data_1PIJ
# 
_entry.id   1PIJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1PIJ         
WWPDB D_1000175697 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1PIH 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   ensemble 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1PIJ 
_pdbx_database_status.recvd_initial_deposition_date   1994-11-11 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Banci, L.'       1 
'Bertini, I.'     2 
'Eltis, L.D.'     3 
'Felli, I.C.'     4 
'Kastrau, D.H.W.' 5 
'Luchinat, C.'    6 
'Piccioli, M.'    7 
'Pierattelli, R.' 8 
'Smith, M.'       9 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;The three-dimensional structure in solution of the paramagnetic high-potential iron-sulfur protein I from Ectothiorhodospira halophila through nuclear magnetic resonance.
;
Eur.J.Biochem. 225 715 725 1994 EJBCAI IX 0014-2956 0262 ? 7957187 10.1111/j.1432-1033.1994.00715.x 
1       
;Sequence Specific Assignment of the 1H and 15N Nuclear Magnetic Resonance Spectra of the Reduced Recombinant High Potential Iron Sulfur Protein (Hipip) I from Ectothiorhodospira Halophila
;
Eur.J.Biochem. 225 703 ?   1994 EJBCAI IX 0014-2956 0262 ? ?       ?                                
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Banci, L.'       1  
primary 'Bertini, I.'     2  
primary 'Eltis, L.D.'     3  
primary 'Felli, I.C.'     4  
primary 'Kastrau, D.H.'   5  
primary 'Luchinat, C.'    6  
primary 'Piccioli, M.'    7  
primary 'Pierattelli, R.' 8  
primary 'Smith, M.'       9  
1       'Bertini, I.'     10 
1       'Felli, I.'       11 
1       'Kastrau, D.H.W.' 12 
1       'Luchinat, C.'    13 
1       'Piccioli, M.'    14 
1       'Viezzoli, M.S.'  15 
# 
_cell.entry_id           1PIJ 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1PIJ 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'HIGH POTENTIAL IRON SULFUR PROTEIN' 8003.524 1 ? ? ? ? 
2 non-polymer syn 'IRON/SULFUR CLUSTER'                351.640  1 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       ASEPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS 
_entity_poly.pdbx_seq_one_letter_code_can   ASEPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  SER n 
1 3  GLU n 
1 4  PRO n 
1 5  ARG n 
1 6  ALA n 
1 7  GLU n 
1 8  ASP n 
1 9  GLY n 
1 10 HIS n 
1 11 ALA n 
1 12 HIS n 
1 13 ASP n 
1 14 TYR n 
1 15 VAL n 
1 16 ASN n 
1 17 GLU n 
1 18 ALA n 
1 19 ALA n 
1 20 ASP n 
1 21 ALA n 
1 22 SER n 
1 23 GLY n 
1 24 HIS n 
1 25 PRO n 
1 26 ARG n 
1 27 TYR n 
1 28 GLN n 
1 29 GLU n 
1 30 GLY n 
1 31 GLN n 
1 32 LEU n 
1 33 CYS n 
1 34 GLU n 
1 35 ASN n 
1 36 CYS n 
1 37 ALA n 
1 38 PHE n 
1 39 TRP n 
1 40 GLY n 
1 41 GLU n 
1 42 ALA n 
1 43 VAL n 
1 44 GLN n 
1 45 ASP n 
1 46 GLY n 
1 47 TRP n 
1 48 GLY n 
1 49 ARG n 
1 50 CYS n 
1 51 THR n 
1 52 HIS n 
1 53 PRO n 
1 54 ASP n 
1 55 PHE n 
1 56 ASP n 
1 57 GLU n 
1 58 VAL n 
1 59 LEU n 
1 60 VAL n 
1 61 LYS n 
1 62 ALA n 
1 63 GLU n 
1 64 GLY n 
1 65 TRP n 
1 66 CYS n 
1 67 SER n 
1 68 VAL n 
1 69 TYR n 
1 70 ALA n 
1 71 PRO n 
1 72 ALA n 
1 73 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Halorhodospira 
_entity_src_gen.pdbx_gene_src_gene                 POTENTIAL 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Halorhodospira halophila' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1053 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HIP1_ECTHA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04168 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   EPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1PIJ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 73 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04168 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  71 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       3 
_struct_ref_seq.pdbx_auth_seq_align_end       73 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE               ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE              ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE            ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'       ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE              ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE             ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'       ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE               ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE             ? 'C6 H10 N3 O2 1' 156.162 
LEU 'L-peptide linking' y LEUCINE               ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE         ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE               ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                ? 'C3 H7 N O3'     105.093 
SF4 non-polymer         . 'IRON/SULFUR CLUSTER' ? 'Fe4 S4'         351.640 
THR 'L-peptide linking' y THREONINE             ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN            ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE              ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_ensemble.entry_id                             1PIJ 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    1 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement DIANA ?   GUNTERT,BRAUN,WUTHRICH                             1 
refinement AMBER 4.0 PEARLMAN,CASE,CALDWELL,SIEBEL,SINGH,WEINER,KOLLMAN 2 
# 
_exptl.entry_id          1PIJ 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1PIJ 
_struct.title                     
'THE THREE DIMENSIONAL STRUCTURE OF THE PARAMAGNETIC PROTEIN HIPIP I FROM E.HALOPHILA THROUGH NUCLEAR MAGNETIC RESONANCE' 
_struct.pdbx_descriptor           
'HIGH POTENTIAL IRON SULFUR PROTEIN MUTANT WITH ALA 1 AND SER 2 INSERTED AT N-TERMINUS (INS(1-2)) (NMR, MINIMIZED BEST STRUCTURE)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1PIJ 
_struct_keywords.pdbx_keywords   'ELECTRON TRANSFER (IRON-SULFUR PROTEIN)' 
_struct_keywords.text            'ELECTRON TRANSFER (IRON-SULFUR PROTEIN)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A Y N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 17 ? HIS A 24 ? GLU A 17 HIS A 24 5 ? 8 
HELX_P HELX_P2 2 LEU A 32 ? ASN A 35 ? LEU A 32 ASN A 35 5 ? 4 
HELX_P HELX_P3 3 HIS A 52 ? GLU A 57 ? HIS A 52 GLU A 57 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A CYS 33 SG ? ? ? 1_555 B SF4 . FE1 ? ? A CYS 33 A SF4 74 1_555 ? ? ? ? ? ? ? 2.036 ? 
metalc2 metalc ? ? A CYS 36 SG ? ? ? 1_555 B SF4 . FE2 ? ? A CYS 36 A SF4 74 1_555 ? ? ? ? ? ? ? 2.031 ? 
metalc3 metalc ? ? A CYS 50 SG ? ? ? 1_555 B SF4 . FE3 ? ? A CYS 50 A SF4 74 1_555 ? ? ? ? ? ? ? 1.990 ? 
metalc4 metalc ? ? A CYS 66 SG ? ? ? 1_555 B SF4 . FE4 ? ? A CYS 66 A SF4 74 1_555 ? ? ? ? ? ? ? 2.015 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP A 39 ? GLN A 44 ? TRP A 39 GLN A 44 
A 2 TRP A 47 ? CYS A 50 ? TRP A 47 CYS A 50 
A 3 VAL A 60 ? LYS A 61 ? VAL A 60 LYS A 61 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 43 ? N VAL A 43 O TRP A 47 ? O TRP A 47 
A 2 3 N GLY A 48 ? N GLY A 48 O VAL A 60 ? O VAL A 60 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    7 
_struct_site.details              'BINDING SITE FOR RESIDUE SF4 A 74' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 7 CYS A 33 ? CYS A 33 . ? 1_555 ? 
2 AC1 7 CYS A 36 ? CYS A 36 . ? 1_555 ? 
3 AC1 7 CYS A 50 ? CYS A 50 . ? 1_555 ? 
4 AC1 7 PHE A 55 ? PHE A 55 . ? 1_555 ? 
5 AC1 7 CYS A 66 ? CYS A 66 . ? 1_555 ? 
6 AC1 7 VAL A 68 ? VAL A 68 . ? 1_555 ? 
7 AC1 7 TYR A 69 ? TYR A 69 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1PIJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1PIJ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . ALA A 1 1  ? -9.260  -6.171  -12.891 1.00 0.00 ? 1  ALA A N    1 
ATOM   2    C  CA   . ALA A 1 1  ? -8.939  -5.833  -14.282 1.00 0.00 ? 1  ALA A CA   1 
ATOM   3    C  C    . ALA A 1 1  ? -7.632  -5.066  -14.366 1.00 0.00 ? 1  ALA A C    1 
ATOM   4    O  O    . ALA A 1 1  ? -6.802  -5.277  -13.483 1.00 0.00 ? 1  ALA A O    1 
ATOM   5    C  CB   . ALA A 1 1  ? -10.089 -4.958  -14.788 1.00 0.00 ? 1  ALA A CB   1 
ATOM   6    H  H1   . ALA A 1 1  ? -8.431  -5.928  -12.342 1.00 0.00 ? 1  ALA A H1   1 
ATOM   7    H  H2   . ALA A 1 1  ? -8.431  -5.928  -12.342 1.00 0.00 ? 1  ALA A H2   1 
ATOM   8    H  H3   . ALA A 1 1  ? -9.903  -5.429  -12.607 1.00 0.00 ? 1  ALA A H3   1 
ATOM   9    H  HA   . ALA A 1 1  ? -8.907  -6.753  -14.869 1.00 0.00 ? 1  ALA A HA   1 
ATOM   10   H  HB1  . ALA A 1 1  ? -11.028 -5.504  -14.702 1.00 0.00 ? 1  ALA A HB1  1 
ATOM   11   H  HB2  . ALA A 1 1  ? -10.152 -4.039  -14.204 1.00 0.00 ? 1  ALA A HB2  1 
ATOM   12   H  HB3  . ALA A 1 1  ? -9.921  -4.706  -15.839 1.00 0.00 ? 1  ALA A HB3  1 
ATOM   13   N  N    . SER A 1 2  ? -7.465  -4.173  -15.340 1.00 0.00 ? 2  SER A N    1 
ATOM   14   C  CA   . SER A 1 2  ? -6.300  -3.299  -15.407 1.00 0.00 ? 2  SER A CA   1 
ATOM   15   C  C    . SER A 1 2  ? -6.485  -2.120  -14.446 1.00 0.00 ? 2  SER A C    1 
ATOM   16   O  O    . SER A 1 2  ? -6.664  -0.988  -14.890 1.00 0.00 ? 2  SER A O    1 
ATOM   17   C  CB   . SER A 1 2  ? -6.105  -2.828  -16.852 1.00 0.00 ? 2  SER A CB   1 
ATOM   18   O  OG   . SER A 1 2  ? -5.935  -3.948  -17.700 1.00 0.00 ? 2  SER A OG   1 
ATOM   19   H  H    . SER A 1 2  ? -8.225  -4.000  -15.982 1.00 0.00 ? 2  SER A H    1 
ATOM   20   H  HA   . SER A 1 2  ? -5.401  -3.846  -15.114 1.00 0.00 ? 2  SER A HA   1 
ATOM   21   H  HB2  . SER A 1 2  ? -6.965  -2.240  -17.180 1.00 0.00 ? 2  SER A HB2  1 
ATOM   22   H  HB3  . SER A 1 2  ? -5.218  -2.195  -16.909 1.00 0.00 ? 2  SER A HB3  1 
ATOM   23   H  HG   . SER A 1 2  ? -6.658  -4.565  -17.567 1.00 0.00 ? 2  SER A HG   1 
ATOM   24   N  N    . GLU A 1 3  ? -6.473  -2.386  -13.137 1.00 0.00 ? 3  GLU A N    1 
ATOM   25   C  CA   . GLU A 1 3  ? -6.724  -1.349  -12.143 1.00 0.00 ? 3  GLU A CA   1 
ATOM   26   C  C    . GLU A 1 3  ? -5.660  -0.240  -12.226 1.00 0.00 ? 3  GLU A C    1 
ATOM   27   O  O    . GLU A 1 3  ? -4.473  -0.549  -12.337 1.00 0.00 ? 3  GLU A O    1 
ATOM   28   C  CB   . GLU A 1 3  ? -6.782  -1.950  -10.732 1.00 0.00 ? 3  GLU A CB   1 
ATOM   29   C  CG   . GLU A 1 3  ? -8.154  -2.566  -10.430 1.00 0.00 ? 3  GLU A CG   1 
ATOM   30   C  CD   . GLU A 1 3  ? -8.481  -3.767  -11.284 1.00 0.00 ? 3  GLU A CD   1 
ATOM   31   O  OE1  . GLU A 1 3  ? -7.843  -4.833  -11.096 1.00 0.00 ? 3  GLU A OE1  1 
ATOM   32   O  OE2  . GLU A 1 3  ? -9.372  -3.703  -12.154 1.00 0.00 ? 3  GLU A OE2  1 
ATOM   33   H  H    . GLU A 1 3  ? -6.339  -3.342  -12.830 1.00 0.00 ? 3  GLU A H    1 
ATOM   34   H  HA   . GLU A 1 3  ? -7.707  -0.940  -12.370 1.00 0.00 ? 3  GLU A HA   1 
ATOM   35   H  HB2  . GLU A 1 3  ? -5.986  -2.683  -10.592 1.00 0.00 ? 3  GLU A HB2  1 
ATOM   36   H  HB3  . GLU A 1 3  ? -6.634  -1.148  -10.009 1.00 0.00 ? 3  GLU A HB3  1 
ATOM   37   H  HG2  . GLU A 1 3  ? -8.165  -2.897  -9.394  1.00 0.00 ? 3  GLU A HG2  1 
ATOM   38   H  HG3  . GLU A 1 3  ? -8.932  -1.810  -10.550 1.00 0.00 ? 3  GLU A HG3  1 
ATOM   39   N  N    . PRO A 1 4  ? -6.061  1.041   -12.176 1.00 0.00 ? 4  PRO A N    1 
ATOM   40   C  CA   . PRO A 1 4  ? -5.140  2.162   -12.280 1.00 0.00 ? 4  PRO A CA   1 
ATOM   41   C  C    . PRO A 1 4  ? -4.290  2.297   -11.014 1.00 0.00 ? 4  PRO A C    1 
ATOM   42   O  O    . PRO A 1 4  ? -4.696  1.872   -9.934  1.00 0.00 ? 4  PRO A O    1 
ATOM   43   C  CB   . PRO A 1 4  ? -6.020  3.397   -12.497 1.00 0.00 ? 4  PRO A CB   1 
ATOM   44   C  CG   . PRO A 1 4  ? -7.345  3.017   -11.838 1.00 0.00 ? 4  PRO A CG   1 
ATOM   45   C  CD   . PRO A 1 4  ? -7.433  1.506   -12.048 1.00 0.00 ? 4  PRO A CD   1 
ATOM   46   H  HA   . PRO A 1 4  ? -4.486  2.025   -13.144 1.00 0.00 ? 4  PRO A HA   1 
ATOM   47   H  HB2  . PRO A 1 4  ? -5.601  4.297   -12.042 1.00 0.00 ? 4  PRO A HB2  1 
ATOM   48   H  HB3  . PRO A 1 4  ? -6.182  3.548   -13.565 1.00 0.00 ? 4  PRO A HB3  1 
ATOM   49   H  HG2  . PRO A 1 4  ? -7.278  3.230   -10.773 1.00 0.00 ? 4  PRO A HG2  1 
ATOM   50   H  HG3  . PRO A 1 4  ? -8.193  3.548   -12.271 1.00 0.00 ? 4  PRO A HG3  1 
ATOM   51   H  HD2  . PRO A 1 4  ? -7.945  1.044   -11.201 1.00 0.00 ? 4  PRO A HD2  1 
ATOM   52   H  HD3  . PRO A 1 4  ? -7.972  1.300   -12.975 1.00 0.00 ? 4  PRO A HD3  1 
ATOM   53   N  N    . ARG A 1 5  ? -3.108  2.904   -11.152 1.00 0.00 ? 5  ARG A N    1 
ATOM   54   C  CA   . ARG A 1 5  ? -2.196  3.192   -10.062 1.00 0.00 ? 5  ARG A CA   1 
ATOM   55   C  C    . ARG A 1 5  ? -2.858  4.119   -9.034  1.00 0.00 ? 5  ARG A C    1 
ATOM   56   O  O    . ARG A 1 5  ? -3.385  5.168   -9.400  1.00 0.00 ? 5  ARG A O    1 
ATOM   57   C  CB   . ARG A 1 5  ? -0.971  3.849   -10.703 1.00 0.00 ? 5  ARG A CB   1 
ATOM   58   C  CG   . ARG A 1 5  ? -0.230  2.852   -11.561 1.00 0.00 ? 5  ARG A CG   1 
ATOM   59   C  CD   . ARG A 1 5  ? 0.687   3.674   -12.457 1.00 0.00 ? 5  ARG A CD   1 
ATOM   60   N  NE   . ARG A 1 5  ? 1.035   2.824   -13.572 1.00 0.00 ? 5  ARG A NE   1 
ATOM   61   C  CZ   . ARG A 1 5  ? 2.241   2.274   -13.779 1.00 0.00 ? 5  ARG A CZ   1 
ATOM   62   N  NH1  . ARG A 1 5  ? 3.339   2.903   -13.362 1.00 0.00 ? 5  ARG A NH1  1 
ATOM   63   N  NH2  . ARG A 1 5  ? 2.344   1.092   -14.382 1.00 0.00 ? 5  ARG A NH2  1 
ATOM   64   H  H    . ARG A 1 5  ? -2.785  3.223   -12.054 1.00 0.00 ? 5  ARG A H    1 
ATOM   65   H  HA   . ARG A 1 5  ? -1.902  2.247   -9.599  1.00 0.00 ? 5  ARG A HA   1 
ATOM   66   H  HB2  . ARG A 1 5  ? -1.293  4.573   -11.448 1.00 0.00 ? 5  ARG A HB2  1 
ATOM   67   H  HB3  . ARG A 1 5  ? -0.289  4.310   -9.982  1.00 0.00 ? 5  ARG A HB3  1 
ATOM   68   H  HG2  . ARG A 1 5  ? 0.330   2.149   -10.950 1.00 0.00 ? 5  ARG A HG2  1 
ATOM   69   H  HG3  . ARG A 1 5  ? -0.928  2.282   -12.174 1.00 0.00 ? 5  ARG A HG3  1 
ATOM   70   H  HD2  . ARG A 1 5  ? 0.199   4.550   -12.889 1.00 0.00 ? 5  ARG A HD2  1 
ATOM   71   H  HD3  . ARG A 1 5  ? 1.501   4.011   -11.838 1.00 0.00 ? 5  ARG A HD3  1 
ATOM   72   H  HE   . ARG A 1 5  ? 0.177   2.453   -13.947 1.00 0.00 ? 5  ARG A HE   1 
ATOM   73   H  HH11 . ARG A 1 5  ? 3.298   3.830   -12.976 1.00 0.00 ? 5  ARG A HH11 1 
ATOM   74   H  HH12 . ARG A 1 5  ? 4.229   2.394   -13.412 1.00 0.00 ? 5  ARG A HH12 1 
ATOM   75   H  HH21 . ARG A 1 5  ? 1.547   0.578   -14.722 1.00 0.00 ? 5  ARG A HH21 1 
ATOM   76   H  HH22 . ARG A 1 5  ? 3.246   0.598   -14.386 1.00 0.00 ? 5  ARG A HH22 1 
ATOM   77   N  N    . ALA A 1 6  ? -2.835  3.722   -7.761  1.00 0.00 ? 6  ALA A N    1 
ATOM   78   C  CA   . ALA A 1 6  ? -3.447  4.434   -6.652  1.00 0.00 ? 6  ALA A CA   1 
ATOM   79   C  C    . ALA A 1 6  ? -2.876  5.840   -6.498  1.00 0.00 ? 6  ALA A C    1 
ATOM   80   O  O    . ALA A 1 6  ? -1.665  6.047   -6.588  1.00 0.00 ? 6  ALA A O    1 
ATOM   81   C  CB   . ALA A 1 6  ? -3.220  3.639   -5.364  1.00 0.00 ? 6  ALA A CB   1 
ATOM   82   H  H    . ALA A 1 6  ? -2.416  2.827   -7.552  1.00 0.00 ? 6  ALA A H    1 
ATOM   83   H  HA   . ALA A 1 6  ? -4.519  4.505   -6.842  1.00 0.00 ? 6  ALA A HA   1 
ATOM   84   H  HB1  . ALA A 1 6  ? -3.618  2.630   -5.470  1.00 0.00 ? 6  ALA A HB1  1 
ATOM   85   H  HB2  . ALA A 1 6  ? -2.151  3.574   -5.158  1.00 0.00 ? 6  ALA A HB2  1 
ATOM   86   H  HB3  . ALA A 1 6  ? -3.713  4.136   -4.528  1.00 0.00 ? 6  ALA A HB3  1 
ATOM   87   N  N    . GLU A 1 7  ? -3.750  6.801   -6.215  1.00 0.00 ? 7  GLU A N    1 
ATOM   88   C  CA   . GLU A 1 7  ? -3.378  8.160   -5.898  1.00 0.00 ? 7  GLU A CA   1 
ATOM   89   C  C    . GLU A 1 7  ? -2.879  8.194   -4.461  1.00 0.00 ? 7  GLU A C    1 
ATOM   90   O  O    . GLU A 1 7  ? -3.393  7.468   -3.607  1.00 0.00 ? 7  GLU A O    1 
ATOM   91   C  CB   . GLU A 1 7  ? -4.585  9.090   -6.027  1.00 0.00 ? 7  GLU A CB   1 
ATOM   92   C  CG   . GLU A 1 7  ? -5.416  8.813   -7.287  1.00 0.00 ? 7  GLU A CG   1 
ATOM   93   C  CD   . GLU A 1 7  ? -6.613  7.907   -7.007  1.00 0.00 ? 7  GLU A CD   1 
ATOM   94   O  OE1  . GLU A 1 7  ? -6.395  6.816   -6.432  1.00 0.00 ? 7  GLU A OE1  1 
ATOM   95   O  OE2  . GLU A 1 7  ? -7.750  8.308   -7.320  1.00 0.00 ? 7  GLU A OE2  1 
ATOM   96   H  H    . GLU A 1 7  ? -4.741  6.580   -6.145  1.00 0.00 ? 7  GLU A H    1 
ATOM   97   H  HA   . GLU A 1 7  ? -2.620  8.502   -6.604  1.00 0.00 ? 7  GLU A HA   1 
ATOM   98   H  HB2  . GLU A 1 7  ? -5.218  8.999   -5.143  1.00 0.00 ? 7  GLU A HB2  1 
ATOM   99   H  HB3  . GLU A 1 7  ? -4.210  10.115  -6.059  1.00 0.00 ? 7  GLU A HB3  1 
ATOM   100  H  HG2  . GLU A 1 7  ? -5.772  9.777   -7.637  1.00 0.00 ? 7  GLU A HG2  1 
ATOM   101  H  HG3  . GLU A 1 7  ? -4.801  8.380   -8.076  1.00 0.00 ? 7  GLU A HG3  1 
ATOM   102  N  N    . ASP A 1 8  ? -1.937  9.083   -4.171  1.00 0.00 ? 8  ASP A N    1 
ATOM   103  C  CA   . ASP A 1 8  ? -1.583  9.409   -2.810  1.00 0.00 ? 8  ASP A CA   1 
ATOM   104  C  C    . ASP A 1 8  ? -2.845  9.933   -2.128  1.00 0.00 ? 8  ASP A C    1 
ATOM   105  O  O    . ASP A 1 8  ? -3.526  10.813  -2.653  1.00 0.00 ? 8  ASP A O    1 
ATOM   106  C  CB   . ASP A 1 8  ? -0.447  10.428  -2.831  1.00 0.00 ? 8  ASP A CB   1 
ATOM   107  C  CG   . ASP A 1 8  ? 0.830   9.771   -3.322  1.00 0.00 ? 8  ASP A CG   1 
ATOM   108  O  OD1  . ASP A 1 8  ? 0.999   9.717   -4.561  1.00 0.00 ? 8  ASP A OD1  1 
ATOM   109  O  OD2  . ASP A 1 8  ? 1.569   9.236   -2.470  1.00 0.00 ? 8  ASP A OD2  1 
ATOM   110  H  H    . ASP A 1 8  ? -1.559  9.685   -4.883  1.00 0.00 ? 8  ASP A H    1 
ATOM   111  H  HA   . ASP A 1 8  ? -1.232  8.509   -2.301  1.00 0.00 ? 8  ASP A HA   1 
ATOM   112  H  HB2  . ASP A 1 8  ? -0.700  11.278  -3.465  1.00 0.00 ? 8  ASP A HB2  1 
ATOM   113  H  HB3  . ASP A 1 8  ? -0.287  10.785  -1.823  1.00 0.00 ? 8  ASP A HB3  1 
ATOM   114  N  N    . GLY A 1 9  ? -3.209  9.325   -1.003  1.00 0.00 ? 9  GLY A N    1 
ATOM   115  C  CA   . GLY A 1 9  ? -4.446  9.607   -0.305  1.00 0.00 ? 9  GLY A CA   1 
ATOM   116  C  C    . GLY A 1 9  ? -5.690  9.097   -1.038  1.00 0.00 ? 9  GLY A C    1 
ATOM   117  O  O    . GLY A 1 9  ? -6.777  9.594   -0.752  1.00 0.00 ? 9  GLY A O    1 
ATOM   118  H  H    . GLY A 1 9  ? -2.574  8.656   -0.583  1.00 0.00 ? 9  GLY A H    1 
ATOM   119  H  HA2  . GLY A 1 9  ? -4.403  9.118   0.669   1.00 0.00 ? 9  GLY A HA2  1 
ATOM   120  H  HA3  . GLY A 1 9  ? -4.538  10.682  -0.143  1.00 0.00 ? 9  GLY A HA3  1 
ATOM   121  N  N    . HIS A 1 10 ? -5.577  8.089   -1.924  1.00 0.00 ? 10 HIS A N    1 
ATOM   122  C  CA   . HIS A 1 10 ? -6.737  7.400   -2.496  1.00 0.00 ? 10 HIS A CA   1 
ATOM   123  C  C    . HIS A 1 10 ? -7.785  7.100   -1.423  1.00 0.00 ? 10 HIS A C    1 
ATOM   124  O  O    . HIS A 1 10 ? -8.960  7.430   -1.564  1.00 0.00 ? 10 HIS A O    1 
ATOM   125  C  CB   . HIS A 1 10 ? -6.301  6.076   -3.137  1.00 0.00 ? 10 HIS A CB   1 
ATOM   126  C  CG   . HIS A 1 10 ? -7.468  5.307   -3.709  1.00 0.00 ? 10 HIS A CG   1 
ATOM   127  N  ND1  . HIS A 1 10 ? -8.075  5.561   -4.922  1.00 0.00 ? 10 HIS A ND1  1 
ATOM   128  C  CD2  . HIS A 1 10 ? -8.195  4.341   -3.066  1.00 0.00 ? 10 HIS A CD2  1 
ATOM   129  C  CE1  . HIS A 1 10 ? -9.159  4.770   -5.015  1.00 0.00 ? 10 HIS A CE1  1 
ATOM   130  N  NE2  . HIS A 1 10 ? -9.249  4.022   -3.898  1.00 0.00 ? 10 HIS A NE2  1 
ATOM   131  H  H    . HIS A 1 10 ? -4.660  7.810   -2.268  1.00 0.00 ? 10 HIS A H    1 
ATOM   132  H  HA   . HIS A 1 10 ? -7.182  8.040   -3.260  1.00 0.00 ? 10 HIS A HA   1 
ATOM   133  H  HB2  . HIS A 1 10 ? -5.597  6.291   -3.933  1.00 0.00 ? 10 HIS A HB2  1 
ATOM   134  H  HB3  . HIS A 1 10 ? -5.788  5.451   -2.405  1.00 0.00 ? 10 HIS A HB3  1 
ATOM   135  H  HD1  . HIS A 1 10 ? -7.702  6.193   -5.638  1.00 0.00 ? 10 HIS A HD1  1 
ATOM   136  H  HD2  . HIS A 1 10 ? -8.012  3.931   -2.083  1.00 0.00 ? 10 HIS A HD2  1 
ATOM   137  H  HE1  . HIS A 1 10 ? -9.837  4.731   -5.856  1.00 0.00 ? 10 HIS A HE1  1 
ATOM   138  H  HE2  . HIS A 1 10 ? -9.983  3.342   -3.690  1.00 0.00 ? 10 HIS A HE2  1 
ATOM   139  N  N    . ALA A 1 11 ? -7.334  6.424   -0.369  1.00 0.00 ? 11 ALA A N    1 
ATOM   140  C  CA   . ALA A 1 11 ? -8.096  6.143   0.834   1.00 0.00 ? 11 ALA A CA   1 
ATOM   141  C  C    . ALA A 1 11 ? -7.093  5.789   1.930   1.00 0.00 ? 11 ALA A C    1 
ATOM   142  O  O    . ALA A 1 11 ? -5.911  5.587   1.647   1.00 0.00 ? 11 ALA A O    1 
ATOM   143  C  CB   . ALA A 1 11 ? -9.101  5.003   0.581   1.00 0.00 ? 11 ALA A CB   1 
ATOM   144  H  H    . ALA A 1 11 ? -6.349  6.188   -0.346  1.00 0.00 ? 11 ALA A H    1 
ATOM   145  H  HA   . ALA A 1 11 ? -8.632  7.044   1.139   1.00 0.00 ? 11 ALA A HA   1 
ATOM   146  H  HB1  . ALA A 1 11 ? -8.586  4.107   0.235   1.00 0.00 ? 11 ALA A HB1  1 
ATOM   147  H  HB2  . ALA A 1 11 ? -9.654  4.755   1.488   1.00 0.00 ? 11 ALA A HB2  1 
ATOM   148  H  HB3  . ALA A 1 11 ? -9.825  5.297   -0.180  1.00 0.00 ? 11 ALA A HB3  1 
ATOM   149  N  N    . HIS A 1 12 ? -7.570  5.703   3.174   1.00 0.00 ? 12 HIS A N    1 
ATOM   150  C  CA   . HIS A 1 12 ? -6.839  5.117   4.293   1.00 0.00 ? 12 HIS A CA   1 
ATOM   151  C  C    . HIS A 1 12 ? -5.435  5.709   4.488   1.00 0.00 ? 12 HIS A C    1 
ATOM   152  O  O    . HIS A 1 12 ? -4.510  4.973   4.832   1.00 0.00 ? 12 HIS A O    1 
ATOM   153  C  CB   . HIS A 1 12 ? -6.728  3.603   4.079   1.00 0.00 ? 12 HIS A CB   1 
ATOM   154  C  CG   . HIS A 1 12 ? -8.013  2.880   3.760   1.00 0.00 ? 12 HIS A CG   1 
ATOM   155  N  ND1  . HIS A 1 12 ? -8.891  2.358   4.693   1.00 0.00 ? 12 HIS A ND1  1 
ATOM   156  C  CD2  . HIS A 1 12 ? -8.320  2.334   2.543   1.00 0.00 ? 12 HIS A CD2  1 
ATOM   157  C  CE1  . HIS A 1 12 ? -9.690  1.483   4.056   1.00 0.00 ? 12 HIS A CE1  1 
ATOM   158  N  NE2  . HIS A 1 12 ? -9.346  1.443   2.756   1.00 0.00 ? 12 HIS A NE2  1 
ATOM   159  H  H    . HIS A 1 12 ? -8.540  5.937   3.325   1.00 0.00 ? 12 HIS A H    1 
ATOM   160  H  HA   . HIS A 1 12 ? -7.410  5.301   5.204   1.00 0.00 ? 12 HIS A HA   1 
ATOM   161  H  HB2  . HIS A 1 12 ? -6.022  3.428   3.269   1.00 0.00 ? 12 HIS A HB2  1 
ATOM   162  H  HB3  . HIS A 1 12 ? -6.302  3.156   4.974   1.00 0.00 ? 12 HIS A HB3  1 
ATOM   163  H  HD1  . HIS A 1 12 ? -8.872  2.527   5.689   1.00 0.00 ? 12 HIS A HD1  1 
ATOM   164  H  HD2  . HIS A 1 12 ? -7.771  2.439   1.618   1.00 0.00 ? 12 HIS A HD2  1 
ATOM   165  H  HE1  . HIS A 1 12 ? -10.423 0.836   4.521   1.00 0.00 ? 12 HIS A HE1  1 
ATOM   166  H  HE2  . HIS A 1 12 ? -9.702  0.757   2.074   1.00 0.00 ? 12 HIS A HE2  1 
ATOM   167  N  N    . ASP A 1 13 ? -5.274  7.016   4.288   1.00 0.00 ? 13 ASP A N    1 
ATOM   168  C  CA   . ASP A 1 13 ? -4.002  7.721   4.450   1.00 0.00 ? 13 ASP A CA   1 
ATOM   169  C  C    . ASP A 1 13 ? -2.887  7.091   3.603   1.00 0.00 ? 13 ASP A C    1 
ATOM   170  O  O    . ASP A 1 13 ? -1.720  7.128   3.995   1.00 0.00 ? 13 ASP A O    1 
ATOM   171  C  CB   . ASP A 1 13 ? -3.575  7.830   5.925   1.00 0.00 ? 13 ASP A CB   1 
ATOM   172  C  CG   . ASP A 1 13 ? -4.701  8.087   6.916   1.00 0.00 ? 13 ASP A CG   1 
ATOM   173  O  OD1  . ASP A 1 13 ? -5.672  8.778   6.549   1.00 0.00 ? 13 ASP A OD1  1 
ATOM   174  O  OD2  . ASP A 1 13 ? -4.543  7.579   8.051   1.00 0.00 ? 13 ASP A OD2  1 
ATOM   175  H  H    . ASP A 1 13 ? -6.087  7.576   4.076   1.00 0.00 ? 13 ASP A H    1 
ATOM   176  H  HA   . ASP A 1 13 ? -4.148  8.739   4.106   1.00 0.00 ? 13 ASP A HA   1 
ATOM   177  H  HB2  . ASP A 1 13 ? -3.070  6.913   6.201   1.00 0.00 ? 13 ASP A HB2  1 
ATOM   178  H  HB3  . ASP A 1 13 ? -2.842  8.631   6.010   1.00 0.00 ? 13 ASP A HB3  1 
ATOM   179  N  N    . TYR A 1 14 ? -3.234  6.481   2.465   1.00 0.00 ? 14 TYR A N    1 
ATOM   180  C  CA   . TYR A 1 14 ? -2.254  5.805   1.631   1.00 0.00 ? 14 TYR A CA   1 
ATOM   181  C  C    . TYR A 1 14 ? -1.229  6.786   1.062   1.00 0.00 ? 14 TYR A C    1 
ATOM   182  O  O    . TYR A 1 14 ? -1.584  7.913   0.722   1.00 0.00 ? 14 TYR A O    1 
ATOM   183  C  CB   . TYR A 1 14 ? -2.970  5.023   0.527   1.00 0.00 ? 14 TYR A CB   1 
ATOM   184  C  CG   . TYR A 1 14 ? -2.082  4.522   -0.594  1.00 0.00 ? 14 TYR A CG   1 
ATOM   185  C  CD1  . TYR A 1 14 ? -1.444  3.272   -0.509  1.00 0.00 ? 14 TYR A CD1  1 
ATOM   186  C  CD2  . TYR A 1 14 ? -1.857  5.342   -1.713  1.00 0.00 ? 14 TYR A CD2  1 
ATOM   187  C  CE1  . TYR A 1 14 ? -0.605  2.837   -1.545  1.00 0.00 ? 14 TYR A CE1  1 
ATOM   188  C  CE2  . TYR A 1 14 ? -1.048  4.893   -2.767  1.00 0.00 ? 14 TYR A CE2  1 
ATOM   189  C  CZ   . TYR A 1 14 ? -0.432  3.633   -2.686  1.00 0.00 ? 14 TYR A CZ   1 
ATOM   190  O  OH   . TYR A 1 14 ? 0.269   3.148   -3.745  1.00 0.00 ? 14 TYR A OH   1 
ATOM   191  H  H    . TYR A 1 14 ? -4.213  6.401   2.211   1.00 0.00 ? 14 TYR A H    1 
ATOM   192  H  HA   . TYR A 1 14 ? -1.739  5.093   2.262   1.00 0.00 ? 14 TYR A HA   1 
ATOM   193  H  HB2  . TYR A 1 14 ? -3.455  4.174   0.991   1.00 0.00 ? 14 TYR A HB2  1 
ATOM   194  H  HB3  . TYR A 1 14 ? -3.751  5.648   0.101   1.00 0.00 ? 14 TYR A HB3  1 
ATOM   195  H  HD1  . TYR A 1 14 ? -1.581  2.638   0.349   1.00 0.00 ? 14 TYR A HD1  1 
ATOM   196  H  HD2  . TYR A 1 14 ? -2.295  6.326   -1.747  1.00 0.00 ? 14 TYR A HD2  1 
ATOM   197  H  HE1  . TYR A 1 14 ? -0.084  1.896   -1.452  1.00 0.00 ? 14 TYR A HE1  1 
ATOM   198  H  HE2  . TYR A 1 14 ? -0.923  5.518   -3.639  1.00 0.00 ? 14 TYR A HE2  1 
ATOM   199  H  HH   . TYR A 1 14 ? 0.425   3.834   -4.404  1.00 0.00 ? 14 TYR A HH   1 
ATOM   200  N  N    . VAL A 1 15 ? 0.018   6.338   0.910   1.00 0.00 ? 15 VAL A N    1 
ATOM   201  C  CA   . VAL A 1 15 ? 1.072   7.059   0.207   1.00 0.00 ? 15 VAL A CA   1 
ATOM   202  C  C    . VAL A 1 15 ? 1.708   6.114   -0.810  1.00 0.00 ? 15 VAL A C    1 
ATOM   203  O  O    . VAL A 1 15 ? 1.821   4.913   -0.552  1.00 0.00 ? 15 VAL A O    1 
ATOM   204  C  CB   . VAL A 1 15 ? 2.121   7.605   1.193   1.00 0.00 ? 15 VAL A CB   1 
ATOM   205  C  CG1  . VAL A 1 15 ? 1.485   8.660   2.108   1.00 0.00 ? 15 VAL A CG1  1 
ATOM   206  C  CG2  . VAL A 1 15 ? 2.740   6.489   2.047   1.00 0.00 ? 15 VAL A CG2  1 
ATOM   207  H  H    . VAL A 1 15 ? 0.226   5.383   1.191   1.00 0.00 ? 15 VAL A H    1 
ATOM   208  H  HA   . VAL A 1 15 ? 0.648   7.903   -0.340  1.00 0.00 ? 15 VAL A HA   1 
ATOM   209  H  HB   . VAL A 1 15 ? 2.922   8.091   0.621   1.00 0.00 ? 15 VAL A HB   1 
ATOM   210  H  HG11 . VAL A 1 15 ? 1.077   9.472   1.505   1.00 0.00 ? 15 VAL A HG11 1 
ATOM   211  H  HG12 . VAL A 1 15 ? 0.687   8.222   2.708   1.00 0.00 ? 15 VAL A HG12 1 
ATOM   212  H  HG13 . VAL A 1 15 ? 2.237   9.070   2.780   1.00 0.00 ? 15 VAL A HG13 1 
ATOM   213  H  HG21 . VAL A 1 15 ? 3.183   5.720   1.418   1.00 0.00 ? 15 VAL A HG21 1 
ATOM   214  H  HG22 . VAL A 1 15 ? 3.530   6.908   2.665   1.00 0.00 ? 15 VAL A HG22 1 
ATOM   215  H  HG23 . VAL A 1 15 ? 1.987   6.031   2.688   1.00 0.00 ? 15 VAL A HG23 1 
ATOM   216  N  N    . ASN A 1 16 ? 2.116   6.654   -1.961  1.00 0.00 ? 16 ASN A N    1 
ATOM   217  C  CA   . ASN A 1 16 ? 2.805   5.939   -3.009  1.00 0.00 ? 16 ASN A CA   1 
ATOM   218  C  C    . ASN A 1 16 ? 4.246   5.629   -2.629  1.00 0.00 ? 16 ASN A C    1 
ATOM   219  O  O    . ASN A 1 16 ? 4.781   4.601   -3.041  1.00 0.00 ? 16 ASN A O    1 
ATOM   220  C  CB   . ASN A 1 16 ? 2.731   6.673   -4.350  1.00 0.00 ? 16 ASN A CB   1 
ATOM   221  C  CG   . ASN A 1 16 ? 1.474   6.261   -5.092  1.00 0.00 ? 16 ASN A CG   1 
ATOM   222  O  OD1  . ASN A 1 16 ? 1.259   5.080   -5.334  1.00 0.00 ? 16 ASN A OD1  1 
ATOM   223  N  ND2  . ASN A 1 16 ? 0.621   7.202   -5.441  1.00 0.00 ? 16 ASN A ND2  1 
ATOM   224  H  H    . ASN A 1 16 ? 1.915   7.626   -2.152  1.00 0.00 ? 16 ASN A H    1 
ATOM   225  H  HA   . ASN A 1 16 ? 2.240   5.033   -3.106  1.00 0.00 ? 16 ASN A HA   1 
ATOM   226  H  HB2  . ASN A 1 16 ? 2.768   7.752   -4.219  1.00 0.00 ? 16 ASN A HB2  1 
ATOM   227  H  HB3  . ASN A 1 16 ? 3.575   6.376   -4.973  1.00 0.00 ? 16 ASN A HB3  1 
ATOM   228  H  HD21 . ASN A 1 16 ? 0.813   8.163   -5.146  1.00 0.00 ? 16 ASN A HD21 1 
ATOM   229  H  HD22 . ASN A 1 16 ? -0.233  6.947   -5.923  1.00 0.00 ? 16 ASN A HD22 1 
ATOM   230  N  N    . GLU A 1 17 ? 4.875   6.523   -1.863  1.00 0.00 ? 17 GLU A N    1 
ATOM   231  C  CA   . GLU A 1 17 ? 6.164   6.296   -1.251  1.00 0.00 ? 17 GLU A CA   1 
ATOM   232  C  C    . GLU A 1 17 ? 5.912   6.090   0.231   1.00 0.00 ? 17 GLU A C    1 
ATOM   233  O  O    . GLU A 1 17 ? 5.533   7.031   0.919   1.00 0.00 ? 17 GLU A O    1 
ATOM   234  C  CB   . GLU A 1 17 ? 7.055   7.515   -1.486  1.00 0.00 ? 17 GLU A CB   1 
ATOM   235  C  CG   . GLU A 1 17 ? 8.472   7.264   -0.976  1.00 0.00 ? 17 GLU A CG   1 
ATOM   236  C  CD   . GLU A 1 17 ? 9.423   8.384   -1.381  1.00 0.00 ? 17 GLU A CD   1 
ATOM   237  O  OE1  . GLU A 1 17 ? 9.553   8.595   -2.606  1.00 0.00 ? 17 GLU A OE1  1 
ATOM   238  O  OE2  . GLU A 1 17 ? 10.007  8.994   -0.461  1.00 0.00 ? 17 GLU A OE2  1 
ATOM   239  H  H    . GLU A 1 17 ? 4.386   7.349   -1.553  1.00 0.00 ? 17 GLU A H    1 
ATOM   240  H  HA   . GLU A 1 17 ? 6.655   5.420   -1.679  1.00 0.00 ? 17 GLU A HA   1 
ATOM   241  H  HB2  . GLU A 1 17 ? 7.107   7.696   -2.548  1.00 0.00 ? 17 GLU A HB2  1 
ATOM   242  H  HB3  . GLU A 1 17 ? 6.646   8.405   -1.006  1.00 0.00 ? 17 GLU A HB3  1 
ATOM   243  H  HG2  . GLU A 1 17 ? 8.418   7.196   0.105   1.00 0.00 ? 17 GLU A HG2  1 
ATOM   244  H  HG3  . GLU A 1 17 ? 8.862   6.331   -1.383  1.00 0.00 ? 17 GLU A HG3  1 
ATOM   245  N  N    . ALA A 1 18 ? 6.135   4.872   0.721   1.00 0.00 ? 18 ALA A N    1 
ATOM   246  C  CA   . ALA A 1 18 ? 6.027   4.517   2.129   1.00 0.00 ? 18 ALA A CA   1 
ATOM   247  C  C    . ALA A 1 18 ? 6.631   5.609   3.018   1.00 0.00 ? 18 ALA A C    1 
ATOM   248  O  O    . ALA A 1 18 ? 5.996   6.083   3.959   1.00 0.00 ? 18 ALA A O    1 
ATOM   249  C  CB   . ALA A 1 18 ? 6.728   3.174   2.349   1.00 0.00 ? 18 ALA A CB   1 
ATOM   250  H  H    . ALA A 1 18 ? 6.405   4.150   0.061   1.00 0.00 ? 18 ALA A H    1 
ATOM   251  H  HA   . ALA A 1 18 ? 4.975   4.405   2.385   1.00 0.00 ? 18 ALA A HA   1 
ATOM   252  H  HB1  . ALA A 1 18 ? 7.747   3.207   1.962   1.00 0.00 ? 18 ALA A HB1  1 
ATOM   253  H  HB2  . ALA A 1 18 ? 6.764   2.948   3.409   1.00 0.00 ? 18 ALA A HB2  1 
ATOM   254  H  HB3  . ALA A 1 18 ? 6.177   2.381   1.846   1.00 0.00 ? 18 ALA A HB3  1 
ATOM   255  N  N    . ALA A 1 19 ? 7.854   6.029   2.684   1.00 0.00 ? 19 ALA A N    1 
ATOM   256  C  CA   . ALA A 1 19 ? 8.573   7.059   3.417   1.00 0.00 ? 19 ALA A CA   1 
ATOM   257  C  C    . ALA A 1 19 ? 7.776   8.357   3.568   1.00 0.00 ? 19 ALA A C    1 
ATOM   258  O  O    . ALA A 1 19 ? 7.881   8.983   4.625   1.00 0.00 ? 19 ALA A O    1 
ATOM   259  C  CB   . ALA A 1 19 ? 9.923   7.334   2.763   1.00 0.00 ? 19 ALA A CB   1 
ATOM   260  H  H    . ALA A 1 19 ? 8.295   5.614   1.877   1.00 0.00 ? 19 ALA A H    1 
ATOM   261  H  HA   . ALA A 1 19 ? 8.766   6.667   4.417   1.00 0.00 ? 19 ALA A HA   1 
ATOM   262  H  HB1  . ALA A 1 19 ? 10.476  6.404   2.633   1.00 0.00 ? 19 ALA A HB1  1 
ATOM   263  H  HB2  . ALA A 1 19 ? 9.770   7.812   1.799   1.00 0.00 ? 19 ALA A HB2  1 
ATOM   264  H  HB3  . ALA A 1 19 ? 10.495  8.010   3.400   1.00 0.00 ? 19 ALA A HB3  1 
ATOM   265  N  N    . ASP A 1 20 ? 6.973   8.761   2.568   1.00 0.00 ? 20 ASP A N    1 
ATOM   266  C  CA   . ASP A 1 20 ? 6.121   9.947   2.700   1.00 0.00 ? 20 ASP A CA   1 
ATOM   267  C  C    . ASP A 1 20 ? 5.379   9.941   4.038   1.00 0.00 ? 20 ASP A C    1 
ATOM   268  O  O    . ASP A 1 20 ? 5.325   10.936  4.761   1.00 0.00 ? 20 ASP A O    1 
ATOM   269  C  CB   . ASP A 1 20 ? 5.080   10.013  1.585   1.00 0.00 ? 20 ASP A CB   1 
ATOM   270  C  CG   . ASP A 1 20 ? 4.364   11.356  1.614   1.00 0.00 ? 20 ASP A CG   1 
ATOM   271  O  OD1  . ASP A 1 20 ? 4.924   12.311  1.035   1.00 0.00 ? 20 ASP A OD1  1 
ATOM   272  O  OD2  . ASP A 1 20 ? 3.283   11.411  2.239   1.00 0.00 ? 20 ASP A OD2  1 
ATOM   273  H  H    . ASP A 1 20 ? 6.869   8.205   1.719   1.00 0.00 ? 20 ASP A H    1 
ATOM   274  H  HA   . ASP A 1 20 ? 6.736   10.835  2.629   1.00 0.00 ? 20 ASP A HA   1 
ATOM   275  H  HB2  . ASP A 1 20 ? 5.486   9.827   0.594   1.00 0.00 ? 20 ASP A HB2  1 
ATOM   276  H  HB3  . ASP A 1 20 ? 4.360   9.238   1.791   1.00 0.00 ? 20 ASP A HB3  1 
ATOM   277  N  N    . ALA A 1 21 ? 4.860   8.765   4.397   1.00 0.00 ? 21 ALA A N    1 
ATOM   278  C  CA   . ALA A 1 21 ? 4.005   8.610   5.557   1.00 0.00 ? 21 ALA A CA   1 
ATOM   279  C  C    . ALA A 1 21 ? 4.788   8.627   6.868   1.00 0.00 ? 21 ALA A C    1 
ATOM   280  O  O    . ALA A 1 21 ? 4.188   8.358   7.901   1.00 0.00 ? 21 ALA A O    1 
ATOM   281  C  CB   . ALA A 1 21 ? 3.141   7.351   5.425   1.00 0.00 ? 21 ALA A CB   1 
ATOM   282  H  H    . ALA A 1 21 ? 5.123   7.950   3.850   1.00 0.00 ? 21 ALA A H    1 
ATOM   283  H  HA   . ALA A 1 21 ? 3.320   9.459   5.589   1.00 0.00 ? 21 ALA A HA   1 
ATOM   284  H  HB1  . ALA A 1 21 ? 3.766   6.480   5.238   1.00 0.00 ? 21 ALA A HB1  1 
ATOM   285  H  HB2  . ALA A 1 21 ? 2.562   7.188   6.334   1.00 0.00 ? 21 ALA A HB2  1 
ATOM   286  H  HB3  . ALA A 1 21 ? 2.439   7.476   4.604   1.00 0.00 ? 21 ALA A HB3  1 
ATOM   287  N  N    . SER A 1 22 ? 6.073   9.004   6.896   1.00 0.00 ? 22 SER A N    1 
ATOM   288  C  CA   . SER A 1 22 ? 6.813   9.174   8.138   1.00 0.00 ? 22 SER A CA   1 
ATOM   289  C  C    . SER A 1 22 ? 6.134   10.096  9.150   1.00 0.00 ? 22 SER A C    1 
ATOM   290  O  O    . SER A 1 22 ? 6.282   9.948   10.359  1.00 0.00 ? 22 SER A O    1 
ATOM   291  C  CB   . SER A 1 22 ? 8.223   9.654   7.810   1.00 0.00 ? 22 SER A CB   1 
ATOM   292  O  OG   . SER A 1 22 ? 8.943   8.652   7.123   1.00 0.00 ? 22 SER A OG   1 
ATOM   293  H  H    . SER A 1 22 ? 6.582   9.196   6.041   1.00 0.00 ? 22 SER A H    1 
ATOM   294  H  HA   . SER A 1 22 ? 6.839   8.219   8.622   1.00 0.00 ? 22 SER A HA   1 
ATOM   295  H  HB2  . SER A 1 22 ? 8.186   10.569  7.216   1.00 0.00 ? 22 SER A HB2  1 
ATOM   296  H  HB3  . SER A 1 22 ? 8.720   9.871   8.744   1.00 0.00 ? 22 SER A HB3  1 
ATOM   297  H  HG   . SER A 1 22 ? 8.619   8.611   6.216   1.00 0.00 ? 22 SER A HG   1 
ATOM   298  N  N    . GLY A 1 23 ? 5.371   11.042  8.627   1.00 0.00 ? 23 GLY A N    1 
ATOM   299  C  CA   . GLY A 1 23 ? 4.530   11.950  9.399   1.00 0.00 ? 23 GLY A CA   1 
ATOM   300  C  C    . GLY A 1 23 ? 3.439   11.210  10.187  1.00 0.00 ? 23 GLY A C    1 
ATOM   301  O  O    . GLY A 1 23 ? 2.991   11.679  11.230  1.00 0.00 ? 23 GLY A O    1 
ATOM   302  H  H    . GLY A 1 23 ? 5.348   11.006  7.622   1.00 0.00 ? 23 GLY A H    1 
ATOM   303  H  HA2  . GLY A 1 23 ? 5.152   12.517  10.093  1.00 0.00 ? 23 GLY A HA2  1 
ATOM   304  H  HA3  . GLY A 1 23 ? 4.049   12.646  8.712   1.00 0.00 ? 23 GLY A HA3  1 
ATOM   305  N  N    . HIS A 1 24 ? 2.987   10.066  9.672   1.00 0.00 ? 24 HIS A N    1 
ATOM   306  C  CA   . HIS A 1 24 ? 1.928   9.236   10.221  1.00 0.00 ? 24 HIS A CA   1 
ATOM   307  C  C    . HIS A 1 24 ? 2.495   8.394   11.375  1.00 0.00 ? 24 HIS A C    1 
ATOM   308  O  O    . HIS A 1 24 ? 3.308   7.518   11.107  1.00 0.00 ? 24 HIS A O    1 
ATOM   309  C  CB   . HIS A 1 24 ? 1.420   8.319   9.089   1.00 0.00 ? 24 HIS A CB   1 
ATOM   310  C  CG   . HIS A 1 24 ? 0.025   7.791   9.291   1.00 0.00 ? 24 HIS A CG   1 
ATOM   311  N  ND1  . HIS A 1 24 ? -0.333  6.842   10.225  1.00 0.00 ? 24 HIS A ND1  1 
ATOM   312  C  CD2  . HIS A 1 24 ? -1.087  8.106   8.557   1.00 0.00 ? 24 HIS A CD2  1 
ATOM   313  C  CE1  . HIS A 1 24 ? -1.652  6.605   10.087  1.00 0.00 ? 24 HIS A CE1  1 
ATOM   314  N  NE2  . HIS A 1 24 ? -2.128  7.370   9.087   1.00 0.00 ? 24 HIS A NE2  1 
ATOM   315  H  H    . HIS A 1 24 ? 3.475   9.693   8.868   1.00 0.00 ? 24 HIS A H    1 
ATOM   316  H  HA   . HIS A 1 24 ? 1.108   9.879   10.539  1.00 0.00 ? 24 HIS A HA   1 
ATOM   317  H  HB2  . HIS A 1 24 ? 1.473   8.847   8.140   1.00 0.00 ? 24 HIS A HB2  1 
ATOM   318  H  HB3  . HIS A 1 24 ? 2.082   7.462   8.983   1.00 0.00 ? 24 HIS A HB3  1 
ATOM   319  H  HD1  . HIS A 1 24 ? 0.306   6.360   10.838  1.00 0.00 ? 24 HIS A HD1  1 
ATOM   320  H  HD2  . HIS A 1 24 ? -1.158  8.764   7.702   1.00 0.00 ? 24 HIS A HD2  1 
ATOM   321  H  HE1  . HIS A 1 24 ? -2.226  5.886   10.655  1.00 0.00 ? 24 HIS A HE1  1 
ATOM   322  H  HE2  . HIS A 1 24 ? -3.095  7.401   8.758   1.00 0.00 ? 24 HIS A HE2  1 
ATOM   323  N  N    . PRO A 1 25 ? 2.059   8.556   12.636  1.00 0.00 ? 25 PRO A N    1 
ATOM   324  C  CA   . PRO A 1 25 ? 2.588   7.785   13.763  1.00 0.00 ? 25 PRO A CA   1 
ATOM   325  C  C    . PRO A 1 25 ? 2.646   6.269   13.520  1.00 0.00 ? 25 PRO A C    1 
ATOM   326  O  O    . PRO A 1 25 ? 3.633   5.617   13.844  1.00 0.00 ? 25 PRO A O    1 
ATOM   327  C  CB   . PRO A 1 25 ? 1.696   8.143   14.954  1.00 0.00 ? 25 PRO A CB   1 
ATOM   328  C  CG   . PRO A 1 25 ? 1.268   9.574   14.629  1.00 0.00 ? 25 PRO A CG   1 
ATOM   329  C  CD   . PRO A 1 25 ? 1.109   9.551   13.108  1.00 0.00 ? 25 PRO A CD   1 
ATOM   330  H  HA   . PRO A 1 25 ? 3.599   8.146   13.962  1.00 0.00 ? 25 PRO A HA   1 
ATOM   331  H  HB2  . PRO A 1 25 ? 0.814   7.503   14.979  1.00 0.00 ? 25 PRO A HB2  1 
ATOM   332  H  HB3  . PRO A 1 25 ? 2.234   8.078   15.901  1.00 0.00 ? 25 PRO A HB3  1 
ATOM   333  H  HG2  . PRO A 1 25 ? 0.350   9.863   15.141  1.00 0.00 ? 25 PRO A HG2  1 
ATOM   334  H  HG3  . PRO A 1 25 ? 2.076   10.258  14.895  1.00 0.00 ? 25 PRO A HG3  1 
ATOM   335  H  HD2  . PRO A 1 25 ? 0.097   9.241   12.846  1.00 0.00 ? 25 PRO A HD2  1 
ATOM   336  H  HD3  . PRO A 1 25 ? 1.309   10.546  12.712  1.00 0.00 ? 25 PRO A HD3  1 
ATOM   337  N  N    . ARG A 1 26 ? 1.579   5.692   12.955  1.00 0.00 ? 26 ARG A N    1 
ATOM   338  C  CA   . ARG A 1 26 ? 1.526   4.260   12.658  1.00 0.00 ? 26 ARG A CA   1 
ATOM   339  C  C    . ARG A 1 26 ? 2.468   3.813   11.527  1.00 0.00 ? 26 ARG A C    1 
ATOM   340  O  O    . ARG A 1 26 ? 2.653   2.607   11.337  1.00 0.00 ? 26 ARG A O    1 
ATOM   341  C  CB   . ARG A 1 26 ? 0.073   3.834   12.382  1.00 0.00 ? 26 ARG A CB   1 
ATOM   342  C  CG   . ARG A 1 26 ? -0.840  3.881   13.620  1.00 0.00 ? 26 ARG A CG   1 
ATOM   343  C  CD   . ARG A 1 26 ? -0.753  2.604   14.472  1.00 0.00 ? 26 ARG A CD   1 
ATOM   344  N  NE   . ARG A 1 26 ? 0.545   2.484   15.157  1.00 0.00 ? 26 ARG A NE   1 
ATOM   345  C  CZ   . ARG A 1 26 ? 1.211   1.345   15.411  1.00 0.00 ? 26 ARG A CZ   1 
ATOM   346  N  NH1  . ARG A 1 26 ? 0.638   0.158   15.180  1.00 0.00 ? 26 ARG A NH1  1 
ATOM   347  N  NH2  . ARG A 1 26 ? 2.456   1.402   15.900  1.00 0.00 ? 26 ARG A NH2  1 
ATOM   348  H  H    . ARG A 1 26 ? 0.753   6.256   12.847  1.00 0.00 ? 26 ARG A H    1 
ATOM   349  H  HA   . ARG A 1 26 ? 1.895   3.730   13.530  1.00 0.00 ? 26 ARG A HA   1 
ATOM   350  H  HB2  . ARG A 1 26 ? -0.340  4.493   11.624  1.00 0.00 ? 26 ARG A HB2  1 
ATOM   351  H  HB3  . ARG A 1 26 ? 0.049   2.827   11.964  1.00 0.00 ? 26 ARG A HB3  1 
ATOM   352  H  HG2  . ARG A 1 26 ? -0.631  4.763   14.228  1.00 0.00 ? 26 ARG A HG2  1 
ATOM   353  H  HG3  . ARG A 1 26 ? -1.870  3.956   13.266  1.00 0.00 ? 26 ARG A HG3  1 
ATOM   354  H  HD2  . ARG A 1 26 ? -1.540  2.639   15.229  1.00 0.00 ? 26 ARG A HD2  1 
ATOM   355  H  HD3  . ARG A 1 26 ? -0.948  1.757   13.813  1.00 0.00 ? 26 ARG A HD3  1 
ATOM   356  H  HE   . ARG A 1 26 ? 0.978   3.359   15.419  1.00 0.00 ? 26 ARG A HE   1 
ATOM   357  H  HH11 . ARG A 1 26 ? -0.314  0.120   14.849  1.00 0.00 ? 26 ARG A HH11 1 
ATOM   358  H  HH12 . ARG A 1 26 ? 1.129   -0.710  15.334  1.00 0.00 ? 26 ARG A HH12 1 
ATOM   359  H  HH21 . ARG A 1 26 ? 2.914   2.292   16.042  1.00 0.00 ? 26 ARG A HH21 1 
ATOM   360  H  HH22 . ARG A 1 26 ? 2.968   0.561   16.122  1.00 0.00 ? 26 ARG A HH22 1 
ATOM   361  N  N    . TYR A 1 27 ? 3.067   4.743   10.774  1.00 0.00 ? 27 TYR A N    1 
ATOM   362  C  CA   . TYR A 1 27 ? 4.087   4.383   9.804   1.00 0.00 ? 27 TYR A CA   1 
ATOM   363  C  C    . TYR A 1 27 ? 5.361   3.990   10.555  1.00 0.00 ? 27 TYR A C    1 
ATOM   364  O  O    . TYR A 1 27 ? 6.249   4.807   10.779  1.00 0.00 ? 27 TYR A O    1 
ATOM   365  C  CB   . TYR A 1 27 ? 4.337   5.520   8.800   1.00 0.00 ? 27 TYR A CB   1 
ATOM   366  C  CG   . TYR A 1 27 ? 5.333   5.133   7.720   1.00 0.00 ? 27 TYR A CG   1 
ATOM   367  C  CD1  . TYR A 1 27 ? 4.868   4.352   6.656   1.00 0.00 ? 27 TYR A CD1  1 
ATOM   368  C  CD2  . TYR A 1 27 ? 6.723   5.261   7.916   1.00 0.00 ? 27 TYR A CD2  1 
ATOM   369  C  CE1  . TYR A 1 27 ? 5.741   3.503   5.967   1.00 0.00 ? 27 TYR A CE1  1 
ATOM   370  C  CE2  . TYR A 1 27 ? 7.611   4.438   7.199   1.00 0.00 ? 27 TYR A CE2  1 
ATOM   371  C  CZ   . TYR A 1 27 ? 7.108   3.497   6.285   1.00 0.00 ? 27 TYR A CZ   1 
ATOM   372  O  OH   . TYR A 1 27 ? 7.930   2.552   5.745   1.00 0.00 ? 27 TYR A OH   1 
ATOM   373  H  H    . TYR A 1 27 ? 3.000   5.725   11.013  1.00 0.00 ? 27 TYR A H    1 
ATOM   374  H  HA   . TYR A 1 27 ? 3.721   3.526   9.232   1.00 0.00 ? 27 TYR A HA   1 
ATOM   375  H  HB2  . TYR A 1 27 ? 3.390   5.745   8.312   1.00 0.00 ? 27 TYR A HB2  1 
ATOM   376  H  HB3  . TYR A 1 27 ? 4.666   6.422   9.314   1.00 0.00 ? 27 TYR A HB3  1 
ATOM   377  H  HD1  . TYR A 1 27 ? 3.821   4.344   6.433   1.00 0.00 ? 27 TYR A HD1  1 
ATOM   378  H  HD2  . TYR A 1 27 ? 7.110   5.895   8.700   1.00 0.00 ? 27 TYR A HD2  1 
ATOM   379  H  HE1  . TYR A 1 27 ? 5.339   2.849   5.214   1.00 0.00 ? 27 TYR A HE1  1 
ATOM   380  H  HE2  . TYR A 1 27 ? 8.667   4.468   7.419   1.00 0.00 ? 27 TYR A HE2  1 
ATOM   381  H  HH   . TYR A 1 27 ? 7.419   1.898   5.249   1.00 0.00 ? 27 TYR A HH   1 
ATOM   382  N  N    . GLN A 1 28 ? 5.448   2.724   10.955  1.00 0.00 ? 28 GLN A N    1 
ATOM   383  C  CA   . GLN A 1 28 ? 6.687   2.137   11.422  1.00 0.00 ? 28 GLN A CA   1 
ATOM   384  C  C    . GLN A 1 28 ? 7.650   1.976   10.242  1.00 0.00 ? 28 GLN A C    1 
ATOM   385  O  O    . GLN A 1 28 ? 7.234   1.775   9.098   1.00 0.00 ? 28 GLN A O    1 
ATOM   386  C  CB   . GLN A 1 28 ? 6.404   0.793   12.107  1.00 0.00 ? 28 GLN A CB   1 
ATOM   387  C  CG   . GLN A 1 28 ? 7.469   0.416   13.145  1.00 0.00 ? 28 GLN A CG   1 
ATOM   388  C  CD   . GLN A 1 28 ? 7.425   1.345   14.353  1.00 0.00 ? 28 GLN A CD   1 
ATOM   389  O  OE1  . GLN A 1 28 ? 8.245   2.243   14.488  1.00 0.00 ? 28 GLN A OE1  1 
ATOM   390  N  NE2  . GLN A 1 28 ? 6.452   1.145   15.238  1.00 0.00 ? 28 GLN A NE2  1 
ATOM   391  H  H    . GLN A 1 28 ? 4.632   2.139   10.860  1.00 0.00 ? 28 GLN A H    1 
ATOM   392  H  HA   . GLN A 1 28 ? 7.117   2.832   12.144  1.00 0.00 ? 28 GLN A HA   1 
ATOM   393  H  HB2  . GLN A 1 28 ? 5.433   0.840   12.595  1.00 0.00 ? 28 GLN A HB2  1 
ATOM   394  H  HB3  . GLN A 1 28 ? 6.370   0.008   11.357  1.00 0.00 ? 28 GLN A HB3  1 
ATOM   395  H  HG2  . GLN A 1 28 ? 7.290   -0.605  13.480  1.00 0.00 ? 28 GLN A HG2  1 
ATOM   396  H  HG3  . GLN A 1 28 ? 8.462   0.450   12.696  1.00 0.00 ? 28 GLN A HG3  1 
ATOM   397  H  HE21 . GLN A 1 28 ? 5.806   0.385   15.109  1.00 0.00 ? 28 GLN A HE21 1 
ATOM   398  H  HE22 . GLN A 1 28 ? 6.424   1.748   16.046  1.00 0.00 ? 28 GLN A HE22 1 
ATOM   399  N  N    . GLU A 1 29 ? 8.941   2.057   10.551  1.00 0.00 ? 29 GLU A N    1 
ATOM   400  C  CA   . GLU A 1 29 ? 10.029  2.022   9.597   1.00 0.00 ? 29 GLU A CA   1 
ATOM   401  C  C    . GLU A 1 29 ? 9.959   0.787   8.706   1.00 0.00 ? 29 GLU A C    1 
ATOM   402  O  O    . GLU A 1 29 ? 9.841   -0.339  9.186   1.00 0.00 ? 29 GLU A O    1 
ATOM   403  C  CB   . GLU A 1 29 ? 11.362  2.038   10.356  1.00 0.00 ? 29 GLU A CB   1 
ATOM   404  C  CG   . GLU A 1 29 ? 11.554  3.293   11.215  1.00 0.00 ? 29 GLU A CG   1 
ATOM   405  C  CD   . GLU A 1 29 ? 12.825  3.166   12.043  1.00 0.00 ? 29 GLU A CD   1 
ATOM   406  O  OE1  . GLU A 1 29 ? 13.894  3.509   11.496  1.00 0.00 ? 29 GLU A OE1  1 
ATOM   407  O  OE2  . GLU A 1 29 ? 12.702  2.698   13.195  1.00 0.00 ? 29 GLU A OE2  1 
ATOM   408  H  H    . GLU A 1 29 ? 9.187   2.201   11.516  1.00 0.00 ? 29 GLU A H    1 
ATOM   409  H  HA   . GLU A 1 29 ? 9.942   2.904   8.964   1.00 0.00 ? 29 GLU A HA   1 
ATOM   410  H  HB2  . GLU A 1 29 ? 11.416  1.159   11.003  1.00 0.00 ? 29 GLU A HB2  1 
ATOM   411  H  HB3  . GLU A 1 29 ? 12.187  1.983   9.644   1.00 0.00 ? 29 GLU A HB3  1 
ATOM   412  H  HG2  . GLU A 1 29 ? 11.637  4.168   10.572  1.00 0.00 ? 29 GLU A HG2  1 
ATOM   413  H  HG3  . GLU A 1 29 ? 10.724  3.440   11.904  1.00 0.00 ? 29 GLU A HG3  1 
ATOM   414  N  N    . GLY A 1 30 ? 10.056  1.012   7.397   1.00 0.00 ? 30 GLY A N    1 
ATOM   415  C  CA   . GLY A 1 30 ? 10.215  -0.048  6.418   1.00 0.00 ? 30 GLY A CA   1 
ATOM   416  C  C    . GLY A 1 30 ? 8.934   -0.843  6.190   1.00 0.00 ? 30 GLY A C    1 
ATOM   417  O  O    . GLY A 1 30 ? 8.954   -1.811  5.431   1.00 0.00 ? 30 GLY A O    1 
ATOM   418  H  H    . GLY A 1 30 ? 10.035  1.966   7.069   1.00 0.00 ? 30 GLY A H    1 
ATOM   419  H  HA2  . GLY A 1 30 ? 10.511  0.401   5.470   1.00 0.00 ? 30 GLY A HA2  1 
ATOM   420  H  HA3  . GLY A 1 30 ? 11.005  -0.729  6.738   1.00 0.00 ? 30 GLY A HA3  1 
ATOM   421  N  N    . GLN A 1 31 ? 7.806   -0.442  6.787   1.00 0.00 ? 31 GLN A N    1 
ATOM   422  C  CA   . GLN A 1 31 ? 6.536   -1.014  6.384   1.00 0.00 ? 31 GLN A CA   1 
ATOM   423  C  C    . GLN A 1 31 ? 6.276   -0.564  4.945   1.00 0.00 ? 31 GLN A C    1 
ATOM   424  O  O    . GLN A 1 31 ? 6.216   0.639   4.697   1.00 0.00 ? 31 GLN A O    1 
ATOM   425  C  CB   . GLN A 1 31 ? 5.432   -0.518  7.320   1.00 0.00 ? 31 GLN A CB   1 
ATOM   426  C  CG   . GLN A 1 31 ? 5.581   -1.046  8.753   1.00 0.00 ? 31 GLN A CG   1 
ATOM   427  C  CD   . GLN A 1 31 ? 4.440   -0.605  9.676   1.00 0.00 ? 31 GLN A CD   1 
ATOM   428  O  OE1  . GLN A 1 31 ? 4.023   -1.346  10.559  1.00 0.00 ? 31 GLN A OE1  1 
ATOM   429  N  NE2  . GLN A 1 31 ? 3.933   0.615   9.513   1.00 0.00 ? 31 GLN A NE2  1 
ATOM   430  H  H    . GLN A 1 31 ? 7.798   0.365   7.406   1.00 0.00 ? 31 GLN A H    1 
ATOM   431  H  HA   . GLN A 1 31 ? 6.595   -2.105  6.422   1.00 0.00 ? 31 GLN A HA   1 
ATOM   432  H  HB2  . GLN A 1 31 ? 5.442   0.571   7.310   1.00 0.00 ? 31 GLN A HB2  1 
ATOM   433  H  HB3  . GLN A 1 31 ? 4.484   -0.863  6.928   1.00 0.00 ? 31 GLN A HB3  1 
ATOM   434  H  HG2  . GLN A 1 31 ? 5.601   -2.136  8.726   1.00 0.00 ? 31 GLN A HG2  1 
ATOM   435  H  HG3  . GLN A 1 31 ? 6.528   -0.708  9.169   1.00 0.00 ? 31 GLN A HG3  1 
ATOM   436  H  HE21 . GLN A 1 31 ? 4.365   1.242   8.850   1.00 0.00 ? 31 GLN A HE21 1 
ATOM   437  H  HE22 . GLN A 1 31 ? 3.207   0.943   10.144  1.00 0.00 ? 31 GLN A HE22 1 
ATOM   438  N  N    . LEU A 1 32 ? 6.163   -1.504  4.008   1.00 0.00 ? 32 LEU A N    1 
ATOM   439  C  CA   . LEU A 1 32 ? 5.835   -1.260  2.608   1.00 0.00 ? 32 LEU A CA   1 
ATOM   440  C  C    . LEU A 1 32 ? 4.646   -2.162  2.290   1.00 0.00 ? 32 LEU A C    1 
ATOM   441  O  O    . LEU A 1 32 ? 4.575   -3.257  2.847   1.00 0.00 ? 32 LEU A O    1 
ATOM   442  C  CB   . LEU A 1 32 ? 7.014   -1.662  1.703   1.00 0.00 ? 32 LEU A CB   1 
ATOM   443  C  CG   . LEU A 1 32 ? 7.945   -0.525  1.257   1.00 0.00 ? 32 LEU A CG   1 
ATOM   444  C  CD1  . LEU A 1 32 ? 8.761   0.107   2.384   1.00 0.00 ? 32 LEU A CD1  1 
ATOM   445  C  CD2  . LEU A 1 32 ? 8.946   -1.092  0.243   1.00 0.00 ? 32 LEU A CD2  1 
ATOM   446  H  H    . LEU A 1 32 ? 6.177   -2.481  4.290   1.00 0.00 ? 32 LEU A H    1 
ATOM   447  H  HA   . LEU A 1 32 ? 5.561   -0.220  2.434   1.00 0.00 ? 32 LEU A HA   1 
ATOM   448  H  HB2  . LEU A 1 32 ? 7.601   -2.450  2.170   1.00 0.00 ? 32 LEU A HB2  1 
ATOM   449  H  HB3  . LEU A 1 32 ? 6.594   -2.076  0.787   1.00 0.00 ? 32 LEU A HB3  1 
ATOM   450  H  HG   . LEU A 1 32 ? 7.347   0.254   0.787   1.00 0.00 ? 32 LEU A HG   1 
ATOM   451  H  HD11 . LEU A 1 32 ? 9.318   -0.661  2.919   1.00 0.00 ? 32 LEU A HD11 1 
ATOM   452  H  HD12 . LEU A 1 32 ? 9.461   0.817   1.939   1.00 0.00 ? 32 LEU A HD12 1 
ATOM   453  H  HD13 . LEU A 1 32 ? 8.111   0.640   3.071   1.00 0.00 ? 32 LEU A HD13 1 
ATOM   454  H  HD21 . LEU A 1 32 ? 8.429   -1.622  -0.558  1.00 0.00 ? 32 LEU A HD21 1 
ATOM   455  H  HD22 . LEU A 1 32 ? 9.529   -0.281  -0.195  1.00 0.00 ? 32 LEU A HD22 1 
ATOM   456  H  HD23 . LEU A 1 32 ? 9.614   -1.793  0.745   1.00 0.00 ? 32 LEU A HD23 1 
ATOM   457  N  N    . CYS A 1 33 ? 3.758   -1.757  1.377   1.00 0.00 ? 33 CYS A N    1 
ATOM   458  C  CA   . CYS A 1 33 ? 2.695   -2.613  0.859   1.00 0.00 ? 33 CYS A CA   1 
ATOM   459  C  C    . CYS A 1 33 ? 3.243   -4.005  0.523   1.00 0.00 ? 33 CYS A C    1 
ATOM   460  O  O    . CYS A 1 33 ? 2.642   -5.011  0.885   1.00 0.00 ? 33 CYS A O    1 
ATOM   461  C  CB   . CYS A 1 33 ? 2.047   -1.986  -0.349  1.00 0.00 ? 33 CYS A CB   1 
ATOM   462  S  SG   . CYS A 1 33 ? 0.900   -0.652  0.086   1.00 0.00 ? 33 CYS A SG   1 
ATOM   463  H  H    . CYS A 1 33 ? 3.842   -0.824  0.982   1.00 0.00 ? 33 CYS A H    1 
ATOM   464  H  HA   . CYS A 1 33 ? 1.942   -2.730  1.634   1.00 0.00 ? 33 CYS A HA   1 
ATOM   465  H  HB2  . CYS A 1 33 ? 2.820   -1.579  -0.998  1.00 0.00 ? 33 CYS A HB2  1 
ATOM   466  H  HB3  . CYS A 1 33 ? 1.512   -2.744  -0.915  1.00 0.00 ? 33 CYS A HB3  1 
ATOM   467  N  N    . GLU A 1 34 ? 4.412   -4.082  -0.120  1.00 0.00 ? 34 GLU A N    1 
ATOM   468  C  CA   . GLU A 1 34 ? 5.020   -5.365  -0.458  1.00 0.00 ? 34 GLU A CA   1 
ATOM   469  C  C    . GLU A 1 34 ? 5.128   -6.322  0.745   1.00 0.00 ? 34 GLU A C    1 
ATOM   470  O  O    . GLU A 1 34 ? 5.034   -7.536  0.573   1.00 0.00 ? 34 GLU A O    1 
ATOM   471  C  CB   . GLU A 1 34 ? 6.358   -5.158  -1.186  1.00 0.00 ? 34 GLU A CB   1 
ATOM   472  C  CG   . GLU A 1 34 ? 7.598   -5.153  -0.278  1.00 0.00 ? 34 GLU A CG   1 
ATOM   473  C  CD   . GLU A 1 34 ? 8.881   -4.996  -1.082  1.00 0.00 ? 34 GLU A CD   1 
ATOM   474  O  OE1  . GLU A 1 34 ? 9.013   -5.729  -2.086  1.00 0.00 ? 34 GLU A OE1  1 
ATOM   475  O  OE2  . GLU A 1 34 ? 9.712   -4.161  -0.668  1.00 0.00 ? 34 GLU A OE2  1 
ATOM   476  H  H    . GLU A 1 34 ? 4.848   -3.220  -0.437  1.00 0.00 ? 34 GLU A H    1 
ATOM   477  H  HA   . GLU A 1 34 ? 4.348   -5.833  -1.177  1.00 0.00 ? 34 GLU A HA   1 
ATOM   478  H  HB2  . GLU A 1 34 ? 6.458   -5.953  -1.927  1.00 0.00 ? 34 GLU A HB2  1 
ATOM   479  H  HB3  . GLU A 1 34 ? 6.345   -4.213  -1.724  1.00 0.00 ? 34 GLU A HB3  1 
ATOM   480  H  HG2  . GLU A 1 34 ? 7.524   -4.337  0.440   1.00 0.00 ? 34 GLU A HG2  1 
ATOM   481  H  HG3  . GLU A 1 34 ? 7.686   -6.098  0.258   1.00 0.00 ? 34 GLU A HG3  1 
ATOM   482  N  N    . ASN A 1 35 ? 5.337   -5.780  1.954   1.00 0.00 ? 35 ASN A N    1 
ATOM   483  C  CA   . ASN A 1 35 ? 5.478   -6.533  3.200   1.00 0.00 ? 35 ASN A CA   1 
ATOM   484  C  C    . ASN A 1 35 ? 4.270   -6.347  4.126   1.00 0.00 ? 35 ASN A C    1 
ATOM   485  O  O    . ASN A 1 35 ? 4.385   -6.528  5.339   1.00 0.00 ? 35 ASN A O    1 
ATOM   486  C  CB   . ASN A 1 35 ? 6.811   -6.182  3.885   1.00 0.00 ? 35 ASN A CB   1 
ATOM   487  C  CG   . ASN A 1 35 ? 6.927   -4.760  4.417   1.00 0.00 ? 35 ASN A CG   1 
ATOM   488  O  OD1  . ASN A 1 35 ? 6.076   -4.250  5.137   1.00 0.00 ? 35 ASN A OD1  1 
ATOM   489  N  ND2  . ASN A 1 35 ? 8.034   -4.104  4.101   1.00 0.00 ? 35 ASN A ND2  1 
ATOM   490  H  H    . ASN A 1 35 ? 5.294   -4.769  2.030   1.00 0.00 ? 35 ASN A H    1 
ATOM   491  H  HA   . ASN A 1 35 ? 5.521   -7.599  2.974   1.00 0.00 ? 35 ASN A HA   1 
ATOM   492  H  HB2  . ASN A 1 35 ? 6.976   -6.834  4.740   1.00 0.00 ? 35 ASN A HB2  1 
ATOM   493  H  HB3  . ASN A 1 35 ? 7.621   -6.348  3.175   1.00 0.00 ? 35 ASN A HB3  1 
ATOM   494  H  HD21 . ASN A 1 35 ? 8.701   -4.501  3.467   1.00 0.00 ? 35 ASN A HD21 1 
ATOM   495  H  HD22 . ASN A 1 35 ? 8.233   -3.211  4.529   1.00 0.00 ? 35 ASN A HD22 1 
ATOM   496  N  N    . CYS A 1 36 ? 3.110   -6.013  3.559   1.00 0.00 ? 36 CYS A N    1 
ATOM   497  C  CA   . CYS A 1 36 ? 1.850   -5.891  4.273   1.00 0.00 ? 36 CYS A CA   1 
ATOM   498  C  C    . CYS A 1 36 ? 1.152   -7.250  4.291   1.00 0.00 ? 36 CYS A C    1 
ATOM   499  O  O    . CYS A 1 36 ? 1.129   -7.960  3.286   1.00 0.00 ? 36 CYS A O    1 
ATOM   500  C  CB   . CYS A 1 36 ? 1.038   -4.861  3.542   1.00 0.00 ? 36 CYS A CB   1 
ATOM   501  S  SG   . CYS A 1 36 ? -0.523  -4.464  4.326   1.00 0.00 ? 36 CYS A SG   1 
ATOM   502  H  H    . CYS A 1 36 ? 3.070   -5.859  2.555   1.00 0.00 ? 36 CYS A H    1 
ATOM   503  H  HA   . CYS A 1 36 ? 2.020   -5.552  5.295   1.00 0.00 ? 36 CYS A HA   1 
ATOM   504  H  HB2  . CYS A 1 36 ? 1.619   -3.943  3.475   1.00 0.00 ? 36 CYS A HB2  1 
ATOM   505  H  HB3  . CYS A 1 36 ? 0.817   -5.227  2.541   1.00 0.00 ? 36 CYS A HB3  1 
ATOM   506  N  N    . ALA A 1 37 ? 0.551   -7.627  5.420   1.00 0.00 ? 37 ALA A N    1 
ATOM   507  C  CA   . ALA A 1 37 ? -0.173  -8.888  5.536   1.00 0.00 ? 37 ALA A CA   1 
ATOM   508  C  C    . ALA A 1 37 ? -1.349  -8.979  4.561   1.00 0.00 ? 37 ALA A C    1 
ATOM   509  O  O    . ALA A 1 37 ? -1.847  -10.073 4.306   1.00 0.00 ? 37 ALA A O    1 
ATOM   510  C  CB   . ALA A 1 37 ? -0.645  -9.077  6.975   1.00 0.00 ? 37 ALA A CB   1 
ATOM   511  H  H    . ALA A 1 37 ? 0.588   -7.007  6.222   1.00 0.00 ? 37 ALA A H    1 
ATOM   512  H  HA   . ALA A 1 37 ? 0.509   -9.705  5.297   1.00 0.00 ? 37 ALA A HA   1 
ATOM   513  H  HB1  . ALA A 1 37 ? 0.221   -9.047  7.631   1.00 0.00 ? 37 ALA A HB1  1 
ATOM   514  H  HB2  . ALA A 1 37 ? -1.342  -8.286  7.250   1.00 0.00 ? 37 ALA A HB2  1 
ATOM   515  H  HB3  . ALA A 1 37 ? -1.136  -10.045 7.081   1.00 0.00 ? 37 ALA A HB3  1 
ATOM   516  N  N    . PHE A 1 38 ? -1.801  -7.841  4.025   1.00 0.00 ? 38 PHE A N    1 
ATOM   517  C  CA   . PHE A 1 38 ? -2.873  -7.780  3.044   1.00 0.00 ? 38 PHE A CA   1 
ATOM   518  C  C    . PHE A 1 38 ? -2.336  -7.592  1.625   1.00 0.00 ? 38 PHE A C    1 
ATOM   519  O  O    . PHE A 1 38 ? -3.123  -7.348  0.709   1.00 0.00 ? 38 PHE A O    1 
ATOM   520  C  CB   . PHE A 1 38 ? -3.848  -6.672  3.454   1.00 0.00 ? 38 PHE A CB   1 
ATOM   521  C  CG   . PHE A 1 38 ? -4.315  -6.767  4.900   1.00 0.00 ? 38 PHE A CG   1 
ATOM   522  C  CD1  . PHE A 1 38 ? -4.723  -8.007  5.434   1.00 0.00 ? 38 PHE A CD1  1 
ATOM   523  C  CD2  . PHE A 1 38 ? -4.277  -5.634  5.737   1.00 0.00 ? 38 PHE A CD2  1 
ATOM   524  C  CE1  . PHE A 1 38 ? -5.146  -8.101  6.770   1.00 0.00 ? 38 PHE A CE1  1 
ATOM   525  C  CE2  . PHE A 1 38 ? -4.700  -5.731  7.074   1.00 0.00 ? 38 PHE A CE2  1 
ATOM   526  C  CZ   . PHE A 1 38 ? -5.147  -6.960  7.588   1.00 0.00 ? 38 PHE A CZ   1 
ATOM   527  H  H    . PHE A 1 38 ? -1.356  -6.970  4.282   1.00 0.00 ? 38 PHE A H    1 
ATOM   528  H  HA   . PHE A 1 38 ? -3.420  -8.722  3.018   1.00 0.00 ? 38 PHE A HA   1 
ATOM   529  H  HB2  . PHE A 1 38 ? -3.353  -5.713  3.293   1.00 0.00 ? 38 PHE A HB2  1 
ATOM   530  H  HB3  . PHE A 1 38 ? -4.715  -6.711  2.792   1.00 0.00 ? 38 PHE A HB3  1 
ATOM   531  H  HD1  . PHE A 1 38 ? -4.681  -8.907  4.837   1.00 0.00 ? 38 PHE A HD1  1 
ATOM   532  H  HD2  . PHE A 1 38 ? -3.891  -4.690  5.372   1.00 0.00 ? 38 PHE A HD2  1 
ATOM   533  H  HE1  . PHE A 1 38 ? -5.407  -9.064  7.186   1.00 0.00 ? 38 PHE A HE1  1 
ATOM   534  H  HE2  . PHE A 1 38 ? -4.620  -4.878  7.731   1.00 0.00 ? 38 PHE A HE2  1 
ATOM   535  H  HZ   . PHE A 1 38 ? -5.408  -7.044  8.634   1.00 0.00 ? 38 PHE A HZ   1 
ATOM   536  N  N    . TRP A 1 39 ? -1.026  -7.742  1.416   1.00 0.00 ? 39 TRP A N    1 
ATOM   537  C  CA   . TRP A 1 39 ? -0.458  -7.756  0.081   1.00 0.00 ? 39 TRP A CA   1 
ATOM   538  C  C    . TRP A 1 39 ? -1.082  -8.882  -0.745  1.00 0.00 ? 39 TRP A C    1 
ATOM   539  O  O    . TRP A 1 39 ? -1.320  -9.973  -0.229  1.00 0.00 ? 39 TRP A O    1 
ATOM   540  C  CB   . TRP A 1 39 ? 1.057   -7.957  0.172   1.00 0.00 ? 39 TRP A CB   1 
ATOM   541  C  CG   . TRP A 1 39 ? 1.783   -7.872  -1.134  1.00 0.00 ? 39 TRP A CG   1 
ATOM   542  C  CD1  . TRP A 1 39 ? 2.503   -8.861  -1.707  1.00 0.00 ? 39 TRP A CD1  1 
ATOM   543  C  CD2  . TRP A 1 39 ? 1.867   -6.738  -2.044  1.00 0.00 ? 39 TRP A CD2  1 
ATOM   544  N  NE1  . TRP A 1 39 ? 3.022   -8.420  -2.906  1.00 0.00 ? 39 TRP A NE1  1 
ATOM   545  C  CE2  . TRP A 1 39 ? 2.666   -7.113  -3.164  1.00 0.00 ? 39 TRP A CE2  1 
ATOM   546  C  CE3  . TRP A 1 39 ? 1.357   -5.423  -2.033  1.00 0.00 ? 39 TRP A CE3  1 
ATOM   547  C  CZ2  . TRP A 1 39 ? 2.948   -6.228  -4.215  1.00 0.00 ? 39 TRP A CZ2  1 
ATOM   548  C  CZ3  . TRP A 1 39 ? 1.652   -4.524  -3.070  1.00 0.00 ? 39 TRP A CZ3  1 
ATOM   549  C  CH2  . TRP A 1 39 ? 2.454   -4.916  -4.150  1.00 0.00 ? 39 TRP A CH2  1 
ATOM   550  H  H    . TRP A 1 39 ? -0.395  -7.928  2.190   1.00 0.00 ? 39 TRP A H    1 
ATOM   551  H  HA   . TRP A 1 39 ? -0.670  -6.793  -0.384  1.00 0.00 ? 39 TRP A HA   1 
ATOM   552  H  HB2  . TRP A 1 39 ? 1.468   -7.191  0.825   1.00 0.00 ? 39 TRP A HB2  1 
ATOM   553  H  HB3  . TRP A 1 39 ? 1.258   -8.928  0.628   1.00 0.00 ? 39 TRP A HB3  1 
ATOM   554  H  HD1  . TRP A 1 39 ? 2.645   -9.849  -1.292  1.00 0.00 ? 39 TRP A HD1  1 
ATOM   555  H  HE1  . TRP A 1 39 ? 3.606   -9.003  -3.487  1.00 0.00 ? 39 TRP A HE1  1 
ATOM   556  H  HE3  . TRP A 1 39 ? 0.753   -5.093  -1.200  1.00 0.00 ? 39 TRP A HE3  1 
ATOM   557  H  HZ2  . TRP A 1 39 ? 3.536   -6.544  -5.061  1.00 0.00 ? 39 TRP A HZ2  1 
ATOM   558  H  HZ3  . TRP A 1 39 ? 1.280   -3.516  -3.026  1.00 0.00 ? 39 TRP A HZ3  1 
ATOM   559  H  HH2  . TRP A 1 39 ? 2.662   -4.209  -4.941  1.00 0.00 ? 39 TRP A HH2  1 
ATOM   560  N  N    . GLY A 1 40 ? -1.338  -8.619  -2.028  1.00 0.00 ? 40 GLY A N    1 
ATOM   561  C  CA   . GLY A 1 40 ? -1.655  -9.652  -2.996  1.00 0.00 ? 40 GLY A CA   1 
ATOM   562  C  C    . GLY A 1 40 ? -0.352  -10.129 -3.625  1.00 0.00 ? 40 GLY A C    1 
ATOM   563  O  O    . GLY A 1 40 ? 0.430   -10.829 -2.986  1.00 0.00 ? 40 GLY A O    1 
ATOM   564  H  H    . GLY A 1 40 ? -1.168  -7.681  -2.379  1.00 0.00 ? 40 GLY A H    1 
ATOM   565  H  HA2  . GLY A 1 40 ? -2.161  -10.498 -2.532  1.00 0.00 ? 40 GLY A HA2  1 
ATOM   566  H  HA3  . GLY A 1 40 ? -2.312  -9.233  -3.758  1.00 0.00 ? 40 GLY A HA3  1 
ATOM   567  N  N    . GLU A 1 41 ? -0.113  -9.711  -4.869  1.00 0.00 ? 41 GLU A N    1 
ATOM   568  C  CA   . GLU A 1 41 ? 1.106   -9.966  -5.610  1.00 0.00 ? 41 GLU A CA   1 
ATOM   569  C  C    . GLU A 1 41 ? 1.436   -8.703  -6.398  1.00 0.00 ? 41 GLU A C    1 
ATOM   570  O  O    . GLU A 1 41 ? 0.568   -7.846  -6.600  1.00 0.00 ? 41 GLU A O    1 
ATOM   571  C  CB   . GLU A 1 41 ? 0.924   -11.159 -6.559  1.00 0.00 ? 41 GLU A CB   1 
ATOM   572  C  CG   . GLU A 1 41 ? 0.733   -12.477 -5.798  1.00 0.00 ? 41 GLU A CG   1 
ATOM   573  C  CD   . GLU A 1 41 ? 0.645   -13.674 -6.738  1.00 0.00 ? 41 GLU A CD   1 
ATOM   574  O  OE1  . GLU A 1 41 ? 1.435   -13.696 -7.707  1.00 0.00 ? 41 GLU A OE1  1 
ATOM   575  O  OE2  . GLU A 1 41 ? -0.209  -14.546 -6.470  1.00 0.00 ? 41 GLU A OE2  1 
ATOM   576  H  H    . GLU A 1 41 ? -0.752  -9.063  -5.305  1.00 0.00 ? 41 GLU A H    1 
ATOM   577  H  HA   . GLU A 1 41 ? 1.930   -10.172 -4.924  1.00 0.00 ? 41 GLU A HA   1 
ATOM   578  H  HB2  . GLU A 1 41 ? 0.067   -10.993 -7.214  1.00 0.00 ? 41 GLU A HB2  1 
ATOM   579  H  HB3  . GLU A 1 41 ? 1.813   -11.254 -7.186  1.00 0.00 ? 41 GLU A HB3  1 
ATOM   580  H  HG2  . GLU A 1 41 ? 1.578   -12.634 -5.128  1.00 0.00 ? 41 GLU A HG2  1 
ATOM   581  H  HG3  . GLU A 1 41 ? -0.182  -12.440 -5.209  1.00 0.00 ? 41 GLU A HG3  1 
ATOM   582  N  N    . ALA A 1 42 ? 2.691   -8.610  -6.846  1.00 0.00 ? 42 ALA A N    1 
ATOM   583  C  CA   . ALA A 1 42 ? 3.114   -7.578  -7.774  1.00 0.00 ? 42 ALA A CA   1 
ATOM   584  C  C    . ALA A 1 42 ? 2.498   -7.851  -9.141  1.00 0.00 ? 42 ALA A C    1 
ATOM   585  O  O    . ALA A 1 42 ? 2.341   -9.004  -9.536  1.00 0.00 ? 42 ALA A O    1 
ATOM   586  C  CB   . ALA A 1 42 ? 4.639   -7.501  -7.846  1.00 0.00 ? 42 ALA A CB   1 
ATOM   587  H  H    . ALA A 1 42 ? 3.311   -9.389  -6.686  1.00 0.00 ? 42 ALA A H    1 
ATOM   588  H  HA   . ALA A 1 42 ? 2.748   -6.623  -7.413  1.00 0.00 ? 42 ALA A HA   1 
ATOM   589  H  HB1  . ALA A 1 42 ? 5.048   -7.304  -6.855  1.00 0.00 ? 42 ALA A HB1  1 
ATOM   590  H  HB2  . ALA A 1 42 ? 5.047   -8.436  -8.231  1.00 0.00 ? 42 ALA A HB2  1 
ATOM   591  H  HB3  . ALA A 1 42 ? 4.923   -6.682  -8.509  1.00 0.00 ? 42 ALA A HB3  1 
ATOM   592  N  N    . VAL A 1 43 ? 2.134   -6.781  -9.843  1.00 0.00 ? 43 VAL A N    1 
ATOM   593  C  CA   . VAL A 1 43 ? 1.451   -6.829  -11.122 1.00 0.00 ? 43 VAL A CA   1 
ATOM   594  C  C    . VAL A 1 43 ? 2.390   -6.289  -12.205 1.00 0.00 ? 43 VAL A C    1 
ATOM   595  O  O    . VAL A 1 43 ? 2.664   -6.986  -13.178 1.00 0.00 ? 43 VAL A O    1 
ATOM   596  C  CB   . VAL A 1 43 ? 0.121   -6.066  -11.003 1.00 0.00 ? 43 VAL A CB   1 
ATOM   597  C  CG1  . VAL A 1 43 ? -0.613  -6.006  -12.349 1.00 0.00 ? 43 VAL A CG1  1 
ATOM   598  C  CG2  . VAL A 1 43 ? -0.821  -6.708  -9.963  1.00 0.00 ? 43 VAL A CG2  1 
ATOM   599  H  H    . VAL A 1 43 ? 2.334   -5.867  -9.455  1.00 0.00 ? 43 VAL A H    1 
ATOM   600  H  HA   . VAL A 1 43 ? 1.217   -7.857  -11.390 1.00 0.00 ? 43 VAL A HA   1 
ATOM   601  H  HB   . VAL A 1 43 ? 0.344   -5.051  -10.683 1.00 0.00 ? 43 VAL A HB   1 
ATOM   602  H  HG11 . VAL A 1 43 ? -0.827  -7.016  -12.702 1.00 0.00 ? 43 VAL A HG11 1 
ATOM   603  H  HG12 . VAL A 1 43 ? -1.552  -5.464  -12.233 1.00 0.00 ? 43 VAL A HG12 1 
ATOM   604  H  HG13 . VAL A 1 43 ? -0.011  -5.490  -13.096 1.00 0.00 ? 43 VAL A HG13 1 
ATOM   605  H  HG21 . VAL A 1 43 ? -0.400  -6.735  -8.954  1.00 0.00 ? 43 VAL A HG21 1 
ATOM   606  H  HG22 . VAL A 1 43 ? -1.744  -6.127  -9.931  1.00 0.00 ? 43 VAL A HG22 1 
ATOM   607  H  HG23 . VAL A 1 43 ? -1.071  -7.730  -10.241 1.00 0.00 ? 43 VAL A HG23 1 
ATOM   608  N  N    . GLN A 1 44 ? 2.895   -5.059  -12.046 1.00 0.00 ? 44 GLN A N    1 
ATOM   609  C  CA   . GLN A 1 44 ? 3.801   -4.437  -13.001 1.00 0.00 ? 44 GLN A CA   1 
ATOM   610  C  C    . GLN A 1 44 ? 4.597   -3.298  -12.364 1.00 0.00 ? 44 GLN A C    1 
ATOM   611  O  O    . GLN A 1 44 ? 4.109   -2.687  -11.423 1.00 0.00 ? 44 GLN A O    1 
ATOM   612  C  CB   . GLN A 1 44 ? 3.005   -3.937  -14.202 1.00 0.00 ? 44 GLN A CB   1 
ATOM   613  C  CG   . GLN A 1 44 ? 1.960   -2.880  -13.833 1.00 0.00 ? 44 GLN A CG   1 
ATOM   614  C  CD   . GLN A 1 44 ? 1.383   -2.247  -15.090 1.00 0.00 ? 44 GLN A CD   1 
ATOM   615  O  OE1  . GLN A 1 44 ? 0.229   -2.465  -15.442 1.00 0.00 ? 44 GLN A OE1  1 
ATOM   616  N  NE2  . GLN A 1 44 ? 2.189   -1.443  -15.774 1.00 0.00 ? 44 GLN A NE2  1 
ATOM   617  H  H    . GLN A 1 44 ? 2.641   -4.511  -11.241 1.00 0.00 ? 44 GLN A H    1 
ATOM   618  H  HA   . GLN A 1 44 ? 4.502   -5.185  -13.358 1.00 0.00 ? 44 GLN A HA   1 
ATOM   619  H  HB2  . GLN A 1 44 ? 3.707   -3.530  -14.928 1.00 0.00 ? 44 GLN A HB2  1 
ATOM   620  H  HB3  . GLN A 1 44 ? 2.488   -4.788  -14.636 1.00 0.00 ? 44 GLN A HB3  1 
ATOM   621  H  HG2  . GLN A 1 44 ? 1.168   -3.349  -13.253 1.00 0.00 ? 44 GLN A HG2  1 
ATOM   622  H  HG3  . GLN A 1 44 ? 2.413   -2.095  -13.233 1.00 0.00 ? 44 GLN A HG3  1 
ATOM   623  H  HE21 . GLN A 1 44 ? 3.134   -1.268  -15.401 1.00 0.00 ? 44 GLN A HE21 1 
ATOM   624  H  HE22 . GLN A 1 44 ? 1.901   -1.081  -16.669 1.00 0.00 ? 44 GLN A HE22 1 
ATOM   625  N  N    . ASP A 1 45 ? 5.798   -3.020  -12.888 1.00 0.00 ? 45 ASP A N    1 
ATOM   626  C  CA   . ASP A 1 45 ? 6.682   -1.895  -12.563 1.00 0.00 ? 45 ASP A CA   1 
ATOM   627  C  C    . ASP A 1 45 ? 6.571   -1.328  -11.137 1.00 0.00 ? 45 ASP A C    1 
ATOM   628  O  O    . ASP A 1 45 ? 6.441   -0.126  -10.922 1.00 0.00 ? 45 ASP A O    1 
ATOM   629  C  CB   . ASP A 1 45 ? 6.629   -0.823  -13.663 1.00 0.00 ? 45 ASP A CB   1 
ATOM   630  C  CG   . ASP A 1 45 ? 5.297   -0.096  -13.800 1.00 0.00 ? 45 ASP A CG   1 
ATOM   631  O  OD1  . ASP A 1 45 ? 4.347   -0.676  -14.374 1.00 0.00 ? 45 ASP A OD1  1 
ATOM   632  O  OD2  . ASP A 1 45 ? 5.209   1.087   -13.406 1.00 0.00 ? 45 ASP A OD2  1 
ATOM   633  H  H    . ASP A 1 45 ? 6.078   -3.581  -13.678 1.00 0.00 ? 45 ASP A H    1 
ATOM   634  H  HA   . ASP A 1 45 ? 7.692   -2.304  -12.619 1.00 0.00 ? 45 ASP A HA   1 
ATOM   635  H  HB2  . ASP A 1 45 ? 7.400   -0.086  -13.439 1.00 0.00 ? 45 ASP A HB2  1 
ATOM   636  H  HB3  . ASP A 1 45 ? 6.866   -1.288  -14.618 1.00 0.00 ? 45 ASP A HB3  1 
ATOM   637  N  N    . GLY A 1 46 ? 6.710   -2.208  -10.145 1.00 0.00 ? 46 GLY A N    1 
ATOM   638  C  CA   . GLY A 1 46 ? 6.749   -1.837  -8.732  1.00 0.00 ? 46 GLY A CA   1 
ATOM   639  C  C    . GLY A 1 46 ? 5.370   -1.496  -8.157  1.00 0.00 ? 46 GLY A C    1 
ATOM   640  O  O    . GLY A 1 46 ? 5.272   -0.861  -7.108  1.00 0.00 ? 46 GLY A O    1 
ATOM   641  H  H    . GLY A 1 46 ? 6.833   -3.172  -10.408 1.00 0.00 ? 46 GLY A H    1 
ATOM   642  H  HA2  . GLY A 1 46 ? 7.150   -2.680  -8.169  1.00 0.00 ? 46 GLY A HA2  1 
ATOM   643  H  HA3  . GLY A 1 46 ? 7.414   -0.985  -8.589  1.00 0.00 ? 46 GLY A HA3  1 
ATOM   644  N  N    . TRP A 1 47 ? 4.301   -1.946  -8.814  1.00 0.00 ? 47 TRP A N    1 
ATOM   645  C  CA   . TRP A 1 47 ? 2.925   -1.874  -8.381  1.00 0.00 ? 47 TRP A CA   1 
ATOM   646  C  C    . TRP A 1 47 ? 2.374   -3.282  -8.236  1.00 0.00 ? 47 TRP A C    1 
ATOM   647  O  O    . TRP A 1 47 ? 2.724   -4.174  -9.013  1.00 0.00 ? 47 TRP A O    1 
ATOM   648  C  CB   . TRP A 1 47 ? 2.094   -1.111  -9.409  1.00 0.00 ? 47 TRP A CB   1 
ATOM   649  C  CG   . TRP A 1 47 ? 2.524   0.287   -9.682  1.00 0.00 ? 47 TRP A CG   1 
ATOM   650  C  CD1  . TRP A 1 47 ? 3.470   0.667   -10.564 1.00 0.00 ? 47 TRP A CD1  1 
ATOM   651  C  CD2  . TRP A 1 47 ? 2.035   1.506   -9.067  1.00 0.00 ? 47 TRP A CD2  1 
ATOM   652  N  NE1  . TRP A 1 47 ? 3.657   2.029   -10.476 1.00 0.00 ? 47 TRP A NE1  1 
ATOM   653  C  CE2  . TRP A 1 47 ? 2.795   2.601   -9.564  1.00 0.00 ? 47 TRP A CE2  1 
ATOM   654  C  CE3  . TRP A 1 47 ? 0.987   1.799   -8.176  1.00 0.00 ? 47 TRP A CE3  1 
ATOM   655  C  CZ2  . TRP A 1 47 ? 2.570   3.916   -9.136  1.00 0.00 ? 47 TRP A CZ2  1 
ATOM   656  C  CZ3  . TRP A 1 47 ? 0.786   3.103   -7.697  1.00 0.00 ? 47 TRP A CZ3  1 
ATOM   657  C  CH2  . TRP A 1 47 ? 1.599   4.154   -8.151  1.00 0.00 ? 47 TRP A CH2  1 
ATOM   658  H  H    . TRP A 1 47 ? 4.423   -2.416  -9.694  1.00 0.00 ? 47 TRP A H    1 
ATOM   659  H  HA   . TRP A 1 47 ? 2.864   -1.383  -7.419  1.00 0.00 ? 47 TRP A HA   1 
ATOM   660  H  HB2  . TRP A 1 47 ? 2.046   -1.660  -10.348 1.00 0.00 ? 47 TRP A HB2  1 
ATOM   661  H  HB3  . TRP A 1 47 ? 1.095   -1.062  -9.000  1.00 0.00 ? 47 TRP A HB3  1 
ATOM   662  H  HD1  . TRP A 1 47 ? 4.016   -0.002  -11.208 1.00 0.00 ? 47 TRP A HD1  1 
ATOM   663  H  HE1  . TRP A 1 47 ? 4.354   2.500   -11.033 1.00 0.00 ? 47 TRP A HE1  1 
ATOM   664  H  HE3  . TRP A 1 47 ? 0.336   0.999   -7.867  1.00 0.00 ? 47 TRP A HE3  1 
ATOM   665  H  HZ2  . TRP A 1 47 ? 3.149   4.731   -9.529  1.00 0.00 ? 47 TRP A HZ2  1 
ATOM   666  H  HZ3  . TRP A 1 47 ? 0.027   3.297   -6.955  1.00 0.00 ? 47 TRP A HZ3  1 
ATOM   667  H  HH2  . TRP A 1 47 ? 1.488   5.135   -7.719  1.00 0.00 ? 47 TRP A HH2  1 
ATOM   668  N  N    . GLY A 1 48 ? 1.491   -3.471  -7.259  1.00 0.00 ? 48 GLY A N    1 
ATOM   669  C  CA   . GLY A 1 48 ? 0.810   -4.719  -7.017  1.00 0.00 ? 48 GLY A CA   1 
ATOM   670  C  C    . GLY A 1 48 ? -0.495  -4.496  -6.277  1.00 0.00 ? 48 GLY A C    1 
ATOM   671  O  O    . GLY A 1 48 ? -0.892  -3.364  -5.999  1.00 0.00 ? 48 GLY A O    1 
ATOM   672  H  H    . GLY A 1 48 ? 1.205   -2.687  -6.681  1.00 0.00 ? 48 GLY A H    1 
ATOM   673  H  HA2  . GLY A 1 48 ? 0.609   -5.194  -7.969  1.00 0.00 ? 48 GLY A HA2  1 
ATOM   674  H  HA3  . GLY A 1 48 ? 1.420   -5.375  -6.416  1.00 0.00 ? 48 GLY A HA3  1 
ATOM   675  N  N    . ARG A 1 49 ? -1.197  -5.594  -6.019  1.00 0.00 ? 49 ARG A N    1 
ATOM   676  C  CA   . ARG A 1 49 ? -2.530  -5.548  -5.455  1.00 0.00 ? 49 ARG A CA   1 
ATOM   677  C  C    . ARG A 1 49 ? -2.522  -5.555  -3.926  1.00 0.00 ? 49 ARG A C    1 
ATOM   678  O  O    . ARG A 1 49 ? -1.662  -6.187  -3.314  1.00 0.00 ? 49 ARG A O    1 
ATOM   679  C  CB   . ARG A 1 49 ? -3.265  -6.752  -6.015  1.00 0.00 ? 49 ARG A CB   1 
ATOM   680  C  CG   . ARG A 1 49 ? -3.370  -6.612  -7.528  1.00 0.00 ? 49 ARG A CG   1 
ATOM   681  C  CD   . ARG A 1 49 ? -4.404  -7.600  -8.018  1.00 0.00 ? 49 ARG A CD   1 
ATOM   682  N  NE   . ARG A 1 49 ? -5.747  -7.005  -7.899  1.00 0.00 ? 49 ARG A NE   1 
ATOM   683  C  CZ   . ARG A 1 49 ? -6.380  -6.325  -8.866  1.00 0.00 ? 49 ARG A CZ   1 
ATOM   684  N  NH1  . ARG A 1 49 ? -5.769  -6.043  -10.019 1.00 0.00 ? 49 ARG A NH1  1 
ATOM   685  N  NH2  . ARG A 1 49 ? -7.629  -5.906  -8.712  1.00 0.00 ? 49 ARG A NH2  1 
ATOM   686  H  H    . ARG A 1 49 ? -0.848  -6.500  -6.335  1.00 0.00 ? 49 ARG A H    1 
ATOM   687  H  HA   . ARG A 1 49 ? -3.047  -4.646  -5.787  1.00 0.00 ? 49 ARG A HA   1 
ATOM   688  H  HB2  . ARG A 1 49 ? -2.662  -7.648  -5.859  1.00 0.00 ? 49 ARG A HB2  1 
ATOM   689  H  HB3  . ARG A 1 49 ? -4.248  -6.840  -5.547  1.00 0.00 ? 49 ARG A HB3  1 
ATOM   690  H  HG2  . ARG A 1 49 ? -3.647  -5.601  -7.822  1.00 0.00 ? 49 ARG A HG2  1 
ATOM   691  H  HG3  . ARG A 1 49 ? -2.409  -6.880  -7.951  1.00 0.00 ? 49 ARG A HG3  1 
ATOM   692  H  HD2  . ARG A 1 49 ? -4.161  -7.890  -9.037  1.00 0.00 ? 49 ARG A HD2  1 
ATOM   693  H  HD3  . ARG A 1 49 ? -4.303  -8.487  -7.393  1.00 0.00 ? 49 ARG A HD3  1 
ATOM   694  H  HE   . ARG A 1 49 ? -6.143  -6.904  -6.960  1.00 0.00 ? 49 ARG A HE   1 
ATOM   695  H  HH11 . ARG A 1 49 ? -4.798  -6.261  -10.159 1.00 0.00 ? 49 ARG A HH11 1 
ATOM   696  H  HH12 . ARG A 1 49 ? -6.299  -5.480  -10.693 1.00 0.00 ? 49 ARG A HH12 1 
ATOM   697  H  HH21 . ARG A 1 49 ? -8.135  -6.022  -7.828  1.00 0.00 ? 49 ARG A HH21 1 
ATOM   698  H  HH22 . ARG A 1 49 ? -8.039  -5.348  -9.458  1.00 0.00 ? 49 ARG A HH22 1 
ATOM   699  N  N    . CYS A 1 50 ? -3.516  -4.883  -3.334  1.00 0.00 ? 50 CYS A N    1 
ATOM   700  C  CA   . CYS A 1 50 ? -3.789  -4.844  -1.905  1.00 0.00 ? 50 CYS A CA   1 
ATOM   701  C  C    . CYS A 1 50 ? -5.168  -5.467  -1.669  1.00 0.00 ? 50 CYS A C    1 
ATOM   702  O  O    . CYS A 1 50 ? -6.186  -4.933  -2.108  1.00 0.00 ? 50 CYS A O    1 
ATOM   703  C  CB   . CYS A 1 50 ? -3.743  -3.417  -1.435  1.00 0.00 ? 50 CYS A CB   1 
ATOM   704  S  SG   . CYS A 1 50 ? -4.319  -3.384  0.267   1.00 0.00 ? 50 CYS A SG   1 
ATOM   705  H  H    . CYS A 1 50 ? -4.202  -4.423  -3.915  1.00 0.00 ? 50 CYS A H    1 
ATOM   706  H  HA   . CYS A 1 50 ? -3.034  -5.406  -1.352  1.00 0.00 ? 50 CYS A HA   1 
ATOM   707  H  HB2  . CYS A 1 50 ? -2.720  -3.055  -1.473  1.00 0.00 ? 50 CYS A HB2  1 
ATOM   708  H  HB3  . CYS A 1 50 ? -4.382  -2.780  -2.048  1.00 0.00 ? 50 CYS A HB3  1 
ATOM   709  N  N    . THR A 1 51 ? -5.211  -6.630  -1.020  1.00 0.00 ? 51 THR A N    1 
ATOM   710  C  CA   . THR A 1 51 ? -6.364  -7.523  -1.052  1.00 0.00 ? 51 THR A CA   1 
ATOM   711  C  C    . THR A 1 51 ? -7.452  -7.115  -0.052  1.00 0.00 ? 51 THR A C    1 
ATOM   712  O  O    . THR A 1 51 ? -7.901  -7.931  0.755   1.00 0.00 ? 51 THR A O    1 
ATOM   713  C  CB   . THR A 1 51 ? -5.892  -8.973  -0.850  1.00 0.00 ? 51 THR A CB   1 
ATOM   714  O  OG1  . THR A 1 51 ? -5.181  -9.122  0.364   1.00 0.00 ? 51 THR A OG1  1 
ATOM   715  C  CG2  . THR A 1 51 ? -4.990  -9.414  -2.006  1.00 0.00 ? 51 THR A CG2  1 
ATOM   716  H  H    . THR A 1 51 ? -4.357  -6.957  -0.584  1.00 0.00 ? 51 THR A H    1 
ATOM   717  H  HA   . THR A 1 51 ? -6.815  -7.469  -2.045  1.00 0.00 ? 51 THR A HA   1 
ATOM   718  H  HB   . THR A 1 51 ? -6.762  -9.632  -0.828  1.00 0.00 ? 51 THR A HB   1 
ATOM   719  H  HG1  . THR A 1 51 ? -4.352  -8.631  0.312   1.00 0.00 ? 51 THR A HG1  1 
ATOM   720  H  HG21 . THR A 1 51 ? -5.536  -9.353  -2.948  1.00 0.00 ? 51 THR A HG21 1 
ATOM   721  H  HG22 . THR A 1 51 ? -4.110  -8.776  -2.064  1.00 0.00 ? 51 THR A HG22 1 
ATOM   722  H  HG23 . THR A 1 51 ? -4.671  -10.445 -1.846  1.00 0.00 ? 51 THR A HG23 1 
ATOM   723  N  N    . HIS A 1 52 ? -7.915  -5.863  -0.094  1.00 0.00 ? 52 HIS A N    1 
ATOM   724  C  CA   . HIS A 1 52 ? -9.056  -5.388  0.688   1.00 0.00 ? 52 HIS A CA   1 
ATOM   725  C  C    . HIS A 1 52 ? -10.007 -4.616  -0.235  1.00 0.00 ? 52 HIS A C    1 
ATOM   726  O  O    . HIS A 1 52 ? -9.512  -3.919  -1.117  1.00 0.00 ? 52 HIS A O    1 
ATOM   727  C  CB   . HIS A 1 52 ? -8.578  -4.528  1.869   1.00 0.00 ? 52 HIS A CB   1 
ATOM   728  C  CG   . HIS A 1 52 ? -8.070  -5.324  3.052   1.00 0.00 ? 52 HIS A CG   1 
ATOM   729  N  ND1  . HIS A 1 52 ? -8.017  -6.703  3.151   1.00 0.00 ? 52 HIS A ND1  1 
ATOM   730  C  CD2  . HIS A 1 52 ? -7.622  -4.807  4.237   1.00 0.00 ? 52 HIS A CD2  1 
ATOM   731  C  CE1  . HIS A 1 52 ? -7.551  -7.016  4.370   1.00 0.00 ? 52 HIS A CE1  1 
ATOM   732  N  NE2  . HIS A 1 52 ? -7.293  -5.879  5.043   1.00 0.00 ? 52 HIS A NE2  1 
ATOM   733  H  H    . HIS A 1 52 ? -7.541  -5.245  -0.814  1.00 0.00 ? 52 HIS A H    1 
ATOM   734  H  HA   . HIS A 1 52 ? -9.588  -6.247  1.084   1.00 0.00 ? 52 HIS A HA   1 
ATOM   735  H  HB2  . HIS A 1 52 ? -7.792  -3.852  1.528   1.00 0.00 ? 52 HIS A HB2  1 
ATOM   736  H  HB3  . HIS A 1 52 ? -9.416  -3.922  2.218   1.00 0.00 ? 52 HIS A HB3  1 
ATOM   737  H  HD1  . HIS A 1 52 ? -8.221  -7.363  2.405   1.00 0.00 ? 52 HIS A HD1  1 
ATOM   738  H  HD2  . HIS A 1 52 ? -7.539  -3.763  4.493   1.00 0.00 ? 52 HIS A HD2  1 
ATOM   739  H  HE1  . HIS A 1 52 ? -7.361  -8.018  4.728   1.00 0.00 ? 52 HIS A HE1  1 
ATOM   740  H  HE2  . HIS A 1 52 ? -6.845  -5.828  5.951   1.00 0.00 ? 52 HIS A HE2  1 
ATOM   741  N  N    . PRO A 1 53 ? -11.341 -4.739  -0.064  1.00 0.00 ? 53 PRO A N    1 
ATOM   742  C  CA   . PRO A 1 53 ? -12.328 -4.127  -0.946  1.00 0.00 ? 53 PRO A CA   1 
ATOM   743  C  C    . PRO A 1 53 ? -12.047 -2.656  -1.241  1.00 0.00 ? 53 PRO A C    1 
ATOM   744  O  O    . PRO A 1 53 ? -11.819 -2.303  -2.393  1.00 0.00 ? 53 PRO A O    1 
ATOM   745  C  CB   . PRO A 1 53 ? -13.690 -4.331  -0.275  1.00 0.00 ? 53 PRO A CB   1 
ATOM   746  C  CG   . PRO A 1 53 ? -13.486 -5.635  0.488   1.00 0.00 ? 53 PRO A CG   1 
ATOM   747  C  CD   . PRO A 1 53 ? -12.027 -5.552  0.937   1.00 0.00 ? 53 PRO A CD   1 
ATOM   748  H  HA   . PRO A 1 53 ? -12.318 -4.682  -1.886  1.00 0.00 ? 53 PRO A HA   1 
ATOM   749  H  HB2  . PRO A 1 53 ? -13.900 -3.534  0.439   1.00 0.00 ? 53 PRO A HB2  1 
ATOM   750  H  HB3  . PRO A 1 53 ? -14.498 -4.399  -1.004  1.00 0.00 ? 53 PRO A HB3  1 
ATOM   751  H  HG2  . PRO A 1 53 ? -14.177 -5.738  1.326   1.00 0.00 ? 53 PRO A HG2  1 
ATOM   752  H  HG3  . PRO A 1 53 ? -13.607 -6.473  -0.202  1.00 0.00 ? 53 PRO A HG3  1 
ATOM   753  H  HD2  . PRO A 1 53 ? -11.965 -5.059  1.908   1.00 0.00 ? 53 PRO A HD2  1 
ATOM   754  H  HD3  . PRO A 1 53 ? -11.652 -6.573  1.003   1.00 0.00 ? 53 PRO A HD3  1 
ATOM   755  N  N    . ASP A 1 54 ? -12.014 -1.809  -0.206  1.00 0.00 ? 54 ASP A N    1 
ATOM   756  C  CA   . ASP A 1 54 ? -11.733 -0.376  -0.308  1.00 0.00 ? 54 ASP A CA   1 
ATOM   757  C  C    . ASP A 1 54 ? -10.235 -0.119  -0.516  1.00 0.00 ? 54 ASP A C    1 
ATOM   758  O  O    . ASP A 1 54 ? -9.637  0.734   0.146   1.00 0.00 ? 54 ASP A O    1 
ATOM   759  C  CB   . ASP A 1 54 ? -12.274 0.354   0.937   1.00 0.00 ? 54 ASP A CB   1 
ATOM   760  C  CG   . ASP A 1 54 ? -11.768 -0.216  2.255   1.00 0.00 ? 54 ASP A CG   1 
ATOM   761  O  OD1  . ASP A 1 54 ? -10.650 -0.781  2.257   1.00 0.00 ? 54 ASP A OD1  1 
ATOM   762  O  OD2  . ASP A 1 54 ? -12.443 0.004   3.279   1.00 0.00 ? 54 ASP A OD2  1 
ATOM   763  H  H    . ASP A 1 54 ? -12.116 -2.183  0.726   1.00 0.00 ? 54 ASP A H    1 
ATOM   764  H  HA   . ASP A 1 54 ? -12.256 0.027   -1.177  1.00 0.00 ? 54 ASP A HA   1 
ATOM   765  H  HB2  . ASP A 1 54 ? -11.980 1.410   0.885   1.00 0.00 ? 54 ASP A HB2  1 
ATOM   766  H  HB3  . ASP A 1 54 ? -13.362 0.299   0.934   1.00 0.00 ? 54 ASP A HB3  1 
ATOM   767  N  N    . PHE A 1 55 ? -9.625  -0.870  -1.434  1.00 0.00 ? 55 PHE A N    1 
ATOM   768  C  CA   . PHE A 1 55 ? -8.211  -0.790  -1.735  1.00 0.00 ? 55 PHE A CA   1 
ATOM   769  C  C    . PHE A 1 55 ? -7.938  -1.369  -3.119  1.00 0.00 ? 55 PHE A C    1 
ATOM   770  O  O    . PHE A 1 55 ? -7.451  -0.652  -3.991  1.00 0.00 ? 55 PHE A O    1 
ATOM   771  C  CB   . PHE A 1 55 ? -7.380  -1.475  -0.631  1.00 0.00 ? 55 PHE A CB   1 
ATOM   772  C  CG   . PHE A 1 55 ? -6.447  -0.510  0.061   1.00 0.00 ? 55 PHE A CG   1 
ATOM   773  C  CD1  . PHE A 1 55 ? -5.615  0.292   -0.744  1.00 0.00 ? 55 PHE A CD1  1 
ATOM   774  C  CD2  . PHE A 1 55 ? -6.499  -0.294  1.456   1.00 0.00 ? 55 PHE A CD2  1 
ATOM   775  C  CE1  . PHE A 1 55 ? -5.006  1.433   -0.206  1.00 0.00 ? 55 PHE A CE1  1 
ATOM   776  C  CE2  . PHE A 1 55 ? -5.781  0.776   2.004   1.00 0.00 ? 55 PHE A CE2  1 
ATOM   777  C  CZ   . PHE A 1 55 ? -5.126  1.690   1.166   1.00 0.00 ? 55 PHE A CZ   1 
ATOM   778  H  H    . PHE A 1 55 ? -10.193 -1.516  -1.968  1.00 0.00 ? 55 PHE A H    1 
ATOM   779  H  HA   . PHE A 1 55 ? -7.973  0.274   -1.787  1.00 0.00 ? 55 PHE A HA   1 
ATOM   780  H  HB2  . PHE A 1 55 ? -8.043  -1.928  0.104   1.00 0.00 ? 55 PHE A HB2  1 
ATOM   781  H  HB3  . PHE A 1 55 ? -6.771  -2.273  -1.062  1.00 0.00 ? 55 PHE A HB3  1 
ATOM   782  H  HD1  . PHE A 1 55 ? -5.499  0.073   -1.796  1.00 0.00 ? 55 PHE A HD1  1 
ATOM   783  H  HD2  . PHE A 1 55 ? -7.091  -0.893  2.140   1.00 0.00 ? 55 PHE A HD2  1 
ATOM   784  H  HE1  . PHE A 1 55 ? -4.382  2.060   -0.826  1.00 0.00 ? 55 PHE A HE1  1 
ATOM   785  H  HE2  . PHE A 1 55 ? -5.789  0.940   3.069   1.00 0.00 ? 55 PHE A HE2  1 
ATOM   786  H  HZ   . PHE A 1 55 ? -4.643  2.546   1.592   1.00 0.00 ? 55 PHE A HZ   1 
ATOM   787  N  N    . ASP A 1 56 ? -8.297  -2.642  -3.327  1.00 0.00 ? 56 ASP A N    1 
ATOM   788  C  CA   . ASP A 1 56 ? -8.089  -3.361  -4.583  1.00 0.00 ? 56 ASP A CA   1 
ATOM   789  C  C    . ASP A 1 56 ? -8.706  -2.621  -5.781  1.00 0.00 ? 56 ASP A C    1 
ATOM   790  O  O    . ASP A 1 56 ? -8.263  -2.813  -6.910  1.00 0.00 ? 56 ASP A O    1 
ATOM   791  C  CB   . ASP A 1 56 ? -8.611  -4.800  -4.455  1.00 0.00 ? 56 ASP A CB   1 
ATOM   792  C  CG   . ASP A 1 56 ? -8.187  -5.669  -5.631  1.00 0.00 ? 56 ASP A CG   1 
ATOM   793  O  OD1  . ASP A 1 56 ? -6.996  -6.045  -5.728  1.00 0.00 ? 56 ASP A OD1  1 
ATOM   794  O  OD2  . ASP A 1 56 ? -9.060  -5.970  -6.473  1.00 0.00 ? 56 ASP A OD2  1 
ATOM   795  H  H    . ASP A 1 56 ? -8.698  -3.160  -2.554  1.00 0.00 ? 56 ASP A H    1 
ATOM   796  H  HA   . ASP A 1 56 ? -7.011  -3.414  -4.748  1.00 0.00 ? 56 ASP A HA   1 
ATOM   797  H  HB2  . ASP A 1 56 ? -8.220  -5.260  -3.550  1.00 0.00 ? 56 ASP A HB2  1 
ATOM   798  H  HB3  . ASP A 1 56 ? -9.700  -4.788  -4.397  1.00 0.00 ? 56 ASP A HB3  1 
ATOM   799  N  N    . GLU A 1 57 ? -9.681  -1.734  -5.518  1.00 0.00 ? 57 GLU A N    1 
ATOM   800  C  CA   . GLU A 1 57 ? -10.138 -0.659  -6.400  1.00 0.00 ? 57 GLU A CA   1 
ATOM   801  C  C    . GLU A 1 57 ? -9.029  -0.140  -7.321  1.00 0.00 ? 57 GLU A C    1 
ATOM   802  O  O    . GLU A 1 57 ? -9.240  0.048   -8.517  1.00 0.00 ? 57 GLU A O    1 
ATOM   803  C  CB   . GLU A 1 57 ? -10.599 0.547   -5.561  1.00 0.00 ? 57 GLU A CB   1 
ATOM   804  C  CG   . GLU A 1 57 ? -11.679 0.264   -4.515  1.00 0.00 ? 57 GLU A CG   1 
ATOM   805  C  CD   . GLU A 1 57 ? -12.077 1.543   -3.792  1.00 0.00 ? 57 GLU A CD   1 
ATOM   806  O  OE1  . GLU A 1 57 ? -11.141 2.259   -3.367  1.00 0.00 ? 57 GLU A OE1  1 
ATOM   807  O  OE2  . GLU A 1 57 ? -13.292 1.806   -3.698  1.00 0.00 ? 57 GLU A OE2  1 
ATOM   808  H  H    . GLU A 1 57 ? -10.042 -1.723  -4.578  1.00 0.00 ? 57 GLU A H    1 
ATOM   809  H  HA   . GLU A 1 57 ? -10.970 -1.027  -7.001  1.00 0.00 ? 57 GLU A HA   1 
ATOM   810  H  HB2  . GLU A 1 57 ? -9.739  0.966   -5.035  1.00 0.00 ? 57 GLU A HB2  1 
ATOM   811  H  HB3  . GLU A 1 57 ? -10.984 1.309   -6.241  1.00 0.00 ? 57 GLU A HB3  1 
ATOM   812  H  HG2  . GLU A 1 57 ? -12.557 -0.182  -4.982  1.00 0.00 ? 57 GLU A HG2  1 
ATOM   813  H  HG3  . GLU A 1 57 ? -11.289 -0.410  -3.762  1.00 0.00 ? 57 GLU A HG3  1 
ATOM   814  N  N    . VAL A 1 58 ? -7.877  0.174   -6.723  1.00 0.00 ? 58 VAL A N    1 
ATOM   815  C  CA   . VAL A 1 58 ? -6.711  0.712   -7.395  1.00 0.00 ? 58 VAL A CA   1 
ATOM   816  C  C    . VAL A 1 58 ? -5.538  -0.227  -7.148  1.00 0.00 ? 58 VAL A C    1 
ATOM   817  O  O    . VAL A 1 58 ? -5.498  -0.953  -6.157  1.00 0.00 ? 58 VAL A O    1 
ATOM   818  C  CB   . VAL A 1 58 ? -6.400  2.130   -6.890  1.00 0.00 ? 58 VAL A CB   1 
ATOM   819  C  CG1  . VAL A 1 58 ? -7.385  3.142   -7.481  1.00 0.00 ? 58 VAL A CG1  1 
ATOM   820  C  CG2  . VAL A 1 58 ? -6.401  2.228   -5.358  1.00 0.00 ? 58 VAL A CG2  1 
ATOM   821  H  H    . VAL A 1 58 ? -7.748  -0.097  -5.751  1.00 0.00 ? 58 VAL A H    1 
ATOM   822  H  HA   . VAL A 1 58 ? -6.877  0.757   -8.472  1.00 0.00 ? 58 VAL A HA   1 
ATOM   823  H  HB   . VAL A 1 58 ? -5.407  2.396   -7.252  1.00 0.00 ? 58 VAL A HB   1 
ATOM   824  H  HG11 . VAL A 1 58 ? -7.328  3.110   -8.567  1.00 0.00 ? 58 VAL A HG11 1 
ATOM   825  H  HG12 . VAL A 1 58 ? -8.402  2.910   -7.168  1.00 0.00 ? 58 VAL A HG12 1 
ATOM   826  H  HG13 . VAL A 1 58 ? -7.120  4.148   -7.157  1.00 0.00 ? 58 VAL A HG13 1 
ATOM   827  H  HG21 . VAL A 1 58 ? -5.719  1.493   -4.930  1.00 0.00 ? 58 VAL A HG21 1 
ATOM   828  H  HG22 . VAL A 1 58 ? -6.073  3.222   -5.060  1.00 0.00 ? 58 VAL A HG22 1 
ATOM   829  H  HG23 . VAL A 1 58 ? -7.401  2.056   -4.961  1.00 0.00 ? 58 VAL A HG23 1 
ATOM   830  N  N    . LEU A 1 59 ? -4.565  -0.201  -8.052  1.00 0.00 ? 59 LEU A N    1 
ATOM   831  C  CA   . LEU A 1 59 ? -3.344  -0.955  -7.906  1.00 0.00 ? 59 LEU A CA   1 
ATOM   832  C  C    . LEU A 1 59 ? -2.396  -0.112  -7.057  1.00 0.00 ? 59 LEU A C    1 
ATOM   833  O  O    . LEU A 1 59 ? -2.178  1.053   -7.381  1.00 0.00 ? 59 LEU A O    1 
ATOM   834  C  CB   . LEU A 1 59 ? -2.811  -1.209  -9.316  1.00 0.00 ? 59 LEU A CB   1 
ATOM   835  C  CG   . LEU A 1 59 ? -1.656  -2.204  -9.334  1.00 0.00 ? 59 LEU A CG   1 
ATOM   836  C  CD1  . LEU A 1 59 ? -2.121  -3.610  -8.971  1.00 0.00 ? 59 LEU A CD1  1 
ATOM   837  C  CD2  . LEU A 1 59 ? -1.087  -2.251  -10.749 1.00 0.00 ? 59 LEU A CD2  1 
ATOM   838  H  H    . LEU A 1 59 ? -4.598  0.473   -8.809  1.00 0.00 ? 59 LEU A H    1 
ATOM   839  H  HA   . LEU A 1 59 ? -3.573  -1.890  -7.401  1.00 0.00 ? 59 LEU A HA   1 
ATOM   840  H  HB2  . LEU A 1 59 ? -3.615  -1.602  -9.939  1.00 0.00 ? 59 LEU A HB2  1 
ATOM   841  H  HB3  . LEU A 1 59 ? -2.478  -0.260  -9.742  1.00 0.00 ? 59 LEU A HB3  1 
ATOM   842  H  HG   . LEU A 1 59 ? -0.890  -1.890  -8.628  1.00 0.00 ? 59 LEU A HG   1 
ATOM   843  H  HD11 . LEU A 1 59 ? -2.553  -3.636  -7.977  1.00 0.00 ? 59 LEU A HD11 1 
ATOM   844  H  HD12 . LEU A 1 59 ? -2.857  -3.968  -9.692  1.00 0.00 ? 59 LEU A HD12 1 
ATOM   845  H  HD13 . LEU A 1 59 ? -1.249  -4.253  -8.978  1.00 0.00 ? 59 LEU A HD13 1 
ATOM   846  H  HD21 . LEU A 1 59 ? -0.755  -1.252  -11.042 1.00 0.00 ? 59 LEU A HD21 1 
ATOM   847  H  HD22 . LEU A 1 59 ? -0.254  -2.951  -10.774 1.00 0.00 ? 59 LEU A HD22 1 
ATOM   848  H  HD23 . LEU A 1 59 ? -1.861  -2.598  -11.436 1.00 0.00 ? 59 LEU A HD23 1 
ATOM   849  N  N    . VAL A 1 60 ? -1.858  -0.652  -5.963  1.00 0.00 ? 60 VAL A N    1 
ATOM   850  C  CA   . VAL A 1 60 ? -1.029  0.128   -5.054  1.00 0.00 ? 60 VAL A CA   1 
ATOM   851  C  C    . VAL A 1 60 ? 0.437   -0.048  -5.435  1.00 0.00 ? 60 VAL A C    1 
ATOM   852  O  O    . VAL A 1 60 ? 0.826   -1.079  -5.980  1.00 0.00 ? 60 VAL A O    1 
ATOM   853  C  CB   . VAL A 1 60 ? -1.296  -0.257  -3.592  1.00 0.00 ? 60 VAL A CB   1 
ATOM   854  C  CG1  . VAL A 1 60 ? -2.721  0.125   -3.174  1.00 0.00 ? 60 VAL A CG1  1 
ATOM   855  C  CG2  . VAL A 1 60 ? -1.054  -1.741  -3.315  1.00 0.00 ? 60 VAL A CG2  1 
ATOM   856  H  H    . VAL A 1 60 ? -1.897  -1.657  -5.815  1.00 0.00 ? 60 VAL A H    1 
ATOM   857  H  HA   . VAL A 1 60 ? -1.268  1.189   -5.144  1.00 0.00 ? 60 VAL A HA   1 
ATOM   858  H  HB   . VAL A 1 60 ? -0.597  0.304   -2.974  1.00 0.00 ? 60 VAL A HB   1 
ATOM   859  H  HG11 . VAL A 1 60 ? -2.876  1.195   -3.313  1.00 0.00 ? 60 VAL A HG11 1 
ATOM   860  H  HG12 . VAL A 1 60 ? -3.455  -0.424  -3.766  1.00 0.00 ? 60 VAL A HG12 1 
ATOM   861  H  HG13 . VAL A 1 60 ? -2.866  -0.116  -2.121  1.00 0.00 ? 60 VAL A HG13 1 
ATOM   862  H  HG21 . VAL A 1 60 ? -0.114  -2.048  -3.760  1.00 0.00 ? 60 VAL A HG21 1 
ATOM   863  H  HG22 . VAL A 1 60 ? -0.988  -1.894  -2.238  1.00 0.00 ? 60 VAL A HG22 1 
ATOM   864  H  HG23 . VAL A 1 60 ? -1.862  -2.349  -3.722  1.00 0.00 ? 60 VAL A HG23 1 
ATOM   865  N  N    . LYS A 1 61 ? 1.267   0.960   -5.187  1.00 0.00 ? 61 LYS A N    1 
ATOM   866  C  CA   . LYS A 1 61 ? 2.698   0.807   -5.337  1.00 0.00 ? 61 LYS A CA   1 
ATOM   867  C  C    . LYS A 1 61 ? 3.162   -0.171  -4.270  1.00 0.00 ? 61 LYS A C    1 
ATOM   868  O  O    . LYS A 1 61 ? 2.804   -0.024  -3.106  1.00 0.00 ? 61 LYS A O    1 
ATOM   869  C  CB   . LYS A 1 61 ? 3.370   2.175   -5.202  1.00 0.00 ? 61 LYS A CB   1 
ATOM   870  C  CG   . LYS A 1 61 ? 4.689   2.272   -5.980  1.00 0.00 ? 61 LYS A CG   1 
ATOM   871  C  CD   . LYS A 1 61 ? 4.897   3.731   -6.414  1.00 0.00 ? 61 LYS A CD   1 
ATOM   872  C  CE   . LYS A 1 61 ? 6.047   3.884   -7.415  1.00 0.00 ? 61 LYS A CE   1 
ATOM   873  N  NZ   . LYS A 1 61 ? 7.352   3.513   -6.827  1.00 0.00 ? 61 LYS A NZ   1 
ATOM   874  H  H    . LYS A 1 61 ? 0.918   1.817   -4.775  1.00 0.00 ? 61 LYS A H    1 
ATOM   875  H  HA   . LYS A 1 61 ? 2.895   0.407   -6.331  1.00 0.00 ? 61 LYS A HA   1 
ATOM   876  H  HB2  . LYS A 1 61 ? 2.676   2.888   -5.625  1.00 0.00 ? 61 LYS A HB2  1 
ATOM   877  H  HB3  . LYS A 1 61 ? 3.519   2.438   -4.154  1.00 0.00 ? 61 LYS A HB3  1 
ATOM   878  H  HG2  . LYS A 1 61 ? 5.507   1.918   -5.353  1.00 0.00 ? 61 LYS A HG2  1 
ATOM   879  H  HG3  . LYS A 1 61 ? 4.641   1.645   -6.870  1.00 0.00 ? 61 LYS A HG3  1 
ATOM   880  H  HD2  . LYS A 1 61 ? 3.990   4.084   -6.904  1.00 0.00 ? 61 LYS A HD2  1 
ATOM   881  H  HD3  . LYS A 1 61 ? 5.046   4.362   -5.539  1.00 0.00 ? 61 LYS A HD3  1 
ATOM   882  H  HE2  . LYS A 1 61 ? 5.834   3.266   -8.291  1.00 0.00 ? 61 LYS A HE2  1 
ATOM   883  H  HE3  . LYS A 1 61 ? 6.078   4.925   -7.743  1.00 0.00 ? 61 LYS A HE3  1 
ATOM   884  H  HZ1  . LYS A 1 61 ? 7.547   4.044   -5.991  1.00 0.00 ? 61 LYS A HZ1  1 
ATOM   885  H  HZ2  . LYS A 1 61 ? 7.381   2.528   -6.560  1.00 0.00 ? 61 LYS A HZ2  1 
ATOM   886  H  HZ3  . LYS A 1 61 ? 8.108   3.644   -7.480  1.00 0.00 ? 61 LYS A HZ3  1 
ATOM   887  N  N    . ALA A 1 62 ? 3.974   -1.151  -4.653  1.00 0.00 ? 62 ALA A N    1 
ATOM   888  C  CA   . ALA A 1 62 ? 4.568   -2.091  -3.710  1.00 0.00 ? 62 ALA A CA   1 
ATOM   889  C  C    . ALA A 1 62 ? 5.371   -1.340  -2.644  1.00 0.00 ? 62 ALA A C    1 
ATOM   890  O  O    . ALA A 1 62 ? 5.403   -1.743  -1.483  1.00 0.00 ? 62 ALA A O    1 
ATOM   891  C  CB   . ALA A 1 62 ? 5.427   -3.096  -4.473  1.00 0.00 ? 62 ALA A CB   1 
ATOM   892  H  H    . ALA A 1 62 ? 4.263   -1.163  -5.625  1.00 0.00 ? 62 ALA A H    1 
ATOM   893  H  HA   . ALA A 1 62 ? 3.783   -2.647  -3.198  1.00 0.00 ? 62 ALA A HA   1 
ATOM   894  H  HB1  . ALA A 1 62 ? 4.857   -3.511  -5.302  1.00 0.00 ? 62 ALA A HB1  1 
ATOM   895  H  HB2  . ALA A 1 62 ? 6.326   -2.613  -4.856  1.00 0.00 ? 62 ALA A HB2  1 
ATOM   896  H  HB3  . ALA A 1 62 ? 5.698   -3.908  -3.802  1.00 0.00 ? 62 ALA A HB3  1 
ATOM   897  N  N    . GLU A 1 63 ? 5.987   -0.224  -3.050  1.00 0.00 ? 63 GLU A N    1 
ATOM   898  C  CA   . GLU A 1 63 ? 6.733   0.662   -2.170  1.00 0.00 ? 63 GLU A CA   1 
ATOM   899  C  C    . GLU A 1 63 ? 5.836   1.658   -1.426  1.00 0.00 ? 63 GLU A C    1 
ATOM   900  O  O    . GLU A 1 63 ? 6.359   2.510   -0.711  1.00 0.00 ? 63 GLU A O    1 
ATOM   901  C  CB   . GLU A 1 63 ? 7.767   1.434   -2.988  1.00 0.00 ? 63 GLU A CB   1 
ATOM   902  C  CG   . GLU A 1 63 ? 8.738   0.526   -3.753  1.00 0.00 ? 63 GLU A CG   1 
ATOM   903  C  CD   . GLU A 1 63 ? 9.088   1.159   -5.089  1.00 0.00 ? 63 GLU A CD   1 
ATOM   904  O  OE1  . GLU A 1 63 ? 8.154   1.241   -5.921  1.00 0.00 ? 63 GLU A OE1  1 
ATOM   905  O  OE2  . GLU A 1 63 ? 10.229  1.634   -5.250  1.00 0.00 ? 63 GLU A OE2  1 
ATOM   906  H  H    . GLU A 1 63 ? 5.958   0.012   -4.033  1.00 0.00 ? 63 GLU A H    1 
ATOM   907  H  HA   . GLU A 1 63 ? 7.269   0.063   -1.442  1.00 0.00 ? 63 GLU A HA   1 
ATOM   908  H  HB2  . GLU A 1 63 ? 7.222   2.074   -3.678  1.00 0.00 ? 63 GLU A HB2  1 
ATOM   909  H  HB3  . GLU A 1 63 ? 8.349   2.081   -2.329  1.00 0.00 ? 63 GLU A HB3  1 
ATOM   910  H  HG2  . GLU A 1 63 ? 9.623   0.371   -3.129  1.00 0.00 ? 63 GLU A HG2  1 
ATOM   911  H  HG3  . GLU A 1 63 ? 8.304   -0.449  -3.970  1.00 0.00 ? 63 GLU A HG3  1 
ATOM   912  N  N    . GLY A 1 64 ? 4.516   1.604   -1.617  1.00 0.00 ? 64 GLY A N    1 
ATOM   913  C  CA   . GLY A 1 64 ? 3.578   2.467   -0.922  1.00 0.00 ? 64 GLY A CA   1 
ATOM   914  C  C    . GLY A 1 64 ? 3.305   1.945   0.483   1.00 0.00 ? 64 GLY A C    1 
ATOM   915  O  O    . GLY A 1 64 ? 3.950   1.001   0.941   1.00 0.00 ? 64 GLY A O    1 
ATOM   916  H  H    . GLY A 1 64 ? 4.112   0.878   -2.195  1.00 0.00 ? 64 GLY A H    1 
ATOM   917  H  HA2  . GLY A 1 64 ? 3.976   3.477   -0.844  1.00 0.00 ? 64 GLY A HA2  1 
ATOM   918  H  HA3  . GLY A 1 64 ? 2.645   2.490   -1.486  1.00 0.00 ? 64 GLY A HA3  1 
ATOM   919  N  N    . TRP A 1 65 ? 2.353   2.571   1.173   1.00 0.00 ? 65 TRP A N    1 
ATOM   920  C  CA   . TRP A 1 65 ? 1.900   2.149   2.490   1.00 0.00 ? 65 TRP A CA   1 
ATOM   921  C  C    . TRP A 1 65 ? 0.532   2.764   2.742   1.00 0.00 ? 65 TRP A C    1 
ATOM   922  O  O    . TRP A 1 65 ? 0.205   3.758   2.094   1.00 0.00 ? 65 TRP A O    1 
ATOM   923  C  CB   . TRP A 1 65 ? 2.890   2.629   3.554   1.00 0.00 ? 65 TRP A CB   1 
ATOM   924  C  CG   . TRP A 1 65 ? 2.531   2.292   4.967   1.00 0.00 ? 65 TRP A CG   1 
ATOM   925  C  CD1  . TRP A 1 65 ? 2.900   1.163   5.607   1.00 0.00 ? 65 TRP A CD1  1 
ATOM   926  C  CD2  . TRP A 1 65 ? 1.736   3.059   5.926   1.00 0.00 ? 65 TRP A CD2  1 
ATOM   927  N  NE1  . TRP A 1 65 ? 2.464   1.210   6.913   1.00 0.00 ? 65 TRP A NE1  1 
ATOM   928  C  CE2  . TRP A 1 65 ? 1.756   2.364   7.170   1.00 0.00 ? 65 TRP A CE2  1 
ATOM   929  C  CE3  . TRP A 1 65 ? 1.027   4.284   5.888   1.00 0.00 ? 65 TRP A CE3  1 
ATOM   930  C  CZ2  . TRP A 1 65 ? 1.141   2.871   8.321   1.00 0.00 ? 65 TRP A CZ2  1 
ATOM   931  C  CZ3  . TRP A 1 65 ? 0.329   4.757   7.016   1.00 0.00 ? 65 TRP A CZ3  1 
ATOM   932  C  CH2  . TRP A 1 65 ? 0.413   4.067   8.238   1.00 0.00 ? 65 TRP A CH2  1 
ATOM   933  H  H    . TRP A 1 65 ? 1.866   3.356   0.742   1.00 0.00 ? 65 TRP A H    1 
ATOM   934  H  HA   . TRP A 1 65 ? 1.821   1.060   2.522   1.00 0.00 ? 65 TRP A HA   1 
ATOM   935  H  HB2  . TRP A 1 65 ? 3.868   2.198   3.340   1.00 0.00 ? 65 TRP A HB2  1 
ATOM   936  H  HB3  . TRP A 1 65 ? 2.977   3.714   3.485   1.00 0.00 ? 65 TRP A HB3  1 
ATOM   937  H  HD1  . TRP A 1 65 ? 3.482   0.368   5.165   1.00 0.00 ? 65 TRP A HD1  1 
ATOM   938  H  HE1  . TRP A 1 65 ? 2.639   0.468   7.577   1.00 0.00 ? 65 TRP A HE1  1 
ATOM   939  H  HE3  . TRP A 1 65 ? 0.987   4.845   4.965   1.00 0.00 ? 65 TRP A HE3  1 
ATOM   940  H  HZ2  . TRP A 1 65 ? 1.231   2.341   9.254   1.00 0.00 ? 65 TRP A HZ2  1 
ATOM   941  H  HZ3  . TRP A 1 65 ? -0.307  5.631   6.935   1.00 0.00 ? 65 TRP A HZ3  1 
ATOM   942  H  HH2  . TRP A 1 65 ? -0.120  4.420   9.103   1.00 0.00 ? 65 TRP A HH2  1 
ATOM   943  N  N    . CYS A 1 66 ? -0.233  2.213   3.694   1.00 0.00 ? 66 CYS A N    1 
ATOM   944  C  CA   . CYS A 1 66 ? -1.488  2.787   4.150   1.00 0.00 ? 66 CYS A CA   1 
ATOM   945  C  C    . CYS A 1 66 ? -1.746  2.527   5.638   1.00 0.00 ? 66 CYS A C    1 
ATOM   946  O  O    . CYS A 1 66 ? -1.092  1.697   6.270   1.00 0.00 ? 66 CYS A O    1 
ATOM   947  C  CB   . CYS A 1 66 ? -2.623  2.256   3.323   1.00 0.00 ? 66 CYS A CB   1 
ATOM   948  S  SG   . CYS A 1 66 ? -3.167  0.666   3.983   1.00 0.00 ? 66 CYS A SG   1 
ATOM   949  H  H    . CYS A 1 66 ? 0.108   1.409   4.206   1.00 0.00 ? 66 CYS A H    1 
ATOM   950  H  HA   . CYS A 1 66 ? -1.435  3.869   4.034   1.00 0.00 ? 66 CYS A HA   1 
ATOM   951  H  HB2  . CYS A 1 66 ? -3.440  2.976   3.396   1.00 0.00 ? 66 CYS A HB2  1 
ATOM   952  H  HB3  . CYS A 1 66 ? -2.352  2.149   2.279   1.00 0.00 ? 66 CYS A HB3  1 
ATOM   953  N  N    . SER A 1 67 ? -2.743  3.222   6.194   1.00 0.00 ? 67 SER A N    1 
ATOM   954  C  CA   . SER A 1 67 ? -3.119  3.077   7.591   1.00 0.00 ? 67 SER A CA   1 
ATOM   955  C  C    . SER A 1 67 ? -3.614  1.666   7.921   1.00 0.00 ? 67 SER A C    1 
ATOM   956  O  O    . SER A 1 67 ? -3.363  1.193   9.027   1.00 0.00 ? 67 SER A O    1 
ATOM   957  C  CB   . SER A 1 67 ? -4.153  4.133   7.982   1.00 0.00 ? 67 SER A CB   1 
ATOM   958  O  OG   . SER A 1 67 ? -5.338  3.948   7.242   1.00 0.00 ? 67 SER A OG   1 
ATOM   959  H  H    . SER A 1 67 ? -3.264  3.861   5.603   1.00 0.00 ? 67 SER A H    1 
ATOM   960  H  HA   . SER A 1 67 ? -2.231  3.256   8.196   1.00 0.00 ? 67 SER A HA   1 
ATOM   961  H  HB2  . SER A 1 67 ? -4.362  4.051   9.047   1.00 0.00 ? 67 SER A HB2  1 
ATOM   962  H  HB3  . SER A 1 67 ? -3.759  5.130   7.781   1.00 0.00 ? 67 SER A HB3  1 
ATOM   963  H  HG   . SER A 1 67 ? -5.148  4.240   6.345   1.00 0.00 ? 67 SER A HG   1 
ATOM   964  N  N    . VAL A 1 68 ? -4.311  0.988   6.995   1.00 0.00 ? 68 VAL A N    1 
ATOM   965  C  CA   . VAL A 1 68 ? -4.794  -0.369  7.255   1.00 0.00 ? 68 VAL A CA   1 
ATOM   966  C  C    . VAL A 1 68 ? -3.661  -1.405  7.253   1.00 0.00 ? 68 VAL A C    1 
ATOM   967  O  O    . VAL A 1 68 ? -3.942  -2.581  7.470   1.00 0.00 ? 68 VAL A O    1 
ATOM   968  C  CB   . VAL A 1 68 ? -6.032  -0.809  6.440   1.00 0.00 ? 68 VAL A CB   1 
ATOM   969  C  CG1  . VAL A 1 68 ? -6.959  0.370   6.221   1.00 0.00 ? 68 VAL A CG1  1 
ATOM   970  C  CG2  . VAL A 1 68 ? -5.813  -1.505  5.098   1.00 0.00 ? 68 VAL A CG2  1 
ATOM   971  H  H    . VAL A 1 68 ? -4.476  1.416   6.097   1.00 0.00 ? 68 VAL A H    1 
ATOM   972  H  HA   . VAL A 1 68 ? -5.230  -0.308  8.251   1.00 0.00 ? 68 VAL A HA   1 
ATOM   973  H  HB   . VAL A 1 68 ? -6.572  -1.528  7.060   1.00 0.00 ? 68 VAL A HB   1 
ATOM   974  H  HG11 . VAL A 1 68 ? -6.996  0.919   7.164   1.00 0.00 ? 68 VAL A HG11 1 
ATOM   975  H  HG12 . VAL A 1 68 ? -6.559  0.976   5.411   1.00 0.00 ? 68 VAL A HG12 1 
ATOM   976  H  HG13 . VAL A 1 68 ? -7.945  0.006   5.933   1.00 0.00 ? 68 VAL A HG13 1 
ATOM   977  H  HG21 . VAL A 1 68 ? -5.203  -0.896  4.449   1.00 0.00 ? 68 VAL A HG21 1 
ATOM   978  H  HG22 . VAL A 1 68 ? -5.345  -2.475  5.252   1.00 0.00 ? 68 VAL A HG22 1 
ATOM   979  H  HG23 . VAL A 1 68 ? -6.773  -1.648  4.601   1.00 0.00 ? 68 VAL A HG23 1 
ATOM   980  N  N    . TYR A 1 69 ? -2.401  -1.004  7.007   1.00 0.00 ? 69 TYR A N    1 
ATOM   981  C  CA   . TYR A 1 69 ? -1.250  -1.895  7.106   1.00 0.00 ? 69 TYR A CA   1 
ATOM   982  C  C    . TYR A 1 69 ? -1.321  -2.756  8.368   1.00 0.00 ? 69 TYR A C    1 
ATOM   983  O  O    . TYR A 1 69 ? -1.514  -2.236  9.467   1.00 0.00 ? 69 TYR A O    1 
ATOM   984  C  CB   . TYR A 1 69 ? 0.062   -1.093  7.102   1.00 0.00 ? 69 TYR A CB   1 
ATOM   985  C  CG   . TYR A 1 69 ? 1.319   -1.946  7.189   1.00 0.00 ? 69 TYR A CG   1 
ATOM   986  C  CD1  . TYR A 1 69 ? 1.781   -2.418  8.433   1.00 0.00 ? 69 TYR A CD1  1 
ATOM   987  C  CD2  . TYR A 1 69 ? 2.005   -2.311  6.016   1.00 0.00 ? 69 TYR A CD2  1 
ATOM   988  C  CE1  . TYR A 1 69 ? 2.863   -3.311  8.490   1.00 0.00 ? 69 TYR A CE1  1 
ATOM   989  C  CE2  . TYR A 1 69 ? 3.111   -3.174  6.081   1.00 0.00 ? 69 TYR A CE2  1 
ATOM   990  C  CZ   . TYR A 1 69 ? 3.518   -3.703  7.314   1.00 0.00 ? 69 TYR A CZ   1 
ATOM   991  O  OH   . TYR A 1 69 ? 4.588   -4.540  7.391   1.00 0.00 ? 69 TYR A OH   1 
ATOM   992  H  H    . TYR A 1 69 ? -2.213  -0.035  6.769   1.00 0.00 ? 69 TYR A H    1 
ATOM   993  H  HA   . TYR A 1 69 ? -1.263  -2.537  6.228   1.00 0.00 ? 69 TYR A HA   1 
ATOM   994  H  HB2  . TYR A 1 69 ? 0.109   -0.510  6.183   1.00 0.00 ? 69 TYR A HB2  1 
ATOM   995  H  HB3  . TYR A 1 69 ? 0.052   -0.396  7.941   1.00 0.00 ? 69 TYR A HB3  1 
ATOM   996  H  HD1  . TYR A 1 69 ? 1.295   -2.130  9.354   1.00 0.00 ? 69 TYR A HD1  1 
ATOM   997  H  HD2  . TYR A 1 69 ? 1.689   -1.942  5.056   1.00 0.00 ? 69 TYR A HD2  1 
ATOM   998  H  HE1  . TYR A 1 69 ? 3.211   -3.675  9.445   1.00 0.00 ? 69 TYR A HE1  1 
ATOM   999  H  HE2  . TYR A 1 69 ? 3.603   -3.471  5.169   1.00 0.00 ? 69 TYR A HE2  1 
ATOM   1000 H  HH   . TYR A 1 69 ? 4.938   -4.764  6.515   1.00 0.00 ? 69 TYR A HH   1 
ATOM   1001 N  N    . ALA A 1 70 ? -1.105  -4.062  8.210   1.00 0.00 ? 70 ALA A N    1 
ATOM   1002 C  CA   . ALA A 1 70 ? -0.856  -4.981  9.307   1.00 0.00 ? 70 ALA A CA   1 
ATOM   1003 C  C    . ALA A 1 70 ? 0.423   -5.738  8.953   1.00 0.00 ? 70 ALA A C    1 
ATOM   1004 O  O    . ALA A 1 70 ? 0.597   -6.082  7.783   1.00 0.00 ? 70 ALA A O    1 
ATOM   1005 C  CB   . ALA A 1 70 ? -2.043  -5.934  9.467   1.00 0.00 ? 70 ALA A CB   1 
ATOM   1006 H  H    . ALA A 1 70 ? -0.891  -4.412  7.284   1.00 0.00 ? 70 ALA A H    1 
ATOM   1007 H  HA   . ALA A 1 70 ? -0.728  -4.425  10.235  1.00 0.00 ? 70 ALA A HA   1 
ATOM   1008 H  HB1  . ALA A 1 70 ? -2.220  -6.468  8.534   1.00 0.00 ? 70 ALA A HB1  1 
ATOM   1009 H  HB2  . ALA A 1 70 ? -1.832  -6.655  10.257  1.00 0.00 ? 70 ALA A HB2  1 
ATOM   1010 H  HB3  . ALA A 1 70 ? -2.935  -5.366  9.731   1.00 0.00 ? 70 ALA A HB3  1 
ATOM   1011 N  N    . PRO A 1 71 ? 1.332   -5.972  9.909   1.00 0.00 ? 71 PRO A N    1 
ATOM   1012 C  CA   . PRO A 1 71 ? 2.561   -6.689  9.636   1.00 0.00 ? 71 PRO A CA   1 
ATOM   1013 C  C    . PRO A 1 71 ? 2.263   -8.139  9.318   1.00 0.00 ? 71 PRO A C    1 
ATOM   1014 O  O    . PRO A 1 71 ? 1.372   -8.748  9.906   1.00 0.00 ? 71 PRO A O    1 
ATOM   1015 C  CB   . PRO A 1 71 ? 3.409   -6.571  10.899  1.00 0.00 ? 71 PRO A CB   1 
ATOM   1016 C  CG   . PRO A 1 71 ? 2.371   -6.383  12.007  1.00 0.00 ? 71 PRO A CG   1 
ATOM   1017 C  CD   . PRO A 1 71 ? 1.249   -5.607  11.313  1.00 0.00 ? 71 PRO A CD   1 
ATOM   1018 H  HA   . PRO A 1 71 ? 3.082   -6.266  8.780   1.00 0.00 ? 71 PRO A HA   1 
ATOM   1019 H  HB2  . PRO A 1 71 ? 4.044   -7.443  11.067  1.00 0.00 ? 71 PRO A HB2  1 
ATOM   1020 H  HB3  . PRO A 1 71 ? 4.025   -5.684  10.803  1.00 0.00 ? 71 PRO A HB3  1 
ATOM   1021 H  HG2  . PRO A 1 71 ? 1.999   -7.363  12.313  1.00 0.00 ? 71 PRO A HG2  1 
ATOM   1022 H  HG3  . PRO A 1 71 ? 2.773   -5.850  12.869  1.00 0.00 ? 71 PRO A HG3  1 
ATOM   1023 H  HD2  . PRO A 1 71 ? 0.287   -5.876  11.753  1.00 0.00 ? 71 PRO A HD2  1 
ATOM   1024 H  HD3  . PRO A 1 71 ? 1.426   -4.535  11.414  1.00 0.00 ? 71 PRO A HD3  1 
ATOM   1025 N  N    . ALA A 1 72 ? 3.052   -8.704  8.409   1.00 0.00 ? 72 ALA A N    1 
ATOM   1026 C  CA   . ALA A 1 72 ? 2.988   -10.111 8.095   1.00 0.00 ? 72 ALA A CA   1 
ATOM   1027 C  C    . ALA A 1 72 ? 3.863   -10.846 9.096   1.00 0.00 ? 72 ALA A C    1 
ATOM   1028 O  O    . ALA A 1 72 ? 4.905   -11.415 8.770   1.00 0.00 ? 72 ALA A O    1 
ATOM   1029 C  CB   . ALA A 1 72 ? 3.407   -10.340 6.654   1.00 0.00 ? 72 ALA A CB   1 
ATOM   1030 H  H    . ALA A 1 72 ? 3.833   -8.180  8.051   1.00 0.00 ? 72 ALA A H    1 
ATOM   1031 H  HA   . ALA A 1 72 ? 1.961   -10.450 8.202   1.00 0.00 ? 72 ALA A HA   1 
ATOM   1032 H  HB1  . ALA A 1 72 ? 2.726   -9.782  6.014   1.00 0.00 ? 72 ALA A HB1  1 
ATOM   1033 H  HB2  . ALA A 1 72 ? 4.431   -10.000 6.507   1.00 0.00 ? 72 ALA A HB2  1 
ATOM   1034 H  HB3  . ALA A 1 72 ? 3.330   -11.405 6.443   1.00 0.00 ? 72 ALA A HB3  1 
ATOM   1035 N  N    . SER A 1 73 ? 3.445   -10.766 10.349  1.00 0.00 ? 73 SER A N    1 
ATOM   1036 C  CA   . SER A 1 73 ? 4.054   -11.454 11.469  1.00 0.00 ? 73 SER A CA   1 
ATOM   1037 C  C    . SER A 1 73 ? 2.985   -11.741 12.517  1.00 0.00 ? 73 SER A C    1 
ATOM   1038 O  O    . SER A 1 73 ? 3.229   -12.646 13.343  1.00 0.00 ? 73 SER A O    1 
ATOM   1039 C  CB   . SER A 1 73 ? 5.172   -10.603 12.067  1.00 0.00 ? 73 SER A CB   1 
ATOM   1040 O  OG   . SER A 1 73 ? 6.106   -10.242 11.064  1.00 0.00 ? 73 SER A OG   1 
ATOM   1041 O  OXT  . SER A 1 73 ? 1.958   -11.028 12.481  1.00 0.00 ? 73 SER A OXT  1 
ATOM   1042 H  H    . SER A 1 73 ? 2.602   -10.224 10.523  1.00 0.00 ? 73 SER A H    1 
ATOM   1043 H  HA   . SER A 1 73 ? 4.472   -12.396 11.116  1.00 0.00 ? 73 SER A HA   1 
ATOM   1044 H  HB2  . SER A 1 73 ? 4.740   -9.709  12.521  1.00 0.00 ? 73 SER A HB2  1 
ATOM   1045 H  HB3  . SER A 1 73 ? 5.662   -11.189 12.847  1.00 0.00 ? 73 SER A HB3  1 
ATOM   1046 H  HG   . SER A 1 73 ? 5.932   -10.783 10.280  1.00 0.00 ? 73 SER A HG   1 
HETATM 1047 FE FE1  . SF4 B 2 .  ? -0.589  -1.435  1.232   1.00 0.00 ? 74 SF4 A FE1  1 
HETATM 1048 FE FE2  . SF4 B 2 .  ? -1.194  -3.021  3.064   1.00 0.00 ? 74 SF4 A FE2  1 
HETATM 1049 FE FE3  . SF4 B 2 .  ? -2.816  -2.558  1.277   1.00 0.00 ? 74 SF4 A FE3  1 
HETATM 1050 FE FE4  . SF4 B 2 .  ? -2.303  -0.806  2.912   1.00 0.00 ? 74 SF4 A FE4  1 
HETATM 1051 S  S1   . SF4 B 2 .  ? -3.263  -2.684  3.360   1.00 0.00 ? 74 SF4 A S1   1 
HETATM 1052 S  S2   . SF4 B 2 .  ? -2.462  -0.494  0.802   1.00 0.00 ? 74 SF4 A S2   1 
HETATM 1053 S  S3   . SF4 B 2 .  ? -0.222  -1.103  3.342   1.00 0.00 ? 74 SF4 A S3   1 
HETATM 1054 S  S4   . SF4 B 2 .  ? -0.935  -3.562  0.987   1.00 0.00 ? 74 SF4 A S4   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ALA 1  1  1  ALA ALA A . n 
A 1 2  SER 2  2  2  SER SER A . n 
A 1 3  GLU 3  3  3  GLU GLU A . n 
A 1 4  PRO 4  4  4  PRO PRO A . n 
A 1 5  ARG 5  5  5  ARG ARG A . n 
A 1 6  ALA 6  6  6  ALA ALA A . n 
A 1 7  GLU 7  7  7  GLU GLU A . n 
A 1 8  ASP 8  8  8  ASP ASP A . n 
A 1 9  GLY 9  9  9  GLY GLY A . n 
A 1 10 HIS 10 10 10 HIS HIS A . n 
A 1 11 ALA 11 11 11 ALA ALA A . n 
A 1 12 HIS 12 12 12 HIS HIS A . n 
A 1 13 ASP 13 13 13 ASP ASP A . n 
A 1 14 TYR 14 14 14 TYR TYR A . n 
A 1 15 VAL 15 15 15 VAL VAL A . n 
A 1 16 ASN 16 16 16 ASN ASN A . n 
A 1 17 GLU 17 17 17 GLU GLU A . n 
A 1 18 ALA 18 18 18 ALA ALA A . n 
A 1 19 ALA 19 19 19 ALA ALA A . n 
A 1 20 ASP 20 20 20 ASP ASP A . n 
A 1 21 ALA 21 21 21 ALA ALA A . n 
A 1 22 SER 22 22 22 SER SER A . n 
A 1 23 GLY 23 23 23 GLY GLY A . n 
A 1 24 HIS 24 24 24 HIS HIS A . n 
A 1 25 PRO 25 25 25 PRO PRO A . n 
A 1 26 ARG 26 26 26 ARG ARG A . n 
A 1 27 TYR 27 27 27 TYR TYR A . n 
A 1 28 GLN 28 28 28 GLN GLN A . n 
A 1 29 GLU 29 29 29 GLU GLU A . n 
A 1 30 GLY 30 30 30 GLY GLY A . n 
A 1 31 GLN 31 31 31 GLN GLN A . n 
A 1 32 LEU 32 32 32 LEU LEU A . n 
A 1 33 CYS 33 33 33 CYS CYS A . n 
A 1 34 GLU 34 34 34 GLU GLU A . n 
A 1 35 ASN 35 35 35 ASN ASN A . n 
A 1 36 CYS 36 36 36 CYS CYS A . n 
A 1 37 ALA 37 37 37 ALA ALA A . n 
A 1 38 PHE 38 38 38 PHE PHE A . n 
A 1 39 TRP 39 39 39 TRP TRP A . n 
A 1 40 GLY 40 40 40 GLY GLY A . n 
A 1 41 GLU 41 41 41 GLU GLU A . n 
A 1 42 ALA 42 42 42 ALA ALA A . n 
A 1 43 VAL 43 43 43 VAL VAL A . n 
A 1 44 GLN 44 44 44 GLN GLN A . n 
A 1 45 ASP 45 45 45 ASP ASP A . n 
A 1 46 GLY 46 46 46 GLY GLY A . n 
A 1 47 TRP 47 47 47 TRP TRP A . n 
A 1 48 GLY 48 48 48 GLY GLY A . n 
A 1 49 ARG 49 49 49 ARG ARG A . n 
A 1 50 CYS 50 50 50 CYS CYS A . n 
A 1 51 THR 51 51 51 THR THR A . n 
A 1 52 HIS 52 52 52 HIS HIS A . n 
A 1 53 PRO 53 53 53 PRO PRO A . n 
A 1 54 ASP 54 54 54 ASP ASP A . n 
A 1 55 PHE 55 55 55 PHE PHE A . n 
A 1 56 ASP 56 56 56 ASP ASP A . n 
A 1 57 GLU 57 57 57 GLU GLU A . n 
A 1 58 VAL 58 58 58 VAL VAL A . n 
A 1 59 LEU 59 59 59 LEU LEU A . n 
A 1 60 VAL 60 60 60 VAL VAL A . n 
A 1 61 LYS 61 61 61 LYS LYS A . n 
A 1 62 ALA 62 62 62 ALA ALA A . n 
A 1 63 GLU 63 63 63 GLU GLU A . n 
A 1 64 GLY 64 64 64 GLY GLY A . n 
A 1 65 TRP 65 65 65 TRP TRP A . n 
A 1 66 CYS 66 66 66 CYS CYS A . n 
A 1 67 SER 67 67 67 SER SER A . n 
A 1 68 VAL 68 68 68 VAL VAL A . n 
A 1 69 TYR 69 69 69 TYR TYR A . n 
A 1 70 ALA 70 70 70 ALA ALA A . n 
A 1 71 PRO 71 71 71 PRO PRO A . n 
A 1 72 ALA 72 72 72 ALA ALA A . n 
A 1 73 SER 73 73 73 SER SER A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          SF4 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     74 
_pdbx_nonpoly_scheme.auth_seq_num    74 
_pdbx_nonpoly_scheme.pdb_mon_id      SF4 
_pdbx_nonpoly_scheme.auth_mon_id     FS4 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? A CYS 33 ? A CYS 33 ? 1_555 FE1 ? B SF4 . ? A SF4 74 ? 1_555 S2 ? B SF4 . ? A SF4 74 ? 1_555 111.0 ? 
2  SG ? A CYS 33 ? A CYS 33 ? 1_555 FE1 ? B SF4 . ? A SF4 74 ? 1_555 S3 ? B SF4 . ? A SF4 74 ? 1_555 111.4 ? 
3  S2 ? B SF4 .  ? A SF4 74 ? 1_555 FE1 ? B SF4 . ? A SF4 74 ? 1_555 S3 ? B SF4 . ? A SF4 74 ? 1_555 106.1 ? 
4  SG ? A CYS 33 ? A CYS 33 ? 1_555 FE1 ? B SF4 . ? A SF4 74 ? 1_555 S4 ? B SF4 . ? A SF4 74 ? 1_555 115.5 ? 
5  S2 ? B SF4 .  ? A SF4 74 ? 1_555 FE1 ? B SF4 . ? A SF4 74 ? 1_555 S4 ? B SF4 . ? A SF4 74 ? 1_555 105.6 ? 
6  S3 ? B SF4 .  ? A SF4 74 ? 1_555 FE1 ? B SF4 . ? A SF4 74 ? 1_555 S4 ? B SF4 . ? A SF4 74 ? 1_555 106.7 ? 
7  SG ? A CYS 36 ? A CYS 36 ? 1_555 FE2 ? B SF4 . ? A SF4 74 ? 1_555 S1 ? B SF4 . ? A SF4 74 ? 1_555 110.4 ? 
8  SG ? A CYS 36 ? A CYS 36 ? 1_555 FE2 ? B SF4 . ? A SF4 74 ? 1_555 S3 ? B SF4 . ? A SF4 74 ? 1_555 113.6 ? 
9  S1 ? B SF4 .  ? A SF4 74 ? 1_555 FE2 ? B SF4 . ? A SF4 74 ? 1_555 S3 ? B SF4 . ? A SF4 74 ? 1_555 106.2 ? 
10 SG ? A CYS 36 ? A CYS 36 ? 1_555 FE2 ? B SF4 . ? A SF4 74 ? 1_555 S4 ? B SF4 . ? A SF4 74 ? 1_555 112.3 ? 
11 S1 ? B SF4 .  ? A SF4 74 ? 1_555 FE2 ? B SF4 . ? A SF4 74 ? 1_555 S4 ? B SF4 . ? A SF4 74 ? 1_555 106.9 ? 
12 S3 ? B SF4 .  ? A SF4 74 ? 1_555 FE2 ? B SF4 . ? A SF4 74 ? 1_555 S4 ? B SF4 . ? A SF4 74 ? 1_555 106.9 ? 
13 SG ? A CYS 50 ? A CYS 50 ? 1_555 FE3 ? B SF4 . ? A SF4 74 ? 1_555 S1 ? B SF4 . ? A SF4 74 ? 1_555 108.2 ? 
14 SG ? A CYS 50 ? A CYS 50 ? 1_555 FE3 ? B SF4 . ? A SF4 74 ? 1_555 S2 ? B SF4 . ? A SF4 74 ? 1_555 114.3 ? 
15 S1 ? B SF4 .  ? A SF4 74 ? 1_555 FE3 ? B SF4 . ? A SF4 74 ? 1_555 S2 ? B SF4 . ? A SF4 74 ? 1_555 107.9 ? 
16 SG ? A CYS 50 ? A CYS 50 ? 1_555 FE3 ? B SF4 . ? A SF4 74 ? 1_555 S4 ? B SF4 . ? A SF4 74 ? 1_555 113.5 ? 
17 S1 ? B SF4 .  ? A SF4 74 ? 1_555 FE3 ? B SF4 . ? A SF4 74 ? 1_555 S4 ? B SF4 . ? A SF4 74 ? 1_555 106.7 ? 
18 S2 ? B SF4 .  ? A SF4 74 ? 1_555 FE3 ? B SF4 . ? A SF4 74 ? 1_555 S4 ? B SF4 . ? A SF4 74 ? 1_555 105.9 ? 
19 SG ? A CYS 66 ? A CYS 66 ? 1_555 FE4 ? B SF4 . ? A SF4 74 ? 1_555 S1 ? B SF4 . ? A SF4 74 ? 1_555 109.6 ? 
20 SG ? A CYS 66 ? A CYS 66 ? 1_555 FE4 ? B SF4 . ? A SF4 74 ? 1_555 S2 ? B SF4 . ? A SF4 74 ? 1_555 112.7 ? 
21 S1 ? B SF4 .  ? A SF4 74 ? 1_555 FE4 ? B SF4 . ? A SF4 74 ? 1_555 S2 ? B SF4 . ? A SF4 74 ? 1_555 107.4 ? 
22 SG ? A CYS 66 ? A CYS 66 ? 1_555 FE4 ? B SF4 . ? A SF4 74 ? 1_555 S3 ? B SF4 . ? A SF4 74 ? 1_555 114.2 ? 
23 S1 ? B SF4 .  ? A SF4 74 ? 1_555 FE4 ? B SF4 . ? A SF4 74 ? 1_555 S3 ? B SF4 . ? A SF4 74 ? 1_555 105.6 ? 
24 S2 ? B SF4 .  ? A SF4 74 ? 1_555 FE4 ? B SF4 . ? A SF4 74 ? 1_555 S3 ? B SF4 . ? A SF4 74 ? 1_555 106.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1995-02-07 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
_software.name             AMBER 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 45 ? ? 28.36   53.97  
2 1 ASP A 54 ? ? -76.35  46.35  
3 1 PHE A 55 ? ? -159.32 -58.48 
4 1 GLU A 57 ? ? -29.36  -50.02 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 ARG A 5  ? ? 0.148 'SIDE CHAIN' 
2 1 TYR A 27 ? ? 0.210 'SIDE CHAIN' 
3 1 PHE A 55 ? ? 0.095 'SIDE CHAIN' 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'IRON/SULFUR CLUSTER' 
_pdbx_entity_nonpoly.comp_id     SF4 
#