.00 ? 57 GLU A OE1 5  
ATOM   2729 O  OE2 . GLU A 1 57 ? 7.261   -3.621  8.331   1.00 0.00 ? 57 GLU A OE2 5  
ATOM   2730 N  N   . VAL A 1 58 ? 9.220   -4.024  3.736   1.00 0.00 ? 58 VAL A N   5  
ATOM   2731 C  CA  . VAL A 1 58 ? 9.201   -4.277  2.302   1.00 0.00 ? 58 VAL A CA  5  
ATOM   2732 C  C   . VAL A 1 58 ? 8.885   -2.981  1.558   1.00 0.00 ? 58 VAL A C   5  
ATOM   2733 O  O   . VAL A 1 58 ? 8.291   -2.061  2.119   1.00 0.00 ? 58 VAL A O   5  
ATOM   2734 C  CB  . VAL A 1 58 ? 8.191   -5.388  1.976   1.00 0.00 ? 58 VAL A CB  5  
ATOM   2735 C  CG1 . VAL A 1 58 ? 8.718   -6.736  2.479   1.00 0.00 ? 58 VAL A CG1 5  
ATOM   2736 C  CG2 . VAL A 1 58 ? 6.799   -5.127  2.569   1.00 0.00 ? 58 VAL A CG2 5  
ATOM   2737 N  N   . LEU A 1 59 ? 9.278   -2.888  0.287   1.00 0.00 ? 59 LEU A N   5  
ATOM   2738 C  CA  . LEU A 1 59 ? 8.974   -1.725  -0.513  1.00 0.00 ? 59 LEU A CA  5  
ATOM   2739 C  C   . LEU A 1 59 ? 7.550   -1.862  -1.039  1.00 0.00 ? 59 LEU A C   5  
ATOM   2740 O  O   . LEU A 1 59 ? 7.178   -2.919  -1.541  1.00 0.00 ? 59 LEU A O   5  
ATOM   2741 C  CB  . LEU A 1 59 ? 9.997   -1.631  -1.640  1.00 0.00 ? 59 LEU A CB  5  
ATOM   2742 C  CG  . LEU A 1 59 ? 9.877   -0.298  -2.374  1.00 0.00 ? 59 LEU A CG  5  
ATOM   2743 C  CD1 . LEU A 1 59 ? 10.423  0.851   -1.531  1.00 0.00 ? 59 LEU A CD1 5  
ATOM   2744 C  CD2 . LEU A 1 59 ? 10.690  -0.369  -3.661  1.00 0.00 ? 59 LEU A CD2 5  
ATOM   2745 N  N   . VAL A 1 60 ? 6.747   -0.811  -0.916  1.00 0.00 ? 60 VAL A N   5  
ATOM   2746 C  CA  . VAL A 1 60 ? 5.314   -0.862  -1.132  1.00 0.00 ? 60 VAL A CA  5  
ATOM   2747 C  C   . VAL A 1 60 ? 4.987   -0.221  -2.478  1.00 0.00 ? 60 VAL A C   5  
ATOM   2748 O  O   . VAL A 1 60 ? 5.486   0.857   -2.796  1.00 0.00 ? 60 VAL A O   5  
ATOM   2749 C  CB  . VAL A 1 60 ? 4.652   -0.161  0.061   1.00 0.00 ? 60 VAL A CB  5  
ATOM   2750 C  CG1 . VAL A 1 60 ? 3.155   0.034   -0.139  1.00 0.00 ? 60 VAL A CG1 5  
ATOM   2751 C  CG2 . VAL A 1 60 ? 4.860   -1.016  1.320   1.00 0.00 ? 60 VAL A CG2 5  
ATOM   2752 N  N   . LYS A 1 61 ? 4.186   -0.896  -3.307  1.00 0.00 ? 61 LYS A N   5  
ATOM   2753 C  CA  . LYS A 1 61 ? 3.773   -0.347  -4.584  1.00 0.00 ? 61 LYS A CA  5  
ATOM   2754 C  C   . LYS A 1 61 ? 2.973   0.924   -4.347  1.00 0.00 ? 61 LYS A C   5  
ATOM   2755 O  O   . LYS A 1 61 ? 2.055   0.925   -3.533  1.00 0.00 ? 61 LYS A O   5  
ATOM   2756 C  CB  . LYS A 1 61 ? 2.924   -1.395  -5.296  1.00 0.00 ? 61 LYS A CB  5  
ATOM   2757 C  CG  . LYS A 1 61 ? 2.801   -1.104  -6.788  1.00 0.00 ? 61 LYS A CG  5  
ATOM   2758 C  CD  . LYS A 1 61 ? 2.626   -2.411  -7.571  1.00 0.00 ? 61 LYS A CD  5  
ATOM   2759 C  CE  . LYS A 1 61 ? 2.774   -2.158  -9.074  1.00 0.00 ? 61 LYS A CE  5  
ATOM   2760 N  NZ  . LYS A 1 61 ? 1.875   -1.068  -9.531  1.00 0.00 ? 61 LYS A NZ  5  
ATOM   2761 N  N   . ALA A 1 62 ? 3.291   1.996   -5.066  1.00 0.00 ? 62 ALA A N   5  
ATOM   2762 C  CA  . ALA A 1 62 ? 2.630   3.276   -4.870  1.00 0.00 ? 62 ALA A CA  5  
ATOM   2763 C  C   . ALA A 1 62 ? 1.142   3.180   -5.193  1.00 0.00 ? 62 ALA A C   5  
ATOM   2764 O  O   . ALA A 1 62 ? 0.335   3.830   -4.521  1.00 0.00 ? 62 ALA A O   5  
ATOM   2765 C  CB  . ALA A 1 62 ? 3.322   4.358   -5.687  1.00 0.00 ? 62 ALA A CB  5  
ATOM   2766 N  N   . GLU A 1 63 ? 0.769   2.366   -6.192  1.00 0.00 ? 63 GLU A N   5  
ATOM   2767 C  CA  . GLU A 1 63 ? -0.629  2.095   -6.468  1.00 0.00 ? 63 GLU A CA  5  
ATOM   2768 C  C   . GLU A 1 63 ? -1.234  1.029   -5.561  1.00 0.00 ? 63 GLU A C   5  
ATOM   2769 O  O   . GLU A 1 63 ? -2.413  0.726   -5.731  1.00 0.00 ? 63 GLU A O   5  
ATOM   2770 C  CB  . GLU A 1 63 ? -0.870  1.699   -7.923  1.00 0.00 ? 63 GLU A CB  5  
ATOM   2771 C  CG  . GLU A 1 63 ? -0.126  2.594   -8.917  1.00 0.00 ? 63 GLU A CG  5  
ATOM   2772 C  CD  . GLU A 1 63 ? 1.127   1.865   -9.386  1.00 0.00 ? 63 GLU A CD  5  
ATOM   2773 O  OE1 . GLU A 1 63 ? 1.877   1.396   -8.500  1.00 0.00 ? 63 GLU A OE1 5  
ATOM   2774 O  OE2 . GLU A 1 63 ? 1.277   1.628   -10.601 1.00 0.00 ? 63 GLU A OE2 5  
ATOM   2775 N  N   . GLY A 1 64 ? -0.473  0.432   -4.642  1.00 0.00 ? 64 GLY A N   5  
ATOM   2776 C  CA  . GLY A 1 64 ? -1.020  -0.528  -3.701  1.00 0.00 ? 64 GLY A CA  5  
ATOM   2777 C  C   . GLY A 1 64 ? -1.914  0.155   -2.677  1.00 0.00 ? 64 GLY A C   5  
ATOM   2778 O  O   . GLY A 1 64 ? -2.199  1.349   -2.771  1.00 0.00 ? 64 GLY A O   5  
ATOM   2779 N  N   . TRP A 1 65 ? -2.376  -0.621  -1.700  1.00 0.00 ? 65 TRP A N   5  
ATOM   2780 C  CA  . TRP A 1 65 ? -3.165  -0.150  -0.575  1.00 0.00 ? 65 TRP A CA  5  
ATOM   2781 C  C   . TRP A 1 65 ? -3.155  -1.276  0.450   1.00 0.00 ? 65 TRP A C   5  
ATOM   2782 O  O   . TRP A 1 65 ? -3.028  -2.435  0.055   1.00 0.00 ? 65 TRP A O   5  
ATOM   2783 C  CB  . TRP A 1 65 ? -4.589  0.156   -1.042  1.00 0.00 ? 65 TRP A CB  5  
ATOM   2784 C  CG  . TRP A 1 65 ? -5.591  0.477   0.024   1.00 0.00 ? 65 TRP A CG  5  
ATOM   2785 C  CD1 . TRP A 1 65 ? -6.035  1.713   0.333   1.00 0.00 ? 65 TRP A CD1 5  
ATOM   2786 C  CD2 . TRP A 1 65 ? -6.383  -0.447  0.830   1.00 0.00 ? 65 TRP A CD2 5  
ATOM   2787 N  NE1 . TRP A 1 65 ? -7.105  1.620   1.198   1.00 0.00 ? 65 TRP A NE1 5  
ATOM   2788 C  CE2 . TRP A 1 65 ? -7.378  0.305   1.526   1.00 0.00 ? 65 TRP A CE2 5  
ATOM   2789 C  CE3 . TRP A 1 65 ? -6.430  -1.853  0.958   1.00 0.00 ? 65 TRP A CE3 5  
ATOM   2790 C  CZ2 . TRP A 1 65 ? -8.404  -0.319  2.253   1.00 0.00 ? 65 TRP A CZ2 5  
ATOM   2791 C  CZ3 . TRP A 1 65 ? -7.397  -2.477  1.764   1.00 0.00 ? 65 TRP A CZ3 5  
ATOM   2792 C  CH2 . TRP A 1 65 ? -8.411  -1.719  2.369   1.00 0.00 ? 65 TRP A CH2 5  
ATOM   2793 N  N   . CYS A 1 66 ? -3.309  -0.942  1.735   1.00 0.00 ? 66 CYS A N   5  
ATOM   2794 C  CA  . CYS A 1 66 ? -3.442  -1.895  2.825   1.00 0.00 ? 66 CYS A CA  5  
ATOM   2795 C  C   . CYS A 1 66 ? -4.571  -1.444  3.755   1.00 0.00 ? 66 CYS A C   5  
ATOM   2796 O  O   . CYS A 1 66 ? -4.972  -0.280  3.738   1.00 0.00 ? 66 CYS A O   5  
ATOM   2797 C  CB  . CYS A 1 66 ? -2.141  -2.037  3.571   1.00 0.00 ? 66 CYS A CB  5  
ATOM   2798 S  SG  . CYS A 1 66 ? -1.891  -0.689  4.752   1.00 0.00 ? 66 CYS A SG  5  
ATOM   2799 N  N   . SER A 1 67 ? -5.099  -2.343  4.589   1.00 0.00 ? 67 SER A N   5  
ATOM   2800 C  CA  . SER A 1 67 ? -6.186  -1.974  5.480   1.00 0.00 ? 67 SER A CA  5  
ATOM   2801 C  C   . SER A 1 67 ? -5.730  -1.058  6.623   1.00 0.00 ? 67 SER A C   5  
ATOM   2802 O  O   . SER A 1 67 ? -6.583  -0.407  7.236   1.00 0.00 ? 67 SER A O   5  
ATOM   2803 C  CB  . SER A 1 67 ? -6.965  -3.213  5.930   1.00 0.00 ? 67 SER A CB  5  
ATOM   2804 O  OG  . SER A 1 67 ? -6.146  -4.221  6.475   1.00 0.00 ? 67 SER A OG  5  
ATOM   2805 N  N   . VAL A 1 68 ? -4.417  -0.931  6.881   1.00 0.00 ? 68 VAL A N   5  
ATOM   2806 C  CA  . VAL A 1 68 ? -3.914  0.087   7.810   1.00 0.00 ? 68 VAL A CA  5  
ATOM   2807 C  C   . VAL A 1 68 ? -3.931  1.498   7.201   1.00 0.00 ? 68 VAL A C   5  
ATOM   2808 O  O   . VAL A 1 68 ? -3.679  2.458   7.923   1.00 0.00 ? 68 VAL A O   5  
ATOM   2809 C  CB  . VAL A 1 68 ? -2.623  -0.270  8.585   1.00 0.00 ? 68 VAL A CB  5  
ATOM   2810 C  CG1 . VAL A 1 68 ? -2.557  -1.769  8.787   1.00 0.00 ? 68 VAL A CG1 5  
ATOM   2811 C  CG2 . VAL A 1 68 ? -1.246  0.188   8.101   1.00 0.00 ? 68 VAL A CG2 5  
ATOM   2812 N  N   . TYR A 1 69 ? -4.248  1.640   5.899   1.00 0.00 ? 69 TYR A N   5  
ATOM   2813 C  CA  . TYR A 1 69 ? -4.369  2.925   5.207   1.00 0.00 ? 69 TYR A CA  5  
ATOM   2814 C  C   . TYR A 1 69 ? -5.060  3.988   6.065   1.00 0.00 ? 69 TYR A C   5  
ATOM   2815 O  O   . TYR A 1 69 ? -6.198  3.784   6.486   1.00 0.00 ? 69 TYR A O   5  
ATOM   2816 C  CB  . TYR A 1 69 ? -5.151  2.741   3.894   1.00 0.00 ? 69 TYR A CB  5  
ATOM   2817 C  CG  . TYR A 1 69 ? -5.417  4.026   3.126   1.00 0.00 ? 69 TYR A CG  5  
ATOM   2818 C  CD1 . TYR A 1 69 ? -6.521  4.835   3.454   1.00 0.00 ? 69 TYR A CD1 5  
ATOM   2819 C  CD2 . TYR A 1 69 ? -4.532  4.445   2.117   1.00 0.00 ? 69 TYR A CD2 5  
ATOM   2820 C  CE1 . TYR A 1 69 ? -6.678  6.091   2.848   1.00 0.00 ? 69 TYR A CE1 5  
ATOM   2821 C  CE2 . TYR A 1 69 ? -4.715  5.684   1.483   1.00 0.00 ? 69 TYR A CE2 5  
ATOM   2822 C  CZ  . TYR A 1 69 ? -5.774  6.520   1.864   1.00 0.00 ? 69 TYR A CZ  5  
ATOM   2823 O  OH  . TYR A 1 69 ? -5.973  7.718   1.250   1.00 0.00 ? 69 TYR A OH  5  
ATOM   2824 N  N   . ALA A 1 70 ? -4.420  5.140   6.255   1.00 0.00 ? 70 ALA A N   5  
ATOM   2825 C  CA  . ALA A 1 70 ? -5.035  6.330   6.827   1.00 0.00 ? 70 ALA A CA  5  
ATOM   2826 C  C   . ALA A 1 70 ? -4.968  7.413   5.753   1.00 0.00 ? 70 ALA A C   5  
ATOM   2827 O  O   . ALA A 1 70 ? -3.919  7.539   5.125   1.00 0.00 ? 70 ALA A O   5  
ATOM   2828 C  CB  . ALA A 1 70 ? -4.262  6.747   8.081   1.00 0.00 ? 70 ALA A CB  5  
ATOM   2829 N  N   . PRO A 1 71 ? -6.042  8.171   5.490   1.00 0.00 ? 71 PRO A N   5  
ATOM   2830 C  CA  . PRO A 1 71 ? -6.019  9.190   4.458   1.00 0.00 ? 71 PRO A CA  5  
ATOM   2831 C  C   . PRO A 1 71 ? -5.138  10.359  4.869   1.00 0.00 ? 71 PRO A C   5  
ATOM   2832 O  O   . PRO A 1 71 ? -5.011  10.672  6.052   1.00 0.00 ? 71 PRO A O   5  
ATOM   2833 C  CB  . PRO A 1 71 ? -7.473  9.612   4.256   1.00 0.00 ? 71 PRO A CB  5  
ATOM   2834 C  CG  . PRO A 1 71 ? -8.095  9.355   5.630   1.00 0.00 ? 71 PRO A CG  5  
ATOM   2835 C  CD  . PRO A 1 71 ? -7.340  8.125   6.141   1.00 0.00 ? 71 PRO A CD  5  
ATOM   2836 N  N   . ALA A 1 72 ? -4.531  11.001  3.869   1.00 0.00 ? 72 ALA A N   5  
ATOM   2837 C  CA  . ALA A 1 72 ? -3.677  12.161  4.054   1.00 0.00 ? 72 ALA A CA  5  
ATOM   2838 C  C   . ALA A 1 72 ? -4.449  13.448  3.756   1.00 0.00 ? 72 ALA A C   5  
ATOM   2839 O  O   . ALA A 1 72 ? -3.897  14.413  3.228   1.00 0.00 ? 72 ALA A O   5  
ATOM   2840 C  CB  . ALA A 1 72 ? -2.465  12.015  3.142   1.00 0.00 ? 72 ALA A CB  5  
ATOM   2841 N  N   . SER A 1 73 ? -5.740  13.440  4.067   1.00 0.00 ? 73 SER A N   5  
ATOM   2842 C  CA  . SER A 1 73 ? -6.709  14.513  3.941   1.00 0.00 ? 73 SER A CA  5  
ATOM   2843 C  C   . SER A 1 73 ? -7.946  14.042  4.707   1.00 0.00 ? 73 SER A C   5  
ATOM   2844 O  O   . SER A 1 73 ? -8.898  14.844  4.808   1.00 0.00 ? 73 SER A O   5  
ATOM   2845 C  CB  . SER A 1 73 ? -7.082  14.764  2.475   1.00 0.00 ? 73 SER A CB  5  
ATOM   2846 O  OG  . SER A 1 73 ? -6.019  15.352  1.749   1.00 0.00 ? 73 SER A OG  5  
ATOM   2847 O  OXT . SER A 1 73 ? -7.914  12.869  5.145   1.00 0.00 ? 73 SER A OXT 5  
HETATM 2848 FE FE1 . SF4 B 2 .  ? 0.154   1.715   1.766   1.00 0.00 ? 74 SF4 A FE1 5  
HETATM 2849 FE FE2 . SF4 B 2 .  ? -0.530  3.230   3.635   1.00 0.00 ? 74 SF4 A FE2 5  
HETATM 2850 FE FE3 . SF4 B 2 .  ? 1.489   1.851   3.876   1.00 0.00 ? 74 SF4 A FE3 5  
HETATM 2851 FE FE4 . SF4 B 2 .  ? -0.747  0.763   3.884   1.00 0.00 ? 74 SF4 A FE4 5  
HETATM 2852 S  S1  . SF4 B 2 .  ? -0.016  2.134   5.387   1.00 0.00 ? 74 SF4 A S1  5  
HETATM 2853 S  S2  . SF4 B 2 .  ? 0.982   0.026   2.838   1.00 0.00 ? 74 SF4 A S2  5  
HETATM 2854 S  S3  . SF4 B 2 .  ? -1.863  1.966   2.502   1.00 0.00 ? 74 SF4 A S3  5  
HETATM 2855 S  S4  . SF4 B 2 .  ? 1.259   3.440   2.450   1.00 0.00 ? 74 SF4 A S4  5  
ATOM   2856 N  N   . ALA A 1 1  ? 15.781  3.272   -1.266  1.00 0.00 ? 1  ALA A N   6  
ATOM   2857 C  CA  . ALA A 1 1  ? 16.504  2.082   -0.836  1.00 0.00 ? 1  ALA A CA  6  
ATOM   2858 C  C   . ALA A 1 1  ? 16.279  1.006   -1.906  1.00 0.00 ? 1  ALA A C   6  
ATOM   2859 O  O   . ALA A 1 1  ? 16.099  1.348   -3.072  1.00 0.00 ? 1  ALA A O   6  
ATOM   2860 C  CB  . ALA A 1 1  ? 15.977  1.568   0.507   1.00 0.00 ? 1  ALA A CB  6  
ATOM   2861 N  N   . SER A 1 2  ? 16.320  -0.284  -1.559  1.00 0.00 ? 2  SER A N   6  
ATOM   2862 C  CA  . SER A 1 2  ? 16.205  -1.365  -2.538  1.00 0.00 ? 2  SER A CA  6  
ATOM   2863 C  C   . SER A 1 2  ? 15.644  -2.611  -1.856  1.00 0.00 ? 2  SER A C   6  
ATOM   2864 O  O   . SER A 1 2  ? 16.172  -3.711  -2.002  1.00 0.00 ? 2  SER A O   6  
ATOM   2865 C  CB  . SER A 1 2  ? 17.563  -1.636  -3.198  1.00 0.00 ? 2  SER A CB  6  
ATOM   2866 O  OG  . SER A 1 2  ? 18.108  -0.442  -3.729  1.00 0.00 ? 2  SER A OG  6  
ATOM   2867 N  N   . GLU A 1 3  ? 14.575  -2.408  -1.093  1.00 0.00 ? 3  GLU A N   6  
ATOM   2868 C  CA  . GLU A 1 3  ? 13.935  -3.440  -0.304  1.00 0.00 ? 3  GLU A CA  6  
ATOM   2869 C  C   . GLU A 1 3  ? 13.041  -4.276  -1.229  1.00 0.00 ? 3  GLU A C   6  
ATOM   2870 O  O   . GLU A 1 3  ? 12.565  -3.756  -2.239  1.00 0.00 ? 3  GLU A O   6  
ATOM   2871 C  CB  . GLU A 1 3  ? 13.139  -2.760  0.820   1.00 0.00 ? 3  GLU A CB  6  
ATOM   2872 C  CG  . GLU A 1 3  ? 14.027  -2.005  1.826   1.00 0.00 ? 3  GLU A CG  6  
ATOM   2873 C  CD  . GLU A 1 3  ? 14.653  -0.740  1.264   1.00 0.00 ? 3  GLU A CD  6  
ATOM   2874 O  OE1 . GLU A 1 3  ? 13.924  0.240   0.959   1.00 0.00 ? 3  GLU A OE1 6  
ATOM   2875 O  OE2 . GLU A 1 3  ? 15.885  -0.697  1.061   1.00 0.00 ? 3  GLU A OE2 6  
ATOM   2876 N  N   . PRO A 1 4  ? 12.811  -5.563  -0.922  1.00 0.00 ? 4  PRO A N   6  
ATOM   2877 C  CA  . PRO A 1 4  ? 12.018  -6.429  -1.776  1.00 0.00 ? 4  PRO A CA  6  
ATOM   2878 C  C   . PRO A 1 4  ? 10.593  -5.888  -1.921  1.00 0.00 ? 4  PRO A C   6  
ATOM   2879 O  O   . PRO A 1 4  ? 10.051  -5.275  -1.004  1.00 0.00 ? 4  PRO A O   6  
ATOM   2880 C  CB  . PRO A 1 4  ? 12.064  -7.817  -1.133  1.00 0.00 ? 4  PRO A CB  6  
ATOM   2881 C  CG  . PRO A 1 4  ? 12.396  -7.526  0.330   1.00 0.00 ? 4  PRO A CG  6  
ATOM   2882 C  CD  . PRO A 1 4  ? 13.281  -6.282  0.249   1.00 0.00 ? 4  PRO A CD  6  
ATOM   2883 N  N   . ARG A 1 5  ? 10.007  -6.087  -3.102  1.00 0.00 ? 5  ARG A N   6  
ATOM   2884 C  CA  . ARG A 1 5  ? 8.747   -5.480  -3.488  1.00 0.00 ? 5  ARG A CA  6  
ATOM   2885 C  C   . ARG A 1 5  ? 7.614   -6.318  -2.883  1.00 0.00 ? 5  ARG A C   6  
ATOM   2886 O  O   . ARG A 1 5  ? 7.605   -7.537  -3.035  1.00 0.00 ? 5  ARG A O   6  
ATOM   2887 C  CB  . ARG A 1 5  ? 8.668   -5.391  -5.019  1.00 0.00 ? 5  ARG A CB  6  
ATOM   2888 C  CG  . ARG A 1 5  ? 9.922   -4.830  -5.693  1.00 0.00 ? 5  ARG A CG  6  
ATOM   2889 C  CD  . ARG A 1 5  ? 9.958   -5.342  -7.133  1.00 0.00 ? 5  ARG A CD  6  
ATOM   2890 N  NE  . ARG A 1 5  ? 9.149   -4.539  -8.042  1.00 0.00 ? 5  ARG A NE  6  
ATOM   2891 C  CZ  . ARG A 1 5  ? 9.038   -4.824  -9.355  1.00 0.00 ? 5  ARG A CZ  6  
ATOM   2892 N  NH1 . ARG A 1 5  ? 9.465   -6.008  -9.809  1.00 0.00 ? 5  ARG A NH1 6  
ATOM   2893 N  NH2 . ARG A 1 5  ? 8.528   -3.961  -10.231 1.00 0.00 ? 5  ARG A NH2 6  
ATOM   2894 N  N   . ALA A 1 6  ? 6.707   -5.667  -2.153  1.00 0.00 ? 6  ALA A N   6  
ATOM   2895 C  CA  . ALA A 1 6  ? 5.740   -6.289  -1.263  1.00 0.00 ? 6  ALA A CA  6  
ATOM   2896 C  C   . ALA A 1 6  ? 4.895   -7.367  -1.938  1.00 0.00 ? 6  ALA A C   6  
ATOM   2897 O  O   . ALA A 1 6  ? 4.438   -7.205  -3.071  1.00 0.00 ? 6  ALA A O   6  
ATOM   2898 C  CB  . ALA A 1 6  ? 4.834   -5.209  -0.668  1.00 0.00 ? 6  ALA A CB  6  
ATOM   2899 N  N   . GLU A 1 7  ? 4.655   -8.448  -1.200  1.00 0.00 ? 7  GLU A N   6  
ATOM   2900 C  CA  . GLU A 1 7  ? 3.816   -9.558  -1.591  1.00 0.00 ? 7  GLU A CA  6  
ATOM   2901 C  C   . GLU A 1 7  ? 2.366   -9.098  -1.556  1.00 0.00 ? 7  GLU A C   6  
ATOM   2902 O  O   . GLU A 1 7  ? 1.977   -8.354  -0.653  1.00 0.00 ? 7  GLU A O   6  
ATOM   2903 C  CB  . GLU A 1 7  ? 3.980   -10.734 -0.624  1.00 0.00 ? 7  GLU A CB  6  
ATOM   2904 C  CG  . GLU A 1 7  ? 5.436   -10.976 -0.212  1.00 0.00 ? 7  GLU A CG  6  
ATOM   2905 C  CD  . GLU A 1 7  ? 5.766   -10.254 1.088   1.00 0.00 ? 7  GLU A CD  6  
ATOM   2906 O  OE1 . GLU A 1 7  ? 5.968   -9.025  1.034   1.00 0.00 ? 7  GLU A OE1 6  
ATOM   2907 O  OE2 . GLU A 1 7  ? 5.704   -10.864 2.175   1.00 0.00 ? 7  GLU A OE2 6  
ATOM   2908 N  N   . ASP A 1 8  ? 1.553   -9.612  -2.474  1.00 0.00 ? 8  ASP A N   6  
ATOM   2909 C  CA  . ASP A 1 8  ? 0.122   -9.667  -2.288  1.00 0.00 ? 8  ASP A CA  6  
ATOM   2910 C  C   . ASP A 1 8  ? -0.148  -10.293 -0.915  1.00 0.00 ? 8  ASP A C   6  
ATOM   2911 O  O   . ASP A 1 8  ? 0.350   -11.370 -0.595  1.00 0.00 ? 8  ASP A O   6  
ATOM   2912 C  CB  . ASP A 1 8  ? -0.499  -10.468 -3.441  1.00 0.00 ? 8  ASP A CB  6  
ATOM   2913 C  CG  . ASP A 1 8  ? 0.153   -11.831 -3.660  1.00 0.00 ? 8  ASP A CG  6  
ATOM   2914 O  OD1 . ASP A 1 8  ? 1.382   -11.822 -3.915  1.00 0.00 ? 8  ASP A OD1 6  
ATOM   2915 O  OD2 . ASP A 1 8  ? -0.582  -12.839 -3.606  1.00 0.00 ? 8  ASP A OD2 6  
ATOM   2916 N  N   . GLY A 1 9  ? -0.857  -9.559  -0.061  1.00 0.00 ? 9  GLY A N   6  
ATOM   2917 C  CA  . GLY A 1 9  ? -1.149  -9.972  1.298   1.00 0.00 ? 9  GLY A CA  6  
ATOM   2918 C  C   . GLY A 1 9  ? 0.082   -10.072 2.201   1.00 0.00 ? 9  GLY A C   6  
ATOM   2919 O  O   . GLY A 1 9  ? 0.025   -10.820 3.174   1.00 0.00 ? 9  GLY A O   6  
ATOM   2920 N  N   . HIS A 1 10 ? 1.159   -9.303  1.953   1.00 0.00 ? 10 HIS A N   6  
ATOM   2921 C  CA  . HIS A 1 10 ? 2.297   -9.211  2.875   1.00 0.00 ? 10 HIS A CA  6  
ATOM   2922 C  C   . HIS A 1 10 ? 1.841   -9.097  4.332   1.00 0.00 ? 10 HIS A C   6  
ATOM   2923 O  O   . HIS A 1 10 ? 2.249   -9.870  5.195   1.00 0.00 ? 10 HIS A O   6  
ATOM   2924 C  CB  . HIS A 1 10 ? 3.150   -7.980  2.544   1.00 0.00 ? 10 HIS A CB  6  
ATOM   2925 C  CG  . HIS A 1 10 ? 4.285   -7.792  3.526   1.00 0.00 ? 10 HIS A CG  6  
ATOM   2926 N  ND1 . HIS A 1 10 ? 5.346   -8.661  3.696   1.00 0.00 ? 10 HIS A ND1 6  
ATOM   2927 C  CD2 . HIS A 1 10 ? 4.385   -6.808  4.475   1.00 0.00 ? 10 HIS A CD2 6  
ATOM   2928 C  CE1 . HIS A 1 10 ? 6.094   -8.201  4.714   1.00 0.00 ? 10 HIS A CE1 6  
ATOM   2929 N  NE2 . HIS A 1 10 ? 5.530   -7.082  5.200   1.00 0.00 ? 10 HIS A NE2 6  
ATOM   2930 N  N   . ALA A 1 11 ? 1.021   -8.080  4.592   1.00 0.00 ? 11 ALA A N   6  
ATOM   2931 C  CA  . ALA A 1 11 ? 0.352   -7.855  5.860   1.00 0.00 ? 11 ALA A CA  6  
ATOM   2932 C  C   . ALA A 1 11 ? -0.874  -6.994  5.567   1.00 0.00 ? 11 ALA A C   6  
ATOM   2933 O  O   . ALA A 1 11 ? -0.983  -6.429  4.477   1.00 0.00 ? 11 ALA A O   6  
ATOM   2934 C  CB  . ALA A 1 11 ? 1.313   -7.187  6.864   1.00 0.00 ? 11 ALA A CB  6  
ATOM   2935 N  N   . HIS A 1 12 ? -1.794  -6.912  6.533   1.00 0.00 ? 12 HIS A N   6  
ATOM   2936 C  CA  . HIS A 1 12 ? -2.932  -5.997  6.525   1.00 0.00 ? 12 HIS A CA  6  
ATOM   2937 C  C   . HIS A 1 12 ? -3.650  -5.939  5.175   1.00 0.00 ? 12 HIS A C   6  
ATOM   2938 O  O   . HIS A 1 12 ? -3.918  -4.858  4.649   1.00 0.00 ? 12 HIS A O   6  
ATOM   2939 C  CB  . HIS A 1 12 ? -2.452  -4.601  6.907   1.00 0.00 ? 12 HIS A CB  6  
ATOM   2940 C  CG  . HIS A 1 12 ? -1.659  -4.521  8.181   1.00 0.00 ? 12 HIS A CG  6  
ATOM   2941 N  ND1 . HIS A 1 12 ? -2.185  -4.192  9.415   1.00 0.00 ? 12 HIS A ND1 6  
ATOM   2942 C  CD2 . HIS A 1 12 ? -0.294  -4.439  8.260   1.00 0.00 ? 12 HIS A CD2 6  
ATOM   2943 C  CE1 . HIS A 1 12 ? -1.155  -3.878  10.219  1.00 0.00 ? 12 HIS A CE1 6  
ATOM   2944 N  NE2 . HIS A 1 12 ? -0.007  -4.040  9.543   1.00 0.00 ? 12 HIS A NE2 6  
ATOM   2945 N  N   . ASP A 1 13 ? -3.953  -7.111  4.618   1.00 0.00 ? 13 ASP A N   6  
ATOM   2946 C  CA  . ASP A 1 13 ? -4.803  -7.234  3.441   1.00 0.00 ? 13 ASP A CA  6  
ATOM   2947 C  C   . ASP A 1 13 ? -4.204  -6.510  2.223   1.00 0.00 ? 13 ASP A C   6  
ATOM   2948 O  O   . ASP A 1 13 ? -4.943  -6.163  1.302   1.00 0.00 ? 13 ASP A O   6  
ATOM   2949 C  CB  . ASP A 1 13 ? -6.247  -6.750  3.704   1.00 0.00 ? 13 ASP A CB  6  
ATOM   2950 C  CG  . ASP A 1 13 ? -6.820  -6.931  5.110   1.00 0.00 ? 13 ASP A CG  6  
ATOM   2951 O  OD1 . ASP A 1 13 ? -6.269  -6.360  6.075   1.00 0.00 ? 13 ASP A OD1 6  
ATOM   2952 O  OD2 . ASP A 1 13 ? -7.931  -7.498  5.171   1.00 0.00 ? 13 ASP A OD2 6  
ATOM   2953 N  N   . TYR A 1 14 ? -2.890  -6.239  2.219   1.00 0.00 ? 14 TYR A N   6  
ATOM   2954 C  CA  . TYR A 1 14 ? -2.288  -5.407  1.188   1.00 0.00 ? 14 TYR A CA  6  
ATOM   2955 C  C   . TYR A 1 14 ? -2.426  -6.008  -0.208  1.00 0.00 ? 14 TYR A C   6  
ATOM   2956 O  O   . TYR A 1 14 ? -2.313  -7.220  -0.384  1.00 0.00 ? 14 TYR A O   6  
ATOM   2957 C  CB  . TYR A 1 14 ? -0.830  -5.091  1.535   1.00 0.00 ? 14 TYR A CB  6  
ATOM   2958 C  CG  . TYR A 1 14 ? 0.009   -4.532  0.401   1.00 0.00 ? 14 TYR A CG  6  
ATOM   2959 C  CD1 . TYR A 1 14 ? 0.639   -5.413  -0.495  1.00 0.00 ? 14 TYR A CD1 6  
ATOM   2960 C  CD2 . TYR A 1 14 ? 0.126   -3.144  0.208   1.00 0.00 ? 14 TYR A CD2 6  
ATOM   2961 C  CE1 . TYR A 1 14 ? 1.416   -4.914  -1.553  1.00 0.00 ? 14 TYR A CE1 6  
ATOM   2962 C  CE2 . TYR A 1 14 ? 0.884   -2.644  -0.862  1.00 0.00 ? 14 TYR A CE2 6  
ATOM   2963 C  CZ  . TYR A 1 14 ? 1.558   -3.526  -1.718  1.00 0.00 ? 14 TYR A CZ  6  
ATOM   2964 O  OH  . TYR A 1 14 ? 2.391   -3.034  -2.674  1.00 0.00 ? 14 TYR A OH  6  
ATOM   2965 N  N   . VAL A 1 15 ? -2.613  -5.140  -1.203  1.00 0.00 ? 15 VAL A N   6  
ATOM   2966 C  CA  . VAL A 1 15 ? -2.632  -5.488  -2.613  1.00 0.00 ? 15 VAL A CA  6  
ATOM   2967 C  C   . VAL A 1 15 ? -1.655  -4.578  -3.352  1.00 0.00 ? 15 VAL A C   6  
ATOM   2968 O  O   . VAL A 1 15 ? -1.514  -3.406  -3.000  1.00 0.00 ? 15 VAL A O   6  
ATOM   2969 C  CB  . VAL A 1 15 ? -4.058  -5.359  -3.177  1.00 0.00 ? 15 VAL A CB  6  
ATOM   2970 C  CG1 . VAL A 1 15 ? -4.975  -6.402  -2.525  1.00 0.00 ? 15 VAL A CG1 6  
ATOM   2971 C  CG2 . VAL A 1 15 ? -4.643  -3.956  -2.948  1.00 0.00 ? 15 VAL A CG2 6  
ATOM   2972 N  N   . ASN A 1 16 ? -0.979  -5.116  -4.375  1.00 0.00 ? 16 ASN A N   6  
ATOM   2973 C  CA  . ASN A 1 16 ? -0.082  -4.359  -5.224  1.00 0.00 ? 16 ASN A CA  6  
ATOM   2974 C  C   . ASN A 1 16 ? -0.827  -3.383  -6.133  1.00 0.00 ? 16 ASN A C   6  
ATOM   2975 O  O   . ASN A 1 16 ? -0.246  -2.378  -6.537  1.00 0.00 ? 16 ASN A O   6  
ATOM   2976 C  CB  . ASN A 1 16 ? 0.874   -5.255  -6.022  1.00 0.00 ? 16 ASN A CB  6  
ATOM   2977 C  CG  . ASN A 1 16 ? 2.133   -5.542  -5.217  1.00 0.00 ? 16 ASN A CG  6  
ATOM   2978 O  OD1 . ASN A 1 16 ? 2.837   -4.633  -4.799  1.00 0.00 ? 16 ASN A OD1 6  
ATOM   2979 N  ND2 . ASN A 1 16 ? 2.417   -6.806  -4.963  1.00 0.00 ? 16 ASN A ND2 6  
ATOM   2980 N  N   . GLU A 1 17 ? -2.089  -3.678  -6.464  1.00 0.00 ? 17 GLU A N   6  
ATOM   2981 C  CA  . GLU A 1 17 ? -2.969  -2.796  -7.197  1.00 0.00 ? 17 GLU A CA  6  
ATOM   2982 C  C   . GLU A 1 17 ? -4.140  -2.475  -6.286  1.00 0.00 ? 17 GLU A C   6  
ATOM   2983 O  O   . GLU A 1 17 ? -4.907  -3.371  -5.941  1.00 0.00 ? 17 GLU A O   6  
ATOM   2984 C  CB  . GLU A 1 17 ? -3.466  -3.506  -8.455  1.00 0.00 ? 17 GLU A CB  6  
ATOM   2985 C  CG  . GLU A 1 17 ? -4.169  -2.515  -9.380  1.00 0.00 ? 17 GLU A CG  6  
ATOM   2986 C  CD  . GLU A 1 17 ? -4.563  -3.134  -10.717 1.00 0.00 ? 17 GLU A CD  6  
ATOM   2987 O  OE1 . GLU A 1 17 ? -3.773  -3.959  -11.221 1.00 0.00 ? 17 GLU A OE1 6  
ATOM   2988 O  OE2 . GLU A 1 17 ? -5.644  -2.754  -11.216 1.00 0.00 ? 17 GLU A OE2 6  
ATOM   2989 N  N   . ALA A 1 18 ? -4.292  -1.208  -5.918  1.00 0.00 ? 18 ALA A N   6  
ATOM   2990 C  CA  . ALA A 1 18 ? -5.383  -0.722  -5.087  1.00 0.00 ? 18 ALA A CA  6  
ATOM   2991 C  C   . ALA A 1 18 ? -6.726  -1.270  -5.568  1.00 0.00 ? 18 ALA A C   6  
ATOM   2992 O  O   . ALA A 1 18 ? -7.536  -1.736  -4.768  1.00 0.00 ? 18 ALA A O   6  
ATOM   2993 C  CB  . ALA A 1 18 ? -5.377  0.805   -5.097  1.00 0.00 ? 18 ALA A CB  6  
ATOM   2994 N  N   . ALA A 1 19 ? -6.944  -1.239  -6.884  1.00 0.00 ? 19 ALA A N   6  
ATOM   2995 C  CA  . ALA A 1 19 ? -8.158  -1.745  -7.502  1.00 0.00 ? 19 ALA A CA  6  
ATOM   2996 C  C   . ALA A 1 19 ? -8.479  -3.179  -7.080  1.00 0.00 ? 19 ALA A C   6  
ATOM   2997 O  O   . ALA A 1 19 ? -9.655  -3.479  -6.866  1.00 0.00 ? 19 ALA A O   6  
ATOM   2998 C  CB  . ALA A 1 19 ? -8.063  -1.647  -9.024  1.00 0.00 ? 19 ALA A CB  6  
ATOM   2999 N  N   . ASP A 1 20 ? -7.467  -4.049  -6.923  1.00 0.00 ? 20 ASP A N   6  
ATOM   3000 C  CA  . ASP A 1 20 ? -7.697  -5.406  -6.422  1.00 0.00 ? 20 ASP A CA  6  
ATOM   3001 C  C   . ASP A 1 20 ? -8.578  -5.382  -5.168  1.00 0.00 ? 20 ASP A C   6  
ATOM   3002 O  O   . ASP A 1 20 ? -9.541  -6.137  -5.027  1.00 0.00 ? 20 ASP A O   6  
ATOM   3003 C  CB  . ASP A 1 20 ? -6.373  -6.094  -6.095  1.00 0.00 ? 20 ASP A CB  6  
ATOM   3004 C  CG  . ASP A 1 20 ? -6.579  -7.582  -5.861  1.00 0.00 ? 20 ASP A CG  6  
ATOM   3005 O  OD1 . ASP A 1 20 ? -6.840  -7.943  -4.695  1.00 0.00 ? 20 ASP A OD1 6  
ATOM   3006 O  OD2 . ASP A 1 20 ? -6.476  -8.330  -6.856  1.00 0.00 ? 20 ASP A OD2 6  
ATOM   3007 N  N   . ALA A 1 21 ? -8.282  -4.436  -4.274  1.00 0.00 ? 21 ALA A N   6  
ATOM   3008 C  CA  . ALA A 1 21 ? -8.939  -4.340  -2.983  1.00 0.00 ? 21 ALA A CA  6  
ATOM   3009 C  C   . ALA A 1 21 ? -10.346 -3.752  -3.078  1.00 0.00 ? 21 ALA A C   6  
ATOM   3010 O  O   . ALA A 1 21 ? -10.994 -3.638  -2.044  1.00 0.00 ? 21 ALA A O   6  
ATOM   3011 C  CB  . ALA A 1 21 ? -8.073  -3.567  -1.985  1.00 0.00 ? 21 ALA A CB  6  
ATOM   3012 N  N   . SER A 1 22 ? -10.879 -3.445  -4.270  1.00 0.00 ? 22 SER A N   6  
ATOM   3013 C  CA  . SER A 1 22 ? -12.274 -3.020  -4.400  1.00 0.00 ? 22 SER A CA  6  
ATOM   3014 C  C   . SER A 1 22 ? -13.258 -4.070  -3.871  1.00 0.00 ? 22 SER A C   6  
ATOM   3015 O  O   . SER A 1 22 ? -14.352 -3.764  -3.404  1.00 0.00 ? 22 SER A O   6  
ATOM   3016 C  CB  . SER A 1 22 ? -12.562 -2.542  -5.831  1.00 0.00 ? 22 SER A CB  6  
ATOM   3017 O  OG  . SER A 1 22 ? -13.799 -1.860  -5.926  1.00 0.00 ? 22 SER A OG  6  
ATOM   3018 N  N   . GLY A 1 23 ? -12.808 -5.319  -3.863  1.00 0.00 ? 23 GLY A N   6  
ATOM   3019 C  CA  . GLY A 1 23 ? -13.509 -6.436  -3.246  1.00 0.00 ? 23 GLY A CA  6  
ATOM   3020 C  C   . GLY A 1 23 ? -13.638 -6.299  -1.721  1.00 0.00 ? 23 GLY A C   6  
ATOM   3021 O  O   . GLY A 1 23 ? -14.532 -6.890  -1.121  1.00 0.00 ? 23 GLY A O   6  
ATOM   3022 N  N   . HIS A 1 24 ? -12.728 -5.564  -1.074  1.00 0.00 ? 24 HIS A N   6  
ATOM   3023 C  CA  . HIS A 1 24 ? -12.619 -5.476  0.373   1.00 0.00 ? 24 HIS A CA  6  
ATOM   3024 C  C   . HIS A 1 24 ? -13.633 -4.472  0.940   1.00 0.00 ? 24 HIS A C   6  
ATOM   3025 O  O   . HIS A 1 24 ? -13.394 -3.272  0.814   1.00 0.00 ? 24 HIS A O   6  
ATOM   3026 C  CB  . HIS A 1 24 ? -11.194 -5.014  0.731   1.00 0.00 ? 24 HIS A CB  6  
ATOM   3027 C  CG  . HIS A 1 24 ? -10.793 -5.288  2.162   1.00 0.00 ? 24 HIS A CG  6  
ATOM   3028 N  ND1 . HIS A 1 24 ? -11.487 -4.910  3.300   1.00 0.00 ? 24 HIS A ND1 6  
ATOM   3029 C  CD2 . HIS A 1 24 ? -9.659  -5.936  2.566   1.00 0.00 ? 24 HIS A CD2 6  
ATOM   3030 C  CE1 . HIS A 1 24 ? -10.785 -5.306  4.374   1.00 0.00 ? 24 HIS A CE1 6  
ATOM   3031 N  NE2 . HIS A 1 24 ? -9.693  -5.967  3.948   1.00 0.00 ? 24 HIS A NE2 6  
ATOM   3032 N  N   . PRO A 1 25 ? -14.679 -4.875  1.682   1.00 0.00 ? 25 PRO A N   6  
ATOM   3033 C  CA  . PRO A 1 25 ? -15.406 -3.917  2.503   1.00 0.00 ? 25 PRO A CA  6  
ATOM   3034 C  C   . PRO A 1 25 ? -14.412 -3.350  3.525   1.00 0.00 ? 25 PRO A C   6  
ATOM   3035 O  O   . PRO A 1 25 ? -13.886 -4.118  4.325   1.00 0.00 ? 25 PRO A O   6  
ATOM   3036 C  CB  . PRO A 1 25 ? -16.542 -4.709  3.153   1.00 0.00 ? 25 PRO A CB  6  
ATOM   3037 C  CG  . PRO A 1 25 ? -16.005 -6.140  3.203   1.00 0.00 ? 25 PRO A CG  6  
ATOM   3038 C  CD  . PRO A 1 25 ? -15.123 -6.235  1.957   1.00 0.00 ? 25 PRO A CD  6  
ATOM   3039 N  N   . ARG A 1 26 ? -14.064 -2.063  3.390   1.00 0.00 ? 26 ARG A N   6  
ATOM   3040 C  CA  . ARG A 1 26 ? -13.022 -1.249  4.043   1.00 0.00 ? 26 ARG A CA  6  
ATOM   3041 C  C   . ARG A 1 26 ? -12.461 -0.344  2.954   1.00 0.00 ? 26 ARG A C   6  
ATOM   3042 O  O   . ARG A 1 26 ? -12.229 0.834   3.202   1.00 0.00 ? 26 ARG A O   6  
ATOM   3043 C  CB  . ARG A 1 26 ? -11.848 -2.013  4.706   1.00 0.00 ? 26 ARG A CB  6  
ATOM   3044 C  CG  . ARG A 1 26 ? -11.125 -1.312  5.876   1.00 0.00 ? 26 ARG A CG  6  
ATOM   3045 C  CD  . ARG A 1 26 ? -9.915  -0.399  5.597   1.00 0.00 ? 26 ARG A CD  6  
ATOM   3046 N  NE  . ARG A 1 26 ? -10.246 0.880   4.948   1.00 0.00 ? 26 ARG A NE  6  
ATOM   3047 C  CZ  . ARG A 1 26 ? -9.412  1.920   4.769   1.00 0.00 ? 26 ARG A CZ  6  
ATOM   3048 N  NH1 . ARG A 1 26 ? -8.206  1.921   5.347   1.00 0.00 ? 26 ARG A NH1 6  
ATOM   3049 N  NH2 . ARG A 1 26 ? -9.800  2.944   3.996   1.00 0.00 ? 26 ARG A NH2 6  
ATOM   3050 N  N   . TYR A 1 27 ? -12.208 -0.905  1.768   1.00 0.00 ? 27 TYR A N   6  
ATOM   3051 C  CA  . TYR A 1 27 ? -11.659 -0.166  0.650   1.00 0.00 ? 27 TYR A CA  6  
ATOM   3052 C  C   . TYR A 1 27 ? -12.629 0.916   0.184   1.00 0.00 ? 27 TYR A C   6  
ATOM   3053 O  O   . TYR A 1 27 ? -13.840 0.834   0.381   1.00 0.00 ? 27 TYR A O   6  
ATOM   3054 C  CB  . TYR A 1 27 ? -11.249 -1.127  -0.475  1.00 0.00 ? 27 TYR A CB  6  
ATOM   3055 C  CG  . TYR A 1 27 ? -10.613 -0.458  -1.682  1.00 0.00 ? 27 TYR A CG  6  
ATOM   3056 C  CD1 . TYR A 1 27 ? -9.231  -0.222  -1.691  1.00 0.00 ? 27 TYR A CD1 6  
ATOM   3057 C  CD2 . TYR A 1 27 ? -11.392 -0.012  -2.767  1.00 0.00 ? 27 TYR A CD2 6  
ATOM   3058 C  CE1 . TYR A 1 27 ? -8.642  0.551   -2.702  1.00 0.00 ? 27 TYR A CE1 6  
ATOM   3059 C  CE2 . TYR A 1 27 ? -10.773 0.620   -3.858  1.00 0.00 ? 27 TYR A CE2 6  
ATOM   3060 C  CZ  . TYR A 1 27 ? -9.413  0.966   -3.798  1.00 0.00 ? 27 TYR A CZ  6  
ATOM   3061 O  OH  . TYR A 1 27 ? -8.862  1.768   -4.755  1.00 0.00 ? 27 TYR A OH  6  
ATOM   3062 N  N   . GLN A 1 28 ? -12.037 1.945   -0.412  1.00 0.00 ? 28 GLN A N   6  
ATOM   3063 C  CA  . GLN A 1 28 ? -12.651 3.032   -1.126  1.00 0.00 ? 28 GLN A CA  6  
ATOM   3064 C  C   . GLN A 1 28 ? -11.712 3.381   -2.276  1.00 0.00 ? 28 GLN A C   6  
ATOM   3065 O  O   . GLN A 1 28 ? -10.490 3.407   -2.097  1.00 0.00 ? 28 GLN A O   6  
ATOM   3066 C  CB  . GLN A 1 28 ? -12.795 4.260   -0.226  1.00 0.00 ? 28 GLN A CB  6  
ATOM   3067 C  CG  . GLN A 1 28 ? -13.753 4.090   0.962   1.00 0.00 ? 28 GLN A CG  6  
ATOM   3068 C  CD  . GLN A 1 28 ? -13.077 3.628   2.252   1.00 0.00 ? 28 GLN A CD  6  
ATOM   3069 O  OE1 . GLN A 1 28 ? -11.871 3.388   2.312   1.00 0.00 ? 28 GLN A OE1 6  
ATOM   3070 N  NE2 . GLN A 1 28 ? -13.848 3.531   3.331   1.00 0.00 ? 28 GLN A NE2 6  
ATOM   3071 N  N   . GLU A 1 29 ? -12.298 3.639   -3.437  1.00 0.00 ? 29 GLU A N   6  
ATOM   3072 C  CA  . GLU A 1 29 ? -11.657 3.987   -4.677  1.00 0.00 ? 29 GLU A CA  6  
ATOM   3073 C  C   . GLU A 1 29 ? -10.821 5.251   -4.501  1.00 0.00 ? 29 GLU A C   6  
ATOM   3074 O  O   . GLU A 1 29 ? -11.112 6.111   -3.671  1.00 0.00 ? 29 GLU A O   6  
ATOM   3075 C  CB  . GLU A 1 29 ? -12.751 4.144   -5.742  1.00 0.00 ? 29 GLU A CB  6  
ATOM   3076 C  CG  . GLU A 1 29 ? -13.345 2.791   -6.188  1.00 0.00 ? 29 GLU A CG  6  
ATOM   3077 C  CD  . GLU A 1 29 ? -13.992 1.946   -5.092  1.00 0.00 ? 29 GLU A CD  6  
ATOM   3078 O  OE1 . GLU A 1 29 ? -14.593 2.561   -4.182  1.00 0.00 ? 29 GLU A OE1 6  
ATOM   3079 O  OE2 . GLU A 1 29 ? -13.837 0.705   -5.166  1.00 0.00 ? 29 GLU A OE2 6  
ATOM   3080 N  N   . GLY A 1 30 ? -9.744  5.334   -5.276  1.00 0.00 ? 30 GLY A N   6  
ATOM   3081 C  CA  . GLY A 1 30 ? -8.825  6.463   -5.260  1.00 0.00 ? 30 GLY A CA  6  
ATOM   3082 C  C   . GLY A 1 30 ? -7.753  6.335   -4.176  1.00 0.00 ? 30 GLY A C   6  
ATOM   3083 O  O   . GLY A 1 30 ? -6.731  7.014   -4.242  1.00 0.00 ? 30 GLY A O   6  
ATOM   3084 N  N   . GLN A 1 31 ? -7.939  5.466   -3.180  1.00 0.00 ? 31 GLN A N   6  
ATOM   3085 C  CA  . GLN A 1 31 ? -6.904  5.222   -2.194  1.00 0.00 ? 31 GLN A CA  6  
ATOM   3086 C  C   . GLN A 1 31 ? -5.805  4.351   -2.819  1.00 0.00 ? 31 GLN A C   6  
ATOM   3087 O  O   . GLN A 1 31 ? -5.939  3.130   -2.864  1.00 0.00 ? 31 GLN A O   6  
ATOM   3088 C  CB  . GLN A 1 31 ? -7.534  4.556   -0.975  1.00 0.00 ? 31 GLN A CB  6  
ATOM   3089 C  CG  . GLN A 1 31 ? -8.581  5.427   -0.266  1.00 0.00 ? 31 GLN A CG  6  
ATOM   3090 C  CD  . GLN A 1 31 ? -9.207  4.660   0.895   1.00 0.00 ? 31 GLN A CD  6  
ATOM   3091 O  OE1 . GLN A 1 31 ? -9.270  5.100   2.041   1.00 0.00 ? 31 GLN A OE1 6  
ATOM   3092 N  NE2 . GLN A 1 31 ? -9.704  3.475   0.585   1.00 0.00 ? 31 GLN A NE2 6  
ATOM   3093 N  N   . LEU A 1 32 ? -4.732  4.986   -3.296  1.00 0.00 ? 32 LEU A N   6  
ATOM   3094 C  CA  . LEU A 1 32 ? -3.459  4.367   -3.652  1.00 0.00 ? 32 LEU A CA  6  
ATOM   3095 C  C   . LEU A 1 32 ? -2.477  4.640   -2.501  1.00 0.00 ? 32 LEU A C   6  
ATOM   3096 O  O   . LEU A 1 32 ? -2.568  5.705   -1.895  1.00 0.00 ? 32 LEU A O   6  
ATOM   3097 C  CB  . LEU A 1 32 ? -2.926  5.020   -4.939  1.00 0.00 ? 32 LEU A CB  6  
ATOM   3098 C  CG  . LEU A 1 32 ? -3.337  4.341   -6.255  1.00 0.00 ? 32 LEU A CG  6  
ATOM   3099 C  CD1 . LEU A 1 32 ? -4.817  4.425   -6.607  1.00 0.00 ? 32 LEU A CD1 6  
ATOM   3100 C  CD2 . LEU A 1 32 ? -2.562  4.988   -7.411  1.00 0.00 ? 32 LEU A CD2 6  
ATOM   3101 N  N   . CYS A 1 33 ? -1.535  3.733   -2.210  1.00 0.00 ? 33 CYS A N   6  
ATOM   3102 C  CA  . CYS A 1 33 ? -0.474  3.900   -1.209  1.00 0.00 ? 33 CYS A CA  6  
ATOM   3103 C  C   . CYS A 1 33 ? 0.174   5.285   -1.306  1.00 0.00 ? 33 CYS A C   6  
ATOM   3104 O  O   . CYS A 1 33 ? 0.409   5.930   -0.292  1.00 0.00 ? 33 CYS A O   6  
ATOM   3105 C  CB  . CYS A 1 33 ? 0.591   2.839   -1.374  1.00 0.00 ? 33 CYS A CB  6  
ATOM   3106 S  SG  . CYS A 1 33 ? 0.308   1.306   -0.434  1.00 0.00 ? 33 CYS A SG  6  
ATOM   3107 N  N   . GLU A 1 34 ? 0.465   5.785   -2.507  1.00 0.00 ? 34 GLU A N   6  
ATOM   3108 C  CA  . GLU A 1 34 ? 1.094   7.096   -2.624  1.00 0.00 ? 34 GLU A CA  6  
ATOM   3109 C  C   . GLU A 1 34 ? 0.240   8.252   -2.064  1.00 0.00 ? 34 GLU A C   6  
ATOM   3110 O  O   . GLU A 1 34 ? 0.772   9.325   -1.782  1.00 0.00 ? 34 GLU A O   6  
ATOM   3111 C  CB  . GLU A 1 34 ? 1.590   7.316   -4.052  1.00 0.00 ? 34 GLU A CB  6  
ATOM   3112 C  CG  . GLU A 1 34 ? 0.472   7.357   -5.103  1.00 0.00 ? 34 GLU A CG  6  
ATOM   3113 C  CD  . GLU A 1 34 ? 1.009   7.538   -6.520  1.00 0.00 ? 34 GLU A CD  6  
ATOM   3114 O  OE1 . GLU A 1 34 ? 2.218   7.831   -6.648  1.00 0.00 ? 34 GLU A OE1 6  
ATOM   3115 O  OE2 . GLU A 1 34 ? 0.196   7.373   -7.454  1.00 0.00 ? 34 GLU A OE2 6  
ATOM   3116 N  N   . ASN A 1 35 ? -1.066  8.034   -1.860  1.00 0.00 ? 35 ASN A N   6  
ATOM   3117 C  CA  . ASN A 1 35 ? -1.993  8.986   -1.246  1.00 0.00 ? 35 ASN A CA  6  
ATOM   3118 C  C   . ASN A 1 35 ? -2.154  8.736   0.260   1.00 0.00 ? 35 ASN A C   6  
ATOM   3119 O  O   . ASN A 1 35 ? -2.999  9.369   0.897   1.00 0.00 ? 35 ASN A O   6  
ATOM   3120 C  CB  . ASN A 1 35 ? -3.384  8.857   -1.890  1.00 0.00 ? 35 ASN A CB  6  
ATOM   3121 C  CG  . ASN A 1 35 ? -3.408  8.982   -3.400  1.00 0.00 ? 35 ASN A CG  6  
ATOM   3122 O  OD1 . ASN A 1 35 ? -2.528  9.574   -4.017  1.00 0.00 ? 35 ASN A OD1 6  
ATOM   3123 N  ND2 . ASN A 1 35 ? -4.435  8.411   -4.018  1.00 0.00 ? 35 ASN A ND2 6  
ATOM   3124 N  N   . CYS A 1 36 ? -1.424  7.769   0.820   1.00 0.00 ? 36 CYS A N   6  
ATOM   3125 C  CA  . CYS A 1 36 ? -1.563  7.324   2.196   1.00 0.00 ? 36 CYS A CA  6  
ATOM   3126 C  C   . CYS A 1 36 ? -0.806  8.282   3.110   1.00 0.00 ? 36 CYS A C   6  
ATOM   3127 O  O   . CYS A 1 36 ? 0.357   8.596   2.866   1.00 0.00 ? 36 CYS A O   6  
ATOM   3128 C  CB  . CYS A 1 36 ? -1.003  5.929   2.267   1.00 0.00 ? 36 CYS A CB  6  
ATOM   3129 S  SG  . CYS A 1 36 ? -1.264  5.089   3.824   1.00 0.00 ? 36 CYS A SG  6  
ATOM   3130 N  N   . ALA A 1 37 ? -1.431  8.738   4.195   1.00 0.00 ? 37 ALA A N   6  
ATOM   3131 C  CA  . ALA A 1 37 ? -0.789  9.610   5.172   1.00 0.00 ? 37 ALA A CA  6  
ATOM   3132 C  C   . ALA A 1 37 ? 0.445   8.959   5.805   1.00 0.00 ? 37 ALA A C   6  
ATOM   3133 O  O   . ALA A 1 37 ? 1.276   9.647   6.390   1.00 0.00 ? 37 ALA A O   6  
ATOM   3134 C  CB  . ALA A 1 37 ? -1.808  10.004  6.242   1.00 0.00 ? 37 ALA A CB  6  
ATOM   3135 N  N   . PHE A 1 38 ? 0.557   7.631   5.720   1.00 0.00 ? 38 PHE A N   6  
ATOM   3136 C  CA  . PHE A 1 38 ? 1.689   6.873   6.227   1.00 0.00 ? 38 PHE A CA  6  
ATOM   3137 C  C   . PHE A 1 38 ? 2.820   6.759   5.200   1.00 0.00 ? 38 PHE A C   6  
ATOM   3138 O  O   . PHE A 1 38 ? 3.904   6.296   5.556   1.00 0.00 ? 38 PHE A O   6  
ATOM   3139 C  CB  . PHE A 1 38 ? 1.188   5.491   6.656   1.00 0.00 ? 38 PHE A CB  6  
ATOM   3140 C  CG  . PHE A 1 38 ? 0.219   5.450   7.835   1.00 0.00 ? 38 PHE A CG  6  
ATOM   3141 C  CD1 . PHE A 1 38 ? -0.049  6.583   8.634   1.00 0.00 ? 38 PHE A CD1 6  
ATOM   3142 C  CD2 . PHE A 1 38 ? -0.366  4.219   8.178   1.00 0.00 ? 38 PHE A CD2 6  
ATOM   3143 C  CE1 . PHE A 1 38 ? -0.886  6.477   9.758   1.00 0.00 ? 38 PHE A CE1 6  
ATOM   3144 C  CE2 . PHE A 1 38 ? -1.223  4.118   9.286   1.00 0.00 ? 38 PHE A CE2 6  
ATOM   3145 C  CZ  . PHE A 1 38 ? -1.473  5.245   10.086  1.00 0.00 ? 38 PHE A CZ  6  
ATOM   3146 N  N   . TRP A 1 39 ? 2.584   7.164   3.948   1.00 0.00 ? 39 TRP A N   6  
ATOM   3147 C  CA  . TRP A 1 39 ? 3.585   7.122   2.897   1.00 0.00 ? 39 TRP A CA  6  
ATOM   3148 C  C   . TRP A 1 39 ? 4.849   7.883   3.307   1.00 0.00 ? 39 TRP A C   6  
ATOM   3149 O  O   . TRP A 1 39 ? 4.774   8.930   3.948   1.00 0.00 ? 39 TRP A O   6  
ATOM   3150 C  CB  . TRP A 1 39 ? 2.990   7.733   1.627   1.00 0.00 ? 39 TRP A CB  6  
ATOM   3151 C  CG  . TRP A 1 39 ? 3.865   7.720   0.416   1.00 0.00 ? 39 TRP A CG  6  
ATOM   3152 C  CD1 . TRP A 1 39 ? 4.518   8.791   -0.086  1.00 0.00 ? 39 TRP A CD1 6  
ATOM   3153 C  CD2 . TRP A 1 39 ? 4.144   6.615   -0.492  1.00 0.00 ? 39 TRP A CD2 6  
ATOM   3154 N  NE1 . TRP A 1 39 ? 5.156   8.436   -1.254  1.00 0.00 ? 39 TRP A NE1 6  
ATOM   3155 C  CE2 . TRP A 1 39 ? 4.948   7.108   -1.561  1.00 0.00 ? 39 TRP A CE2 6  
ATOM   3156 C  CE3 . TRP A 1 39 ? 3.768   5.255   -0.544  1.00 0.00 ? 39 TRP A CE3 6  
ATOM   3157 C  CZ2 . TRP A 1 39 ? 5.347   6.299   -2.632  1.00 0.00 ? 39 TRP A CZ2 6  
ATOM   3158 C  CZ3 . TRP A 1 39 ? 4.167   4.436   -1.617  1.00 0.00 ? 39 TRP A CZ3 6  
ATOM   3159 C  CH2 . TRP A 1 39 ? 4.943   4.958   -2.663  1.00 0.00 ? 39 TRP A CH2 6  
ATOM   3160 N  N   . GLY A 1 40 ? 6.009   7.353   2.918   1.00 0.00 ? 40 GLY A N   6  
ATOM   3161 C  CA  . GLY A 1 40 ? 7.291   8.019   3.055   1.00 0.00 ? 40 GLY A CA  6  
ATOM   3162 C  C   . GLY A 1 40 ? 7.584   8.782   1.768   1.00 0.00 ? 40 GLY A C   6  
ATOM   3163 O  O   . GLY A 1 40 ? 7.081   9.883   1.566   1.00 0.00 ? 40 GLY A O   6  
ATOM   3164 N  N   . GLU A 1 41 ? 8.383   8.169   0.891   1.00 0.00 ? 41 GLU A N   6  
ATOM   3165 C  CA  . GLU A 1 41 ? 8.762   8.695   -0.405  1.00 0.00 ? 41 GLU A CA  6  
ATOM   3166 C  C   . GLU A 1 41 ? 8.798   7.531   -1.389  1.00 0.00 ? 41 GLU A C   6  
ATOM   3167 O  O   . GLU A 1 41 ? 8.935   6.372   -0.982  1.00 0.00 ? 41 GLU A O   6  
ATOM   3168 C  CB  . GLU A 1 41 ? 10.145  9.356   -0.332  1.00 0.00 ? 41 GLU A CB  6  
ATOM   3169 C  CG  . GLU A 1 41 ? 10.134  10.629  0.520   1.00 0.00 ? 41 GLU A CG  6  
ATOM   3170 C  CD  . GLU A 1 41 ? 11.503  11.295  0.509   1.00 0.00 ? 41 GLU A CD  6  
ATOM   3171 O  OE1 . GLU A 1 41 ? 12.408  10.726  1.157   1.00 0.00 ? 41 GLU A OE1 6  
ATOM   3172 O  OE2 . GLU A 1 41 ? 11.623  12.341  -0.161  1.00 0.00 ? 41 GLU A OE2 6  
ATOM   3173 N  N   . ALA A 1 42 ? 8.693   7.858   -2.679  1.00 0.00 ? 42 ALA A N   6  
ATOM   3174 C  CA  . ALA A 1 42 ? 8.877   6.886   -3.741  1.00 0.00 ? 42 ALA A CA  6  
ATOM   3175 C  C   . ALA A 1 42 ? 10.351  6.513   -3.856  1.00 0.00 ? 42 ALA A C   6  
ATOM   3176 O  O   . ALA A 1 42 ? 11.231  7.305   -3.527  1.00 0.00 ? 42 ALA A O   6  
ATOM   3177 C  CB  . ALA A 1 42 ? 8.325   7.400   -5.070  1.00 0.00 ? 42 ALA A CB  6  
ATOM   3178 N  N   . VAL A 1 43 ? 10.596  5.286   -4.308  1.00 0.00 ? 43 VAL A N   6  
ATOM   3179 C  CA  . VAL A 1 43 ? 11.903  4.660   -4.361  1.00 0.00 ? 43 VAL A CA  6  
ATOM   3180 C  C   . VAL A 1 43 ? 12.212  4.211   -5.796  1.00 0.00 ? 43 VAL A C   6  
ATOM   3181 O  O   . VAL A 1 43 ? 13.287  4.514   -6.307  1.00 0.00 ? 43 VAL A O   6  
ATOM   3182 C  CB  . VAL A 1 43 ? 11.914  3.499   -3.354  1.00 0.00 ? 43 VAL A CB  6  
ATOM   3183 C  CG1 . VAL A 1 43 ? 13.235  2.721   -3.402  1.00 0.00 ? 43 VAL A CG1 6  
ATOM   3184 C  CG2 . VAL A 1 43 ? 11.681  3.975   -1.909  1.00 0.00 ? 43 VAL A CG2 6  
ATOM   3185 N  N   . GLN A 1 44 ? 11.295  3.477   -6.442  1.00 0.00 ? 44 GLN A N   6  
ATOM   3186 C  CA  . GLN A 1 44 ? 11.496  2.931   -7.786  1.00 0.00 ? 44 GLN A CA  6  
ATOM   3187 C  C   . GLN A 1 44 ? 10.219  3.013   -8.645  1.00 0.00 ? 44 GLN A C   6  
ATOM   3188 O  O   . GLN A 1 44 ? 9.550   4.042   -8.607  1.00 0.00 ? 44 GLN A O   6  
ATOM   3189 C  CB  . GLN A 1 44 ? 12.164  1.553   -7.689  1.00 0.00 ? 44 GLN A CB  6  
ATOM   3190 C  CG  . GLN A 1 44 ? 11.376  0.556   -6.841  1.00 0.00 ? 44 GLN A CG  6  
ATOM   3191 C  CD  . GLN A 1 44 ? 12.026  -0.821  -6.818  1.00 0.00 ? 44 GLN A CD  6  
ATOM   3192 O  OE1 . GLN A 1 44 ? 12.732  -1.167  -5.877  1.00 0.00 ? 44 GLN A OE1 6  
ATOM   3193 N  NE2 . GLN A 1 44 ? 11.789  -1.626  -7.848  1.00 0.00 ? 44 GLN A NE2 6  
ATOM   3194 N  N   . ASP A 1 45 ? 9.888   1.974   -9.431  1.00 0.00 ? 45 ASP A N   6  
ATOM   3195 C  CA  . ASP A 1 45 ? 8.881   1.935   -10.501 1.00 0.00 ? 45 ASP A CA  6  
ATOM   3196 C  C   . ASP A 1 45 ? 7.434   2.046   -9.989  1.00 0.00 ? 45 ASP A C   6  
ATOM   3197 O  O   . ASP A 1 45 ? 6.602   1.142   -10.114 1.00 0.00 ? 45 ASP A O   6  
ATOM   3198 C  CB  . ASP A 1 45 ? 9.097   0.673   -11.354 1.00 0.00 ? 45 ASP A CB  6  
ATOM   3199 C  CG  . ASP A 1 45 ? 9.140   -0.599  -10.521 1.00 0.00 ? 45 ASP A CG  6  
ATOM   3200 O  OD1 . ASP A 1 45 ? 10.110  -0.726  -9.741  1.00 0.00 ? 45 ASP A OD1 6  
ATOM   3201 O  OD2 . ASP A 1 45 ? 8.203   -1.426  -10.615 1.00 0.00 ? 45 ASP A OD2 6  
ATOM   3202 N  N   . GLY A 1 46 ? 7.133   3.195   -9.398  1.00 0.00 ? 46 GLY A N   6  
ATOM   3203 C  CA  . GLY A 1 46 ? 5.917   3.396   -8.642  1.00 0.00 ? 46 GLY A CA  6  
ATOM   3204 C  C   . GLY A 1 46 ? 5.914   2.415   -7.475  1.00 0.00 ? 46 GLY A C   6  
ATOM   3205 O  O   . GLY A 1 46 ? 4.991   1.622   -7.335  1.00 0.00 ? 46 GLY A O   6  
ATOM   3206 N  N   . TRP A 1 47 ? 6.956   2.452   -6.644  1.00 0.00 ? 47 TRP A N   6  
ATOM   3207 C  CA  . TRP A 1 47 ? 7.010   1.832   -5.344  1.00 0.00 ? 47 TRP A CA  6  
ATOM   3208 C  C   . TRP A 1 47 ? 7.583   2.863   -4.403  1.00 0.00 ? 47 TRP A C   6  
ATOM   3209 O  O   . TRP A 1 47 ? 8.357   3.714   -4.845  1.00 0.00 ? 47 TRP A O   6  
ATOM   3210 C  CB  . TRP A 1 47 ? 7.969   0.655   -5.342  1.00 0.00 ? 47 TRP A CB  6  
ATOM   3211 C  CG  . TRP A 1 47 ? 7.649   -0.473  -6.247  1.00 0.00 ? 47 TRP A CG  6  
ATOM   3212 C  CD1 . TRP A 1 47 ? 7.858   -0.468  -7.572  1.00 0.00 ? 47 TRP A CD1 6  
ATOM   3213 C  CD2 . TRP A 1 47 ? 6.992   -1.735  -5.952  1.00 0.00 ? 47 TRP A CD2 6  
ATOM   3214 N  NE1 . TRP A 1 47 ? 7.367   -1.624  -8.122  1.00 0.00 ? 47 TRP A NE1 6  
ATOM   3215 C  CE2 . TRP A 1 47 ? 6.812   -2.442  -7.172  1.00 0.00 ? 47 TRP A CE2 6  
ATOM   3216 C  CE3 . TRP A 1 47 ? 6.500   -2.337  -4.784  1.00 0.00 ? 47 TRP A CE3 6  
ATOM   3217 C  CZ2 . TRP A 1 47 ? 6.157   -3.673  -7.238  1.00 0.00 ? 47 TRP A CZ2 6  
ATOM   3218 C  CZ3 . TRP A 1 47 ? 5.731   -3.512  -4.847  1.00 0.00 ? 47 TRP A CZ3 6  
ATOM   3219 C  CH2 . TRP A 1 47 ? 5.556   -4.177  -6.075  1.00 0.00 ? 47 TRP A CH2 6  
ATOM   3220 N  N   . GLY A 1 48 ? 7.265   2.751   -3.119  1.00 0.00 ? 48 GLY A N   6  
ATOM   3221 C  CA  . GLY A 1 48 ? 7.825   3.614   -2.117  1.00 0.00 ? 48 GLY A CA  6  
ATOM   3222 C  C   . GLY A 1 48 ? 7.613   3.086   -0.715  1.00 0.00 ? 48 GLY A C   6  
ATOM   3223 O  O   . GLY A 1 48 ? 7.002   2.042   -0.487  1.00 0.00 ? 48 GLY A O   6  
ATOM   3224 N  N   . ARG A 1 49 ? 8.219   3.816   0.210   1.00 0.00 ? 49 ARG A N   6  
ATOM   3225 C  CA  . ARG A 1 49 ? 8.249   3.552   1.623   1.00 0.00 ? 49 ARG A CA  6  
ATOM   3226 C  C   . ARG A 1 49 ? 6.892   3.862   2.283   1.00 0.00 ? 49 ARG A C   6  
ATOM   3227 O  O   . ARG A 1 49 ? 6.200   4.787   1.863   1.00 0.00 ? 49 ARG A O   6  
ATOM   3228 C  CB  . ARG A 1 49 ? 9.425   4.383   2.128   1.00 0.00 ? 49 ARG A CB  6  
ATOM   3229 C  CG  . ARG A 1 49 ? 10.694  3.865   1.439   1.00 0.00 ? 49 ARG A CG  6  
ATOM   3230 C  CD  . ARG A 1 49 ? 11.543  2.952   2.294   1.00 0.00 ? 49 ARG A CD  6  
ATOM   3231 N  NE  . ARG A 1 49 ? 10.730  1.927   2.958   1.00 0.00 ? 49 ARG A NE  6  
ATOM   3232 C  CZ  . ARG A 1 49 ? 10.537  0.662   2.566   1.00 0.00 ? 49 ARG A CZ  6  
ATOM   3233 N  NH1 . ARG A 1 49 ? 11.450  -0.038  1.888   1.00 0.00 ? 49 ARG A NH1 6  
ATOM   3234 N  NH2 . ARG A 1 49 ? 9.357   0.116   2.835   1.00 0.00 ? 49 ARG A NH2 6  
ATOM   3235 N  N   . CYS A 1 50 ? 6.525   3.074   3.298   1.00 0.00 ? 50 CYS A N   6  
ATOM   3236 C  CA  . CYS A 1 50 ? 5.261   3.093   4.046   1.00 0.00 ? 50 CYS A CA  6  
ATOM   3237 C  C   . CYS A 1 50 ? 5.524   3.455   5.529   1.00 0.00 ? 50 CYS A C   6  
ATOM   3238 O  O   . CYS A 1 50 ? 4.611   3.708   6.319   1.00 0.00 ? 50 CYS A O   6  
ATOM   3239 C  CB  . CYS A 1 50 ? 4.632   1.726   3.882   1.00 0.00 ? 50 CYS A CB  6  
ATOM   3240 S  SG  . CYS A 1 50 ? 3.163   1.474   4.905   1.00 0.00 ? 50 CYS A SG  6  
ATOM   3241 N  N   . THR A 1 51 ? 6.799   3.490   5.939   1.00 0.00 ? 51 THR A N   6  
ATOM   3242 C  CA  . THR A 1 51 ? 7.307   3.997   7.217   1.00 0.00 ? 51 THR A CA  6  
ATOM   3243 C  C   . THR A 1 51 ? 6.978   3.119   8.434   1.00 0.00 ? 51 THR A C   6  
ATOM   3244 O  O   . THR A 1 51 ? 7.708   3.141   9.423   1.00 0.00 ? 51 THR A O   6  
ATOM   3245 C  CB  . THR A 1 51 ? 6.924   5.473   7.453   1.00 0.00 ? 51 THR A CB  6  
ATOM   3246 O  OG1 . THR A 1 51 ? 5.541   5.657   7.701   1.00 0.00 ? 51 THR A OG1 6  
ATOM   3247 C  CG2 . THR A 1 51 ? 7.335   6.360   6.271   1.00 0.00 ? 51 THR A CG2 6  
ATOM   3248 N  N   . HIS A 1 52 ? 5.862   2.392   8.407   1.00 0.00 ? 52 HIS A N   6  
ATOM   3249 C  CA  . HIS A 1 52 ? 5.336   1.672   9.559   1.00 0.00 ? 52 HIS A CA  6  
ATOM   3250 C  C   . HIS A 1 52 ? 5.999   0.295   9.648   1.00 0.00 ? 52 HIS A C   6  
ATOM   3251 O  O   . HIS A 1 52 ? 6.117   -0.366  8.622   1.00 0.00 ? 52 HIS A O   6  
ATOM   3252 C  CB  . HIS A 1 52 ? 3.813   1.588   9.421   1.00 0.00 ? 52 HIS A CB  6  
ATOM   3253 C  CG  . HIS A 1 52 ? 3.170   2.952   9.538   1.00 0.00 ? 52 HIS A CG  6  
ATOM   3254 N  ND1 . HIS A 1 52 ? 3.617   4.119   8.937   1.00 0.00 ? 52 HIS A ND1 6  
ATOM   3255 C  CD2 . HIS A 1 52 ? 2.138   3.277   10.374  1.00 0.00 ? 52 HIS A CD2 6  
ATOM   3256 C  CE1 . HIS A 1 52 ? 2.889   5.135   9.427   1.00 0.00 ? 52 HIS A CE1 6  
ATOM   3257 N  NE2 . HIS A 1 52 ? 1.966   4.645   10.277  1.00 0.00 ? 52 HIS A NE2 6  
ATOM   3258 N  N   . PRO A 1 53 ? 6.456   -0.142  10.832  1.00 0.00 ? 53 PRO A N   6  
ATOM   3259 C  CA  . PRO A 1 53 ? 7.350   -1.286  10.974  1.00 0.00 ? 53 PRO A CA  6  
ATOM   3260 C  C   . PRO A 1 53 ? 6.756   -2.553  10.361  1.00 0.00 ? 53 PRO A C   6  
ATOM   3261 O  O   . PRO A 1 53 ? 7.390   -3.201  9.532   1.00 0.00 ? 53 PRO A O   6  
ATOM   3262 C  CB  . PRO A 1 53 ? 7.623   -1.422  12.478  1.00 0.00 ? 53 PRO A CB  6  
ATOM   3263 C  CG  . PRO A 1 53 ? 6.460   -0.681  13.139  1.00 0.00 ? 53 PRO A CG  6  
ATOM   3264 C  CD  . PRO A 1 53 ? 6.139   0.423   12.132  1.00 0.00 ? 53 PRO A CD  6  
ATOM   3265 N  N   . ASP A 1 54 ? 5.520   -2.880  10.727  1.00 0.00 ? 54 ASP A N   6  
ATOM   3266 C  CA  . ASP A 1 54 ? 4.711   -3.963  10.182  1.00 0.00 ? 54 ASP A CA  6  
ATOM   3267 C  C   . ASP A 1 54 ? 4.222   -3.618  8.771   1.00 0.00 ? 54 ASP A C   6  
ATOM   3268 O  O   . ASP A 1 54 ? 3.026   -3.719  8.486   1.00 0.00 ? 54 ASP A O   6  
ATOM   3269 C  CB  . ASP A 1 54 ? 3.517   -4.205  11.124  1.00 0.00 ? 54 ASP A CB  6  
ATOM   3270 C  CG  . ASP A 1 54 ? 2.724   -2.929  11.422  1.00 0.00 ? 54 ASP A CG  6  
ATOM   3271 O  OD1 . ASP A 1 54 ? 3.351   -1.901  11.766  1.00 0.00 ? 54 ASP A OD1 6  
ATOM   3272 O  OD2 . ASP A 1 54 ? 1.485   -3.000  11.297  1.00 0.00 ? 54 ASP A OD2 6  
ATOM   3273 N  N   . PHE A 1 55 ? 5.144   -3.213  7.892   1.00 0.00 ? 55 PHE A N   6  
ATOM   3274 C  CA  . PHE A 1 55 ? 4.845   -2.793  6.534   1.00 0.00 ? 55 PHE A CA  6  
ATOM   3275 C  C   . PHE A 1 55 ? 6.094   -2.393  5.744   1.00 0.00 ? 55 PHE A C   6  
ATOM   3276 O  O   . PHE A 1 55 ? 6.179   -2.675  4.550   1.00 0.00 ? 55 PHE A O   6  
ATOM   3277 C  CB  . PHE A 1 55 ? 3.827   -1.630  6.526   1.00 0.00 ? 55 PHE A CB  6  
ATOM   3278 C  CG  . PHE A 1 55 ? 2.549   -1.979  5.795   1.00 0.00 ? 55 PHE A CG  6  
ATOM   3279 C  CD1 . PHE A 1 55 ? 2.660   -2.593  4.532   1.00 0.00 ? 55 PHE A CD1 6  
ATOM   3280 C  CD2 . PHE A 1 55 ? 1.282   -1.861  6.408   1.00 0.00 ? 55 PHE A CD2 6  
ATOM   3281 C  CE1 . PHE A 1 55 ? 1.587   -3.332  4.017   1.00 0.00 ? 55 PHE A CE1 6  
ATOM   3282 C  CE2 . PHE A 1 55 ? 0.185   -2.487  5.810   1.00 0.00 ? 55 PHE A CE2 6  
ATOM   3283 C  CZ  . PHE A 1 55 ? 0.368   -3.333  4.706   1.00 0.00 ? 55 PHE A CZ  6  
ATOM   3284 N  N   . ASP A 1 56 ? 7.008   -1.658  6.383   1.00 0.00 ? 56 ASP A N   6  
ATOM   3285 C  CA  . ASP A 1 56 ? 8.075   -0.926  5.711   1.00 0.00 ? 56 ASP A CA  6  
ATOM   3286 C  C   . ASP A 1 56 ? 9.367   -1.745  5.587   1.00 0.00 ? 56 ASP A C   6  
ATOM   3287 O  O   . ASP A 1 56 ? 10.377  -1.232  5.112   1.00 0.00 ? 56 ASP A O   6  
ATOM   3288 C  CB  . ASP A 1 56 ? 8.300   0.406   6.448   1.00 0.00 ? 56 ASP A CB  6  
ATOM   3289 C  CG  . ASP A 1 56 ? 9.078   1.425   5.628   1.00 0.00 ? 56 ASP A CG  6  
ATOM   3290 O  OD1 . ASP A 1 56 ? 8.534   1.858   4.581   1.00 0.00 ? 56 ASP A OD1 6  
ATOM   3291 O  OD2 . ASP A 1 56 ? 10.195  1.805   6.020   1.00 0.00 ? 56 ASP A OD2 6  
ATOM   3292 N  N   . GLU A 1 57 ? 9.349   -3.023  5.979   1.00 0.00 ? 57 GLU A N   6  
ATOM   3293 C  CA  . GLU A 1 57 ? 10.458  -3.930  5.737   1.00 0.00 ? 57 GLU A CA  6  
ATOM   3294 C  C   . GLU A 1 57 ? 10.511  -4.182  4.232   1.00 0.00 ? 57 GLU A C   6  
ATOM   3295 O  O   . GLU A 1 57 ? 11.524  -3.937  3.582   1.00 0.00 ? 57 GLU A O   6  
ATOM   3296 C  CB  . GLU A 1 57 ? 10.329  -5.247  6.541   1.00 0.00 ? 57 GLU A CB  6  
ATOM   3297 C  CG  . GLU A 1 57 ? 9.132   -5.368  7.503   1.00 0.00 ? 57 GLU A CG  6  
ATOM   3298 C  CD  . GLU A 1 57 ? 7.813   -5.626  6.792   1.00 0.00 ? 57 GLU A CD  6  
ATOM   3299 O  OE1 . GLU A 1 57 ? 7.606   -5.028  5.717   1.00 0.00 ? 57 GLU A OE1 6  
ATOM   3300 O  OE2 . GLU A 1 57 ? 7.001   -6.443  7.273   1.00 0.00 ? 57 GLU A OE2 6  
ATOM   3301 N  N   . VAL A 1 58 ? 9.390   -4.641  3.675   1.00 0.00 ? 58 VAL A N   6  
ATOM   3302 C  CA  . VAL A 1 58 ? 9.208   -4.709  2.231   1.00 0.00 ? 58 VAL A CA  6  
ATOM   3303 C  C   . VAL A 1 58 ? 8.882   -3.313  1.699   1.00 0.00 ? 58 VAL A C   6  
ATOM   3304 O  O   . VAL A 1 58 ? 8.584   -2.405  2.470   1.00 0.00 ? 58 VAL A O   6  
ATOM   3305 C  CB  . VAL A 1 58 ? 8.135   -5.744  1.866   1.00 0.00 ? 58 VAL A CB  6  
ATOM   3306 C  CG1 . VAL A 1 58 ? 8.527   -7.112  2.437   1.00 0.00 ? 58 VAL A CG1 6  
ATOM   3307 C  CG2 . VAL A 1 58 ? 6.734   -5.348  2.343   1.00 0.00 ? 58 VAL A CG2 6  
ATOM   3308 N  N   . LEU A 1 59 ? 8.961   -3.110  0.385   1.00 0.00 ? 59 LEU A N   6  
ATOM   3309 C  CA  . LEU A 1 59 ? 8.641   -1.856  -0.278  1.00 0.00 ? 59 LEU A CA  6  
ATOM   3310 C  C   . LEU A 1 59 ? 7.267   -1.989  -0.929  1.00 0.00 ? 59 LEU A C   6  
ATOM   3311 O  O   . LEU A 1 59 ? 7.038   -2.977  -1.620  1.00 0.00 ? 59 LEU A O   6  
ATOM   3312 C  CB  . LEU A 1 59 ? 9.722   -1.629  -1.334  1.00 0.00 ? 59 LEU A CB  6  
ATOM   3313 C  CG  . LEU A 1 59 ? 9.637   -0.252  -1.984  1.00 0.00 ? 59 LEU A CG  6  
ATOM   3314 C  CD1 . LEU A 1 59 ? 10.092  0.856   -1.033  1.00 0.00 ? 59 LEU A CD1 6  
ATOM   3315 C  CD2 . LEU A 1 59 ? 10.554  -0.266  -3.205  1.00 0.00 ? 59 LEU A CD2 6  
ATOM   3316 N  N   . VAL A 1 60 ? 6.355   -1.034  -0.735  1.00 0.00 ? 60 VAL A N   6  
ATOM   3317 C  CA  . VAL A 1 60 ? 4.991   -1.156  -1.247  1.00 0.00 ? 60 VAL A CA  6  
ATOM   3318 C  C   . VAL A 1 60 ? 4.853   -0.413  -2.575  1.00 0.00 ? 60 VAL A C   6  
ATOM   3319 O  O   . VAL A 1 60 ? 5.487   0.622   -2.776  1.00 0.00 ? 60 VAL A O   6  
ATOM   3320 C  CB  . VAL A 1 60 ? 3.972   -0.685  -0.199  1.00 0.00 ? 60 VAL A CB  6  
ATOM   3321 C  CG1 . VAL A 1 60 ? 4.023   -1.590  1.040   1.00 0.00 ? 60 VAL A CG1 6  
ATOM   3322 C  CG2 . VAL A 1 60 ? 4.162   0.775   0.221   1.00 0.00 ? 60 VAL A CG2 6  
ATOM   3323 N  N   . LYS A 1 61 ? 4.068   -0.955  -3.510  1.00 0.00 ? 61 LYS A N   6  
ATOM   3324 C  CA  . LYS A 1 61 ? 3.727   -0.278  -4.751  1.00 0.00 ? 61 LYS A CA  6  
ATOM   3325 C  C   . LYS A 1 61 ? 3.046   1.046   -4.404  1.00 0.00 ? 61 LYS A C   6  
ATOM   3326 O  O   . LYS A 1 61 ? 2.174   1.068   -3.547  1.00 0.00 ? 61 LYS A O   6  
ATOM   3327 C  CB  . LYS A 1 61 ? 2.771   -1.172  -5.556  1.00 0.00 ? 61 LYS A CB  6  
ATOM   3328 C  CG  . LYS A 1 61 ? 2.672   -0.745  -7.029  1.00 0.00 ? 61 LYS A CG  6  
ATOM   3329 C  CD  . LYS A 1 61 ? 3.430   -1.670  -7.987  1.00 0.00 ? 61 LYS A CD  6  
ATOM   3330 C  CE  . LYS A 1 61 ? 4.402   -0.942  -8.928  1.00 0.00 ? 61 LYS A CE  6  
ATOM   3331 N  NZ  . LYS A 1 61 ? 3.906   0.298   -9.568  1.00 0.00 ? 61 LYS A NZ  6  
ATOM   3332 N  N   . ALA A 1 62 ? 3.397   2.127   -5.098  1.00 0.00 ? 62 ALA A N   6  
ATOM   3333 C  CA  . ALA A 1 62 ? 2.711   3.410   -5.007  1.00 0.00 ? 62 ALA A CA  6  
ATOM   3334 C  C   . ALA A 1 62 ? 1.226   3.234   -5.293  1.00 0.00 ? 62 ALA A C   6  
ATOM   3335 O  O   . ALA A 1 62 ? 0.390   3.792   -4.584  1.00 0.00 ? 62 ALA A O   6  
ATOM   3336 C  CB  . ALA A 1 62 ? 3.351   4.386   -5.984  1.00 0.00 ? 62 ALA A CB  6  
ATOM   3337 N  N   . GLU A 1 63 ? 0.897   2.424   -6.305  1.00 0.00 ? 63 GLU A N   6  
ATOM   3338 C  CA  . GLU A 1 63 ? -0.483  2.090   -6.609  1.00 0.00 ? 63 GLU A CA  6  
ATOM   3339 C  C   . GLU A 1 63 ? -1.057  0.986   -5.724  1.00 0.00 ? 63 GLU A C   6  
ATOM   3340 O  O   . GLU A 1 63 ? -2.155  0.514   -6.009  1.00 0.00 ? 63 GLU A O   6  
ATOM   3341 C  CB  . GLU A 1 63 ? -0.670  1.705   -8.079  1.00 0.00 ? 63 GLU A CB  6  
ATOM   3342 C  CG  . GLU A 1 63 ? 0.111   2.592   -9.048  1.00 0.00 ? 63 GLU A CG  6  
ATOM   3343 C  CD  . GLU A 1 63 ? 1.460   1.952   -9.362  1.00 0.00 ? 63 GLU A CD  6  
ATOM   3344 O  OE1 . GLU A 1 63 ? 2.391   2.132   -8.543  1.00 0.00 ? 63 GLU A OE1 6  
ATOM   3345 O  OE2 . GLU A 1 63 ? 1.579   1.170   -10.332 1.00 0.00 ? 63 GLU A OE2 6  
ATOM   3346 N  N   . GLY A 1 64 ? -0.339  0.537   -4.694  1.00 0.00 ? 64 GLY A N   6  
ATOM   3347 C  CA  . GLY A 1 64 ? -0.841  -0.495  -3.807  1.00 0.00 ? 64 GLY A CA  6  
ATOM   3348 C  C   . GLY A 1 64 ? -1.913  0.074   -2.888  1.00 0.00 ? 64 GLY A C   6  
ATOM   3349 O  O   . GLY A 1 64 ? -2.307  1.232   -3.013  1.00 0.00 ? 64 GLY A O   6  
ATOM   3350 N  N   . TRP A 1 65 ? -2.391  -0.746  -1.958  1.00 0.00 ? 65 TRP A N   6  
ATOM   3351 C  CA  . TRP A 1 65 ? -3.249  -0.300  -0.873  1.00 0.00 ? 65 TRP A CA  6  
ATOM   3352 C  C   . TRP A 1 65 ? -3.161  -1.345  0.222   1.00 0.00 ? 65 TRP A C   6  
ATOM   3353 O  O   . TRP A 1 65 ? -2.906  -2.511  -0.089  1.00 0.00 ? 65 TRP A O   6  
ATOM   3354 C  CB  . TRP A 1 65 ? -4.695  -0.175  -1.359  1.00 0.00 ? 65 TRP A CB  6  
ATOM   3355 C  CG  . TRP A 1 65 ? -5.713  0.196   -0.324  1.00 0.00 ? 65 TRP A CG  6  
ATOM   3356 C  CD1 . TRP A 1 65 ? -6.120  1.452   -0.049  1.00 0.00 ? 65 TRP A CD1 6  
ATOM   3357 C  CD2 . TRP A 1 65 ? -6.496  -0.677  0.544   1.00 0.00 ? 65 TRP A CD2 6  
ATOM   3358 N  NE1 . TRP A 1 65 ? -7.169  1.418   0.846   1.00 0.00 ? 65 TRP A NE1 6  
ATOM   3359 C  CE2 . TRP A 1 65 ? -7.441  0.124   1.257   1.00 0.00 ? 65 TRP A CE2 6  
ATOM   3360 C  CE3 . TRP A 1 65 ? -6.535  -2.071  0.766   1.00 0.00 ? 65 TRP A CE3 6  
ATOM   3361 C  CZ2 . TRP A 1 65 ? -8.405  -0.445  2.107   1.00 0.00 ? 65 TRP A CZ2 6  
ATOM   3362 C  CZ3 . TRP A 1 65 ? -7.461  -2.641  1.657   1.00 0.00 ? 65 TRP A CZ3 6  
ATOM   3363 C  CH2 . TRP A 1 65 ? -8.417  -1.836  2.294   1.00 0.00 ? 65 TRP A CH2 6  
ATOM   3364 N  N   . CYS A 1 66 ? -3.406  -0.942  1.471   1.00 0.00 ? 66 CYS A N   6  
ATOM   3365 C  CA  . CYS A 1 66 ? -3.556  -1.847  2.594   1.00 0.00 ? 66 CYS A CA  6  
ATOM   3366 C  C   . CYS A 1 66 ? -4.708  -1.407  3.493   1.00 0.00 ? 66 CYS A C   6  
ATOM   3367 O  O   . CYS A 1 66 ? -5.200  -0.279  3.400   1.00 0.00 ? 66 CYS A O   6  
ATOM   3368 C  CB  . CYS A 1 66 ? -2.274  -1.933  3.374   1.00 0.00 ? 66 CYS A CB  6  
ATOM   3369 S  SG  . CYS A 1 66 ? -2.126  -0.522  4.491   1.00 0.00 ? 66 CYS A SG  6  
ATOM   3370 N  N   . SER A 1 67 ? -5.142  -2.293  4.392   1.00 0.00 ? 67 SER A N   6  
ATOM   3371 C  CA  . SER A 1 67 ? -6.243  -1.982  5.278   1.00 0.00 ? 67 SER A CA  6  
ATOM   3372 C  C   . SER A 1 67 ? -5.896  -0.836  6.231   1.00 0.00 ? 67 SER A C   6  
ATOM   3373 O  O   . SER A 1 67 ? -6.789  -0.047  6.556   1.00 0.00 ? 67 SER A O   6  
ATOM   3374 C  CB  . SER A 1 67 ? -6.749  -3.243  5.979   1.00 0.00 ? 67 SER A CB  6  
ATOM   3375 O  OG  . SER A 1 67 ? -5.741  -3.863  6.744   1.00 0.00 ? 67 SER A OG  6  
ATOM   3376 N  N   . VAL A 1 68 ? -4.623  -0.697  6.638   1.00 0.00 ? 68 VAL A N   6  
ATOM   3377 C  CA  . VAL A 1 68 ? -4.210  0.407   7.508   1.00 0.00 ? 68 VAL A CA  6  
ATOM   3378 C  C   . VAL A 1 68 ? -4.164  1.759   6.784   1.00 0.00 ? 68 VAL A C   6  
ATOM   3379 O  O   . VAL A 1 68 ? -3.892  2.763   7.439   1.00 0.00 ? 68 VAL A O   6  
ATOM   3380 C  CB  . VAL A 1 68 ? -2.960  0.139   8.377   1.00 0.00 ? 68 VAL A CB  6  
ATOM   3381 C  CG1 . VAL A 1 68 ? -2.941  -1.304  8.831   1.00 0.00 ? 68 VAL A CG1 6  
ATOM   3382 C  CG2 . VAL A 1 68 ? -1.571  0.458   7.825   1.00 0.00 ? 68 VAL A CG2 6  
ATOM   3383 N  N   . TYR A 1 69 ? -4.425  1.810   5.465   1.00 0.00 ? 69 TYR A N   6  
ATOM   3384 C  CA  . TYR A 1 69 ? -4.478  3.059   4.711   1.00 0.00 ? 69 TYR A CA  6  
ATOM   3385 C  C   . TYR A 1 69 ? -5.272  4.121   5.472   1.00 0.00 ? 69 TYR A C   6  
ATOM   3386 O  O   . TYR A 1 69 ? -6.435  3.885   5.811   1.00 0.00 ? 69 TYR A O   6  
ATOM   3387 C  CB  . TYR A 1 69 ? -5.114  2.835   3.325   1.00 0.00 ? 69 TYR A CB  6  
ATOM   3388 C  CG  . TYR A 1 69 ? -5.290  4.109   2.512   1.00 0.00 ? 69 TYR A CG  6  
ATOM   3389 C  CD1 . TYR A 1 69 ? -6.370  4.966   2.785   1.00 0.00 ? 69 TYR A CD1 6  
ATOM   3390 C  CD2 . TYR A 1 69 ? -4.340  4.493   1.546   1.00 0.00 ? 69 TYR A CD2 6  
ATOM   3391 C  CE1 . TYR A 1 69 ? -6.460  6.216   2.160   1.00 0.00 ? 69 TYR A CE1 6  
ATOM   3392 C  CE2 . TYR A 1 69 ? -4.452  5.733   0.895   1.00 0.00 ? 69 TYR A CE2 6  
ATOM   3393 C  CZ  . TYR A 1 69 ? -5.514  6.596   1.199   1.00 0.00 ? 69 TYR A CZ  6  
ATOM   3394 O  OH  . TYR A 1 69 ? -5.710  7.740   0.484   1.00 0.00 ? 69 TYR A OH  6  
ATOM   3395 N  N   . ALA A 1 70 ? -4.678  5.299   5.666   1.00 0.00 ? 70 ALA A N   6  
ATOM   3396 C  CA  . ALA A 1 70 ? -5.349  6.492   6.156   1.00 0.00 ? 70 ALA A CA  6  
ATOM   3397 C  C   . ALA A 1 70 ? -5.125  7.579   5.105   1.00 0.00 ? 70 ALA A C   6  
ATOM   3398 O  O   . ALA A 1 70 ? -3.995  7.709   4.639   1.00 0.00 ? 70 ALA A O   6  
ATOM   3399 C  CB  . ALA A 1 70 ? -4.746  6.896   7.504   1.00 0.00 ? 70 ALA A CB  6  
ATOM   3400 N  N   . PRO A 1 71 ? -6.153  8.328   4.682   1.00 0.00 ? 71 PRO A N   6  
ATOM   3401 C  CA  . PRO A 1 71 ? -5.993  9.333   3.645   1.00 0.00 ? 71 PRO A CA  6  
ATOM   3402 C  C   . PRO A 1 71 ? -5.187  10.518  4.155   1.00 0.00 ? 71 PRO A C   6  
ATOM   3403 O  O   . PRO A 1 71 ? -5.209  10.837  5.342   1.00 0.00 ? 71 PRO A O   6  
ATOM   3404 C  CB  . PRO A 1 71 ? -7.411  9.741   3.242   1.00 0.00 ? 71 PRO A CB  6  
ATOM   3405 C  CG  . PRO A 1 71 ? -8.215  9.496   4.520   1.00 0.00 ? 71 PRO A CG  6  
ATOM   3406 C  CD  . PRO A 1 71 ? -7.528  8.280   5.147   1.00 0.00 ? 71 PRO A CD  6  
ATOM   3407 N  N   . ALA A 1 72 ? -4.483  11.174  3.230   1.00 0.00 ? 72 ALA A N   6  
ATOM   3408 C  CA  . ALA A 1 72 ? -3.712  12.374  3.502   1.00 0.00 ? 72 ALA A CA  6  
ATOM   3409 C  C   . ALA A 1 72 ? -4.521  13.622  3.141   1.00 0.00 ? 72 ALA A C   6  
ATOM   3410 O  O   . ALA A 1 72 ? -3.976  14.622  2.679   1.00 0.00 ? 72 ALA A O   6  
ATOM   3411 C  CB  . ALA A 1 72 ? -2.419  12.303  2.701   1.00 0.00 ? 72 ALA A CB  6  
ATOM   3412 N  N   . SER A 1 73 ? -5.835  13.541  3.319   1.00 0.00 ? 73 SER A N   6  
ATOM   3413 C  CA  . SER A 1 73 ? -6.834  14.569  3.114   1.00 0.00 ? 73 SER A CA  6  
ATOM   3414 C  C   . SER A 1 73 ? -8.102  14.056  3.793   1.00 0.00 ? 73 SER A C   6  
ATOM   3415 O  O   . SER A 1 73 ? -8.058  12.884  4.236   1.00 0.00 ? 73 SER A O   6  
ATOM   3416 C  CB  . SER A 1 73 ? -7.101  14.797  1.622   1.00 0.00 ? 73 SER A CB  6  
ATOM   3417 O  OG  . SER A 1 73 ? -6.000  15.417  0.981   1.00 0.00 ? 73 SER A OG  6  
ATOM   3418 O  OXT . SER A 1 73 ? -9.086  14.824  3.829   1.00 0.00 ? 73 SER A OXT 6  
HETATM 3419 FE FE1 . SF4 B 2 .  ? 0.240   1.671   1.583   1.00 0.00 ? 74 SF4 A FE1 6  
HETATM 3420 FE FE2 . SF4 B 2 .  ? -0.461  3.247   3.394   1.00 0.00 ? 74 SF4 A FE2 6  
HETATM 3421 FE FE3 . SF4 B 2 .  ? 1.462   1.708   3.788   1.00 0.00 ? 74 SF4 A FE3 6  
HETATM 3422 FE FE4 . SF4 B 2 .  ? -0.848  0.811   3.656   1.00 0.00 ? 74 SF4 A FE4 6  
HETATM 3423 S  S1  . SF4 B 2 .  ? -0.122  2.145   5.169   1.00 0.00 ? 74 SF4 A S1  6  
HETATM 3424 S  S2  . SF4 B 2 .  ? 0.865   -0.068  2.707   1.00 0.00 ? 74 SF4 A S2  6  
HETATM 3425 S  S3  . SF4 B 2 .  ? -1.793  2.044   2.190   1.00 0.00 ? 74 SF4 A S3  6  
HETATM 3426 S  S4  . SF4 B 2 .  ? 1.450   3.326   2.342   1.00 0.00 ? 74 SF4 A S4  6  
ATOM   3427 N  N   . ALA A 1 1  ? 16.561  2.532   -1.322  1.00 0.00 ? 1  ALA A N   7  
ATOM   3428 C  CA  . ALA A 1 1  ? 17.559  1.588   -1.813  1.00 0.00 ? 1  ALA A CA  7  
ATOM   3429 C  C   . ALA A 1 1  ? 16.966  0.835   -3.005  1.00 0.00 ? 1  ALA A C   7  
ATOM   3430 O  O   . ALA A 1 1  ? 16.723  1.428   -4.052  1.00 0.00 ? 1  ALA A O   7  
ATOM   3431 C  CB  . ALA A 1 1  ? 18.046  0.573   -0.774  1.00 0.00 ? 1  ALA A CB  7  
ATOM   3432 N  N   . SER A 1 2  ? 16.683  -0.450  -2.819  1.00 0.00 ? 2  SER A N   7  
ATOM   3433 C  CA  . SER A 1 2  ? 15.973  -1.318  -3.751  1.00 0.00 ? 2  SER A CA  7  
ATOM   3434 C  C   . SER A 1 2  ? 15.491  -2.531  -2.963  1.00 0.00 ? 2  SER A C   7  
ATOM   3435 O  O   . SER A 1 2  ? 15.808  -3.677  -3.276  1.00 0.00 ? 2  SER A O   7  
ATOM   3436 C  CB  . SER A 1 2  ? 16.840  -1.707  -4.955  1.00 0.00 ? 2  SER A CB  7  
ATOM   3437 O  OG  . SER A 1 2  ? 16.916  -0.621  -5.860  1.00 0.00 ? 2  SER A OG  7  
ATOM   3438 N  N   . GLU A 1 3  ? 14.740  -2.230  -1.908  1.00 0.00 ? 3  GLU A N   7  
ATOM   3439 C  CA  . GLU A 1 3  ? 14.139  -3.184  -1.002  1.00 0.00 ? 3  GLU A CA  7  
ATOM   3440 C  C   . GLU A 1 3  ? 13.200  -4.096  -1.808  1.00 0.00 ? 3  GLU A C   7  
ATOM   3441 O  O   . GLU A 1 3  ? 12.683  -3.676  -2.846  1.00 0.00 ? 3  GLU A O   7  
ATOM   3442 C  CB  . GLU A 1 3  ? 13.426  -2.399  0.112   1.00 0.00 ? 3  GLU A CB  7  
ATOM   3443 C  CG  . GLU A 1 3  ? 14.389  -1.591  1.005   1.00 0.00 ? 3  GLU A CG  7  
ATOM   3444 C  CD  . GLU A 1 3  ? 15.006  -0.368  0.335   1.00 0.00 ? 3  GLU A CD  7  
ATOM   3445 O  OE1 . GLU A 1 3  ? 14.393  0.721   0.320   1.00 0.00 ? 3  GLU A OE1 7  
ATOM   3446 O  OE2 . GLU A 1 3  ? 16.120  -0.462  -0.217  1.00 0.00 ? 3  GLU A OE2 7  
ATOM   3447 N  N   . PRO A 1 4  ? 12.993  -5.352  -1.387  1.00 0.00 ? 4  PRO A N   7  
ATOM   3448 C  CA  . PRO A 1 4  ? 12.213  -6.295  -2.166  1.00 0.00 ? 4  PRO A CA  7  
ATOM   3449 C  C   . PRO A 1 4  ? 10.762  -5.822  -2.260  1.00 0.00 ? 4  PRO A C   7  
ATOM   3450 O  O   . PRO A 1 4  ? 10.160  -5.447  -1.256  1.00 0.00 ? 4  PRO A O   7  
ATOM   3451 C  CB  . PRO A 1 4  ? 12.345  -7.643  -1.451  1.00 0.00 ? 4  PRO A CB  7  
ATOM   3452 C  CG  . PRO A 1 4  ? 12.695  -7.261  -0.013  1.00 0.00 ? 4  PRO A CG  7  
ATOM   3453 C  CD  . PRO A 1 4  ? 13.487  -5.960  -0.163  1.00 0.00 ? 4  PRO A CD  7  
ATOM   3454 N  N   . ARG A 1 5  ? 10.214  -5.816  -3.477  1.00 0.00 ? 5  ARG A N   7  
ATOM   3455 C  CA  . ARG A 1 5  ? 8.849   -5.435  -3.767  1.00 0.00 ? 5  ARG A CA  7  
ATOM   3456 C  C   . ARG A 1 5  ? 7.868   -6.323  -2.992  1.00 0.00 ? 5  ARG A C   7  
ATOM   3457 O  O   . ARG A 1 5  ? 7.952   -7.547  -3.066  1.00 0.00 ? 5  ARG A O   7  
ATOM   3458 C  CB  . ARG A 1 5  ? 8.692   -5.579  -5.281  1.00 0.00 ? 5  ARG A CB  7  
ATOM   3459 C  CG  . ARG A 1 5  ? 9.505   -4.516  -5.983  1.00 0.00 ? 5  ARG A CG  7  
ATOM   3460 C  CD  . ARG A 1 5  ? 9.652   -4.976  -7.428  1.00 0.00 ? 5  ARG A CD  7  
ATOM   3461 N  NE  . ARG A 1 5  ? 10.782  -4.263  -7.973  1.00 0.00 ? 5  ARG A NE  7  
ATOM   3462 C  CZ  . ARG A 1 5  ? 10.737  -3.362  -8.965  1.00 0.00 ? 5  ARG A CZ  7  
ATOM   3463 N  NH1 . ARG A 1 5  ? 9.773   -3.443  -9.884  1.00 0.00 ? 5  ARG A NH1 7  
ATOM   3464 N  NH2 . ARG A 1 5  ? 11.631  -2.379  -9.019  1.00 0.00 ? 5  ARG A NH2 7  
ATOM   3465 N  N   . ALA A 1 6  ? 6.960   -5.697  -2.239  1.00 0.00 ? 6  ALA A N   7  
ATOM   3466 C  CA  . ALA A 1 6  ? 5.977   -6.346  -1.391  1.00 0.00 ? 6  ALA A CA  7  
ATOM   3467 C  C   . ALA A 1 6  ? 5.100   -7.302  -2.193  1.00 0.00 ? 6  ALA A C   7  
ATOM   3468 O  O   . ALA A 1 6  ? 4.733   -7.016  -3.334  1.00 0.00 ? 6  ALA A O   7  
ATOM   3469 C  CB  . ALA A 1 6  ? 5.111   -5.274  -0.728  1.00 0.00 ? 6  ALA A CB  7  
ATOM   3470 N  N   . GLU A 1 7  ? 4.736   -8.422  -1.578  1.00 0.00 ? 7  GLU A N   7  
ATOM   3471 C  CA  . GLU A 1 7  ? 3.855   -9.395  -2.176  1.00 0.00 ? 7  GLU A CA  7  
ATOM   3472 C  C   . GLU A 1 7  ? 2.404   -9.090  -1.853  1.00 0.00 ? 7  GLU A C   7  
ATOM   3473 O  O   . GLU A 1 7  ? 2.080   -8.557  -0.793  1.00 0.00 ? 7  GLU A O   7  
ATOM   3474 C  CB  . GLU A 1 7  ? 4.267   -10.809 -1.872  1.00 0.00 ? 7  GLU A CB  7  
ATOM   3475 C  CG  . GLU A 1 7  ? 4.259   -11.106 -0.395  1.00 0.00 ? 7  GLU A CG  7  
ATOM   3476 C  CD  . GLU A 1 7  ? 5.488   -10.643 0.380   1.00 0.00 ? 7  GLU A CD  7  
ATOM   3477 O  OE1 . GLU A 1 7  ? 5.489   -9.461  0.795   1.00 0.00 ? 7  GLU A OE1 7  
ATOM   3478 O  OE2 . GLU A 1 7  ? 6.397   -11.473 0.574   1.00 0.00 ? 7  GLU A OE2 7  
ATOM   3479 N  N   . ASP A 1 8  ? 1.527   -9.457  -2.777  1.00 0.00 ? 8  ASP A N   7  
ATOM   3480 C  CA  . ASP A 1 8  ? 0.102   -9.373  -2.577  1.00 0.00 ? 8  ASP A CA  7  
ATOM   3481 C  C   . ASP A 1 8  ? -0.254  -10.285 -1.407  1.00 0.00 ? 8  ASP A C   7  
ATOM   3482 O  O   . ASP A 1 8  ? 0.069   -11.471 -1.414  1.00 0.00 ? 8  ASP A O   7  
ATOM   3483 C  CB  . ASP A 1 8  ? -0.589  -9.764  -3.882  1.00 0.00 ? 8  ASP A CB  7  
ATOM   3484 C  CG  . ASP A 1 8  ? -0.371  -8.684  -4.925  1.00 0.00 ? 8  ASP A CG  7  
ATOM   3485 O  OD1 . ASP A 1 8  ? 0.679   -8.750  -5.602  1.00 0.00 ? 8  ASP A OD1 7  
ATOM   3486 O  OD2 . ASP A 1 8  ? -1.200  -7.750  -4.964  1.00 0.00 ? 8  ASP A OD2 7  
ATOM   3487 N  N   . GLY A 1 9  ? -0.847  -9.707  -0.365  1.00 0.00 ? 9  GLY A N   7  
ATOM   3488 C  CA  . GLY A 1 9  ? -1.137  -10.392 0.878   1.00 0.00 ? 9  GLY A CA  7  
ATOM   3489 C  C   . GLY A 1 9  ? 0.054   -10.421 1.841   1.00 0.00 ? 9  GLY A C   7  
ATOM   3490 O  O   . GLY A 1 9  ? -0.003  -11.182 2.803   1.00 0.00 ? 9  GLY A O   7  
ATOM   3491 N  N   . HIS A 1 10 ? 1.093   -9.589  1.639   1.00 0.00 ? 10 HIS A N   7  
ATOM   3492 C  CA  . HIS A 1 10 ? 2.196   -9.417  2.586   1.00 0.00 ? 10 HIS A CA  7  
ATOM   3493 C  C   . HIS A 1 10 ? 1.712   -9.429  4.038   1.00 0.00 ? 10 HIS A C   7  
ATOM   3494 O  O   . HIS A 1 10 ? 2.165   -10.227 4.852   1.00 0.00 ? 10 HIS A O   7  
ATOM   3495 C  CB  . HIS A 1 10 ? 2.921   -8.092  2.308   1.00 0.00 ? 10 HIS A CB  7  
ATOM   3496 C  CG  . HIS A 1 10 ? 4.065   -7.851  3.262   1.00 0.00 ? 10 HIS A CG  7  
ATOM   3497 N  ND1 . HIS A 1 10 ? 5.304   -8.455  3.186   1.00 0.00 ? 10 HIS A ND1 7  
ATOM   3498 C  CD2 . HIS A 1 10 ? 3.999   -7.153  4.435   1.00 0.00 ? 10 HIS A CD2 7  
ATOM   3499 C  CE1 . HIS A 1 10 ? 5.981   -8.142  4.308   1.00 0.00 ? 10 HIS A CE1 7  
ATOM   3500 N  NE2 . HIS A 1 10 ? 5.202   -7.356  5.078   1.00 0.00 ? 10 HIS A NE2 7  
ATOM   3501 N  N   . ALA A 1 11 ? 0.809   -8.497  4.347   1.00 0.00 ? 11 ALA A N   7  
ATOM   3502 C  CA  . ALA A 1 11 ? 0.121   -8.377  5.621   1.00 0.00 ? 11 ALA A CA  7  
ATOM   3503 C  C   . ALA A 1 11 ? -1.003  -7.359  5.434   1.00 0.00 ? 11 ALA A C   7  
ATOM   3504 O  O   . ALA A 1 11 ? -1.067  -6.718  4.385   1.00 0.00 ? 11 ALA A O   7  
ATOM   3505 C  CB  . ALA A 1 11 ? 1.092   -7.940  6.724   1.00 0.00 ? 11 ALA A CB  7  
ATOM   3506 N  N   . HIS A 1 12 ? -1.872  -7.215  6.443   1.00 0.00 ? 12 HIS A N   7  
ATOM   3507 C  CA  . HIS A 1 12 ? -2.977  -6.255  6.489   1.00 0.00 ? 12 HIS A CA  7  
ATOM   3508 C  C   . HIS A 1 12 ? -3.675  -6.100  5.134   1.00 0.00 ? 12 HIS A C   7  
ATOM   3509 O  O   . HIS A 1 12 ? -3.854  -4.986  4.642   1.00 0.00 ? 12 HIS A O   7  
ATOM   3510 C  CB  . HIS A 1 12 ? -2.493  -4.892  6.985   1.00 0.00 ? 12 HIS A CB  7  
ATOM   3511 C  CG  . HIS A 1 12 ? -1.697  -4.899  8.265   1.00 0.00 ? 12 HIS A CG  7  
ATOM   3512 N  ND1 . HIS A 1 12 ? -2.148  -4.407  9.475   1.00 0.00 ? 12 HIS A ND1 7  
ATOM   3513 C  CD2 . HIS A 1 12 ? -0.340  -5.057  8.354   1.00 0.00 ? 12 HIS A CD2 7  
ATOM   3514 C  CE1 . HIS A 1 12 ? -1.076  -4.233  10.269  1.00 0.00 ? 12 HIS A CE1 7  
ATOM   3515 N  NE2 . HIS A 1 12 ? 0.022   -4.657  9.623   1.00 0.00 ? 12 HIS A NE2 7  
ATOM   3516 N  N   . ASP A 1 13 ? -4.047  -7.228  4.533   1.00 0.00 ? 13 ASP A N   7  
ATOM   3517 C  CA  . ASP A 1 13 ? -4.828  -7.284  3.305   1.00 0.00 ? 13 ASP A CA  7  
ATOM   3518 C  C   . ASP A 1 13 ? -4.181  -6.493  2.159   1.00 0.00 ? 13 ASP A C   7  
ATOM   3519 O  O   . ASP A 1 13 ? -4.892  -6.024  1.271   1.00 0.00 ? 13 ASP A O   7  
ATOM   3520 C  CB  . ASP A 1 13 ? -6.267  -6.814  3.559   1.00 0.00 ? 13 ASP A CB  7  
ATOM   3521 C  CG  . ASP A 1 13 ? -6.818  -7.191  4.924   1.00 0.00 ? 13 ASP A CG  7  
ATOM   3522 O  OD1 . ASP A 1 13 ? -6.663  -8.360  5.329   1.00 0.00 ? 13 ASP A OD1 7  
ATOM   3523 O  OD2 . ASP A 1 13 ? -7.413  -6.271  5.536   1.00 0.00 ? 13 ASP A OD2 7  
ATOM   3524 N  N   . TYR A 1 14 ? -2.855  -6.312  2.180   1.00 0.00 ? 14 TYR A N   7  
ATOM   3525 C  CA  . TYR A 1 14 ? -2.193  -5.485  1.186   1.00 0.00 ? 14 TYR A CA  7  
ATOM   3526 C  C   . TYR A 1 14 ? -2.348  -6.074  -0.209  1.00 0.00 ? 14 TYR A C   7  
ATOM   3527 O  O   . TYR A 1 14 ? -2.178  -7.278  -0.391  1.00 0.00 ? 14 TYR A O   7  
ATOM   3528 C  CB  . TYR A 1 14 ? -0.720  -5.264  1.536   1.00 0.00 ? 14 TYR A CB  7  
ATOM   3529 C  CG  . TYR A 1 14 ? 0.119   -4.671  0.415   1.00 0.00 ? 14 TYR A CG  7  
ATOM   3530 C  CD1 . TYR A 1 14 ? 0.131   -3.285  0.177   1.00 0.00 ? 14 TYR A CD1 7  
ATOM   3531 C  CD2 . TYR A 1 14 ? 0.835   -5.523  -0.445  1.00 0.00 ? 14 TYR A CD2 7  
ATOM   3532 C  CE1 . TYR A 1 14 ? 0.915   -2.752  -0.858  1.00 0.00 ? 14 TYR A CE1 7  
ATOM   3533 C  CE2 . TYR A 1 14 ? 1.627   -4.991  -1.475  1.00 0.00 ? 14 TYR A CE2 7  
ATOM   3534 C  CZ  . TYR A 1 14 ? 1.698   -3.599  -1.654  1.00 0.00 ? 14 TYR A CZ  7  
ATOM   3535 O  OH  . TYR A 1 14 ? 2.570   -3.061  -2.552  1.00 0.00 ? 14 TYR A OH  7  
ATOM   3536 N  N   . VAL A 1 15 ? -2.622  -5.214  -1.189  1.00 0.00 ? 15 VAL A N   7  
ATOM   3537 C  CA  . VAL A 1 15 ? -2.654  -5.561  -2.602  1.00 0.00 ? 15 VAL A CA  7  
ATOM   3538 C  C   . VAL A 1 15 ? -1.688  -4.631  -3.325  1.00 0.00 ? 15 VAL A C   7  
ATOM   3539 O  O   . VAL A 1 15 ? -1.558  -3.464  -2.944  1.00 0.00 ? 15 VAL A O   7  
ATOM   3540 C  CB  . VAL A 1 15 ? -4.087  -5.444  -3.149  1.00 0.00 ? 15 VAL A CB  7  
ATOM   3541 C  CG1 . VAL A 1 15 ? -4.980  -6.509  -2.498  1.00 0.00 ? 15 VAL A CG1 7  
ATOM   3542 C  CG2 . VAL A 1 15 ? -4.697  -4.056  -2.896  1.00 0.00 ? 15 VAL A CG2 7  
ATOM   3543 N  N   . ASN A 1 16 ? -1.002  -5.140  -4.353  1.00 0.00 ? 16 ASN A N   7  
ATOM   3544 C  CA  . ASN A 1 16 ? -0.105  -4.377  -5.189  1.00 0.00 ? 16 ASN A CA  7  
ATOM   3545 C  C   . ASN A 1 16 ? -0.859  -3.423  -6.107  1.00 0.00 ? 16 ASN A C   7  
ATOM   3546 O  O   . ASN A 1 16 ? -0.308  -2.394  -6.493  1.00 0.00 ? 16 ASN A O   7  
ATOM   3547 C  CB  . ASN A 1 16 ? 0.863   -5.267  -5.975  1.00 0.00 ? 16 ASN A CB  7  
ATOM   3548 C  CG  . ASN A 1 16 ? 2.108   -5.558  -5.152  1.00 0.00 ? 16 ASN A CG  7  
ATOM   3549 O  OD1 . ASN A 1 16 ? 2.793   -4.644  -4.706  1.00 0.00 ? 16 ASN A OD1 7  
ATOM   3550 N  ND2 . ASN A 1 16 ? 2.423   -6.817  -4.930  1.00 0.00 ? 16 ASN A ND2 7  
ATOM   3551 N  N   . GLU A 1 17 ? -2.105  -3.762  -6.459  1.00 0.00 ? 17 GLU A N   7  
ATOM   3552 C  CA  . GLU A 1 17 ? -3.015  -2.901  -7.178  1.00 0.00 ? 17 GLU A CA  7  
ATOM   3553 C  C   . GLU A 1 17 ? -4.168  -2.572  -6.245  1.00 0.00 ? 17 GLU A C   7  
ATOM   3554 O  O   . GLU A 1 17 ? -4.946  -3.455  -5.899  1.00 0.00 ? 17 GLU A O   7  
ATOM   3555 C  CB  . GLU A 1 17 ? -3.529  -3.632  -8.417  1.00 0.00 ? 17 GLU A CB  7  
ATOM   3556 C  CG  . GLU A 1 17 ? -4.235  -2.653  -9.350  1.00 0.00 ? 17 GLU A CG  7  
ATOM   3557 C  CD  . GLU A 1 17 ? -4.575  -3.281  -10.697 1.00 0.00 ? 17 GLU A CD  7  
ATOM   3558 O  OE1 . GLU A 1 17 ? -3.639  -3.831  -11.316 1.00 0.00 ? 17 GLU A OE1 7  
ATOM   3559 O  OE2 . GLU A 1 17 ? -5.756  -3.184  -11.090 1.00 0.00 ? 17 GLU A OE2 7  
ATOM   3560 N  N   . ALA A 1 18 ? -4.286  -1.301  -5.869  1.00 0.00 ? 18 ALA A N   7  
ATOM   3561 C  CA  . ALA A 1 18 ? -5.381  -0.754  -5.083  1.00 0.00 ? 18 ALA A CA  7  
ATOM   3562 C  C   . ALA A 1 18 ? -6.724  -1.340  -5.528  1.00 0.00 ? 18 ALA A C   7  
ATOM   3563 O  O   . ALA A 1 18 ? -7.495  -1.839  -4.711  1.00 0.00 ? 18 ALA A O   7  
ATOM   3564 C  CB  . ALA A 1 18 ? -5.363  0.770   -5.231  1.00 0.00 ? 18 ALA A CB  7  
ATOM   3565 N  N   . ALA A 1 19 ? -6.970  -1.321  -6.840  1.00 0.00 ? 19 ALA A N   7  
ATOM   3566 C  CA  . ALA A 1 19 ? -8.196  -1.827  -7.436  1.00 0.00 ? 19 ALA A CA  7  
ATOM   3567 C  C   . ALA A 1 19 ? -8.510  -3.266  -7.025  1.00 0.00 ? 19 ALA A C   7  
ATOM   3568 O  O   . ALA A 1 19 ? -9.687  -3.588  -6.862  1.00 0.00 ? 19 ALA A O   7  
ATOM   3569 C  CB  . ALA A 1 19 ? -8.130  -1.716  -8.956  1.00 0.00 ? 19 ALA A CB  7  
ATOM   3570 N  N   . ASP A 1 20 ? -7.502  -4.135  -6.831  1.00 0.00 ? 20 ASP A N   7  
ATOM   3571 C  CA  . ASP A 1 20 ? -7.769  -5.484  -6.328  1.00 0.00 ? 20 ASP A CA  7  
ATOM   3572 C  C   . ASP A 1 20 ? -8.655  -5.437  -5.077  1.00 0.00 ? 20 ASP A C   7  
ATOM   3573 O  O   . ASP A 1 20 ? -9.619  -6.188  -4.932  1.00 0.00 ? 20 ASP A O   7  
ATOM   3574 C  CB  . ASP A 1 20 ? -6.474  -6.221  -6.001  1.00 0.00 ? 20 ASP A CB  7  
ATOM   3575 C  CG  . ASP A 1 20 ? -6.757  -7.697  -5.757  1.00 0.00 ? 20 ASP A CG  7  
ATOM   3576 O  OD1 . ASP A 1 20 ? -6.795  -8.439  -6.763  1.00 0.00 ? 20 ASP A OD1 7  
ATOM   3577 O  OD2 . ASP A 1 20 ? -6.953  -8.054  -4.577  1.00 0.00 ? 20 ASP A OD2 7  
ATOM   3578 N  N   . ALA A 1 21 ? -8.369  -4.474  -4.196  1.00 0.00 ? 21 ALA A N   7  
ATOM   3579 C  CA  . ALA A 1 21 ? -9.071  -4.322  -2.935  1.00 0.00 ? 21 ALA A CA  7  
ATOM   3580 C  C   . ALA A 1 21 ? -10.455 -3.689  -3.099  1.00 0.00 ? 21 ALA A C   7  
ATOM   3581 O  O   . ALA A 1 21 ? -11.093 -3.410  -2.089  1.00 0.00 ? 21 ALA A O   7  
ATOM   3582 C  CB  . ALA A 1 21 ? -8.211  -3.547  -1.929  1.00 0.00 ? 21 ALA A CB  7  
ATOM   3583 N  N   . SER A 1 22 ? -10.977 -3.521  -4.322  1.00 0.00 ? 22 SER A N   7  
ATOM   3584 C  CA  . SER A 1 22 ? -12.343 -3.044  -4.547  1.00 0.00 ? 22 SER A CA  7  
ATOM   3585 C  C   . SER A 1 22 ? -13.387 -3.858  -3.778  1.00 0.00 ? 22 SER A C   7  
ATOM   3586 O  O   . SER A 1 22 ? -14.395 -3.348  -3.293  1.00 0.00 ? 22 SER A O   7  
ATOM   3587 C  CB  . SER A 1 22 ? -12.627 -2.918  -6.051  1.00 0.00 ? 22 SER A CB  7  
ATOM   3588 O  OG  . SER A 1 22 ? -13.825 -2.208  -6.292  1.00 0.00 ? 22 SER A OG  7  
ATOM   3589 N  N   . GLY A 1 23 ? -13.079 -5.135  -3.607  1.00 0.00 ? 23 GLY A N   7  
ATOM   3590 C  CA  . GLY A 1 23 ? -13.879 -6.086  -2.849  1.00 0.00 ? 23 GLY A CA  7  
ATOM   3591 C  C   . GLY A 1 23 ? -13.852 -5.849  -1.332  1.00 0.00 ? 23 GLY A C   7  
ATOM   3592 O  O   . GLY A 1 23 ? -14.727 -6.337  -0.622  1.00 0.00 ? 23 GLY A O   7  
ATOM   3593 N  N   . HIS A 1 24 ? -12.834 -5.161  -0.807  1.00 0.00 ? 24 HIS A N   7  
ATOM   3594 C  CA  . HIS A 1 24 ? -12.559 -5.077  0.620   1.00 0.00 ? 24 HIS A CA  7  
ATOM   3595 C  C   . HIS A 1 24 ? -13.474 -4.051  1.307   1.00 0.00 ? 24 HIS A C   7  
ATOM   3596 O  O   . HIS A 1 24 ? -13.281 -2.857  1.085   1.00 0.00 ? 24 HIS A O   7  
ATOM   3597 C  CB  . HIS A 1 24 ? -11.090 -4.667  0.800   1.00 0.00 ? 24 HIS A CB  7  
ATOM   3598 C  CG  . HIS A 1 24 ? -10.574 -4.810  2.208   1.00 0.00 ? 24 HIS A CG  7  
ATOM   3599 N  ND1 . HIS A 1 24 ? -11.109 -4.228  3.344   1.00 0.00 ? 24 HIS A ND1 7  
ATOM   3600 C  CD2 . HIS A 1 24 ? -9.463  -5.516  2.574   1.00 0.00 ? 24 HIS A CD2 7  
ATOM   3601 C  CE1 . HIS A 1 24 ? -10.334 -4.584  4.385   1.00 0.00 ? 24 HIS A CE1 7  
ATOM   3602 N  NE2 . HIS A 1 24 ? -9.334  -5.364  3.940   1.00 0.00 ? 24 HIS A NE2 7  
ATOM   3603 N  N   . PRO A 1 25 ? -14.372 -4.442  2.231   1.00 0.00 ? 25 PRO A N   7  
ATOM   3604 C  CA  . PRO A 1 25 ? -15.253 -3.507  2.930   1.00 0.00 ? 25 PRO A CA  7  
ATOM   3605 C  C   . PRO A 1 25 ? -14.475 -2.678  3.966   1.00 0.00 ? 25 PRO A C   7  
ATOM   3606 O  O   . PRO A 1 25 ? -14.598 -2.894  5.169   1.00 0.00 ? 25 PRO A O   7  
ATOM   3607 C  CB  . PRO A 1 25 ? -16.341 -4.383  3.559   1.00 0.00 ? 25 PRO A CB  7  
ATOM   3608 C  CG  . PRO A 1 25 ? -15.605 -5.691  3.842   1.00 0.00 ? 25 PRO A CG  7  
ATOM   3609 C  CD  . PRO A 1 25 ? -14.649 -5.808  2.656   1.00 0.00 ? 25 PRO A CD  7  
ATOM   3610 N  N   . ARG A 1 26 ? -13.672 -1.738  3.463   1.00 0.00 ? 26 ARG A N   7  
ATOM   3611 C  CA  . ARG A 1 26 ? -12.876 -0.686  4.110   1.00 0.00 ? 26 ARG A CA  7  
ATOM   3612 C  C   . ARG A 1 26 ? -12.187 0.129   3.010   1.00 0.00 ? 26 ARG A C   7  
ATOM   3613 O  O   . ARG A 1 26 ? -12.002 1.335   3.155   1.00 0.00 ? 26 ARG A O   7  
ATOM   3614 C  CB  . ARG A 1 26 ? -11.763 -1.187  5.054   1.00 0.00 ? 26 ARG A CB  7  
ATOM   3615 C  CG  . ARG A 1 26 ? -12.151 -1.814  6.398   1.00 0.00 ? 26 ARG A CG  7  
ATOM   3616 C  CD  . ARG A 1 26 ? -13.195 -0.986  7.163   1.00 0.00 ? 26 ARG A CD  7  
ATOM   3617 N  NE  . ARG A 1 26 ? -13.447 -1.524  8.510   1.00 0.00 ? 26 ARG A NE  7  
ATOM   3618 C  CZ  . ARG A 1 26 ? -14.239 -2.571  8.799   1.00 0.00 ? 26 ARG A CZ  7  
ATOM   3619 N  NH1 . ARG A 1 26 ? -14.826 -3.269  7.821   1.00 0.00 ? 26 ARG A NH1 7  
ATOM   3620 N  NH2 . ARG A 1 26 ? -14.441 -2.919  10.075  1.00 0.00 ? 26 ARG A NH2 7  
ATOM   3621 N  N   . TYR A 1 27 ? -11.766 -0.538  1.930   1.00 0.00 ? 27 TYR A N   7  
ATOM   3622 C  CA  . TYR A 1 27 ? -11.226 0.135   0.767   1.00 0.00 ? 27 TYR A CA  7  
ATOM   3623 C  C   . TYR A 1 27 ? -12.253 1.105   0.189   1.00 0.00 ? 27 TYR A C   7  
ATOM   3624 O  O   . TYR A 1 27 ? -13.462 0.898   0.288   1.00 0.00 ? 27 TYR A O   7  
ATOM   3625 C  CB  . TYR A 1 27 ? -10.822 -0.917  -0.268  1.00 0.00 ? 27 TYR A CB  7  
ATOM   3626 C  CG  . TYR A 1 27 ? -10.371 -0.347  -1.595  1.00 0.00 ? 27 TYR A CG  7  
ATOM   3627 C  CD1 . TYR A 1 27 ? -9.062  0.128   -1.771  1.00 0.00 ? 27 TYR A CD1 7  
ATOM   3628 C  CD2 . TYR A 1 27 ? -11.292 -0.239  -2.645  1.00 0.00 ? 27 TYR A CD2 7  
ATOM   3629 C  CE1 . TYR A 1 27 ? -8.659  0.644   -3.014  1.00 0.00 ? 27 TYR A CE1 7  
ATOM   3630 C  CE2 . TYR A 1 27 ? -10.863 0.183   -3.910  1.00 0.00 ? 27 TYR A CE2 7  
ATOM   3631 C  CZ  . TYR A 1 27 ? -9.546  0.628   -4.105  1.00 0.00 ? 27 TYR A CZ  7  
ATOM   3632 O  OH  . TYR A 1 27 ? -9.147  1.088   -5.326  1.00 0.00 ? 27 TYR A OH  7  
ATOM   3633 N  N   . GLN A 1 28 ? -11.726 2.148   -0.444  1.00 0.00 ? 28 GLN A N   7  
ATOM   3634 C  CA  . GLN A 1 28 ? -12.448 3.064   -1.303  1.00 0.00 ? 28 GLN A CA  7  
ATOM   3635 C  C   . GLN A 1 28 ? -11.571 3.305   -2.520  1.00 0.00 ? 28 GLN A C   7  
ATOM   3636 O  O   . GLN A 1 28 ? -10.346 3.345   -2.399  1.00 0.00 ? 28 GLN A O   7  
ATOM   3637 C  CB  . GLN A 1 28 ? -12.695 4.381   -0.567  1.00 0.00 ? 28 GLN A CB  7  
ATOM   3638 C  CG  . GLN A 1 28 ? -13.713 5.273   -1.286  1.00 0.00 ? 28 GLN A CG  7  
ATOM   3639 C  CD  . GLN A 1 28 ? -13.717 6.676   -0.692  1.00 0.00 ? 28 GLN A CD  7  
ATOM   3640 O  OE1 . GLN A 1 28 ? -14.587 7.026   0.095   1.00 0.00 ? 28 GLN A OE1 7  
ATOM   3641 N  NE2 . GLN A 1 28 ? -12.736 7.490   -1.075  1.00 0.00 ? 28 GLN A NE2 7  
ATOM   3642 N  N   . GLU A 1 29 ? -12.202 3.489   -3.677  1.00 0.00 ? 29 GLU A N   7  
ATOM   3643 C  CA  . GLU A 1 29 ? -11.501 3.800   -4.901  1.00 0.00 ? 29 GLU A CA  7  
ATOM   3644 C  C   . GLU A 1 29 ? -10.713 5.097   -4.741  1.00 0.00 ? 29 GLU A C   7  
ATOM   3645 O  O   . GLU A 1 29 ? -11.092 5.991   -3.980  1.00 0.00 ? 29 GLU A O   7  
ATOM   3646 C  CB  . GLU A 1 29 ? -12.471 3.875   -6.091  1.00 0.00 ? 29 GLU A CB  7  
ATOM   3647 C  CG  . GLU A 1 29 ? -13.281 2.586   -6.320  1.00 0.00 ? 29 GLU A CG  7  
ATOM   3648 C  CD  . GLU A 1 29 ? -12.444 1.376   -6.730  1.00 0.00 ? 29 GLU A CD  7  
ATOM   3649 O  OE1 . GLU A 1 29 ? -11.215 1.538   -6.912  1.00 0.00 ? 29 GLU A OE1 7  
ATOM   3650 O  OE2 . GLU A 1 29 ? -13.040 0.281   -6.794  1.00 0.00 ? 29 GLU A OE2 7  
ATOM   3651 N  N   . GLY A 1 30 ? -9.586  5.163   -5.446  1.00 0.00 ? 30 GLY A N   7  
ATOM   3652 C  CA  . GLY A 1 30 ? -8.681  6.303   -5.443  1.00 0.00 ? 30 GLY A CA  7  
ATOM   3653 C  C   . GLY A 1 30 ? -7.630  6.215   -4.336  1.00 0.00 ? 30 GLY A C   7  
ATOM   3654 O  O   . GLY A 1 30 ? -6.571  6.830   -4.448  1.00 0.00 ? 30 GLY A O   7  
ATOM   3655 N  N   . GLN A 1 31 ? -7.897  5.461   -3.267  1.00 0.00 ? 31 GLN A N   7  
ATOM   3656 C  CA  . GLN A 1 31 ? -6.941  5.277   -2.194  1.00 0.00 ? 31 GLN A CA  7  
ATOM   3657 C  C   . GLN A 1 31 ? -5.818  4.364   -2.687  1.00 0.00 ? 31 GLN A C   7  
ATOM   3658 O  O   . GLN A 1 31 ? -6.009  3.157   -2.813  1.00 0.00 ? 31 GLN A O   7  
ATOM   3659 C  CB  . GLN A 1 31 ? -7.662  4.684   -0.981  1.00 0.00 ? 31 GLN A CB  7  
ATOM   3660 C  CG  . GLN A 1 31 ? -8.760  5.628   -0.461  1.00 0.00 ? 31 GLN A CG  7  
ATOM   3661 C  CD  . GLN A 1 31 ? -9.393  5.147   0.843   1.00 0.00 ? 31 GLN A CD  7  
ATOM   3662 O  OE1 . GLN A 1 31 ? -9.790  5.948   1.681   1.00 0.00 ? 31 GLN A OE1 7  
ATOM   3663 N  NE2 . GLN A 1 31 ? -9.518  3.837   1.027   1.00 0.00 ? 31 GLN A NE2 7  
ATOM   3664 N  N   . LEU A 1 32 ? -4.660  4.957   -2.965  1.00 0.00 ? 32 LEU A N   7  
ATOM   3665 C  CA  . LEU A 1 32 ? -3.429  4.289   -3.344  1.00 0.00 ? 32 LEU A CA  7  
ATOM   3666 C  C   . LEU A 1 32 ? -2.415  4.608   -2.245  1.00 0.00 ? 32 LEU A C   7  
ATOM   3667 O  O   . LEU A 1 32 ? -2.468  5.698   -1.671  1.00 0.00 ? 32 LEU A O   7  
ATOM   3668 C  CB  . LEU A 1 32 ? -2.910  4.860   -4.674  1.00 0.00 ? 32 LEU A CB  7  
ATOM   3669 C  CG  . LEU A 1 32 ? -3.338  4.156   -5.968  1.00 0.00 ? 32 LEU A CG  7  
ATOM   3670 C  CD1 . LEU A 1 32 ? -4.829  4.209   -6.280  1.00 0.00 ? 32 LEU A CD1 7  
ATOM   3671 C  CD2 . LEU A 1 32 ? -2.609  4.837   -7.138  1.00 0.00 ? 32 LEU A CD2 7  
ATOM   3672 N  N   . CYS A 1 33 ? -1.481  3.691   -1.984  1.00 0.00 ? 33 CYS A N   7  
ATOM   3673 C  CA  . CYS A 1 33 ? -0.350  3.875   -1.083  1.00 0.00 ? 33 CYS A CA  7  
ATOM   3674 C  C   . CYS A 1 33 ? 0.283   5.258   -1.259  1.00 0.00 ? 33 CYS A C   7  
ATOM   3675 O  O   . CYS A 1 33 ? 0.533   5.954   -0.282  1.00 0.00 ? 33 CYS A O   7  
ATOM   3676 C  CB  . CYS A 1 33 ? 0.665   2.783   -1.318  1.00 0.00 ? 33 CYS A CB  7  
ATOM   3677 S  SG  . CYS A 1 33 ? 0.228   1.250   -0.442  1.00 0.00 ? 33 CYS A SG  7  
ATOM   3678 N  N   . GLU A 1 34 ? 0.524   5.702   -2.493  1.00 0.00 ? 34 GLU A N   7  
ATOM   3679 C  CA  . GLU A 1 34 ? 1.145   7.002   -2.704  1.00 0.00 ? 34 GLU A CA  7  
ATOM   3680 C  C   . GLU A 1 34 ? 0.381   8.178   -2.062  1.00 0.00 ? 34 GLU A C   7  
ATOM   3681 O  O   . GLU A 1 34 ? 1.011   9.168   -1.690  1.00 0.00 ? 34 GLU A O   7  
ATOM   3682 C  CB  . GLU A 1 34 ? 1.508   7.188   -4.179  1.00 0.00 ? 34 GLU A CB  7  
ATOM   3683 C  CG  . GLU A 1 34 ? 0.328   7.175   -5.169  1.00 0.00 ? 34 GLU A CG  7  
ATOM   3684 C  CD  . GLU A 1 34 ? -0.595  8.382   -5.050  1.00 0.00 ? 34 GLU A CD  7  
ATOM   3685 O  OE1 . GLU A 1 34 ? -0.054  9.508   -5.069  1.00 0.00 ? 34 GLU A OE1 7  
ATOM   3686 O  OE2 . GLU A 1 34 ? -1.823  8.164   -4.947  1.00 0.00 ? 34 GLU A OE2 7  
ATOM   3687 N  N   . ASN A 1 35 ? -0.943  8.059   -1.879  1.00 0.00 ? 35 ASN A N   7  
ATOM   3688 C  CA  . ASN A 1 35 ? -1.774  9.064   -1.209  1.00 0.00 ? 35 ASN A CA  7  
ATOM   3689 C  C   . ASN A 1 35 ? -2.226  8.618   0.187   1.00 0.00 ? 35 ASN A C   7  
ATOM   3690 O  O   . ASN A 1 35 ? -3.165  9.185   0.750   1.00 0.00 ? 35 ASN A O   7  
ATOM   3691 C  CB  . ASN A 1 35 ? -2.948  9.479   -2.104  1.00 0.00 ? 35 ASN A CB  7  
ATOM   3692 C  CG  . ASN A 1 35 ? -4.004  8.414   -2.341  1.00 0.00 ? 35 ASN A CG  7  
ATOM   3693 O  OD1 . ASN A 1 35 ? -4.765  8.042   -1.451  1.00 0.00 ? 35 ASN A OD1 7  
ATOM   3694 N  ND2 . ASN A 1 35 ? -4.128  7.981   -3.583  1.00 0.00 ? 35 ASN A ND2 7  
ATOM   3695 N  N   . CYS A 1 36 ? -1.538  7.635   0.767   1.00 0.00 ? 36 CYS A N   7  
ATOM   3696 C  CA  . CYS A 1 36 ? -1.734  7.186   2.135   1.00 0.00 ? 36 CYS A CA  7  
ATOM   3697 C  C   . CYS A 1 36 ? -0.951  8.110   3.066   1.00 0.00 ? 36 CYS A C   7  
ATOM   3698 O  O   . CYS A 1 36 ? 0.214   8.413   2.822   1.00 0.00 ? 36 CYS A O   7  
ATOM   3699 C  CB  . CYS A 1 36 ? -1.212  5.779   2.200   1.00 0.00 ? 36 CYS A CB  7  
ATOM   3700 S  SG  . CYS A 1 36 ? -1.476  4.949   3.764   1.00 0.00 ? 36 CYS A SG  7  
ATOM   3701 N  N   . ALA A 1 37 ? -1.560  8.551   4.166   1.00 0.00 ? 37 ALA A N   7  
ATOM   3702 C  CA  . ALA A 1 37 ? -0.889  9.392   5.150   1.00 0.00 ? 37 ALA A CA  7  
ATOM   3703 C  C   . ALA A 1 37 ? 0.324   8.696   5.771   1.00 0.00 ? 37 ALA A C   7  
ATOM   3704 O  O   . ALA A 1 37 ? 1.175   9.355   6.365   1.00 0.00 ? 37 ALA A O   7  
ATOM   3705 C  CB  . ALA A 1 37 ? -1.883  9.806   6.233   1.00 0.00 ? 37 ALA A CB  7  
ATOM   3706 N  N   . PHE A 1 38 ? 0.400   7.364   5.678   1.00 0.00 ? 38 PHE A N   7  
ATOM   3707 C  CA  . PHE A 1 38 ? 1.531   6.602   6.182   1.00 0.00 ? 38 PHE A CA  7  
ATOM   3708 C  C   . PHE A 1 38 ? 2.638   6.484   5.132   1.00 0.00 ? 38 PHE A C   7  
ATOM   3709 O  O   . PHE A 1 38 ? 3.697   5.950   5.455   1.00 0.00 ? 38 PHE A O   7  
ATOM   3710 C  CB  . PHE A 1 38 ? 1.070   5.211   6.642   1.00 0.00 ? 38 PHE A CB  7  
ATOM   3711 C  CG  . PHE A 1 38 ? 0.235   5.115   7.913   1.00 0.00 ? 38 PHE A CG  7  
ATOM   3712 C  CD1 . PHE A 1 38 ? -0.433  6.224   8.476   1.00 0.00 ? 38 PHE A CD1 7  
ATOM   3713 C  CD2 . PHE A 1 38 ? 0.067   3.845   8.495   1.00 0.00 ? 38 PHE A CD2 7  
ATOM   3714 C  CE1 . PHE A 1 38 ? -1.267  6.057   9.595   1.00 0.00 ? 38 PHE A CE1 7  
ATOM   3715 C  CE2 . PHE A 1 38 ? -0.768  3.678   9.612   1.00 0.00 ? 38 PHE A CE2 7  
ATOM   3716 C  CZ  . PHE A 1 38 ? -1.437  4.783   10.162  1.00 0.00 ? 38 PHE A CZ  7  
ATOM   3717 N  N   . TRP A 1 39 ? 2.432   6.961   3.901   1.00 0.00 ? 39 TRP A N   7  
ATOM   3718 C  CA  . TRP A 1 39 ? 3.435   6.875   2.851   1.00 0.00 ? 39 TRP A CA  7  
ATOM   3719 C  C   . TRP A 1 39 ? 4.772   7.474   3.302   1.00 0.00 ? 39 TRP A C   7  
ATOM   3720 O  O   . TRP A 1 39 ? 4.804   8.472   4.019   1.00 0.00 ? 39 TRP A O   7  
ATOM   3721 C  CB  . TRP A 1 39 ? 2.919   7.601   1.607   1.00 0.00 ? 39 TRP A CB  7  
ATOM   3722 C  CG  . TRP A 1 39 ? 3.781   7.517   0.386   1.00 0.00 ? 39 TRP A CG  7  
ATOM   3723 C  CD1 . TRP A 1 39 ? 4.356   8.566   -0.238  1.00 0.00 ? 39 TRP A CD1 7  
ATOM   3724 C  CD2 . TRP A 1 39 ? 4.132   6.339   -0.404  1.00 0.00 ? 39 TRP A CD2 7  
ATOM   3725 N  NE1 . TRP A 1 39 ? 5.020   8.131   -1.365  1.00 0.00 ? 39 TRP A NE1 7  
ATOM   3726 C  CE2 . TRP A 1 39 ? 4.904   6.767   -1.523  1.00 0.00 ? 39 TRP A CE2 7  
ATOM   3727 C  CE3 . TRP A 1 39 ? 3.854   4.959   -0.309  1.00 0.00 ? 39 TRP A CE3 7  
ATOM   3728 C  CZ2 . TRP A 1 39 ? 5.358   5.878   -2.507  1.00 0.00 ? 39 TRP A CZ2 7  
ATOM   3729 C  CZ3 . TRP A 1 39 ? 4.334   4.051   -1.273  1.00 0.00 ? 39 TRP A CZ3 7  
ATOM   3730 C  CH2 . TRP A 1 39 ? 5.063   4.512   -2.379  1.00 0.00 ? 39 TRP A CH2 7  
ATOM   3731 N  N   . GLY A 1 40 ? 5.874   6.852   2.879   1.00 0.00 ? 40 GLY A N   7  
ATOM   3732 C  CA  . GLY A 1 40 ? 7.218   7.356   3.085   1.00 0.00 ? 40 GLY A CA  7  
ATOM   3733 C  C   . GLY A 1 40 ? 7.575   8.284   1.929   1.00 0.00 ? 40 GLY A C   7  
ATOM   3734 O  O   . GLY A 1 40 ? 7.398   9.495   2.022   1.00 0.00 ? 40 GLY A O   7  
ATOM   3735 N  N   . GLU A 1 41 ? 8.078   7.704   0.839   1.00 0.00 ? 41 GLU A N   7  
ATOM   3736 C  CA  . GLU A 1 41 ? 8.470   8.407   -0.371  1.00 0.00 ? 41 GLU A CA  7  
ATOM   3737 C  C   . GLU A 1 41 ? 8.656   7.351   -1.457  1.00 0.00 ? 41 GLU A C   7  
ATOM   3738 O  O   . GLU A 1 41 ? 8.849   6.173   -1.143  1.00 0.00 ? 41 GLU A O   7  
ATOM   3739 C  CB  . GLU A 1 41 ? 9.763   9.204   -0.139  1.00 0.00 ? 41 GLU A CB  7  
ATOM   3740 C  CG  . GLU A 1 41 ? 10.085  10.193  -1.270  1.00 0.00 ? 41 GLU A CG  7  
ATOM   3741 C  CD  . GLU A 1 41 ? 11.275  11.073  -0.906  1.00 0.00 ? 41 GLU A CD  7  
ATOM   3742 O  OE1 . GLU A 1 41 ? 12.288  10.496  -0.455  1.00 0.00 ? 41 GLU A OE1 7  
ATOM   3743 O  OE2 . GLU A 1 41 ? 11.146  12.302  -1.083  1.00 0.00 ? 41 GLU A OE2 7  
ATOM   3744 N  N   . ALA A 1 42 ? 8.589   7.777   -2.719  1.00 0.00 ? 42 ALA A N   7  
ATOM   3745 C  CA  . ALA A 1 42 ? 8.804   6.904   -3.861  1.00 0.00 ? 42 ALA A CA  7  
ATOM   3746 C  C   . ALA A 1 42 ? 10.296  6.642   -4.045  1.00 0.00 ? 42 ALA A C   7  
ATOM   3747 O  O   . ALA A 1 42 ? 11.114  7.549   -3.925  1.00 0.00 ? 42 ALA A O   7  
ATOM   3748 C  CB  . ALA A 1 42 ? 8.169   7.484   -5.123  1.00 0.00 ? 42 ALA A CB  7  
ATOM   3749 N  N   . VAL A 1 43 ? 10.635  5.384   -4.321  1.00 0.00 ? 43 VAL A N   7  
ATOM   3750 C  CA  . VAL A 1 43 ? 11.992  4.887   -4.445  1.00 0.00 ? 43 VAL A CA  7  
ATOM   3751 C  C   . VAL A 1 43 ? 12.282  4.572   -5.915  1.00 0.00 ? 43 VAL A C   7  
ATOM   3752 O  O   . VAL A 1 43 ? 13.320  4.971   -6.437  1.00 0.00 ? 43 VAL A O   7  
ATOM   3753 C  CB  . VAL A 1 43 ? 12.144  3.640   -3.558  1.00 0.00 ? 43 VAL A CB  7  
ATOM   3754 C  CG1 . VAL A 1 43 ? 13.539  3.012   -3.691  1.00 0.00 ? 43 VAL A CG1 7  
ATOM   3755 C  CG2 . VAL A 1 43 ? 11.894  3.933   -2.069  1.00 0.00 ? 43 VAL A CG2 7  
ATOM   3756 N  N   . GLN A 1 44 ? 11.392  3.819   -6.570  1.00 0.00 ? 44 GLN A N   7  
ATOM   3757 C  CA  . GLN A 1 44 ? 11.562  3.349   -7.939  1.00 0.00 ? 44 GLN A CA  7  
ATOM   3758 C  C   . GLN A 1 44 ? 10.201  3.151   -8.623  1.00 0.00 ? 44 GLN A C   7  
ATOM   3759 O  O   . GLN A 1 44 ? 9.244   3.819   -8.235  1.00 0.00 ? 44 GLN A O   7  
ATOM   3760 C  CB  . GLN A 1 44 ? 12.524  2.156   -7.949  1.00 0.00 ? 44 GLN A CB  7  
ATOM   3761 C  CG  . GLN A 1 44 ? 12.088  0.974   -7.077  1.00 0.00 ? 44 GLN A CG  7  
ATOM   3762 C  CD  . GLN A 1 44 ? 13.208  -0.047  -6.864  1.00 0.00 ? 44 GLN A CD  7  
ATOM   3763 O  OE1 . GLN A 1 44 ? 13.011  -1.247  -7.048  1.00 0.00 ? 44 GLN A OE1 7  
ATOM   3764 N  NE2 . GLN A 1 44 ? 14.395  0.409   -6.469  1.00 0.00 ? 44 GLN A NE2 7  
ATOM   3765 N  N   . ASP A 1 45 ? 10.120  2.288   -9.645  1.00 0.00 ? 45 ASP A N   7  
ATOM   3766 C  CA  . ASP A 1 45 ? 9.102   2.183   -10.697 1.00 0.00 ? 45 ASP A CA  7  
ATOM   3767 C  C   . ASP A 1 45 ? 7.674   1.992   -10.179 1.00 0.00 ? 45 ASP A C   7  
ATOM   3768 O  O   . ASP A 1 45 ? 7.049   0.941   -10.319 1.00 0.00 ? 45 ASP A O   7  
ATOM   3769 C  CB  . ASP A 1 45 ? 9.512   1.087   -11.698 1.00 0.00 ? 45 ASP A CB  7  
ATOM   3770 C  CG  . ASP A 1 45 ? 9.891   -0.219  -11.019 1.00 0.00 ? 45 ASP A CG  7  
ATOM   3771 O  OD1 . ASP A 1 45 ? 10.910  -0.196  -10.291 1.00 0.00 ? 45 ASP A OD1 7  
ATOM   3772 O  OD2 . ASP A 1 45 ? 9.186   -1.236  -11.194 1.00 0.00 ? 45 ASP A OD2 7  
ATOM   3773 N  N   . GLY A 1 46 ? 7.148   3.057   -9.588  1.00 0.00 ? 46 GLY A N   7  
ATOM   3774 C  CA  . GLY A 1 46 ? 5.884   3.049   -8.883  1.00 0.00 ? 46 GLY A CA  7  
ATOM   3775 C  C   . GLY A 1 46 ? 5.999   2.202   -7.621  1.00 0.00 ? 46 GLY A C   7  
ATOM   3776 O  O   . GLY A 1 46 ? 5.049   1.526   -7.251  1.00 0.00 ? 46 GLY A O   7  
ATOM   3777 N  N   . TRP A 1 47 ? 7.150   2.237   -6.944  1.00 0.00 ? 47 TRP A N   7  
ATOM   3778 C  CA  . TRP A 1 47 ? 7.387   1.615   -5.664  1.00 0.00 ? 47 TRP A CA  7  
ATOM   3779 C  C   . TRP A 1 47 ? 8.027   2.625   -4.734  1.00 0.00 ? 47 TRP A C   7  
ATOM   3780 O  O   . TRP A 1 47 ? 8.875   3.408   -5.165  1.00 0.00 ? 47 TRP A O   7  
ATOM   3781 C  CB  . TRP A 1 47 ? 8.354   0.456   -5.825  1.00 0.00 ? 47 TRP A CB  7  
ATOM   3782 C  CG  . TRP A 1 47 ? 7.894   -0.660  -6.691  1.00 0.00 ? 47 TRP A CG  7  
ATOM   3783 C  CD1 . TRP A 1 47 ? 8.112   -0.781  -8.014  1.00 0.00 ? 47 TRP A CD1 7  
ATOM   3784 C  CD2 . TRP A 1 47 ? 7.103   -1.810  -6.303  1.00 0.00 ? 47 TRP A CD2 7  
ATOM   3785 N  NE1 . TRP A 1 47 ? 7.473   -1.908  -8.482  1.00 0.00 ? 47 TRP A NE1 7  
ATOM   3786 C  CE2 . TRP A 1 47 ? 6.823   -2.581  -7.467  1.00 0.00 ? 47 TRP A CE2 7  
ATOM   3787 C  CE3 . TRP A 1 47 ? 6.628   -2.289  -5.071  1.00 0.00 ? 47 TRP A CE3 7  
ATOM   3788 C  CZ2 . TRP A 1 47 ? 6.042   -3.745  -7.411  1.00 0.00 ? 47 TRP A CZ2 7  
ATOM   3789 C  CZ3 . TRP A 1 47 ? 5.802   -3.425  -5.011  1.00 0.00 ? 47 TRP A CZ3 7  
ATOM   3790 C  CH2 . TRP A 1 47 ? 5.458   -4.112  -6.188  1.00 0.00 ? 47 TRP A CH2 7  
ATOM   3791 N  N   . GLY A 1 48 ? 7.661   2.568   -3.458  1.00 0.00 ? 48 GLY A N   7  
ATOM   3792 C  CA  . GLY A 1 48 ? 8.205   3.422   -2.437  1.00 0.00 ? 48 GLY A CA  7  
ATOM   3793 C  C   . GLY A 1 48 ? 8.071   2.816   -1.051  1.00 0.00 ? 48 GLY A C   7  
ATOM   3794 O  O   . GLY A 1 48 ? 7.658   1.671   -0.883  1.00 0.00 ? 48 GLY A O   7  
ATOM   3795 N  N   . ARG A 1 49 ? 8.492   3.592   -0.059  1.00 0.00 ? 49 ARG A N   7  
ATOM   3796 C  CA  . ARG A 1 49 ? 8.485   3.209   1.336   1.00 0.00 ? 49 ARG A CA  7  
ATOM   3797 C  C   . ARG A 1 49 ? 7.168   3.628   1.985   1.00 0.00 ? 49 ARG A C   7  
ATOM   3798 O  O   . ARG A 1 49 ? 6.526   4.569   1.520   1.00 0.00 ? 49 ARG A O   7  
ATOM   3799 C  CB  . ARG A 1 49 ? 9.702   3.852   1.978   1.00 0.00 ? 49 ARG A CB  7  
ATOM   3800 C  CG  . ARG A 1 49 ? 10.966  3.366   1.281   1.00 0.00 ? 49 ARG A CG  7  
ATOM   3801 C  CD  . ARG A 1 49 ? 11.346  1.918   1.530   1.00 0.00 ? 49 ARG A CD  7  
ATOM   3802 N  NE  . ARG A 1 49 ? 11.673  1.703   2.936   1.00 0.00 ? 49 ARG A NE  7  
ATOM   3803 C  CZ  . ARG A 1 49 ? 12.890  1.727   3.491   1.00 0.00 ? 49 ARG A CZ  7  
ATOM   3804 N  NH1 . ARG A 1 49 ? 13.993  1.679   2.739   1.00 0.00 ? 49 ARG A NH1 7  
ATOM   3805 N  NH2 . ARG A 1 49 ? 13.016  1.821   4.811   1.00 0.00 ? 49 ARG A NH2 7  
ATOM   3806 N  N   . CYS A 1 50 ? 6.781   2.934   3.057   1.00 0.00 ? 50 CYS A N   7  
ATOM   3807 C  CA  . CYS A 1 50 ? 5.558   3.149   3.816   1.00 0.00 ? 50 CYS A CA  7  
ATOM   3808 C  C   . CYS A 1 50 ? 5.940   3.004   5.290   1.00 0.00 ? 50 CYS A C   7  
ATOM   3809 O  O   . CYS A 1 50 ? 6.657   2.073   5.644   1.00 0.00 ? 50 CYS A O   7  
ATOM   3810 C  CB  . CYS A 1 50 ? 4.513   2.156   3.369   1.00 0.00 ? 50 CYS A CB  7  
ATOM   3811 S  SG  . CYS A 1 50 ? 3.241   1.994   4.640   1.00 0.00 ? 50 CYS A SG  7  
ATOM   3812 N  N   . THR A 1 51 ? 5.552   3.969   6.123   1.00 0.00 ? 51 THR A N   7  
ATOM   3813 C  CA  . THR A 1 51 ? 6.000   4.100   7.503   1.00 0.00 ? 51 THR A CA  7  
ATOM   3814 C  C   . THR A 1 51 ? 4.981   3.474   8.457   1.00 0.00 ? 51 THR A C   7  
ATOM   3815 O  O   . THR A 1 51 ? 3.902   3.074   8.032   1.00 0.00 ? 51 THR A O   7  
ATOM   3816 C  CB  . THR A 1 51 ? 6.185   5.592   7.828   1.00 0.00 ? 51 THR A CB  7  
ATOM   3817 O  OG1 . THR A 1 51 ? 4.928   6.242   7.848   1.00 0.00 ? 51 THR A OG1 7  
ATOM   3818 C  CG2 . THR A 1 51 ? 7.100   6.293   6.820   1.00 0.00 ? 51 THR A CG2 7  
ATOM   3819 N  N   . HIS A 1 52 ? 5.268   3.539   9.766   1.00 0.00 ? 52 HIS A N   7  
ATOM   3820 C  CA  . HIS A 1 52 ? 4.484   2.950   10.857  1.00 0.00 ? 52 HIS A CA  7  
ATOM   3821 C  C   . HIS A 1 52 ? 4.867   1.468   10.984  1.00 0.00 ? 52 HIS A C   7  
ATOM   3822 O  O   . HIS A 1 52 ? 5.528   0.952   10.087  1.00 0.00 ? 52 HIS A O   7  
ATOM   3823 C  CB  . HIS A 1 52 ? 2.966   3.199   10.711  1.00 0.00 ? 52 HIS A CB  7  
ATOM   3824 C  CG  . HIS A 1 52 ? 2.577   4.660   10.610  1.00 0.00 ? 52 HIS A CG  7  
ATOM   3825 N  ND1 . HIS A 1 52 ? 2.995   5.571   9.653   1.00 0.00 ? 52 HIS A ND1 7  
ATOM   3826 C  CD2 . HIS A 1 52 ? 1.729   5.314   11.462  1.00 0.00 ? 52 HIS A CD2 7  
ATOM   3827 C  CE1 . HIS A 1 52 ? 2.422   6.755   9.929   1.00 0.00 ? 52 HIS A CE1 7  
ATOM   3828 N  NE2 . HIS A 1 52 ? 1.643   6.621   11.019  1.00 0.00 ? 52 HIS A NE2 7  
ATOM   3829 N  N   . PRO A 1 53 ? 4.552   0.793   12.105  1.00 0.00 ? 53 PRO A N   7  
ATOM   3830 C  CA  . PRO A 1 53 ? 4.874   -0.615  12.291  1.00 0.00 ? 53 PRO A CA  7  
ATOM   3831 C  C   . PRO A 1 53 ? 4.449   -1.497  11.115  1.00 0.00 ? 53 PRO A C   7  
ATOM   3832 O  O   . PRO A 1 53 ? 3.443   -1.219  10.458  1.00 0.00 ? 53 PRO A O   7  
ATOM   3833 C  CB  . PRO A 1 53 ? 4.182   -1.026  13.591  1.00 0.00 ? 53 PRO A CB  7  
ATOM   3834 C  CG  . PRO A 1 53 ? 4.233   0.266   14.404  1.00 0.00 ? 53 PRO A CG  7  
ATOM   3835 C  CD  . PRO A 1 53 ? 4.018   1.347   13.341  1.00 0.00 ? 53 PRO A CD  7  
ATOM   3836 N  N   . ASP A 1 54 ? 5.231   -2.558  10.884  1.00 0.00 ? 54 ASP A N   7  
ATOM   3837 C  CA  . ASP A 1 54 ? 5.143   -3.460  9.741   1.00 0.00 ? 54 ASP A CA  7  
ATOM   3838 C  C   . ASP A 1 54 ? 5.438   -2.693  8.449   1.00 0.00 ? 54 ASP A C   7  
ATOM   3839 O  O   . ASP A 1 54 ? 5.837   -1.529  8.470   1.00 0.00 ? 54 ASP A O   7  
ATOM   3840 C  CB  . ASP A 1 54 ? 3.780   -4.177  9.676   1.00 0.00 ? 54 ASP A CB  7  
ATOM   3841 C  CG  . ASP A 1 54 ? 3.320   -4.765  11.002  1.00 0.00 ? 54 ASP A CG  7  
ATOM   3842 O  OD1 . ASP A 1 54 ? 4.178   -5.236  11.778  1.00 0.00 ? 54 ASP A OD1 7  
ATOM   3843 O  OD2 . ASP A 1 54 ? 2.084   -4.749  11.201  1.00 0.00 ? 54 ASP A OD2 7  
ATOM   3844 N  N   . PHE A 1 55 ? 5.226   -3.339  7.305   1.00 0.00 ? 55 PHE A N   7  
ATOM   3845 C  CA  . PHE A 1 55 ? 5.170   -2.722  5.989   1.00 0.00 ? 55 PHE A CA  7  
ATOM   3846 C  C   . PHE A 1 55 ? 6.534   -2.295  5.450   1.00 0.00 ? 55 PHE A C   7  
ATOM   3847 O  O   . PHE A 1 55 ? 6.970   -2.837  4.434   1.00 0.00 ? 55 PHE A O   7  
ATOM   3848 C  CB  . PHE A 1 55 ? 4.085   -1.621  5.907   1.00 0.00 ? 55 PHE A CB  7  
ATOM   3849 C  CG  . PHE A 1 55 ? 2.735   -2.183  5.510   1.00 0.00 ? 55 PHE A CG  7  
ATOM   3850 C  CD1 . PHE A 1 55 ? 2.657   -2.840  4.266   1.00 0.00 ? 55 PHE A CD1 7  
ATOM   3851 C  CD2 . PHE A 1 55 ? 1.612   -2.177  6.369   1.00 0.00 ? 55 PHE A CD2 7  
ATOM   3852 C  CE1 . PHE A 1 55 ? 1.557   -3.650  3.962   1.00 0.00 ? 55 PHE A CE1 7  
ATOM   3853 C  CE2 . PHE A 1 55 ? 0.477   -2.919  6.013   1.00 0.00 ? 55 PHE A CE2 7  
ATOM   3854 C  CZ  . PHE A 1 55 ? 0.482   -3.720  4.857   1.00 0.00 ? 55 PHE A CZ  7  
ATOM   3855 N  N   . ASP A 1 56 ? 7.223   -1.362  6.119   1.00 0.00 ? 56 ASP A N   7  
ATOM   3856 C  CA  . ASP A 1 56 ? 8.501   -0.815  5.656   1.00 0.00 ? 56 ASP A CA  7  
ATOM   3857 C  C   . ASP A 1 56 ? 9.541   -1.913  5.386   1.00 0.00 ? 56 ASP A C   7  
ATOM   3858 O  O   . ASP A 1 56 ? 10.452  -1.733  4.578   1.00 0.00 ? 56 ASP A O   7  
ATOM   3859 C  CB  . ASP A 1 56 ? 9.043   0.205   6.664   1.00 0.00 ? 56 ASP A CB  7  
ATOM   3860 C  CG  . ASP A 1 56 ? 10.132  1.060   6.035   1.00 0.00 ? 56 ASP A CG  7  
ATOM   3861 O  OD1 . ASP A 1 56 ? 9.921   1.608   4.931   1.00 0.00 ? 56 ASP A OD1 7  
ATOM   3862 O  OD2 . ASP A 1 56 ? 11.220  1.167   6.640   1.00 0.00 ? 56 ASP A OD2 7  
ATOM   3863 N  N   . GLU A 1 57 ? 9.363   -3.059  6.057   1.00 0.00 ? 57 GLU A N   7  
ATOM   3864 C  CA  . GLU A 1 57 ? 9.918   -4.369  5.738   1.00 0.00 ? 57 GLU A CA  7  
ATOM   3865 C  C   . GLU A 1 57 ? 10.269  -4.523  4.252   1.00 0.00 ? 57 GLU A C   7  
ATOM   3866 O  O   . GLU A 1 57 ? 11.365  -4.957  3.902   1.00 0.00 ? 57 GLU A O   7  
ATOM   3867 C  CB  . GLU A 1 57 ? 8.853   -5.439  6.035   1.00 0.00 ? 57 GLU A CB  7  
ATOM   3868 C  CG  . GLU A 1 57 ? 8.242   -5.516  7.439   1.00 0.00 ? 57 GLU A CG  7  
ATOM   3869 C  CD  . GLU A 1 57 ? 7.036   -6.435  7.341   1.00 0.00 ? 57 GLU A CD  7  
ATOM   3870 O  OE1 . GLU A 1 57 ? 7.243   -7.644  7.116   1.00 0.00 ? 57 GLU A OE1 7  
ATOM   3871 O  OE2 . GLU A 1 57 ? 5.898   -5.923  7.236   1.00 0.00 ? 57 GLU A OE2 7  
ATOM   3872 N  N   . VAL A 1 58 ? 9.281   -4.252  3.394   1.00 0.00 ? 58 VAL A N   7  
ATOM   3873 C  CA  . VAL A 1 58 ? 9.304   -4.502  1.965   1.00 0.00 ? 58 VAL A CA  7  
ATOM   3874 C  C   . VAL A 1 58 ? 8.956   -3.199  1.251   1.00 0.00 ? 58 VAL A C   7  
ATOM   3875 O  O   . VAL A 1 58 ? 8.359   -2.299  1.840   1.00 0.00 ? 58 VAL A O   7  
ATOM   3876 C  CB  . VAL A 1 58 ? 8.303   -5.619  1.616   1.00 0.00 ? 58 VAL A CB  7  
ATOM   3877 C  CG1 . VAL A 1 58 ? 8.810   -6.988  2.085   1.00 0.00 ? 58 VAL A CG1 7  
ATOM   3878 C  CG2 . VAL A 1 58 ? 6.912   -5.373  2.217   1.00 0.00 ? 58 VAL A CG2 7  
ATOM   3879 N  N   . LEU A 1 59 ? 9.326   -3.080  -0.021  1.00 0.00 ? 59 LEU A N   7  
ATOM   3880 C  CA  . LEU A 1 59 ? 9.027   -1.902  -0.798  1.00 0.00 ? 59 LEU A CA  7  
ATOM   3881 C  C   . LEU A 1 59 ? 7.576   -1.972  -1.259  1.00 0.00 ? 59 LEU A C   7  
ATOM   3882 O  O   . LEU A 1 59 ? 7.168   -2.945  -1.887  1.00 0.00 ? 59 LEU A O   7  
ATOM   3883 C  CB  . LEU A 1 59 ? 10.019  -1.830  -1.957  1.00 0.00 ? 59 LEU A CB  7  
ATOM   3884 C  CG  . LEU A 1 59 ? 10.231  -0.385  -2.388  1.00 0.00 ? 59 LEU A CG  7  
ATOM   3885 C  CD1 . LEU A 1 59 ? 10.961  0.432   -1.310  1.00 0.00 ? 59 LEU A CD1 7  
ATOM   3886 C  CD2 . LEU A 1 59 ? 11.086  -0.384  -3.648  1.00 0.00 ? 59 LEU A CD2 7  
ATOM   3887 N  N   . VAL A 1 60 ? 6.792   -0.957  -0.922  1.00 0.00 ? 60 VAL A N   7  
ATOM   3888 C  CA  . VAL A 1 60 ? 5.358   -0.932  -1.116  1.00 0.00 ? 60 VAL A CA  7  
ATOM   3889 C  C   . VAL A 1 60 ? 5.078   -0.288  -2.471  1.00 0.00 ? 60 VAL A C   7  
ATOM   3890 O  O   . VAL A 1 60 ? 5.619   0.774   -2.777  1.00 0.00 ? 60 VAL A O   7  
ATOM   3891 C  CB  . VAL A 1 60 ? 4.756   -0.165  0.070   1.00 0.00 ? 60 VAL A CB  7  
ATOM   3892 C  CG1 . VAL A 1 60 ? 3.277   0.148   -0.123  1.00 0.00 ? 60 VAL A CG1 7  
ATOM   3893 C  CG2 . VAL A 1 60 ? 4.916   -1.007  1.345   1.00 0.00 ? 60 VAL A CG2 7  
ATOM   3894 N  N   . LYS A 1 61 ? 4.271   -0.930  -3.318  1.00 0.00 ? 61 LYS A N   7  
ATOM   3895 C  CA  . LYS A 1 61 ? 3.916   -0.338  -4.592  1.00 0.00 ? 61 LYS A CA  7  
ATOM   3896 C  C   . LYS A 1 61 ? 3.136   0.940   -4.332  1.00 0.00 ? 61 LYS A C   7  
ATOM   3897 O  O   . LYS A 1 61 ? 2.179   0.925   -3.567  1.00 0.00 ? 61 LYS A O   7  
ATOM   3898 C  CB  . LYS A 1 61 ? 3.080   -1.319  -5.426  1.00 0.00 ? 61 LYS A CB  7  
ATOM   3899 C  CG  . LYS A 1 61 ? 3.168   -0.917  -6.896  1.00 0.00 ? 61 LYS A CG  7  
ATOM   3900 C  CD  . LYS A 1 61 ? 2.904   -2.050  -7.884  1.00 0.00 ? 61 LYS A CD  7  
ATOM   3901 C  CE  . LYS A 1 61 ? 3.536   -1.697  -9.245  1.00 0.00 ? 61 LYS A CE  7  
ATOM   3902 N  NZ  . LYS A 1 61 ? 3.280   -0.309  -9.700  1.00 0.00 ? 61 LYS A NZ  7  
ATOM   3903 N  N   . ALA A 1 62 ? 3.520   2.027   -4.996  1.00 0.00 ? 62 ALA A N   7  
ATOM   3904 C  CA  . ALA A 1 62 ? 2.795   3.287   -4.960  1.00 0.00 ? 62 ALA A CA  7  
ATOM   3905 C  C   . ALA A 1 62 ? 1.308   3.086   -5.246  1.00 0.00 ? 62 ALA A C   7  
ATOM   3906 O  O   . ALA A 1 62 ? 0.480   3.693   -4.570  1.00 0.00 ? 62 ALA A O   7  
ATOM   3907 C  CB  . ALA A 1 62 ? 3.426   4.251   -5.953  1.00 0.00 ? 62 ALA A CB  7  
ATOM   3908 N  N   . GLU A 1 63 ? 0.963   2.239   -6.225  1.00 0.00 ? 63 GLU A N   7  
ATOM   3909 C  CA  . GLU A 1 63 ? -0.436  1.955   -6.511  1.00 0.00 ? 63 GLU A CA  7  
ATOM   3910 C  C   . GLU A 1 63 ? -1.047  0.857   -5.643  1.00 0.00 ? 63 GLU A C   7  
ATOM   3911 O  O   . GLU A 1 63 ? -2.181  0.465   -5.908  1.00 0.00 ? 63 GLU A O   7  
ATOM   3912 C  CB  . GLU A 1 63 ? -0.664  1.613   -7.981  1.00 0.00 ? 63 GLU A CB  7  
ATOM   3913 C  CG  . GLU A 1 63 ? 0.078   2.550   -8.929  1.00 0.00 ? 63 GLU A CG  7  
ATOM   3914 C  CD  . GLU A 1 63 ? 1.361   1.866   -9.377  1.00 0.00 ? 63 GLU A CD  7  
ATOM   3915 O  OE1 . GLU A 1 63 ? 2.316   1.819   -8.566  1.00 0.00 ? 63 GLU A OE1 7  
ATOM   3916 O  OE2 . GLU A 1 63 ? 1.363   1.219   -10.445 1.00 0.00 ? 63 GLU A OE2 7  
ATOM   3917 N  N   . GLY A 1 64 ? -0.330  0.333   -4.650  1.00 0.00 ? 64 GLY A N   7  
ATOM   3918 C  CA  . GLY A 1 64 ? -0.894  -0.655  -3.753  1.00 0.00 ? 64 GLY A CA  7  
ATOM   3919 C  C   . GLY A 1 64 ? -1.903  -0.021  -2.800  1.00 0.00 ? 64 GLY A C   7  
ATOM   3920 O  O   . GLY A 1 64 ? -2.208  1.168   -2.899  1.00 0.00 ? 64 GLY A O   7  
ATOM   3921 N  N   . TRP A 1 65 ? -2.426  -0.822  -1.873  1.00 0.00 ? 65 TRP A N   7  
ATOM   3922 C  CA  . TRP A 1 65 ? -3.236  -0.351  -0.760  1.00 0.00 ? 65 TRP A CA  7  
ATOM   3923 C  C   . TRP A 1 65 ? -3.195  -1.430  0.312   1.00 0.00 ? 65 TRP A C   7  
ATOM   3924 O  O   . TRP A 1 65 ? -3.001  -2.595  -0.036  1.00 0.00 ? 65 TRP A O   7  
ATOM   3925 C  CB  . TRP A 1 65 ? -4.677  -0.100  -1.219  1.00 0.00 ? 65 TRP A CB  7  
ATOM   3926 C  CG  . TRP A 1 65 ? -5.628  0.372   -0.159  1.00 0.00 ? 65 TRP A CG  7  
ATOM   3927 C  CD1 . TRP A 1 65 ? -5.907  1.663   0.122   1.00 0.00 ? 65 TRP A CD1 7  
ATOM   3928 C  CD2 . TRP A 1 65 ? -6.455  -0.421  0.747   1.00 0.00 ? 65 TRP A CD2 7  
ATOM   3929 N  NE1 . TRP A 1 65 ? -6.892  1.727   1.085   1.00 0.00 ? 65 TRP A NE1 7  
ATOM   3930 C  CE2 . TRP A 1 65 ? -7.276  0.468   1.503   1.00 0.00 ? 65 TRP A CE2 7  
ATOM   3931 C  CE3 . TRP A 1 65 ? -6.625  -1.804  0.977   1.00 0.00 ? 65 TRP A CE3 7  
ATOM   3932 C  CZ2 . TRP A 1 65 ? -8.241  0.008   2.411   1.00 0.00 ? 65 TRP A CZ2 7  
ATOM   3933 C  CZ3 . TRP A 1 65 ? -7.547  -2.275  1.931   1.00 0.00 ? 65 TRP A CZ3 7  
ATOM   3934 C  CH2 . TRP A 1 65 ? -8.364  -1.374  2.635   1.00 0.00 ? 65 TRP A CH2 7  
ATOM   3935 N  N   . CYS A 1 66 ? -3.383  -1.053  1.584   1.00 0.00 ? 66 CYS A N   7  
ATOM   3936 C  CA  . CYS A 1 66 ? -3.463  -1.962  2.718   1.00 0.00 ? 66 CYS A CA  7  
ATOM   3937 C  C   . CYS A 1 66 ? -4.515  -1.480  3.721   1.00 0.00 ? 66 CYS A C   7  
ATOM   3938 O  O   . CYS A 1 66 ? -4.938  -0.324  3.687   1.00 0.00 ? 66 CYS A O   7  
ATOM   3939 C  CB  . CYS A 1 66 ? -2.117  -2.119  3.380   1.00 0.00 ? 66 CYS A CB  7  
ATOM   3940 S  SG  . CYS A 1 66 ? -1.781  -0.806  4.575   1.00 0.00 ? 66 CYS A SG  7  
ATOM   3941 N  N   . SER A 1 67 ? -4.951  -2.351  4.636   1.00 0.00 ? 67 SER A N   7  
ATOM   3942 C  CA  . SER A 1 67 ? -6.007  -2.005  5.575   1.00 0.00 ? 67 SER A CA  7  
ATOM   3943 C  C   . SER A 1 67 ? -5.539  -1.135  6.744   1.00 0.00 ? 67 SER A C   7  
ATOM   3944 O  O   . SER A 1 67 ? -6.391  -0.668  7.499   1.00 0.00 ? 67 SER A O   7  
ATOM   3945 C  CB  . SER A 1 67 ? -6.772  -3.258  6.012   1.00 0.00 ? 67 SER A CB  7  
ATOM   3946 O  OG  . SER A 1 67 ? -5.930  -4.283  6.493   1.00 0.00 ? 67 SER A OG  7  
ATOM   3947 N  N   . VAL A 1 68 ? -4.230  -0.866  6.889   1.00 0.00 ? 68 VAL A N   7  
ATOM   3948 C  CA  . VAL A 1 68 ? -3.765  0.212   7.770   1.00 0.00 ? 68 VAL A CA  7  
ATOM   3949 C  C   . VAL A 1 68 ? -3.799  1.584   7.076   1.00 0.00 ? 68 VAL A C   7  
ATOM   3950 O  O   . VAL A 1 68 ? -3.435  2.573   7.708   1.00 0.00 ? 68 VAL A O   7  
ATOM   3951 C  CB  . VAL A 1 68 ? -2.450  -0.069  8.531   1.00 0.00 ? 68 VAL A CB  7  
ATOM   3952 C  CG1 . VAL A 1 68 ? -2.413  -1.515  8.971   1.00 0.00 ? 68 VAL A CG1 7  
ATOM   3953 C  CG2 . VAL A 1 68 ? -1.100  0.213   7.877   1.00 0.00 ? 68 VAL A CG2 7  
ATOM   3954 N  N   . TYR A 1 69 ? -4.232  1.663   5.805   1.00 0.00 ? 69 TYR A N   7  
ATOM   3955 C  CA  . TYR A 1 69 ? -4.385  2.931   5.095   1.00 0.00 ? 69 TYR A CA  7  
ATOM   3956 C  C   . TYR A 1 69 ? -5.122  3.970   5.944   1.00 0.00 ? 69 TYR A C   7  
ATOM   3957 O  O   . TYR A 1 69 ? -6.143  3.664   6.562   1.00 0.00 ? 69 TYR A O   7  
ATOM   3958 C  CB  . TYR A 1 69 ? -5.125  2.724   3.761   1.00 0.00 ? 69 TYR A CB  7  
ATOM   3959 C  CG  . TYR A 1 69 ? -5.391  3.994   2.962   1.00 0.00 ? 69 TYR A CG  7  
ATOM   3960 C  CD1 . TYR A 1 69 ? -6.517  4.787   3.252   1.00 0.00 ? 69 TYR A CD1 7  
ATOM   3961 C  CD2 . TYR A 1 69 ? -4.524  4.382   1.922   1.00 0.00 ? 69 TYR A CD2 7  
ATOM   3962 C  CE1 . TYR A 1 69 ? -6.711  6.005   2.582   1.00 0.00 ? 69 TYR A CE1 7  
ATOM   3963 C  CE2 . TYR A 1 69 ? -4.750  5.578   1.216   1.00 0.00 ? 69 TYR A CE2 7  
ATOM   3964 C  CZ  . TYR A 1 69 ? -5.822  6.408   1.573   1.00 0.00 ? 69 TYR A CZ  7  
ATOM   3965 O  OH  . TYR A 1 69 ? -6.063  7.568   0.900   1.00 0.00 ? 69 TYR A OH  7  
ATOM   3966 N  N   . ALA A 1 70 ? -4.638  5.212   5.910   1.00 0.00 ? 70 ALA A N   7  
ATOM   3967 C  CA  . ALA A 1 70 ? -5.332  6.385   6.416   1.00 0.00 ? 70 ALA A CA  7  
ATOM   3968 C  C   . ALA A 1 70 ? -5.176  7.463   5.343   1.00 0.00 ? 70 ALA A C   7  
ATOM   3969 O  O   . ALA A 1 70 ? -4.099  7.549   4.758   1.00 0.00 ? 70 ALA A O   7  
ATOM   3970 C  CB  . ALA A 1 70 ? -4.701  6.823   7.740   1.00 0.00 ? 70 ALA A CB  7  
ATOM   3971 N  N   . PRO A 1 71 ? -6.214  8.252   5.031   1.00 0.00 ? 71 PRO A N   7  
ATOM   3972 C  CA  . PRO A 1 71 ? -6.137  9.243   3.974   1.00 0.00 ? 71 PRO A CA  7  
ATOM   3973 C  C   . PRO A 1 71 ? -5.266  10.419  4.387   1.00 0.00 ? 71 PRO A C   7  
ATOM   3974 O  O   . PRO A 1 71 ? -5.185  10.766  5.563   1.00 0.00 ? 71 PRO A O   7  
ATOM   3975 C  CB  . PRO A 1 71 ? -7.579  9.672   3.701   1.00 0.00 ? 71 PRO A CB  7  
ATOM   3976 C  CG  . PRO A 1 71 ? -8.257  9.464   5.057   1.00 0.00 ? 71 PRO A CG  7  
ATOM   3977 C  CD  . PRO A 1 71 ? -7.540  8.238   5.628   1.00 0.00 ? 71 PRO A CD  7  
ATOM   3978 N  N   . ALA A 1 72 ? -4.623  11.034  3.393   1.00 0.00 ? 72 ALA A N   7  
ATOM   3979 C  CA  . ALA A 1 72 ? -3.803  12.220  3.569   1.00 0.00 ? 72 ALA A CA  7  
ATOM   3980 C  C   . ALA A 1 72 ? -4.611  13.472  3.227   1.00 0.00 ? 72 ALA A C   7  
ATOM   3981 O  O   . ALA A 1 72 ? -4.109  14.412  2.612   1.00 0.00 ? 72 ALA A O   7  
ATOM   3982 C  CB  . ALA A 1 72 ? -2.572  12.096  2.682   1.00 0.00 ? 72 ALA A CB  7  
ATOM   3983 N  N   . SER A 1 73 ? -5.885  13.453  3.597   1.00 0.00 ? 73 SER A N   7  
ATOM   3984 C  CA  . SER A 1 73 ? -6.884  14.489  3.434   1.00 0.00 ? 73 SER A CA  7  
ATOM   3985 C  C   . SER A 1 73 ? -8.055  14.071  4.321   1.00 0.00 ? 73 SER A C   7  
ATOM   3986 O  O   . SER A 1 73 ? -8.005  12.913  4.798   1.00 0.00 ? 73 SER A O   7  
ATOM   3987 C  CB  . SER A 1 73 ? -7.348  14.583  1.977   1.00 0.00 ? 73 SER A CB  7  
ATOM   3988 O  OG  . SER A 1 73 ? -6.339  15.123  1.141   1.00 0.00 ? 73 SER A OG  7  
ATOM   3989 O  OXT . SER A 1 73 ? -8.978  14.897  4.480   1.00 0.00 ? 73 SER A OXT 7  
HETATM 3990 FE FE1 . SF4 B 2 .  ? 0.184   1.601   1.561   1.00 0.00 ? 74 SF4 A FE1 7  
HETATM 3991 FE FE2 . SF4 B 2 .  ? -0.600  3.146   3.359   1.00 0.00 ? 74 SF4 A FE2 7  
HETATM 3992 FE FE3 . SF4 B 2 .  ? 1.468   1.847   3.694   1.00 0.00 ? 74 SF4 A FE3 7  
HETATM 3993 FE FE4 . SF4 B 2 .  ? -0.722  0.677   3.678   1.00 0.00 ? 74 SF4 A FE4 7  
HETATM 3994 S  S1  . SF4 B 2 .  ? -0.088  2.118   5.143   1.00 0.00 ? 74 SF4 A S1  7  
HETATM 3995 S  S2  . SF4 B 2 .  ? 1.062   -0.026  2.695   1.00 0.00 ? 74 SF4 A S2  7  
HETATM 3996 S  S3  . SF4 B 2 .  ? -1.859  1.796   2.238   1.00 0.00 ? 74 SF4 A S3  7  
HETATM 3997 S  S4  . SF4 B 2 .  ? 1.217   3.380   2.213   1.00 0.00 ? 74 SF4 A S4  7  
ATOM   3998 N  N   . ALA A 1 1  ? 16.673  1.332   2.811   1.00 0.00 ? 1  ALA A N   8  
ATOM   3999 C  CA  . ALA A 1 1  ? 16.358  1.714   1.433   1.00 0.00 ? 1  ALA A CA  8  
ATOM   4000 C  C   . ALA A 1 1  ? 16.419  0.468   0.562   1.00 0.00 ? 1  ALA A C   8  
ATOM   4001 O  O   . ALA A 1 1  ? 16.933  -0.538  1.047   1.00 0.00 ? 1  ALA A O   8  
ATOM   4002 C  CB  . ALA A 1 1  ? 17.410  2.666   0.855   1.00 0.00 ? 1  ALA A CB  8  
ATOM   4003 N  N   . SER A 1 2  ? 15.920  0.542   -0.676  1.00 0.00 ? 2  SER A N   8  
ATOM   4004 C  CA  . SER A 1 2  ? 15.934  -0.547  -1.646  1.00 0.00 ? 2  SER A CA  8  
ATOM   4005 C  C   . SER A 1 2  ? 15.380  -1.858  -1.084  1.00 0.00 ? 2  SER A C   8  
ATOM   4006 O  O   . SER A 1 2  ? 15.848  -2.937  -1.448  1.00 0.00 ? 2  SER A O   8  
ATOM   4007 C  CB  . SER A 1 2  ? 17.345  -0.722  -2.217  1.00 0.00 ? 2  SER A CB  8  
ATOM   4008 O  OG  . SER A 1 2  ? 17.830  0.532   -2.668  1.00 0.00 ? 2  SER A OG  8  
ATOM   4009 N  N   . GLU A 1 3  ? 14.374  -1.767  -0.213  1.00 0.00 ? 3  GLU A N   8  
ATOM   4010 C  CA  . GLU A 1 3  ? 13.673  -2.918  0.315   1.00 0.00 ? 3  GLU A CA  8  
ATOM   4011 C  C   . GLU A 1 3  ? 12.996  -3.681  -0.841  1.00 0.00 ? 3  GLU A C   8  
ATOM   4012 O  O   . GLU A 1 3  ? 12.650  -3.078  -1.857  1.00 0.00 ? 3  GLU A O   8  
ATOM   4013 C  CB  . GLU A 1 3  ? 12.663  -2.440  1.374   1.00 0.00 ? 3  GLU A CB  8  
ATOM   4014 C  CG  . GLU A 1 3  ? 13.321  -1.810  2.616   1.00 0.00 ? 3  GLU A CG  8  
ATOM   4015 C  CD  . GLU A 1 3  ? 13.678  -0.340  2.487   1.00 0.00 ? 3  GLU A CD  8  
ATOM   4016 O  OE1 . GLU A 1 3  ? 13.651  0.232   1.380   1.00 0.00 ? 3  GLU A OE1 8  
ATOM   4017 O  OE2 . GLU A 1 3  ? 14.069  0.282   3.505   1.00 0.00 ? 3  GLU A OE2 8  
ATOM   4018 N  N   . PRO A 1 4  ? 12.816  -5.006  -0.726  1.00 0.00 ? 4  PRO A N   8  
ATOM   4019 C  CA  . PRO A 1 4  ? 12.169  -5.796  -1.763  1.00 0.00 ? 4  PRO A CA  8  
ATOM   4020 C  C   . PRO A 1 4  ? 10.694  -5.408  -1.902  1.00 0.00 ? 4  PRO A C   8  
ATOM   4021 O  O   . PRO A 1 4  ? 10.046  -5.064  -0.915  1.00 0.00 ? 4  PRO A O   8  
ATOM   4022 C  CB  . PRO A 1 4  ? 12.341  -7.257  -1.337  1.00 0.00 ? 4  PRO A CB  8  
ATOM   4023 C  CG  . PRO A 1 4  ? 12.538  -7.181  0.178   1.00 0.00 ? 4  PRO A CG  8  
ATOM   4024 C  CD  . PRO A 1 4  ? 13.241  -5.840  0.385   1.00 0.00 ? 4  PRO A CD  8  
ATOM   4025 N  N   . ARG A 1 5  ? 10.166  -5.457  -3.129  1.00 0.00 ? 5  ARG A N   8  
ATOM   4026 C  CA  . ARG A 1 5  ? 8.781   -5.173  -3.452  1.00 0.00 ? 5  ARG A CA  8  
ATOM   4027 C  C   . ARG A 1 5  ? 7.841   -6.102  -2.667  1.00 0.00 ? 5  ARG A C   8  
ATOM   4028 O  O   . ARG A 1 5  ? 8.007   -7.320  -2.707  1.00 0.00 ? 5  ARG A O   8  
ATOM   4029 C  CB  . ARG A 1 5  ? 8.659   -5.365  -4.967  1.00 0.00 ? 5  ARG A CB  8  
ATOM   4030 C  CG  . ARG A 1 5  ? 9.474   -4.321  -5.698  1.00 0.00 ? 5  ARG A CG  8  
ATOM   4031 C  CD  . ARG A 1 5  ? 9.544   -4.800  -7.140  1.00 0.00 ? 5  ARG A CD  8  
ATOM   4032 N  NE  . ARG A 1 5  ? 10.663  -4.121  -7.751  1.00 0.00 ? 5  ARG A NE  8  
ATOM   4033 C  CZ  . ARG A 1 5  ? 10.619  -3.306  -8.817  1.00 0.00 ? 5  ARG A CZ  8  
ATOM   4034 N  NH1 . ARG A 1 5  ? 9.624   -3.413  -9.700  1.00 0.00 ? 5  ARG A NH1 8  
ATOM   4035 N  NH2 . ARG A 1 5  ? 11.561  -2.382  -8.976  1.00 0.00 ? 5  ARG A NH2 8  
ATOM   4036 N  N   . ALA A 1 6  ? 6.889   -5.516  -1.939  1.00 0.00 ? 6  ALA A N   8  
ATOM   4037 C  CA  . ALA A 1 6  ? 5.992   -6.203  -1.023  1.00 0.00 ? 6  ALA A CA  8  
ATOM   4038 C  C   . ALA A 1 6  ? 5.137   -7.260  -1.716  1.00 0.00 ? 6  ALA A C   8  
ATOM   4039 O  O   . ALA A 1 6  ? 4.776   -7.130  -2.887  1.00 0.00 ? 6  ALA A O   8  
ATOM   4040 C  CB  . ALA A 1 6  ? 5.097   -5.172  -0.328  1.00 0.00 ? 6  ALA A CB  8  
ATOM   4041 N  N   . GLU A 1 7  ? 4.786   -8.298  -0.962  1.00 0.00 ? 7  GLU A N   8  
ATOM   4042 C  CA  . GLU A 1 7  ? 3.990   -9.418  -1.414  1.00 0.00 ? 7  GLU A CA  8  
ATOM   4043 C  C   . GLU A 1 7  ? 2.525   -9.038  -1.325  1.00 0.00 ? 7  GLU A C   8  
ATOM   4044 O  O   . GLU A 1 7  ? 2.107   -8.395  -0.359  1.00 0.00 ? 7  GLU A O   8  
ATOM   4045 C  CB  . GLU A 1 7  ? 4.219   -10.645 -0.531  1.00 0.00 ? 7  GLU A CB  8  
ATOM   4046 C  CG  . GLU A 1 7  ? 5.683   -10.820 -0.123  1.00 0.00 ? 7  GLU A CG  8  
ATOM   4047 C  CD  . GLU A 1 7  ? 5.957   -10.170 1.229   1.00 0.00 ? 7  GLU A CD  8  
ATOM   4048 O  OE1 . GLU A 1 7  ? 6.065   -8.926  1.274   1.00 0.00 ? 7  GLU A OE1 8  
ATOM   4049 O  OE2 . GLU A 1 7  ? 5.943   -10.856 2.267   1.00 0.00 ? 7  GLU A OE2 8  
ATOM   4050 N  N   . ASP A 1 8  ? 1.726   -9.516  -2.269  1.00 0.00 ? 8  ASP A N   8  
ATOM   4051 C  CA  . ASP A 1 8  ? 0.290   -9.469  -2.140  1.00 0.00 ? 8  ASP A CA  8  
ATOM   4052 C  C   . ASP A 1 8  ? -0.076  -10.307 -0.918  1.00 0.00 ? 8  ASP A C   8  
ATOM   4053 O  O   . ASP A 1 8  ? 0.315   -11.468 -0.811  1.00 0.00 ? 8  ASP A O   8  
ATOM   4054 C  CB  . ASP A 1 8  ? -0.335  -9.990  -3.433  1.00 0.00 ? 8  ASP A CB  8  
ATOM   4055 C  CG  . ASP A 1 8  ? -0.207  -8.941  -4.524  1.00 0.00 ? 8  ASP A CG  8  
ATOM   4056 O  OD1 . ASP A 1 8  ? -1.075  -8.046  -4.561  1.00 0.00 ? 8  ASP A OD1 8  
ATOM   4057 O  OD2 . ASP A 1 8  ? 0.814   -8.991  -5.246  1.00 0.00 ? 8  ASP A OD2 8  
ATOM   4058 N  N   . GLY A 1 9  ? -0.749  -9.686  0.047   1.00 0.00 ? 9  GLY A N   8  
ATOM   4059 C  CA  . GLY A 1 9  ? -1.054  -10.288 1.328   1.00 0.00 ? 9  GLY A CA  8  
ATOM   4060 C  C   . GLY A 1 9  ? 0.156   -10.368 2.262   1.00 0.00 ? 9  GLY A C   8  
ATOM   4061 O  O   . GLY A 1 9  ? 0.118   -11.168 3.193   1.00 0.00 ? 9  GLY A O   8  
ATOM   4062 N  N   . HIS A 1 10 ? 1.192   -9.528  2.080   1.00 0.00 ? 10 HIS A N   8  
ATOM   4063 C  CA  . HIS A 1 10 ? 2.269   -9.363  3.060   1.00 0.00 ? 10 HIS A CA  8  
ATOM   4064 C  C   . HIS A 1 10 ? 1.716   -9.312  4.486   1.00 0.00 ? 10 HIS A C   8  
ATOM   4065 O  O   . HIS A 1 10 ? 2.135   -10.067 5.359   1.00 0.00 ? 10 HIS A O   8  
ATOM   4066 C  CB  . HIS A 1 10 ? 3.031   -8.063  2.770   1.00 0.00 ? 10 HIS A CB  8  
ATOM   4067 C  CG  . HIS A 1 10 ? 4.141   -7.786  3.757   1.00 0.00 ? 10 HIS A CG  8  
ATOM   4068 N  ND1 . HIS A 1 10 ? 5.405   -8.342  3.729   1.00 0.00 ? 10 HIS A ND1 8  
ATOM   4069 C  CD2 . HIS A 1 10 ? 4.082   -6.923  4.817   1.00 0.00 ? 10 HIS A CD2 8  
ATOM   4070 C  CE1 . HIS A 1 10 ? 6.105   -7.822  4.753   1.00 0.00 ? 10 HIS A CE1 8  
ATOM   4071 N  NE2 . HIS A 1 10 ? 5.323   -6.954  5.423   1.00 0.00 ? 10 HIS A NE2 8  
ATOM   4072 N  N   . ALA A 1 11 ? 0.782   -8.386  4.705   1.00 0.00 ? 11 ALA A N   8  
ATOM   4073 C  CA  . ALA A 1 11 ? 0.025   -8.238  5.938   1.00 0.00 ? 11 ALA A CA  8  
ATOM   4074 C  C   . ALA A 1 11 ? -1.158  -7.315  5.659   1.00 0.00 ? 11 ALA A C   8  
ATOM   4075 O  O   . ALA A 1 11 ? -1.246  -6.761  4.563   1.00 0.00 ? 11 ALA A O   8  
ATOM   4076 C  CB  . ALA A 1 11 ? 0.922   -7.667  7.046   1.00 0.00 ? 11 ALA A CB  8  
ATOM   4077 N  N   . HIS A 1 12 ? -2.050  -7.156  6.648   1.00 0.00 ? 12 HIS A N   8  
ATOM   4078 C  CA  . HIS A 1 12 ? -3.164  -6.207  6.658   1.00 0.00 ? 12 HIS A CA  8  
ATOM   4079 C  C   . HIS A 1 12 ? -3.837  -6.062  5.293   1.00 0.00 ? 12 HIS A C   8  
ATOM   4080 O  O   . HIS A 1 12 ? -4.027  -4.951  4.797   1.00 0.00 ? 12 HIS A O   8  
ATOM   4081 C  CB  . HIS A 1 12 ? -2.678  -4.842  7.140   1.00 0.00 ? 12 HIS A CB  8  
ATOM   4082 C  CG  . HIS A 1 12 ? -2.124  -4.787  8.534   1.00 0.00 ? 12 HIS A CG  8  
ATOM   4083 N  ND1 . HIS A 1 12 ? -2.797  -4.245  9.613   1.00 0.00 ? 12 HIS A ND1 8  
ATOM   4084 C  CD2 . HIS A 1 12 ? -0.797  -4.859  8.855   1.00 0.00 ? 12 HIS A CD2 8  
ATOM   4085 C  CE1 . HIS A 1 12 ? -1.884  -3.954  10.557  1.00 0.00 ? 12 HIS A CE1 8  
ATOM   4086 N  NE2 . HIS A 1 12 ? -0.674  -4.354  10.133  1.00 0.00 ? 12 HIS A NE2 8  
ATOM   4087 N  N   . ASP A 1 13 ? -4.191  -7.199  4.695   1.00 0.00 ? 13 ASP A N   8  
ATOM   4088 C  CA  . ASP A 1 13 ? -5.001  -7.250  3.486   1.00 0.00 ? 13 ASP A CA  8  
ATOM   4089 C  C   . ASP A 1 13 ? -4.339  -6.498  2.320   1.00 0.00 ? 13 ASP A C   8  
ATOM   4090 O  O   . ASP A 1 13 ? -5.038  -6.100  1.388   1.00 0.00 ? 13 ASP A O   8  
ATOM   4091 C  CB  . ASP A 1 13 ? -6.441  -6.740  3.722   1.00 0.00 ? 13 ASP A CB  8  
ATOM   4092 C  CG  . ASP A 1 13 ? -7.052  -6.941  5.107   1.00 0.00 ? 13 ASP A CG  8  
ATOM   4093 O  OD1 . ASP A 1 13 ? -6.511  -6.410  6.099   1.00 0.00 ? 13 ASP A OD1 8  
ATOM   4094 O  OD2 . ASP A 1 13 ? -8.180  -7.481  5.127   1.00 0.00 ? 13 ASP A OD2 8  
ATOM   4095 N  N   . TYR A 1 14 ? -3.018  -6.269  2.364   1.00 0.00 ? 14 TYR A N   8  
ATOM   4096 C  CA  . TYR A 1 14 ? -2.354  -5.479  1.341   1.00 0.00 ? 14 TYR A CA  8  
ATOM   4097 C  C   . TYR A 1 14 ? -2.466  -6.159  -0.015  1.00 0.00 ? 14 TYR A C   8  
ATOM   4098 O  O   . TYR A 1 14 ? -2.232  -7.362  -0.122  1.00 0.00 ? 14 TYR A O   8  
ATOM   4099 C  CB  . TYR A 1 14 ? -0.891  -5.195  1.704   1.00 0.00 ? 14 TYR A CB  8  
ATOM   4100 C  CG  . TYR A 1 14 ? -0.052  -4.613  0.575   1.00 0.00 ? 14 TYR A CG  8  
ATOM   4101 C  CD1 . TYR A 1 14 ? -0.047  -3.232  0.309   1.00 0.00 ? 14 TYR A CD1 8  
ATOM   4102 C  CD2 . TYR A 1 14 ? 0.703   -5.469  -0.246  1.00 0.00 ? 14 TYR A CD2 8  
ATOM   4103 C  CE1 . TYR A 1 14 ? 0.748   -2.711  -0.725  1.00 0.00 ? 14 TYR A CE1 8  
ATOM   4104 C  CE2 . TYR A 1 14 ? 1.544   -4.944  -1.242  1.00 0.00 ? 14 TYR A CE2 8  
ATOM   4105 C  CZ  . TYR A 1 14 ? 1.597   -3.556  -1.456  1.00 0.00 ? 14 TYR A CZ  8  
ATOM   4106 O  OH  . TYR A 1 14 ? 2.484   -3.027  -2.351  1.00 0.00 ? 14 TYR A OH  8  
ATOM   4107 N  N   . VAL A 1 15 ? -2.774  -5.375  -1.045  1.00 0.00 ? 15 VAL A N   8  
ATOM   4108 C  CA  . VAL A 1 15 ? -2.713  -5.806  -2.431  1.00 0.00 ? 15 VAL A CA  8  
ATOM   4109 C  C   . VAL A 1 15 ? -1.769  -4.855  -3.150  1.00 0.00 ? 15 VAL A C   8  
ATOM   4110 O  O   . VAL A 1 15 ? -1.738  -3.657  -2.850  1.00 0.00 ? 15 VAL A O   8  
ATOM   4111 C  CB  . VAL A 1 15 ? -4.108  -5.826  -3.073  1.00 0.00 ? 15 VAL A CB  8  
ATOM   4112 C  CG1 . VAL A 1 15 ? -4.896  -7.026  -2.528  1.00 0.00 ? 15 VAL A CG1 8  
ATOM   4113 C  CG2 . VAL A 1 15 ? -4.876  -4.531  -2.785  1.00 0.00 ? 15 VAL A CG2 8  
ATOM   4114 N  N   . ASN A 1 16 ? -0.977  -5.397  -4.072  1.00 0.00 ? 16 ASN A N   8  
ATOM   4115 C  CA  . ASN A 1 16 ? -0.019  -4.630  -4.821  1.00 0.00 ? 16 ASN A CA  8  
ATOM   4116 C  C   . ASN A 1 16 ? -0.710  -3.578  -5.667  1.00 0.00 ? 16 ASN A C   8  
ATOM   4117 O  O   . ASN A 1 16 ? -0.185  -2.477  -5.794  1.00 0.00 ? 16 ASN A O   8  
ATOM   4118 C  CB  . ASN A 1 16 ? 0.945   -5.510  -5.620  1.00 0.00 ? 16 ASN A CB  8  
ATOM   4119 C  CG  . ASN A 1 16 ? 2.190   -5.777  -4.790  1.00 0.00 ? 16 ASN A CG  8  
ATOM   4120 O  OD1 . ASN A 1 16 ? 2.841   -4.847  -4.324  1.00 0.00 ? 16 ASN A OD1 8  
ATOM   4121 N  ND2 . ASN A 1 16 ? 2.531   -7.031  -4.568  1.00 0.00 ? 16 ASN A ND2 8  
ATOM   4122 N  N   . GLU A 1 17 ? -1.883  -3.890  -6.223  1.00 0.00 ? 17 GLU A N   8  
ATOM   4123 C  CA  . GLU A 1 17 ? -2.725  -2.933  -6.878  1.00 0.00 ? 17 GLU A CA  8  
ATOM   4124 C  C   . GLU A 1 17 ? -3.958  -2.678  -6.024  1.00 0.00 ? 17 GLU A C   8  
ATOM   4125 O  O   . GLU A 1 17 ? -4.743  -3.588  -5.757  1.00 0.00 ? 17 GLU A O   8  
ATOM   4126 C  CB  . GLU A 1 17 ? -3.137  -3.533  -8.211  1.00 0.00 ? 17 GLU A CB  8  
ATOM   4127 C  CG  . GLU A 1 17 ? -3.061  -2.479  -9.297  1.00 0.00 ? 17 GLU A CG  8  
ATOM   4128 C  CD  . GLU A 1 17 ? -1.662  -2.395  -9.911  1.00 0.00 ? 17 GLU A CD  8  
ATOM   4129 O  OE1 . GLU A 1 17 ? -0.764  -1.826  -9.250  1.00 0.00 ? 17 GLU A OE1 8  
ATOM   4130 O  OE2 . GLU A 1 17 ? -1.493  -2.930  -11.027 1.00 0.00 ? 17 GLU A OE2 8  
ATOM   4131 N  N   . ALA A 1 18 ? -4.164  -1.412  -5.682  1.00 0.00 ? 18 ALA A N   8  
ATOM   4132 C  CA  . ALA A 1 18 ? -5.352  -0.906  -5.020  1.00 0.00 ? 18 ALA A CA  8  
ATOM   4133 C  C   . ALA A 1 18 ? -6.617  -1.422  -5.701  1.00 0.00 ? 18 ALA A C   8  
ATOM   4134 O  O   . ALA A 1 18 ? -7.600  -1.721  -5.027  1.00 0.00 ? 18 ALA A O   8  
ATOM   4135 C  CB  . ALA A 1 18 ? -5.327  0.625   -5.037  1.00 0.00 ? 18 ALA A CB  8  
ATOM   4136 N  N   . ALA A 1 19 ? -6.591  -1.549  -7.036  1.00 0.00 ? 19 ALA A N   8  
ATOM   4137 C  CA  . ALA A 1 19 ? -7.743  -2.025  -7.783  1.00 0.00 ? 19 ALA A CA  8  
ATOM   4138 C  C   . ALA A 1 19 ? -8.257  -3.358  -7.240  1.00 0.00 ? 19 ALA A C   8  
ATOM   4139 O  O   . ALA A 1 19 ? -9.470  -3.539  -7.107  1.00 0.00 ? 19 ALA A O   8  
ATOM   4140 C  CB  . ALA A 1 19 ? -7.389  -2.123  -9.270  1.00 0.00 ? 19 ALA A CB  8  
ATOM   4141 N  N   . ASP A 1 20 ? -7.348  -4.273  -6.885  1.00 0.00 ? 20 ASP A N   8  
ATOM   4142 C  CA  . ASP A 1 20 ? -7.738  -5.574  -6.355  1.00 0.00 ? 20 ASP A CA  8  
ATOM   4143 C  C   . ASP A 1 20 ? -8.630  -5.408  -5.122  1.00 0.00 ? 20 ASP A C   8  
ATOM   4144 O  O   . ASP A 1 20 ? -9.620  -6.114  -4.933  1.00 0.00 ? 20 ASP A O   8  
ATOM   4145 C  CB  . ASP A 1 20 ? -6.506  -6.406  -6.011  1.00 0.00 ? 20 ASP A CB  8  
ATOM   4146 C  CG  . ASP A 1 20 ? -6.875  -7.880  -5.937  1.00 0.00 ? 20 ASP A CG  8  
ATOM   4147 O  OD1 . ASP A 1 20 ? -6.894  -8.509  -7.018  1.00 0.00 ? 20 ASP A OD1 8  
ATOM   4148 O  OD2 . ASP A 1 20 ? -7.149  -8.346  -4.812  1.00 0.00 ? 20 ASP A OD2 8  
ATOM   4149 N  N   . ALA A 1 21 ? -8.311  -4.400  -4.303  1.00 0.00 ? 21 ALA A N   8  
ATOM   4150 C  CA  . ALA A 1 21 ? -8.995  -4.179  -3.043  1.00 0.00 ? 21 ALA A CA  8  
ATOM   4151 C  C   . ALA A 1 21 ? -10.389 -3.593  -3.238  1.00 0.00 ? 21 ALA A C   8  
ATOM   4152 O  O   . ALA A 1 21 ? -11.082 -3.420  -2.241  1.00 0.00 ? 21 ALA A O   8  
ATOM   4153 C  CB  . ALA A 1 21 ? -8.149  -3.319  -2.097  1.00 0.00 ? 21 ALA A CB  8  
ATOM   4154 N  N   . SER A 1 22 ? -10.857 -3.354  -4.471  1.00 0.00 ? 22 SER A N   8  
ATOM   4155 C  CA  . SER A 1 22 ? -12.239 -2.937  -4.705  1.00 0.00 ? 22 SER A CA  8  
ATOM   4156 C  C   . SER A 1 22 ? -13.262 -3.866  -4.041  1.00 0.00 ? 22 SER A C   8  
ATOM   4157 O  O   . SER A 1 22 ? -14.322 -3.454  -3.578  1.00 0.00 ? 22 SER A O   8  
ATOM   4158 C  CB  . SER A 1 22 ? -12.475 -2.716  -6.205  1.00 0.00 ? 22 SER A CB  8  
ATOM   4159 O  OG  . SER A 1 22 ? -13.730 -2.110  -6.445  1.00 0.00 ? 22 SER A OG  8  
ATOM   4160 N  N   . GLY A 1 23 ? -12.881 -5.131  -3.933  1.00 0.00 ? 23 GLY A N   8  
ATOM   4161 C  CA  . GLY A 1 23 ? -13.643 -6.167  -3.246  1.00 0.00 ? 23 GLY A CA  8  
ATOM   4162 C  C   . GLY A 1 23 ? -13.775 -5.935  -1.733  1.00 0.00 ? 23 GLY A C   8  
ATOM   4163 O  O   . GLY A 1 23 ? -14.711 -6.433  -1.112  1.00 0.00 ? 23 GLY A O   8  
ATOM   4164 N  N   . HIS A 1 24 ? -12.820 -5.237  -1.112  1.00 0.00 ? 24 HIS A N   8  
ATOM   4165 C  CA  . HIS A 1 24 ? -12.700 -5.129  0.335   1.00 0.00 ? 24 HIS A CA  8  
ATOM   4166 C  C   . HIS A 1 24 ? -13.650 -4.065  0.900   1.00 0.00 ? 24 HIS A C   8  
ATOM   4167 O  O   . HIS A 1 24 ? -13.387 -2.879  0.705   1.00 0.00 ? 24 HIS A O   8  
ATOM   4168 C  CB  . HIS A 1 24 ? -11.252 -4.757  0.691   1.00 0.00 ? 24 HIS A CB  8  
ATOM   4169 C  CG  . HIS A 1 24 ? -10.878 -5.050  2.127   1.00 0.00 ? 24 HIS A CG  8  
ATOM   4170 N  ND1 . HIS A 1 24 ? -11.581 -4.677  3.262   1.00 0.00 ? 24 HIS A ND1 8  
ATOM   4171 C  CD2 . HIS A 1 24 ? -9.789  -5.772  2.529   1.00 0.00 ? 24 HIS A CD2 8  
ATOM   4172 C  CE1 . HIS A 1 24 ? -10.924 -5.157  4.330   1.00 0.00 ? 24 HIS A CE1 8  
ATOM   4173 N  NE2 . HIS A 1 24 ? -9.855  -5.853  3.906   1.00 0.00 ? 24 HIS A NE2 8  
ATOM   4174 N  N   . PRO A 1 25 ? -14.660 -4.411  1.718   1.00 0.00 ? 25 PRO A N   8  
ATOM   4175 C  CA  . PRO A 1 25 ? -15.357 -3.403  2.505   1.00 0.00 ? 25 PRO A CA  8  
ATOM   4176 C  C   . PRO A 1 25 ? -14.341 -2.786  3.473   1.00 0.00 ? 25 PRO A C   8  
ATOM   4177 O  O   . PRO A 1 25 ? -13.847 -3.492  4.348   1.00 0.00 ? 25 PRO A O   8  
ATOM   4178 C  CB  . PRO A 1 25 ? -16.483 -4.150  3.224   1.00 0.00 ? 25 PRO A CB  8  
ATOM   4179 C  CG  . PRO A 1 25 ? -15.956 -5.580  3.341   1.00 0.00 ? 25 PRO A CG  8  
ATOM   4180 C  CD  . PRO A 1 25 ? -15.097 -5.750  2.086   1.00 0.00 ? 25 PRO A CD  8  
ATOM   4181 N  N   . ARG A 1 26 ? -13.953 -1.529  3.221   1.00 0.00 ? 26 ARG A N   8  
ATOM   4182 C  CA  . ARG A 1 26 ? -12.919 -0.685  3.841   1.00 0.00 ? 26 ARG A CA  8  
ATOM   4183 C  C   . ARG A 1 26 ? -12.199 0.094   2.744   1.00 0.00 ? 26 ARG A C   8  
ATOM   4184 O  O   . ARG A 1 26 ? -11.764 1.225   2.977   1.00 0.00 ? 26 ARG A O   8  
ATOM   4185 C  CB  . ARG A 1 26 ? -11.850 -1.399  4.705   1.00 0.00 ? 26 ARG A CB  8  
ATOM   4186 C  CG  . ARG A 1 26 ? -11.959 -1.031  6.184   1.00 0.00 ? 26 ARG A CG  8  
ATOM   4187 C  CD  . ARG A 1 26 ? -11.471 0.404   6.434   1.00 0.00 ? 26 ARG A CD  8  
ATOM   4188 N  NE  . ARG A 1 26 ? -10.013 0.548   6.240   1.00 0.00 ? 26 ARG A NE  8  
ATOM   4189 C  CZ  . ARG A 1 26 ? -9.388  1.576   5.635   1.00 0.00 ? 26 ARG A CZ  8  
ATOM   4190 N  NH1 . ARG A 1 26 ? -9.998  2.327   4.710   1.00 0.00 ? 26 ARG A NH1 8  
ATOM   4191 N  NH2 . ARG A 1 26 ? -8.128  1.831   5.987   1.00 0.00 ? 26 ARG A NH2 8  
ATOM   4192 N  N   . TYR A 1 27 ? -12.027 -0.540  1.581   1.00 0.00 ? 27 TYR A N   8  
ATOM   4193 C  CA  . TYR A 1 27 ? -11.454 0.096   0.415   1.00 0.00 ? 27 TYR A CA  8  
ATOM   4194 C  C   . TYR A 1 27 ? -12.445 1.091   -0.167  1.00 0.00 ? 27 TYR A C   8  
ATOM   4195 O  O   . TYR A 1 27 ? -13.653 0.983   0.029   1.00 0.00 ? 27 TYR A O   8  
ATOM   4196 C  CB  . TYR A 1 27 ? -11.063 -0.959  -0.623  1.00 0.00 ? 27 TYR A CB  8  
ATOM   4197 C  CG  . TYR A 1 27 ? -10.342 -0.390  -1.830  1.00 0.00 ? 27 TYR A CG  8  
ATOM   4198 C  CD1 . TYR A 1 27 ? -8.977  -0.101  -1.716  1.00 0.00 ? 27 TYR A CD1 8  
ATOM   4199 C  CD2 . TYR A 1 27 ? -11.038 0.018   -2.982  1.00 0.00 ? 27 TYR A CD2 8  
ATOM   4200 C  CE1 . TYR A 1 27 ? -8.348  0.741   -2.640  1.00 0.00 ? 27 TYR A CE1 8  
ATOM   4201 C  CE2 . TYR A 1 27 ? -10.371 0.764   -3.974  1.00 0.00 ? 27 TYR A CE2 8  
ATOM   4202 C  CZ  . TYR A 1 27 ? -9.060  1.223   -3.747  1.00 0.00 ? 27 TYR A CZ  8  
ATOM   4203 O  OH  . TYR A 1 27 ? -8.526  2.231   -4.500  1.00 0.00 ? 27 TYR A OH  8  
ATOM   4204 N  N   . GLN A 1 28 ? -11.892 2.056   -0.897  1.00 0.00 ? 28 GLN A N   8  
ATOM   4205 C  CA  . GLN A 1 28 ? -12.635 2.926   -1.788  1.00 0.00 ? 28 GLN A CA  8  
ATOM   4206 C  C   . GLN A 1 28 ? -11.704 3.452   -2.874  1.00 0.00 ? 28 GLN A C   8  
ATOM   4207 O  O   . GLN A 1 28 ? -10.558 3.818   -2.599  1.00 0.00 ? 28 GLN A O   8  
ATOM   4208 C  CB  . GLN A 1 28 ? -13.274 4.097   -1.036  1.00 0.00 ? 28 GLN A CB  8  
ATOM   4209 C  CG  . GLN A 1 28 ? -14.463 4.690   -1.806  1.00 0.00 ? 28 GLN A CG  8  
ATOM   4210 C  CD  . GLN A 1 28 ? -15.714 3.820   -1.692  1.00 0.00 ? 28 GLN A CD  8  
ATOM   4211 O  OE1 . GLN A 1 28 ? -16.471 3.959   -0.735  1.00 0.00 ? 28 GLN A OE1 8  
ATOM   4212 N  NE2 . GLN A 1 28 ? -15.967 2.929   -2.646  1.00 0.00 ? 28 GLN A NE2 8  
ATOM   4213 N  N   . GLU A 1 29 ? -12.243 3.486   -4.085  1.00 0.00 ? 29 GLU A N   8  
ATOM   4214 C  CA  . GLU A 1 29 ? -11.610 3.845   -5.333  1.00 0.00 ? 29 GLU A CA  8  
ATOM   4215 C  C   . GLU A 1 29 ? -10.978 5.226   -5.205  1.00 0.00 ? 29 GLU A C   8  
ATOM   4216 O  O   . GLU A 1 29 ? -11.678 6.215   -4.998  1.00 0.00 ? 29 GLU A O   8  
ATOM   4217 C  CB  . GLU A 1 29 ? -12.670 3.790   -6.447  1.00 0.00 ? 29 GLU A CB  8  
ATOM   4218 C  CG  . GLU A 1 29 ? -13.144 2.358   -6.777  1.00 0.00 ? 29 GLU A CG  8  
ATOM   4219 C  CD  . GLU A 1 29 ? -13.843 1.621   -5.635  1.00 0.00 ? 29 GLU A CD  8  
ATOM   4220 O  OE1 . GLU A 1 29 ? -14.506 2.314   -4.825  1.00 0.00 ? 29 GLU A OE1 8  
ATOM   4221 O  OE2 . GLU A 1 29 ? -13.653 0.389   -5.552  1.00 0.00 ? 29 GLU A OE2 8  
ATOM   4222 N  N   . GLY A 1 30 ? -9.648  5.275   -5.309  1.00 0.00 ? 30 GLY A N   8  
ATOM   4223 C  CA  . GLY A 1 30 ? -8.875  6.501   -5.179  1.00 0.00 ? 30 GLY A CA  8  
ATOM   4224 C  C   . GLY A 1 30 ? -7.946  6.438   -3.973  1.00 0.00 ? 30 GLY A C   8  
ATOM   4225 O  O   . GLY A 1 30 ? -6.946  7.152   -3.929  1.00 0.00 ? 30 GLY A O   8  
ATOM   4226 N  N   . GLN A 1 31 ? -8.225  5.573   -2.993  1.00 0.00 ? 31 GLN A N   8  
ATOM   4227 C  CA  . GLN A 1 31 ? -7.240  5.289   -1.972  1.00 0.00 ? 31 GLN A CA  8  
ATOM   4228 C  C   . GLN A 1 31 ? -6.151  4.425   -2.624  1.00 0.00 ? 31 GLN A C   8  
ATOM   4229 O  O   . GLN A 1 31 ? -6.411  3.273   -2.970  1.00 0.00 ? 31 GLN A O   8  
ATOM   4230 C  CB  . GLN A 1 31 ? -7.929  4.595   -0.788  1.00 0.00 ? 31 GLN A CB  8  
ATOM   4231 C  CG  . GLN A 1 31 ? -8.888  5.507   -0.010  1.00 0.00 ? 31 GLN A CG  8  
ATOM   4232 C  CD  . GLN A 1 31 ? -9.599  4.722   1.093   1.00 0.00 ? 31 GLN A CD  8  
ATOM   4233 O  OE1 . GLN A 1 31 ? -9.281  4.784   2.275   1.00 0.00 ? 31 GLN A OE1 8  
ATOM   4234 N  NE2 . GLN A 1 31 ? -10.578 3.930   0.700   1.00 0.00 ? 31 GLN A NE2 8  
ATOM   4235 N  N   . LEU A 1 32 ? -4.963  5.004   -2.825  1.00 0.00 ? 32 LEU A N   8  
ATOM   4236 C  CA  . LEU A 1 32 ? -3.729  4.363   -3.272  1.00 0.00 ? 32 LEU A CA  8  
ATOM   4237 C  C   . LEU A 1 32 ? -2.682  4.654   -2.191  1.00 0.00 ? 32 LEU A C   8  
ATOM   4238 O  O   . LEU A 1 32 ? -2.742  5.727   -1.592  1.00 0.00 ? 32 LEU A O   8  
ATOM   4239 C  CB  . LEU A 1 32 ? -3.251  5.010   -4.585  1.00 0.00 ? 32 LEU A CB  8  
ATOM   4240 C  CG  . LEU A 1 32 ? -3.569  4.250   -5.878  1.00 0.00 ? 32 LEU A CG  8  
ATOM   4241 C  CD1 . LEU A 1 32 ? -5.046  4.187   -6.250  1.00 0.00 ? 32 LEU A CD1 8  
ATOM   4242 C  CD2 . LEU A 1 32 ? -2.841  4.943   -7.037  1.00 0.00 ? 32 LEU A CD2 8  
ATOM   4243 N  N   . CYS A 1 33 ? -1.720  3.755   -1.967  1.00 0.00 ? 33 CYS A N   8  
ATOM   4244 C  CA  . CYS A 1 33 ? -0.600  3.922   -1.040  1.00 0.00 ? 33 CYS A CA  8  
ATOM   4245 C  C   . CYS A 1 33 ? 0.043   5.302   -1.173  1.00 0.00 ? 33 CYS A C   8  
ATOM   4246 O  O   . CYS A 1 33 ? 0.305   5.970   -0.179  1.00 0.00 ? 33 CYS A O   8  
ATOM   4247 C  CB  . CYS A 1 33 ? 0.421   2.833   -1.276  1.00 0.00 ? 33 CYS A CB  8  
ATOM   4248 S  SG  . CYS A 1 33 ? 0.023   1.310   -0.363  1.00 0.00 ? 33 CYS A SG  8  
ATOM   4249 N  N   . GLU A 1 34 ? 0.277   5.781   -2.395  1.00 0.00 ? 34 GLU A N   8  
ATOM   4250 C  CA  . GLU A 1 34 ? 0.891   7.093   -2.570  1.00 0.00 ? 34 GLU A CA  8  
ATOM   4251 C  C   . GLU A 1 34 ? 0.087   8.251   -1.934  1.00 0.00 ? 34 GLU A C   8  
ATOM   4252 O  O   . GLU A 1 34 ? 0.647   9.314   -1.676  1.00 0.00 ? 34 GLU A O   8  
ATOM   4253 C  CB  . GLU A 1 34 ? 1.239   7.302   -4.044  1.00 0.00 ? 34 GLU A CB  8  
ATOM   4254 C  CG  . GLU A 1 34 ? 0.018   7.546   -4.942  1.00 0.00 ? 34 GLU A CG  8  
ATOM   4255 C  CD  . GLU A 1 34 ? 0.383   7.620   -6.421  1.00 0.00 ? 34 GLU A CD  8  
ATOM   4256 O  OE1 . GLU A 1 34 ? 1.598   7.638   -6.717  1.00 0.00 ? 34 GLU A OE1 8  
ATOM   4257 O  OE2 . GLU A 1 34 ? -0.566  7.657   -7.231  1.00 0.00 ? 34 GLU A OE2 8  
ATOM   4258 N  N   . ASN A 1 35 ? -1.208  8.047   -1.647  1.00 0.00 ? 35 ASN A N   8  
ATOM   4259 C  CA  . ASN A 1 35 ? -2.098  9.025   -1.011  1.00 0.00 ? 35 ASN A CA  8  
ATOM   4260 C  C   . ASN A 1 35 ? -2.214  8.799   0.506   1.00 0.00 ? 35 ASN A C   8  
ATOM   4261 O  O   . ASN A 1 35 ? -3.038  9.445   1.160   1.00 0.00 ? 35 ASN A O   8  
ATOM   4262 C  CB  . ASN A 1 35 ? -3.508  8.918   -1.622  1.00 0.00 ? 35 ASN A CB  8  
ATOM   4263 C  CG  . ASN A 1 35 ? -3.551  9.000   -3.138  1.00 0.00 ? 35 ASN A CG  8  
ATOM   4264 O  OD1 . ASN A 1 35 ? -2.713  9.629   -3.772  1.00 0.00 ? 35 ASN A OD1 8  
ATOM   4265 N  ND2 . ASN A 1 35 ? -4.546  8.353   -3.739  1.00 0.00 ? 35 ASN A ND2 8  
ATOM   4266 N  N   . CYS A 1 36 ? -1.464  7.841   1.057   1.00 0.00 ? 36 CYS A N   8  
ATOM   4267 C  CA  . CYS A 1 36 ? -1.612  7.349   2.418   1.00 0.00 ? 36 CYS A CA  8  
ATOM   4268 C  C   . CYS A 1 36 ? -0.722  8.148   3.374   1.00 0.00 ? 36 CYS A C   8  
ATOM   4269 O  O   . CYS A 1 36 ? 0.427   8.455   3.069   1.00 0.00 ? 36 CYS A O   8  
ATOM   4270 C  CB  . CYS A 1 36 ? -1.203  5.904   2.402   1.00 0.00 ? 36 CYS A CB  8  
ATOM   4271 S  SG  . CYS A 1 36 ? -1.487  5.031   3.940   1.00 0.00 ? 36 CYS A SG  8  
ATOM   4272 N  N   . ALA A 1 37 ? -1.222  8.461   4.569   1.00 0.00 ? 37 ALA A N   8  
ATOM   4273 C  CA  . ALA A 1 37 ? -0.482  9.222   5.565   1.00 0.00 ? 37 ALA A CA  8  
ATOM   4274 C  C   . ALA A 1 37 ? 0.718   8.452   6.133   1.00 0.00 ? 37 ALA A C   8  
ATOM   4275 O  O   . ALA A 1 37 ? 1.546   9.041   6.825   1.00 0.00 ? 37 ALA A O   8  
ATOM   4276 C  CB  . ALA A 1 37 ? -1.444  9.672   6.663   1.00 0.00 ? 37 ALA A CB  8  
ATOM   4277 N  N   . PHE A 1 38 ? 0.828   7.148   5.860   1.00 0.00 ? 38 PHE A N   8  
ATOM   4278 C  CA  . PHE A 1 38 ? 2.011   6.362   6.204   1.00 0.00 ? 38 PHE A CA  8  
ATOM   4279 C  C   . PHE A 1 38 ? 3.056   6.393   5.081   1.00 0.00 ? 38 PHE A C   8  
ATOM   4280 O  O   . PHE A 1 38 ? 4.137   5.824   5.263   1.00 0.00 ? 38 PHE A O   8  
ATOM   4281 C  CB  . PHE A 1 38 ? 1.607   4.916   6.522   1.00 0.00 ? 38 PHE A CB  8  
ATOM   4282 C  CG  . PHE A 1 38 ? 1.113   4.619   7.930   1.00 0.00 ? 38 PHE A CG  8  
ATOM   4283 C  CD1 . PHE A 1 38 ? 0.541   5.617   8.743   1.00 0.00 ? 38 PHE A CD1 8  
ATOM   4284 C  CD2 . PHE A 1 38 ? 1.199   3.299   8.412   1.00 0.00 ? 38 PHE A CD2 8  
ATOM   4285 C  CE1 . PHE A 1 38 ? 0.095   5.302   10.038  1.00 0.00 ? 38 PHE A CE1 8  
ATOM   4286 C  CE2 . PHE A 1 38 ? 0.764   2.988   9.710   1.00 0.00 ? 38 PHE A CE2 8  
ATOM   4287 C  CZ  . PHE A 1 38 ? 0.214   3.992   10.527  1.00 0.00 ? 38 PHE A CZ  8  
ATOM   4288 N  N   . TRP A 1 39 ? 2.764   7.026   3.938   1.00 0.00 ? 39 TRP A N   8  
ATOM   4289 C  CA  . TRP A 1 39 ? 3.702   7.105   2.830   1.00 0.00 ? 39 TRP A CA  8  
ATOM   4290 C  C   . TRP A 1 39 ? 4.993   7.803   3.274   1.00 0.00 ? 39 TRP A C   8  
ATOM   4291 O  O   . TRP A 1 39 ? 4.954   8.851   3.916   1.00 0.00 ? 39 TRP A O   8  
ATOM   4292 C  CB  . TRP A 1 39 ? 3.052   7.820   1.638   1.00 0.00 ? 39 TRP A CB  8  
ATOM   4293 C  CG  . TRP A 1 39 ? 3.809   7.762   0.345   1.00 0.00 ? 39 TRP A CG  8  
ATOM   4294 C  CD1 . TRP A 1 39 ? 4.368   8.810   -0.303  1.00 0.00 ? 39 TRP A CD1 8  
ATOM   4295 C  CD2 . TRP A 1 39 ? 4.076   6.594   -0.484  1.00 0.00 ? 39 TRP A CD2 8  
ATOM   4296 N  NE1 . TRP A 1 39 ? 4.961   8.377   -1.473  1.00 0.00 ? 39 TRP A NE1 8  
ATOM   4297 C  CE2 . TRP A 1 39 ? 4.803   7.015   -1.639  1.00 0.00 ? 39 TRP A CE2 8  
ATOM   4298 C  CE3 . TRP A 1 39 ? 3.775   5.217   -0.376  1.00 0.00 ? 39 TRP A CE3 8  
ATOM   4299 C  CZ2 . TRP A 1 39 ? 5.210   6.111   -2.631  1.00 0.00 ? 39 TRP A CZ2 8  
ATOM   4300 C  CZ3 . TRP A 1 39 ? 4.198   4.301   -1.356  1.00 0.00 ? 39 TRP A CZ3 8  
ATOM   4301 C  CH2 . TRP A 1 39 ? 4.904   4.749   -2.485  1.00 0.00 ? 39 TRP A CH2 8  
ATOM   4302 N  N   . GLY A 1 40 ? 6.131   7.200   2.938   1.00 0.00 ? 40 GLY A N   8  
ATOM   4303 C  CA  . GLY A 1 40 ? 7.460   7.758   3.104   1.00 0.00 ? 40 GLY A CA  8  
ATOM   4304 C  C   . GLY A 1 40 ? 7.772   8.610   1.880   1.00 0.00 ? 40 GLY A C   8  
ATOM   4305 O  O   . GLY A 1 40 ? 7.605   9.825   1.925   1.00 0.00 ? 40 GLY A O   8  
ATOM   4306 N  N   . GLU A 1 41 ? 8.191   7.962   0.788   1.00 0.00 ? 41 GLU A N   8  
ATOM   4307 C  CA  . GLU A 1 41 ? 8.193   8.546   -0.543  1.00 0.00 ? 41 GLU A CA  8  
ATOM   4308 C  C   . GLU A 1 41 ? 8.459   7.465   -1.593  1.00 0.00 ? 41 GLU A C   8  
ATOM   4309 O  O   . GLU A 1 41 ? 8.907   6.366   -1.246  1.00 0.00 ? 41 GLU A O   8  
ATOM   4310 C  CB  . GLU A 1 41 ? 9.166   9.734   -0.689  1.00 0.00 ? 41 GLU A CB  8  
ATOM   4311 C  CG  . GLU A 1 41 ? 8.425   11.017  -1.115  1.00 0.00 ? 41 GLU A CG  8  
ATOM   4312 C  CD  . GLU A 1 41 ? 7.769   10.924  -2.493  1.00 0.00 ? 41 GLU A CD  8  
ATOM   4313 O  OE1 . GLU A 1 41 ? 6.840   10.091  -2.644  1.00 0.00 ? 41 GLU A OE1 8  
ATOM   4314 O  OE2 . GLU A 1 41 ? 8.236   11.654  -3.390  1.00 0.00 ? 41 GLU A OE2 8  
ATOM   4315 N  N   . ALA A 1 42 ? 8.202   7.783   -2.866  1.00 0.00 ? 42 ALA A N   8  
ATOM   4316 C  CA  . ALA A 1 42 ? 8.577   6.964   -4.007  1.00 0.00 ? 42 ALA A CA  8  
ATOM   4317 C  C   . ALA A 1 42 ? 10.085  6.743   -4.050  1.00 0.00 ? 42 ALA A C   8  
ATOM   4318 O  O   . ALA A 1 42 ? 10.870  7.594   -3.641  1.00 0.00 ? 42 ALA A O   8  
ATOM   4319 C  CB  . ALA A 1 42 ? 8.052   7.551   -5.321  1.00 0.00 ? 42 ALA A CB  8  
ATOM   4320 N  N   . VAL A 1 43 ? 10.471  5.562   -4.533  1.00 0.00 ? 43 VAL A N   8  
ATOM   4321 C  CA  . VAL A 1 43 ? 11.848  5.106   -4.613  1.00 0.00 ? 43 VAL A CA  8  
ATOM   4322 C  C   . VAL A 1 43 ? 12.161  4.702   -6.053  1.00 0.00 ? 43 VAL A C   8  
ATOM   4323 O  O   . VAL A 1 43 ? 13.203  5.076   -6.587  1.00 0.00 ? 43 VAL A O   8  
ATOM   4324 C  CB  . VAL A 1 43 ? 12.051  3.931   -3.641  1.00 0.00 ? 43 VAL A CB  8  
ATOM   4325 C  CG1 . VAL A 1 43 ? 13.481  3.378   -3.722  1.00 0.00 ? 43 VAL A CG1 8  
ATOM   4326 C  CG2 . VAL A 1 43 ? 11.780  4.319   -2.179  1.00 0.00 ? 43 VAL A CG2 8  
ATOM   4327 N  N   . GLN A 1 44 ? 11.287  3.898   -6.669  1.00 0.00 ? 44 GLN A N   8  
ATOM   4328 C  CA  . GLN A 1 44 ? 11.499  3.325   -7.988  1.00 0.00 ? 44 GLN A CA  8  
ATOM   4329 C  C   . GLN A 1 44 ? 10.155  3.136   -8.706  1.00 0.00 ? 44 GLN A C   8  
ATOM   4330 O  O   . GLN A 1 44 ? 9.185   3.809   -8.359  1.00 0.00 ? 44 GLN A O   8  
ATOM   4331 C  CB  . GLN A 1 44 ? 12.388  2.078   -7.855  1.00 0.00 ? 44 GLN A CB  8  
ATOM   4332 C  CG  . GLN A 1 44 ? 11.774  0.985   -6.976  1.00 0.00 ? 44 GLN A CG  8  
ATOM   4333 C  CD  . GLN A 1 44 ? 12.781  -0.090  -6.567  1.00 0.00 ? 44 GLN A CD  8  
ATOM   4334 O  OE1 . GLN A 1 44 ? 12.566  -1.279  -6.793  1.00 0.00 ? 44 GLN A OE1 8  
ATOM   4335 N  NE2 . GLN A 1 44 ? 13.890  0.299   -5.948  1.00 0.00 ? 44 GLN A NE2 8  
ATOM   4336 N  N   . ASP A 1 45 ? 10.108  2.258   -9.712  1.00 0.00 ? 45 ASP A N   8  
ATOM   4337 C  CA  . ASP A 1 45 ? 9.116   2.110   -10.775 1.00 0.00 ? 45 ASP A CA  8  
ATOM   4338 C  C   . ASP A 1 45 ? 7.699   1.838   -10.264 1.00 0.00 ? 45 ASP A C   8  
ATOM   4339 O  O   . ASP A 1 45 ? 7.148   0.753   -10.426 1.00 0.00 ? 45 ASP A O   8  
ATOM   4340 C  CB  . ASP A 1 45 ? 9.597   1.028   -11.759 1.00 0.00 ? 45 ASP A CB  8  
ATOM   4341 C  CG  . ASP A 1 45 ? 10.022  -0.260  -11.065 1.00 0.00 ? 45 ASP A CG  8  
ATOM   4342 O  OD1 . ASP A 1 45 ? 10.997  -0.180  -10.282 1.00 0.00 ? 45 ASP A OD1 8  
ATOM   4343 O  OD2 . ASP A 1 45 ? 9.410   -1.324  -11.295 1.00 0.00 ? 45 ASP A OD2 8  
ATOM   4344 N  N   . GLY A 1 46 ? 7.104   2.861   -9.659  1.00 0.00 ? 46 GLY A N   8  
ATOM   4345 C  CA  . GLY A 1 46 ? 5.792   2.783   -9.042  1.00 0.00 ? 46 GLY A CA  8  
ATOM   4346 C  C   . GLY A 1 46 ? 5.884   2.051   -7.706  1.00 0.00 ? 46 GLY A C   8  
ATOM   4347 O  O   . GLY A 1 46 ? 4.926   1.418   -7.277  1.00 0.00 ? 46 GLY A O   8  
ATOM   4348 N  N   . TRP A 1 47 ? 7.029   2.151   -7.027  1.00 0.00 ? 47 TRP A N   8  
ATOM   4349 C  CA  . TRP A 1 47 ? 7.250   1.633   -5.704  1.00 0.00 ? 47 TRP A CA  8  
ATOM   4350 C  C   . TRP A 1 47 ? 7.887   2.712   -4.857  1.00 0.00 ? 47 TRP A C   8  
ATOM   4351 O  O   . TRP A 1 47 ? 8.749   3.461   -5.329  1.00 0.00 ? 47 TRP A O   8  
ATOM   4352 C  CB  . TRP A 1 47 ? 8.191   0.445   -5.757  1.00 0.00 ? 47 TRP A CB  8  
ATOM   4353 C  CG  . TRP A 1 47 ? 7.717   -0.709  -6.564  1.00 0.00 ? 47 TRP A CG  8  
ATOM   4354 C  CD1 . TRP A 1 47 ? 7.893   -0.880  -7.890  1.00 0.00 ? 47 TRP A CD1 8  
ATOM   4355 C  CD2 . TRP A 1 47 ? 6.935   -1.842  -6.110  1.00 0.00 ? 47 TRP A CD2 8  
ATOM   4356 N  NE1 . TRP A 1 47 ? 7.199   -1.995  -8.302  1.00 0.00 ? 47 TRP A NE1 8  
ATOM   4357 C  CE2 . TRP A 1 47 ? 6.596   -2.636  -7.239  1.00 0.00 ? 47 TRP A CE2 8  
ATOM   4358 C  CE3 . TRP A 1 47 ? 6.507   -2.290  -4.846  1.00 0.00 ? 47 TRP A CE3 8  
ATOM   4359 C  CZ2 . TRP A 1 47 ? 5.819   -3.795  -7.125  1.00 0.00 ? 47 TRP A CZ2 8  
ATOM   4360 C  CZ3 . TRP A 1 47 ? 5.717   -3.445  -4.720  1.00 0.00 ? 47 TRP A CZ3 8  
ATOM   4361 C  CH2 . TRP A 1 47 ? 5.368   -4.190  -5.859  1.00 0.00 ? 47 TRP A CH2 8  
ATOM   4362 N  N   . GLY A 1 48 ? 7.491   2.750   -3.592  1.00 0.00 ? 48 GLY A N   8  
ATOM   4363 C  CA  . GLY A 1 48 ? 8.031   3.662   -2.627  1.00 0.00 ? 48 GLY A CA  8  
ATOM   4364 C  C   . GLY A 1 48 ? 7.922   3.085   -1.242  1.00 0.00 ? 48 GLY A C   8  
ATOM   4365 O  O   . GLY A 1 48 ? 7.330   2.029   -1.021  1.00 0.00 ? 48 GLY A O   8  
ATOM   4366 N  N   . ARG A 1 49 ? 8.523   3.781   -0.292  1.00 0.00 ? 49 ARG A N   8  
ATOM   4367 C  CA  . ARG A 1 49 ? 8.330   3.447   1.084   1.00 0.00 ? 49 ARG A CA  8  
ATOM   4368 C  C   . ARG A 1 49 ? 6.932   3.837   1.524   1.00 0.00 ? 49 ARG A C   8  
ATOM   4369 O  O   . ARG A 1 49 ? 6.535   4.989   1.390   1.00 0.00 ? 49 ARG A O   8  
ATOM   4370 C  CB  . ARG A 1 49 ? 9.399   4.138   1.902   1.00 0.00 ? 49 ARG A CB  8  
ATOM   4371 C  CG  . ARG A 1 49 ? 10.747  3.546   1.538   1.00 0.00 ? 49 ARG A CG  8  
ATOM   4372 C  CD  . ARG A 1 49 ? 10.947  2.101   1.961   1.00 0.00 ? 49 ARG A CD  8  
ATOM   4373 N  NE  . ARG A 1 49 ? 11.803  1.975   3.115   1.00 0.00 ? 49 ARG A NE  8  
ATOM   4374 C  CZ  . ARG A 1 49 ? 11.366  1.761   4.352   1.00 0.00 ? 49 ARG A CZ  8  
ATOM   4375 N  NH1 . ARG A 1 49 ? 10.135  2.066   4.780   1.00 0.00 ? 49 ARG A NH1 8  
ATOM   4376 N  NH2 . ARG A 1 49 ? 12.208  1.185   5.183   1.00 0.00 ? 49 ARG A NH2 8  
ATOM   4377 N  N   . CYS A 1 50 ? 6.253   2.861   2.107   1.00 0.00 ? 50 CYS A N   8  
ATOM   4378 C  CA  . CYS A 1 50 ? 5.383   3.061   3.246   1.00 0.00 ? 50 CYS A CA  8  
ATOM   4379 C  C   . CYS A 1 50 ? 6.316   3.004   4.467   1.00 0.00 ? 50 CYS A C   8  
ATOM   4380 O  O   . CYS A 1 50 ? 7.501   2.660   4.323   1.00 0.00 ? 50 CYS A O   8  
ATOM   4381 C  CB  . CYS A 1 50 ? 4.345   1.967   3.212   1.00 0.00 ? 50 CYS A CB  8  
ATOM   4382 S  SG  . CYS A 1 50 ? 3.171   2.070   4.578   1.00 0.00 ? 50 CYS A SG  8  
ATOM   4383 N  N   . THR A 1 51 ? 5.827   3.404   5.638   1.00 0.00 ? 51 THR A N   8  
ATOM   4384 C  CA  . THR A 1 51 ? 6.557   3.325   6.891   1.00 0.00 ? 51 THR A CA  8  
ATOM   4385 C  C   . THR A 1 51 ? 5.710   2.601   7.935   1.00 0.00 ? 51 THR A C   8  
ATOM   4386 O  O   . THR A 1 51 ? 4.487   2.526   7.793   1.00 0.00 ? 51 THR A O   8  
ATOM   4387 C  CB  . THR A 1 51 ? 6.890   4.746   7.368   1.00 0.00 ? 51 THR A CB  8  
ATOM   4388 O  OG1 . THR A 1 51 ? 5.701   5.502   7.516   1.00 0.00 ? 51 THR A OG1 8  
ATOM   4389 C  CG2 . THR A 1 51 ? 7.821   5.468   6.390   1.00 0.00 ? 51 THR A CG2 8  
ATOM   4390 N  N   . HIS A 1 52 ? 6.356   2.196   9.035   1.00 0.00 ? 52 HIS A N   8  
ATOM   4391 C  CA  . HIS A 1 52 ? 5.819   1.595   10.256  1.00 0.00 ? 52 HIS A CA  8  
ATOM   4392 C  C   . HIS A 1 52 ? 5.888   0.068   10.130  1.00 0.00 ? 52 HIS A C   8  
ATOM   4393 O  O   . HIS A 1 52 ? 5.293   -0.466  9.196   1.00 0.00 ? 52 HIS A O   8  
ATOM   4394 C  CB  . HIS A 1 52 ? 4.396   2.054   10.625  1.00 0.00 ? 52 HIS A CB  8  
ATOM   4395 C  CG  . HIS A 1 52 ? 4.201   3.552   10.681  1.00 0.00 ? 52 HIS A CG  8  
ATOM   4396 N  ND1 . HIS A 1 52 ? 3.858   4.351   9.609   1.00 0.00 ? 52 HIS A ND1 8  
ATOM   4397 C  CD2 . HIS A 1 52 ? 4.333   4.356   11.780  1.00 0.00 ? 52 HIS A CD2 8  
ATOM   4398 C  CE1 . HIS A 1 52 ? 3.792   5.622   10.037  1.00 0.00 ? 52 HIS A CE1 8  
ATOM   4399 N  NE2 . HIS A 1 52 ? 4.073   5.648   11.355  1.00 0.00 ? 52 HIS A NE2 8  
ATOM   4400 N  N   . PRO A 1 53 ? 6.609   -0.638  11.024  1.00 0.00 ? 53 PRO A N   8  
ATOM   4401 C  CA  . PRO A 1 53 ? 6.825   -2.073  10.901  1.00 0.00 ? 53 PRO A CA  8  
ATOM   4402 C  C   . PRO A 1 53 ? 5.501   -2.823  10.751  1.00 0.00 ? 53 PRO A C   8  
ATOM   4403 O  O   . PRO A 1 53 ? 4.571   -2.562  11.511  1.00 0.00 ? 53 PRO A O   8  
ATOM   4404 C  CB  . PRO A 1 53 ? 7.625   -2.517  12.132  1.00 0.00 ? 53 PRO A CB  8  
ATOM   4405 C  CG  . PRO A 1 53 ? 7.634   -1.307  13.070  1.00 0.00 ? 53 PRO A CG  8  
ATOM   4406 C  CD  . PRO A 1 53 ? 7.312   -0.109  12.179  1.00 0.00 ? 53 PRO A CD  8  
ATOM   4407 N  N   . ASP A 1 54 ? 5.451   -3.685  9.730   1.00 0.00 ? 54 ASP A N   8  
ATOM   4408 C  CA  . ASP A 1 54 ? 4.311   -4.286  9.036   1.00 0.00 ? 54 ASP A CA  8  
ATOM   4409 C  C   . ASP A 1 54 ? 4.417   -3.822  7.586   1.00 0.00 ? 54 ASP A C   8  
ATOM   4410 O  O   . ASP A 1 54 ? 4.270   -4.616  6.658   1.00 0.00 ? 54 ASP A O   8  
ATOM   4411 C  CB  . ASP A 1 54 ? 2.922   -3.909  9.581   1.00 0.00 ? 54 ASP A CB  8  
ATOM   4412 C  CG  . ASP A 1 54 ? 2.509   -4.661  10.838  1.00 0.00 ? 54 ASP A CG  8  
ATOM   4413 O  OD1 . ASP A 1 54 ? 2.997   -5.789  11.053  1.00 0.00 ? 54 ASP A OD1 8  
ATOM   4414 O  OD2 . ASP A 1 54 ? 1.571   -4.147  11.491  1.00 0.00 ? 54 ASP A OD2 8  
ATOM   4415 N  N   . PHE A 1 55 ? 4.667   -2.520  7.414   1.00 0.00 ? 55 PHE A N   8  
ATOM   4416 C  CA  . PHE A 1 55 ? 4.863   -1.864  6.135   1.00 0.00 ? 55 PHE A CA  8  
ATOM   4417 C  C   . PHE A 1 55 ? 6.087   -0.952  6.194   1.00 0.00 ? 55 PHE A C   8  
ATOM   4418 O  O   . PHE A 1 55 ? 6.014   0.220   5.830   1.00 0.00 ? 55 PHE A O   8  
ATOM   4419 C  CB  . PHE A 1 55 ? 3.584   -1.106  5.763   1.00 0.00 ? 55 PHE A CB  8  
ATOM   4420 C  CG  . PHE A 1 55 ? 2.399   -2.015  5.525   1.00 0.00 ? 55 PHE A CG  8  
ATOM   4421 C  CD1 . PHE A 1 55 ? 2.485   -2.940  4.466   1.00 0.00 ? 55 PHE A CD1 8  
ATOM   4422 C  CD2 . PHE A 1 55 ? 1.233   -1.962  6.321   1.00 0.00 ? 55 PHE A CD2 8  
ATOM   4423 C  CE1 . PHE A 1 55 ? 1.447   -3.851  4.234   1.00 0.00 ? 55 PHE A CE1 8  
ATOM   4424 C  CE2 . PHE A 1 55 ? 0.184   -2.850  6.057   1.00 0.00 ? 55 PHE A CE2 8  
ATOM   4425 C  CZ  . PHE A 1 55 ? 0.297   -3.806  5.033   1.00 0.00 ? 55 PHE A CZ  8  
ATOM   4426 N  N   . ASP A 1 56 ? 7.223   -1.504  6.627   1.00 0.00 ? 56 ASP A N   8  
ATOM   4427 C  CA  . ASP A 1 56 ? 8.520   -0.829  6.593   1.00 0.00 ? 56 ASP A CA  8  
ATOM   4428 C  C   . ASP A 1 56 ? 9.589   -1.756  6.005   1.00 0.00 ? 56 ASP A C   8  
ATOM   4429 O  O   . ASP A 1 56 ? 10.430  -1.331  5.214   1.00 0.00 ? 56 ASP A O   8  
ATOM   4430 C  CB  . ASP A 1 56 ? 8.892   -0.355  8.006   1.00 0.00 ? 56 ASP A CB  8  
ATOM   4431 C  CG  . ASP A 1 56 ? 9.551   1.011   7.973   1.00 0.00 ? 56 ASP A CG  8  
ATOM   4432 O  OD1 . ASP A 1 56 ? 10.525  1.155   7.201   1.00 0.00 ? 56 ASP A OD1 8  
ATOM   4433 O  OD2 . ASP A 1 56 ? 9.019   1.918   8.651   1.00 0.00 ? 56 ASP A OD2 8  
ATOM   4434 N  N   . GLU A 1 57 ? 9.529   -3.034  6.392   1.00 0.00 ? 57 GLU A N   8  
ATOM   4435 C  CA  . GLU A 1 57 ? 10.422  -4.110  5.973   1.00 0.00 ? 57 GLU A CA  8  
ATOM   4436 C  C   . GLU A 1 57 ? 10.542  -4.208  4.448   1.00 0.00 ? 57 GLU A C   8  
ATOM   4437 O  O   . GLU A 1 57 ? 11.613  -4.500  3.922   1.00 0.00 ? 57 GLU A O   8  
ATOM   4438 C  CB  . GLU A 1 57 ? 9.940   -5.481  6.501   1.00 0.00 ? 57 GLU A CB  8  
ATOM   4439 C  CG  . GLU A 1 57 ? 9.179   -5.475  7.836   1.00 0.00 ? 57 GLU A CG  8  
ATOM   4440 C  CD  . GLU A 1 57 ? 7.721   -5.093  7.642   1.00 0.00 ? 57 GLU A CD  8  
ATOM   4441 O  OE1 . GLU A 1 57 ? 6.941   -5.954  7.184   1.00 0.00 ? 57 GLU A OE1 8  
ATOM   4442 O  OE2 . GLU A 1 57 ? 7.426   -3.901  7.889   1.00 0.00 ? 57 GLU A OE2 8  
ATOM   4443 N  N   . VAL A 1 58 ? 9.407   -4.055  3.762   1.00 0.00 ? 58 VAL A N   8  
ATOM   4444 C  CA  . VAL A 1 58 ? 9.257   -4.237  2.326   1.00 0.00 ? 58 VAL A CA  8  
ATOM   4445 C  C   . VAL A 1 58 ? 8.900   -2.902  1.680   1.00 0.00 ? 58 VAL A C   8  
ATOM   4446 O  O   . VAL A 1 58 ? 8.318   -2.031  2.329   1.00 0.00 ? 58 VAL A O   8  
ATOM   4447 C  CB  . VAL A 1 58 ? 8.190   -5.304  2.033   1.00 0.00 ? 58 VAL A CB  8  
ATOM   4448 C  CG1 . VAL A 1 58 ? 8.712   -6.697  2.399   1.00 0.00 ? 58 VAL A CG1 8  
ATOM   4449 C  CG2 . VAL A 1 58 ? 6.865   -5.042  2.765   1.00 0.00 ? 58 VAL A CG2 8  
ATOM   4450 N  N   . LEU A 1 59 ? 9.242   -2.737  0.402   1.00 0.00 ? 59 LEU A N   8  
ATOM   4451 C  CA  . LEU A 1 59 ? 8.916   -1.560  -0.366  1.00 0.00 ? 59 LEU A CA  8  
ATOM   4452 C  C   . LEU A 1 59 ? 7.514   -1.733  -0.937  1.00 0.00 ? 59 LEU A C   8  
ATOM   4453 O  O   . LEU A 1 59 ? 7.170   -2.811  -1.416  1.00 0.00 ? 59 LEU A O   8  
ATOM   4454 C  CB  . LEU A 1 59 ? 9.965   -1.410  -1.466  1.00 0.00 ? 59 LEU A CB  8  
ATOM   4455 C  CG  . LEU A 1 59 ? 9.924   -0.043  -2.142  1.00 0.00 ? 59 LEU A CG  8  
ATOM   4456 C  CD1 . LEU A 1 59 ? 10.421  1.048   -1.197  1.00 0.00 ? 59 LEU A CD1 8  
ATOM   4457 C  CD2 . LEU A 1 59 ? 10.870  -0.067  -3.339  1.00 0.00 ? 59 LEU A CD2 8  
ATOM   4458 N  N   . VAL A 1 60 ? 6.697   -0.689  -0.870  1.00 0.00 ? 60 VAL A N   8  
ATOM   4459 C  CA  . VAL A 1 60 ? 5.274   -0.767  -1.127  1.00 0.00 ? 60 VAL A CA  8  
ATOM   4460 C  C   . VAL A 1 60 ? 4.981   -0.164  -2.495  1.00 0.00 ? 60 VAL A C   8  
ATOM   4461 O  O   . VAL A 1 60 ? 5.525   0.879   -2.854  1.00 0.00 ? 60 VAL A O   8  
ATOM   4462 C  CB  . VAL A 1 60 ? 4.563   -0.065  0.038   1.00 0.00 ? 60 VAL A CB  8  
ATOM   4463 C  CG1 . VAL A 1 60 ? 3.110   0.259   -0.278  1.00 0.00 ? 60 VAL A CG1 8  
ATOM   4464 C  CG2 . VAL A 1 60 ? 4.617   -0.985  1.268   1.00 0.00 ? 60 VAL A CG2 8  
ATOM   4465 N  N   . LYS A 1 61 ? 4.157   -0.839  -3.295  1.00 0.00 ? 61 LYS A N   8  
ATOM   4466 C  CA  . LYS A 1 61 ? 3.764   -0.317  -4.588  1.00 0.00 ? 61 LYS A CA  8  
ATOM   4467 C  C   . LYS A 1 61 ? 2.970   0.964   -4.366  1.00 0.00 ? 61 LYS A C   8  
ATOM   4468 O  O   . LYS A 1 61 ? 2.027   0.970   -3.582  1.00 0.00 ? 61 LYS A O   8  
ATOM   4469 C  CB  . LYS A 1 61 ? 2.910   -1.374  -5.288  1.00 0.00 ? 61 LYS A CB  8  
ATOM   4470 C  CG  . LYS A 1 61 ? 2.821   -1.126  -6.791  1.00 0.00 ? 61 LYS A CG  8  
ATOM   4471 C  CD  . LYS A 1 61 ? 2.551   -2.428  -7.555  1.00 0.00 ? 61 LYS A CD  8  
ATOM   4472 C  CE  . LYS A 1 61 ? 2.696   -2.207  -9.062  1.00 0.00 ? 61 LYS A CE  8  
ATOM   4473 N  NZ  . LYS A 1 61 ? 1.785   -1.133  -9.526  1.00 0.00 ? 61 LYS A NZ  8  
ATOM   4474 N  N   . ALA A 1 62 ? 3.338   2.034   -5.061  1.00 0.00 ? 62 ALA A N   8  
ATOM   4475 C  CA  . ALA A 1 62 ? 2.643   3.314   -4.983  1.00 0.00 ? 62 ALA A CA  8  
ATOM   4476 C  C   . ALA A 1 62 ? 1.148   3.162   -5.267  1.00 0.00 ? 62 ALA A C   8  
ATOM   4477 O  O   . ALA A 1 62 ? 0.336   3.787   -4.578  1.00 0.00 ? 62 ALA A O   8  
ATOM   4478 C  CB  . ALA A 1 62 ? 3.306   4.304   -5.927  1.00 0.00 ? 62 ALA A CB  8  
ATOM   4479 N  N   . GLU A 1 63 ? 0.773   2.324   -6.246  1.00 0.00 ? 63 GLU A N   8  
ATOM   4480 C  CA  . GLU A 1 63 ? -0.631  2.061   -6.509  1.00 0.00 ? 63 GLU A CA  8  
ATOM   4481 C  C   . GLU A 1 63 ? -1.242  1.001   -5.595  1.00 0.00 ? 63 GLU A C   8  
ATOM   4482 O  O   . GLU A 1 63 ? -2.407  0.672   -5.796  1.00 0.00 ? 63 GLU A O   8  
ATOM   4483 C  CB  . GLU A 1 63 ? -0.890  1.663   -7.964  1.00 0.00 ? 63 GLU A CB  8  
ATOM   4484 C  CG  . GLU A 1 63 ? -0.126  2.511   -8.981  1.00 0.00 ? 63 GLU A CG  8  
ATOM   4485 C  CD  . GLU A 1 63 ? 1.105   1.739   -9.432  1.00 0.00 ? 63 GLU A CD  8  
ATOM   4486 O  OE1 . GLU A 1 63 ? 1.901   1.364   -8.542  1.00 0.00 ? 63 GLU A OE1 8  
ATOM   4487 O  OE2 . GLU A 1 63 ? 1.179   1.337   -10.611 1.00 0.00 ? 63 GLU A OE2 8  
ATOM   4488 N  N   . GLY A 1 64 ? -0.500  0.430   -4.645  1.00 0.00 ? 64 GLY A N   8  
ATOM   4489 C  CA  . GLY A 1 64 ? -1.044  -0.571  -3.741  1.00 0.00 ? 64 GLY A CA  8  
ATOM   4490 C  C   . GLY A 1 64 ? -2.005  0.039   -2.735  1.00 0.00 ? 64 GLY A C   8  
ATOM   4491 O  O   . GLY A 1 64 ? -2.359  1.215   -2.821  1.00 0.00 ? 64 GLY A O   8  
ATOM   4492 N  N   . TRP A 1 65 ? -2.456  -0.785  -1.788  1.00 0.00 ? 65 TRP A N   8  
ATOM   4493 C  CA  . TRP A 1 65 ? -3.286  -0.342  -0.684  1.00 0.00 ? 65 TRP A CA  8  
ATOM   4494 C  C   . TRP A 1 65 ? -3.266  -1.429  0.378   1.00 0.00 ? 65 TRP A C   8  
ATOM   4495 O  O   . TRP A 1 65 ? -3.135  -2.602  0.025   1.00 0.00 ? 65 TRP A O   8  
ATOM   4496 C  CB  . TRP A 1 65 ? -4.713  -0.107  -1.175  1.00 0.00 ? 65 TRP A CB  8  
ATOM   4497 C  CG  . TRP A 1 65 ? -5.682  0.348   -0.133  1.00 0.00 ? 65 TRP A CG  8  
ATOM   4498 C  CD1 . TRP A 1 65 ? -6.013  1.632   0.117   1.00 0.00 ? 65 TRP A CD1 8  
ATOM   4499 C  CD2 . TRP A 1 65 ? -6.518  -0.466  0.740   1.00 0.00 ? 65 TRP A CD2 8  
ATOM   4500 N  NE1 . TRP A 1 65 ? -7.058  1.669   1.016   1.00 0.00 ? 65 TRP A NE1 8  
ATOM   4501 C  CE2 . TRP A 1 65 ? -7.434  0.400   1.405   1.00 0.00 ? 65 TRP A CE2 8  
ATOM   4502 C  CE3 . TRP A 1 65 ? -6.667  -1.853  0.959   1.00 0.00 ? 65 TRP A CE3 8  
ATOM   4503 C  CZ2 . TRP A 1 65 ? -8.482  -0.086  2.195   1.00 0.00 ? 65 TRP A CZ2 8  
ATOM   4504 C  CZ3 . TRP A 1 65 ? -7.680  -2.351  1.799   1.00 0.00 ? 65 TRP A CZ3 8  
ATOM   4505 C  CH2 . TRP A 1 65 ? -8.604  -1.473  2.389   1.00 0.00 ? 65 TRP A CH2 8  
ATOM   4506 N  N   . CYS A 1 66 ? -3.422  -1.037  1.650   1.00 0.00 ? 66 CYS A N   8  
ATOM   4507 C  CA  . CYS A 1 66 ? -3.549  -1.929  2.791   1.00 0.00 ? 66 CYS A CA  8  
ATOM   4508 C  C   . CYS A 1 66 ? -4.673  -1.456  3.718   1.00 0.00 ? 66 CYS A C   8  
ATOM   4509 O  O   . CYS A 1 66 ? -5.117  -0.306  3.649   1.00 0.00 ? 66 CYS A O   8  
ATOM   4510 C  CB  . CYS A 1 66 ? -2.242  -2.047  3.534   1.00 0.00 ? 66 CYS A CB  8  
ATOM   4511 S  SG  . CYS A 1 66 ? -1.997  -0.680  4.691   1.00 0.00 ? 66 CYS A SG  8  
ATOM   4512 N  N   . SER A 1 67 ? -5.143  -2.336  4.605   1.00 0.00 ? 67 SER A N   8  
ATOM   4513 C  CA  . SER A 1 67 ? -6.260  -2.012  5.477   1.00 0.00 ? 67 SER A CA  8  
ATOM   4514 C  C   . SER A 1 67 ? -5.905  -0.941  6.511   1.00 0.00 ? 67 SER A C   8  
ATOM   4515 O  O   . SER A 1 67 ? -6.817  -0.264  6.993   1.00 0.00 ? 67 SER A O   8  
ATOM   4516 C  CB  . SER A 1 67 ? -6.845  -3.279  6.105   1.00 0.00 ? 67 SER A CB  8  
ATOM   4517 O  OG  . SER A 1 67 ? -5.892  -3.972  6.881   1.00 0.00 ? 67 SER A OG  8  
ATOM   4518 N  N   . VAL A 1 68 ? -4.615  -0.738  6.830   1.00 0.00 ? 68 VAL A N   8  
ATOM   4519 C  CA  . VAL A 1 68 ? -4.215  0.344   7.733   1.00 0.00 ? 68 VAL A CA  8  
ATOM   4520 C  C   . VAL A 1 68 ? -4.242  1.719   7.057   1.00 0.00 ? 68 VAL A C   8  
ATOM   4521 O  O   . VAL A 1 68 ? -4.020  2.713   7.741   1.00 0.00 ? 68 VAL A O   8  
ATOM   4522 C  CB  . VAL A 1 68 ? -2.937  0.092   8.559   1.00 0.00 ? 68 VAL A CB  8  
ATOM   4523 C  CG1 . VAL A 1 68 ? -2.845  -1.373  8.920   1.00 0.00 ? 68 VAL A CG1 8  
ATOM   4524 C  CG2 . VAL A 1 68 ? -1.562  0.497   8.030   1.00 0.00 ? 68 VAL A CG2 8  
ATOM   4525 N  N   . TYR A 1 69 ? -4.519  1.789   5.743   1.00 0.00 ? 69 TYR A N   8  
ATOM   4526 C  CA  . TYR A 1 69 ? -4.598  3.050   5.008   1.00 0.00 ? 69 TYR A CA  8  
ATOM   4527 C  C   . TYR A 1 69 ? -5.349  4.123   5.800   1.00 0.00 ? 69 TYR A C   8  
ATOM   4528 O  O   . TYR A 1 69 ? -6.506  3.911   6.172   1.00 0.00 ? 69 TYR A O   8  
ATOM   4529 C  CB  . TYR A 1 69 ? -5.286  2.841   3.650   1.00 0.00 ? 69 TYR A CB  8  
ATOM   4530 C  CG  . TYR A 1 69 ? -5.472  4.119   2.846   1.00 0.00 ? 69 TYR A CG  8  
ATOM   4531 C  CD1 . TYR A 1 69 ? -6.529  4.994   3.153   1.00 0.00 ? 69 TYR A CD1 8  
ATOM   4532 C  CD2 . TYR A 1 69 ? -4.555  4.478   1.843   1.00 0.00 ? 69 TYR A CD2 8  
ATOM   4533 C  CE1 . TYR A 1 69 ? -6.646  6.225   2.496   1.00 0.00 ? 69 TYR A CE1 8  
ATOM   4534 C  CE2 . TYR A 1 69 ? -4.686  5.705   1.169   1.00 0.00 ? 69 TYR A CE2 8  
ATOM   4535 C  CZ  . TYR A 1 69 ? -5.734  6.576   1.493   1.00 0.00 ? 69 TYR A CZ  8  
ATOM   4536 O  OH  . TYR A 1 69 ? -5.940  7.711   0.768   1.00 0.00 ? 69 TYR A OH  8  
ATOM   4537 N  N   . ALA A 1 70 ? -4.727  5.287   5.981   1.00 0.00 ? 70 ALA A N   8  
ATOM   4538 C  CA  . ALA A 1 70 ? -5.375  6.508   6.431   1.00 0.00 ? 70 ALA A CA  8  
ATOM   4539 C  C   . ALA A 1 70 ? -5.007  7.570   5.397   1.00 0.00 ? 70 ALA A C   8  
ATOM   4540 O  O   . ALA A 1 70 ? -3.846  7.602   4.995   1.00 0.00 ? 70 ALA A O   8  
ATOM   4541 C  CB  . ALA A 1 70 ? -4.853  6.884   7.820   1.00 0.00 ? 70 ALA A CB  8  
ATOM   4542 N  N   . PRO A 1 71 ? -5.946  8.392   4.914   1.00 0.00 ? 71 PRO A N   8  
ATOM   4543 C  CA  . PRO A 1 71 ? -5.653  9.344   3.858   1.00 0.00 ? 71 PRO A CA  8  
ATOM   4544 C  C   . PRO A 1 71 ? -4.753  10.458  4.363   1.00 0.00 ? 71 PRO A C   8  
ATOM   4545 O  O   . PRO A 1 71 ? -4.808  10.832  5.532   1.00 0.00 ? 71 PRO A O   8  
ATOM   4546 C  CB  . PRO A 1 71 ? -7.008  9.880   3.394   1.00 0.00 ? 71 PRO A CB  8  
ATOM   4547 C  CG  . PRO A 1 71 ? -7.884  9.735   4.641   1.00 0.00 ? 71 PRO A CG  8  
ATOM   4548 C  CD  . PRO A 1 71 ? -7.335  8.483   5.328   1.00 0.00 ? 71 PRO A CD  8  
ATOM   4549 N  N   . ALA A 1 72 ? -3.941  11.001  3.456   1.00 0.00 ? 72 ALA A N   8  
ATOM   4550 C  CA  . ALA A 1 72 ? -3.129  12.175  3.720   1.00 0.00 ? 72 ALA A CA  8  
ATOM   4551 C  C   . ALA A 1 72 ? -3.846  13.425  3.213   1.00 0.00 ? 72 ALA A C   8  
ATOM   4552 O  O   . ALA A 1 72 ? -3.247  14.307  2.601   1.00 0.00 ? 72 ALA A O   8  
ATOM   4553 C  CB  . ALA A 1 72 ? -1.779  11.999  3.048   1.00 0.00 ? 72 ALA A CB  8  
ATOM   4554 N  N   . SER A 1 73 ? -5.151  13.469  3.442   1.00 0.00 ? 73 SER A N   8  
ATOM   4555 C  CA  . SER A 1 73 ? -6.078  14.533  3.115   1.00 0.00 ? 73 SER A CA  8  
ATOM   4556 C  C   . SER A 1 73 ? -7.350  14.243  3.908   1.00 0.00 ? 73 SER A C   8  
ATOM   4557 O  O   . SER A 1 73 ? -8.231  15.128  3.925   1.00 0.00 ? 73 SER A O   8  
ATOM   4558 C  CB  . SER A 1 73 ? -6.391  14.553  1.615   1.00 0.00 ? 73 SER A CB  8  
ATOM   4559 O  OG  . SER A 1 73 ? -5.279  14.981  0.851   1.00 0.00 ? 73 SER A OG  8  
ATOM   4560 O  OXT . SER A 1 73 ? -7.416  13.120  4.460   1.00 0.00 ? 73 SER A OXT 8  
HETATM 4561 FE FE1 . SF4 B 2 .  ? 0.025   1.668   1.644   1.00 0.00 ? 74 SF4 A FE1 8  
HETATM 4562 FE FE2 . SF4 B 2 .  ? -0.686  3.217   3.477   1.00 0.00 ? 74 SF4 A FE2 8  
HETATM 4563 FE FE3 . SF4 B 2 .  ? 1.356   1.898   3.738   1.00 0.00 ? 74 SF4 A FE3 8  
HETATM 4564 FE FE4 . SF4 B 2 .  ? -0.863  0.755   3.781   1.00 0.00 ? 74 SF4 A FE4 8  
HETATM 4565 S  S1  . SF4 B 2 .  ? -0.150  2.159   5.242   1.00 0.00 ? 74 SF4 A S1  8  
HETATM 4566 S  S2  . SF4 B 2 .  ? 0.897   0.022   2.764   1.00 0.00 ? 74 SF4 A S2  8  
HETATM 4567 S  S3  . SF4 B 2 .  ? -2.000  1.913   2.372   1.00 0.00 ? 74 SF4 A S3  8  
HETATM 4568 S  S4  . SF4 B 2 .  ? 1.087   3.428   2.270   1.00 0.00 ? 74 SF4 A S4  8  
ATOM   4569 N  N   . ALA A 1 1  ? 14.989  -1.446  6.840   1.00 0.00 ? 1  ALA A N   9  
ATOM   4570 C  CA  . ALA A 1 1  ? 14.787  -1.078  5.450   1.00 0.00 ? 1  ALA A CA  9  
ATOM   4571 C  C   . ALA A 1 1  ? 15.323  -2.175  4.529   1.00 0.00 ? 1  ALA A C   9  
ATOM   4572 O  O   . ALA A 1 1  ? 15.140  -3.349  4.838   1.00 0.00 ? 1  ALA A O   9  
ATOM   4573 C  CB  . ALA A 1 1  ? 15.327  0.321   5.137   1.00 0.00 ? 1  ALA A CB  9  
ATOM   4574 N  N   . SER A 1 2  ? 15.992  -1.805  3.432   1.00 0.00 ? 2  SER A N   9  
ATOM   4575 C  CA  . SER A 1 2  ? 16.661  -2.722  2.514   1.00 0.00 ? 2  SER A CA  9  
ATOM   4576 C  C   . SER A 1 2  ? 15.625  -3.657  1.897   1.00 0.00 ? 2  SER A C   9  
ATOM   4577 O  O   . SER A 1 2  ? 15.746  -4.878  1.971   1.00 0.00 ? 2  SER A O   9  
ATOM   4578 C  CB  . SER A 1 2  ? 17.792  -3.472  3.230   1.00 0.00 ? 2  SER A CB  9  
ATOM   4579 O  OG  . SER A 1 2  ? 18.652  -2.541  3.863   1.00 0.00 ? 2  SER A OG  9  
ATOM   4580 N  N   . GLU A 1 3  ? 14.572  -3.054  1.349   1.00 0.00 ? 3  GLU A N   9  
ATOM   4581 C  CA  . GLU A 1 3  ? 13.253  -3.654  1.312   1.00 0.00 ? 3  GLU A CA  9  
ATOM   4582 C  C   . GLU A 1 3  ? 12.883  -4.202  -0.082  1.00 0.00 ? 3  GLU A C   9  
ATOM   4583 O  O   . GLU A 1 3  ? 12.785  -3.428  -1.032  1.00 0.00 ? 3  GLU A O   9  
ATOM   4584 C  CB  . GLU A 1 3  ? 12.246  -2.626  1.851   1.00 0.00 ? 3  GLU A CB  9  
ATOM   4585 C  CG  . GLU A 1 3  ? 12.394  -1.179  1.350   1.00 0.00 ? 3  GLU A CG  9  
ATOM   4586 C  CD  . GLU A 1 3  ? 13.388  -0.355  2.145   1.00 0.00 ? 3  GLU A CD  9  
ATOM   4587 O  OE1 . GLU A 1 3  ? 12.983  0.161   3.210   1.00 0.00 ? 3  GLU A OE1 9  
ATOM   4588 O  OE2 . GLU A 1 3  ? 14.574  -0.344  1.760   1.00 0.00 ? 3  GLU A OE2 9  
ATOM   4589 N  N   . PRO A 1 4  ? 12.647  -5.521  -0.236  1.00 0.00 ? 4  PRO A N   9  
ATOM   4590 C  CA  . PRO A 1 4  ? 12.096  -6.081  -1.464  1.00 0.00 ? 4  PRO A CA  9  
ATOM   4591 C  C   . PRO A 1 4  ? 10.667  -5.581  -1.695  1.00 0.00 ? 4  PRO A C   9  
ATOM   4592 O  O   . PRO A 1 4  ? 9.967   -5.261  -0.740  1.00 0.00 ? 4  PRO A O   9  
ATOM   4593 C  CB  . PRO A 1 4  ? 12.080  -7.607  -1.278  1.00 0.00 ? 4  PRO A CB  9  
ATOM   4594 C  CG  . PRO A 1 4  ? 12.920  -7.871  -0.028  1.00 0.00 ? 4  PRO A CG  9  
ATOM   4595 C  CD  . PRO A 1 4  ? 12.846  -6.564  0.758   1.00 0.00 ? 4  PRO A CD  9  
ATOM   4596 N  N   . ARG A 1 5  ? 10.209  -5.556  -2.949  1.00 0.00 ? 5  ARG A N   9  
ATOM   4597 C  CA  . ARG A 1 5  ? 8.835   -5.260  -3.317  1.00 0.00 ? 5  ARG A CA  9  
ATOM   4598 C  C   . ARG A 1 5  ? 7.859   -6.197  -2.588  1.00 0.00 ? 5  ARG A C   9  
ATOM   4599 O  O   . ARG A 1 5  ? 8.023   -7.415  -2.649  1.00 0.00 ? 5  ARG A O   9  
ATOM   4600 C  CB  . ARG A 1 5  ? 8.768   -5.439  -4.834  1.00 0.00 ? 5  ARG A CB  9  
ATOM   4601 C  CG  . ARG A 1 5  ? 9.602   -4.380  -5.519  1.00 0.00 ? 5  ARG A CG  9  
ATOM   4602 C  CD  . ARG A 1 5  ? 9.735   -4.841  -6.963  1.00 0.00 ? 5  ARG A CD  9  
ATOM   4603 N  NE  . ARG A 1 5  ? 10.883  -4.161  -7.513  1.00 0.00 ? 5  ARG A NE  9  
ATOM   4604 C  CZ  . ARG A 1 5  ? 10.891  -3.340  -8.573  1.00 0.00 ? 5  ARG A CZ  9  
ATOM   4605 N  NH1 . ARG A 1 5  ? 9.937   -3.441  -9.500  1.00 0.00 ? 5  ARG A NH1 9  
ATOM   4606 N  NH2 . ARG A 1 5  ? 11.843  -2.419  -8.683  1.00 0.00 ? 5  ARG A NH2 9  
ATOM   4607 N  N   . ALA A 1 6  ? 6.879   -5.629  -1.883  1.00 0.00 ? 6  ALA A N   9  
ATOM   4608 C  CA  . ALA A 1 6  ? 5.968   -6.348  -1.004  1.00 0.00 ? 6  ALA A CA  9  
ATOM   4609 C  C   . ALA A 1 6  ? 5.101   -7.373  -1.731  1.00 0.00 ? 6  ALA A C   9  
ATOM   4610 O  O   . ALA A 1 6  ? 4.773   -7.226  -2.909  1.00 0.00 ? 6  ALA A O   9  
ATOM   4611 C  CB  . ALA A 1 6  ? 5.089   -5.344  -0.253  1.00 0.00 ? 6  ALA A CB  9  
ATOM   4612 N  N   . GLU A 1 7  ? 4.704   -8.405  -0.988  1.00 0.00 ? 7  GLU A N   9  
ATOM   4613 C  CA  . GLU A 1 7  ? 3.916   -9.521  -1.457  1.00 0.00 ? 7  GLU A CA  9  
ATOM   4614 C  C   . GLU A 1 7  ? 2.449   -9.142  -1.397  1.00 0.00 ? 7  GLU A C   9  
ATOM   4615 O  O   . GLU A 1 7  ? 2.005   -8.522  -0.430  1.00 0.00 ? 7  GLU A O   9  
ATOM   4616 C  CB  . GLU A 1 7  ? 4.125   -10.751 -0.575  1.00 0.00 ? 7  GLU A CB  9  
ATOM   4617 C  CG  . GLU A 1 7  ? 5.576   -10.920 -0.123  1.00 0.00 ? 7  GLU A CG  9  
ATOM   4618 C  CD  . GLU A 1 7  ? 5.817   -10.257 1.231   1.00 0.00 ? 7  GLU A CD  9  
ATOM   4619 O  OE1 . GLU A 1 7  ? 5.971   -9.020  1.257   1.00 0.00 ? 7  GLU A OE1 9  
ATOM   4620 O  OE2 . GLU A 1 7  ? 5.729   -10.932 2.278   1.00 0.00 ? 7  GLU A OE2 9  
ATOM   4621 N  N   . ASP A 1 8  ? 1.678   -9.601  -2.373  1.00 0.00 ? 8  ASP A N   9  
ATOM   4622 C  CA  . ASP A 1 8  ? 0.240   -9.541  -2.299  1.00 0.00 ? 8  ASP A CA  9  
ATOM   4623 C  C   . ASP A 1 8  ? -0.185  -10.417 -1.124  1.00 0.00 ? 8  ASP A C   9  
ATOM   4624 O  O   . ASP A 1 8  ? 0.136   -11.604 -1.076  1.00 0.00 ? 8  ASP A O   9  
ATOM   4625 C  CB  . ASP A 1 8  ? -0.339  -10.004 -3.632  1.00 0.00 ? 8  ASP A CB  9  
ATOM   4626 C  CG  . ASP A 1 8  ? -0.178  -8.908  -4.669  1.00 0.00 ? 8  ASP A CG  9  
ATOM   4627 O  OD1 . ASP A 1 8  ? -1.028  -7.993  -4.668  1.00 0.00 ? 8  ASP A OD1 9  
ATOM   4628 O  OD2 . ASP A 1 8  ? 0.848   -8.944  -5.383  1.00 0.00 ? 8  ASP A OD2 9  
ATOM   4629 N  N   . GLY A 1 9  ? -0.833  -9.808  -0.133  1.00 0.00 ? 9  GLY A N   9  
ATOM   4630 C  CA  . GLY A 1 9  ? -1.190  -10.458 1.111   1.00 0.00 ? 9  GLY A CA  9  
ATOM   4631 C  C   . GLY A 1 9  ? -0.012  -10.588 2.081   1.00 0.00 ? 9  GLY A C   9  
ATOM   4632 O  O   . GLY A 1 9  ? -0.099  -11.399 3.000   1.00 0.00 ? 9  GLY A O   9  
ATOM   4633 N  N   . HIS A 1 10 ? 1.054   -9.780  1.939   1.00 0.00 ? 10 HIS A N   9  
ATOM   4634 C  CA  . HIS A 1 10 ? 2.117   -9.680  2.940   1.00 0.00 ? 10 HIS A CA  9  
ATOM   4635 C  C   . HIS A 1 10 ? 1.546   -9.603  4.358   1.00 0.00 ? 10 HIS A C   9  
ATOM   4636 O  O   . HIS A 1 10 ? 1.896   -10.393 5.231   1.00 0.00 ? 10 HIS A O   9  
ATOM   4637 C  CB  . HIS A 1 10 ? 2.948   -8.421  2.669   1.00 0.00 ? 10 HIS A CB  9  
ATOM   4638 C  CG  . HIS A 1 10 ? 3.993   -8.155  3.728   1.00 0.00 ? 10 HIS A CG  9  
ATOM   4639 N  ND1 . HIS A 1 10 ? 5.176   -8.846  3.905   1.00 0.00 ? 10 HIS A ND1 9  
ATOM   4640 C  CD2 . HIS A 1 10 ? 3.930   -7.173  4.675   1.00 0.00 ? 10 HIS A CD2 9  
ATOM   4641 C  CE1 . HIS A 1 10 ? 5.833   -8.276  4.932   1.00 0.00 ? 10 HIS A CE1 9  
ATOM   4642 N  NE2 . HIS A 1 10 ? 5.093   -7.259  5.416   1.00 0.00 ? 10 HIS A NE2 9  
ATOM   4643 N  N   . ALA A 1 11 ? 0.691   -8.604  4.577   1.00 0.00 ? 11 ALA A N   9  
ATOM   4644 C  CA  . ALA A 1 11 ? -0.020  -8.369  5.823   1.00 0.00 ? 11 ALA A CA  9  
ATOM   4645 C  C   . ALA A 1 11 ? -1.135  -7.361  5.548   1.00 0.00 ? 11 ALA A C   9  
ATOM   4646 O  O   . ALA A 1 11 ? -1.192  -6.815  4.447   1.00 0.00 ? 11 ALA A O   9  
ATOM   4647 C  CB  . ALA A 1 11 ? 0.951   -7.849  6.893   1.00 0.00 ? 11 ALA A CB  9  
ATOM   4648 N  N   . HIS A 1 12 ? -2.004  -7.116  6.540   1.00 0.00 ? 12 HIS A N   9  
ATOM   4649 C  CA  . HIS A 1 12 ? -3.104  -6.146  6.513   1.00 0.00 ? 12 HIS A CA  9  
ATOM   4650 C  C   . HIS A 1 12 ? -3.788  -6.047  5.149   1.00 0.00 ? 12 HIS A C   9  
ATOM   4651 O  O   . HIS A 1 12 ? -3.999  -4.952  4.630   1.00 0.00 ? 12 HIS A O   9  
ATOM   4652 C  CB  . HIS A 1 12 ? -2.627  -4.758  6.942   1.00 0.00 ? 12 HIS A CB  9  
ATOM   4653 C  CG  . HIS A 1 12 ? -2.021  -4.687  8.315   1.00 0.00 ? 12 HIS A CG  9  
ATOM   4654 N  ND1 . HIS A 1 12 ? -2.580  -4.048  9.407   1.00 0.00 ? 12 HIS A ND1 9  
ATOM   4655 C  CD2 . HIS A 1 12 ? -0.733  -5.017  8.630   1.00 0.00 ? 12 HIS A CD2 9  
ATOM   4656 C  CE1 . HIS A 1 12 ? -1.642  -3.995  10.371  1.00 0.00 ? 12 HIS A CE1 9  
ATOM   4657 N  NE2 . HIS A 1 12 ? -0.530  -4.611  9.930   1.00 0.00 ? 12 HIS A NE2 9  
ATOM   4658 N  N   . ASP A 1 13 ? -4.129  -7.201  4.578   1.00 0.00 ? 13 ASP A N   9  
ATOM   4659 C  CA  . ASP A 1 13 ? -4.899  -7.300  3.349   1.00 0.00 ? 13 ASP A CA  9  
ATOM   4660 C  C   . ASP A 1 13 ? -4.247  -6.526  2.194   1.00 0.00 ? 13 ASP A C   9  
ATOM   4661 O  O   . ASP A 1 13 ? -4.946  -6.113  1.267   1.00 0.00 ? 13 ASP A O   9  
ATOM   4662 C  CB  . ASP A 1 13 ? -6.345  -6.839  3.585   1.00 0.00 ? 13 ASP A CB  9  
ATOM   4663 C  CG  . ASP A 1 13 ? -6.879  -7.163  4.970   1.00 0.00 ? 13 ASP A CG  9  
ATOM   4664 O  OD1 . ASP A 1 13 ? -6.756  -8.326  5.400   1.00 0.00 ? 13 ASP A OD1 9  
ATOM   4665 O  OD2 . ASP A 1 13 ? -7.431  -6.206  5.564   1.00 0.00 ? 13 ASP A OD2 9  
ATOM   4666 N  N   . TYR A 1 14 ? -2.929  -6.297  2.251   1.00 0.00 ? 14 TYR A N   9  
ATOM   4667 C  CA  . TYR A 1 14 ? -2.252  -5.492  1.251   1.00 0.00 ? 14 TYR A CA  9  
ATOM   4668 C  C   . TYR A 1 14 ? -2.357  -6.155  -0.111  1.00 0.00 ? 14 TYR A C   9  
ATOM   4669 O  O   . TYR A 1 14 ? -2.117  -7.356  -0.232  1.00 0.00 ? 14 TYR A O   9  
ATOM   4670 C  CB  . TYR A 1 14 ? -0.792  -5.214  1.624   1.00 0.00 ? 14 TYR A CB  9  
ATOM   4671 C  CG  . TYR A 1 14 ? 0.056   -4.623  0.505   1.00 0.00 ? 14 TYR A CG  9  
ATOM   4672 C  CD1 . TYR A 1 14 ? 0.104   -3.235  0.271   1.00 0.00 ? 14 TYR A CD1 9  
ATOM   4673 C  CD2 . TYR A 1 14 ? 0.785   -5.482  -0.333  1.00 0.00 ? 14 TYR A CD2 9  
ATOM   4674 C  CE1 . TYR A 1 14 ? 0.941   -2.712  -0.729  1.00 0.00 ? 14 TYR A CE1 9  
ATOM   4675 C  CE2 . TYR A 1 14 ? 1.632   -4.962  -1.326  1.00 0.00 ? 14 TYR A CE2 9  
ATOM   4676 C  CZ  . TYR A 1 14 ? 1.742   -3.572  -1.497  1.00 0.00 ? 14 TYR A CZ  9  
ATOM   4677 O  OH  . TYR A 1 14 ? 2.635   -3.052  -2.388  1.00 0.00 ? 14 TYR A OH  9  
ATOM   4678 N  N   . VAL A 1 15 ? -2.672  -5.360  -1.126  1.00 0.00 ? 15 VAL A N   9  
ATOM   4679 C  CA  . VAL A 1 15 ? -2.618  -5.774  -2.514  1.00 0.00 ? 15 VAL A CA  9  
ATOM   4680 C  C   . VAL A 1 15 ? -1.695  -4.811  -3.240  1.00 0.00 ? 15 VAL A C   9  
ATOM   4681 O  O   . VAL A 1 15 ? -1.678  -3.611  -2.944  1.00 0.00 ? 15 VAL A O   9  
ATOM   4682 C  CB  . VAL A 1 15 ? -4.020  -5.809  -3.134  1.00 0.00 ? 15 VAL A CB  9  
ATOM   4683 C  CG1 . VAL A 1 15 ? -4.772  -7.061  -2.663  1.00 0.00 ? 15 VAL A CG1 9  
ATOM   4684 C  CG2 . VAL A 1 15 ? -4.839  -4.563  -2.787  1.00 0.00 ? 15 VAL A CG2 9  
ATOM   4685 N  N   . ASN A 1 16 ? -0.900  -5.348  -4.165  1.00 0.00 ? 16 ASN A N   9  
ATOM   4686 C  CA  . ASN A 1 16 ? 0.062   -4.583  -4.913  1.00 0.00 ? 16 ASN A CA  9  
ATOM   4687 C  C   . ASN A 1 16 ? -0.620  -3.524  -5.757  1.00 0.00 ? 16 ASN A C   9  
ATOM   4688 O  O   . ASN A 1 16 ? -0.085  -2.428  -5.880  1.00 0.00 ? 16 ASN A O   9  
ATOM   4689 C  CB  . ASN A 1 16 ? 1.022   -5.471  -5.710  1.00 0.00 ? 16 ASN A CB  9  
ATOM   4690 C  CG  . ASN A 1 16 ? 2.260   -5.759  -4.875  1.00 0.00 ? 16 ASN A CG  9  
ATOM   4691 O  OD1 . ASN A 1 16 ? 2.916   -4.840  -4.396  1.00 0.00 ? 16 ASN A OD1 9  
ATOM   4692 N  ND2 . ASN A 1 16 ? 2.586   -7.019  -4.665  1.00 0.00 ? 16 ASN A ND2 9  
ATOM   4693 N  N   . GLU A 1 17 ? -1.799  -3.825  -6.305  1.00 0.00 ? 17 GLU A N   9  
ATOM   4694 C  CA  . GLU A 1 17 ? -2.655  -2.854  -6.929  1.00 0.00 ? 17 GLU A CA  9  
ATOM   4695 C  C   . GLU A 1 17 ? -3.864  -2.602  -6.039  1.00 0.00 ? 17 GLU A C   9  
ATOM   4696 O  O   . GLU A 1 17 ? -4.573  -3.530  -5.660  1.00 0.00 ? 17 GLU A O   9  
ATOM   4697 C  CB  . GLU A 1 17 ? -3.113  -3.441  -8.256  1.00 0.00 ? 17 GLU A CB  9  
ATOM   4698 C  CG  . GLU A 1 17 ? -2.966  -2.421  -9.368  1.00 0.00 ? 17 GLU A CG  9  
ATOM   4699 C  CD  . GLU A 1 17 ? -1.534  -2.349  -9.901  1.00 0.00 ? 17 GLU A CD  9  
ATOM   4700 O  OE1 . GLU A 1 17 ? -0.647  -1.906  -9.135  1.00 0.00 ? 17 GLU A OE1 9  
ATOM   4701 O  OE2 . GLU A 1 17 ? -1.315  -2.755  -11.060 1.00 0.00 ? 17 GLU A OE2 9  
ATOM   4702 N  N   . ALA A 1 18 ? -4.145  -1.328  -5.793  1.00 0.00 ? 18 ALA A N   9  
ATOM   4703 C  CA  . ALA A 1 18 ? -5.355  -0.868  -5.136  1.00 0.00 ? 18 ALA A CA  9  
ATOM   4704 C  C   . ALA A 1 18 ? -6.593  -1.460  -5.810  1.00 0.00 ? 18 ALA A C   9  
ATOM   4705 O  O   . ALA A 1 18 ? -7.576  -1.760  -5.137  1.00 0.00 ? 18 ALA A O   9  
ATOM   4706 C  CB  . ALA A 1 18 ? -5.399  0.663   -5.168  1.00 0.00 ? 18 ALA A CB  9  
ATOM   4707 N  N   . ALA A 1 19 ? -6.545  -1.645  -7.138  1.00 0.00 ? 19 ALA A N   9  
ATOM   4708 C  CA  . ALA A 1 19 ? -7.671  -2.176  -7.888  1.00 0.00 ? 19 ALA A CA  9  
ATOM   4709 C  C   . ALA A 1 19 ? -8.183  -3.481  -7.278  1.00 0.00 ? 19 ALA A C   9  
ATOM   4710 O  O   . ALA A 1 19 ? -9.389  -3.640  -7.084  1.00 0.00 ? 19 ALA A O   9  
ATOM   4711 C  CB  . ALA A 1 19 ? -7.275  -2.365  -9.354  1.00 0.00 ? 19 ALA A CB  9  
ATOM   4712 N  N   . ASP A 1 20 ? -7.277  -4.395  -6.926  1.00 0.00 ? 20 ASP A N   9  
ATOM   4713 C  CA  . ASP A 1 20 ? -7.618  -5.699  -6.405  1.00 0.00 ? 20 ASP A CA  9  
ATOM   4714 C  C   . ASP A 1 20 ? -8.356  -5.605  -5.064  1.00 0.00 ? 20 ASP A C   9  
ATOM   4715 O  O   . ASP A 1 20 ? -9.066  -6.536  -4.690  1.00 0.00 ? 20 ASP A O   9  
ATOM   4716 C  CB  . ASP A 1 20 ? -6.325  -6.515  -6.307  1.00 0.00 ? 20 ASP A CB  9  
ATOM   4717 C  CG  . ASP A 1 20 ? -6.081  -7.329  -7.570  1.00 0.00 ? 20 ASP A CG  9  
ATOM   4718 O  OD1 . ASP A 1 20 ? -5.841  -6.687  -8.615  1.00 0.00 ? 20 ASP A OD1 9  
ATOM   4719 O  OD2 . ASP A 1 20 ? -6.156  -8.573  -7.472  1.00 0.00 ? 20 ASP A OD2 9  
ATOM   4720 N  N   . ALA A 1 21 ? -8.234  -4.484  -4.343  1.00 0.00 ? 21 ALA A N   9  
ATOM   4721 C  CA  . ALA A 1 21 ? -8.957  -4.300  -3.091  1.00 0.00 ? 21 ALA A CA  9  
ATOM   4722 C  C   . ALA A 1 21 ? -10.424 -3.925  -3.326  1.00 0.00 ? 21 ALA A C   9  
ATOM   4723 O  O   . ALA A 1 21 ? -11.187 -3.866  -2.359  1.00 0.00 ? 21 ALA A O   9  
ATOM   4724 C  CB  . ALA A 1 21 ? -8.253  -3.259  -2.215  1.00 0.00 ? 21 ALA A CB  9  
ATOM   4725 N  N   . SER A 1 22 ? -10.843 -3.680  -4.574  1.00 0.00 ? 22 SER A N   9  
ATOM   4726 C  CA  . SER A 1 22 ? -12.213 -3.356  -4.908  1.00 0.00 ? 22 SER A CA  9  
ATOM   4727 C  C   . SER A 1 22 ? -13.153 -4.508  -4.563  1.00 0.00 ? 22 SER A C   9  
ATOM   4728 O  O   . SER A 1 22 ? -13.393 -5.408  -5.364  1.00 0.00 ? 22 SER A O   9  
ATOM   4729 C  CB  . SER A 1 22 ? -12.323 -2.999  -6.378  1.00 0.00 ? 22 SER A CB  9  
ATOM   4730 O  OG  . SER A 1 22 ? -11.468 -1.921  -6.694  1.00 0.00 ? 22 SER A OG  9  
ATOM   4731 N  N   . GLY A 1 23 ? -13.683 -4.443  -3.350  1.00 0.00 ? 23 GLY A N   9  
ATOM   4732 C  CA  . GLY A 1 23 ? -14.487 -5.482  -2.729  1.00 0.00 ? 23 GLY A CA  9  
ATOM   4733 C  C   . GLY A 1 23 ? -14.306 -5.473  -1.213  1.00 0.00 ? 23 GLY A C   9  
ATOM   4734 O  O   . GLY A 1 23 ? -15.253 -5.721  -0.472  1.00 0.00 ? 23 GLY A O   9  
ATOM   4735 N  N   . HIS A 1 24 ? -13.091 -5.181  -0.738  1.00 0.00 ? 24 HIS A N   9  
ATOM   4736 C  CA  . HIS A 1 24 ? -12.784 -5.135  0.683   1.00 0.00 ? 24 HIS A CA  9  
ATOM   4737 C  C   . HIS A 1 24 ? -13.627 -4.040  1.348   1.00 0.00 ? 24 HIS A C   9  
ATOM   4738 O  O   . HIS A 1 24 ? -13.389 -2.870  1.064   1.00 0.00 ? 24 HIS A O   9  
ATOM   4739 C  CB  . HIS A 1 24 ? -11.288 -4.816  0.851   1.00 0.00 ? 24 HIS A CB  9  
ATOM   4740 C  CG  . HIS A 1 24 ? -10.739 -4.965  2.253   1.00 0.00 ? 24 HIS A CG  9  
ATOM   4741 N  ND1 . HIS A 1 24 ? -11.258 -4.415  3.413   1.00 0.00 ? 24 HIS A ND1 9  
ATOM   4742 C  CD2 . HIS A 1 24 ? -9.557  -5.570  2.578   1.00 0.00 ? 24 HIS A CD2 9  
ATOM   4743 C  CE1 . HIS A 1 24 ? -10.405 -4.673  4.417   1.00 0.00 ? 24 HIS A CE1 9  
ATOM   4744 N  NE2 . HIS A 1 24 ? -9.371  -5.383  3.936   1.00 0.00 ? 24 HIS A NE2 9  
ATOM   4745 N  N   . PRO A 1 25 ? -14.537 -4.338  2.290   1.00 0.00 ? 25 PRO A N   9  
ATOM   4746 C  CA  . PRO A 1 25 ? -15.177 -3.286  3.065   1.00 0.00 ? 25 PRO A CA  9  
ATOM   4747 C  C   . PRO A 1 25 ? -14.082 -2.575  3.867   1.00 0.00 ? 25 PRO A C   9  
ATOM   4748 O  O   . PRO A 1 25 ? -13.382 -3.236  4.631   1.00 0.00 ? 25 PRO A O   9  
ATOM   4749 C  CB  . PRO A 1 25 ? -16.206 -3.995  3.950   1.00 0.00 ? 25 PRO A CB  9  
ATOM   4750 C  CG  . PRO A 1 25 ? -15.646 -5.409  4.102   1.00 0.00 ? 25 PRO A CG  9  
ATOM   4751 C  CD  . PRO A 1 25 ? -14.905 -5.656  2.787   1.00 0.00 ? 25 PRO A CD  9  
ATOM   4752 N  N   . ARG A 1 26 ? -13.861 -1.283  3.593   1.00 0.00 ? 26 ARG A N   9  
ATOM   4753 C  CA  . ARG A 1 26 ? -12.775 -0.404  4.050   1.00 0.00 ? 26 ARG A CA  9  
ATOM   4754 C  C   . ARG A 1 26 ? -12.053 0.180   2.835   1.00 0.00 ? 26 ARG A C   9  
ATOM   4755 O  O   . ARG A 1 26 ? -11.610 1.333   2.880   1.00 0.00 ? 26 ARG A O   9  
ATOM   4756 C  CB  . ARG A 1 26 ? -11.771 -1.059  5.023   1.00 0.00 ? 26 ARG A CB  9  
ATOM   4757 C  CG  . ARG A 1 26 ? -10.570 -0.190  5.430   1.00 0.00 ? 26 ARG A CG  9  
ATOM   4758 C  CD  . ARG A 1 26 ? -10.943 1.152   6.072   1.00 0.00 ? 26 ARG A CD  9  
ATOM   4759 N  NE  . ARG A 1 26 ? -9.789  2.068   6.107   1.00 0.00 ? 26 ARG A NE  9  
ATOM   4760 C  CZ  . ARG A 1 26 ? -9.615  3.138   5.310   1.00 0.00 ? 26 ARG A CZ  9  
ATOM   4761 N  NH1 . ARG A 1 26 ? -10.357 3.319   4.212   1.00 0.00 ? 26 ARG A NH1 9  
ATOM   4762 N  NH2 . ARG A 1 26 ? -8.679  4.039   5.614   1.00 0.00 ? 26 ARG A NH2 9  
ATOM   4763 N  N   . TYR A 1 27 ? -11.921 -0.600  1.754   1.00 0.00 ? 27 TYR A N   9  
ATOM   4764 C  CA  . TYR A 1 27 ? -11.472 -0.044  0.492   1.00 0.00 ? 27 TYR A CA  9  
ATOM   4765 C  C   . TYR A 1 27 ? -12.479 0.988   0.006   1.00 0.00 ? 27 TYR A C   9  
ATOM   4766 O  O   . TYR A 1 27 ? -13.670 0.913   0.302   1.00 0.00 ? 27 TYR A O   9  
ATOM   4767 C  CB  . TYR A 1 27 ? -11.194 -1.124  -0.561  1.00 0.00 ? 27 TYR A CB  9  
ATOM   4768 C  CG  . TYR A 1 27 ? -10.661 -0.553  -1.861  1.00 0.00 ? 27 TYR A CG  9  
ATOM   4769 C  CD1 . TYR A 1 27 ? -9.346  -0.064  -1.900  1.00 0.00 ? 27 TYR A CD1 9  
ATOM   4770 C  CD2 . TYR A 1 27 ? -11.531 -0.285  -2.935  1.00 0.00 ? 27 TYR A CD2 9  
ATOM   4771 C  CE1 . TYR A 1 27 ? -8.893  0.682   -2.998  1.00 0.00 ? 27 TYR A CE1 9  
ATOM   4772 C  CE2 . TYR A 1 27 ? -11.072 0.444   -4.049  1.00 0.00 ? 27 TYR A CE2 9  
ATOM   4773 C  CZ  . TYR A 1 27 ? -9.751  0.920   -4.085  1.00 0.00 ? 27 TYR A CZ  9  
ATOM   4774 O  OH  . TYR A 1 27 ? -9.320  1.670   -5.140  1.00 0.00 ? 27 TYR A OH  9  
ATOM   4775 N  N   . GLN A 1 28 ? -11.947 1.967   -0.714  1.00 0.00 ? 28 GLN A N   9  
ATOM   4776 C  CA  . GLN A 1 28 ? -12.662 3.076   -1.305  1.00 0.00 ? 28 GLN A CA  9  
ATOM   4777 C  C   . GLN A 1 28 ? -11.797 3.580   -2.459  1.00 0.00 ? 28 GLN A C   9  
ATOM   4778 O  O   . GLN A 1 28 ? -10.569 3.638   -2.351  1.00 0.00 ? 28 GLN A O   9  
ATOM   4779 C  CB  . GLN A 1 28 ? -12.952 4.138   -0.234  1.00 0.00 ? 28 GLN A CB  9  
ATOM   4780 C  CG  . GLN A 1 28 ? -13.974 5.205   -0.656  1.00 0.00 ? 28 GLN A CG  9  
ATOM   4781 C  CD  . GLN A 1 28 ? -13.353 6.272   -1.546  1.00 0.00 ? 28 GLN A CD  9  
ATOM   4782 O  OE1 . GLN A 1 28 ? -12.461 6.994   -1.112  1.00 0.00 ? 28 GLN A OE1 9  
ATOM   4783 N  NE2 . GLN A 1 28 ? -13.779 6.357   -2.799  1.00 0.00 ? 28 GLN A NE2 9  
ATOM   4784 N  N   . GLU A 1 29 ? -12.464 3.865   -3.568  1.00 0.00 ? 29 GLU A N   9  
ATOM   4785 C  CA  . GLU A 1 29 ? -11.917 4.221   -4.857  1.00 0.00 ? 29 GLU A CA  9  
ATOM   4786 C  C   . GLU A 1 29 ? -11.040 5.465   -4.754  1.00 0.00 ? 29 GLU A C   9  
ATOM   4787 O  O   . GLU A 1 29 ? -11.499 6.524   -4.324  1.00 0.00 ? 29 GLU A O   9  
ATOM   4788 C  CB  . GLU A 1 29 ? -13.069 4.461   -5.849  1.00 0.00 ? 29 GLU A CB  9  
ATOM   4789 C  CG  . GLU A 1 29 ? -14.162 3.376   -5.827  1.00 0.00 ? 29 GLU A CG  9  
ATOM   4790 C  CD  . GLU A 1 29 ? -15.342 3.698   -4.907  1.00 0.00 ? 29 GLU A CD  9  
ATOM   4791 O  OE1 . GLU A 1 29 ? -15.086 4.247   -3.809  1.00 0.00 ? 29 GLU A OE1 9  
ATOM   4792 O  OE2 . GLU A 1 29 ? -16.480 3.389   -5.312  1.00 0.00 ? 29 GLU A OE2 9  
ATOM   4793 N  N   . GLY A 1 30 ? -9.785  5.337   -5.183  1.00 0.00 ? 30 GLY A N   9  
ATOM   4794 C  CA  . GLY A 1 30 ? -8.838  6.440   -5.218  1.00 0.00 ? 30 GLY A CA  9  
ATOM   4795 C  C   . GLY A 1 30 ? -7.814  6.336   -4.095  1.00 0.00 ? 30 GLY A C   9  
ATOM   4796 O  O   . GLY A 1 30 ? -6.738  6.917   -4.210  1.00 0.00 ? 30 GLY A O   9  
ATOM   4797 N  N   . GLN A 1 31 ? -8.105  5.588   -3.023  1.00 0.00 ? 31 GLN A N   9  
ATOM   4798 C  CA  . GLN A 1 31 ? -7.102  5.341   -2.003  1.00 0.00 ? 31 GLN A CA  9  
ATOM   4799 C  C   . GLN A 1 31 ? -6.009  4.459   -2.620  1.00 0.00 ? 31 GLN A C   9  
ATOM   4800 O  O   . GLN A 1 31 ? -6.261  3.292   -2.920  1.00 0.00 ? 31 GLN A O   9  
ATOM   4801 C  CB  . GLN A 1 31 ? -7.750  4.626   -0.810  1.00 0.00 ? 31 GLN A CB  9  
ATOM   4802 C  CG  . GLN A 1 31 ? -8.844  5.404   -0.051  1.00 0.00 ? 31 GLN A CG  9  
ATOM   4803 C  CD  . GLN A 1 31 ? -9.422  4.583   1.113   1.00 0.00 ? 31 GLN A CD  9  
ATOM   4804 O  OE1 . GLN A 1 31 ? -9.594  5.050   2.239   1.00 0.00 ? 31 GLN A OE1 9  
ATOM   4805 N  NE2 . GLN A 1 31 ? -9.729  3.315   0.863   1.00 0.00 ? 31 GLN A NE2 9  
ATOM   4806 N  N   . LEU A 1 32 ? -4.815  5.020   -2.807  1.00 0.00 ? 32 LEU A N   9  
ATOM   4807 C  CA  . LEU A 1 32 ? -3.601  4.340   -3.232  1.00 0.00 ? 32 LEU A CA  9  
ATOM   4808 C  C   . LEU A 1 32 ? -2.554  4.660   -2.167  1.00 0.00 ? 32 LEU A C   9  
ATOM   4809 O  O   . LEU A 1 32 ? -2.592  5.749   -1.593  1.00 0.00 ? 32 LEU A O   9  
ATOM   4810 C  CB  . LEU A 1 32 ? -3.099  4.902   -4.574  1.00 0.00 ? 32 LEU A CB  9  
ATOM   4811 C  CG  . LEU A 1 32 ? -3.513  4.169   -5.854  1.00 0.00 ? 32 LEU A CG  9  
ATOM   4812 C  CD1 . LEU A 1 32 ? -5.014  4.178   -6.128  1.00 0.00 ? 32 LEU A CD1 9  
ATOM   4813 C  CD2 . LEU A 1 32 ? -2.822  4.853   -7.041  1.00 0.00 ? 32 LEU A CD2 9  
ATOM   4814 N  N   . CYS A 1 33 ? -1.607  3.749   -1.938  1.00 0.00 ? 33 CYS A N   9  
ATOM   4815 C  CA  . CYS A 1 33 ? -0.455  3.940   -1.064  1.00 0.00 ? 33 CYS A CA  9  
ATOM   4816 C  C   . CYS A 1 33 ? 0.180   5.321   -1.250  1.00 0.00 ? 33 CYS A C   9  
ATOM   4817 O  O   . CYS A 1 33 ? 0.464   6.014   -0.278  1.00 0.00 ? 33 CYS A O   9  
ATOM   4818 C  CB  . CYS A 1 33 ? 0.542   2.839   -1.316  1.00 0.00 ? 33 CYS A CB  9  
ATOM   4819 S  SG  . CYS A 1 33 ? 0.044   1.312   -0.466  1.00 0.00 ? 33 CYS A SG  9  
ATOM   4820 N  N   . GLU A 1 34 ? 0.383   5.765   -2.493  1.00 0.00 ? 34 GLU A N   9  
ATOM   4821 C  CA  . GLU A 1 34 ? 0.987   7.070   -2.724  1.00 0.00 ? 34 GLU A CA  9  
ATOM   4822 C  C   . GLU A 1 34 ? 0.231   8.236   -2.062  1.00 0.00 ? 34 GLU A C   9  
ATOM   4823 O  O   . GLU A 1 34 ? 0.855   9.237   -1.713  1.00 0.00 ? 34 GLU A O   9  
ATOM   4824 C  CB  . GLU A 1 34 ? 1.308   7.255   -4.209  1.00 0.00 ? 34 GLU A CB  9  
ATOM   4825 C  CG  . GLU A 1 34 ? 0.110   7.238   -5.174  1.00 0.00 ? 34 GLU A CG  9  
ATOM   4826 C  CD  . GLU A 1 34 ? -0.808  8.446   -5.046  1.00 0.00 ? 34 GLU A CD  9  
ATOM   4827 O  OE1 . GLU A 1 34 ? -0.275  9.574   -5.100  1.00 0.00 ? 34 GLU A OE1 9  
ATOM   4828 O  OE2 . GLU A 1 34 ? -2.031  8.225   -4.900  1.00 0.00 ? 34 GLU A OE2 9  
ATOM   4829 N  N   . ASN A 1 35 ? -1.083  8.094   -1.829  1.00 0.00 ? 35 ASN A N   9  
ATOM   4830 C  CA  . ASN A 1 35 ? -1.902  9.075   -1.118  1.00 0.00 ? 35 ASN A CA  9  
ATOM   4831 C  C   . ASN A 1 35 ? -2.333  8.580   0.269   1.00 0.00 ? 35 ASN A C   9  
ATOM   4832 O  O   . ASN A 1 35 ? -3.337  9.041   0.814   1.00 0.00 ? 35 ASN A O   9  
ATOM   4833 C  CB  . ASN A 1 35 ? -3.089  9.511   -1.990  1.00 0.00 ? 35 ASN A CB  9  
ATOM   4834 C  CG  . ASN A 1 35 ? -4.149  8.451   -2.223  1.00 0.00 ? 35 ASN A CG  9  
ATOM   4835 O  OD1 . ASN A 1 35 ? -4.915  8.090   -1.337  1.00 0.00 ? 35 ASN A OD1 9  
ATOM   4836 N  ND2 . ASN A 1 35 ? -4.270  7.999   -3.455  1.00 0.00 ? 35 ASN A ND2 9  
ATOM   4837 N  N   . CYS A 1 36 ? -1.558  7.672   0.864   1.00 0.00 ? 36 CYS A N   9  
ATOM   4838 C  CA  . CYS A 1 36 ? -1.729  7.210   2.233   1.00 0.00 ? 36 CYS A CA  9  
ATOM   4839 C  C   . CYS A 1 36 ? -0.984  8.158   3.170   1.00 0.00 ? 36 CYS A C   9  
ATOM   4840 O  O   . CYS A 1 36 ? 0.134   8.580   2.881   1.00 0.00 ? 36 CYS A O   9  
ATOM   4841 C  CB  . CYS A 1 36 ? -1.159  5.823   2.300   1.00 0.00 ? 36 CYS A CB  9  
ATOM   4842 S  SG  . CYS A 1 36 ? -1.382  4.988   3.872   1.00 0.00 ? 36 CYS A SG  9  
ATOM   4843 N  N   . ALA A 1 37 ? -1.579  8.493   4.314   1.00 0.00 ? 37 ALA A N   9  
ATOM   4844 C  CA  . ALA A 1 37 ? -0.962  9.382   5.289   1.00 0.00 ? 37 ALA A CA  9  
ATOM   4845 C  C   . ALA A 1 37 ? 0.379   8.843   5.791   1.00 0.00 ? 37 ALA A C   9  
ATOM   4846 O  O   . ALA A 1 37 ? 1.232   9.622   6.209   1.00 0.00 ? 37 ALA A O   9  
ATOM   4847 C  CB  . ALA A 1 37 ? -1.929  9.622   6.447   1.00 0.00 ? 37 ALA A CB  9  
ATOM   4848 N  N   . PHE A 1 38 ? 0.576   7.521   5.759   1.00 0.00 ? 38 PHE A N   9  
ATOM   4849 C  CA  . PHE A 1 38 ? 1.842   6.921   6.154   1.00 0.00 ? 38 PHE A CA  9  
ATOM   4850 C  C   . PHE A 1 38 ? 2.914   7.042   5.067   1.00 0.00 ? 38 PHE A C   9  
ATOM   4851 O  O   . PHE A 1 38 ? 4.064   6.726   5.361   1.00 0.00 ? 38 PHE A O   9  
ATOM   4852 C  CB  . PHE A 1 38 ? 1.639   5.453   6.559   1.00 0.00 ? 38 PHE A CB  9  
ATOM   4853 C  CG  . PHE A 1 38 ? 0.837   5.269   7.834   1.00 0.00 ? 38 PHE A CG  9  
ATOM   4854 C  CD1 . PHE A 1 38 ? 1.370   5.710   9.060   1.00 0.00 ? 38 PHE A CD1 9  
ATOM   4855 C  CD2 . PHE A 1 38 ? -0.439  4.675   7.801   1.00 0.00 ? 38 PHE A CD2 9  
ATOM   4856 C  CE1 . PHE A 1 38 ? 0.609   5.608   10.237  1.00 0.00 ? 38 PHE A CE1 9  
ATOM   4857 C  CE2 . PHE A 1 38 ? -1.189  4.554   8.983   1.00 0.00 ? 38 PHE A CE2 9  
ATOM   4858 C  CZ  . PHE A 1 38 ? -0.672  5.031   10.199  1.00 0.00 ? 38 PHE A CZ  9  
ATOM   4859 N  N   . TRP A 1 39 ? 2.577   7.448   3.838   1.00 0.00 ? 39 TRP A N   9  
ATOM   4860 C  CA  . TRP A 1 39 ? 3.516   7.433   2.722   1.00 0.00 ? 39 TRP A CA  9  
ATOM   4861 C  C   . TRP A 1 39 ? 4.851   8.097   3.088   1.00 0.00 ? 39 TRP A C   9  
ATOM   4862 O  O   . TRP A 1 39 ? 4.881   9.214   3.601   1.00 0.00 ? 39 TRP A O   9  
ATOM   4863 C  CB  . TRP A 1 39 ? 2.878   8.084   1.490   1.00 0.00 ? 39 TRP A CB  9  
ATOM   4864 C  CG  . TRP A 1 39 ? 3.658   7.954   0.218   1.00 0.00 ? 39 TRP A CG  9  
ATOM   4865 C  CD1 . TRP A 1 39 ? 4.196   8.974   -0.489  1.00 0.00 ? 39 TRP A CD1 9  
ATOM   4866 C  CD2 . TRP A 1 39 ? 3.988   6.740   -0.521  1.00 0.00 ? 39 TRP A CD2 9  
ATOM   4867 N  NE1 . TRP A 1 39 ? 4.842   8.480   -1.602  1.00 0.00 ? 39 TRP A NE1 9  
ATOM   4868 C  CE2 . TRP A 1 39 ? 4.736   7.106   -1.678  1.00 0.00 ? 39 TRP A CE2 9  
ATOM   4869 C  CE3 . TRP A 1 39 ? 3.722   5.365   -0.337  1.00 0.00 ? 39 TRP A CE3 9  
ATOM   4870 C  CZ2 . TRP A 1 39 ? 5.204   6.157   -2.598  1.00 0.00 ? 39 TRP A CZ2 9  
ATOM   4871 C  CZ3 . TRP A 1 39 ? 4.192   4.404   -1.251  1.00 0.00 ? 39 TRP A CZ3 9  
ATOM   4872 C  CH2 . TRP A 1 39 ? 4.923   4.800   -2.383  1.00 0.00 ? 39 TRP A CH2 9  
ATOM   4873 N  N   . GLY A 1 40 ? 5.952   7.382   2.847   1.00 0.00 ? 40 GLY A N   9  
ATOM   4874 C  CA  . GLY A 1 40 ? 7.314   7.835   3.062   1.00 0.00 ? 40 GLY A CA  9  
ATOM   4875 C  C   . GLY A 1 40 ? 7.699   8.728   1.895   1.00 0.00 ? 40 GLY A C   9  
ATOM   4876 O  O   . GLY A 1 40 ? 7.545   9.944   1.957   1.00 0.00 ? 40 GLY A O   9  
ATOM   4877 N  N   . GLU A 1 41 ? 8.155   8.093   0.813   1.00 0.00 ? 41 GLU A N   9  
ATOM   4878 C  CA  . GLU A 1 41 ? 8.087   8.631   -0.529  1.00 0.00 ? 41 GLU A CA  9  
ATOM   4879 C  C   . GLU A 1 41 ? 8.396   7.497   -1.505  1.00 0.00 ? 41 GLU A C   9  
ATOM   4880 O  O   . GLU A 1 41 ? 8.807   6.410   -1.083  1.00 0.00 ? 41 GLU A O   9  
ATOM   4881 C  CB  . GLU A 1 41 ? 8.990   9.861   -0.745  1.00 0.00 ? 41 GLU A CB  9  
ATOM   4882 C  CG  . GLU A 1 41 ? 8.175   11.079  -1.221  1.00 0.00 ? 41 GLU A CG  9  
ATOM   4883 C  CD  . GLU A 1 41 ? 7.597   10.916  -2.626  1.00 0.00 ? 41 GLU A CD  9  
ATOM   4884 O  OE1 . GLU A 1 41 ? 6.739   10.017  -2.797  1.00 0.00 ? 41 GLU A OE1 9  
ATOM   4885 O  OE2 . GLU A 1 41 ? 8.053   11.659  -3.518  1.00 0.00 ? 41 GLU A OE2 9  
ATOM   4886 N  N   . ALA A 1 42 ? 8.201   7.763   -2.796  1.00 0.00 ? 42 ALA A N   9  
ATOM   4887 C  CA  . ALA A 1 42 ? 8.627   6.908   -3.884  1.00 0.00 ? 42 ALA A CA  9  
ATOM   4888 C  C   . ALA A 1 42 ? 10.142  6.720   -3.871  1.00 0.00 ? 42 ALA A C   9  
ATOM   4889 O  O   . ALA A 1 42 ? 10.895  7.616   -3.497  1.00 0.00 ? 42 ALA A O   9  
ATOM   4890 C  CB  . ALA A 1 42 ? 8.142   7.467   -5.220  1.00 0.00 ? 42 ALA A CB  9  
ATOM   4891 N  N   . VAL A 1 43 ? 10.568  5.524   -4.272  1.00 0.00 ? 43 VAL A N   9  
ATOM   4892 C  CA  . VAL A 1 43 ? 11.951  5.077   -4.289  1.00 0.00 ? 43 VAL A CA  9  
ATOM   4893 C  C   . VAL A 1 43 ? 12.320  4.633   -5.706  1.00 0.00 ? 43 VAL A C   9  
ATOM   4894 O  O   . VAL A 1 43 ? 13.387  4.985   -6.204  1.00 0.00 ? 43 VAL A O   9  
ATOM   4895 C  CB  . VAL A 1 43 ? 12.111  3.923   -3.285  1.00 0.00 ? 43 VAL A CB  9  
ATOM   4896 C  CG1 . VAL A 1 43 ? 13.543  3.371   -3.281  1.00 0.00 ? 43 VAL A CG1 9  
ATOM   4897 C  CG2 . VAL A 1 43 ? 11.765  4.362   -1.856  1.00 0.00 ? 43 VAL A CG2 9  
ATOM   4898 N  N   . GLN A 1 44 ? 11.465  3.821   -6.337  1.00 0.00 ? 44 GLN A N   9  
ATOM   4899 C  CA  . GLN A 1 44 ? 11.726  3.214   -7.632  1.00 0.00 ? 44 GLN A CA  9  
ATOM   4900 C  C   . GLN A 1 44 ? 10.413  3.034   -8.407  1.00 0.00 ? 44 GLN A C   9  
ATOM   4901 O  O   . GLN A 1 44 ? 9.423   3.685   -8.077  1.00 0.00 ? 44 GLN A O   9  
ATOM   4902 C  CB  . GLN A 1 44 ? 12.583  1.955   -7.433  1.00 0.00 ? 44 GLN A CB  9  
ATOM   4903 C  CG  . GLN A 1 44 ? 11.904  0.885   -6.574  1.00 0.00 ? 44 GLN A CG  9  
ATOM   4904 C  CD  . GLN A 1 44 ? 12.865  -0.207  -6.109  1.00 0.00 ? 44 GLN A CD  9  
ATOM   4905 O  OE1 . GLN A 1 44 ? 12.674  -1.386  -6.397  1.00 0.00 ? 44 GLN A OE1 9  
ATOM   4906 N  NE2 . GLN A 1 44 ? 13.909  0.162   -5.372  1.00 0.00 ? 44 GLN A NE2 9  
ATOM   4907 N  N   . ASP A 1 45 ? 10.413  2.188   -9.442  1.00 0.00 ? 45 ASP A N   9  
ATOM   4908 C  CA  . ASP A 1 45 ? 9.452   2.052   -10.538 1.00 0.00 ? 45 ASP A CA  9  
ATOM   4909 C  C   . ASP A 1 45 ? 8.021   1.762   -10.077 1.00 0.00 ? 45 ASP A C   9  
ATOM   4910 O  O   . ASP A 1 45 ? 7.480   0.675   -10.259 1.00 0.00 ? 45 ASP A O   9  
ATOM   4911 C  CB  . ASP A 1 45 ? 9.970   0.993   -11.529 1.00 0.00 ? 45 ASP A CB  9  
ATOM   4912 C  CG  . ASP A 1 45 ? 10.383  -0.302  -10.845 1.00 0.00 ? 45 ASP A CG  9  
ATOM   4913 O  OD1 . ASP A 1 45 ? 11.332  -0.231  -10.032 1.00 0.00 ? 45 ASP A OD1 9  
ATOM   4914 O  OD2 . ASP A 1 45 ? 9.779   -1.362  -11.111 1.00 0.00 ? 45 ASP A OD2 9  
ATOM   4915 N  N   . GLY A 1 46 ? 7.402   2.782   -9.492  1.00 0.00 ? 46 GLY A N   9  
ATOM   4916 C  CA  . GLY A 1 46 ? 6.067   2.731   -8.926  1.00 0.00 ? 46 GLY A CA  9  
ATOM   4917 C  C   . GLY A 1 46 ? 6.083   2.067   -7.550  1.00 0.00 ? 46 GLY A C   9  
ATOM   4918 O  O   . GLY A 1 46 ? 5.073   1.515   -7.123  1.00 0.00 ? 46 GLY A O   9  
ATOM   4919 N  N   . TRP A 1 47 ? 7.212   2.137   -6.839  1.00 0.00 ? 47 TRP A N   9  
ATOM   4920 C  CA  . TRP A 1 47 ? 7.378   1.630   -5.498  1.00 0.00 ? 47 TRP A CA  9  
ATOM   4921 C  C   . TRP A 1 47 ? 7.987   2.704   -4.619  1.00 0.00 ? 47 TRP A C   9  
ATOM   4922 O  O   . TRP A 1 47 ? 8.856   3.457   -5.066  1.00 0.00 ? 47 TRP A O   9  
ATOM   4923 C  CB  . TRP A 1 47 ? 8.317   0.435   -5.509  1.00 0.00 ? 47 TRP A CB  9  
ATOM   4924 C  CG  . TRP A 1 47 ? 7.885   -0.713  -6.352  1.00 0.00 ? 47 TRP A CG  9  
ATOM   4925 C  CD1 . TRP A 1 47 ? 8.131   -0.873  -7.669  1.00 0.00 ? 47 TRP A CD1 9  
ATOM   4926 C  CD2 . TRP A 1 47 ? 7.088   -1.853  -5.948  1.00 0.00 ? 47 TRP A CD2 9  
ATOM   4927 N  NE1 . TRP A 1 47 ? 7.462   -1.986  -8.126  1.00 0.00 ? 47 TRP A NE1 9  
ATOM   4928 C  CE2 . TRP A 1 47 ? 6.803   -2.637  -7.103  1.00 0.00 ? 47 TRP A CE2 9  
ATOM   4929 C  CE3 . TRP A 1 47 ? 6.603   -2.316  -4.710  1.00 0.00 ? 47 TRP A CE3 9  
ATOM   4930 C  CZ2 . TRP A 1 47 ? 6.023   -3.797  -7.034  1.00 0.00 ? 47 TRP A CZ2 9  
ATOM   4931 C  CZ3 . TRP A 1 47 ? 5.819   -3.476  -4.630  1.00 0.00 ? 47 TRP A CZ3 9  
ATOM   4932 C  CH2 . TRP A 1 47 ? 5.517   -4.206  -5.790  1.00 0.00 ? 47 TRP A CH2 9  
ATOM   4933 N  N   . GLY A 1 48 ? 7.563   2.731   -3.362  1.00 0.00 ? 48 GLY A N   9  
ATOM   4934 C  CA  . GLY A 1 48 ? 8.061   3.632   -2.359  1.00 0.00 ? 48 GLY A CA  9  
ATOM   4935 C  C   . GLY A 1 48 ? 7.886   3.037   -0.980  1.00 0.00 ? 48 GLY A C   9  
ATOM   4936 O  O   . GLY A 1 48 ? 7.445   1.901   -0.828  1.00 0.00 ? 48 GLY A O   9  
ATOM   4937 N  N   . ARG A 1 49 ? 8.283   3.803   0.026   1.00 0.00 ? 49 ARG A N   9  
ATOM   4938 C  CA  . ARG A 1 49 ? 8.152   3.399   1.417   1.00 0.00 ? 49 ARG A CA  9  
ATOM   4939 C  C   . ARG A 1 49 ? 6.861   3.956   1.999   1.00 0.00 ? 49 ARG A C   9  
ATOM   4940 O  O   . ARG A 1 49 ? 6.418   5.015   1.558   1.00 0.00 ? 49 ARG A O   9  
ATOM   4941 C  CB  . ARG A 1 49 ? 9.351   3.960   2.176   1.00 0.00 ? 49 ARG A CB  9  
ATOM   4942 C  CG  . ARG A 1 49 ? 10.613  3.207   1.769   1.00 0.00 ? 49 ARG A CG  9  
ATOM   4943 C  CD  . ARG A 1 49 ? 11.877  3.876   2.301   1.00 0.00 ? 49 ARG A CD  9  
ATOM   4944 N  NE  . ARG A 1 49 ? 11.747  4.185   3.728   1.00 0.00 ? 49 ARG A NE  9  
ATOM   4945 C  CZ  . ARG A 1 49 ? 11.449  3.292   4.685   1.00 0.00 ? 49 ARG A CZ  9  
ATOM   4946 N  NH1 . ARG A 1 49 ? 11.779  2.006   4.577   1.00 0.00 ? 49 ARG A NH1 9  
ATOM   4947 N  NH2 . ARG A 1 49 ? 10.767  3.705   5.747   1.00 0.00 ? 49 ARG A NH2 9  
ATOM   4948 N  N   . CYS A 1 50 ? 6.318   3.301   3.032   1.00 0.00 ? 50 CYS A N   9  
ATOM   4949 C  CA  . CYS A 1 50 ? 5.363   3.901   3.950   1.00 0.00 ? 50 CYS A CA  9  
ATOM   4950 C  C   . CYS A 1 50 ? 5.805   3.618   5.388   1.00 0.00 ? 50 CYS A C   9  
ATOM   4951 O  O   . CYS A 1 50 ? 6.437   2.603   5.678   1.00 0.00 ? 50 CYS A O   9  
ATOM   4952 C  CB  . CYS A 1 50 ? 3.949   3.519   3.598   1.00 0.00 ? 50 CYS A CB  9  
ATOM   4953 S  SG  . CYS A 1 50 ? 3.361   1.980   4.340   1.00 0.00 ? 50 CYS A SG  9  
ATOM   4954 N  N   . THR A 1 51 ? 5.599   4.596   6.267   1.00 0.00 ? 51 THR A N   9  
ATOM   4955 C  CA  . THR A 1 51 ? 6.275   4.710   7.550   1.00 0.00 ? 51 THR A CA  9  
ATOM   4956 C  C   . THR A 1 51 ? 5.605   3.831   8.605   1.00 0.00 ? 51 THR A C   9  
ATOM   4957 O  O   . THR A 1 51 ? 5.133   4.314   9.635   1.00 0.00 ? 51 THR A O   9  
ATOM   4958 C  CB  . THR A 1 51 ? 6.345   6.193   7.962   1.00 0.00 ? 51 THR A CB  9  
ATOM   4959 O  OG1 . THR A 1 51 ? 5.072   6.809   7.912   1.00 0.00 ? 51 THR A OG1 9  
ATOM   4960 C  CG2 . THR A 1 51 ? 7.293   6.968   7.040   1.00 0.00 ? 51 THR A CG2 9  
ATOM   4961 N  N   . HIS A 1 52 ? 5.586   2.520   8.369   1.00 0.00 ? 52 HIS A N   9  
ATOM   4962 C  CA  . HIS A 1 52 ? 5.061   1.573   9.335   1.00 0.00 ? 52 HIS A CA  9  
ATOM   4963 C  C   . HIS A 1 52 ? 5.730   0.222   9.117   1.00 0.00 ? 52 HIS A C   9  
ATOM   4964 O  O   . HIS A 1 52 ? 5.478   -0.381  8.079   1.00 0.00 ? 52 HIS A O   9  
ATOM   4965 C  CB  . HIS A 1 52 ? 3.535   1.459   9.172   1.00 0.00 ? 52 HIS A CB  9  
ATOM   4966 C  CG  . HIS A 1 52 ? 2.836   1.104   10.459  1.00 0.00 ? 52 HIS A CG  9  
ATOM   4967 N  ND1 . HIS A 1 52 ? 2.596   -0.163  10.970  1.00 0.00 ? 52 HIS A ND1 9  
ATOM   4968 C  CD2 . HIS A 1 52 ? 2.339   2.017   11.349  1.00 0.00 ? 52 HIS A CD2 9  
ATOM   4969 C  CE1 . HIS A 1 52 ? 1.957   -0.013  12.141  1.00 0.00 ? 52 HIS A CE1 9  
ATOM   4970 N  NE2 . HIS A 1 52 ? 1.792   1.300   12.395  1.00 0.00 ? 52 HIS A NE2 9  
ATOM   4971 N  N   . PRO A 1 53 ? 6.533   -0.294  10.064  1.00 0.00 ? 53 PRO A N   9  
ATOM   4972 C  CA  . PRO A 1 53 ? 6.828   -1.719  10.124  1.00 0.00 ? 53 PRO A CA  9  
ATOM   4973 C  C   . PRO A 1 53 ? 5.506   -2.478  10.012  1.00 0.00 ? 53 PRO A C   9  
ATOM   4974 O  O   . PRO A 1 53 ? 4.556   -2.098  10.698  1.00 0.00 ? 53 PRO A O   9  
ATOM   4975 C  CB  . PRO A 1 53 ? 7.516   -1.943  11.476  1.00 0.00 ? 53 PRO A CB  9  
ATOM   4976 C  CG  . PRO A 1 53 ? 8.110   -0.570  11.798  1.00 0.00 ? 53 PRO A CG  9  
ATOM   4977 C  CD  . PRO A 1 53 ? 7.066   0.389   11.227  1.00 0.00 ? 53 PRO A CD  9  
ATOM   4978 N  N   . ASP A 1 54 ? 5.439   -3.439  9.084   1.00 0.00 ? 54 ASP A N   9  
ATOM   4979 C  CA  . ASP A 1 54 ? 4.251   -3.962  8.396   1.00 0.00 ? 54 ASP A CA  9  
ATOM   4980 C  C   . ASP A 1 54 ? 4.525   -3.798  6.901   1.00 0.00 ? 54 ASP A C   9  
ATOM   4981 O  O   . ASP A 1 54 ? 4.224   -4.669  6.089   1.00 0.00 ? 54 ASP A O   9  
ATOM   4982 C  CB  . ASP A 1 54 ? 2.941   -3.195  8.664   1.00 0.00 ? 54 ASP A CB  9  
ATOM   4983 C  CG  . ASP A 1 54 ? 2.240   -3.504  9.969   1.00 0.00 ? 54 ASP A CG  9  
ATOM   4984 O  OD1 . ASP A 1 54 ? 2.044   -4.697  10.287  1.00 0.00 ? 54 ASP A OD1 9  
ATOM   4985 O  OD2 . ASP A 1 54 ? 1.712   -2.538  10.561  1.00 0.00 ? 54 ASP A OD2 9  
ATOM   4986 N  N   . PHE A 1 55 ? 5.046   -2.619  6.561   1.00 0.00 ? 55 PHE A N   9  
ATOM   4987 C  CA  . PHE A 1 55 ? 5.218   -2.084  5.227   1.00 0.00 ? 55 PHE A CA  9  
ATOM   4988 C  C   . PHE A 1 55 ? 6.518   -1.277  5.149   1.00 0.00 ? 55 PHE A C   9  
ATOM   4989 O  O   . PHE A 1 55 ? 6.588   -0.289  4.419   1.00 0.00 ? 55 PHE A O   9  
ATOM   4990 C  CB  . PHE A 1 55 ? 3.986   -1.214  4.928   1.00 0.00 ? 55 PHE A CB  9  
ATOM   4991 C  CG  . PHE A 1 55 ? 2.710   -2.015  4.783   1.00 0.00 ? 55 PHE A CG  9  
ATOM   4992 C  CD1 . PHE A 1 55 ? 2.678   -2.995  3.773   1.00 0.00 ? 55 PHE A CD1 9  
ATOM   4993 C  CD2 . PHE A 1 55 ? 1.639   -1.919  5.707   1.00 0.00 ? 55 PHE A CD2 9  
ATOM   4994 C  CE1 . PHE A 1 55 ? 1.680   -3.976  3.764   1.00 0.00 ? 55 PHE A CE1 9  
ATOM   4995 C  CE2 . PHE A 1 55 ? 0.676   -2.941  5.720   1.00 0.00 ? 55 PHE A CE2 9  
ATOM   4996 C  CZ  . PHE A 1 55 ? 0.697   -3.966  4.762   1.00 0.00 ? 55 PHE A CZ  9  
ATOM   4997 N  N   . ASP A 1 56 ? 7.546   -1.699  5.899   1.00 0.00 ? 56 ASP A N   9  
ATOM   4998 C  CA  . ASP A 1 56 ? 8.857   -1.043  5.909   1.00 0.00 ? 56 ASP A CA  9  
ATOM   4999 C  C   . ASP A 1 56 ? 9.951   -2.076  5.642   1.00 0.00 ? 56 ASP A C   9  
ATOM   5000 O  O   . ASP A 1 56 ? 10.884  -1.861  4.863   1.00 0.00 ? 56 ASP A O   9  
ATOM   5001 C  CB  . ASP A 1 56 ? 9.067   -0.324  7.251   1.00 0.00 ? 56 ASP A CB  9  
ATOM   5002 C  CG  . ASP A 1 56 ? 10.159  0.721   7.140   1.00 0.00 ? 56 ASP A CG  9  
ATOM   5003 O  OD1 . ASP A 1 56 ? 11.245  0.392   6.620   1.00 0.00 ? 56 ASP A OD1 9  
ATOM   5004 O  OD2 . ASP A 1 56 ? 9.892   1.893   7.480   1.00 0.00 ? 56 ASP A OD2 9  
ATOM   5005 N  N   . GLU A 1 57 ? 9.802   -3.243  6.269   1.00 0.00 ? 57 GLU A N   9  
ATOM   5006 C  CA  . GLU A 1 57 ? 10.538  -4.451  5.964   1.00 0.00 ? 57 GLU A CA  9  
ATOM   5007 C  C   . GLU A 1 57 ? 10.467  -4.792  4.470   1.00 0.00 ? 57 GLU A C   9  
ATOM   5008 O  O   . GLU A 1 57 ? 11.432  -5.305  3.903   1.00 0.00 ? 57 GLU A O   9  
ATOM   5009 C  CB  . GLU A 1 57 ? 10.084  -5.568  6.907   1.00 0.00 ? 57 GLU A CB  9  
ATOM   5010 C  CG  . GLU A 1 57 ? 8.682   -6.102  6.631   1.00 0.00 ? 57 GLU A CG  9  
ATOM   5011 C  CD  . GLU A 1 57 ? 7.488   -5.323  7.177   1.00 0.00 ? 57 GLU A CD  9  
ATOM   5012 O  OE1 . GLU A 1 57 ? 7.586   -4.096  7.431   1.00 0.00 ? 57 GLU A OE1 9  
ATOM   5013 O  OE2 . GLU A 1 57 ? 6.440   -5.991  7.289   1.00 0.00 ? 57 GLU A OE2 9  
ATOM   5014 N  N   . VAL A 1 58 ? 9.331   -4.489  3.837   1.00 0.00 ? 58 VAL A N   9  
ATOM   5015 C  CA  . VAL A 1 58 ? 9.093   -4.657  2.415   1.00 0.00 ? 58 VAL A CA  9  
ATOM   5016 C  C   . VAL A 1 58 ? 8.589   -3.331  1.845   1.00 0.00 ? 58 VAL A C   9  
ATOM   5017 O  O   . VAL A 1 58 ? 7.974   -2.544  2.562   1.00 0.00 ? 58 VAL A O   9  
ATOM   5018 C  CB  . VAL A 1 58 ? 8.106   -5.805  2.167   1.00 0.00 ? 58 VAL A CB  9  
ATOM   5019 C  CG1 . VAL A 1 58 ? 8.737   -7.145  2.565   1.00 0.00 ? 58 VAL A CG1 9  
ATOM   5020 C  CG2 . VAL A 1 58 ? 6.766   -5.605  2.888   1.00 0.00 ? 58 VAL A CG2 9  
ATOM   5021 N  N   . LEU A 1 59 ? 8.897   -3.074  0.574   1.00 0.00 ? 59 LEU A N   9  
ATOM   5022 C  CA  . LEU A 1 59 ? 8.670   -1.819  -0.104  1.00 0.00 ? 59 LEU A CA  9  
ATOM   5023 C  C   . LEU A 1 59 ? 7.302   -1.860  -0.778  1.00 0.00 ? 59 LEU A C   9  
ATOM   5024 O  O   . LEU A 1 59 ? 6.875   -2.899  -1.281  1.00 0.00 ? 59 LEU A O   9  
ATOM   5025 C  CB  . LEU A 1 59 ? 9.803   -1.611  -1.112  1.00 0.00 ? 59 LEU A CB  9  
ATOM   5026 C  CG  . LEU A 1 59 ? 9.902   -0.184  -1.657  1.00 0.00 ? 59 LEU A CG  9  
ATOM   5027 C  CD1 . LEU A 1 59 ? 10.315  0.856   -0.603  1.00 0.00 ? 59 LEU A CD1 9  
ATOM   5028 C  CD2 . LEU A 1 59 ? 10.963  -0.176  -2.759  1.00 0.00 ? 59 LEU A CD2 9  
ATOM   5029 N  N   . VAL A 1 60 ? 6.611   -0.731  -0.764  1.00 0.00 ? 60 VAL A N   9  
ATOM   5030 C  CA  . VAL A 1 60 ? 5.189   -0.627  -1.010  1.00 0.00 ? 60 VAL A CA  9  
ATOM   5031 C  C   . VAL A 1 60 ? 4.981   -0.122  -2.434  1.00 0.00 ? 60 VAL A C   9  
ATOM   5032 O  O   . VAL A 1 60 ? 5.518   0.923   -2.793  1.00 0.00 ? 60 VAL A O   9  
ATOM   5033 C  CB  . VAL A 1 60 ? 4.641   0.366   0.024   1.00 0.00 ? 60 VAL A CB  9  
ATOM   5034 C  CG1 . VAL A 1 60 ? 3.142   0.575   -0.134  1.00 0.00 ? 60 VAL A CG1 9  
ATOM   5035 C  CG2 . VAL A 1 60 ? 4.922   -0.118  1.451   1.00 0.00 ? 60 VAL A CG2 9  
ATOM   5036 N  N   . LYS A 1 61 ? 4.223   -0.838  -3.267  1.00 0.00 ? 61 LYS A N   9  
ATOM   5037 C  CA  . LYS A 1 61 ? 3.852   -0.296  -4.564  1.00 0.00 ? 61 LYS A CA  9  
ATOM   5038 C  C   . LYS A 1 61 ? 3.035   0.967   -4.325  1.00 0.00 ? 61 LYS A C   9  
ATOM   5039 O  O   . LYS A 1 61 ? 2.044   0.925   -3.608  1.00 0.00 ? 61 LYS A O   9  
ATOM   5040 C  CB  . LYS A 1 61 ? 3.039   -1.335  -5.337  1.00 0.00 ? 61 LYS A CB  9  
ATOM   5041 C  CG  . LYS A 1 61 ? 3.042   -1.105  -6.854  1.00 0.00 ? 61 LYS A CG  9  
ATOM   5042 C  CD  . LYS A 1 61 ? 2.750   -2.436  -7.559  1.00 0.00 ? 61 LYS A CD  9  
ATOM   5043 C  CE  . LYS A 1 61 ? 2.906   -2.362  -9.079  1.00 0.00 ? 61 LYS A CE  9  
ATOM   5044 N  NZ  . LYS A 1 61 ? 1.888   -1.478  -9.692  1.00 0.00 ? 61 LYS A NZ  9  
ATOM   5045 N  N   . ALA A 1 62 ? 3.437   2.074   -4.942  1.00 0.00 ? 62 ALA A N   9  
ATOM   5046 C  CA  . ALA A 1 62 ? 2.717   3.345   -4.895  1.00 0.00 ? 62 ALA A CA  9  
ATOM   5047 C  C   . ALA A 1 62 ? 1.231   3.166   -5.222  1.00 0.00 ? 62 ALA A C   9  
ATOM   5048 O  O   . ALA A 1 62 ? 0.380   3.820   -4.621  1.00 0.00 ? 62 ALA A O   9  
ATOM   5049 C  CB  . ALA A 1 62 ? 3.385   4.303   -5.871  1.00 0.00 ? 62 ALA A CB  9  
ATOM   5050 N  N   . GLU A 1 63 ? 0.927   2.280   -6.175  1.00 0.00 ? 63 GLU A N   9  
ATOM   5051 C  CA  . GLU A 1 63 ? -0.438  1.997   -6.592  1.00 0.00 ? 63 GLU A CA  9  
ATOM   5052 C  C   . GLU A 1 63 ? -1.144  0.978   -5.697  1.00 0.00 ? 63 GLU A C   9  
ATOM   5053 O  O   . GLU A 1 63 ? -2.315  0.697   -5.936  1.00 0.00 ? 63 GLU A O   9  
ATOM   5054 C  CB  . GLU A 1 63 ? -0.432  1.496   -8.034  1.00 0.00 ? 63 GLU A CB  9  
ATOM   5055 C  CG  . GLU A 1 63 ? 0.170   2.539   -8.986  1.00 0.00 ? 63 GLU A CG  9  
ATOM   5056 C  CD  . GLU A 1 63 ? 1.061   1.877   -10.027 1.00 0.00 ? 63 GLU A CD  9  
ATOM   5057 O  OE1 . GLU A 1 63 ? 1.972   1.131   -9.593  1.00 0.00 ? 63 GLU A OE1 9  
ATOM   5058 O  OE2 . GLU A 1 63 ? 0.822   2.099   -11.231 1.00 0.00 ? 63 GLU A OE2 9  
ATOM   5059 N  N   . GLY A 1 64 ? -0.457  0.394   -4.714  1.00 0.00 ? 64 GLY A N   9  
ATOM   5060 C  CA  . GLY A 1 64 ? -1.039  -0.600  -3.832  1.00 0.00 ? 64 GLY A CA  9  
ATOM   5061 C  C   . GLY A 1 64 ? -1.981  0.022   -2.818  1.00 0.00 ? 64 GLY A C   9  
ATOM   5062 O  O   . GLY A 1 64 ? -2.302  1.210   -2.885  1.00 0.00 ? 64 GLY A O   9  
ATOM   5063 N  N   . TRP A 1 65 ? -2.446  -0.807  -1.887  1.00 0.00 ? 65 TRP A N   9  
ATOM   5064 C  CA  . TRP A 1 65 ? -3.301  -0.388  -0.794  1.00 0.00 ? 65 TRP A CA  9  
ATOM   5065 C  C   . TRP A 1 65 ? -3.240  -1.473  0.273   1.00 0.00 ? 65 TRP A C   9  
ATOM   5066 O  O   . TRP A 1 65 ? -3.084  -2.642  -0.084  1.00 0.00 ? 65 TRP A O   9  
ATOM   5067 C  CB  . TRP A 1 65 ? -4.730  -0.220  -1.313  1.00 0.00 ? 65 TRP A CB  9  
ATOM   5068 C  CG  . TRP A 1 65 ? -5.735  0.237   -0.309  1.00 0.00 ? 65 TRP A CG  9  
ATOM   5069 C  CD1 . TRP A 1 65 ? -6.076  1.523   -0.079  1.00 0.00 ? 65 TRP A CD1 9  
ATOM   5070 C  CD2 . TRP A 1 65 ? -6.570  -0.567  0.576   1.00 0.00 ? 65 TRP A CD2 9  
ATOM   5071 N  NE1 . TRP A 1 65 ? -7.111  1.570   0.829   1.00 0.00 ? 65 TRP A NE1 9  
ATOM   5072 C  CE2 . TRP A 1 65 ? -7.463  0.308   1.258   1.00 0.00 ? 65 TRP A CE2 9  
ATOM   5073 C  CE3 . TRP A 1 65 ? -6.698  -1.949  0.838   1.00 0.00 ? 65 TRP A CE3 9  
ATOM   5074 C  CZ2 . TRP A 1 65 ? -8.464  -0.164  2.115   1.00 0.00 ? 65 TRP A CZ2 9  
ATOM   5075 C  CZ3 . TRP A 1 65 ? -7.661  -2.430  1.742   1.00 0.00 ? 65 TRP A CZ3 9  
ATOM   5076 C  CH2 . TRP A 1 65 ? -8.561  -1.544  2.364   1.00 0.00 ? 65 TRP A CH2 9  
ATOM   5077 N  N   . CYS A 1 66 ? -3.381  -1.090  1.547   1.00 0.00 ? 66 CYS A N   9  
ATOM   5078 C  CA  . CYS A 1 66 ? -3.504  -1.990  2.685   1.00 0.00 ? 66 CYS A CA  9  
ATOM   5079 C  C   . CYS A 1 66 ? -4.632  -1.501  3.599   1.00 0.00 ? 66 CYS A C   9  
ATOM   5080 O  O   . CYS A 1 66 ? -5.071  -0.359  3.488   1.00 0.00 ? 66 CYS A O   9  
ATOM   5081 C  CB  . CYS A 1 66 ? -2.189  -2.112  3.422   1.00 0.00 ? 66 CYS A CB  9  
ATOM   5082 S  SG  . CYS A 1 66 ? -1.895  -0.745  4.565   1.00 0.00 ? 66 CYS A SG  9  
ATOM   5083 N  N   . SER A 1 67 ? -5.127  -2.342  4.511   1.00 0.00 ? 67 SER A N   9  
ATOM   5084 C  CA  . SER A 1 67 ? -6.202  -1.939  5.413   1.00 0.00 ? 67 SER A CA  9  
ATOM   5085 C  C   . SER A 1 67 ? -5.727  -0.967  6.503   1.00 0.00 ? 67 SER A C   9  
ATOM   5086 O  O   . SER A 1 67 ? -6.543  -0.248  7.079   1.00 0.00 ? 67 SER A O   9  
ATOM   5087 C  CB  . SER A 1 67 ? -6.925  -3.175  5.953   1.00 0.00 ? 67 SER A CB  9  
ATOM   5088 O  OG  . SER A 1 67 ? -6.046  -4.128  6.510   1.00 0.00 ? 67 SER A OG  9  
ATOM   5089 N  N   . VAL A 1 68 ? -4.413  -0.902  6.739   1.00 0.00 ? 68 VAL A N   9  
ATOM   5090 C  CA  . VAL A 1 68 ? -3.750  0.163   7.493   1.00 0.00 ? 68 VAL A CA  9  
ATOM   5091 C  C   . VAL A 1 68 ? -3.579  1.448   6.644   1.00 0.00 ? 68 VAL A C   9  
ATOM   5092 O  O   . VAL A 1 68 ? -3.038  2.438   7.128   1.00 0.00 ? 68 VAL A O   9  
ATOM   5093 C  CB  . VAL A 1 68 ? -2.553  -0.394  8.308   1.00 0.00 ? 68 VAL A CB  9  
ATOM   5094 C  CG1 . VAL A 1 68 ? -1.611  -1.393  7.657   1.00 0.00 ? 68 VAL A CG1 9  
ATOM   5095 C  CG2 . VAL A 1 68 ? -1.659  0.692   8.887   1.00 0.00 ? 68 VAL A CG2 9  
ATOM   5096 N  N   . TYR A 1 69 ? -4.152  1.516   5.429   1.00 0.00 ? 69 TYR A N   9  
ATOM   5097 C  CA  . TYR A 1 69 ? -4.363  2.789   4.747   1.00 0.00 ? 69 TYR A CA  9  
ATOM   5098 C  C   . TYR A 1 69 ? -5.106  3.767   5.665   1.00 0.00 ? 69 TYR A C   9  
ATOM   5099 O  O   . TYR A 1 69 ? -6.166  3.439   6.210   1.00 0.00 ? 69 TYR A O   9  
ATOM   5100 C  CB  . TYR A 1 69 ? -5.135  2.609   3.427   1.00 0.00 ? 69 TYR A CB  9  
ATOM   5101 C  CG  . TYR A 1 69 ? -5.393  3.906   2.679   1.00 0.00 ? 69 TYR A CG  9  
ATOM   5102 C  CD1 . TYR A 1 69 ? -6.519  4.673   3.010   1.00 0.00 ? 69 TYR A CD1 9  
ATOM   5103 C  CD2 . TYR A 1 69 ? -4.487  4.400   1.722   1.00 0.00 ? 69 TYR A CD2 9  
ATOM   5104 C  CE1 . TYR A 1 69 ? -6.657  5.982   2.533   1.00 0.00 ? 69 TYR A CE1 9  
ATOM   5105 C  CE2 . TYR A 1 69 ? -4.680  5.676   1.162   1.00 0.00 ? 69 TYR A CE2 9  
ATOM   5106 C  CZ  . TYR A 1 69 ? -5.735  6.488   1.609   1.00 0.00 ? 69 TYR A CZ  9  
ATOM   5107 O  OH  . TYR A 1 69 ? -5.939  7.733   1.103   1.00 0.00 ? 69 TYR A OH  9  
ATOM   5108 N  N   . ALA A 1 70 ? -4.582  4.986   5.787   1.00 0.00 ? 70 ALA A N   9  
ATOM   5109 C  CA  . ALA A 1 70 ? -5.219  6.106   6.459   1.00 0.00 ? 70 ALA A CA  9  
ATOM   5110 C  C   . ALA A 1 70 ? -5.173  7.281   5.481   1.00 0.00 ? 70 ALA A C   9  
ATOM   5111 O  O   . ALA A 1 70 ? -4.133  7.477   4.855   1.00 0.00 ? 70 ALA A O   9  
ATOM   5112 C  CB  . ALA A 1 70 ? -4.455  6.428   7.745   1.00 0.00 ? 70 ALA A CB  9  
ATOM   5113 N  N   . PRO A 1 71 ? -6.266  8.035   5.292   1.00 0.00 ? 71 PRO A N   9  
ATOM   5114 C  CA  . PRO A 1 71 ? -6.286  9.124   4.337   1.00 0.00 ? 71 PRO A CA  9  
ATOM   5115 C  C   . PRO A 1 71 ? -5.481  10.304  4.853   1.00 0.00 ? 71 PRO A C   9  
ATOM   5116 O  O   . PRO A 1 71 ? -5.425  10.561  6.053   1.00 0.00 ? 71 PRO A O   9  
ATOM   5117 C  CB  . PRO A 1 71 ? -7.758  9.485   4.155   1.00 0.00 ? 71 PRO A CB  9  
ATOM   5118 C  CG  . PRO A 1 71 ? -8.366  9.127   5.511   1.00 0.00 ? 71 PRO A CG  9  
ATOM   5119 C  CD  . PRO A 1 71 ? -7.552  7.909   5.957   1.00 0.00 ? 71 PRO A CD  9  
ATOM   5120 N  N   . ALA A 1 72 ? -4.876  11.045  3.924   1.00 0.00 ? 72 ALA A N   9  
ATOM   5121 C  CA  . ALA A 1 72 ? -4.086  12.223  4.231   1.00 0.00 ? 72 ALA A CA  9  
ATOM   5122 C  C   . ALA A 1 72 ? -4.969  13.466  4.146   1.00 0.00 ? 72 ALA A C   9  
ATOM   5123 O  O   . ALA A 1 72 ? -4.616  14.470  3.528   1.00 0.00 ? 72 ALA A O   9  
ATOM   5124 C  CB  . ALA A 1 72 ? -2.910  12.291  3.269   1.00 0.00 ? 72 ALA A CB  9  
ATOM   5125 N  N   . SER A 1 73 ? -6.142  13.357  4.754   1.00 0.00 ? 73 SER A N   9  
ATOM   5126 C  CA  . SER A 1 73 ? -7.221  14.319  4.692   1.00 0.00 ? 73 SER A CA  9  
ATOM   5127 C  C   . SER A 1 73 ? -8.283  13.854  5.682   1.00 0.00 ? 73 SER A C   9  
ATOM   5128 O  O   . SER A 1 73 ? -8.634  14.643  6.585   1.00 0.00 ? 73 SER A O   9  
ATOM   5129 C  CB  . SER A 1 73 ? -7.808  14.342  3.275   1.00 0.00 ? 73 SER A CB  9  
ATOM   5130 O  OG  . SER A 1 73 ? -8.187  13.028  2.911   1.00 0.00 ? 73 SER A OG  9  
ATOM   5131 O  OXT . SER A 1 73 ? -8.718  12.695  5.486   1.00 0.00 ? 73 SER A OXT 9  
HETATM 5132 FE FE1 . SF4 B 2 .  ? 0.078   1.636   1.533   1.00 0.00 ? 74 SF4 A FE1 9  
HETATM 5133 FE FE2 . SF4 B 2 .  ? -0.576  3.169   3.402   1.00 0.00 ? 74 SF4 A FE2 9  
HETATM 5134 FE FE3 . SF4 B 2 .  ? 1.477   1.830   3.591   1.00 0.00 ? 74 SF4 A FE3 9  
HETATM 5135 FE FE4 . SF4 B 2 .  ? -0.760  0.703   3.669   1.00 0.00 ? 74 SF4 A FE4 9  
HETATM 5136 S  S1  . SF4 B 2 .  ? 0.016   2.088   5.148   1.00 0.00 ? 74 SF4 A S1  9  
HETATM 5137 S  S2  . SF4 B 2 .  ? 0.964   -0.024  2.597   1.00 0.00 ? 74 SF4 A S2  9  
HETATM 5138 S  S3  . SF4 B 2 .  ? -1.918  1.878   2.303   1.00 0.00 ? 74 SF4 A S3  9  
HETATM 5139 S  S4  . SF4 B 2 .  ? 1.152   3.387   2.150   1.00 0.00 ? 74 SF4 A S4  9  
ATOM   5140 N  N   . ALA A 1 1  ? 15.598  0.638   -5.058  1.00 0.00 ? 1  ALA A N   10 
ATOM   5141 C  CA  . ALA A 1 1  ? 16.795  0.231   -4.343  1.00 0.00 ? 1  ALA A CA  10 
ATOM   5142 C  C   . ALA A 1 1  ? 16.533  -1.206  -3.950  1.00 0.00 ? 1  ALA A C   10 
ATOM   5143 O  O   . ALA A 1 1  ? 15.441  -1.672  -4.275  1.00 0.00 ? 1  ALA A O   10 
ATOM   5144 C  CB  . ALA A 1 1  ? 17.210  1.115   -3.164  1.00 0.00 ? 1  ALA A CB  10 
ATOM   5145 N  N   . SER A 1 2  ? 17.462  -1.880  -3.267  1.00 0.00 ? 2  SER A N   10 
ATOM   5146 C  CA  . SER A 1 2  ? 17.375  -3.297  -2.939  1.00 0.00 ? 2  SER A CA  10 
ATOM   5147 C  C   . SER A 1 2  ? 16.354  -3.638  -1.847  1.00 0.00 ? 2  SER A C   10 
ATOM   5148 O  O   . SER A 1 2  ? 16.537  -4.614  -1.125  1.00 0.00 ? 2  SER A O   10 
ATOM   5149 C  CB  . SER A 1 2  ? 18.777  -3.756  -2.514  1.00 0.00 ? 2  SER A CB  10 
ATOM   5150 O  OG  . SER A 1 2  ? 19.758  -3.046  -3.251  1.00 0.00 ? 2  SER A OG  10 
ATOM   5151 N  N   . GLU A 1 3  ? 15.285  -2.854  -1.722  1.00 0.00 ? 3  GLU A N   10 
ATOM   5152 C  CA  . GLU A 1 3  ? 14.216  -3.111  -0.776  1.00 0.00 ? 3  GLU A CA  10 
ATOM   5153 C  C   . GLU A 1 3  ? 13.281  -4.156  -1.403  1.00 0.00 ? 3  GLU A C   10 
ATOM   5154 O  O   . GLU A 1 3  ? 12.880  -3.977  -2.554  1.00 0.00 ? 3  GLU A O   10 
ATOM   5155 C  CB  . GLU A 1 3  ? 13.478  -1.797  -0.503  1.00 0.00 ? 3  GLU A CB  10 
ATOM   5156 C  CG  . GLU A 1 3  ? 14.394  -0.694  0.056   1.00 0.00 ? 3  GLU A CG  10 
ATOM   5157 C  CD  . GLU A 1 3  ? 14.501  0.510   -0.871  1.00 0.00 ? 3  GLU A CD  10 
ATOM   5158 O  OE1 . GLU A 1 3  ? 14.886  0.310   -2.046  1.00 0.00 ? 3  GLU A OE1 10 
ATOM   5159 O  OE2 . GLU A 1 3  ? 14.217  1.636   -0.401  1.00 0.00 ? 3  GLU A OE2 10 
ATOM   5160 N  N   . PRO A 1 4  ? 12.945  -5.254  -0.706  1.00 0.00 ? 4  PRO A N   10 
ATOM   5161 C  CA  . PRO A 1 4  ? 12.129  -6.310  -1.284  1.00 0.00 ? 4  PRO A CA  10 
ATOM   5162 C  C   . PRO A 1 4  ? 10.720  -5.784  -1.565  1.00 0.00 ? 4  PRO A C   10 
ATOM   5163 O  O   . PRO A 1 4  ? 10.120  -5.128  -0.718  1.00 0.00 ? 4  PRO A O   10 
ATOM   5164 C  CB  . PRO A 1 4  ? 12.150  -7.456  -0.267  1.00 0.00 ? 4  PRO A CB  10 
ATOM   5165 C  CG  . PRO A 1 4  ? 12.429  -6.751  1.061   1.00 0.00 ? 4  PRO A CG  10 
ATOM   5166 C  CD  . PRO A 1 4  ? 13.311  -5.569  0.665   1.00 0.00 ? 4  PRO A CD  10 
ATOM   5167 N  N   . ARG A 1 5  ? 10.212  -6.032  -2.775  1.00 0.00 ? 5  ARG A N   10 
ATOM   5168 C  CA  . ARG A 1 5  ? 8.960   -5.461  -3.245  1.00 0.00 ? 5  ARG A CA  10 
ATOM   5169 C  C   . ARG A 1 5  ? 7.798   -6.270  -2.666  1.00 0.00 ? 5  ARG A C   10 
ATOM   5170 O  O   . ARG A 1 5  ? 7.758   -7.487  -2.831  1.00 0.00 ? 5  ARG A O   10 
ATOM   5171 C  CB  . ARG A 1 5  ? 8.957   -5.397  -4.779  1.00 0.00 ? 5  ARG A CB  10 
ATOM   5172 C  CG  . ARG A 1 5  ? 10.172  -4.634  -5.315  1.00 0.00 ? 5  ARG A CG  10 
ATOM   5173 C  CD  . ARG A 1 5  ? 10.365  -4.967  -6.791  1.00 0.00 ? 5  ARG A CD  10 
ATOM   5174 N  NE  . ARG A 1 5  ? 9.391   -4.324  -7.657  1.00 0.00 ? 5  ARG A NE  10 
ATOM   5175 C  CZ  . ARG A 1 5  ? 9.680   -3.579  -8.735  1.00 0.00 ? 5  ARG A CZ  10 
ATOM   5176 N  NH1 . ARG A 1 5  ? 10.685  -2.704  -8.688  1.00 0.00 ? 5  ARG A NH1 10 
ATOM   5177 N  NH2 . ARG A 1 5  ? 8.932   -3.684  -9.835  1.00 0.00 ? 5  ARG A NH2 10 
ATOM   5178 N  N   . ALA A 1 6  ? 6.905   -5.592  -1.943  1.00 0.00 ? 6  ALA A N   10 
ATOM   5179 C  CA  . ALA A 1 6  ? 5.900   -6.194  -1.082  1.00 0.00 ? 6  ALA A CA  10 
ATOM   5180 C  C   . ALA A 1 6  ? 5.060   -7.248  -1.800  1.00 0.00 ? 6  ALA A C   10 
ATOM   5181 O  O   . ALA A 1 6  ? 4.595   -7.041  -2.922  1.00 0.00 ? 6  ALA A O   10 
ATOM   5182 C  CB  . ALA A 1 6  ? 5.000   -5.099  -0.508  1.00 0.00 ? 6  ALA A CB  10 
ATOM   5183 N  N   . GLU A 1 7  ? 4.851   -8.375  -1.120  1.00 0.00 ? 7  GLU A N   10 
ATOM   5184 C  CA  . GLU A 1 7  ? 4.051   -9.484  -1.591  1.00 0.00 ? 7  GLU A CA  10 
ATOM   5185 C  C   . GLU A 1 7  ? 2.583   -9.068  -1.639  1.00 0.00 ? 7  GLU A C   10 
ATOM   5186 O  O   . GLU A 1 7  ? 2.117   -8.300  -0.790  1.00 0.00 ? 7  GLU A O   10 
ATOM   5187 C  CB  . GLU A 1 7  ? 4.214   -10.699 -0.676  1.00 0.00 ? 7  GLU A CB  10 
ATOM   5188 C  CG  . GLU A 1 7  ? 5.670   -10.930 -0.248  1.00 0.00 ? 7  GLU A CG  10 
ATOM   5189 C  CD  . GLU A 1 7  ? 5.967   -10.265 1.089   1.00 0.00 ? 7  GLU A CD  10 
ATOM   5190 O  OE1 . GLU A 1 7  ? 6.176   -9.035  1.111   1.00 0.00 ? 7  GLU A OE1 10 
ATOM   5191 O  OE2 . GLU A 1 7  ? 5.880   -10.927 2.143   1.00 0.00 ? 7  GLU A OE2 10 
ATOM   5192 N  N   . ASP A 1 8  ? 1.842   -9.628  -2.592  1.00 0.00 ? 8  ASP A N   10 
ATOM   5193 C  CA  . ASP A 1 8  ? 0.416   -9.419  -2.729  1.00 0.00 ? 8  ASP A CA  10 
ATOM   5194 C  C   . ASP A 1 8  ? -0.307  -10.030 -1.532  1.00 0.00 ? 8  ASP A C   10 
ATOM   5195 O  O   . ASP A 1 8  ? -0.698  -11.194 -1.546  1.00 0.00 ? 8  ASP A O   10 
ATOM   5196 C  CB  . ASP A 1 8  ? -0.051  -9.999  -4.065  1.00 0.00 ? 8  ASP A CB  10 
ATOM   5197 C  CG  . ASP A 1 8  ? 0.158   -8.978  -5.163  1.00 0.00 ? 8  ASP A CG  10 
ATOM   5198 O  OD1 . ASP A 1 8  ? -0.734  -8.117  -5.300  1.00 0.00 ? 8  ASP A OD1 10 
ATOM   5199 O  OD2 . ASP A 1 8  ? 1.249   -9.000  -5.773  1.00 0.00 ? 8  ASP A OD2 10 
ATOM   5200 N  N   . GLY A 1 9  ? -0.438  -9.226  -0.477  1.00 0.00 ? 9  GLY A N   10 
ATOM   5201 C  CA  . GLY A 1 9  ? -0.968  -9.647  0.802   1.00 0.00 ? 9  GLY A CA  10 
ATOM   5202 C  C   . GLY A 1 9  ? 0.155   -10.082 1.741   1.00 0.00 ? 9  GLY A C   10 
ATOM   5203 O  O   . GLY A 1 9  ? -0.046  -10.999 2.529   1.00 0.00 ? 9  GLY A O   10 
ATOM   5204 N  N   . HIS A 1 10 ? 1.308   -9.389  1.702   1.00 0.00 ? 10 HIS A N   10 
ATOM   5205 C  CA  . HIS A 1 10 ? 2.344   -9.468  2.734   1.00 0.00 ? 10 HIS A CA  10 
ATOM   5206 C  C   . HIS A 1 10 ? 1.698   -9.533  4.117   1.00 0.00 ? 10 HIS A C   10 
ATOM   5207 O  O   . HIS A 1 10 ? 1.957   -10.436 4.906   1.00 0.00 ? 10 HIS A O   10 
ATOM   5208 C  CB  . HIS A 1 10 ? 3.243   -8.225  2.653   1.00 0.00 ? 10 HIS A CB  10 
ATOM   5209 C  CG  . HIS A 1 10 ? 4.271   -8.161  3.760   1.00 0.00 ? 10 HIS A CG  10 
ATOM   5210 N  ND1 . HIS A 1 10 ? 5.474   -8.842  3.788   1.00 0.00 ? 10 HIS A ND1 10 
ATOM   5211 C  CD2 . HIS A 1 10 ? 4.134   -7.499  4.951   1.00 0.00 ? 10 HIS A CD2 10 
ATOM   5212 C  CE1 . HIS A 1 10 ? 6.066   -8.581  4.967   1.00 0.00 ? 10 HIS A CE1 10 
ATOM   5213 N  NE2 . HIS A 1 10 ? 5.259   -7.791  5.696   1.00 0.00 ? 10 HIS A NE2 10 
ATOM   5214 N  N   . ALA A 1 11 ? 0.842   -8.545  4.372   1.00 0.00 ? 11 ALA A N   10 
ATOM   5215 C  CA  . ALA A 1 11 ? -0.037  -8.470  5.519   1.00 0.00 ? 11 ALA A CA  10 
ATOM   5216 C  C   . ALA A 1 11 ? -1.068  -7.382  5.221   1.00 0.00 ? 11 ALA A C   10 
ATOM   5217 O  O   . ALA A 1 11 ? -0.975  -6.693  4.201   1.00 0.00 ? 11 ALA A O   10 
ATOM   5218 C  CB  . ALA A 1 11 ? 0.775   -8.179  6.792   1.00 0.00 ? 11 ALA A CB  10 
ATOM   5219 N  N   . HIS A 1 12 ? -2.040  -7.221  6.121   1.00 0.00 ? 12 HIS A N   10 
ATOM   5220 C  CA  . HIS A 1 12 ? -2.989  -6.110  6.139   1.00 0.00 ? 12 HIS A CA  10 
ATOM   5221 C  C   . HIS A 1 12 ? -3.760  -5.939  4.823   1.00 0.00 ? 12 HIS A C   10 
ATOM   5222 O  O   . HIS A 1 12 ? -4.156  -4.818  4.503   1.00 0.00 ? 12 HIS A O   10 
ATOM   5223 C  CB  . HIS A 1 12 ? -2.279  -4.793  6.493   1.00 0.00 ? 12 HIS A CB  10 
ATOM   5224 C  CG  . HIS A 1 12 ? -1.144  -4.879  7.482   1.00 0.00 ? 12 HIS A CG  10 
ATOM   5225 N  ND1 . HIS A 1 12 ? -1.180  -4.495  8.812   1.00 0.00 ? 12 HIS A ND1 10 
ATOM   5226 C  CD2 . HIS A 1 12 ? 0.166   -5.051  7.134   1.00 0.00 ? 12 HIS A CD2 10 
ATOM   5227 C  CE1 . HIS A 1 12 ? 0.092   -4.423  9.253   1.00 0.00 ? 12 HIS A CE1 10 
ATOM   5228 N  NE2 . HIS A 1 12 ? 0.916   -4.764  8.248   1.00 0.00 ? 12 HIS A NE2 10 
ATOM   5229 N  N   . ASP A 1 13 ? -3.998  -7.025  4.086   1.00 0.00 ? 13 ASP A N   10 
ATOM   5230 C  CA  . ASP A 1 13 ? -4.798  -7.039  2.862   1.00 0.00 ? 13 ASP A CA  10 
ATOM   5231 C  C   . ASP A 1 13 ? -4.254  -6.062  1.810   1.00 0.00 ? 13 ASP A C   10 
ATOM   5232 O  O   . ASP A 1 13 ? -5.026  -5.450  1.076   1.00 0.00 ? 13 ASP A O   10 
ATOM   5233 C  CB  . ASP A 1 13 ? -6.286  -6.793  3.166   1.00 0.00 ? 13 ASP A CB  10 
ATOM   5234 C  CG  . ASP A 1 13 ? -6.758  -7.370  4.491   1.00 0.00 ? 13 ASP A CG  10 
ATOM   5235 O  OD1 . ASP A 1 13 ? -6.363  -8.506  4.822   1.00 0.00 ? 13 ASP A OD1 10 
ATOM   5236 O  OD2 . ASP A 1 13 ? -7.530  -6.631  5.143   1.00 0.00 ? 13 ASP A OD2 10 
ATOM   5237 N  N   . TYR A 1 14 ? -2.926  -5.905  1.759   1.00 0.00 ? 14 TYR A N   10 
ATOM   5238 C  CA  . TYR A 1 14 ? -2.249  -4.898  0.953   1.00 0.00 ? 14 TYR A CA  10 
ATOM   5239 C  C   . TYR A 1 14 ? -2.626  -4.918  -0.536  1.00 0.00 ? 14 TYR A C   10 
ATOM   5240 O  O   . TYR A 1 14 ? -3.201  -3.948  -1.021  1.00 0.00 ? 14 TYR A O   10 
ATOM   5241 C  CB  . TYR A 1 14 ? -0.743  -4.981  1.240   1.00 0.00 ? 14 TYR A CB  10 
ATOM   5242 C  CG  . TYR A 1 14 ? 0.190   -4.474  0.159   1.00 0.00 ? 14 TYR A CG  10 
ATOM   5243 C  CD1 . TYR A 1 14 ? 0.576   -3.122  0.124   1.00 0.00 ? 14 TYR A CD1 10 
ATOM   5244 C  CD2 . TYR A 1 14 ? 0.723   -5.373  -0.780  1.00 0.00 ? 14 TYR A CD2 10 
ATOM   5245 C  CE1 . TYR A 1 14 ? 1.418   -2.659  -0.898  1.00 0.00 ? 14 TYR A CE1 10 
ATOM   5246 C  CE2 . TYR A 1 14 ? 1.606   -4.922  -1.771  1.00 0.00 ? 14 TYR A CE2 10 
ATOM   5247 C  CZ  . TYR A 1 14 ? 1.935   -3.559  -1.840  1.00 0.00 ? 14 TYR A CZ  10 
ATOM   5248 O  OH  . TYR A 1 14 ? 2.842   -3.126  -2.755  1.00 0.00 ? 14 TYR A OH  10 
ATOM   5249 N  N   . VAL A 1 15 ? -2.297  -6.011  -1.242  1.00 0.00 ? 15 VAL A N   10 
ATOM   5250 C  CA  . VAL A 1 15 ? -2.351  -6.176  -2.703  1.00 0.00 ? 15 VAL A CA  10 
ATOM   5251 C  C   . VAL A 1 15 ? -1.548  -5.115  -3.487  1.00 0.00 ? 15 VAL A C   10 
ATOM   5252 O  O   . VAL A 1 15 ? -1.570  -3.924  -3.186  1.00 0.00 ? 15 VAL A O   10 
ATOM   5253 C  CB  . VAL A 1 15 ? -3.779  -6.425  -3.244  1.00 0.00 ? 15 VAL A CB  10 
ATOM   5254 C  CG1 . VAL A 1 15 ? -4.274  -7.788  -2.744  1.00 0.00 ? 15 VAL A CG1 10 
ATOM   5255 C  CG2 . VAL A 1 15 ? -4.814  -5.365  -2.851  1.00 0.00 ? 15 VAL A CG2 10 
ATOM   5256 N  N   . ASN A 1 16 ? -0.776  -5.554  -4.488  1.00 0.00 ? 16 ASN A N   10 
ATOM   5257 C  CA  . ASN A 1 16 ? 0.122   -4.697  -5.238  1.00 0.00 ? 16 ASN A CA  10 
ATOM   5258 C  C   . ASN A 1 16 ? -0.624  -3.662  -6.072  1.00 0.00 ? 16 ASN A C   10 
ATOM   5259 O  O   . ASN A 1 16 ? -0.082  -2.589  -6.333  1.00 0.00 ? 16 ASN A O   10 
ATOM   5260 C  CB  . ASN A 1 16 ? 1.130   -5.484  -6.087  1.00 0.00 ? 16 ASN A CB  10 
ATOM   5261 C  CG  . ASN A 1 16 ? 2.423   -5.692  -5.316  1.00 0.00 ? 16 ASN A CG  10 
ATOM   5262 O  OD1 . ASN A 1 16 ? 3.065   -4.730  -4.913  1.00 0.00 ? 16 ASN A OD1 10 
ATOM   5263 N  ND2 . ASN A 1 16 ? 2.816   -6.927  -5.072  1.00 0.00 ? 16 ASN A ND2 10 
ATOM   5264 N  N   . GLU A 1 17 ? -1.847  -3.986  -6.501  1.00 0.00 ? 17 GLU A N   10 
ATOM   5265 C  CA  . GLU A 1 17 ? -2.751  -3.063  -7.138  1.00 0.00 ? 17 GLU A CA  10 
ATOM   5266 C  C   . GLU A 1 17 ? -3.922  -2.868  -6.188  1.00 0.00 ? 17 GLU A C   10 
ATOM   5267 O  O   . GLU A 1 17 ? -4.639  -3.821  -5.890  1.00 0.00 ? 17 GLU A O   10 
ATOM   5268 C  CB  . GLU A 1 17 ? -3.217  -3.657  -8.467  1.00 0.00 ? 17 GLU A CB  10 
ATOM   5269 C  CG  . GLU A 1 17 ? -3.818  -2.557  -9.337  1.00 0.00 ? 17 GLU A CG  10 
ATOM   5270 C  CD  . GLU A 1 17 ? -4.249  -3.054  -10.714 1.00 0.00 ? 17 GLU A CD  10 
ATOM   5271 O  OE1 . GLU A 1 17 ? -3.628  -4.024  -11.196 1.00 0.00 ? 17 GLU A OE1 10 
ATOM   5272 O  OE2 . GLU A 1 17 ? -5.184  -2.435  -11.267 1.00 0.00 ? 17 GLU A OE2 10 
ATOM   5273 N  N   . ALA A 1 18 ? -4.129  -1.632  -5.740  1.00 0.00 ? 18 ALA A N   10 
ATOM   5274 C  CA  . ALA A 1 18 ? -5.250  -1.237  -4.902  1.00 0.00 ? 18 ALA A CA  10 
ATOM   5275 C  C   . ALA A 1 18 ? -6.551  -1.782  -5.487  1.00 0.00 ? 18 ALA A C   10 
ATOM   5276 O  O   . ALA A 1 18 ? -7.388  -2.319  -4.766  1.00 0.00 ? 18 ALA A O   10 
ATOM   5277 C  CB  . ALA A 1 18 ? -5.298  0.290   -4.803  1.00 0.00 ? 18 ALA A CB  10 
ATOM   5278 N  N   . ALA A 1 19 ? -6.704  -1.667  -6.810  1.00 0.00 ? 19 ALA A N   10 
ATOM   5279 C  CA  . ALA A 1 19 ? -7.837  -2.211  -7.543  1.00 0.00 ? 19 ALA A CA  10 
ATOM   5280 C  C   . ALA A 1 19 ? -8.156  -3.656  -7.158  1.00 0.00 ? 19 ALA A C   10 
ATOM   5281 O  O   . ALA A 1 19 ? -9.337  -3.981  -7.029  1.00 0.00 ? 19 ALA A O   10 
ATOM   5282 C  CB  . ALA A 1 19 ? -7.607  -2.098  -9.049  1.00 0.00 ? 19 ALA A CB  10 
ATOM   5283 N  N   . ASP A 1 20 ? -7.152  -4.521  -6.948  1.00 0.00 ? 20 ASP A N   10 
ATOM   5284 C  CA  . ASP A 1 20 ? -7.429  -5.900  -6.545  1.00 0.00 ? 20 ASP A CA  10 
ATOM   5285 C  C   . ASP A 1 20 ? -8.352  -5.952  -5.316  1.00 0.00 ? 20 ASP A C   10 
ATOM   5286 O  O   . ASP A 1 20 ? -9.233  -6.803  -5.216  1.00 0.00 ? 20 ASP A O   10 
ATOM   5287 C  CB  . ASP A 1 20 ? -6.142  -6.678  -6.278  1.00 0.00 ? 20 ASP A CB  10 
ATOM   5288 C  CG  . ASP A 1 20 ? -6.412  -8.176  -6.291  1.00 0.00 ? 20 ASP A CG  10 
ATOM   5289 O  OD1 . ASP A 1 20 ? -6.511  -8.724  -7.410  1.00 0.00 ? 20 ASP A OD1 10 
ATOM   5290 O  OD2 . ASP A 1 20 ? -6.524  -8.747  -5.185  1.00 0.00 ? 20 ASP A OD2 10 
ATOM   5291 N  N   . ALA A 1 21 ? -8.197  -4.981  -4.409  1.00 0.00 ? 21 ALA A N   10 
ATOM   5292 C  CA  . ALA A 1 21 ? -8.973  -4.887  -3.179  1.00 0.00 ? 21 ALA A CA  10 
ATOM   5293 C  C   . ALA A 1 21 ? -10.428 -4.464  -3.397  1.00 0.00 ? 21 ALA A C   10 
ATOM   5294 O  O   . ALA A 1 21 ? -11.108 -4.277  -2.393  1.00 0.00 ? 21 ALA A O   10 
ATOM   5295 C  CB  . ALA A 1 21 ? -8.281  -3.948  -2.183  1.00 0.00 ? 21 ALA A CB  10 
ATOM   5296 N  N   . SER A 1 22 ? -10.906 -4.318  -4.644  1.00 0.00 ? 22 SER A N   10 
ATOM   5297 C  CA  . SER A 1 22 ? -12.281 -4.120  -5.058  1.00 0.00 ? 22 SER A CA  10 
ATOM   5298 C  C   . SER A 1 22 ? -13.305 -4.404  -3.962  1.00 0.00 ? 22 SER A C   10 
ATOM   5299 O  O   . SER A 1 22 ? -13.669 -5.551  -3.706  1.00 0.00 ? 22 SER A O   10 
ATOM   5300 C  CB  . SER A 1 22 ? -12.555 -5.021  -6.261  1.00 0.00 ? 22 SER A CB  10 
ATOM   5301 O  OG  . SER A 1 22 ? -11.972 -4.523  -7.448  1.00 0.00 ? 22 SER A OG  10 
ATOM   5302 N  N   . GLY A 1 23 ? -13.781 -3.334  -3.340  1.00 0.00 ? 23 GLY A N   10 
ATOM   5303 C  CA  . GLY A 1 23 ? -14.872 -3.362  -2.380  1.00 0.00 ? 23 GLY A CA  10 
ATOM   5304 C  C   . GLY A 1 23 ? -14.595 -4.168  -1.106  1.00 0.00 ? 23 GLY A C   10 
ATOM   5305 O  O   . GLY A 1 23 ? -15.539 -4.536  -0.408  1.00 0.00 ? 23 GLY A O   10 
ATOM   5306 N  N   . HIS A 1 24 ? -13.327 -4.403  -0.741  1.00 0.00 ? 24 HIS A N   10 
ATOM   5307 C  CA  . HIS A 1 24 ? -12.955 -4.818  0.607   1.00 0.00 ? 24 HIS A CA  10 
ATOM   5308 C  C   . HIS A 1 24 ? -13.663 -3.887  1.595   1.00 0.00 ? 24 HIS A C   10 
ATOM   5309 O  O   . HIS A 1 24 ? -13.475 -2.680  1.483   1.00 0.00 ? 24 HIS A O   10 
ATOM   5310 C  CB  . HIS A 1 24 ? -11.429 -4.659  0.741   1.00 0.00 ? 24 HIS A CB  10 
ATOM   5311 C  CG  . HIS A 1 24 ? -10.803 -4.935  2.090   1.00 0.00 ? 24 HIS A CG  10 
ATOM   5312 N  ND1 . HIS A 1 24 ? -11.185 -4.407  3.315   1.00 0.00 ? 24 HIS A ND1 10 
ATOM   5313 C  CD2 . HIS A 1 24 ? -9.598  -5.556  2.274   1.00 0.00 ? 24 HIS A CD2 10 
ATOM   5314 C  CE1 . HIS A 1 24 ? -10.246 -4.717  4.221   1.00 0.00 ? 24 HIS A CE1 10 
ATOM   5315 N  NE2 . HIS A 1 24 ? -9.286  -5.430  3.613   1.00 0.00 ? 24 HIS A NE2 10 
ATOM   5316 N  N   . PRO A 1 25 ? -14.407 -4.374  2.599   1.00 0.00 ? 25 PRO A N   10 
ATOM   5317 C  CA  . PRO A 1 25 ? -15.005 -3.493  3.592   1.00 0.00 ? 25 PRO A CA  10 
ATOM   5318 C  C   . PRO A 1 25 ? -13.878 -2.749  4.316   1.00 0.00 ? 25 PRO A C   10 
ATOM   5319 O  O   . PRO A 1 25 ? -13.066 -3.394  4.973   1.00 0.00 ? 25 PRO A O   10 
ATOM   5320 C  CB  . PRO A 1 25 ? -15.814 -4.411  4.516   1.00 0.00 ? 25 PRO A CB  10 
ATOM   5321 C  CG  . PRO A 1 25 ? -15.135 -5.773  4.369   1.00 0.00 ? 25 PRO A CG  10 
ATOM   5322 C  CD  . PRO A 1 25 ? -14.645 -5.771  2.920   1.00 0.00 ? 25 PRO A CD  10 
ATOM   5323 N  N   . ARG A 1 26 ? -13.762 -1.437  4.077   1.00 0.00 ? 26 ARG A N   10 
ATOM   5324 C  CA  . ARG A 1 26 ? -12.702 -0.503  4.478   1.00 0.00 ? 26 ARG A CA  10 
ATOM   5325 C  C   . ARG A 1 26 ? -12.117 0.188   3.249   1.00 0.00 ? 26 ARG A C   10 
ATOM   5326 O  O   . ARG A 1 26 ? -11.840 1.385   3.311   1.00 0.00 ? 26 ARG A O   10 
ATOM   5327 C  CB  . ARG A 1 26 ? -11.575 -1.108  5.341   1.00 0.00 ? 26 ARG A CB  10 
ATOM   5328 C  CG  . ARG A 1 26 ? -10.398 -0.166  5.643   1.00 0.00 ? 26 ARG A CG  10 
ATOM   5329 C  CD  . ARG A 1 26 ? -10.768 1.204   6.234   1.00 0.00 ? 26 ARG A CD  10 
ATOM   5330 N  NE  . ARG A 1 26 ? -9.636  2.148   6.171   1.00 0.00 ? 26 ARG A NE  10 
ATOM   5331 C  CZ  . ARG A 1 26 ? -9.532  3.222   5.361   1.00 0.00 ? 26 ARG A CZ  10 
ATOM   5332 N  NH1 . ARG A 1 26 ? -10.298 3.374   4.275   1.00 0.00 ? 26 ARG A NH1 10 
ATOM   5333 N  NH2 . ARG A 1 26 ? -8.644  4.173   5.640   1.00 0.00 ? 26 ARG A NH2 10 
ATOM   5334 N  N   . TYR A 1 27 ? -11.911 -0.531  2.145   1.00 0.00 ? 27 TYR A N   10 
ATOM   5335 C  CA  . TYR A 1 27 ? -11.412 0.066   0.919   1.00 0.00 ? 27 TYR A CA  10 
ATOM   5336 C  C   . TYR A 1 27 ? -12.479 0.951   0.281   1.00 0.00 ? 27 TYR A C   10 
ATOM   5337 O  O   . TYR A 1 27 ? -13.672 0.652   0.320   1.00 0.00 ? 27 TYR A O   10 
ATOM   5338 C  CB  . TYR A 1 27 ? -10.962 -1.020  -0.064  1.00 0.00 ? 27 TYR A CB  10 
ATOM   5339 C  CG  . TYR A 1 27 ? -10.369 -0.538  -1.377  1.00 0.00 ? 27 TYR A CG  10 
ATOM   5340 C  CD1 . TYR A 1 27 ? -9.345  0.428   -1.405  1.00 0.00 ? 27 TYR A CD1 10 
ATOM   5341 C  CD2 . TYR A 1 27 ? -10.782 -1.136  -2.580  1.00 0.00 ? 27 TYR A CD2 10 
ATOM   5342 C  CE1 . TYR A 1 27 ? -8.736  0.777   -2.620  1.00 0.00 ? 27 TYR A CE1 10 
ATOM   5343 C  CE2 . TYR A 1 27 ? -10.120 -0.843  -3.782  1.00 0.00 ? 27 TYR A CE2 10 
ATOM   5344 C  CZ  . TYR A 1 27 ? -9.103  0.122   -3.806  1.00 0.00 ? 27 TYR A CZ  10 
ATOM   5345 O  OH  . TYR A 1 27 ? -8.559  0.512   -4.994  1.00 0.00 ? 27 TYR A OH  10 
ATOM   5346 N  N   . GLN A 1 28 ? -12.002 2.048   -0.295  1.00 0.00 ? 28 GLN A N   10 
ATOM   5347 C  CA  . GLN A 1 28 ? -12.681 2.874   -1.262  1.00 0.00 ? 28 GLN A CA  10 
ATOM   5348 C  C   . GLN A 1 28 ? -11.671 3.120   -2.379  1.00 0.00 ? 28 GLN A C   10 
ATOM   5349 O  O   . GLN A 1 28 ? -10.567 3.619   -2.126  1.00 0.00 ? 28 GLN A O   10 
ATOM   5350 C  CB  . GLN A 1 28 ? -13.108 4.216   -0.673  1.00 0.00 ? 28 GLN A CB  10 
ATOM   5351 C  CG  . GLN A 1 28 ? -14.138 4.135   0.461   1.00 0.00 ? 28 GLN A CG  10 
ATOM   5352 C  CD  . GLN A 1 28 ? -13.533 3.649   1.774   1.00 0.00 ? 28 GLN A CD  10 
ATOM   5353 O  OE1 . GLN A 1 28 ? -12.525 4.173   2.242   1.00 0.00 ? 28 GLN A OE1 10 
ATOM   5354 N  NE2 . GLN A 1 28 ? -14.104 2.614   2.374   1.00 0.00 ? 28 GLN A NE2 10 
ATOM   5355 N  N   . GLU A 1 29 ? -12.074 2.747   -3.584  1.00 0.00 ? 29 GLU A N   10 
ATOM   5356 C  CA  . GLU A 1 29 ? -11.352 2.814   -4.831  1.00 0.00 ? 29 GLU A CA  10 
ATOM   5357 C  C   . GLU A 1 29 ? -10.864 4.244   -5.052  1.00 0.00 ? 29 GLU A C   10 
ATOM   5358 O  O   . GLU A 1 29 ? -11.668 5.173   -5.110  1.00 0.00 ? 29 GLU A O   10 
ATOM   5359 C  CB  . GLU A 1 29 ? -12.282 2.331   -5.956  1.00 0.00 ? 29 GLU A CB  10 
ATOM   5360 C  CG  . GLU A 1 29 ? -12.585 0.816   -5.920  1.00 0.00 ? 29 GLU A CG  10 
ATOM   5361 C  CD  . GLU A 1 29 ? -13.406 0.319   -4.728  1.00 0.00 ? 29 GLU A CD  10 
ATOM   5362 O  OE1 . GLU A 1 29 ? -14.115 1.154   -4.124  1.00 0.00 ? 29 GLU A OE1 10 
ATOM   5363 O  OE2 . GLU A 1 29 ? -13.304 -0.893  -4.430  1.00 0.00 ? 29 GLU A OE2 10 
ATOM   5364 N  N   . GLY A 1 30 ? -9.544  4.416   -5.138  1.00 0.00 ? 30 GLY A N   10 
ATOM   5365 C  CA  . GLY A 1 30 ? -8.899  5.717   -5.234  1.00 0.00 ? 30 GLY A CA  10 
ATOM   5366 C  C   . GLY A 1 30 ? -7.861  5.879   -4.129  1.00 0.00 ? 30 GLY A C   10 
ATOM   5367 O  O   . GLY A 1 30 ? -6.816  6.494   -4.348  1.00 0.00 ? 30 GLY A O   10 
ATOM   5368 N  N   . GLN A 1 31 ? -8.119  5.316   -2.942  1.00 0.00 ? 31 GLN A N   10 
ATOM   5369 C  CA  . GLN A 1 31 ? -7.087  5.283   -1.916  1.00 0.00 ? 31 GLN A CA  10 
ATOM   5370 C  C   . GLN A 1 31 ? -5.929  4.419   -2.435  1.00 0.00 ? 31 GLN A C   10 
ATOM   5371 O  O   . GLN A 1 31 ? -6.129  3.242   -2.721  1.00 0.00 ? 31 GLN A O   10 
ATOM   5372 C  CB  . GLN A 1 31 ? -7.674  4.713   -0.622  1.00 0.00 ? 31 GLN A CB  10 
ATOM   5373 C  CG  . GLN A 1 31 ? -8.583  5.695   0.130   1.00 0.00 ? 31 GLN A CG  10 
ATOM   5374 C  CD  . GLN A 1 31 ? -9.381  4.955   1.198   1.00 0.00 ? 31 GLN A CD  10 
ATOM   5375 O  OE1 . GLN A 1 31 ? -9.273  5.154   2.411   1.00 0.00 ? 31 GLN A OE1 10 
ATOM   5376 N  NE2 . GLN A 1 31 ? -10.223 4.064   0.718   1.00 0.00 ? 31 GLN A NE2 10 
ATOM   5377 N  N   . LEU A 1 32 ? -4.742  5.009   -2.581  1.00 0.00 ? 32 LEU A N   10 
ATOM   5378 C  CA  . LEU A 1 32 ? -3.529  4.383   -3.094  1.00 0.00 ? 32 LEU A CA  10 
ATOM   5379 C  C   . LEU A 1 32 ? -2.417  4.665   -2.088  1.00 0.00 ? 32 LEU A C   10 
ATOM   5380 O  O   . LEU A 1 32 ? -2.404  5.748   -1.511  1.00 0.00 ? 32 LEU A O   10 
ATOM   5381 C  CB  . LEU A 1 32 ? -3.141  5.033   -4.436  1.00 0.00 ? 32 LEU A CB  10 
ATOM   5382 C  CG  . LEU A 1 32 ? -3.223  4.112   -5.651  1.00 0.00 ? 32 LEU A CG  10 
ATOM   5383 C  CD1 . LEU A 1 32 ? -4.658  3.808   -6.063  1.00 0.00 ? 32 LEU A CD1 10 
ATOM   5384 C  CD2 . LEU A 1 32 ? -2.551  4.824   -6.833  1.00 0.00 ? 32 LEU A CD2 10 
ATOM   5385 N  N   . CYS A 1 33 ? -1.459  3.751   -1.920  1.00 0.00 ? 33 CYS A N   10 
ATOM   5386 C  CA  . CYS A 1 33 ? -0.280  3.945   -1.084  1.00 0.00 ? 33 CYS A CA  10 
ATOM   5387 C  C   . CYS A 1 33 ? 0.337   5.333   -1.298  1.00 0.00 ? 33 CYS A C   10 
ATOM   5388 O  O   . CYS A 1 33 ? 0.584   6.053   -0.336  1.00 0.00 ? 33 CYS A O   10 
ATOM   5389 C  CB  . CYS A 1 33 ? 0.730   2.859   -1.358  1.00 0.00 ? 33 CYS A CB  10 
ATOM   5390 S  SG  . CYS A 1 33 ? 0.424   1.332   -0.417  1.00 0.00 ? 33 CYS A SG  10 
ATOM   5391 N  N   . GLU A 1 34 ? 0.561   5.765   -2.541  1.00 0.00 ? 34 GLU A N   10 
ATOM   5392 C  CA  . GLU A 1 34 ? 1.174   7.077   -2.744  1.00 0.00 ? 34 GLU A CA  10 
ATOM   5393 C  C   . GLU A 1 34 ? 0.346   8.248   -2.184  1.00 0.00 ? 34 GLU A C   10 
ATOM   5394 O  O   . GLU A 1 34 ? 0.902   9.318   -1.940  1.00 0.00 ? 34 GLU A O   10 
ATOM   5395 C  CB  . GLU A 1 34 ? 1.584   7.262   -4.205  1.00 0.00 ? 34 GLU A CB  10 
ATOM   5396 C  CG  . GLU A 1 34 ? 0.400   7.531   -5.138  1.00 0.00 ? 34 GLU A CG  10 
ATOM   5397 C  CD  . GLU A 1 34 ? 0.817   7.690   -6.597  1.00 0.00 ? 34 GLU A CD  10 
ATOM   5398 O  OE1 . GLU A 1 34 ? 2.039   7.636   -6.859  1.00 0.00 ? 34 GLU A OE1 10 
ATOM   5399 O  OE2 . GLU A 1 34 ? -0.102  7.879   -7.421  1.00 0.00 ? 34 GLU A OE2 10 
ATOM   5400 N  N   . ASN A 1 35 ? -0.965  8.058   -1.966  1.00 0.00 ? 35 ASN A N   10 
ATOM   5401 C  CA  . ASN A 1 35 ? -1.857  9.032   -1.334  1.00 0.00 ? 35 ASN A CA  10 
ATOM   5402 C  C   . ASN A 1 35 ? -2.248  8.609   0.091   1.00 0.00 ? 35 ASN A C   10 
ATOM   5403 O  O   . ASN A 1 35 ? -3.274  9.058   0.608   1.00 0.00 ? 35 ASN A O   10 
ATOM   5404 C  CB  . ASN A 1 35 ? -3.061  9.344   -2.249  1.00 0.00 ? 35 ASN A CB  10 
ATOM   5405 C  CG  . ASN A 1 35 ? -4.098  8.243   -2.416  1.00 0.00 ? 35 ASN A CG  10 
ATOM   5406 O  OD1 . ASN A 1 35 ? -4.571  7.641   -1.461  1.00 0.00 ? 35 ASN A OD1 10 
ATOM   5407 N  ND2 . ASN A 1 35 ? -4.515  8.000   -3.652  1.00 0.00 ? 35 ASN A ND2 10 
ATOM   5408 N  N   . CYS A 1 36 ? -1.423  7.781   0.742   1.00 0.00 ? 36 CYS A N   10 
ATOM   5409 C  CA  . CYS A 1 36 ? -1.595  7.326   2.115   1.00 0.00 ? 36 CYS A CA  10 
ATOM   5410 C  C   . CYS A 1 36 ? -0.785  8.218   3.056   1.00 0.00 ? 36 CYS A C   10 
ATOM   5411 O  O   . CYS A 1 36 ? 0.385   8.509   2.803   1.00 0.00 ? 36 CYS A O   10 
ATOM   5412 C  CB  . CYS A 1 36 ? -1.102  5.910   2.178   1.00 0.00 ? 36 CYS A CB  10 
ATOM   5413 S  SG  . CYS A 1 36 ? -1.335  5.122   3.770   1.00 0.00 ? 36 CYS A SG  10 
ATOM   5414 N  N   . ALA A 1 37 ? -1.382  8.643   4.170   1.00 0.00 ? 37 ALA A N   10 
ATOM   5415 C  CA  . ALA A 1 37 ? -0.726  9.498   5.150   1.00 0.00 ? 37 ALA A CA  10 
ATOM   5416 C  C   . ALA A 1 37 ? 0.530   8.857   5.748   1.00 0.00 ? 37 ALA A C   10 
ATOM   5417 O  O   . ALA A 1 37 ? 1.370   9.565   6.298   1.00 0.00 ? 37 ALA A O   10 
ATOM   5418 C  CB  . ALA A 1 37 ? -1.719  9.868   6.252   1.00 0.00 ? 37 ALA A CB  10 
ATOM   5419 N  N   . PHE A 1 38 ? 0.658   7.529   5.662   1.00 0.00 ? 38 PHE A N   10 
ATOM   5420 C  CA  . PHE A 1 38 ? 1.817   6.806   6.169   1.00 0.00 ? 38 PHE A CA  10 
ATOM   5421 C  C   . PHE A 1 38 ? 2.835   6.501   5.068   1.00 0.00 ? 38 PHE A C   10 
ATOM   5422 O  O   . PHE A 1 38 ? 3.823   5.817   5.336   1.00 0.00 ? 38 PHE A O   10 
ATOM   5423 C  CB  . PHE A 1 38 ? 1.340   5.541   6.892   1.00 0.00 ? 38 PHE A CB  10 
ATOM   5424 C  CG  . PHE A 1 38 ? 0.261   5.786   7.941   1.00 0.00 ? 38 PHE A CG  10 
ATOM   5425 C  CD1 . PHE A 1 38 ? 0.364   6.880   8.826   1.00 0.00 ? 38 PHE A CD1 10 
ATOM   5426 C  CD2 . PHE A 1 38 ? -0.882  4.964   7.989   1.00 0.00 ? 38 PHE A CD2 10 
ATOM   5427 C  CE1 . PHE A 1 38 ? -0.653  7.135   9.762   1.00 0.00 ? 38 PHE A CE1 10 
ATOM   5428 C  CE2 . PHE A 1 38 ? -1.896  5.219   8.929   1.00 0.00 ? 38 PHE A CE2 10 
ATOM   5429 C  CZ  . PHE A 1 38 ? -1.779  6.298   9.822   1.00 0.00 ? 38 PHE A CZ  10 
ATOM   5430 N  N   . TRP A 1 39 ? 2.638   7.021   3.853   1.00 0.00 ? 39 TRP A N   10 
ATOM   5431 C  CA  . TRP A 1 39 ? 3.638   6.934   2.803   1.00 0.00 ? 39 TRP A CA  10 
ATOM   5432 C  C   . TRP A 1 39 ? 4.938   7.614   3.246   1.00 0.00 ? 39 TRP A C   10 
ATOM   5433 O  O   . TRP A 1 39 ? 4.915   8.616   3.957   1.00 0.00 ? 39 TRP A O   10 
ATOM   5434 C  CB  . TRP A 1 39 ? 3.094   7.604   1.544   1.00 0.00 ? 39 TRP A CB  10 
ATOM   5435 C  CG  . TRP A 1 39 ? 3.969   7.553   0.331   1.00 0.00 ? 39 TRP A CG  10 
ATOM   5436 C  CD1 . TRP A 1 39 ? 4.683   8.590   -0.159  1.00 0.00 ? 39 TRP A CD1 10 
ATOM   5437 C  CD2 . TRP A 1 39 ? 4.179   6.448   -0.599  1.00 0.00 ? 39 TRP A CD2 10 
ATOM   5438 N  NE1 . TRP A 1 39 ? 5.287   8.217   -1.340  1.00 0.00 ? 39 TRP A NE1 10 
ATOM   5439 C  CE2 . TRP A 1 39 ? 4.958   6.928   -1.691  1.00 0.00 ? 39 TRP A CE2 10 
ATOM   5440 C  CE3 . TRP A 1 39 ? 3.766   5.099   -0.659  1.00 0.00 ? 39 TRP A CE3 10 
ATOM   5441 C  CZ2 . TRP A 1 39 ? 5.257   6.139   -2.807  1.00 0.00 ? 39 TRP A CZ2 10 
ATOM   5442 C  CZ3 . TRP A 1 39 ? 4.106   4.285   -1.756  1.00 0.00 ? 39 TRP A CZ3 10 
ATOM   5443 C  CH2 . TRP A 1 39 ? 4.835   4.805   -2.834  1.00 0.00 ? 39 TRP A CH2 10 
ATOM   5444 N  N   . GLY A 1 40 ? 6.071   7.069   2.806   1.00 0.00 ? 40 GLY A N   10 
ATOM   5445 C  CA  . GLY A 1 40 ? 7.387   7.652   2.992   1.00 0.00 ? 40 GLY A CA  10 
ATOM   5446 C  C   . GLY A 1 40 ? 7.692   8.603   1.840   1.00 0.00 ? 40 GLY A C   10 
ATOM   5447 O  O   . GLY A 1 40 ? 7.751   9.817   2.017   1.00 0.00 ? 40 GLY A O   10 
ATOM   5448 N  N   . GLU A 1 41 ? 7.896   8.026   0.656   1.00 0.00 ? 41 GLU A N   10 
ATOM   5449 C  CA  . GLU A 1 41 ? 8.411   8.673   -0.541  1.00 0.00 ? 41 GLU A CA  10 
ATOM   5450 C  C   . GLU A 1 41 ? 8.371   7.612   -1.639  1.00 0.00 ? 41 GLU A C   10 
ATOM   5451 O  O   . GLU A 1 41 ? 8.331   6.422   -1.312  1.00 0.00 ? 41 GLU A O   10 
ATOM   5452 C  CB  . GLU A 1 41 ? 9.849   9.161   -0.310  1.00 0.00 ? 41 GLU A CB  10 
ATOM   5453 C  CG  . GLU A 1 41 ? 10.748  7.962   -0.007  1.00 0.00 ? 41 GLU A CG  10 
ATOM   5454 C  CD  . GLU A 1 41 ? 12.141  8.356   0.458   1.00 0.00 ? 41 GLU A CD  10 
ATOM   5455 O  OE1 . GLU A 1 41 ? 12.677  9.344   -0.082  1.00 0.00 ? 41 GLU A OE1 10 
ATOM   5456 O  OE2 . GLU A 1 41 ? 12.668  7.626   1.328   1.00 0.00 ? 41 GLU A OE2 10 
ATOM   5457 N  N   . ALA A 1 42 ? 8.405   8.021   -2.912  1.00 0.00 ? 42 ALA A N   10 
ATOM   5458 C  CA  . ALA A 1 42 ? 8.607   7.089   -4.014  1.00 0.00 ? 42 ALA A CA  10 
ATOM   5459 C  C   . ALA A 1 42 ? 10.103  6.850   -4.204  1.00 0.00 ? 42 ALA A C   10 
ATOM   5460 O  O   . ALA A 1 42 ? 10.904  7.773   -4.080  1.00 0.00 ? 42 ALA A O   10 
ATOM   5461 C  CB  . ALA A 1 42 ? 7.961   7.591   -5.305  1.00 0.00 ? 42 ALA A CB  10 
ATOM   5462 N  N   . VAL A 1 43 ? 10.464  5.600   -4.486  1.00 0.00 ? 43 VAL A N   10 
ATOM   5463 C  CA  . VAL A 1 43 ? 11.831  5.121   -4.583  1.00 0.00 ? 43 VAL A CA  10 
ATOM   5464 C  C   . VAL A 1 43 ? 12.172  4.862   -6.050  1.00 0.00 ? 43 VAL A C   10 
ATOM   5465 O  O   . VAL A 1 43 ? 13.219  5.292   -6.528  1.00 0.00 ? 43 VAL A O   10 
ATOM   5466 C  CB  . VAL A 1 43 ? 11.967  3.823   -3.767  1.00 0.00 ? 43 VAL A CB  10 
ATOM   5467 C  CG1 . VAL A 1 43 ? 13.407  3.294   -3.791  1.00 0.00 ? 43 VAL A CG1 10 
ATOM   5468 C  CG2 . VAL A 1 43 ? 11.522  3.970   -2.305  1.00 0.00 ? 43 VAL A CG2 10 
ATOM   5469 N  N   . GLN A 1 44 ? 11.320  4.097   -6.745  1.00 0.00 ? 44 GLN A N   10 
ATOM   5470 C  CA  . GLN A 1 44 ? 11.603  3.591   -8.079  1.00 0.00 ? 44 GLN A CA  10 
ATOM   5471 C  C   . GLN A 1 44 ? 10.322  3.427   -8.908  1.00 0.00 ? 44 GLN A C   10 
ATOM   5472 O  O   . GLN A 1 44 ? 9.482   4.324   -8.891  1.00 0.00 ? 44 GLN A O   10 
ATOM   5473 C  CB  . GLN A 1 44 ? 12.500  2.353   -7.970  1.00 0.00 ? 44 GLN A CB  10 
ATOM   5474 C  CG  . GLN A 1 44 ? 11.929  1.237   -7.094  1.00 0.00 ? 44 GLN A CG  10 
ATOM   5475 C  CD  . GLN A 1 44 ? 12.884  0.050   -7.066  1.00 0.00 ? 44 GLN A CD  10 
ATOM   5476 O  OE1 . GLN A 1 44 ? 13.650  -0.130  -6.115  1.00 0.00 ? 44 GLN A OE1 10 
ATOM   5477 N  NE2 . GLN A 1 44 ? 12.869  -0.748  -8.127  1.00 0.00 ? 44 GLN A NE2 10 
ATOM   5478 N  N   . ASP A 1 45 ? 10.176  2.320   -9.647  1.00 0.00 ? 45 ASP A N   10 
ATOM   5479 C  CA  . ASP A 1 45 ? 9.228   2.109   -10.740 1.00 0.00 ? 45 ASP A CA  10 
ATOM   5480 C  C   . ASP A 1 45 ? 7.778   1.976   -10.258 1.00 0.00 ? 45 ASP A C   10 
ATOM   5481 O  O   . ASP A 1 45 ? 7.141   0.930   -10.379 1.00 0.00 ? 45 ASP A O   10 
ATOM   5482 C  CB  . ASP A 1 45 ? 9.692   0.901   -11.574 1.00 0.00 ? 45 ASP A CB  10 
ATOM   5483 C  CG  . ASP A 1 45 ? 9.947   -0.355  -10.747 1.00 0.00 ? 45 ASP A CG  10 
ATOM   5484 O  OD1 . ASP A 1 45 ? 10.860  -0.320  -9.885  1.00 0.00 ? 45 ASP A OD1 10 
ATOM   5485 O  OD2 . ASP A 1 45 ? 9.256   -1.375  -10.949 1.00 0.00 ? 45 ASP A OD2 10 
ATOM   5486 N  N   . GLY A 1 46 ? 7.256   3.067   -9.707  1.00 0.00 ? 46 GLY A N   10 
ATOM   5487 C  CA  . GLY A 1 46 ? 5.951   3.102   -9.077  1.00 0.00 ? 46 GLY A CA  10 
ATOM   5488 C  C   . GLY A 1 46 ? 5.989   2.289   -7.790  1.00 0.00 ? 46 GLY A C   10 
ATOM   5489 O  O   . GLY A 1 46 ? 5.062   1.544   -7.502  1.00 0.00 ? 46 GLY A O   10 
ATOM   5490 N  N   . TRP A 1 47 ? 7.058   2.423   -7.003  1.00 0.00 ? 47 TRP A N   10 
ATOM   5491 C  CA  . TRP A 1 47 ? 7.190   1.887   -5.672  1.00 0.00 ? 47 TRP A CA  10 
ATOM   5492 C  C   . TRP A 1 47 ? 7.739   2.970   -4.780  1.00 0.00 ? 47 TRP A C   10 
ATOM   5493 O  O   . TRP A 1 47 ? 8.444   3.861   -5.257  1.00 0.00 ? 47 TRP A O   10 
ATOM   5494 C  CB  . TRP A 1 47 ? 8.195   0.750   -5.657  1.00 0.00 ? 47 TRP A CB  10 
ATOM   5495 C  CG  . TRP A 1 47 ? 7.833   -0.421  -6.485  1.00 0.00 ? 47 TRP A CG  10 
ATOM   5496 C  CD1 . TRP A 1 47 ? 8.051   -0.531  -7.806  1.00 0.00 ? 47 TRP A CD1 10 
ATOM   5497 C  CD2 . TRP A 1 47 ? 7.160   -1.639  -6.077  1.00 0.00 ? 47 TRP A CD2 10 
ATOM   5498 N  NE1 . TRP A 1 47 ? 7.498   -1.704  -8.256  1.00 0.00 ? 47 TRP A NE1 10 
ATOM   5499 C  CE2 . TRP A 1 47 ? 6.956   -2.439  -7.231  1.00 0.00 ? 47 TRP A CE2 10 
ATOM   5500 C  CE3 . TRP A 1 47 ? 6.733   -2.168  -4.847  1.00 0.00 ? 47 TRP A CE3 10 
ATOM   5501 C  CZ2 . TRP A 1 47 ? 6.369   -3.705  -7.174  1.00 0.00 ? 47 TRP A CZ2 10 
ATOM   5502 C  CZ3 . TRP A 1 47 ? 6.007   -3.372  -4.793  1.00 0.00 ? 47 TRP A CZ3 10 
ATOM   5503 C  CH2 . TRP A 1 47 ? 5.833   -4.140  -5.957  1.00 0.00 ? 47 TRP A CH2 10 
ATOM   5504 N  N   . GLY A 1 48 ? 7.470   2.836   -3.490  1.00 0.00 ? 48 GLY A N   10 
ATOM   5505 C  CA  . GLY A 1 48 ? 7.951   3.725   -2.473  1.00 0.00 ? 48 GLY A CA  10 
ATOM   5506 C  C   . GLY A 1 48 ? 7.954   3.034   -1.120  1.00 0.00 ? 48 GLY A C   10 
ATOM   5507 O  O   . GLY A 1 48 ? 7.719   1.831   -1.012  1.00 0.00 ? 48 GLY A O   10 
ATOM   5508 N  N   . ARG A 1 49 ? 8.267   3.817   -0.097  1.00 0.00 ? 49 ARG A N   10 
ATOM   5509 C  CA  . ARG A 1 49 ? 8.394   3.360   1.281   1.00 0.00 ? 49 ARG A CA  10 
ATOM   5510 C  C   . ARG A 1 49 ? 7.092   3.669   2.028   1.00 0.00 ? 49 ARG A C   10 
ATOM   5511 O  O   . ARG A 1 49 ? 6.384   4.600   1.645   1.00 0.00 ? 49 ARG A O   10 
ATOM   5512 C  CB  . ARG A 1 49 ? 9.623   4.061   1.880   1.00 0.00 ? 49 ARG A CB  10 
ATOM   5513 C  CG  . ARG A 1 49 ? 10.907  3.471   1.295   1.00 0.00 ? 49 ARG A CG  10 
ATOM   5514 C  CD  . ARG A 1 49 ? 12.121  4.374   1.526   1.00 0.00 ? 49 ARG A CD  10 
ATOM   5515 N  NE  . ARG A 1 49 ? 13.321  3.852   0.845   1.00 0.00 ? 49 ARG A NE  10 
ATOM   5516 C  CZ  . ARG A 1 49 ? 14.421  4.557   0.536   1.00 0.00 ? 49 ARG A CZ  10 
ATOM   5517 N  NH1 . ARG A 1 49 ? 14.532  5.857   0.830   1.00 0.00 ? 49 ARG A NH1 10 
ATOM   5518 N  NH2 . ARG A 1 49 ? 15.417  3.929   -0.088  1.00 0.00 ? 49 ARG A NH2 10 
ATOM   5519 N  N   . CYS A 1 50 ? 6.780   2.898   3.077   1.00 0.00 ? 50 CYS A N   10 
ATOM   5520 C  CA  . CYS A 1 50 ? 5.618   3.077   3.945   1.00 0.00 ? 50 CYS A CA  10 
ATOM   5521 C  C   . CYS A 1 50 ? 6.090   2.948   5.393   1.00 0.00 ? 50 CYS A C   10 
ATOM   5522 O  O   . CYS A 1 50 ? 6.914   2.091   5.706   1.00 0.00 ? 50 CYS A O   10 
ATOM   5523 C  CB  . CYS A 1 50 ? 4.544   2.082   3.583   1.00 0.00 ? 50 CYS A CB  10 
ATOM   5524 S  SG  . CYS A 1 50 ? 3.259   2.022   4.846   1.00 0.00 ? 50 CYS A SG  10 
ATOM   5525 N  N   . THR A 1 51 ? 5.644   3.859   6.260   1.00 0.00 ? 51 THR A N   10 
ATOM   5526 C  CA  . THR A 1 51 ? 6.261   4.120   7.555   1.00 0.00 ? 51 THR A CA  10 
ATOM   5527 C  C   . THR A 1 51 ? 5.416   3.550   8.698   1.00 0.00 ? 51 THR A C   10 
ATOM   5528 O  O   . THR A 1 51 ? 5.083   4.260   9.646   1.00 0.00 ? 51 THR A O   10 
ATOM   5529 C  CB  . THR A 1 51 ? 6.505   5.634   7.697   1.00 0.00 ? 51 THR A CB  10 
ATOM   5530 O  OG1 . THR A 1 51 ? 5.307   6.371   7.547   1.00 0.00 ? 51 THR A OG1 10 
ATOM   5531 C  CG2 . THR A 1 51 ? 7.511   6.129   6.653   1.00 0.00 ? 51 THR A CG2 10 
ATOM   5532 N  N   . HIS A 1 52 ? 5.057   2.265   8.634   1.00 0.00 ? 52 HIS A N   10 
ATOM   5533 C  CA  . HIS A 1 52 ? 4.300   1.576   9.679   1.00 0.00 ? 52 HIS A CA  10 
ATOM   5534 C  C   . HIS A 1 52 ? 4.880   0.173   9.872   1.00 0.00 ? 52 HIS A C   10 
ATOM   5535 O  O   . HIS A 1 52 ? 5.481   -0.349  8.939   1.00 0.00 ? 52 HIS A O   10 
ATOM   5536 C  CB  . HIS A 1 52 ? 2.808   1.523   9.300   1.00 0.00 ? 52 HIS A CB  10 
ATOM   5537 C  CG  . HIS A 1 52 ? 1.983   2.660   9.862   1.00 0.00 ? 52 HIS A CG  10 
ATOM   5538 N  ND1 . HIS A 1 52 ? 2.452   3.903   10.247  1.00 0.00 ? 52 HIS A ND1 10 
ATOM   5539 C  CD2 . HIS A 1 52 ? 0.642   2.620   10.133  1.00 0.00 ? 52 HIS A CD2 10 
ATOM   5540 C  CE1 . HIS A 1 52 ? 1.420   4.601   10.748  1.00 0.00 ? 52 HIS A CE1 10 
ATOM   5541 N  NE2 . HIS A 1 52 ? 0.308   3.845   10.676  1.00 0.00 ? 52 HIS A NE2 10 
ATOM   5542 N  N   . PRO A 1 53 ? 4.721   -0.434  11.059  1.00 0.00 ? 53 PRO A N   10 
ATOM   5543 C  CA  . PRO A 1 53 ? 5.254   -1.756  11.344  1.00 0.00 ? 53 PRO A CA  10 
ATOM   5544 C  C   . PRO A 1 53 ? 4.552   -2.821  10.497  1.00 0.00 ? 53 PRO A C   10 
ATOM   5545 O  O   . PRO A 1 53 ? 3.352   -2.707  10.233  1.00 0.00 ? 53 PRO A O   10 
ATOM   5546 C  CB  . PRO A 1 53 ? 5.028   -1.976  12.843  1.00 0.00 ? 53 PRO A CB  10 
ATOM   5547 C  CG  . PRO A 1 53 ? 3.814   -1.098  13.149  1.00 0.00 ? 53 PRO A CG  10 
ATOM   5548 C  CD  . PRO A 1 53 ? 4.027   0.098   12.221  1.00 0.00 ? 53 PRO A CD  10 
ATOM   5549 N  N   . ASP A 1 54 ? 5.311   -3.840  10.075  1.00 0.00 ? 54 ASP A N   10 
ATOM   5550 C  CA  . ASP A 1 54 ? 4.865   -4.878  9.149   1.00 0.00 ? 54 ASP A CA  10 
ATOM   5551 C  C   . ASP A 1 54 ? 4.476   -4.201  7.835   1.00 0.00 ? 54 ASP A C   10 
ATOM   5552 O  O   . ASP A 1 54 ? 3.398   -4.428  7.286   1.00 0.00 ? 54 ASP A O   10 
ATOM   5553 C  CB  . ASP A 1 54 ? 3.766   -5.756  9.777   1.00 0.00 ? 54 ASP A CB  10 
ATOM   5554 C  CG  . ASP A 1 54 ? 3.252   -6.852  8.866   1.00 0.00 ? 54 ASP A CG  10 
ATOM   5555 O  OD1 . ASP A 1 54 ? 3.980   -7.261  7.938   1.00 0.00 ? 54 ASP A OD1 10 
ATOM   5556 O  OD2 . ASP A 1 54 ? 2.080   -7.210  9.103   1.00 0.00 ? 54 ASP A OD2 10 
ATOM   5557 N  N   . PHE A 1 55 ? 5.354   -3.307  7.381   1.00 0.00 ? 55 PHE A N   10 
ATOM   5558 C  CA  . PHE A 1 55 ? 5.229   -2.538  6.154   1.00 0.00 ? 55 PHE A CA  10 
ATOM   5559 C  C   . PHE A 1 55 ? 6.583   -1.912  5.859   1.00 0.00 ? 55 PHE A C   10 
ATOM   5560 O  O   . PHE A 1 55 ? 7.148   -2.148  4.796   1.00 0.00 ? 55 PHE A O   10 
ATOM   5561 C  CB  . PHE A 1 55 ? 4.111   -1.480  6.248   1.00 0.00 ? 55 PHE A CB  10 
ATOM   5562 C  CG  . PHE A 1 55 ? 2.811   -1.915  5.609   1.00 0.00 ? 55 PHE A CG  10 
ATOM   5563 C  CD1 . PHE A 1 55 ? 2.854   -2.437  4.302   1.00 0.00 ? 55 PHE A CD1 10 
ATOM   5564 C  CD2 . PHE A 1 55 ? 1.584   -1.868  6.306   1.00 0.00 ? 55 PHE A CD2 10 
ATOM   5565 C  CE1 . PHE A 1 55 ? 1.742   -3.099  3.772   1.00 0.00 ? 55 PHE A CE1 10 
ATOM   5566 C  CE2 . PHE A 1 55 ? 0.445   -2.434  5.717   1.00 0.00 ? 55 PHE A CE2 10 
ATOM   5567 C  CZ  . PHE A 1 55 ? 0.545   -3.120  4.497   1.00 0.00 ? 55 PHE A CZ  10 
ATOM   5568 N  N   . ASP A 1 56 ? 7.120   -1.200  6.849   1.00 0.00 ? 56 ASP A N   10 
ATOM   5569 C  CA  . ASP A 1 56 ? 8.539   -0.950  7.069   1.00 0.00 ? 56 ASP A CA  10 
ATOM   5570 C  C   . ASP A 1 56 ? 9.449   -2.005  6.425   1.00 0.00 ? 56 ASP A C   10 
ATOM   5571 O  O   . ASP A 1 56 ? 10.382  -1.656  5.703   1.00 0.00 ? 56 ASP A O   10 
ATOM   5572 C  CB  . ASP A 1 56 ? 8.792   -0.849  8.586   1.00 0.00 ? 56 ASP A CB  10 
ATOM   5573 C  CG  . ASP A 1 56 ? 8.378   -2.072  9.413   1.00 0.00 ? 56 ASP A CG  10 
ATOM   5574 O  OD1 . ASP A 1 56 ? 7.619   -2.924  8.891   1.00 0.00 ? 56 ASP A OD1 10 
ATOM   5575 O  OD2 . ASP A 1 56 ? 8.786   -2.111  10.591  1.00 0.00 ? 56 ASP A OD2 10 
ATOM   5576 N  N   . GLU A 1 57 ? 9.176   -3.286  6.684   1.00 0.00 ? 57 GLU A N   10 
ATOM   5577 C  CA  . GLU A 1 57 ? 9.889   -4.424  6.114   1.00 0.00 ? 57 GLU A CA  10 
ATOM   5578 C  C   . GLU A 1 57 ? 10.150  -4.315  4.601   1.00 0.00 ? 57 GLU A C   10 
ATOM   5579 O  O   . GLU A 1 57 ? 11.206  -4.739  4.134   1.00 0.00 ? 57 GLU A O   10 
ATOM   5580 C  CB  . GLU A 1 57 ? 9.082   -5.705  6.364   1.00 0.00 ? 57 GLU A CB  10 
ATOM   5581 C  CG  . GLU A 1 57 ? 8.926   -6.081  7.840   1.00 0.00 ? 57 GLU A CG  10 
ATOM   5582 C  CD  . GLU A 1 57 ? 8.159   -7.388  7.948   1.00 0.00 ? 57 GLU A CD  10 
ATOM   5583 O  OE1 . GLU A 1 57 ? 6.975   -7.372  7.544   1.00 0.00 ? 57 GLU A OE1 10 
ATOM   5584 O  OE2 . GLU A 1 57 ? 8.776   -8.393  8.356   1.00 0.00 ? 57 GLU A OE2 10 
ATOM   5585 N  N   . VAL A 1 58 ? 9.159   -3.861  3.827   1.00 0.00 ? 58 VAL A N   10 
ATOM   5586 C  CA  . VAL A 1 58 ? 9.087   -4.070  2.385   1.00 0.00 ? 58 VAL A CA  10 
ATOM   5587 C  C   . VAL A 1 58 ? 8.812   -2.765  1.630   1.00 0.00 ? 58 VAL A C   10 
ATOM   5588 O  O   . VAL A 1 58 ? 8.251   -1.813  2.169   1.00 0.00 ? 58 VAL A O   10 
ATOM   5589 C  CB  . VAL A 1 58 ? 8.014   -5.133  2.073   1.00 0.00 ? 58 VAL A CB  10 
ATOM   5590 C  CG1 . VAL A 1 58 ? 8.406   -6.521  2.600   1.00 0.00 ? 58 VAL A CG1 10 
ATOM   5591 C  CG2 . VAL A 1 58 ? 6.641   -4.767  2.651   1.00 0.00 ? 58 VAL A CG2 10 
ATOM   5592 N  N   . LEU A 1 59 ? 9.194   -2.719  0.354   1.00 0.00 ? 59 LEU A N   10 
ATOM   5593 C  CA  . LEU A 1 59 ? 8.892   -1.621  -0.539  1.00 0.00 ? 59 LEU A CA  10 
ATOM   5594 C  C   . LEU A 1 59 ? 7.448   -1.776  -1.008  1.00 0.00 ? 59 LEU A C   10 
ATOM   5595 O  O   . LEU A 1 59 ? 7.099   -2.837  -1.521  1.00 0.00 ? 59 LEU A O   10 
ATOM   5596 C  CB  . LEU A 1 59 ? 9.853   -1.713  -1.728  1.00 0.00 ? 59 LEU A CB  10 
ATOM   5597 C  CG  . LEU A 1 59 ? 10.112  -0.339  -2.332  1.00 0.00 ? 59 LEU A CG  10 
ATOM   5598 C  CD1 . LEU A 1 59 ? 10.946  0.517   -1.368  1.00 0.00 ? 59 LEU A CD1 10 
ATOM   5599 C  CD2 . LEU A 1 59 ? 10.823  -0.526  -3.672  1.00 0.00 ? 59 LEU A CD2 10 
ATOM   5600 N  N   . VAL A 1 60 ? 6.613   -0.751  -0.862  1.00 0.00 ? 60 VAL A N   10 
ATOM   5601 C  CA  . VAL A 1 60 ? 5.212   -0.828  -1.252  1.00 0.00 ? 60 VAL A CA  10 
ATOM   5602 C  C   . VAL A 1 60 ? 5.031   -0.202  -2.632  1.00 0.00 ? 60 VAL A C   10 
ATOM   5603 O  O   . VAL A 1 60 ? 5.592   0.851   -2.928  1.00 0.00 ? 60 VAL A O   10 
ATOM   5604 C  CB  . VAL A 1 60 ? 4.317   -0.168  -0.193  1.00 0.00 ? 60 VAL A CB  10 
ATOM   5605 C  CG1 . VAL A 1 60 ? 4.250   -1.048  1.062   1.00 0.00 ? 60 VAL A CG1 10 
ATOM   5606 C  CG2 . VAL A 1 60 ? 4.785   1.237   0.192   1.00 0.00 ? 60 VAL A CG2 10 
ATOM   5607 N  N   . LYS A 1 61 ? 4.281   -0.866  -3.508  1.00 0.00 ? 61 LYS A N   10 
ATOM   5608 C  CA  . LYS A 1 61 ? 3.908   -0.316  -4.792  1.00 0.00 ? 61 LYS A CA  10 
ATOM   5609 C  C   . LYS A 1 61 ? 3.092   0.948   -4.555  1.00 0.00 ? 61 LYS A C   10 
ATOM   5610 O  O   . LYS A 1 61 ? 2.189   0.941   -3.725  1.00 0.00 ? 61 LYS A O   10 
ATOM   5611 C  CB  . LYS A 1 61 ? 3.088   -1.368  -5.553  1.00 0.00 ? 61 LYS A CB  10 
ATOM   5612 C  CG  . LYS A 1 61 ? 3.035   -1.045  -7.047  1.00 0.00 ? 61 LYS A CG  10 
ATOM   5613 C  CD  . LYS A 1 61 ? 3.269   -2.253  -7.958  1.00 0.00 ? 61 LYS A CD  10 
ATOM   5614 C  CE  . LYS A 1 61 ? 3.928   -1.818  -9.285  1.00 0.00 ? 61 LYS A CE  10 
ATOM   5615 N  NZ  . LYS A 1 61 ? 3.465   -0.511  -9.815  1.00 0.00 ? 61 LYS A NZ  10 
ATOM   5616 N  N   . ALA A 1 62 ? 3.384   2.018   -5.290  1.00 0.00 ? 62 ALA A N   10 
ATOM   5617 C  CA  . ALA A 1 62 ? 2.626   3.258   -5.208  1.00 0.00 ? 62 ALA A CA  10 
ATOM   5618 C  C   . ALA A 1 62 ? 1.144   3.018   -5.477  1.00 0.00 ? 62 ALA A C   10 
ATOM   5619 O  O   . ALA A 1 62 ? 0.295   3.587   -4.788  1.00 0.00 ? 62 ALA A O   10 
ATOM   5620 C  CB  . ALA A 1 62 ? 3.207   4.268   -6.185  1.00 0.00 ? 62 ALA A CB  10 
ATOM   5621 N  N   . GLU A 1 63 ? 0.837   2.159   -6.460  1.00 0.00 ? 63 GLU A N   10 
ATOM   5622 C  CA  . GLU A 1 63 ? -0.535  1.775   -6.739  1.00 0.00 ? 63 GLU A CA  10 
ATOM   5623 C  C   . GLU A 1 63 ? -1.103  0.764   -5.750  1.00 0.00 ? 63 GLU A C   10 
ATOM   5624 O  O   . GLU A 1 63 ? -2.261  0.384   -5.906  1.00 0.00 ? 63 GLU A O   10 
ATOM   5625 C  CB  . GLU A 1 63 ? -0.704  1.227   -8.153  1.00 0.00 ? 63 GLU A CB  10 
ATOM   5626 C  CG  . GLU A 1 63 ? -0.006  2.100   -9.193  1.00 0.00 ? 63 GLU A CG  10 
ATOM   5627 C  CD  . GLU A 1 63 ? 1.319   1.456   -9.559  1.00 0.00 ? 63 GLU A CD  10 
ATOM   5628 O  OE1 . GLU A 1 63 ? 2.248   1.505   -8.718  1.00 0.00 ? 63 GLU A OE1 10 
ATOM   5629 O  OE2 . GLU A 1 63 ? 1.396   0.760   -10.595 1.00 0.00 ? 63 GLU A OE2 10 
ATOM   5630 N  N   . GLY A 1 64 ? -0.323  0.290   -4.776  1.00 0.00 ? 64 GLY A N   10 
ATOM   5631 C  CA  . GLY A 1 64 ? -0.838  -0.587  -3.744  1.00 0.00 ? 64 GLY A CA  10 
ATOM   5632 C  C   . GLY A 1 64 ? -1.845  0.155   -2.866  1.00 0.00 ? 64 GLY A C   10 
ATOM   5633 O  O   . GLY A 1 64 ? -2.149  1.327   -3.083  1.00 0.00 ? 64 GLY A O   10 
ATOM   5634 N  N   . TRP A 1 65 ? -2.364  -0.540  -1.863  1.00 0.00 ? 65 TRP A N   10 
ATOM   5635 C  CA  . TRP A 1 65 ? -3.174  0.015   -0.793  1.00 0.00 ? 65 TRP A CA  10 
ATOM   5636 C  C   . TRP A 1 65 ? -2.865  -0.859  0.416   1.00 0.00 ? 65 TRP A C   10 
ATOM   5637 O  O   . TRP A 1 65 ? -2.085  -1.796  0.280   1.00 0.00 ? 65 TRP A O   10 
ATOM   5638 C  CB  . TRP A 1 65 ? -4.650  -0.069  -1.203  1.00 0.00 ? 65 TRP A CB  10 
ATOM   5639 C  CG  . TRP A 1 65 ? -5.663  0.351   -0.187  1.00 0.00 ? 65 TRP A CG  10 
ATOM   5640 C  CD1 . TRP A 1 65 ? -5.950  1.629   0.144   1.00 0.00 ? 65 TRP A CD1 10 
ATOM   5641 C  CD2 . TRP A 1 65 ? -6.508  -0.481  0.666   1.00 0.00 ? 65 TRP A CD2 10 
ATOM   5642 N  NE1 . TRP A 1 65 ? -6.951  1.651   1.093   1.00 0.00 ? 65 TRP A NE1 10 
ATOM   5643 C  CE2 . TRP A 1 65 ? -7.333  0.375   1.451   1.00 0.00 ? 65 TRP A CE2 10 
ATOM   5644 C  CE3 . TRP A 1 65 ? -6.651  -1.872  0.871   1.00 0.00 ? 65 TRP A CE3 10 
ATOM   5645 C  CZ2 . TRP A 1 65 ? -8.297  -0.121  2.341   1.00 0.00 ? 65 TRP A CZ2 10 
ATOM   5646 C  CZ3 . TRP A 1 65 ? -7.558  -2.378  1.819   1.00 0.00 ? 65 TRP A CZ3 10 
ATOM   5647 C  CH2 . TRP A 1 65 ? -8.409  -1.508  2.524   1.00 0.00 ? 65 TRP A CH2 10 
ATOM   5648 N  N   . CYS A 1 66 ? -3.475  -0.602  1.573   1.00 0.00 ? 66 CYS A N   10 
ATOM   5649 C  CA  . CYS A 1 66 ? -3.591  -1.598  2.621   1.00 0.00 ? 66 CYS A CA  10 
ATOM   5650 C  C   . CYS A 1 66 ? -4.673  -1.195  3.619   1.00 0.00 ? 66 CYS A C   10 
ATOM   5651 O  O   . CYS A 1 66 ? -5.117  -0.047  3.652   1.00 0.00 ? 66 CYS A O   10 
ATOM   5652 C  CB  . CYS A 1 66 ? -2.268  -1.855  3.299   1.00 0.00 ? 66 CYS A CB  10 
ATOM   5653 S  SG  . CYS A 1 66 ? -1.962  -0.577  4.537   1.00 0.00 ? 66 CYS A SG  10 
ATOM   5654 N  N   . SER A 1 67 ? -5.106  -2.143  4.449   1.00 0.00 ? 67 SER A N   10 
ATOM   5655 C  CA  . SER A 1 67 ? -6.137  -1.881  5.438   1.00 0.00 ? 67 SER A CA  10 
ATOM   5656 C  C   . SER A 1 67 ? -5.687  -0.835  6.466   1.00 0.00 ? 67 SER A C   10 
ATOM   5657 O  O   . SER A 1 67 ? -6.528  -0.081  6.956   1.00 0.00 ? 67 SER A O   10 
ATOM   5658 C  CB  . SER A 1 67 ? -6.600  -3.191  6.079   1.00 0.00 ? 67 SER A CB  10 
ATOM   5659 O  OG  . SER A 1 67 ? -5.521  -3.838  6.709   1.00 0.00 ? 67 SER A OG  10 
ATOM   5660 N  N   . VAL A 1 68 ? -4.382  -0.754  6.782   1.00 0.00 ? 68 VAL A N   10 
ATOM   5661 C  CA  . VAL A 1 68 ? -3.879  0.259   7.714   1.00 0.00 ? 68 VAL A CA  10 
ATOM   5662 C  C   . VAL A 1 68 ? -3.878  1.670   7.104   1.00 0.00 ? 68 VAL A C   10 
ATOM   5663 O  O   . VAL A 1 68 ? -3.570  2.622   7.818   1.00 0.00 ? 68 VAL A O   10 
ATOM   5664 C  CB  . VAL A 1 68 ? -2.571  -0.099  8.460   1.00 0.00 ? 68 VAL A CB  10 
ATOM   5665 C  CG1 . VAL A 1 68 ? -2.533  -1.587  8.755   1.00 0.00 ? 68 VAL A CG1 10 
ATOM   5666 C  CG2 . VAL A 1 68 ? -1.221  0.313   7.865   1.00 0.00 ? 68 VAL A CG2 10 
ATOM   5667 N  N   . TYR A 1 69 ? -4.210  1.823   5.811   1.00 0.00 ? 69 TYR A N   10 
ATOM   5668 C  CA  . TYR A 1 69 ? -4.295  3.117   5.140   1.00 0.00 ? 69 TYR A CA  10 
ATOM   5669 C  C   . TYR A 1 69 ? -5.060  4.150   5.977   1.00 0.00 ? 69 TYR A C   10 
ATOM   5670 O  O   . TYR A 1 69 ? -6.144  3.866   6.496   1.00 0.00 ? 69 TYR A O   10 
ATOM   5671 C  CB  . TYR A 1 69 ? -4.961  2.942   3.761   1.00 0.00 ? 69 TYR A CB  10 
ATOM   5672 C  CG  . TYR A 1 69 ? -5.168  4.218   2.962   1.00 0.00 ? 69 TYR A CG  10 
ATOM   5673 C  CD1 . TYR A 1 69 ? -6.222  5.080   3.293   1.00 0.00 ? 69 TYR A CD1 10 
ATOM   5674 C  CD2 . TYR A 1 69 ? -4.350  4.535   1.860   1.00 0.00 ? 69 TYR A CD2 10 
ATOM   5675 C  CE1 . TYR A 1 69 ? -6.374  6.310   2.644   1.00 0.00 ? 69 TYR A CE1 10 
ATOM   5676 C  CE2 . TYR A 1 69 ? -4.524  5.754   1.186   1.00 0.00 ? 69 TYR A CE2 10 
ATOM   5677 C  CZ  . TYR A 1 69 ? -5.506  6.662   1.604   1.00 0.00 ? 69 TYR A CZ  10 
ATOM   5678 O  OH  . TYR A 1 69 ? -5.713  7.831   0.945   1.00 0.00 ? 69 TYR A OH  10 
ATOM   5679 N  N   . ALA A 1 70 ? -4.534  5.378   6.027   1.00 0.00 ? 70 ALA A N   10 
ATOM   5680 C  CA  . ALA A 1 70 ? -5.238  6.567   6.491   1.00 0.00 ? 70 ALA A CA  10 
ATOM   5681 C  C   . ALA A 1 70 ? -5.033  7.647   5.426   1.00 0.00 ? 70 ALA A C   10 
ATOM   5682 O  O   . ALA A 1 70 ? -3.945  7.709   4.857   1.00 0.00 ? 70 ALA A O   10 
ATOM   5683 C  CB  . ALA A 1 70 ? -4.670  7.013   7.839   1.00 0.00 ? 70 ALA A CB  10 
ATOM   5684 N  N   . PRO A 1 71 ? -6.050  8.463   5.107   1.00 0.00 ? 71 PRO A N   10 
ATOM   5685 C  CA  . PRO A 1 71 ? -5.951  9.445   4.045   1.00 0.00 ? 71 PRO A CA  10 
ATOM   5686 C  C   . PRO A 1 71 ? -5.090  10.624  4.464   1.00 0.00 ? 71 PRO A C   10 
ATOM   5687 O  O   . PRO A 1 71 ? -5.081  11.021  5.626   1.00 0.00 ? 71 PRO A O   10 
ATOM   5688 C  CB  . PRO A 1 71 ? -7.386  9.882   3.749   1.00 0.00 ? 71 PRO A CB  10 
ATOM   5689 C  CG  . PRO A 1 71 ? -8.082  9.695   5.098   1.00 0.00 ? 71 PRO A CG  10 
ATOM   5690 C  CD  . PRO A 1 71 ? -7.380  8.471   5.692   1.00 0.00 ? 71 PRO A CD  10 
ATOM   5691 N  N   . ALA A 1 72 ? -4.393  11.205  3.488   1.00 0.00 ? 72 ALA A N   10 
ATOM   5692 C  CA  . ALA A 1 72 ? -3.566  12.382  3.689   1.00 0.00 ? 72 ALA A CA  10 
ATOM   5693 C  C   . ALA A 1 72 ? -4.388  13.635  3.401   1.00 0.00 ? 72 ALA A C   10 
ATOM   5694 O  O   . ALA A 1 72 ? -3.962  14.533  2.677   1.00 0.00 ? 72 ALA A O   10 
ATOM   5695 C  CB  . ALA A 1 72 ? -2.346  12.279  2.788   1.00 0.00 ? 72 ALA A CB  10 
ATOM   5696 N  N   . SER A 1 73 ? -5.591  13.656  3.959   1.00 0.00 ? 73 SER A N   10 
ATOM   5697 C  CA  . SER A 1 73 ? -6.612  14.654  3.725   1.00 0.00 ? 73 SER A CA  10 
ATOM   5698 C  C   . SER A 1 73 ? -7.736  14.389  4.722   1.00 0.00 ? 73 SER A C   10 
ATOM   5699 O  O   . SER A 1 73 ? -8.065  15.309  5.499   1.00 0.00 ? 73 SER A O   10 
ATOM   5700 C  CB  . SER A 1 73 ? -7.145  14.527  2.294   1.00 0.00 ? 73 SER A CB  10 
ATOM   5701 O  OG  . SER A 1 73 ? -7.606  13.204  2.085   1.00 0.00 ? 73 SER A OG  10 
ATOM   5702 O  OXT . SER A 1 73 ? -8.246  13.245  4.656   1.00 0.00 ? 73 SER A OXT 10 
HETATM 5703 FE FE1 . SF4 B 2 .  ? 0.299   1.735   1.605   1.00 0.00 ? 74 SF4 A FE1 10 
HETATM 5704 FE FE2 . SF4 B 2 .  ? -0.503  3.315   3.382   1.00 0.00 ? 74 SF4 A FE2 10 
HETATM 5705 FE FE3 . SF4 B 2 .  ? 1.493   1.943   3.816   1.00 0.00 ? 74 SF4 A FE3 10 
HETATM 5706 FE FE4 . SF4 B 2 .  ? -0.759  0.860   3.692   1.00 0.00 ? 74 SF4 A FE4 10 
HETATM 5707 S  S1  . SF4 B 2 .  ? -0.121  2.277   5.201   1.00 0.00 ? 74 SF4 A S1  10 
HETATM 5708 S  S2  . SF4 B 2 .  ? 1.047   0.093   2.797   1.00 0.00 ? 74 SF4 A S2  10 
HETATM 5709 S  S3  . SF4 B 2 .  ? -1.761  2.029   2.196   1.00 0.00 ? 74 SF4 A S3  10 
HETATM 5710 S  S4  . SF4 B 2 .  ? 1.368   3.484   2.310   1.00 0.00 ? 74 SF4 A S4  10 
ATOM   5711 N  N   . ALA A 1 1  ? 14.664  -2.163  -4.664  1.00 0.00 ? 1  ALA A N   11 
ATOM   5712 C  CA  . ALA A 1 1  ? 15.583  -1.408  -3.822  1.00 0.00 ? 1  ALA A CA  11 
ATOM   5713 C  C   . ALA A 1 1  ? 16.319  -2.393  -2.940  1.00 0.00 ? 1  ALA A C   11 
ATOM   5714 O  O   . ALA A 1 1  ? 16.001  -3.573  -3.029  1.00 0.00 ? 1  ALA A O   11 
ATOM   5715 C  CB  . ALA A 1 1  ? 14.849  -0.397  -2.936  1.00 0.00 ? 1  ALA A CB  11 
ATOM   5716 N  N   . SER A 1 2  ? 17.146  -1.926  -2.004  1.00 0.00 ? 2  SER A N   11 
ATOM   5717 C  CA  . SER A 1 2  ? 17.572  -2.752  -0.881  1.00 0.00 ? 2  SER A CA  11 
ATOM   5718 C  C   . SER A 1 2  ? 16.407  -3.415  -0.156  1.00 0.00 ? 2  SER A C   11 
ATOM   5719 O  O   . SER A 1 2  ? 16.485  -4.537  0.333   1.00 0.00 ? 2  SER A O   11 
ATOM   5720 C  CB  . SER A 1 2  ? 18.457  -1.928  0.057   1.00 0.00 ? 2  SER A CB  11 
ATOM   5721 O  OG  . SER A 1 2  ? 19.319  -1.113  -0.718  1.00 0.00 ? 2  SER A OG  11 
ATOM   5722 N  N   . GLU A 1 3  ? 15.310  -2.685  -0.164  1.00 0.00 ? 3  GLU A N   11 
ATOM   5723 C  CA  . GLU A 1 3  ? 13.998  -3.090  0.286   1.00 0.00 ? 3  GLU A CA  11 
ATOM   5724 C  C   . GLU A 1 3  ? 13.373  -3.985  -0.796  1.00 0.00 ? 3  GLU A C   11 
ATOM   5725 O  O   . GLU A 1 3  ? 13.332  -3.548  -1.959  1.00 0.00 ? 3  GLU A O   11 
ATOM   5726 C  CB  . GLU A 1 3  ? 13.115  -1.850  0.499   1.00 0.00 ? 3  GLU A CB  11 
ATOM   5727 C  CG  . GLU A 1 3  ? 13.850  -0.585  0.979   1.00 0.00 ? 3  GLU A CG  11 
ATOM   5728 C  CD  . GLU A 1 3  ? 14.361  0.282   -0.167  1.00 0.00 ? 3  GLU A CD  11 
ATOM   5729 O  OE1 . GLU A 1 3  ? 14.743  -0.303  -1.207  1.00 0.00 ? 3  GLU A OE1 11 
ATOM   5730 O  OE2 . GLU A 1 3  ? 14.360  1.520   0.003   1.00 0.00 ? 3  GLU A OE2 11 
ATOM   5731 N  N   . PRO A 1 4  ? 12.888  -5.192  -0.460  1.00 0.00 ? 4  PRO A N   11 
ATOM   5732 C  CA  . PRO A 1 4  ? 12.179  -6.062  -1.391  1.00 0.00 ? 4  PRO A CA  11 
ATOM   5733 C  C   . PRO A 1 4  ? 10.783  -5.508  -1.698  1.00 0.00 ? 4  PRO A C   11 
ATOM   5734 O  O   . PRO A 1 4  ? 10.213  -4.791  -0.883  1.00 0.00 ? 4  PRO A O   11 
ATOM   5735 C  CB  . PRO A 1 4  ? 12.092  -7.423  -0.694  1.00 0.00 ? 4  PRO A CB  11 
ATOM   5736 C  CG  . PRO A 1 4  ? 12.164  -7.087  0.792   1.00 0.00 ? 4  PRO A CG  11 
ATOM   5737 C  CD  . PRO A 1 4  ? 12.998  -5.810  0.854   1.00 0.00 ? 4  PRO A CD  11 
ATOM   5738 N  N   . ARG A 1 5  ? 10.226  -5.835  -2.870  1.00 0.00 ? 5  ARG A N   11 
ATOM   5739 C  CA  . ARG A 1 5  ? 8.905   -5.377  -3.282  1.00 0.00 ? 5  ARG A CA  11 
ATOM   5740 C  C   . ARG A 1 5  ? 7.837   -6.235  -2.591  1.00 0.00 ? 5  ARG A C   11 
ATOM   5741 O  O   . ARG A 1 5  ? 7.881   -7.459  -2.702  1.00 0.00 ? 5  ARG A O   11 
ATOM   5742 C  CB  . ARG A 1 5  ? 8.805   -5.419  -4.816  1.00 0.00 ? 5  ARG A CB  11 
ATOM   5743 C  CG  . ARG A 1 5  ? 9.965   -4.670  -5.482  1.00 0.00 ? 5  ARG A CG  11 
ATOM   5744 C  CD  . ARG A 1 5  ? 10.016  -5.045  -6.960  1.00 0.00 ? 5  ARG A CD  11 
ATOM   5745 N  NE  . ARG A 1 5  ? 9.101   -4.264  -7.780  1.00 0.00 ? 5  ARG A NE  11 
ATOM   5746 C  CZ  . ARG A 1 5  ? 9.439   -3.535  -8.856  1.00 0.00 ? 5  ARG A CZ  11 
ATOM   5747 N  NH1 . ARG A 1 5  ? 10.500  -2.733  -8.805  1.00 0.00 ? 5  ARG A NH1 11 
ATOM   5748 N  NH2 . ARG A 1 5  ? 8.686   -3.580  -9.956  1.00 0.00 ? 5  ARG A NH2 11 
ATOM   5749 N  N   . ALA A 1 6  ? 6.929   -5.597  -1.848  1.00 0.00 ? 6  ALA A N   11 
ATOM   5750 C  CA  . ALA A 1 6  ? 5.966   -6.248  -0.972  1.00 0.00 ? 6  ALA A CA  11 
ATOM   5751 C  C   . ALA A 1 6  ? 5.126   -7.298  -1.697  1.00 0.00 ? 6  ALA A C   11 
ATOM   5752 O  O   . ALA A 1 6  ? 4.726   -7.121  -2.849  1.00 0.00 ? 6  ALA A O   11 
ATOM   5753 C  CB  . ALA A 1 6  ? 5.058   -5.196  -0.326  1.00 0.00 ? 6  ALA A CB  11 
ATOM   5754 N  N   . GLU A 1 7  ? 4.841   -8.387  -0.990  1.00 0.00 ? 7  GLU A N   11 
ATOM   5755 C  CA  . GLU A 1 7  ? 4.085   -9.518  -1.478  1.00 0.00 ? 7  GLU A CA  11 
ATOM   5756 C  C   . GLU A 1 7  ? 2.616   -9.143  -1.490  1.00 0.00 ? 7  GLU A C   11 
ATOM   5757 O  O   . GLU A 1 7  ? 2.146   -8.468  -0.574  1.00 0.00 ? 7  GLU A O   11 
ATOM   5758 C  CB  . GLU A 1 7  ? 4.272   -10.730 -0.564  1.00 0.00 ? 7  GLU A CB  11 
ATOM   5759 C  CG  . GLU A 1 7  ? 5.716   -10.890 -0.085  1.00 0.00 ? 7  GLU A CG  11 
ATOM   5760 C  CD  . GLU A 1 7  ? 5.944   -10.185 1.249   1.00 0.00 ? 7  GLU A CD  11 
ATOM   5761 O  OE1 . GLU A 1 7  ? 6.182   -8.961  1.243   1.00 0.00 ? 7  GLU A OE1 11 
ATOM   5762 O  OE2 . GLU A 1 7  ? 5.757   -10.798 2.319   1.00 0.00 ? 7  GLU A OE2 11 
ATOM   5763 N  N   . ASP A 1 8  ? 1.867   -9.648  -2.461  1.00 0.00 ? 8  ASP A N   11 
ATOM   5764 C  CA  . ASP A 1 8  ? 0.426   -9.579  -2.404  1.00 0.00 ? 8  ASP A CA  11 
ATOM   5765 C  C   . ASP A 1 8  ? -0.010  -10.426 -1.214  1.00 0.00 ? 8  ASP A C   11 
ATOM   5766 O  O   . ASP A 1 8  ? 0.358   -11.595 -1.107  1.00 0.00 ? 8  ASP A O   11 
ATOM   5767 C  CB  . ASP A 1 8  ? -0.150  -10.065 -3.730  1.00 0.00 ? 8  ASP A CB  11 
ATOM   5768 C  CG  . ASP A 1 8  ? -0.032  -8.965  -4.767  1.00 0.00 ? 8  ASP A CG  11 
ATOM   5769 O  OD1 . ASP A 1 8  ? -0.896  -8.063  -4.740  1.00 0.00 ? 8  ASP A OD1 11 
ATOM   5770 O  OD2 . ASP A 1 8  ? 0.978   -8.980  -5.505  1.00 0.00 ? 8  ASP A OD2 11 
ATOM   5771 N  N   . GLY A 1 9  ? -0.713  -9.806  -0.270  1.00 0.00 ? 9  GLY A N   11 
ATOM   5772 C  CA  . GLY A 1 9  ? -1.034  -10.415 1.004   1.00 0.00 ? 9  GLY A CA  11 
ATOM   5773 C  C   . GLY A 1 9  ? 0.181   -10.535 1.929   1.00 0.00 ? 9  GLY A C   11 
ATOM   5774 O  O   . GLY A 1 9  ? 0.154   -11.382 2.818   1.00 0.00 ? 9  GLY A O   11 
ATOM   5775 N  N   . HIS A 1 10 ? 1.210   -9.680  1.782   1.00 0.00 ? 10 HIS A N   11 
ATOM   5776 C  CA  . HIS A 1 10 ? 2.291   -9.543  2.760   1.00 0.00 ? 10 HIS A CA  11 
ATOM   5777 C  C   . HIS A 1 10 ? 1.736   -9.559  4.185   1.00 0.00 ? 10 HIS A C   11 
ATOM   5778 O  O   . HIS A 1 10 ? 2.128   -10.377 5.014   1.00 0.00 ? 10 HIS A O   11 
ATOM   5779 C  CB  . HIS A 1 10 ? 3.041   -8.223  2.518   1.00 0.00 ? 10 HIS A CB  11 
ATOM   5780 C  CG  . HIS A 1 10 ? 4.055   -7.912  3.593   1.00 0.00 ? 10 HIS A CG  11 
ATOM   5781 N  ND1 . HIS A 1 10 ? 5.247   -8.583  3.790   1.00 0.00 ? 10 HIS A ND1 11 
ATOM   5782 C  CD2 . HIS A 1 10 ? 3.824   -7.134  4.693   1.00 0.00 ? 10 HIS A CD2 11 
ATOM   5783 C  CE1 . HIS A 1 10 ? 5.731   -8.221  4.990   1.00 0.00 ? 10 HIS A CE1 11 
ATOM   5784 N  NE2 . HIS A 1 10 ? 4.871   -7.354  5.560   1.00 0.00 ? 10 HIS A NE2 11 
ATOM   5785 N  N   . ALA A 1 11 ? 0.834   -8.615  4.449   1.00 0.00 ? 11 ALA A N   11 
ATOM   5786 C  CA  . ALA A 1 11 ? 0.067   -8.494  5.676   1.00 0.00 ? 11 ALA A CA  11 
ATOM   5787 C  C   . ALA A 1 11 ? -0.988  -7.413  5.449   1.00 0.00 ? 11 ALA A C   11 
ATOM   5788 O  O   . ALA A 1 11 ? -0.977  -6.748  4.413   1.00 0.00 ? 11 ALA A O   11 
ATOM   5789 C  CB  . ALA A 1 11 ? 0.975   -8.150  6.868   1.00 0.00 ? 11 ALA A CB  11 
ATOM   5790 N  N   . HIS A 1 12 ? -1.885  -7.228  6.421   1.00 0.00 ? 12 HIS A N   11 
ATOM   5791 C  CA  . HIS A 1 12 ? -2.864  -6.144  6.457   1.00 0.00 ? 12 HIS A CA  11 
ATOM   5792 C  C   . HIS A 1 12 ? -3.728  -6.071  5.194   1.00 0.00 ? 12 HIS A C   11 
ATOM   5793 O  O   . HIS A 1 12 ? -4.131  -4.977  4.796   1.00 0.00 ? 12 HIS A O   11 
ATOM   5794 C  CB  . HIS A 1 12 ? -2.166  -4.791  6.654   1.00 0.00 ? 12 HIS A CB  11 
ATOM   5795 C  CG  . HIS A 1 12 ? -1.036  -4.765  7.648   1.00 0.00 ? 12 HIS A CG  11 
ATOM   5796 N  ND1 . HIS A 1 12 ? -1.098  -4.291  8.946   1.00 0.00 ? 12 HIS A ND1 11 
ATOM   5797 C  CD2 . HIS A 1 12 ? 0.281   -4.919  7.319   1.00 0.00 ? 12 HIS A CD2 11 
ATOM   5798 C  CE1 . HIS A 1 12 ? 0.166   -4.139  9.386   1.00 0.00 ? 12 HIS A CE1 11 
ATOM   5799 N  NE2 . HIS A 1 12 ? 1.010   -4.528  8.416   1.00 0.00 ? 12 HIS A NE2 11 
ATOM   5800 N  N   . ASP A 1 13 ? -4.005  -7.215  4.567   1.00 0.00 ? 13 ASP A N   11 
ATOM   5801 C  CA  . ASP A 1 13 ? -4.747  -7.306  3.317   1.00 0.00 ? 13 ASP A CA  11 
ATOM   5802 C  C   . ASP A 1 13 ? -4.112  -6.442  2.219   1.00 0.00 ? 13 ASP A C   11 
ATOM   5803 O  O   . ASP A 1 13 ? -4.822  -5.938  1.349   1.00 0.00 ? 13 ASP A O   11 
ATOM   5804 C  CB  . ASP A 1 13 ? -6.236  -6.973  3.508   1.00 0.00 ? 13 ASP A CB  11 
ATOM   5805 C  CG  . ASP A 1 13 ? -6.827  -7.441  4.828   1.00 0.00 ? 13 ASP A CG  11 
ATOM   5806 O  OD1 . ASP A 1 13 ? -6.548  -8.589  5.227   1.00 0.00 ? 13 ASP A OD1 11 
ATOM   5807 O  OD2 . ASP A 1 13 ? -7.577  -6.619  5.404   1.00 0.00 ? 13 ASP A OD2 11 
ATOM   5808 N  N   . TYR A 1 14 ? -2.787  -6.246  2.255   1.00 0.00 ? 14 TYR A N   11 
ATOM   5809 C  CA  . TYR A 1 14 ? -2.119  -5.457  1.234   1.00 0.00 ? 14 TYR A CA  11 
ATOM   5810 C  C   . TYR A 1 14 ? -2.246  -6.142  -0.122  1.00 0.00 ? 14 TYR A C   11 
ATOM   5811 O  O   . TYR A 1 14 ? -1.996  -7.342  -0.226  1.00 0.00 ? 14 TYR A O   11 
ATOM   5812 C  CB  . TYR A 1 14 ? -0.650  -5.198  1.581   1.00 0.00 ? 14 TYR A CB  11 
ATOM   5813 C  CG  . TYR A 1 14 ? 0.169   -4.610  0.439   1.00 0.00 ? 14 TYR A CG  11 
ATOM   5814 C  CD1 . TYR A 1 14 ? 0.109   -3.239  0.129   1.00 0.00 ? 14 TYR A CD1 11 
ATOM   5815 C  CD2 . TYR A 1 14 ? 0.913   -5.466  -0.388  1.00 0.00 ? 14 TYR A CD2 11 
ATOM   5816 C  CE1 . TYR A 1 14 ? 0.850   -2.726  -0.949  1.00 0.00 ? 14 TYR A CE1 11 
ATOM   5817 C  CE2 . TYR A 1 14 ? 1.695   -4.948  -1.435  1.00 0.00 ? 14 TYR A CE2 11 
ATOM   5818 C  CZ  . TYR A 1 14 ? 1.701   -3.565  -1.684  1.00 0.00 ? 14 TYR A CZ  11 
ATOM   5819 O  OH  . TYR A 1 14 ? 2.552   -3.033  -2.608  1.00 0.00 ? 14 TYR A OH  11 
ATOM   5820 N  N   . VAL A 1 15 ? -2.580  -5.370  -1.153  1.00 0.00 ? 15 VAL A N   11 
ATOM   5821 C  CA  . VAL A 1 15 ? -2.549  -5.805  -2.539  1.00 0.00 ? 15 VAL A CA  11 
ATOM   5822 C  C   . VAL A 1 15 ? -1.636  -4.859  -3.305  1.00 0.00 ? 15 VAL A C   11 
ATOM   5823 O  O   . VAL A 1 15 ? -1.610  -3.654  -3.031  1.00 0.00 ? 15 VAL A O   11 
ATOM   5824 C  CB  . VAL A 1 15 ? -3.963  -5.840  -3.140  1.00 0.00 ? 15 VAL A CB  11 
ATOM   5825 C  CG1 . VAL A 1 15 ? -4.734  -7.036  -2.567  1.00 0.00 ? 15 VAL A CG1 11 
ATOM   5826 C  CG2 . VAL A 1 15 ? -4.741  -4.549  -2.857  1.00 0.00 ? 15 VAL A CG2 11 
ATOM   5827 N  N   . ASN A 1 16 ? -0.866  -5.410  -4.247  1.00 0.00 ? 16 ASN A N   11 
ATOM   5828 C  CA  . ASN A 1 16 ? 0.071   -4.652  -5.035  1.00 0.00 ? 16 ASN A CA  11 
ATOM   5829 C  C   . ASN A 1 16 ? -0.633  -3.613  -5.892  1.00 0.00 ? 16 ASN A C   11 
ATOM   5830 O  O   . ASN A 1 16 ? -0.093  -2.527  -6.073  1.00 0.00 ? 16 ASN A O   11 
ATOM   5831 C  CB  . ASN A 1 16 ? 1.029   -5.543  -5.832  1.00 0.00 ? 16 ASN A CB  11 
ATOM   5832 C  CG  . ASN A 1 16 ? 2.299   -5.768  -5.024  1.00 0.00 ? 16 ASN A CG  11 
ATOM   5833 O  OD1 . ASN A 1 16 ? 2.946   -4.813  -4.609  1.00 0.00 ? 16 ASN A OD1 11 
ATOM   5834 N  ND2 . ASN A 1 16 ? 2.658   -7.009  -4.761  1.00 0.00 ? 16 ASN A ND2 11 
ATOM   5835 N  N   . GLU A 1 17 ? -1.833  -3.923  -6.391  1.00 0.00 ? 17 GLU A N   11 
ATOM   5836 C  CA  . GLU A 1 17 ? -2.698  -2.972  -7.032  1.00 0.00 ? 17 GLU A CA  11 
ATOM   5837 C  C   . GLU A 1 17 ? -3.903  -2.694  -6.145  1.00 0.00 ? 17 GLU A C   11 
ATOM   5838 O  O   . GLU A 1 17 ? -4.651  -3.607  -5.798  1.00 0.00 ? 17 GLU A O   11 
ATOM   5839 C  CB  . GLU A 1 17 ? -3.172  -3.590  -8.336  1.00 0.00 ? 17 GLU A CB  11 
ATOM   5840 C  CG  . GLU A 1 17 ? -2.992  -2.613  -9.480  1.00 0.00 ? 17 GLU A CG  11 
ATOM   5841 C  CD  . GLU A 1 17 ? -1.568  -2.639  -10.033 1.00 0.00 ? 17 GLU A CD  11 
ATOM   5842 O  OE1 . GLU A 1 17 ? -0.658  -2.157  -9.322  1.00 0.00 ? 17 GLU A OE1 11 
ATOM   5843 O  OE2 . GLU A 1 17 ? -1.385  -3.168  -11.147 1.00 0.00 ? 17 GLU A OE2 11 
ATOM   5844 N  N   . ALA A 1 18 ? -4.146  -1.415  -5.884  1.00 0.00 ? 18 ALA A N   11 
ATOM   5845 C  CA  . ALA A 1 18 ? -5.364  -0.912  -5.274  1.00 0.00 ? 18 ALA A CA  11 
ATOM   5846 C  C   . ALA A 1 18 ? -6.591  -1.519  -5.947  1.00 0.00 ? 18 ALA A C   11 
ATOM   5847 O  O   . ALA A 1 18 ? -7.561  -1.858  -5.271  1.00 0.00 ? 18 ALA A O   11 
ATOM   5848 C  CB  . ALA A 1 18 ? -5.401  0.615   -5.375  1.00 0.00 ? 18 ALA A CB  11 
ATOM   5849 N  N   . ALA A 1 19 ? -6.539  -1.686  -7.276  1.00 0.00 ? 19 ALA A N   11 
ATOM   5850 C  CA  . ALA A 1 19 ? -7.647  -2.263  -8.018  1.00 0.00 ? 19 ALA A CA  11 
ATOM   5851 C  C   . ALA A 1 19 ? -8.115  -3.587  -7.410  1.00 0.00 ? 19 ALA A C   11 
ATOM   5852 O  O   . ALA A 1 19 ? -9.321  -3.810  -7.284  1.00 0.00 ? 19 ALA A O   11 
ATOM   5853 C  CB  . ALA A 1 19 ? -7.258  -2.428  -9.490  1.00 0.00 ? 19 ALA A CB  11 
ATOM   5854 N  N   . ASP A 1 20 ? -7.176  -4.443  -6.994  1.00 0.00 ? 20 ASP A N   11 
ATOM   5855 C  CA  . ASP A 1 20 ? -7.509  -5.759  -6.464  1.00 0.00 ? 20 ASP A CA  11 
ATOM   5856 C  C   . ASP A 1 20 ? -8.406  -5.652  -5.227  1.00 0.00 ? 20 ASP A C   11 
ATOM   5857 O  O   . ASP A 1 20 ? -9.250  -6.510  -4.978  1.00 0.00 ? 20 ASP A O   11 
ATOM   5858 C  CB  . ASP A 1 20 ? -6.237  -6.530  -6.131  1.00 0.00 ? 20 ASP A CB  11 
ATOM   5859 C  CG  . ASP A 1 20 ? -6.508  -8.027  -6.100  1.00 0.00 ? 20 ASP A CG  11 
ATOM   5860 O  OD1 . ASP A 1 20 ? -6.662  -8.591  -7.203  1.00 0.00 ? 20 ASP A OD1 11 
ATOM   5861 O  OD2 . ASP A 1 20 ? -6.560  -8.577  -4.980  1.00 0.00 ? 20 ASP A OD2 11 
ATOM   5862 N  N   . ALA A 1 21 ? -8.250  -4.567  -4.461  1.00 0.00 ? 21 ALA A N   11 
ATOM   5863 C  CA  . ALA A 1 21 ? -8.981  -4.381  -3.216  1.00 0.00 ? 21 ALA A CA  11 
ATOM   5864 C  C   . ALA A 1 21 ? -10.417 -3.907  -3.447  1.00 0.00 ? 21 ALA A C   11 
ATOM   5865 O  O   . ALA A 1 21 ? -11.149 -3.729  -2.471  1.00 0.00 ? 21 ALA A O   11 
ATOM   5866 C  CB  . ALA A 1 21 ? -8.217  -3.420  -2.298  1.00 0.00 ? 21 ALA A CB  11 
ATOM   5867 N  N   . SER A 1 22 ? -10.848 -3.710  -4.701  1.00 0.00 ? 22 SER A N   11 
ATOM   5868 C  CA  . SER A 1 22 ? -12.204 -3.322  -5.022  1.00 0.00 ? 22 SER A CA  11 
ATOM   5869 C  C   . SER A 1 22 ? -13.207 -4.379  -4.569  1.00 0.00 ? 22 SER A C   11 
ATOM   5870 O  O   . SER A 1 22 ? -13.535 -5.310  -5.297  1.00 0.00 ? 22 SER A O   11 
ATOM   5871 C  CB  . SER A 1 22 ? -12.332 -3.080  -6.514  1.00 0.00 ? 22 SER A CB  11 
ATOM   5872 O  OG  . SER A 1 22 ? -11.425 -2.085  -6.942  1.00 0.00 ? 22 SER A OG  11 
ATOM   5873 N  N   . GLY A 1 23 ? -13.691 -4.195  -3.348  1.00 0.00 ? 23 GLY A N   11 
ATOM   5874 C  CA  . GLY A 1 23 ? -14.560 -5.124  -2.645  1.00 0.00 ? 23 GLY A CA  11 
ATOM   5875 C  C   . GLY A 1 23 ? -14.305 -5.096  -1.138  1.00 0.00 ? 23 GLY A C   11 
ATOM   5876 O  O   . GLY A 1 23 ? -15.228 -5.300  -0.351  1.00 0.00 ? 23 GLY A O   11 
ATOM   5877 N  N   . HIS A 1 24 ? -13.061 -4.849  -0.715  1.00 0.00 ? 24 HIS A N   11 
ATOM   5878 C  CA  . HIS A 1 24 ? -12.715 -4.820  0.699   1.00 0.00 ? 24 HIS A CA  11 
ATOM   5879 C  C   . HIS A 1 24 ? -13.529 -3.731  1.404   1.00 0.00 ? 24 HIS A C   11 
ATOM   5880 O  O   . HIS A 1 24 ? -13.401 -2.568  1.025   1.00 0.00 ? 24 HIS A O   11 
ATOM   5881 C  CB  . HIS A 1 24 ? -11.215 -4.528  0.857   1.00 0.00 ? 24 HIS A CB  11 
ATOM   5882 C  CG  . HIS A 1 24 ? -10.667 -4.753  2.250   1.00 0.00 ? 24 HIS A CG  11 
ATOM   5883 N  ND1 . HIS A 1 24 ? -11.115 -4.166  3.425   1.00 0.00 ? 24 HIS A ND1 11 
ATOM   5884 C  CD2 . HIS A 1 24 ? -9.561  -5.498  2.560   1.00 0.00 ? 24 HIS A CD2 11 
ATOM   5885 C  CE1 . HIS A 1 24 ? -10.290 -4.534  4.418   1.00 0.00 ? 24 HIS A CE1 11 
ATOM   5886 N  NE2 . HIS A 1 24 ? -9.353  -5.355  3.918   1.00 0.00 ? 24 HIS A NE2 11 
ATOM   5887 N  N   . PRO A 1 25 ? -14.281 -4.032  2.475   1.00 0.00 ? 25 PRO A N   11 
ATOM   5888 C  CA  . PRO A 1 25 ? -14.875 -2.991  3.300   1.00 0.00 ? 25 PRO A CA  11 
ATOM   5889 C  C   . PRO A 1 25 ? -13.726 -2.225  3.962   1.00 0.00 ? 25 PRO A C   11 
ATOM   5890 O  O   . PRO A 1 25 ? -13.068 -2.779  4.839   1.00 0.00 ? 25 PRO A O   11 
ATOM   5891 C  CB  . PRO A 1 25 ? -15.765 -3.728  4.306   1.00 0.00 ? 25 PRO A CB  11 
ATOM   5892 C  CG  . PRO A 1 25 ? -15.112 -5.105  4.434   1.00 0.00 ? 25 PRO A CG  11 
ATOM   5893 C  CD  . PRO A 1 25 ? -14.517 -5.350  3.046   1.00 0.00 ? 25 PRO A CD  11 
ATOM   5894 N  N   . ARG A 1 26 ? -13.409 -1.036  3.435   1.00 0.00 ? 26 ARG A N   11 
ATOM   5895 C  CA  . ARG A 1 26 ? -12.304 -0.114  3.735   1.00 0.00 ? 26 ARG A CA  11 
ATOM   5896 C  C   . ARG A 1 26 ? -11.753 0.491   2.441   1.00 0.00 ? 26 ARG A C   11 
ATOM   5897 O  O   . ARG A 1 26 ? -11.213 1.603   2.478   1.00 0.00 ? 26 ARG A O   11 
ATOM   5898 C  CB  . ARG A 1 26 ? -11.125 -0.689  4.558   1.00 0.00 ? 26 ARG A CB  11 
ATOM   5899 C  CG  . ARG A 1 26 ? -11.069 -0.199  6.009   1.00 0.00 ? 26 ARG A CG  11 
ATOM   5900 C  CD  . ARG A 1 26 ? -10.960 1.330   6.135   1.00 0.00 ? 26 ARG A CD  11 
ATOM   5901 N  NE  . ARG A 1 26 ? -10.122 1.970   5.095   1.00 0.00 ? 26 ARG A NE  11 
ATOM   5902 C  CZ  . ARG A 1 26 ? -8.947  2.576   5.341   1.00 0.00 ? 26 ARG A CZ  11 
ATOM   5903 N  NH1 . ARG A 1 26 ? -8.157  2.172   6.341   1.00 0.00 ? 26 ARG A NH1 11 
ATOM   5904 N  NH2 . ARG A 1 26 ? -8.531  3.612   4.607   1.00 0.00 ? 26 ARG A NH2 11 
ATOM   5905 N  N   . TYR A 1 27 ? -11.839 -0.242  1.322   1.00 0.00 ? 27 TYR A N   11 
ATOM   5906 C  CA  . TYR A 1 27 ? -11.384 0.240   0.029   1.00 0.00 ? 27 TYR A CA  11 
ATOM   5907 C  C   . TYR A 1 27 ? -12.390 1.247   -0.531  1.00 0.00 ? 27 TYR A C   11 
ATOM   5908 O  O   . TYR A 1 27 ? -13.207 0.926   -1.387  1.00 0.00 ? 27 TYR A O   11 
ATOM   5909 C  CB  . TYR A 1 27 ? -11.099 -0.909  -0.954  1.00 0.00 ? 27 TYR A CB  11 
ATOM   5910 C  CG  . TYR A 1 27 ? -10.409 -0.410  -2.213  1.00 0.00 ? 27 TYR A CG  11 
ATOM   5911 C  CD1 . TYR A 1 27 ? -9.044  -0.102  -2.132  1.00 0.00 ? 27 TYR A CD1 11 
ATOM   5912 C  CD2 . TYR A 1 27 ? -11.141 0.032   -3.332  1.00 0.00 ? 27 TYR A CD2 11 
ATOM   5913 C  CE1 . TYR A 1 27 ? -8.465  0.812   -3.022  1.00 0.00 ? 27 TYR A CE1 11 
ATOM   5914 C  CE2 . TYR A 1 27 ? -10.547 0.915   -4.256  1.00 0.00 ? 27 TYR A CE2 11 
ATOM   5915 C  CZ  . TYR A 1 27 ? -9.240  1.382   -4.039  1.00 0.00 ? 27 TYR A CZ  11 
ATOM   5916 O  OH  . TYR A 1 27 ? -8.754  2.445   -4.748  1.00 0.00 ? 27 TYR A OH  11 
ATOM   5917 N  N   . GLN A 1 28 ? -12.311 2.482   -0.041  1.00 0.00 ? 28 GLN A N   11 
ATOM   5918 C  CA  . GLN A 1 28 ? -12.883 3.633   -0.706  1.00 0.00 ? 28 GLN A CA  11 
ATOM   5919 C  C   . GLN A 1 28 ? -12.138 3.824   -2.034  1.00 0.00 ? 28 GLN A C   11 
ATOM   5920 O  O   . GLN A 1 28 ? -10.917 3.662   -2.112  1.00 0.00 ? 28 GLN A O   11 
ATOM   5921 C  CB  . GLN A 1 28 ? -12.799 4.839   0.241   1.00 0.00 ? 28 GLN A CB  11 
ATOM   5922 C  CG  . GLN A 1 28 ? -13.638 6.048   -0.196  1.00 0.00 ? 28 GLN A CG  11 
ATOM   5923 C  CD  . GLN A 1 28 ? -12.956 6.843   -1.303  1.00 0.00 ? 28 GLN A CD  11 
ATOM   5924 O  OE1 . GLN A 1 28 ? -11.880 7.391   -1.093  1.00 0.00 ? 28 GLN A OE1 11 
ATOM   5925 N  NE2 . GLN A 1 28 ? -13.547 6.877   -2.490  1.00 0.00 ? 28 GLN A NE2 11 
ATOM   5926 N  N   . GLU A 1 29 ? -12.912 4.119   -3.070  1.00 0.00 ? 29 GLU A N   11 
ATOM   5927 C  CA  . GLU A 1 29 ? -12.538 4.219   -4.462  1.00 0.00 ? 29 GLU A CA  11 
ATOM   5928 C  C   . GLU A 1 29 ? -11.461 5.279   -4.696  1.00 0.00 ? 29 GLU A C   11 
ATOM   5929 O  O   . GLU A 1 29 ? -11.690 6.467   -4.467  1.00 0.00 ? 29 GLU A O   11 
ATOM   5930 C  CB  . GLU A 1 29 ? -13.789 4.538   -5.301  1.00 0.00 ? 29 GLU A CB  11 
ATOM   5931 C  CG  . GLU A 1 29 ? -15.030 3.701   -4.934  1.00 0.00 ? 29 GLU A CG  11 
ATOM   5932 C  CD  . GLU A 1 29 ? -15.957 4.380   -3.923  1.00 0.00 ? 29 GLU A CD  11 
ATOM   5933 O  OE1 . GLU A 1 29 ? -15.419 5.003   -2.977  1.00 0.00 ? 29 GLU A OE1 11 
ATOM   5934 O  OE2 . GLU A 1 29 ? -17.185 4.263   -4.113  1.00 0.00 ? 29 GLU A OE2 11 
ATOM   5935 N  N   . GLY A 1 30 ? -10.299 4.857   -5.197  1.00 0.00 ? 30 GLY A N   11 
ATOM   5936 C  CA  . GLY A 1 30 ? -9.227  5.763   -5.575  1.00 0.00 ? 30 GLY A CA  11 
ATOM   5937 C  C   . GLY A 1 30 ? -8.199  5.924   -4.461  1.00 0.00 ? 30 GLY A C   11 
ATOM   5938 O  O   . GLY A 1 30 ? -7.193  6.601   -4.662  1.00 0.00 ? 30 GLY A O   11 
ATOM   5939 N  N   . GLN A 1 31 ? -8.399  5.269   -3.311  1.00 0.00 ? 31 GLN A N   11 
ATOM   5940 C  CA  . GLN A 1 31 ? -7.328  5.147   -2.340  1.00 0.00 ? 31 GLN A CA  11 
ATOM   5941 C  C   . GLN A 1 31 ? -6.162  4.389   -2.997  1.00 0.00 ? 31 GLN A C   11 
ATOM   5942 O  O   . GLN A 1 31 ? -6.377  3.264   -3.453  1.00 0.00 ? 31 GLN A O   11 
ATOM   5943 C  CB  . GLN A 1 31 ? -7.854  4.387   -1.116  1.00 0.00 ? 31 GLN A CB  11 
ATOM   5944 C  CG  . GLN A 1 31 ? -8.728  5.230   -0.173  1.00 0.00 ? 31 GLN A CG  11 
ATOM   5945 C  CD  . GLN A 1 31 ? -9.120  4.401   1.050   1.00 0.00 ? 31 GLN A CD  11 
ATOM   5946 O  OE1 . GLN A 1 31 ? -8.955  4.787   2.206   1.00 0.00 ? 31 GLN A OE1 11 
ATOM   5947 N  NE2 . GLN A 1 31 ? -9.623  3.199   0.805   1.00 0.00 ? 31 GLN A NE2 11 
ATOM   5948 N  N   . LEU A 1 32 ? -4.965  4.989   -3.059  1.00 0.00 ? 32 LEU A N   11 
ATOM   5949 C  CA  . LEU A 1 32 ? -3.709  4.390   -3.517  1.00 0.00 ? 32 LEU A CA  11 
ATOM   5950 C  C   . LEU A 1 32 ? -2.650  4.651   -2.444  1.00 0.00 ? 32 LEU A C   11 
ATOM   5951 O  O   . LEU A 1 32 ? -2.673  5.717   -1.831  1.00 0.00 ? 32 LEU A O   11 
ATOM   5952 C  CB  . LEU A 1 32 ? -3.224  5.060   -4.817  1.00 0.00 ? 32 LEU A CB  11 
ATOM   5953 C  CG  . LEU A 1 32 ? -3.601  4.321   -6.106  1.00 0.00 ? 32 LEU A CG  11 
ATOM   5954 C  CD1 . LEU A 1 32 ? -5.085  4.432   -6.441  1.00 0.00 ? 32 LEU A CD1 11 
ATOM   5955 C  CD2 . LEU A 1 32 ? -2.827  4.930   -7.279  1.00 0.00 ? 32 LEU A CD2 11 
ATOM   5956 N  N   . CYS A 1 33 ? -1.722  3.714   -2.230  1.00 0.00 ? 33 CYS A N   11 
ATOM   5957 C  CA  . CYS A 1 33 ? -0.622  3.832   -1.277  1.00 0.00 ? 33 CYS A CA  11 
ATOM   5958 C  C   . CYS A 1 33 ? 0.083   5.188   -1.352  1.00 0.00 ? 33 CYS A C   11 
ATOM   5959 O  O   . CYS A 1 33 ? 0.335   5.801   -0.322  1.00 0.00 ? 33 CYS A O   11 
ATOM   5960 C  CB  . CYS A 1 33 ? 0.359   2.705   -1.480  1.00 0.00 ? 33 CYS A CB  11 
ATOM   5961 S  SG  . CYS A 1 33 ? -0.137  1.209   -0.578  1.00 0.00 ? 33 CYS A SG  11 
ATOM   5962 N  N   . GLU A 1 34 ? 0.403   5.717   -2.536  1.00 0.00 ? 34 GLU A N   11 
ATOM   5963 C  CA  . GLU A 1 34 ? 1.078   7.011   -2.567  1.00 0.00 ? 34 GLU A CA  11 
ATOM   5964 C  C   . GLU A 1 34 ? 0.227   8.175   -2.025  1.00 0.00 ? 34 GLU A C   11 
ATOM   5965 O  O   . GLU A 1 34 ? 0.773   9.234   -1.716  1.00 0.00 ? 34 GLU A O   11 
ATOM   5966 C  CB  . GLU A 1 34 ? 1.711   7.266   -3.935  1.00 0.00 ? 34 GLU A CB  11 
ATOM   5967 C  CG  . GLU A 1 34 ? 0.711   7.431   -5.085  1.00 0.00 ? 34 GLU A CG  11 
ATOM   5968 C  CD  . GLU A 1 34 ? 1.403   7.738   -6.411  1.00 0.00 ? 34 GLU A CD  11 
ATOM   5969 O  OE1 . GLU A 1 34 ? 2.642   7.913   -6.391  1.00 0.00 ? 34 GLU A OE1 11 
ATOM   5970 O  OE2 . GLU A 1 34 ? 0.678   7.790   -7.427  1.00 0.00 ? 34 GLU A OE2 11 
ATOM   5971 N  N   . ASN A 1 35 ? -1.089  7.982   -1.855  1.00 0.00 ? 35 ASN A N   11 
ATOM   5972 C  CA  . ASN A 1 35 ? -1.990  8.948   -1.225  1.00 0.00 ? 35 ASN A CA  11 
ATOM   5973 C  C   . ASN A 1 35 ? -2.143  8.674   0.282   1.00 0.00 ? 35 ASN A C   11 
ATOM   5974 O  O   . ASN A 1 35 ? -2.888  9.374   0.968   1.00 0.00 ? 35 ASN A O   11 
ATOM   5975 C  CB  . ASN A 1 35 ? -3.398  8.899   -1.840  1.00 0.00 ? 35 ASN A CB  11 
ATOM   5976 C  CG  . ASN A 1 35 ? -3.529  8.773   -3.350  1.00 0.00 ? 35 ASN A CG  11 
ATOM   5977 O  OD1 . ASN A 1 35 ? -2.597  9.013   -4.110  1.00 0.00 ? 35 ASN A OD1 11 
ATOM   5978 N  ND2 . ASN A 1 35 ? -4.721  8.386   -3.799  1.00 0.00 ? 35 ASN A ND2 11 
ATOM   5979 N  N   . CYS A 1 36 ? -1.497  7.635   0.812   1.00 0.00 ? 36 CYS A N   11 
ATOM   5980 C  CA  . CYS A 1 36 ? -1.632  7.201   2.193   1.00 0.00 ? 36 CYS A CA  11 
ATOM   5981 C  C   . CYS A 1 36 ? -0.767  8.093   3.086   1.00 0.00 ? 36 CYS A C   11 
ATOM   5982 O  O   . CYS A 1 36 ? 0.413   8.308   2.821   1.00 0.00 ? 36 CYS A O   11 
ATOM   5983 C  CB  . CYS A 1 36 ? -1.180  5.770   2.237   1.00 0.00 ? 36 CYS A CB  11 
ATOM   5984 S  SG  . CYS A 1 36 ? -1.410  4.931   3.801   1.00 0.00 ? 36 CYS A SG  11 
ATOM   5985 N  N   . ALA A 1 37 ? -1.327  8.603   4.180   1.00 0.00 ? 37 ALA A N   11 
ATOM   5986 C  CA  . ALA A 1 37 ? -0.611  9.456   5.119   1.00 0.00 ? 37 ALA A CA  11 
ATOM   5987 C  C   . ALA A 1 37 ? 0.491   8.699   5.878   1.00 0.00 ? 37 ALA A C   11 
ATOM   5988 O  O   . ALA A 1 37 ? 1.250   9.320   6.618   1.00 0.00 ? 37 ALA A O   11 
ATOM   5989 C  CB  . ALA A 1 37 ? -1.614  10.128  6.065   1.00 0.00 ? 37 ALA A CB  11 
ATOM   5990 N  N   . PHE A 1 38 ? 0.597   7.373   5.715   1.00 0.00 ? 38 PHE A N   11 
ATOM   5991 C  CA  . PHE A 1 38 ? 1.715   6.585   6.233   1.00 0.00 ? 38 PHE A CA  11 
ATOM   5992 C  C   . PHE A 1 38 ? 2.823   6.411   5.184   1.00 0.00 ? 38 PHE A C   11 
ATOM   5993 O  O   . PHE A 1 38 ? 3.847   5.797   5.493   1.00 0.00 ? 38 PHE A O   11 
ATOM   5994 C  CB  . PHE A 1 38 ? 1.215   5.214   6.707   1.00 0.00 ? 38 PHE A CB  11 
ATOM   5995 C  CG  . PHE A 1 38 ? 0.315   5.174   7.934   1.00 0.00 ? 38 PHE A CG  11 
ATOM   5996 C  CD1 . PHE A 1 38 ? -0.056  6.336   8.644   1.00 0.00 ? 38 PHE A CD1 11 
ATOM   5997 C  CD2 . PHE A 1 38 ? -0.131  3.919   8.385   1.00 0.00 ? 38 PHE A CD2 11 
ATOM   5998 C  CE1 . PHE A 1 38 ? -0.880  6.237   9.780   1.00 0.00 ? 38 PHE A CE1 11 
ATOM   5999 C  CE2 . PHE A 1 38 ? -0.972  3.822   9.506   1.00 0.00 ? 38 PHE A CE2 11 
ATOM   6000 C  CZ  . PHE A 1 38 ? -1.346  4.983   10.206  1.00 0.00 ? 38 PHE A CZ  11 
ATOM   6001 N  N   . TRP A 1 39 ? 2.635   6.927   3.966   1.00 0.00 ? 39 TRP A N   11 
ATOM   6002 C  CA  . TRP A 1 39 ? 3.630   6.848   2.910   1.00 0.00 ? 39 TRP A CA  11 
ATOM   6003 C  C   . TRP A 1 39 ? 4.936   7.525   3.329   1.00 0.00 ? 39 TRP A C   11 
ATOM   6004 O  O   . TRP A 1 39 ? 4.935   8.491   4.091   1.00 0.00 ? 39 TRP A O   11 
ATOM   6005 C  CB  . TRP A 1 39 ? 3.068   7.498   1.644   1.00 0.00 ? 39 TRP A CB  11 
ATOM   6006 C  CG  . TRP A 1 39 ? 3.941   7.426   0.434   1.00 0.00 ? 39 TRP A CG  11 
ATOM   6007 C  CD1 . TRP A 1 39 ? 4.705   8.431   -0.047  1.00 0.00 ? 39 TRP A CD1 11 
ATOM   6008 C  CD2 . TRP A 1 39 ? 4.136   6.302   -0.476  1.00 0.00 ? 39 TRP A CD2 11 
ATOM   6009 N  NE1 . TRP A 1 39 ? 5.335   8.019   -1.202  1.00 0.00 ? 39 TRP A NE1 11 
ATOM   6010 C  CE2 . TRP A 1 39 ? 4.976   6.734   -1.540  1.00 0.00 ? 39 TRP A CE2 11 
ATOM   6011 C  CE3 . TRP A 1 39 ? 3.666   4.973   -0.529  1.00 0.00 ? 39 TRP A CE3 11 
ATOM   6012 C  CZ2 . TRP A 1 39 ? 5.299   5.909   -2.623  1.00 0.00 ? 39 TRP A CZ2 11 
ATOM   6013 C  CZ3 . TRP A 1 39 ? 4.052   4.109   -1.570  1.00 0.00 ? 39 TRP A CZ3 11 
ATOM   6014 C  CH2 . TRP A 1 39 ? 4.857   4.578   -2.621  1.00 0.00 ? 39 TRP A CH2 11 
ATOM   6015 N  N   . GLY A 1 40 ? 6.053   7.019   2.806   1.00 0.00 ? 40 GLY A N   11 
ATOM   6016 C  CA  . GLY A 1 40 ? 7.380   7.584   2.958   1.00 0.00 ? 40 GLY A CA  11 
ATOM   6017 C  C   . GLY A 1 40 ? 7.686   8.496   1.775   1.00 0.00 ? 40 GLY A C   11 
ATOM   6018 O  O   . GLY A 1 40 ? 7.682   9.718   1.902   1.00 0.00 ? 40 GLY A O   11 
ATOM   6019 N  N   . GLU A 1 41 ? 7.970   7.889   0.620   1.00 0.00 ? 41 GLU A N   11 
ATOM   6020 C  CA  . GLU A 1 41 ? 8.510   8.543   -0.563  1.00 0.00 ? 41 GLU A CA  11 
ATOM   6021 C  C   . GLU A 1 41 ? 8.514   7.509   -1.687  1.00 0.00 ? 41 GLU A C   11 
ATOM   6022 O  O   . GLU A 1 41 ? 8.580   6.314   -1.395  1.00 0.00 ? 41 GLU A O   11 
ATOM   6023 C  CB  . GLU A 1 41 ? 9.932   9.054   -0.285  1.00 0.00 ? 41 GLU A CB  11 
ATOM   6024 C  CG  . GLU A 1 41 ? 10.824  7.897   0.171   1.00 0.00 ? 41 GLU A CG  11 
ATOM   6025 C  CD  . GLU A 1 41 ? 12.229  8.332   0.555   1.00 0.00 ? 41 GLU A CD  11 
ATOM   6026 O  OE1 . GLU A 1 41 ? 12.716  9.321   -0.030  1.00 0.00 ? 41 GLU A OE1 11 
ATOM   6027 O  OE2 . GLU A 1 41 ? 12.816  7.630   1.409   1.00 0.00 ? 41 GLU A OE2 11 
ATOM   6028 N  N   . ALA A 1 42 ? 8.452   7.946   -2.952  1.00 0.00 ? 42 ALA A N   11 
ATOM   6029 C  CA  . ALA A 1 42 ? 8.643   7.047   -4.084  1.00 0.00 ? 42 ALA A CA  11 
ATOM   6030 C  C   . ALA A 1 42 ? 10.135  6.802   -4.290  1.00 0.00 ? 42 ALA A C   11 
ATOM   6031 O  O   . ALA A 1 42 ? 10.939  7.726   -4.191  1.00 0.00 ? 42 ALA A O   11 
ATOM   6032 C  CB  . ALA A 1 42 ? 7.975   7.580   -5.351  1.00 0.00 ? 42 ALA A CB  11 
ATOM   6033 N  N   . VAL A 1 43 ? 10.490  5.545   -4.549  1.00 0.00 ? 43 VAL A N   11 
ATOM   6034 C  CA  . VAL A 1 43 ? 11.858  5.062   -4.643  1.00 0.00 ? 43 VAL A CA  11 
ATOM   6035 C  C   . VAL A 1 43 ? 12.183  4.772   -6.108  1.00 0.00 ? 43 VAL A C   11 
ATOM   6036 O  O   . VAL A 1 43 ? 13.249  5.151   -6.588  1.00 0.00 ? 43 VAL A O   11 
ATOM   6037 C  CB  . VAL A 1 43 ? 11.995  3.785   -3.797  1.00 0.00 ? 43 VAL A CB  11 
ATOM   6038 C  CG1 . VAL A 1 43 ? 13.414  3.198   -3.858  1.00 0.00 ? 43 VAL A CG1 11 
ATOM   6039 C  CG2 . VAL A 1 43 ? 11.639  4.004   -2.321  1.00 0.00 ? 43 VAL A CG2 11 
ATOM   6040 N  N   . GLN A 1 44 ? 11.297  4.042   -6.796  1.00 0.00 ? 44 GLN A N   11 
ATOM   6041 C  CA  . GLN A 1 44 ? 11.589  3.480   -8.107  1.00 0.00 ? 44 GLN A CA  11 
ATOM   6042 C  C   . GLN A 1 44 ? 10.329  3.372   -8.976  1.00 0.00 ? 44 GLN A C   11 
ATOM   6043 O  O   . GLN A 1 44 ? 9.500   4.278   -8.964  1.00 0.00 ? 44 GLN A O   11 
ATOM   6044 C  CB  . GLN A 1 44 ? 12.371  2.173   -7.923  1.00 0.00 ? 44 GLN A CB  11 
ATOM   6045 C  CG  . GLN A 1 44 ? 11.602  1.124   -7.115  1.00 0.00 ? 44 GLN A CG  11 
ATOM   6046 C  CD  . GLN A 1 44 ? 12.415  -0.154  -6.968  1.00 0.00 ? 44 GLN A CD  11 
ATOM   6047 O  OE1 . GLN A 1 44 ? 12.861  -0.498  -5.879  1.00 0.00 ? 44 GLN A OE1 11 
ATOM   6048 N  NE2 . GLN A 1 44 ? 12.615  -0.874  -8.065  1.00 0.00 ? 44 GLN A NE2 11 
ATOM   6049 N  N   . ASP A 1 45 ? 10.191  2.286   -9.744  1.00 0.00 ? 45 ASP A N   11 
ATOM   6050 C  CA  . ASP A 1 45 ? 9.232   2.084   -10.821 1.00 0.00 ? 45 ASP A CA  11 
ATOM   6051 C  C   . ASP A 1 45 ? 7.802   1.889   -10.306 1.00 0.00 ? 45 ASP A C   11 
ATOM   6052 O  O   . ASP A 1 45 ? 7.201   0.830   -10.464 1.00 0.00 ? 45 ASP A O   11 
ATOM   6053 C  CB  . ASP A 1 45 ? 9.713   0.909   -11.690 1.00 0.00 ? 45 ASP A CB  11 
ATOM   6054 C  CG  . ASP A 1 45 ? 9.989   -0.372  -10.909 1.00 0.00 ? 45 ASP A CG  11 
ATOM   6055 O  OD1 . ASP A 1 45 ? 10.826  -0.334  -9.974  1.00 0.00 ? 45 ASP A OD1 11 
ATOM   6056 O  OD2 . ASP A 1 45 ? 9.398   -1.425  -11.224 1.00 0.00 ? 45 ASP A OD2 11 
ATOM   6057 N  N   . GLY A 1 46 ? 7.256   2.934   -9.689  1.00 0.00 ? 46 GLY A N   11 
ATOM   6058 C  CA  . GLY A 1 46 ? 5.920   2.929   -9.117  1.00 0.00 ? 46 GLY A CA  11 
ATOM   6059 C  C   . GLY A 1 46 ? 5.907   2.211   -7.771  1.00 0.00 ? 46 GLY A C   11 
ATOM   6060 O  O   . GLY A 1 46 ? 4.901   1.619   -7.383  1.00 0.00 ? 46 GLY A O   11 
ATOM   6061 N  N   . TRP A 1 47 ? 7.020   2.276   -7.036  1.00 0.00 ? 47 TRP A N   11 
ATOM   6062 C  CA  . TRP A 1 47 ? 7.161   1.775   -5.693  1.00 0.00 ? 47 TRP A CA  11 
ATOM   6063 C  C   . TRP A 1 47 ? 7.813   2.828   -4.837  1.00 0.00 ? 47 TRP A C   11 
ATOM   6064 O  O   . TRP A 1 47 ? 8.626   3.620   -5.328  1.00 0.00 ? 47 TRP A O   11 
ATOM   6065 C  CB  . TRP A 1 47 ? 8.080   0.570   -5.677  1.00 0.00 ? 47 TRP A CB  11 
ATOM   6066 C  CG  . TRP A 1 47 ? 7.611   -0.583  -6.472  1.00 0.00 ? 47 TRP A CG  11 
ATOM   6067 C  CD1 . TRP A 1 47 ? 7.749   -0.721  -7.804  1.00 0.00 ? 47 TRP A CD1 11 
ATOM   6068 C  CD2 . TRP A 1 47 ? 6.909   -1.764  -6.007  1.00 0.00 ? 47 TRP A CD2 11 
ATOM   6069 N  NE1 . TRP A 1 47 ? 7.108   -1.866  -8.205  1.00 0.00 ? 47 TRP A NE1 11 
ATOM   6070 C  CE2 . TRP A 1 47 ? 6.601   -2.563  -7.138  1.00 0.00 ? 47 TRP A CE2 11 
ATOM   6071 C  CE3 . TRP A 1 47 ? 6.543   -2.261  -4.743  1.00 0.00 ? 47 TRP A CE3 11 
ATOM   6072 C  CZ2 . TRP A 1 47 ? 5.989   -3.810  -7.030  1.00 0.00 ? 47 TRP A CZ2 11 
ATOM   6073 C  CZ3 . TRP A 1 47 ? 5.823   -3.461  -4.628  1.00 0.00 ? 47 TRP A CZ3 11 
ATOM   6074 C  CH2 . TRP A 1 47 ? 5.579   -4.248  -5.765  1.00 0.00 ? 47 TRP A CH2 11 
ATOM   6075 N  N   . GLY A 1 48 ? 7.501   2.769   -3.551  1.00 0.00 ? 48 GLY A N   11 
ATOM   6076 C  CA  . GLY A 1 48 ? 8.046   3.652   -2.565  1.00 0.00 ? 48 GLY A CA  11 
ATOM   6077 C  C   . GLY A 1 48 ? 8.021   3.009   -1.193  1.00 0.00 ? 48 GLY A C   11 
ATOM   6078 O  O   . GLY A 1 48 ? 7.609   1.864   -1.025  1.00 0.00 ? 48 GLY A O   11 
ATOM   6079 N  N   . ARG A 1 49 ? 8.508   3.762   -0.218  1.00 0.00 ? 49 ARG A N   11 
ATOM   6080 C  CA  . ARG A 1 49 ? 8.533   3.352   1.172   1.00 0.00 ? 49 ARG A CA  11 
ATOM   6081 C  C   . ARG A 1 49 ? 7.186   3.726   1.789   1.00 0.00 ? 49 ARG A C   11 
ATOM   6082 O  O   . ARG A 1 49 ? 6.604   4.742   1.412   1.00 0.00 ? 49 ARG A O   11 
ATOM   6083 C  CB  . ARG A 1 49 ? 9.717   4.051   1.850   1.00 0.00 ? 49 ARG A CB  11 
ATOM   6084 C  CG  . ARG A 1 49 ? 11.032  3.467   1.338   1.00 0.00 ? 49 ARG A CG  11 
ATOM   6085 C  CD  . ARG A 1 49 ? 12.246  4.331   1.685   1.00 0.00 ? 49 ARG A CD  11 
ATOM   6086 N  NE  . ARG A 1 49 ? 13.454  3.815   1.018   1.00 0.00 ? 49 ARG A NE  11 
ATOM   6087 C  CZ  . ARG A 1 49 ? 14.524  4.517   0.617   1.00 0.00 ? 49 ARG A CZ  11 
ATOM   6088 N  NH1 . ARG A 1 49 ? 14.627  5.835   0.813   1.00 0.00 ? 49 ARG A NH1 11 
ATOM   6089 N  NH2 . ARG A 1 49 ? 15.506  3.858   -0.003  1.00 0.00 ? 49 ARG A NH2 11 
ATOM   6090 N  N   . CYS A 1 50 ? 6.706   2.905   2.723   1.00 0.00 ? 50 CYS A N   11 
ATOM   6091 C  CA  . CYS A 1 50 ? 5.507   3.108   3.524   1.00 0.00 ? 50 CYS A CA  11 
ATOM   6092 C  C   . CYS A 1 50 ? 5.881   2.688   4.944   1.00 0.00 ? 50 CYS A C   11 
ATOM   6093 O  O   . CYS A 1 50 ? 6.564   1.681   5.124   1.00 0.00 ? 50 CYS A O   11 
ATOM   6094 C  CB  . CYS A 1 50 ? 4.351   2.321   2.951   1.00 0.00 ? 50 CYS A CB  11 
ATOM   6095 S  SG  . CYS A 1 50 ? 3.215   1.783   4.261   1.00 0.00 ? 50 CYS A SG  11 
ATOM   6096 N  N   . THR A 1 51 ? 5.529   3.514   5.929   1.00 0.00 ? 51 THR A N   11 
ATOM   6097 C  CA  . THR A 1 51 ? 6.028   3.376   7.287   1.00 0.00 ? 51 THR A CA  11 
ATOM   6098 C  C   . THR A 1 51 ? 5.103   2.506   8.132   1.00 0.00 ? 51 THR A C   11 
ATOM   6099 O  O   . THR A 1 51 ? 3.942   2.315   7.774   1.00 0.00 ? 51 THR A O   11 
ATOM   6100 C  CB  . THR A 1 51 ? 6.135   4.767   7.927   1.00 0.00 ? 51 THR A CB  11 
ATOM   6101 O  OG1 . THR A 1 51 ? 4.841   5.342   8.024   1.00 0.00 ? 51 THR A OG1 11 
ATOM   6102 C  CG2 . THR A 1 51 ? 7.056   5.698   7.132   1.00 0.00 ? 51 THR A CG2 11 
ATOM   6103 N  N   . HIS A 1 52 ? 5.558   2.162   9.339   1.00 0.00 ? 52 HIS A N   11 
ATOM   6104 C  CA  . HIS A 1 52 ? 4.896   1.450   10.429  1.00 0.00 ? 52 HIS A CA  11 
ATOM   6105 C  C   . HIS A 1 52 ? 5.365   -0.011  10.392  1.00 0.00 ? 52 HIS A C   11 
ATOM   6106 O  O   . HIS A 1 52 ? 5.526   -0.554  9.303   1.00 0.00 ? 52 HIS A O   11 
ATOM   6107 C  CB  . HIS A 1 52 ? 3.360   1.590   10.446  1.00 0.00 ? 52 HIS A CB  11 
ATOM   6108 C  CG  . HIS A 1 52 ? 2.854   3.010   10.614  1.00 0.00 ? 52 HIS A CG  11 
ATOM   6109 N  ND1 . HIS A 1 52 ? 3.098   4.085   9.774   1.00 0.00 ? 52 HIS A ND1 11 
ATOM   6110 C  CD2 . HIS A 1 52 ? 2.071   3.460   11.643  1.00 0.00 ? 52 HIS A CD2 11 
ATOM   6111 C  CE1 . HIS A 1 52 ? 2.498   5.167   10.296  1.00 0.00 ? 52 HIS A CE1 11 
ATOM   6112 N  NE2 . HIS A 1 52 ? 1.854   4.808   11.421  1.00 0.00 ? 52 HIS A NE2 11 
ATOM   6113 N  N   . PRO A 1 53 ? 5.599   -0.659  11.546  1.00 0.00 ? 53 PRO A N   11 
ATOM   6114 C  CA  . PRO A 1 53 ? 6.074   -2.036  11.582  1.00 0.00 ? 53 PRO A CA  11 
ATOM   6115 C  C   . PRO A 1 53 ? 5.120   -2.980  10.843  1.00 0.00 ? 53 PRO A C   11 
ATOM   6116 O  O   . PRO A 1 53 ? 3.910   -2.743  10.806  1.00 0.00 ? 53 PRO A O   11 
ATOM   6117 C  CB  . PRO A 1 53 ? 6.237   -2.399  13.062  1.00 0.00 ? 53 PRO A CB  11 
ATOM   6118 C  CG  . PRO A 1 53 ? 5.472   -1.312  13.823  1.00 0.00 ? 53 PRO A CG  11 
ATOM   6119 C  CD  . PRO A 1 53 ? 5.507   -0.108  12.885  1.00 0.00 ? 53 PRO A CD  11 
ATOM   6120 N  N   . ASP A 1 54 ? 5.683   -4.029  10.233  1.00 0.00 ? 54 ASP A N   11 
ATOM   6121 C  CA  . ASP A 1 54 ? 5.025   -4.860  9.237   1.00 0.00 ? 54 ASP A CA  11 
ATOM   6122 C  C   . ASP A 1 54 ? 4.587   -4.000  8.045   1.00 0.00 ? 54 ASP A C   11 
ATOM   6123 O  O   . ASP A 1 54 ? 3.502   -4.190  7.497   1.00 0.00 ? 54 ASP A O   11 
ATOM   6124 C  CB  . ASP A 1 54 ? 3.899   -5.698  9.863   1.00 0.00 ? 54 ASP A CB  11 
ATOM   6125 C  CG  . ASP A 1 54 ? 3.333   -6.727  8.919   1.00 0.00 ? 54 ASP A CG  11 
ATOM   6126 O  OD1 . ASP A 1 54 ? 4.059   -7.151  7.995   1.00 0.00 ? 54 ASP A OD1 11 
ATOM   6127 O  OD2 . ASP A 1 54 ? 2.143   -7.032  9.136   1.00 0.00 ? 54 ASP A OD2 11 
ATOM   6128 N  N   . PHE A 1 55 ? 5.439   -3.053  7.652   1.00 0.00 ? 55 PHE A N   11 
ATOM   6129 C  CA  . PHE A 1 55 ? 5.310   -2.221  6.465   1.00 0.00 ? 55 PHE A CA  11 
ATOM   6130 C  C   . PHE A 1 55 ? 6.662   -1.572  6.146   1.00 0.00 ? 55 PHE A C   11 
ATOM   6131 O  O   . PHE A 1 55 ? 7.176   -1.791  5.052   1.00 0.00 ? 55 PHE A O   11 
ATOM   6132 C  CB  . PHE A 1 55 ? 4.143   -1.207  6.561   1.00 0.00 ? 55 PHE A CB  11 
ATOM   6133 C  CG  . PHE A 1 55 ? 2.860   -1.663  5.886   1.00 0.00 ? 55 PHE A CG  11 
ATOM   6134 C  CD1 . PHE A 1 55 ? 2.942   -2.164  4.572   1.00 0.00 ? 55 PHE A CD1 11 
ATOM   6135 C  CD2 . PHE A 1 55 ? 1.604   -1.629  6.540   1.00 0.00 ? 55 PHE A CD2 11 
ATOM   6136 C  CE1 . PHE A 1 55 ? 1.856   -2.842  4.003   1.00 0.00 ? 55 PHE A CE1 11 
ATOM   6137 C  CE2 . PHE A 1 55 ? 0.497   -2.226  5.922   1.00 0.00 ? 55 PHE A CE2 11 
ATOM   6138 C  CZ  . PHE A 1 55 ? 0.642   -2.899  4.699   1.00 0.00 ? 55 PHE A CZ  11 
ATOM   6139 N  N   . ASP A 1 56 ? 7.256   -0.847  7.105   1.00 0.00 ? 56 ASP A N   11 
ATOM   6140 C  CA  . ASP A 1 56 ? 8.603   -0.263  7.021   1.00 0.00 ? 56 ASP A CA  11 
ATOM   6141 C  C   . ASP A 1 56 ? 9.585   -1.187  6.288   1.00 0.00 ? 56 ASP A C   11 
ATOM   6142 O  O   . ASP A 1 56 ? 10.355  -0.756  5.432   1.00 0.00 ? 56 ASP A O   11 
ATOM   6143 C  CB  . ASP A 1 56 ? 9.147   0.028   8.436   1.00 0.00 ? 56 ASP A CB  11 
ATOM   6144 C  CG  . ASP A 1 56 ? 8.703   1.368   9.004   1.00 0.00 ? 56 ASP A CG  11 
ATOM   6145 O  OD1 . ASP A 1 56 ? 9.081   2.403   8.420   1.00 0.00 ? 56 ASP A OD1 11 
ATOM   6146 O  OD2 . ASP A 1 56 ? 7.973   1.362   10.019  1.00 0.00 ? 56 ASP A OD2 11 
ATOM   6147 N  N   . GLU A 1 57 ? 9.569   -2.465  6.658   1.00 0.00 ? 57 GLU A N   11 
ATOM   6148 C  CA  . GLU A 1 57 ? 10.477  -3.497  6.184   1.00 0.00 ? 57 GLU A CA  11 
ATOM   6149 C  C   . GLU A 1 57 ? 10.353  -3.846  4.690   1.00 0.00 ? 57 GLU A C   11 
ATOM   6150 O  O   . GLU A 1 57 ? 11.270  -4.474  4.158   1.00 0.00 ? 57 GLU A O   11 
ATOM   6151 C  CB  . GLU A 1 57 ? 10.403  -4.730  7.095   1.00 0.00 ? 57 GLU A CB  11 
ATOM   6152 C  CG  . GLU A 1 57 ? 8.960   -5.172  7.332   1.00 0.00 ? 57 GLU A CG  11 
ATOM   6153 C  CD  . GLU A 1 57 ? 8.358   -4.604  8.614   1.00 0.00 ? 57 GLU A CD  11 
ATOM   6154 O  OE1 . GLU A 1 57 ? 7.926   -3.433  8.572   1.00 0.00 ? 57 GLU A OE1 11 
ATOM   6155 O  OE2 . GLU A 1 57 ? 8.291   -5.336  9.621   1.00 0.00 ? 57 GLU A OE2 11 
ATOM   6156 N  N   . VAL A 1 58 ? 9.259   -3.489  4.003   1.00 0.00 ? 58 VAL A N   11 
ATOM   6157 C  CA  . VAL A 1 58 ? 9.044   -3.847  2.598   1.00 0.00 ? 58 VAL A CA  11 
ATOM   6158 C  C   . VAL A 1 58 ? 8.719   -2.611  1.754   1.00 0.00 ? 58 VAL A C   11 
ATOM   6159 O  O   . VAL A 1 58 ? 8.121   -1.652  2.231   1.00 0.00 ? 58 VAL A O   11 
ATOM   6160 C  CB  . VAL A 1 58 ? 7.954   -4.927  2.458   1.00 0.00 ? 58 VAL A CB  11 
ATOM   6161 C  CG1 . VAL A 1 58 ? 8.434   -6.276  3.012   1.00 0.00 ? 58 VAL A CG1 11 
ATOM   6162 C  CG2 . VAL A 1 58 ? 6.627   -4.528  3.121   1.00 0.00 ? 58 VAL A CG2 11 
ATOM   6163 N  N   . LEU A 1 59 ? 9.112   -2.631  0.477   1.00 0.00 ? 59 LEU A N   11 
ATOM   6164 C  CA  . LEU A 1 59 ? 8.787   -1.590  -0.471  1.00 0.00 ? 59 LEU A CA  11 
ATOM   6165 C  C   . LEU A 1 59 ? 7.348   -1.770  -0.930  1.00 0.00 ? 59 LEU A C   11 
ATOM   6166 O  O   . LEU A 1 59 ? 6.963   -2.864  -1.337  1.00 0.00 ? 59 LEU A O   11 
ATOM   6167 C  CB  . LEU A 1 59 ? 9.735   -1.701  -1.667  1.00 0.00 ? 59 LEU A CB  11 
ATOM   6168 C  CG  . LEU A 1 59 ? 9.978   -0.323  -2.265  1.00 0.00 ? 59 LEU A CG  11 
ATOM   6169 C  CD1 . LEU A 1 59 ? 10.831  0.521   -1.309  1.00 0.00 ? 59 LEU A CD1 11 
ATOM   6170 C  CD2 . LEU A 1 59 ? 10.674  -0.505  -3.611  1.00 0.00 ? 59 LEU A CD2 11 
ATOM   6171 N  N   . VAL A 1 60 ? 6.561   -0.705  -0.892  1.00 0.00 ? 60 VAL A N   11 
ATOM   6172 C  CA  . VAL A 1 60 ? 5.141   -0.734  -1.174  1.00 0.00 ? 60 VAL A CA  11 
ATOM   6173 C  C   . VAL A 1 60 ? 4.910   -0.107  -2.548  1.00 0.00 ? 60 VAL A C   11 
ATOM   6174 O  O   . VAL A 1 60 ? 5.434   0.967   -2.845  1.00 0.00 ? 60 VAL A O   11 
ATOM   6175 C  CB  . VAL A 1 60 ? 4.447   -0.002  -0.019  1.00 0.00 ? 60 VAL A CB  11 
ATOM   6176 C  CG1 . VAL A 1 60 ? 2.997   0.357   -0.316  1.00 0.00 ? 60 VAL A CG1 11 
ATOM   6177 C  CG2 . VAL A 1 60 ? 4.479   -0.914  1.219   1.00 0.00 ? 60 VAL A CG2 11 
ATOM   6178 N  N   . LYS A 1 61 ? 4.167   -0.797  -3.416  1.00 0.00 ? 61 LYS A N   11 
ATOM   6179 C  CA  . LYS A 1 61 ? 3.790   -0.259  -4.710  1.00 0.00 ? 61 LYS A CA  11 
ATOM   6180 C  C   . LYS A 1 61 ? 2.945   0.987   -4.482  1.00 0.00 ? 61 LYS A C   11 
ATOM   6181 O  O   . LYS A 1 61 ? 1.980   0.938   -3.730  1.00 0.00 ? 61 LYS A O   11 
ATOM   6182 C  CB  . LYS A 1 61 ? 2.996   -1.325  -5.467  1.00 0.00 ? 61 LYS A CB  11 
ATOM   6183 C  CG  . LYS A 1 61 ? 2.992   -1.134  -6.986  1.00 0.00 ? 61 LYS A CG  11 
ATOM   6184 C  CD  . LYS A 1 61 ? 2.828   -2.517  -7.634  1.00 0.00 ? 61 LYS A CD  11 
ATOM   6185 C  CE  . LYS A 1 61 ? 2.949   -2.489  -9.159  1.00 0.00 ? 61 LYS A CE  11 
ATOM   6186 N  NZ  . LYS A 1 61 ? 1.877   -1.681  -9.784  1.00 0.00 ? 61 LYS A NZ  11 
ATOM   6187 N  N   . ALA A 1 62 ? 3.287   2.087   -5.143  1.00 0.00 ? 62 ALA A N   11 
ATOM   6188 C  CA  . ALA A 1 62 ? 2.565   3.352   -5.034  1.00 0.00 ? 62 ALA A CA  11 
ATOM   6189 C  C   . ALA A 1 62 ? 1.085   3.182   -5.370  1.00 0.00 ? 62 ALA A C   11 
ATOM   6190 O  O   . ALA A 1 62 ? 0.227   3.812   -4.753  1.00 0.00 ? 62 ALA A O   11 
ATOM   6191 C  CB  . ALA A 1 62 ? 3.214   4.362   -5.969  1.00 0.00 ? 62 ALA A CB  11 
ATOM   6192 N  N   . GLU A 1 63 ? 0.803   2.318   -6.349  1.00 0.00 ? 63 GLU A N   11 
ATOM   6193 C  CA  . GLU A 1 63 ? -0.549  2.002   -6.775  1.00 0.00 ? 63 GLU A CA  11 
ATOM   6194 C  C   . GLU A 1 63 ? -1.224  0.981   -5.863  1.00 0.00 ? 63 GLU A C   11 
ATOM   6195 O  O   . GLU A 1 63 ? -2.395  0.685   -6.079  1.00 0.00 ? 63 GLU A O   11 
ATOM   6196 C  CB  . GLU A 1 63 ? -0.520  1.448   -8.199  1.00 0.00 ? 63 GLU A CB  11 
ATOM   6197 C  CG  . GLU A 1 63 ? 0.089   2.429   -9.209  1.00 0.00 ? 63 GLU A CG  11 
ATOM   6198 C  CD  . GLU A 1 63 ? 0.891   1.680   -10.266 1.00 0.00 ? 63 GLU A CD  11 
ATOM   6199 O  OE1 . GLU A 1 63 ? 1.802   0.925   -9.849  1.00 0.00 ? 63 GLU A OE1 11 
ATOM   6200 O  OE2 . GLU A 1 63 ? 0.582   1.842   -11.464 1.00 0.00 ? 63 GLU A OE2 11 
ATOM   6201 N  N   . GLY A 1 64 ? -0.503  0.396   -4.905  1.00 0.00 ? 64 GLY A N   11 
ATOM   6202 C  CA  . GLY A 1 64 ? -1.046  -0.622  -4.027  1.00 0.00 ? 64 GLY A CA  11 
ATOM   6203 C  C   . GLY A 1 64 ? -2.015  -0.039  -3.015  1.00 0.00 ? 64 GLY A C   11 
ATOM   6204 O  O   . GLY A 1 64 ? -2.393  1.132   -3.086  1.00 0.00 ? 64 GLY A O   11 
ATOM   6205 N  N   . TRP A 1 65 ? -2.445  -0.888  -2.082  1.00 0.00 ? 65 TRP A N   11 
ATOM   6206 C  CA  . TRP A 1 65 ? -3.347  -0.492  -1.020  1.00 0.00 ? 65 TRP A CA  11 
ATOM   6207 C  C   . TRP A 1 65 ? -3.264  -1.520  0.096   1.00 0.00 ? 65 TRP A C   11 
ATOM   6208 O  O   . TRP A 1 65 ? -3.024  -2.690  -0.202  1.00 0.00 ? 65 TRP A O   11 
ATOM   6209 C  CB  . TRP A 1 65 ? -4.768  -0.441  -1.575  1.00 0.00 ? 65 TRP A CB  11 
ATOM   6210 C  CG  . TRP A 1 65 ? -5.789  0.017   -0.598  1.00 0.00 ? 65 TRP A CG  11 
ATOM   6211 C  CD1 . TRP A 1 65 ? -6.172  1.300   -0.433  1.00 0.00 ? 65 TRP A CD1 11 
ATOM   6212 C  CD2 . TRP A 1 65 ? -6.558  -0.765  0.363   1.00 0.00 ? 65 TRP A CD2 11 
ATOM   6213 N  NE1 . TRP A 1 65 ? -7.139  1.370   0.541   1.00 0.00 ? 65 TRP A NE1 11 
ATOM   6214 C  CE2 . TRP A 1 65 ? -7.425  0.125   1.058   1.00 0.00 ? 65 TRP A CE2 11 
ATOM   6215 C  CE3 . TRP A 1 65 ? -6.636  -2.136  0.701   1.00 0.00 ? 65 TRP A CE3 11 
ATOM   6216 C  CZ2 . TRP A 1 65 ? -8.338  -0.319  2.017   1.00 0.00 ? 65 TRP A CZ2 11 
ATOM   6217 C  CZ3 . TRP A 1 65 ? -7.524  -2.586  1.697   1.00 0.00 ? 65 TRP A CZ3 11 
ATOM   6218 C  CH2 . TRP A 1 65 ? -8.393  -1.686  2.333   1.00 0.00 ? 65 TRP A CH2 11 
ATOM   6219 N  N   . CYS A 1 66 ? -3.502  -1.100  1.347   1.00 0.00 ? 66 CYS A N   11 
ATOM   6220 C  CA  . CYS A 1 66 ? -3.647  -1.985  2.495   1.00 0.00 ? 66 CYS A CA  11 
ATOM   6221 C  C   . CYS A 1 66 ? -4.769  -1.510  3.423   1.00 0.00 ? 66 CYS A C   11 
ATOM   6222 O  O   . CYS A 1 66 ? -5.331  -0.432  3.240   1.00 0.00 ? 66 CYS A O   11 
ATOM   6223 C  CB  . CYS A 1 66 ? -2.343  -2.114  3.238   1.00 0.00 ? 66 CYS A CB  11 
ATOM   6224 S  SG  . CYS A 1 66 ? -2.110  -0.776  4.432   1.00 0.00 ? 66 CYS A SG  11 
ATOM   6225 N  N   . SER A 1 67 ? -5.107  -2.320  4.431   1.00 0.00 ? 67 SER A N   11 
ATOM   6226 C  CA  . SER A 1 67 ? -6.181  -2.002  5.362   1.00 0.00 ? 67 SER A CA  11 
ATOM   6227 C  C   . SER A 1 67 ? -5.814  -0.869  6.332   1.00 0.00 ? 67 SER A C   11 
ATOM   6228 O  O   . SER A 1 67 ? -6.697  -0.087  6.696   1.00 0.00 ? 67 SER A O   11 
ATOM   6229 C  CB  . SER A 1 67 ? -6.613  -3.262  6.115   1.00 0.00 ? 67 SER A CB  11 
ATOM   6230 O  OG  . SER A 1 67 ? -5.525  -3.784  6.845   1.00 0.00 ? 67 SER A OG  11 
ATOM   6231 N  N   . VAL A 1 68 ? -4.544  -0.784  6.772   1.00 0.00 ? 68 VAL A N   11 
ATOM   6232 C  CA  . VAL A 1 68 ? -4.141  0.203   7.780   1.00 0.00 ? 68 VAL A CA  11 
ATOM   6233 C  C   . VAL A 1 68 ? -4.287  1.637   7.257   1.00 0.00 ? 68 VAL A C   11 
ATOM   6234 O  O   . VAL A 1 68 ? -4.433  2.556   8.058   1.00 0.00 ? 68 VAL A O   11 
ATOM   6235 C  CB  . VAL A 1 68 ? -2.778  -0.054  8.462   1.00 0.00 ? 68 VAL A CB  11 
ATOM   6236 C  CG1 . VAL A 1 68 ? -2.623  -1.530  8.783   1.00 0.00 ? 68 VAL A CG1 11 
ATOM   6237 C  CG2 . VAL A 1 68 ? -1.504  0.419   7.758   1.00 0.00 ? 68 VAL A CG2 11 
ATOM   6238 N  N   . TYR A 1 69 ? -4.255  1.799   5.926   1.00 0.00 ? 69 TYR A N   11 
ATOM   6239 C  CA  . TYR A 1 69 ? -4.414  3.036   5.166   1.00 0.00 ? 69 TYR A CA  11 
ATOM   6240 C  C   . TYR A 1 69 ? -5.115  4.145   5.948   1.00 0.00 ? 69 TYR A C   11 
ATOM   6241 O  O   . TYR A 1 69 ? -6.343  4.111   6.090   1.00 0.00 ? 69 TYR A O   11 
ATOM   6242 C  CB  . TYR A 1 69 ? -5.170  2.715   3.867   1.00 0.00 ? 69 TYR A CB  11 
ATOM   6243 C  CG  . TYR A 1 69 ? -5.195  3.792   2.793   1.00 0.00 ? 69 TYR A CG  11 
ATOM   6244 C  CD1 . TYR A 1 69 ? -5.833  5.033   2.987   1.00 0.00 ? 69 TYR A CD1 11 
ATOM   6245 C  CD2 . TYR A 1 69 ? -4.693  3.487   1.516   1.00 0.00 ? 69 TYR A CD2 11 
ATOM   6246 C  CE1 . TYR A 1 69 ? -5.895  5.964   1.943   1.00 0.00 ? 69 TYR A CE1 11 
ATOM   6247 C  CE2 . TYR A 1 69 ? -4.658  4.461   0.512   1.00 0.00 ? 69 TYR A CE2 11 
ATOM   6248 C  CZ  . TYR A 1 69 ? -5.232  5.718   0.732   1.00 0.00 ? 69 TYR A CZ  11 
ATOM   6249 O  OH  . TYR A 1 69 ? -5.392  6.568   -0.313  1.00 0.00 ? 69 TYR A OH  11 
ATOM   6250 N  N   . ALA A 1 70 ? -4.358  5.145   6.397   1.00 0.00 ? 70 ALA A N   11 
ATOM   6251 C  CA  . ALA A 1 70 ? -4.891  6.409   6.880   1.00 0.00 ? 70 ALA A CA  11 
ATOM   6252 C  C   . ALA A 1 70 ? -4.742  7.397   5.724   1.00 0.00 ? 70 ALA A C   11 
ATOM   6253 O  O   . ALA A 1 70 ? -3.622  7.569   5.254   1.00 0.00 ? 70 ALA A O   11 
ATOM   6254 C  CB  . ALA A 1 70 ? -4.088  6.869   8.096   1.00 0.00 ? 70 ALA A CB  11 
ATOM   6255 N  N   . PRO A 1 71 ? -5.816  8.007   5.205   1.00 0.00 ? 71 PRO A N   11 
ATOM   6256 C  CA  . PRO A 1 71 ? -5.711  8.836   4.019   1.00 0.00 ? 71 PRO A CA  11 
ATOM   6257 C  C   . PRO A 1 71 ? -4.884  10.093  4.249   1.00 0.00 ? 71 PRO A C   11 
ATOM   6258 O  O   . PRO A 1 71 ? -5.136  10.823  5.205   1.00 0.00 ? 71 PRO A O   11 
ATOM   6259 C  CB  . PRO A 1 71 ? -7.138  9.219   3.618   1.00 0.00 ? 71 PRO A CB  11 
ATOM   6260 C  CG  . PRO A 1 71 ? -8.057  8.708   4.731   1.00 0.00 ? 71 PRO A CG  11 
ATOM   6261 C  CD  . PRO A 1 71 ? -7.190  7.839   5.643   1.00 0.00 ? 71 PRO A CD  11 
ATOM   6262 N  N   . ALA A 1 72 ? -3.978  10.391  3.308   1.00 0.00 ? 72 ALA A N   11 
ATOM   6263 C  CA  . ALA A 1 72 ? -3.720  11.778  2.918   1.00 0.00 ? 72 ALA A CA  11 
ATOM   6264 C  C   . ALA A 1 72 ? -4.600  12.253  1.760   1.00 0.00 ? 72 ALA A C   11 
ATOM   6265 O  O   . ALA A 1 72 ? -4.717  13.449  1.505   1.00 0.00 ? 72 ALA A O   11 
ATOM   6266 C  CB  . ALA A 1 72 ? -2.233  12.038  2.654   1.00 0.00 ? 72 ALA A CB  11 
ATOM   6267 N  N   . SER A 1 73 ? -5.235  11.287  1.113   1.00 0.00 ? 73 SER A N   11 
ATOM   6268 C  CA  . SER A 1 73 ? -6.228  11.262  0.056   1.00 0.00 ? 73 SER A CA  11 
ATOM   6269 C  C   . SER A 1 73 ? -6.297  9.778   -0.337  1.00 0.00 ? 73 SER A C   11 
ATOM   6270 O  O   . SER A 1 73 ? -6.493  9.464   -1.531  1.00 0.00 ? 73 SER A O   11 
ATOM   6271 C  CB  . SER A 1 73 ? -5.874  12.160  -1.140  1.00 0.00 ? 73 SER A CB  11 
ATOM   6272 O  OG  . SER A 1 73 ? -6.067  13.529  -0.837  1.00 0.00 ? 73 SER A OG  11 
ATOM   6273 O  OXT . SER A 1 73 ? -6.056  8.955   0.579   1.00 0.00 ? 73 SER A OXT 11 
HETATM 6274 FE FE1 . SF4 B 2 .  ? -0.056  1.555   1.424   1.00 0.00 ? 74 SF4 A FE1 11 
HETATM 6275 FE FE2 . SF4 B 2 .  ? -0.650  3.103   3.303   1.00 0.00 ? 74 SF4 A FE2 11 
HETATM 6276 FE FE3 . SF4 B 2 .  ? 1.363   1.704   3.470   1.00 0.00 ? 74 SF4 A FE3 11 
HETATM 6277 FE FE4 . SF4 B 2 .  ? -0.903  0.645   3.571   1.00 0.00 ? 74 SF4 A FE4 11 
HETATM 6278 S  S1  . SF4 B 2 .  ? -0.097  2.010   5.042   1.00 0.00 ? 74 SF4 A S1  11 
HETATM 6279 S  S2  . SF4 B 2 .  ? 0.785   -0.133  2.475   1.00 0.00 ? 74 SF4 A S2  11 
HETATM 6280 S  S3  . SF4 B 2 .  ? -2.029  1.846   2.227   1.00 0.00 ? 74 SF4 A S3  11 
HETATM 6281 S  S4  . SF4 B 2 .  ? 1.085   3.270   2.037   1.00 0.00 ? 74 SF4 A S4  11 
ATOM   6282 N  N   . ALA A 1 1  ? 17.133  1.487   1.153   1.00 0.00 ? 1  ALA A N   12 
ATOM   6283 C  CA  . ALA A 1 1  ? 18.070  0.399   0.896   1.00 0.00 ? 1  ALA A CA  12 
ATOM   6284 C  C   . ALA A 1 1  ? 17.695  -0.312  -0.394  1.00 0.00 ? 1  ALA A C   12 
ATOM   6285 O  O   . ALA A 1 1  ? 17.021  0.326   -1.197  1.00 0.00 ? 1  ALA A O   12 
ATOM   6286 C  CB  . ALA A 1 1  ? 18.077  -0.616  2.041   1.00 0.00 ? 1  ALA A CB  12 
ATOM   6287 N  N   . SER A 1 2  ? 17.978  -1.606  -0.535  1.00 0.00 ? 2  SER A N   12 
ATOM   6288 C  CA  . SER A 1 2  ? 17.521  -2.378  -1.682  1.00 0.00 ? 2  SER A CA  12 
ATOM   6289 C  C   . SER A 1 2  ? 16.378  -3.269  -1.192  1.00 0.00 ? 2  SER A C   12 
ATOM   6290 O  O   . SER A 1 2  ? 16.497  -4.494  -1.231  1.00 0.00 ? 2  SER A O   12 
ATOM   6291 C  CB  . SER A 1 2  ? 18.694  -3.203  -2.227  1.00 0.00 ? 2  SER A CB  12 
ATOM   6292 O  OG  . SER A 1 2  ? 19.212  -4.018  -1.193  1.00 0.00 ? 2  SER A OG  12 
ATOM   6293 N  N   . GLU A 1 3  ? 15.314  -2.667  -0.647  1.00 0.00 ? 3  GLU A N   12 
ATOM   6294 C  CA  . GLU A 1 3  ? 14.243  -3.434  -0.020  1.00 0.00 ? 3  GLU A CA  12 
ATOM   6295 C  C   . GLU A 1 3  ? 13.385  -4.121  -1.097  1.00 0.00 ? 3  GLU A C   12 
ATOM   6296 O  O   . GLU A 1 3  ? 13.138  -3.534  -2.151  1.00 0.00 ? 3  GLU A O   12 
ATOM   6297 C  CB  . GLU A 1 3  ? 13.412  -2.588  0.967   1.00 0.00 ? 3  GLU A CB  12 
ATOM   6298 C  CG  . GLU A 1 3  ? 13.007  -1.204  0.444   1.00 0.00 ? 3  GLU A CG  12 
ATOM   6299 C  CD  . GLU A 1 3  ? 14.105  -0.185  0.628   1.00 0.00 ? 3  GLU A CD  12 
ATOM   6300 O  OE1 . GLU A 1 3  ? 14.315  0.310   1.760   1.00 0.00 ? 3  GLU A OE1 12 
ATOM   6301 O  OE2 . GLU A 1 3  ? 14.840  0.072   -0.348  1.00 0.00 ? 3  GLU A OE2 12 
ATOM   6302 N  N   . PRO A 1 4  ? 12.949  -5.369  -0.867  1.00 0.00 ? 4  PRO A N   12 
ATOM   6303 C  CA  . PRO A 1 4  ? 12.188  -6.124  -1.848  1.00 0.00 ? 4  PRO A CA  12 
ATOM   6304 C  C   . PRO A 1 4  ? 10.787  -5.538  -2.036  1.00 0.00 ? 4  PRO A C   12 
ATOM   6305 O  O   . PRO A 1 4  ? 10.191  -5.015  -1.096  1.00 0.00 ? 4  PRO A O   12 
ATOM   6306 C  CB  . PRO A 1 4  ? 12.127  -7.559  -1.313  1.00 0.00 ? 4  PRO A CB  12 
ATOM   6307 C  CG  . PRO A 1 4  ? 12.299  -7.391  0.195   1.00 0.00 ? 4  PRO A CG  12 
ATOM   6308 C  CD  . PRO A 1 4  ? 13.212  -6.172  0.317   1.00 0.00 ? 4  PRO A CD  12 
ATOM   6309 N  N   . ARG A 1 5  ? 10.258  -5.651  -3.257  1.00 0.00 ? 5  ARG A N   12 
ATOM   6310 C  CA  . ARG A 1 5  ? 8.891   -5.318  -3.599  1.00 0.00 ? 5  ARG A CA  12 
ATOM   6311 C  C   . ARG A 1 5  ? 7.922   -6.220  -2.824  1.00 0.00 ? 5  ARG A C   12 
ATOM   6312 O  O   . ARG A 1 5  ? 8.072   -7.441  -2.838  1.00 0.00 ? 5  ARG A O   12 
ATOM   6313 C  CB  . ARG A 1 5  ? 8.777   -5.507  -5.113  1.00 0.00 ? 5  ARG A CB  12 
ATOM   6314 C  CG  . ARG A 1 5  ? 9.592   -4.470  -5.841  1.00 0.00 ? 5  ARG A CG  12 
ATOM   6315 C  CD  . ARG A 1 5  ? 9.686   -4.986  -7.272  1.00 0.00 ? 5  ARG A CD  12 
ATOM   6316 N  NE  . ARG A 1 5  ? 10.669  -4.167  -7.932  1.00 0.00 ? 5  ARG A NE  12 
ATOM   6317 C  CZ  . ARG A 1 5  ? 10.490  -3.461  -9.058  1.00 0.00 ? 5  ARG A CZ  12 
ATOM   6318 N  NH1 . ARG A 1 5  ? 9.514   -3.784  -9.908  1.00 0.00 ? 5  ARG A NH1 12 
ATOM   6319 N  NH2 . ARG A 1 5  ? 11.257  -2.413  -9.356  1.00 0.00 ? 5  ARG A NH2 12 
ATOM   6320 N  N   . ALA A 1 6  ? 6.960   -5.611  -2.130  1.00 0.00 ? 6  ALA A N   12 
ATOM   6321 C  CA  . ALA A 1 6  ? 6.008   -6.266  -1.253  1.00 0.00 ? 6  ALA A CA  12 
ATOM   6322 C  C   . ALA A 1 6  ? 5.176   -7.298  -2.003  1.00 0.00 ? 6  ALA A C   12 
ATOM   6323 O  O   . ALA A 1 6  ? 4.811   -7.101  -3.165  1.00 0.00 ? 6  ALA A O   12 
ATOM   6324 C  CB  . ALA A 1 6  ? 5.083   -5.211  -0.642  1.00 0.00 ? 6  ALA A CB  12 
ATOM   6325 N  N   . GLU A 1 7  ? 4.835   -8.382  -1.314  1.00 0.00 ? 7  GLU A N   12 
ATOM   6326 C  CA  . GLU A 1 7  ? 3.966   -9.405  -1.839  1.00 0.00 ? 7  GLU A CA  12 
ATOM   6327 C  C   . GLU A 1 7  ? 2.514   -9.095  -1.528  1.00 0.00 ? 7  GLU A C   12 
ATOM   6328 O  O   . GLU A 1 7  ? 2.187   -8.545  -0.476  1.00 0.00 ? 7  GLU A O   12 
ATOM   6329 C  CB  . GLU A 1 7  ? 4.395   -10.791 -1.446  1.00 0.00 ? 7  GLU A CB  12 
ATOM   6330 C  CG  . GLU A 1 7  ? 4.433   -10.984 0.047   1.00 0.00 ? 7  GLU A CG  12 
ATOM   6331 C  CD  . GLU A 1 7  ? 5.653   -10.407 0.759   1.00 0.00 ? 7  GLU A CD  12 
ATOM   6332 O  OE1 . GLU A 1 7  ? 5.576   -9.216  1.145   1.00 0.00 ? 7  GLU A OE1 12 
ATOM   6333 O  OE2 . GLU A 1 7  ? 6.637   -11.155 0.922   1.00 0.00 ? 7  GLU A OE2 12 
ATOM   6334 N  N   . ASP A 1 8  ? 1.644   -9.476  -2.452  1.00 0.00 ? 8  ASP A N   12 
ATOM   6335 C  CA  . ASP A 1 8  ? 0.216   -9.407  -2.266  1.00 0.00 ? 8  ASP A CA  12 
ATOM   6336 C  C   . ASP A 1 8  ? -0.124  -10.281 -1.060  1.00 0.00 ? 8  ASP A C   12 
ATOM   6337 O  O   . ASP A 1 8  ? 0.215   -11.462 -1.025  1.00 0.00 ? 8  ASP A O   12 
ATOM   6338 C  CB  . ASP A 1 8  ? -0.456  -9.866  -3.558  1.00 0.00 ? 8  ASP A CB  12 
ATOM   6339 C  CG  . ASP A 1 8  ? -0.208  -8.859  -4.667  1.00 0.00 ? 8  ASP A CG  12 
ATOM   6340 O  OD1 . ASP A 1 8  ? 0.850   -8.984  -5.323  1.00 0.00 ? 8  ASP A OD1 12 
ATOM   6341 O  OD2 . ASP A 1 8  ? -1.021  -7.919  -4.786  1.00 0.00 ? 8  ASP A OD2 12 
ATOM   6342 N  N   . GLY A 1 9  ? -0.719  -9.674  -0.034  1.00 0.00 ? 9  GLY A N   12 
ATOM   6343 C  CA  . GLY A 1 9  ? -0.996  -10.325 1.230   1.00 0.00 ? 9  GLY A CA  12 
ATOM   6344 C  C   . GLY A 1 9  ? 0.199   -10.347 2.187   1.00 0.00 ? 9  GLY A C   12 
ATOM   6345 O  O   . GLY A 1 9  ? 0.159   -11.120 3.143   1.00 0.00 ? 9  GLY A O   12 
ATOM   6346 N  N   . HIS A 1 10 ? 1.221   -9.491  1.996   1.00 0.00 ? 10 HIS A N   12 
ATOM   6347 C  CA  . HIS A 1 10 ? 2.292   -9.245  2.969   1.00 0.00 ? 10 HIS A CA  12 
ATOM   6348 C  C   . HIS A 1 10 ? 1.768   -9.290  4.408   1.00 0.00 ? 10 HIS A C   12 
ATOM   6349 O  O   . HIS A 1 10 ? 2.258   -10.040 5.249   1.00 0.00 ? 10 HIS A O   12 
ATOM   6350 C  CB  . HIS A 1 10 ? 2.915   -7.868  2.690   1.00 0.00 ? 10 HIS A CB  12 
ATOM   6351 C  CG  . HIS A 1 10 ? 4.065   -7.529  3.608   1.00 0.00 ? 10 HIS A CG  12 
ATOM   6352 N  ND1 . HIS A 1 10 ? 5.353   -7.997  3.447   1.00 0.00 ? 10 HIS A ND1 12 
ATOM   6353 C  CD2 . HIS A 1 10 ? 4.025   -6.756  4.740   1.00 0.00 ? 10 HIS A CD2 12 
ATOM   6354 C  CE1 . HIS A 1 10 ? 6.086   -7.528  4.473   1.00 0.00 ? 10 HIS A CE1 12 
ATOM   6355 N  NE2 . HIS A 1 10 ? 5.305   -6.764  5.261   1.00 0.00 ? 10 HIS A NE2 12 
ATOM   6356 N  N   . ALA A 1 11 ? 0.754   -8.464  4.662   1.00 0.00 ? 11 ALA A N   12 
ATOM   6357 C  CA  . ALA A 1 11 ? -0.137  -8.514  5.806   1.00 0.00 ? 11 ALA A CA  12 
ATOM   6358 C  C   . ALA A 1 11 ? -1.318  -7.634  5.442   1.00 0.00 ? 11 ALA A C   12 
ATOM   6359 O  O   . ALA A 1 11 ? -1.331  -7.048  4.359   1.00 0.00 ? 11 ALA A O   12 
ATOM   6360 C  CB  . ALA A 1 11 ? 0.548   -7.987  7.076   1.00 0.00 ? 11 ALA A CB  12 
ATOM   6361 N  N   . HIS A 1 12 ? -2.274  -7.522  6.368   1.00 0.00 ? 12 HIS A N   12 
ATOM   6362 C  CA  . HIS A 1 12 ? -3.255  -6.444  6.394   1.00 0.00 ? 12 HIS A CA  12 
ATOM   6363 C  C   . HIS A 1 12 ? -3.864  -6.196  5.016   1.00 0.00 ? 12 HIS A C   12 
ATOM   6364 O  O   . HIS A 1 12 ? -3.972  -5.060  4.558   1.00 0.00 ? 12 HIS A O   12 
ATOM   6365 C  CB  . HIS A 1 12 ? -2.579  -5.195  6.968   1.00 0.00 ? 12 HIS A CB  12 
ATOM   6366 C  CG  . HIS A 1 12 ? -2.054  -5.349  8.377   1.00 0.00 ? 12 HIS A CG  12 
ATOM   6367 N  ND1 . HIS A 1 12 ? -1.100  -4.553  8.998   1.00 0.00 ? 12 HIS A ND1 12 
ATOM   6368 C  CD2 . HIS A 1 12 ? -2.657  -6.109  9.342   1.00 0.00 ? 12 HIS A CD2 12 
ATOM   6369 C  CE1 . HIS A 1 12 ? -1.226  -4.751  10.323  1.00 0.00 ? 12 HIS A CE1 12 
ATOM   6370 N  NE2 . HIS A 1 12 ? -2.132  -5.717  10.554  1.00 0.00 ? 12 HIS A NE2 12 
ATOM   6371 N  N   . ASP A 1 13 ? -4.238  -7.300  4.369   1.00 0.00 ? 13 ASP A N   12 
ATOM   6372 C  CA  . ASP A 1 13 ? -4.988  -7.322  3.123   1.00 0.00 ? 13 ASP A CA  12 
ATOM   6373 C  C   . ASP A 1 13 ? -4.291  -6.528  2.013   1.00 0.00 ? 13 ASP A C   12 
ATOM   6374 O  O   . ASP A 1 13 ? -4.960  -6.046  1.101   1.00 0.00 ? 13 ASP A O   12 
ATOM   6375 C  CB  . ASP A 1 13 ? -6.425  -6.831  3.348   1.00 0.00 ? 13 ASP A CB  12 
ATOM   6376 C  CG  . ASP A 1 13 ? -7.022  -7.245  4.683   1.00 0.00 ? 13 ASP A CG  12 
ATOM   6377 O  OD1 . ASP A 1 13 ? -6.950  -8.443  5.021   1.00 0.00 ? 13 ASP A OD1 12 
ATOM   6378 O  OD2 . ASP A 1 13 ? -7.576  -6.332  5.340   1.00 0.00 ? 13 ASP A OD2 12 
ATOM   6379 N  N   . TYR A 1 14 ? -2.966  -6.361  2.093   1.00 0.00 ? 14 TYR A N   12 
ATOM   6380 C  CA  . TYR A 1 14 ? -2.250  -5.563  1.116   1.00 0.00 ? 14 TYR A CA  12 
ATOM   6381 C  C   . TYR A 1 14 ? -2.366  -6.158  -0.280  1.00 0.00 ? 14 TYR A C   12 
ATOM   6382 O  O   . TYR A 1 14 ? -2.205  -7.366  -0.452  1.00 0.00 ? 14 TYR A O   12 
ATOM   6383 C  CB  . TYR A 1 14 ? -0.793  -5.349  1.525   1.00 0.00 ? 14 TYR A CB  12 
ATOM   6384 C  CG  . TYR A 1 14 ? 0.091   -4.763  0.440   1.00 0.00 ? 14 TYR A CG  12 
ATOM   6385 C  CD1 . TYR A 1 14 ? 0.184   -3.371  0.266   1.00 0.00 ? 14 TYR A CD1 12 
ATOM   6386 C  CD2 . TYR A 1 14 ? 0.754   -5.617  -0.457  1.00 0.00 ? 14 TYR A CD2 12 
ATOM   6387 C  CE1 . TYR A 1 14 ? 0.942   -2.838  -0.786  1.00 0.00 ? 14 TYR A CE1 12 
ATOM   6388 C  CE2 . TYR A 1 14 ? 1.543   -5.086  -1.490  1.00 0.00 ? 14 TYR A CE2 12 
ATOM   6389 C  CZ  . TYR A 1 14 ? 1.647   -3.693  -1.643  1.00 0.00 ? 14 TYR A CZ  12 
ATOM   6390 O  OH  . TYR A 1 14 ? 2.485   -3.165  -2.573  1.00 0.00 ? 14 TYR A OH  12 
ATOM   6391 N  N   . VAL A 1 15 ? -2.600  -5.293  -1.265  1.00 0.00 ? 15 VAL A N   12 
ATOM   6392 C  CA  . VAL A 1 15 ? -2.632  -5.636  -2.674  1.00 0.00 ? 15 VAL A CA  12 
ATOM   6393 C  C   . VAL A 1 15 ? -1.650  -4.720  -3.396  1.00 0.00 ? 15 VAL A C   12 
ATOM   6394 O  O   . VAL A 1 15 ? -1.520  -3.545  -3.039  1.00 0.00 ? 15 VAL A O   12 
ATOM   6395 C  CB  . VAL A 1 15 ? -4.063  -5.497  -3.225  1.00 0.00 ? 15 VAL A CB  12 
ATOM   6396 C  CG1 . VAL A 1 15 ? -4.948  -6.618  -2.663  1.00 0.00 ? 15 VAL A CG1 12 
ATOM   6397 C  CG2 . VAL A 1 15 ? -4.685  -4.140  -2.870  1.00 0.00 ? 15 VAL A CG2 12 
ATOM   6398 N  N   . ASN A 1 16 ? -0.944  -5.256  -4.393  1.00 0.00 ? 16 ASN A N   12 
ATOM   6399 C  CA  . ASN A 1 16 ? -0.011  -4.521  -5.213  1.00 0.00 ? 16 ASN A CA  12 
ATOM   6400 C  C   . ASN A 1 16 ? -0.717  -3.545  -6.150  1.00 0.00 ? 16 ASN A C   12 
ATOM   6401 O  O   . ASN A 1 16 ? -0.115  -2.555  -6.560  1.00 0.00 ? 16 ASN A O   12 
ATOM   6402 C  CB  . ASN A 1 16 ? 0.958   -5.446  -5.956  1.00 0.00 ? 16 ASN A CB  12 
ATOM   6403 C  CG  . ASN A 1 16 ? 2.198   -5.696  -5.112  1.00 0.00 ? 16 ASN A CG  12 
ATOM   6404 O  OD1 . ASN A 1 16 ? 2.868   -4.758  -4.699  1.00 0.00 ? 16 ASN A OD1 12 
ATOM   6405 N  ND2 . ASN A 1 16 ? 2.521   -6.941  -4.821  1.00 0.00 ? 16 ASN A ND2 12 
ATOM   6406 N  N   . GLU A 1 17 ? -1.983  -3.819  -6.486  1.00 0.00 ? 17 GLU A N   12 
ATOM   6407 C  CA  . GLU A 1 17 ? -2.882  -2.906  -7.154  1.00 0.00 ? 17 GLU A CA  12 
ATOM   6408 C  C   . GLU A 1 17 ? -4.021  -2.591  -6.201  1.00 0.00 ? 17 GLU A C   12 
ATOM   6409 O  O   . GLU A 1 17 ? -4.729  -3.495  -5.769  1.00 0.00 ? 17 GLU A O   12 
ATOM   6410 C  CB  . GLU A 1 17 ? -3.417  -3.566  -8.426  1.00 0.00 ? 17 GLU A CB  12 
ATOM   6411 C  CG  . GLU A 1 17 ? -3.921  -2.497  -9.393  1.00 0.00 ? 17 GLU A CG  12 
ATOM   6412 C  CD  . GLU A 1 17 ? -5.355  -2.124  -9.129  1.00 0.00 ? 17 GLU A CD  12 
ATOM   6413 O  OE1 . GLU A 1 17 ? -6.177  -3.056  -9.070  1.00 0.00 ? 17 GLU A OE1 12 
ATOM   6414 O  OE2 . GLU A 1 17 ? -5.588  -0.918  -8.902  1.00 0.00 ? 17 GLU A OE2 12 
ATOM   6415 N  N   . ALA A 1 18 ? -4.188  -1.317  -5.872  1.00 0.00 ? 18 ALA A N   12 
ATOM   6416 C  CA  . ALA A 1 18 ? -5.222  -0.836  -4.981  1.00 0.00 ? 18 ALA A CA  12 
ATOM   6417 C  C   . ALA A 1 18 ? -6.595  -1.390  -5.359  1.00 0.00 ? 18 ALA A C   12 
ATOM   6418 O  O   . ALA A 1 18 ? -7.325  -1.890  -4.501  1.00 0.00 ? 18 ALA A O   12 
ATOM   6419 C  CB  . ALA A 1 18 ? -5.226  0.693   -5.012  1.00 0.00 ? 18 ALA A CB  12 
ATOM   6420 N  N   . ALA A 1 19 ? -6.964  -1.287  -6.637  1.00 0.00 ? 19 ALA A N   12 
ATOM   6421 C  CA  . ALA A 1 19 ? -8.305  -1.662  -7.065  1.00 0.00 ? 19 ALA A CA  12 
ATOM   6422 C  C   . ALA A 1 19 ? -8.556  -3.168  -6.975  1.00 0.00 ? 19 ALA A C   12 
ATOM   6423 O  O   . ALA A 1 19 ? -9.720  -3.559  -6.860  1.00 0.00 ? 19 ALA A O   12 
ATOM   6424 C  CB  . ALA A 1 19 ? -8.655  -1.091  -8.439  1.00 0.00 ? 19 ALA A CB  12 
ATOM   6425 N  N   . ASP A 1 20 ? -7.517  -4.016  -6.934  1.00 0.00 ? 20 ASP A N   12 
ATOM   6426 C  CA  . ASP A 1 20 ? -7.693  -5.415  -6.542  1.00 0.00 ? 20 ASP A CA  12 
ATOM   6427 C  C   . ASP A 1 20 ? -8.594  -5.516  -5.306  1.00 0.00 ? 20 ASP A C   12 
ATOM   6428 O  O   . ASP A 1 20 ? -9.539  -6.302  -5.256  1.00 0.00 ? 20 ASP A O   12 
ATOM   6429 C  CB  . ASP A 1 20 ? -6.360  -6.093  -6.234  1.00 0.00 ? 20 ASP A CB  12 
ATOM   6430 C  CG  . ASP A 1 20 ? -6.544  -7.600  -6.124  1.00 0.00 ? 20 ASP A CG  12 
ATOM   6431 O  OD1 . ASP A 1 20 ? -6.477  -8.259  -7.182  1.00 0.00 ? 20 ASP A OD1 12 
ATOM   6432 O  OD2 . ASP A 1 20 ? -6.772  -8.065  -4.987  1.00 0.00 ? 20 ASP A OD2 12 
ATOM   6433 N  N   . ALA A 1 21 ? -8.344  -4.636  -4.332  1.00 0.00 ? 21 ALA A N   12 
ATOM   6434 C  CA  . ALA A 1 21 ? -9.034  -4.653  -3.049  1.00 0.00 ? 21 ALA A CA  12 
ATOM   6435 C  C   . ALA A 1 21 ? -10.402 -3.967  -3.090  1.00 0.00 ? 21 ALA A C   12 
ATOM   6436 O  O   . ALA A 1 21 ? -11.018 -3.827  -2.034  1.00 0.00 ? 21 ALA A O   12 
ATOM   6437 C  CB  . ALA A 1 21 ? -8.141  -4.044  -1.962  1.00 0.00 ? 21 ALA A CB  12 
ATOM   6438 N  N   . SER A 1 22 ? -10.908 -3.574  -4.266  1.00 0.00 ? 22 SER A N   12 
ATOM   6439 C  CA  . SER A 1 22 ? -12.218 -3.012  -4.514  1.00 0.00 ? 22 SER A CA  12 
ATOM   6440 C  C   . SER A 1 22 ? -13.291 -3.566  -3.592  1.00 0.00 ? 22 SER A C   12 
ATOM   6441 O  O   . SER A 1 22 ? -13.963 -2.859  -2.846  1.00 0.00 ? 22 SER A O   12 
ATOM   6442 C  CB  . SER A 1 22 ? -12.523 -3.323  -5.978  1.00 0.00 ? 22 SER A CB  12 
ATOM   6443 O  OG  . SER A 1 22 ? -12.158 -4.657  -6.289  1.00 0.00 ? 22 SER A OG  12 
ATOM   6444 N  N   . GLY A 1 23 ? -13.414 -4.875  -3.699  1.00 0.00 ? 23 GLY A N   12 
ATOM   6445 C  CA  . GLY A 1 23 ? -14.369 -5.711  -2.991  1.00 0.00 ? 23 GLY A CA  12 
ATOM   6446 C  C   . GLY A 1 23 ? -14.350 -5.520  -1.468  1.00 0.00 ? 23 GLY A C   12 
ATOM   6447 O  O   . GLY A 1 23 ? -15.368 -5.741  -0.819  1.00 0.00 ? 23 GLY A O   12 
ATOM   6448 N  N   . HIS A 1 24 ? -13.203 -5.164  -0.880  1.00 0.00 ? 24 HIS A N   12 
ATOM   6449 C  CA  . HIS A 1 24 ? -13.014 -5.116  0.564   1.00 0.00 ? 24 HIS A CA  12 
ATOM   6450 C  C   . HIS A 1 24 ? -13.808 -3.961  1.181   1.00 0.00 ? 24 HIS A C   12 
ATOM   6451 O  O   . HIS A 1 24 ? -13.443 -2.809  0.955   1.00 0.00 ? 24 HIS A O   12 
ATOM   6452 C  CB  . HIS A 1 24 ? -11.518 -4.916  0.854   1.00 0.00 ? 24 HIS A CB  12 
ATOM   6453 C  CG  . HIS A 1 24 ? -11.074 -5.219  2.270   1.00 0.00 ? 24 HIS A CG  12 
ATOM   6454 N  ND1 . HIS A 1 24 ? -11.779 -5.007  3.447   1.00 0.00 ? 24 HIS A ND1 12 
ATOM   6455 C  CD2 . HIS A 1 24 ? -9.821  -5.651  2.612   1.00 0.00 ? 24 HIS A CD2 12 
ATOM   6456 C  CE1 . HIS A 1 24 ? -10.967 -5.306  4.476   1.00 0.00 ? 24 HIS A CE1 12 
ATOM   6457 N  NE2 . HIS A 1 24 ? -9.776  -5.701  3.992   1.00 0.00 ? 24 HIS A NE2 12 
ATOM   6458 N  N   . PRO A 1 25 ? -14.788 -4.209  2.067   1.00 0.00 ? 25 PRO A N   12 
ATOM   6459 C  CA  . PRO A 1 25 ? -15.310 -3.160  2.932   1.00 0.00 ? 25 PRO A CA  12 
ATOM   6460 C  C   . PRO A 1 25 ? -14.147 -2.654  3.794   1.00 0.00 ? 25 PRO A C   12 
ATOM   6461 O  O   . PRO A 1 25 ? -13.675 -3.410  4.642   1.00 0.00 ? 25 PRO A O   12 
ATOM   6462 C  CB  . PRO A 1 25 ? -16.421 -3.812  3.769   1.00 0.00 ? 25 PRO A CB  12 
ATOM   6463 C  CG  . PRO A 1 25 ? -16.730 -5.119  3.034   1.00 0.00 ? 25 PRO A CG  12 
ATOM   6464 C  CD  . PRO A 1 25 ? -15.386 -5.487  2.411   1.00 0.00 ? 25 PRO A CD  12 
ATOM   6465 N  N   . ARG A 1 26 ? -13.629 -1.457  3.484   1.00 0.00 ? 26 ARG A N   12 
ATOM   6466 C  CA  . ARG A 1 26 ? -12.439 -0.759  3.995   1.00 0.00 ? 26 ARG A CA  12 
ATOM   6467 C  C   . ARG A 1 26 ? -11.759 -0.041  2.835   1.00 0.00 ? 26 ARG A C   12 
ATOM   6468 O  O   . ARG A 1 26 ? -11.226 1.061   3.017   1.00 0.00 ? 26 ARG A O   12 
ATOM   6469 C  CB  . ARG A 1 26 ? -11.367 -1.639  4.682   1.00 0.00 ? 26 ARG A CB  12 
ATOM   6470 C  CG  . ARG A 1 26 ? -11.211 -1.341  6.176   1.00 0.00 ? 26 ARG A CG  12 
ATOM   6471 C  CD  . ARG A 1 26 ? -10.051 -0.363  6.421   1.00 0.00 ? 26 ARG A CD  12 
ATOM   6472 N  NE  . ARG A 1 26 ? -10.092 0.830   5.555   1.00 0.00 ? 26 ARG A NE  12 
ATOM   6473 C  CZ  . ARG A 1 26 ? -9.189  1.822   5.585   1.00 0.00 ? 26 ARG A CZ  12 
ATOM   6474 N  NH1 . ARG A 1 26 ? -8.108  1.714   6.359   1.00 0.00 ? 26 ARG A NH1 12 
ATOM   6475 N  NH2 . ARG A 1 26 ? -9.376  2.914   4.836   1.00 0.00 ? 26 ARG A NH2 12 
ATOM   6476 N  N   . TYR A 1 27 ? -11.717 -0.707  1.678   1.00 0.00 ? 27 TYR A N   12 
ATOM   6477 C  CA  . TYR A 1 27 ? -11.232 -0.104  0.460   1.00 0.00 ? 27 TYR A CA  12 
ATOM   6478 C  C   . TYR A 1 27 ? -12.228 0.965   0.025   1.00 0.00 ? 27 TYR A C   12 
ATOM   6479 O  O   . TYR A 1 27 ? -13.416 0.893   0.334   1.00 0.00 ? 27 TYR A O   12 
ATOM   6480 C  CB  . TYR A 1 27 ? -10.972 -1.161  -0.621  1.00 0.00 ? 27 TYR A CB  12 
ATOM   6481 C  CG  . TYR A 1 27 ? -10.245 -0.588  -1.823  1.00 0.00 ? 27 TYR A CG  12 
ATOM   6482 C  CD1 . TYR A 1 27 ? -8.866  -0.352  -1.718  1.00 0.00 ? 27 TYR A CD1 12 
ATOM   6483 C  CD2 . TYR A 1 27 ? -10.956 -0.029  -2.901  1.00 0.00 ? 27 TYR A CD2 12 
ATOM   6484 C  CE1 . TYR A 1 27 ? -8.246  0.607   -2.531  1.00 0.00 ? 27 TYR A CE1 12 
ATOM   6485 C  CE2 . TYR A 1 27 ? -10.294 0.815   -3.812  1.00 0.00 ? 27 TYR A CE2 12 
ATOM   6486 C  CZ  . TYR A 1 27 ? -8.969  1.217   -3.569  1.00 0.00 ? 27 TYR A CZ  12 
ATOM   6487 O  OH  . TYR A 1 27 ? -8.426  2.274   -4.247  1.00 0.00 ? 27 TYR A OH  12 
ATOM   6488 N  N   . GLN A 1 28 ? -11.697 1.978   -0.647  1.00 0.00 ? 28 GLN A N   12 
ATOM   6489 C  CA  . GLN A 1 28 ? -12.429 3.114   -1.165  1.00 0.00 ? 28 GLN A CA  12 
ATOM   6490 C  C   . GLN A 1 28 ? -11.673 3.573   -2.406  1.00 0.00 ? 28 GLN A C   12 
ATOM   6491 O  O   . GLN A 1 28 ? -10.443 3.660   -2.393  1.00 0.00 ? 28 GLN A O   12 
ATOM   6492 C  CB  . GLN A 1 28 ? -12.552 4.178   -0.067  1.00 0.00 ? 28 GLN A CB  12 
ATOM   6493 C  CG  . GLN A 1 28 ? -13.462 5.365   -0.403  1.00 0.00 ? 28 GLN A CG  12 
ATOM   6494 C  CD  . GLN A 1 28 ? -12.787 6.338   -1.362  1.00 0.00 ? 28 GLN A CD  12 
ATOM   6495 O  OE1 . GLN A 1 28 ? -11.782 6.954   -1.020  1.00 0.00 ? 28 GLN A OE1 12 
ATOM   6496 N  NE2 . GLN A 1 28 ? -13.297 6.444   -2.579  1.00 0.00 ? 28 GLN A NE2 12 
ATOM   6497 N  N   . GLU A 1 29 ? -12.423 3.786   -3.481  1.00 0.00 ? 29 GLU A N   12 
ATOM   6498 C  CA  . GLU A 1 29 ? -11.921 4.091   -4.805  1.00 0.00 ? 29 GLU A CA  12 
ATOM   6499 C  C   . GLU A 1 29 ? -11.031 5.336   -4.810  1.00 0.00 ? 29 GLU A C   12 
ATOM   6500 O  O   . GLU A 1 29 ? -11.495 6.465   -4.657  1.00 0.00 ? 29 GLU A O   12 
ATOM   6501 C  CB  . GLU A 1 29 ? -13.027 4.027   -5.868  1.00 0.00 ? 29 GLU A CB  12 
ATOM   6502 C  CG  . GLU A 1 29 ? -14.204 4.944   -5.572  1.00 0.00 ? 29 GLU A CG  12 
ATOM   6503 C  CD  . GLU A 1 29 ? -15.224 4.353   -4.607  1.00 0.00 ? 29 GLU A CD  12 
ATOM   6504 O  OE1 . GLU A 1 29 ? -14.992 4.520   -3.386  1.00 0.00 ? 29 GLU A OE1 12 
ATOM   6505 O  OE2 . GLU A 1 29 ? -16.180 3.720   -5.095  1.00 0.00 ? 29 GLU A OE2 12 
ATOM   6506 N  N   . GLY A 1 30 ? -9.724  5.109   -4.966  1.00 0.00 ? 30 GLY A N   12 
ATOM   6507 C  CA  . GLY A 1 30 ? -8.733  6.169   -5.020  1.00 0.00 ? 30 GLY A CA  12 
ATOM   6508 C  C   . GLY A 1 30 ? -7.826  6.166   -3.793  1.00 0.00 ? 30 GLY A C   12 
ATOM   6509 O  O   . GLY A 1 30 ? -6.890  6.960   -3.739  1.00 0.00 ? 30 GLY A O   12 
ATOM   6510 N  N   . GLN A 1 31 ? -8.031  5.275   -2.820  1.00 0.00 ? 31 GLN A N   12 
ATOM   6511 C  CA  . GLN A 1 31 ? -6.996  5.041   -1.834  1.00 0.00 ? 31 GLN A CA  12 
ATOM   6512 C  C   . GLN A 1 31 ? -5.880  4.246   -2.532  1.00 0.00 ? 31 GLN A C   12 
ATOM   6513 O  O   . GLN A 1 31 ? -6.102  3.090   -2.888  1.00 0.00 ? 31 GLN A O   12 
ATOM   6514 C  CB  . GLN A 1 31 ? -7.583  4.270   -0.646  1.00 0.00 ? 31 GLN A CB  12 
ATOM   6515 C  CG  . GLN A 1 31 ? -8.699  5.006   0.117   1.00 0.00 ? 31 GLN A CG  12 
ATOM   6516 C  CD  . GLN A 1 31 ? -9.212  4.216   1.332   1.00 0.00 ? 31 GLN A CD  12 
ATOM   6517 O  OE1 . GLN A 1 31 ? -9.436  4.756   2.411   1.00 0.00 ? 31 GLN A OE1 12 
ATOM   6518 N  NE2 . GLN A 1 31 ? -9.415  2.910   1.181   1.00 0.00 ? 31 GLN A NE2 12 
ATOM   6519 N  N   . LEU A 1 32 ? -4.718  4.871   -2.746  1.00 0.00 ? 32 LEU A N   12 
ATOM   6520 C  CA  . LEU A 1 32 ? -3.469  4.269   -3.217  1.00 0.00 ? 32 LEU A CA  12 
ATOM   6521 C  C   . LEU A 1 32 ? -2.417  4.556   -2.137  1.00 0.00 ? 32 LEU A C   12 
ATOM   6522 O  O   . LEU A 1 32 ? -2.520  5.595   -1.487  1.00 0.00 ? 32 LEU A O   12 
ATOM   6523 C  CB  . LEU A 1 32 ? -3.028  4.949   -4.530  1.00 0.00 ? 32 LEU A CB  12 
ATOM   6524 C  CG  . LEU A 1 32 ? -3.330  4.178   -5.824  1.00 0.00 ? 32 LEU A CG  12 
ATOM   6525 C  CD1 . LEU A 1 32 ? -4.803  4.097   -6.212  1.00 0.00 ? 32 LEU A CD1 12 
ATOM   6526 C  CD2 . LEU A 1 32 ? -2.607  4.864   -6.992  1.00 0.00 ? 32 LEU A CD2 12 
ATOM   6527 N  N   . CYS A 1 33 ? -1.408  3.695   -1.957  1.00 0.00 ? 33 CYS A N   12 
ATOM   6528 C  CA  . CYS A 1 33 ? -0.324  3.884   -0.992  1.00 0.00 ? 33 CYS A CA  12 
ATOM   6529 C  C   . CYS A 1 33 ? 0.274   5.296   -1.070  1.00 0.00 ? 33 CYS A C   12 
ATOM   6530 O  O   . CYS A 1 33 ? 0.444   5.945   -0.045  1.00 0.00 ? 33 CYS A O   12 
ATOM   6531 C  CB  . CYS A 1 33 ? 0.751   2.837   -1.177  1.00 0.00 ? 33 CYS A CB  12 
ATOM   6532 S  SG  . CYS A 1 33 ? 0.418   1.285   -0.282  1.00 0.00 ? 33 CYS A SG  12 
ATOM   6533 N  N   . GLU A 1 34 ? 0.562   5.831   -2.260  1.00 0.00 ? 34 GLU A N   12 
ATOM   6534 C  CA  . GLU A 1 34 ? 1.128   7.184   -2.331  1.00 0.00 ? 34 GLU A CA  12 
ATOM   6535 C  C   . GLU A 1 34 ? 0.183   8.281   -1.780  1.00 0.00 ? 34 GLU A C   12 
ATOM   6536 O  O   . GLU A 1 34 ? 0.624   9.392   -1.494  1.00 0.00 ? 34 GLU A O   12 
ATOM   6537 C  CB  . GLU A 1 34 ? 1.721   7.455   -3.720  1.00 0.00 ? 34 GLU A CB  12 
ATOM   6538 C  CG  . GLU A 1 34 ? 2.591   8.730   -3.798  1.00 0.00 ? 34 GLU A CG  12 
ATOM   6539 C  CD  . GLU A 1 34 ? 3.965   8.511   -4.433  1.00 0.00 ? 34 GLU A CD  12 
ATOM   6540 O  OE1 . GLU A 1 34 ? 4.015   7.807   -5.463  1.00 0.00 ? 34 GLU A OE1 12 
ATOM   6541 O  OE2 . GLU A 1 34 ? 4.948   9.050   -3.871  1.00 0.00 ? 34 GLU A OE2 12 
ATOM   6542 N  N   . ASN A 1 35 ? -1.105  7.977   -1.565  1.00 0.00 ? 35 ASN A N   12 
ATOM   6543 C  CA  . ASN A 1 35 ? -2.076  8.892   -0.954  1.00 0.00 ? 35 ASN A CA  12 
ATOM   6544 C  C   . ASN A 1 35 ? -2.222  8.647   0.555   1.00 0.00 ? 35 ASN A C   12 
ATOM   6545 O  O   . ASN A 1 35 ? -3.092  9.247   1.192   1.00 0.00 ? 35 ASN A O   12 
ATOM   6546 C  CB  . ASN A 1 35 ? -3.462  8.713   -1.594  1.00 0.00 ? 35 ASN A CB  12 
ATOM   6547 C  CG  . ASN A 1 35 ? -3.481  8.759   -3.112  1.00 0.00 ? 35 ASN A CG  12 
ATOM   6548 O  OD1 . ASN A 1 35 ? -2.571  9.257   -3.765  1.00 0.00 ? 35 ASN A OD1 12 
ATOM   6549 N  ND2 . ASN A 1 35 ? -4.537  8.207   -3.696  1.00 0.00 ? 35 ASN A ND2 12 
ATOM   6550 N  N   . CYS A 1 36 ? -1.448  7.714   1.114   1.00 0.00 ? 36 CYS A N   12 
ATOM   6551 C  CA  . CYS A 1 36 ? -1.580  7.238   2.481   1.00 0.00 ? 36 CYS A CA  12 
ATOM   6552 C  C   . CYS A 1 36 ? -0.777  8.142   3.414   1.00 0.00 ? 36 CYS A C   12 
ATOM   6553 O  O   . CYS A 1 36 ? 0.361   8.505   3.121   1.00 0.00 ? 36 CYS A O   12 
ATOM   6554 C  CB  . CYS A 1 36 ? -1.055  5.830   2.507   1.00 0.00 ? 36 CYS A CB  12 
ATOM   6555 S  SG  . CYS A 1 36 ? -1.390  4.932   4.022   1.00 0.00 ? 36 CYS A SG  12 
ATOM   6556 N  N   . ALA A 1 37 ? -1.338  8.497   4.567   1.00 0.00 ? 37 ALA A N   12 
ATOM   6557 C  CA  . ALA A 1 37 ? -0.649  9.307   5.562   1.00 0.00 ? 37 ALA A CA  12 
ATOM   6558 C  C   . ALA A 1 37 ? 0.592   8.599   6.114   1.00 0.00 ? 37 ALA A C   12 
ATOM   6559 O  O   . ALA A 1 37 ? 1.483   9.260   6.642   1.00 0.00 ? 37 ALA A O   12 
ATOM   6560 C  CB  . ALA A 1 37 ? -1.625  9.689   6.672   1.00 0.00 ? 37 ALA A CB  12 
ATOM   6561 N  N   . PHE A 1 38 ? 0.667   7.269   5.988   1.00 0.00 ? 38 PHE A N   12 
ATOM   6562 C  CA  . PHE A 1 38 ? 1.854   6.515   6.357   1.00 0.00 ? 38 PHE A CA  12 
ATOM   6563 C  C   . PHE A 1 38 ? 2.869   6.420   5.212   1.00 0.00 ? 38 PHE A C   12 
ATOM   6564 O  O   . PHE A 1 38 ? 3.892   5.759   5.386   1.00 0.00 ? 38 PHE A O   12 
ATOM   6565 C  CB  . PHE A 1 38 ? 1.458   5.108   6.816   1.00 0.00 ? 38 PHE A CB  12 
ATOM   6566 C  CG  . PHE A 1 38 ? 0.624   5.038   8.085   1.00 0.00 ? 38 PHE A CG  12 
ATOM   6567 C  CD1 . PHE A 1 38 ? 1.166   5.489   9.304   1.00 0.00 ? 38 PHE A CD1 12 
ATOM   6568 C  CD2 . PHE A 1 38 ? -0.644  4.430   8.071   1.00 0.00 ? 38 PHE A CD2 12 
ATOM   6569 C  CE1 . PHE A 1 38 ? 0.424   5.372   10.493  1.00 0.00 ? 38 PHE A CE1 12 
ATOM   6570 C  CE2 . PHE A 1 38 ? -1.381  4.300   9.262   1.00 0.00 ? 38 PHE A CE2 12 
ATOM   6571 C  CZ  . PHE A 1 38 ? -0.851  4.780   10.472  1.00 0.00 ? 38 PHE A CZ  12 
ATOM   6572 N  N   . TRP A 1 39 ? 2.620   7.035   4.053   1.00 0.00 ? 39 TRP A N   12 
ATOM   6573 C  CA  . TRP A 1 39 ? 3.562   6.967   2.947   1.00 0.00 ? 39 TRP A CA  12 
ATOM   6574 C  C   . TRP A 1 39 ? 4.926   7.534   3.350   1.00 0.00 ? 39 TRP A C   12 
ATOM   6575 O  O   . TRP A 1 39 ? 5.007   8.505   4.100   1.00 0.00 ? 39 TRP A O   12 
ATOM   6576 C  CB  . TRP A 1 39 ? 3.003   7.716   1.735   1.00 0.00 ? 39 TRP A CB  12 
ATOM   6577 C  CG  . TRP A 1 39 ? 3.815   7.624   0.477   1.00 0.00 ? 39 TRP A CG  12 
ATOM   6578 C  CD1 . TRP A 1 39 ? 4.308   8.673   -0.220  1.00 0.00 ? 39 TRP A CD1 12 
ATOM   6579 C  CD2 . TRP A 1 39 ? 4.159   6.435   -0.300  1.00 0.00 ? 39 TRP A CD2 12 
ATOM   6580 N  NE1 . TRP A 1 39 ? 4.921   8.217   -1.367  1.00 0.00 ? 39 TRP A NE1 12 
ATOM   6581 C  CE2 . TRP A 1 39 ? 4.856   6.848   -1.472  1.00 0.00 ? 39 TRP A CE2 12 
ATOM   6582 C  CE3 . TRP A 1 39 ? 3.901   5.055   -0.169  1.00 0.00 ? 39 TRP A CE3 12 
ATOM   6583 C  CZ2 . TRP A 1 39 ? 5.266   5.949   -2.464  1.00 0.00 ? 39 TRP A CZ2 12 
ATOM   6584 C  CZ3 . TRP A 1 39 ? 4.327   4.144   -1.152  1.00 0.00 ? 39 TRP A CZ3 12 
ATOM   6585 C  CH2 . TRP A 1 39 ? 4.977   4.588   -2.312  1.00 0.00 ? 39 TRP A CH2 12 
ATOM   6586 N  N   . GLY A 1 40 ? 5.992   6.913   2.848   1.00 0.00 ? 40 GLY A N   12 
ATOM   6587 C  CA  . GLY A 1 40 ? 7.336   7.461   2.854   1.00 0.00 ? 40 GLY A CA  12 
ATOM   6588 C  C   . GLY A 1 40 ? 7.491   8.306   1.597   1.00 0.00 ? 40 GLY A C   12 
ATOM   6589 O  O   . GLY A 1 40 ? 6.846   9.344   1.466   1.00 0.00 ? 40 GLY A O   12 
ATOM   6590 N  N   . GLU A 1 41 ? 8.298   7.816   0.652   1.00 0.00 ? 41 GLU A N   12 
ATOM   6591 C  CA  . GLU A 1 41 ? 8.512   8.406   -0.654  1.00 0.00 ? 41 GLU A CA  12 
ATOM   6592 C  C   . GLU A 1 41 ? 8.566   7.275   -1.672  1.00 0.00 ? 41 GLU A C   12 
ATOM   6593 O  O   . GLU A 1 41 ? 8.904   6.137   -1.327  1.00 0.00 ? 41 GLU A O   12 
ATOM   6594 C  CB  . GLU A 1 41 ? 9.852   9.155   -0.685  1.00 0.00 ? 41 GLU A CB  12 
ATOM   6595 C  CG  . GLU A 1 41 ? 9.837   10.428  0.173   1.00 0.00 ? 41 GLU A CG  12 
ATOM   6596 C  CD  . GLU A 1 41 ? 10.916  10.397  1.250   1.00 0.00 ? 41 GLU A CD  12 
ATOM   6597 O  OE1 . GLU A 1 41 ? 10.866  9.459   2.076   1.00 0.00 ? 41 GLU A OE1 12 
ATOM   6598 O  OE2 . GLU A 1 41 ? 11.784  11.295  1.211   1.00 0.00 ? 41 GLU A OE2 12 
ATOM   6599 N  N   . ALA A 1 42 ? 8.286   7.619   -2.929  1.00 0.00 ? 42 ALA A N   12 
ATOM   6600 C  CA  . ALA A 1 42 ? 8.576   6.755   -4.058  1.00 0.00 ? 42 ALA A CA  12 
ATOM   6601 C  C   . ALA A 1 42 ? 10.088  6.605   -4.208  1.00 0.00 ? 42 ALA A C   12 
ATOM   6602 O  O   . ALA A 1 42 ? 10.835  7.558   -3.991  1.00 0.00 ? 42 ALA A O   12 
ATOM   6603 C  CB  . ALA A 1 42 ? 7.932   7.298   -5.333  1.00 0.00 ? 42 ALA A CB  12 
ATOM   6604 N  N   . VAL A 1 43 ? 10.529  5.397   -4.554  1.00 0.00 ? 43 VAL A N   12 
ATOM   6605 C  CA  . VAL A 1 43 ? 11.933  5.024   -4.634  1.00 0.00 ? 43 VAL A CA  12 
ATOM   6606 C  C   . VAL A 1 43 ? 12.296  4.736   -6.091  1.00 0.00 ? 43 VAL A C   12 
ATOM   6607 O  O   . VAL A 1 43 ? 13.255  5.298   -6.617  1.00 0.00 ? 43 VAL A O   12 
ATOM   6608 C  CB  . VAL A 1 43 ? 12.183  3.815   -3.715  1.00 0.00 ? 43 VAL A CB  12 
ATOM   6609 C  CG1 . VAL A 1 43 ? 13.640  3.337   -3.794  1.00 0.00 ? 43 VAL A CG1 12 
ATOM   6610 C  CG2 . VAL A 1 43 ? 11.865  4.138   -2.247  1.00 0.00 ? 43 VAL A CG2 12 
ATOM   6611 N  N   . GLN A 1 44 ? 11.549  3.841   -6.744  1.00 0.00 ? 44 GLN A N   12 
ATOM   6612 C  CA  . GLN A 1 44 ? 11.795  3.407   -8.107  1.00 0.00 ? 44 GLN A CA  12 
ATOM   6613 C  C   . GLN A 1 44 ? 10.509  2.846   -8.701  1.00 0.00 ? 44 GLN A C   12 
ATOM   6614 O  O   . GLN A 1 44 ? 9.699   2.319   -7.948  1.00 0.00 ? 44 GLN A O   12 
ATOM   6615 C  CB  . GLN A 1 44 ? 12.882  2.331   -8.106  1.00 0.00 ? 44 GLN A CB  12 
ATOM   6616 C  CG  . GLN A 1 44 ? 12.535  1.137   -7.204  1.00 0.00 ? 44 GLN A CG  12 
ATOM   6617 C  CD  . GLN A 1 44 ? 13.484  -0.041  -7.399  1.00 0.00 ? 44 GLN A CD  12 
ATOM   6618 O  OE1 . GLN A 1 44 ? 13.057  -1.133  -7.775  1.00 0.00 ? 44 GLN A OE1 12 
ATOM   6619 N  NE2 . GLN A 1 44 ? 14.772  0.165   -7.153  1.00 0.00 ? 44 GLN A NE2 12 
ATOM   6620 N  N   . ASP A 1 45 ? 10.360  2.888   -10.027 1.00 0.00 ? 45 ASP A N   12 
ATOM   6621 C  CA  . ASP A 1 45 ? 9.492   1.984   -10.789 1.00 0.00 ? 45 ASP A CA  12 
ATOM   6622 C  C   . ASP A 1 45 ? 8.052   1.873   -10.236 1.00 0.00 ? 45 ASP A C   12 
ATOM   6623 O  O   . ASP A 1 45 ? 7.418   0.820   -10.258 1.00 0.00 ? 45 ASP A O   12 
ATOM   6624 C  CB  . ASP A 1 45 ? 10.244  0.645   -10.884 1.00 0.00 ? 45 ASP A CB  12 
ATOM   6625 C  CG  . ASP A 1 45 ? 9.535   -0.423  -11.701 1.00 0.00 ? 45 ASP A CG  12 
ATOM   6626 O  OD1 . ASP A 1 45 ? 8.938   -0.072  -12.737 1.00 0.00 ? 45 ASP A OD1 12 
ATOM   6627 O  OD2 . ASP A 1 45 ? 9.666   -1.596  -11.280 1.00 0.00 ? 45 ASP A OD2 12 
ATOM   6628 N  N   . GLY A 1 46 ? 7.511   2.983   -9.723  1.00 0.00 ? 46 GLY A N   12 
ATOM   6629 C  CA  . GLY A 1 46 ? 6.177   3.020   -9.132  1.00 0.00 ? 46 GLY A CA  12 
ATOM   6630 C  C   . GLY A 1 46 ? 6.069   2.193   -7.843  1.00 0.00 ? 46 GLY A C   12 
ATOM   6631 O  O   . GLY A 1 46 ? 5.012   1.658   -7.531  1.00 0.00 ? 46 GLY A O   12 
ATOM   6632 N  N   . TRP A 1 47 ? 7.153   2.105   -7.075  1.00 0.00 ? 47 TRP A N   12 
ATOM   6633 C  CA  . TRP A 1 47 ? 7.256   1.553   -5.747  1.00 0.00 ? 47 TRP A CA  12 
ATOM   6634 C  C   . TRP A 1 47 ? 7.818   2.617   -4.830  1.00 0.00 ? 47 TRP A C   12 
ATOM   6635 O  O   . TRP A 1 47 ? 8.598   3.469   -5.263  1.00 0.00 ? 47 TRP A O   12 
ATOM   6636 C  CB  . TRP A 1 47 ? 8.229   0.380   -5.738  1.00 0.00 ? 47 TRP A CB  12 
ATOM   6637 C  CG  . TRP A 1 47 ? 7.854   -0.765  -6.604  1.00 0.00 ? 47 TRP A CG  12 
ATOM   6638 C  CD1 . TRP A 1 47 ? 8.143   -0.897  -7.910  1.00 0.00 ? 47 TRP A CD1 12 
ATOM   6639 C  CD2 . TRP A 1 47 ? 7.076   -1.930  -6.240  1.00 0.00 ? 47 TRP A CD2 12 
ATOM   6640 N  NE1 . TRP A 1 47 ? 7.513   -2.016  -8.409  1.00 0.00 ? 47 TRP A NE1 12 
ATOM   6641 C  CE2 . TRP A 1 47 ? 6.845   -2.700  -7.415  1.00 0.00 ? 47 TRP A CE2 12 
ATOM   6642 C  CE3 . TRP A 1 47 ? 6.571   -2.424  -5.026  1.00 0.00 ? 47 TRP A CE3 12 
ATOM   6643 C  CZ2 . TRP A 1 47 ? 6.084   -3.874  -7.391  1.00 0.00 ? 47 TRP A CZ2 12 
ATOM   6644 C  CZ3 . TRP A 1 47 ? 5.750   -3.564  -5.004  1.00 0.00 ? 47 TRP A CZ3 12 
ATOM   6645 C  CH2 . TRP A 1 47 ? 5.465   -4.255  -6.194  1.00 0.00 ? 47 TRP A CH2 12 
ATOM   6646 N  N   . GLY A 1 48 ? 7.475   2.521   -3.551  1.00 0.00 ? 48 GLY A N   12 
ATOM   6647 C  CA  . GLY A 1 48 ? 8.030   3.390   -2.553  1.00 0.00 ? 48 GLY A CA  12 
ATOM   6648 C  C   . GLY A 1 48 ? 7.899   2.796   -1.173  1.00 0.00 ? 48 GLY A C   12 
ATOM   6649 O  O   . GLY A 1 48 ? 7.351   1.709   -0.979  1.00 0.00 ? 48 GLY A O   12 
ATOM   6650 N  N   . ARG A 1 49 ? 8.450   3.516   -0.207  1.00 0.00 ? 49 ARG A N   12 
ATOM   6651 C  CA  . ARG A 1 49 ? 8.334   3.120   1.168   1.00 0.00 ? 49 ARG A CA  12 
ATOM   6652 C  C   . ARG A 1 49 ? 7.005   3.544   1.767   1.00 0.00 ? 49 ARG A C   12 
ATOM   6653 O  O   . ARG A 1 49 ? 6.493   4.619   1.472   1.00 0.00 ? 49 ARG A O   12 
ATOM   6654 C  CB  . ARG A 1 49 ? 9.510   3.730   1.907   1.00 0.00 ? 49 ARG A CB  12 
ATOM   6655 C  CG  . ARG A 1 49 ? 10.728  2.956   1.426   1.00 0.00 ? 49 ARG A CG  12 
ATOM   6656 C  CD  . ARG A 1 49 ? 11.932  3.247   2.299   1.00 0.00 ? 49 ARG A CD  12 
ATOM   6657 N  NE  . ARG A 1 49 ? 12.534  1.988   2.779   1.00 0.00 ? 49 ARG A NE  12 
ATOM   6658 C  CZ  . ARG A 1 49 ? 11.916  1.053   3.524   1.00 0.00 ? 49 ARG A CZ  12 
ATOM   6659 N  NH1 . ARG A 1 49 ? 10.784  1.339   4.168   1.00 0.00 ? 49 ARG A NH1 12 
ATOM   6660 N  NH2 . ARG A 1 49 ? 12.438  -0.175  3.567   1.00 0.00 ? 49 ARG A NH2 12 
ATOM   6661 N  N   . CYS A 1 50 ? 6.508   2.688   2.652   1.00 0.00 ? 50 CYS A N   12 
ATOM   6662 C  CA  . CYS A 1 50 ? 5.508   2.979   3.653   1.00 0.00 ? 50 CYS A CA  12 
ATOM   6663 C  C   . CYS A 1 50 ? 6.283   2.999   4.974   1.00 0.00 ? 50 CYS A C   12 
ATOM   6664 O  O   . CYS A 1 50 ? 7.287   2.298   5.107   1.00 0.00 ? 50 CYS A O   12 
ATOM   6665 C  CB  . CYS A 1 50 ? 4.461   1.901   3.553   1.00 0.00 ? 50 CYS A CB  12 
ATOM   6666 S  SG  . CYS A 1 50 ? 3.269   1.988   4.894   1.00 0.00 ? 50 CYS A SG  12 
ATOM   6667 N  N   . THR A 1 51 ? 5.909   3.880   5.903   1.00 0.00 ? 51 THR A N   12 
ATOM   6668 C  CA  . THR A 1 51 ? 6.632   4.086   7.156   1.00 0.00 ? 51 THR A CA  12 
ATOM   6669 C  C   . THR A 1 51 ? 5.994   3.301   8.304   1.00 0.00 ? 51 THR A C   12 
ATOM   6670 O  O   . THR A 1 51 ? 6.599   3.144   9.361   1.00 0.00 ? 51 THR A O   12 
ATOM   6671 C  CB  . THR A 1 51 ? 6.696   5.583   7.490   1.00 0.00 ? 51 THR A CB  12 
ATOM   6672 O  OG1 . THR A 1 51 ? 5.398   6.126   7.622   1.00 0.00 ? 51 THR A OG1 12 
ATOM   6673 C  CG2 . THR A 1 51 ? 7.455   6.363   6.413   1.00 0.00 ? 51 THR A CG2 12 
ATOM   6674 N  N   . HIS A 1 52 ? 4.756   2.836   8.114   1.00 0.00 ? 52 HIS A N   12 
ATOM   6675 C  CA  . HIS A 1 52 ? 3.991   2.142   9.133   1.00 0.00 ? 52 HIS A CA  12 
ATOM   6676 C  C   . HIS A 1 52 ? 4.687   0.827   9.523   1.00 0.00 ? 52 HIS A C   12 
ATOM   6677 O  O   . HIS A 1 52 ? 4.784   -0.045  8.666   1.00 0.00 ? 52 HIS A O   12 
ATOM   6678 C  CB  . HIS A 1 52 ? 2.590   1.872   8.564   1.00 0.00 ? 52 HIS A CB  12 
ATOM   6679 C  CG  . HIS A 1 52 ? 1.723   1.083   9.498   1.00 0.00 ? 52 HIS A CG  12 
ATOM   6680 N  ND1 . HIS A 1 52 ? 0.964   1.594   10.533  1.00 0.00 ? 52 HIS A ND1 12 
ATOM   6681 C  CD2 . HIS A 1 52 ? 1.763   -0.274  9.616   1.00 0.00 ? 52 HIS A CD2 12 
ATOM   6682 C  CE1 . HIS A 1 52 ? 0.578   0.552   11.296  1.00 0.00 ? 52 HIS A CE1 12 
ATOM   6683 N  NE2 . HIS A 1 52 ? 1.061   -0.584  10.756  1.00 0.00 ? 52 HIS A NE2 12 
ATOM   6684 N  N   . PRO A 1 53 ? 5.107   0.630   10.788  1.00 0.00 ? 53 PRO A N   12 
ATOM   6685 C  CA  . PRO A 1 53 ? 5.631   -0.647  11.268  1.00 0.00 ? 53 PRO A CA  12 
ATOM   6686 C  C   . PRO A 1 53 ? 4.681   -1.805  10.936  1.00 0.00 ? 53 PRO A C   12 
ATOM   6687 O  O   . PRO A 1 53 ? 3.541   -1.752  11.382  1.00 0.00 ? 53 PRO A O   12 
ATOM   6688 C  CB  . PRO A 1 53 ? 5.808   -0.482  12.782  1.00 0.00 ? 53 PRO A CB  12 
ATOM   6689 C  CG  . PRO A 1 53 ? 6.030   1.021   12.937  1.00 0.00 ? 53 PRO A CG  12 
ATOM   6690 C  CD  . PRO A 1 53 ? 5.111   1.606   11.866  1.00 0.00 ? 53 PRO A CD  12 
ATOM   6691 N  N   . ASP A 1 54 ? 5.142   -2.792  10.154  1.00 0.00 ? 54 ASP A N   12 
ATOM   6692 C  CA  . ASP A 1 54 ? 4.442   -3.926  9.521   1.00 0.00 ? 54 ASP A CA  12 
ATOM   6693 C  C   . ASP A 1 54 ? 4.354   -3.775  7.995   1.00 0.00 ? 54 ASP A C   12 
ATOM   6694 O  O   . ASP A 1 54 ? 4.159   -4.758  7.277   1.00 0.00 ? 54 ASP A O   12 
ATOM   6695 C  CB  . ASP A 1 54 ? 3.144   -4.419  10.207  1.00 0.00 ? 54 ASP A CB  12 
ATOM   6696 C  CG  . ASP A 1 54 ? 1.853   -3.652  9.933   1.00 0.00 ? 54 ASP A CG  12 
ATOM   6697 O  OD1 . ASP A 1 54 ? 1.350   -3.647  8.787   1.00 0.00 ? 54 ASP A OD1 12 
ATOM   6698 O  OD2 . ASP A 1 54 ? 1.256   -3.157  10.914  1.00 0.00 ? 54 ASP A OD2 12 
ATOM   6699 N  N   . PHE A 1 55 ? 4.595   -2.554  7.508   1.00 0.00 ? 55 PHE A N   12 
ATOM   6700 C  CA  . PHE A 1 55 ? 4.858   -2.225  6.112   1.00 0.00 ? 55 PHE A CA  12 
ATOM   6701 C  C   . PHE A 1 55 ? 6.141   -1.394  5.977   1.00 0.00 ? 55 PHE A C   12 
ATOM   6702 O  O   . PHE A 1 55 ? 6.389   -0.800  4.932   1.00 0.00 ? 55 PHE A O   12 
ATOM   6703 C  CB  . PHE A 1 55 ? 3.645   -1.468  5.555   1.00 0.00 ? 55 PHE A CB  12 
ATOM   6704 C  CG  . PHE A 1 55 ? 2.466   -2.372  5.281   1.00 0.00 ? 55 PHE A CG  12 
ATOM   6705 C  CD1 . PHE A 1 55 ? 2.583   -3.305  4.235   1.00 0.00 ? 55 PHE A CD1 12 
ATOM   6706 C  CD2 . PHE A 1 55 ? 1.273   -2.300  6.033   1.00 0.00 ? 55 PHE A CD2 12 
ATOM   6707 C  CE1 . PHE A 1 55 ? 1.538   -4.198  3.965   1.00 0.00 ? 55 PHE A CE1 12 
ATOM   6708 C  CE2 . PHE A 1 55 ? 0.231   -3.190  5.750   1.00 0.00 ? 55 PHE A CE2 12 
ATOM   6709 C  CZ  . PHE A 1 55 ? 0.376   -4.162  4.748   1.00 0.00 ? 55 PHE A CZ  12 
ATOM   6710 N  N   . ASP A 1 56 ? 6.956   -1.344  7.031   1.00 0.00 ? 56 ASP A N   12 
ATOM   6711 C  CA  . ASP A 1 56 ? 8.174   -0.558  7.113   1.00 0.00 ? 56 ASP A CA  12 
ATOM   6712 C  C   . ASP A 1 56 ? 9.334   -1.263  6.416   1.00 0.00 ? 56 ASP A C   12 
ATOM   6713 O  O   . ASP A 1 56 ? 10.233  -0.603  5.895   1.00 0.00 ? 56 ASP A O   12 
ATOM   6714 C  CB  . ASP A 1 56 ? 8.514   -0.320  8.590   1.00 0.00 ? 56 ASP A CB  12 
ATOM   6715 C  CG  . ASP A 1 56 ? 8.685   -1.627  9.354   1.00 0.00 ? 56 ASP A CG  12 
ATOM   6716 O  OD1 . ASP A 1 56 ? 7.703   -2.409  9.344   1.00 0.00 ? 56 ASP A OD1 12 
ATOM   6717 O  OD2 . ASP A 1 56 ? 9.769   -1.812  9.943   1.00 0.00 ? 56 ASP A OD2 12 
ATOM   6718 N  N   . GLU A 1 57 ? 9.342   -2.594  6.416   1.00 0.00 ? 57 GLU A N   12 
ATOM   6719 C  CA  . GLU A 1 57 ? 10.432  -3.381  5.876   1.00 0.00 ? 57 GLU A CA  12 
ATOM   6720 C  C   . GLU A 1 57 ? 10.419  -3.273  4.351   1.00 0.00 ? 57 GLU A C   12 
ATOM   6721 O  O   . GLU A 1 57 ? 11.313  -2.654  3.763   1.00 0.00 ? 57 GLU A O   12 
ATOM   6722 C  CB  . GLU A 1 57 ? 10.384  -4.845  6.382   1.00 0.00 ? 57 GLU A CB  12 
ATOM   6723 C  CG  . GLU A 1 57 ? 9.229   -5.226  7.334   1.00 0.00 ? 57 GLU A CG  12 
ATOM   6724 C  CD  . GLU A 1 57 ? 7.876   -5.355  6.645   1.00 0.00 ? 57 GLU A CD  12 
ATOM   6725 O  OE1 . GLU A 1 57 ? 7.647   -4.596  5.682   1.00 0.00 ? 57 GLU A OE1 12 
ATOM   6726 O  OE2 . GLU A 1 57 ? 7.085   -6.234  7.046   1.00 0.00 ? 57 GLU A OE2 12 
ATOM   6727 N  N   . VAL A 1 58 ? 9.416   -3.891  3.725   1.00 0.00 ? 58 VAL A N   12 
ATOM   6728 C  CA  . VAL A 1 58 ? 9.342   -4.052  2.277   1.00 0.00 ? 58 VAL A CA  12 
ATOM   6729 C  C   . VAL A 1 58 ? 9.085   -2.720  1.571   1.00 0.00 ? 58 VAL A C   12 
ATOM   6730 O  O   . VAL A 1 58 ? 8.699   -1.731  2.192   1.00 0.00 ? 58 VAL A O   12 
ATOM   6731 C  CB  . VAL A 1 58 ? 8.283   -5.103  1.886   1.00 0.00 ? 58 VAL A CB  12 
ATOM   6732 C  CG1 . VAL A 1 58 ? 8.672   -6.485  2.420   1.00 0.00 ? 58 VAL A CG1 12 
ATOM   6733 C  CG2 . VAL A 1 58 ? 6.867   -4.733  2.348   1.00 0.00 ? 58 VAL A CG2 12 
ATOM   6734 N  N   . LEU A 1 59 ? 9.286   -2.702  0.251   1.00 0.00 ? 59 LEU A N   12 
ATOM   6735 C  CA  . LEU A 1 59 ? 8.907   -1.602  -0.602  1.00 0.00 ? 59 LEU A CA  12 
ATOM   6736 C  C   . LEU A 1 59 ? 7.502   -1.883  -1.110  1.00 0.00 ? 59 LEU A C   12 
ATOM   6737 O  O   . LEU A 1 59 ? 7.296   -2.896  -1.772  1.00 0.00 ? 59 LEU A O   12 
ATOM   6738 C  CB  . LEU A 1 59 ? 9.925   -1.548  -1.748  1.00 0.00 ? 59 LEU A CB  12 
ATOM   6739 C  CG  . LEU A 1 59 ? 10.018  -0.155  -2.357  1.00 0.00 ? 59 LEU A CG  12 
ATOM   6740 C  CD1 . LEU A 1 59 ? 10.660  0.859   -1.408  1.00 0.00 ? 59 LEU A CD1 12 
ATOM   6741 C  CD2 . LEU A 1 59 ? 10.921  -0.209  -3.584  1.00 0.00 ? 59 LEU A CD2 12 
ATOM   6742 N  N   . VAL A 1 60 ? 6.528   -1.030  -0.800  1.00 0.00 ? 60 VAL A N   12 
ATOM   6743 C  CA  . VAL A 1 60 ? 5.165   -1.256  -1.252  1.00 0.00 ? 60 VAL A CA  12 
ATOM   6744 C  C   . VAL A 1 60 ? 4.983   -0.536  -2.585  1.00 0.00 ? 60 VAL A C   12 
ATOM   6745 O  O   . VAL A 1 60 ? 5.646   0.465   -2.862  1.00 0.00 ? 60 VAL A O   12 
ATOM   6746 C  CB  . VAL A 1 60 ? 4.139   -0.868  -0.175  1.00 0.00 ? 60 VAL A CB  12 
ATOM   6747 C  CG1 . VAL A 1 60 ? 4.448   -1.541  1.168   1.00 0.00 ? 60 VAL A CG1 12 
ATOM   6748 C  CG2 . VAL A 1 60 ? 3.999   0.640   0.003   1.00 0.00 ? 60 VAL A CG2 12 
ATOM   6749 N  N   . LYS A 1 61 ? 4.141   -1.073  -3.463  1.00 0.00 ? 61 LYS A N   12 
ATOM   6750 C  CA  . LYS A 1 61 ? 3.877   -0.430  -4.728  1.00 0.00 ? 61 LYS A CA  12 
ATOM   6751 C  C   . LYS A 1 61 ? 3.148   0.878   -4.452  1.00 0.00 ? 61 LYS A C   12 
ATOM   6752 O  O   . LYS A 1 61 ? 2.262   0.909   -3.605  1.00 0.00 ? 61 LYS A O   12 
ATOM   6753 C  CB  . LYS A 1 61 ? 3.049   -1.372  -5.603  1.00 0.00 ? 61 LYS A CB  12 
ATOM   6754 C  CG  . LYS A 1 61 ? 3.167   -0.932  -7.057  1.00 0.00 ? 61 LYS A CG  12 
ATOM   6755 C  CD  . LYS A 1 61 ? 3.050   -2.085  -8.054  1.00 0.00 ? 61 LYS A CD  12 
ATOM   6756 C  CE  . LYS A 1 61 ? 3.714   -1.665  -9.377  1.00 0.00 ? 61 LYS A CE  12 
ATOM   6757 N  NZ  . LYS A 1 61 ? 3.361   -0.292  -9.823  1.00 0.00 ? 61 LYS A NZ  12 
ATOM   6758 N  N   . ALA A 1 62 ? 3.494   1.952   -5.159  1.00 0.00 ? 62 ALA A N   12 
ATOM   6759 C  CA  . ALA A 1 62 ? 2.822   3.229   -4.968  1.00 0.00 ? 62 ALA A CA  12 
ATOM   6760 C  C   . ALA A 1 62 ? 1.332   3.119   -5.286  1.00 0.00 ? 62 ALA A C   12 
ATOM   6761 O  O   . ALA A 1 62 ? 0.516   3.725   -4.587  1.00 0.00 ? 62 ALA A O   12 
ATOM   6762 C  CB  . ALA A 1 62 ? 3.505   4.312   -5.793  1.00 0.00 ? 62 ALA A CB  12 
ATOM   6763 N  N   . GLU A 1 63 ? 0.970   2.325   -6.307  1.00 0.00 ? 63 GLU A N   12 
ATOM   6764 C  CA  . GLU A 1 63 ? -0.425  2.008   -6.573  1.00 0.00 ? 63 GLU A CA  12 
ATOM   6765 C  C   . GLU A 1 63 ? -0.975  0.874   -5.713  1.00 0.00 ? 63 GLU A C   12 
ATOM   6766 O  O   . GLU A 1 63 ? -2.112  0.464   -5.932  1.00 0.00 ? 63 GLU A O   12 
ATOM   6767 C  CB  . GLU A 1 63 ? -0.683  1.663   -8.039  1.00 0.00 ? 63 GLU A CB  12 
ATOM   6768 C  CG  . GLU A 1 63 ? 0.079   2.541   -9.024  1.00 0.00 ? 63 GLU A CG  12 
ATOM   6769 C  CD  . GLU A 1 63 ? 1.341   1.805   -9.447  1.00 0.00 ? 63 GLU A CD  12 
ATOM   6770 O  OE1 . GLU A 1 63 ? 2.305   1.780   -8.648  1.00 0.00 ? 63 GLU A OE1 12 
ATOM   6771 O  OE2 . GLU A 1 63 ? 1.324   1.116   -10.490 1.00 0.00 ? 63 GLU A OE2 12 
ATOM   6772 N  N   . GLY A 1 64 ? -0.193  0.330   -4.780  1.00 0.00 ? 64 GLY A N   12 
ATOM   6773 C  CA  . GLY A 1 64 ? -0.685  -0.679  -3.868  1.00 0.00 ? 64 GLY A CA  12 
ATOM   6774 C  C   . GLY A 1 64 ? -1.628  -0.048  -2.853  1.00 0.00 ? 64 GLY A C   12 
ATOM   6775 O  O   . GLY A 1 64 ? -1.928  1.145   -2.921  1.00 0.00 ? 64 GLY A O   12 
ATOM   6776 N  N   . TRP A 1 65 ? -2.105  -0.856  -1.912  1.00 0.00 ? 65 TRP A N   12 
ATOM   6777 C  CA  . TRP A 1 65 ? -2.922  -0.389  -0.806  1.00 0.00 ? 65 TRP A CA  12 
ATOM   6778 C  C   . TRP A 1 65 ? -2.931  -1.480  0.253   1.00 0.00 ? 65 TRP A C   12 
ATOM   6779 O  O   . TRP A 1 65 ? -2.781  -2.648  -0.106  1.00 0.00 ? 65 TRP A O   12 
ATOM   6780 C  CB  . TRP A 1 65 ? -4.343  -0.132  -1.300  1.00 0.00 ? 65 TRP A CB  12 
ATOM   6781 C  CG  . TRP A 1 65 ? -5.338  0.240   -0.250  1.00 0.00 ? 65 TRP A CG  12 
ATOM   6782 C  CD1 . TRP A 1 65 ? -5.658  1.498   0.115   1.00 0.00 ? 65 TRP A CD1 12 
ATOM   6783 C  CD2 . TRP A 1 65 ? -6.194  -0.642  0.531   1.00 0.00 ? 65 TRP A CD2 12 
ATOM   6784 N  NE1 . TRP A 1 65 ? -6.719  1.459   0.995   1.00 0.00 ? 65 TRP A NE1 12 
ATOM   6785 C  CE2 . TRP A 1 65 ? -7.107  0.166   1.266   1.00 0.00 ? 65 TRP A CE2 12 
ATOM   6786 C  CE3 . TRP A 1 65 ? -6.341  -2.043  0.643   1.00 0.00 ? 65 TRP A CE3 12 
ATOM   6787 C  CZ2 . TRP A 1 65 ? -8.153  -0.380  2.017   1.00 0.00 ? 65 TRP A CZ2 12 
ATOM   6788 C  CZ3 . TRP A 1 65 ? -7.356  -2.604  1.438   1.00 0.00 ? 65 TRP A CZ3 12 
ATOM   6789 C  CH2 . TRP A 1 65 ? -8.284  -1.778  2.092   1.00 0.00 ? 65 TRP A CH2 12 
ATOM   6790 N  N   . CYS A 1 66 ? -3.141  -1.101  1.519   1.00 0.00 ? 66 CYS A N   12 
ATOM   6791 C  CA  . CYS A 1 66 ? -3.332  -2.012  2.637   1.00 0.00 ? 66 CYS A CA  12 
ATOM   6792 C  C   . CYS A 1 66 ? -4.493  -1.540  3.515   1.00 0.00 ? 66 CYS A C   12 
ATOM   6793 O  O   . CYS A 1 66 ? -4.884  -0.372  3.478   1.00 0.00 ? 66 CYS A O   12 
ATOM   6794 C  CB  . CYS A 1 66 ? -2.061  -2.158  3.436   1.00 0.00 ? 66 CYS A CB  12 
ATOM   6795 S  SG  . CYS A 1 66 ? -1.863  -0.817  4.635   1.00 0.00 ? 66 CYS A SG  12 
ATOM   6796 N  N   . SER A 1 67 ? -5.060  -2.437  4.327   1.00 0.00 ? 67 SER A N   12 
ATOM   6797 C  CA  . SER A 1 67 ? -6.199  -2.082  5.155   1.00 0.00 ? 67 SER A CA  12 
ATOM   6798 C  C   . SER A 1 67 ? -5.821  -1.151  6.310   1.00 0.00 ? 67 SER A C   12 
ATOM   6799 O  O   . SER A 1 67 ? -6.717  -0.504  6.860   1.00 0.00 ? 67 SER A O   12 
ATOM   6800 C  CB  . SER A 1 67 ? -6.964  -3.333  5.596   1.00 0.00 ? 67 SER A CB  12 
ATOM   6801 O  OG  . SER A 1 67 ? -6.144  -4.286  6.235   1.00 0.00 ? 67 SER A OG  12 
ATOM   6802 N  N   . VAL A 1 68 ? -4.530  -1.018  6.652   1.00 0.00 ? 68 VAL A N   12 
ATOM   6803 C  CA  . VAL A 1 68 ? -4.105  -0.016  7.631   1.00 0.00 ? 68 VAL A CA  12 
ATOM   6804 C  C   . VAL A 1 68 ? -4.076  1.404   7.039   1.00 0.00 ? 68 VAL A C   12 
ATOM   6805 O  O   . VAL A 1 68 ? -3.832  2.352   7.781   1.00 0.00 ? 68 VAL A O   12 
ATOM   6806 C  CB  . VAL A 1 68 ? -2.867  -0.387  8.476   1.00 0.00 ? 68 VAL A CB  12 
ATOM   6807 C  CG1 . VAL A 1 68 ? -2.819  -1.889  8.688   1.00 0.00 ? 68 VAL A CG1 12 
ATOM   6808 C  CG2 . VAL A 1 68 ? -1.472  0.057   8.042   1.00 0.00 ? 68 VAL A CG2 12 
ATOM   6809 N  N   . TYR A 1 69 ? -4.337  1.565   5.728   1.00 0.00 ? 69 TYR A N   12 
ATOM   6810 C  CA  . TYR A 1 69 ? -4.399  2.862   5.056   1.00 0.00 ? 69 TYR A CA  12 
ATOM   6811 C  C   . TYR A 1 69 ? -5.154  3.908   5.882   1.00 0.00 ? 69 TYR A C   12 
ATOM   6812 O  O   . TYR A 1 69 ? -6.292  3.668   6.288   1.00 0.00 ? 69 TYR A O   12 
ATOM   6813 C  CB  . TYR A 1 69 ? -5.075  2.714   3.682   1.00 0.00 ? 69 TYR A CB  12 
ATOM   6814 C  CG  . TYR A 1 69 ? -5.273  4.016   2.918   1.00 0.00 ? 69 TYR A CG  12 
ATOM   6815 C  CD1 . TYR A 1 69 ? -6.390  4.827   3.187   1.00 0.00 ? 69 TYR A CD1 12 
ATOM   6816 C  CD2 . TYR A 1 69 ? -4.348  4.423   1.941   1.00 0.00 ? 69 TYR A CD2 12 
ATOM   6817 C  CE1 . TYR A 1 69 ? -6.564  6.041   2.506   1.00 0.00 ? 69 TYR A CE1 12 
ATOM   6818 C  CE2 . TYR A 1 69 ? -4.530  5.636   1.253   1.00 0.00 ? 69 TYR A CE2 12 
ATOM   6819 C  CZ  . TYR A 1 69 ? -5.640  6.444   1.532   1.00 0.00 ? 69 TYR A CZ  12 
ATOM   6820 O  OH  . TYR A 1 69 ? -5.879  7.565   0.797   1.00 0.00 ? 69 TYR A OH  12 
ATOM   6821 N  N   . ALA A 1 70 ? -4.564  5.092   6.047   1.00 0.00 ? 70 ALA A N   12 
ATOM   6822 C  CA  . ALA A 1 70 ? -5.244  6.285   6.527   1.00 0.00 ? 70 ALA A CA  12 
ATOM   6823 C  C   . ALA A 1 70 ? -5.007  7.355   5.463   1.00 0.00 ? 70 ALA A C   12 
ATOM   6824 O  O   . ALA A 1 70 ? -3.883  7.440   4.975   1.00 0.00 ? 70 ALA A O   12 
ATOM   6825 C  CB  . ALA A 1 70 ? -4.650  6.705   7.874   1.00 0.00 ? 70 ALA A CB  12 
ATOM   6826 N  N   . PRO A 1 71 ? -6.015  8.134   5.049   1.00 0.00 ? 71 PRO A N   12 
ATOM   6827 C  CA  . PRO A 1 71 ? -5.832  9.132   4.011   1.00 0.00 ? 71 PRO A CA  12 
ATOM   6828 C  C   . PRO A 1 71 ? -4.967  10.277  4.510   1.00 0.00 ? 71 PRO A C   12 
ATOM   6829 O  O   . PRO A 1 71 ? -4.980  10.609  5.693   1.00 0.00 ? 71 PRO A O   12 
ATOM   6830 C  CB  . PRO A 1 71 ? -7.235  9.606   3.634   1.00 0.00 ? 71 PRO A CB  12 
ATOM   6831 C  CG  . PRO A 1 71 ? -8.031  9.382   4.923   1.00 0.00 ? 71 PRO A CG  12 
ATOM   6832 C  CD  . PRO A 1 71 ? -7.385  8.138   5.536   1.00 0.00 ? 71 PRO A CD  12 
ATOM   6833 N  N   . ALA A 1 72 ? -4.229  10.889  3.583   1.00 0.00 ? 72 ALA A N   12 
ATOM   6834 C  CA  . ALA A 1 72 ? -3.441  12.078  3.847   1.00 0.00 ? 72 ALA A CA  12 
ATOM   6835 C  C   . ALA A 1 72 ? -4.221  13.324  3.434   1.00 0.00 ? 72 ALA A C   12 
ATOM   6836 O  O   . ALA A 1 72 ? -3.679  14.261  2.850   1.00 0.00 ? 72 ALA A O   12 
ATOM   6837 C  CB  . ALA A 1 72 ? -2.126  11.968  3.093   1.00 0.00 ? 72 ALA A CB  12 
ATOM   6838 N  N   . SER A 1 73 ? -5.520  13.301  3.710   1.00 0.00 ? 73 SER A N   12 
ATOM   6839 C  CA  . SER A 1 73 ? -6.508  14.336  3.478   1.00 0.00 ? 73 SER A CA  12 
ATOM   6840 C  C   . SER A 1 73 ? -7.739  13.919  4.279   1.00 0.00 ? 73 SER A C   12 
ATOM   6841 O  O   . SER A 1 73 ? -8.685  14.730  4.342   1.00 0.00 ? 73 SER A O   12 
ATOM   6842 C  CB  . SER A 1 73 ? -6.866  14.438  1.992   1.00 0.00 ? 73 SER A CB  12 
ATOM   6843 O  OG  . SER A 1 73 ? -5.799  14.974  1.229   1.00 0.00 ? 73 SER A OG  12 
ATOM   6844 O  OXT . SER A 1 73 ? -7.708  12.773  4.789   1.00 0.00 ? 73 SER A OXT 12 
HETATM 6845 FE FE1 . SF4 B 2 .  ? 0.296   1.630   1.745   1.00 0.00 ? 74 SF4 A FE1 12 
HETATM 6846 FE FE2 . SF4 B 2 .  ? -0.537  3.139   3.569   1.00 0.00 ? 74 SF4 A FE2 12 
HETATM 6847 FE FE3 . SF4 B 2 .  ? 1.496   1.836   3.937   1.00 0.00 ? 74 SF4 A FE3 12 
HETATM 6848 FE FE4 . SF4 B 2 .  ? -0.706  0.663   3.816   1.00 0.00 ? 74 SF4 A FE4 12 
HETATM 6849 S  S1  . SF4 B 2 .  ? -0.097  2.056   5.353   1.00 0.00 ? 74 SF4 A S1  12 
HETATM 6850 S  S2  . SF4 B 2 .  ? 1.122   -0.020  2.891   1.00 0.00 ? 74 SF4 A S2  12 
HETATM 6851 S  S3  . SF4 B 2 .  ? -1.772  1.838   2.363   1.00 0.00 ? 74 SF4 A S3  12 
HETATM 6852 S  S4  . SF4 B 2 .  ? 1.299   3.394   2.475   1.00 0.00 ? 74 SF4 A S4  12 
ATOM   6853 N  N   . ALA A 1 1  ? 19.096  1.548   0.270   1.00 0.00 ? 1  ALA A N   13 
ATOM   6854 C  CA  . ALA A 1 1  ? 18.039  1.261   -0.697  1.00 0.00 ? 1  ALA A CA  13 
ATOM   6855 C  C   . ALA A 1 1  ? 17.853  -0.226  -1.025  1.00 0.00 ? 1  ALA A C   13 
ATOM   6856 O  O   . ALA A 1 1  ? 17.993  -1.059  -0.137  1.00 0.00 ? 1  ALA A O   13 
ATOM   6857 C  CB  . ALA A 1 1  ? 18.214  2.042   -2.004  1.00 0.00 ? 1  ALA A CB  13 
ATOM   6858 N  N   . SER A 1 2  ? 17.529  -0.540  -2.283  1.00 0.00 ? 2  SER A N   13 
ATOM   6859 C  CA  . SER A 1 2  ? 17.414  -1.899  -2.806  1.00 0.00 ? 2  SER A CA  13 
ATOM   6860 C  C   . SER A 1 2  ? 16.567  -2.841  -1.942  1.00 0.00 ? 2  SER A C   13 
ATOM   6861 O  O   . SER A 1 2  ? 16.882  -4.026  -1.836  1.00 0.00 ? 2  SER A O   13 
ATOM   6862 C  CB  . SER A 1 2  ? 18.819  -2.467  -3.031  1.00 0.00 ? 2  SER A CB  13 
ATOM   6863 O  OG  . SER A 1 2  ? 19.585  -1.545  -3.787  1.00 0.00 ? 2  SER A OG  13 
ATOM   6864 N  N   . GLU A 1 3  ? 15.487  -2.336  -1.343  1.00 0.00 ? 3  GLU A N   13 
ATOM   6865 C  CA  . GLU A 1 3  ? 14.578  -3.148  -0.545  1.00 0.00 ? 3  GLU A CA  13 
ATOM   6866 C  C   . GLU A 1 3  ? 13.603  -3.907  -1.464  1.00 0.00 ? 3  GLU A C   13 
ATOM   6867 O  O   . GLU A 1 3  ? 13.288  -3.421  -2.554  1.00 0.00 ? 3  GLU A O   13 
ATOM   6868 C  CB  . GLU A 1 3  ? 13.878  -2.271  0.506   1.00 0.00 ? 3  GLU A CB  13 
ATOM   6869 C  CG  . GLU A 1 3  ? 13.304  -0.963  -0.055  1.00 0.00 ? 3  GLU A CG  13 
ATOM   6870 C  CD  . GLU A 1 3  ? 14.302  0.173   -0.099  1.00 0.00 ? 3  GLU A CD  13 
ATOM   6871 O  OE1 . GLU A 1 3  ? 14.517  0.855   0.924   1.00 0.00 ? 3  GLU A OE1 13 
ATOM   6872 O  OE2 . GLU A 1 3  ? 14.976  0.363   -1.135  1.00 0.00 ? 3  GLU A OE2 13 
ATOM   6873 N  N   . PRO A 1 4  ? 13.145  -5.109  -1.076  1.00 0.00 ? 4  PRO A N   13 
ATOM   6874 C  CA  . PRO A 1 4  ? 12.331  -5.957  -1.939  1.00 0.00 ? 4  PRO A CA  13 
ATOM   6875 C  C   . PRO A 1 4  ? 10.894  -5.434  -2.057  1.00 0.00 ? 4  PRO A C   13 
ATOM   6876 O  O   . PRO A 1 4  ? 10.301  -4.986  -1.079  1.00 0.00 ? 4  PRO A O   13 
ATOM   6877 C  CB  . PRO A 1 4  ? 12.371  -7.347  -1.300  1.00 0.00 ? 4  PRO A CB  13 
ATOM   6878 C  CG  . PRO A 1 4  ? 12.567  -7.040  0.185   1.00 0.00 ? 4  PRO A CG  13 
ATOM   6879 C  CD  . PRO A 1 4  ? 13.471  -5.806  0.159   1.00 0.00 ? 4  PRO A CD  13 
ATOM   6880 N  N   . ARG A 1 5  ? 10.330  -5.518  -3.264  1.00 0.00 ? 5  ARG A N   13 
ATOM   6881 C  CA  . ARG A 1 5  ? 8.949   -5.191  -3.574  1.00 0.00 ? 5  ARG A CA  13 
ATOM   6882 C  C   . ARG A 1 5  ? 7.979   -6.088  -2.794  1.00 0.00 ? 5  ARG A C   13 
ATOM   6883 O  O   . ARG A 1 5  ? 8.149   -7.306  -2.771  1.00 0.00 ? 5  ARG A O   13 
ATOM   6884 C  CB  . ARG A 1 5  ? 8.812   -5.382  -5.085  1.00 0.00 ? 5  ARG A CB  13 
ATOM   6885 C  CG  . ARG A 1 5  ? 9.621   -4.339  -5.818  1.00 0.00 ? 5  ARG A CG  13 
ATOM   6886 C  CD  . ARG A 1 5  ? 9.785   -4.859  -7.240  1.00 0.00 ? 5  ARG A CD  13 
ATOM   6887 N  NE  . ARG A 1 5  ? 10.918  -4.160  -7.799  1.00 0.00 ? 5  ARG A NE  13 
ATOM   6888 C  CZ  . ARG A 1 5  ? 10.891  -3.330  -8.850  1.00 0.00 ? 5  ARG A CZ  13 
ATOM   6889 N  NH1 . ARG A 1 5  ? 9.912   -3.432  -9.751  1.00 0.00 ? 5  ARG A NH1 13 
ATOM   6890 N  NH2 . ARG A 1 5  ? 11.829  -2.395  -8.975  1.00 0.00 ? 5  ARG A NH2 13 
ATOM   6891 N  N   . ALA A 1 6  ? 6.977   -5.481  -2.154  1.00 0.00 ? 6  ALA A N   13 
ATOM   6892 C  CA  . ALA A 1 6  ? 5.985   -6.152  -1.333  1.00 0.00 ? 6  ALA A CA  13 
ATOM   6893 C  C   . ALA A 1 6  ? 5.181   -7.179  -2.129  1.00 0.00 ? 6  ALA A C   13 
ATOM   6894 O  O   . ALA A 1 6  ? 4.829   -6.955  -3.288  1.00 0.00 ? 6  ALA A O   13 
ATOM   6895 C  CB  . ALA A 1 6  ? 5.034   -5.110  -0.738  1.00 0.00 ? 6  ALA A CB  13 
ATOM   6896 N  N   . GLU A 1 7  ? 4.860   -8.292  -1.475  1.00 0.00 ? 7  GLU A N   13 
ATOM   6897 C  CA  . GLU A 1 7  ? 4.010   -9.325  -2.018  1.00 0.00 ? 7  GLU A CA  13 
ATOM   6898 C  C   . GLU A 1 7  ? 2.529   -9.028  -1.798  1.00 0.00 ? 7  GLU A C   13 
ATOM   6899 O  O   . GLU A 1 7  ? 2.135   -8.316  -0.871  1.00 0.00 ? 7  GLU A O   13 
ATOM   6900 C  CB  . GLU A 1 7  ? 4.446   -10.698 -1.575  1.00 0.00 ? 7  GLU A CB  13 
ATOM   6901 C  CG  . GLU A 1 7  ? 4.219   -10.942 -0.104  1.00 0.00 ? 7  GLU A CG  13 
ATOM   6902 C  CD  . GLU A 1 7  ? 5.329   -10.471 0.831   1.00 0.00 ? 7  GLU A CD  13 
ATOM   6903 O  OE1 . GLU A 1 7  ? 5.534   -9.240  0.920   1.00 0.00 ? 7  GLU A OE1 13 
ATOM   6904 O  OE2 . GLU A 1 7  ? 5.924   -11.328 1.510   1.00 0.00 ? 7  GLU A OE2 13 
ATOM   6905 N  N   . ASP A 1 8  ? 1.711   -9.608  -2.669  1.00 0.00 ? 8  ASP A N   13 
ATOM   6906 C  CA  . ASP A 1 8  ? 0.275   -9.452  -2.672  1.00 0.00 ? 8  ASP A CA  13 
ATOM   6907 C  C   . ASP A 1 8  ? -0.314  -10.109 -1.428  1.00 0.00 ? 8  ASP A C   13 
ATOM   6908 O  O   . ASP A 1 8  ? -0.530  -11.318 -1.387  1.00 0.00 ? 8  ASP A O   13 
ATOM   6909 C  CB  . ASP A 1 8  ? -0.273  -10.034 -3.971  1.00 0.00 ? 8  ASP A CB  13 
ATOM   6910 C  CG  . ASP A 1 8  ? -0.052  -9.048  -5.098  1.00 0.00 ? 8  ASP A CG  13 
ATOM   6911 O  OD1 . ASP A 1 8  ? 1.057   -9.072  -5.677  1.00 0.00 ? 8  ASP A OD1 13 
ATOM   6912 O  OD2 . ASP A 1 8  ? -0.954  -8.206  -5.287  1.00 0.00 ? 8  ASP A OD2 13 
ATOM   6913 N  N   . GLY A 1 9  ? -0.543  -9.288  -0.405  1.00 0.00 ? 9  GLY A N   13 
ATOM   6914 C  CA  . GLY A 1 9  ? -1.031  -9.709  0.895   1.00 0.00 ? 9  GLY A CA  13 
ATOM   6915 C  C   . GLY A 1 9  ? 0.106   -9.852  1.905   1.00 0.00 ? 9  GLY A C   13 
ATOM   6916 O  O   . GLY A 1 9  ? -0.060  -10.575 2.883   1.00 0.00 ? 9  GLY A O   13 
ATOM   6917 N  N   . HIS A 1 10 ? 1.226   -9.136  1.703   1.00 0.00 ? 10 HIS A N   13 
ATOM   6918 C  CA  . HIS A 1 10 ? 2.328   -9.005  2.657   1.00 0.00 ? 10 HIS A CA  13 
ATOM   6919 C  C   . HIS A 1 10 ? 1.833   -9.004  4.103   1.00 0.00 ? 10 HIS A C   13 
ATOM   6920 O  O   . HIS A 1 10 ? 2.277   -9.787  4.938   1.00 0.00 ? 10 HIS A O   13 
ATOM   6921 C  CB  . HIS A 1 10 ? 3.074   -7.691  2.385   1.00 0.00 ? 10 HIS A CB  13 
ATOM   6922 C  CG  . HIS A 1 10 ? 4.226   -7.480  3.336   1.00 0.00 ? 10 HIS A CG  13 
ATOM   6923 N  ND1 . HIS A 1 10 ? 5.429   -8.152  3.273   1.00 0.00 ? 10 HIS A ND1 13 
ATOM   6924 C  CD2 . HIS A 1 10 ? 4.223   -6.705  4.465   1.00 0.00 ? 10 HIS A CD2 13 
ATOM   6925 C  CE1 . HIS A 1 10 ? 6.150   -7.798  4.350   1.00 0.00 ? 10 HIS A CE1 13 
ATOM   6926 N  NE2 . HIS A 1 10 ? 5.440   -6.919  5.081   1.00 0.00 ? 10 HIS A NE2 13 
ATOM   6927 N  N   . ALA A 1 11 ? 0.918   -8.077  4.375   1.00 0.00 ? 11 ALA A N   13 
ATOM   6928 C  CA  . ALA A 1 11 ? 0.141   -7.997  5.594   1.00 0.00 ? 11 ALA A CA  13 
ATOM   6929 C  C   . ALA A 1 11 ? -1.071  -7.129  5.259   1.00 0.00 ? 11 ALA A C   13 
ATOM   6930 O  O   . ALA A 1 11 ? -1.114  -6.525  4.184   1.00 0.00 ? 11 ALA A O   13 
ATOM   6931 C  CB  . ALA A 1 11 ? 1.003   -7.428  6.734   1.00 0.00 ? 11 ALA A CB  13 
ATOM   6932 N  N   . HIS A 1 12 ? -2.049  -7.082  6.167   1.00 0.00 ? 12 HIS A N   13 
ATOM   6933 C  CA  . HIS A 1 12 ? -3.186  -6.166  6.125   1.00 0.00 ? 12 HIS A CA  13 
ATOM   6934 C  C   . HIS A 1 12 ? -3.812  -6.036  4.733   1.00 0.00 ? 12 HIS A C   13 
ATOM   6935 O  O   . HIS A 1 12 ? -4.089  -4.928  4.275   1.00 0.00 ? 12 HIS A O   13 
ATOM   6936 C  CB  . HIS A 1 12 ? -2.746  -4.790  6.624   1.00 0.00 ? 12 HIS A CB  13 
ATOM   6937 C  CG  . HIS A 1 12 ? -1.990  -4.801  7.925   1.00 0.00 ? 12 HIS A CG  13 
ATOM   6938 N  ND1 . HIS A 1 12 ? -2.513  -4.401  9.139   1.00 0.00 ? 12 HIS A ND1 13 
ATOM   6939 C  CD2 . HIS A 1 12 ? -0.627  -4.764  8.018   1.00 0.00 ? 12 HIS A CD2 13 
ATOM   6940 C  CE1 . HIS A 1 12 ? -1.477  -4.064  9.930   1.00 0.00 ? 12 HIS A CE1 13 
ATOM   6941 N  NE2 . HIS A 1 12 ? -0.329  -4.296  9.273   1.00 0.00 ? 12 HIS A NE2 13 
ATOM   6942 N  N   . ASP A 1 13 ? -4.040  -7.170  4.070   1.00 0.00 ? 13 ASP A N   13 
ATOM   6943 C  CA  . ASP A 1 13 ? -4.831  -7.234  2.845   1.00 0.00 ? 13 ASP A CA  13 
ATOM   6944 C  C   . ASP A 1 13 ? -4.251  -6.349  1.729   1.00 0.00 ? 13 ASP A C   13 
ATOM   6945 O  O   . ASP A 1 13 ? -4.995  -5.871  0.876   1.00 0.00 ? 13 ASP A O   13 
ATOM   6946 C  CB  . ASP A 1 13 ? -6.300  -6.882  3.136   1.00 0.00 ? 13 ASP A CB  13 
ATOM   6947 C  CG  . ASP A 1 13 ? -6.781  -7.296  4.519   1.00 0.00 ? 13 ASP A CG  13 
ATOM   6948 O  OD1 . ASP A 1 13 ? -6.681  -8.494  4.844   1.00 0.00 ? 13 ASP A OD1 13 
ATOM   6949 O  OD2 . ASP A 1 13 ? -7.261  -6.381  5.230   1.00 0.00 ? 13 ASP A OD2 13 
ATOM   6950 N  N   . TYR A 1 14 ? -2.933  -6.110  1.758   1.00 0.00 ? 14 TYR A N   13 
ATOM   6951 C  CA  . TYR A 1 14 ? -2.264  -5.078  0.977   1.00 0.00 ? 14 TYR A CA  13 
ATOM   6952 C  C   . TYR A 1 14 ? -2.652  -5.011  -0.511  1.00 0.00 ? 14 TYR A C   13 
ATOM   6953 O  O   . TYR A 1 14 ? -3.156  -3.980  -0.943  1.00 0.00 ? 14 TYR A O   13 
ATOM   6954 C  CB  . TYR A 1 14 ? -0.758  -5.122  1.281   1.00 0.00 ? 14 TYR A CB  13 
ATOM   6955 C  CG  . TYR A 1 14 ? 0.181   -4.609  0.210   1.00 0.00 ? 14 TYR A CG  13 
ATOM   6956 C  CD1 . TYR A 1 14 ? 0.646   -5.472  -0.796  1.00 0.00 ? 14 TYR A CD1 13 
ATOM   6957 C  CD2 . TYR A 1 14 ? 0.620   -3.274  0.234   1.00 0.00 ? 14 TYR A CD2 13 
ATOM   6958 C  CE1 . TYR A 1 14 ? 1.492   -4.992  -1.806  1.00 0.00 ? 14 TYR A CE1 13 
ATOM   6959 C  CE2 . TYR A 1 14 ? 1.353   -2.764  -0.847  1.00 0.00 ? 14 TYR A CE2 13 
ATOM   6960 C  CZ  . TYR A 1 14 ? 1.811   -3.625  -1.852  1.00 0.00 ? 14 TYR A CZ  13 
ATOM   6961 O  OH  . TYR A 1 14 ? 2.654   -3.146  -2.804  1.00 0.00 ? 14 TYR A OH  13 
ATOM   6962 N  N   . VAL A 1 15 ? -2.426  -6.093  -1.270  1.00 0.00 ? 15 VAL A N   13 
ATOM   6963 C  CA  . VAL A 1 15 ? -2.555  -6.185  -2.734  1.00 0.00 ? 15 VAL A CA  13 
ATOM   6964 C  C   . VAL A 1 15 ? -1.693  -5.164  -3.502  1.00 0.00 ? 15 VAL A C   13 
ATOM   6965 O  O   . VAL A 1 15 ? -1.649  -3.977  -3.186  1.00 0.00 ? 15 VAL A O   13 
ATOM   6966 C  CB  . VAL A 1 15 ? -4.023  -6.249  -3.228  1.00 0.00 ? 15 VAL A CB  13 
ATOM   6967 C  CG1 . VAL A 1 15 ? -4.704  -7.501  -2.662  1.00 0.00 ? 15 VAL A CG1 13 
ATOM   6968 C  CG2 . VAL A 1 15 ? -4.884  -5.026  -2.887  1.00 0.00 ? 15 VAL A CG2 13 
ATOM   6969 N  N   . ASN A 1 16 ? -0.958  -5.625  -4.522  1.00 0.00 ? 16 ASN A N   13 
ATOM   6970 C  CA  . ASN A 1 16 ? -0.068  -4.785  -5.294  1.00 0.00 ? 16 ASN A CA  13 
ATOM   6971 C  C   . ASN A 1 16 ? -0.813  -3.768  -6.151  1.00 0.00 ? 16 ASN A C   13 
ATOM   6972 O  O   . ASN A 1 16 ? -0.257  -2.713  -6.451  1.00 0.00 ? 16 ASN A O   13 
ATOM   6973 C  CB  . ASN A 1 16 ? 0.938   -5.590  -6.125  1.00 0.00 ? 16 ASN A CB  13 
ATOM   6974 C  CG  . ASN A 1 16 ? 2.232   -5.759  -5.350  1.00 0.00 ? 16 ASN A CG  13 
ATOM   6975 O  OD1 . ASN A 1 16 ? 2.846   -4.777  -4.955  1.00 0.00 ? 16 ASN A OD1 13 
ATOM   6976 N  ND2 . ASN A 1 16 ? 2.653   -6.982  -5.091  1.00 0.00 ? 16 ASN A ND2 13 
ATOM   6977 N  N   . GLU A 1 17 ? -2.047  -4.086  -6.552  1.00 0.00 ? 17 GLU A N   13 
ATOM   6978 C  CA  . GLU A 1 17 ? -2.947  -3.166  -7.201  1.00 0.00 ? 17 GLU A CA  13 
ATOM   6979 C  C   . GLU A 1 17 ? -4.069  -2.869  -6.219  1.00 0.00 ? 17 GLU A C   13 
ATOM   6980 O  O   . GLU A 1 17 ? -4.854  -3.756  -5.893  1.00 0.00 ? 17 GLU A O   13 
ATOM   6981 C  CB  . GLU A 1 17 ? -3.497  -3.808  -8.476  1.00 0.00 ? 17 GLU A CB  13 
ATOM   6982 C  CG  . GLU A 1 17 ? -4.131  -2.739  -9.361  1.00 0.00 ? 17 GLU A CG  13 
ATOM   6983 C  CD  . GLU A 1 17 ? -4.618  -3.279  -10.702 1.00 0.00 ? 17 GLU A CD  13 
ATOM   6984 O  OE1 . GLU A 1 17 ? -4.018  -4.267  -11.177 1.00 0.00 ? 17 GLU A OE1 13 
ATOM   6985 O  OE2 . GLU A 1 17 ? -5.570  -2.674  -11.237 1.00 0.00 ? 17 GLU A OE2 13 
ATOM   6986 N  N   . ALA A 1 18 ? -4.159  -1.614  -5.784  1.00 0.00 ? 18 ALA A N   13 
ATOM   6987 C  CA  . ALA A 1 18 ? -5.238  -1.090  -4.960  1.00 0.00 ? 18 ALA A CA  13 
ATOM   6988 C  C   . ALA A 1 18 ? -6.591  -1.606  -5.451  1.00 0.00 ? 18 ALA A C   13 
ATOM   6989 O  O   . ALA A 1 18 ? -7.416  -2.076  -4.668  1.00 0.00 ? 18 ALA A O   13 
ATOM   6990 C  CB  . ALA A 1 18 ? -5.191  0.440   -5.017  1.00 0.00 ? 18 ALA A CB  13 
ATOM   6991 N  N   . ALA A 1 19 ? -6.799  -1.535  -6.769  1.00 0.00 ? 19 ALA A N   13 
ATOM   6992 C  CA  . ALA A 1 19 ? -8.015  -1.993  -7.418  1.00 0.00 ? 19 ALA A CA  13 
ATOM   6993 C  C   . ALA A 1 19 ? -8.402  -3.419  -7.020  1.00 0.00 ? 19 ALA A C   13 
ATOM   6994 O  O   . ALA A 1 19 ? -9.595  -3.674  -6.862  1.00 0.00 ? 19 ALA A O   13 
ATOM   6995 C  CB  . ALA A 1 19 ? -7.886  -1.885  -8.936  1.00 0.00 ? 19 ALA A CB  13 
ATOM   6996 N  N   . ASP A 1 20 ? -7.439  -4.336  -6.834  1.00 0.00 ? 20 ASP A N   13 
ATOM   6997 C  CA  . ASP A 1 20 ? -7.771  -5.702  -6.423  1.00 0.00 ? 20 ASP A CA  13 
ATOM   6998 C  C   . ASP A 1 20 ? -8.678  -5.716  -5.185  1.00 0.00 ? 20 ASP A C   13 
ATOM   6999 O  O   . ASP A 1 20 ? -9.591  -6.531  -5.072  1.00 0.00 ? 20 ASP A O   13 
ATOM   7000 C  CB  . ASP A 1 20 ? -6.514  -6.532  -6.163  1.00 0.00 ? 20 ASP A CB  13 
ATOM   7001 C  CG  . ASP A 1 20 ? -6.846  -8.018  -6.139  1.00 0.00 ? 20 ASP A CG  13 
ATOM   7002 O  OD1 . ASP A 1 20 ? -7.016  -8.577  -7.243  1.00 0.00 ? 20 ASP A OD1 13 
ATOM   7003 O  OD2 . ASP A 1 20 ? -6.931  -8.567  -5.020  1.00 0.00 ? 20 ASP A OD2 13 
ATOM   7004 N  N   . ALA A 1 21 ? -8.465  -4.761  -4.273  1.00 0.00 ? 21 ALA A N   13 
ATOM   7005 C  CA  . ALA A 1 21 ? -9.208  -4.682  -3.020  1.00 0.00 ? 21 ALA A CA  13 
ATOM   7006 C  C   . ALA A 1 21 ? -10.627 -4.118  -3.189  1.00 0.00 ? 21 ALA A C   13 
ATOM   7007 O  O   . ALA A 1 21 ? -11.331 -3.966  -2.187  1.00 0.00 ? 21 ALA A O   13 
ATOM   7008 C  CB  . ALA A 1 21 ? -8.412  -3.873  -1.992  1.00 0.00 ? 21 ALA A CB  13 
ATOM   7009 N  N   . SER A 1 22 ? -11.076 -3.813  -4.413  1.00 0.00 ? 22 SER A N   13 
ATOM   7010 C  CA  . SER A 1 22 ? -12.418 -3.345  -4.682  1.00 0.00 ? 22 SER A CA  13 
ATOM   7011 C  C   . SER A 1 22 ? -13.459 -4.386  -4.281  1.00 0.00 ? 22 SER A C   13 
ATOM   7012 O  O   . SER A 1 22 ? -13.827 -5.265  -5.055  1.00 0.00 ? 22 SER A O   13 
ATOM   7013 C  CB  . SER A 1 22 ? -12.566 -2.991  -6.152  1.00 0.00 ? 22 SER A CB  13 
ATOM   7014 O  OG  . SER A 1 22 ? -11.676 -1.952  -6.500  1.00 0.00 ? 22 SER A OG  13 
ATOM   7015 N  N   . GLY A 1 23 ? -13.932 -4.240  -3.051  1.00 0.00 ? 23 GLY A N   13 
ATOM   7016 C  CA  . GLY A 1 23 ? -14.841 -5.155  -2.382  1.00 0.00 ? 23 GLY A CA  13 
ATOM   7017 C  C   . GLY A 1 23 ? -14.599 -5.142  -0.875  1.00 0.00 ? 23 GLY A C   13 
ATOM   7018 O  O   . GLY A 1 23 ? -15.534 -5.276  -0.091  1.00 0.00 ? 23 GLY A O   13 
ATOM   7019 N  N   . HIS A 1 24 ? -13.341 -4.972  -0.457  1.00 0.00 ? 24 HIS A N   13 
ATOM   7020 C  CA  . HIS A 1 24 ? -12.964 -4.921  0.946   1.00 0.00 ? 24 HIS A CA  13 
ATOM   7021 C  C   . HIS A 1 24 ? -13.639 -3.713  1.610   1.00 0.00 ? 24 HIS A C   13 
ATOM   7022 O  O   . HIS A 1 24 ? -13.258 -2.594  1.286   1.00 0.00 ? 24 HIS A O   13 
ATOM   7023 C  CB  . HIS A 1 24 ? -11.437 -4.771  1.030   1.00 0.00 ? 24 HIS A CB  13 
ATOM   7024 C  CG  . HIS A 1 24 ? -10.835 -4.937  2.405   1.00 0.00 ? 24 HIS A CG  13 
ATOM   7025 N  ND1 . HIS A 1 24 ? -11.234 -4.305  3.571   1.00 0.00 ? 24 HIS A ND1 13 
ATOM   7026 C  CD2 . HIS A 1 24 ? -9.707  -5.658  2.690   1.00 0.00 ? 24 HIS A CD2 13 
ATOM   7027 C  CE1 . HIS A 1 24 ? -10.366 -4.636  4.541   1.00 0.00 ? 24 HIS A CE1 13 
ATOM   7028 N  NE2 . HIS A 1 24 ? -9.439  -5.465  4.030   1.00 0.00 ? 24 HIS A NE2 13 
ATOM   7029 N  N   . PRO A 1 25 ? -14.548 -3.866  2.586   1.00 0.00 ? 25 PRO A N   13 
ATOM   7030 C  CA  . PRO A 1 25 ? -15.035 -2.712  3.331   1.00 0.00 ? 25 PRO A CA  13 
ATOM   7031 C  C   . PRO A 1 25 ? -13.840 -2.100  4.070   1.00 0.00 ? 25 PRO A C   13 
ATOM   7032 O  O   . PRO A 1 25 ? -13.162 -2.826  4.796   1.00 0.00 ? 25 PRO A O   13 
ATOM   7033 C  CB  . PRO A 1 25 ? -16.109 -3.261  4.275   1.00 0.00 ? 25 PRO A CB  13 
ATOM   7034 C  CG  . PRO A 1 25 ? -15.696 -4.718  4.487   1.00 0.00 ? 25 PRO A CG  13 
ATOM   7035 C  CD  . PRO A 1 25 ? -15.058 -5.107  3.150   1.00 0.00 ? 25 PRO A CD  13 
ATOM   7036 N  N   . ARG A 1 26 ? -13.525 -0.826  3.790   1.00 0.00 ? 26 ARG A N   13 
ATOM   7037 C  CA  . ARG A 1 26 ? -12.322 -0.063  4.159   1.00 0.00 ? 26 ARG A CA  13 
ATOM   7038 C  C   . ARG A 1 26 ? -11.604 0.381   2.880   1.00 0.00 ? 26 ARG A C   13 
ATOM   7039 O  O   . ARG A 1 26 ? -11.118 1.512   2.811   1.00 0.00 ? 26 ARG A O   13 
ATOM   7040 C  CB  . ARG A 1 26 ? -11.383 -0.789  5.146   1.00 0.00 ? 26 ARG A CB  13 
ATOM   7041 C  CG  . ARG A 1 26 ? -10.098 -0.063  5.563   1.00 0.00 ? 26 ARG A CG  13 
ATOM   7042 C  CD  . ARG A 1 26 ? -10.311 1.352   6.118   1.00 0.00 ? 26 ARG A CD  13 
ATOM   7043 N  NE  . ARG A 1 26 ? -9.058  1.907   6.666   1.00 0.00 ? 26 ARG A NE  13 
ATOM   7044 C  CZ  . ARG A 1 26 ? -8.546  1.637   7.878   1.00 0.00 ? 26 ARG A CZ  13 
ATOM   7045 N  NH1 . ARG A 1 26 ? -9.160  0.764   8.684   1.00 0.00 ? 26 ARG A NH1 13 
ATOM   7046 N  NH2 . ARG A 1 26 ? -7.427  2.244   8.280   1.00 0.00 ? 26 ARG A NH2 13 
ATOM   7047 N  N   . TYR A 1 27 ? -11.552 -0.478  1.851   1.00 0.00 ? 27 TYR A N   13 
ATOM   7048 C  CA  . TYR A 1 27 ? -11.149 -0.008  0.537   1.00 0.00 ? 27 TYR A CA  13 
ATOM   7049 C  C   . TYR A 1 27 ? -12.182 0.997   0.049   1.00 0.00 ? 27 TYR A C   13 
ATOM   7050 O  O   . TYR A 1 27 ? -13.379 0.839   0.281   1.00 0.00 ? 27 TYR A O   13 
ATOM   7051 C  CB  . TYR A 1 27 ? -10.968 -1.142  -0.483  1.00 0.00 ? 27 TYR A CB  13 
ATOM   7052 C  CG  . TYR A 1 27 ? -10.408 -0.631  -1.801  1.00 0.00 ? 27 TYR A CG  13 
ATOM   7053 C  CD1 . TYR A 1 27 ? -9.059  -0.249  -1.855  1.00 0.00 ? 27 TYR A CD1 13 
ATOM   7054 C  CD2 . TYR A 1 27 ? -11.267 -0.275  -2.858  1.00 0.00 ? 27 TYR A CD2 13 
ATOM   7055 C  CE1 . TYR A 1 27 ? -8.589  0.564   -2.898  1.00 0.00 ? 27 TYR A CE1 13 
ATOM   7056 C  CE2 . TYR A 1 27 ? -10.781 0.478   -3.943  1.00 0.00 ? 27 TYR A CE2 13 
ATOM   7057 C  CZ  . TYR A 1 27 ? -9.451  0.933   -3.945  1.00 0.00 ? 27 TYR A CZ  13 
ATOM   7058 O  OH  . TYR A 1 27 ? -9.022  1.815   -4.900  1.00 0.00 ? 27 TYR A OH  13 
ATOM   7059 N  N   . GLN A 1 28 ? -11.685 2.030   -0.621  1.00 0.00 ? 28 GLN A N   13 
ATOM   7060 C  CA  . GLN A 1 28 ? -12.481 3.040   -1.278  1.00 0.00 ? 28 GLN A CA  13 
ATOM   7061 C  C   . GLN A 1 28 ? -11.735 3.449   -2.542  1.00 0.00 ? 28 GLN A C   13 
ATOM   7062 O  O   . GLN A 1 28 ? -10.503 3.404   -2.596  1.00 0.00 ? 28 GLN A O   13 
ATOM   7063 C  CB  . GLN A 1 28 ? -12.700 4.223   -0.329  1.00 0.00 ? 28 GLN A CB  13 
ATOM   7064 C  CG  . GLN A 1 28 ? -13.971 5.020   -0.629  1.00 0.00 ? 28 GLN A CG  13 
ATOM   7065 C  CD  . GLN A 1 28 ? -15.237 4.265   -0.226  1.00 0.00 ? 28 GLN A CD  13 
ATOM   7066 O  OE1 . GLN A 1 28 ? -15.562 4.187   0.953   1.00 0.00 ? 28 GLN A OE1 13 
ATOM   7067 N  NE2 . GLN A 1 28 ? -15.969 3.715   -1.187  1.00 0.00 ? 28 GLN A NE2 13 
ATOM   7068 N  N   . GLU A 1 29 ? -12.504 3.805   -3.562  1.00 0.00 ? 29 GLU A N   13 
ATOM   7069 C  CA  . GLU A 1 29 ? -12.048 4.040   -4.913  1.00 0.00 ? 29 GLU A CA  13 
ATOM   7070 C  C   . GLU A 1 29 ? -10.943 5.092   -4.936  1.00 0.00 ? 29 GLU A C   13 
ATOM   7071 O  O   . GLU A 1 29 ? -11.161 6.244   -4.566  1.00 0.00 ? 29 GLU A O   13 
ATOM   7072 C  CB  . GLU A 1 29 ? -13.239 4.445   -5.795  1.00 0.00 ? 29 GLU A CB  13 
ATOM   7073 C  CG  . GLU A 1 29 ? -14.324 3.354   -5.891  1.00 0.00 ? 29 GLU A CG  13 
ATOM   7074 C  CD  . GLU A 1 29 ? -15.433 3.450   -4.843  1.00 0.00 ? 29 GLU A CD  13 
ATOM   7075 O  OE1 . GLU A 1 29 ? -15.145 3.935   -3.726  1.00 0.00 ? 29 GLU A OE1 13 
ATOM   7076 O  OE2 . GLU A 1 29 ? -16.558 3.020   -5.167  1.00 0.00 ? 29 GLU A OE2 13 
ATOM   7077 N  N   . GLY A 1 30 ? -9.753  4.686   -5.380  1.00 0.00 ? 30 GLY A N   13 
ATOM   7078 C  CA  . GLY A 1 30 ? -8.629  5.590   -5.554  1.00 0.00 ? 30 GLY A CA  13 
ATOM   7079 C  C   . GLY A 1 30 ? -7.783  5.715   -4.290  1.00 0.00 ? 30 GLY A C   13 
ATOM   7080 O  O   . GLY A 1 30 ? -6.850  6.515   -4.258  1.00 0.00 ? 30 GLY A O   13 
ATOM   7081 N  N   . GLN A 1 31 ? -8.043  4.912   -3.253  1.00 0.00 ? 31 GLN A N   13 
ATOM   7082 C  CA  . GLN A 1 31 ? -7.093  4.814   -2.162  1.00 0.00 ? 31 GLN A CA  13 
ATOM   7083 C  C   . GLN A 1 31 ? -5.875  4.018   -2.647  1.00 0.00 ? 31 GLN A C   13 
ATOM   7084 O  O   . GLN A 1 31 ? -5.865  2.793   -2.563  1.00 0.00 ? 31 GLN A O   13 
ATOM   7085 C  CB  . GLN A 1 31 ? -7.770  4.155   -0.953  1.00 0.00 ? 31 GLN A CB  13 
ATOM   7086 C  CG  . GLN A 1 31 ? -8.869  5.046   -0.350  1.00 0.00 ? 31 GLN A CG  13 
ATOM   7087 C  CD  . GLN A 1 31 ? -9.521  4.464   0.910   1.00 0.00 ? 31 GLN A CD  13 
ATOM   7088 O  OE1 . GLN A 1 31 ? -10.033 5.205   1.741   1.00 0.00 ? 31 GLN A OE1 13 
ATOM   7089 N  NE2 . GLN A 1 31 ? -9.530  3.143   1.073   1.00 0.00 ? 31 GLN A NE2 13 
ATOM   7090 N  N   . LEU A 1 32 ? -4.866  4.714   -3.177  1.00 0.00 ? 32 LEU A N   13 
ATOM   7091 C  CA  . LEU A 1 32 ? -3.548  4.170   -3.489  1.00 0.00 ? 32 LEU A CA  13 
ATOM   7092 C  C   . LEU A 1 32 ? -2.599  4.455   -2.316  1.00 0.00 ? 32 LEU A C   13 
ATOM   7093 O  O   . LEU A 1 32 ? -2.754  5.483   -1.659  1.00 0.00 ? 32 LEU A O   13 
ATOM   7094 C  CB  . LEU A 1 32 ? -3.006  4.851   -4.756  1.00 0.00 ? 32 LEU A CB  13 
ATOM   7095 C  CG  . LEU A 1 32 ? -3.339  4.128   -6.070  1.00 0.00 ? 32 LEU A CG  13 
ATOM   7096 C  CD1 . LEU A 1 32 ? -4.815  4.141   -6.455  1.00 0.00 ? 32 LEU A CD1 13 
ATOM   7097 C  CD2 . LEU A 1 32 ? -2.552  4.781   -7.215  1.00 0.00 ? 32 LEU A CD2 13 
ATOM   7098 N  N   . CYS A 1 33 ? -1.601  3.597   -2.078  1.00 0.00 ? 33 CYS A N   13 
ATOM   7099 C  CA  . CYS A 1 33 ? -0.528  3.808   -1.104  1.00 0.00 ? 33 CYS A CA  13 
ATOM   7100 C  C   . CYS A 1 33 ? 0.043   5.222   -1.228  1.00 0.00 ? 33 CYS A C   13 
ATOM   7101 O  O   . CYS A 1 33 ? 0.227   5.905   -0.230  1.00 0.00 ? 33 CYS A O   13 
ATOM   7102 C  CB  . CYS A 1 33 ? 0.581   2.796   -1.291  1.00 0.00 ? 33 CYS A CB  13 
ATOM   7103 S  SG  . CYS A 1 33 ? 0.343   1.264   -0.345  1.00 0.00 ? 33 CYS A SG  13 
ATOM   7104 N  N   . GLU A 1 34 ? 0.305   5.706   -2.442  1.00 0.00 ? 34 GLU A N   13 
ATOM   7105 C  CA  . GLU A 1 34 ? 0.871   7.042   -2.583  1.00 0.00 ? 34 GLU A CA  13 
ATOM   7106 C  C   . GLU A 1 34 ? -0.046  8.175   -2.065  1.00 0.00 ? 34 GLU A C   13 
ATOM   7107 O  O   . GLU A 1 34 ? 0.427   9.293   -1.875  1.00 0.00 ? 34 GLU A O   13 
ATOM   7108 C  CB  . GLU A 1 34 ? 1.409   7.237   -4.001  1.00 0.00 ? 34 GLU A CB  13 
ATOM   7109 C  CG  . GLU A 1 34 ? 0.322   7.310   -5.080  1.00 0.00 ? 34 GLU A CG  13 
ATOM   7110 C  CD  . GLU A 1 34 ? 0.901   7.473   -6.485  1.00 0.00 ? 34 GLU A CD  13 
ATOM   7111 O  OE1 . GLU A 1 34 ? 2.114   7.760   -6.581  1.00 0.00 ? 34 GLU A OE1 13 
ATOM   7112 O  OE2 . GLU A 1 34 ? 0.113   7.307   -7.440  1.00 0.00 ? 34 GLU A OE2 13 
ATOM   7113 N  N   . ASN A 1 35 ? -1.329  7.893   -1.789  1.00 0.00 ? 35 ASN A N   13 
ATOM   7114 C  CA  . ASN A 1 35 ? -2.285  8.833   -1.191  1.00 0.00 ? 35 ASN A CA  13 
ATOM   7115 C  C   . ASN A 1 35 ? -2.426  8.622   0.325   1.00 0.00 ? 35 ASN A C   13 
ATOM   7116 O  O   . ASN A 1 35 ? -3.281  9.249   0.956   1.00 0.00 ? 35 ASN A O   13 
ATOM   7117 C  CB  . ASN A 1 35 ? -3.676  8.648   -1.820  1.00 0.00 ? 35 ASN A CB  13 
ATOM   7118 C  CG  . ASN A 1 35 ? -3.707  8.758   -3.333  1.00 0.00 ? 35 ASN A CG  13 
ATOM   7119 O  OD1 . ASN A 1 35 ? -2.848  9.373   -3.955  1.00 0.00 ? 35 ASN A OD1 13 
ATOM   7120 N  ND2 . ASN A 1 35 ? -4.715  8.149   -3.948  1.00 0.00 ? 35 ASN A ND2 13 
ATOM   7121 N  N   . CYS A 1 36 ? -1.659  7.693   0.898   1.00 0.00 ? 36 CYS A N   13 
ATOM   7122 C  CA  . CYS A 1 36 ? -1.786  7.247   2.276   1.00 0.00 ? 36 CYS A CA  13 
ATOM   7123 C  C   . CYS A 1 36 ? -1.026  8.196   3.198   1.00 0.00 ? 36 CYS A C   13 
ATOM   7124 O  O   . CYS A 1 36 ? 0.115   8.565   2.925   1.00 0.00 ? 36 CYS A O   13 
ATOM   7125 C  CB  . CYS A 1 36 ? -1.209  5.861   2.341   1.00 0.00 ? 36 CYS A CB  13 
ATOM   7126 S  SG  . CYS A 1 36 ? -1.478  5.007   3.890   1.00 0.00 ? 36 CYS A SG  13 
ATOM   7127 N  N   . ALA A 1 37 ? -1.631  8.574   4.321   1.00 0.00 ? 37 ALA A N   13 
ATOM   7128 C  CA  . ALA A 1 37 ? -0.998  9.444   5.302   1.00 0.00 ? 37 ALA A CA  13 
ATOM   7129 C  C   . ALA A 1 37 ? 0.250   8.812   5.925   1.00 0.00 ? 37 ALA A C   13 
ATOM   7130 O  O   . ALA A 1 37 ? 1.051   9.524   6.526   1.00 0.00 ? 37 ALA A O   13 
ATOM   7131 C  CB  . ALA A 1 37 ? -2.031  9.843   6.353   1.00 0.00 ? 37 ALA A CB  13 
ATOM   7132 N  N   . PHE A 1 38 ? 0.431   7.493   5.785   1.00 0.00 ? 38 PHE A N   13 
ATOM   7133 C  CA  . PHE A 1 38 ? 1.634   6.805   6.232   1.00 0.00 ? 38 PHE A CA  13 
ATOM   7134 C  C   . PHE A 1 38 ? 2.665   6.645   5.111   1.00 0.00 ? 38 PHE A C   13 
ATOM   7135 O  O   . PHE A 1 38 ? 3.731   6.086   5.365   1.00 0.00 ? 38 PHE A O   13 
ATOM   7136 C  CB  . PHE A 1 38 ? 1.259   5.450   6.846   1.00 0.00 ? 38 PHE A CB  13 
ATOM   7137 C  CG  . PHE A 1 38 ? 0.224   5.530   7.957   1.00 0.00 ? 38 PHE A CG  13 
ATOM   7138 C  CD1 . PHE A 1 38 ? 0.414   6.420   9.033   1.00 0.00 ? 38 PHE A CD1 13 
ATOM   7139 C  CD2 . PHE A 1 38 ? -0.962  4.774   7.882   1.00 0.00 ? 38 PHE A CD2 13 
ATOM   7140 C  CE1 . PHE A 1 38 ? -0.591  6.579   10.005  1.00 0.00 ? 38 PHE A CE1 13 
ATOM   7141 C  CE2 . PHE A 1 38 ? -1.961  4.925   8.860   1.00 0.00 ? 38 PHE A CE2 13 
ATOM   7142 C  CZ  . PHE A 1 38 ? -1.778  5.832   9.918   1.00 0.00 ? 38 PHE A CZ  13 
ATOM   7143 N  N   . TRP A 1 39 ? 2.392   7.121   3.892   1.00 0.00 ? 39 TRP A N   13 
ATOM   7144 C  CA  . TRP A 1 39 ? 3.359   7.058   2.805   1.00 0.00 ? 39 TRP A CA  13 
ATOM   7145 C  C   . TRP A 1 39 ? 4.677   7.729   3.209   1.00 0.00 ? 39 TRP A C   13 
ATOM   7146 O  O   . TRP A 1 39 ? 4.670   8.770   3.864   1.00 0.00 ? 39 TRP A O   13 
ATOM   7147 C  CB  . TRP A 1 39 ? 2.775   7.743   1.567   1.00 0.00 ? 39 TRP A CB  13 
ATOM   7148 C  CG  . TRP A 1 39 ? 3.660   7.742   0.361   1.00 0.00 ? 39 TRP A CG  13 
ATOM   7149 C  CD1 . TRP A 1 39 ? 4.312   8.819   -0.132  1.00 0.00 ? 39 TRP A CD1 13 
ATOM   7150 C  CD2 . TRP A 1 39 ? 4.006   6.628   -0.515  1.00 0.00 ? 39 TRP A CD2 13 
ATOM   7151 N  NE1 . TRP A 1 39 ? 5.014   8.457   -1.261  1.00 0.00 ? 39 TRP A NE1 13 
ATOM   7152 C  CE2 . TRP A 1 39 ? 4.865   7.118   -1.543  1.00 0.00 ? 39 TRP A CE2 13 
ATOM   7153 C  CE3 . TRP A 1 39 ? 3.665   5.261   -0.565  1.00 0.00 ? 39 TRP A CE3 13 
ATOM   7154 C  CZ2 . TRP A 1 39 ? 5.362   6.296   -2.561  1.00 0.00 ? 39 TRP A CZ2 13 
ATOM   7155 C  CZ3 . TRP A 1 39 ? 4.152   4.428   -1.589  1.00 0.00 ? 39 TRP A CZ3 13 
ATOM   7156 C  CH2 . TRP A 1 39 ? 5.005   4.941   -2.580  1.00 0.00 ? 39 TRP A CH2 13 
ATOM   7157 N  N   . GLY A 1 40 ? 5.802   7.132   2.815   1.00 0.00 ? 40 GLY A N   13 
ATOM   7158 C  CA  . GLY A 1 40 ? 7.124   7.713   2.975   1.00 0.00 ? 40 GLY A CA  13 
ATOM   7159 C  C   . GLY A 1 40 ? 7.455   8.553   1.745   1.00 0.00 ? 40 GLY A C   13 
ATOM   7160 O  O   . GLY A 1 40 ? 6.985   9.680   1.609   1.00 0.00 ? 40 GLY A O   13 
ATOM   7161 N  N   . GLU A 1 41 ? 8.248   7.978   0.839   1.00 0.00 ? 41 GLU A N   13 
ATOM   7162 C  CA  . GLU A 1 41 ? 8.661   8.567   -0.423  1.00 0.00 ? 41 GLU A CA  13 
ATOM   7163 C  C   . GLU A 1 41 ? 8.767   7.439   -1.438  1.00 0.00 ? 41 GLU A C   13 
ATOM   7164 O  O   . GLU A 1 41 ? 8.988   6.282   -1.063  1.00 0.00 ? 41 GLU A O   13 
ATOM   7165 C  CB  . GLU A 1 41 ? 10.027  9.255   -0.284  1.00 0.00 ? 41 GLU A CB  13 
ATOM   7166 C  CG  . GLU A 1 41 ? 9.916   10.673  0.286   1.00 0.00 ? 41 GLU A CG  13 
ATOM   7167 C  CD  . GLU A 1 41 ? 11.285  11.337  0.342   1.00 0.00 ? 41 GLU A CD  13 
ATOM   7168 O  OE1 . GLU A 1 41 ? 12.144  10.792  1.068   1.00 0.00 ? 41 GLU A OE1 13 
ATOM   7169 O  OE2 . GLU A 1 41 ? 11.453  12.359  -0.355  1.00 0.00 ? 41 GLU A OE2 13 
ATOM   7170 N  N   . ALA A 1 42 ? 8.633   7.791   -2.720  1.00 0.00 ? 42 ALA A N   13 
ATOM   7171 C  CA  . ALA A 1 42 ? 8.902   6.880   -3.815  1.00 0.00 ? 42 ALA A CA  13 
ATOM   7172 C  C   . ALA A 1 42 ? 10.404  6.641   -3.923  1.00 0.00 ? 42 ALA A C   13 
ATOM   7173 O  O   . ALA A 1 42 ? 11.205  7.531   -3.645  1.00 0.00 ? 42 ALA A O   13 
ATOM   7174 C  CB  . ALA A 1 42 ? 8.334   7.430   -5.125  1.00 0.00 ? 42 ALA A CB  13 
ATOM   7175 N  N   . VAL A 1 43 ? 10.768  5.421   -4.311  1.00 0.00 ? 43 VAL A N   13 
ATOM   7176 C  CA  . VAL A 1 43 ? 12.135  4.934   -4.378  1.00 0.00 ? 43 VAL A CA  13 
ATOM   7177 C  C   . VAL A 1 43 ? 12.437  4.452   -5.800  1.00 0.00 ? 43 VAL A C   13 
ATOM   7178 O  O   . VAL A 1 43 ? 13.506  4.738   -6.332  1.00 0.00 ? 43 VAL A O   13 
ATOM   7179 C  CB  . VAL A 1 43 ? 12.309  3.800   -3.354  1.00 0.00 ? 43 VAL A CB  13 
ATOM   7180 C  CG1 . VAL A 1 43 ? 13.751  3.279   -3.333  1.00 0.00 ? 43 VAL A CG1 13 
ATOM   7181 C  CG2 . VAL A 1 43 ? 11.928  4.233   -1.929  1.00 0.00 ? 43 VAL A CG2 13 
ATOM   7182 N  N   . GLN A 1 44 ? 11.517  3.689   -6.402  1.00 0.00 ? 44 GLN A N   13 
ATOM   7183 C  CA  . GLN A 1 44 ? 11.690  3.082   -7.714  1.00 0.00 ? 44 GLN A CA  13 
ATOM   7184 C  C   . GLN A 1 44 ? 10.335  2.995   -8.430  1.00 0.00 ? 44 GLN A C   13 
ATOM   7185 O  O   . GLN A 1 44 ? 9.404   3.683   -8.012  1.00 0.00 ? 44 GLN A O   13 
ATOM   7186 C  CB  . GLN A 1 44 ? 12.484  1.775   -7.560  1.00 0.00 ? 44 GLN A CB  13 
ATOM   7187 C  CG  . GLN A 1 44 ? 11.786  0.734   -6.684  1.00 0.00 ? 44 GLN A CG  13 
ATOM   7188 C  CD  . GLN A 1 44 ? 12.738  -0.349  -6.177  1.00 0.00 ? 44 GLN A CD  13 
ATOM   7189 O  OE1 . GLN A 1 44 ? 12.749  -1.469  -6.681  1.00 0.00 ? 44 GLN A OE1 13 
ATOM   7190 N  NE2 . GLN A 1 44 ? 13.535  -0.040  -5.160  1.00 0.00 ? 44 GLN A NE2 13 
ATOM   7191 N  N   . ASP A 1 45 ? 10.233  2.202   -9.506  1.00 0.00 ? 45 ASP A N   13 
ATOM   7192 C  CA  . ASP A 1 45 ? 9.195   2.156   -10.547 1.00 0.00 ? 45 ASP A CA  13 
ATOM   7193 C  C   . ASP A 1 45 ? 7.760   2.048   -10.021 1.00 0.00 ? 45 ASP A C   13 
ATOM   7194 O  O   . ASP A 1 45 ? 7.077   1.033   -10.151 1.00 0.00 ? 45 ASP A O   13 
ATOM   7195 C  CB  . ASP A 1 45 ? 9.522   1.036   -11.553 1.00 0.00 ? 45 ASP A CB  13 
ATOM   7196 C  CG  . ASP A 1 45 ? 9.865   -0.275  -10.867 1.00 0.00 ? 45 ASP A CG  13 
ATOM   7197 O  OD1 . ASP A 1 45 ? 10.955  -0.301  -10.253 1.00 0.00 ? 45 ASP A OD1 13 
ATOM   7198 O  OD2 . ASP A 1 45 ? 9.074   -1.242  -10.925 1.00 0.00 ? 45 ASP A OD2 13 
ATOM   7199 N  N   . GLY A 1 46 ? 7.299   3.149   -9.444  1.00 0.00 ? 46 GLY A N   13 
ATOM   7200 C  CA  . GLY A 1 46 ? 6.026   3.226   -8.759  1.00 0.00 ? 46 GLY A CA  13 
ATOM   7201 C  C   . GLY A 1 46 ? 6.062   2.351   -7.513  1.00 0.00 ? 46 GLY A C   13 
ATOM   7202 O  O   . GLY A 1 46 ? 5.099   1.649   -7.232  1.00 0.00 ? 46 GLY A O   13 
ATOM   7203 N  N   . TRP A 1 47 ? 7.163   2.381   -6.757  1.00 0.00 ? 47 TRP A N   13 
ATOM   7204 C  CA  . TRP A 1 47 ? 7.311   1.747   -5.469  1.00 0.00 ? 47 TRP A CA  13 
ATOM   7205 C  C   . TRP A 1 47 ? 7.943   2.734   -4.505  1.00 0.00 ? 47 TRP A C   13 
ATOM   7206 O  O   . TRP A 1 47 ? 8.845   3.478   -4.903  1.00 0.00 ? 47 TRP A O   13 
ATOM   7207 C  CB  . TRP A 1 47 ? 8.249   0.560   -5.588  1.00 0.00 ? 47 TRP A CB  13 
ATOM   7208 C  CG  . TRP A 1 47 ? 7.858   -0.544  -6.505  1.00 0.00 ? 47 TRP A CG  13 
ATOM   7209 C  CD1 . TRP A 1 47 ? 8.170   -0.636  -7.813  1.00 0.00 ? 47 TRP A CD1 13 
ATOM   7210 C  CD2 . TRP A 1 47 ? 7.107   -1.740  -6.186  1.00 0.00 ? 47 TRP A CD2 13 
ATOM   7211 N  NE1 . TRP A 1 47 ? 7.615   -1.780  -8.341  1.00 0.00 ? 47 TRP A NE1 13 
ATOM   7212 C  CE2 . TRP A 1 47 ? 6.931   -2.499  -7.378  1.00 0.00 ? 47 TRP A CE2 13 
ATOM   7213 C  CE3 . TRP A 1 47 ? 6.599   -2.279  -4.990  1.00 0.00 ? 47 TRP A CE3 13 
ATOM   7214 C  CZ2 . TRP A 1 47 ? 6.204   -3.699  -7.387  1.00 0.00 ? 47 TRP A CZ2 13 
ATOM   7215 C  CZ3 . TRP A 1 47 ? 5.820   -3.448  -4.999  1.00 0.00 ? 47 TRP A CZ3 13 
ATOM   7216 C  CH2 . TRP A 1 47 ? 5.564   -4.113  -6.210  1.00 0.00 ? 47 TRP A CH2 13 
ATOM   7217 N  N   . GLY A 1 48 ? 7.511   2.710   -3.245  1.00 0.00 ? 48 GLY A N   13 
ATOM   7218 C  CA  . GLY A 1 48 ? 8.015   3.592   -2.221  1.00 0.00 ? 48 GLY A CA  13 
ATOM   7219 C  C   . GLY A 1 48 ? 7.827   3.040   -0.818  1.00 0.00 ? 48 GLY A C   13 
ATOM   7220 O  O   . GLY A 1 48 ? 7.246   1.976   -0.603  1.00 0.00 ? 48 GLY A O   13 
ATOM   7221 N  N   . ARG A 1 49 ? 8.407   3.768   0.129   1.00 0.00 ? 49 ARG A N   13 
ATOM   7222 C  CA  . ARG A 1 49 ? 8.393   3.486   1.539   1.00 0.00 ? 49 ARG A CA  13 
ATOM   7223 C  C   . ARG A 1 49 ? 7.039   3.802   2.182   1.00 0.00 ? 49 ARG A C   13 
ATOM   7224 O  O   . ARG A 1 49 ? 6.311   4.662   1.685   1.00 0.00 ? 49 ARG A O   13 
ATOM   7225 C  CB  . ARG A 1 49 ? 9.555   4.286   2.129   1.00 0.00 ? 49 ARG A CB  13 
ATOM   7226 C  CG  . ARG A 1 49 ? 10.875  3.608   1.736   1.00 0.00 ? 49 ARG A CG  13 
ATOM   7227 C  CD  . ARG A 1 49 ? 11.069  2.428   2.678   1.00 0.00 ? 49 ARG A CD  13 
ATOM   7228 N  NE  . ARG A 1 49 ? 12.297  1.632   2.509   1.00 0.00 ? 49 ARG A NE  13 
ATOM   7229 C  CZ  . ARG A 1 49 ? 12.513  0.564   3.296   1.00 0.00 ? 49 ARG A CZ  13 
ATOM   7230 N  NH1 . ARG A 1 49 ? 11.612  0.237   4.217   1.00 0.00 ? 49 ARG A NH1 13 
ATOM   7231 N  NH2 . ARG A 1 49 ? 13.615  -0.169  3.156   1.00 0.00 ? 49 ARG A NH2 13 
ATOM   7232 N  N   . CYS A 1 50 ? 6.720   3.112   3.284   1.00 0.00 ? 50 CYS A N   13 
ATOM   7233 C  CA  . CYS A 1 50 ? 5.482   3.266   4.042   1.00 0.00 ? 50 CYS A CA  13 
ATOM   7234 C  C   . CYS A 1 50 ? 5.816   3.150   5.531   1.00 0.00 ? 50 CYS A C   13 
ATOM   7235 O  O   . CYS A 1 50 ? 6.337   2.136   5.982   1.00 0.00 ? 50 CYS A O   13 
ATOM   7236 C  CB  . CYS A 1 50 ? 4.462   2.255   3.581   1.00 0.00 ? 50 CYS A CB  13 
ATOM   7237 S  SG  . CYS A 1 50 ? 3.181   2.042   4.833   1.00 0.00 ? 50 CYS A SG  13 
ATOM   7238 N  N   . THR A 1 51 ? 5.572   4.217   6.292   1.00 0.00 ? 51 THR A N   13 
ATOM   7239 C  CA  . THR A 1 51 ? 6.104   4.411   7.633   1.00 0.00 ? 51 THR A CA  13 
ATOM   7240 C  C   . THR A 1 51 ? 5.342   3.581   8.676   1.00 0.00 ? 51 THR A C   13 
ATOM   7241 O  O   . THR A 1 51 ? 4.697   4.122   9.575   1.00 0.00 ? 51 THR A O   13 
ATOM   7242 C  CB  . THR A 1 51 ? 6.111   5.920   7.954   1.00 0.00 ? 51 THR A CB  13 
ATOM   7243 O  OG1 . THR A 1 51 ? 4.824   6.491   7.830   1.00 0.00 ? 51 THR A OG1 13 
ATOM   7244 C  CG2 . THR A 1 51 ? 7.053   6.687   7.017   1.00 0.00 ? 51 THR A CG2 13 
ATOM   7245 N  N   . HIS A 1 52 ? 5.406   2.251   8.577   1.00 0.00 ? 52 HIS A N   13 
ATOM   7246 C  CA  . HIS A 1 52 ? 4.813   1.307   9.524   1.00 0.00 ? 52 HIS A CA  13 
ATOM   7247 C  C   . HIS A 1 52 ? 5.752   0.107   9.651   1.00 0.00 ? 52 HIS A C   13 
ATOM   7248 O  O   . HIS A 1 52 ? 6.097   -0.460  8.624   1.00 0.00 ? 52 HIS A O   13 
ATOM   7249 C  CB  . HIS A 1 52 ? 3.446   0.840   8.995   1.00 0.00 ? 52 HIS A CB  13 
ATOM   7250 C  CG  . HIS A 1 52 ? 2.272   1.609   9.542   1.00 0.00 ? 52 HIS A CG  13 
ATOM   7251 N  ND1 . HIS A 1 52 ? 2.232   2.966   9.796   1.00 0.00 ? 52 HIS A ND1 13 
ATOM   7252 C  CD2 . HIS A 1 52 ? 1.070   1.071   9.907   1.00 0.00 ? 52 HIS A CD2 13 
ATOM   7253 C  CE1 . HIS A 1 52 ? 1.020   3.252   10.297  1.00 0.00 ? 52 HIS A CE1 13 
ATOM   7254 N  NE2 . HIS A 1 52 ? 0.292   2.121   10.361  1.00 0.00 ? 52 HIS A NE2 13 
ATOM   7255 N  N   . PRO A 1 53 ? 6.172   -0.308  10.860  1.00 0.00 ? 53 PRO A N   13 
ATOM   7256 C  CA  . PRO A 1 53 ? 7.114   -1.411  11.017  1.00 0.00 ? 53 PRO A CA  13 
ATOM   7257 C  C   . PRO A 1 53 ? 6.565   -2.690  10.378  1.00 0.00 ? 53 PRO A C   13 
ATOM   7258 O  O   . PRO A 1 53 ? 7.277   -3.389  9.661   1.00 0.00 ? 53 PRO A O   13 
ATOM   7259 C  CB  . PRO A 1 53 ? 7.342   -1.551  12.526  1.00 0.00 ? 53 PRO A CB  13 
ATOM   7260 C  CG  . PRO A 1 53 ? 6.084   -0.944  13.145  1.00 0.00 ? 53 PRO A CG  13 
ATOM   7261 C  CD  . PRO A 1 53 ? 5.705   0.159   12.155  1.00 0.00 ? 53 PRO A CD  13 
ATOM   7262 N  N   . ASP A 1 54 ? 5.273   -2.947  10.574  1.00 0.00 ? 54 ASP A N   13 
ATOM   7263 C  CA  . ASP A 1 54 ? 4.468   -3.996  9.960   1.00 0.00 ? 54 ASP A CA  13 
ATOM   7264 C  C   . ASP A 1 54 ? 4.236   -3.756  8.460   1.00 0.00 ? 54 ASP A C   13 
ATOM   7265 O  O   . ASP A 1 54 ? 3.136   -4.013  7.971   1.00 0.00 ? 54 ASP A O   13 
ATOM   7266 C  CB  . ASP A 1 54 ? 3.112   -4.022  10.698  1.00 0.00 ? 54 ASP A CB  13 
ATOM   7267 C  CG  . ASP A 1 54 ? 2.434   -2.646  10.705  1.00 0.00 ? 54 ASP A CG  13 
ATOM   7268 O  OD1 . ASP A 1 54 ? 3.056   -1.694  11.229  1.00 0.00 ? 54 ASP A OD1 13 
ATOM   7269 O  OD2 . ASP A 1 54 ? 1.298   -2.555  10.193  1.00 0.00 ? 54 ASP A OD2 13 
ATOM   7270 N  N   . PHE A 1 55 ? 5.241   -3.259  7.732   1.00 0.00 ? 55 PHE A N   13 
ATOM   7271 C  CA  . PHE A 1 55 ? 5.104   -2.829  6.344   1.00 0.00 ? 55 PHE A CA  13 
ATOM   7272 C  C   . PHE A 1 55 ? 6.437   -2.380  5.733   1.00 0.00 ? 55 PHE A C   13 
ATOM   7273 O  O   . PHE A 1 55 ? 6.659   -2.594  4.544   1.00 0.00 ? 55 PHE A O   13 
ATOM   7274 C  CB  . PHE A 1 55 ? 4.035   -1.718  6.211   1.00 0.00 ? 55 PHE A CB  13 
ATOM   7275 C  CG  . PHE A 1 55 ? 2.726   -2.197  5.610   1.00 0.00 ? 55 PHE A CG  13 
ATOM   7276 C  CD1 . PHE A 1 55 ? 2.788   -2.879  4.380   1.00 0.00 ? 55 PHE A CD1 13 
ATOM   7277 C  CD2 . PHE A 1 55 ? 1.482   -2.066  6.277   1.00 0.00 ? 55 PHE A CD2 13 
ATOM   7278 C  CE1 . PHE A 1 55 ? 1.680   -3.599  3.912   1.00 0.00 ? 55 PHE A CE1 13 
ATOM   7279 C  CE2 . PHE A 1 55 ? 0.368   -2.751  5.772   1.00 0.00 ? 55 PHE A CE2 13 
ATOM   7280 C  CZ  . PHE A 1 55 ? 0.488   -3.582  4.649   1.00 0.00 ? 55 PHE A CZ  13 
ATOM   7281 N  N   . ASP A 1 56 ? 7.294   -1.723  6.520   1.00 0.00 ? 56 ASP A N   13 
ATOM   7282 C  CA  . ASP A 1 56 ? 8.494   -1.042  6.039   1.00 0.00 ? 56 ASP A CA  13 
ATOM   7283 C  C   . ASP A 1 56 ? 9.726   -1.960  6.036   1.00 0.00 ? 56 ASP A C   13 
ATOM   7284 O  O   . ASP A 1 56 ? 10.862  -1.483  6.032   1.00 0.00 ? 56 ASP A O   13 
ATOM   7285 C  CB  . ASP A 1 56 ? 8.728   0.210   6.905   1.00 0.00 ? 56 ASP A CB  13 
ATOM   7286 C  CG  . ASP A 1 56 ? 9.534   1.300   6.211   1.00 0.00 ? 56 ASP A CG  13 
ATOM   7287 O  OD1 . ASP A 1 56 ? 9.390   1.453   4.974   1.00 0.00 ? 56 ASP A OD1 13 
ATOM   7288 O  OD2 . ASP A 1 56 ? 10.329  1.960   6.912   1.00 0.00 ? 56 ASP A OD2 13 
ATOM   7289 N  N   . GLU A 1 57 ? 9.532   -3.278  6.032   1.00 0.00 ? 57 GLU A N   13 
ATOM   7290 C  CA  . GLU A 1 57 ? 10.594  -4.234  5.765   1.00 0.00 ? 57 GLU A CA  13 
ATOM   7291 C  C   . GLU A 1 57 ? 10.697  -4.336  4.242   1.00 0.00 ? 57 GLU A C   13 
ATOM   7292 O  O   . GLU A 1 57 ? 11.755  -4.094  3.661   1.00 0.00 ? 57 GLU A O   13 
ATOM   7293 C  CB  . GLU A 1 57 ? 10.322  -5.601  6.433   1.00 0.00 ? 57 GLU A CB  13 
ATOM   7294 C  CG  . GLU A 1 57 ? 9.131   -5.659  7.412   1.00 0.00 ? 57 GLU A CG  13 
ATOM   7295 C  CD  . GLU A 1 57 ? 7.789   -5.708  6.698   1.00 0.00 ? 57 GLU A CD  13 
ATOM   7296 O  OE1 . GLU A 1 57 ? 7.718   -5.183  5.569   1.00 0.00 ? 57 GLU A OE1 13 
ATOM   7297 O  OE2 . GLU A 1 57 ? 6.832   -6.311  7.230   1.00 0.00 ? 57 GLU A OE2 13 
ATOM   7298 N  N   . VAL A 1 58 ? 9.569   -4.660  3.605   1.00 0.00 ? 58 VAL A N   13 
ATOM   7299 C  CA  . VAL A 1 58 ? 9.426   -4.583  2.156   1.00 0.00 ? 58 VAL A CA  13 
ATOM   7300 C  C   . VAL A 1 58 ? 9.251   -3.125  1.710   1.00 0.00 ? 58 VAL A C   13 
ATOM   7301 O  O   . VAL A 1 58 ? 9.179   -2.211  2.529   1.00 0.00 ? 58 VAL A O   13 
ATOM   7302 C  CB  . VAL A 1 58 ? 8.273   -5.483  1.669   1.00 0.00 ? 58 VAL A CB  13 
ATOM   7303 C  CG1 . VAL A 1 58 ? 8.543   -6.950  2.021   1.00 0.00 ? 58 VAL A CG1 13 
ATOM   7304 C  CG2 . VAL A 1 58 ? 6.904   -5.052  2.211   1.00 0.00 ? 58 VAL A CG2 13 
ATOM   7305 N  N   . LEU A 1 59 ? 9.177   -2.914  0.393   1.00 0.00 ? 59 LEU A N   13 
ATOM   7306 C  CA  . LEU A 1 59 ? 8.845   -1.656  -0.246  1.00 0.00 ? 59 LEU A CA  13 
ATOM   7307 C  C   . LEU A 1 59 ? 7.464   -1.804  -0.875  1.00 0.00 ? 59 LEU A C   13 
ATOM   7308 O  O   . LEU A 1 59 ? 7.227   -2.787  -1.576  1.00 0.00 ? 59 LEU A O   13 
ATOM   7309 C  CB  . LEU A 1 59 ? 9.897   -1.426  -1.329  1.00 0.00 ? 59 LEU A CB  13 
ATOM   7310 C  CG  . LEU A 1 59 ? 9.833   -0.030  -1.946  1.00 0.00 ? 59 LEU A CG  13 
ATOM   7311 C  CD1 . LEU A 1 59 ? 10.321  1.047   -0.975  1.00 0.00 ? 59 LEU A CD1 13 
ATOM   7312 C  CD2 . LEU A 1 59 ? 10.759  -0.007  -3.158  1.00 0.00 ? 59 LEU A CD2 13 
ATOM   7313 N  N   . VAL A 1 60 ? 6.550   -0.863  -0.641  1.00 0.00 ? 60 VAL A N   13 
ATOM   7314 C  CA  . VAL A 1 60 ? 5.175   -1.000  -1.103  1.00 0.00 ? 60 VAL A CA  13 
ATOM   7315 C  C   . VAL A 1 60 ? 5.012   -0.319  -2.458  1.00 0.00 ? 60 VAL A C   13 
ATOM   7316 O  O   . VAL A 1 60 ? 5.608   0.725   -2.714  1.00 0.00 ? 60 VAL A O   13 
ATOM   7317 C  CB  . VAL A 1 60 ? 4.197   -0.469  -0.044  1.00 0.00 ? 60 VAL A CB  13 
ATOM   7318 C  CG1 . VAL A 1 60 ? 4.209   -1.387  1.184   1.00 0.00 ? 60 VAL A CG1 13 
ATOM   7319 C  CG2 . VAL A 1 60 ? 4.469   0.971   0.389   1.00 0.00 ? 60 VAL A CG2 13 
ATOM   7320 N  N   . LYS A 1 61 ? 4.244   -0.922  -3.365  1.00 0.00 ? 61 LYS A N   13 
ATOM   7321 C  CA  . LYS A 1 61 ? 3.923   -0.296  -4.629  1.00 0.00 ? 61 LYS A CA  13 
ATOM   7322 C  C   . LYS A 1 61 ? 3.125   0.975   -4.355  1.00 0.00 ? 61 LYS A C   13 
ATOM   7323 O  O   . LYS A 1 61 ? 2.197   0.946   -3.555  1.00 0.00 ? 61 LYS A O   13 
ATOM   7324 C  CB  . LYS A 1 61 ? 3.133   -1.282  -5.504  1.00 0.00 ? 61 LYS A CB  13 
ATOM   7325 C  CG  . LYS A 1 61 ? 3.258   -0.870  -6.968  1.00 0.00 ? 61 LYS A CG  13 
ATOM   7326 C  CD  . LYS A 1 61 ? 3.077   -2.007  -7.972  1.00 0.00 ? 61 LYS A CD  13 
ATOM   7327 C  CE  . LYS A 1 61 ? 3.764   -1.616  -9.297  1.00 0.00 ? 61 LYS A CE  13 
ATOM   7328 N  NZ  . LYS A 1 61 ? 3.486   -0.229  -9.744  1.00 0.00 ? 61 LYS A NZ  13 
ATOM   7329 N  N   . ALA A 1 62 ? 3.456   2.071   -5.033  1.00 0.00 ? 62 ALA A N   13 
ATOM   7330 C  CA  . ALA A 1 62 ? 2.684   3.308   -4.977  1.00 0.00 ? 62 ALA A CA  13 
ATOM   7331 C  C   . ALA A 1 62 ? 1.213   3.050   -5.292  1.00 0.00 ? 62 ALA A C   13 
ATOM   7332 O  O   . ALA A 1 62 ? 0.341   3.591   -4.609  1.00 0.00 ? 62 ALA A O   13 
ATOM   7333 C  CB  . ALA A 1 62 ? 3.278   4.330   -5.937  1.00 0.00 ? 62 ALA A CB  13 
ATOM   7334 N  N   . GLU A 1 63 ? 0.936   2.204   -6.297  1.00 0.00 ? 63 GLU A N   13 
ATOM   7335 C  CA  . GLU A 1 63 ? -0.430  1.815   -6.611  1.00 0.00 ? 63 GLU A CA  13 
ATOM   7336 C  C   . GLU A 1 63 ? -0.964  0.668   -5.752  1.00 0.00 ? 63 GLU A C   13 
ATOM   7337 O  O   . GLU A 1 63 ? -2.059  0.182   -6.029  1.00 0.00 ? 63 GLU A O   13 
ATOM   7338 C  CB  . GLU A 1 63 ? -0.607  1.467   -8.089  1.00 0.00 ? 63 GLU A CB  13 
ATOM   7339 C  CG  . GLU A 1 63 ? 0.106   2.441   -9.027  1.00 0.00 ? 63 GLU A CG  13 
ATOM   7340 C  CD  . GLU A 1 63 ? 1.437   1.834   -9.441  1.00 0.00 ? 63 GLU A CD  13 
ATOM   7341 O  OE1 . GLU A 1 63 ? 2.366   1.822   -8.602  1.00 0.00 ? 63 GLU A OE1 13 
ATOM   7342 O  OE2 . GLU A 1 63 ? 1.508   1.207   -10.522 1.00 0.00 ? 63 GLU A OE2 13 
ATOM   7343 N  N   . GLY A 1 64 ? -0.221  0.221   -4.740  1.00 0.00 ? 64 GLY A N   13 
ATOM   7344 C  CA  . GLY A 1 64 ? -0.731  -0.729  -3.769  1.00 0.00 ? 64 GLY A CA  13 
ATOM   7345 C  C   . GLY A 1 64 ? -1.729  -0.033  -2.849  1.00 0.00 ? 64 GLY A C   13 
ATOM   7346 O  O   . GLY A 1 64 ? -2.142  1.098   -3.103  1.00 0.00 ? 64 GLY A O   13 
ATOM   7347 N  N   . TRP A 1 65 ? -2.120  -0.711  -1.777  1.00 0.00 ? 65 TRP A N   13 
ATOM   7348 C  CA  . TRP A 1 65 ? -2.965  -0.174  -0.726  1.00 0.00 ? 65 TRP A CA  13 
ATOM   7349 C  C   . TRP A 1 65 ? -2.707  -1.044  0.499   1.00 0.00 ? 65 TRP A C   13 
ATOM   7350 O  O   . TRP A 1 65 ? -1.920  -1.976  0.396   1.00 0.00 ? 65 TRP A O   13 
ATOM   7351 C  CB  . TRP A 1 65 ? -4.419  -0.258  -1.192  1.00 0.00 ? 65 TRP A CB  13 
ATOM   7352 C  CG  . TRP A 1 65 ? -5.443  0.199   -0.211  1.00 0.00 ? 65 TRP A CG  13 
ATOM   7353 C  CD1 . TRP A 1 65 ? -5.666  1.482   0.145   1.00 0.00 ? 65 TRP A CD1 13 
ATOM   7354 C  CD2 . TRP A 1 65 ? -6.352  -0.608  0.593   1.00 0.00 ? 65 TRP A CD2 13 
ATOM   7355 N  NE1 . TRP A 1 65 ? -6.725  1.536   1.024   1.00 0.00 ? 65 TRP A NE1 13 
ATOM   7356 C  CE2 . TRP A 1 65 ? -7.181  0.276   1.336   1.00 0.00 ? 65 TRP A CE2 13 
ATOM   7357 C  CE3 . TRP A 1 65 ? -6.578  -1.994  0.757   1.00 0.00 ? 65 TRP A CE3 13 
ATOM   7358 C  CZ2 . TRP A 1 65 ? -8.212  -0.179  2.157   1.00 0.00 ? 65 TRP A CZ2 13 
ATOM   7359 C  CZ3 . TRP A 1 65 ? -7.586  -2.465  1.618   1.00 0.00 ? 65 TRP A CZ3 13 
ATOM   7360 C  CH2 . TRP A 1 65 ? -8.420  -1.562  2.301   1.00 0.00 ? 65 TRP A CH2 13 
ATOM   7361 N  N   . CYS A 1 66 ? -3.359  -0.789  1.637   1.00 0.00 ? 66 CYS A N   13 
ATOM   7362 C  CA  . CYS A 1 66 ? -3.488  -1.764  2.708   1.00 0.00 ? 66 CYS A CA  13 
ATOM   7363 C  C   . CYS A 1 66 ? -4.607  -1.354  3.663   1.00 0.00 ? 66 CYS A C   13 
ATOM   7364 O  O   . CYS A 1 66 ? -5.028  -0.197  3.684   1.00 0.00 ? 66 CYS A O   13 
ATOM   7365 C  CB  . CYS A 1 66 ? -2.178  -1.997  3.422   1.00 0.00 ? 66 CYS A CB  13 
ATOM   7366 S  SG  . CYS A 1 66 ? -1.893  -0.706  4.647   1.00 0.00 ? 66 CYS A SG  13 
ATOM   7367 N  N   . SER A 1 67 ? -5.119  -2.291  4.463   1.00 0.00 ? 67 SER A N   13 
ATOM   7368 C  CA  . SER A 1 67 ? -6.258  -2.012  5.323   1.00 0.00 ? 67 SER A CA  13 
ATOM   7369 C  C   . SER A 1 67 ? -5.907  -1.113  6.511   1.00 0.00 ? 67 SER A C   13 
ATOM   7370 O  O   . SER A 1 67 ? -6.822  -0.622  7.172   1.00 0.00 ? 67 SER A O   13 
ATOM   7371 C  CB  . SER A 1 67 ? -6.960  -3.312  5.720   1.00 0.00 ? 67 SER A CB  13 
ATOM   7372 O  OG  . SER A 1 67 ? -6.084  -4.256  6.295   1.00 0.00 ? 67 SER A OG  13 
ATOM   7373 N  N   . VAL A 1 68 ? -4.619  -0.839  6.773   1.00 0.00 ? 68 VAL A N   13 
ATOM   7374 C  CA  . VAL A 1 68 ? -4.255  0.206   7.727   1.00 0.00 ? 68 VAL A CA  13 
ATOM   7375 C  C   . VAL A 1 68 ? -4.465  1.607   7.132   1.00 0.00 ? 68 VAL A C   13 
ATOM   7376 O  O   . VAL A 1 68 ? -4.533  2.565   7.900   1.00 0.00 ? 68 VAL A O   13 
ATOM   7377 C  CB  . VAL A 1 68 ? -2.870  0.025   8.384   1.00 0.00 ? 68 VAL A CB  13 
ATOM   7378 C  CG1 . VAL A 1 68 ? -2.681  -1.414  8.815   1.00 0.00 ? 68 VAL A CG1 13 
ATOM   7379 C  CG2 . VAL A 1 68 ? -1.633  0.426   7.586   1.00 0.00 ? 68 VAL A CG2 13 
ATOM   7380 N  N   . TYR A 1 69 ? -4.581  1.729   5.795   1.00 0.00 ? 69 TYR A N   13 
ATOM   7381 C  CA  . TYR A 1 69 ? -4.678  2.995   5.066   1.00 0.00 ? 69 TYR A CA  13 
ATOM   7382 C  C   . TYR A 1 69 ? -5.526  4.040   5.789   1.00 0.00 ? 69 TYR A C   13 
ATOM   7383 O  O   . TYR A 1 69 ? -6.650  3.750   6.213   1.00 0.00 ? 69 TYR A O   13 
ATOM   7384 C  CB  . TYR A 1 69 ? -5.259  2.761   3.662   1.00 0.00 ? 69 TYR A CB  13 
ATOM   7385 C  CG  . TYR A 1 69 ? -5.485  4.018   2.833   1.00 0.00 ? 69 TYR A CG  13 
ATOM   7386 C  CD1 . TYR A 1 69 ? -6.684  4.745   2.955   1.00 0.00 ? 69 TYR A CD1 13 
ATOM   7387 C  CD2 . TYR A 1 69 ? -4.510  4.443   1.912   1.00 0.00 ? 69 TYR A CD2 13 
ATOM   7388 C  CE1 . TYR A 1 69 ? -6.875  5.915   2.201   1.00 0.00 ? 69 TYR A CE1 13 
ATOM   7389 C  CE2 . TYR A 1 69 ? -4.722  5.591   1.132   1.00 0.00 ? 69 TYR A CE2 13 
ATOM   7390 C  CZ  . TYR A 1 69 ? -5.903  6.332   1.278   1.00 0.00 ? 69 TYR A CZ  13 
ATOM   7391 O  OH  . TYR A 1 69 ? -6.145  7.404   0.471   1.00 0.00 ? 69 TYR A OH  13 
ATOM   7392 N  N   . ALA A 1 70 ? -4.994  5.260   5.873   1.00 0.00 ? 70 ALA A N   13 
ATOM   7393 C  CA  . ALA A 1 70 ? -5.717  6.465   6.239   1.00 0.00 ? 70 ALA A CA  13 
ATOM   7394 C  C   . ALA A 1 70 ? -5.372  7.487   5.156   1.00 0.00 ? 70 ALA A C   13 
ATOM   7395 O  O   . ALA A 1 70 ? -4.204  7.553   4.775   1.00 0.00 ? 70 ALA A O   13 
ATOM   7396 C  CB  . ALA A 1 70 ? -5.249  6.941   7.616   1.00 0.00 ? 70 ALA A CB  13 
ATOM   7397 N  N   . PRO A 1 71 ? -6.339  8.238   4.614   1.00 0.00 ? 71 PRO A N   13 
ATOM   7398 C  CA  . PRO A 1 71 ? -6.077  9.160   3.523   1.00 0.00 ? 71 PRO A CA  13 
ATOM   7399 C  C   . PRO A 1 71 ? -5.304  10.374  4.005   1.00 0.00 ? 71 PRO A C   13 
ATOM   7400 O  O   . PRO A 1 71 ? -5.498  10.849  5.124   1.00 0.00 ? 71 PRO A O   13 
ATOM   7401 C  CB  . PRO A 1 71 ? -7.448  9.558   2.981   1.00 0.00 ? 71 PRO A CB  13 
ATOM   7402 C  CG  . PRO A 1 71 ? -8.362  9.412   4.199   1.00 0.00 ? 71 PRO A CG  13 
ATOM   7403 C  CD  . PRO A 1 71 ? -7.746  8.243   4.972   1.00 0.00 ? 71 PRO A CD  13 
ATOM   7404 N  N   . ALA A 1 72 ? -4.453  10.911  3.132   1.00 0.00 ? 72 ALA A N   13 
ATOM   7405 C  CA  . ALA A 1 72 ? -3.704  12.121  3.409   1.00 0.00 ? 72 ALA A CA  13 
ATOM   7406 C  C   . ALA A 1 72 ? -4.515  13.330  2.958   1.00 0.00 ? 72 ALA A C   13 
ATOM   7407 O  O   . ALA A 1 72 ? -4.047  14.177  2.198   1.00 0.00 ? 72 ALA A O   13 
ATOM   7408 C  CB  . ALA A 1 72 ? -2.358  12.042  2.709   1.00 0.00 ? 72 ALA A CB  13 
ATOM   7409 N  N   . SER A 1 73 ? -5.756  13.371  3.425   1.00 0.00 ? 73 SER A N   13 
ATOM   7410 C  CA  . SER A 1 73 ? -6.731  14.386  3.091   1.00 0.00 ? 73 SER A CA  13 
ATOM   7411 C  C   . SER A 1 73 ? -7.871  14.290  4.099   1.00 0.00 ? 73 SER A C   13 
ATOM   7412 O  O   . SER A 1 73 ? -8.493  13.201  4.102   1.00 0.00 ? 73 SER A O   13 
ATOM   7413 C  CB  . SER A 1 73 ? -7.254  14.164  1.666   1.00 0.00 ? 73 SER A CB  13 
ATOM   7414 O  OG  . SER A 1 73 ? -7.826  12.874  1.570   1.00 0.00 ? 73 SER A OG  13 
ATOM   7415 O  OXT . SER A 1 73 ? -8.101  15.281  4.821   1.00 0.00 ? 73 SER A OXT 13 
HETATM 7416 FE FE1 . SF4 B 2 .  ? 0.220   1.672   1.664   1.00 0.00 ? 74 SF4 A FE1 13 
HETATM 7417 FE FE2 . SF4 B 2 .  ? -0.593  3.231   3.454   1.00 0.00 ? 74 SF4 A FE2 13 
HETATM 7418 FE FE3 . SF4 B 2 .  ? 1.445   1.919   3.831   1.00 0.00 ? 74 SF4 A FE3 13 
HETATM 7419 FE FE4 . SF4 B 2 .  ? -0.763  0.768   3.768   1.00 0.00 ? 74 SF4 A FE4 13 
HETATM 7420 S  S1  . SF4 B 2 .  ? -0.126  2.208   5.249   1.00 0.00 ? 74 SF4 A S1  13 
HETATM 7421 S  S2  . SF4 B 2 .  ? 1.041   0.049   2.841   1.00 0.00 ? 74 SF4 A S2  13 
HETATM 7422 S  S3  . SF4 B 2 .  ? -1.843  1.906   2.295   1.00 0.00 ? 74 SF4 A S3  13 
HETATM 7423 S  S4  . SF4 B 2 .  ? 1.242   3.457   2.337   1.00 0.00 ? 74 SF4 A S4  13 
ATOM   7424 N  N   . ALA A 1 1  ? 16.007  1.421   2.355   1.00 0.00 ? 1  ALA A N   14 
ATOM   7425 C  CA  . ALA A 1 1  ? 16.469  1.792   1.023   1.00 0.00 ? 1  ALA A CA  14 
ATOM   7426 C  C   . ALA A 1 1  ? 16.657  0.535   0.180   1.00 0.00 ? 1  ALA A C   14 
ATOM   7427 O  O   . ALA A 1 1  ? 17.340  -0.377  0.637   1.00 0.00 ? 1  ALA A O   14 
ATOM   7428 C  CB  . ALA A 1 1  ? 17.792  2.549   1.173   1.00 0.00 ? 1  ALA A CB  14 
ATOM   7429 N  N   . SER A 1 2  ? 16.030  0.464   -0.998  1.00 0.00 ? 2  SER A N   14 
ATOM   7430 C  CA  . SER A 1 2  ? 16.017  -0.720  -1.852  1.00 0.00 ? 2  SER A CA  14 
ATOM   7431 C  C   . SER A 1 2  ? 15.617  -2.003  -1.106  1.00 0.00 ? 2  SER A C   14 
ATOM   7432 O  O   . SER A 1 2  ? 16.147  -3.075  -1.393  1.00 0.00 ? 2  SER A O   14 
ATOM   7433 C  CB  . SER A 1 2  ? 17.368  -0.863  -2.564  1.00 0.00 ? 2  SER A CB  14 
ATOM   7434 O  OG  . SER A 1 2  ? 17.661  0.335   -3.259  1.00 0.00 ? 2  SER A OG  14 
ATOM   7435 N  N   . GLU A 1 3  ? 14.659  -1.903  -0.179  1.00 0.00 ? 3  GLU A N   14 
ATOM   7436 C  CA  . GLU A 1 3  ? 14.013  -3.066  0.416   1.00 0.00 ? 3  GLU A CA  14 
ATOM   7437 C  C   . GLU A 1 3  ? 13.228  -3.814  -0.680  1.00 0.00 ? 3  GLU A C   14 
ATOM   7438 O  O   . GLU A 1 3  ? 12.860  -3.211  -1.690  1.00 0.00 ? 3  GLU A O   14 
ATOM   7439 C  CB  . GLU A 1 3  ? 13.168  -2.675  1.654   1.00 0.00 ? 3  GLU A CB  14 
ATOM   7440 C  CG  . GLU A 1 3  ? 12.416  -1.331  1.636   1.00 0.00 ? 3  GLU A CG  14 
ATOM   7441 C  CD  . GLU A 1 3  ? 13.312  -0.136  1.884   1.00 0.00 ? 3  GLU A CD  14 
ATOM   7442 O  OE1 . GLU A 1 3  ? 13.608  0.281   3.022   1.00 0.00 ? 3  GLU A OE1 14 
ATOM   7443 O  OE2 . GLU A 1 3  ? 13.930  0.417   0.957   1.00 0.00 ? 3  GLU A OE2 14 
ATOM   7444 N  N   . PRO A 1 4  ? 13.013  -5.135  -0.552  1.00 0.00 ? 4  PRO A N   14 
ATOM   7445 C  CA  . PRO A 1 4  ? 12.391  -5.923  -1.607  1.00 0.00 ? 4  PRO A CA  14 
ATOM   7446 C  C   . PRO A 1 4  ? 10.911  -5.556  -1.777  1.00 0.00 ? 4  PRO A C   14 
ATOM   7447 O  O   . PRO A 1 4  ? 10.225  -5.272  -0.798  1.00 0.00 ? 4  PRO A O   14 
ATOM   7448 C  CB  . PRO A 1 4  ? 12.582  -7.387  -1.195  1.00 0.00 ? 4  PRO A CB  14 
ATOM   7449 C  CG  . PRO A 1 4  ? 12.715  -7.317  0.326   1.00 0.00 ? 4  PRO A CG  14 
ATOM   7450 C  CD  . PRO A 1 4  ? 13.433  -5.987  0.550   1.00 0.00 ? 4  PRO A CD  14 
ATOM   7451 N  N   . ARG A 1 5  ? 10.423  -5.557  -3.022  1.00 0.00 ? 5  ARG A N   14 
ATOM   7452 C  CA  . ARG A 1 5  ? 9.047   -5.264  -3.389  1.00 0.00 ? 5  ARG A CA  14 
ATOM   7453 C  C   . ARG A 1 5  ? 8.051   -6.162  -2.644  1.00 0.00 ? 5  ARG A C   14 
ATOM   7454 O  O   . ARG A 1 5  ? 8.192   -7.384  -2.655  1.00 0.00 ? 5  ARG A O   14 
ATOM   7455 C  CB  . ARG A 1 5  ? 8.972   -5.459  -4.906  1.00 0.00 ? 5  ARG A CB  14 
ATOM   7456 C  CG  . ARG A 1 5  ? 9.764   -4.390  -5.623  1.00 0.00 ? 5  ARG A CG  14 
ATOM   7457 C  CD  . ARG A 1 5  ? 9.895   -4.883  -7.058  1.00 0.00 ? 5  ARG A CD  14 
ATOM   7458 N  NE  . ARG A 1 5  ? 11.000  -4.172  -7.663  1.00 0.00 ? 5  ARG A NE  14 
ATOM   7459 C  CZ  . ARG A 1 5  ? 10.927  -3.349  -8.722  1.00 0.00 ? 5  ARG A CZ  14 
ATOM   7460 N  NH1 . ARG A 1 5  ? 9.893   -3.448  -9.559  1.00 0.00 ? 5  ARG A NH1 14 
ATOM   7461 N  NH2 . ARG A 1 5  ? 11.862  -2.426  -8.934  1.00 0.00 ? 5  ARG A NH2 14 
ATOM   7462 N  N   . ALA A 1 6  ? 7.054   -5.549  -1.998  1.00 0.00 ? 6  ALA A N   14 
ATOM   7463 C  CA  . ALA A 1 6  ? 6.070   -6.228  -1.171  1.00 0.00 ? 6  ALA A CA  14 
ATOM   7464 C  C   . ALA A 1 6  ? 5.197   -7.190  -1.973  1.00 0.00 ? 6  ALA A C   14 
ATOM   7465 O  O   . ALA A 1 6  ? 4.877   -6.961  -3.141  1.00 0.00 ? 6  ALA A O   14 
ATOM   7466 C  CB  . ALA A 1 6  ? 5.195   -5.197  -0.455  1.00 0.00 ? 6  ALA A CB  14 
ATOM   7467 N  N   . GLU A 1 7  ? 4.798   -8.267  -1.305  1.00 0.00 ? 7  GLU A N   14 
ATOM   7468 C  CA  . GLU A 1 7  ? 4.022   -9.353  -1.844  1.00 0.00 ? 7  GLU A CA  14 
ATOM   7469 C  C   . GLU A 1 7  ? 2.526   -9.149  -1.646  1.00 0.00 ? 7  GLU A C   14 
ATOM   7470 O  O   . GLU A 1 7  ? 2.075   -8.483  -0.709  1.00 0.00 ? 7  GLU A O   14 
ATOM   7471 C  CB  . GLU A 1 7  ? 4.553   -10.683 -1.377  1.00 0.00 ? 7  GLU A CB  14 
ATOM   7472 C  CG  . GLU A 1 7  ? 4.298   -10.978 0.083   1.00 0.00 ? 7  GLU A CG  14 
ATOM   7473 C  CD  . GLU A 1 7  ? 5.246   -10.372 1.120   1.00 0.00 ? 7  GLU A CD  14 
ATOM   7474 O  OE1 . GLU A 1 7  ? 5.795   -9.274  0.897   1.00 0.00 ? 7  GLU A OE1 14 
ATOM   7475 O  OE2 . GLU A 1 7  ? 5.329   -10.926 2.237   1.00 0.00 ? 7  GLU A OE2 14 
ATOM   7476 N  N   . ASP A 1 8  ? 1.763   -9.745  -2.551  1.00 0.00 ? 8  ASP A N   14 
ATOM   7477 C  CA  . ASP A 1 8  ? 0.327   -9.618  -2.616  1.00 0.00 ? 8  ASP A CA  14 
ATOM   7478 C  C   . ASP A 1 8  ? -0.302  -10.307 -1.412  1.00 0.00 ? 8  ASP A C   14 
ATOM   7479 O  O   . ASP A 1 8  ? -0.489  -11.521 -1.394  1.00 0.00 ? 8  ASP A O   14 
ATOM   7480 C  CB  . ASP A 1 8  ? -0.159  -10.178 -3.950  1.00 0.00 ? 8  ASP A CB  14 
ATOM   7481 C  CG  . ASP A 1 8  ? 0.042   -9.136  -5.031  1.00 0.00 ? 8  ASP A CG  14 
ATOM   7482 O  OD1 . ASP A 1 8  ? -0.867  -8.292  -5.173  1.00 0.00 ? 8  ASP A OD1 14 
ATOM   7483 O  OD2 . ASP A 1 8  ? 1.147   -9.120  -5.618  1.00 0.00 ? 8  ASP A OD2 14 
ATOM   7484 N  N   . GLY A 1 9  ? -0.596  -9.505  -0.389  1.00 0.00 ? 9  GLY A N   14 
ATOM   7485 C  CA  . GLY A 1 9  ? -1.120  -9.973  0.879   1.00 0.00 ? 9  GLY A CA  14 
ATOM   7486 C  C   . GLY A 1 9  ? 0.002   -10.274 1.869   1.00 0.00 ? 9  GLY A C   14 
ATOM   7487 O  O   . GLY A 1 9  ? -0.198  -11.090 2.764   1.00 0.00 ? 9  GLY A O   14 
ATOM   7488 N  N   . HIS A 1 10 ? 1.147   -9.580  1.753   1.00 0.00 ? 10 HIS A N   14 
ATOM   7489 C  CA  . HIS A 1 10 ? 2.196   -9.531  2.772   1.00 0.00 ? 10 HIS A CA  14 
ATOM   7490 C  C   . HIS A 1 10 ? 1.596   -9.521  4.174   1.00 0.00 ? 10 HIS A C   14 
ATOM   7491 O  O   . HIS A 1 10 ? 1.947   -10.332 5.026   1.00 0.00 ? 10 HIS A O   14 
ATOM   7492 C  CB  . HIS A 1 10 ? 3.015   -8.251  2.558   1.00 0.00 ? 10 HIS A CB  14 
ATOM   7493 C  CG  . HIS A 1 10 ? 4.088   -8.018  3.592   1.00 0.00 ? 10 HIS A CG  14 
ATOM   7494 N  ND1 . HIS A 1 10 ? 5.283   -8.706  3.705   1.00 0.00 ? 10 HIS A ND1 14 
ATOM   7495 C  CD2 . HIS A 1 10 ? 4.071   -7.041  4.547   1.00 0.00 ? 10 HIS A CD2 14 
ATOM   7496 C  CE1 . HIS A 1 10 ? 5.990   -8.133  4.699   1.00 0.00 ? 10 HIS A CE1 14 
ATOM   7497 N  NE2 . HIS A 1 10 ? 5.274   -7.117  5.223   1.00 0.00 ? 10 HIS A NE2 14 
ATOM   7498 N  N   . ALA A 1 11 ? 0.682   -8.576  4.386   1.00 0.00 ? 11 ALA A N   14 
ATOM   7499 C  CA  . ALA A 1 11 ? -0.176  -8.503  5.551   1.00 0.00 ? 11 ALA A CA  14 
ATOM   7500 C  C   . ALA A 1 11 ? -1.325  -7.550  5.216   1.00 0.00 ? 11 ALA A C   14 
ATOM   7501 O  O   . ALA A 1 11 ? -1.385  -7.039  4.095   1.00 0.00 ? 11 ALA A O   14 
ATOM   7502 C  CB  . ALA A 1 11 ? 0.645   -8.049  6.765   1.00 0.00 ? 11 ALA A CB  14 
ATOM   7503 N  N   . HIS A 1 12 ? -2.218  -7.329  6.190   1.00 0.00 ? 12 HIS A N   14 
ATOM   7504 C  CA  . HIS A 1 12 ? -3.328  -6.372  6.193   1.00 0.00 ? 12 HIS A CA  14 
ATOM   7505 C  C   . HIS A 1 12 ? -3.926  -6.137  4.807   1.00 0.00 ? 12 HIS A C   14 
ATOM   7506 O  O   . HIS A 1 12 ? -4.093  -4.995  4.380   1.00 0.00 ? 12 HIS A O   14 
ATOM   7507 C  CB  . HIS A 1 12 ? -2.909  -5.035  6.813   1.00 0.00 ? 12 HIS A CB  14 
ATOM   7508 C  CG  . HIS A 1 12 ? -2.320  -5.113  8.198   1.00 0.00 ? 12 HIS A CG  14 
ATOM   7509 N  ND1 . HIS A 1 12 ? -2.849  -4.494  9.313   1.00 0.00 ? 12 HIS A ND1 14 
ATOM   7510 C  CD2 . HIS A 1 12 ? -1.027  -5.447  8.482   1.00 0.00 ? 12 HIS A CD2 14 
ATOM   7511 C  CE1 . HIS A 1 12 ? -1.874  -4.415  10.239  1.00 0.00 ? 12 HIS A CE1 14 
ATOM   7512 N  NE2 . HIS A 1 12 ? -0.792  -5.068  9.784   1.00 0.00 ? 12 HIS A NE2 14 
ATOM   7513 N  N   . ASP A 1 13 ? -4.253  -7.231  4.124   1.00 0.00 ? 13 ASP A N   14 
ATOM   7514 C  CA  . ASP A 1 13 ? -5.031  -7.212  2.892   1.00 0.00 ? 13 ASP A CA  14 
ATOM   7515 C  C   . ASP A 1 13 ? -4.401  -6.307  1.820   1.00 0.00 ? 13 ASP A C   14 
ATOM   7516 O  O   . ASP A 1 13 ? -5.126  -5.718  1.021   1.00 0.00 ? 13 ASP A O   14 
ATOM   7517 C  CB  . ASP A 1 13 ? -6.486  -6.807  3.191   1.00 0.00 ? 13 ASP A CB  14 
ATOM   7518 C  CG  . ASP A 1 13 ? -6.995  -7.224  4.563   1.00 0.00 ? 13 ASP A CG  14 
ATOM   7519 O  OD1 . ASP A 1 13 ? -6.862  -8.413  4.910   1.00 0.00 ? 13 ASP A OD1 14 
ATOM   7520 O  OD2 . ASP A 1 13 ? -7.534  -6.316  5.240   1.00 0.00 ? 13 ASP A OD2 14 
ATOM   7521 N  N   . TYR A 1 14 ? -3.066  -6.174  1.823   1.00 0.00 ? 14 TYR A N   14 
ATOM   7522 C  CA  . TYR A 1 14 ? -2.345  -5.179  1.034   1.00 0.00 ? 14 TYR A CA  14 
ATOM   7523 C  C   . TYR A 1 14 ? -2.720  -5.148  -0.455  1.00 0.00 ? 14 TYR A C   14 
ATOM   7524 O  O   . TYR A 1 14 ? -3.276  -4.154  -0.909  1.00 0.00 ? 14 TYR A O   14 
ATOM   7525 C  CB  . TYR A 1 14 ? -0.842  -5.274  1.343   1.00 0.00 ? 14 TYR A CB  14 
ATOM   7526 C  CG  . TYR A 1 14 ? 0.121   -4.727  0.301   1.00 0.00 ? 14 TYR A CG  14 
ATOM   7527 C  CD1 . TYR A 1 14 ? 0.640   -5.577  -0.693  1.00 0.00 ? 14 TYR A CD1 14 
ATOM   7528 C  CD2 . TYR A 1 14 ? 0.571   -3.397  0.372   1.00 0.00 ? 14 TYR A CD2 14 
ATOM   7529 C  CE1 . TYR A 1 14 ? 1.564   -5.091  -1.631  1.00 0.00 ? 14 TYR A CE1 14 
ATOM   7530 C  CE2 . TYR A 1 14 ? 1.416   -2.886  -0.625  1.00 0.00 ? 14 TYR A CE2 14 
ATOM   7531 C  CZ  . TYR A 1 14 ? 1.929   -3.734  -1.616  1.00 0.00 ? 14 TYR A CZ  14 
ATOM   7532 O  OH  . TYR A 1 14 ? 2.846   -3.250  -2.500  1.00 0.00 ? 14 TYR A OH  14 
ATOM   7533 N  N   . VAL A 1 15 ? -2.430  -6.234  -1.188  1.00 0.00 ? 15 VAL A N   14 
ATOM   7534 C  CA  . VAL A 1 15 ? -2.535  -6.367  -2.648  1.00 0.00 ? 15 VAL A CA  14 
ATOM   7535 C  C   . VAL A 1 15 ? -1.772  -5.287  -3.437  1.00 0.00 ? 15 VAL A C   14 
ATOM   7536 O  O   . VAL A 1 15 ? -1.861  -4.089  -3.175  1.00 0.00 ? 15 VAL A O   14 
ATOM   7537 C  CB  . VAL A 1 15 ? -3.979  -6.620  -3.144  1.00 0.00 ? 15 VAL A CB  14 
ATOM   7538 C  CG1 . VAL A 1 15 ? -4.414  -8.012  -2.672  1.00 0.00 ? 15 VAL A CG1 14 
ATOM   7539 C  CG2 . VAL A 1 15 ? -5.014  -5.602  -2.650  1.00 0.00 ? 15 VAL A CG2 14 
ATOM   7540 N  N   . ASN A 1 16 ? -0.962  -5.713  -4.411  1.00 0.00 ? 16 ASN A N   14 
ATOM   7541 C  CA  . ASN A 1 16 ? -0.071  -4.832  -5.137  1.00 0.00 ? 16 ASN A CA  14 
ATOM   7542 C  C   . ASN A 1 16 ? -0.813  -3.810  -5.989  1.00 0.00 ? 16 ASN A C   14 
ATOM   7543 O  O   . ASN A 1 16 ? -0.256  -2.752  -6.280  1.00 0.00 ? 16 ASN A O   14 
ATOM   7544 C  CB  . ASN A 1 16 ? 0.969   -5.605  -5.955  1.00 0.00 ? 16 ASN A CB  14 
ATOM   7545 C  CG  . ASN A 1 16 ? 2.241   -5.783  -5.146  1.00 0.00 ? 16 ASN A CG  14 
ATOM   7546 O  OD1 . ASN A 1 16 ? 2.843   -4.804  -4.719  1.00 0.00 ? 16 ASN A OD1 14 
ATOM   7547 N  ND2 . ASN A 1 16 ? 2.660   -7.010  -4.897  1.00 0.00 ? 16 ASN A ND2 14 
ATOM   7548 N  N   . GLU A 1 17 ? -2.045  -4.126  -6.397  1.00 0.00 ? 17 GLU A N   14 
ATOM   7549 C  CA  . GLU A 1 17 ? -2.939  -3.199  -7.047  1.00 0.00 ? 17 GLU A CA  14 
ATOM   7550 C  C   . GLU A 1 17 ? -4.073  -2.891  -6.077  1.00 0.00 ? 17 GLU A C   14 
ATOM   7551 O  O   . GLU A 1 17 ? -4.857  -3.775  -5.739  1.00 0.00 ? 17 GLU A O   14 
ATOM   7552 C  CB  . GLU A 1 17 ? -3.470  -3.828  -8.334  1.00 0.00 ? 17 GLU A CB  14 
ATOM   7553 C  CG  . GLU A 1 17 ? -4.133  -2.756  -9.195  1.00 0.00 ? 17 GLU A CG  14 
ATOM   7554 C  CD  . GLU A 1 17 ? -4.697  -3.317  -10.495 1.00 0.00 ? 17 GLU A CD  14 
ATOM   7555 O  OE1 . GLU A 1 17 ? -5.395  -4.348  -10.410 1.00 0.00 ? 17 GLU A OE1 14 
ATOM   7556 O  OE2 . GLU A 1 17 ? -4.433  -2.692  -11.543 1.00 0.00 ? 17 GLU A OE2 14 
ATOM   7557 N  N   . ALA A 1 18 ? -4.184  -1.627  -5.672  1.00 0.00 ? 18 ALA A N   14 
ATOM   7558 C  CA  . ALA A 1 18 ? -5.281  -1.108  -4.868  1.00 0.00 ? 18 ALA A CA  14 
ATOM   7559 C  C   . ALA A 1 18 ? -6.626  -1.597  -5.405  1.00 0.00 ? 18 ALA A C   14 
ATOM   7560 O  O   . ALA A 1 18 ? -7.495  -2.015  -4.643  1.00 0.00 ? 18 ALA A O   14 
ATOM   7561 C  CB  . ALA A 1 18 ? -5.224  0.422   -4.880  1.00 0.00 ? 18 ALA A CB  14 
ATOM   7562 N  N   . ALA A 1 19 ? -6.791  -1.562  -6.730  1.00 0.00 ? 19 ALA A N   14 
ATOM   7563 C  CA  . ALA A 1 19 ? -7.993  -2.037  -7.396  1.00 0.00 ? 19 ALA A CA  14 
ATOM   7564 C  C   . ALA A 1 19 ? -8.377  -3.461  -6.988  1.00 0.00 ? 19 ALA A C   14 
ATOM   7565 O  O   . ALA A 1 19 ? -9.569  -3.723  -6.823  1.00 0.00 ? 19 ALA A O   14 
ATOM   7566 C  CB  . ALA A 1 19 ? -7.849  -1.934  -8.914  1.00 0.00 ? 19 ALA A CB  14 
ATOM   7567 N  N   . ASP A 1 20 ? -7.408  -4.370  -6.791  1.00 0.00 ? 20 ASP A N   14 
ATOM   7568 C  CA  . ASP A 1 20 ? -7.727  -5.715  -6.310  1.00 0.00 ? 20 ASP A CA  14 
ATOM   7569 C  C   . ASP A 1 20 ? -8.577  -5.645  -5.035  1.00 0.00 ? 20 ASP A C   14 
ATOM   7570 O  O   . ASP A 1 20 ? -9.564  -6.361  -4.872  1.00 0.00 ? 20 ASP A O   14 
ATOM   7571 C  CB  . ASP A 1 20 ? -6.463  -6.535  -6.051  1.00 0.00 ? 20 ASP A CB  14 
ATOM   7572 C  CG  . ASP A 1 20 ? -6.831  -7.997  -5.836  1.00 0.00 ? 20 ASP A CG  14 
ATOM   7573 O  OD1 . ASP A 1 20 ? -7.154  -8.339  -4.681  1.00 0.00 ? 20 ASP A OD1 14 
ATOM   7574 O  OD2 . ASP A 1 20 ? -6.808  -8.741  -6.839  1.00 0.00 ? 20 ASP A OD2 14 
ATOM   7575 N  N   . ALA A 1 21 ? -8.242  -4.693  -4.157  1.00 0.00 ? 21 ALA A N   14 
ATOM   7576 C  CA  . ALA A 1 21 ? -8.920  -4.524  -2.882  1.00 0.00 ? 21 ALA A CA  14 
ATOM   7577 C  C   . ALA A 1 21 ? -10.316 -3.916  -3.037  1.00 0.00 ? 21 ALA A C   14 
ATOM   7578 O  O   . ALA A 1 21 ? -11.000 -3.736  -2.033  1.00 0.00 ? 21 ALA A O   14 
ATOM   7579 C  CB  . ALA A 1 21 ? -8.064  -3.695  -1.914  1.00 0.00 ? 21 ALA A CB  14 
ATOM   7580 N  N   . SER A 1 22 ? -10.798 -3.645  -4.257  1.00 0.00 ? 22 SER A N   14 
ATOM   7581 C  CA  . SER A 1 22 ? -12.122 -3.062  -4.461  1.00 0.00 ? 22 SER A CA  14 
ATOM   7582 C  C   . SER A 1 22 ? -13.283 -3.977  -4.068  1.00 0.00 ? 22 SER A C   14 
ATOM   7583 O  O   . SER A 1 22 ? -14.437 -3.556  -4.130  1.00 0.00 ? 22 SER A O   14 
ATOM   7584 C  CB  . SER A 1 22 ? -12.271 -2.544  -5.898  1.00 0.00 ? 22 SER A CB  14 
ATOM   7585 O  OG  . SER A 1 22 ? -13.456 -1.778  -6.019  1.00 0.00 ? 22 SER A OG  14 
ATOM   7586 N  N   . GLY A 1 23 ? -12.987 -5.204  -3.648  1.00 0.00 ? 23 GLY A N   14 
ATOM   7587 C  CA  . GLY A 1 23 ? -13.947 -6.118  -3.043  1.00 0.00 ? 23 GLY A CA  14 
ATOM   7588 C  C   . GLY A 1 23 ? -14.056 -5.928  -1.526  1.00 0.00 ? 23 GLY A C   14 
ATOM   7589 O  O   . GLY A 1 23 ? -14.924 -6.524  -0.895  1.00 0.00 ? 23 GLY A O   14 
ATOM   7590 N  N   . HIS A 1 24 ? -13.161 -5.139  -0.921  1.00 0.00 ? 24 HIS A N   14 
ATOM   7591 C  CA  . HIS A 1 24 ? -12.995 -5.020  0.519   1.00 0.00 ? 24 HIS A CA  14 
ATOM   7592 C  C   . HIS A 1 24 ? -13.796 -3.826  1.054   1.00 0.00 ? 24 HIS A C   14 
ATOM   7593 O  O   . HIS A 1 24 ? -13.379 -2.692  0.830   1.00 0.00 ? 24 HIS A O   14 
ATOM   7594 C  CB  . HIS A 1 24 ? -11.494 -4.798  0.783   1.00 0.00 ? 24 HIS A CB  14 
ATOM   7595 C  CG  . HIS A 1 24 ? -11.014 -5.066  2.189   1.00 0.00 ? 24 HIS A CG  14 
ATOM   7596 N  ND1 . HIS A 1 24 ? -11.644 -4.717  3.371   1.00 0.00 ? 24 HIS A ND1 14 
ATOM   7597 C  CD2 . HIS A 1 24 ? -9.779  -5.562  2.503   1.00 0.00 ? 24 HIS A CD2 14 
ATOM   7598 C  CE1 . HIS A 1 24 ? -10.800 -4.986  4.383   1.00 0.00 ? 24 HIS A CE1 14 
ATOM   7599 N  NE2 . HIS A 1 24 ? -9.668  -5.511  3.879   1.00 0.00 ? 24 HIS A NE2 14 
ATOM   7600 N  N   . PRO A 1 25 ? -14.864 -4.011  1.846   1.00 0.00 ? 25 PRO A N   14 
ATOM   7601 C  CA  . PRO A 1 25 ? -15.403 -2.904  2.623   1.00 0.00 ? 25 PRO A CA  14 
ATOM   7602 C  C   . PRO A 1 25 ? -14.285 -2.404  3.547   1.00 0.00 ? 25 PRO A C   14 
ATOM   7603 O  O   . PRO A 1 25 ? -13.738 -3.224  4.283   1.00 0.00 ? 25 PRO A O   14 
ATOM   7604 C  CB  . PRO A 1 25 ? -16.593 -3.458  3.415   1.00 0.00 ? 25 PRO A CB  14 
ATOM   7605 C  CG  . PRO A 1 25 ? -16.687 -4.949  3.070   1.00 0.00 ? 25 PRO A CG  14 
ATOM   7606 C  CD  . PRO A 1 25 ? -15.446 -5.281  2.238   1.00 0.00 ? 25 PRO A CD  14 
ATOM   7607 N  N   . ARG A 1 26 ? -13.898 -1.124  3.432   1.00 0.00 ? 26 ARG A N   14 
ATOM   7608 C  CA  . ARG A 1 26 ? -12.718 -0.453  4.006   1.00 0.00 ? 26 ARG A CA  14 
ATOM   7609 C  C   . ARG A 1 26 ? -11.905 0.157   2.864   1.00 0.00 ? 26 ARG A C   14 
ATOM   7610 O  O   . ARG A 1 26 ? -11.394 1.272   2.989   1.00 0.00 ? 26 ARG A O   14 
ATOM   7611 C  CB  . ARG A 1 26 ? -11.831 -1.374  4.862   1.00 0.00 ? 26 ARG A CB  14 
ATOM   7612 C  CG  . ARG A 1 26 ? -10.542 -0.772  5.435   1.00 0.00 ? 26 ARG A CG  14 
ATOM   7613 C  CD  . ARG A 1 26 ? -10.722 0.480   6.296   1.00 0.00 ? 26 ARG A CD  14 
ATOM   7614 N  NE  . ARG A 1 26 ? -9.469  0.746   7.024   1.00 0.00 ? 26 ARG A NE  14 
ATOM   7615 C  CZ  . ARG A 1 26 ? -8.603  1.760   6.857   1.00 0.00 ? 26 ARG A CZ  14 
ATOM   7616 N  NH1 . ARG A 1 26 ? -8.846  2.784   6.038   1.00 0.00 ? 26 ARG A NH1 14 
ATOM   7617 N  NH2 . ARG A 1 26 ? -7.449  1.737   7.519   1.00 0.00 ? 26 ARG A NH2 14 
ATOM   7618 N  N   . TYR A 1 27 ? -11.786 -0.572  1.749   1.00 0.00 ? 27 TYR A N   14 
ATOM   7619 C  CA  . TYR A 1 27 ? -11.284 0.023   0.527   1.00 0.00 ? 27 TYR A CA  14 
ATOM   7620 C  C   . TYR A 1 27 ? -12.285 1.074   0.064   1.00 0.00 ? 27 TYR A C   14 
ATOM   7621 O  O   . TYR A 1 27 ? -13.490 0.941   0.280   1.00 0.00 ? 27 TYR A O   14 
ATOM   7622 C  CB  . TYR A 1 27 ? -10.994 -1.027  -0.554  1.00 0.00 ? 27 TYR A CB  14 
ATOM   7623 C  CG  . TYR A 1 27 ? -10.285 -0.432  -1.755  1.00 0.00 ? 27 TYR A CG  14 
ATOM   7624 C  CD1 . TYR A 1 27 ? -8.912  -0.161  -1.655  1.00 0.00 ? 27 TYR A CD1 14 
ATOM   7625 C  CD2 . TYR A 1 27 ? -11.008 0.082   -2.848  1.00 0.00 ? 27 TYR A CD2 14 
ATOM   7626 C  CE1 . TYR A 1 27 ? -8.302  0.755   -2.523  1.00 0.00 ? 27 TYR A CE1 14 
ATOM   7627 C  CE2 . TYR A 1 27 ? -10.363 0.897   -3.796  1.00 0.00 ? 27 TYR A CE2 14 
ATOM   7628 C  CZ  . TYR A 1 27 ? -9.035  1.310   -3.585  1.00 0.00 ? 27 TYR A CZ  14 
ATOM   7629 O  OH  . TYR A 1 27 ? -8.494  2.306   -4.347  1.00 0.00 ? 27 TYR A OH  14 
ATOM   7630 N  N   . GLN A 1 28 ? -11.752 2.130   -0.538  1.00 0.00 ? 28 GLN A N   14 
ATOM   7631 C  CA  . GLN A 1 28 ? -12.505 3.224   -1.116  1.00 0.00 ? 28 GLN A CA  14 
ATOM   7632 C  C   . GLN A 1 28 ? -11.769 3.653   -2.381  1.00 0.00 ? 28 GLN A C   14 
ATOM   7633 O  O   . GLN A 1 28 ? -10.538 3.738   -2.400  1.00 0.00 ? 28 GLN A O   14 
ATOM   7634 C  CB  . GLN A 1 28 ? -12.665 4.346   -0.083  1.00 0.00 ? 28 GLN A CB  14 
ATOM   7635 C  CG  . GLN A 1 28 ? -13.685 5.428   -0.471  1.00 0.00 ? 28 GLN A CG  14 
ATOM   7636 C  CD  . GLN A 1 28 ? -13.087 6.428   -1.455  1.00 0.00 ? 28 GLN A CD  14 
ATOM   7637 O  OE1 . GLN A 1 28 ? -12.160 7.154   -1.110  1.00 0.00 ? 28 GLN A OE1 14 
ATOM   7638 N  NE2 . GLN A 1 28 ? -13.567 6.444   -2.690  1.00 0.00 ? 28 GLN A NE2 14 
ATOM   7639 N  N   . GLU A 1 29 ? -12.545 3.861   -3.436  1.00 0.00 ? 29 GLU A N   14 
ATOM   7640 C  CA  . GLU A 1 29 ? -12.112 4.172   -4.779  1.00 0.00 ? 29 GLU A CA  14 
ATOM   7641 C  C   . GLU A 1 29 ? -11.116 5.325   -4.798  1.00 0.00 ? 29 GLU A C   14 
ATOM   7642 O  O   . GLU A 1 29 ? -11.477 6.474   -4.536  1.00 0.00 ? 29 GLU A O   14 
ATOM   7643 C  CB  . GLU A 1 29 ? -13.328 4.479   -5.670  1.00 0.00 ? 29 GLU A CB  14 
ATOM   7644 C  CG  . GLU A 1 29 ? -14.495 3.485   -5.506  1.00 0.00 ? 29 GLU A CG  14 
ATOM   7645 C  CD  . GLU A 1 29 ? -15.557 3.972   -4.521  1.00 0.00 ? 29 GLU A CD  14 
ATOM   7646 O  OE1 . GLU A 1 29 ? -15.152 4.390   -3.411  1.00 0.00 ? 29 GLU A OE1 14 
ATOM   7647 O  OE2 . GLU A 1 29 ? -16.747 3.932   -4.895  1.00 0.00 ? 29 GLU A OE2 14 
ATOM   7648 N  N   . GLY A 1 30 ? -9.868  5.004   -5.139  1.00 0.00 ? 30 GLY A N   14 
ATOM   7649 C  CA  . GLY A 1 30 ? -8.817  5.982   -5.331  1.00 0.00 ? 30 GLY A CA  14 
ATOM   7650 C  C   . GLY A 1 30 ? -7.831  5.981   -4.171  1.00 0.00 ? 30 GLY A C   14 
ATOM   7651 O  O   . GLY A 1 30 ? -6.770  6.589   -4.291  1.00 0.00 ? 30 GLY A O   14 
ATOM   7652 N  N   . GLN A 1 31 ? -8.128  5.288   -3.064  1.00 0.00 ? 31 GLN A N   14 
ATOM   7653 C  CA  . GLN A 1 31 ? -7.127  5.134   -2.023  1.00 0.00 ? 31 GLN A CA  14 
ATOM   7654 C  C   . GLN A 1 31 ? -5.974  4.310   -2.609  1.00 0.00 ? 31 GLN A C   14 
ATOM   7655 O  O   . GLN A 1 31 ? -6.198  3.176   -3.028  1.00 0.00 ? 31 GLN A O   14 
ATOM   7656 C  CB  . GLN A 1 31 ? -7.740  4.433   -0.804  1.00 0.00 ? 31 GLN A CB  14 
ATOM   7657 C  CG  . GLN A 1 31 ? -8.799  5.276   -0.075  1.00 0.00 ? 31 GLN A CG  14 
ATOM   7658 C  CD  . GLN A 1 31 ? -9.353  4.604   1.190   1.00 0.00 ? 31 GLN A CD  14 
ATOM   7659 O  OE1 . GLN A 1 31 ? -9.697  5.275   2.157   1.00 0.00 ? 31 GLN A OE1 14 
ATOM   7660 N  NE2 . GLN A 1 31 ? -9.473  3.278   1.206   1.00 0.00 ? 31 GLN A NE2 14 
ATOM   7661 N  N   . LEU A 1 32 ? -4.772  4.890   -2.666  1.00 0.00 ? 32 LEU A N   14 
ATOM   7662 C  CA  . LEU A 1 32 ? -3.538  4.260   -3.116  1.00 0.00 ? 32 LEU A CA  14 
ATOM   7663 C  C   . LEU A 1 32 ? -2.491  4.539   -2.039  1.00 0.00 ? 32 LEU A C   14 
ATOM   7664 O  O   . LEU A 1 32 ? -2.533  5.602   -1.422  1.00 0.00 ? 32 LEU A O   14 
ATOM   7665 C  CB  . LEU A 1 32 ? -3.054  4.899   -4.430  1.00 0.00 ? 32 LEU A CB  14 
ATOM   7666 C  CG  . LEU A 1 32 ? -3.306  4.091   -5.708  1.00 0.00 ? 32 LEU A CG  14 
ATOM   7667 C  CD1 . LEU A 1 32 ? -4.765  4.014   -6.145  1.00 0.00 ? 32 LEU A CD1 14 
ATOM   7668 C  CD2 . LEU A 1 32 ? -2.538  4.774   -6.849  1.00 0.00 ? 32 LEU A CD2 14 
ATOM   7669 N  N   . CYS A 1 33 ? -1.532  3.636   -1.847  1.00 0.00 ? 33 CYS A N   14 
ATOM   7670 C  CA  . CYS A 1 33 ? -0.405  3.822   -0.942  1.00 0.00 ? 33 CYS A CA  14 
ATOM   7671 C  C   . CYS A 1 33 ? 0.234   5.206   -1.100  1.00 0.00 ? 33 CYS A C   14 
ATOM   7672 O  O   . CYS A 1 33 ? 0.452   5.904   -0.115  1.00 0.00 ? 33 CYS A O   14 
ATOM   7673 C  CB  . CYS A 1 33 ? 0.599   2.724   -1.167  1.00 0.00 ? 33 CYS A CB  14 
ATOM   7674 S  SG  . CYS A 1 33 ? 0.110   1.216   -0.281  1.00 0.00 ? 33 CYS A SG  14 
ATOM   7675 N  N   . GLU A 1 34 ? 0.502   5.663   -2.325  1.00 0.00 ? 34 GLU A N   14 
ATOM   7676 C  CA  . GLU A 1 34 ? 1.126   6.974   -2.476  1.00 0.00 ? 34 GLU A CA  14 
ATOM   7677 C  C   . GLU A 1 34 ? 0.274   8.144   -1.943  1.00 0.00 ? 34 GLU A C   14 
ATOM   7678 O  O   . GLU A 1 34 ? 0.811   9.231   -1.733  1.00 0.00 ? 34 GLU A O   14 
ATOM   7679 C  CB  . GLU A 1 34 ? 1.630   7.171   -3.905  1.00 0.00 ? 34 GLU A CB  14 
ATOM   7680 C  CG  . GLU A 1 34 ? 0.512   7.419   -4.920  1.00 0.00 ? 34 GLU A CG  14 
ATOM   7681 C  CD  . GLU A 1 34 ? 1.039   7.678   -6.329  1.00 0.00 ? 34 GLU A CD  14 
ATOM   7682 O  OE1 . GLU A 1 34 ? 2.269   7.548   -6.521  1.00 0.00 ? 34 GLU A OE1 14 
ATOM   7683 O  OE2 . GLU A 1 34 ? 0.197   8.016   -7.186  1.00 0.00 ? 34 GLU A OE2 14 
ATOM   7684 N  N   . ASN A 1 35 ? -1.032  7.938   -1.704  1.00 0.00 ? 35 ASN A N   14 
ATOM   7685 C  CA  . ASN A 1 35 ? -1.923  8.906   -1.061  1.00 0.00 ? 35 ASN A CA  14 
ATOM   7686 C  C   . ASN A 1 35 ? -2.361  8.451   0.340   1.00 0.00 ? 35 ASN A C   14 
ATOM   7687 O  O   . ASN A 1 35 ? -3.381  8.914   0.852   1.00 0.00 ? 35 ASN A O   14 
ATOM   7688 C  CB  . ASN A 1 35 ? -3.106  9.256   -1.983  1.00 0.00 ? 35 ASN A CB  14 
ATOM   7689 C  CG  . ASN A 1 35 ? -4.117  8.146   -2.230  1.00 0.00 ? 35 ASN A CG  14 
ATOM   7690 O  OD1 . ASN A 1 35 ? -4.628  7.503   -1.319  1.00 0.00 ? 35 ASN A OD1 14 
ATOM   7691 N  ND2 . ASN A 1 35 ? -4.469  7.943   -3.490  1.00 0.00 ? 35 ASN A ND2 14 
ATOM   7692 N  N   . CYS A 1 36 ? -1.572  7.578   0.974   1.00 0.00 ? 36 CYS A N   14 
ATOM   7693 C  CA  . CYS A 1 36 ? -1.732  7.146   2.355   1.00 0.00 ? 36 CYS A CA  14 
ATOM   7694 C  C   . CYS A 1 36 ? -0.916  8.081   3.246   1.00 0.00 ? 36 CYS A C   14 
ATOM   7695 O  O   . CYS A 1 36 ? 0.230   8.404   2.934   1.00 0.00 ? 36 CYS A O   14 
ATOM   7696 C  CB  . CYS A 1 36 ? -1.213  5.739   2.433   1.00 0.00 ? 36 CYS A CB  14 
ATOM   7697 S  SG  . CYS A 1 36 ? -1.415  4.928   4.020   1.00 0.00 ? 36 CYS A SG  14 
ATOM   7698 N  N   . ALA A 1 37 ? -1.478  8.526   4.367   1.00 0.00 ? 37 ALA A N   14 
ATOM   7699 C  CA  . ALA A 1 37 ? -0.806  9.442   5.280   1.00 0.00 ? 37 ALA A CA  14 
ATOM   7700 C  C   . ALA A 1 37 ? 0.500   8.869   5.834   1.00 0.00 ? 37 ALA A C   14 
ATOM   7701 O  O   . ALA A 1 37 ? 1.374   9.633   6.237   1.00 0.00 ? 37 ALA A O   14 
ATOM   7702 C  CB  . ALA A 1 37 ? -1.759  9.838   6.405   1.00 0.00 ? 37 ALA A CB  14 
ATOM   7703 N  N   . PHE A 1 38 ? 0.655   7.540   5.856   1.00 0.00 ? 38 PHE A N   14 
ATOM   7704 C  CA  . PHE A 1 38 ? 1.904   6.923   6.281   1.00 0.00 ? 38 PHE A CA  14 
ATOM   7705 C  C   . PHE A 1 38 ? 3.005   7.038   5.223   1.00 0.00 ? 38 PHE A C   14 
ATOM   7706 O  O   . PHE A 1 38 ? 4.156   6.746   5.544   1.00 0.00 ? 38 PHE A O   14 
ATOM   7707 C  CB  . PHE A 1 38 ? 1.671   5.456   6.669   1.00 0.00 ? 38 PHE A CB  14 
ATOM   7708 C  CG  . PHE A 1 38 ? 0.831   5.265   7.919   1.00 0.00 ? 38 PHE A CG  14 
ATOM   7709 C  CD1 . PHE A 1 38 ? 1.325   5.699   9.164   1.00 0.00 ? 38 PHE A CD1 14 
ATOM   7710 C  CD2 . PHE A 1 38 ? -0.436  4.656   7.847   1.00 0.00 ? 38 PHE A CD2 14 
ATOM   7711 C  CE1 . PHE A 1 38 ? 0.544   5.553   10.325  1.00 0.00 ? 38 PHE A CE1 14 
ATOM   7712 C  CE2 . PHE A 1 38 ? -1.209  4.494   9.011   1.00 0.00 ? 38 PHE A CE2 14 
ATOM   7713 C  CZ  . PHE A 1 38 ? -0.724  4.950   10.248  1.00 0.00 ? 38 PHE A CZ  14 
ATOM   7714 N  N   . TRP A 1 39 ? 2.686   7.406   3.977   1.00 0.00 ? 39 TRP A N   14 
ATOM   7715 C  CA  . TRP A 1 39 ? 3.644   7.352   2.880   1.00 0.00 ? 39 TRP A CA  14 
ATOM   7716 C  C   . TRP A 1 39 ? 4.958   8.077   3.201   1.00 0.00 ? 39 TRP A C   14 
ATOM   7717 O  O   . TRP A 1 39 ? 4.966   9.176   3.751   1.00 0.00 ? 39 TRP A O   14 
ATOM   7718 C  CB  . TRP A 1 39 ? 3.029   7.889   1.588   1.00 0.00 ? 39 TRP A CB  14 
ATOM   7719 C  CG  . TRP A 1 39 ? 3.906   7.703   0.390   1.00 0.00 ? 39 TRP A CG  14 
ATOM   7720 C  CD1 . TRP A 1 39 ? 4.675   8.658   -0.178  1.00 0.00 ? 39 TRP A CD1 14 
ATOM   7721 C  CD2 . TRP A 1 39 ? 4.161   6.479   -0.365  1.00 0.00 ? 39 TRP A CD2 14 
ATOM   7722 N  NE1 . TRP A 1 39 ? 5.364   8.120   -1.244  1.00 0.00 ? 39 TRP A NE1 14 
ATOM   7723 C  CE2 . TRP A 1 39 ? 5.051   6.793   -1.431  1.00 0.00 ? 39 TRP A CE2 14 
ATOM   7724 C  CE3 . TRP A 1 39 ? 3.723   5.139   -0.273  1.00 0.00 ? 39 TRP A CE3 14 
ATOM   7725 C  CZ2 . TRP A 1 39 ? 5.452   5.848   -2.381  1.00 0.00 ? 39 TRP A CZ2 14 
ATOM   7726 C  CZ3 . TRP A 1 39 ? 4.175   4.166   -1.185  1.00 0.00 ? 39 TRP A CZ3 14 
ATOM   7727 C  CH2 . TRP A 1 39 ? 5.021   4.522   -2.246  1.00 0.00 ? 39 TRP A CH2 14 
ATOM   7728 N  N   . GLY A 1 40 ? 6.070   7.435   2.842   1.00 0.00 ? 40 GLY A N   14 
ATOM   7729 C  CA  . GLY A 1 40 ? 7.425   7.912   3.035   1.00 0.00 ? 40 GLY A CA  14 
ATOM   7730 C  C   . GLY A 1 40 ? 7.866   8.748   1.844   1.00 0.00 ? 40 GLY A C   14 
ATOM   7731 O  O   . GLY A 1 40 ? 8.124   9.943   1.966   1.00 0.00 ? 40 GLY A O   14 
ATOM   7732 N  N   . GLU A 1 41 ? 7.993   8.087   0.694   1.00 0.00 ? 41 GLU A N   14 
ATOM   7733 C  CA  . GLU A 1 41 ? 8.750   8.559   -0.453  1.00 0.00 ? 41 GLU A CA  14 
ATOM   7734 C  C   . GLU A 1 41 ? 8.581   7.510   -1.545  1.00 0.00 ? 41 GLU A C   14 
ATOM   7735 O  O   . GLU A 1 41 ? 8.372   6.339   -1.216  1.00 0.00 ? 41 GLU A O   14 
ATOM   7736 C  CB  . GLU A 1 41 ? 10.239  8.695   -0.080  1.00 0.00 ? 41 GLU A CB  14 
ATOM   7737 C  CG  . GLU A 1 41 ? 10.785  7.311   0.281   1.00 0.00 ? 41 GLU A CG  14 
ATOM   7738 C  CD  . GLU A 1 41 ? 12.135  7.342   0.980   1.00 0.00 ? 41 GLU A CD  14 
ATOM   7739 O  OE1 . GLU A 1 41 ? 13.101  7.795   0.332   1.00 0.00 ? 41 GLU A OE1 14 
ATOM   7740 O  OE2 . GLU A 1 41 ? 12.178  6.876   2.140   1.00 0.00 ? 41 GLU A OE2 14 
ATOM   7741 N  N   . ALA A 1 42 ? 8.705   7.908   -2.812  1.00 0.00 ? 42 ALA A N   14 
ATOM   7742 C  CA  . ALA A 1 42 ? 8.842   6.961   -3.909  1.00 0.00 ? 42 ALA A CA  14 
ATOM   7743 C  C   . ALA A 1 42 ? 10.324  6.679   -4.141  1.00 0.00 ? 42 ALA A C   14 
ATOM   7744 O  O   . ALA A 1 42 ? 11.140  7.598   -4.139  1.00 0.00 ? 42 ALA A O   14 
ATOM   7745 C  CB  . ALA A 1 42 ? 8.146   7.474   -5.169  1.00 0.00 ? 42 ALA A CB  14 
ATOM   7746 N  N   . VAL A 1 43 ? 10.653  5.400   -4.306  1.00 0.00 ? 43 VAL A N   14 
ATOM   7747 C  CA  . VAL A 1 43 ? 12.005  4.870   -4.377  1.00 0.00 ? 43 VAL A CA  14 
ATOM   7748 C  C   . VAL A 1 43 ? 12.281  4.311   -5.780  1.00 0.00 ? 43 VAL A C   14 
ATOM   7749 O  O   . VAL A 1 43 ? 13.395  4.435   -6.284  1.00 0.00 ? 43 VAL A O   14 
ATOM   7750 C  CB  . VAL A 1 43 ? 12.145  3.758   -3.322  1.00 0.00 ? 43 VAL A CB  14 
ATOM   7751 C  CG1 . VAL A 1 43 ? 13.531  3.097   -3.359  1.00 0.00 ? 43 VAL A CG1 14 
ATOM   7752 C  CG2 . VAL A 1 43 ? 11.877  4.227   -1.883  1.00 0.00 ? 43 VAL A CG2 14 
ATOM   7753 N  N   . GLN A 1 44 ? 11.295  3.639   -6.384  1.00 0.00 ? 44 GLN A N   14 
ATOM   7754 C  CA  . GLN A 1 44 ? 11.460  2.858   -7.610  1.00 0.00 ? 44 GLN A CA  14 
ATOM   7755 C  C   . GLN A 1 44 ? 10.174  2.910   -8.449  1.00 0.00 ? 44 GLN A C   14 
ATOM   7756 O  O   . GLN A 1 44 ? 9.266   3.669   -8.119  1.00 0.00 ? 44 GLN A O   14 
ATOM   7757 C  CB  . GLN A 1 44 ? 11.898  1.427   -7.226  1.00 0.00 ? 44 GLN A CB  14 
ATOM   7758 C  CG  . GLN A 1 44 ? 13.347  1.153   -7.651  1.00 0.00 ? 44 GLN A CG  14 
ATOM   7759 C  CD  . GLN A 1 44 ? 13.898  -0.106  -6.985  1.00 0.00 ? 44 GLN A CD  14 
ATOM   7760 O  OE1 . GLN A 1 44 ? 13.738  -1.214  -7.491  1.00 0.00 ? 44 GLN A OE1 14 
ATOM   7761 N  NE2 . GLN A 1 44 ? 14.546  0.042   -5.834  1.00 0.00 ? 44 GLN A NE2 14 
ATOM   7762 N  N   . ASP A 1 45 ? 10.115  2.120   -9.530  1.00 0.00 ? 45 ASP A N   14 
ATOM   7763 C  CA  . ASP A 1 45 ? 9.106   2.043   -10.593 1.00 0.00 ? 45 ASP A CA  14 
ATOM   7764 C  C   . ASP A 1 45 ? 7.677   1.863   -10.073 1.00 0.00 ? 45 ASP A C   14 
ATOM   7765 O  O   . ASP A 1 45 ? 7.051   0.813   -10.197 1.00 0.00 ? 45 ASP A O   14 
ATOM   7766 C  CB  . ASP A 1 45 ? 9.498   0.934   -11.591 1.00 0.00 ? 45 ASP A CB  14 
ATOM   7767 C  CG  . ASP A 1 45 ? 9.895   -0.366  -10.907 1.00 0.00 ? 45 ASP A CG  14 
ATOM   7768 O  OD1 . ASP A 1 45 ? 10.944  -0.337  -10.225 1.00 0.00 ? 45 ASP A OD1 14 
ATOM   7769 O  OD2 . ASP A 1 45 ? 9.178   -1.382  -11.029 1.00 0.00 ? 45 ASP A OD2 14 
ATOM   7770 N  N   . GLY A 1 46 ? 7.157   2.939   -9.496  1.00 0.00 ? 46 GLY A N   14 
ATOM   7771 C  CA  . GLY A 1 46 ? 5.884   2.945   -8.803  1.00 0.00 ? 46 GLY A CA  14 
ATOM   7772 C  C   . GLY A 1 46 ? 5.993   2.129   -7.520  1.00 0.00 ? 46 GLY A C   14 
ATOM   7773 O  O   . GLY A 1 46 ? 5.051   1.443   -7.144  1.00 0.00 ? 46 GLY A O   14 
ATOM   7774 N  N   . TRP A 1 47 ? 7.136   2.201   -6.837  1.00 0.00 ? 47 TRP A N   14 
ATOM   7775 C  CA  . TRP A 1 47 ? 7.373   1.634   -5.534  1.00 0.00 ? 47 TRP A CA  14 
ATOM   7776 C  C   . TRP A 1 47 ? 7.972   2.697   -4.640  1.00 0.00 ? 47 TRP A C   14 
ATOM   7777 O  O   . TRP A 1 47 ? 8.735   3.549   -5.101  1.00 0.00 ? 47 TRP A O   14 
ATOM   7778 C  CB  . TRP A 1 47 ? 8.369   0.491   -5.638  1.00 0.00 ? 47 TRP A CB  14 
ATOM   7779 C  CG  . TRP A 1 47 ? 7.951   -0.663  -6.477  1.00 0.00 ? 47 TRP A CG  14 
ATOM   7780 C  CD1 . TRP A 1 47 ? 8.179   -0.813  -7.797  1.00 0.00 ? 47 TRP A CD1 14 
ATOM   7781 C  CD2 . TRP A 1 47 ? 7.202   -1.832  -6.060  1.00 0.00 ? 47 TRP A CD2 14 
ATOM   7782 N  NE1 . TRP A 1 47 ? 7.582   -1.975  -8.235  1.00 0.00 ? 47 TRP A NE1 14 
ATOM   7783 C  CE2 . TRP A 1 47 ? 6.959   -2.646  -7.202  1.00 0.00 ? 47 TRP A CE2 14 
ATOM   7784 C  CE3 . TRP A 1 47 ? 6.731   -2.295  -4.818  1.00 0.00 ? 47 TRP A CE3 14 
ATOM   7785 C  CZ2 . TRP A 1 47 ? 6.230   -3.839  -7.119  1.00 0.00 ? 47 TRP A CZ2 14 
ATOM   7786 C  CZ3 . TRP A 1 47 ? 5.960   -3.466  -4.730  1.00 0.00 ? 47 TRP A CZ3 14 
ATOM   7787 C  CH2 . TRP A 1 47 ? 5.661   -4.200  -5.888  1.00 0.00 ? 47 TRP A CH2 14 
ATOM   7788 N  N   . GLY A 1 48 ? 7.671   2.616   -3.352  1.00 0.00 ? 48 GLY A N   14 
ATOM   7789 C  CA  . GLY A 1 48 ? 8.195   3.519   -2.366  1.00 0.00 ? 48 GLY A CA  14 
ATOM   7790 C  C   . GLY A 1 48 ? 7.979   2.974   -0.972  1.00 0.00 ? 48 GLY A C   14 
ATOM   7791 O  O   . GLY A 1 48 ? 7.529   1.845   -0.806  1.00 0.00 ? 48 GLY A O   14 
ATOM   7792 N  N   . ARG A 1 49 ? 8.348   3.752   0.038   1.00 0.00 ? 49 ARG A N   14 
ATOM   7793 C  CA  . ARG A 1 49 ? 8.172   3.360   1.421   1.00 0.00 ? 49 ARG A CA  14 
ATOM   7794 C  C   . ARG A 1 49 ? 6.889   3.961   1.982   1.00 0.00 ? 49 ARG A C   14 
ATOM   7795 O  O   . ARG A 1 49 ? 6.509   5.053   1.563   1.00 0.00 ? 49 ARG A O   14 
ATOM   7796 C  CB  . ARG A 1 49 ? 9.372   3.902   2.182   1.00 0.00 ? 49 ARG A CB  14 
ATOM   7797 C  CG  . ARG A 1 49 ? 10.633  3.208   1.686   1.00 0.00 ? 49 ARG A CG  14 
ATOM   7798 C  CD  . ARG A 1 49 ? 11.833  3.683   2.492   1.00 0.00 ? 49 ARG A CD  14 
ATOM   7799 N  NE  . ARG A 1 49 ? 12.301  2.616   3.397   1.00 0.00 ? 49 ARG A NE  14 
ATOM   7800 C  CZ  . ARG A 1 49 ? 11.783  2.250   4.578   1.00 0.00 ? 49 ARG A CZ  14 
ATOM   7801 N  NH1 . ARG A 1 49 ? 10.926  3.039   5.227   1.00 0.00 ? 49 ARG A NH1 14 
ATOM   7802 N  NH2 . ARG A 1 49 ? 12.151  1.067   5.072   1.00 0.00 ? 49 ARG A NH2 14 
ATOM   7803 N  N   . CYS A 1 50 ? 6.288   3.301   2.980   1.00 0.00 ? 50 CYS A N   14 
ATOM   7804 C  CA  . CYS A 1 50 ? 5.389   3.930   3.933   1.00 0.00 ? 50 CYS A CA  14 
ATOM   7805 C  C   . CYS A 1 50 ? 5.926   3.666   5.338   1.00 0.00 ? 50 CYS A C   14 
ATOM   7806 O  O   . CYS A 1 50 ? 6.457   2.596   5.627   1.00 0.00 ? 50 CYS A O   14 
ATOM   7807 C  CB  . CYS A 1 50 ? 3.953   3.546   3.678   1.00 0.00 ? 50 CYS A CB  14 
ATOM   7808 S  SG  . CYS A 1 50 ? 3.403   2.006   4.451   1.00 0.00 ? 50 CYS A SG  14 
ATOM   7809 N  N   . THR A 1 51 ? 5.920   4.702   6.176   1.00 0.00 ? 51 THR A N   14 
ATOM   7810 C  CA  . THR A 1 51 ? 6.712   4.795   7.394   1.00 0.00 ? 51 THR A CA  14 
ATOM   7811 C  C   . THR A 1 51 ? 6.041   4.027   8.534   1.00 0.00 ? 51 THR A C   14 
ATOM   7812 O  O   . THR A 1 51 ? 5.740   4.582   9.589   1.00 0.00 ? 51 THR A O   14 
ATOM   7813 C  CB  . THR A 1 51 ? 6.943   6.279   7.729   1.00 0.00 ? 51 THR A CB  14 
ATOM   7814 O  OG1 . THR A 1 51 ? 5.728   7.006   7.794   1.00 0.00 ? 51 THR A OG1 14 
ATOM   7815 C  CG2 . THR A 1 51 ? 7.839   6.935   6.676   1.00 0.00 ? 51 THR A CG2 14 
ATOM   7816 N  N   . HIS A 1 52 ? 5.779   2.738   8.320   1.00 0.00 ? 52 HIS A N   14 
ATOM   7817 C  CA  . HIS A 1 52 ? 4.965   1.959   9.229   1.00 0.00 ? 52 HIS A CA  14 
ATOM   7818 C  C   . HIS A 1 52 ? 5.308   0.468   9.125   1.00 0.00 ? 52 HIS A C   14 
ATOM   7819 O  O   . HIS A 1 52 ? 4.789   -0.203  8.234   1.00 0.00 ? 52 HIS A O   14 
ATOM   7820 C  CB  . HIS A 1 52 ? 3.487   2.235   8.921   1.00 0.00 ? 52 HIS A CB  14 
ATOM   7821 C  CG  . HIS A 1 52 ? 2.582   1.432   9.813   1.00 0.00 ? 52 HIS A CG  14 
ATOM   7822 N  ND1 . HIS A 1 52 ? 2.559   1.502   11.194  1.00 0.00 ? 52 HIS A ND1 14 
ATOM   7823 C  CD2 . HIS A 1 52 ? 1.969   0.275   9.436   1.00 0.00 ? 52 HIS A CD2 14 
ATOM   7824 C  CE1 . HIS A 1 52 ? 1.946   0.392   11.647  1.00 0.00 ? 52 HIS A CE1 14 
ATOM   7825 N  NE2 . HIS A 1 52 ? 1.580   -0.362  10.595  1.00 0.00 ? 52 HIS A NE2 14 
ATOM   7826 N  N   . PRO A 1 53 ? 6.132   -0.064  10.047  1.00 0.00 ? 53 PRO A N   14 
ATOM   7827 C  CA  . PRO A 1 53 ? 6.376   -1.492  10.188  1.00 0.00 ? 53 PRO A CA  14 
ATOM   7828 C  C   . PRO A 1 53 ? 5.071   -2.290  10.149  1.00 0.00 ? 53 PRO A C   14 
ATOM   7829 O  O   . PRO A 1 53 ? 4.102   -1.904  10.803  1.00 0.00 ? 53 PRO A O   14 
ATOM   7830 C  CB  . PRO A 1 53 ? 7.122   -1.654  11.515  1.00 0.00 ? 53 PRO A CB  14 
ATOM   7831 C  CG  . PRO A 1 53 ? 7.888   -0.336  11.621  1.00 0.00 ? 53 PRO A CG  14 
ATOM   7832 C  CD  . PRO A 1 53 ? 6.891   0.672   11.046  1.00 0.00 ? 53 PRO A CD  14 
ATOM   7833 N  N   . ASP A 1 54 ? 5.071   -3.341  9.324   1.00 0.00 ? 54 ASP A N   14 
ATOM   7834 C  CA  . ASP A 1 54 ? 3.957   -3.992  8.633   1.00 0.00 ? 54 ASP A CA  14 
ATOM   7835 C  C   . ASP A 1 54 ? 4.267   -3.827  7.147   1.00 0.00 ? 54 ASP A C   14 
ATOM   7836 O  O   . ASP A 1 54 ? 4.142   -4.765  6.365   1.00 0.00 ? 54 ASP A O   14 
ATOM   7837 C  CB  . ASP A 1 54 ? 2.569   -3.359  8.856   1.00 0.00 ? 54 ASP A CB  14 
ATOM   7838 C  CG  . ASP A 1 54 ? 1.829   -3.781  10.107  1.00 0.00 ? 54 ASP A CG  14 
ATOM   7839 O  OD1 . ASP A 1 54 ? 1.781   -4.995  10.394  1.00 0.00 ? 54 ASP A OD1 14 
ATOM   7840 O  OD2 . ASP A 1 54 ? 1.060   -2.939  10.623  1.00 0.00 ? 54 ASP A OD2 14 
ATOM   7841 N  N   . PHE A 1 55 ? 4.622   -2.592  6.782   1.00 0.00 ? 55 PHE A N   14 
ATOM   7842 C  CA  . PHE A 1 55 ? 4.820   -2.122  5.427   1.00 0.00 ? 55 PHE A CA  14 
ATOM   7843 C  C   . PHE A 1 55 ? 6.067   -1.238  5.336   1.00 0.00 ? 55 PHE A C   14 
ATOM   7844 O  O   . PHE A 1 55 ? 6.115   -0.333  4.507   1.00 0.00 ? 55 PHE A O   14 
ATOM   7845 C  CB  . PHE A 1 55 ? 3.542   -1.376  5.019   1.00 0.00 ? 55 PHE A CB  14 
ATOM   7846 C  CG  . PHE A 1 55 ? 2.342   -2.299  4.935   1.00 0.00 ? 55 PHE A CG  14 
ATOM   7847 C  CD1 . PHE A 1 55 ? 2.381   -3.328  3.977   1.00 0.00 ? 55 PHE A CD1 14 
ATOM   7848 C  CD2 . PHE A 1 55 ? 1.265   -2.229  5.848   1.00 0.00 ? 55 PHE A CD2 14 
ATOM   7849 C  CE1 . PHE A 1 55 ? 1.401   -4.327  3.969   1.00 0.00 ? 55 PHE A CE1 14 
ATOM   7850 C  CE2 . PHE A 1 55 ? 0.286   -3.231  5.832   1.00 0.00 ? 55 PHE A CE2 14 
ATOM   7851 C  CZ  . PHE A 1 55 ? 0.350   -4.272  4.894   1.00 0.00 ? 55 PHE A CZ  14 
ATOM   7852 N  N   . ASP A 1 56 ? 7.080   -1.516  6.165   1.00 0.00 ? 56 ASP A N   14 
ATOM   7853 C  CA  . ASP A 1 56 ? 8.371   -0.829  6.127   1.00 0.00 ? 56 ASP A CA  14 
ATOM   7854 C  C   . ASP A 1 56 ? 9.466   -1.809  5.694   1.00 0.00 ? 56 ASP A C   14 
ATOM   7855 O  O   . ASP A 1 56 ? 10.320  -1.476  4.873   1.00 0.00 ? 56 ASP A O   14 
ATOM   7856 C  CB  . ASP A 1 56 ? 8.670   -0.198  7.493   1.00 0.00 ? 56 ASP A CB  14 
ATOM   7857 C  CG  . ASP A 1 56 ? 9.853   0.748   7.390   1.00 0.00 ? 56 ASP A CG  14 
ATOM   7858 O  OD1 . ASP A 1 56 ? 10.995  0.253   7.328   1.00 0.00 ? 56 ASP A OD1 14 
ATOM   7859 O  OD2 . ASP A 1 56 ? 9.620   1.972   7.284   1.00 0.00 ? 56 ASP A OD2 14 
ATOM   7860 N  N   . GLU A 1 57 ? 9.406   -3.035  6.227   1.00 0.00 ? 57 GLU A N   14 
ATOM   7861 C  CA  . GLU A 1 57 ? 10.309  -4.143  5.923   1.00 0.00 ? 57 GLU A CA  14 
ATOM   7862 C  C   . GLU A 1 57 ? 10.464  -4.345  4.412   1.00 0.00 ? 57 GLU A C   14 
ATOM   7863 O  O   . GLU A 1 57 ? 11.561  -4.594  3.917   1.00 0.00 ? 57 GLU A O   14 
ATOM   7864 C  CB  . GLU A 1 57 ? 9.821   -5.469  6.549   1.00 0.00 ? 57 GLU A CB  14 
ATOM   7865 C  CG  . GLU A 1 57 ? 8.957   -5.356  7.814   1.00 0.00 ? 57 GLU A CG  14 
ATOM   7866 C  CD  . GLU A 1 57 ? 7.521   -4.986  7.476   1.00 0.00 ? 57 GLU A CD  14 
ATOM   7867 O  OE1 . GLU A 1 57 ? 6.797   -5.863  6.953   1.00 0.00 ? 57 GLU A OE1 14 
ATOM   7868 O  OE2 . GLU A 1 57 ? 7.200   -3.794  7.685   1.00 0.00 ? 57 GLU A OE2 14 
ATOM   7869 N  N   . VAL A 1 58 ? 9.331   -4.309  3.705   1.00 0.00 ? 58 VAL A N   14 
ATOM   7870 C  CA  . VAL A 1 58 ? 9.220   -4.511  2.269   1.00 0.00 ? 58 VAL A CA  14 
ATOM   7871 C  C   . VAL A 1 58 ? 8.814   -3.190  1.620   1.00 0.00 ? 58 VAL A C   14 
ATOM   7872 O  O   . VAL A 1 58 ? 8.125   -2.383  2.241   1.00 0.00 ? 58 VAL A O   14 
ATOM   7873 C  CB  . VAL A 1 58 ? 8.188   -5.612  1.970   1.00 0.00 ? 58 VAL A CB  14 
ATOM   7874 C  CG1 . VAL A 1 58 ? 8.720   -6.994  2.366   1.00 0.00 ? 58 VAL A CG1 14 
ATOM   7875 C  CG2 . VAL A 1 58 ? 6.841   -5.370  2.668   1.00 0.00 ? 58 VAL A CG2 14 
ATOM   7876 N  N   . LEU A 1 59 ? 9.233   -2.963  0.373   1.00 0.00 ? 59 LEU A N   14 
ATOM   7877 C  CA  . LEU A 1 59 ? 8.925   -1.751  -0.348  1.00 0.00 ? 59 LEU A CA  14 
ATOM   7878 C  C   . LEU A 1 59 ? 7.492   -1.818  -0.867  1.00 0.00 ? 59 LEU A C   14 
ATOM   7879 O  O   . LEU A 1 59 ? 7.073   -2.822  -1.438  1.00 0.00 ? 59 LEU A O   14 
ATOM   7880 C  CB  . LEU A 1 59 ? 9.944   -1.576  -1.475  1.00 0.00 ? 59 LEU A CB  14 
ATOM   7881 C  CG  . LEU A 1 59 ? 9.999   -0.147  -2.013  1.00 0.00 ? 59 LEU A CG  14 
ATOM   7882 C  CD1 . LEU A 1 59 ? 10.490  0.879   -0.988  1.00 0.00 ? 59 LEU A CD1 14 
ATOM   7883 C  CD2 . LEU A 1 59 ? 10.985  -0.107  -3.178  1.00 0.00 ? 59 LEU A CD2 14 
ATOM   7884 N  N   . VAL A 1 60 ? 6.741   -0.746  -0.651  1.00 0.00 ? 60 VAL A N   14 
ATOM   7885 C  CA  . VAL A 1 60 ? 5.313   -0.654  -0.862  1.00 0.00 ? 60 VAL A CA  14 
ATOM   7886 C  C   . VAL A 1 60 ? 5.081   -0.180  -2.295  1.00 0.00 ? 60 VAL A C   14 
ATOM   7887 O  O   . VAL A 1 60 ? 5.588   0.875   -2.677  1.00 0.00 ? 60 VAL A O   14 
ATOM   7888 C  CB  . VAL A 1 60 ? 4.785   0.355   0.173   1.00 0.00 ? 60 VAL A CB  14 
ATOM   7889 C  CG1 . VAL A 1 60 ? 3.273   0.536   0.100   1.00 0.00 ? 60 VAL A CG1 14 
ATOM   7890 C  CG2 . VAL A 1 60 ? 5.148   -0.080  1.599   1.00 0.00 ? 60 VAL A CG2 14 
ATOM   7891 N  N   . LYS A 1 61 ? 4.349   -0.931  -3.122  1.00 0.00 ? 61 LYS A N   14 
ATOM   7892 C  CA  . LYS A 1 61 ? 3.973   -0.407  -4.424  1.00 0.00 ? 61 LYS A CA  14 
ATOM   7893 C  C   . LYS A 1 61 ? 3.134   0.848   -4.215  1.00 0.00 ? 61 LYS A C   14 
ATOM   7894 O  O   . LYS A 1 61 ? 2.178   0.820   -3.449  1.00 0.00 ? 61 LYS A O   14 
ATOM   7895 C  CB  . LYS A 1 61 ? 3.183   -1.450  -5.225  1.00 0.00 ? 61 LYS A CB  14 
ATOM   7896 C  CG  . LYS A 1 61 ? 3.239   -1.084  -6.707  1.00 0.00 ? 61 LYS A CG  14 
ATOM   7897 C  CD  . LYS A 1 61 ? 3.043   -2.261  -7.661  1.00 0.00 ? 61 LYS A CD  14 
ATOM   7898 C  CE  . LYS A 1 61 ? 3.665   -1.918  -9.031  1.00 0.00 ? 61 LYS A CE  14 
ATOM   7899 N  NZ  . LYS A 1 61 ? 3.365   -0.548  -9.518  1.00 0.00 ? 61 LYS A NZ  14 
ATOM   7900 N  N   . ALA A 1 62 ? 3.476   1.930   -4.906  1.00 0.00 ? 62 ALA A N   14 
ATOM   7901 C  CA  . ALA A 1 62 ? 2.727   3.176   -4.852  1.00 0.00 ? 62 ALA A CA  14 
ATOM   7902 C  C   . ALA A 1 62 ? 1.246   2.959   -5.171  1.00 0.00 ? 62 ALA A C   14 
ATOM   7903 O  O   . ALA A 1 62 ? 0.395   3.559   -4.511  1.00 0.00 ? 62 ALA A O   14 
ATOM   7904 C  CB  . ALA A 1 62 ? 3.354   4.182   -5.803  1.00 0.00 ? 62 ALA A CB  14 
ATOM   7905 N  N   . GLU A 1 63 ? 0.939   2.101   -6.156  1.00 0.00 ? 63 GLU A N   14 
ATOM   7906 C  CA  . GLU A 1 63 ? -0.443  1.763   -6.461  1.00 0.00 ? 63 GLU A CA  14 
ATOM   7907 C  C   . GLU A 1 63 ? -1.021  0.661   -5.576  1.00 0.00 ? 63 GLU A C   14 
ATOM   7908 O  O   . GLU A 1 63 ? -2.155  0.247   -5.815  1.00 0.00 ? 63 GLU A O   14 
ATOM   7909 C  CB  . GLU A 1 63 ? -0.642  1.374   -7.925  1.00 0.00 ? 63 GLU A CB  14 
ATOM   7910 C  CG  . GLU A 1 63 ? 0.107   2.284   -8.893  1.00 0.00 ? 63 GLU A CG  14 
ATOM   7911 C  CD  . GLU A 1 63 ? 1.407   1.601   -9.283  1.00 0.00 ? 63 GLU A CD  14 
ATOM   7912 O  OE1 . GLU A 1 63 ? 2.339   1.574   -8.445  1.00 0.00 ? 63 GLU A OE1 14 
ATOM   7913 O  OE2 . GLU A 1 63 ? 1.443   0.929   -10.336 1.00 0.00 ? 63 GLU A OE2 14 
ATOM   7914 N  N   . GLY A 1 64 ? -0.272  0.160   -4.595  1.00 0.00 ? 64 GLY A N   14 
ATOM   7915 C  CA  . GLY A 1 64 ? -0.812  -0.760  -3.616  1.00 0.00 ? 64 GLY A CA  14 
ATOM   7916 C  C   . GLY A 1 64 ? -1.799  -0.038  -2.702  1.00 0.00 ? 64 GLY A C   14 
ATOM   7917 O  O   . GLY A 1 64 ? -2.151  1.123   -2.917  1.00 0.00 ? 64 GLY A O   14 
ATOM   7918 N  N   . TRP A 1 65 ? -2.243  -0.742  -1.667  1.00 0.00 ? 65 TRP A N   14 
ATOM   7919 C  CA  . TRP A 1 65 ? -3.052  -0.216  -0.585  1.00 0.00 ? 65 TRP A CA  14 
ATOM   7920 C  C   . TRP A 1 65 ? -2.777  -1.136  0.601   1.00 0.00 ? 65 TRP A C   14 
ATOM   7921 O  O   . TRP A 1 65 ? -2.034  -2.097  0.437   1.00 0.00 ? 65 TRP A O   14 
ATOM   7922 C  CB  . TRP A 1 65 ? -4.515  -0.250  -1.031  1.00 0.00 ? 65 TRP A CB  14 
ATOM   7923 C  CG  . TRP A 1 65 ? -5.525  0.190   -0.027  1.00 0.00 ? 65 TRP A CG  14 
ATOM   7924 C  CD1 . TRP A 1 65 ? -5.863  1.469   0.246   1.00 0.00 ? 65 TRP A CD1 14 
ATOM   7925 C  CD2 . TRP A 1 65 ? -6.381  -0.644  0.808   1.00 0.00 ? 65 TRP A CD2 14 
ATOM   7926 N  NE1 . TRP A 1 65 ? -6.916  1.484   1.136   1.00 0.00 ? 65 TRP A NE1 14 
ATOM   7927 C  CE2 . TRP A 1 65 ? -7.299  0.206   1.487   1.00 0.00 ? 65 TRP A CE2 14 
ATOM   7928 C  CE3 . TRP A 1 65 ? -6.517  -2.035  1.007   1.00 0.00 ? 65 TRP A CE3 14 
ATOM   7929 C  CZ2 . TRP A 1 65 ? -8.343  -0.303  2.269   1.00 0.00 ? 65 TRP A CZ2 14 
ATOM   7930 C  CZ3 . TRP A 1 65 ? -7.532  -2.554  1.829   1.00 0.00 ? 65 TRP A CZ3 14 
ATOM   7931 C  CH2 . TRP A 1 65 ? -8.468  -1.694  2.427   1.00 0.00 ? 65 TRP A CH2 14 
ATOM   7932 N  N   . CYS A 1 66 ? -3.355  -0.883  1.776   1.00 0.00 ? 66 CYS A N   14 
ATOM   7933 C  CA  . CYS A 1 66 ? -3.451  -1.862  2.846   1.00 0.00 ? 66 CYS A CA  14 
ATOM   7934 C  C   . CYS A 1 66 ? -4.542  -1.429  3.819   1.00 0.00 ? 66 CYS A C   14 
ATOM   7935 O  O   . CYS A 1 66 ? -4.925  -0.260  3.851   1.00 0.00 ? 66 CYS A O   14 
ATOM   7936 C  CB  . CYS A 1 66 ? -2.117  -2.111  3.517   1.00 0.00 ? 66 CYS A CB  14 
ATOM   7937 S  SG  . CYS A 1 66 ? -1.771  -0.852  4.773   1.00 0.00 ? 66 CYS A SG  14 
ATOM   7938 N  N   . SER A 1 67 ? -5.084  -2.352  4.615   1.00 0.00 ? 67 SER A N   14 
ATOM   7939 C  CA  . SER A 1 67 ? -6.196  -2.030  5.494   1.00 0.00 ? 67 SER A CA  14 
ATOM   7940 C  C   . SER A 1 67 ? -5.777  -1.191  6.707   1.00 0.00 ? 67 SER A C   14 
ATOM   7941 O  O   . SER A 1 67 ? -6.654  -0.769  7.467   1.00 0.00 ? 67 SER A O   14 
ATOM   7942 C  CB  . SER A 1 67 ? -6.989  -3.294  5.842   1.00 0.00 ? 67 SER A CB  14 
ATOM   7943 O  OG  . SER A 1 67 ? -6.180  -4.328  6.353   1.00 0.00 ? 67 SER A OG  14 
ATOM   7944 N  N   . VAL A 1 68 ? -4.482  -0.871  6.871   1.00 0.00 ? 68 VAL A N   14 
ATOM   7945 C  CA  . VAL A 1 68 ? -4.049  0.175   7.800   1.00 0.00 ? 68 VAL A CA  14 
ATOM   7946 C  C   . VAL A 1 68 ? -4.141  1.579   7.181   1.00 0.00 ? 68 VAL A C   14 
ATOM   7947 O  O   . VAL A 1 68 ? -4.017  2.557   7.914   1.00 0.00 ? 68 VAL A O   14 
ATOM   7948 C  CB  . VAL A 1 68 ? -2.740  -0.110  8.570   1.00 0.00 ? 68 VAL A CB  14 
ATOM   7949 C  CG1 . VAL A 1 68 ? -2.610  -1.597  8.813   1.00 0.00 ? 68 VAL A CG1 14 
ATOM   7950 C  CG2 . VAL A 1 68 ? -1.381  0.361   8.065   1.00 0.00 ? 68 VAL A CG2 14 
ATOM   7951 N  N   . TYR A 1 69 ? -4.412  1.692   5.869   1.00 0.00 ? 69 TYR A N   14 
ATOM   7952 C  CA  . TYR A 1 69 ? -4.536  2.954   5.136   1.00 0.00 ? 69 TYR A CA  14 
ATOM   7953 C  C   . TYR A 1 69 ? -5.247  4.044   5.942   1.00 0.00 ? 69 TYR A C   14 
ATOM   7954 O  O   . TYR A 1 69 ? -6.397  3.856   6.353   1.00 0.00 ? 69 TYR A O   14 
ATOM   7955 C  CB  . TYR A 1 69 ? -5.277  2.732   3.807   1.00 0.00 ? 69 TYR A CB  14 
ATOM   7956 C  CG  . TYR A 1 69 ? -5.509  3.994   2.995   1.00 0.00 ? 69 TYR A CG  14 
ATOM   7957 C  CD1 . TYR A 1 69 ? -6.618  4.818   3.262   1.00 0.00 ? 69 TYR A CD1 14 
ATOM   7958 C  CD2 . TYR A 1 69 ? -4.581  4.382   2.012   1.00 0.00 ? 69 TYR A CD2 14 
ATOM   7959 C  CE1 . TYR A 1 69 ? -6.735  6.066   2.631   1.00 0.00 ? 69 TYR A CE1 14 
ATOM   7960 C  CE2 . TYR A 1 69 ? -4.735  5.604   1.339   1.00 0.00 ? 69 TYR A CE2 14 
ATOM   7961 C  CZ  . TYR A 1 69 ? -5.795  6.461   1.670   1.00 0.00 ? 69 TYR A CZ  14 
ATOM   7962 O  OH  . TYR A 1 69 ? -5.964  7.644   1.019   1.00 0.00 ? 69 TYR A OH  14 
ATOM   7963 N  N   . ALA A 1 70 ? -4.588  5.189   6.119   1.00 0.00 ? 70 ALA A N   14 
ATOM   7964 C  CA  . ALA A 1 70 ? -5.176  6.406   6.657   1.00 0.00 ? 70 ALA A CA  14 
ATOM   7965 C  C   . ALA A 1 70 ? -5.087  7.459   5.551   1.00 0.00 ? 70 ALA A C   14 
ATOM   7966 O  O   . ALA A 1 70 ? -4.041  7.540   4.911   1.00 0.00 ? 70 ALA A O   14 
ATOM   7967 C  CB  . ALA A 1 70 ? -4.390  6.838   7.897   1.00 0.00 ? 70 ALA A CB  14 
ATOM   7968 N  N   . PRO A 1 71 ? -6.145  8.234   5.278   1.00 0.00 ? 71 PRO A N   14 
ATOM   7969 C  CA  . PRO A 1 71 ? -6.120  9.228   4.221   1.00 0.00 ? 71 PRO A CA  14 
ATOM   7970 C  C   . PRO A 1 71 ? -5.225  10.398  4.596   1.00 0.00 ? 71 PRO A C   14 
ATOM   7971 O  O   . PRO A 1 71 ? -5.081  10.733  5.769   1.00 0.00 ? 71 PRO A O   14 
ATOM   7972 C  CB  . PRO A 1 71 ? -7.571  9.665   4.030   1.00 0.00 ? 71 PRO A CB  14 
ATOM   7973 C  CG  . PRO A 1 71 ? -8.159  9.483   5.430   1.00 0.00 ? 71 PRO A CG  14 
ATOM   7974 C  CD  . PRO A 1 71 ? -7.429  8.246   5.959   1.00 0.00 ? 71 PRO A CD  14 
ATOM   7975 N  N   . ALA A 1 72 ? -4.638  11.022  3.574   1.00 0.00 ? 72 ALA A N   14 
ATOM   7976 C  CA  . ALA A 1 72 ? -3.802  12.201  3.715   1.00 0.00 ? 72 ALA A CA  14 
ATOM   7977 C  C   . ALA A 1 72 ? -4.602  13.460  3.377   1.00 0.00 ? 72 ALA A C   14 
ATOM   7978 O  O   . ALA A 1 72 ? -4.101  14.392  2.750   1.00 0.00 ? 72 ALA A O   14 
ATOM   7979 C  CB  . ALA A 1 72 ? -2.591  12.048  2.807   1.00 0.00 ? 72 ALA A CB  14 
ATOM   7980 N  N   . SER A 1 73 ? -5.870  13.455  3.767   1.00 0.00 ? 73 SER A N   14 
ATOM   7981 C  CA  . SER A 1 73 ? -6.867  14.499  3.639   1.00 0.00 ? 73 SER A CA  14 
ATOM   7982 C  C   . SER A 1 73 ? -8.027  14.058  4.530   1.00 0.00 ? 73 SER A C   14 
ATOM   7983 O  O   . SER A 1 73 ? -8.974  14.860  4.680   1.00 0.00 ? 73 SER A O   14 
ATOM   7984 C  CB  . SER A 1 73 ? -7.348  14.633  2.189   1.00 0.00 ? 73 SER A CB  14 
ATOM   7985 O  OG  . SER A 1 73 ? -6.347  15.179  1.350   1.00 0.00 ? 73 SER A OG  14 
ATOM   7986 O  OXT . SER A 1 73 ? -7.946  12.908  5.019   1.00 0.00 ? 73 SER A OXT 14 
HETATM 7987 FE FE1 . SF4 B 2 .  ? 0.101   1.584   1.713   1.00 0.00 ? 74 SF4 A FE1 14 
HETATM 7988 FE FE2 . SF4 B 2 .  ? -0.578  3.127   3.566   1.00 0.00 ? 74 SF4 A FE2 14 
HETATM 7989 FE FE3 . SF4 B 2 .  ? 1.508   1.834   3.750   1.00 0.00 ? 74 SF4 A FE3 14 
HETATM 7990 FE FE4 . SF4 B 2 .  ? -0.708  0.657   3.867   1.00 0.00 ? 74 SF4 A FE4 14 
HETATM 7991 S  S1  . SF4 B 2 .  ? 0.051   2.075   5.326   1.00 0.00 ? 74 SF4 A S1  14 
HETATM 7992 S  S2  . SF4 B 2 .  ? 1.029   -0.034  2.795   1.00 0.00 ? 74 SF4 A S2  14 
HETATM 7993 S  S3  . SF4 B 2 .  ? -1.909  1.809   2.499   1.00 0.00 ? 74 SF4 A S3  14 
HETATM 7994 S  S4  . SF4 B 2 .  ? 1.134   3.362   2.296   1.00 0.00 ? 74 SF4 A S4  14 
ATOM   7995 N  N   . ALA A 1 1  ? 15.977  1.718   2.011   1.00 0.00 ? 1  ALA A N   15 
ATOM   7996 C  CA  . ALA A 1 1  ? 17.004  0.715   1.777   1.00 0.00 ? 1  ALA A CA  15 
ATOM   7997 C  C   . ALA A 1 1  ? 16.890  0.275   0.325   1.00 0.00 ? 1  ALA A C   15 
ATOM   7998 O  O   . ALA A 1 1  ? 16.317  1.031   -0.456  1.00 0.00 ? 1  ALA A O   15 
ATOM   7999 C  CB  . ALA A 1 1  ? 16.806  -0.503  2.684   1.00 0.00 ? 1  ALA A CB  15 
ATOM   8000 N  N   . SER A 1 2  ? 17.277  -0.958  0.004   1.00 0.00 ? 2  SER A N   15 
ATOM   8001 C  CA  . SER A 1 2  ? 16.810  -1.632  -1.199  1.00 0.00 ? 2  SER A CA  15 
ATOM   8002 C  C   . SER A 1 2  ? 15.833  -2.732  -0.779  1.00 0.00 ? 2  SER A C   15 
ATOM   8003 O  O   . SER A 1 2  ? 16.046  -3.902  -1.086  1.00 0.00 ? 2  SER A O   15 
ATOM   8004 C  CB  . SER A 1 2  ? 18.017  -2.174  -1.969  1.00 0.00 ? 2  SER A CB  15 
ATOM   8005 O  OG  . SER A 1 2  ? 18.962  -1.135  -2.146  1.00 0.00 ? 2  SER A OG  15 
ATOM   8006 N  N   . GLU A 1 3  ? 14.793  -2.359  -0.030  1.00 0.00 ? 3  GLU A N   15 
ATOM   8007 C  CA  . GLU A 1 3  ? 13.831  -3.301  0.514   1.00 0.00 ? 3  GLU A CA  15 
ATOM   8008 C  C   . GLU A 1 3  ? 13.130  -4.064  -0.625  1.00 0.00 ? 3  GLU A C   15 
ATOM   8009 O  O   . GLU A 1 3  ? 12.821  -3.465  -1.656  1.00 0.00 ? 3  GLU A O   15 
ATOM   8010 C  CB  . GLU A 1 3  ? 12.826  -2.551  1.405   1.00 0.00 ? 3  GLU A CB  15 
ATOM   8011 C  CG  . GLU A 1 3  ? 13.468  -1.838  2.609   1.00 0.00 ? 3  GLU A CG  15 
ATOM   8012 C  CD  . GLU A 1 3  ? 13.902  -0.407  2.346   1.00 0.00 ? 3  GLU A CD  15 
ATOM   8013 O  OE1 . GLU A 1 3  ? 14.186  -0.026  1.187   1.00 0.00 ? 3  GLU A OE1 15 
ATOM   8014 O  OE2 . GLU A 1 3  ? 14.048  0.385   3.307   1.00 0.00 ? 3  GLU A OE2 15 
ATOM   8015 N  N   . PRO A 1 4  ? 12.884  -5.377  -0.474  1.00 0.00 ? 4  PRO A N   15 
ATOM   8016 C  CA  . PRO A 1 4  ? 12.246  -6.180  -1.507  1.00 0.00 ? 4  PRO A CA  15 
ATOM   8017 C  C   . PRO A 1 4  ? 10.801  -5.724  -1.731  1.00 0.00 ? 4  PRO A C   15 
ATOM   8018 O  O   . PRO A 1 4  ? 10.169  -5.184  -0.825  1.00 0.00 ? 4  PRO A O   15 
ATOM   8019 C  CB  . PRO A 1 4  ? 12.332  -7.631  -1.022  1.00 0.00 ? 4  PRO A CB  15 
ATOM   8020 C  CG  . PRO A 1 4  ? 12.463  -7.505  0.495   1.00 0.00 ? 4  PRO A CG  15 
ATOM   8021 C  CD  . PRO A 1 4  ? 13.207  -6.186  0.688   1.00 0.00 ? 4  PRO A CD  15 
ATOM   8022 N  N   . ARG A 1 5  ? 10.288  -5.918  -2.948  1.00 0.00 ? 5  ARG A N   15 
ATOM   8023 C  CA  . ARG A 1 5  ? 8.976   -5.431  -3.350  1.00 0.00 ? 5  ARG A CA  15 
ATOM   8024 C  C   . ARG A 1 5  ? 7.897   -6.273  -2.659  1.00 0.00 ? 5  ARG A C   15 
ATOM   8025 O  O   . ARG A 1 5  ? 7.936   -7.500  -2.729  1.00 0.00 ? 5  ARG A O   15 
ATOM   8026 C  CB  . ARG A 1 5  ? 8.874   -5.453  -4.882  1.00 0.00 ? 5  ARG A CB  15 
ATOM   8027 C  CG  . ARG A 1 5  ? 10.044  -4.711  -5.542  1.00 0.00 ? 5  ARG A CG  15 
ATOM   8028 C  CD  . ARG A 1 5  ? 10.068  -5.037  -7.031  1.00 0.00 ? 5  ARG A CD  15 
ATOM   8029 N  NE  . ARG A 1 5  ? 9.180   -4.184  -7.807  1.00 0.00 ? 5  ARG A NE  15 
ATOM   8030 C  CZ  . ARG A 1 5  ? 9.526   -3.489  -8.902  1.00 0.00 ? 5  ARG A CZ  15 
ATOM   8031 N  NH1 . ARG A 1 5  ? 10.601  -2.706  -8.883  1.00 0.00 ? 5  ARG A NH1 15 
ATOM   8032 N  NH2 . ARG A 1 5  ? 8.763   -3.567  -9.994  1.00 0.00 ? 5  ARG A NH2 15 
ATOM   8033 N  N   . ALA A 1 6  ? 6.979   -5.610  -1.956  1.00 0.00 ? 6  ALA A N   15 
ATOM   8034 C  CA  . ALA A 1 6  ? 6.014   -6.205  -1.046  1.00 0.00 ? 6  ALA A CA  15 
ATOM   8035 C  C   . ALA A 1 6  ? 5.175   -7.296  -1.704  1.00 0.00 ? 6  ALA A C   15 
ATOM   8036 O  O   . ALA A 1 6  ? 4.765   -7.177  -2.860  1.00 0.00 ? 6  ALA A O   15 
ATOM   8037 C  CB  . ALA A 1 6  ? 5.112   -5.104  -0.482  1.00 0.00 ? 6  ALA A CB  15 
ATOM   8038 N  N   . GLU A 1 7  ? 4.899   -8.350  -0.940  1.00 0.00 ? 7  GLU A N   15 
ATOM   8039 C  CA  . GLU A 1 7  ? 4.125   -9.489  -1.374  1.00 0.00 ? 7  GLU A CA  15 
ATOM   8040 C  C   . GLU A 1 7  ? 2.656   -9.109  -1.361  1.00 0.00 ? 7  GLU A C   15 
ATOM   8041 O  O   . GLU A 1 7  ? 2.199   -8.426  -0.442  1.00 0.00 ? 7  GLU A O   15 
ATOM   8042 C  CB  . GLU A 1 7  ? 4.326   -10.682 -0.437  1.00 0.00 ? 7  GLU A CB  15 
ATOM   8043 C  CG  . GLU A 1 7  ? 5.776   -10.844 0.022   1.00 0.00 ? 7  GLU A CG  15 
ATOM   8044 C  CD  . GLU A 1 7  ? 6.014   -10.153 1.361   1.00 0.00 ? 7  GLU A CD  15 
ATOM   8045 O  OE1 . GLU A 1 7  ? 6.109   -8.908  1.370   1.00 0.00 ? 7  GLU A OE1 15 
ATOM   8046 O  OE2 . GLU A 1 7  ? 6.000   -10.818 2.413   1.00 0.00 ? 7  GLU A OE2 15 
ATOM   8047 N  N   . ASP A 1 8  ? 1.899   -9.627  -2.317  1.00 0.00 ? 8  ASP A N   15 
ATOM   8048 C  CA  . ASP A 1 8  ? 0.459   -9.600  -2.241  1.00 0.00 ? 8  ASP A CA  15 
ATOM   8049 C  C   . ASP A 1 8  ? 0.068   -10.430 -1.021  1.00 0.00 ? 8  ASP A C   15 
ATOM   8050 O  O   . ASP A 1 8  ? 0.454   -11.592 -0.903  1.00 0.00 ? 8  ASP A O   15 
ATOM   8051 C  CB  . ASP A 1 8  ? -0.111  -10.140 -3.549  1.00 0.00 ? 8  ASP A CB  15 
ATOM   8052 C  CG  . ASP A 1 8  ? 0.014   -9.088  -4.637  1.00 0.00 ? 8  ASP A CG  15 
ATOM   8053 O  OD1 . ASP A 1 8  ? -0.884  -8.223  -4.697  1.00 0.00 ? 8  ASP A OD1 15 
ATOM   8054 O  OD2 . ASP A 1 8  ? 1.053   -9.105  -5.335  1.00 0.00 ? 8  ASP A OD2 15 
ATOM   8055 N  N   . GLY A 1 9  ? -0.615  -9.802  -0.067  1.00 0.00 ? 9  GLY A N   15 
ATOM   8056 C  CA  . GLY A 1 9  ? -0.919  -10.391 1.221   1.00 0.00 ? 9  GLY A CA  15 
ATOM   8057 C  C   . GLY A 1 9  ? 0.299   -10.464 2.146   1.00 0.00 ? 9  GLY A C   15 
ATOM   8058 O  O   . GLY A 1 9  ? 0.286   -11.285 3.060   1.00 0.00 ? 9  GLY A O   15 
ATOM   8059 N  N   . HIS A 1 10 ? 1.316   -9.598  1.976   1.00 0.00 ? 10 HIS A N   15 
ATOM   8060 C  CA  . HIS A 1 10 ? 2.383   -9.397  2.960   1.00 0.00 ? 10 HIS A CA  15 
ATOM   8061 C  C   . HIS A 1 10 ? 1.817   -9.397  4.382   1.00 0.00 ? 10 HIS A C   15 
ATOM   8062 O  O   . HIS A 1 10 ? 2.264   -10.142 5.249   1.00 0.00 ? 10 HIS A O   15 
ATOM   8063 C  CB  . HIS A 1 10 ? 3.077   -8.051  2.698   1.00 0.00 ? 10 HIS A CB  15 
ATOM   8064 C  CG  . HIS A 1 10 ? 4.124   -7.693  3.728   1.00 0.00 ? 10 HIS A CG  15 
ATOM   8065 N  ND1 . HIS A 1 10 ? 5.414   -8.185  3.775   1.00 0.00 ? 10 HIS A ND1 15 
ATOM   8066 C  CD2 . HIS A 1 10 ? 3.964   -6.832  4.780   1.00 0.00 ? 10 HIS A CD2 15 
ATOM   8067 C  CE1 . HIS A 1 10 ? 6.026   -7.634  4.840   1.00 0.00 ? 10 HIS A CE1 15 
ATOM   8068 N  NE2 . HIS A 1 10 ? 5.165   -6.807  5.465   1.00 0.00 ? 10 HIS A NE2 15 
ATOM   8069 N  N   . ALA A 1 11 ? 0.835   -8.522  4.596   1.00 0.00 ? 11 ALA A N   15 
ATOM   8070 C  CA  . ALA A 1 11 ? 0.041   -8.429  5.808   1.00 0.00 ? 11 ALA A CA  15 
ATOM   8071 C  C   . ALA A 1 11 ? -1.149  -7.520  5.511   1.00 0.00 ? 11 ALA A C   15 
ATOM   8072 O  O   . ALA A 1 11 ? -1.246  -7.000  4.400   1.00 0.00 ? 11 ALA A O   15 
ATOM   8073 C  CB  . ALA A 1 11 ? 0.897   -7.885  6.961   1.00 0.00 ? 11 ALA A CB  15 
ATOM   8074 N  N   . HIS A 1 12 ? -2.035  -7.343  6.502   1.00 0.00 ? 12 HIS A N   15 
ATOM   8075 C  CA  . HIS A 1 12 ? -3.168  -6.414  6.518   1.00 0.00 ? 12 HIS A CA  15 
ATOM   8076 C  C   . HIS A 1 12 ? -3.797  -6.213  5.142   1.00 0.00 ? 12 HIS A C   15 
ATOM   8077 O  O   . HIS A 1 12 ? -3.976  -5.083  4.683   1.00 0.00 ? 12 HIS A O   15 
ATOM   8078 C  CB  . HIS A 1 12 ? -2.750  -5.067  7.106   1.00 0.00 ? 12 HIS A CB  15 
ATOM   8079 C  CG  . HIS A 1 12 ? -2.241  -5.110  8.520   1.00 0.00 ? 12 HIS A CG  15 
ATOM   8080 N  ND1 . HIS A 1 12 ? -2.857  -4.484  9.588   1.00 0.00 ? 12 HIS A ND1 15 
ATOM   8081 C  CD2 . HIS A 1 12 ? -0.951  -5.381  8.880   1.00 0.00 ? 12 HIS A CD2 15 
ATOM   8082 C  CE1 . HIS A 1 12 ? -1.937  -4.331  10.556  1.00 0.00 ? 12 HIS A CE1 15 
ATOM   8083 N  NE2 . HIS A 1 12 ? -0.802  -4.940  10.175  1.00 0.00 ? 12 HIS A NE2 15 
ATOM   8084 N  N   . ASP A 1 13 ? -4.130  -7.330  4.501   1.00 0.00 ? 13 ASP A N   15 
ATOM   8085 C  CA  . ASP A 1 13 ? -4.929  -7.365  3.286   1.00 0.00 ? 13 ASP A CA  15 
ATOM   8086 C  C   . ASP A 1 13 ? -4.282  -6.593  2.131   1.00 0.00 ? 13 ASP A C   15 
ATOM   8087 O  O   . ASP A 1 13 ? -4.980  -6.218  1.190   1.00 0.00 ? 13 ASP A O   15 
ATOM   8088 C  CB  . ASP A 1 13 ? -6.344  -6.834  3.555   1.00 0.00 ? 13 ASP A CB  15 
ATOM   8089 C  CG  . ASP A 1 13 ? -6.903  -7.189  4.923   1.00 0.00 ? 13 ASP A CG  15 
ATOM   8090 O  OD1 . ASP A 1 13 ? -6.821  -8.368  5.314   1.00 0.00 ? 13 ASP A OD1 15 
ATOM   8091 O  OD2 . ASP A 1 13 ? -7.429  -6.238  5.551   1.00 0.00 ? 13 ASP A OD2 15 
ATOM   8092 N  N   . TYR A 1 14 ? -2.972  -6.323  2.196   1.00 0.00 ? 14 TYR A N   15 
ATOM   8093 C  CA  . TYR A 1 14 ? -2.315  -5.563  1.149   1.00 0.00 ? 14 TYR A CA  15 
ATOM   8094 C  C   . TYR A 1 14 ? -2.396  -6.315  -0.169  1.00 0.00 ? 14 TYR A C   15 
ATOM   8095 O  O   . TYR A 1 14 ? -2.155  -7.518  -0.214  1.00 0.00 ? 14 TYR A O   15 
ATOM   8096 C  CB  . TYR A 1 14 ? -0.866  -5.245  1.517   1.00 0.00 ? 14 TYR A CB  15 
ATOM   8097 C  CG  . TYR A 1 14 ? -0.021  -4.675  0.388   1.00 0.00 ? 14 TYR A CG  15 
ATOM   8098 C  CD1 . TYR A 1 14 ? 0.030   -3.289  0.152   1.00 0.00 ? 14 TYR A CD1 15 
ATOM   8099 C  CD2 . TYR A 1 14 ? 0.713   -5.542  -0.442  1.00 0.00 ? 14 TYR A CD2 15 
ATOM   8100 C  CE1 . TYR A 1 14 ? 0.827   -2.778  -0.886  1.00 0.00 ? 14 TYR A CE1 15 
ATOM   8101 C  CE2 . TYR A 1 14 ? 1.559   -5.027  -1.438  1.00 0.00 ? 14 TYR A CE2 15 
ATOM   8102 C  CZ  . TYR A 1 14 ? 1.642   -3.639  -1.640  1.00 0.00 ? 14 TYR A CZ  15 
ATOM   8103 O  OH  . TYR A 1 14 ? 2.536   -3.125  -2.536  1.00 0.00 ? 14 TYR A OH  15 
ATOM   8104 N  N   . VAL A 1 15 ? -2.684  -5.582  -1.238  1.00 0.00 ? 15 VAL A N   15 
ATOM   8105 C  CA  . VAL A 1 15 ? -2.581  -6.063  -2.601  1.00 0.00 ? 15 VAL A CA  15 
ATOM   8106 C  C   . VAL A 1 15 ? -1.715  -5.061  -3.344  1.00 0.00 ? 15 VAL A C   15 
ATOM   8107 O  O   . VAL A 1 15 ? -1.758  -3.862  -3.054  1.00 0.00 ? 15 VAL A O   15 
ATOM   8108 C  CB  . VAL A 1 15 ? -3.967  -6.223  -3.242  1.00 0.00 ? 15 VAL A CB  15 
ATOM   8109 C  CG1 . VAL A 1 15 ? -4.572  -7.572  -2.832  1.00 0.00 ? 15 VAL A CG1 15 
ATOM   8110 C  CG2 . VAL A 1 15 ? -4.921  -5.096  -2.842  1.00 0.00 ? 15 VAL A CG2 15 
ATOM   8111 N  N   . ASN A 1 16 ? -0.892  -5.563  -4.263  1.00 0.00 ? 16 ASN A N   15 
ATOM   8112 C  CA  . ASN A 1 16 ? 0.066   -4.759  -4.976  1.00 0.00 ? 16 ASN A CA  15 
ATOM   8113 C  C   . ASN A 1 16 ? -0.619  -3.653  -5.764  1.00 0.00 ? 16 ASN A C   15 
ATOM   8114 O  O   . ASN A 1 16 ? -0.085  -2.550  -5.833  1.00 0.00 ? 16 ASN A O   15 
ATOM   8115 C  CB  . ASN A 1 16 ? 1.032   -5.617  -5.805  1.00 0.00 ? 16 ASN A CB  15 
ATOM   8116 C  CG  . ASN A 1 16 ? 2.321   -5.822  -5.023  1.00 0.00 ? 16 ASN A CG  15 
ATOM   8117 O  OD1 . ASN A 1 16 ? 2.955   -4.857  -4.605  1.00 0.00 ? 16 ASN A OD1 15 
ATOM   8118 N  ND2 . ASN A 1 16 ? 2.712   -7.059  -4.775  1.00 0.00 ? 16 ASN A ND2 15 
ATOM   8119 N  N   . GLU A 1 17 ? -1.816  -3.923  -6.293  1.00 0.00 ? 17 GLU A N   15 
ATOM   8120 C  CA  . GLU A 1 17 ? -2.673  -2.921  -6.866  1.00 0.00 ? 17 GLU A CA  15 
ATOM   8121 C  C   . GLU A 1 17 ? -3.852  -2.648  -5.947  1.00 0.00 ? 17 GLU A C   15 
ATOM   8122 O  O   . GLU A 1 17 ? -4.624  -3.548  -5.615  1.00 0.00 ? 17 GLU A O   15 
ATOM   8123 C  CB  . GLU A 1 17 ? -3.181  -3.441  -8.204  1.00 0.00 ? 17 GLU A CB  15 
ATOM   8124 C  CG  . GLU A 1 17 ? -2.801  -2.482  -9.320  1.00 0.00 ? 17 GLU A CG  15 
ATOM   8125 C  CD  . GLU A 1 17 ? -1.329  -2.578  -9.732  1.00 0.00 ? 17 GLU A CD  15 
ATOM   8126 O  OE1 . GLU A 1 17 ? -0.496  -2.999  -8.901  1.00 0.00 ? 17 GLU A OE1 15 
ATOM   8127 O  OE2 . GLU A 1 17 ? -0.996  -2.185  -10.867 1.00 0.00 ? 17 GLU A OE2 15 
ATOM   8128 N  N   . ALA A 1 18 ? -4.058  -1.368  -5.659  1.00 0.00 ? 18 ALA A N   15 
ATOM   8129 C  CA  . ALA A 1 18 ? -5.269  -0.846  -5.057  1.00 0.00 ? 18 ALA A CA  15 
ATOM   8130 C  C   . ALA A 1 18 ? -6.500  -1.322  -5.825  1.00 0.00 ? 18 ALA A C   15 
ATOM   8131 O  O   . ALA A 1 18 ? -7.549  -1.531  -5.220  1.00 0.00 ? 18 ALA A O   15 
ATOM   8132 C  CB  . ALA A 1 18 ? -5.211  0.681   -5.038  1.00 0.00 ? 18 ALA A CB  15 
ATOM   8133 N  N   . ALA A 1 19 ? -6.390  -1.522  -7.148  1.00 0.00 ? 19 ALA A N   15 
ATOM   8134 C  CA  . ALA A 1 19 ? -7.531  -1.983  -7.926  1.00 0.00 ? 19 ALA A CA  15 
ATOM   8135 C  C   . ALA A 1 19 ? -8.107  -3.279  -7.357  1.00 0.00 ? 19 ALA A C   15 
ATOM   8136 O  O   . ALA A 1 19 ? -9.319  -3.394  -7.173  1.00 0.00 ? 19 ALA A O   15 
ATOM   8137 C  CB  . ALA A 1 19 ? -7.136  -2.139  -9.396  1.00 0.00 ? 19 ALA A CB  15 
ATOM   8138 N  N   . ASP A 1 20 ? -7.239  -4.238  -7.026  1.00 0.00 ? 20 ASP A N   15 
ATOM   8139 C  CA  . ASP A 1 20 ? -7.679  -5.517  -6.485  1.00 0.00 ? 20 ASP A CA  15 
ATOM   8140 C  C   . ASP A 1 20 ? -8.424  -5.315  -5.161  1.00 0.00 ? 20 ASP A C   15 
ATOM   8141 O  O   . ASP A 1 20 ? -9.346  -6.059  -4.828  1.00 0.00 ? 20 ASP A O   15 
ATOM   8142 C  CB  . ASP A 1 20 ? -6.479  -6.467  -6.334  1.00 0.00 ? 20 ASP A CB  15 
ATOM   8143 C  CG  . ASP A 1 20 ? -6.729  -7.782  -7.056  1.00 0.00 ? 20 ASP A CG  15 
ATOM   8144 O  OD1 . ASP A 1 20 ? -6.420  -7.828  -8.267  1.00 0.00 ? 20 ASP A OD1 15 
ATOM   8145 O  OD2 . ASP A 1 20 ? -7.244  -8.708  -6.396  1.00 0.00 ? 20 ASP A OD2 15 
ATOM   8146 N  N   . ALA A 1 21 ? -8.065  -4.264  -4.415  1.00 0.00 ? 21 ALA A N   15 
ATOM   8147 C  CA  . ALA A 1 21 ? -8.654  -4.000  -3.110  1.00 0.00 ? 21 ALA A CA  15 
ATOM   8148 C  C   . ALA A 1 21 ? -10.104 -3.527  -3.205  1.00 0.00 ? 21 ALA A C   15 
ATOM   8149 O  O   . ALA A 1 21 ? -10.750 -3.412  -2.164  1.00 0.00 ? 21 ALA A O   15 
ATOM   8150 C  CB  . ALA A 1 21 ? -7.811  -2.999  -2.317  1.00 0.00 ? 21 ALA A CB  15 
ATOM   8151 N  N   . SER A 1 22 ? -10.650 -3.282  -4.405  1.00 0.00 ? 22 SER A N   15 
ATOM   8152 C  CA  . SER A 1 22 ? -12.018 -2.826  -4.586  1.00 0.00 ? 22 SER A CA  15 
ATOM   8153 C  C   . SER A 1 22 ? -13.067 -3.644  -3.839  1.00 0.00 ? 22 SER A C   15 
ATOM   8154 O  O   . SER A 1 22 ? -14.093 -3.134  -3.397  1.00 0.00 ? 22 SER A O   15 
ATOM   8155 C  CB  . SER A 1 22 ? -12.323 -2.759  -6.078  1.00 0.00 ? 22 SER A CB  15 
ATOM   8156 O  OG  . SER A 1 22 ? -11.494 -1.805  -6.710  1.00 0.00 ? 22 SER A OG  15 
ATOM   8157 N  N   . GLY A 1 23 ? -12.782 -4.927  -3.710  1.00 0.00 ? 23 GLY A N   15 
ATOM   8158 C  CA  . GLY A 1 23 ? -13.618 -5.895  -3.015  1.00 0.00 ? 23 GLY A CA  15 
ATOM   8159 C  C   . GLY A 1 23 ? -13.694 -5.651  -1.504  1.00 0.00 ? 23 GLY A C   15 
ATOM   8160 O  O   . GLY A 1 23 ? -14.634 -6.102  -0.853  1.00 0.00 ? 23 GLY A O   15 
ATOM   8161 N  N   . HIS A 1 24 ? -12.691 -4.992  -0.915  1.00 0.00 ? 24 HIS A N   15 
ATOM   8162 C  CA  . HIS A 1 24 ? -12.539 -4.900  0.528   1.00 0.00 ? 24 HIS A CA  15 
ATOM   8163 C  C   . HIS A 1 24 ? -13.480 -3.843  1.115   1.00 0.00 ? 24 HIS A C   15 
ATOM   8164 O  O   . HIS A 1 24 ? -13.257 -2.658  0.870   1.00 0.00 ? 24 HIS A O   15 
ATOM   8165 C  CB  . HIS A 1 24 ? -11.084 -4.526  0.850   1.00 0.00 ? 24 HIS A CB  15 
ATOM   8166 C  CG  . HIS A 1 24 ? -10.656 -4.811  2.272   1.00 0.00 ? 24 HIS A CG  15 
ATOM   8167 N  ND1 . HIS A 1 24 ? -11.345 -4.505  3.437   1.00 0.00 ? 24 HIS A ND1 15 
ATOM   8168 C  CD2 . HIS A 1 24 ? -9.452  -5.353  2.631   1.00 0.00 ? 24 HIS A CD2 15 
ATOM   8169 C  CE1 . HIS A 1 24 ? -10.565 -4.844  4.478   1.00 0.00 ? 24 HIS A CE1 15 
ATOM   8170 N  NE2 . HIS A 1 24 ? -9.419  -5.368  4.013   1.00 0.00 ? 24 HIS A NE2 15 
ATOM   8171 N  N   . PRO A 1 25 ? -14.438 -4.189  1.992   1.00 0.00 ? 25 PRO A N   15 
ATOM   8172 C  CA  . PRO A 1 25 ? -15.111 -3.178  2.792   1.00 0.00 ? 25 PRO A CA  15 
ATOM   8173 C  C   . PRO A 1 25 ? -14.055 -2.542  3.704   1.00 0.00 ? 25 PRO A C   15 
ATOM   8174 O  O   . PRO A 1 25 ? -13.524 -3.232  4.570   1.00 0.00 ? 25 PRO A O   15 
ATOM   8175 C  CB  . PRO A 1 25 ? -16.197 -3.926  3.572   1.00 0.00 ? 25 PRO A CB  15 
ATOM   8176 C  CG  . PRO A 1 25 ? -15.646 -5.348  3.691   1.00 0.00 ? 25 PRO A CG  15 
ATOM   8177 C  CD  . PRO A 1 25 ? -14.833 -5.529  2.409   1.00 0.00 ? 25 PRO A CD  15 
ATOM   8178 N  N   . ARG A 1 26 ? -13.684 -1.288  3.414   1.00 0.00 ? 26 ARG A N   15 
ATOM   8179 C  CA  . ARG A 1 26 ? -12.625 -0.438  3.976   1.00 0.00 ? 26 ARG A CA  15 
ATOM   8180 C  C   . ARG A 1 26 ? -11.877 0.271   2.851   1.00 0.00 ? 26 ARG A C   15 
ATOM   8181 O  O   . ARG A 1 26 ? -11.367 1.377   3.062   1.00 0.00 ? 26 ARG A O   15 
ATOM   8182 C  CB  . ARG A 1 26 ? -11.584 -1.124  4.891   1.00 0.00 ? 26 ARG A CB  15 
ATOM   8183 C  CG  . ARG A 1 26 ? -11.805 -0.824  6.380   1.00 0.00 ? 26 ARG A CG  15 
ATOM   8184 C  CD  . ARG A 1 26 ? -11.734 0.681   6.710   1.00 0.00 ? 26 ARG A CD  15 
ATOM   8185 N  NE  . ARG A 1 26 ? -10.739 1.412   5.896   1.00 0.00 ? 26 ARG A NE  15 
ATOM   8186 C  CZ  . ARG A 1 26 ? -9.429  1.519   6.172   1.00 0.00 ? 26 ARG A CZ  15 
ATOM   8187 N  NH1 . ARG A 1 26 ? -8.902  0.800   7.166   1.00 0.00 ? 26 ARG A NH1 15 
ATOM   8188 N  NH2 . ARG A 1 26 ? -8.655  2.331   5.447   1.00 0.00 ? 26 ARG A NH2 15 
ATOM   8189 N  N   . TYR A 1 27 ? -11.775 -0.383  1.689   1.00 0.00 ? 27 TYR A N   15 
ATOM   8190 C  CA  . TYR A 1 27 ? -11.259 0.258   0.497   1.00 0.00 ? 27 TYR A CA  15 
ATOM   8191 C  C   . TYR A 1 27 ? -12.259 1.312   0.039   1.00 0.00 ? 27 TYR A C   15 
ATOM   8192 O  O   . TYR A 1 27 ? -13.463 1.181   0.259   1.00 0.00 ? 27 TYR A O   15 
ATOM   8193 C  CB  . TYR A 1 27 ? -10.947 -0.770  -0.596  1.00 0.00 ? 27 TYR A CB  15 
ATOM   8194 C  CG  . TYR A 1 27 ? -10.252 -0.148  -1.792  1.00 0.00 ? 27 TYR A CG  15 
ATOM   8195 C  CD1 . TYR A 1 27 ? -8.884  0.135   -1.691  1.00 0.00 ? 27 TYR A CD1 15 
ATOM   8196 C  CD2 . TYR A 1 27 ? -10.977 0.339   -2.895  1.00 0.00 ? 27 TYR A CD2 15 
ATOM   8197 C  CE1 . TYR A 1 27 ? -8.265  0.999   -2.602  1.00 0.00 ? 27 TYR A CE1 15 
ATOM   8198 C  CE2 . TYR A 1 27 ? -10.335 1.140   -3.857  1.00 0.00 ? 27 TYR A CE2 15 
ATOM   8199 C  CZ  . TYR A 1 27 ? -9.003  1.549   -3.662  1.00 0.00 ? 27 TYR A CZ  15 
ATOM   8200 O  OH  . TYR A 1 27 ? -8.465  2.551   -4.419  1.00 0.00 ? 27 TYR A OH  15 
ATOM   8201 N  N   . GLN A 1 28 ? -11.729 2.366   -0.573  1.00 0.00 ? 28 GLN A N   15 
ATOM   8202 C  CA  . GLN A 1 28 ? -12.484 3.447   -1.171  1.00 0.00 ? 28 GLN A CA  15 
ATOM   8203 C  C   . GLN A 1 28 ? -11.736 3.873   -2.429  1.00 0.00 ? 28 GLN A C   15 
ATOM   8204 O  O   . GLN A 1 28 ? -10.503 3.946   -2.437  1.00 0.00 ? 28 GLN A O   15 
ATOM   8205 C  CB  . GLN A 1 28 ? -12.661 4.578   -0.152  1.00 0.00 ? 28 GLN A CB  15 
ATOM   8206 C  CG  . GLN A 1 28 ? -13.696 5.641   -0.552  1.00 0.00 ? 28 GLN A CG  15 
ATOM   8207 C  CD  . GLN A 1 28 ? -13.108 6.658   -1.528  1.00 0.00 ? 28 GLN A CD  15 
ATOM   8208 O  OE1 . GLN A 1 28 ? -12.202 7.403   -1.169  1.00 0.00 ? 28 GLN A OE1 15 
ATOM   8209 N  NE2 . GLN A 1 28 ? -13.575 6.673   -2.769  1.00 0.00 ? 28 GLN A NE2 15 
ATOM   8210 N  N   . GLU A 1 29 ? -12.500 4.092   -3.489  1.00 0.00 ? 29 GLU A N   15 
ATOM   8211 C  CA  . GLU A 1 29 ? -12.058 4.396   -4.830  1.00 0.00 ? 29 GLU A CA  15 
ATOM   8212 C  C   . GLU A 1 29 ? -11.050 5.539   -4.847  1.00 0.00 ? 29 GLU A C   15 
ATOM   8213 O  O   . GLU A 1 29 ? -11.405 6.693   -4.608  1.00 0.00 ? 29 GLU A O   15 
ATOM   8214 C  CB  . GLU A 1 29 ? -13.272 4.716   -5.722  1.00 0.00 ? 29 GLU A CB  15 
ATOM   8215 C  CG  . GLU A 1 29 ? -14.421 3.697   -5.602  1.00 0.00 ? 29 GLU A CG  15 
ATOM   8216 C  CD  . GLU A 1 29 ? -15.499 4.104   -4.596  1.00 0.00 ? 29 GLU A CD  15 
ATOM   8217 O  OE1 . GLU A 1 29 ? -15.111 4.596   -3.511  1.00 0.00 ? 29 GLU A OE1 15 
ATOM   8218 O  OE2 . GLU A 1 29 ? -16.686 3.921   -4.928  1.00 0.00 ? 29 GLU A OE2 15 
ATOM   8219 N  N   . GLY A 1 30 ? -9.799  5.199   -5.163  1.00 0.00 ? 30 GLY A N   15 
ATOM   8220 C  CA  . GLY A 1 30 ? -8.731  6.162   -5.350  1.00 0.00 ? 30 GLY A CA  15 
ATOM   8221 C  C   . GLY A 1 30 ? -7.759  6.153   -4.180  1.00 0.00 ? 30 GLY A C   15 
ATOM   8222 O  O   . GLY A 1 30 ? -6.694  6.755   -4.284  1.00 0.00 ? 30 GLY A O   15 
ATOM   8223 N  N   . GLN A 1 31 ? -8.075  5.462   -3.077  1.00 0.00 ? 31 GLN A N   15 
ATOM   8224 C  CA  . GLN A 1 31 ? -7.093  5.302   -2.019  1.00 0.00 ? 31 GLN A CA  15 
ATOM   8225 C  C   . GLN A 1 31 ? -5.932  4.471   -2.578  1.00 0.00 ? 31 GLN A C   15 
ATOM   8226 O  O   . GLN A 1 31 ? -6.166  3.346   -3.018  1.00 0.00 ? 31 GLN A O   15 
ATOM   8227 C  CB  . GLN A 1 31 ? -7.737  4.605   -0.814  1.00 0.00 ? 31 GLN A CB  15 
ATOM   8228 C  CG  . GLN A 1 31 ? -8.790  5.468   -0.102  1.00 0.00 ? 31 GLN A CG  15 
ATOM   8229 C  CD  . GLN A 1 31 ? -9.375  4.810   1.154   1.00 0.00 ? 31 GLN A CD  15 
ATOM   8230 O  OE1 . GLN A 1 31 ? -9.749  5.486   2.106   1.00 0.00 ? 31 GLN A OE1 15 
ATOM   8231 N  NE2 . GLN A 1 31 ? -9.484  3.483   1.187   1.00 0.00 ? 31 GLN A NE2 15 
ATOM   8232 N  N   . LEU A 1 32 ? -4.717  5.024   -2.588  1.00 0.00 ? 32 LEU A N   15 
ATOM   8233 C  CA  . LEU A 1 32 ? -3.480  4.383   -3.030  1.00 0.00 ? 32 LEU A CA  15 
ATOM   8234 C  C   . LEU A 1 32 ? -2.428  4.634   -1.947  1.00 0.00 ? 32 LEU A C   15 
ATOM   8235 O  O   . LEU A 1 32 ? -2.503  5.657   -1.268  1.00 0.00 ? 32 LEU A O   15 
ATOM   8236 C  CB  . LEU A 1 32 ? -2.994  5.025   -4.345  1.00 0.00 ? 32 LEU A CB  15 
ATOM   8237 C  CG  . LEU A 1 32 ? -3.275  4.225   -5.624  1.00 0.00 ? 32 LEU A CG  15 
ATOM   8238 C  CD1 . LEU A 1 32 ? -4.753  4.142   -6.002  1.00 0.00 ? 32 LEU A CD1 15 
ATOM   8239 C  CD2 . LEU A 1 32 ? -2.555  4.907   -6.792  1.00 0.00 ? 32 LEU A CD2 15 
ATOM   8240 N  N   . CYS A 1 33 ? -1.428  3.761   -1.805  1.00 0.00 ? 33 CYS A N   15 
ATOM   8241 C  CA  . CYS A 1 33 ? -0.307  3.969   -0.891  1.00 0.00 ? 33 CYS A CA  15 
ATOM   8242 C  C   . CYS A 1 33 ? 0.293   5.370   -1.067  1.00 0.00 ? 33 CYS A C   15 
ATOM   8243 O  O   . CYS A 1 33 ? 0.434   6.101   -0.093  1.00 0.00 ? 33 CYS A O   15 
ATOM   8244 C  CB  . CYS A 1 33 ? 0.725   2.887   -1.063  1.00 0.00 ? 33 CYS A CB  15 
ATOM   8245 S  SG  . CYS A 1 33 ? 0.228   1.348   -0.238  1.00 0.00 ? 33 CYS A SG  15 
ATOM   8246 N  N   . GLU A 1 34 ? 0.556   5.826   -2.298  1.00 0.00 ? 34 GLU A N   15 
ATOM   8247 C  CA  . GLU A 1 34 ? 1.051   7.196   -2.487  1.00 0.00 ? 34 GLU A CA  15 
ATOM   8248 C  C   . GLU A 1 34 ? -0.044  8.280   -2.330  1.00 0.00 ? 34 GLU A C   15 
ATOM   8249 O  O   . GLU A 1 34 ? 0.087   9.391   -2.841  1.00 0.00 ? 34 GLU A O   15 
ATOM   8250 C  CB  . GLU A 1 34 ? 1.924   7.281   -3.743  1.00 0.00 ? 34 GLU A CB  15 
ATOM   8251 C  CG  . GLU A 1 34 ? 2.717   8.596   -3.890  1.00 0.00 ? 34 GLU A CG  15 
ATOM   8252 C  CD  . GLU A 1 34 ? 4.107   8.385   -4.481  1.00 0.00 ? 34 GLU A CD  15 
ATOM   8253 O  OE1 . GLU A 1 34 ? 4.189   7.684   -5.512  1.00 0.00 ? 34 GLU A OE1 15 
ATOM   8254 O  OE2 . GLU A 1 34 ? 5.072   8.906   -3.872  1.00 0.00 ? 34 GLU A OE2 15 
ATOM   8255 N  N   . ASN A 1 35 ? -1.105  8.004   -1.563  1.00 0.00 ? 35 ASN A N   15 
ATOM   8256 C  CA  . ASN A 1 35 ? -1.950  9.004   -0.917  1.00 0.00 ? 35 ASN A CA  15 
ATOM   8257 C  C   . ASN A 1 35 ? -2.387  8.530   0.478   1.00 0.00 ? 35 ASN A C   15 
ATOM   8258 O  O   . ASN A 1 35 ? -3.451  8.913   0.966   1.00 0.00 ? 35 ASN A O   15 
ATOM   8259 C  CB  . ASN A 1 35 ? -3.122  9.395   -1.827  1.00 0.00 ? 35 ASN A CB  15 
ATOM   8260 C  CG  . ASN A 1 35 ? -4.119  8.286   -2.118  1.00 0.00 ? 35 ASN A CG  15 
ATOM   8261 O  OD1 . ASN A 1 35 ? -4.645  7.620   -1.232  1.00 0.00 ? 35 ASN A OD1 15 
ATOM   8262 N  ND2 . ASN A 1 35 ? -4.432  8.104   -3.391  1.00 0.00 ? 35 ASN A ND2 15 
ATOM   8263 N  N   . CYS A 1 36 ? -1.547  7.717   1.127   1.00 0.00 ? 36 CYS A N   15 
ATOM   8264 C  CA  . CYS A 1 36 ? -1.731  7.200   2.474   1.00 0.00 ? 36 CYS A CA  15 
ATOM   8265 C  C   . CYS A 1 36 ? -0.957  8.076   3.459   1.00 0.00 ? 36 CYS A C   15 
ATOM   8266 O  O   . CYS A 1 36 ? 0.171   8.487   3.192   1.00 0.00 ? 36 CYS A O   15 
ATOM   8267 C  CB  . CYS A 1 36 ? -1.198  5.797   2.488   1.00 0.00 ? 36 CYS A CB  15 
ATOM   8268 S  SG  . CYS A 1 36 ? -1.386  4.958   4.063   1.00 0.00 ? 36 CYS A SG  15 
ATOM   8269 N  N   . ALA A 1 37 ? -1.547  8.361   4.620   1.00 0.00 ? 37 ALA A N   15 
ATOM   8270 C  CA  . ALA A 1 37 ? -0.918  9.187   5.639   1.00 0.00 ? 37 ALA A CA  15 
ATOM   8271 C  C   . ALA A 1 37 ? 0.382   8.577   6.170   1.00 0.00 ? 37 ALA A C   15 
ATOM   8272 O  O   . ALA A 1 37 ? 1.213   9.302   6.710   1.00 0.00 ? 37 ALA A O   15 
ATOM   8273 C  CB  . ALA A 1 37 ? -1.916  9.452   6.764   1.00 0.00 ? 37 ALA A CB  15 
ATOM   8274 N  N   . PHE A 1 38 ? 0.572   7.261   6.014   1.00 0.00 ? 38 PHE A N   15 
ATOM   8275 C  CA  . PHE A 1 38 ? 1.808   6.588   6.393   1.00 0.00 ? 38 PHE A CA  15 
ATOM   8276 C  C   . PHE A 1 38 ? 2.753   6.414   5.202   1.00 0.00 ? 38 PHE A C   15 
ATOM   8277 O  O   . PHE A 1 38 ? 3.697   5.631   5.299   1.00 0.00 ? 38 PHE A O   15 
ATOM   8278 C  CB  . PHE A 1 38 ? 1.491   5.233   7.038   1.00 0.00 ? 38 PHE A CB  15 
ATOM   8279 C  CG  . PHE A 1 38 ? 0.550   5.296   8.229   1.00 0.00 ? 38 PHE A CG  15 
ATOM   8280 C  CD1 . PHE A 1 38 ? 0.877   6.098   9.339   1.00 0.00 ? 38 PHE A CD1 15 
ATOM   8281 C  CD2 . PHE A 1 38 ? -0.656  4.571   8.223   1.00 0.00 ? 38 PHE A CD2 15 
ATOM   8282 C  CE1 . PHE A 1 38 ? -0.009  6.192   10.427  1.00 0.00 ? 38 PHE A CE1 15 
ATOM   8283 C  CE2 . PHE A 1 38 ? -1.538  4.661   9.313   1.00 0.00 ? 38 PHE A CE2 15 
ATOM   8284 C  CZ  . PHE A 1 38 ? -1.218  5.476   10.414  1.00 0.00 ? 38 PHE A CZ  15 
ATOM   8285 N  N   . TRP A 1 39 ? 2.540   7.118   4.087   1.00 0.00 ? 39 TRP A N   15 
ATOM   8286 C  CA  . TRP A 1 39 ? 3.478   7.056   2.980   1.00 0.00 ? 39 TRP A CA  15 
ATOM   8287 C  C   . TRP A 1 39 ? 4.821   7.684   3.363   1.00 0.00 ? 39 TRP A C   15 
ATOM   8288 O  O   . TRP A 1 39 ? 4.880   8.603   4.178   1.00 0.00 ? 39 TRP A O   15 
ATOM   8289 C  CB  . TRP A 1 39 ? 2.890   7.743   1.747   1.00 0.00 ? 39 TRP A CB  15 
ATOM   8290 C  CG  . TRP A 1 39 ? 3.684   7.580   0.486   1.00 0.00 ? 39 TRP A CG  15 
ATOM   8291 C  CD1 . TRP A 1 39 ? 4.187   8.587   -0.263  1.00 0.00 ? 39 TRP A CD1 15 
ATOM   8292 C  CD2 . TRP A 1 39 ? 4.044   6.346   -0.211  1.00 0.00 ? 39 TRP A CD2 15 
ATOM   8293 N  NE1 . TRP A 1 39 ? 4.806   8.065   -1.378  1.00 0.00 ? 39 TRP A NE1 15 
ATOM   8294 C  CE2 . TRP A 1 39 ? 4.750   6.692   -1.398  1.00 0.00 ? 39 TRP A CE2 15 
ATOM   8295 C  CE3 . TRP A 1 39 ? 3.823   4.970   0.018   1.00 0.00 ? 39 TRP A CE3 15 
ATOM   8296 C  CZ2 . TRP A 1 39 ? 5.193   5.738   -2.320  1.00 0.00 ? 39 TRP A CZ2 15 
ATOM   8297 C  CZ3 . TRP A 1 39 ? 4.296   3.997   -0.883  1.00 0.00 ? 39 TRP A CZ3 15 
ATOM   8298 C  CH2 . TRP A 1 39 ? 4.952   4.382   -2.062  1.00 0.00 ? 39 TRP A CH2 15 
ATOM   8299 N  N   . GLY A 1 40 ? 5.895   7.177   2.761   1.00 0.00 ? 40 GLY A N   15 
ATOM   8300 C  CA  . GLY A 1 40 ? 7.229   7.743   2.791   1.00 0.00 ? 40 GLY A CA  15 
ATOM   8301 C  C   . GLY A 1 40 ? 7.427   8.574   1.528   1.00 0.00 ? 40 GLY A C   15 
ATOM   8302 O  O   . GLY A 1 40 ? 6.927   9.693   1.438   1.00 0.00 ? 40 GLY A O   15 
ATOM   8303 N  N   . GLU A 1 41 ? 8.134   8.002   0.551   1.00 0.00 ? 41 GLU A N   15 
ATOM   8304 C  CA  . GLU A 1 41 ? 8.437   8.598   -0.738  1.00 0.00 ? 41 GLU A CA  15 
ATOM   8305 C  C   . GLU A 1 41 ? 8.555   7.467   -1.754  1.00 0.00 ? 41 GLU A C   15 
ATOM   8306 O  O   . GLU A 1 41 ? 8.910   6.341   -1.388  1.00 0.00 ? 41 GLU A O   15 
ATOM   8307 C  CB  . GLU A 1 41 ? 9.773   9.358   -0.680  1.00 0.00 ? 41 GLU A CB  15 
ATOM   8308 C  CG  . GLU A 1 41 ? 9.636   10.780  -0.127  1.00 0.00 ? 41 GLU A CG  15 
ATOM   8309 C  CD  . GLU A 1 41 ? 10.983  11.491  -0.121  1.00 0.00 ? 41 GLU A CD  15 
ATOM   8310 O  OE1 . GLU A 1 41 ? 11.877  10.997  0.600   1.00 0.00 ? 41 GLU A OE1 15 
ATOM   8311 O  OE2 . GLU A 1 41 ? 11.100  12.505  -0.842  1.00 0.00 ? 41 GLU A OE2 15 
ATOM   8312 N  N   . ALA A 1 42 ? 8.295   7.785   -3.024  1.00 0.00 ? 42 ALA A N   15 
ATOM   8313 C  CA  . ALA A 1 42 ? 8.594   6.902   -4.136  1.00 0.00 ? 42 ALA A CA  15 
ATOM   8314 C  C   . ALA A 1 42 ? 10.100  6.661   -4.242  1.00 0.00 ? 42 ALA A C   15 
ATOM   8315 O  O   . ALA A 1 42 ? 10.905  7.559   -4.009  1.00 0.00 ? 42 ALA A O   15 
ATOM   8316 C  CB  . ALA A 1 42 ? 8.000   7.446   -5.435  1.00 0.00 ? 42 ALA A CB  15 
ATOM   8317 N  N   . VAL A 1 43 ? 10.461  5.423   -4.575  1.00 0.00 ? 43 VAL A N   15 
ATOM   8318 C  CA  . VAL A 1 43 ? 11.821  4.931   -4.709  1.00 0.00 ? 43 VAL A CA  15 
ATOM   8319 C  C   . VAL A 1 43 ? 12.084  4.568   -6.173  1.00 0.00 ? 43 VAL A C   15 
ATOM   8320 O  O   . VAL A 1 43 ? 13.122  4.933   -6.719  1.00 0.00 ? 43 VAL A O   15 
ATOM   8321 C  CB  . VAL A 1 43 ? 12.007  3.706   -3.796  1.00 0.00 ? 43 VAL A CB  15 
ATOM   8322 C  CG1 . VAL A 1 43 ? 13.393  3.070   -3.982  1.00 0.00 ? 43 VAL A CG1 15 
ATOM   8323 C  CG2 . VAL A 1 43 ? 11.845  4.042   -2.305  1.00 0.00 ? 43 VAL A CG2 15 
ATOM   8324 N  N   . GLN A 1 44 ? 11.178  3.798   -6.790  1.00 0.00 ? 44 GLN A N   15 
ATOM   8325 C  CA  . GLN A 1 44 ? 11.377  3.232   -8.120  1.00 0.00 ? 44 GLN A CA  15 
ATOM   8326 C  C   . GLN A 1 44 ? 10.046  3.108   -8.876  1.00 0.00 ? 44 GLN A C   15 
ATOM   8327 O  O   . GLN A 1 44 ? 9.148   3.918   -8.657  1.00 0.00 ? 44 GLN A O   15 
ATOM   8328 C  CB  . GLN A 1 44 ? 12.216  1.947   -8.004  1.00 0.00 ? 44 GLN A CB  15 
ATOM   8329 C  CG  . GLN A 1 44 ? 11.535  0.859   -7.166  1.00 0.00 ? 44 GLN A CG  15 
ATOM   8330 C  CD  . GLN A 1 44 ? 12.397  -0.377  -6.908  1.00 0.00 ? 44 GLN A CD  15 
ATOM   8331 O  OE1 . GLN A 1 44 ? 11.895  -1.498  -6.902  1.00 0.00 ? 44 GLN A OE1 15 
ATOM   8332 N  NE2 . GLN A 1 44 ? 13.694  -0.204  -6.664  1.00 0.00 ? 44 GLN A NE2 15 
ATOM   8333 N  N   . ASP A 1 45 ? 9.924   2.128   -9.779  1.00 0.00 ? 45 ASP A N   15 
ATOM   8334 C  CA  . ASP A 1 45 ? 8.947   2.007   -10.859 1.00 0.00 ? 45 ASP A CA  15 
ATOM   8335 C  C   . ASP A 1 45 ? 7.516   1.787   -10.357 1.00 0.00 ? 45 ASP A C   15 
ATOM   8336 O  O   . ASP A 1 45 ? 6.922   0.727   -10.537 1.00 0.00 ? 45 ASP A O   15 
ATOM   8337 C  CB  . ASP A 1 45 ? 9.409   0.896   -11.822 1.00 0.00 ? 45 ASP A CB  15 
ATOM   8338 C  CG  . ASP A 1 45 ? 9.695   -0.433  -11.131 1.00 0.00 ? 45 ASP A CG  15 
ATOM   8339 O  OD1 . ASP A 1 45 ? 10.536  -0.430  -10.200 1.00 0.00 ? 45 ASP A OD1 15 
ATOM   8340 O  OD2 . ASP A 1 45 ? 9.110   -1.465  -11.518 1.00 0.00 ? 45 ASP A OD2 15 
ATOM   8341 N  N   . GLY A 1 46 ? 6.965   2.819   -9.725  1.00 0.00 ? 46 GLY A N   15 
ATOM   8342 C  CA  . GLY A 1 46 ? 5.655   2.796   -9.095  1.00 0.00 ? 46 GLY A CA  15 
ATOM   8343 C  C   . GLY A 1 46 ? 5.732   2.126   -7.726  1.00 0.00 ? 46 GLY A C   15 
ATOM   8344 O  O   . GLY A 1 46 ? 4.755   1.541   -7.264  1.00 0.00 ? 46 GLY A O   15 
ATOM   8345 N  N   . TRP A 1 47 ? 6.886   2.219   -7.061  1.00 0.00 ? 47 TRP A N   15 
ATOM   8346 C  CA  . TRP A 1 47 ? 7.130   1.690   -5.742  1.00 0.00 ? 47 TRP A CA  15 
ATOM   8347 C  C   . TRP A 1 47 ? 7.793   2.744   -4.893  1.00 0.00 ? 47 TRP A C   15 
ATOM   8348 O  O   . TRP A 1 47 ? 8.604   3.525   -5.396  1.00 0.00 ? 47 TRP A O   15 
ATOM   8349 C  CB  . TRP A 1 47 ? 8.091   0.522   -5.825  1.00 0.00 ? 47 TRP A CB  15 
ATOM   8350 C  CG  . TRP A 1 47 ? 7.593   -0.634  -6.599  1.00 0.00 ? 47 TRP A CG  15 
ATOM   8351 C  CD1 . TRP A 1 47 ? 7.686   -0.785  -7.932  1.00 0.00 ? 47 TRP A CD1 15 
ATOM   8352 C  CD2 . TRP A 1 47 ? 6.919   -1.812  -6.099  1.00 0.00 ? 47 TRP A CD2 15 
ATOM   8353 N  NE1 . TRP A 1 47 ? 7.045   -1.942  -8.300  1.00 0.00 ? 47 TRP A NE1 15 
ATOM   8354 C  CE2 . TRP A 1 47 ? 6.576   -2.628  -7.208  1.00 0.00 ? 47 TRP A CE2 15 
ATOM   8355 C  CE3 . TRP A 1 47 ? 6.615   -2.302  -4.815  1.00 0.00 ? 47 TRP A CE3 15 
ATOM   8356 C  CZ2 . TRP A 1 47 ? 5.995   -3.886  -7.058  1.00 0.00 ? 47 TRP A CZ2 15 
ATOM   8357 C  CZ3 . TRP A 1 47 ? 5.909   -3.507  -4.657  1.00 0.00 ? 47 TRP A CZ3 15 
ATOM   8358 C  CH2 . TRP A 1 47 ? 5.630   -4.309  -5.775  1.00 0.00 ? 47 TRP A CH2 15 
ATOM   8359 N  N   . GLY A 1 48 ? 7.500   2.698   -3.601  1.00 0.00 ? 48 GLY A N   15 
ATOM   8360 C  CA  . GLY A 1 48 ? 8.057   3.593   -2.631  1.00 0.00 ? 48 GLY A CA  15 
ATOM   8361 C  C   . GLY A 1 48 ? 7.923   3.022   -1.239  1.00 0.00 ? 48 GLY A C   15 
ATOM   8362 O  O   . GLY A 1 48 ? 7.410   1.923   -1.030  1.00 0.00 ? 48 GLY A O   15 
ATOM   8363 N  N   . ARG A 1 49 ? 8.434   3.772   -0.280  1.00 0.00 ? 49 ARG A N   15 
ATOM   8364 C  CA  . ARG A 1 49 ? 8.370   3.394   1.104   1.00 0.00 ? 49 ARG A CA  15 
ATOM   8365 C  C   . ARG A 1 49 ? 7.020   3.762   1.699   1.00 0.00 ? 49 ARG A C   15 
ATOM   8366 O  O   . ARG A 1 49 ? 6.558   4.887   1.550   1.00 0.00 ? 49 ARG A O   15 
ATOM   8367 C  CB  . ARG A 1 49 ? 9.534   4.059   1.814   1.00 0.00 ? 49 ARG A CB  15 
ATOM   8368 C  CG  . ARG A 1 49 ? 10.837  3.489   1.269   1.00 0.00 ? 49 ARG A CG  15 
ATOM   8369 C  CD  . ARG A 1 49 ? 11.156  2.042   1.590   1.00 0.00 ? 49 ARG A CD  15 
ATOM   8370 N  NE  . ARG A 1 49 ? 11.857  1.877   2.846   1.00 0.00 ? 49 ARG A NE  15 
ATOM   8371 C  CZ  . ARG A 1 49 ? 11.289  1.588   4.013   1.00 0.00 ? 49 ARG A CZ  15 
ATOM   8372 N  NH1 . ARG A 1 49 ? 10.008  1.813   4.298   1.00 0.00 ? 49 ARG A NH1 15 
ATOM   8373 N  NH2 . ARG A 1 49 ? 12.056  1.032   4.924   1.00 0.00 ? 49 ARG A NH2 15 
ATOM   8374 N  N   . CYS A 1 50 ? 6.441   2.799   2.407   1.00 0.00 ? 50 CYS A N   15 
ATOM   8375 C  CA  . CYS A 1 50 ? 5.467   3.004   3.467   1.00 0.00 ? 50 CYS A CA  15 
ATOM   8376 C  C   . CYS A 1 50 ? 6.299   3.154   4.748   1.00 0.00 ? 50 CYS A C   15 
ATOM   8377 O  O   . CYS A 1 50 ? 7.429   2.662   4.788   1.00 0.00 ? 50 CYS A O   15 
ATOM   8378 C  CB  . CYS A 1 50 ? 4.568   1.794   3.498   1.00 0.00 ? 50 CYS A CB  15 
ATOM   8379 S  SG  . CYS A 1 50 ? 3.363   1.882   4.838   1.00 0.00 ? 50 CYS A SG  15 
ATOM   8380 N  N   . THR A 1 51 ? 5.793   3.862   5.761   1.00 0.00 ? 51 THR A N   15 
ATOM   8381 C  CA  . THR A 1 51 ? 6.529   4.147   6.995   1.00 0.00 ? 51 THR A CA  15 
ATOM   8382 C  C   . THR A 1 51 ? 5.810   3.578   8.220   1.00 0.00 ? 51 THR A C   15 
ATOM   8383 O  O   . THR A 1 51 ? 5.954   4.096   9.326   1.00 0.00 ? 51 THR A O   15 
ATOM   8384 C  CB  . THR A 1 51 ? 6.790   5.658   7.119   1.00 0.00 ? 51 THR A CB  15 
ATOM   8385 O  OG1 . THR A 1 51 ? 5.584   6.392   7.086   1.00 0.00 ? 51 THR A OG1 15 
ATOM   8386 C  CG2 . THR A 1 51 ? 7.700   6.152   5.993   1.00 0.00 ? 51 THR A CG2 15 
ATOM   8387 N  N   . HIS A 1 52 ? 5.055   2.489   8.040   1.00 0.00 ? 52 HIS A N   15 
ATOM   8388 C  CA  . HIS A 1 52 ? 4.414   1.777   9.135   1.00 0.00 ? 52 HIS A CA  15 
ATOM   8389 C  C   . HIS A 1 52 ? 5.065   0.402   9.255   1.00 0.00 ? 52 HIS A C   15 
ATOM   8390 O  O   . HIS A 1 52 ? 4.863   -0.407  8.352   1.00 0.00 ? 52 HIS A O   15 
ATOM   8391 C  CB  . HIS A 1 52 ? 2.907   1.641   8.857   1.00 0.00 ? 52 HIS A CB  15 
ATOM   8392 C  CG  . HIS A 1 52 ? 2.089   1.506   10.119  1.00 0.00 ? 52 HIS A CG  15 
ATOM   8393 N  ND1 . HIS A 1 52 ? 1.831   0.352   10.845  1.00 0.00 ? 52 HIS A ND1 15 
ATOM   8394 C  CD2 . HIS A 1 52 ? 1.478   2.551   10.759  1.00 0.00 ? 52 HIS A CD2 15 
ATOM   8395 C  CE1 . HIS A 1 52 ? 1.068   0.700   11.897  1.00 0.00 ? 52 HIS A CE1 15 
ATOM   8396 N  NE2 . HIS A 1 52 ? 0.842   2.027   11.867  1.00 0.00 ? 52 HIS A NE2 15 
ATOM   8397 N  N   . PRO A 1 53 ? 5.805   0.094   10.334  1.00 0.00 ? 53 PRO A N   15 
ATOM   8398 C  CA  . PRO A 1 53 ? 6.097   -1.285  10.697  1.00 0.00 ? 53 PRO A CA  15 
ATOM   8399 C  C   . PRO A 1 53 ? 4.793   -2.078  10.616  1.00 0.00 ? 53 PRO A C   15 
ATOM   8400 O  O   . PRO A 1 53 ? 3.800   -1.624  11.184  1.00 0.00 ? 53 PRO A O   15 
ATOM   8401 C  CB  . PRO A 1 53 ? 6.667   -1.228  12.117  1.00 0.00 ? 53 PRO A CB  15 
ATOM   8402 C  CG  . PRO A 1 53 ? 7.277   0.173   12.179  1.00 0.00 ? 53 PRO A CG  15 
ATOM   8403 C  CD  . PRO A 1 53 ? 6.290   1.003   11.357  1.00 0.00 ? 53 PRO A CD  15 
ATOM   8404 N  N   . ASP A 1 54 ? 4.797   -3.155  9.821   1.00 0.00 ? 54 ASP A N   15 
ATOM   8405 C  CA  . ASP A 1 54 ? 3.660   -3.843  9.194   1.00 0.00 ? 54 ASP A CA  15 
ATOM   8406 C  C   . ASP A 1 54 ? 4.008   -3.995  7.715   1.00 0.00 ? 54 ASP A C   15 
ATOM   8407 O  O   . ASP A 1 54 ? 3.721   -5.017  7.093   1.00 0.00 ? 54 ASP A O   15 
ATOM   8408 C  CB  . ASP A 1 54 ? 2.330   -3.066  9.222   1.00 0.00 ? 54 ASP A CB  15 
ATOM   8409 C  CG  . ASP A 1 54 ? 1.572   -3.106  10.533  1.00 0.00 ? 54 ASP A CG  15 
ATOM   8410 O  OD1 . ASP A 1 54 ? 1.498   -4.198  11.136  1.00 0.00 ? 54 ASP A OD1 15 
ATOM   8411 O  OD2 . ASP A 1 54 ? 0.947   -2.070  10.845  1.00 0.00 ? 54 ASP A OD2 15 
ATOM   8412 N  N   . PHE A 1 55 ? 4.545   -2.903  7.167   1.00 0.00 ? 55 PHE A N   15 
ATOM   8413 C  CA  . PHE A 1 55 ? 4.817   -2.667  5.766   1.00 0.00 ? 55 PHE A CA  15 
ATOM   8414 C  C   . PHE A 1 55 ? 6.234   -2.142  5.542   1.00 0.00 ? 55 PHE A C   15 
ATOM   8415 O  O   . PHE A 1 55 ? 6.863   -2.531  4.563   1.00 0.00 ? 55 PHE A O   15 
ATOM   8416 C  CB  . PHE A 1 55 ? 3.754   -1.691  5.249   1.00 0.00 ? 55 PHE A CB  15 
ATOM   8417 C  CG  . PHE A 1 55 ? 2.439   -2.399  5.031   1.00 0.00 ? 55 PHE A CG  15 
ATOM   8418 C  CD1 . PHE A 1 55 ? 2.395   -3.359  4.003   1.00 0.00 ? 55 PHE A CD1 15 
ATOM   8419 C  CD2 . PHE A 1 55 ? 1.360   -2.286  5.936   1.00 0.00 ? 55 PHE A CD2 15 
ATOM   8420 C  CE1 . PHE A 1 55 ? 1.328   -4.260  3.925   1.00 0.00 ? 55 PHE A CE1 15 
ATOM   8421 C  CE2 . PHE A 1 55 ? 0.271   -3.156  5.816   1.00 0.00 ? 55 PHE A CE2 15 
ATOM   8422 C  CZ  . PHE A 1 55 ? 0.260   -4.150  4.825   1.00 0.00 ? 55 PHE A CZ  15 
ATOM   8423 N  N   . ASP A 1 56 ? 6.732   -1.273  6.428   1.00 0.00 ? 56 ASP A N   15 
ATOM   8424 C  CA  . ASP A 1 56 ? 8.063   -0.668  6.375   1.00 0.00 ? 56 ASP A CA  15 
ATOM   8425 C  C   . ASP A 1 56 ? 9.159   -1.668  5.981   1.00 0.00 ? 56 ASP A C   15 
ATOM   8426 O  O   . ASP A 1 56 ? 10.064  -1.330  5.217   1.00 0.00 ? 56 ASP A O   15 
ATOM   8427 C  CB  . ASP A 1 56 ? 8.363   -0.032  7.739   1.00 0.00 ? 56 ASP A CB  15 
ATOM   8428 C  CG  . ASP A 1 56 ? 9.760   0.561   7.818   1.00 0.00 ? 56 ASP A CG  15 
ATOM   8429 O  OD1 . ASP A 1 56 ? 10.210  1.106   6.786   1.00 0.00 ? 56 ASP A OD1 15 
ATOM   8430 O  OD2 . ASP A 1 56 ? 10.360  0.474   8.909   1.00 0.00 ? 56 ASP A OD2 15 
ATOM   8431 N  N   . GLU A 1 57 ? 9.065   -2.901  6.492   1.00 0.00 ? 57 GLU A N   15 
ATOM   8432 C  CA  . GLU A 1 57 ? 9.977   -3.997  6.164   1.00 0.00 ? 57 GLU A CA  15 
ATOM   8433 C  C   . GLU A 1 57 ? 10.254  -4.126  4.657   1.00 0.00 ? 57 GLU A C   15 
ATOM   8434 O  O   . GLU A 1 57 ? 11.365  -4.471  4.261   1.00 0.00 ? 57 GLU A O   15 
ATOM   8435 C  CB  . GLU A 1 57 ? 9.433   -5.349  6.664   1.00 0.00 ? 57 GLU A CB  15 
ATOM   8436 C  CG  . GLU A 1 57 ? 8.769   -5.321  8.047   1.00 0.00 ? 57 GLU A CG  15 
ATOM   8437 C  CD  . GLU A 1 57 ? 7.315   -4.890  7.948   1.00 0.00 ? 57 GLU A CD  15 
ATOM   8438 O  OE1 . GLU A 1 57 ? 6.518   -5.680  7.396   1.00 0.00 ? 57 GLU A OE1 15 
ATOM   8439 O  OE2 . GLU A 1 57 ? 7.048   -3.736  8.354   1.00 0.00 ? 57 GLU A OE2 15 
ATOM   8440 N  N   . VAL A 1 58 ? 9.221   -3.936  3.831   1.00 0.00 ? 58 VAL A N   15 
ATOM   8441 C  CA  . VAL A 1 58 ? 9.246   -4.166  2.393   1.00 0.00 ? 58 VAL A CA  15 
ATOM   8442 C  C   . VAL A 1 58 ? 9.002   -2.851  1.652   1.00 0.00 ? 58 VAL A C   15 
ATOM   8443 O  O   . VAL A 1 58 ? 8.479   -1.893  2.218   1.00 0.00 ? 58 VAL A O   15 
ATOM   8444 C  CB  . VAL A 1 58 ? 8.209   -5.241  2.017   1.00 0.00 ? 58 VAL A CB  15 
ATOM   8445 C  CG1 . VAL A 1 58 ? 8.678   -6.615  2.507   1.00 0.00 ? 58 VAL A CG1 15 
ATOM   8446 C  CG2 . VAL A 1 58 ? 6.810   -4.956  2.582   1.00 0.00 ? 58 VAL A CG2 15 
ATOM   8447 N  N   . LEU A 1 59 ? 9.379   -2.785  0.375   1.00 0.00 ? 59 LEU A N   15 
ATOM   8448 C  CA  . LEU A 1 59 ? 9.073   -1.649  -0.462  1.00 0.00 ? 59 LEU A CA  15 
ATOM   8449 C  C   . LEU A 1 59 ? 7.663   -1.831  -1.010  1.00 0.00 ? 59 LEU A C   15 
ATOM   8450 O  O   . LEU A 1 59 ? 7.329   -2.901  -1.507  1.00 0.00 ? 59 LEU A O   15 
ATOM   8451 C  CB  . LEU A 1 59 ? 10.103  -1.567  -1.583  1.00 0.00 ? 59 LEU A CB  15 
ATOM   8452 C  CG  . LEU A 1 59 ? 9.969   -0.260  -2.358  1.00 0.00 ? 59 LEU A CG  15 
ATOM   8453 C  CD1 . LEU A 1 59 ? 10.449  0.927   -1.525  1.00 0.00 ? 59 LEU A CD1 15 
ATOM   8454 C  CD2 . LEU A 1 59 ? 10.837  -0.352  -3.608  1.00 0.00 ? 59 LEU A CD2 15 
ATOM   8455 N  N   . VAL A 1 60 ? 6.830   -0.802  -0.909  1.00 0.00 ? 60 VAL A N   15 
ATOM   8456 C  CA  . VAL A 1 60 ? 5.403   -0.898  -1.140  1.00 0.00 ? 60 VAL A CA  15 
ATOM   8457 C  C   . VAL A 1 60 ? 5.079   -0.281  -2.499  1.00 0.00 ? 60 VAL A C   15 
ATOM   8458 O  O   . VAL A 1 60 ? 5.588   0.784   -2.837  1.00 0.00 ? 60 VAL A O   15 
ATOM   8459 C  CB  . VAL A 1 60 ? 4.717   -0.194  0.037   1.00 0.00 ? 60 VAL A CB  15 
ATOM   8460 C  CG1 . VAL A 1 60 ? 3.229   0.019   -0.208  1.00 0.00 ? 60 VAL A CG1 15 
ATOM   8461 C  CG2 . VAL A 1 60 ? 4.886   -1.048  1.301   1.00 0.00 ? 60 VAL A CG2 15 
ATOM   8462 N  N   . LYS A 1 61 ? 4.269   -0.956  -3.316  1.00 0.00 ? 61 LYS A N   15 
ATOM   8463 C  CA  . LYS A 1 61 ? 3.842   -0.385  -4.582  1.00 0.00 ? 61 LYS A CA  15 
ATOM   8464 C  C   . LYS A 1 61 ? 3.030   0.866   -4.280  1.00 0.00 ? 61 LYS A C   15 
ATOM   8465 O  O   . LYS A 1 61 ? 2.072   0.806   -3.518  1.00 0.00 ? 61 LYS A O   15 
ATOM   8466 C  CB  . LYS A 1 61 ? 3.024   -1.426  -5.346  1.00 0.00 ? 61 LYS A CB  15 
ATOM   8467 C  CG  . LYS A 1 61 ? 3.018   -1.229  -6.868  1.00 0.00 ? 61 LYS A CG  15 
ATOM   8468 C  CD  . LYS A 1 61 ? 2.815   -2.603  -7.524  1.00 0.00 ? 61 LYS A CD  15 
ATOM   8469 C  CE  . LYS A 1 61 ? 2.907   -2.580  -9.051  1.00 0.00 ? 61 LYS A CE  15 
ATOM   8470 N  NZ  . LYS A 1 61 ? 1.768   -1.855  -9.660  1.00 0.00 ? 61 LYS A NZ  15 
ATOM   8471 N  N   . ALA A 1 62 ? 3.400   1.989   -4.883  1.00 0.00 ? 62 ALA A N   15 
ATOM   8472 C  CA  . ALA A 1 62 ? 2.716   3.262   -4.695  1.00 0.00 ? 62 ALA A CA  15 
ATOM   8473 C  C   . ALA A 1 62 ? 1.244   3.152   -5.091  1.00 0.00 ? 62 ALA A C   15 
ATOM   8474 O  O   . ALA A 1 62 ? 0.387   3.824   -4.513  1.00 0.00 ? 62 ALA A O   15 
ATOM   8475 C  CB  . ALA A 1 62 ? 3.425   4.331   -5.524  1.00 0.00 ? 62 ALA A CB  15 
ATOM   8476 N  N   . GLU A 1 63 ? 0.975   2.291   -6.078  1.00 0.00 ? 63 GLU A N   15 
ATOM   8477 C  CA  . GLU A 1 63 ? -0.358  1.983   -6.570  1.00 0.00 ? 63 GLU A CA  15 
ATOM   8478 C  C   . GLU A 1 63 ? -1.083  0.961   -5.692  1.00 0.00 ? 63 GLU A C   15 
ATOM   8479 O  O   . GLU A 1 63 ? -2.256  0.696   -5.940  1.00 0.00 ? 63 GLU A O   15 
ATOM   8480 C  CB  . GLU A 1 63 ? -0.260  1.445   -7.998  1.00 0.00 ? 63 GLU A CB  15 
ATOM   8481 C  CG  . GLU A 1 63 ? 0.418   2.438   -8.954  1.00 0.00 ? 63 GLU A CG  15 
ATOM   8482 C  CD  . GLU A 1 63 ? 1.081   1.718   -10.120 1.00 0.00 ? 63 GLU A CD  15 
ATOM   8483 O  OE1 . GLU A 1 63 ? 1.827   0.752   -9.832  1.00 0.00 ? 63 GLU A OE1 15 
ATOM   8484 O  OE2 . GLU A 1 63 ? 0.843   2.137   -11.271 1.00 0.00 ? 63 GLU A OE2 15 
ATOM   8485 N  N   . GLY A 1 64 ? -0.402  0.355   -4.718  1.00 0.00 ? 64 GLY A N   15 
ATOM   8486 C  CA  . GLY A 1 64 ? -0.993  -0.618  -3.819  1.00 0.00 ? 64 GLY A CA  15 
ATOM   8487 C  C   . GLY A 1 64 ? -1.845  0.060   -2.760  1.00 0.00 ? 64 GLY A C   15 
ATOM   8488 O  O   . GLY A 1 64 ? -2.103  1.262   -2.825  1.00 0.00 ? 64 GLY A O   15 
ATOM   8489 N  N   . TRP A 1 65 ? -2.305  -0.732  -1.792  1.00 0.00 ? 65 TRP A N   15 
ATOM   8490 C  CA  . TRP A 1 65 ? -3.111  -0.273  -0.678  1.00 0.00 ? 65 TRP A CA  15 
ATOM   8491 C  C   . TRP A 1 65 ? -3.123  -1.387  0.361   1.00 0.00 ? 65 TRP A C   15 
ATOM   8492 O  O   . TRP A 1 65 ? -3.028  -2.553  -0.026  1.00 0.00 ? 65 TRP A O   15 
ATOM   8493 C  CB  . TRP A 1 65 ? -4.530  0.011   -1.173  1.00 0.00 ? 65 TRP A CB  15 
ATOM   8494 C  CG  . TRP A 1 65 ? -5.500  0.466   -0.135  1.00 0.00 ? 65 TRP A CG  15 
ATOM   8495 C  CD1 . TRP A 1 65 ? -5.806  1.754   0.129   1.00 0.00 ? 65 TRP A CD1 15 
ATOM   8496 C  CD2 . TRP A 1 65 ? -6.350  -0.340  0.734   1.00 0.00 ? 65 TRP A CD2 15 
ATOM   8497 N  NE1 . TRP A 1 65 ? -6.838  1.802   1.040   1.00 0.00 ? 65 TRP A NE1 15 
ATOM   8498 C  CE2 . TRP A 1 65 ? -7.229  0.538   1.430   1.00 0.00 ? 65 TRP A CE2 15 
ATOM   8499 C  CE3 . TRP A 1 65 ? -6.520  -1.725  0.951   1.00 0.00 ? 65 TRP A CE3 15 
ATOM   8500 C  CZ2 . TRP A 1 65 ? -8.257  0.070   2.255   1.00 0.00 ? 65 TRP A CZ2 15 
ATOM   8501 C  CZ3 . TRP A 1 65 ? -7.507  -2.207  1.830   1.00 0.00 ? 65 TRP A CZ3 15 
ATOM   8502 C  CH2 . TRP A 1 65 ? -8.397  -1.315  2.455   1.00 0.00 ? 65 TRP A CH2 15 
ATOM   8503 N  N   . CYS A 1 66 ? -3.252  -1.036  1.644   1.00 0.00 ? 66 CYS A N   15 
ATOM   8504 C  CA  . CYS A 1 66 ? -3.382  -1.968  2.755   1.00 0.00 ? 66 CYS A CA  15 
ATOM   8505 C  C   . CYS A 1 66 ? -4.508  -1.518  3.686   1.00 0.00 ? 66 CYS A C   15 
ATOM   8506 O  O   . CYS A 1 66 ? -4.925  -0.359  3.648   1.00 0.00 ? 66 CYS A O   15 
ATOM   8507 C  CB  . CYS A 1 66 ? -2.079  -2.095  3.507   1.00 0.00 ? 66 CYS A CB  15 
ATOM   8508 S  SG  . CYS A 1 66 ? -1.843  -0.767  4.716   1.00 0.00 ? 66 CYS A SG  15 
ATOM   8509 N  N   . SER A 1 67 ? -5.017  -2.405  4.547   1.00 0.00 ? 67 SER A N   15 
ATOM   8510 C  CA  . SER A 1 67 ? -6.098  -2.013  5.439   1.00 0.00 ? 67 SER A CA  15 
ATOM   8511 C  C   . SER A 1 67 ? -5.642  -1.031  6.524   1.00 0.00 ? 67 SER A C   15 
ATOM   8512 O  O   . SER A 1 67 ? -6.486  -0.298  7.048   1.00 0.00 ? 67 SER A O   15 
ATOM   8513 C  CB  . SER A 1 67 ? -6.858  -3.232  5.969   1.00 0.00 ? 67 SER A CB  15 
ATOM   8514 O  OG  . SER A 1 67 ? -6.017  -4.211  6.535   1.00 0.00 ? 67 SER A OG  15 
ATOM   8515 N  N   . VAL A 1 68 ? -4.338  -0.946  6.835   1.00 0.00 ? 68 VAL A N   15 
ATOM   8516 C  CA  . VAL A 1 68 ? -3.847  0.119   7.714   1.00 0.00 ? 68 VAL A CA  15 
ATOM   8517 C  C   . VAL A 1 68 ? -3.854  1.495   7.034   1.00 0.00 ? 68 VAL A C   15 
ATOM   8518 O  O   . VAL A 1 68 ? -3.565  2.487   7.699   1.00 0.00 ? 68 VAL A O   15 
ATOM   8519 C  CB  . VAL A 1 68 ? -2.574  -0.194  8.535   1.00 0.00 ? 68 VAL A CB  15 
ATOM   8520 C  CG1 . VAL A 1 68 ? -2.508  -1.676  8.810   1.00 0.00 ? 68 VAL A CG1 15 
ATOM   8521 C  CG2 . VAL A 1 68 ? -1.182  0.218   8.066   1.00 0.00 ? 68 VAL A CG2 15 
ATOM   8522 N  N   . TYR A 1 69 ? -4.214  1.577   5.741   1.00 0.00 ? 69 TYR A N   15 
ATOM   8523 C  CA  . TYR A 1 69 ? -4.430  2.849   5.057   1.00 0.00 ? 69 TYR A CA  15 
ATOM   8524 C  C   . TYR A 1 69 ? -5.260  3.799   5.917   1.00 0.00 ? 69 TYR A C   15 
ATOM   8525 O  O   . TYR A 1 69 ? -6.362  3.435   6.344   1.00 0.00 ? 69 TYR A O   15 
ATOM   8526 C  CB  . TYR A 1 69 ? -5.150  2.639   3.716   1.00 0.00 ? 69 TYR A CB  15 
ATOM   8527 C  CG  . TYR A 1 69 ? -5.421  3.925   2.953   1.00 0.00 ? 69 TYR A CG  15 
ATOM   8528 C  CD1 . TYR A 1 69 ? -6.555  4.707   3.248   1.00 0.00 ? 69 TYR A CD1 15 
ATOM   8529 C  CD2 . TYR A 1 69 ? -4.505  4.377   1.988   1.00 0.00 ? 69 TYR A CD2 15 
ATOM   8530 C  CE1 . TYR A 1 69 ? -6.710  5.972   2.658   1.00 0.00 ? 69 TYR A CE1 15 
ATOM   8531 C  CE2 . TYR A 1 69 ? -4.691  5.619   1.364   1.00 0.00 ? 69 TYR A CE2 15 
ATOM   8532 C  CZ  . TYR A 1 69 ? -5.776  6.433   1.719   1.00 0.00 ? 69 TYR A CZ  15 
ATOM   8533 O  OH  . TYR A 1 69 ? -5.961  7.641   1.123   1.00 0.00 ? 69 TYR A OH  15 
ATOM   8534 N  N   . ALA A 1 70 ? -4.762  5.023   6.091   1.00 0.00 ? 70 ALA A N   15 
ATOM   8535 C  CA  . ALA A 1 70 ? -5.498  6.161   6.613   1.00 0.00 ? 70 ALA A CA  15 
ATOM   8536 C  C   . ALA A 1 70 ? -5.281  7.297   5.613   1.00 0.00 ? 70 ALA A C   15 
ATOM   8537 O  O   . ALA A 1 70 ? -4.161  7.432   5.118   1.00 0.00 ? 70 ALA A O   15 
ATOM   8538 C  CB  . ALA A 1 70 ? -4.951  6.528   7.996   1.00 0.00 ? 70 ALA A CB  15 
ATOM   8539 N  N   . PRO A 1 71 ? -6.311  8.081   5.263   1.00 0.00 ? 71 PRO A N   15 
ATOM   8540 C  CA  . PRO A 1 71 ? -6.174  9.137   4.278   1.00 0.00 ? 71 PRO A CA  15 
ATOM   8541 C  C   . PRO A 1 71 ? -5.345  10.284  4.829   1.00 0.00 ? 71 PRO A C   15 
ATOM   8542 O  O   . PRO A 1 71 ? -5.366  10.567  6.025   1.00 0.00 ? 71 PRO A O   15 
ATOM   8543 C  CB  . PRO A 1 71 ? -7.600  9.576   3.940   1.00 0.00 ? 71 PRO A CB  15 
ATOM   8544 C  CG  . PRO A 1 71 ? -8.362  9.277   5.231   1.00 0.00 ? 71 PRO A CG  15 
ATOM   8545 C  CD  . PRO A 1 71 ? -7.672  8.024   5.772   1.00 0.00 ? 71 PRO A CD  15 
ATOM   8546 N  N   . ALA A 1 72 ? -4.623  10.960  3.935   1.00 0.00 ? 72 ALA A N   15 
ATOM   8547 C  CA  . ALA A 1 72 ? -3.779  12.092  4.277   1.00 0.00 ? 72 ALA A CA  15 
ATOM   8548 C  C   . ALA A 1 72 ? -4.543  13.397  4.058   1.00 0.00 ? 72 ALA A C   15 
ATOM   8549 O  O   . ALA A 1 72 ? -4.021  14.361  3.500   1.00 0.00 ? 72 ALA A O   15 
ATOM   8550 C  CB  . ALA A 1 72 ? -2.519  12.024  3.427   1.00 0.00 ? 72 ALA A CB  15 
ATOM   8551 N  N   . SER A 1 73 ? -5.800  13.394  4.479   1.00 0.00 ? 73 SER A N   15 
ATOM   8552 C  CA  . SER A 1 73 ? -6.771  14.442  4.248   1.00 0.00 ? 73 SER A CA  15 
ATOM   8553 C  C   . SER A 1 73 ? -7.997  14.097  5.084   1.00 0.00 ? 73 SER A C   15 
ATOM   8554 O  O   . SER A 1 73 ? -8.480  12.961  4.868   1.00 0.00 ? 73 SER A O   15 
ATOM   8555 C  CB  . SER A 1 73 ? -7.150  14.467  2.763   1.00 0.00 ? 73 SER A CB  15 
ATOM   8556 O  OG  . SER A 1 73 ? -7.575  13.172  2.378   1.00 0.00 ? 73 SER A OG  15 
ATOM   8557 O  OXT . SER A 1 73 ? -8.424  14.951  5.889   1.00 0.00 ? 73 SER A OXT 15 
HETATM 8558 FE FE1 . SF4 B 2 .  ? 0.215   1.658   1.781   1.00 0.00 ? 74 SF4 A FE1 15 
HETATM 8559 FE FE2 . SF4 B 2 .  ? -0.523  3.172   3.623   1.00 0.00 ? 74 SF4 A FE2 15 
HETATM 8560 FE FE3 . SF4 B 2 .  ? 1.528   1.833   3.919   1.00 0.00 ? 74 SF4 A FE3 15 
HETATM 8561 FE FE4 . SF4 B 2 .  ? -0.704  0.704   3.880   1.00 0.00 ? 74 SF4 A FE4 15 
HETATM 8562 S  S1  . SF4 B 2 .  ? -0.016  2.091   5.393   1.00 0.00 ? 74 SF4 A S1  15 
HETATM 8563 S  S2  . SF4 B 2 .  ? 1.065   -0.008  2.877   1.00 0.00 ? 74 SF4 A S2  15 
HETATM 8564 S  S3  . SF4 B 2 .  ? -1.812  1.882   2.476   1.00 0.00 ? 74 SF4 A S3  15 
HETATM 8565 S  S4  . SF4 B 2 .  ? 1.289   3.406   2.473   1.00 0.00 ? 74 SF4 A S4  15 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ALA 1  1  1  ALA ALA A . n 
A 1 2  SER 2  2  2  SER SER A . n 
A 1 3  GLU 3  3  3  GLU GLU A . n 
A 1 4  PRO 4  4  4  PRO PRO A . n 
A 1 5  ARG 5  5  5  ARG ARG A . n 
A 1 6  ALA 6  6  6  ALA ALA A . n 
A 1 7  GLU 7  7  7  GLU GLU A . n 
A 1 8  ASP 8  8  8  ASP ASP A . n 
A 1 9  GLY 9  9  9  GLY GLY A . n 
A 1 10 HIS 10 10 10 HIS HIS A . n 
A 1 11 ALA 11 11 11 ALA ALA A . n 
A 1 12 HIS 12 12 12 HIS HIS A . n 
A 1 13 ASP 13 13 13 ASP ASP A . n 
A 1 14 TYR 14 14 14 TYR TYR A . n 
A 1 15 VAL 15 15 15 VAL VAL A . n 
A 1 16 ASN 16 16 16 ASN ASN A . n 
A 1 17 GLU 17 17 17 GLU GLU A . n 
A 1 18 ALA 18 18 18 ALA ALA A . n 
A 1 19 ALA 19 19 19 ALA ALA A . n 
A 1 20 ASP 20 20 20 ASP ASP A . n 
A 1 21 ALA 21 21 21 ALA ALA A . n 
A 1 22 SER 22 22 22 SER SER A . n 
A 1 23 GLY 23 23 23 GLY GLY A . n 
A 1 24 HIS 24 24 24 HIS HIS A . n 
A 1 25 PRO 25 25 25 PRO PRO A . n 
A 1 26 ARG 26 26 26 ARG ARG A . n 
A 1 27 TYR 27 27 27 TYR TYR A . n 
A 1 28 GLN 28 28 28 GLN GLN A . n 
A 1 29 GLU 29 29 29 GLU GLU A . n 
A 1 30 GLY 30 30 30 GLY GLY A . n 
A 1 31 GLN 31 31 31 GLN GLN A . n 
A 1 32 LEU 32 32 32 LEU LEU A . n 
A 1 33 CYS 33 33 33 CYS CYS A . n 
A 1 34 GLU 34 34 34 GLU GLU A . n 
A 1 35 ASN 35 35 35 ASN ASN A . n 
A 1 36 CYS 36 36 36 CYS CYS A . n 
A 1 37 ALA 37 37 37 ALA ALA A . n 
A 1 38 PHE 38 38 38 PHE PHE A . n 
A 1 39 TRP 39 39 39 TRP TRP A . n 
A 1 40 GLY 40 40 40 GLY GLY A . n 
A 1 41 GLU 41 41 41 GLU GLU A . n 
A 1 42 ALA 42 42 42 ALA ALA A . n 
A 1 43 VAL 43 43 43 VAL VAL A . n 
A 1 44 GLN 44 44 44 GLN GLN A . n 
A 1 45 ASP 45 45 45 ASP ASP A . n 
A 1 46 GLY 46 46 46 GLY GLY A . n 
A 1 47 TRP 47 47 47 TRP TRP A . n 
A 1 48 GLY 48 48 48 GLY GLY A . n 
A 1 49 ARG 49 49 49 ARG ARG A . n 
A 1 50 CYS 50 50 50 CYS CYS A . n 
A 1 51 THR 51 51 51 THR THR A . n 
A 1 52 HIS 52 52 52 HIS HIS A . n 
A 1 53 PRO 53 53 53 PRO PRO A . n 
A 1 54 ASP 54 54 54 ASP ASP A . n 
A 1 55 PHE 55 55 55 PHE PHE A . n 
A 1 56 ASP 56 56 56 ASP ASP A . n 
A 1 57 GLU 57 57 57 GLU GLU A . n 
A 1 58 VAL 58 58 58 VAL VAL A . n 
A 1 59 LEU 59 59 59 LEU LEU A . n 
A 1 60 VAL 60 60 60 VAL VAL A . n 
A 1 61 LYS 61 61 61 LYS LYS A . n 
A 1 62 ALA 62 62 62 ALA ALA A . n 
A 1 63 GLU 63 63 63 GLU GLU A . n 
A 1 64 GLY 64 64 64 GLY GLY A . n 
A 1 65 TRP 65 65 65 TRP TRP A . n 
A 1 66 CYS 66 66 66 CYS CYS A . n 
A 1 67 SER 67 67 67 SER SER A . n 
A 1 68 VAL 68 68 68 VAL VAL A . n 
A 1 69 TYR 69 69 69 TYR TYR A . n 
A 1 70 ALA 70 70 70 ALA ALA A . n 
A 1 71 PRO 71 71 71 PRO PRO A . n 
A 1 72 ALA 72 72 72 ALA ALA A . n 
A 1 73 SER 73 73 73 SER SER A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          SF4 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     74 
_pdbx_nonpoly_scheme.auth_seq_num    74 
_pdbx_nonpoly_scheme.pdb_mon_id      SF4 
_pdbx_nonpoly_scheme.auth_mon_id     FS4 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? A CYS 33 ? A CYS 33 ? 1_555 FE1 ? B SF4 . ? A SF4 74 ? 1_555 S2 ? B SF4 . ? A SF4 74 ? 1_555 111.6 ? 
2  SG ? A CYS 33 ? A CYS 33 ? 1_555 FE1 ? B SF4 . ? A SF4 74 ? 1_555 S3 ? B SF4 . ? A SF4 74 ? 1_555 110.7 ? 
3  S2 ? B SF4 .  ? A SF4 74 ? 1_555 FE1 ? B SF4 . ? A SF4 74 ? 1_555 S3 ? B SF4 . ? A SF4 74 ? 1_555 105.8 ? 
4  SG ? A CYS 33 ? A CYS 33 ? 1_555 FE1 ? B SF4 . ? A SF4 74 ? 1_555 S4 ? B SF4 . ? A SF4 74 ? 1_555 116.3 ? 
5  S2 ? B SF4 .  ? A SF4 74 ? 1_555 FE1 ? B SF4 . ? A SF4 74 ? 1_555 S4 ? B SF4 . ? A SF4 74 ? 1_555 105.5 ? 
6  S3 ? B SF4 .  ? A SF4 74 ? 1_555 FE1 ? B SF4 . ? A SF4 74 ? 1_555 S4 ? B SF4 . ? A SF4 74 ? 1_555 106.3 ? 
7  SG ? A CYS 36 ? A CYS 36 ? 1_555 FE2 ? B SF4 . ? A SF4 74 ? 1_555 S1 ? B SF4 . ? A SF4 74 ? 1_555 110.1 ? 
8  SG ? A CYS 36 ? A CYS 36 ? 1_555 FE2 ? B SF4 . ? A SF4 74 ? 1_555 S3 ? B SF4 . ? A SF4 74 ? 1_555 113.5 ? 
9  S1 ? B SF4 .  ? A SF4 74 ? 1_555 FE2 ? B SF4 . ? A SF4 74 ? 1_555 S3 ? B SF4 . ? A SF4 74 ? 1_555 106.4 ? 
10 SG ? A CYS 36 ? A CYS 36 ? 1_555 FE2 ? B SF4 . ? A SF4 74 ? 1_555 S4 ? B SF4 . ? A SF4 74 ? 1_555 112.6 ? 
11 S1 ? B SF4 .  ? A SF4 74 ? 1_555 FE2 ? B SF4 . ? A SF4 74 ? 1_555 S4 ? B SF4 . ? A SF4 74 ? 1_555 107.3 ? 
12 S3 ? B SF4 .  ? A SF4 74 ? 1_555 FE2 ? B SF4 . ? A SF4 74 ? 1_555 S4 ? B SF4 . ? A SF4 74 ? 1_555 106.6 ? 
13 SG ? A CYS 50 ? A CYS 50 ? 1_555 FE3 ? B SF4 . ? A SF4 74 ? 1_555 S1 ? B SF4 . ? A SF4 74 ? 1_555 108.3 ? 
14 SG ? A CYS 50 ? A CYS 50 ? 1_555 FE3 ? B SF4 . ? A SF4 74 ? 1_555 S2 ? B SF4 . ? A SF4 74 ? 1_555 115.7 ? 
15 S1 ? B SF4 .  ? A SF4 74 ? 1_555 FE3 ? B SF4 . ? A SF4 74 ? 1_555 S2 ? B SF4 . ? A SF4 74 ? 1_555 106.8 ? 
16 SG ? A CYS 50 ? A CYS 50 ? 1_555 FE3 ? B SF4 . ? A SF4 74 ? 1_555 S4 ? B SF4 . ? A SF4 74 ? 1_555 112.8 ? 
17 S1 ? B SF4 .  ? A SF4 74 ? 1_555 FE3 ? B SF4 . ? A SF4 74 ? 1_555 S4 ? B SF4 . ? A SF4 74 ? 1_555 106.7 ? 
18 S2 ? B SF4 .  ? A SF4 74 ? 1_555 FE3 ? B SF4 . ? A SF4 74 ? 1_555 S4 ? B SF4 . ? A SF4 74 ? 1_555 106.1 ? 
19 SG ? A CYS 66 ? A CYS 66 ? 1_555 FE4 ? B SF4 . ? A SF4 74 ? 1_555 S1 ? B SF4 . ? A SF4 74 ? 1_555 109.2 ? 
20 SG ? A CYS 66 ? A CYS 66 ? 1_555 FE4 ? B SF4 . ? A SF4 74 ? 1_555 S2 ? B SF4 . ? A SF4 74 ? 1_555 114.3 ? 
21 S1 ? B SF4 .  ? A SF4 74 ? 1_555 FE4 ? B SF4 . ? A SF4 74 ? 1_555 S2 ? B SF4 . ? A SF4 74 ? 1_555 106.6 ? 
22 SG ? A CYS 66 ? A CYS 66 ? 1_555 FE4 ? B SF4 . ? A SF4 74 ? 1_555 S3 ? B SF4 . ? A SF4 74 ? 1_555 113.0 ? 
23 S1 ? B SF4 .  ? A SF4 74 ? 1_555 FE4 ? B SF4 . ? A SF4 74 ? 1_555 S3 ? B SF4 . ? A SF4 74 ? 1_555 105.8 ? 
24 S2 ? B SF4 .  ? A SF4 74 ? 1_555 FE4 ? B SF4 . ? A SF4 74 ? 1_555 S3 ? B SF4 . ? A SF4 74 ? 1_555 107.3 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-12-20 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
_software.name             AMBER 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 2  CB A ALA 1 ? ? OE1 A GLU 3  ? ? 1.97 
2 3  CB A ALA 1 ? ? OE1 A GLN 44 ? ? 2.10 
3 11 CB A ALA 1 ? ? OE1 A GLU 3  ? ? 1.73 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1  CA  A VAL 68 ? ? CB A VAL 68 ? ? CG2 A VAL 68 ? ? 121.00 110.90 10.10 1.50 N 
2  3  CA  A VAL 68 ? ? CB A VAL 68 ? ? CG2 A VAL 68 ? ? 120.79 110.90 9.89  1.50 N 
3  4  CB  A PHE 55 ? ? CG A PHE 55 ? ? CD1 A PHE 55 ? ? 116.39 120.80 -4.41 0.70 N 
4  5  OE1 A GLU 3  ? ? CD A GLU 3  ? ? OE2 A GLU 3  ? ? 114.82 123.30 -8.48 1.20 N 
5  5  CA  A VAL 68 ? ? CB A VAL 68 ? ? CG2 A VAL 68 ? ? 121.56 110.90 10.66 1.50 N 
6  6  NE  A ARG 49 ? ? CZ A ARG 49 ? ? NH2 A ARG 49 ? ? 117.23 120.30 -3.07 0.50 N 
7  7  CA  A VAL 68 ? ? CB A VAL 68 ? ? CG2 A VAL 68 ? ? 120.54 110.90 9.64  1.50 N 
8  8  NE  A ARG 49 ? ? CZ A ARG 49 ? ? NH1 A ARG 49 ? ? 124.28 120.30 3.98  0.50 N 
9  8  NE  A ARG 49 ? ? CZ A ARG 49 ? ? NH2 A ARG 49 ? ? 116.60 120.30 -3.70 0.50 N 
10 8  CA  A VAL 68 ? ? CB A VAL 68 ? ? CG2 A VAL 68 ? ? 121.13 110.90 10.23 1.50 N 
11 12 CA  A VAL 68 ? ? CB A VAL 68 ? ? CG2 A VAL 68 ? ? 120.47 110.90 9.57  1.50 N 
12 14 OE1 A GLU 3  ? ? CD A GLU 3  ? ? OE2 A GLU 3  ? ? 114.41 123.30 -8.89 1.20 N 
13 14 CA  A VAL 68 ? ? CB A VAL 68 ? ? CG2 A VAL 68 ? ? 122.22 110.90 11.32 1.50 N 
14 15 NE  A ARG 49 ? ? CZ A ARG 49 ? ? NH1 A ARG 49 ? ? 124.20 120.30 3.90  0.50 N 
15 15 NE  A ARG 49 ? ? CZ A ARG 49 ? ? NH2 A ARG 49 ? ? 116.81 120.30 -3.49 0.50 N 
16 15 CA  A VAL 68 ? ? CB A VAL 68 ? ? CG2 A VAL 68 ? ? 122.22 110.90 11.32 1.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  GLN A 44 ? ? -151.43 -138.98 
2   1  ASP A 45 ? ? -69.19  66.83   
3   1  ASP A 54 ? ? -70.10  47.14   
4   1  PHE A 55 ? ? -172.71 -55.40  
5   1  ALA A 72 ? ? -97.40  34.84   
6   2  ARG A 26 ? ? 127.18  -41.32  
7   2  GLN A 44 ? ? -152.07 -128.59 
8   2  HIS A 52 ? ? 95.72   136.80  
9   2  ASP A 54 ? ? 98.28   -13.49  
10  2  TYR A 69 ? ? -27.06  113.01  
11  2  ALA A 72 ? ? -98.76  35.41   
12  3  SER A 2  ? ? -57.31  -158.48 
13  3  GLU A 3  ? ? -45.53  154.34  
14  3  ARG A 26 ? ? 124.96  -37.62  
15  3  GLU A 34 ? ? -76.92  31.35   
16  3  ASN A 35 ? ? -143.11 30.31   
17  3  GLN A 44 ? ? -147.67 -152.85 
18  3  ASP A 45 ? ? -56.54  68.45   
19  3  HIS A 52 ? ? 96.41   117.59  
20  3  ASP A 54 ? ? 100.08  -20.33  
21  3  VAL A 68 ? ? -67.74  -70.35  
22  3  TYR A 69 ? ? 58.72   -85.34  
23  3  ALA A 70 ? ? 62.68   124.95  
24  3  ALA A 72 ? ? -91.93  48.66   
25  4  SER A 2  ? ? -94.13  38.11   
26  4  HIS A 12 ? ? 37.11   50.07   
27  4  ARG A 26 ? ? 143.16  -35.81  
28  4  ASP A 45 ? ? -56.40  71.12   
29  4  ASP A 54 ? ? 122.01  -40.19  
30  4  ALA A 72 ? ? -98.96  35.43   
31  5  HIS A 12 ? ? 39.97   48.13   
32  5  ARG A 26 ? ? 127.58  -38.60  
33  5  GLU A 34 ? ? -75.10  23.96   
34  5  ASP A 54 ? ? 120.80  -29.20  
35  5  ALA A 72 ? ? -99.33  33.59   
36  6  SER A 2  ? ? -153.75 47.49   
37  6  ARG A 26 ? ? 141.10  -44.19  
38  6  VAL A 43 ? ? -123.82 -50.72  
39  6  GLN A 44 ? ? -140.73 -138.64 
40  6  ASP A 45 ? ? -68.51  64.18   
41  6  THR A 51 ? ? 71.44   -29.44  
42  6  PHE A 55 ? ? -179.46 -42.29  
43  6  ALA A 72 ? ? -96.73  33.07   
44  7  SER A 2  ? ? -162.09 55.92   
45  7  HIS A 12 ? ? 39.02   50.52   
46  7  ARG A 26 ? ? -178.06 -36.27  
47  7  GLN A 44 ? ? -151.71 -155.44 
48  7  ASP A 45 ? ? -56.96  70.52   
49  7  HIS A 52 ? ? 82.52   163.26  
50  7  ASP A 54 ? ? 63.43   -171.50 
51  7  PHE A 55 ? ? 73.84   -62.66  
52  7  GLU A 57 ? ? -24.34  -53.74  
53  7  ALA A 72 ? ? -97.22  37.82   
54  8  HIS A 12 ? ? 38.33   50.69   
55  8  ARG A 26 ? ? 139.34  -35.41  
56  8  GLN A 44 ? ? -149.17 -159.15 
57  8  ASP A 45 ? ? -59.32  70.30   
58  8  HIS A 52 ? ? 93.95   120.09  
59  8  ASP A 54 ? ? 118.69  -46.14  
60  8  ASP A 56 ? ? -132.42 -40.68  
61  8  ALA A 72 ? ? -96.42  41.18   
62  9  HIS A 12 ? ? 36.84   48.45   
63  9  SER A 22 ? ? -62.73  91.88   
64  9  ARG A 26 ? ? 123.20  -35.54  
65  9  ASP A 45 ? ? -58.05  71.23   
66  9  ASP A 54 ? ? 124.03  -44.39  
67  9  PHE A 55 ? ? -143.85 33.51   
68  9  ALA A 72 ? ? -93.26  46.27   
69  10 SER A 2  ? ? -72.82  29.34   
70  10 ASP A 8  ? ? -66.27  87.75   
71  10 VAL A 15 ? ? 55.52   134.80  
72  10 SER A 22 ? ? -13.68  99.99   
73  10 ARG A 26 ? ? 123.66  -40.72  
74  10 GLN A 44 ? ? -149.55 -136.88 
75  10 THR A 51 ? ? -105.98 52.62   
76  10 PHE A 55 ? ? -166.40 -53.37  
77  10 ASP A 56 ? ? -23.49  -50.89  
78  10 ALA A 72 ? ? -92.30  46.75   
79  11 SER A 22 ? ? -61.79  91.56   
80  11 ARG A 26 ? ? 139.90  -29.44  
81  11 GLN A 44 ? ? -149.37 -140.80 
82  11 HIS A 52 ? ? 100.23  141.19  
83  11 PHE A 55 ? ? -163.22 -55.56  
84  11 TYR A 69 ? ? -20.45  105.39  
85  12 SER A 2  ? ? -105.64 58.42   
86  12 ARG A 26 ? ? 141.41  -40.00  
87  12 GLU A 29 ? ? -56.94  107.26  
88  12 ASP A 54 ? ? 110.07  -16.06  
89  12 GLU A 57 ? ? -71.58  -70.46  
90  12 ALA A 72 ? ? -96.70  39.54   
91  13 ASP A 8  ? ? -67.34  96.23   
92  13 VAL A 15 ? ? 56.85   132.13  
93  13 SER A 22 ? ? -61.62  93.00   
94  13 ARG A 26 ? ? 118.91  -39.22  
95  13 ASP A 45 ? ? -51.74  71.36   
96  13 ASP A 54 ? ? -69.03  38.59   
97  13 PHE A 55 ? ? -176.58 -36.74  
98  13 TYR A 69 ? ? -38.57  132.79  
99  14 ASP A 8  ? ? -68.28  96.40   
100 14 HIS A 12 ? ? 31.86   50.70   
101 14 VAL A 15 ? ? 54.18   130.12  
102 14 ARG A 26 ? ? 122.76  -40.33  
103 14 ASP A 45 ? ? -52.81  72.08   
104 14 ASP A 54 ? ? 118.27  -47.53  
105 14 TYR A 69 ? ? -38.86  123.70  
106 14 ALA A 72 ? ? -99.70  37.21   
107 15 SER A 2  ? ? -107.97 55.29   
108 15 HIS A 12 ? ? 33.38   52.04   
109 15 ARG A 26 ? ? 135.69  -31.79  
110 15 GLU A 34 ? ? -75.72  26.13   
111 15 ASN A 35 ? ? -142.25 29.77   
112 15 GLN A 44 ? ? -148.02 -150.58 
113 15 ASP A 45 ? ? -67.55  68.16   
114 15 ASP A 54 ? ? 129.82  -43.52  
115 15 PHE A 55 ? ? -131.48 -38.40  
116 15 ALA A 72 ? ? -95.13  42.83   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 5  GLN A 44 ? ? ASP A 45 ? ? 148.94  
2 8  ARG A 49 ? ? CYS A 50 ? ? 141.06  
3 9  SER A 2  ? ? GLU A 3  ? ? -148.89 
4 11 PRO A 71 ? ? ALA A 72 ? ? 142.48  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  1  ARG A 5  ? ? 0.159 'SIDE CHAIN' 
2  1  PHE A 55 ? ? 0.086 'SIDE CHAIN' 
3  2  ARG A 5  ? ? 0.158 'SIDE CHAIN' 
4  2  TYR A 27 ? ? 0.166 'SIDE CHAIN' 
5  2  PHE A 55 ? ? 0.088 'SIDE CHAIN' 
6  2  TYR A 69 ? ? 0.071 'SIDE CHAIN' 
7  3  ARG A 5  ? ? 0.151 'SIDE CHAIN' 
8  3  HIS A 12 ? ? 0.092 'SIDE CHAIN' 
9  3  TYR A 27 ? ? 0.175 'SIDE CHAIN' 
10 3  PHE A 55 ? ? 0.102 'SIDE CHAIN' 
11 4  ARG A 5  ? ? 0.125 'SIDE CHAIN' 
12 4  ARG A 26 ? ? 0.120 'SIDE CHAIN' 
13 4  PHE A 55 ? ? 0.153 'SIDE CHAIN' 
14 4  TYR A 69 ? ? 0.064 'SIDE CHAIN' 
15 5  ARG A 5  ? ? 0.197 'SIDE CHAIN' 
16 5  TYR A 27 ? ? 0.145 'SIDE CHAIN' 
17 5  PHE A 55 ? ? 0.081 'SIDE CHAIN' 
18 6  ARG A 49 ? ? 0.147 'SIDE CHAIN' 
19 6  PHE A 55 ? ? 0.126 'SIDE CHAIN' 
20 7  ARG A 5  ? ? 0.135 'SIDE CHAIN' 
21 7  PHE A 55 ? ? 0.087 'SIDE CHAIN' 
22 8  ARG A 5  ? ? 0.117 'SIDE CHAIN' 
23 8  HIS A 12 ? ? 0.095 'SIDE CHAIN' 
24 8  ARG A 26 ? ? 0.123 'SIDE CHAIN' 
25 8  TYR A 27 ? ? 0.164 'SIDE CHAIN' 
26 8  ARG A 49 ? ? 0.117 'SIDE CHAIN' 
27 9  ARG A 5  ? ? 0.116 'SIDE CHAIN' 
28 9  TYR A 27 ? ? 0.065 'SIDE CHAIN' 
29 9  ARG A 49 ? ? 0.146 'SIDE CHAIN' 
30 9  PHE A 55 ? ? 0.097 'SIDE CHAIN' 
31 9  TYR A 69 ? ? 0.067 'SIDE CHAIN' 
32 10 ARG A 5  ? ? 0.183 'SIDE CHAIN' 
33 10 ARG A 26 ? ? 0.084 'SIDE CHAIN' 
34 11 ARG A 5  ? ? 0.196 'SIDE CHAIN' 
35 11 ARG A 26 ? ? 0.151 'SIDE CHAIN' 
36 11 TYR A 27 ? ? 0.208 'SIDE CHAIN' 
37 12 ARG A 5  ? ? 0.107 'SIDE CHAIN' 
38 12 TYR A 27 ? ? 0.184 'SIDE CHAIN' 
39 12 ARG A 49 ? ? 0.088 'SIDE CHAIN' 
40 13 ARG A 5  ? ? 0.115 'SIDE CHAIN' 
41 13 HIS A 12 ? ? 0.110 'SIDE CHAIN' 
42 13 TYR A 27 ? ? 0.124 'SIDE CHAIN' 
43 13 PHE A 55 ? ? 0.089 'SIDE CHAIN' 
44 14 ARG A 5  ? ? 0.105 'SIDE CHAIN' 
45 14 HIS A 12 ? ? 0.086 'SIDE CHAIN' 
46 14 TYR A 27 ? ? 0.154 'SIDE CHAIN' 
47 14 ARG A 49 ? ? 0.075 'SIDE CHAIN' 
48 14 HIS A 52 ? ? 0.087 'SIDE CHAIN' 
49 15 ARG A 5  ? ? 0.215 'SIDE CHAIN' 
50 15 HIS A 12 ? ? 0.095 'SIDE CHAIN' 
51 15 TYR A 27 ? ? 0.146 'SIDE CHAIN' 
52 15 ARG A 49 ? ? 0.107 'SIDE CHAIN' 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'IRON/SULFUR CLUSTER' 
_pdbx_entity_nonpoly.comp_id     SF4 
#